data_1PG4
# 
_entry.id   1PG4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1PG4         pdb_00001pg4 10.2210/pdb1pg4/pdb 
RCSB  RCSB019304   ?            ?                   
WWPDB D_1000019304 ?            ?                   
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.pdb_id           1PG4 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1NNM 
_pdbx_database_PDB_obs_spr.date             2003-06-03 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1PG3 
_pdbx_database_related.details        'Acetyl CoA Synthetase, Acetylated on Lys609' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1PG4 
_pdbx_database_status.recvd_initial_deposition_date   2003-05-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gulick, A.M.'             1 
'Starai, V.J.'             2 
'Horswill, A.R.'           3 
'Homick, K.M.'             4 
'Escalante-Semerena, J.C.' 5 
# 
_citation.id                        primary 
_citation.title                     
;The 1.75 A Crystal Structure of Acetyl-CoA Synthetase Bound 
to Adenosine-5'-propylphosphate and Coenzyme A
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            42 
_citation.page_first                2866 
_citation.page_last                 2873 
_citation.year                      2003 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12627952 
_citation.pdbx_database_id_DOI      10.1021/bi0271603 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gulick, A.M.'             1 ? 
primary 'Starai, V.J.'             2 ? 
primary 'Horswill, A.R.'           3 ? 
primary 'Homick, K.M.'             4 ? 
primary 'Escalante-Semerena, J.C.' 5 ? 
# 
_cell.entry_id           1PG4 
_cell.length_a           59.994 
_cell.length_b           143.016 
_cell.length_c           71.731 
_cell.angle_alpha        90.00 
_cell.angle_beta         91.32 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1PG4 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.cell_setting                     monoclinic 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'acetyl-CoA synthetase'                   72182.422 2   6.2.1.1 R174C ? ? 
2 non-polymer syn 'CHLORIDE ION'                            35.453    2   ?       ?     ? ? 
3 non-polymer syn 'MAGNESIUM ION'                           24.305    2   ?       ?     ? ? 
4 non-polymer syn 'COENZYME A'                              767.534   2   ?       ?     ? ? 
5 non-polymer syn 
;ADENOSINE-5'-MONOPHOSPHATE-PROPYL ESTER
;
389.301   2   ?       ?     ? ? 
6 non-polymer syn 1,2-ETHANEDIOL                            62.068    5   ?       ?     ? ? 
7 water       nat water                                     18.015    849 ?       ?     ? ? 
# 
_entity_name_sys.entity_id   1 
_entity_name_sys.name        E.C.6.2.1.1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGCIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGCIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLN n 
1 4   THR n 
1 5   HIS n 
1 6   LYS n 
1 7   HIS n 
1 8   ALA n 
1 9   ILE n 
1 10  PRO n 
1 11  ALA n 
1 12  ASN n 
1 13  ILE n 
1 14  ALA n 
1 15  ASP n 
1 16  ARG n 
1 17  CYS n 
1 18  LEU n 
1 19  ILE n 
1 20  ASN n 
1 21  PRO n 
1 22  GLU n 
1 23  GLN n 
1 24  TYR n 
1 25  GLU n 
1 26  THR n 
1 27  LYS n 
1 28  TYR n 
1 29  LYS n 
1 30  GLN n 
1 31  SER n 
1 32  ILE n 
1 33  ASN n 
1 34  ASP n 
1 35  PRO n 
1 36  ASP n 
1 37  THR n 
1 38  PHE n 
1 39  TRP n 
1 40  GLY n 
1 41  GLU n 
1 42  GLN n 
1 43  GLY n 
1 44  LYS n 
1 45  ILE n 
1 46  LEU n 
1 47  ASP n 
1 48  TRP n 
1 49  ILE n 
1 50  THR n 
1 51  PRO n 
1 52  TYR n 
1 53  GLN n 
1 54  LYS n 
1 55  VAL n 
1 56  LYS n 
1 57  ASN n 
1 58  THR n 
1 59  SER n 
1 60  PHE n 
1 61  ALA n 
1 62  PRO n 
1 63  GLY n 
1 64  ASN n 
1 65  VAL n 
1 66  SER n 
1 67  ILE n 
1 68  LYS n 
1 69  TRP n 
1 70  TYR n 
1 71  GLU n 
1 72  ASP n 
1 73  GLY n 
1 74  THR n 
1 75  LEU n 
1 76  ASN n 
1 77  LEU n 
1 78  ALA n 
1 79  ALA n 
1 80  ASN n 
1 81  CYS n 
1 82  LEU n 
1 83  ASP n 
1 84  ARG n 
1 85  HIS n 
1 86  LEU n 
1 87  GLN n 
1 88  GLU n 
1 89  ASN n 
1 90  GLY n 
1 91  ASP n 
1 92  ARG n 
1 93  THR n 
1 94  ALA n 
1 95  ILE n 
1 96  ILE n 
1 97  TRP n 
1 98  GLU n 
1 99  GLY n 
1 100 ASP n 
1 101 ASP n 
1 102 THR n 
1 103 SER n 
1 104 GLN n 
1 105 SER n 
1 106 LYS n 
1 107 HIS n 
1 108 ILE n 
1 109 SER n 
1 110 TYR n 
1 111 ARG n 
1 112 GLU n 
1 113 LEU n 
1 114 HIS n 
1 115 ARG n 
1 116 ASP n 
1 117 VAL n 
1 118 CYS n 
1 119 ARG n 
1 120 PHE n 
1 121 ALA n 
1 122 ASN n 
1 123 THR n 
1 124 LEU n 
1 125 LEU n 
1 126 ASP n 
1 127 LEU n 
1 128 GLY n 
1 129 ILE n 
1 130 LYS n 
1 131 LYS n 
1 132 GLY n 
1 133 ASP n 
1 134 VAL n 
1 135 VAL n 
1 136 ALA n 
1 137 ILE n 
1 138 TYR n 
1 139 MET n 
1 140 PRO n 
1 141 MET n 
1 142 VAL n 
1 143 PRO n 
1 144 GLU n 
1 145 ALA n 
1 146 ALA n 
1 147 VAL n 
1 148 ALA n 
1 149 MET n 
1 150 LEU n 
1 151 ALA n 
1 152 CYS n 
1 153 ALA n 
1 154 ARG n 
1 155 ILE n 
1 156 GLY n 
1 157 ALA n 
1 158 VAL n 
1 159 HIS n 
1 160 SER n 
1 161 VAL n 
1 162 ILE n 
1 163 PHE n 
1 164 GLY n 
1 165 GLY n 
1 166 PHE n 
1 167 SER n 
1 168 PRO n 
1 169 GLU n 
1 170 ALA n 
1 171 VAL n 
1 172 ALA n 
1 173 GLY n 
1 174 CYS n 
1 175 ILE n 
1 176 ILE n 
1 177 ASP n 
1 178 SER n 
1 179 SER n 
1 180 SER n 
1 181 ARG n 
1 182 LEU n 
1 183 VAL n 
1 184 ILE n 
1 185 THR n 
1 186 ALA n 
1 187 ASP n 
1 188 GLU n 
1 189 GLY n 
1 190 VAL n 
1 191 ARG n 
1 192 ALA n 
1 193 GLY n 
1 194 ARG n 
1 195 SER n 
1 196 ILE n 
1 197 PRO n 
1 198 LEU n 
1 199 LYS n 
1 200 LYS n 
1 201 ASN n 
1 202 VAL n 
1 203 ASP n 
1 204 ASP n 
1 205 ALA n 
1 206 LEU n 
1 207 LYS n 
1 208 ASN n 
1 209 PRO n 
1 210 ASN n 
1 211 VAL n 
1 212 THR n 
1 213 SER n 
1 214 VAL n 
1 215 GLU n 
1 216 HIS n 
1 217 VAL n 
1 218 ILE n 
1 219 VAL n 
1 220 LEU n 
1 221 LYS n 
1 222 ARG n 
1 223 THR n 
1 224 GLY n 
1 225 SER n 
1 226 ASP n 
1 227 ILE n 
1 228 ASP n 
1 229 TRP n 
1 230 GLN n 
1 231 GLU n 
1 232 GLY n 
1 233 ARG n 
1 234 ASP n 
1 235 LEU n 
1 236 TRP n 
1 237 TRP n 
1 238 ARG n 
1 239 ASP n 
1 240 LEU n 
1 241 ILE n 
1 242 GLU n 
1 243 LYS n 
1 244 ALA n 
1 245 SER n 
1 246 PRO n 
1 247 GLU n 
1 248 HIS n 
1 249 GLN n 
1 250 PRO n 
1 251 GLU n 
1 252 ALA n 
1 253 MET n 
1 254 ASN n 
1 255 ALA n 
1 256 GLU n 
1 257 ASP n 
1 258 PRO n 
1 259 LEU n 
1 260 PHE n 
1 261 ILE n 
1 262 LEU n 
1 263 TYR n 
1 264 THR n 
1 265 SER n 
1 266 GLY n 
1 267 SER n 
1 268 THR n 
1 269 GLY n 
1 270 LYS n 
1 271 PRO n 
1 272 LYS n 
1 273 GLY n 
1 274 VAL n 
1 275 LEU n 
1 276 HIS n 
1 277 THR n 
1 278 THR n 
1 279 GLY n 
1 280 GLY n 
1 281 TYR n 
1 282 LEU n 
1 283 VAL n 
1 284 TYR n 
1 285 ALA n 
1 286 ALA n 
1 287 THR n 
1 288 THR n 
1 289 PHE n 
1 290 LYS n 
1 291 TYR n 
1 292 VAL n 
1 293 PHE n 
1 294 ASP n 
1 295 TYR n 
1 296 HIS n 
1 297 PRO n 
1 298 GLY n 
1 299 ASP n 
1 300 ILE n 
1 301 TYR n 
1 302 TRP n 
1 303 CYS n 
1 304 THR n 
1 305 ALA n 
1 306 ASP n 
1 307 VAL n 
1 308 GLY n 
1 309 TRP n 
1 310 VAL n 
1 311 THR n 
1 312 GLY n 
1 313 HIS n 
1 314 SER n 
1 315 TYR n 
1 316 LEU n 
1 317 LEU n 
1 318 TYR n 
1 319 GLY n 
1 320 PRO n 
1 321 LEU n 
1 322 ALA n 
1 323 CYS n 
1 324 GLY n 
1 325 ALA n 
1 326 THR n 
1 327 THR n 
1 328 LEU n 
1 329 MET n 
1 330 PHE n 
1 331 GLU n 
1 332 GLY n 
1 333 VAL n 
1 334 PRO n 
1 335 ASN n 
1 336 TRP n 
1 337 PRO n 
1 338 THR n 
1 339 PRO n 
1 340 ALA n 
1 341 ARG n 
1 342 MET n 
1 343 CYS n 
1 344 GLN n 
1 345 VAL n 
1 346 VAL n 
1 347 ASP n 
1 348 LYS n 
1 349 HIS n 
1 350 GLN n 
1 351 VAL n 
1 352 ASN n 
1 353 ILE n 
1 354 LEU n 
1 355 TYR n 
1 356 THR n 
1 357 ALA n 
1 358 PRO n 
1 359 THR n 
1 360 ALA n 
1 361 ILE n 
1 362 ARG n 
1 363 ALA n 
1 364 LEU n 
1 365 MET n 
1 366 ALA n 
1 367 GLU n 
1 368 GLY n 
1 369 ASP n 
1 370 LYS n 
1 371 ALA n 
1 372 ILE n 
1 373 GLU n 
1 374 GLY n 
1 375 THR n 
1 376 ASP n 
1 377 ARG n 
1 378 SER n 
1 379 SER n 
1 380 LEU n 
1 381 ARG n 
1 382 ILE n 
1 383 LEU n 
1 384 GLY n 
1 385 SER n 
1 386 VAL n 
1 387 GLY n 
1 388 GLU n 
1 389 PRO n 
1 390 ILE n 
1 391 ASN n 
1 392 PRO n 
1 393 GLU n 
1 394 ALA n 
1 395 TRP n 
1 396 GLU n 
1 397 TRP n 
1 398 TYR n 
1 399 TRP n 
1 400 LYS n 
1 401 LYS n 
1 402 ILE n 
1 403 GLY n 
1 404 LYS n 
1 405 GLU n 
1 406 LYS n 
1 407 CYS n 
1 408 PRO n 
1 409 VAL n 
1 410 VAL n 
1 411 ASP n 
1 412 THR n 
1 413 TRP n 
1 414 TRP n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 THR n 
1 419 GLY n 
1 420 GLY n 
1 421 PHE n 
1 422 MET n 
1 423 ILE n 
1 424 THR n 
1 425 PRO n 
1 426 LEU n 
1 427 PRO n 
1 428 GLY n 
1 429 ALA n 
1 430 ILE n 
1 431 GLU n 
1 432 LEU n 
1 433 LYS n 
1 434 ALA n 
1 435 GLY n 
1 436 SER n 
1 437 ALA n 
1 438 THR n 
1 439 ARG n 
1 440 PRO n 
1 441 PHE n 
1 442 PHE n 
1 443 GLY n 
1 444 VAL n 
1 445 GLN n 
1 446 PRO n 
1 447 ALA n 
1 448 LEU n 
1 449 VAL n 
1 450 ASP n 
1 451 ASN n 
1 452 GLU n 
1 453 GLY n 
1 454 HIS n 
1 455 PRO n 
1 456 GLN n 
1 457 GLU n 
1 458 GLY n 
1 459 ALA n 
1 460 THR n 
1 461 GLU n 
1 462 GLY n 
1 463 ASN n 
1 464 LEU n 
1 465 VAL n 
1 466 ILE n 
1 467 THR n 
1 468 ASP n 
1 469 SER n 
1 470 TRP n 
1 471 PRO n 
1 472 GLY n 
1 473 GLN n 
1 474 ALA n 
1 475 ARG n 
1 476 THR n 
1 477 LEU n 
1 478 PHE n 
1 479 GLY n 
1 480 ASP n 
1 481 HIS n 
1 482 GLU n 
1 483 ARG n 
1 484 PHE n 
1 485 GLU n 
1 486 GLN n 
1 487 THR n 
1 488 TYR n 
1 489 PHE n 
1 490 SER n 
1 491 THR n 
1 492 PHE n 
1 493 LYS n 
1 494 ASN n 
1 495 MET n 
1 496 TYR n 
1 497 PHE n 
1 498 SER n 
1 499 GLY n 
1 500 ASP n 
1 501 GLY n 
1 502 ALA n 
1 503 ARG n 
1 504 ARG n 
1 505 ASP n 
1 506 GLU n 
1 507 ASP n 
1 508 GLY n 
1 509 TYR n 
1 510 TYR n 
1 511 TRP n 
1 512 ILE n 
1 513 THR n 
1 514 GLY n 
1 515 ARG n 
1 516 VAL n 
1 517 ASP n 
1 518 ASP n 
1 519 VAL n 
1 520 LEU n 
1 521 ASN n 
1 522 VAL n 
1 523 SER n 
1 524 GLY n 
1 525 HIS n 
1 526 ARG n 
1 527 LEU n 
1 528 GLY n 
1 529 THR n 
1 530 ALA n 
1 531 GLU n 
1 532 ILE n 
1 533 GLU n 
1 534 SER n 
1 535 ALA n 
1 536 LEU n 
1 537 VAL n 
1 538 ALA n 
1 539 HIS n 
1 540 PRO n 
1 541 LYS n 
1 542 ILE n 
1 543 ALA n 
1 544 GLU n 
1 545 ALA n 
1 546 ALA n 
1 547 VAL n 
1 548 VAL n 
1 549 GLY n 
1 550 ILE n 
1 551 PRO n 
1 552 HIS n 
1 553 ALA n 
1 554 ILE n 
1 555 LYS n 
1 556 GLY n 
1 557 GLN n 
1 558 ALA n 
1 559 ILE n 
1 560 TYR n 
1 561 ALA n 
1 562 TYR n 
1 563 VAL n 
1 564 THR n 
1 565 LEU n 
1 566 ASN n 
1 567 HIS n 
1 568 GLY n 
1 569 GLU n 
1 570 GLU n 
1 571 PRO n 
1 572 SER n 
1 573 PRO n 
1 574 GLU n 
1 575 LEU n 
1 576 TYR n 
1 577 ALA n 
1 578 GLU n 
1 579 VAL n 
1 580 ARG n 
1 581 ASN n 
1 582 TRP n 
1 583 VAL n 
1 584 ARG n 
1 585 LYS n 
1 586 GLU n 
1 587 ILE n 
1 588 GLY n 
1 589 PRO n 
1 590 LEU n 
1 591 ALA n 
1 592 THR n 
1 593 PRO n 
1 594 ASP n 
1 595 VAL n 
1 596 LEU n 
1 597 HIS n 
1 598 TRP n 
1 599 THR n 
1 600 ASP n 
1 601 SER n 
1 602 LEU n 
1 603 PRO n 
1 604 LYS n 
1 605 THR n 
1 606 ARG n 
1 607 SER n 
1 608 GLY n 
1 609 LYS n 
1 610 ILE n 
1 611 MET n 
1 612 ARG n 
1 613 ARG n 
1 614 ILE n 
1 615 LEU n 
1 616 ARG n 
1 617 LYS n 
1 618 ILE n 
1 619 ALA n 
1 620 ALA n 
1 621 GLY n 
1 622 ASP n 
1 623 THR n 
1 624 SER n 
1 625 ASN n 
1 626 LEU n 
1 627 GLY n 
1 628 ASP n 
1 629 THR n 
1 630 SER n 
1 631 THR n 
1 632 LEU n 
1 633 ALA n 
1 634 ASP n 
1 635 PRO n 
1 636 GLY n 
1 637 VAL n 
1 638 VAL n 
1 639 GLU n 
1 640 LYS n 
1 641 LEU n 
1 642 LEU n 
1 643 GLU n 
1 644 GLU n 
1 645 LYS n 
1 646 GLN n 
1 647 ALA n 
1 648 ILE n 
1 649 ALA n 
1 650 MET n 
1 651 PRO n 
1 652 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Salmonella 
_entity_src_gen.pdbx_gene_src_gene                 ACS 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Salmonella enterica' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     28901 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTYB1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACSA_SALTY 
_struct_ref.pdbx_db_accession          Q8ZKF6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1PG4 A 1 ? 652 ? Q8ZKF6 1 ? 652 ? 1 652 
2 1 1PG4 B 1 ? 652 ? Q8ZKF6 1 ? 652 ? 1 652 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1PG4 CYS A 174 ? UNP Q8ZKF6 ARG 174 'engineered mutation' 174 1 
2 1PG4 CYS B 174 ? UNP Q8ZKF6 ARG 174 'engineered mutation' 174 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                   ?                              'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE                                  ?                              'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE                                ?                              'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                           ?                              'C4 H7 N O4'          133.103 
CL  non-polymer         . 'CHLORIDE ION'                            ?                              'Cl -1'               35.453  
COA non-polymer         . 'COENZYME A'                              ?                              'C21 H36 N7 O16 P3 S' 767.534 
CYS 'L-peptide linking' y CYSTEINE                                  ?                              'C3 H7 N O2 S'        121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                            'ETHYLENE GLYCOL'              'C2 H6 O2'            62.068  
GLN 'L-peptide linking' y GLUTAMINE                                 ?                              'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                           ?                              'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE                                   ?                              'C2 H5 N O2'          75.067  
HIS 'L-peptide linking' y HISTIDINE                                 ?                              'C6 H10 N3 O2 1'      156.162 
HOH non-polymer         . WATER                                     ?                              'H2 O'                18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                ?                              'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE                                   ?                              'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE                                    ?                              'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE                                ?                              'C5 H11 N O2 S'       149.211 
MG  non-polymer         . 'MAGNESIUM ION'                           ?                              'Mg 2'                24.305  
PHE 'L-peptide linking' y PHENYLALANINE                             ?                              'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE                                   ?                              'C5 H9 N O2'          115.130 
PRX non-polymer         . 
;ADENOSINE-5'-MONOPHOSPHATE-PROPYL ESTER
;
"ADENOSINE-5'-PROPYLPHOSPHATE" 'C13 H20 N5 O7 P'     389.301 
SER 'L-peptide linking' y SERINE                                    ?                              'C3 H7 N O3'          105.093 
THR 'L-peptide linking' y THREONINE                                 ?                              'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                ?                              'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE                                  ?                              'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE                                    ?                              'C5 H11 N O2'         117.146 
# 
_exptl.entry_id          1PG4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   38.9 
_exptl_crystal.density_Matthews      2.03 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            287 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'PEG 8000, ethylene glycol, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 287K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           113 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2002-04-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98074 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F2' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.98074 
# 
_reflns.entry_id                     1PG4 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            1.75 
_reflns.d_resolution_low             29.8 
_reflns.number_all                   121298 
_reflns.number_obs                   114107 
_reflns.percent_possible_obs         93.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.071 
_reflns.pdbx_netI_over_sigmaI        14.2 
_reflns.B_iso_Wilson_estimate        19.4 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.75 
_reflns_shell.d_res_low              1.81 
_reflns_shell.percent_possible_all   75.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.415 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2926 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1PG4 
_refine.ls_d_res_high                            1.75 
_refine.ls_d_res_low                             29.80 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     121298 
_refine.ls_number_reflns_obs                     113617 
_refine.ls_number_reflns_R_free                  5695 
_refine.ls_percent_reflns_obs                    93.7 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.184 
_refine.ls_R_factor_R_free                       0.211 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               21.22 
_refine.aniso_B[1][1]                            -2.06 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -2.74 
_refine.aniso_B[2][2]                            -0.77 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            2.83 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1PG4 
_refine_analyze.Luzzati_coordinate_error_obs    0.17 
_refine_analyze.Luzzati_sigma_a_obs             0.19 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.21 
_refine_analyze.Luzzati_sigma_a_free            0.22 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9816 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         172 
_refine_hist.number_atoms_solvent             849 
_refine_hist.number_atoms_total               10837 
_refine_hist.d_res_high                       1.75 
_refine_hist.d_res_low                        29.80 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_all 
8 1.75 1.83 . 0.288 78.0 0.285 0.012 . 606 11794 . . 'X-RAY DIFFRACTION' . 
8 1.83 1.93 . 0.241 87.6 0.239 0.009 . 650 13298 . . 'X-RAY DIFFRACTION' . 
8 1.93 2.05 . 0.196 90.1 0.196 0.008 . 657 13638 . . 'X-RAY DIFFRACTION' . 
8 2.05 2.2  . 0.194 94.6 0.187 0.007 . 726 14943 . . 'X-RAY DIFFRACTION' . 
8 2.20 2.43 . 0.179 98.5 0.181 0.007 . 735 14943 . . 'X-RAY DIFFRACTION' . 
8 2.43 3.78 . 0.178 99.8 0.178 0.007 . 717 15135 . . 'X-RAY DIFFRACTION' . 
8 2.78 3.50 . 0.177 100. 0.177 0.006 . 801 15175 . . 'X-RAY DIFFRACTION' . 
8 3.50 29.8 . 0.168 100. 0.168 0.006 . 803 15297 . . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  1PG4 
_struct.title                     'Acetyl CoA Synthetase, Salmonella enterica' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1PG4 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            'AMP-forming; Adenylate-forming; thioester-forming, LIGASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
J N N 2 ? 
K N N 3 ? 
L N N 4 ? 
M N N 5 ? 
N N N 6 ? 
O N N 6 ? 
P N N 7 ? 
Q N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 10  ? CYS A 17  ? PRO A 10  CYS A 17  1 ? 8  
HELX_P HELX_P2  2  ASN A 20  ? ASP A 34  ? ASN A 20  ASP A 34  1 ? 15 
HELX_P HELX_P3  3  ASP A 34  ? GLY A 43  ? ASP A 34  GLY A 43  1 ? 10 
HELX_P HELX_P4  4  LYS A 44  ? LEU A 46  ? LYS A 44  LEU A 46  5 ? 3  
HELX_P HELX_P5  5  ASN A 76  ? LEU A 82  ? ASN A 76  LEU A 82  1 ? 7  
HELX_P HELX_P6  6  HIS A 85  ? GLY A 90  ? HIS A 85  GLY A 90  1 ? 6  
HELX_P HELX_P7  7  TYR A 110 ? GLY A 128 ? TYR A 110 GLY A 128 1 ? 19 
HELX_P HELX_P8  8  VAL A 142 ? GLY A 156 ? VAL A 142 GLY A 156 1 ? 15 
HELX_P HELX_P9  9  SER A 167 ? SER A 179 ? SER A 167 SER A 179 1 ? 13 
HELX_P HELX_P10 10 LEU A 198 ? LYS A 207 ? LEU A 198 LYS A 207 1 ? 10 
HELX_P HELX_P11 11 TRP A 237 ? GLU A 242 ? TRP A 237 GLU A 242 1 ? 6  
HELX_P HELX_P12 12 THR A 278 ? PHE A 293 ? THR A 278 PHE A 293 1 ? 16 
HELX_P HELX_P13 13 TRP A 309 ? LEU A 316 ? TRP A 309 LEU A 316 1 ? 8  
HELX_P HELX_P14 14 LEU A 317 ? CYS A 323 ? LEU A 317 CYS A 323 1 ? 7  
HELX_P HELX_P15 15 ALA A 340 ? GLN A 350 ? ALA A 340 GLN A 350 1 ? 11 
HELX_P HELX_P16 16 ALA A 357 ? ALA A 366 ? ALA A 357 ALA A 366 1 ? 10 
HELX_P HELX_P17 17 GLU A 367 ? ILE A 372 ? GLU A 367 ILE A 372 5 ? 6  
HELX_P HELX_P18 18 ASN A 391 ? ILE A 402 ? ASN A 391 ILE A 402 1 ? 12 
HELX_P HELX_P19 19 GLN A 415 ? GLY A 419 ? GLN A 415 GLY A 419 5 ? 5  
HELX_P HELX_P20 20 ASP A 480 ? SER A 490 ? ASP A 480 SER A 490 1 ? 11 
HELX_P HELX_P21 21 THR A 529 ? HIS A 539 ? THR A 529 HIS A 539 1 ? 11 
HELX_P HELX_P22 22 SER A 572 ? ILE A 587 ? SER A 572 ILE A 587 1 ? 16 
HELX_P HELX_P23 23 GLY A 588 ? THR A 592 ? GLY A 588 THR A 592 5 ? 5  
HELX_P HELX_P24 24 MET A 611 ? GLY A 621 ? MET A 611 GLY A 621 1 ? 11 
HELX_P HELX_P25 25 GLY A 636 ? ALA A 647 ? GLY A 636 ALA A 647 1 ? 12 
HELX_P HELX_P26 26 PRO B 10  ? CYS B 17  ? PRO B 10  CYS B 17  1 ? 8  
HELX_P HELX_P27 27 ASN B 20  ? ASP B 34  ? ASN B 20  ASP B 34  1 ? 15 
HELX_P HELX_P28 28 ASP B 34  ? GLY B 43  ? ASP B 34  GLY B 43  1 ? 10 
HELX_P HELX_P29 29 LYS B 44  ? LEU B 46  ? LYS B 44  LEU B 46  5 ? 3  
HELX_P HELX_P30 30 ASN B 76  ? LEU B 82  ? ASN B 76  LEU B 82  1 ? 7  
HELX_P HELX_P31 31 HIS B 85  ? GLY B 90  ? HIS B 85  GLY B 90  1 ? 6  
HELX_P HELX_P32 32 TYR B 110 ? LEU B 127 ? TYR B 110 LEU B 127 1 ? 18 
HELX_P HELX_P33 33 VAL B 142 ? GLY B 156 ? VAL B 142 GLY B 156 1 ? 15 
HELX_P HELX_P34 34 SER B 167 ? SER B 179 ? SER B 167 SER B 179 1 ? 13 
HELX_P HELX_P35 35 LEU B 198 ? LEU B 206 ? LEU B 198 LEU B 206 1 ? 9  
HELX_P HELX_P36 36 TRP B 237 ? GLU B 242 ? TRP B 237 GLU B 242 1 ? 6  
HELX_P HELX_P37 37 THR B 278 ? PHE B 293 ? THR B 278 PHE B 293 1 ? 16 
HELX_P HELX_P38 38 TRP B 309 ? LEU B 316 ? TRP B 309 LEU B 316 1 ? 8  
HELX_P HELX_P39 39 LEU B 317 ? CYS B 323 ? LEU B 317 CYS B 323 1 ? 7  
HELX_P HELX_P40 40 ALA B 340 ? GLN B 350 ? ALA B 340 GLN B 350 1 ? 11 
HELX_P HELX_P41 41 ALA B 357 ? ALA B 366 ? ALA B 357 ALA B 366 1 ? 10 
HELX_P HELX_P42 42 GLU B 367 ? ILE B 372 ? GLU B 367 ILE B 372 5 ? 6  
HELX_P HELX_P43 43 ASN B 391 ? ILE B 402 ? ASN B 391 ILE B 402 1 ? 12 
HELX_P HELX_P44 44 GLN B 415 ? GLY B 419 ? GLN B 415 GLY B 419 5 ? 5  
HELX_P HELX_P45 45 ASP B 480 ? SER B 490 ? ASP B 480 SER B 490 1 ? 11 
HELX_P HELX_P46 46 THR B 529 ? ALA B 538 ? THR B 529 ALA B 538 1 ? 10 
HELX_P HELX_P47 47 SER B 572 ? ILE B 587 ? SER B 572 ILE B 587 1 ? 16 
HELX_P HELX_P48 48 GLY B 588 ? THR B 592 ? GLY B 588 THR B 592 5 ? 5  
HELX_P HELX_P49 49 MET B 611 ? GLY B 621 ? MET B 611 GLY B 621 1 ? 11 
HELX_P HELX_P50 50 ASP B 628 ? LEU B 632 ? ASP B 628 LEU B 632 5 ? 5  
HELX_P HELX_P51 51 PRO B 635 ? ALA B 647 ? PRO B 635 ALA B 647 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A VAL 537 O  ? ? ? 1_555 D MG  . MG ? ? A VAL 537 A MG  904  1_555 ? ? ? ? ? ? ? 2.364 ? ? 
metalc2  metalc ? ? A HIS 539 O  ? ? ? 1_555 D MG  . MG ? ? A HIS 539 A MG  904  1_555 ? ? ? ? ? ? ? 2.461 ? ? 
metalc3  metalc ? ? A ILE 542 O  ? ? ? 1_555 D MG  . MG ? ? A ILE 542 A MG  904  1_555 ? ? ? ? ? ? ? 2.276 ? ? 
metalc4  metalc ? ? D MG  .   MG ? ? ? 1_555 P HOH . O  ? ? A MG  904 A HOH 1877 1_555 ? ? ? ? ? ? ? 2.505 ? ? 
metalc5  metalc ? ? D MG  .   MG ? ? ? 1_555 P HOH . O  ? ? A MG  904 A HOH 1910 1_555 ? ? ? ? ? ? ? 2.643 ? ? 
metalc6  metalc ? ? D MG  .   MG ? ? ? 1_555 P HOH . O  ? ? A MG  904 A HOH 2208 1_555 ? ? ? ? ? ? ? 2.524 ? ? 
metalc7  metalc ? ? B VAL 537 O  ? ? ? 1_555 K MG  . MG ? ? B VAL 537 B MG  903  1_555 ? ? ? ? ? ? ? 2.252 ? ? 
metalc8  metalc ? ? B HIS 539 O  ? ? ? 1_555 K MG  . MG ? ? B HIS 539 B MG  903  1_555 ? ? ? ? ? ? ? 2.466 ? ? 
metalc9  metalc ? ? B ILE 542 O  ? ? ? 1_555 K MG  . MG ? ? B ILE 542 B MG  903  1_555 ? ? ? ? ? ? ? 2.381 ? ? 
metalc10 metalc ? ? K MG  .   MG ? ? ? 1_555 Q HOH . O  ? ? B MG  903 B HOH 1893 1_555 ? ? ? ? ? ? ? 2.463 ? ? 
metalc11 metalc ? ? K MG  .   MG ? ? ? 1_555 Q HOH . O  ? ? B MG  903 B HOH 2179 1_555 ? ? ? ? ? ? ? 2.892 ? ? 
metalc12 metalc ? ? K MG  .   MG ? ? ? 1_555 Q HOH . O  ? ? B MG  903 B HOH 2180 1_555 ? ? ? ? ? ? ? 2.997 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 336 A . ? TRP 336 A PRO 337 A ? PRO 337 A 1 0.14 
2 TRP 336 B . ? TRP 336 B PRO 337 B ? PRO 337 B 1 0.25 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 7 ? 
D ? 8 ? 
E ? 2 ? 
F ? 4 ? 
G ? 2 ? 
H ? 3 ? 
I ? 2 ? 
J ? 2 ? 
K ? 7 ? 
L ? 8 ? 
M ? 2 ? 
N ? 4 ? 
O ? 2 ? 
P ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? anti-parallel 
D 7 8 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? parallel      
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? parallel      
K 3 4 ? parallel      
K 4 5 ? parallel      
K 5 6 ? parallel      
K 6 7 ? parallel      
L 1 2 ? parallel      
L 2 3 ? parallel      
L 3 4 ? parallel      
L 4 5 ? parallel      
L 5 6 ? parallel      
L 6 7 ? anti-parallel 
L 7 8 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 56  ? SER A 59  ? LYS A 56  SER A 59  
A 2 SER A 66  ? TRP A 69  ? SER A 66  TRP A 69  
B 1 THR A 74  ? LEU A 75  ? THR A 74  LEU A 75  
B 2 MET A 253 ? ASN A 254 ? MET A 253 ASN A 254 
C 1 SER A 105 ? SER A 109 ? SER A 105 SER A 109 
C 2 THR A 93  ? GLU A 98  ? THR A 93  GLU A 98  
C 3 THR A 326 ? PHE A 330 ? THR A 326 PHE A 330 
C 4 ILE A 300 ? CYS A 303 ? ILE A 300 CYS A 303 
C 5 ILE A 353 ? THR A 356 ? ILE A 353 THR A 356 
C 6 ILE A 382 ? VAL A 386 ? ILE A 382 VAL A 386 
C 7 VAL A 409 ? THR A 412 ? VAL A 409 THR A 412 
D 1 ASP A 234 ? TRP A 236 ? ASP A 234 TRP A 236 
D 2 HIS A 216 ? LEU A 220 ? HIS A 216 LEU A 220 
D 3 LEU A 182 ? ALA A 186 ? LEU A 182 ALA A 186 
D 4 VAL A 134 ? TYR A 138 ? VAL A 134 TYR A 138 
D 5 VAL A 158 ? VAL A 161 ? VAL A 158 VAL A 161 
D 6 PRO A 258 ? THR A 264 ? PRO A 258 THR A 264 
D 7 LYS A 272 ? THR A 277 ? LYS A 272 THR A 277 
D 8 THR A 476 ? LEU A 477 ? THR A 476 LEU A 477 
E 1 GLU A 188 ? ARG A 191 ? GLU A 188 ARG A 191 
E 2 ARG A 194 ? PRO A 197 ? ARG A 194 PRO A 197 
F 1 PRO A 446 ? VAL A 449 ? PRO A 446 VAL A 449 
F 2 THR A 460 ? ILE A 466 ? THR A 460 ILE A 466 
F 3 TYR A 496 ? ARG A 504 ? TYR A 496 ARG A 504 
F 4 TYR A 510 ? ARG A 515 ? TYR A 510 ARG A 515 
G 1 VAL A 519 ? VAL A 522 ? VAL A 519 VAL A 522 
G 2 HIS A 525 ? GLY A 528 ? HIS A 525 GLY A 528 
H 1 ILE A 542 ? HIS A 552 ? ILE A 542 HIS A 552 
H 2 GLY A 556 ? LEU A 565 ? GLY A 556 LEU A 565 
H 3 VAL A 595 ? TRP A 598 ? VAL A 595 TRP A 598 
I 1 LYS B 56  ? SER B 59  ? LYS B 56  SER B 59  
I 2 SER B 66  ? TRP B 69  ? SER B 66  TRP B 69  
J 1 THR B 74  ? LEU B 75  ? THR B 74  LEU B 75  
J 2 MET B 253 ? ASN B 254 ? MET B 253 ASN B 254 
K 1 SER B 105 ? SER B 109 ? SER B 105 SER B 109 
K 2 THR B 93  ? GLU B 98  ? THR B 93  GLU B 98  
K 3 THR B 326 ? PHE B 330 ? THR B 326 PHE B 330 
K 4 ILE B 300 ? CYS B 303 ? ILE B 300 CYS B 303 
K 5 ILE B 353 ? THR B 356 ? ILE B 353 THR B 356 
K 6 ILE B 382 ? SER B 385 ? ILE B 382 SER B 385 
K 7 VAL B 409 ? ASP B 411 ? VAL B 409 ASP B 411 
L 1 ASP B 234 ? TRP B 236 ? ASP B 234 TRP B 236 
L 2 HIS B 216 ? LEU B 220 ? HIS B 216 LEU B 220 
L 3 LEU B 182 ? ALA B 186 ? LEU B 182 ALA B 186 
L 4 VAL B 134 ? TYR B 138 ? VAL B 134 TYR B 138 
L 5 VAL B 158 ? VAL B 161 ? VAL B 158 VAL B 161 
L 6 PRO B 258 ? THR B 264 ? PRO B 258 THR B 264 
L 7 LYS B 272 ? THR B 277 ? LYS B 272 THR B 277 
L 8 THR B 476 ? LEU B 477 ? THR B 476 LEU B 477 
M 1 GLU B 188 ? ARG B 191 ? GLU B 188 ARG B 191 
M 2 ARG B 194 ? PRO B 197 ? ARG B 194 PRO B 197 
N 1 PRO B 446 ? VAL B 449 ? PRO B 446 VAL B 449 
N 2 THR B 460 ? ILE B 466 ? THR B 460 ILE B 466 
N 3 TYR B 496 ? ARG B 504 ? TYR B 496 ARG B 504 
N 4 TYR B 510 ? ARG B 515 ? TYR B 510 ARG B 515 
O 1 VAL B 519 ? VAL B 522 ? VAL B 519 VAL B 522 
O 2 HIS B 525 ? GLY B 528 ? HIS B 525 GLY B 528 
P 1 ILE B 542 ? HIS B 552 ? ILE B 542 HIS B 552 
P 2 GLY B 556 ? LEU B 565 ? GLY B 556 LEU B 565 
P 3 VAL B 595 ? TRP B 598 ? VAL B 595 TRP B 598 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 59  ? N SER A 59  O SER A 66  ? O SER A 66  
B 1 2 N LEU A 75  ? N LEU A 75  O MET A 253 ? O MET A 253 
C 1 2 O LYS A 106 ? O LYS A 106 N TRP A 97  ? N TRP A 97  
C 2 3 N ILE A 96  ? N ILE A 96  O MET A 329 ? O MET A 329 
C 3 4 O THR A 326 ? O THR A 326 N TYR A 301 ? N TYR A 301 
C 4 5 N TRP A 302 ? N TRP A 302 O TYR A 355 ? O TYR A 355 
C 5 6 N LEU A 354 ? N LEU A 354 O ILE A 382 ? O ILE A 382 
C 6 7 N LEU A 383 ? N LEU A 383 O VAL A 410 ? O VAL A 410 
D 1 2 O LEU A 235 ? O LEU A 235 N VAL A 219 ? N VAL A 219 
D 2 3 O ILE A 218 ? O ILE A 218 N THR A 185 ? N THR A 185 
D 3 4 O ILE A 184 ? O ILE A 184 N TYR A 138 ? N TYR A 138 
D 4 5 N VAL A 135 ? N VAL A 135 O SER A 160 ? O SER A 160 
D 5 6 N HIS A 159 ? N HIS A 159 O ILE A 261 ? O ILE A 261 
D 6 7 N THR A 264 ? N THR A 264 O LYS A 272 ? O LYS A 272 
D 7 8 N LEU A 275 ? N LEU A 275 O THR A 476 ? O THR A 476 
E 1 2 N GLY A 189 ? N GLY A 189 O ILE A 196 ? O ILE A 196 
F 1 2 N VAL A 449 ? N VAL A 449 O ASN A 463 ? O ASN A 463 
F 2 3 N THR A 460 ? N THR A 460 O ARG A 504 ? O ARG A 504 
F 3 4 N ARG A 503 ? N ARG A 503 O TRP A 511 ? O TRP A 511 
G 1 2 N LEU A 520 ? N LEU A 520 O LEU A 527 ? O LEU A 527 
H 1 2 N ALA A 546 ? N ALA A 546 O TYR A 562 ? O TYR A 562 
H 2 3 N ALA A 561 ? N ALA A 561 O HIS A 597 ? O HIS A 597 
I 1 2 N SER B 59  ? N SER B 59  O SER B 66  ? O SER B 66  
J 1 2 N LEU B 75  ? N LEU B 75  O MET B 253 ? O MET B 253 
K 1 2 O LYS B 106 ? O LYS B 106 N TRP B 97  ? N TRP B 97  
K 2 3 N ILE B 96  ? N ILE B 96  O MET B 329 ? O MET B 329 
K 3 4 O THR B 326 ? O THR B 326 N TYR B 301 ? N TYR B 301 
K 4 5 N TRP B 302 ? N TRP B 302 O TYR B 355 ? O TYR B 355 
K 5 6 N LEU B 354 ? N LEU B 354 O ILE B 382 ? O ILE B 382 
K 6 7 N LEU B 383 ? N LEU B 383 O VAL B 410 ? O VAL B 410 
L 1 2 O LEU B 235 ? O LEU B 235 N VAL B 219 ? N VAL B 219 
L 2 3 O ILE B 218 ? O ILE B 218 N THR B 185 ? N THR B 185 
L 3 4 O LEU B 182 ? O LEU B 182 N ALA B 136 ? N ALA B 136 
L 4 5 N VAL B 135 ? N VAL B 135 O SER B 160 ? O SER B 160 
L 5 6 N HIS B 159 ? N HIS B 159 O ILE B 261 ? O ILE B 261 
L 6 7 N THR B 264 ? N THR B 264 O LYS B 272 ? O LYS B 272 
L 7 8 N LEU B 275 ? N LEU B 275 O THR B 476 ? O THR B 476 
M 1 2 N GLY B 189 ? N GLY B 189 O ILE B 196 ? O ILE B 196 
N 1 2 N VAL B 449 ? N VAL B 449 O ASN B 463 ? O ASN B 463 
N 2 3 N ILE B 466 ? N ILE B 466 O TYR B 496 ? O TYR B 496 
N 3 4 N ARG B 503 ? N ARG B 503 O TRP B 511 ? O TRP B 511 
O 1 2 N LEU B 520 ? N LEU B 520 O LEU B 527 ? O LEU B 527 
P 1 2 N ALA B 546 ? N ALA B 546 O TYR B 562 ? O TYR B 562 
P 2 3 N ALA B 561 ? N ALA B 561 O VAL B 595 ? O VAL B 595 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B CL  901  ? 2  'BINDING SITE FOR RESIDUE CL B 901'   
AC2 Software A CL  902  ? 2  'BINDING SITE FOR RESIDUE CL A 902'   
AC3 Software B MG  903  ? 6  'BINDING SITE FOR RESIDUE MG B 903'   
AC4 Software A MG  904  ? 6  'BINDING SITE FOR RESIDUE MG A 904'   
AC5 Software A COA 990  ? 17 'BINDING SITE FOR RESIDUE COA A 990'  
AC6 Software B COA 991  ? 20 'BINDING SITE FOR RESIDUE COA B 991'  
AC7 Software A PRX 999  ? 19 'BINDING SITE FOR RESIDUE PRX A 999'  
AC8 Software B PRX 998  ? 19 'BINDING SITE FOR RESIDUE PRX B 998'  
AC9 Software B EDO 1800 ? 7  'BINDING SITE FOR RESIDUE EDO B 1800' 
BC1 Software A EDO 1801 ? 6  'BINDING SITE FOR RESIDUE EDO A 1801' 
BC2 Software A EDO 1802 ? 5  'BINDING SITE FOR RESIDUE EDO A 1802' 
BC3 Software A EDO 1803 ? 8  'BINDING SITE FOR RESIDUE EDO A 1803' 
BC4 Software B EDO 1804 ? 4  'BINDING SITE FOR RESIDUE EDO B 1804' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 2  LYS B 221 ? LYS B 221  . ? 1_555 ? 
2   AC1 2  ARG B 238 ? ARG B 238  . ? 1_555 ? 
3   AC2 2  LYS A 221 ? LYS A 221  . ? 1_555 ? 
4   AC2 2  ARG A 238 ? ARG A 238  . ? 1_555 ? 
5   AC3 6  VAL B 537 ? VAL B 537  . ? 1_555 ? 
6   AC3 6  HIS B 539 ? HIS B 539  . ? 1_555 ? 
7   AC3 6  ILE B 542 ? ILE B 542  . ? 1_555 ? 
8   AC3 6  HOH Q .   ? HOH B 1893 . ? 1_555 ? 
9   AC3 6  HOH Q .   ? HOH B 2179 . ? 1_555 ? 
10  AC3 6  HOH Q .   ? HOH B 2180 . ? 1_555 ? 
11  AC4 6  VAL A 537 ? VAL A 537  . ? 1_555 ? 
12  AC4 6  HIS A 539 ? HIS A 539  . ? 1_555 ? 
13  AC4 6  ILE A 542 ? ILE A 542  . ? 1_555 ? 
14  AC4 6  HOH P .   ? HOH A 1877 . ? 1_555 ? 
15  AC4 6  HOH P .   ? HOH A 1910 . ? 1_555 ? 
16  AC4 6  HOH P .   ? HOH A 2208 . ? 1_555 ? 
17  AC5 17 PHE A 163 ? PHE A 163  . ? 1_555 ? 
18  AC5 17 GLY A 165 ? GLY A 165  . ? 1_555 ? 
19  AC5 17 ARG A 191 ? ARG A 191  . ? 1_555 ? 
20  AC5 17 TRP A 309 ? TRP A 309  . ? 1_555 ? 
21  AC5 17 ALA A 357 ? ALA A 357  . ? 1_555 ? 
22  AC5 17 THR A 359 ? THR A 359  . ? 1_555 ? 
23  AC5 17 VAL A 386 ? VAL A 386  . ? 1_555 ? 
24  AC5 17 SER A 523 ? SER A 523  . ? 1_555 ? 
25  AC5 17 GLY A 524 ? GLY A 524  . ? 1_555 ? 
26  AC5 17 ARG A 584 ? ARG A 584  . ? 1_555 ? 
27  AC5 17 PRO A 589 ? PRO A 589  . ? 1_555 ? 
28  AC5 17 HOH P .   ? HOH A 1854 . ? 1_555 ? 
29  AC5 17 HOH P .   ? HOH A 1883 . ? 1_555 ? 
30  AC5 17 HOH P .   ? HOH A 1923 . ? 1_555 ? 
31  AC5 17 HOH P .   ? HOH A 2133 . ? 1_555 ? 
32  AC5 17 HOH P .   ? HOH A 2162 . ? 1_555 ? 
33  AC5 17 HOH P .   ? HOH A 2163 . ? 1_555 ? 
34  AC6 20 PHE B 163 ? PHE B 163  . ? 1_555 ? 
35  AC6 20 GLY B 165 ? GLY B 165  . ? 1_555 ? 
36  AC6 20 ARG B 191 ? ARG B 191  . ? 1_555 ? 
37  AC6 20 ILE B 196 ? ILE B 196  . ? 1_555 ? 
38  AC6 20 TRP B 309 ? TRP B 309  . ? 1_555 ? 
39  AC6 20 ALA B 357 ? ALA B 357  . ? 1_555 ? 
40  AC6 20 THR B 359 ? THR B 359  . ? 1_555 ? 
41  AC6 20 VAL B 386 ? VAL B 386  . ? 1_555 ? 
42  AC6 20 SER B 523 ? SER B 523  . ? 1_555 ? 
43  AC6 20 GLY B 524 ? GLY B 524  . ? 1_555 ? 
44  AC6 20 ARG B 584 ? ARG B 584  . ? 1_555 ? 
45  AC6 20 PRO B 589 ? PRO B 589  . ? 1_555 ? 
46  AC6 20 HOH Q .   ? HOH B 1883 . ? 1_555 ? 
47  AC6 20 HOH Q .   ? HOH B 2010 . ? 1_555 ? 
48  AC6 20 HOH Q .   ? HOH B 2014 . ? 1_555 ? 
49  AC6 20 HOH Q .   ? HOH B 2060 . ? 1_555 ? 
50  AC6 20 HOH Q .   ? HOH B 2092 . ? 1_555 ? 
51  AC6 20 HOH Q .   ? HOH B 2093 . ? 1_555 ? 
52  AC6 20 HOH Q .   ? HOH B 2110 . ? 1_555 ? 
53  AC6 20 HOH Q .   ? HOH B 2131 . ? 1_555 ? 
54  AC7 19 THR A 311 ? THR A 311  . ? 1_555 ? 
55  AC7 19 GLY A 387 ? GLY A 387  . ? 1_555 ? 
56  AC7 19 GLU A 388 ? GLU A 388  . ? 1_555 ? 
57  AC7 19 PRO A 389 ? PRO A 389  . ? 1_555 ? 
58  AC7 19 ASP A 411 ? ASP A 411  . ? 1_555 ? 
59  AC7 19 THR A 412 ? THR A 412  . ? 1_555 ? 
60  AC7 19 TRP A 413 ? TRP A 413  . ? 1_555 ? 
61  AC7 19 TRP A 414 ? TRP A 414  . ? 1_555 ? 
62  AC7 19 GLN A 415 ? GLN A 415  . ? 1_555 ? 
63  AC7 19 THR A 416 ? THR A 416  . ? 1_555 ? 
64  AC7 19 ASP A 500 ? ASP A 500  . ? 1_555 ? 
65  AC7 19 ILE A 512 ? ILE A 512  . ? 1_555 ? 
66  AC7 19 ARG A 515 ? ARG A 515  . ? 1_555 ? 
67  AC7 19 ARG A 526 ? ARG A 526  . ? 1_555 ? 
68  AC7 19 HOH P .   ? HOH A 1887 . ? 1_555 ? 
69  AC7 19 HOH P .   ? HOH A 2054 . ? 1_555 ? 
70  AC7 19 HOH P .   ? HOH A 2056 . ? 1_555 ? 
71  AC7 19 HOH P .   ? HOH A 2078 . ? 1_555 ? 
72  AC7 19 HOH P .   ? HOH A 2201 . ? 1_555 ? 
73  AC8 19 THR B 311 ? THR B 311  . ? 1_555 ? 
74  AC8 19 GLY B 387 ? GLY B 387  . ? 1_555 ? 
75  AC8 19 GLU B 388 ? GLU B 388  . ? 1_555 ? 
76  AC8 19 PRO B 389 ? PRO B 389  . ? 1_555 ? 
77  AC8 19 ASP B 411 ? ASP B 411  . ? 1_555 ? 
78  AC8 19 THR B 412 ? THR B 412  . ? 1_555 ? 
79  AC8 19 TRP B 413 ? TRP B 413  . ? 1_555 ? 
80  AC8 19 TRP B 414 ? TRP B 414  . ? 1_555 ? 
81  AC8 19 GLN B 415 ? GLN B 415  . ? 1_555 ? 
82  AC8 19 THR B 416 ? THR B 416  . ? 1_555 ? 
83  AC8 19 ASP B 500 ? ASP B 500  . ? 1_555 ? 
84  AC8 19 ILE B 512 ? ILE B 512  . ? 1_555 ? 
85  AC8 19 ARG B 515 ? ARG B 515  . ? 1_555 ? 
86  AC8 19 ARG B 526 ? ARG B 526  . ? 1_555 ? 
87  AC8 19 HOH Q .   ? HOH B 2005 . ? 1_555 ? 
88  AC8 19 HOH Q .   ? HOH B 2023 . ? 1_555 ? 
89  AC8 19 HOH Q .   ? HOH B 2030 . ? 1_555 ? 
90  AC8 19 HOH Q .   ? HOH B 2104 . ? 1_555 ? 
91  AC8 19 HOH Q .   ? HOH B 2111 . ? 1_555 ? 
92  AC9 7  VAL B 161 ? VAL B 161  . ? 1_555 ? 
93  AC9 7  ILE B 162 ? ILE B 162  . ? 1_555 ? 
94  AC9 7  PHE B 163 ? PHE B 163  . ? 1_555 ? 
95  AC9 7  PHE B 166 ? PHE B 166  . ? 1_555 ? 
96  AC9 7  TYR B 263 ? TYR B 263  . ? 1_555 ? 
97  AC9 7  GLY B 308 ? GLY B 308  . ? 1_555 ? 
98  AC9 7  HOH Q .   ? HOH B 1834 . ? 1_555 ? 
99  BC1 6  VAL A 161 ? VAL A 161  . ? 1_555 ? 
100 BC1 6  ILE A 162 ? ILE A 162  . ? 1_555 ? 
101 BC1 6  PHE A 163 ? PHE A 163  . ? 1_555 ? 
102 BC1 6  PHE A 166 ? PHE A 166  . ? 1_555 ? 
103 BC1 6  TYR A 263 ? TYR A 263  . ? 1_555 ? 
104 BC1 6  GLY A 308 ? GLY A 308  . ? 1_555 ? 
105 BC2 5  GLU A 41  ? GLU A 41   . ? 1_555 ? 
106 BC2 5  GLN A 42  ? GLN A 42   . ? 1_555 ? 
107 BC2 5  ILE A 45  ? ILE A 45   . ? 1_555 ? 
108 BC2 5  HOH P .   ? HOH A 1891 . ? 1_555 ? 
109 BC2 5  HOH P .   ? HOH A 1996 . ? 1_555 ? 
110 BC3 8  GLY A 164 ? GLY A 164  . ? 1_555 ? 
111 BC3 8  GLY A 165 ? GLY A 165  . ? 1_555 ? 
112 BC3 8  PHE A 166 ? PHE A 166  . ? 1_555 ? 
113 BC3 8  SER A 167 ? SER A 167  . ? 1_555 ? 
114 BC3 8  ILE A 196 ? ILE A 196  . ? 1_555 ? 
115 BC3 8  ASN A 201 ? ASN A 201  . ? 1_555 ? 
116 BC3 8  PRO A 589 ? PRO A 589  . ? 1_555 ? 
117 BC3 8  HOH P .   ? HOH A 2035 . ? 1_555 ? 
118 BC4 4  VAL B 190 ? VAL B 190  . ? 1_555 ? 
119 BC4 4  GLY B 193 ? GLY B 193  . ? 1_555 ? 
120 BC4 4  ARG B 194 ? ARG B 194  . ? 1_555 ? 
121 BC4 4  SER B 195 ? SER B 195  . ? 1_555 ? 
# 
_atom_sites.entry_id                    1PG4 
_atom_sites.fract_transf_matrix[1][1]   0.016668 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000384 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006992 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013945 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . HIS A 1 5   ? 18.010  146.008 43.341  1.00 34.64 ? 5    HIS A N     1 
ATOM   2     C  CA    . HIS A 1 5   ? 17.841  146.955 42.199  1.00 34.55 ? 5    HIS A CA    1 
ATOM   3     C  C     . HIS A 1 5   ? 18.997  146.848 41.207  1.00 33.80 ? 5    HIS A C     1 
ATOM   4     O  O     . HIS A 1 5   ? 20.160  147.030 41.574  1.00 33.17 ? 5    HIS A O     1 
ATOM   5     C  CB    . HIS A 1 5   ? 17.767  148.396 42.708  1.00 36.06 ? 5    HIS A CB    1 
ATOM   6     C  CG    . HIS A 1 5   ? 17.640  149.415 41.616  1.00 38.19 ? 5    HIS A CG    1 
ATOM   7     N  ND1   . HIS A 1 5   ? 18.216  150.665 41.693  1.00 38.65 ? 5    HIS A ND1   1 
ATOM   8     C  CD2   . HIS A 1 5   ? 16.998  149.370 40.424  1.00 39.57 ? 5    HIS A CD2   1 
ATOM   9     C  CE1   . HIS A 1 5   ? 17.936  151.345 40.596  1.00 39.68 ? 5    HIS A CE1   1 
ATOM   10    N  NE2   . HIS A 1 5   ? 17.198  150.582 39.809  1.00 40.48 ? 5    HIS A NE2   1 
ATOM   11    N  N     . LYS A 1 6   ? 18.673  146.559 39.952  1.00 32.78 ? 6    LYS A N     1 
ATOM   12    C  CA    . LYS A 1 6   ? 19.682  146.444 38.907  1.00 31.82 ? 6    LYS A CA    1 
ATOM   13    C  C     . LYS A 1 6   ? 19.466  147.544 37.875  1.00 30.42 ? 6    LYS A C     1 
ATOM   14    O  O     . LYS A 1 6   ? 18.355  147.735 37.380  1.00 30.88 ? 6    LYS A O     1 
ATOM   15    C  CB    . LYS A 1 6   ? 19.601  145.070 38.230  1.00 33.32 ? 6    LYS A CB    1 
ATOM   16    C  CG    . LYS A 1 6   ? 19.864  143.901 39.172  1.00 36.02 ? 6    LYS A CG    1 
ATOM   17    C  CD    . LYS A 1 6   ? 19.682  142.539 38.495  1.00 37.51 ? 6    LYS A CD    1 
ATOM   18    C  CE    . LYS A 1 6   ? 20.831  142.196 37.558  1.00 37.09 ? 6    LYS A CE    1 
ATOM   19    N  NZ    . LYS A 1 6   ? 20.754  140.782 37.075  1.00 37.01 ? 6    LYS A NZ    1 
ATOM   20    N  N     . HIS A 1 7   ? 20.529  148.277 37.567  1.00 26.98 ? 7    HIS A N     1 
ATOM   21    C  CA    . HIS A 1 7   ? 20.455  149.348 36.584  1.00 24.72 ? 7    HIS A CA    1 
ATOM   22    C  C     . HIS A 1 7   ? 20.557  148.737 35.197  1.00 24.18 ? 7    HIS A C     1 
ATOM   23    O  O     . HIS A 1 7   ? 21.509  148.017 34.897  1.00 22.22 ? 7    HIS A O     1 
ATOM   24    C  CB    . HIS A 1 7   ? 21.601  150.336 36.798  1.00 24.43 ? 7    HIS A CB    1 
ATOM   25    C  CG    . HIS A 1 7   ? 21.474  151.142 38.051  1.00 23.96 ? 7    HIS A CG    1 
ATOM   26    N  ND1   . HIS A 1 7   ? 20.821  152.355 38.091  1.00 24.55 ? 7    HIS A ND1   1 
ATOM   27    C  CD2   . HIS A 1 7   ? 21.900  150.901 39.313  1.00 24.19 ? 7    HIS A CD2   1 
ATOM   28    C  CE1   . HIS A 1 7   ? 20.852  152.827 39.325  1.00 24.79 ? 7    HIS A CE1   1 
ATOM   29    N  NE2   . HIS A 1 7   ? 21.500  151.963 40.085  1.00 23.14 ? 7    HIS A NE2   1 
ATOM   30    N  N     . ALA A 1 8   ? 19.574  149.025 34.353  1.00 22.31 ? 8    ALA A N     1 
ATOM   31    C  CA    . ALA A 1 8   ? 19.559  148.491 32.998  1.00 21.99 ? 8    ALA A CA    1 
ATOM   32    C  C     . ALA A 1 8   ? 20.565  149.207 32.105  1.00 21.07 ? 8    ALA A C     1 
ATOM   33    O  O     . ALA A 1 8   ? 21.022  150.306 32.420  1.00 21.35 ? 8    ALA A O     1 
ATOM   34    C  CB    . ALA A 1 8   ? 18.151  148.621 32.402  1.00 23.08 ? 8    ALA A CB    1 
ATOM   35    N  N     . ILE A 1 9   ? 20.909  148.571 30.991  1.00 20.41 ? 9    ILE A N     1 
ATOM   36    C  CA    . ILE A 1 9   ? 21.834  149.158 30.030  1.00 19.35 ? 9    ILE A CA    1 
ATOM   37    C  C     . ILE A 1 9   ? 21.061  150.204 29.228  1.00 20.33 ? 9    ILE A C     1 
ATOM   38    O  O     . ILE A 1 9   ? 20.066  149.887 28.570  1.00 21.41 ? 9    ILE A O     1 
ATOM   39    C  CB    . ILE A 1 9   ? 22.385  148.085 29.074  1.00 19.63 ? 9    ILE A CB    1 
ATOM   40    C  CG1   . ILE A 1 9   ? 23.181  147.050 29.871  1.00 18.99 ? 9    ILE A CG1   1 
ATOM   41    C  CG2   . ILE A 1 9   ? 23.254  148.732 27.999  1.00 20.85 ? 9    ILE A CG2   1 
ATOM   42    C  CD1   . ILE A 1 9   ? 23.417  145.758 29.125  1.00 20.00 ? 9    ILE A CD1   1 
ATOM   43    N  N     . PRO A 1 10  ? 21.505  151.469 29.277  1.00 19.46 ? 10   PRO A N     1 
ATOM   44    C  CA    . PRO A 1 10  ? 20.858  152.574 28.559  1.00 20.15 ? 10   PRO A CA    1 
ATOM   45    C  C     . PRO A 1 10  ? 20.898  152.372 27.046  1.00 19.64 ? 10   PRO A C     1 
ATOM   46    O  O     . PRO A 1 10  ? 21.860  151.816 26.514  1.00 19.00 ? 10   PRO A O     1 
ATOM   47    C  CB    . PRO A 1 10  ? 21.672  153.797 28.987  1.00 21.11 ? 10   PRO A CB    1 
ATOM   48    C  CG    . PRO A 1 10  ? 22.282  153.388 30.301  1.00 20.42 ? 10   PRO A CG    1 
ATOM   49    C  CD    . PRO A 1 10  ? 22.656  151.956 30.058  1.00 20.02 ? 10   PRO A CD    1 
ATOM   50    N  N     . ALA A 1 11  ? 19.862  152.845 26.359  1.00 19.38 ? 11   ALA A N     1 
ATOM   51    C  CA    . ALA A 1 11  ? 19.774  152.707 24.910  1.00 20.31 ? 11   ALA A CA    1 
ATOM   52    C  C     . ALA A 1 11  ? 20.962  153.311 24.163  1.00 18.52 ? 11   ALA A C     1 
ATOM   53    O  O     . ALA A 1 11  ? 21.420  152.744 23.174  1.00 19.02 ? 11   ALA A O     1 
ATOM   54    C  CB    . ALA A 1 11  ? 18.471  153.333 24.399  1.00 19.65 ? 11   ALA A CB    1 
ATOM   55    N  N     . ASN A 1 12  ? 21.458  154.458 24.621  1.00 18.03 ? 12   ASN A N     1 
ATOM   56    C  CA    . ASN A 1 12  ? 22.585  155.095 23.941  1.00 18.07 ? 12   ASN A CA    1 
ATOM   57    C  C     . ASN A 1 12  ? 23.820  154.200 23.995  1.00 17.42 ? 12   ASN A C     1 
ATOM   58    O  O     . ASN A 1 12  ? 24.580  154.125 23.028  1.00 17.37 ? 12   ASN A O     1 
ATOM   59    C  CB    . ASN A 1 12  ? 22.892  156.474 24.551  1.00 17.78 ? 12   ASN A CB    1 
ATOM   60    C  CG    . ASN A 1 12  ? 23.396  156.390 25.982  1.00 17.45 ? 12   ASN A CG    1 
ATOM   61    O  OD1   . ASN A 1 12  ? 22.745  155.811 26.849  1.00 17.43 ? 12   ASN A OD1   1 
ATOM   62    N  ND2   . ASN A 1 12  ? 24.564  156.982 26.235  1.00 17.91 ? 12   ASN A ND2   1 
ATOM   63    N  N     . ILE A 1 13  ? 24.010  153.519 25.122  1.00 16.80 ? 13   ILE A N     1 
ATOM   64    C  CA    . ILE A 1 13  ? 25.142  152.610 25.281  1.00 17.11 ? 13   ILE A CA    1 
ATOM   65    C  C     . ILE A 1 13  ? 24.879  151.331 24.484  1.00 17.87 ? 13   ILE A C     1 
ATOM   66    O  O     . ILE A 1 13  ? 25.776  150.792 23.841  1.00 17.35 ? 13   ILE A O     1 
ATOM   67    C  CB    . ILE A 1 13  ? 25.369  152.241 26.771  1.00 17.13 ? 13   ILE A CB    1 
ATOM   68    C  CG1   . ILE A 1 13  ? 25.767  153.492 27.565  1.00 16.01 ? 13   ILE A CG1   1 
ATOM   69    C  CG2   . ILE A 1 13  ? 26.449  151.162 26.889  1.00 13.95 ? 13   ILE A CG2   1 
ATOM   70    C  CD1   . ILE A 1 13  ? 27.058  154.143 27.096  1.00 16.77 ? 13   ILE A CD1   1 
ATOM   71    N  N     . ALA A 1 14  ? 23.641  150.850 24.523  1.00 18.78 ? 14   ALA A N     1 
ATOM   72    C  CA    . ALA A 1 14  ? 23.287  149.645 23.788  1.00 18.03 ? 14   ALA A CA    1 
ATOM   73    C  C     . ALA A 1 14  ? 23.506  149.865 22.290  1.00 19.35 ? 14   ALA A C     1 
ATOM   74    O  O     . ALA A 1 14  ? 23.927  148.957 21.575  1.00 18.38 ? 14   ALA A O     1 
ATOM   75    C  CB    . ALA A 1 14  ? 21.830  149.277 24.057  1.00 19.43 ? 14   ALA A CB    1 
ATOM   76    N  N     . ASP A 1 15  ? 23.237  151.081 21.824  1.00 17.85 ? 15   ASP A N     1 
ATOM   77    C  CA    . ASP A 1 15  ? 23.383  151.410 20.409  1.00 19.56 ? 15   ASP A CA    1 
ATOM   78    C  C     . ASP A 1 15  ? 24.813  151.511 19.890  1.00 18.65 ? 15   ASP A C     1 
ATOM   79    O  O     . ASP A 1 15  ? 25.039  151.419 18.687  1.00 18.71 ? 15   ASP A O     1 
ATOM   80    C  CB    . ASP A 1 15  ? 22.674  152.731 20.090  1.00 21.99 ? 15   ASP A CB    1 
ATOM   81    C  CG    . ASP A 1 15  ? 21.167  152.629 20.183  1.00 23.10 ? 15   ASP A CG    1 
ATOM   82    O  OD1   . ASP A 1 15  ? 20.645  151.497 20.239  1.00 24.65 ? 15   ASP A OD1   1 
ATOM   83    O  OD2   . ASP A 1 15  ? 20.503  153.688 20.186  1.00 26.58 ? 15   ASP A OD2   1 
ATOM   84    N  N     . ARG A 1 16  ? 25.781  151.694 20.778  1.00 19.58 ? 16   ARG A N     1 
ATOM   85    C  CA    . ARG A 1 16  ? 27.158  151.844 20.326  1.00 20.13 ? 16   ARG A CA    1 
ATOM   86    C  C     . ARG A 1 16  ? 28.180  150.927 20.979  1.00 18.40 ? 16   ARG A C     1 
ATOM   87    O  O     . ARG A 1 16  ? 29.350  150.935 20.590  1.00 17.23 ? 16   ARG A O     1 
ATOM   88    C  CB    . ARG A 1 16  ? 27.597  153.295 20.530  1.00 23.81 ? 16   ARG A CB    1 
ATOM   89    C  CG    . ARG A 1 16  ? 27.414  153.790 21.960  1.00 28.84 ? 16   ARG A CG    1 
ATOM   90    C  CD    . ARG A 1 16  ? 27.762  155.270 22.091  1.00 31.71 ? 16   ARG A CD    1 
ATOM   91    N  NE    . ARG A 1 16  ? 29.204  155.496 22.125  1.00 33.89 ? 16   ARG A NE    1 
ATOM   92    C  CZ    . ARG A 1 16  ? 29.794  156.628 21.753  1.00 35.49 ? 16   ARG A CZ    1 
ATOM   93    N  NH1   . ARG A 1 16  ? 29.065  157.644 21.309  1.00 37.21 ? 16   ARG A NH1   1 
ATOM   94    N  NH2   . ARG A 1 16  ? 31.114  156.746 21.832  1.00 34.24 ? 16   ARG A NH2   1 
ATOM   95    N  N     . CYS A 1 17  ? 27.746  150.127 21.948  1.00 16.97 ? 17   CYS A N     1 
ATOM   96    C  CA    . CYS A 1 17  ? 28.667  149.251 22.663  1.00 15.70 ? 17   CYS A CA    1 
ATOM   97    C  C     . CYS A 1 17  ? 29.433  148.257 21.797  1.00 16.42 ? 17   CYS A C     1 
ATOM   98    O  O     . CYS A 1 17  ? 28.911  147.704 20.823  1.00 14.40 ? 17   CYS A O     1 
ATOM   99    C  CB    . CYS A 1 17  ? 27.941  148.506 23.794  1.00 15.57 ? 17   CYS A CB    1 
ATOM   100   S  SG    . CYS A 1 17  ? 26.752  147.221 23.301  1.00 15.00 ? 17   CYS A SG    1 
ATOM   101   N  N     . LEU A 1 18  ? 30.688  148.039 22.173  1.00 14.84 ? 18   LEU A N     1 
ATOM   102   C  CA    . LEU A 1 18  ? 31.554  147.115 21.461  1.00 16.36 ? 18   LEU A CA    1 
ATOM   103   C  C     . LEU A 1 18  ? 31.176  145.679 21.806  1.00 17.13 ? 18   LEU A C     1 
ATOM   104   O  O     . LEU A 1 18  ? 31.359  144.774 20.997  1.00 18.06 ? 18   LEU A O     1 
ATOM   105   C  CB    . LEU A 1 18  ? 33.018  147.368 21.835  1.00 16.82 ? 18   LEU A CB    1 
ATOM   106   C  CG    . LEU A 1 18  ? 33.575  148.767 21.545  1.00 17.31 ? 18   LEU A CG    1 
ATOM   107   C  CD1   . LEU A 1 18  ? 35.029  148.845 22.014  1.00 17.80 ? 18   LEU A CD1   1 
ATOM   108   C  CD2   . LEU A 1 18  ? 33.477  149.070 20.054  1.00 18.90 ? 18   LEU A CD2   1 
ATOM   109   N  N     . ILE A 1 19  ? 30.639  145.478 23.007  1.00 17.41 ? 19   ILE A N     1 
ATOM   110   C  CA    . ILE A 1 19  ? 30.248  144.145 23.454  1.00 18.71 ? 19   ILE A CA    1 
ATOM   111   C  C     . ILE A 1 19  ? 28.882  144.149 24.133  1.00 18.72 ? 19   ILE A C     1 
ATOM   112   O  O     . ILE A 1 19  ? 28.690  144.820 25.146  1.00 18.34 ? 19   ILE A O     1 
ATOM   113   C  CB    . ILE A 1 19  ? 31.305  143.560 24.439  1.00 20.14 ? 19   ILE A CB    1 
ATOM   114   C  CG1   . ILE A 1 19  ? 32.619  143.307 23.689  1.00 21.94 ? 19   ILE A CG1   1 
ATOM   115   C  CG2   . ILE A 1 19  ? 30.782  142.276 25.088  1.00 20.25 ? 19   ILE A CG2   1 
ATOM   116   C  CD1   . ILE A 1 19  ? 33.680  142.606 24.507  1.00 22.70 ? 19   ILE A CD1   1 
ATOM   117   N  N     . ASN A 1 20  ? 27.934  143.402 23.570  1.00 17.18 ? 20   ASN A N     1 
ATOM   118   C  CA    . ASN A 1 20  ? 26.602  143.323 24.160  1.00 17.94 ? 20   ASN A CA    1 
ATOM   119   C  C     . ASN A 1 20  ? 26.518  142.097 25.079  1.00 17.86 ? 20   ASN A C     1 
ATOM   120   O  O     . ASN A 1 20  ? 27.469  141.316 25.168  1.00 18.47 ? 20   ASN A O     1 
ATOM   121   C  CB    . ASN A 1 20  ? 25.517  143.288 23.066  1.00 18.33 ? 20   ASN A CB    1 
ATOM   122   C  CG    . ASN A 1 20  ? 25.636  142.085 22.150  1.00 19.76 ? 20   ASN A CG    1 
ATOM   123   O  OD1   . ASN A 1 20  ? 25.879  140.968 22.603  1.00 18.99 ? 20   ASN A OD1   1 
ATOM   124   N  ND2   . ASN A 1 20  ? 25.443  142.306 20.855  1.00 17.76 ? 20   ASN A ND2   1 
ATOM   125   N  N     . PRO A 1 21  ? 25.390  141.917 25.789  1.00 17.85 ? 21   PRO A N     1 
ATOM   126   C  CA    . PRO A 1 21  ? 25.245  140.769 26.694  1.00 18.05 ? 21   PRO A CA    1 
ATOM   127   C  C     . PRO A 1 21  ? 25.559  139.399 26.094  1.00 18.94 ? 21   PRO A C     1 
ATOM   128   O  O     . PRO A 1 21  ? 26.271  138.598 26.702  1.00 17.71 ? 21   PRO A O     1 
ATOM   129   C  CB    . PRO A 1 21  ? 23.795  140.881 27.160  1.00 19.10 ? 21   PRO A CB    1 
ATOM   130   C  CG    . PRO A 1 21  ? 23.585  142.367 27.193  1.00 20.44 ? 21   PRO A CG    1 
ATOM   131   C  CD    . PRO A 1 21  ? 24.224  142.814 25.892  1.00 18.54 ? 21   PRO A CD    1 
ATOM   132   N  N     . GLU A 1 22  ? 25.028  139.128 24.906  1.00 19.83 ? 22   GLU A N     1 
ATOM   133   C  CA    . GLU A 1 22  ? 25.259  137.843 24.253  1.00 21.77 ? 22   GLU A CA    1 
ATOM   134   C  C     . GLU A 1 22  ? 26.724  137.645 23.882  1.00 21.78 ? 22   GLU A C     1 
ATOM   135   O  O     . GLU A 1 22  ? 27.285  136.566 24.084  1.00 21.08 ? 22   GLU A O     1 
ATOM   136   C  CB    . GLU A 1 22  ? 24.384  137.725 22.999  1.00 24.89 ? 22   GLU A CB    1 
ATOM   137   C  CG    . GLU A 1 22  ? 22.888  137.716 23.293  1.00 29.56 ? 22   GLU A CG    1 
ATOM   138   C  CD    . GLU A 1 22  ? 22.379  139.042 23.838  1.00 33.11 ? 22   GLU A CD    1 
ATOM   139   O  OE1   . GLU A 1 22  ? 21.643  139.026 24.850  1.00 34.17 ? 22   GLU A OE1   1 
ATOM   140   O  OE2   . GLU A 1 22  ? 22.704  140.100 23.252  1.00 34.23 ? 22   GLU A OE2   1 
ATOM   141   N  N     . GLN A 1 23  ? 27.342  138.689 23.342  1.00 20.79 ? 23   GLN A N     1 
ATOM   142   C  CA    . GLN A 1 23  ? 28.740  138.612 22.949  1.00 21.01 ? 23   GLN A CA    1 
ATOM   143   C  C     . GLN A 1 23  ? 29.638  138.401 24.170  1.00 20.64 ? 23   GLN A C     1 
ATOM   144   O  O     . GLN A 1 23  ? 30.639  137.687 24.093  1.00 20.66 ? 23   GLN A O     1 
ATOM   145   C  CB    . GLN A 1 23  ? 29.125  139.880 22.184  1.00 20.42 ? 23   GLN A CB    1 
ATOM   146   C  CG    . GLN A 1 23  ? 28.224  140.107 20.978  1.00 21.24 ? 23   GLN A CG    1 
ATOM   147   C  CD    . GLN A 1 23  ? 28.464  141.433 20.283  1.00 21.74 ? 23   GLN A CD    1 
ATOM   148   O  OE1   . GLN A 1 23  ? 28.614  142.471 20.930  1.00 21.12 ? 23   GLN A OE1   1 
ATOM   149   N  NE2   . GLN A 1 23  ? 28.483  141.407 18.958  1.00 23.99 ? 23   GLN A NE2   1 
ATOM   150   N  N     . TYR A 1 24  ? 29.277  139.008 25.297  1.00 20.09 ? 24   TYR A N     1 
ATOM   151   C  CA    . TYR A 1 24  ? 30.057  138.835 26.522  1.00 20.43 ? 24   TYR A CA    1 
ATOM   152   C  C     . TYR A 1 24  ? 30.031  137.361 26.922  1.00 20.65 ? 24   TYR A C     1 
ATOM   153   O  O     . TYR A 1 24  ? 31.068  136.751 27.173  1.00 19.80 ? 24   TYR A O     1 
ATOM   154   C  CB    . TYR A 1 24  ? 29.475  139.661 27.672  1.00 20.03 ? 24   TYR A CB    1 
ATOM   155   C  CG    . TYR A 1 24  ? 30.010  139.232 29.027  1.00 21.38 ? 24   TYR A CG    1 
ATOM   156   C  CD1   . TYR A 1 24  ? 31.284  139.614 29.452  1.00 20.18 ? 24   TYR A CD1   1 
ATOM   157   C  CD2   . TYR A 1 24  ? 29.274  138.369 29.842  1.00 19.99 ? 24   TYR A CD2   1 
ATOM   158   C  CE1   . TYR A 1 24  ? 31.815  139.139 30.657  1.00 19.16 ? 24   TYR A CE1   1 
ATOM   159   C  CE2   . TYR A 1 24  ? 29.793  137.887 31.042  1.00 21.28 ? 24   TYR A CE2   1 
ATOM   160   C  CZ    . TYR A 1 24  ? 31.061  138.272 31.444  1.00 21.31 ? 24   TYR A CZ    1 
ATOM   161   O  OH    . TYR A 1 24  ? 31.570  137.773 32.621  1.00 20.02 ? 24   TYR A OH    1 
ATOM   162   N  N     . GLU A 1 25  ? 28.829  136.798 26.988  1.00 21.74 ? 25   GLU A N     1 
ATOM   163   C  CA    . GLU A 1 25  ? 28.663  135.400 27.363  1.00 22.55 ? 25   GLU A CA    1 
ATOM   164   C  C     . GLU A 1 25  ? 29.454  134.461 26.459  1.00 21.80 ? 25   GLU A C     1 
ATOM   165   O  O     . GLU A 1 25  ? 30.148  133.570 26.938  1.00 20.45 ? 25   GLU A O     1 
ATOM   166   C  CB    . GLU A 1 25  ? 27.183  135.020 27.328  1.00 25.53 ? 25   GLU A CB    1 
ATOM   167   C  CG    . GLU A 1 25  ? 26.363  135.584 28.471  1.00 30.35 ? 25   GLU A CG    1 
ATOM   168   C  CD    . GLU A 1 25  ? 26.817  135.060 29.819  1.00 35.49 ? 25   GLU A CD    1 
ATOM   169   O  OE1   . GLU A 1 25  ? 27.104  133.849 29.917  1.00 38.62 ? 25   GLU A OE1   1 
ATOM   170   O  OE2   . GLU A 1 25  ? 26.879  135.853 30.784  1.00 38.80 ? 25   GLU A OE2   1 
ATOM   171   N  N     . THR A 1 26  ? 29.347  134.663 25.150  1.00 20.41 ? 26   THR A N     1 
ATOM   172   C  CA    . THR A 1 26  ? 30.047  133.824 24.189  1.00 19.87 ? 26   THR A CA    1 
ATOM   173   C  C     . THR A 1 26  ? 31.559  133.941 24.327  1.00 18.96 ? 26   THR A C     1 
ATOM   174   O  O     . THR A 1 26  ? 32.258  132.933 24.434  1.00 18.00 ? 26   THR A O     1 
ATOM   175   C  CB    . THR A 1 26  ? 29.645  134.187 22.748  1.00 20.32 ? 26   THR A CB    1 
ATOM   176   O  OG1   . THR A 1 26  ? 28.243  133.940 22.580  1.00 22.23 ? 26   THR A OG1   1 
ATOM   177   C  CG2   . THR A 1 26  ? 30.436  133.354 21.739  1.00 18.42 ? 26   THR A CG2   1 
ATOM   178   N  N     . LYS A 1 27  ? 32.059  135.173 24.320  1.00 19.10 ? 27   LYS A N     1 
ATOM   179   C  CA    . LYS A 1 27  ? 33.490  135.411 24.448  1.00 18.66 ? 27   LYS A CA    1 
ATOM   180   C  C     . LYS A 1 27  ? 34.049  134.891 25.769  1.00 17.60 ? 27   LYS A C     1 
ATOM   181   O  O     . LYS A 1 27  ? 35.130  134.300 25.802  1.00 14.92 ? 27   LYS A O     1 
ATOM   182   C  CB    . LYS A 1 27  ? 33.800  136.905 24.310  1.00 19.88 ? 27   LYS A CB    1 
ATOM   183   C  CG    . LYS A 1 27  ? 33.715  137.425 22.883  1.00 24.28 ? 27   LYS A CG    1 
ATOM   184   C  CD    . LYS A 1 27  ? 34.342  138.807 22.768  1.00 28.67 ? 27   LYS A CD    1 
ATOM   185   C  CE    . LYS A 1 27  ? 34.632  139.164 21.315  1.00 31.28 ? 27   LYS A CE    1 
ATOM   186   N  NZ    . LYS A 1 27  ? 35.463  140.393 21.204  1.00 35.49 ? 27   LYS A NZ    1 
ATOM   187   N  N     . TYR A 1 28  ? 33.325  135.110 26.861  1.00 16.25 ? 28   TYR A N     1 
ATOM   188   C  CA    . TYR A 1 28  ? 33.809  134.635 28.149  1.00 17.10 ? 28   TYR A CA    1 
ATOM   189   C  C     . TYR A 1 28  ? 33.948  133.119 28.131  1.00 17.53 ? 28   TYR A C     1 
ATOM   190   O  O     . TYR A 1 28  ? 34.971  132.575 28.543  1.00 16.92 ? 28   TYR A O     1 
ATOM   191   C  CB    . TYR A 1 28  ? 32.870  135.033 29.287  1.00 17.74 ? 28   TYR A CB    1 
ATOM   192   C  CG    . TYR A 1 28  ? 33.377  134.546 30.626  1.00 18.59 ? 28   TYR A CG    1 
ATOM   193   C  CD1   . TYR A 1 28  ? 34.394  135.231 31.300  1.00 17.52 ? 28   TYR A CD1   1 
ATOM   194   C  CD2   . TYR A 1 28  ? 32.907  133.352 31.180  1.00 18.81 ? 28   TYR A CD2   1 
ATOM   195   C  CE1   . TYR A 1 28  ? 34.930  134.735 32.491  1.00 17.89 ? 28   TYR A CE1   1 
ATOM   196   C  CE2   . TYR A 1 28  ? 33.439  132.850 32.361  1.00 18.39 ? 28   TYR A CE2   1 
ATOM   197   C  CZ    . TYR A 1 28  ? 34.450  133.545 33.012  1.00 17.40 ? 28   TYR A CZ    1 
ATOM   198   O  OH    . TYR A 1 28  ? 34.987  133.041 34.177  1.00 16.71 ? 28   TYR A OH    1 
ATOM   199   N  N     . LYS A 1 29  ? 32.915  132.437 27.647  1.00 17.59 ? 29   LYS A N     1 
ATOM   200   C  CA    . LYS A 1 29  ? 32.941  130.981 27.586  1.00 17.97 ? 29   LYS A CA    1 
ATOM   201   C  C     . LYS A 1 29  ? 34.145  130.489 26.787  1.00 18.25 ? 29   LYS A C     1 
ATOM   202   O  O     . LYS A 1 29  ? 34.818  129.541 27.193  1.00 19.98 ? 29   LYS A O     1 
ATOM   203   C  CB    . LYS A 1 29  ? 31.643  130.457 26.964  1.00 18.09 ? 29   LYS A CB    1 
ATOM   204   N  N     . GLN A 1 30  ? 34.423  131.123 25.652  1.00 17.22 ? 30   GLN A N     1 
ATOM   205   C  CA    . GLN A 1 30  ? 35.561  130.703 24.841  1.00 18.57 ? 30   GLN A CA    1 
ATOM   206   C  C     . GLN A 1 30  ? 36.898  131.018 25.510  1.00 18.99 ? 30   GLN A C     1 
ATOM   207   O  O     . GLN A 1 30  ? 37.861  130.256 25.377  1.00 17.45 ? 30   GLN A O     1 
ATOM   208   C  CB    . GLN A 1 30  ? 35.534  131.363 23.459  1.00 18.00 ? 30   GLN A CB    1 
ATOM   209   C  CG    . GLN A 1 30  ? 36.717  130.937 22.588  1.00 21.97 ? 30   GLN A CG    1 
ATOM   210   C  CD    . GLN A 1 30  ? 36.765  131.646 21.242  1.00 25.72 ? 30   GLN A CD    1 
ATOM   211   O  OE1   . GLN A 1 30  ? 36.789  132.873 21.172  1.00 26.39 ? 30   GLN A OE1   1 
ATOM   212   N  NE2   . GLN A 1 30  ? 36.789  130.868 20.167  1.00 28.15 ? 30   GLN A NE2   1 
ATOM   213   N  N     . SER A 1 31  ? 36.960  132.142 26.218  1.00 18.34 ? 31   SER A N     1 
ATOM   214   C  CA    . SER A 1 31  ? 38.194  132.531 26.887  1.00 18.20 ? 31   SER A CA    1 
ATOM   215   C  C     . SER A 1 31  ? 38.555  131.507 27.958  1.00 19.98 ? 31   SER A C     1 
ATOM   216   O  O     . SER A 1 31  ? 39.728  131.314 28.267  1.00 18.95 ? 31   SER A O     1 
ATOM   217   C  CB    . SER A 1 31  ? 38.053  133.921 27.519  1.00 17.10 ? 31   SER A CB    1 
ATOM   218   O  OG    . SER A 1 31  ? 37.171  133.907 28.628  1.00 14.42 ? 31   SER A OG    1 
ATOM   219   N  N     . ILE A 1 32  ? 37.544  130.847 28.515  1.00 20.55 ? 32   ILE A N     1 
ATOM   220   C  CA    . ILE A 1 32  ? 37.769  129.841 29.548  1.00 23.32 ? 32   ILE A CA    1 
ATOM   221   C  C     . ILE A 1 32  ? 37.972  128.440 28.973  1.00 23.84 ? 32   ILE A C     1 
ATOM   222   O  O     . ILE A 1 32  ? 38.861  127.705 29.407  1.00 24.09 ? 32   ILE A O     1 
ATOM   223   C  CB    . ILE A 1 32  ? 36.588  129.777 30.541  1.00 23.29 ? 32   ILE A CB    1 
ATOM   224   C  CG1   . ILE A 1 32  ? 36.372  131.145 31.192  1.00 26.06 ? 32   ILE A CG1   1 
ATOM   225   C  CG2   . ILE A 1 32  ? 36.848  128.699 31.588  1.00 27.38 ? 32   ILE A CG2   1 
ATOM   226   C  CD1   . ILE A 1 32  ? 37.625  131.774 31.761  1.00 22.85 ? 32   ILE A CD1   1 
ATOM   227   N  N     . ASN A 1 33  ? 37.146  128.066 28.001  1.00 24.15 ? 33   ASN A N     1 
ATOM   228   C  CA    . ASN A 1 33  ? 37.248  126.738 27.410  1.00 24.94 ? 33   ASN A CA    1 
ATOM   229   C  C     . ASN A 1 33  ? 38.403  126.600 26.434  1.00 24.49 ? 33   ASN A C     1 
ATOM   230   O  O     . ASN A 1 33  ? 38.995  125.528 26.311  1.00 25.04 ? 33   ASN A O     1 
ATOM   231   C  CB    . ASN A 1 33  ? 35.944  126.374 26.704  1.00 28.16 ? 33   ASN A CB    1 
ATOM   232   C  CG    . ASN A 1 33  ? 34.740  126.514 27.606  1.00 31.80 ? 33   ASN A CG    1 
ATOM   233   O  OD1   . ASN A 1 33  ? 34.764  126.091 28.762  1.00 33.80 ? 33   ASN A OD1   1 
ATOM   234   N  ND2   . ASN A 1 33  ? 33.674  127.104 27.081  1.00 35.11 ? 33   ASN A ND2   1 
ATOM   235   N  N     . ASP A 1 34  ? 38.727  127.680 25.733  1.00 22.14 ? 34   ASP A N     1 
ATOM   236   C  CA    . ASP A 1 34  ? 39.813  127.631 24.766  1.00 21.59 ? 34   ASP A CA    1 
ATOM   237   C  C     . ASP A 1 34  ? 40.626  128.924 24.763  1.00 20.72 ? 34   ASP A C     1 
ATOM   238   O  O     . ASP A 1 34  ? 40.581  129.697 23.806  1.00 18.50 ? 34   ASP A O     1 
ATOM   239   C  CB    . ASP A 1 34  ? 39.243  127.359 23.372  1.00 22.26 ? 34   ASP A CB    1 
ATOM   240   C  CG    . ASP A 1 34  ? 40.319  127.118 22.338  1.00 21.81 ? 34   ASP A CG    1 
ATOM   241   O  OD1   . ASP A 1 34  ? 41.514  127.111 22.705  1.00 22.90 ? 34   ASP A OD1   1 
ATOM   242   O  OD2   . ASP A 1 34  ? 39.968  126.936 21.154  1.00 23.46 ? 34   ASP A OD2   1 
ATOM   243   N  N     . PRO A 1 35  ? 41.382  129.173 25.845  1.00 20.72 ? 35   PRO A N     1 
ATOM   244   C  CA    . PRO A 1 35  ? 42.207  130.382 25.956  1.00 20.28 ? 35   PRO A CA    1 
ATOM   245   C  C     . PRO A 1 35  ? 43.214  130.584 24.827  1.00 20.37 ? 35   PRO A C     1 
ATOM   246   O  O     . PRO A 1 35  ? 43.497  131.721 24.442  1.00 18.48 ? 35   PRO A O     1 
ATOM   247   C  CB    . PRO A 1 35  ? 42.875  130.229 27.327  1.00 21.40 ? 35   PRO A CB    1 
ATOM   248   C  CG    . PRO A 1 35  ? 42.843  128.748 27.582  1.00 22.77 ? 35   PRO A CG    1 
ATOM   249   C  CD    . PRO A 1 35  ? 41.486  128.355 27.064  1.00 21.49 ? 35   PRO A CD    1 
ATOM   250   N  N     . ASP A 1 36  ? 43.757  129.496 24.290  1.00 18.93 ? 36   ASP A N     1 
ATOM   251   C  CA    . ASP A 1 36  ? 44.728  129.626 23.209  1.00 19.42 ? 36   ASP A CA    1 
ATOM   252   C  C     . ASP A 1 36  ? 44.101  130.271 21.982  1.00 18.34 ? 36   ASP A C     1 
ATOM   253   O  O     . ASP A 1 36  ? 44.708  131.131 21.345  1.00 18.30 ? 36   ASP A O     1 
ATOM   254   C  CB    . ASP A 1 36  ? 45.321  128.263 22.836  1.00 21.30 ? 36   ASP A CB    1 
ATOM   255   C  CG    . ASP A 1 36  ? 46.514  127.889 23.697  1.00 24.28 ? 36   ASP A CG    1 
ATOM   256   O  OD1   . ASP A 1 36  ? 47.036  126.767 23.531  1.00 26.45 ? 36   ASP A OD1   1 
ATOM   257   O  OD2   . ASP A 1 36  ? 46.938  128.715 24.534  1.00 25.66 ? 36   ASP A OD2   1 
ATOM   258   N  N     . THR A 1 37  ? 42.885  129.863 21.645  1.00 16.72 ? 37   THR A N     1 
ATOM   259   C  CA    . THR A 1 37  ? 42.228  130.451 20.490  1.00 17.53 ? 37   THR A CA    1 
ATOM   260   C  C     . THR A 1 37  ? 41.750  131.857 20.832  1.00 15.72 ? 37   THR A C     1 
ATOM   261   O  O     . THR A 1 37  ? 41.974  132.795 20.072  1.00 16.58 ? 37   THR A O     1 
ATOM   262   C  CB    . THR A 1 37  ? 41.037  129.591 20.022  1.00 19.56 ? 37   THR A CB    1 
ATOM   263   O  OG1   . THR A 1 37  ? 41.525  128.323 19.567  1.00 21.43 ? 37   THR A OG1   1 
ATOM   264   C  CG2   . THR A 1 37  ? 40.293  130.276 18.882  1.00 20.37 ? 37   THR A CG2   1 
ATOM   265   N  N     . PHE A 1 38  ? 41.106  132.004 21.984  1.00 14.37 ? 38   PHE A N     1 
ATOM   266   C  CA    . PHE A 1 38  ? 40.605  133.311 22.389  1.00 15.13 ? 38   PHE A CA    1 
ATOM   267   C  C     . PHE A 1 38  ? 41.693  134.372 22.475  1.00 14.81 ? 38   PHE A C     1 
ATOM   268   O  O     . PHE A 1 38  ? 41.590  135.429 21.854  1.00 15.15 ? 38   PHE A O     1 
ATOM   269   C  CB    . PHE A 1 38  ? 39.904  133.248 23.744  1.00 13.45 ? 38   PHE A CB    1 
ATOM   270   C  CG    . PHE A 1 38  ? 39.355  134.580 24.182  1.00 14.81 ? 38   PHE A CG    1 
ATOM   271   C  CD1   . PHE A 1 38  ? 38.155  135.055 23.663  1.00 16.43 ? 38   PHE A CD1   1 
ATOM   272   C  CD2   . PHE A 1 38  ? 40.073  135.391 25.059  1.00 13.37 ? 38   PHE A CD2   1 
ATOM   273   C  CE1   . PHE A 1 38  ? 37.673  136.323 24.007  1.00 15.65 ? 38   PHE A CE1   1 
ATOM   274   C  CE2   . PHE A 1 38  ? 39.603  136.657 25.408  1.00 13.68 ? 38   PHE A CE2   1 
ATOM   275   C  CZ    . PHE A 1 38  ? 38.403  137.125 24.881  1.00 15.16 ? 38   PHE A CZ    1 
ATOM   276   N  N     . TRP A 1 39  ? 42.728  134.104 23.262  1.00 14.59 ? 39   TRP A N     1 
ATOM   277   C  CA    . TRP A 1 39  ? 43.798  135.080 23.406  1.00 15.59 ? 39   TRP A CA    1 
ATOM   278   C  C     . TRP A 1 39  ? 44.696  135.137 22.175  1.00 15.72 ? 39   TRP A C     1 
ATOM   279   O  O     . TRP A 1 39  ? 45.353  136.147 21.924  1.00 16.14 ? 39   TRP A O     1 
ATOM   280   C  CB    . TRP A 1 39  ? 44.605  134.794 24.678  1.00 14.34 ? 39   TRP A CB    1 
ATOM   281   C  CG    . TRP A 1 39  ? 43.820  135.137 25.914  1.00 14.16 ? 39   TRP A CG    1 
ATOM   282   C  CD1   . TRP A 1 39  ? 43.339  134.270 26.855  1.00 13.11 ? 39   TRP A CD1   1 
ATOM   283   C  CD2   . TRP A 1 39  ? 43.376  136.443 26.308  1.00 12.53 ? 39   TRP A CD2   1 
ATOM   284   N  NE1   . TRP A 1 39  ? 42.621  134.956 27.810  1.00 14.13 ? 39   TRP A NE1   1 
ATOM   285   C  CE2   . TRP A 1 39  ? 42.629  136.291 27.497  1.00 13.29 ? 39   TRP A CE2   1 
ATOM   286   C  CE3   . TRP A 1 39  ? 43.538  137.727 25.769  1.00 13.33 ? 39   TRP A CE3   1 
ATOM   287   C  CZ2   . TRP A 1 39  ? 42.043  137.379 28.159  1.00 13.92 ? 39   TRP A CZ2   1 
ATOM   288   C  CZ3   . TRP A 1 39  ? 42.955  138.810 26.427  1.00 12.29 ? 39   TRP A CZ3   1 
ATOM   289   C  CH2   . TRP A 1 39  ? 42.216  138.625 27.612  1.00 11.39 ? 39   TRP A CH2   1 
ATOM   290   N  N     . GLY A 1 40  ? 44.717  134.053 21.404  1.00 16.41 ? 40   GLY A N     1 
ATOM   291   C  CA    . GLY A 1 40  ? 45.522  134.037 20.194  1.00 16.53 ? 40   GLY A CA    1 
ATOM   292   C  C     . GLY A 1 40  ? 44.975  135.073 19.228  1.00 17.07 ? 40   GLY A C     1 
ATOM   293   O  O     . GLY A 1 40  ? 45.726  135.758 18.530  1.00 17.62 ? 40   GLY A O     1 
ATOM   294   N  N     . GLU A 1 41  ? 43.651  135.184 19.183  1.00 17.05 ? 41   GLU A N     1 
ATOM   295   C  CA    . GLU A 1 41  ? 43.002  136.154 18.313  1.00 18.64 ? 41   GLU A CA    1 
ATOM   296   C  C     . GLU A 1 41  ? 43.014  137.551 18.941  1.00 17.62 ? 41   GLU A C     1 
ATOM   297   O  O     . GLU A 1 41  ? 43.327  138.535 18.272  1.00 18.10 ? 41   GLU A O     1 
ATOM   298   C  CB    . GLU A 1 41  ? 41.557  135.720 18.026  1.00 19.50 ? 41   GLU A CB    1 
ATOM   299   C  CG    . GLU A 1 41  ? 41.454  134.425 17.220  1.00 25.71 ? 41   GLU A CG    1 
ATOM   300   C  CD    . GLU A 1 41  ? 40.018  133.959 17.010  1.00 30.06 ? 41   GLU A CD    1 
ATOM   301   O  OE1   . GLU A 1 41  ? 39.809  133.018 16.215  1.00 34.02 ? 41   GLU A OE1   1 
ATOM   302   O  OE2   . GLU A 1 41  ? 39.099  134.524 17.641  1.00 31.32 ? 41   GLU A OE2   1 
ATOM   303   N  N     . GLN A 1 42  ? 42.693  137.638 20.229  1.00 15.52 ? 42   GLN A N     1 
ATOM   304   C  CA    . GLN A 1 42  ? 42.655  138.938 20.899  1.00 15.92 ? 42   GLN A CA    1 
ATOM   305   C  C     . GLN A 1 42  ? 44.026  139.607 21.012  1.00 16.92 ? 42   GLN A C     1 
ATOM   306   O  O     . GLN A 1 42  ? 44.120  140.831 21.091  1.00 17.50 ? 42   GLN A O     1 
ATOM   307   C  CB    . GLN A 1 42  ? 42.023  138.803 22.289  1.00 16.01 ? 42   GLN A CB    1 
ATOM   308   C  CG    . GLN A 1 42  ? 41.899  140.132 23.028  1.00 16.49 ? 42   GLN A CG    1 
ATOM   309   C  CD    . GLN A 1 42  ? 41.113  141.171 22.242  1.00 18.00 ? 42   GLN A CD    1 
ATOM   310   O  OE1   . GLN A 1 42  ? 41.367  142.374 22.348  1.00 21.02 ? 42   GLN A OE1   1 
ATOM   311   N  NE2   . GLN A 1 42  ? 40.147  140.714 21.456  1.00 14.67 ? 42   GLN A NE2   1 
ATOM   312   N  N     . GLY A 1 43  ? 45.090  138.810 21.015  1.00 16.02 ? 43   GLY A N     1 
ATOM   313   C  CA    . GLY A 1 43  ? 46.425  139.380 21.114  1.00 15.91 ? 43   GLY A CA    1 
ATOM   314   C  C     . GLY A 1 43  ? 46.765  140.268 19.931  1.00 15.99 ? 43   GLY A C     1 
ATOM   315   O  O     . GLY A 1 43  ? 47.723  141.044 19.975  1.00 15.24 ? 43   GLY A O     1 
ATOM   316   N  N     . LYS A 1 44  ? 45.974  140.161 18.867  1.00 16.00 ? 44   LYS A N     1 
ATOM   317   C  CA    . LYS A 1 44  ? 46.203  140.956 17.668  1.00 15.46 ? 44   LYS A CA    1 
ATOM   318   C  C     . LYS A 1 44  ? 45.783  142.410 17.859  1.00 15.33 ? 44   LYS A C     1 
ATOM   319   O  O     . LYS A 1 44  ? 45.865  143.212 16.927  1.00 14.75 ? 44   LYS A O     1 
ATOM   320   C  CB    . LYS A 1 44  ? 45.457  140.346 16.475  1.00 17.99 ? 44   LYS A CB    1 
ATOM   321   C  CG    . LYS A 1 44  ? 45.936  138.949 16.100  1.00 19.63 ? 44   LYS A CG    1 
ATOM   322   C  CD    . LYS A 1 44  ? 47.396  138.954 15.670  1.00 24.48 ? 44   LYS A CD    1 
ATOM   323   C  CE    . LYS A 1 44  ? 47.879  137.544 15.346  1.00 26.50 ? 44   LYS A CE    1 
ATOM   324   N  NZ    . LYS A 1 44  ? 47.078  136.931 14.247  1.00 27.92 ? 44   LYS A NZ    1 
ATOM   325   N  N     . ILE A 1 45  ? 45.326  142.750 19.063  1.00 13.55 ? 45   ILE A N     1 
ATOM   326   C  CA    . ILE A 1 45  ? 44.942  144.129 19.344  1.00 13.79 ? 45   ILE A CA    1 
ATOM   327   C  C     . ILE A 1 45  ? 46.235  144.951 19.317  1.00 13.77 ? 45   ILE A C     1 
ATOM   328   O  O     . ILE A 1 45  ? 46.212  146.175 19.199  1.00 15.22 ? 45   ILE A O     1 
ATOM   329   C  CB    . ILE A 1 45  ? 44.258  144.256 20.729  1.00 14.21 ? 45   ILE A CB    1 
ATOM   330   C  CG1   . ILE A 1 45  ? 43.762  145.691 20.931  1.00 14.08 ? 45   ILE A CG1   1 
ATOM   331   C  CG2   . ILE A 1 45  ? 45.234  143.844 21.841  1.00 13.42 ? 45   ILE A CG2   1 
ATOM   332   C  CD1   . ILE A 1 45  ? 42.935  145.885 22.193  1.00 14.63 ? 45   ILE A CD1   1 
ATOM   333   N  N     . LEU A 1 46  ? 47.363  144.253 19.413  1.00 13.22 ? 46   LEU A N     1 
ATOM   334   C  CA    . LEU A 1 46  ? 48.684  144.875 19.383  1.00 12.91 ? 46   LEU A CA    1 
ATOM   335   C  C     . LEU A 1 46  ? 49.402  144.517 18.092  1.00 13.73 ? 46   LEU A C     1 
ATOM   336   O  O     . LEU A 1 46  ? 49.057  143.529 17.441  1.00 13.82 ? 46   LEU A O     1 
ATOM   337   C  CB    . LEU A 1 46  ? 49.553  144.374 20.545  1.00 13.32 ? 46   LEU A CB    1 
ATOM   338   C  CG    . LEU A 1 46  ? 49.086  144.575 21.986  1.00 13.76 ? 46   LEU A CG    1 
ATOM   339   C  CD1   . LEU A 1 46  ? 50.203  144.126 22.929  1.00 11.50 ? 46   LEU A CD1   1 
ATOM   340   C  CD2   . LEU A 1 46  ? 48.747  146.041 22.223  1.00 11.65 ? 46   LEU A CD2   1 
ATOM   341   N  N     . ASP A 1 47  ? 50.393  145.329 17.731  1.00 14.53 ? 47   ASP A N     1 
ATOM   342   C  CA    . ASP A 1 47  ? 51.219  145.082 16.552  1.00 15.39 ? 47   ASP A CA    1 
ATOM   343   C  C     . ASP A 1 47  ? 52.386  144.258 17.082  1.00 15.70 ? 47   ASP A C     1 
ATOM   344   O  O     . ASP A 1 47  ? 53.010  144.639 18.072  1.00 14.14 ? 47   ASP A O     1 
ATOM   345   C  CB    . ASP A 1 47  ? 51.821  146.375 15.982  1.00 16.42 ? 47   ASP A CB    1 
ATOM   346   C  CG    . ASP A 1 47  ? 50.834  147.212 15.190  1.00 17.97 ? 47   ASP A CG    1 
ATOM   347   O  OD1   . ASP A 1 47  ? 51.277  148.242 14.635  1.00 20.51 ? 47   ASP A OD1   1 
ATOM   348   O  OD2   . ASP A 1 47  ? 49.642  146.866 15.117  1.00 17.36 ? 47   ASP A OD2   1 
ATOM   349   N  N     . TRP A 1 48  ? 52.682  143.139 16.437  1.00 14.73 ? 48   TRP A N     1 
ATOM   350   C  CA    . TRP A 1 48  ? 53.802  142.315 16.852  1.00 16.46 ? 48   TRP A CA    1 
ATOM   351   C  C     . TRP A 1 48  ? 54.864  142.389 15.770  1.00 16.88 ? 48   TRP A C     1 
ATOM   352   O  O     . TRP A 1 48  ? 54.544  142.354 14.586  1.00 18.55 ? 48   TRP A O     1 
ATOM   353   C  CB    . TRP A 1 48  ? 53.357  140.860 17.065  1.00 15.30 ? 48   TRP A CB    1 
ATOM   354   C  CG    . TRP A 1 48  ? 52.414  140.716 18.219  1.00 14.58 ? 48   TRP A CG    1 
ATOM   355   C  CD1   . TRP A 1 48  ? 51.096  141.073 18.252  1.00 15.29 ? 48   TRP A CD1   1 
ATOM   356   C  CD2   . TRP A 1 48  ? 52.738  140.256 19.535  1.00 14.07 ? 48   TRP A CD2   1 
ATOM   357   N  NE1   . TRP A 1 48  ? 50.582  140.870 19.510  1.00 14.88 ? 48   TRP A NE1   1 
ATOM   358   C  CE2   . TRP A 1 48  ? 51.568  140.368 20.317  1.00 14.65 ? 48   TRP A CE2   1 
ATOM   359   C  CE3   . TRP A 1 48  ? 53.908  139.762 20.132  1.00 15.02 ? 48   TRP A CE3   1 
ATOM   360   C  CZ2   . TRP A 1 48  ? 51.530  140.003 21.669  1.00 15.25 ? 48   TRP A CZ2   1 
ATOM   361   C  CZ3   . TRP A 1 48  ? 53.873  139.399 21.475  1.00 14.92 ? 48   TRP A CZ3   1 
ATOM   362   C  CH2   . TRP A 1 48  ? 52.688  139.522 22.229  1.00 13.98 ? 48   TRP A CH2   1 
ATOM   363   N  N     . ILE A 1 49  ? 56.124  142.513 16.180  1.00 17.51 ? 49   ILE A N     1 
ATOM   364   C  CA    . ILE A 1 49  ? 57.237  142.584 15.241  1.00 17.96 ? 49   ILE A CA    1 
ATOM   365   C  C     . ILE A 1 49  ? 57.468  141.198 14.641  1.00 18.95 ? 49   ILE A C     1 
ATOM   366   O  O     . ILE A 1 49  ? 57.780  141.063 13.461  1.00 19.49 ? 49   ILE A O     1 
ATOM   367   C  CB    . ILE A 1 49  ? 58.494  143.126 15.947  1.00 18.13 ? 49   ILE A CB    1 
ATOM   368   C  CG1   . ILE A 1 49  ? 58.239  144.587 16.348  1.00 16.67 ? 49   ILE A CG1   1 
ATOM   369   C  CG2   . ILE A 1 49  ? 59.709  143.026 15.026  1.00 19.29 ? 49   ILE A CG2   1 
ATOM   370   C  CD1   . ILE A 1 49  ? 59.265  145.170 17.287  1.00 18.63 ? 49   ILE A CD1   1 
ATOM   371   N  N     . THR A 1 50  ? 57.316  140.171 15.468  1.00 19.82 ? 50   THR A N     1 
ATOM   372   C  CA    . THR A 1 50  ? 57.414  138.787 15.011  1.00 20.75 ? 50   THR A CA    1 
ATOM   373   C  C     . THR A 1 50  ? 56.233  138.141 15.712  1.00 20.42 ? 50   THR A C     1 
ATOM   374   O  O     . THR A 1 50  ? 56.056  138.305 16.916  1.00 19.20 ? 50   THR A O     1 
ATOM   375   C  CB    . THR A 1 50  ? 58.720  138.082 15.437  1.00 21.24 ? 50   THR A CB    1 
ATOM   376   O  OG1   . THR A 1 50  ? 58.813  138.046 16.864  1.00 23.14 ? 50   THR A OG1   1 
ATOM   377   C  CG2   . THR A 1 50  ? 59.920  138.803 14.862  1.00 21.62 ? 50   THR A CG2   1 
ATOM   378   N  N     . PRO A 1 51  ? 55.403  137.406 14.964  1.00 21.37 ? 51   PRO A N     1 
ATOM   379   C  CA    . PRO A 1 51  ? 54.228  136.753 15.543  1.00 20.47 ? 51   PRO A CA    1 
ATOM   380   C  C     . PRO A 1 51  ? 54.523  135.664 16.560  1.00 20.12 ? 51   PRO A C     1 
ATOM   381   O  O     . PRO A 1 51  ? 55.534  134.965 16.481  1.00 20.86 ? 51   PRO A O     1 
ATOM   382   C  CB    . PRO A 1 51  ? 53.503  136.215 14.316  1.00 21.37 ? 51   PRO A CB    1 
ATOM   383   C  CG    . PRO A 1 51  ? 54.644  135.832 13.423  1.00 22.93 ? 51   PRO A CG    1 
ATOM   384   C  CD    . PRO A 1 51  ? 55.572  137.025 13.550  1.00 20.68 ? 51   PRO A CD    1 
ATOM   385   N  N     . TYR A 1 52  ? 53.631  135.538 17.530  1.00 18.44 ? 52   TYR A N     1 
ATOM   386   C  CA    . TYR A 1 52  ? 53.770  134.505 18.535  1.00 19.28 ? 52   TYR A CA    1 
ATOM   387   C  C     . TYR A 1 52  ? 53.133  133.240 17.968  1.00 20.75 ? 52   TYR A C     1 
ATOM   388   O  O     . TYR A 1 52  ? 52.296  133.305 17.064  1.00 19.49 ? 52   TYR A O     1 
ATOM   389   C  CB    . TYR A 1 52  ? 53.062  134.915 19.832  1.00 18.22 ? 52   TYR A CB    1 
ATOM   390   C  CG    . TYR A 1 52  ? 51.667  135.475 19.646  1.00 16.70 ? 52   TYR A CG    1 
ATOM   391   C  CD1   . TYR A 1 52  ? 50.586  134.648 19.339  1.00 16.72 ? 52   TYR A CD1   1 
ATOM   392   C  CD2   . TYR A 1 52  ? 51.429  136.842 19.785  1.00 16.97 ? 52   TYR A CD2   1 
ATOM   393   C  CE1   . TYR A 1 52  ? 49.302  135.174 19.176  1.00 17.61 ? 52   TYR A CE1   1 
ATOM   394   C  CE2   . TYR A 1 52  ? 50.161  137.375 19.625  1.00 16.88 ? 52   TYR A CE2   1 
ATOM   395   C  CZ    . TYR A 1 52  ? 49.100  136.541 19.322  1.00 18.04 ? 52   TYR A CZ    1 
ATOM   396   O  OH    . TYR A 1 52  ? 47.844  137.084 19.166  1.00 17.26 ? 52   TYR A OH    1 
ATOM   397   N  N     . GLN A 1 53  ? 53.554  132.095 18.485  1.00 22.15 ? 53   GLN A N     1 
ATOM   398   C  CA    . GLN A 1 53  ? 53.005  130.818 18.060  1.00 26.05 ? 53   GLN A CA    1 
ATOM   399   C  C     . GLN A 1 53  ? 52.259  130.306 19.283  1.00 24.51 ? 53   GLN A C     1 
ATOM   400   O  O     . GLN A 1 53  ? 51.050  130.089 19.249  1.00 26.59 ? 53   GLN A O     1 
ATOM   401   C  CB    . GLN A 1 53  ? 54.125  129.844 17.681  1.00 28.90 ? 53   GLN A CB    1 
ATOM   402   C  CG    . GLN A 1 53  ? 53.628  128.469 17.244  1.00 35.56 ? 53   GLN A CG    1 
ATOM   403   C  CD    . GLN A 1 53  ? 53.663  128.270 15.734  1.00 39.61 ? 53   GLN A CD    1 
ATOM   404   O  OE1   . GLN A 1 53  ? 53.050  127.339 15.205  1.00 41.43 ? 53   GLN A OE1   1 
ATOM   405   N  NE2   . GLN A 1 53  ? 54.394  129.135 15.036  1.00 41.08 ? 53   GLN A NE2   1 
ATOM   406   N  N     . LYS A 1 54  ? 52.994  130.143 20.377  1.00 23.95 ? 54   LYS A N     1 
ATOM   407   C  CA    . LYS A 1 54  ? 52.413  129.667 21.623  1.00 20.70 ? 54   LYS A CA    1 
ATOM   408   C  C     . LYS A 1 54  ? 51.670  130.809 22.307  1.00 20.35 ? 54   LYS A C     1 
ATOM   409   O  O     . LYS A 1 54  ? 52.119  131.955 22.292  1.00 21.48 ? 54   LYS A O     1 
ATOM   410   C  CB    . LYS A 1 54  ? 53.508  129.130 22.536  1.00 22.21 ? 54   LYS A CB    1 
ATOM   411   N  N     . VAL A 1 55  ? 50.525  130.499 22.896  1.00 18.42 ? 55   VAL A N     1 
ATOM   412   C  CA    . VAL A 1 55  ? 49.749  131.516 23.581  1.00 17.74 ? 55   VAL A CA    1 
ATOM   413   C  C     . VAL A 1 55  ? 49.860  131.300 25.086  1.00 16.52 ? 55   VAL A C     1 
ATOM   414   O  O     . VAL A 1 55  ? 50.665  131.947 25.741  1.00 18.34 ? 55   VAL A O     1 
ATOM   415   C  CB    . VAL A 1 55  ? 48.267  131.478 23.144  1.00 17.34 ? 55   VAL A CB    1 
ATOM   416   C  CG1   . VAL A 1 55  ? 47.452  132.493 23.943  1.00 14.80 ? 55   VAL A CG1   1 
ATOM   417   C  CG2   . VAL A 1 55  ? 48.166  131.787 21.659  1.00 16.69 ? 55   VAL A CG2   1 
ATOM   418   N  N     . LYS A 1 56  ? 49.076  130.374 25.626  1.00 16.21 ? 56   LYS A N     1 
ATOM   419   C  CA    . LYS A 1 56  ? 49.100  130.109 27.063  1.00 16.96 ? 56   LYS A CA    1 
ATOM   420   C  C     . LYS A 1 56  ? 50.054  128.984 27.470  1.00 17.31 ? 56   LYS A C     1 
ATOM   421   O  O     . LYS A 1 56  ? 49.963  127.865 26.967  1.00 17.68 ? 56   LYS A O     1 
ATOM   422   C  CB    . LYS A 1 56  ? 47.687  129.779 27.551  1.00 15.17 ? 56   LYS A CB    1 
ATOM   423   C  CG    . LYS A 1 56  ? 47.555  129.569 29.054  1.00 16.36 ? 56   LYS A CG    1 
ATOM   424   C  CD    . LYS A 1 56  ? 46.090  129.361 29.438  1.00 16.89 ? 56   LYS A CD    1 
ATOM   425   C  CE    . LYS A 1 56  ? 45.899  129.203 30.944  1.00 16.46 ? 56   LYS A CE    1 
ATOM   426   N  NZ    . LYS A 1 56  ? 46.479  127.933 31.472  1.00 16.97 ? 56   LYS A NZ    1 
ATOM   427   N  N     . ASN A 1 57  ? 50.964  129.294 28.390  1.00 16.68 ? 57   ASN A N     1 
ATOM   428   C  CA    . ASN A 1 57  ? 51.933  128.321 28.899  1.00 15.16 ? 57   ASN A CA    1 
ATOM   429   C  C     . ASN A 1 57  ? 52.155  128.656 30.373  1.00 14.93 ? 57   ASN A C     1 
ATOM   430   O  O     . ASN A 1 57  ? 53.159  129.269 30.740  1.00 16.00 ? 57   ASN A O     1 
ATOM   431   C  CB    . ASN A 1 57  ? 53.246  128.425 28.128  1.00 14.87 ? 57   ASN A CB    1 
ATOM   432   C  CG    . ASN A 1 57  ? 54.214  127.301 28.471  1.00 16.09 ? 57   ASN A CG    1 
ATOM   433   O  OD1   . ASN A 1 57  ? 53.847  126.334 29.138  1.00 18.76 ? 57   ASN A OD1   1 
ATOM   434   N  ND2   . ASN A 1 57  ? 55.448  127.418 28.004  1.00 16.56 ? 57   ASN A ND2   1 
ATOM   435   N  N     . THR A 1 58  ? 51.210  128.239 31.212  1.00 14.01 ? 58   THR A N     1 
ATOM   436   C  CA    . THR A 1 58  ? 51.261  128.547 32.633  1.00 14.51 ? 58   THR A CA    1 
ATOM   437   C  C     . THR A 1 58  ? 51.059  127.362 33.575  1.00 15.86 ? 58   THR A C     1 
ATOM   438   O  O     . THR A 1 58  ? 50.545  126.314 33.187  1.00 14.89 ? 58   THR A O     1 
ATOM   439   C  CB    . THR A 1 58  ? 50.190  129.608 32.980  1.00 13.64 ? 58   THR A CB    1 
ATOM   440   O  OG1   . THR A 1 58  ? 48.882  129.039 32.815  1.00 13.07 ? 58   THR A OG1   1 
ATOM   441   C  CG2   . THR A 1 58  ? 50.312  130.811 32.046  1.00 13.89 ? 58   THR A CG2   1 
ATOM   442   N  N     . SER A 1 59  ? 51.466  127.563 34.826  1.00 15.24 ? 59   SER A N     1 
ATOM   443   C  CA    . SER A 1 59  ? 51.333  126.567 35.880  1.00 15.35 ? 59   SER A CA    1 
ATOM   444   C  C     . SER A 1 59  ? 51.340  127.255 37.242  1.00 14.03 ? 59   SER A C     1 
ATOM   445   O  O     . SER A 1 59  ? 52.188  128.110 37.512  1.00 14.90 ? 59   SER A O     1 
ATOM   446   C  CB    . SER A 1 59  ? 52.483  125.560 35.836  1.00 15.00 ? 59   SER A CB    1 
ATOM   447   O  OG    . SER A 1 59  ? 52.421  124.686 36.958  1.00 15.76 ? 59   SER A OG    1 
ATOM   448   N  N     . PHE A 1 60  ? 50.395  126.872 38.092  1.00 12.96 ? 60   PHE A N     1 
ATOM   449   C  CA    . PHE A 1 60  ? 50.288  127.426 39.439  1.00 13.92 ? 60   PHE A CA    1 
ATOM   450   C  C     . PHE A 1 60  ? 50.752  126.366 40.443  1.00 13.85 ? 60   PHE A C     1 
ATOM   451   O  O     . PHE A 1 60  ? 50.437  126.447 41.629  1.00 14.38 ? 60   PHE A O     1 
ATOM   452   C  CB    . PHE A 1 60  ? 48.833  127.804 39.749  1.00 13.08 ? 60   PHE A CB    1 
ATOM   453   C  CG    . PHE A 1 60  ? 48.367  129.087 39.096  1.00 12.01 ? 60   PHE A CG    1 
ATOM   454   C  CD1   . PHE A 1 60  ? 47.059  129.532 39.284  1.00 13.78 ? 60   PHE A CD1   1 
ATOM   455   C  CD2   . PHE A 1 60  ? 49.231  129.859 38.324  1.00 12.44 ? 60   PHE A CD2   1 
ATOM   456   C  CE1   . PHE A 1 60  ? 46.616  130.730 38.714  1.00 12.51 ? 60   PHE A CE1   1 
ATOM   457   C  CE2   . PHE A 1 60  ? 48.801  131.061 37.748  1.00 13.41 ? 60   PHE A CE2   1 
ATOM   458   C  CZ    . PHE A 1 60  ? 47.489  131.496 37.945  1.00 12.24 ? 60   PHE A CZ    1 
ATOM   459   N  N     . ALA A 1 61  ? 51.495  125.374 39.959  1.00 14.43 ? 61   ALA A N     1 
ATOM   460   C  CA    . ALA A 1 61  ? 51.984  124.290 40.811  1.00 16.05 ? 61   ALA A CA    1 
ATOM   461   C  C     . ALA A 1 61  ? 52.734  124.795 42.043  1.00 15.78 ? 61   ALA A C     1 
ATOM   462   O  O     . ALA A 1 61  ? 53.544  125.718 41.957  1.00 16.63 ? 61   ALA A O     1 
ATOM   463   C  CB    . ALA A 1 61  ? 52.884  123.347 39.999  1.00 15.68 ? 61   ALA A CB    1 
ATOM   464   N  N     . PRO A 1 62  ? 52.478  124.180 43.210  1.00 16.78 ? 62   PRO A N     1 
ATOM   465   C  CA    . PRO A 1 62  ? 53.120  124.555 44.476  1.00 18.11 ? 62   PRO A CA    1 
ATOM   466   C  C     . PRO A 1 62  ? 54.640  124.625 44.354  1.00 18.57 ? 62   PRO A C     1 
ATOM   467   O  O     . PRO A 1 62  ? 55.276  123.681 43.886  1.00 19.57 ? 62   PRO A O     1 
ATOM   468   C  CB    . PRO A 1 62  ? 52.678  123.444 45.428  1.00 19.58 ? 62   PRO A CB    1 
ATOM   469   C  CG    . PRO A 1 62  ? 51.345  123.049 44.893  1.00 19.64 ? 62   PRO A CG    1 
ATOM   470   C  CD    . PRO A 1 62  ? 51.581  123.026 43.402  1.00 17.78 ? 62   PRO A CD    1 
ATOM   471   N  N     . GLY A 1 63  ? 55.213  125.747 44.776  1.00 18.17 ? 63   GLY A N     1 
ATOM   472   C  CA    . GLY A 1 63  ? 56.653  125.922 44.712  1.00 18.69 ? 63   GLY A CA    1 
ATOM   473   C  C     . GLY A 1 63  ? 57.250  125.806 43.320  1.00 18.82 ? 63   GLY A C     1 
ATOM   474   O  O     . GLY A 1 63  ? 58.467  125.705 43.171  1.00 17.99 ? 63   GLY A O     1 
ATOM   475   N  N     . ASN A 1 64  ? 56.402  125.838 42.297  1.00 18.71 ? 64   ASN A N     1 
ATOM   476   C  CA    . ASN A 1 64  ? 56.859  125.726 40.914  1.00 17.90 ? 64   ASN A CA    1 
ATOM   477   C  C     . ASN A 1 64  ? 55.937  126.501 39.982  1.00 17.87 ? 64   ASN A C     1 
ATOM   478   O  O     . ASN A 1 64  ? 55.430  125.967 38.999  1.00 15.85 ? 64   ASN A O     1 
ATOM   479   C  CB    . ASN A 1 64  ? 56.902  124.252 40.500  1.00 18.31 ? 64   ASN A CB    1 
ATOM   480   C  CG    . ASN A 1 64  ? 58.069  123.507 41.121  1.00 17.47 ? 64   ASN A CG    1 
ATOM   481   O  OD1   . ASN A 1 64  ? 59.223  123.720 40.749  1.00 17.96 ? 64   ASN A OD1   1 
ATOM   482   N  ND2   . ASN A 1 64  ? 57.775  122.630 42.074  1.00 18.02 ? 64   ASN A ND2   1 
ATOM   483   N  N     . VAL A 1 65  ? 55.719  127.768 40.311  1.00 17.14 ? 65   VAL A N     1 
ATOM   484   C  CA    . VAL A 1 65  ? 54.856  128.621 39.516  1.00 15.79 ? 65   VAL A CA    1 
ATOM   485   C  C     . VAL A 1 65  ? 55.612  129.164 38.310  1.00 15.90 ? 65   VAL A C     1 
ATOM   486   O  O     . VAL A 1 65  ? 56.733  129.650 38.442  1.00 15.13 ? 65   VAL A O     1 
ATOM   487   C  CB    . VAL A 1 65  ? 54.320  129.792 40.369  1.00 15.19 ? 65   VAL A CB    1 
ATOM   488   C  CG1   . VAL A 1 65  ? 53.537  130.775 39.498  1.00 13.94 ? 65   VAL A CG1   1 
ATOM   489   C  CG2   . VAL A 1 65  ? 53.427  129.246 41.476  1.00 15.37 ? 65   VAL A CG2   1 
ATOM   490   N  N     . SER A 1 66  ? 54.997  129.056 37.135  1.00 16.73 ? 66   SER A N     1 
ATOM   491   C  CA    . SER A 1 66  ? 55.593  129.547 35.894  1.00 17.31 ? 66   SER A CA    1 
ATOM   492   C  C     . SER A 1 66  ? 54.473  130.105 35.026  1.00 16.72 ? 66   SER A C     1 
ATOM   493   O  O     . SER A 1 66  ? 53.520  129.399 34.701  1.00 16.35 ? 66   SER A O     1 
ATOM   494   C  CB    . SER A 1 66  ? 56.313  128.420 35.147  1.00 17.50 ? 66   SER A CB    1 
ATOM   495   O  OG    . SER A 1 66  ? 57.017  128.932 34.021  1.00 19.41 ? 66   SER A OG    1 
ATOM   496   N  N     . ILE A 1 67  ? 54.603  131.372 34.647  1.00 15.61 ? 67   ILE A N     1 
ATOM   497   C  CA    . ILE A 1 67  ? 53.588  132.043 33.845  1.00 14.46 ? 67   ILE A CA    1 
ATOM   498   C  C     . ILE A 1 67  ? 54.196  132.685 32.607  1.00 14.35 ? 67   ILE A C     1 
ATOM   499   O  O     . ILE A 1 67  ? 55.030  133.589 32.711  1.00 12.32 ? 67   ILE A O     1 
ATOM   500   C  CB    . ILE A 1 67  ? 52.892  133.135 34.686  1.00 14.99 ? 67   ILE A CB    1 
ATOM   501   C  CG1   . ILE A 1 67  ? 52.292  132.504 35.944  1.00 15.83 ? 67   ILE A CG1   1 
ATOM   502   C  CG2   . ILE A 1 67  ? 51.810  133.833 33.869  1.00 13.55 ? 67   ILE A CG2   1 
ATOM   503   C  CD1   . ILE A 1 67  ? 52.016  133.502 37.054  1.00 14.90 ? 67   ILE A CD1   1 
ATOM   504   N  N     . LYS A 1 68  ? 53.784  132.204 31.437  1.00 13.07 ? 68   LYS A N     1 
ATOM   505   C  CA    . LYS A 1 68  ? 54.265  132.736 30.167  1.00 14.20 ? 68   LYS A CA    1 
ATOM   506   C  C     . LYS A 1 68  ? 53.094  132.837 29.192  1.00 13.68 ? 68   LYS A C     1 
ATOM   507   O  O     . LYS A 1 68  ? 52.236  131.950 29.146  1.00 15.13 ? 68   LYS A O     1 
ATOM   508   C  CB    . LYS A 1 68  ? 55.340  131.823 29.570  1.00 14.53 ? 68   LYS A CB    1 
ATOM   509   C  CG    . LYS A 1 68  ? 56.575  131.662 30.432  1.00 17.83 ? 68   LYS A CG    1 
ATOM   510   C  CD    . LYS A 1 68  ? 57.513  130.620 29.836  1.00 18.99 ? 68   LYS A CD    1 
ATOM   511   C  CE    . LYS A 1 68  ? 58.713  130.376 30.738  1.00 19.79 ? 68   LYS A CE    1 
ATOM   512   N  NZ    . LYS A 1 68  ? 59.638  129.362 30.155  1.00 21.39 ? 68   LYS A NZ    1 
ATOM   513   N  N     . TRP A 1 69  ? 53.061  133.926 28.431  1.00 14.48 ? 69   TRP A N     1 
ATOM   514   C  CA    . TRP A 1 69  ? 52.022  134.162 27.430  1.00 13.18 ? 69   TRP A CA    1 
ATOM   515   C  C     . TRP A 1 69  ? 52.671  134.738 26.175  1.00 12.75 ? 69   TRP A C     1 
ATOM   516   O  O     . TRP A 1 69  ? 53.539  135.600 26.276  1.00 12.61 ? 69   TRP A O     1 
ATOM   517   C  CB    . TRP A 1 69  ? 50.979  135.168 27.939  1.00 12.00 ? 69   TRP A CB    1 
ATOM   518   C  CG    . TRP A 1 69  ? 50.033  134.634 28.974  1.00 12.41 ? 69   TRP A CG    1 
ATOM   519   C  CD1   . TRP A 1 69  ? 50.225  134.598 30.326  1.00 11.53 ? 69   TRP A CD1   1 
ATOM   520   C  CD2   . TRP A 1 69  ? 48.736  134.076 28.736  1.00 12.99 ? 69   TRP A CD2   1 
ATOM   521   N  NE1   . TRP A 1 69  ? 49.122  134.055 30.945  1.00 12.35 ? 69   TRP A NE1   1 
ATOM   522   C  CE2   . TRP A 1 69  ? 48.195  133.725 29.992  1.00 12.95 ? 69   TRP A CE2   1 
ATOM   523   C  CE3   . TRP A 1 69  ? 47.975  133.839 27.581  1.00 13.31 ? 69   TRP A CE3   1 
ATOM   524   C  CZ2   . TRP A 1 69  ? 46.925  133.148 30.129  1.00 14.15 ? 69   TRP A CZ2   1 
ATOM   525   C  CZ3   . TRP A 1 69  ? 46.712  133.268 27.715  1.00 13.54 ? 69   TRP A CZ3   1 
ATOM   526   C  CH2   . TRP A 1 69  ? 46.200  132.928 28.982  1.00 14.74 ? 69   TRP A CH2   1 
ATOM   527   N  N     . TYR A 1 70  ? 52.257  134.262 25.000  1.00 13.11 ? 70   TYR A N     1 
ATOM   528   C  CA    . TYR A 1 70  ? 52.801  134.765 23.734  1.00 12.87 ? 70   TYR A CA    1 
ATOM   529   C  C     . TYR A 1 70  ? 54.329  134.766 23.781  1.00 14.19 ? 70   TYR A C     1 
ATOM   530   O  O     . TYR A 1 70  ? 54.981  135.562 23.098  1.00 15.20 ? 70   TYR A O     1 
ATOM   531   C  CB    . TYR A 1 70  ? 52.334  136.207 23.505  1.00 12.82 ? 70   TYR A CB    1 
ATOM   532   C  CG    . TYR A 1 70  ? 50.848  136.463 23.663  1.00 13.46 ? 70   TYR A CG    1 
ATOM   533   C  CD1   . TYR A 1 70  ? 50.376  137.319 24.663  1.00 12.84 ? 70   TYR A CD1   1 
ATOM   534   C  CD2   . TYR A 1 70  ? 49.918  135.906 22.778  1.00 12.75 ? 70   TYR A CD2   1 
ATOM   535   C  CE1   . TYR A 1 70  ? 49.016  137.625 24.777  1.00 12.12 ? 70   TYR A CE1   1 
ATOM   536   C  CE2   . TYR A 1 70  ? 48.554  136.204 22.880  1.00 13.40 ? 70   TYR A CE2   1 
ATOM   537   C  CZ    . TYR A 1 70  ? 48.110  137.068 23.882  1.00 14.52 ? 70   TYR A CZ    1 
ATOM   538   O  OH    . TYR A 1 70  ? 46.771  137.399 23.976  1.00 13.40 ? 70   TYR A OH    1 
ATOM   539   N  N     . GLU A 1 71  ? 54.894  133.853 24.561  1.00 16.42 ? 71   GLU A N     1 
ATOM   540   C  CA    . GLU A 1 71  ? 56.338  133.801 24.779  1.00 16.39 ? 71   GLU A CA    1 
ATOM   541   C  C     . GLU A 1 71  ? 57.302  133.897 23.603  1.00 17.70 ? 71   GLU A C     1 
ATOM   542   O  O     . GLU A 1 71  ? 58.406  134.415 23.767  1.00 17.18 ? 71   GLU A O     1 
ATOM   543   C  CB    . GLU A 1 71  ? 56.690  132.566 25.608  1.00 17.37 ? 71   GLU A CB    1 
ATOM   544   C  CG    . GLU A 1 71  ? 56.655  131.263 24.844  1.00 19.75 ? 71   GLU A CG    1 
ATOM   545   C  CD    . GLU A 1 71  ? 56.757  130.074 25.772  1.00 21.69 ? 71   GLU A CD    1 
ATOM   546   O  OE1   . GLU A 1 71  ? 55.776  129.808 26.502  1.00 19.52 ? 71   GLU A OE1   1 
ATOM   547   O  OE2   . GLU A 1 71  ? 57.822  129.419 25.780  1.00 22.62 ? 71   GLU A OE2   1 
ATOM   548   N  N     . ASP A 1 72  ? 56.908  133.407 22.432  1.00 18.70 ? 72   ASP A N     1 
ATOM   549   C  CA    . ASP A 1 72  ? 57.796  133.444 21.274  1.00 21.98 ? 72   ASP A CA    1 
ATOM   550   C  C     . ASP A 1 72  ? 57.611  134.685 20.399  1.00 21.72 ? 72   ASP A C     1 
ATOM   551   O  O     . ASP A 1 72  ? 58.337  134.884 19.426  1.00 22.80 ? 72   ASP A O     1 
ATOM   552   C  CB    . ASP A 1 72  ? 57.604  132.180 20.433  1.00 26.90 ? 72   ASP A CB    1 
ATOM   553   C  CG    . ASP A 1 72  ? 56.213  132.081 19.842  1.00 31.99 ? 72   ASP A CG    1 
ATOM   554   O  OD1   . ASP A 1 72  ? 55.228  132.174 20.607  1.00 34.20 ? 72   ASP A OD1   1 
ATOM   555   O  OD2   . ASP A 1 72  ? 56.107  131.909 18.610  1.00 37.02 ? 72   ASP A OD2   1 
ATOM   556   N  N     . GLY A 1 73  ? 56.639  135.519 20.745  1.00 19.24 ? 73   GLY A N     1 
ATOM   557   C  CA    . GLY A 1 73  ? 56.411  136.722 19.971  1.00 17.21 ? 73   GLY A CA    1 
ATOM   558   C  C     . GLY A 1 73  ? 57.284  137.868 20.452  1.00 16.51 ? 73   GLY A C     1 
ATOM   559   O  O     . GLY A 1 73  ? 57.768  137.865 21.589  1.00 15.65 ? 73   GLY A O     1 
ATOM   560   N  N     . THR A 1 74  ? 57.518  138.839 19.577  1.00 15.85 ? 74   THR A N     1 
ATOM   561   C  CA    . THR A 1 74  ? 58.315  139.999 19.949  1.00 13.97 ? 74   THR A CA    1 
ATOM   562   C  C     . THR A 1 74  ? 57.524  141.254 19.588  1.00 13.71 ? 74   THR A C     1 
ATOM   563   O  O     . THR A 1 74  ? 56.715  141.247 18.658  1.00 12.71 ? 74   THR A O     1 
ATOM   564   C  CB    . THR A 1 74  ? 59.695  140.010 19.240  1.00 15.23 ? 74   THR A CB    1 
ATOM   565   O  OG1   . THR A 1 74  ? 59.524  140.209 17.833  1.00 17.36 ? 74   THR A OG1   1 
ATOM   566   C  CG2   . THR A 1 74  ? 60.416  138.687 19.472  1.00 15.59 ? 74   THR A CG2   1 
ATOM   567   N  N     . LEU A 1 75  ? 57.752  142.326 20.339  1.00 13.27 ? 75   LEU A N     1 
ATOM   568   C  CA    . LEU A 1 75  ? 57.036  143.573 20.115  1.00 13.29 ? 75   LEU A CA    1 
ATOM   569   C  C     . LEU A 1 75  ? 57.732  144.714 20.849  1.00 13.06 ? 75   LEU A C     1 
ATOM   570   O  O     . LEU A 1 75  ? 58.768  144.525 21.480  1.00 15.69 ? 75   LEU A O     1 
ATOM   571   C  CB    . LEU A 1 75  ? 55.603  143.456 20.654  1.00 13.79 ? 75   LEU A CB    1 
ATOM   572   C  CG    . LEU A 1 75  ? 55.432  143.496 22.186  1.00 13.35 ? 75   LEU A CG    1 
ATOM   573   C  CD1   . LEU A 1 75  ? 53.947  143.535 22.543  1.00 11.96 ? 75   LEU A CD1   1 
ATOM   574   C  CD2   . LEU A 1 75  ? 56.089  142.285 22.830  1.00 13.75 ? 75   LEU A CD2   1 
ATOM   575   N  N     . ASN A 1 76  ? 57.154  145.903 20.756  1.00 13.94 ? 76   ASN A N     1 
ATOM   576   C  CA    . ASN A 1 76  ? 57.687  147.059 21.459  1.00 12.81 ? 76   ASN A CA    1 
ATOM   577   C  C     . ASN A 1 76  ? 56.477  147.820 22.002  1.00 13.71 ? 76   ASN A C     1 
ATOM   578   O  O     . ASN A 1 76  ? 55.587  148.197 21.242  1.00 11.59 ? 76   ASN A O     1 
ATOM   579   C  CB    . ASN A 1 76  ? 58.496  147.952 20.518  1.00 15.71 ? 76   ASN A CB    1 
ATOM   580   C  CG    . ASN A 1 76  ? 59.287  149.006 21.266  1.00 15.58 ? 76   ASN A CG    1 
ATOM   581   O  OD1   . ASN A 1 76  ? 60.491  148.855 21.504  1.00 18.16 ? 76   ASN A OD1   1 
ATOM   582   N  ND2   . ASN A 1 76  ? 58.612  150.072 21.661  1.00 12.12 ? 76   ASN A ND2   1 
ATOM   583   N  N     . LEU A 1 77  ? 56.435  148.026 23.316  1.00 13.31 ? 77   LEU A N     1 
ATOM   584   C  CA    . LEU A 1 77  ? 55.309  148.728 23.925  1.00 12.02 ? 77   LEU A CA    1 
ATOM   585   C  C     . LEU A 1 77  ? 55.190  150.164 23.430  1.00 11.84 ? 77   LEU A C     1 
ATOM   586   O  O     . LEU A 1 77  ? 54.087  150.649 23.197  1.00 12.93 ? 77   LEU A O     1 
ATOM   587   C  CB    . LEU A 1 77  ? 55.428  148.708 25.456  1.00 10.55 ? 77   LEU A CB    1 
ATOM   588   C  CG    . LEU A 1 77  ? 54.368  149.506 26.225  1.00 11.20 ? 77   LEU A CG    1 
ATOM   589   C  CD1   . LEU A 1 77  ? 54.097  148.837 27.575  1.00 10.06 ? 77   LEU A CD1   1 
ATOM   590   C  CD2   . LEU A 1 77  ? 54.835  150.954 26.408  1.00 10.19 ? 77   LEU A CD2   1 
ATOM   591   N  N     . ALA A 1 78  ? 56.321  150.841 23.269  1.00 10.88 ? 78   ALA A N     1 
ATOM   592   C  CA    . ALA A 1 78  ? 56.304  152.227 22.810  1.00 11.57 ? 78   ALA A CA    1 
ATOM   593   C  C     . ALA A 1 78  ? 55.781  152.332 21.381  1.00 12.39 ? 78   ALA A C     1 
ATOM   594   O  O     . ALA A 1 78  ? 55.048  153.261 21.052  1.00 13.19 ? 78   ALA A O     1 
ATOM   595   C  CB    . ALA A 1 78  ? 57.704  152.841 22.917  1.00 10.53 ? 78   ALA A CB    1 
ATOM   596   N  N     . ALA A 1 79  ? 56.154  151.386 20.526  1.00 13.02 ? 79   ALA A N     1 
ATOM   597   C  CA    . ALA A 1 79  ? 55.669  151.414 19.151  1.00 14.07 ? 79   ALA A CA    1 
ATOM   598   C  C     . ALA A 1 79  ? 54.147  151.237 19.143  1.00 13.78 ? 79   ALA A C     1 
ATOM   599   O  O     . ALA A 1 79  ? 53.447  151.826 18.319  1.00 15.82 ? 79   ALA A O     1 
ATOM   600   C  CB    . ALA A 1 79  ? 56.328  150.313 18.333  1.00 13.94 ? 79   ALA A CB    1 
ATOM   601   N  N     . ASN A 1 80  ? 53.638  150.425 20.063  1.00 11.19 ? 80   ASN A N     1 
ATOM   602   C  CA    . ASN A 1 80  ? 52.201  150.192 20.141  1.00 13.24 ? 80   ASN A CA    1 
ATOM   603   C  C     . ASN A 1 80  ? 51.425  151.370 20.718  1.00 13.68 ? 80   ASN A C     1 
ATOM   604   O  O     . ASN A 1 80  ? 50.252  151.570 20.392  1.00 13.51 ? 80   ASN A O     1 
ATOM   605   C  CB    . ASN A 1 80  ? 51.913  148.940 20.968  1.00 13.95 ? 80   ASN A CB    1 
ATOM   606   C  CG    . ASN A 1 80  ? 51.879  147.683 20.122  1.00 14.84 ? 80   ASN A CG    1 
ATOM   607   O  OD1   . ASN A 1 80  ? 50.872  147.385 19.477  1.00 14.62 ? 80   ASN A OD1   1 
ATOM   608   N  ND2   . ASN A 1 80  ? 52.989  146.948 20.105  1.00 11.95 ? 80   ASN A ND2   1 
ATOM   609   N  N     . CYS A 1 81  ? 52.079  152.147 21.573  1.00 12.55 ? 81   CYS A N     1 
ATOM   610   C  CA    . CYS A 1 81  ? 51.429  153.288 22.204  1.00 12.59 ? 81   CYS A CA    1 
ATOM   611   C  C     . CYS A 1 81  ? 51.680  154.592 21.463  1.00 12.39 ? 81   CYS A C     1 
ATOM   612   O  O     . CYS A 1 81  ? 51.025  155.595 21.732  1.00 13.72 ? 81   CYS A O     1 
ATOM   613   C  CB    . CYS A 1 81  ? 51.920  153.436 23.654  1.00 11.50 ? 81   CYS A CB    1 
ATOM   614   S  SG    . CYS A 1 81  ? 51.451  152.096 24.768  1.00 15.13 ? 81   CYS A SG    1 
ATOM   615   N  N     . LEU A 1 82  ? 52.618  154.588 20.523  1.00 11.35 ? 82   LEU A N     1 
ATOM   616   C  CA    . LEU A 1 82  ? 52.939  155.818 19.814  1.00 12.37 ? 82   LEU A CA    1 
ATOM   617   C  C     . LEU A 1 82  ? 53.080  155.673 18.304  1.00 12.03 ? 82   LEU A C     1 
ATOM   618   O  O     . LEU A 1 82  ? 52.197  156.077 17.547  1.00 12.43 ? 82   LEU A O     1 
ATOM   619   C  CB    . LEU A 1 82  ? 54.227  156.415 20.393  1.00 12.66 ? 82   LEU A CB    1 
ATOM   620   C  CG    . LEU A 1 82  ? 54.243  156.610 21.912  1.00 14.69 ? 82   LEU A CG    1 
ATOM   621   C  CD1   . LEU A 1 82  ? 55.666  156.876 22.384  1.00 13.68 ? 82   LEU A CD1   1 
ATOM   622   C  CD2   . LEU A 1 82  ? 53.321  157.766 22.297  1.00 14.82 ? 82   LEU A CD2   1 
ATOM   623   N  N     . ASP A 1 83  ? 54.196  155.092 17.880  1.00 13.04 ? 83   ASP A N     1 
ATOM   624   C  CA    . ASP A 1 83  ? 54.510  154.914 16.462  1.00 15.38 ? 83   ASP A CA    1 
ATOM   625   C  C     . ASP A 1 83  ? 53.377  154.463 15.533  1.00 13.06 ? 83   ASP A C     1 
ATOM   626   O  O     . ASP A 1 83  ? 53.145  155.081 14.494  1.00 14.49 ? 83   ASP A O     1 
ATOM   627   C  CB    . ASP A 1 83  ? 55.693  153.947 16.319  1.00 13.81 ? 83   ASP A CB    1 
ATOM   628   C  CG    . ASP A 1 83  ? 56.909  154.393 17.114  1.00 18.44 ? 83   ASP A CG    1 
ATOM   629   O  OD1   . ASP A 1 83  ? 57.979  154.603 16.502  1.00 18.52 ? 83   ASP A OD1   1 
ATOM   630   O  OD2   . ASP A 1 83  ? 56.798  154.533 18.352  1.00 15.96 ? 83   ASP A OD2   1 
ATOM   631   N  N     . ARG A 1 84  ? 52.667  153.401 15.897  1.00 14.02 ? 84   ARG A N     1 
ATOM   632   C  CA    . ARG A 1 84  ? 51.605  152.895 15.036  1.00 12.42 ? 84   ARG A CA    1 
ATOM   633   C  C     . ARG A 1 84  ? 50.385  153.803 14.883  1.00 14.44 ? 84   ARG A C     1 
ATOM   634   O  O     . ARG A 1 84  ? 49.541  153.566 14.019  1.00 15.61 ? 84   ARG A O     1 
ATOM   635   C  CB    . ARG A 1 84  ? 51.151  151.506 15.498  1.00 14.80 ? 84   ARG A CB    1 
ATOM   636   C  CG    . ARG A 1 84  ? 50.346  151.465 16.791  1.00 12.02 ? 84   ARG A CG    1 
ATOM   637   C  CD    . ARG A 1 84  ? 49.783  150.060 16.990  1.00 15.95 ? 84   ARG A CD    1 
ATOM   638   N  NE    . ARG A 1 84  ? 49.022  149.914 18.227  1.00 14.97 ? 84   ARG A NE    1 
ATOM   639   C  CZ    . ARG A 1 84  ? 48.189  148.904 18.472  1.00 15.38 ? 84   ARG A CZ    1 
ATOM   640   N  NH1   . ARG A 1 84  ? 48.008  147.952 17.559  1.00 14.19 ? 84   ARG A NH1   1 
ATOM   641   N  NH2   . ARG A 1 84  ? 47.539  148.842 19.628  1.00 12.90 ? 84   ARG A NH2   1 
ATOM   642   N  N     . HIS A 1 85  ? 50.285  154.838 15.711  1.00 14.26 ? 85   HIS A N     1 
ATOM   643   C  CA    . HIS A 1 85  ? 49.149  155.759 15.634  1.00 15.63 ? 85   HIS A CA    1 
ATOM   644   C  C     . HIS A 1 85  ? 49.498  157.042 14.877  1.00 15.82 ? 85   HIS A C     1 
ATOM   645   O  O     . HIS A 1 85  ? 48.643  157.905 14.672  1.00 15.22 ? 85   HIS A O     1 
ATOM   646   C  CB    . HIS A 1 85  ? 48.677  156.141 17.041  1.00 16.29 ? 85   HIS A CB    1 
ATOM   647   C  CG    . HIS A 1 85  ? 48.341  154.969 17.910  1.00 15.25 ? 85   HIS A CG    1 
ATOM   648   N  ND1   . HIS A 1 85  ? 47.365  154.052 17.583  1.00 15.42 ? 85   HIS A ND1   1 
ATOM   649   C  CD2   . HIS A 1 85  ? 48.835  154.580 19.110  1.00 16.82 ? 85   HIS A CD2   1 
ATOM   650   C  CE1   . HIS A 1 85  ? 47.270  153.150 18.546  1.00 14.92 ? 85   HIS A CE1   1 
ATOM   651   N  NE2   . HIS A 1 85  ? 48.151  153.448 19.484  1.00 15.33 ? 85   HIS A NE2   1 
ATOM   652   N  N     . LEU A 1 86  ? 50.753  157.164 14.464  1.00 16.04 ? 86   LEU A N     1 
ATOM   653   C  CA    . LEU A 1 86  ? 51.213  158.363 13.768  1.00 18.09 ? 86   LEU A CA    1 
ATOM   654   C  C     . LEU A 1 86  ? 50.615  158.619 12.392  1.00 19.25 ? 86   LEU A C     1 
ATOM   655   O  O     . LEU A 1 86  ? 50.114  159.711 12.114  1.00 19.00 ? 86   LEU A O     1 
ATOM   656   C  CB    . LEU A 1 86  ? 52.739  158.339 13.650  1.00 19.57 ? 86   LEU A CB    1 
ATOM   657   C  CG    . LEU A 1 86  ? 53.500  158.422 14.974  1.00 20.09 ? 86   LEU A CG    1 
ATOM   658   C  CD1   . LEU A 1 86  ? 55.002  158.379 14.718  1.00 22.67 ? 86   LEU A CD1   1 
ATOM   659   C  CD2   . LEU A 1 86  ? 53.112  159.707 15.691  1.00 19.44 ? 86   LEU A CD2   1 
ATOM   660   N  N     . GLN A 1 87  ? 50.679  157.613 11.530  1.00 21.37 ? 87   GLN A N     1 
ATOM   661   C  CA    . GLN A 1 87  ? 50.184  157.737 10.166  1.00 24.08 ? 87   GLN A CA    1 
ATOM   662   C  C     . GLN A 1 87  ? 48.736  158.212 10.056  1.00 24.43 ? 87   GLN A C     1 
ATOM   663   O  O     . GLN A 1 87  ? 48.432  159.098 9.261   1.00 25.53 ? 87   GLN A O     1 
ATOM   664   C  CB    . GLN A 1 87  ? 50.363  156.400 9.440   1.00 25.15 ? 87   GLN A CB    1 
ATOM   665   C  CG    . GLN A 1 87  ? 49.957  156.411 7.977   1.00 30.99 ? 87   GLN A CG    1 
ATOM   666   C  CD    . GLN A 1 87  ? 50.471  155.193 7.234   1.00 33.28 ? 87   GLN A CD    1 
ATOM   667   O  OE1   . GLN A 1 87  ? 51.681  155.023 7.061   1.00 35.43 ? 87   GLN A OE1   1 
ATOM   668   N  NE2   . GLN A 1 87  ? 49.557  154.333 6.801   1.00 34.24 ? 87   GLN A NE2   1 
ATOM   669   N  N     . GLU A 1 88  ? 47.848  157.634 10.858  1.00 23.47 ? 88   GLU A N     1 
ATOM   670   C  CA    . GLU A 1 88  ? 46.440  158.009 10.810  1.00 23.50 ? 88   GLU A CA    1 
ATOM   671   C  C     . GLU A 1 88  ? 46.017  159.007 11.886  1.00 24.23 ? 88   GLU A C     1 
ATOM   672   O  O     . GLU A 1 88  ? 45.093  159.792 11.671  1.00 22.89 ? 88   GLU A O     1 
ATOM   673   C  CB    . GLU A 1 88  ? 45.572  156.757 10.898  1.00 23.70 ? 88   GLU A CB    1 
ATOM   674   N  N     . ASN A 1 89  ? 46.689  158.990 13.034  1.00 22.19 ? 89   ASN A N     1 
ATOM   675   C  CA    . ASN A 1 89  ? 46.321  159.890 14.121  1.00 22.54 ? 89   ASN A CA    1 
ATOM   676   C  C     . ASN A 1 89  ? 47.460  160.680 14.754  1.00 21.01 ? 89   ASN A C     1 
ATOM   677   O  O     . ASN A 1 89  ? 47.428  160.960 15.951  1.00 18.56 ? 89   ASN A O     1 
ATOM   678   C  CB    . ASN A 1 89  ? 45.588  159.105 15.213  1.00 25.15 ? 89   ASN A CB    1 
ATOM   679   C  CG    . ASN A 1 89  ? 44.288  158.500 14.719  1.00 26.92 ? 89   ASN A CG    1 
ATOM   680   O  OD1   . ASN A 1 89  ? 44.241  157.339 14.310  1.00 29.75 ? 89   ASN A OD1   1 
ATOM   681   N  ND2   . ASN A 1 89  ? 43.228  159.294 14.738  1.00 27.09 ? 89   ASN A ND2   1 
ATOM   682   N  N     . GLY A 1 90  ? 48.456  161.046 13.954  1.00 19.12 ? 90   GLY A N     1 
ATOM   683   C  CA    . GLY A 1 90  ? 49.575  161.806 14.482  1.00 19.18 ? 90   GLY A CA    1 
ATOM   684   C  C     . GLY A 1 90  ? 49.171  163.131 15.105  1.00 19.45 ? 90   GLY A C     1 
ATOM   685   O  O     . GLY A 1 90  ? 49.770  163.569 16.093  1.00 16.02 ? 90   GLY A O     1 
ATOM   686   N  N     . ASP A 1 91  ? 48.148  163.769 14.539  1.00 19.99 ? 91   ASP A N     1 
ATOM   687   C  CA    . ASP A 1 91  ? 47.674  165.054 15.037  1.00 20.36 ? 91   ASP A CA    1 
ATOM   688   C  C     . ASP A 1 91  ? 46.677  164.945 16.185  1.00 19.80 ? 91   ASP A C     1 
ATOM   689   O  O     . ASP A 1 91  ? 46.340  165.945 16.819  1.00 20.31 ? 91   ASP A O     1 
ATOM   690   C  CB    . ASP A 1 91  ? 47.046  165.866 13.900  1.00 25.65 ? 91   ASP A CB    1 
ATOM   691   C  CG    . ASP A 1 91  ? 48.023  166.143 12.779  1.00 30.12 ? 91   ASP A CG    1 
ATOM   692   O  OD1   . ASP A 1 91  ? 49.231  166.249 13.068  1.00 34.96 ? 91   ASP A OD1   1 
ATOM   693   O  OD2   . ASP A 1 91  ? 47.587  166.267 11.616  1.00 34.39 ? 91   ASP A OD2   1 
ATOM   694   N  N     . ARG A 1 92  ? 46.198  163.740 16.457  1.00 18.80 ? 92   ARG A N     1 
ATOM   695   C  CA    . ARG A 1 92  ? 45.253  163.560 17.547  1.00 19.05 ? 92   ARG A CA    1 
ATOM   696   C  C     . ARG A 1 92  ? 45.971  163.774 18.881  1.00 17.05 ? 92   ARG A C     1 
ATOM   697   O  O     . ARG A 1 92  ? 47.146  163.446 19.023  1.00 15.22 ? 92   ARG A O     1 
ATOM   698   C  CB    . ARG A 1 92  ? 44.649  162.155 17.492  1.00 21.46 ? 92   ARG A CB    1 
ATOM   699   C  CG    . ARG A 1 92  ? 43.830  161.777 18.714  1.00 24.42 ? 92   ARG A CG    1 
ATOM   700   C  CD    . ARG A 1 92  ? 43.165  160.423 18.519  1.00 27.51 ? 92   ARG A CD    1 
ATOM   701   N  NE    . ARG A 1 92  ? 42.143  160.482 17.480  1.00 31.59 ? 92   ARG A NE    1 
ATOM   702   C  CZ    . ARG A 1 92  ? 41.575  159.419 16.926  1.00 34.41 ? 92   ARG A CZ    1 
ATOM   703   N  NH1   . ARG A 1 92  ? 41.934  158.200 17.309  1.00 37.34 ? 92   ARG A NH1   1 
ATOM   704   N  NH2   . ARG A 1 92  ? 40.649  159.574 15.989  1.00 35.73 ? 92   ARG A NH2   1 
ATOM   705   N  N     . THR A 1 93  ? 45.270  164.342 19.853  1.00 15.63 ? 93   THR A N     1 
ATOM   706   C  CA    . THR A 1 93  ? 45.872  164.569 21.158  1.00 14.40 ? 93   THR A CA    1 
ATOM   707   C  C     . THR A 1 93  ? 46.048  163.235 21.881  1.00 12.94 ? 93   THR A C     1 
ATOM   708   O  O     . THR A 1 93  ? 45.100  162.461 22.016  1.00 14.11 ? 93   THR A O     1 
ATOM   709   C  CB    . THR A 1 93  ? 44.995  165.496 22.015  1.00 15.94 ? 93   THR A CB    1 
ATOM   710   O  OG1   . THR A 1 93  ? 44.848  166.758 21.348  1.00 16.46 ? 93   THR A OG1   1 
ATOM   711   C  CG2   . THR A 1 93  ? 45.630  165.714 23.386  1.00 15.05 ? 93   THR A CG2   1 
ATOM   712   N  N     . ALA A 1 94  ? 47.269  162.955 22.323  1.00 11.88 ? 94   ALA A N     1 
ATOM   713   C  CA    . ALA A 1 94  ? 47.544  161.718 23.046  1.00 13.57 ? 94   ALA A CA    1 
ATOM   714   C  C     . ALA A 1 94  ? 47.308  161.989 24.521  1.00 12.39 ? 94   ALA A C     1 
ATOM   715   O  O     . ALA A 1 94  ? 46.615  161.237 25.201  1.00 12.59 ? 94   ALA A O     1 
ATOM   716   C  CB    . ALA A 1 94  ? 48.994  161.273 22.820  1.00 10.12 ? 94   ALA A CB    1 
ATOM   717   N  N     . ILE A 1 95  ? 47.882  163.081 25.006  1.00 13.00 ? 95   ILE A N     1 
ATOM   718   C  CA    . ILE A 1 95  ? 47.738  163.441 26.405  1.00 13.84 ? 95   ILE A CA    1 
ATOM   719   C  C     . ILE A 1 95  ? 47.248  164.864 26.614  1.00 13.33 ? 95   ILE A C     1 
ATOM   720   O  O     . ILE A 1 95  ? 47.791  165.808 26.041  1.00 14.44 ? 95   ILE A O     1 
ATOM   721   C  CB    . ILE A 1 95  ? 49.086  163.310 27.170  1.00 15.58 ? 95   ILE A CB    1 
ATOM   722   C  CG1   . ILE A 1 95  ? 49.560  161.854 27.174  1.00 14.85 ? 95   ILE A CG1   1 
ATOM   723   C  CG2   . ILE A 1 95  ? 48.926  163.835 28.598  1.00 15.80 ? 95   ILE A CG2   1 
ATOM   724   C  CD1   . ILE A 1 95  ? 50.937  161.662 27.812  1.00 15.20 ? 95   ILE A CD1   1 
ATOM   725   N  N     . ILE A 1 96  ? 46.205  165.012 27.424  1.00 11.01 ? 96   ILE A N     1 
ATOM   726   C  CA    . ILE A 1 96  ? 45.722  166.339 27.773  1.00 11.72 ? 96   ILE A CA    1 
ATOM   727   C  C     . ILE A 1 96  ? 46.244  166.500 29.194  1.00 11.57 ? 96   ILE A C     1 
ATOM   728   O  O     . ILE A 1 96  ? 45.909  165.698 30.068  1.00 12.89 ? 96   ILE A O     1 
ATOM   729   C  CB    . ILE A 1 96  ? 44.176  166.431 27.814  1.00 12.58 ? 96   ILE A CB    1 
ATOM   730   C  CG1   . ILE A 1 96  ? 43.601  166.308 26.400  1.00 11.55 ? 96   ILE A CG1   1 
ATOM   731   C  CG2   . ILE A 1 96  ? 43.755  167.764 28.462  1.00 14.53 ? 96   ILE A CG2   1 
ATOM   732   C  CD1   . ILE A 1 96  ? 42.079  166.346 26.347  1.00 15.13 ? 96   ILE A CD1   1 
ATOM   733   N  N     . TRP A 1 97  ? 47.095  167.496 29.422  1.00 11.70 ? 97   TRP A N     1 
ATOM   734   C  CA    . TRP A 1 97  ? 47.622  167.723 30.766  1.00 11.37 ? 97   TRP A CA    1 
ATOM   735   C  C     . TRP A 1 97  ? 46.923  168.931 31.372  1.00 12.56 ? 97   TRP A C     1 
ATOM   736   O  O     . TRP A 1 97  ? 46.910  170.008 30.783  1.00 13.98 ? 97   TRP A O     1 
ATOM   737   C  CB    . TRP A 1 97  ? 49.136  167.973 30.733  1.00 11.98 ? 97   TRP A CB    1 
ATOM   738   C  CG    . TRP A 1 97  ? 49.729  168.229 32.097  1.00 12.64 ? 97   TRP A CG    1 
ATOM   739   C  CD1   . TRP A 1 97  ? 49.903  167.320 33.105  1.00 11.32 ? 97   TRP A CD1   1 
ATOM   740   C  CD2   . TRP A 1 97  ? 50.175  169.491 32.613  1.00 13.77 ? 97   TRP A CD2   1 
ATOM   741   N  NE1   . TRP A 1 97  ? 50.428  167.942 34.220  1.00 12.96 ? 97   TRP A NE1   1 
ATOM   742   C  CE2   . TRP A 1 97  ? 50.604  169.273 33.944  1.00 14.39 ? 97   TRP A CE2   1 
ATOM   743   C  CE3   . TRP A 1 97  ? 50.252  170.786 32.081  1.00 13.56 ? 97   TRP A CE3   1 
ATOM   744   C  CZ2   . TRP A 1 97  ? 51.104  170.304 34.752  1.00 14.03 ? 97   TRP A CZ2   1 
ATOM   745   C  CZ3   . TRP A 1 97  ? 50.751  171.812 32.885  1.00 15.95 ? 97   TRP A CZ3   1 
ATOM   746   C  CH2   . TRP A 1 97  ? 51.170  171.562 34.206  1.00 15.03 ? 97   TRP A CH2   1 
ATOM   747   N  N     . GLU A 1 98  ? 46.325  168.735 32.539  1.00 13.03 ? 98   GLU A N     1 
ATOM   748   C  CA    . GLU A 1 98  ? 45.625  169.806 33.249  1.00 13.36 ? 98   GLU A CA    1 
ATOM   749   C  C     . GLU A 1 98  ? 46.442  170.061 34.510  1.00 13.15 ? 98   GLU A C     1 
ATOM   750   O  O     . GLU A 1 98  ? 46.592  169.171 35.345  1.00 13.47 ? 98   GLU A O     1 
ATOM   751   C  CB    . GLU A 1 98  ? 44.208  169.349 33.614  1.00 13.71 ? 98   GLU A CB    1 
ATOM   752   C  CG    . GLU A 1 98  ? 43.419  170.287 34.535  1.00 15.91 ? 98   GLU A CG    1 
ATOM   753   C  CD    . GLU A 1 98  ? 43.001  171.590 33.871  1.00 15.78 ? 98   GLU A CD    1 
ATOM   754   O  OE1   . GLU A 1 98  ? 43.157  171.723 32.640  1.00 18.86 ? 98   GLU A OE1   1 
ATOM   755   O  OE2   . GLU A 1 98  ? 42.502  172.480 34.591  1.00 17.30 ? 98   GLU A OE2   1 
ATOM   756   N  N     . GLY A 1 99  ? 46.988  171.266 34.637  1.00 14.22 ? 99   GLY A N     1 
ATOM   757   C  CA    . GLY A 1 99  ? 47.793  171.582 35.802  1.00 14.52 ? 99   GLY A CA    1 
ATOM   758   C  C     . GLY A 1 99  ? 47.001  171.762 37.085  1.00 14.76 ? 99   GLY A C     1 
ATOM   759   O  O     . GLY A 1 99  ? 45.775  171.890 37.058  1.00 15.71 ? 99   GLY A O     1 
ATOM   760   N  N     . ASP A 1 100 ? 47.712  171.752 38.212  1.00 15.70 ? 100  ASP A N     1 
ATOM   761   C  CA    . ASP A 1 100 ? 47.112  171.944 39.531  1.00 15.26 ? 100  ASP A CA    1 
ATOM   762   C  C     . ASP A 1 100 ? 46.360  173.276 39.485  1.00 16.58 ? 100  ASP A C     1 
ATOM   763   O  O     . ASP A 1 100 ? 45.291  173.428 40.085  1.00 17.02 ? 100  ASP A O     1 
ATOM   764   C  CB    . ASP A 1 100 ? 48.213  171.986 40.598  1.00 16.65 ? 100  ASP A CB    1 
ATOM   765   C  CG    . ASP A 1 100 ? 47.662  172.082 42.014  1.00 18.28 ? 100  ASP A CG    1 
ATOM   766   O  OD1   . ASP A 1 100 ? 46.841  171.220 42.395  1.00 17.84 ? 100  ASP A OD1   1 
ATOM   767   O  OD2   . ASP A 1 100 ? 48.058  173.015 42.748  1.00 17.60 ? 100  ASP A OD2   1 
ATOM   768   N  N     . ASP A 1 101 ? 46.940  174.238 38.774  1.00 17.78 ? 101  ASP A N     1 
ATOM   769   C  CA    . ASP A 1 101 ? 46.326  175.550 38.593  1.00 22.03 ? 101  ASP A CA    1 
ATOM   770   C  C     . ASP A 1 101 ? 45.681  175.480 37.212  1.00 21.83 ? 101  ASP A C     1 
ATOM   771   O  O     . ASP A 1 101 ? 46.371  175.276 36.212  1.00 22.23 ? 101  ASP A O     1 
ATOM   772   C  CB    . ASP A 1 101 ? 47.389  176.648 38.617  1.00 23.91 ? 101  ASP A CB    1 
ATOM   773   C  CG    . ASP A 1 101 ? 46.786  178.037 38.602  1.00 28.88 ? 101  ASP A CG    1 
ATOM   774   O  OD1   . ASP A 1 101 ? 46.103  178.388 37.616  1.00 29.69 ? 101  ASP A OD1   1 
ATOM   775   O  OD2   . ASP A 1 101 ? 46.990  178.776 39.586  1.00 33.77 ? 101  ASP A OD2   1 
ATOM   776   N  N     . THR A 1 102 ? 44.365  175.647 37.147  1.00 23.48 ? 102  THR A N     1 
ATOM   777   C  CA    . THR A 1 102 ? 43.673  175.534 35.867  1.00 24.85 ? 102  THR A CA    1 
ATOM   778   C  C     . THR A 1 102 ? 44.174  176.438 34.743  1.00 24.38 ? 102  THR A C     1 
ATOM   779   O  O     . THR A 1 102 ? 43.871  176.198 33.573  1.00 24.69 ? 102  THR A O     1 
ATOM   780   C  CB    . THR A 1 102 ? 42.154  175.734 36.024  1.00 26.17 ? 102  THR A CB    1 
ATOM   781   O  OG1   . THR A 1 102 ? 41.504  175.309 34.819  1.00 27.74 ? 102  THR A OG1   1 
ATOM   782   C  CG2   . THR A 1 102 ? 41.821  177.195 36.301  1.00 27.03 ? 102  THR A CG2   1 
ATOM   783   N  N     . SER A 1 103 ? 44.940  177.470 35.078  1.00 22.56 ? 103  SER A N     1 
ATOM   784   C  CA    . SER A 1 103 ? 45.468  178.352 34.043  1.00 22.77 ? 103  SER A CA    1 
ATOM   785   C  C     . SER A 1 103 ? 46.550  177.623 33.251  1.00 22.50 ? 103  SER A C     1 
ATOM   786   O  O     . SER A 1 103 ? 46.958  178.077 32.184  1.00 21.79 ? 103  SER A O     1 
ATOM   787   C  CB    . SER A 1 103 ? 46.059  179.622 34.661  1.00 21.68 ? 103  SER A CB    1 
ATOM   788   O  OG    . SER A 1 103 ? 47.184  179.333 35.473  1.00 23.65 ? 103  SER A OG    1 
ATOM   789   N  N     . GLN A 1 104 ? 47.007  176.490 33.777  1.00 21.57 ? 104  GLN A N     1 
ATOM   790   C  CA    . GLN A 1 104 ? 48.052  175.707 33.127  1.00 22.12 ? 104  GLN A CA    1 
ATOM   791   C  C     . GLN A 1 104 ? 47.524  174.405 32.527  1.00 22.02 ? 104  GLN A C     1 
ATOM   792   O  O     . GLN A 1 104 ? 46.831  173.639 33.194  1.00 21.90 ? 104  GLN A O     1 
ATOM   793   C  CB    . GLN A 1 104 ? 49.161  175.370 34.130  1.00 23.44 ? 104  GLN A CB    1 
ATOM   794   C  CG    . GLN A 1 104 ? 49.781  176.569 34.827  1.00 24.80 ? 104  GLN A CG    1 
ATOM   795   C  CD    . GLN A 1 104 ? 50.245  177.625 33.849  1.00 27.06 ? 104  GLN A CD    1 
ATOM   796   O  OE1   . GLN A 1 104 ? 50.968  177.330 32.893  1.00 25.95 ? 104  GLN A OE1   1 
ATOM   797   N  NE2   . GLN A 1 104 ? 49.833  178.868 34.081  1.00 27.30 ? 104  GLN A NE2   1 
ATOM   798   N  N     . SER A 1 105 ? 47.853  174.161 31.263  1.00 22.14 ? 105  SER A N     1 
ATOM   799   C  CA    . SER A 1 105 ? 47.432  172.934 30.593  1.00 21.70 ? 105  SER A CA    1 
ATOM   800   C  C     . SER A 1 105 ? 48.179  172.789 29.279  1.00 22.07 ? 105  SER A C     1 
ATOM   801   O  O     . SER A 1 105 ? 48.754  173.752 28.770  1.00 23.07 ? 105  SER A O     1 
ATOM   802   C  CB    . SER A 1 105 ? 45.926  172.945 30.324  1.00 22.17 ? 105  SER A CB    1 
ATOM   803   O  OG    . SER A 1 105 ? 45.596  173.863 29.297  1.00 23.65 ? 105  SER A OG    1 
ATOM   804   N  N     . LYS A 1 106 ? 48.177  171.575 28.743  1.00 20.92 ? 106  LYS A N     1 
ATOM   805   C  CA    . LYS A 1 106 ? 48.842  171.286 27.480  1.00 20.42 ? 106  LYS A CA    1 
ATOM   806   C  C     . LYS A 1 106 ? 48.082  170.201 26.743  1.00 18.84 ? 106  LYS A C     1 
ATOM   807   O  O     . LYS A 1 106 ? 47.430  169.361 27.356  1.00 16.76 ? 106  LYS A O     1 
ATOM   808   C  CB    . LYS A 1 106 ? 50.266  170.760 27.702  1.00 21.16 ? 106  LYS A CB    1 
ATOM   809   C  CG    . LYS A 1 106 ? 51.258  171.709 28.343  1.00 23.17 ? 106  LYS A CG    1 
ATOM   810   C  CD    . LYS A 1 106 ? 52.602  170.998 28.475  1.00 24.86 ? 106  LYS A CD    1 
ATOM   811   C  CE    . LYS A 1 106 ? 53.652  171.869 29.136  1.00 25.57 ? 106  LYS A CE    1 
ATOM   812   N  NZ    . LYS A 1 106 ? 54.962  171.160 29.185  1.00 26.94 ? 106  LYS A NZ    1 
ATOM   813   N  N     . HIS A 1 107 ? 48.176  170.232 25.422  1.00 18.21 ? 107  HIS A N     1 
ATOM   814   C  CA    . HIS A 1 107 ? 47.571  169.217 24.579  1.00 18.30 ? 107  HIS A CA    1 
ATOM   815   C  C     . HIS A 1 107 ? 48.779  168.678 23.817  1.00 18.33 ? 107  HIS A C     1 
ATOM   816   O  O     . HIS A 1 107 ? 49.391  169.396 23.027  1.00 17.67 ? 107  HIS A O     1 
ATOM   817   C  CB    . HIS A 1 107 ? 46.542  169.829 23.621  1.00 20.67 ? 107  HIS A CB    1 
ATOM   818   C  CG    . HIS A 1 107 ? 45.228  170.143 24.269  1.00 22.22 ? 107  HIS A CG    1 
ATOM   819   N  ND1   . HIS A 1 107 ? 45.051  171.215 25.116  1.00 24.21 ? 107  HIS A ND1   1 
ATOM   820   C  CD2   . HIS A 1 107 ? 44.035  169.502 24.221  1.00 23.17 ? 107  HIS A CD2   1 
ATOM   821   C  CE1   . HIS A 1 107 ? 43.807  171.221 25.563  1.00 23.56 ? 107  HIS A CE1   1 
ATOM   822   N  NE2   . HIS A 1 107 ? 43.170  170.192 25.035  1.00 23.31 ? 107  HIS A NE2   1 
ATOM   823   N  N     . ILE A 1 108 ? 49.148  167.434 24.098  1.00 15.99 ? 108  ILE A N     1 
ATOM   824   C  CA    . ILE A 1 108 ? 50.304  166.816 23.459  1.00 14.22 ? 108  ILE A CA    1 
ATOM   825   C  C     . ILE A 1 108 ? 49.836  165.773 22.456  1.00 14.23 ? 108  ILE A C     1 
ATOM   826   O  O     . ILE A 1 108 ? 49.252  164.756 22.833  1.00 15.69 ? 108  ILE A O     1 
ATOM   827   C  CB    . ILE A 1 108 ? 51.210  166.158 24.520  1.00 15.17 ? 108  ILE A CB    1 
ATOM   828   C  CG1   . ILE A 1 108 ? 51.619  167.203 25.566  1.00 15.08 ? 108  ILE A CG1   1 
ATOM   829   C  CG2   . ILE A 1 108 ? 52.440  165.555 23.863  1.00 15.25 ? 108  ILE A CG2   1 
ATOM   830   C  CD1   . ILE A 1 108 ? 52.275  166.609 26.792  1.00 18.41 ? 108  ILE A CD1   1 
ATOM   831   N  N     . SER A 1 109 ? 50.083  166.040 21.177  1.00 14.28 ? 109  SER A N     1 
ATOM   832   C  CA    . SER A 1 109 ? 49.672  165.132 20.114  1.00 13.10 ? 109  SER A CA    1 
ATOM   833   C  C     . SER A 1 109 ? 50.509  163.864 20.126  1.00 13.16 ? 109  SER A C     1 
ATOM   834   O  O     . SER A 1 109 ? 51.581  163.821 20.727  1.00 14.64 ? 109  SER A O     1 
ATOM   835   C  CB    . SER A 1 109 ? 49.816  165.812 18.749  1.00 13.28 ? 109  SER A CB    1 
ATOM   836   O  OG    . SER A 1 109 ? 51.182  165.943 18.394  1.00 11.35 ? 109  SER A OG    1 
ATOM   837   N  N     . TYR A 1 110 ? 50.014  162.827 19.464  1.00 13.01 ? 110  TYR A N     1 
ATOM   838   C  CA    . TYR A 1 110 ? 50.751  161.577 19.398  1.00 14.55 ? 110  TYR A CA    1 
ATOM   839   C  C     . TYR A 1 110 ? 52.102  161.817 18.745  1.00 14.35 ? 110  TYR A C     1 
ATOM   840   O  O     . TYR A 1 110 ? 53.108  161.229 19.142  1.00 14.11 ? 110  TYR A O     1 
ATOM   841   C  CB    . TYR A 1 110 ? 49.966  160.525 18.608  1.00 13.36 ? 110  TYR A CB    1 
ATOM   842   C  CG    . TYR A 1 110 ? 49.067  159.693 19.488  1.00 13.15 ? 110  TYR A CG    1 
ATOM   843   C  CD1   . TYR A 1 110 ? 47.752  160.084 19.765  1.00 13.99 ? 110  TYR A CD1   1 
ATOM   844   C  CD2   . TYR A 1 110 ? 49.559  158.548 20.109  1.00 12.14 ? 110  TYR A CD2   1 
ATOM   845   C  CE1   . TYR A 1 110 ? 46.953  159.344 20.651  1.00 12.92 ? 110  TYR A CE1   1 
ATOM   846   C  CE2   . TYR A 1 110 ? 48.778  157.814 20.986  1.00 11.97 ? 110  TYR A CE2   1 
ATOM   847   C  CZ    . TYR A 1 110 ? 47.482  158.212 21.256  1.00 11.27 ? 110  TYR A CZ    1 
ATOM   848   O  OH    . TYR A 1 110 ? 46.741  157.467 22.143  1.00 11.65 ? 110  TYR A OH    1 
ATOM   849   N  N     . ARG A 1 111 ? 52.127  162.693 17.748  1.00 14.53 ? 111  ARG A N     1 
ATOM   850   C  CA    . ARG A 1 111 ? 53.373  162.984 17.059  1.00 15.79 ? 111  ARG A CA    1 
ATOM   851   C  C     . ARG A 1 111 ? 54.362  163.678 17.989  1.00 15.50 ? 111  ARG A C     1 
ATOM   852   O  O     . ARG A 1 111 ? 55.545  163.343 18.004  1.00 15.62 ? 111  ARG A O     1 
ATOM   853   C  CB    . ARG A 1 111 ? 53.115  163.841 15.816  1.00 17.21 ? 111  ARG A CB    1 
ATOM   854   C  CG    . ARG A 1 111 ? 54.350  164.032 14.951  1.00 21.32 ? 111  ARG A CG    1 
ATOM   855   C  CD    . ARG A 1 111 ? 53.994  164.611 13.588  1.00 28.20 ? 111  ARG A CD    1 
ATOM   856   N  NE    . ARG A 1 111 ? 53.154  163.702 12.811  1.00 30.78 ? 111  ARG A NE    1 
ATOM   857   C  CZ    . ARG A 1 111 ? 51.961  164.028 12.322  1.00 34.64 ? 111  ARG A CZ    1 
ATOM   858   N  NH1   . ARG A 1 111 ? 51.468  165.242 12.530  1.00 35.65 ? 111  ARG A NH1   1 
ATOM   859   N  NH2   . ARG A 1 111 ? 51.261  163.144 11.622  1.00 37.05 ? 111  ARG A NH2   1 
ATOM   860   N  N     . GLU A 1 112 ? 53.878  164.634 18.777  1.00 14.52 ? 112  GLU A N     1 
ATOM   861   C  CA    . GLU A 1 112 ? 54.743  165.348 19.711  1.00 15.41 ? 112  GLU A CA    1 
ATOM   862   C  C     . GLU A 1 112 ? 55.249  164.405 20.799  1.00 14.70 ? 112  GLU A C     1 
ATOM   863   O  O     . GLU A 1 112 ? 56.430  164.423 21.153  1.00 14.57 ? 112  GLU A O     1 
ATOM   864   C  CB    . GLU A 1 112 ? 53.989  166.518 20.358  1.00 18.58 ? 112  GLU A CB    1 
ATOM   865   C  CG    . GLU A 1 112 ? 53.482  167.554 19.366  1.00 24.95 ? 112  GLU A CG    1 
ATOM   866   C  CD    . GLU A 1 112 ? 52.664  168.658 20.025  1.00 28.15 ? 112  GLU A CD    1 
ATOM   867   O  OE1   . GLU A 1 112 ? 51.602  168.358 20.618  1.00 25.94 ? 112  GLU A OE1   1 
ATOM   868   O  OE2   . GLU A 1 112 ? 53.089  169.830 19.948  1.00 31.43 ? 112  GLU A OE2   1 
ATOM   869   N  N     . LEU A 1 113 ? 54.355  163.576 21.332  1.00 13.81 ? 113  LEU A N     1 
ATOM   870   C  CA    . LEU A 1 113 ? 54.743  162.644 22.384  1.00 13.87 ? 113  LEU A CA    1 
ATOM   871   C  C     . LEU A 1 113 ? 55.772  161.653 21.853  1.00 13.81 ? 113  LEU A C     1 
ATOM   872   O  O     . LEU A 1 113 ? 56.751  161.324 22.530  1.00 14.81 ? 113  LEU A O     1 
ATOM   873   C  CB    . LEU A 1 113 ? 53.516  161.897 22.908  1.00 12.64 ? 113  LEU A CB    1 
ATOM   874   C  CG    . LEU A 1 113 ? 53.747  161.006 24.134  1.00 10.19 ? 113  LEU A CG    1 
ATOM   875   C  CD1   . LEU A 1 113 ? 54.398  161.804 25.261  1.00 9.92  ? 113  LEU A CD1   1 
ATOM   876   C  CD2   . LEU A 1 113 ? 52.410  160.445 24.590  1.00 12.43 ? 113  LEU A CD2   1 
ATOM   877   N  N     . HIS A 1 114 ? 55.547  161.177 20.636  1.00 14.68 ? 114  HIS A N     1 
ATOM   878   C  CA    . HIS A 1 114 ? 56.469  160.237 20.004  1.00 13.67 ? 114  HIS A CA    1 
ATOM   879   C  C     . HIS A 1 114 ? 57.836  160.890 19.869  1.00 13.74 ? 114  HIS A C     1 
ATOM   880   O  O     . HIS A 1 114 ? 58.861  160.284 20.182  1.00 13.80 ? 114  HIS A O     1 
ATOM   881   C  CB    . HIS A 1 114 ? 55.939  159.832 18.624  1.00 13.93 ? 114  HIS A CB    1 
ATOM   882   C  CG    . HIS A 1 114 ? 56.939  159.106 17.778  1.00 13.61 ? 114  HIS A CG    1 
ATOM   883   N  ND1   . HIS A 1 114 ? 57.778  159.753 16.898  1.00 16.02 ? 114  HIS A ND1   1 
ATOM   884   C  CD2   . HIS A 1 114 ? 57.237  157.790 17.682  1.00 13.21 ? 114  HIS A CD2   1 
ATOM   885   C  CE1   . HIS A 1 114 ? 58.548  158.866 16.293  1.00 15.68 ? 114  HIS A CE1   1 
ATOM   886   N  NE2   . HIS A 1 114 ? 58.240  157.667 16.752  1.00 14.80 ? 114  HIS A NE2   1 
ATOM   887   N  N     . ARG A 1 115 ? 57.847  162.139 19.418  1.00 13.00 ? 115  ARG A N     1 
ATOM   888   C  CA    . ARG A 1 115 ? 59.099  162.862 19.248  1.00 15.42 ? 115  ARG A CA    1 
ATOM   889   C  C     . ARG A 1 115 ? 59.880  162.970 20.553  1.00 14.54 ? 115  ARG A C     1 
ATOM   890   O  O     . ARG A 1 115 ? 61.090  162.724 20.581  1.00 13.41 ? 115  ARG A O     1 
ATOM   891   C  CB    . ARG A 1 115 ? 58.836  164.266 18.698  1.00 17.76 ? 115  ARG A CB    1 
ATOM   892   C  CG    . ARG A 1 115 ? 60.104  165.028 18.372  1.00 22.78 ? 115  ARG A CG    1 
ATOM   893   C  CD    . ARG A 1 115 ? 59.798  166.420 17.862  1.00 27.77 ? 115  ARG A CD    1 
ATOM   894   N  NE    . ARG A 1 115 ? 60.939  167.006 17.164  1.00 34.56 ? 115  ARG A NE    1 
ATOM   895   C  CZ    . ARG A 1 115 ? 61.398  166.579 15.990  1.00 36.52 ? 115  ARG A CZ    1 
ATOM   896   N  NH1   . ARG A 1 115 ? 60.815  165.557 15.375  1.00 38.56 ? 115  ARG A NH1   1 
ATOM   897   N  NH2   . ARG A 1 115 ? 62.438  167.179 15.426  1.00 39.06 ? 115  ARG A NH2   1 
ATOM   898   N  N     . ASP A 1 116 ? 59.199  163.346 21.633  1.00 12.85 ? 116  ASP A N     1 
ATOM   899   C  CA    . ASP A 1 116 ? 59.870  163.473 22.922  1.00 15.02 ? 116  ASP A CA    1 
ATOM   900   C  C     . ASP A 1 116 ? 60.309  162.130 23.487  1.00 13.59 ? 116  ASP A C     1 
ATOM   901   O  O     . ASP A 1 116 ? 61.349  162.039 24.136  1.00 14.84 ? 116  ASP A O     1 
ATOM   902   C  CB    . ASP A 1 116 ? 58.979  164.199 23.934  1.00 18.40 ? 116  ASP A CB    1 
ATOM   903   C  CG    . ASP A 1 116 ? 58.937  165.695 23.697  1.00 25.40 ? 116  ASP A CG    1 
ATOM   904   O  OD1   . ASP A 1 116 ? 59.981  166.259 23.299  1.00 30.39 ? 116  ASP A OD1   1 
ATOM   905   O  OD2   . ASP A 1 116 ? 57.870  166.307 23.919  1.00 29.79 ? 116  ASP A OD2   1 
ATOM   906   N  N     . VAL A 1 117 ? 59.524  161.086 23.245  1.00 12.98 ? 117  VAL A N     1 
ATOM   907   C  CA    . VAL A 1 117 ? 59.886  159.761 23.726  1.00 12.92 ? 117  VAL A CA    1 
ATOM   908   C  C     . VAL A 1 117 ? 61.131  159.282 22.980  1.00 14.31 ? 117  VAL A C     1 
ATOM   909   O  O     . VAL A 1 117 ? 62.002  158.635 23.564  1.00 15.06 ? 117  VAL A O     1 
ATOM   910   C  CB    . VAL A 1 117 ? 58.719  158.763 23.540  1.00 12.24 ? 117  VAL A CB    1 
ATOM   911   C  CG1   . VAL A 1 117 ? 59.173  157.340 23.854  1.00 14.90 ? 117  VAL A CG1   1 
ATOM   912   C  CG2   . VAL A 1 117 ? 57.573  159.148 24.472  1.00 11.41 ? 117  VAL A CG2   1 
ATOM   913   N  N     . CYS A 1 118 ? 61.221  159.611 21.692  1.00 13.90 ? 118  CYS A N     1 
ATOM   914   C  CA    . CYS A 1 118 ? 62.382  159.228 20.896  1.00 14.33 ? 118  CYS A CA    1 
ATOM   915   C  C     . CYS A 1 118 ? 63.615  159.971 21.389  1.00 13.43 ? 118  CYS A C     1 
ATOM   916   O  O     . CYS A 1 118 ? 64.693  159.386 21.509  1.00 14.84 ? 118  CYS A O     1 
ATOM   917   C  CB    . CYS A 1 118 ? 62.159  159.542 19.415  1.00 14.60 ? 118  CYS A CB    1 
ATOM   918   S  SG    . CYS A 1 118 ? 61.087  158.363 18.590  1.00 15.81 ? 118  CYS A SG    1 
ATOM   919   N  N     . ARG A 1 119 ? 63.457  161.259 21.675  1.00 14.29 ? 119  ARG A N     1 
ATOM   920   C  CA    . ARG A 1 119 ? 64.579  162.044 22.169  1.00 15.16 ? 119  ARG A CA    1 
ATOM   921   C  C     . ARG A 1 119 ? 65.027  161.557 23.539  1.00 15.23 ? 119  ARG A C     1 
ATOM   922   O  O     . ARG A 1 119 ? 66.224  161.468 23.805  1.00 14.96 ? 119  ARG A O     1 
ATOM   923   C  CB    . ARG A 1 119 ? 64.225  163.534 22.245  1.00 15.88 ? 119  ARG A CB    1 
ATOM   924   C  CG    . ARG A 1 119 ? 64.138  164.210 20.887  1.00 19.34 ? 119  ARG A CG    1 
ATOM   925   C  CD    . ARG A 1 119 ? 64.353  165.709 21.002  1.00 24.53 ? 119  ARG A CD    1 
ATOM   926   N  NE    . ARG A 1 119 ? 63.349  166.349 21.843  1.00 26.74 ? 119  ARG A NE    1 
ATOM   927   C  CZ    . ARG A 1 119 ? 63.362  167.638 22.167  1.00 30.55 ? 119  ARG A CZ    1 
ATOM   928   N  NH1   . ARG A 1 119 ? 64.333  168.427 21.717  1.00 30.43 ? 119  ARG A NH1   1 
ATOM   929   N  NH2   . ARG A 1 119 ? 62.405  168.140 22.939  1.00 29.93 ? 119  ARG A NH2   1 
ATOM   930   N  N     . PHE A 1 120 ? 64.078  161.240 24.416  1.00 14.09 ? 120  PHE A N     1 
ATOM   931   C  CA    . PHE A 1 120 ? 64.460  160.775 25.745  1.00 13.72 ? 120  PHE A CA    1 
ATOM   932   C  C     . PHE A 1 120 ? 65.030  159.357 25.712  1.00 13.51 ? 120  PHE A C     1 
ATOM   933   O  O     . PHE A 1 120 ? 65.868  158.999 26.542  1.00 13.40 ? 120  PHE A O     1 
ATOM   934   C  CB    . PHE A 1 120 ? 63.286  160.849 26.724  1.00 14.70 ? 120  PHE A CB    1 
ATOM   935   C  CG    . PHE A 1 120 ? 63.720  160.921 28.162  1.00 12.28 ? 120  PHE A CG    1 
ATOM   936   C  CD1   . PHE A 1 120 ? 64.385  162.050 28.643  1.00 14.39 ? 120  PHE A CD1   1 
ATOM   937   C  CD2   . PHE A 1 120 ? 63.514  159.849 29.020  1.00 13.16 ? 120  PHE A CD2   1 
ATOM   938   C  CE1   . PHE A 1 120 ? 64.843  162.110 29.961  1.00 14.19 ? 120  PHE A CE1   1 
ATOM   939   C  CE2   . PHE A 1 120 ? 63.965  159.892 30.337  1.00 11.78 ? 120  PHE A CE2   1 
ATOM   940   C  CZ    . PHE A 1 120 ? 64.633  161.026 30.812  1.00 13.46 ? 120  PHE A CZ    1 
ATOM   941   N  N     . ALA A 1 121 ? 64.573  158.546 24.765  1.00 12.17 ? 121  ALA A N     1 
ATOM   942   C  CA    . ALA A 1 121 ? 65.104  157.194 24.624  1.00 12.53 ? 121  ALA A CA    1 
ATOM   943   C  C     . ALA A 1 121 ? 66.601  157.333 24.307  1.00 13.31 ? 121  ALA A C     1 
ATOM   944   O  O     . ALA A 1 121 ? 67.437  156.653 24.904  1.00 12.57 ? 121  ALA A O     1 
ATOM   945   C  CB    . ALA A 1 121 ? 64.384  156.452 23.493  1.00 11.50 ? 121  ALA A CB    1 
ATOM   946   N  N     . ASN A 1 122 ? 66.940  158.227 23.378  1.00 13.89 ? 122  ASN A N     1 
ATOM   947   C  CA    . ASN A 1 122 ? 68.345  158.440 23.020  1.00 14.67 ? 122  ASN A CA    1 
ATOM   948   C  C     . ASN A 1 122 ? 69.131  159.025 24.187  1.00 14.44 ? 122  ASN A C     1 
ATOM   949   O  O     . ASN A 1 122 ? 70.311  158.724 24.363  1.00 15.09 ? 122  ASN A O     1 
ATOM   950   C  CB    . ASN A 1 122 ? 68.470  159.352 21.792  1.00 14.83 ? 122  ASN A CB    1 
ATOM   951   C  CG    . ASN A 1 122 ? 68.137  158.628 20.495  1.00 14.93 ? 122  ASN A CG    1 
ATOM   952   O  OD1   . ASN A 1 122 ? 68.542  157.483 20.296  1.00 16.99 ? 122  ASN A OD1   1 
ATOM   953   N  ND2   . ASN A 1 122 ? 67.407  159.292 19.609  1.00 17.81 ? 122  ASN A ND2   1 
ATOM   954   N  N     . THR A 1 123 ? 68.474  159.872 24.977  1.00 14.13 ? 123  THR A N     1 
ATOM   955   C  CA    . THR A 1 123 ? 69.102  160.471 26.148  1.00 14.79 ? 123  THR A CA    1 
ATOM   956   C  C     . THR A 1 123 ? 69.526  159.368 27.122  1.00 13.85 ? 123  THR A C     1 
ATOM   957   O  O     . THR A 1 123 ? 70.636  159.390 27.655  1.00 15.35 ? 123  THR A O     1 
ATOM   958   C  CB    . THR A 1 123 ? 68.129  161.429 26.877  1.00 14.17 ? 123  THR A CB    1 
ATOM   959   O  OG1   . THR A 1 123 ? 67.892  162.577 26.057  1.00 16.79 ? 123  THR A OG1   1 
ATOM   960   C  CG2   . THR A 1 123 ? 68.703  161.874 28.222  1.00 16.52 ? 123  THR A CG2   1 
ATOM   961   N  N     . LEU A 1 124 ? 68.636  158.407 27.350  1.00 12.63 ? 124  LEU A N     1 
ATOM   962   C  CA    . LEU A 1 124 ? 68.927  157.300 28.253  1.00 12.97 ? 124  LEU A CA    1 
ATOM   963   C  C     . LEU A 1 124 ? 70.066  156.453 27.695  1.00 14.10 ? 124  LEU A C     1 
ATOM   964   O  O     . LEU A 1 124 ? 71.010  156.116 28.409  1.00 12.70 ? 124  LEU A O     1 
ATOM   965   C  CB    . LEU A 1 124 ? 67.687  156.419 28.446  1.00 13.05 ? 124  LEU A CB    1 
ATOM   966   C  CG    . LEU A 1 124 ? 66.494  157.068 29.154  1.00 13.82 ? 124  LEU A CG    1 
ATOM   967   C  CD1   . LEU A 1 124 ? 65.311  156.105 29.148  1.00 14.60 ? 124  LEU A CD1   1 
ATOM   968   C  CD2   . LEU A 1 124 ? 66.873  157.437 30.570  1.00 16.14 ? 124  LEU A CD2   1 
ATOM   969   N  N     . LEU A 1 125 ? 69.978  156.123 26.412  1.00 14.03 ? 125  LEU A N     1 
ATOM   970   C  CA    . LEU A 1 125 ? 71.008  155.306 25.783  1.00 15.13 ? 125  LEU A CA    1 
ATOM   971   C  C     . LEU A 1 125 ? 72.362  155.996 25.831  1.00 15.95 ? 125  LEU A C     1 
ATOM   972   O  O     . LEU A 1 125 ? 73.376  155.359 26.116  1.00 17.17 ? 125  LEU A O     1 
ATOM   973   C  CB    . LEU A 1 125 ? 70.629  154.989 24.334  1.00 15.67 ? 125  LEU A CB    1 
ATOM   974   C  CG    . LEU A 1 125 ? 69.448  154.032 24.130  1.00 16.58 ? 125  LEU A CG    1 
ATOM   975   C  CD1   . LEU A 1 125 ? 69.072  153.981 22.648  1.00 16.65 ? 125  LEU A CD1   1 
ATOM   976   C  CD2   . LEU A 1 125 ? 69.810  152.642 24.633  1.00 16.52 ? 125  LEU A CD2   1 
ATOM   977   N  N     . ASP A 1 126 ? 72.382  157.296 25.556  1.00 15.84 ? 126  ASP A N     1 
ATOM   978   C  CA    . ASP A 1 126 ? 73.633  158.041 25.582  1.00 17.40 ? 126  ASP A CA    1 
ATOM   979   C  C     . ASP A 1 126 ? 74.206  158.122 26.988  1.00 19.01 ? 126  ASP A C     1 
ATOM   980   O  O     . ASP A 1 126 ? 75.421  158.189 27.165  1.00 18.65 ? 126  ASP A O     1 
ATOM   981   C  CB    . ASP A 1 126 ? 73.436  159.451 25.025  1.00 19.53 ? 126  ASP A CB    1 
ATOM   982   C  CG    . ASP A 1 126 ? 73.204  159.459 23.528  1.00 23.27 ? 126  ASP A CG    1 
ATOM   983   O  OD1   . ASP A 1 126 ? 73.338  158.391 22.893  1.00 26.06 ? 126  ASP A OD1   1 
ATOM   984   O  OD2   . ASP A 1 126 ? 72.892  160.535 22.983  1.00 26.08 ? 126  ASP A OD2   1 
ATOM   985   N  N     . LEU A 1 127 ? 73.335  158.102 27.991  1.00 18.19 ? 127  LEU A N     1 
ATOM   986   C  CA    . LEU A 1 127 ? 73.788  158.179 29.375  1.00 18.72 ? 127  LEU A CA    1 
ATOM   987   C  C     . LEU A 1 127 ? 74.366  156.843 29.835  1.00 18.96 ? 127  LEU A C     1 
ATOM   988   O  O     . LEU A 1 127 ? 75.056  156.774 30.853  1.00 19.74 ? 127  LEU A O     1 
ATOM   989   C  CB    . LEU A 1 127 ? 72.627  158.596 30.285  1.00 20.25 ? 127  LEU A CB    1 
ATOM   990   C  CG    . LEU A 1 127 ? 72.990  159.142 31.667  1.00 23.11 ? 127  LEU A CG    1 
ATOM   991   C  CD1   . LEU A 1 127 ? 73.890  160.366 31.509  1.00 22.63 ? 127  LEU A CD1   1 
ATOM   992   C  CD2   . LEU A 1 127 ? 71.717  159.522 32.422  1.00 23.49 ? 127  LEU A CD2   1 
ATOM   993   N  N     . GLY A 1 128 ? 74.089  155.778 29.084  1.00 19.40 ? 128  GLY A N     1 
ATOM   994   C  CA    . GLY A 1 128 ? 74.617  154.472 29.445  1.00 17.04 ? 128  GLY A CA    1 
ATOM   995   C  C     . GLY A 1 128 ? 73.575  153.429 29.801  1.00 17.00 ? 128  GLY A C     1 
ATOM   996   O  O     . GLY A 1 128 ? 73.911  152.274 30.072  1.00 16.44 ? 128  GLY A O     1 
ATOM   997   N  N     . ILE A 1 129 ? 72.306  153.826 29.809  1.00 15.88 ? 129  ILE A N     1 
ATOM   998   C  CA    . ILE A 1 129 ? 71.236  152.896 30.134  1.00 15.27 ? 129  ILE A CA    1 
ATOM   999   C  C     . ILE A 1 129 ? 71.039  151.914 28.981  1.00 16.97 ? 129  ILE A C     1 
ATOM   1000  O  O     . ILE A 1 129 ? 70.953  152.311 27.818  1.00 17.16 ? 129  ILE A O     1 
ATOM   1001  C  CB    . ILE A 1 129 ? 69.899  153.632 30.389  1.00 13.92 ? 129  ILE A CB    1 
ATOM   1002  C  CG1   . ILE A 1 129 ? 70.075  154.674 31.495  1.00 16.09 ? 129  ILE A CG1   1 
ATOM   1003  C  CG2   . ILE A 1 129 ? 68.811  152.620 30.763  1.00 15.17 ? 129  ILE A CG2   1 
ATOM   1004  C  CD1   . ILE A 1 129 ? 70.539  154.108 32.826  1.00 17.81 ? 129  ILE A CD1   1 
ATOM   1005  N  N     . LYS A 1 130 ? 70.975  150.631 29.317  1.00 16.28 ? 130  LYS A N     1 
ATOM   1006  C  CA    . LYS A 1 130 ? 70.784  149.587 28.322  1.00 17.25 ? 130  LYS A CA    1 
ATOM   1007  C  C     . LYS A 1 130 ? 69.594  148.709 28.687  1.00 16.98 ? 130  LYS A C     1 
ATOM   1008  O  O     . LYS A 1 130 ? 69.104  148.737 29.818  1.00 15.46 ? 130  LYS A O     1 
ATOM   1009  C  CB    . LYS A 1 130 ? 72.044  148.715 28.217  1.00 20.43 ? 130  LYS A CB    1 
ATOM   1010  C  CG    . LYS A 1 130 ? 73.283  149.451 27.725  1.00 23.80 ? 130  LYS A CG    1 
ATOM   1011  C  CD    . LYS A 1 130 ? 74.498  148.525 27.673  1.00 25.82 ? 130  LYS A CD    1 
ATOM   1012  C  CE    . LYS A 1 130 ? 74.334  147.424 26.634  1.00 28.56 ? 130  LYS A CE    1 
ATOM   1013  N  NZ    . LYS A 1 130 ? 74.281  147.951 25.241  1.00 31.13 ? 130  LYS A NZ    1 
ATOM   1014  N  N     . LYS A 1 131 ? 69.135  147.928 27.717  1.00 16.72 ? 131  LYS A N     1 
ATOM   1015  C  CA    . LYS A 1 131 ? 68.018  147.022 27.927  1.00 16.87 ? 131  LYS A CA    1 
ATOM   1016  C  C     . LYS A 1 131 ? 68.296  146.186 29.172  1.00 17.51 ? 131  LYS A C     1 
ATOM   1017  O  O     . LYS A 1 131 ? 69.399  145.668 29.341  1.00 18.50 ? 131  LYS A O     1 
ATOM   1018  C  CB    . LYS A 1 131 ? 67.861  146.104 26.716  1.00 16.76 ? 131  LYS A CB    1 
ATOM   1019  C  CG    . LYS A 1 131 ? 66.814  145.025 26.900  1.00 17.29 ? 131  LYS A CG    1 
ATOM   1020  C  CD    . LYS A 1 131 ? 66.678  144.149 25.674  1.00 16.89 ? 131  LYS A CD    1 
ATOM   1021  C  CE    . LYS A 1 131 ? 65.727  142.996 25.966  1.00 16.24 ? 131  LYS A CE    1 
ATOM   1022  N  NZ    . LYS A 1 131 ? 65.520  142.127 24.790  1.00 16.79 ? 131  LYS A NZ    1 
ATOM   1023  N  N     . GLY A 1 132 ? 67.305  146.059 30.049  1.00 17.98 ? 132  GLY A N     1 
ATOM   1024  C  CA    . GLY A 1 132 ? 67.509  145.272 31.251  1.00 17.03 ? 132  GLY A CA    1 
ATOM   1025  C  C     . GLY A 1 132 ? 67.874  146.084 32.480  1.00 18.17 ? 132  GLY A C     1 
ATOM   1026  O  O     . GLY A 1 132 ? 67.650  145.630 33.601  1.00 17.12 ? 132  GLY A O     1 
ATOM   1027  N  N     . ASP A 1 133 ? 68.449  147.270 32.293  1.00 16.90 ? 133  ASP A N     1 
ATOM   1028  C  CA    . ASP A 1 133 ? 68.791  148.108 33.440  1.00 16.27 ? 133  ASP A CA    1 
ATOM   1029  C  C     . ASP A 1 133 ? 67.500  148.610 34.062  1.00 16.00 ? 133  ASP A C     1 
ATOM   1030  O  O     . ASP A 1 133 ? 66.502  148.785 33.365  1.00 16.94 ? 133  ASP A O     1 
ATOM   1031  C  CB    . ASP A 1 133 ? 69.612  149.332 33.031  1.00 15.17 ? 133  ASP A CB    1 
ATOM   1032  C  CG    . ASP A 1 133 ? 71.012  148.985 32.592  1.00 18.11 ? 133  ASP A CG    1 
ATOM   1033  O  OD1   . ASP A 1 133 ? 71.495  147.891 32.948  1.00 18.54 ? 133  ASP A OD1   1 
ATOM   1034  O  OD2   . ASP A 1 133 ? 71.633  149.826 31.903  1.00 17.15 ? 133  ASP A OD2   1 
ATOM   1035  N  N     . VAL A 1 134 ? 67.519  148.843 35.369  1.00 15.61 ? 134  VAL A N     1 
ATOM   1036  C  CA    . VAL A 1 134 ? 66.337  149.358 36.051  1.00 14.29 ? 134  VAL A CA    1 
ATOM   1037  C  C     . VAL A 1 134 ? 66.518  150.857 36.220  1.00 15.07 ? 134  VAL A C     1 
ATOM   1038  O  O     . VAL A 1 134 ? 67.598  151.322 36.585  1.00 14.91 ? 134  VAL A O     1 
ATOM   1039  C  CB    . VAL A 1 134 ? 66.143  148.715 37.441  1.00 15.90 ? 134  VAL A CB    1 
ATOM   1040  C  CG1   . VAL A 1 134 ? 64.943  149.355 38.144  1.00 15.74 ? 134  VAL A CG1   1 
ATOM   1041  C  CG2   . VAL A 1 134 ? 65.919  147.217 37.296  1.00 13.91 ? 134  VAL A CG2   1 
ATOM   1042  N  N     . VAL A 1 135 ? 65.461  151.612 35.937  1.00 13.92 ? 135  VAL A N     1 
ATOM   1043  C  CA    . VAL A 1 135 ? 65.500  153.061 36.045  1.00 13.51 ? 135  VAL A CA    1 
ATOM   1044  C  C     . VAL A 1 135 ? 64.425  153.499 37.032  1.00 13.45 ? 135  VAL A C     1 
ATOM   1045  O  O     . VAL A 1 135 ? 63.241  153.238 36.823  1.00 13.20 ? 135  VAL A O     1 
ATOM   1046  C  CB    . VAL A 1 135 ? 65.230  153.720 34.671  1.00 13.08 ? 135  VAL A CB    1 
ATOM   1047  C  CG1   . VAL A 1 135 ? 65.163  155.245 34.813  1.00 12.81 ? 135  VAL A CG1   1 
ATOM   1048  C  CG2   . VAL A 1 135 ? 66.316  153.319 33.682  1.00 13.92 ? 135  VAL A CG2   1 
ATOM   1049  N  N     . ALA A 1 136 ? 64.838  154.143 38.116  1.00 13.36 ? 136  ALA A N     1 
ATOM   1050  C  CA    . ALA A 1 136 ? 63.881  154.604 39.115  1.00 12.64 ? 136  ALA A CA    1 
ATOM   1051  C  C     . ALA A 1 136 ? 63.261  155.917 38.664  1.00 12.88 ? 136  ALA A C     1 
ATOM   1052  O  O     . ALA A 1 136 ? 63.964  156.833 38.232  1.00 14.09 ? 136  ALA A O     1 
ATOM   1053  C  CB    . ALA A 1 136 ? 64.568  154.789 40.458  1.00 12.34 ? 136  ALA A CB    1 
ATOM   1054  N  N     . ILE A 1 137 ? 61.939  156.002 38.764  1.00 11.78 ? 137  ILE A N     1 
ATOM   1055  C  CA    . ILE A 1 137 ? 61.219  157.203 38.372  1.00 11.29 ? 137  ILE A CA    1 
ATOM   1056  C  C     . ILE A 1 137 ? 60.394  157.681 39.567  1.00 13.90 ? 137  ILE A C     1 
ATOM   1057  O  O     . ILE A 1 137 ? 59.471  156.999 40.013  1.00 14.32 ? 137  ILE A O     1 
ATOM   1058  C  CB    . ILE A 1 137 ? 60.300  156.921 37.156  1.00 12.36 ? 137  ILE A CB    1 
ATOM   1059  C  CG1   . ILE A 1 137 ? 61.147  156.431 35.973  1.00 12.96 ? 137  ILE A CG1   1 
ATOM   1060  C  CG2   . ILE A 1 137 ? 59.557  158.189 36.758  1.00 11.34 ? 137  ILE A CG2   1 
ATOM   1061  C  CD1   . ILE A 1 137 ? 60.339  156.085 34.721  1.00 14.37 ? 137  ILE A CD1   1 
ATOM   1062  N  N     . TYR A 1 138 ? 60.752  158.856 40.076  1.00 12.30 ? 138  TYR A N     1 
ATOM   1063  C  CA    . TYR A 1 138 ? 60.114  159.470 41.241  1.00 12.34 ? 138  TYR A CA    1 
ATOM   1064  C  C     . TYR A 1 138 ? 59.618  160.817 40.729  1.00 13.14 ? 138  TYR A C     1 
ATOM   1065  O  O     . TYR A 1 138 ? 60.248  161.854 40.947  1.00 11.68 ? 138  TYR A O     1 
ATOM   1066  C  CB    . TYR A 1 138 ? 61.184  159.641 42.328  1.00 13.46 ? 138  TYR A CB    1 
ATOM   1067  C  CG    . TYR A 1 138 ? 60.725  160.119 43.688  1.00 13.63 ? 138  TYR A CG    1 
ATOM   1068  C  CD1   . TYR A 1 138 ? 59.772  159.413 44.423  1.00 12.39 ? 138  TYR A CD1   1 
ATOM   1069  C  CD2   . TYR A 1 138 ? 61.322  161.231 44.284  1.00 14.17 ? 138  TYR A CD2   1 
ATOM   1070  C  CE1   . TYR A 1 138 ? 59.432  159.801 45.725  1.00 12.89 ? 138  TYR A CE1   1 
ATOM   1071  C  CE2   . TYR A 1 138 ? 60.990  161.627 45.577  1.00 13.77 ? 138  TYR A CE2   1 
ATOM   1072  C  CZ    . TYR A 1 138 ? 60.050  160.909 46.293  1.00 12.98 ? 138  TYR A CZ    1 
ATOM   1073  O  OH    . TYR A 1 138 ? 59.746  161.292 47.580  1.00 13.50 ? 138  TYR A OH    1 
ATOM   1074  N  N     . MET A 1 139 ? 58.478  160.775 40.042  1.00 12.15 ? 139  MET A N     1 
ATOM   1075  C  CA    . MET A 1 139 ? 57.897  161.948 39.407  1.00 12.71 ? 139  MET A CA    1 
ATOM   1076  C  C     . MET A 1 139 ? 56.478  162.307 39.802  1.00 12.82 ? 139  MET A C     1 
ATOM   1077  O  O     . MET A 1 139 ? 55.696  161.455 40.232  1.00 12.99 ? 139  MET A O     1 
ATOM   1078  C  CB    . MET A 1 139 ? 57.907  161.752 37.890  1.00 13.92 ? 139  MET A CB    1 
ATOM   1079  C  CG    . MET A 1 139 ? 59.281  161.634 37.271  1.00 16.19 ? 139  MET A CG    1 
ATOM   1080  S  SD    . MET A 1 139 ? 60.025  163.247 37.092  1.00 16.77 ? 139  MET A SD    1 
ATOM   1081  C  CE    . MET A 1 139 ? 59.326  163.769 35.500  1.00 18.11 ? 139  MET A CE    1 
ATOM   1082  N  N     . PRO A 1 140 ? 56.125  163.590 39.637  1.00 13.35 ? 140  PRO A N     1 
ATOM   1083  C  CA    . PRO A 1 140 ? 54.784  164.076 39.959  1.00 13.98 ? 140  PRO A CA    1 
ATOM   1084  C  C     . PRO A 1 140 ? 53.921  163.844 38.718  1.00 15.28 ? 140  PRO A C     1 
ATOM   1085  O  O     . PRO A 1 140 ? 54.379  163.248 37.736  1.00 14.61 ? 140  PRO A O     1 
ATOM   1086  C  CB    . PRO A 1 140 ? 55.015  165.555 40.242  1.00 13.54 ? 140  PRO A CB    1 
ATOM   1087  C  CG    . PRO A 1 140 ? 56.079  165.907 39.246  1.00 14.85 ? 140  PRO A CG    1 
ATOM   1088  C  CD    . PRO A 1 140 ? 57.026  164.708 39.297  1.00 12.01 ? 140  PRO A CD    1 
ATOM   1089  N  N     . MET A 1 141 ? 52.684  164.320 38.752  1.00 12.92 ? 141  MET A N     1 
ATOM   1090  C  CA    . MET A 1 141 ? 51.790  164.135 37.619  1.00 13.19 ? 141  MET A CA    1 
ATOM   1091  C  C     . MET A 1 141 ? 51.991  165.169 36.506  1.00 12.28 ? 141  MET A C     1 
ATOM   1092  O  O     . MET A 1 141 ? 51.163  166.054 36.302  1.00 11.86 ? 141  MET A O     1 
ATOM   1093  C  CB    . MET A 1 141 ? 50.337  164.140 38.107  1.00 11.90 ? 141  MET A CB    1 
ATOM   1094  C  CG    . MET A 1 141 ? 49.924  162.829 38.776  1.00 13.35 ? 141  MET A CG    1 
ATOM   1095  S  SD    . MET A 1 141 ? 49.666  161.469 37.591  1.00 14.38 ? 141  MET A SD    1 
ATOM   1096  C  CE    . MET A 1 141 ? 47.892  161.621 37.329  1.00 11.93 ? 141  MET A CE    1 
ATOM   1097  N  N     . VAL A 1 142 ? 53.108  165.041 35.798  1.00 11.18 ? 142  VAL A N     1 
ATOM   1098  C  CA    . VAL A 1 142 ? 53.436  165.920 34.683  1.00 11.38 ? 142  VAL A CA    1 
ATOM   1099  C  C     . VAL A 1 142 ? 53.718  165.009 33.487  1.00 12.78 ? 142  VAL A C     1 
ATOM   1100  O  O     . VAL A 1 142 ? 54.081  163.844 33.663  1.00 11.98 ? 142  VAL A O     1 
ATOM   1101  C  CB    . VAL A 1 142 ? 54.682  166.793 34.982  1.00 12.33 ? 142  VAL A CB    1 
ATOM   1102  C  CG1   . VAL A 1 142 ? 54.365  167.776 36.108  1.00 13.26 ? 142  VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A 1 142 ? 55.874  165.910 35.359  1.00 12.77 ? 142  VAL A CG2   1 
ATOM   1104  N  N     . PRO A 1 143 ? 53.552  165.528 32.259  1.00 12.70 ? 143  PRO A N     1 
ATOM   1105  C  CA    . PRO A 1 143 ? 53.778  164.764 31.025  1.00 13.14 ? 143  PRO A CA    1 
ATOM   1106  C  C     . PRO A 1 143 ? 55.136  164.082 30.955  1.00 12.94 ? 143  PRO A C     1 
ATOM   1107  O  O     . PRO A 1 143 ? 55.260  162.990 30.398  1.00 13.28 ? 143  PRO A O     1 
ATOM   1108  C  CB    . PRO A 1 143 ? 53.614  165.815 29.929  1.00 14.20 ? 143  PRO A CB    1 
ATOM   1109  C  CG    . PRO A 1 143 ? 52.664  166.802 30.531  1.00 13.94 ? 143  PRO A CG    1 
ATOM   1110  C  CD    . PRO A 1 143 ? 53.170  166.918 31.949  1.00 13.56 ? 143  PRO A CD    1 
ATOM   1111  N  N     . GLU A 1 144 ? 56.154  164.730 31.511  1.00 12.90 ? 144  GLU A N     1 
ATOM   1112  C  CA    . GLU A 1 144 ? 57.499  164.173 31.492  1.00 12.23 ? 144  GLU A CA    1 
ATOM   1113  C  C     . GLU A 1 144 ? 57.580  162.798 32.156  1.00 12.20 ? 144  GLU A C     1 
ATOM   1114  O  O     . GLU A 1 144 ? 58.450  161.992 31.821  1.00 12.00 ? 144  GLU A O     1 
ATOM   1115  C  CB    . GLU A 1 144 ? 58.485  165.151 32.147  1.00 14.36 ? 144  GLU A CB    1 
ATOM   1116  C  CG    . GLU A 1 144 ? 58.705  166.447 31.347  1.00 15.67 ? 144  GLU A CG    1 
ATOM   1117  C  CD    . GLU A 1 144 ? 57.610  167.494 31.544  1.00 17.55 ? 144  GLU A CD    1 
ATOM   1118  O  OE1   . GLU A 1 144 ? 56.617  167.220 32.243  1.00 16.97 ? 144  GLU A OE1   1 
ATOM   1119  O  OE2   . GLU A 1 144 ? 57.750  168.608 30.994  1.00 17.55 ? 144  GLU A OE2   1 
ATOM   1120  N  N     . ALA A 1 145 ? 56.680  162.525 33.097  1.00 11.69 ? 145  ALA A N     1 
ATOM   1121  C  CA    . ALA A 1 145 ? 56.670  161.229 33.766  1.00 11.15 ? 145  ALA A CA    1 
ATOM   1122  C  C     . ALA A 1 145 ? 56.336  160.154 32.729  1.00 10.46 ? 145  ALA A C     1 
ATOM   1123  O  O     . ALA A 1 145 ? 56.947  159.083 32.709  1.00 9.97  ? 145  ALA A O     1 
ATOM   1124  C  CB    . ALA A 1 145 ? 55.633  161.217 34.889  1.00 11.53 ? 145  ALA A CB    1 
ATOM   1125  N  N     . ALA A 1 146 ? 55.366  160.454 31.870  1.00 10.89 ? 146  ALA A N     1 
ATOM   1126  C  CA    . ALA A 1 146 ? 54.954  159.526 30.819  1.00 12.37 ? 146  ALA A CA    1 
ATOM   1127  C  C     . ALA A 1 146 ? 56.067  159.390 29.781  1.00 11.84 ? 146  ALA A C     1 
ATOM   1128  O  O     . ALA A 1 146 ? 56.314  158.303 29.264  1.00 11.84 ? 146  ALA A O     1 
ATOM   1129  C  CB    . ALA A 1 146 ? 53.666  160.023 30.146  1.00 11.30 ? 146  ALA A CB    1 
ATOM   1130  N  N     . VAL A 1 147 ? 56.731  160.498 29.471  1.00 11.88 ? 147  VAL A N     1 
ATOM   1131  C  CA    . VAL A 1 147 ? 57.822  160.463 28.499  1.00 11.42 ? 147  VAL A CA    1 
ATOM   1132  C  C     . VAL A 1 147 ? 58.916  159.514 28.993  1.00 12.26 ? 147  VAL A C     1 
ATOM   1133  O  O     . VAL A 1 147 ? 59.406  158.670 28.240  1.00 9.96  ? 147  VAL A O     1 
ATOM   1134  C  CB    . VAL A 1 147 ? 58.409  161.878 28.278  1.00 12.27 ? 147  VAL A CB    1 
ATOM   1135  C  CG1   . VAL A 1 147 ? 59.713  161.795 27.483  1.00 12.12 ? 147  VAL A CG1   1 
ATOM   1136  C  CG2   . VAL A 1 147 ? 57.396  162.740 27.525  1.00 12.91 ? 147  VAL A CG2   1 
ATOM   1137  N  N     . ALA A 1 148 ? 59.281  159.640 30.266  1.00 10.81 ? 148  ALA A N     1 
ATOM   1138  C  CA    . ALA A 1 148 ? 60.316  158.789 30.848  1.00 11.44 ? 148  ALA A CA    1 
ATOM   1139  C  C     . ALA A 1 148 ? 59.899  157.317 30.858  1.00 11.45 ? 148  ALA A C     1 
ATOM   1140  O  O     . ALA A 1 148 ? 60.689  156.436 30.508  1.00 10.56 ? 148  ALA A O     1 
ATOM   1141  C  CB    . ALA A 1 148 ? 60.645  159.261 32.272  1.00 11.11 ? 148  ALA A CB    1 
ATOM   1142  N  N     . MET A 1 149 ? 58.660  157.043 31.255  1.00 11.47 ? 149  MET A N     1 
ATOM   1143  C  CA    . MET A 1 149 ? 58.183  155.661 31.290  1.00 10.44 ? 149  MET A CA    1 
ATOM   1144  C  C     . MET A 1 149 ? 58.177  155.027 29.897  1.00 10.83 ? 149  MET A C     1 
ATOM   1145  O  O     . MET A 1 149 ? 58.669  153.915 29.710  1.00 11.64 ? 149  MET A O     1 
ATOM   1146  C  CB    . MET A 1 149 ? 56.781  155.600 31.896  1.00 9.71  ? 149  MET A CB    1 
ATOM   1147  C  CG    . MET A 1 149 ? 56.767  155.813 33.403  1.00 10.20 ? 149  MET A CG    1 
ATOM   1148  S  SD    . MET A 1 149 ? 55.098  156.066 34.034  1.00 12.06 ? 149  MET A SD    1 
ATOM   1149  C  CE    . MET A 1 149 ? 54.486  154.381 34.014  1.00 8.83  ? 149  MET A CE    1 
ATOM   1150  N  N     . LEU A 1 150 ? 57.622  155.738 28.925  1.00 10.81 ? 150  LEU A N     1 
ATOM   1151  C  CA    . LEU A 1 150 ? 57.554  155.236 27.557  1.00 10.31 ? 150  LEU A CA    1 
ATOM   1152  C  C     . LEU A 1 150 ? 58.937  155.076 26.945  1.00 11.08 ? 150  LEU A C     1 
ATOM   1153  O  O     . LEU A 1 150 ? 59.163  154.151 26.170  1.00 10.39 ? 150  LEU A O     1 
ATOM   1154  C  CB    . LEU A 1 150 ? 56.710  156.174 26.690  1.00 9.37  ? 150  LEU A CB    1 
ATOM   1155  C  CG    . LEU A 1 150 ? 55.201  156.093 26.944  1.00 9.58  ? 150  LEU A CG    1 
ATOM   1156  C  CD1   . LEU A 1 150 ? 54.523  157.328 26.373  1.00 10.02 ? 150  LEU A CD1   1 
ATOM   1157  C  CD2   . LEU A 1 150 ? 54.634  154.811 26.333  1.00 10.75 ? 150  LEU A CD2   1 
ATOM   1158  N  N     . ALA A 1 151 ? 59.854  155.981 27.287  1.00 10.32 ? 151  ALA A N     1 
ATOM   1159  C  CA    . ALA A 1 151 ? 61.218  155.906 26.763  1.00 11.99 ? 151  ALA A CA    1 
ATOM   1160  C  C     . ALA A 1 151 ? 61.943  154.674 27.307  1.00 12.41 ? 151  ALA A C     1 
ATOM   1161  O  O     . ALA A 1 151 ? 62.697  154.023 26.588  1.00 12.13 ? 151  ALA A O     1 
ATOM   1162  C  CB    . ALA A 1 151 ? 61.987  157.168 27.121  1.00 10.33 ? 151  ALA A CB    1 
ATOM   1163  N  N     . CYS A 1 152 ? 61.724  154.361 28.580  1.00 12.26 ? 152  CYS A N     1 
ATOM   1164  C  CA    . CYS A 1 152 ? 62.350  153.186 29.177  1.00 12.19 ? 152  CYS A CA    1 
ATOM   1165  C  C     . CYS A 1 152 ? 61.820  151.939 28.473  1.00 13.33 ? 152  CYS A C     1 
ATOM   1166  O  O     . CYS A 1 152 ? 62.585  151.047 28.088  1.00 13.51 ? 152  CYS A O     1 
ATOM   1167  C  CB    . CYS A 1 152 ? 62.025  153.093 30.672  1.00 11.92 ? 152  CYS A CB    1 
ATOM   1168  S  SG    . CYS A 1 152 ? 62.917  154.251 31.741  1.00 13.39 ? 152  CYS A SG    1 
ATOM   1169  N  N     . ALA A 1 153 ? 60.503  151.878 28.313  1.00 11.64 ? 153  ALA A N     1 
ATOM   1170  C  CA    . ALA A 1 153 ? 59.877  150.739 27.659  1.00 12.61 ? 153  ALA A CA    1 
ATOM   1171  C  C     . ALA A 1 153 ? 60.383  150.585 26.227  1.00 13.14 ? 153  ALA A C     1 
ATOM   1172  O  O     . ALA A 1 153 ? 60.624  149.470 25.763  1.00 15.58 ? 153  ALA A O     1 
ATOM   1173  C  CB    . ALA A 1 153 ? 58.353  150.900 27.666  1.00 11.79 ? 153  ALA A CB    1 
ATOM   1174  N  N     . ARG A 1 154 ? 60.553  151.707 25.534  1.00 12.28 ? 154  ARG A N     1 
ATOM   1175  C  CA    . ARG A 1 154 ? 61.015  151.680 24.148  1.00 14.27 ? 154  ARG A CA    1 
ATOM   1176  C  C     . ARG A 1 154 ? 62.377  151.002 23.995  1.00 16.10 ? 154  ARG A C     1 
ATOM   1177  O  O     . ARG A 1 154 ? 62.593  150.256 23.040  1.00 16.28 ? 154  ARG A O     1 
ATOM   1178  C  CB    . ARG A 1 154 ? 61.099  153.102 23.585  1.00 13.60 ? 154  ARG A CB    1 
ATOM   1179  C  CG    . ARG A 1 154 ? 61.261  153.172 22.061  1.00 13.34 ? 154  ARG A CG    1 
ATOM   1180  C  CD    . ARG A 1 154 ? 61.359  154.622 21.595  1.00 14.07 ? 154  ARG A CD    1 
ATOM   1181  N  NE    . ARG A 1 154 ? 61.356  154.759 20.138  1.00 15.77 ? 154  ARG A NE    1 
ATOM   1182  C  CZ    . ARG A 1 154 ? 60.266  154.699 19.378  1.00 16.55 ? 154  ARG A CZ    1 
ATOM   1183  N  NH1   . ARG A 1 154 ? 59.074  154.499 19.930  1.00 15.69 ? 154  ARG A NH1   1 
ATOM   1184  N  NH2   . ARG A 1 154 ? 60.363  154.859 18.064  1.00 15.98 ? 154  ARG A NH2   1 
ATOM   1185  N  N     . ILE A 1 155 ? 63.296  151.253 24.923  1.00 14.72 ? 155  ILE A N     1 
ATOM   1186  C  CA    . ILE A 1 155 ? 64.618  150.639 24.814  1.00 15.05 ? 155  ILE A CA    1 
ATOM   1187  C  C     . ILE A 1 155 ? 64.761  149.358 25.629  1.00 15.99 ? 155  ILE A C     1 
ATOM   1188  O  O     . ILE A 1 155 ? 65.831  148.754 25.667  1.00 16.63 ? 155  ILE A O     1 
ATOM   1189  C  CB    . ILE A 1 155 ? 65.745  151.626 25.216  1.00 13.88 ? 155  ILE A CB    1 
ATOM   1190  C  CG1   . ILE A 1 155 ? 65.690  151.920 26.717  1.00 11.80 ? 155  ILE A CG1   1 
ATOM   1191  C  CG2   . ILE A 1 155 ? 65.607  152.918 24.422  1.00 14.42 ? 155  ILE A CG2   1 
ATOM   1192  C  CD1   . ILE A 1 155 ? 66.796  152.855 27.189  1.00 14.47 ? 155  ILE A CD1   1 
ATOM   1193  N  N     . GLY A 1 156 ? 63.682  148.933 26.276  1.00 15.71 ? 156  GLY A N     1 
ATOM   1194  C  CA    . GLY A 1 156 ? 63.750  147.715 27.060  1.00 14.59 ? 156  GLY A CA    1 
ATOM   1195  C  C     . GLY A 1 156 ? 64.325  147.881 28.455  1.00 14.79 ? 156  GLY A C     1 
ATOM   1196  O  O     . GLY A 1 156 ? 64.689  146.895 29.092  1.00 14.76 ? 156  GLY A O     1 
ATOM   1197  N  N     . ALA A 1 157 ? 64.424  149.119 28.933  1.00 13.70 ? 157  ALA A N     1 
ATOM   1198  C  CA    . ALA A 1 157 ? 64.933  149.355 30.279  1.00 14.78 ? 157  ALA A CA    1 
ATOM   1199  C  C     . ALA A 1 157 ? 63.734  149.181 31.213  1.00 16.43 ? 157  ALA A C     1 
ATOM   1200  O  O     . ALA A 1 157 ? 62.654  149.687 30.935  1.00 20.10 ? 157  ALA A O     1 
ATOM   1201  C  CB    . ALA A 1 157 ? 65.502  150.768 30.399  1.00 15.64 ? 157  ALA A CB    1 
ATOM   1202  N  N     . VAL A 1 158 ? 63.925  148.466 32.313  1.00 14.84 ? 158  VAL A N     1 
ATOM   1203  C  CA    . VAL A 1 158 ? 62.836  148.215 33.256  1.00 14.07 ? 158  VAL A CA    1 
ATOM   1204  C  C     . VAL A 1 158 ? 62.603  149.428 34.144  1.00 14.84 ? 158  VAL A C     1 
ATOM   1205  O  O     . VAL A 1 158 ? 63.480  149.799 34.918  1.00 15.40 ? 158  VAL A O     1 
ATOM   1206  C  CB    . VAL A 1 158 ? 63.172  147.005 34.153  1.00 14.46 ? 158  VAL A CB    1 
ATOM   1207  C  CG1   . VAL A 1 158 ? 61.999  146.688 35.085  1.00 14.53 ? 158  VAL A CG1   1 
ATOM   1208  C  CG2   . VAL A 1 158 ? 63.511  145.809 33.285  1.00 15.44 ? 158  VAL A CG2   1 
ATOM   1209  N  N     . HIS A 1 159 ? 61.440  150.066 34.048  1.00 12.68 ? 159  HIS A N     1 
ATOM   1210  C  CA    . HIS A 1 159 ? 61.249  151.210 34.919  1.00 12.84 ? 159  HIS A CA    1 
ATOM   1211  C  C     . HIS A 1 159 ? 60.666  150.816 36.265  1.00 13.37 ? 159  HIS A C     1 
ATOM   1212  O  O     . HIS A 1 159 ? 59.877  149.880 36.375  1.00 13.39 ? 159  HIS A O     1 
ATOM   1213  C  CB    . HIS A 1 159 ? 60.423  152.331 34.247  1.00 11.13 ? 159  HIS A CB    1 
ATOM   1214  C  CG    . HIS A 1 159 ? 59.021  151.959 33.862  1.00 13.66 ? 159  HIS A CG    1 
ATOM   1215  N  ND1   . HIS A 1 159 ? 58.021  151.736 34.785  1.00 11.13 ? 159  HIS A ND1   1 
ATOM   1216  C  CD2   . HIS A 1 159 ? 58.424  151.906 32.646  1.00 13.83 ? 159  HIS A CD2   1 
ATOM   1217  C  CE1   . HIS A 1 159 ? 56.870  151.572 34.157  1.00 13.19 ? 159  HIS A CE1   1 
ATOM   1218  N  NE2   . HIS A 1 159 ? 57.086  151.672 32.857  1.00 13.60 ? 159  HIS A NE2   1 
ATOM   1219  N  N     . SER A 1 160 ? 61.118  151.519 37.296  1.00 13.46 ? 160  SER A N     1 
ATOM   1220  C  CA    . SER A 1 160 ? 60.668  151.293 38.661  1.00 12.93 ? 160  SER A CA    1 
ATOM   1221  C  C     . SER A 1 160 ? 60.127  152.630 39.136  1.00 12.57 ? 160  SER A C     1 
ATOM   1222  O  O     . SER A 1 160 ? 60.861  153.444 39.699  1.00 12.48 ? 160  SER A O     1 
ATOM   1223  C  CB    . SER A 1 160 ? 61.842  150.853 39.540  1.00 14.74 ? 160  SER A CB    1 
ATOM   1224  O  OG    . SER A 1 160 ? 61.434  150.659 40.887  1.00 14.08 ? 160  SER A OG    1 
ATOM   1225  N  N     . VAL A 1 161 ? 58.845  152.864 38.875  1.00 11.74 ? 161  VAL A N     1 
ATOM   1226  C  CA    . VAL A 1 161 ? 58.207  154.111 39.273  1.00 11.87 ? 161  VAL A CA    1 
ATOM   1227  C  C     . VAL A 1 161 ? 57.927  154.058 40.763  1.00 13.55 ? 161  VAL A C     1 
ATOM   1228  O  O     . VAL A 1 161 ? 57.520  153.023 41.298  1.00 13.12 ? 161  VAL A O     1 
ATOM   1229  C  CB    . VAL A 1 161 ? 56.875  154.346 38.510  1.00 12.56 ? 161  VAL A CB    1 
ATOM   1230  C  CG1   . VAL A 1 161 ? 56.149  155.561 39.076  1.00 12.33 ? 161  VAL A CG1   1 
ATOM   1231  C  CG2   . VAL A 1 161 ? 57.152  154.566 37.019  1.00 10.89 ? 161  VAL A CG2   1 
ATOM   1232  N  N     . ILE A 1 162 ? 58.172  155.181 41.425  1.00 12.32 ? 162  ILE A N     1 
ATOM   1233  C  CA    . ILE A 1 162 ? 57.963  155.306 42.856  1.00 11.92 ? 162  ILE A CA    1 
ATOM   1234  C  C     . ILE A 1 162 ? 57.053  156.505 43.099  1.00 11.56 ? 162  ILE A C     1 
ATOM   1235  O  O     . ILE A 1 162 ? 57.367  157.625 42.701  1.00 11.42 ? 162  ILE A O     1 
ATOM   1236  C  CB    . ILE A 1 162 ? 59.314  155.531 43.592  1.00 12.93 ? 162  ILE A CB    1 
ATOM   1237  C  CG1   . ILE A 1 162 ? 60.277  154.381 43.277  1.00 13.61 ? 162  ILE A CG1   1 
ATOM   1238  C  CG2   . ILE A 1 162 ? 59.080  155.636 45.096  1.00 12.75 ? 162  ILE A CG2   1 
ATOM   1239  C  CD1   . ILE A 1 162 ? 61.691  154.593 43.811  1.00 15.59 ? 162  ILE A CD1   1 
ATOM   1240  N  N     . PHE A 1 163 ? 55.914  156.250 43.730  1.00 10.62 ? 163  PHE A N     1 
ATOM   1241  C  CA    . PHE A 1 163 ? 54.944  157.290 44.056  1.00 12.36 ? 163  PHE A CA    1 
ATOM   1242  C  C     . PHE A 1 163 ? 55.632  158.442 44.788  1.00 12.64 ? 163  PHE A C     1 
ATOM   1243  O  O     . PHE A 1 163 ? 56.411  158.215 45.716  1.00 12.79 ? 163  PHE A O     1 
ATOM   1244  C  CB    . PHE A 1 163 ? 53.852  156.685 44.937  1.00 11.39 ? 163  PHE A CB    1 
ATOM   1245  C  CG    . PHE A 1 163 ? 52.834  157.676 45.425  1.00 11.94 ? 163  PHE A CG    1 
ATOM   1246  C  CD1   . PHE A 1 163 ? 52.070  158.417 44.528  1.00 11.70 ? 163  PHE A CD1   1 
ATOM   1247  C  CD2   . PHE A 1 163 ? 52.606  157.831 46.789  1.00 12.78 ? 163  PHE A CD2   1 
ATOM   1248  C  CE1   . PHE A 1 163 ? 51.086  159.295 44.983  1.00 13.38 ? 163  PHE A CE1   1 
ATOM   1249  C  CE2   . PHE A 1 163 ? 51.624  158.707 47.255  1.00 14.23 ? 163  PHE A CE2   1 
ATOM   1250  C  CZ    . PHE A 1 163 ? 50.864  159.437 46.352  1.00 14.17 ? 163  PHE A CZ    1 
ATOM   1251  N  N     . GLY A 1 164 ? 55.336  159.671 44.371  1.00 13.17 ? 164  GLY A N     1 
ATOM   1252  C  CA    . GLY A 1 164 ? 55.946  160.843 44.984  1.00 14.82 ? 164  GLY A CA    1 
ATOM   1253  C  C     . GLY A 1 164 ? 55.730  160.988 46.483  1.00 16.22 ? 164  GLY A C     1 
ATOM   1254  O  O     . GLY A 1 164 ? 56.456  161.736 47.146  1.00 15.63 ? 164  GLY A O     1 
ATOM   1255  N  N     . GLY A 1 165 ? 54.736  160.284 47.015  1.00 16.38 ? 165  GLY A N     1 
ATOM   1256  C  CA    . GLY A 1 165 ? 54.446  160.353 48.440  1.00 16.18 ? 165  GLY A CA    1 
ATOM   1257  C  C     . GLY A 1 165 ? 55.352  159.512 49.325  1.00 16.35 ? 165  GLY A C     1 
ATOM   1258  O  O     . GLY A 1 165 ? 55.257  159.581 50.551  1.00 17.59 ? 165  GLY A O     1 
ATOM   1259  N  N     . PHE A 1 166 ? 56.220  158.709 48.711  1.00 14.65 ? 166  PHE A N     1 
ATOM   1260  C  CA    . PHE A 1 166 ? 57.160  157.868 49.454  1.00 14.45 ? 166  PHE A CA    1 
ATOM   1261  C  C     . PHE A 1 166 ? 58.231  158.757 50.089  1.00 15.83 ? 166  PHE A C     1 
ATOM   1262  O  O     . PHE A 1 166 ? 58.697  159.711 49.464  1.00 14.66 ? 166  PHE A O     1 
ATOM   1263  C  CB    . PHE A 1 166 ? 57.848  156.867 48.511  1.00 16.83 ? 166  PHE A CB    1 
ATOM   1264  C  CG    . PHE A 1 166 ? 57.131  155.547 48.367  1.00 20.27 ? 166  PHE A CG    1 
ATOM   1265  C  CD1   . PHE A 1 166 ? 55.760  155.493 48.144  1.00 20.71 ? 166  PHE A CD1   1 
ATOM   1266  C  CD2   . PHE A 1 166 ? 57.848  154.350 48.427  1.00 21.68 ? 166  PHE A CD2   1 
ATOM   1267  C  CE1   . PHE A 1 166 ? 55.107  154.269 47.983  1.00 21.61 ? 166  PHE A CE1   1 
ATOM   1268  C  CE2   . PHE A 1 166 ? 57.206  153.118 48.267  1.00 22.73 ? 166  PHE A CE2   1 
ATOM   1269  C  CZ    . PHE A 1 166 ? 55.831  153.080 48.044  1.00 24.12 ? 166  PHE A CZ    1 
ATOM   1270  N  N     . SER A 1 167 ? 58.626  158.431 51.319  1.00 14.78 ? 167  SER A N     1 
ATOM   1271  C  CA    . SER A 1 167 ? 59.651  159.193 52.038  1.00 14.05 ? 167  SER A CA    1 
ATOM   1272  C  C     . SER A 1 167 ? 61.035  158.841 51.499  1.00 14.10 ? 167  SER A C     1 
ATOM   1273  O  O     . SER A 1 167 ? 61.185  157.886 50.742  1.00 13.56 ? 167  SER A O     1 
ATOM   1274  C  CB    . SER A 1 167 ? 59.614  158.841 53.524  1.00 13.84 ? 167  SER A CB    1 
ATOM   1275  O  OG    . SER A 1 167 ? 60.070  157.508 53.722  1.00 12.64 ? 167  SER A OG    1 
ATOM   1276  N  N     . PRO A 1 168 ? 62.067  159.616 51.876  1.00 13.14 ? 168  PRO A N     1 
ATOM   1277  C  CA    . PRO A 1 168 ? 63.420  159.313 51.394  1.00 14.33 ? 168  PRO A CA    1 
ATOM   1278  C  C     . PRO A 1 168 ? 63.831  157.877 51.745  1.00 13.80 ? 168  PRO A C     1 
ATOM   1279  O  O     . PRO A 1 168 ? 64.443  157.181 50.938  1.00 13.96 ? 168  PRO A O     1 
ATOM   1280  C  CB    . PRO A 1 168 ? 64.279  160.353 52.109  1.00 13.22 ? 168  PRO A CB    1 
ATOM   1281  C  CG    . PRO A 1 168 ? 63.368  161.541 52.159  1.00 12.61 ? 168  PRO A CG    1 
ATOM   1282  C  CD    . PRO A 1 168 ? 62.024  160.935 52.539  1.00 14.73 ? 168  PRO A CD    1 
ATOM   1283  N  N     . GLU A 1 169 ? 63.478  157.438 52.950  1.00 14.04 ? 169  GLU A N     1 
ATOM   1284  C  CA    . GLU A 1 169 ? 63.803  156.090 53.410  1.00 15.13 ? 169  GLU A CA    1 
ATOM   1285  C  C     . GLU A 1 169 ? 63.141  155.034 52.518  1.00 15.01 ? 169  GLU A C     1 
ATOM   1286  O  O     . GLU A 1 169 ? 63.772  154.045 52.139  1.00 13.73 ? 169  GLU A O     1 
ATOM   1287  C  CB    . GLU A 1 169 ? 63.337  155.912 54.861  1.00 17.01 ? 169  GLU A CB    1 
ATOM   1288  C  CG    . GLU A 1 169 ? 63.697  154.575 55.509  1.00 20.42 ? 169  GLU A CG    1 
ATOM   1289  C  CD    . GLU A 1 169 ? 65.196  154.374 55.667  1.00 25.00 ? 169  GLU A CD    1 
ATOM   1290  O  OE1   . GLU A 1 169 ? 65.909  155.367 55.925  1.00 26.46 ? 169  GLU A OE1   1 
ATOM   1291  O  OE2   . GLU A 1 169 ? 65.662  153.220 55.550  1.00 29.48 ? 169  GLU A OE2   1 
ATOM   1292  N  N     . ALA A 1 170 ? 61.870  155.250 52.191  1.00 14.27 ? 170  ALA A N     1 
ATOM   1293  C  CA    . ALA A 1 170 ? 61.124  154.323 51.344  1.00 14.00 ? 170  ALA A CA    1 
ATOM   1294  C  C     . ALA A 1 170 ? 61.722  154.315 49.941  1.00 14.61 ? 170  ALA A C     1 
ATOM   1295  O  O     . ALA A 1 170 ? 61.831  153.262 49.307  1.00 15.65 ? 170  ALA A O     1 
ATOM   1296  C  CB    . ALA A 1 170 ? 59.649  154.729 51.294  1.00 15.29 ? 170  ALA A CB    1 
ATOM   1297  N  N     . VAL A 1 171 ? 62.106  155.495 49.460  1.00 13.11 ? 171  VAL A N     1 
ATOM   1298  C  CA    . VAL A 1 171 ? 62.718  155.618 48.141  1.00 13.52 ? 171  VAL A CA    1 
ATOM   1299  C  C     . VAL A 1 171 ? 64.022  154.821 48.124  1.00 14.01 ? 171  VAL A C     1 
ATOM   1300  O  O     . VAL A 1 171 ? 64.286  154.072 47.185  1.00 13.61 ? 171  VAL A O     1 
ATOM   1301  C  CB    . VAL A 1 171 ? 63.021  157.098 47.794  1.00 13.36 ? 171  VAL A CB    1 
ATOM   1302  C  CG1   . VAL A 1 171 ? 63.884  157.178 46.548  1.00 14.52 ? 171  VAL A CG1   1 
ATOM   1303  C  CG2   . VAL A 1 171 ? 61.712  157.863 47.575  1.00 14.11 ? 171  VAL A CG2   1 
ATOM   1304  N  N     . ALA A 1 172 ? 64.830  154.970 49.173  1.00 13.37 ? 172  ALA A N     1 
ATOM   1305  C  CA    . ALA A 1 172 ? 66.096  154.247 49.252  1.00 13.82 ? 172  ALA A CA    1 
ATOM   1306  C  C     . ALA A 1 172 ? 65.834  152.749 49.224  1.00 15.14 ? 172  ALA A C     1 
ATOM   1307  O  O     . ALA A 1 172 ? 66.564  151.998 48.584  1.00 14.81 ? 172  ALA A O     1 
ATOM   1308  C  CB    . ALA A 1 172 ? 66.847  154.618 50.524  1.00 14.73 ? 172  ALA A CB    1 
ATOM   1309  N  N     . GLY A 1 173 ? 64.788  152.323 49.928  1.00 15.29 ? 173  GLY A N     1 
ATOM   1310  C  CA    . GLY A 1 173 ? 64.439  150.912 49.966  1.00 16.10 ? 173  GLY A CA    1 
ATOM   1311  C  C     . GLY A 1 173 ? 64.192  150.322 48.587  1.00 15.00 ? 173  GLY A C     1 
ATOM   1312  O  O     . GLY A 1 173 ? 64.633  149.204 48.308  1.00 14.81 ? 173  GLY A O     1 
ATOM   1313  N  N     . CYS A 1 174 ? 63.484  151.059 47.732  1.00 13.13 ? 174  CYS A N     1 
ATOM   1314  C  CA    . CYS A 1 174 ? 63.186  150.600 46.374  1.00 13.88 ? 174  CYS A CA    1 
ATOM   1315  C  C     . CYS A 1 174 ? 64.450  150.561 45.523  1.00 13.98 ? 174  CYS A C     1 
ATOM   1316  O  O     . CYS A 1 174 ? 64.692  149.594 44.796  1.00 16.11 ? 174  CYS A O     1 
ATOM   1317  C  CB    . CYS A 1 174 ? 62.162  151.526 45.703  1.00 14.69 ? 174  CYS A CB    1 
ATOM   1318  S  SG    . CYS A 1 174 ? 60.540  151.568 46.514  1.00 17.68 ? 174  CYS A SG    1 
ATOM   1319  N  N     . ILE A 1 175 ? 65.253  151.616 45.617  1.00 13.73 ? 175  ILE A N     1 
ATOM   1320  C  CA    . ILE A 1 175 ? 66.492  151.708 44.853  1.00 15.17 ? 175  ILE A CA    1 
ATOM   1321  C  C     . ILE A 1 175 ? 67.480  150.607 45.226  1.00 16.25 ? 175  ILE A C     1 
ATOM   1322  O  O     . ILE A 1 175 ? 68.115  150.011 44.356  1.00 18.01 ? 175  ILE A O     1 
ATOM   1323  C  CB    . ILE A 1 175 ? 67.159  153.079 45.054  1.00 15.06 ? 175  ILE A CB    1 
ATOM   1324  C  CG1   . ILE A 1 175 ? 66.289  154.167 44.419  1.00 15.47 ? 175  ILE A CG1   1 
ATOM   1325  C  CG2   . ILE A 1 175 ? 68.556  153.076 44.458  1.00 14.57 ? 175  ILE A CG2   1 
ATOM   1326  C  CD1   . ILE A 1 175 ? 66.791  155.569 44.646  1.00 16.33 ? 175  ILE A CD1   1 
ATOM   1327  N  N     . ILE A 1 176 ? 67.609  150.342 46.520  1.00 17.10 ? 176  ILE A N     1 
ATOM   1328  C  CA    . ILE A 1 176 ? 68.516  149.300 46.992  1.00 18.44 ? 176  ILE A CA    1 
ATOM   1329  C  C     . ILE A 1 176 ? 68.095  147.939 46.444  1.00 17.59 ? 176  ILE A C     1 
ATOM   1330  O  O     . ILE A 1 176 ? 68.921  147.173 45.945  1.00 17.96 ? 176  ILE A O     1 
ATOM   1331  C  CB    . ILE A 1 176 ? 68.529  149.236 48.542  1.00 18.53 ? 176  ILE A CB    1 
ATOM   1332  C  CG1   . ILE A 1 176 ? 69.185  150.498 49.106  1.00 20.24 ? 176  ILE A CG1   1 
ATOM   1333  C  CG2   . ILE A 1 176 ? 69.277  147.989 49.016  1.00 19.91 ? 176  ILE A CG2   1 
ATOM   1334  C  CD1   . ILE A 1 176 ? 68.956  150.695 50.593  1.00 21.23 ? 176  ILE A CD1   1 
ATOM   1335  N  N     . ASP A 1 177 ? 66.805  147.647 46.525  1.00 16.46 ? 177  ASP A N     1 
ATOM   1336  C  CA    . ASP A 1 177 ? 66.292  146.369 46.052  1.00 17.68 ? 177  ASP A CA    1 
ATOM   1337  C  C     . ASP A 1 177 ? 66.439  146.162 44.543  1.00 18.82 ? 177  ASP A C     1 
ATOM   1338  O  O     . ASP A 1 177 ? 66.805  145.075 44.097  1.00 19.16 ? 177  ASP A O     1 
ATOM   1339  C  CB    . ASP A 1 177 ? 64.821  146.218 46.454  1.00 17.46 ? 177  ASP A CB    1 
ATOM   1340  C  CG    . ASP A 1 177 ? 64.266  144.846 46.123  1.00 18.79 ? 177  ASP A CG    1 
ATOM   1341  O  OD1   . ASP A 1 177 ? 63.492  144.725 45.152  1.00 18.29 ? 177  ASP A OD1   1 
ATOM   1342  O  OD2   . ASP A 1 177 ? 64.616  143.881 46.835  1.00 18.84 ? 177  ASP A OD2   1 
ATOM   1343  N  N     . SER A 1 178 ? 66.167  147.205 43.764  1.00 18.14 ? 178  SER A N     1 
ATOM   1344  C  CA    . SER A 1 178 ? 66.242  147.112 42.309  1.00 19.02 ? 178  SER A CA    1 
ATOM   1345  C  C     . SER A 1 178 ? 67.609  147.454 41.730  1.00 20.24 ? 178  SER A C     1 
ATOM   1346  O  O     . SER A 1 178 ? 67.860  147.215 40.547  1.00 19.33 ? 178  SER A O     1 
ATOM   1347  C  CB    . SER A 1 178 ? 65.208  148.042 41.672  1.00 18.99 ? 178  SER A CB    1 
ATOM   1348  O  OG    . SER A 1 178 ? 65.577  149.396 41.874  1.00 19.91 ? 178  SER A OG    1 
ATOM   1349  N  N     . SER A 1 179 ? 68.484  148.015 42.559  1.00 21.30 ? 179  SER A N     1 
ATOM   1350  C  CA    . SER A 1 179 ? 69.809  148.419 42.107  1.00 21.90 ? 179  SER A CA    1 
ATOM   1351  C  C     . SER A 1 179 ? 69.675  149.362 40.910  1.00 22.70 ? 179  SER A C     1 
ATOM   1352  O  O     . SER A 1 179 ? 70.410  149.251 39.927  1.00 23.41 ? 179  SER A O     1 
ATOM   1353  C  CB    . SER A 1 179 ? 70.650  147.194 41.726  1.00 22.34 ? 179  SER A CB    1 
ATOM   1354  O  OG    . SER A 1 179 ? 71.023  146.456 42.878  1.00 20.38 ? 179  SER A OG    1 
ATOM   1355  N  N     . SER A 1 180 ? 68.728  150.290 41.001  1.00 20.32 ? 180  SER A N     1 
ATOM   1356  C  CA    . SER A 1 180 ? 68.507  151.257 39.936  1.00 20.39 ? 180  SER A CA    1 
ATOM   1357  C  C     . SER A 1 180 ? 69.801  152.035 39.703  1.00 20.64 ? 180  SER A C     1 
ATOM   1358  O  O     . SER A 1 180 ? 70.461  152.453 40.655  1.00 16.82 ? 180  SER A O     1 
ATOM   1359  C  CB    . SER A 1 180 ? 67.387  152.232 40.320  1.00 20.26 ? 180  SER A CB    1 
ATOM   1360  O  OG    . SER A 1 180 ? 66.154  151.565 40.552  1.00 22.91 ? 180  SER A OG    1 
ATOM   1361  N  N     . ARG A 1 181 ? 70.157  152.230 38.436  1.00 20.43 ? 181  ARG A N     1 
ATOM   1362  C  CA    . ARG A 1 181 ? 71.374  152.952 38.085  1.00 20.45 ? 181  ARG A CA    1 
ATOM   1363  C  C     . ARG A 1 181 ? 71.095  154.429 37.868  1.00 19.41 ? 181  ARG A C     1 
ATOM   1364  O  O     . ARG A 1 181 ? 72.013  155.247 37.803  1.00 18.63 ? 181  ARG A O     1 
ATOM   1365  C  CB    . ARG A 1 181 ? 71.966  152.413 36.783  1.00 25.58 ? 181  ARG A CB    1 
ATOM   1366  C  CG    . ARG A 1 181 ? 72.313  150.942 36.754  1.00 29.33 ? 181  ARG A CG    1 
ATOM   1367  C  CD    . ARG A 1 181 ? 72.963  150.633 35.411  1.00 29.82 ? 181  ARG A CD    1 
ATOM   1368  N  NE    . ARG A 1 181 ? 74.176  151.425 35.220  1.00 31.34 ? 181  ARG A NE    1 
ATOM   1369  C  CZ    . ARG A 1 181 ? 74.646  151.809 34.037  1.00 32.72 ? 181  ARG A CZ    1 
ATOM   1370  N  NH1   . ARG A 1 181 ? 74.003  151.479 32.925  1.00 33.15 ? 181  ARG A NH1   1 
ATOM   1371  N  NH2   . ARG A 1 181 ? 75.761  152.523 33.966  1.00 32.53 ? 181  ARG A NH2   1 
ATOM   1372  N  N     . LEU A 1 182 ? 69.818  154.765 37.748  1.00 16.24 ? 182  LEU A N     1 
ATOM   1373  C  CA    . LEU A 1 182 ? 69.426  156.130 37.476  1.00 14.48 ? 182  LEU A CA    1 
ATOM   1374  C  C     . LEU A 1 182 ? 68.122  156.496 38.151  1.00 14.36 ? 182  LEU A C     1 
ATOM   1375  O  O     . LEU A 1 182 ? 67.226  155.663 38.277  1.00 12.95 ? 182  LEU A O     1 
ATOM   1376  C  CB    . LEU A 1 182 ? 69.257  156.306 35.966  1.00 13.84 ? 182  LEU A CB    1 
ATOM   1377  C  CG    . LEU A 1 182 ? 68.572  157.569 35.457  1.00 13.89 ? 182  LEU A CG    1 
ATOM   1378  C  CD1   . LEU A 1 182 ? 69.475  158.767 35.675  1.00 15.56 ? 182  LEU A CD1   1 
ATOM   1379  C  CD2   . LEU A 1 182 ? 68.251  157.409 33.973  1.00 15.48 ? 182  LEU A CD2   1 
ATOM   1380  N  N     . VAL A 1 183 ? 68.024  157.745 38.584  1.00 14.22 ? 183  VAL A N     1 
ATOM   1381  C  CA    . VAL A 1 183 ? 66.797  158.237 39.194  1.00 13.96 ? 183  VAL A CA    1 
ATOM   1382  C  C     . VAL A 1 183 ? 66.349  159.437 38.373  1.00 13.16 ? 183  VAL A C     1 
ATOM   1383  O  O     . VAL A 1 183 ? 67.146  160.337 38.091  1.00 14.72 ? 183  VAL A O     1 
ATOM   1384  C  CB    . VAL A 1 183 ? 67.005  158.694 40.654  1.00 14.07 ? 183  VAL A CB    1 
ATOM   1385  C  CG1   . VAL A 1 183 ? 65.680  159.219 41.220  1.00 15.10 ? 183  VAL A CG1   1 
ATOM   1386  C  CG2   . VAL A 1 183 ? 67.522  157.537 41.499  1.00 14.40 ? 183  VAL A CG2   1 
ATOM   1387  N  N     . ILE A 1 184 ? 65.080  159.434 37.971  1.00 12.73 ? 184  ILE A N     1 
ATOM   1388  C  CA    . ILE A 1 184 ? 64.508  160.530 37.200  1.00 11.40 ? 184  ILE A CA    1 
ATOM   1389  C  C     . ILE A 1 184 ? 63.465  161.174 38.103  1.00 11.47 ? 184  ILE A C     1 
ATOM   1390  O  O     . ILE A 1 184 ? 62.512  160.518 38.521  1.00 12.92 ? 184  ILE A O     1 
ATOM   1391  C  CB    . ILE A 1 184 ? 63.837  160.020 35.911  1.00 11.66 ? 184  ILE A CB    1 
ATOM   1392  C  CG1   . ILE A 1 184 ? 64.889  159.340 35.025  1.00 13.06 ? 184  ILE A CG1   1 
ATOM   1393  C  CG2   . ILE A 1 184 ? 63.181  161.180 35.167  1.00 12.52 ? 184  ILE A CG2   1 
ATOM   1394  C  CD1   . ILE A 1 184 ? 64.349  158.806 33.711  1.00 13.23 ? 184  ILE A CD1   1 
ATOM   1395  N  N     . THR A 1 185 ? 63.650  162.452 38.403  1.00 11.55 ? 185  THR A N     1 
ATOM   1396  C  CA    . THR A 1 185 ? 62.737  163.150 39.299  1.00 12.13 ? 185  THR A CA    1 
ATOM   1397  C  C     . THR A 1 185 ? 62.543  164.611 38.885  1.00 12.65 ? 185  THR A C     1 
ATOM   1398  O  O     . THR A 1 185 ? 62.933  165.016 37.787  1.00 13.37 ? 185  THR A O     1 
ATOM   1399  C  CB    . THR A 1 185 ? 63.284  163.078 40.756  1.00 12.78 ? 185  THR A CB    1 
ATOM   1400  O  OG1   . THR A 1 185 ? 62.287  163.527 41.679  1.00 12.74 ? 185  THR A OG1   1 
ATOM   1401  C  CG2   . THR A 1 185 ? 64.540  163.957 40.906  1.00 13.22 ? 185  THR A CG2   1 
ATOM   1402  N  N     . ALA A 1 186 ? 61.919  165.396 39.759  1.00 13.20 ? 186  ALA A N     1 
ATOM   1403  C  CA    . ALA A 1 186 ? 61.699  166.816 39.491  1.00 13.00 ? 186  ALA A CA    1 
ATOM   1404  C  C     . ALA A 1 186 ? 62.155  167.590 40.724  1.00 14.24 ? 186  ALA A C     1 
ATOM   1405  O  O     . ALA A 1 186 ? 62.246  167.013 41.812  1.00 13.62 ? 186  ALA A O     1 
ATOM   1406  C  CB    . ALA A 1 186 ? 60.216  167.080 39.215  1.00 12.23 ? 186  ALA A CB    1 
ATOM   1407  N  N     . ASP A 1 187 ? 62.462  168.881 40.576  1.00 13.68 ? 187  ASP A N     1 
ATOM   1408  C  CA    . ASP A 1 187 ? 62.877  169.626 41.756  1.00 15.30 ? 187  ASP A CA    1 
ATOM   1409  C  C     . ASP A 1 187 ? 61.759  169.519 42.786  1.00 15.01 ? 187  ASP A C     1 
ATOM   1410  O  O     . ASP A 1 187 ? 62.001  169.163 43.944  1.00 16.66 ? 187  ASP A O     1 
ATOM   1411  C  CB    . ASP A 1 187 ? 63.217  171.105 41.449  1.00 14.78 ? 187  ASP A CB    1 
ATOM   1412  C  CG    . ASP A 1 187 ? 62.255  171.772 40.470  1.00 14.97 ? 187  ASP A CG    1 
ATOM   1413  O  OD1   . ASP A 1 187 ? 61.092  171.340 40.335  1.00 12.84 ? 187  ASP A OD1   1 
ATOM   1414  O  OD2   . ASP A 1 187 ? 62.679  172.773 39.842  1.00 14.61 ? 187  ASP A OD2   1 
ATOM   1415  N  N     . GLU A 1 188 ? 60.533  169.789 42.352  1.00 14.85 ? 188  GLU A N     1 
ATOM   1416  C  CA    . GLU A 1 188 ? 59.375  169.683 43.232  1.00 15.53 ? 188  GLU A CA    1 
ATOM   1417  C  C     . GLU A 1 188 ? 58.126  169.349 42.433  1.00 15.04 ? 188  GLU A C     1 
ATOM   1418  O  O     . GLU A 1 188 ? 58.056  169.597 41.228  1.00 14.50 ? 188  GLU A O     1 
ATOM   1419  C  CB    . GLU A 1 188 ? 59.109  171.002 43.970  1.00 15.44 ? 188  GLU A CB    1 
ATOM   1420  C  CG    . GLU A 1 188 ? 60.237  171.517 44.841  1.00 17.61 ? 188  GLU A CG    1 
ATOM   1421  C  CD    . GLU A 1 188 ? 59.868  172.820 45.527  1.00 20.09 ? 188  GLU A CD    1 
ATOM   1422  O  OE1   . GLU A 1 188 ? 59.370  173.730 44.835  1.00 18.72 ? 188  GLU A OE1   1 
ATOM   1423  O  OE2   . GLU A 1 188 ? 60.076  172.935 46.753  1.00 19.64 ? 188  GLU A OE2   1 
ATOM   1424  N  N     . GLY A 1 189 ? 57.141  168.785 43.122  1.00 15.66 ? 189  GLY A N     1 
ATOM   1425  C  CA    . GLY A 1 189 ? 55.870  168.483 42.498  1.00 15.09 ? 189  GLY A CA    1 
ATOM   1426  C  C     . GLY A 1 189 ? 54.917  169.561 42.989  1.00 16.59 ? 189  GLY A C     1 
ATOM   1427  O  O     . GLY A 1 189 ? 55.189  170.211 44.002  1.00 17.74 ? 189  GLY A O     1 
ATOM   1428  N  N     . VAL A 1 190 ? 53.814  169.767 42.280  1.00 14.26 ? 190  VAL A N     1 
ATOM   1429  C  CA    . VAL A 1 190 ? 52.832  170.775 42.667  1.00 15.49 ? 190  VAL A CA    1 
ATOM   1430  C  C     . VAL A 1 190 ? 51.502  170.071 42.904  1.00 16.72 ? 190  VAL A C     1 
ATOM   1431  O  O     . VAL A 1 190 ? 51.003  169.365 42.022  1.00 16.84 ? 190  VAL A O     1 
ATOM   1432  C  CB    . VAL A 1 190 ? 52.663  171.835 41.558  1.00 15.31 ? 190  VAL A CB    1 
ATOM   1433  C  CG1   . VAL A 1 190 ? 51.660  172.890 41.990  1.00 16.60 ? 190  VAL A CG1   1 
ATOM   1434  C  CG2   . VAL A 1 190 ? 54.017  172.472 41.248  1.00 16.66 ? 190  VAL A CG2   1 
ATOM   1435  N  N     . ARG A 1 191 ? 50.925  170.268 44.087  1.00 15.94 ? 191  ARG A N     1 
ATOM   1436  C  CA    . ARG A 1 191 ? 49.665  169.608 44.435  1.00 15.78 ? 191  ARG A CA    1 
ATOM   1437  C  C     . ARG A 1 191 ? 48.830  170.425 45.410  1.00 16.90 ? 191  ARG A C     1 
ATOM   1438  O  O     . ARG A 1 191 ? 49.278  170.717 46.517  1.00 18.78 ? 191  ARG A O     1 
ATOM   1439  C  CB    . ARG A 1 191 ? 49.972  168.241 45.049  1.00 15.23 ? 191  ARG A CB    1 
ATOM   1440  C  CG    . ARG A 1 191 ? 48.758  167.422 45.485  1.00 15.92 ? 191  ARG A CG    1 
ATOM   1441  C  CD    . ARG A 1 191 ? 49.206  166.030 45.920  1.00 15.91 ? 191  ARG A CD    1 
ATOM   1442  N  NE    . ARG A 1 191 ? 48.097  165.173 46.330  1.00 17.79 ? 191  ARG A NE    1 
ATOM   1443  C  CZ    . ARG A 1 191 ? 47.465  165.260 47.497  1.00 23.19 ? 191  ARG A CZ    1 
ATOM   1444  N  NH1   . ARG A 1 191 ? 47.827  166.172 48.394  1.00 24.87 ? 191  ARG A NH1   1 
ATOM   1445  N  NH2   . ARG A 1 191 ? 46.469  164.426 47.770  1.00 23.01 ? 191  ARG A NH2   1 
ATOM   1446  N  N     . ALA A 1 192 ? 47.614  170.774 45.000  1.00 18.01 ? 192  ALA A N     1 
ATOM   1447  C  CA    . ALA A 1 192 ? 46.710  171.560 45.837  1.00 19.91 ? 192  ALA A CA    1 
ATOM   1448  C  C     . ALA A 1 192 ? 47.335  172.900 46.226  1.00 21.92 ? 192  ALA A C     1 
ATOM   1449  O  O     . ALA A 1 192 ? 47.187  173.362 47.359  1.00 21.16 ? 192  ALA A O     1 
ATOM   1450  C  CB    . ALA A 1 192 ? 46.333  170.770 47.093  1.00 20.05 ? 192  ALA A CB    1 
ATOM   1451  N  N     . GLY A 1 193 ? 48.037  173.517 45.281  1.00 21.46 ? 193  GLY A N     1 
ATOM   1452  C  CA    . GLY A 1 193 ? 48.665  174.802 45.540  1.00 23.68 ? 193  GLY A CA    1 
ATOM   1453  C  C     . GLY A 1 193 ? 49.965  174.729 46.320  1.00 24.88 ? 193  GLY A C     1 
ATOM   1454  O  O     . GLY A 1 193 ? 50.637  175.744 46.512  1.00 26.92 ? 193  GLY A O     1 
ATOM   1455  N  N     . ARG A 1 194 ? 50.329  173.532 46.768  1.00 25.81 ? 194  ARG A N     1 
ATOM   1456  C  CA    . ARG A 1 194 ? 51.559  173.350 47.534  1.00 26.74 ? 194  ARG A CA    1 
ATOM   1457  C  C     . ARG A 1 194 ? 52.679  172.727 46.705  1.00 25.60 ? 194  ARG A C     1 
ATOM   1458  O  O     . ARG A 1 194 ? 52.430  172.011 45.735  1.00 23.50 ? 194  ARG A O     1 
ATOM   1459  C  CB    . ARG A 1 194 ? 51.305  172.448 48.744  1.00 28.76 ? 194  ARG A CB    1 
ATOM   1460  C  CG    . ARG A 1 194 ? 50.472  173.040 49.871  1.00 33.96 ? 194  ARG A CG    1 
ATOM   1461  C  CD    . ARG A 1 194 ? 50.203  171.950 50.903  1.00 37.20 ? 194  ARG A CD    1 
ATOM   1462  N  NE    . ARG A 1 194 ? 50.251  172.426 52.283  1.00 42.86 ? 194  ARG A NE    1 
ATOM   1463  C  CZ    . ARG A 1 194 ? 49.278  173.100 52.887  1.00 44.80 ? 194  ARG A CZ    1 
ATOM   1464  N  NH1   . ARG A 1 194 ? 48.159  173.388 52.235  1.00 46.94 ? 194  ARG A NH1   1 
ATOM   1465  N  NH2   . ARG A 1 194 ? 49.423  173.482 54.150  1.00 45.92 ? 194  ARG A NH2   1 
ATOM   1466  N  N     . SER A 1 195 ? 53.916  173.003 47.096  1.00 25.57 ? 195  SER A N     1 
ATOM   1467  C  CA    . SER A 1 195 ? 55.066  172.428 46.415  1.00 27.31 ? 195  SER A CA    1 
ATOM   1468  C  C     . SER A 1 195 ? 55.524  171.249 47.262  1.00 26.74 ? 195  SER A C     1 
ATOM   1469  O  O     . SER A 1 195 ? 55.703  171.378 48.472  1.00 29.71 ? 195  SER A O     1 
ATOM   1470  C  CB    . SER A 1 195 ? 56.197  173.456 46.286  1.00 27.87 ? 195  SER A CB    1 
ATOM   1471  O  OG    . SER A 1 195 ? 55.852  174.481 45.369  1.00 32.07 ? 195  SER A OG    1 
ATOM   1472  N  N     . ILE A 1 196 ? 55.694  170.095 46.631  1.00 24.87 ? 196  ILE A N     1 
ATOM   1473  C  CA    . ILE A 1 196 ? 56.131  168.909 47.346  1.00 24.79 ? 196  ILE A CA    1 
ATOM   1474  C  C     . ILE A 1 196 ? 57.577  168.633 46.993  1.00 23.78 ? 196  ILE A C     1 
ATOM   1475  O  O     . ILE A 1 196 ? 57.935  168.522 45.820  1.00 20.63 ? 196  ILE A O     1 
ATOM   1476  C  CB    . ILE A 1 196 ? 55.286  167.669 46.972  1.00 27.68 ? 196  ILE A CB    1 
ATOM   1477  C  CG1   . ILE A 1 196 ? 53.811  167.915 47.308  1.00 30.46 ? 196  ILE A CG1   1 
ATOM   1478  C  CG2   . ILE A 1 196 ? 55.815  166.441 47.701  1.00 29.08 ? 196  ILE A CG2   1 
ATOM   1479  C  CD1   . ILE A 1 196 ? 53.545  168.241 48.769  1.00 33.95 ? 196  ILE A CD1   1 
ATOM   1480  N  N     . PRO A 1 197 ? 58.439  168.523 48.007  1.00 23.99 ? 197  PRO A N     1 
ATOM   1481  C  CA    . PRO A 1 197 ? 59.829  168.256 47.657  1.00 22.66 ? 197  PRO A CA    1 
ATOM   1482  C  C     . PRO A 1 197 ? 59.943  166.863 47.053  1.00 23.06 ? 197  PRO A C     1 
ATOM   1483  O  O     . PRO A 1 197 ? 59.244  165.935 47.470  1.00 22.70 ? 197  PRO A O     1 
ATOM   1484  C  CB    . PRO A 1 197 ? 60.544  168.374 49.000  1.00 24.82 ? 197  PRO A CB    1 
ATOM   1485  C  CG    . PRO A 1 197 ? 59.516  167.824 49.959  1.00 25.83 ? 197  PRO A CG    1 
ATOM   1486  C  CD    . PRO A 1 197 ? 58.237  168.488 49.468  1.00 24.52 ? 197  PRO A CD    1 
ATOM   1487  N  N     . LEU A 1 198 ? 60.779  166.736 46.033  1.00 17.69 ? 198  LEU A N     1 
ATOM   1488  C  CA    . LEU A 1 198 ? 61.022  165.442 45.413  1.00 15.92 ? 198  LEU A CA    1 
ATOM   1489  C  C     . LEU A 1 198 ? 62.535  165.290 45.294  1.00 14.27 ? 198  LEU A C     1 
ATOM   1490  O  O     . LEU A 1 198 ? 63.103  164.314 45.789  1.00 13.81 ? 198  LEU A O     1 
ATOM   1491  C  CB    . LEU A 1 198 ? 60.347  165.345 44.035  1.00 13.56 ? 198  LEU A CB    1 
ATOM   1492  C  CG    . LEU A 1 198 ? 58.820  165.199 44.062  1.00 14.82 ? 198  LEU A CG    1 
ATOM   1493  C  CD1   . LEU A 1 198 ? 58.272  165.207 42.634  1.00 14.73 ? 198  LEU A CD1   1 
ATOM   1494  C  CD2   . LEU A 1 198 ? 58.430  163.900 44.785  1.00 14.14 ? 198  LEU A CD2   1 
ATOM   1495  N  N     . LYS A 1 199 ? 63.187  166.269 44.668  1.00 14.23 ? 199  LYS A N     1 
ATOM   1496  C  CA    . LYS A 1 199 ? 64.644  166.227 44.499  1.00 16.84 ? 199  LYS A CA    1 
ATOM   1497  C  C     . LYS A 1 199 ? 65.353  166.124 45.851  1.00 14.66 ? 199  LYS A C     1 
ATOM   1498  O  O     . LYS A 1 199 ? 66.275  165.325 46.017  1.00 15.22 ? 199  LYS A O     1 
ATOM   1499  C  CB    . LYS A 1 199 ? 65.134  167.468 43.738  1.00 16.81 ? 199  LYS A CB    1 
ATOM   1500  C  CG    . LYS A 1 199 ? 66.660  167.694 43.731  1.00 23.43 ? 199  LYS A CG    1 
ATOM   1501  C  CD    . LYS A 1 199 ? 67.427  166.571 43.062  1.00 23.98 ? 199  LYS A CD    1 
ATOM   1502  C  CE    . LYS A 1 199 ? 68.864  166.981 42.701  1.00 20.62 ? 199  LYS A CE    1 
ATOM   1503  N  NZ    . LYS A 1 199 ? 69.767  167.303 43.849  1.00 21.89 ? 199  LYS A NZ    1 
ATOM   1504  N  N     . LYS A 1 200 ? 64.917  166.922 46.820  1.00 15.94 ? 200  LYS A N     1 
ATOM   1505  C  CA    . LYS A 1 200 ? 65.525  166.885 48.145  1.00 15.88 ? 200  LYS A CA    1 
ATOM   1506  C  C     . LYS A 1 200 ? 65.367  165.495 48.757  1.00 15.69 ? 200  LYS A C     1 
ATOM   1507  O  O     . LYS A 1 200 ? 66.259  165.007 49.454  1.00 12.83 ? 200  LYS A O     1 
ATOM   1508  C  CB    . LYS A 1 200 ? 64.884  167.925 49.067  1.00 18.51 ? 200  LYS A CB    1 
ATOM   1509  C  CG    . LYS A 1 200 ? 65.546  168.005 50.438  1.00 21.17 ? 200  LYS A CG    1 
ATOM   1510  C  CD    . LYS A 1 200 ? 64.858  169.035 51.326  1.00 24.74 ? 200  LYS A CD    1 
ATOM   1511  C  CE    . LYS A 1 200 ? 65.453  169.052 52.731  1.00 26.66 ? 200  LYS A CE    1 
ATOM   1512  N  NZ    . LYS A 1 200 ? 66.901  169.403 52.725  1.00 27.38 ? 200  LYS A NZ    1 
ATOM   1513  N  N     . ASN A 1 201 ? 64.226  164.862 48.499  1.00 14.01 ? 201  ASN A N     1 
ATOM   1514  C  CA    . ASN A 1 201 ? 63.986  163.525 49.024  1.00 14.36 ? 201  ASN A CA    1 
ATOM   1515  C  C     . ASN A 1 201 ? 64.969  162.541 48.411  1.00 14.54 ? 201  ASN A C     1 
ATOM   1516  O  O     . ASN A 1 201 ? 65.476  161.650 49.098  1.00 12.77 ? 201  ASN A O     1 
ATOM   1517  C  CB    . ASN A 1 201 ? 62.547  163.078 48.740  1.00 14.14 ? 201  ASN A CB    1 
ATOM   1518  C  CG    . ASN A 1 201 ? 61.545  163.717 49.685  1.00 17.49 ? 201  ASN A CG    1 
ATOM   1519  O  OD1   . ASN A 1 201 ? 61.931  164.341 50.676  1.00 16.99 ? 201  ASN A OD1   1 
ATOM   1520  N  ND2   . ASN A 1 201 ? 60.255  163.553 49.394  1.00 15.99 ? 201  ASN A ND2   1 
ATOM   1521  N  N     . VAL A 1 202 ? 65.236  162.706 47.119  1.00 13.85 ? 202  VAL A N     1 
ATOM   1522  C  CA    . VAL A 1 202 ? 66.176  161.837 46.422  1.00 14.59 ? 202  VAL A CA    1 
ATOM   1523  C  C     . VAL A 1 202 ? 67.578  162.037 46.993  1.00 15.77 ? 202  VAL A C     1 
ATOM   1524  O  O     . VAL A 1 202 ? 68.302  161.066 47.222  1.00 14.03 ? 202  VAL A O     1 
ATOM   1525  C  CB    . VAL A 1 202 ? 66.185  162.123 44.897  1.00 15.55 ? 202  VAL A CB    1 
ATOM   1526  C  CG1   . VAL A 1 202 ? 67.276  161.305 44.212  1.00 14.48 ? 202  VAL A CG1   1 
ATOM   1527  C  CG2   . VAL A 1 202 ? 64.821  161.771 44.295  1.00 14.67 ? 202  VAL A CG2   1 
ATOM   1528  N  N     . ASP A 1 203 ? 67.964  163.292 47.224  1.00 16.42 ? 203  ASP A N     1 
ATOM   1529  C  CA    . ASP A 1 203 ? 69.283  163.576 47.794  1.00 16.09 ? 203  ASP A CA    1 
ATOM   1530  C  C     . ASP A 1 203 ? 69.436  162.817 49.105  1.00 16.34 ? 203  ASP A C     1 
ATOM   1531  O  O     . ASP A 1 203 ? 70.453  162.163 49.342  1.00 15.67 ? 203  ASP A O     1 
ATOM   1532  C  CB    . ASP A 1 203 ? 69.469  165.073 48.088  1.00 15.55 ? 203  ASP A CB    1 
ATOM   1533  C  CG    . ASP A 1 203 ? 69.646  165.916 46.833  1.00 17.51 ? 203  ASP A CG    1 
ATOM   1534  O  OD1   . ASP A 1 203 ? 70.004  165.369 45.767  1.00 17.67 ? 203  ASP A OD1   1 
ATOM   1535  O  OD2   . ASP A 1 203 ? 69.439  167.143 46.921  1.00 17.48 ? 203  ASP A OD2   1 
ATOM   1536  N  N     . ASP A 1 204 ? 68.422  162.912 49.960  1.00 14.90 ? 204  ASP A N     1 
ATOM   1537  C  CA    . ASP A 1 204 ? 68.461  162.237 51.253  1.00 15.39 ? 204  ASP A CA    1 
ATOM   1538  C  C     . ASP A 1 204 ? 68.508  160.724 51.115  1.00 15.24 ? 204  ASP A C     1 
ATOM   1539  O  O     . ASP A 1 204 ? 69.218  160.047 51.866  1.00 14.89 ? 204  ASP A O     1 
ATOM   1540  C  CB    . ASP A 1 204 ? 67.257  162.656 52.098  1.00 15.30 ? 204  ASP A CB    1 
ATOM   1541  C  CG    . ASP A 1 204 ? 67.331  164.108 52.520  1.00 19.37 ? 204  ASP A CG    1 
ATOM   1542  O  OD1   . ASP A 1 204 ? 66.335  164.628 53.069  1.00 18.41 ? 204  ASP A OD1   1 
ATOM   1543  O  OD2   . ASP A 1 204 ? 68.396  164.731 52.300  1.00 19.63 ? 204  ASP A OD2   1 
ATOM   1544  N  N     . ALA A 1 205 ? 67.755  160.190 50.157  1.00 14.92 ? 205  ALA A N     1 
ATOM   1545  C  CA    . ALA A 1 205 ? 67.741  158.748 49.936  1.00 15.12 ? 205  ALA A CA    1 
ATOM   1546  C  C     . ALA A 1 205 ? 69.117  158.262 49.490  1.00 16.19 ? 205  ALA A C     1 
ATOM   1547  O  O     . ALA A 1 205 ? 69.582  157.198 49.918  1.00 15.32 ? 205  ALA A O     1 
ATOM   1548  C  CB    . ALA A 1 205 ? 66.698  158.384 48.880  1.00 17.39 ? 205  ALA A CB    1 
ATOM   1549  N  N     . LEU A 1 206 ? 69.774  159.043 48.637  1.00 17.12 ? 206  LEU A N     1 
ATOM   1550  C  CA    . LEU A 1 206 ? 71.083  158.648 48.131  1.00 19.56 ? 206  LEU A CA    1 
ATOM   1551  C  C     . LEU A 1 206 ? 72.192  158.699 49.176  1.00 20.28 ? 206  LEU A C     1 
ATOM   1552  O  O     . LEU A 1 206 ? 73.279  158.168 48.949  1.00 19.60 ? 206  LEU A O     1 
ATOM   1553  C  CB    . LEU A 1 206 ? 71.458  159.488 46.903  1.00 18.80 ? 206  LEU A CB    1 
ATOM   1554  C  CG    . LEU A 1 206 ? 70.482  159.336 45.729  1.00 22.26 ? 206  LEU A CG    1 
ATOM   1555  C  CD1   . LEU A 1 206 ? 71.048  160.014 44.490  1.00 23.32 ? 206  LEU A CD1   1 
ATOM   1556  C  CD2   . LEU A 1 206 ? 70.228  157.862 45.454  1.00 23.32 ? 206  LEU A CD2   1 
ATOM   1557  N  N     . LYS A 1 207 ? 71.920  159.327 50.317  1.00 20.00 ? 207  LYS A N     1 
ATOM   1558  C  CA    . LYS A 1 207 ? 72.909  159.395 51.393  1.00 21.62 ? 207  LYS A CA    1 
ATOM   1559  C  C     . LYS A 1 207 ? 72.946  158.076 52.167  1.00 22.44 ? 207  LYS A C     1 
ATOM   1560  O  O     . LYS A 1 207 ? 73.895  157.802 52.903  1.00 22.72 ? 207  LYS A O     1 
ATOM   1561  C  CB    . LYS A 1 207 ? 72.603  160.562 52.333  1.00 22.12 ? 207  LYS A CB    1 
ATOM   1562  C  CG    . LYS A 1 207 ? 72.857  161.913 51.689  1.00 24.42 ? 207  LYS A CG    1 
ATOM   1563  C  CD    . LYS A 1 207 ? 72.565  163.070 52.626  1.00 24.51 ? 207  LYS A CD    1 
ATOM   1564  C  CE    . LYS A 1 207 ? 72.863  164.394 51.937  1.00 27.16 ? 207  LYS A CE    1 
ATOM   1565  N  NZ    . LYS A 1 207 ? 72.693  165.563 52.844  1.00 30.56 ? 207  LYS A NZ    1 
ATOM   1566  N  N     . ASN A 1 208 ? 71.911  157.257 51.995  1.00 20.98 ? 208  ASN A N     1 
ATOM   1567  C  CA    . ASN A 1 208 ? 71.855  155.953 52.649  1.00 22.65 ? 208  ASN A CA    1 
ATOM   1568  C  C     . ASN A 1 208 ? 73.088  155.180 52.169  1.00 23.72 ? 208  ASN A C     1 
ATOM   1569  O  O     . ASN A 1 208 ? 73.294  155.005 50.969  1.00 21.73 ? 208  ASN A O     1 
ATOM   1570  C  CB    . ASN A 1 208 ? 70.575  155.216 52.239  1.00 22.58 ? 208  ASN A CB    1 
ATOM   1571  C  CG    . ASN A 1 208 ? 70.391  153.898 52.975  1.00 24.92 ? 208  ASN A CG    1 
ATOM   1572  O  OD1   . ASN A 1 208 ? 71.240  153.007 52.908  1.00 24.85 ? 208  ASN A OD1   1 
ATOM   1573  N  ND2   . ASN A 1 208 ? 69.273  153.769 53.681  1.00 22.58 ? 208  ASN A ND2   1 
ATOM   1574  N  N     . PRO A 1 209 ? 73.928  154.706 53.102  1.00 25.62 ? 209  PRO A N     1 
ATOM   1575  C  CA    . PRO A 1 209 ? 75.133  153.964 52.714  1.00 26.33 ? 209  PRO A CA    1 
ATOM   1576  C  C     . PRO A 1 209 ? 74.894  152.683 51.912  1.00 26.07 ? 209  PRO A C     1 
ATOM   1577  O  O     . PRO A 1 209 ? 75.810  152.165 51.275  1.00 27.01 ? 209  PRO A O     1 
ATOM   1578  C  CB    . PRO A 1 209 ? 75.817  153.702 54.055  1.00 27.21 ? 209  PRO A CB    1 
ATOM   1579  C  CG    . PRO A 1 209 ? 74.660  153.584 55.001  1.00 26.23 ? 209  PRO A CG    1 
ATOM   1580  C  CD    . PRO A 1 209 ? 73.776  154.734 54.568  1.00 26.14 ? 209  PRO A CD    1 
ATOM   1581  N  N     . ASN A 1 210 ? 73.666  152.178 51.925  1.00 25.62 ? 210  ASN A N     1 
ATOM   1582  C  CA    . ASN A 1 210 ? 73.367  150.959 51.188  1.00 26.18 ? 210  ASN A CA    1 
ATOM   1583  C  C     . ASN A 1 210 ? 73.011  151.204 49.720  1.00 24.95 ? 210  ASN A C     1 
ATOM   1584  O  O     . ASN A 1 210 ? 72.954  150.265 48.926  1.00 23.53 ? 210  ASN A O     1 
ATOM   1585  C  CB    . ASN A 1 210 ? 72.265  150.177 51.902  1.00 28.01 ? 210  ASN A CB    1 
ATOM   1586  C  CG    . ASN A 1 210 ? 72.706  149.685 53.270  1.00 31.38 ? 210  ASN A CG    1 
ATOM   1587  O  OD1   . ASN A 1 210 ? 73.662  148.919 53.385  1.00 32.33 ? 210  ASN A OD1   1 
ATOM   1588  N  ND2   . ASN A 1 210 ? 72.020  150.134 54.313  1.00 33.06 ? 210  ASN A ND2   1 
ATOM   1589  N  N     . VAL A 1 211 ? 72.779  152.465 49.361  1.00 23.33 ? 211  VAL A N     1 
ATOM   1590  C  CA    . VAL A 1 211 ? 72.478  152.809 47.973  1.00 22.03 ? 211  VAL A CA    1 
ATOM   1591  C  C     . VAL A 1 211 ? 73.827  152.941 47.268  1.00 22.85 ? 211  VAL A C     1 
ATOM   1592  O  O     . VAL A 1 211 ? 74.603  153.848 47.572  1.00 24.03 ? 211  VAL A O     1 
ATOM   1593  C  CB    . VAL A 1 211 ? 71.723  154.149 47.867  1.00 21.38 ? 211  VAL A CB    1 
ATOM   1594  C  CG1   . VAL A 1 211 ? 71.567  154.537 46.405  1.00 20.20 ? 211  VAL A CG1   1 
ATOM   1595  C  CG2   . VAL A 1 211 ? 70.357  154.036 48.539  1.00 21.21 ? 211  VAL A CG2   1 
ATOM   1596  N  N     . THR A 1 212 ? 74.102  152.041 46.327  1.00 23.46 ? 212  THR A N     1 
ATOM   1597  C  CA    . THR A 1 212 ? 75.379  152.043 45.618  1.00 25.51 ? 212  THR A CA    1 
ATOM   1598  C  C     . THR A 1 212 ? 75.255  151.993 44.098  1.00 26.40 ? 212  THR A C     1 
ATOM   1599  O  O     . THR A 1 212 ? 76.240  152.175 43.380  1.00 26.90 ? 212  THR A O     1 
ATOM   1600  C  CB    . THR A 1 212 ? 76.234  150.830 46.047  1.00 27.01 ? 212  THR A CB    1 
ATOM   1601  O  OG1   . THR A 1 212 ? 75.578  149.621 45.640  1.00 27.31 ? 212  THR A OG1   1 
ATOM   1602  C  CG2   . THR A 1 212 ? 76.406  150.801 47.558  1.00 27.33 ? 212  THR A CG2   1 
ATOM   1603  N  N     . SER A 1 213 ? 74.046  151.758 43.607  1.00 24.61 ? 213  SER A N     1 
ATOM   1604  C  CA    . SER A 1 213 ? 73.824  151.631 42.174  1.00 22.71 ? 213  SER A CA    1 
ATOM   1605  C  C     . SER A 1 213 ? 73.586  152.911 41.385  1.00 21.64 ? 213  SER A C     1 
ATOM   1606  O  O     . SER A 1 213 ? 73.868  152.960 40.190  1.00 21.83 ? 213  SER A O     1 
ATOM   1607  C  CB    . SER A 1 213 ? 72.655  150.682 41.937  1.00 23.24 ? 213  SER A CB    1 
ATOM   1608  O  OG    . SER A 1 213 ? 71.507  151.130 42.638  1.00 21.91 ? 213  SER A OG    1 
ATOM   1609  N  N     . VAL A 1 214 ? 73.075  153.943 42.043  1.00 20.01 ? 214  VAL A N     1 
ATOM   1610  C  CA    . VAL A 1 214 ? 72.765  155.201 41.368  1.00 19.62 ? 214  VAL A CA    1 
ATOM   1611  C  C     . VAL A 1 214 ? 73.978  156.029 40.949  1.00 20.34 ? 214  VAL A C     1 
ATOM   1612  O  O     . VAL A 1 214 ? 74.783  156.435 41.782  1.00 22.32 ? 214  VAL A O     1 
ATOM   1613  C  CB    . VAL A 1 214 ? 71.845  156.071 42.246  1.00 17.90 ? 214  VAL A CB    1 
ATOM   1614  C  CG1   . VAL A 1 214 ? 71.500  157.367 41.523  1.00 16.75 ? 214  VAL A CG1   1 
ATOM   1615  C  CG2   . VAL A 1 214 ? 70.583  155.296 42.584  1.00 15.09 ? 214  VAL A CG2   1 
ATOM   1616  N  N     . GLU A 1 215 ? 74.084  156.291 39.648  1.00 19.22 ? 215  GLU A N     1 
ATOM   1617  C  CA    . GLU A 1 215 ? 75.195  157.068 39.108  1.00 19.77 ? 215  GLU A CA    1 
ATOM   1618  C  C     . GLU A 1 215 ? 74.769  158.467 38.657  1.00 18.16 ? 215  GLU A C     1 
ATOM   1619  O  O     . GLU A 1 215 ? 75.582  159.396 38.626  1.00 19.07 ? 215  GLU A O     1 
ATOM   1620  C  CB    . GLU A 1 215 ? 75.845  156.293 37.953  1.00 18.36 ? 215  GLU A CB    1 
ATOM   1621  C  CG    . GLU A 1 215 ? 76.439  154.962 38.414  1.00 20.99 ? 215  GLU A CG    1 
ATOM   1622  C  CD    . GLU A 1 215 ? 76.978  154.106 37.281  1.00 21.69 ? 215  GLU A CD    1 
ATOM   1623  O  OE1   . GLU A 1 215 ? 77.493  153.007 37.571  1.00 25.51 ? 215  GLU A OE1   1 
ATOM   1624  O  OE2   . GLU A 1 215 ? 76.891  154.523 36.111  1.00 23.28 ? 215  GLU A OE2   1 
ATOM   1625  N  N     . HIS A 1 216 ? 73.492  158.628 38.323  1.00 17.32 ? 216  HIS A N     1 
ATOM   1626  C  CA    . HIS A 1 216 ? 72.987  159.926 37.891  1.00 14.81 ? 216  HIS A CA    1 
ATOM   1627  C  C     . HIS A 1 216 ? 71.554  160.176 38.341  1.00 15.84 ? 216  HIS A C     1 
ATOM   1628  O  O     . HIS A 1 216 ? 70.802  159.242 38.622  1.00 14.65 ? 216  HIS A O     1 
ATOM   1629  C  CB    . HIS A 1 216 ? 73.041  160.046 36.365  1.00 16.56 ? 216  HIS A CB    1 
ATOM   1630  C  CG    . HIS A 1 216 ? 74.430  160.108 35.808  1.00 16.06 ? 216  HIS A CG    1 
ATOM   1631  N  ND1   . HIS A 1 216 ? 75.249  161.203 35.974  1.00 16.51 ? 216  HIS A ND1   1 
ATOM   1632  C  CD2   . HIS A 1 216 ? 75.147  159.205 35.100  1.00 17.33 ? 216  HIS A CD2   1 
ATOM   1633  C  CE1   . HIS A 1 216 ? 76.413  160.972 35.392  1.00 16.29 ? 216  HIS A CE1   1 
ATOM   1634  N  NE2   . HIS A 1 216 ? 76.378  159.766 34.855  1.00 17.95 ? 216  HIS A NE2   1 
ATOM   1635  N  N     . VAL A 1 217 ? 71.197  161.451 38.415  1.00 15.12 ? 217  VAL A N     1 
ATOM   1636  C  CA    . VAL A 1 217 ? 69.849  161.867 38.770  1.00 15.48 ? 217  VAL A CA    1 
ATOM   1637  C  C     . VAL A 1 217 ? 69.440  162.902 37.734  1.00 15.42 ? 217  VAL A C     1 
ATOM   1638  O  O     . VAL A 1 217 ? 70.043  163.974 37.646  1.00 17.66 ? 217  VAL A O     1 
ATOM   1639  C  CB    . VAL A 1 217 ? 69.776  162.533 40.166  1.00 12.84 ? 217  VAL A CB    1 
ATOM   1640  C  CG1   . VAL A 1 217 ? 68.339  163.021 40.432  1.00 13.35 ? 217  VAL A CG1   1 
ATOM   1641  C  CG2   . VAL A 1 217 ? 70.205  161.543 41.248  1.00 10.92 ? 217  VAL A CG2   1 
ATOM   1642  N  N     . ILE A 1 218 ? 68.445  162.569 36.920  1.00 13.81 ? 218  ILE A N     1 
ATOM   1643  C  CA    . ILE A 1 218 ? 67.953  163.511 35.926  1.00 13.43 ? 218  ILE A CA    1 
ATOM   1644  C  C     . ILE A 1 218 ? 66.869  164.296 36.639  1.00 14.97 ? 218  ILE A C     1 
ATOM   1645  O  O     . ILE A 1 218 ? 65.958  163.712 37.233  1.00 14.79 ? 218  ILE A O     1 
ATOM   1646  C  CB    . ILE A 1 218 ? 67.353  162.796 34.696  1.00 14.22 ? 218  ILE A CB    1 
ATOM   1647  C  CG1   . ILE A 1 218 ? 68.468  162.073 33.934  1.00 13.24 ? 218  ILE A CG1   1 
ATOM   1648  C  CG2   . ILE A 1 218 ? 66.658  163.809 33.789  1.00 13.43 ? 218  ILE A CG2   1 
ATOM   1649  C  CD1   . ILE A 1 218 ? 67.989  161.298 32.715  1.00 14.84 ? 218  ILE A CD1   1 
ATOM   1650  N  N     . VAL A 1 219 ? 66.974  165.619 36.590  1.00 15.14 ? 219  VAL A N     1 
ATOM   1651  C  CA    . VAL A 1 219 ? 66.025  166.481 37.272  1.00 15.84 ? 219  VAL A CA    1 
ATOM   1652  C  C     . VAL A 1 219 ? 65.257  167.405 36.339  1.00 15.83 ? 219  VAL A C     1 
ATOM   1653  O  O     . VAL A 1 219 ? 65.849  168.114 35.520  1.00 14.86 ? 219  VAL A O     1 
ATOM   1654  C  CB    . VAL A 1 219 ? 66.750  167.358 38.325  1.00 16.45 ? 219  VAL A CB    1 
ATOM   1655  C  CG1   . VAL A 1 219 ? 65.738  168.186 39.104  1.00 17.14 ? 219  VAL A CG1   1 
ATOM   1656  C  CG2   . VAL A 1 219 ? 67.573  166.480 39.257  1.00 16.68 ? 219  VAL A CG2   1 
ATOM   1657  N  N     . LEU A 1 220 ? 63.933  167.382 36.463  1.00 15.13 ? 220  LEU A N     1 
ATOM   1658  C  CA    . LEU A 1 220 ? 63.072  168.250 35.674  1.00 14.44 ? 220  LEU A CA    1 
ATOM   1659  C  C     . LEU A 1 220 ? 62.801  169.500 36.503  1.00 15.23 ? 220  LEU A C     1 
ATOM   1660  O  O     . LEU A 1 220 ? 62.459  169.403 37.683  1.00 13.96 ? 220  LEU A O     1 
ATOM   1661  C  CB    . LEU A 1 220 ? 61.729  167.577 35.374  1.00 15.13 ? 220  LEU A CB    1 
ATOM   1662  C  CG    . LEU A 1 220 ? 60.674  168.515 34.772  1.00 13.91 ? 220  LEU A CG    1 
ATOM   1663  C  CD1   . LEU A 1 220 ? 61.044  168.842 33.328  1.00 16.97 ? 220  LEU A CD1   1 
ATOM   1664  C  CD2   . LEU A 1 220 ? 59.290  167.859 34.837  1.00 14.10 ? 220  LEU A CD2   1 
ATOM   1665  N  N     . LYS A 1 221 ? 62.953  170.671 35.896  1.00 14.36 ? 221  LYS A N     1 
ATOM   1666  C  CA    . LYS A 1 221 ? 62.681  171.911 36.614  1.00 15.58 ? 221  LYS A CA    1 
ATOM   1667  C  C     . LYS A 1 221 ? 61.184  172.212 36.501  1.00 15.83 ? 221  LYS A C     1 
ATOM   1668  O  O     . LYS A 1 221 ? 60.725  172.774 35.508  1.00 16.81 ? 221  LYS A O     1 
ATOM   1669  C  CB    . LYS A 1 221 ? 63.498  173.071 36.028  1.00 17.40 ? 221  LYS A CB    1 
ATOM   1670  C  CG    . LYS A 1 221 ? 63.340  174.373 36.813  1.00 20.65 ? 221  LYS A CG    1 
ATOM   1671  C  CD    . LYS A 1 221 ? 64.039  175.551 36.149  1.00 26.64 ? 221  LYS A CD    1 
ATOM   1672  C  CE    . LYS A 1 221 ? 65.550  175.463 36.262  1.00 29.50 ? 221  LYS A CE    1 
ATOM   1673  N  NZ    . LYS A 1 221 ? 66.188  176.711 35.739  1.00 35.55 ? 221  LYS A NZ    1 
ATOM   1674  N  N     . ARG A 1 222 ? 60.424  171.824 37.519  1.00 15.77 ? 222  ARG A N     1 
ATOM   1675  C  CA    . ARG A 1 222 ? 58.982  172.050 37.524  1.00 15.33 ? 222  ARG A CA    1 
ATOM   1676  C  C     . ARG A 1 222 ? 58.601  173.321 38.273  1.00 15.30 ? 222  ARG A C     1 
ATOM   1677  O  O     . ARG A 1 222 ? 57.657  174.008 37.891  1.00 15.93 ? 222  ARG A O     1 
ATOM   1678  C  CB    . ARG A 1 222 ? 58.261  170.853 38.154  1.00 14.33 ? 222  ARG A CB    1 
ATOM   1679  C  CG    . ARG A 1 222 ? 56.761  171.064 38.365  1.00 10.61 ? 222  ARG A CG    1 
ATOM   1680  C  CD    . ARG A 1 222 ? 56.018  171.188 37.039  1.00 11.34 ? 222  ARG A CD    1 
ATOM   1681  N  NE    . ARG A 1 222 ? 54.616  171.555 37.229  1.00 13.15 ? 222  ARG A NE    1 
ATOM   1682  C  CZ    . ARG A 1 222 ? 54.171  172.806 37.326  1.00 14.70 ? 222  ARG A CZ    1 
ATOM   1683  N  NH1   . ARG A 1 222 ? 55.020  173.823 37.248  1.00 12.06 ? 222  ARG A NH1   1 
ATOM   1684  N  NH2   . ARG A 1 222 ? 52.876  173.041 37.502  1.00 13.20 ? 222  ARG A NH2   1 
ATOM   1685  N  N     . THR A 1 223 ? 59.333  173.637 39.338  1.00 15.97 ? 223  THR A N     1 
ATOM   1686  C  CA    . THR A 1 223 ? 59.027  174.835 40.119  1.00 16.91 ? 223  THR A CA    1 
ATOM   1687  C  C     . THR A 1 223 ? 60.183  175.825 40.186  1.00 17.53 ? 223  THR A C     1 
ATOM   1688  O  O     . THR A 1 223 ? 59.981  176.990 40.515  1.00 19.31 ? 223  THR A O     1 
ATOM   1689  C  CB    . THR A 1 223 ? 58.635  174.485 41.563  1.00 16.27 ? 223  THR A CB    1 
ATOM   1690  O  OG1   . THR A 1 223 ? 59.784  173.991 42.259  1.00 16.85 ? 223  THR A OG1   1 
ATOM   1691  C  CG2   . THR A 1 223 ? 57.537  173.421 41.575  1.00 16.99 ? 223  THR A CG2   1 
ATOM   1692  N  N     . GLY A 1 224 ? 61.391  175.364 39.885  1.00 17.93 ? 224  GLY A N     1 
ATOM   1693  C  CA    . GLY A 1 224 ? 62.538  176.256 39.928  1.00 19.29 ? 224  GLY A CA    1 
ATOM   1694  C  C     . GLY A 1 224 ? 62.970  176.614 41.340  1.00 20.77 ? 224  GLY A C     1 
ATOM   1695  O  O     . GLY A 1 224 ? 63.729  177.564 41.538  1.00 19.09 ? 224  GLY A O     1 
ATOM   1696  N  N     . SER A 1 225 ? 62.493  175.860 42.328  1.00 20.14 ? 225  SER A N     1 
ATOM   1697  C  CA    . SER A 1 225 ? 62.866  176.128 43.713  1.00 22.43 ? 225  SER A CA    1 
ATOM   1698  C  C     . SER A 1 225 ? 64.352  175.879 43.930  1.00 22.76 ? 225  SER A C     1 
ATOM   1699  O  O     . SER A 1 225 ? 64.979  175.111 43.198  1.00 20.50 ? 225  SER A O     1 
ATOM   1700  C  CB    . SER A 1 225 ? 62.061  175.251 44.674  1.00 23.47 ? 225  SER A CB    1 
ATOM   1701  O  OG    . SER A 1 225 ? 60.744  175.749 44.832  1.00 28.44 ? 225  SER A OG    1 
ATOM   1702  N  N     . ASP A 1 226 ? 64.917  176.533 44.937  1.00 24.10 ? 226  ASP A N     1 
ATOM   1703  C  CA    . ASP A 1 226 ? 66.330  176.356 45.231  1.00 27.24 ? 226  ASP A CA    1 
ATOM   1704  C  C     . ASP A 1 226 ? 66.580  174.952 45.758  1.00 27.52 ? 226  ASP A C     1 
ATOM   1705  O  O     . ASP A 1 226 ? 66.074  174.571 46.816  1.00 29.13 ? 226  ASP A O     1 
ATOM   1706  C  CB    . ASP A 1 226 ? 66.802  177.386 46.262  1.00 30.81 ? 226  ASP A CB    1 
ATOM   1707  C  CG    . ASP A 1 226 ? 66.721  178.808 45.743  1.00 33.83 ? 226  ASP A CG    1 
ATOM   1708  O  OD1   . ASP A 1 226 ? 67.249  179.071 44.641  1.00 36.00 ? 226  ASP A OD1   1 
ATOM   1709  O  OD2   . ASP A 1 226 ? 66.136  179.663 46.440  1.00 36.93 ? 226  ASP A OD2   1 
ATOM   1710  N  N     . ILE A 1 227 ? 67.349  174.173 45.007  1.00 25.21 ? 227  ILE A N     1 
ATOM   1711  C  CA    . ILE A 1 227 ? 67.671  172.817 45.419  1.00 23.85 ? 227  ILE A CA    1 
ATOM   1712  C  C     . ILE A 1 227 ? 69.180  172.666 45.471  1.00 23.63 ? 227  ILE A C     1 
ATOM   1713  O  O     . ILE A 1 227 ? 69.913  173.463 44.880  1.00 22.73 ? 227  ILE A O     1 
ATOM   1714  C  CB    . ILE A 1 227 ? 67.102  171.763 44.431  1.00 24.16 ? 227  ILE A CB    1 
ATOM   1715  C  CG1   . ILE A 1 227 ? 67.600  172.049 43.010  1.00 24.47 ? 227  ILE A CG1   1 
ATOM   1716  C  CG2   . ILE A 1 227 ? 65.577  171.764 44.486  1.00 23.17 ? 227  ILE A CG2   1 
ATOM   1717  C  CD1   . ILE A 1 227 ? 67.287  170.939 42.003  1.00 22.31 ? 227  ILE A CD1   1 
ATOM   1718  N  N     . ASP A 1 228 ? 69.644  171.658 46.200  1.00 22.63 ? 228  ASP A N     1 
ATOM   1719  C  CA    . ASP A 1 228 ? 71.068  171.390 46.292  1.00 23.81 ? 228  ASP A CA    1 
ATOM   1720  C  C     . ASP A 1 228 ? 71.413  170.676 44.995  1.00 24.65 ? 228  ASP A C     1 
ATOM   1721  O  O     . ASP A 1 228 ? 70.589  169.944 44.446  1.00 24.87 ? 228  ASP A O     1 
ATOM   1722  C  CB    . ASP A 1 228 ? 71.357  170.502 47.497  1.00 23.22 ? 228  ASP A CB    1 
ATOM   1723  C  CG    . ASP A 1 228 ? 71.087  171.209 48.810  1.00 25.02 ? 228  ASP A CG    1 
ATOM   1724  O  OD1   . ASP A 1 228 ? 70.589  170.555 49.747  1.00 25.43 ? 228  ASP A OD1   1 
ATOM   1725  O  OD2   . ASP A 1 228 ? 71.381  172.421 48.905  1.00 23.00 ? 228  ASP A OD2   1 
ATOM   1726  N  N     . TRP A 1 229 ? 72.619  170.901 44.492  1.00 24.62 ? 229  TRP A N     1 
ATOM   1727  C  CA    . TRP A 1 229 ? 73.027  170.291 43.239  1.00 25.28 ? 229  TRP A CA    1 
ATOM   1728  C  C     . TRP A 1 229 ? 74.396  169.640 43.342  1.00 26.69 ? 229  TRP A C     1 
ATOM   1729  O  O     . TRP A 1 229 ? 75.343  170.235 43.859  1.00 27.39 ? 229  TRP A O     1 
ATOM   1730  C  CB    . TRP A 1 229 ? 73.031  171.355 42.139  1.00 23.89 ? 229  TRP A CB    1 
ATOM   1731  C  CG    . TRP A 1 229 ? 73.096  170.815 40.742  1.00 25.39 ? 229  TRP A CG    1 
ATOM   1732  C  CD1   . TRP A 1 229 ? 74.207  170.701 39.953  1.00 25.64 ? 229  TRP A CD1   1 
ATOM   1733  C  CD2   . TRP A 1 229 ? 71.993  170.351 39.954  1.00 23.24 ? 229  TRP A CD2   1 
ATOM   1734  N  NE1   . TRP A 1 229 ? 73.861  170.201 38.717  1.00 23.71 ? 229  TRP A NE1   1 
ATOM   1735  C  CE2   . TRP A 1 229 ? 72.509  169.978 38.692  1.00 23.16 ? 229  TRP A CE2   1 
ATOM   1736  C  CE3   . TRP A 1 229 ? 70.619  170.217 40.191  1.00 22.54 ? 229  TRP A CE3   1 
ATOM   1737  C  CZ2   . TRP A 1 229 ? 71.696  169.479 37.669  1.00 20.94 ? 229  TRP A CZ2   1 
ATOM   1738  C  CZ3   . TRP A 1 229 ? 69.810  169.719 39.171  1.00 20.70 ? 229  TRP A CZ3   1 
ATOM   1739  C  CH2   . TRP A 1 229 ? 70.354  169.358 37.926  1.00 20.51 ? 229  TRP A CH2   1 
ATOM   1740  N  N     . GLN A 1 230 ? 74.488  168.407 42.861  1.00 26.17 ? 230  GLN A N     1 
ATOM   1741  C  CA    . GLN A 1 230 ? 75.745  167.679 42.882  1.00 27.64 ? 230  GLN A CA    1 
ATOM   1742  C  C     . GLN A 1 230 ? 76.230  167.594 41.441  1.00 28.29 ? 230  GLN A C     1 
ATOM   1743  O  O     . GLN A 1 230 ? 75.817  166.714 40.681  1.00 26.15 ? 230  GLN A O     1 
ATOM   1744  C  CB    . GLN A 1 230 ? 75.541  166.281 43.468  1.00 29.16 ? 230  GLN A CB    1 
ATOM   1745  C  CG    . GLN A 1 230 ? 76.836  165.541 43.762  1.00 32.91 ? 230  GLN A CG    1 
ATOM   1746  C  CD    . GLN A 1 230 ? 76.615  164.280 44.575  1.00 34.08 ? 230  GLN A CD    1 
ATOM   1747  O  OE1   . GLN A 1 230 ? 76.007  164.315 45.647  1.00 36.43 ? 230  GLN A OE1   1 
ATOM   1748  N  NE2   . GLN A 1 230 ? 77.113  163.157 44.072  1.00 36.24 ? 230  GLN A NE2   1 
ATOM   1749  N  N     . GLU A 1 231 ? 77.096  168.532 41.070  1.00 27.97 ? 231  GLU A N     1 
ATOM   1750  C  CA    . GLU A 1 231 ? 77.634  168.593 39.719  1.00 28.94 ? 231  GLU A CA    1 
ATOM   1751  C  C     . GLU A 1 231 ? 78.115  167.224 39.260  1.00 27.48 ? 231  GLU A C     1 
ATOM   1752  O  O     . GLU A 1 231 ? 78.755  166.492 40.014  1.00 27.82 ? 231  GLU A O     1 
ATOM   1753  C  CB    . GLU A 1 231 ? 78.787  169.597 39.654  1.00 32.66 ? 231  GLU A CB    1 
ATOM   1754  C  CG    . GLU A 1 231 ? 78.808  170.408 38.369  1.00 36.35 ? 231  GLU A CG    1 
ATOM   1755  C  CD    . GLU A 1 231 ? 77.576  171.284 38.227  1.00 39.38 ? 231  GLU A CD    1 
ATOM   1756  O  OE1   . GLU A 1 231 ? 77.388  172.194 39.066  1.00 41.58 ? 231  GLU A OE1   1 
ATOM   1757  O  OE2   . GLU A 1 231 ? 76.790  171.062 37.281  1.00 43.68 ? 231  GLU A OE2   1 
ATOM   1758  N  N     . GLY A 1 232 ? 77.800  166.881 38.016  1.00 25.98 ? 232  GLY A N     1 
ATOM   1759  C  CA    . GLY A 1 232 ? 78.203  165.595 37.486  1.00 25.15 ? 232  GLY A CA    1 
ATOM   1760  C  C     . GLY A 1 232 ? 77.091  164.576 37.640  1.00 25.10 ? 232  GLY A C     1 
ATOM   1761  O  O     . GLY A 1 232 ? 76.537  164.096 36.649  1.00 25.97 ? 232  GLY A O     1 
ATOM   1762  N  N     . ARG A 1 233 ? 76.757  164.248 38.885  1.00 22.24 ? 233  ARG A N     1 
ATOM   1763  C  CA    . ARG A 1 233 ? 75.700  163.282 39.153  1.00 19.81 ? 233  ARG A CA    1 
ATOM   1764  C  C     . ARG A 1 233 ? 74.344  163.793 38.670  1.00 18.97 ? 233  ARG A C     1 
ATOM   1765  O  O     . ARG A 1 233 ? 73.630  163.094 37.947  1.00 18.54 ? 233  ARG A O     1 
ATOM   1766  C  CB    . ARG A 1 233 ? 75.612  162.983 40.650  1.00 18.88 ? 233  ARG A CB    1 
ATOM   1767  C  CG    . ARG A 1 233 ? 74.615  161.873 40.984  1.00 18.73 ? 233  ARG A CG    1 
ATOM   1768  C  CD    . ARG A 1 233 ? 74.266  161.855 42.468  1.00 18.67 ? 233  ARG A CD    1 
ATOM   1769  N  NE    . ARG A 1 233 ? 73.422  162.990 42.834  1.00 20.54 ? 233  ARG A NE    1 
ATOM   1770  C  CZ    . ARG A 1 233 ? 73.012  163.253 44.072  1.00 20.40 ? 233  ARG A CZ    1 
ATOM   1771  N  NH1   . ARG A 1 233 ? 73.366  162.463 45.077  1.00 19.16 ? 233  ARG A NH1   1 
ATOM   1772  N  NH2   . ARG A 1 233 ? 72.251  164.309 44.308  1.00 20.69 ? 233  ARG A NH2   1 
ATOM   1773  N  N     . ASP A 1 234 ? 73.995  165.013 39.071  1.00 18.45 ? 234  ASP A N     1 
ATOM   1774  C  CA    . ASP A 1 234 ? 72.712  165.607 38.697  1.00 18.34 ? 234  ASP A CA    1 
ATOM   1775  C  C     . ASP A 1 234 ? 72.737  166.267 37.329  1.00 18.13 ? 234  ASP A C     1 
ATOM   1776  O  O     . ASP A 1 234 ? 73.680  166.978 36.994  1.00 19.35 ? 234  ASP A O     1 
ATOM   1777  C  CB    . ASP A 1 234 ? 72.274  166.640 39.740  1.00 17.52 ? 234  ASP A CB    1 
ATOM   1778  C  CG    . ASP A 1 234 ? 72.162  166.048 41.128  1.00 18.13 ? 234  ASP A CG    1 
ATOM   1779  O  OD1   . ASP A 1 234 ? 71.936  164.824 41.226  1.00 19.57 ? 234  ASP A OD1   1 
ATOM   1780  O  OD2   . ASP A 1 234 ? 72.287  166.804 42.117  1.00 18.73 ? 234  ASP A OD2   1 
ATOM   1781  N  N     . LEU A 1 235 ? 71.683  166.036 36.552  1.00 17.37 ? 235  LEU A N     1 
ATOM   1782  C  CA    . LEU A 1 235 ? 71.558  166.593 35.210  1.00 17.53 ? 235  LEU A CA    1 
ATOM   1783  C  C     . LEU A 1 235 ? 70.149  167.134 35.001  1.00 18.16 ? 235  LEU A C     1 
ATOM   1784  O  O     . LEU A 1 235 ? 69.175  166.524 35.452  1.00 17.94 ? 235  LEU A O     1 
ATOM   1785  C  CB    . LEU A 1 235 ? 71.846  165.509 34.168  1.00 18.22 ? 235  LEU A CB    1 
ATOM   1786  C  CG    . LEU A 1 235 ? 73.230  164.850 34.224  1.00 19.01 ? 235  LEU A CG    1 
ATOM   1787  C  CD1   . LEU A 1 235 ? 73.210  163.544 33.458  1.00 20.02 ? 235  LEU A CD1   1 
ATOM   1788  C  CD2   . LEU A 1 235 ? 74.275  165.795 33.665  1.00 20.01 ? 235  LEU A CD2   1 
ATOM   1789  N  N     . TRP A 1 236 ? 70.041  168.273 34.322  1.00 17.24 ? 236  TRP A N     1 
ATOM   1790  C  CA    . TRP A 1 236 ? 68.738  168.873 34.048  1.00 18.24 ? 236  TRP A CA    1 
ATOM   1791  C  C     . TRP A 1 236 ? 68.082  168.178 32.859  1.00 19.63 ? 236  TRP A C     1 
ATOM   1792  O  O     . TRP A 1 236 ? 68.732  167.917 31.841  1.00 16.89 ? 236  TRP A O     1 
ATOM   1793  C  CB    . TRP A 1 236 ? 68.870  170.371 33.735  1.00 18.35 ? 236  TRP A CB    1 
ATOM   1794  C  CG    . TRP A 1 236 ? 69.179  171.249 34.921  1.00 19.81 ? 236  TRP A CG    1 
ATOM   1795  C  CD1   . TRP A 1 236 ? 70.325  171.964 35.133  1.00 20.26 ? 236  TRP A CD1   1 
ATOM   1796  C  CD2   . TRP A 1 236 ? 68.322  171.525 36.042  1.00 19.04 ? 236  TRP A CD2   1 
ATOM   1797  N  NE1   . TRP A 1 236 ? 70.237  172.667 36.312  1.00 20.41 ? 236  TRP A NE1   1 
ATOM   1798  C  CE2   . TRP A 1 236 ? 69.020  172.417 36.891  1.00 19.63 ? 236  TRP A CE2   1 
ATOM   1799  C  CE3   . TRP A 1 236 ? 67.034  171.106 36.411  1.00 18.62 ? 236  TRP A CE3   1 
ATOM   1800  C  CZ2   . TRP A 1 236 ? 68.475  172.898 38.086  1.00 19.53 ? 236  TRP A CZ2   1 
ATOM   1801  C  CZ3   . TRP A 1 236 ? 66.489  171.583 37.601  1.00 18.95 ? 236  TRP A CZ3   1 
ATOM   1802  C  CH2   . TRP A 1 236 ? 67.211  172.472 38.425  1.00 19.80 ? 236  TRP A CH2   1 
ATOM   1803  N  N     . TRP A 1 237 ? 66.792  167.882 33.002  1.00 17.94 ? 237  TRP A N     1 
ATOM   1804  C  CA    . TRP A 1 237 ? 66.013  167.226 31.955  1.00 18.77 ? 237  TRP A CA    1 
ATOM   1805  C  C     . TRP A 1 237 ? 66.148  167.984 30.638  1.00 20.06 ? 237  TRP A C     1 
ATOM   1806  O  O     . TRP A 1 237 ? 66.534  167.411 29.616  1.00 20.30 ? 237  TRP A O     1 
ATOM   1807  C  CB    . TRP A 1 237 ? 64.537  167.158 32.383  1.00 17.23 ? 237  TRP A CB    1 
ATOM   1808  C  CG    . TRP A 1 237 ? 63.585  166.616 31.340  1.00 17.02 ? 237  TRP A CG    1 
ATOM   1809  C  CD1   . TRP A 1 237 ? 63.172  167.243 30.195  1.00 18.25 ? 237  TRP A CD1   1 
ATOM   1810  C  CD2   . TRP A 1 237 ? 62.922  165.345 31.361  1.00 16.09 ? 237  TRP A CD2   1 
ATOM   1811  N  NE1   . TRP A 1 237 ? 62.292  166.442 29.506  1.00 16.71 ? 237  TRP A NE1   1 
ATOM   1812  C  CE2   . TRP A 1 237 ? 62.122  165.271 30.197  1.00 16.41 ? 237  TRP A CE2   1 
ATOM   1813  C  CE3   . TRP A 1 237 ? 62.923  164.261 32.251  1.00 17.84 ? 237  TRP A CE3   1 
ATOM   1814  C  CZ2   . TRP A 1 237 ? 61.330  164.155 29.897  1.00 15.99 ? 237  TRP A CZ2   1 
ATOM   1815  C  CZ3   . TRP A 1 237 ? 62.131  163.147 31.953  1.00 16.95 ? 237  TRP A CZ3   1 
ATOM   1816  C  CH2   . TRP A 1 237 ? 61.346  163.107 30.783  1.00 15.71 ? 237  TRP A CH2   1 
ATOM   1817  N  N     . ARG A 1 238 ? 65.836  169.276 30.673  1.00 20.39 ? 238  ARG A N     1 
ATOM   1818  C  CA    . ARG A 1 238 ? 65.901  170.127 29.489  1.00 22.24 ? 238  ARG A CA    1 
ATOM   1819  C  C     . ARG A 1 238 ? 67.258  170.118 28.786  1.00 23.36 ? 238  ARG A C     1 
ATOM   1820  O  O     . ARG A 1 238 ? 67.316  170.039 27.560  1.00 21.03 ? 238  ARG A O     1 
ATOM   1821  C  CB    . ARG A 1 238 ? 65.533  171.564 29.864  1.00 26.01 ? 238  ARG A CB    1 
ATOM   1822  C  CG    . ARG A 1 238 ? 65.531  172.538 28.696  1.00 31.16 ? 238  ARG A CG    1 
ATOM   1823  C  CD    . ARG A 1 238 ? 65.292  173.964 29.177  1.00 35.87 ? 238  ARG A CD    1 
ATOM   1824  N  NE    . ARG A 1 238 ? 65.330  174.939 28.088  1.00 40.52 ? 238  ARG A NE    1 
ATOM   1825  C  CZ    . ARG A 1 238 ? 64.431  175.009 27.111  1.00 42.60 ? 238  ARG A CZ    1 
ATOM   1826  N  NH1   . ARG A 1 238 ? 63.414  174.160 27.078  1.00 44.32 ? 238  ARG A NH1   1 
ATOM   1827  N  NH2   . ARG A 1 238 ? 64.546  175.935 26.167  1.00 44.77 ? 238  ARG A NH2   1 
ATOM   1828  N  N     . ASP A 1 239 ? 68.345  170.204 29.549  1.00 23.30 ? 239  ASP A N     1 
ATOM   1829  C  CA    . ASP A 1 239 ? 69.677  170.209 28.946  1.00 24.13 ? 239  ASP A CA    1 
ATOM   1830  C  C     . ASP A 1 239 ? 69.981  168.917 28.197  1.00 25.29 ? 239  ASP A C     1 
ATOM   1831  O  O     . ASP A 1 239 ? 70.627  168.936 27.148  1.00 24.61 ? 239  ASP A O     1 
ATOM   1832  C  CB    . ASP A 1 239 ? 70.761  170.431 30.005  1.00 25.81 ? 239  ASP A CB    1 
ATOM   1833  C  CG    . ASP A 1 239 ? 70.698  171.811 30.628  1.00 26.36 ? 239  ASP A CG    1 
ATOM   1834  O  OD1   . ASP A 1 239 ? 70.129  172.726 29.996  1.00 29.02 ? 239  ASP A OD1   1 
ATOM   1835  O  OD2   . ASP A 1 239 ? 71.232  171.978 31.744  1.00 28.06 ? 239  ASP A OD2   1 
ATOM   1836  N  N     . LEU A 1 240 ? 69.518  167.795 28.735  1.00 23.50 ? 240  LEU A N     1 
ATOM   1837  C  CA    . LEU A 1 240 ? 69.768  166.505 28.106  1.00 24.03 ? 240  LEU A CA    1 
ATOM   1838  C  C     . LEU A 1 240 ? 68.933  166.247 26.861  1.00 24.16 ? 240  LEU A C     1 
ATOM   1839  O  O     . LEU A 1 240 ? 69.472  165.956 25.794  1.00 25.10 ? 240  LEU A O     1 
ATOM   1840  C  CB    . LEU A 1 240 ? 69.522  165.370 29.104  1.00 22.08 ? 240  LEU A CB    1 
ATOM   1841  C  CG    . LEU A 1 240 ? 70.457  165.258 30.304  1.00 20.80 ? 240  LEU A CG    1 
ATOM   1842  C  CD1   . LEU A 1 240 ? 69.991  164.112 31.200  1.00 21.22 ? 240  LEU A CD1   1 
ATOM   1843  C  CD2   . LEU A 1 240 ? 71.886  165.024 29.829  1.00 19.01 ? 240  LEU A CD2   1 
ATOM   1844  N  N     . ILE A 1 241 ? 67.617  166.363 26.998  1.00 24.77 ? 241  ILE A N     1 
ATOM   1845  C  CA    . ILE A 1 241 ? 66.710  166.088 25.891  1.00 24.91 ? 241  ILE A CA    1 
ATOM   1846  C  C     . ILE A 1 241 ? 66.857  167.003 24.679  1.00 27.52 ? 241  ILE A C     1 
ATOM   1847  O  O     . ILE A 1 241 ? 66.644  166.569 23.545  1.00 27.83 ? 241  ILE A O     1 
ATOM   1848  C  CB    . ILE A 1 241 ? 65.234  166.109 26.364  1.00 24.60 ? 241  ILE A CB    1 
ATOM   1849  C  CG1   . ILE A 1 241 ? 64.352  165.373 25.350  1.00 25.40 ? 241  ILE A CG1   1 
ATOM   1850  C  CG2   . ILE A 1 241 ? 64.754  167.547 26.526  1.00 22.94 ? 241  ILE A CG2   1 
ATOM   1851  C  CD1   . ILE A 1 241 ? 62.921  165.117 25.827  1.00 25.52 ? 241  ILE A CD1   1 
ATOM   1852  N  N     . GLU A 1 242 ? 67.221  168.262 24.904  1.00 28.04 ? 242  GLU A N     1 
ATOM   1853  C  CA    . GLU A 1 242 ? 67.365  169.191 23.791  1.00 31.28 ? 242  GLU A CA    1 
ATOM   1854  C  C     . GLU A 1 242 ? 68.614  168.891 22.972  1.00 30.58 ? 242  GLU A C     1 
ATOM   1855  O  O     . GLU A 1 242 ? 68.770  169.387 21.858  1.00 32.94 ? 242  GLU A O     1 
ATOM   1856  C  CB    . GLU A 1 242 ? 67.389  170.639 24.298  1.00 32.94 ? 242  GLU A CB    1 
ATOM   1857  C  CG    . GLU A 1 242 ? 66.153  171.018 25.108  1.00 37.79 ? 242  GLU A CG    1 
ATOM   1858  C  CD    . GLU A 1 242 ? 65.925  172.517 25.192  1.00 41.24 ? 242  GLU A CD    1 
ATOM   1859  O  OE1   . GLU A 1 242 ? 66.898  173.264 25.428  1.00 43.28 ? 242  GLU A OE1   1 
ATOM   1860  O  OE2   . GLU A 1 242 ? 64.763  172.948 25.031  1.00 44.00 ? 242  GLU A OE2   1 
ATOM   1861  N  N     . LYS A 1 243 ? 69.494  168.064 23.521  1.00 30.60 ? 243  LYS A N     1 
ATOM   1862  C  CA    . LYS A 1 243 ? 70.727  167.693 22.840  1.00 29.85 ? 243  LYS A CA    1 
ATOM   1863  C  C     . LYS A 1 243 ? 70.617  166.315 22.188  1.00 30.02 ? 243  LYS A C     1 
ATOM   1864  O  O     . LYS A 1 243 ? 71.529  165.874 21.485  1.00 29.01 ? 243  LYS A O     1 
ATOM   1865  C  CB    . LYS A 1 243 ? 71.885  167.703 23.830  1.00 30.69 ? 243  LYS A CB    1 
ATOM   1866  N  N     . ALA A 1 244 ? 69.496  165.639 22.415  1.00 27.50 ? 244  ALA A N     1 
ATOM   1867  C  CA    . ALA A 1 244 ? 69.299  164.303 21.865  1.00 25.81 ? 244  ALA A CA    1 
ATOM   1868  C  C     . ALA A 1 244 ? 68.585  164.286 20.520  1.00 24.41 ? 244  ALA A C     1 
ATOM   1869  O  O     . ALA A 1 244 ? 67.790  165.170 20.206  1.00 24.27 ? 244  ALA A O     1 
ATOM   1870  C  CB    . ALA A 1 244 ? 68.538  163.438 22.868  1.00 24.53 ? 244  ALA A CB    1 
ATOM   1871  N  N     . SER A 1 245 ? 68.878  163.263 19.726  1.00 24.19 ? 245  SER A N     1 
ATOM   1872  C  CA    . SER A 1 245 ? 68.258  163.113 18.418  1.00 23.40 ? 245  SER A CA    1 
ATOM   1873  C  C     . SER A 1 245 ? 66.812  162.659 18.562  1.00 24.25 ? 245  SER A C     1 
ATOM   1874  O  O     . SER A 1 245 ? 66.508  161.777 19.367  1.00 23.83 ? 245  SER A O     1 
ATOM   1875  C  CB    . SER A 1 245 ? 69.019  162.081 17.585  1.00 22.55 ? 245  SER A CB    1 
ATOM   1876  O  OG    . SER A 1 245 ? 68.264  161.719 16.444  1.00 22.48 ? 245  SER A OG    1 
ATOM   1877  N  N     . PRO A 1 246 ? 65.899  163.270 17.794  1.00 23.73 ? 246  PRO A N     1 
ATOM   1878  C  CA    . PRO A 1 246 ? 64.482  162.903 17.849  1.00 24.07 ? 246  PRO A CA    1 
ATOM   1879  C  C     . PRO A 1 246 ? 64.236  161.661 16.998  1.00 23.80 ? 246  PRO A C     1 
ATOM   1880  O  O     . PRO A 1 246 ? 63.095  161.242 16.801  1.00 25.02 ? 246  PRO A O     1 
ATOM   1881  C  CB    . PRO A 1 246 ? 63.792  164.138 17.286  1.00 24.86 ? 246  PRO A CB    1 
ATOM   1882  C  CG    . PRO A 1 246 ? 64.769  164.594 16.241  1.00 25.65 ? 246  PRO A CG    1 
ATOM   1883  C  CD    . PRO A 1 246 ? 66.098  164.470 16.960  1.00 25.11 ? 246  PRO A CD    1 
ATOM   1884  N  N     . GLU A 1 247 ? 65.321  161.080 16.495  1.00 24.39 ? 247  GLU A N     1 
ATOM   1885  C  CA    . GLU A 1 247 ? 65.236  159.890 15.660  1.00 24.84 ? 247  GLU A CA    1 
ATOM   1886  C  C     . GLU A 1 247 ? 65.616  158.638 16.435  1.00 21.79 ? 247  GLU A C     1 
ATOM   1887  O  O     . GLU A 1 247 ? 66.766  158.483 16.839  1.00 22.39 ? 247  GLU A O     1 
ATOM   1888  C  CB    . GLU A 1 247 ? 66.175  160.022 14.458  1.00 27.92 ? 247  GLU A CB    1 
ATOM   1889  C  CG    . GLU A 1 247 ? 65.943  161.251 13.603  1.00 34.69 ? 247  GLU A CG    1 
ATOM   1890  C  CD    . GLU A 1 247 ? 64.620  161.210 12.878  1.00 38.31 ? 247  GLU A CD    1 
ATOM   1891  O  OE1   . GLU A 1 247 ? 64.412  160.276 12.072  1.00 42.49 ? 247  GLU A OE1   1 
ATOM   1892  O  OE2   . GLU A 1 247 ? 63.786  162.110 13.112  1.00 42.20 ? 247  GLU A OE2   1 
ATOM   1893  N  N     . HIS A 1 248 ? 64.656  157.745 16.645  1.00 19.12 ? 248  HIS A N     1 
ATOM   1894  C  CA    . HIS A 1 248 ? 64.949  156.501 17.346  1.00 17.42 ? 248  HIS A CA    1 
ATOM   1895  C  C     . HIS A 1 248 ? 64.099  155.346 16.840  1.00 17.79 ? 248  HIS A C     1 
ATOM   1896  O  O     . HIS A 1 248 ? 62.871  155.399 16.869  1.00 15.16 ? 248  HIS A O     1 
ATOM   1897  C  CB    . HIS A 1 248 ? 64.756  156.647 18.858  1.00 16.74 ? 248  HIS A CB    1 
ATOM   1898  C  CG    . HIS A 1 248 ? 65.118  155.410 19.619  1.00 15.80 ? 248  HIS A CG    1 
ATOM   1899  N  ND1   . HIS A 1 248 ? 64.242  154.359 19.791  1.00 15.39 ? 248  HIS A ND1   1 
ATOM   1900  C  CD2   . HIS A 1 248 ? 66.290  155.017 20.172  1.00 16.47 ? 248  HIS A CD2   1 
ATOM   1901  C  CE1   . HIS A 1 248 ? 64.859  153.372 20.416  1.00 15.94 ? 248  HIS A CE1   1 
ATOM   1902  N  NE2   . HIS A 1 248 ? 66.104  153.745 20.658  1.00 16.22 ? 248  HIS A NE2   1 
ATOM   1903  N  N     . GLN A 1 249 ? 64.767  154.300 16.374  1.00 19.42 ? 249  GLN A N     1 
ATOM   1904  C  CA    . GLN A 1 249 ? 64.081  153.123 15.857  1.00 22.25 ? 249  GLN A CA    1 
ATOM   1905  C  C     . GLN A 1 249 ? 63.829  152.138 16.991  1.00 21.38 ? 249  GLN A C     1 
ATOM   1906  O  O     . GLN A 1 249 ? 64.746  151.781 17.730  1.00 20.16 ? 249  GLN A O     1 
ATOM   1907  C  CB    . GLN A 1 249 ? 64.932  152.475 14.764  1.00 25.86 ? 249  GLN A CB    1 
ATOM   1908  C  CG    . GLN A 1 249 ? 65.268  153.437 13.637  1.00 32.45 ? 249  GLN A CG    1 
ATOM   1909  C  CD    . GLN A 1 249 ? 64.031  153.938 12.913  1.00 36.12 ? 249  GLN A CD    1 
ATOM   1910  O  OE1   . GLN A 1 249 ? 64.010  155.059 12.401  1.00 40.52 ? 249  GLN A OE1   1 
ATOM   1911  N  NE2   . GLN A 1 249 ? 62.997  153.105 12.856  1.00 37.59 ? 249  GLN A NE2   1 
ATOM   1912  N  N     . PRO A 1 250 ? 62.576  151.687 17.147  1.00 20.70 ? 250  PRO A N     1 
ATOM   1913  C  CA    . PRO A 1 250 ? 62.243  150.740 18.214  1.00 21.46 ? 250  PRO A CA    1 
ATOM   1914  C  C     . PRO A 1 250 ? 62.766  149.335 17.933  1.00 22.02 ? 250  PRO A C     1 
ATOM   1915  O  O     . PRO A 1 250 ? 62.525  148.777 16.861  1.00 22.57 ? 250  PRO A O     1 
ATOM   1916  C  CB    . PRO A 1 250 ? 60.711  150.755 18.248  1.00 22.04 ? 250  PRO A CB    1 
ATOM   1917  C  CG    . PRO A 1 250 ? 60.311  151.947 17.413  1.00 23.69 ? 250  PRO A CG    1 
ATOM   1918  C  CD    . PRO A 1 250 ? 61.380  152.035 16.368  1.00 22.28 ? 250  PRO A CD    1 
ATOM   1919  N  N     . GLU A 1 251 ? 63.477  148.772 18.900  1.00 20.76 ? 251  GLU A N     1 
ATOM   1920  C  CA    . GLU A 1 251 ? 64.000  147.418 18.770  1.00 22.63 ? 251  GLU A CA    1 
ATOM   1921  C  C     . GLU A 1 251 ? 62.965  146.453 19.340  1.00 21.78 ? 251  GLU A C     1 
ATOM   1922  O  O     . GLU A 1 251 ? 62.162  146.824 20.201  1.00 20.48 ? 251  GLU A O     1 
ATOM   1923  C  CB    . GLU A 1 251 ? 65.312  147.273 19.537  1.00 22.65 ? 251  GLU A CB    1 
ATOM   1924  C  CG    . GLU A 1 251 ? 66.484  148.031 18.933  1.00 27.31 ? 251  GLU A CG    1 
ATOM   1925  C  CD    . GLU A 1 251 ? 66.760  147.631 17.493  1.00 30.62 ? 251  GLU A CD    1 
ATOM   1926  O  OE1   . GLU A 1 251 ? 66.637  146.427 17.177  1.00 30.90 ? 251  GLU A OE1   1 
ATOM   1927  O  OE2   . GLU A 1 251 ? 67.110  148.519 16.683  1.00 30.73 ? 251  GLU A OE2   1 
ATOM   1928  N  N     . ALA A 1 252 ? 62.993  145.215 18.864  1.00 20.66 ? 252  ALA A N     1 
ATOM   1929  C  CA    . ALA A 1 252 ? 62.045  144.214 19.321  1.00 19.15 ? 252  ALA A CA    1 
ATOM   1930  C  C     . ALA A 1 252 ? 62.380  143.667 20.704  1.00 17.50 ? 252  ALA A C     1 
ATOM   1931  O  O     . ALA A 1 252 ? 63.531  143.346 21.000  1.00 17.04 ? 252  ALA A O     1 
ATOM   1932  C  CB    . ALA A 1 252 ? 61.973  143.069 18.313  1.00 20.46 ? 252  ALA A CB    1 
ATOM   1933  N  N     . MET A 1 253 ? 61.360  143.574 21.548  1.00 16.97 ? 253  MET A N     1 
ATOM   1934  C  CA    . MET A 1 253 ? 61.513  143.028 22.890  1.00 15.93 ? 253  MET A CA    1 
ATOM   1935  C  C     . MET A 1 253 ? 60.734  141.717 22.896  1.00 15.81 ? 253  MET A C     1 
ATOM   1936  O  O     . MET A 1 253 ? 59.719  141.595 22.208  1.00 15.53 ? 253  MET A O     1 
ATOM   1937  C  CB    . MET A 1 253 ? 60.909  143.974 23.939  1.00 15.68 ? 253  MET A CB    1 
ATOM   1938  C  CG    . MET A 1 253 ? 61.495  145.383 23.948  1.00 14.98 ? 253  MET A CG    1 
ATOM   1939  S  SD    . MET A 1 253 ? 63.257  145.389 24.310  1.00 16.92 ? 253  MET A SD    1 
ATOM   1940  C  CE    . MET A 1 253 ? 63.834  146.680 23.202  1.00 20.32 ? 253  MET A CE    1 
ATOM   1941  N  N     . ASN A 1 254 ? 61.213  140.734 23.652  1.00 14.75 ? 254  ASN A N     1 
ATOM   1942  C  CA    . ASN A 1 254 ? 60.517  139.459 23.748  1.00 16.88 ? 254  ASN A CA    1 
ATOM   1943  C  C     . ASN A 1 254 ? 59.260  139.691 24.578  1.00 16.20 ? 254  ASN A C     1 
ATOM   1944  O  O     . ASN A 1 254 ? 59.227  140.575 25.433  1.00 15.65 ? 254  ASN A O     1 
ATOM   1945  C  CB    . ASN A 1 254 ? 61.402  138.417 24.434  1.00 19.42 ? 254  ASN A CB    1 
ATOM   1946  C  CG    . ASN A 1 254 ? 62.598  138.032 23.594  1.00 24.84 ? 254  ASN A CG    1 
ATOM   1947  O  OD1   . ASN A 1 254 ? 62.452  137.446 22.519  1.00 29.13 ? 254  ASN A OD1   1 
ATOM   1948  N  ND2   . ASN A 1 254 ? 63.793  138.364 24.073  1.00 28.02 ? 254  ASN A ND2   1 
ATOM   1949  N  N     . ALA A 1 255 ? 58.231  138.895 24.324  1.00 15.55 ? 255  ALA A N     1 
ATOM   1950  C  CA    . ALA A 1 255 ? 56.981  139.025 25.051  1.00 14.88 ? 255  ALA A CA    1 
ATOM   1951  C  C     . ALA A 1 255 ? 57.222  138.936 26.559  1.00 14.18 ? 255  ALA A C     1 
ATOM   1952  O  O     . ALA A 1 255 ? 56.554  139.610 27.342  1.00 12.50 ? 255  ALA A O     1 
ATOM   1953  C  CB    . ALA A 1 255 ? 56.008  137.932 24.606  1.00 13.60 ? 255  ALA A CB    1 
ATOM   1954  N  N     . GLU A 1 256 ? 58.189  138.120 26.969  1.00 12.76 ? 256  GLU A N     1 
ATOM   1955  C  CA    . GLU A 1 256 ? 58.462  137.969 28.392  1.00 13.52 ? 256  GLU A CA    1 
ATOM   1956  C  C     . GLU A 1 256 ? 59.606  138.817 28.951  1.00 13.32 ? 256  GLU A C     1 
ATOM   1957  O  O     . GLU A 1 256 ? 60.063  138.581 30.070  1.00 13.83 ? 256  GLU A O     1 
ATOM   1958  C  CB    . GLU A 1 256 ? 58.687  136.490 28.737  1.00 12.50 ? 256  GLU A CB    1 
ATOM   1959  C  CG    . GLU A 1 256 ? 57.428  135.622 28.616  1.00 12.74 ? 256  GLU A CG    1 
ATOM   1960  C  CD    . GLU A 1 256 ? 56.288  136.062 29.538  1.00 14.58 ? 256  GLU A CD    1 
ATOM   1961  O  OE1   . GLU A 1 256 ? 56.557  136.671 30.595  1.00 13.50 ? 256  GLU A OE1   1 
ATOM   1962  O  OE2   . GLU A 1 256 ? 55.115  135.780 29.211  1.00 14.72 ? 256  GLU A OE2   1 
ATOM   1963  N  N     . ASP A 1 257 ? 60.072  139.802 28.191  1.00 13.81 ? 257  ASP A N     1 
ATOM   1964  C  CA    . ASP A 1 257 ? 61.125  140.677 28.704  1.00 14.73 ? 257  ASP A CA    1 
ATOM   1965  C  C     . ASP A 1 257 ? 60.492  141.544 29.791  1.00 14.83 ? 257  ASP A C     1 
ATOM   1966  O  O     . ASP A 1 257 ? 59.363  142.003 29.643  1.00 13.51 ? 257  ASP A O     1 
ATOM   1967  C  CB    . ASP A 1 257 ? 61.683  141.593 27.612  1.00 13.98 ? 257  ASP A CB    1 
ATOM   1968  C  CG    . ASP A 1 257 ? 62.739  140.915 26.759  1.00 15.51 ? 257  ASP A CG    1 
ATOM   1969  O  OD1   . ASP A 1 257 ? 63.351  139.945 27.244  1.00 14.94 ? 257  ASP A OD1   1 
ATOM   1970  O  OD2   . ASP A 1 257 ? 62.969  141.369 25.616  1.00 16.63 ? 257  ASP A OD2   1 
ATOM   1971  N  N     . PRO A 1 258 ? 61.205  141.769 30.902  1.00 15.40 ? 258  PRO A N     1 
ATOM   1972  C  CA    . PRO A 1 258 ? 60.641  142.597 31.972  1.00 14.89 ? 258  PRO A CA    1 
ATOM   1973  C  C     . PRO A 1 258 ? 60.328  144.010 31.494  1.00 14.49 ? 258  PRO A C     1 
ATOM   1974  O  O     . PRO A 1 258 ? 61.134  144.630 30.808  1.00 14.67 ? 258  PRO A O     1 
ATOM   1975  C  CB    . PRO A 1 258 ? 61.729  142.566 33.045  1.00 14.78 ? 258  PRO A CB    1 
ATOM   1976  C  CG    . PRO A 1 258 ? 62.997  142.360 32.240  1.00 18.10 ? 258  PRO A CG    1 
ATOM   1977  C  CD    . PRO A 1 258 ? 62.560  141.309 31.251  1.00 17.43 ? 258  PRO A CD    1 
ATOM   1978  N  N     . LEU A 1 259 ? 59.151  144.503 31.869  1.00 12.58 ? 259  LEU A N     1 
ATOM   1979  C  CA    . LEU A 1 259 ? 58.699  145.838 31.489  1.00 11.62 ? 259  LEU A CA    1 
ATOM   1980  C  C     . LEU A 1 259 ? 58.816  146.813 32.653  1.00 11.42 ? 259  LEU A C     1 
ATOM   1981  O  O     . LEU A 1 259 ? 59.402  147.891 32.522  1.00 10.30 ? 259  LEU A O     1 
ATOM   1982  C  CB    . LEU A 1 259 ? 57.244  145.781 31.019  1.00 11.47 ? 259  LEU A CB    1 
ATOM   1983  C  CG    . LEU A 1 259 ? 56.599  147.115 30.636  1.00 12.69 ? 259  LEU A CG    1 
ATOM   1984  C  CD1   . LEU A 1 259 ? 57.319  147.699 29.423  1.00 13.83 ? 259  LEU A CD1   1 
ATOM   1985  C  CD2   . LEU A 1 259 ? 55.121  146.892 30.335  1.00 12.75 ? 259  LEU A CD2   1 
ATOM   1986  N  N     . PHE A 1 260 ? 58.260  146.443 33.801  1.00 10.86 ? 260  PHE A N     1 
ATOM   1987  C  CA    . PHE A 1 260 ? 58.340  147.330 34.949  1.00 11.90 ? 260  PHE A CA    1 
ATOM   1988  C  C     . PHE A 1 260 ? 58.157  146.627 36.281  1.00 11.62 ? 260  PHE A C     1 
ATOM   1989  O  O     . PHE A 1 260 ? 57.714  145.478 36.345  1.00 11.54 ? 260  PHE A O     1 
ATOM   1990  C  CB    . PHE A 1 260 ? 57.334  148.492 34.803  1.00 12.22 ? 260  PHE A CB    1 
ATOM   1991  C  CG    . PHE A 1 260 ? 55.879  148.105 35.002  1.00 13.42 ? 260  PHE A CG    1 
ATOM   1992  C  CD1   . PHE A 1 260 ? 55.381  147.821 36.272  1.00 10.53 ? 260  PHE A CD1   1 
ATOM   1993  C  CD2   . PHE A 1 260 ? 55.001  148.074 33.921  1.00 11.33 ? 260  PHE A CD2   1 
ATOM   1994  C  CE1   . PHE A 1 260 ? 54.022  147.512 36.466  1.00 12.03 ? 260  PHE A CE1   1 
ATOM   1995  C  CE2   . PHE A 1 260 ? 53.643  147.767 34.100  1.00 12.83 ? 260  PHE A CE2   1 
ATOM   1996  C  CZ    . PHE A 1 260 ? 53.155  147.486 35.377  1.00 11.75 ? 260  PHE A CZ    1 
ATOM   1997  N  N     . ILE A 1 261 ? 58.530  147.338 37.337  1.00 12.67 ? 261  ILE A N     1 
ATOM   1998  C  CA    . ILE A 1 261 ? 58.417  146.852 38.702  1.00 14.18 ? 261  ILE A CA    1 
ATOM   1999  C  C     . ILE A 1 261 ? 57.633  147.880 39.507  1.00 12.54 ? 261  ILE A C     1 
ATOM   2000  O  O     . ILE A 1 261 ? 57.803  149.084 39.311  1.00 13.90 ? 261  ILE A O     1 
ATOM   2001  C  CB    . ILE A 1 261 ? 59.810  146.716 39.366  1.00 17.54 ? 261  ILE A CB    1 
ATOM   2002  C  CG1   . ILE A 1 261 ? 60.675  145.739 38.574  1.00 18.97 ? 261  ILE A CG1   1 
ATOM   2003  C  CG2   . ILE A 1 261 ? 59.658  146.257 40.811  1.00 19.09 ? 261  ILE A CG2   1 
ATOM   2004  C  CD1   . ILE A 1 261 ? 60.126  144.358 38.549  1.00 19.58 ? 261  ILE A CD1   1 
ATOM   2005  N  N     . LEU A 1 262 ? 56.766  147.408 40.396  1.00 11.48 ? 262  LEU A N     1 
ATOM   2006  C  CA    . LEU A 1 262 ? 56.012  148.301 41.270  1.00 11.80 ? 262  LEU A CA    1 
ATOM   2007  C  C     . LEU A 1 262 ? 56.070  147.721 42.675  1.00 11.84 ? 262  LEU A C     1 
ATOM   2008  O  O     . LEU A 1 262 ? 55.634  146.588 42.904  1.00 12.46 ? 262  LEU A O     1 
ATOM   2009  C  CB    . LEU A 1 262 ? 54.549  148.444 40.827  1.00 11.82 ? 262  LEU A CB    1 
ATOM   2010  C  CG    . LEU A 1 262 ? 54.246  149.552 39.817  1.00 12.79 ? 262  LEU A CG    1 
ATOM   2011  C  CD1   . LEU A 1 262 ? 52.754  149.542 39.491  1.00 11.30 ? 262  LEU A CD1   1 
ATOM   2012  C  CD2   . LEU A 1 262 ? 54.664  150.913 40.391  1.00 12.04 ? 262  LEU A CD2   1 
ATOM   2013  N  N     . TYR A 1 263 ? 56.633  148.484 43.609  1.00 12.48 ? 263  TYR A N     1 
ATOM   2014  C  CA    . TYR A 1 263 ? 56.721  148.007 44.980  1.00 13.52 ? 263  TYR A CA    1 
ATOM   2015  C  C     . TYR A 1 263 ? 55.354  148.095 45.622  1.00 14.94 ? 263  TYR A C     1 
ATOM   2016  O  O     . TYR A 1 263 ? 54.706  149.147 45.636  1.00 15.55 ? 263  TYR A O     1 
ATOM   2017  C  CB    . TYR A 1 263 ? 57.792  148.780 45.755  1.00 13.82 ? 263  TYR A CB    1 
ATOM   2018  C  CG    . TYR A 1 263 ? 59.169  148.360 45.307  1.00 12.40 ? 263  TYR A CG    1 
ATOM   2019  C  CD1   . TYR A 1 263 ? 59.772  148.960 44.202  1.00 12.82 ? 263  TYR A CD1   1 
ATOM   2020  C  CD2   . TYR A 1 263 ? 59.805  147.263 45.890  1.00 12.02 ? 263  TYR A CD2   1 
ATOM   2021  C  CE1   . TYR A 1 263 ? 60.967  148.472 43.676  1.00 13.90 ? 263  TYR A CE1   1 
ATOM   2022  C  CE2   . TYR A 1 263 ? 61.006  146.762 45.368  1.00 14.43 ? 263  TYR A CE2   1 
ATOM   2023  C  CZ    . TYR A 1 263 ? 61.574  147.374 44.255  1.00 13.91 ? 263  TYR A CZ    1 
ATOM   2024  O  OH    . TYR A 1 263 ? 62.726  146.871 43.695  1.00 14.74 ? 263  TYR A OH    1 
ATOM   2025  N  N     . THR A 1 264 ? 54.915  146.954 46.132  1.00 14.75 ? 264  THR A N     1 
ATOM   2026  C  CA    . THR A 1 264 ? 53.593  146.819 46.719  1.00 15.06 ? 264  THR A CA    1 
ATOM   2027  C  C     . THR A 1 264 ? 53.649  146.232 48.116  1.00 15.61 ? 264  THR A C     1 
ATOM   2028  O  O     . THR A 1 264 ? 54.427  145.314 48.384  1.00 14.37 ? 264  THR A O     1 
ATOM   2029  C  CB    . THR A 1 264 ? 52.738  145.901 45.834  1.00 16.85 ? 264  THR A CB    1 
ATOM   2030  O  OG1   . THR A 1 264 ? 52.968  146.235 44.458  1.00 16.97 ? 264  THR A OG1   1 
ATOM   2031  C  CG2   . THR A 1 264 ? 51.265  146.062 46.159  1.00 17.87 ? 264  THR A CG2   1 
ATOM   2032  N  N     . SER A 1 265 ? 52.803  146.762 48.993  1.00 17.10 ? 265  SER A N     1 
ATOM   2033  C  CA    . SER A 1 265 ? 52.733  146.317 50.380  1.00 18.20 ? 265  SER A CA    1 
ATOM   2034  C  C     . SER A 1 265 ? 52.054  144.964 50.498  1.00 18.51 ? 265  SER A C     1 
ATOM   2035  O  O     . SER A 1 265 ? 51.089  144.673 49.788  1.00 20.12 ? 265  SER A O     1 
ATOM   2036  C  CB    . SER A 1 265 ? 51.963  147.337 51.227  1.00 16.20 ? 265  SER A CB    1 
ATOM   2037  O  OG    . SER A 1 265 ? 52.627  148.586 51.258  1.00 16.70 ? 265  SER A OG    1 
ATOM   2038  N  N     . GLY A 1 266 ? 52.562  144.143 51.406  1.00 19.59 ? 266  GLY A N     1 
ATOM   2039  C  CA    . GLY A 1 266 ? 51.994  142.825 51.616  1.00 22.00 ? 266  GLY A CA    1 
ATOM   2040  C  C     . GLY A 1 266 ? 51.625  142.624 53.071  1.00 22.96 ? 266  GLY A C     1 
ATOM   2041  O  O     . GLY A 1 266 ? 51.846  143.510 53.901  1.00 20.80 ? 266  GLY A O     1 
ATOM   2042  N  N     . SER A 1 267 ? 51.075  141.455 53.381  1.00 24.78 ? 267  SER A N     1 
ATOM   2043  C  CA    . SER A 1 267 ? 50.657  141.133 54.740  1.00 26.88 ? 267  SER A CA    1 
ATOM   2044  C  C     . SER A 1 267 ? 51.830  141.166 55.716  1.00 27.60 ? 267  SER A C     1 
ATOM   2045  O  O     . SER A 1 267 ? 51.666  141.517 56.887  1.00 30.05 ? 267  SER A O     1 
ATOM   2046  C  CB    . SER A 1 267 ? 49.988  139.757 54.766  1.00 27.74 ? 267  SER A CB    1 
ATOM   2047  O  OG    . SER A 1 267 ? 49.326  139.538 56.002  1.00 31.39 ? 267  SER A OG    1 
ATOM   2048  N  N     . THR A 1 268 ? 53.013  140.797 55.237  1.00 27.56 ? 268  THR A N     1 
ATOM   2049  C  CA    . THR A 1 268 ? 54.206  140.814 56.073  1.00 27.00 ? 268  THR A CA    1 
ATOM   2050  C  C     . THR A 1 268 ? 55.371  141.419 55.303  1.00 26.47 ? 268  THR A C     1 
ATOM   2051  O  O     . THR A 1 268 ? 55.337  141.508 54.074  1.00 26.59 ? 268  THR A O     1 
ATOM   2052  C  CB    . THR A 1 268 ? 54.615  139.399 56.532  1.00 28.26 ? 268  THR A CB    1 
ATOM   2053  O  OG1   . THR A 1 268 ? 54.903  138.587 55.388  1.00 30.14 ? 268  THR A OG1   1 
ATOM   2054  C  CG2   . THR A 1 268 ? 53.503  138.756 57.348  1.00 28.73 ? 268  THR A CG2   1 
ATOM   2055  N  N     . GLY A 1 269 ? 56.392  141.846 56.039  1.00 25.13 ? 269  GLY A N     1 
ATOM   2056  C  CA    . GLY A 1 269 ? 57.568  142.425 55.423  1.00 24.87 ? 269  GLY A CA    1 
ATOM   2057  C  C     . GLY A 1 269 ? 57.364  143.796 54.814  1.00 24.75 ? 269  GLY A C     1 
ATOM   2058  O  O     . GLY A 1 269 ? 56.295  144.402 54.928  1.00 23.95 ? 269  GLY A O     1 
ATOM   2059  N  N     . LYS A 1 270 ? 58.411  144.293 54.169  1.00 23.75 ? 270  LYS A N     1 
ATOM   2060  C  CA    . LYS A 1 270 ? 58.365  145.589 53.521  1.00 24.45 ? 270  LYS A CA    1 
ATOM   2061  C  C     . LYS A 1 270 ? 57.881  145.350 52.097  1.00 22.46 ? 270  LYS A C     1 
ATOM   2062  O  O     . LYS A 1 270 ? 57.805  144.207 51.649  1.00 19.71 ? 270  LYS A O     1 
ATOM   2063  C  CB    . LYS A 1 270 ? 59.759  146.222 53.523  1.00 28.63 ? 270  LYS A CB    1 
ATOM   2064  C  CG    . LYS A 1 270 ? 60.336  146.378 54.925  1.00 31.66 ? 270  LYS A CG    1 
ATOM   2065  C  CD    . LYS A 1 270 ? 61.720  146.998 54.911  1.00 35.68 ? 270  LYS A CD    1 
ATOM   2066  C  CE    . LYS A 1 270 ? 61.681  148.428 54.406  1.00 37.08 ? 270  LYS A CE    1 
ATOM   2067  N  NZ    . LYS A 1 270 ? 63.019  149.065 54.517  1.00 41.34 ? 270  LYS A NZ    1 
ATOM   2068  N  N     . PRO A 1 271 ? 57.536  146.424 51.375  1.00 21.44 ? 271  PRO A N     1 
ATOM   2069  C  CA    . PRO A 1 271 ? 57.056  146.289 49.998  1.00 20.31 ? 271  PRO A CA    1 
ATOM   2070  C  C     . PRO A 1 271 ? 57.980  145.476 49.097  1.00 19.53 ? 271  PRO A C     1 
ATOM   2071  O  O     . PRO A 1 271 ? 59.207  145.561 49.200  1.00 20.69 ? 271  PRO A O     1 
ATOM   2072  C  CB    . PRO A 1 271 ? 56.919  147.738 49.544  1.00 20.82 ? 271  PRO A CB    1 
ATOM   2073  C  CG    . PRO A 1 271 ? 56.496  148.428 50.810  1.00 21.46 ? 271  PRO A CG    1 
ATOM   2074  C  CD    . PRO A 1 271 ? 57.440  147.825 51.826  1.00 21.97 ? 271  PRO A CD    1 
ATOM   2075  N  N     . LYS A 1 272 ? 57.375  144.685 48.219  1.00 17.13 ? 272  LYS A N     1 
ATOM   2076  C  CA    . LYS A 1 272 ? 58.121  143.851 47.283  1.00 17.35 ? 272  LYS A CA    1 
ATOM   2077  C  C     . LYS A 1 272 ? 57.870  144.325 45.856  1.00 14.79 ? 272  LYS A C     1 
ATOM   2078  O  O     . LYS A 1 272 ? 56.799  144.852 45.548  1.00 13.96 ? 272  LYS A O     1 
ATOM   2079  C  CB    . LYS A 1 272 ? 57.701  142.386 47.436  1.00 17.84 ? 272  LYS A CB    1 
ATOM   2080  C  CG    . LYS A 1 272 ? 58.093  141.781 48.780  1.00 20.52 ? 272  LYS A CG    1 
ATOM   2081  C  CD    . LYS A 1 272 ? 59.600  141.825 48.980  1.00 22.26 ? 272  LYS A CD    1 
ATOM   2082  C  CE    . LYS A 1 272 ? 60.003  141.201 50.307  1.00 24.78 ? 272  LYS A CE    1 
ATOM   2083  N  NZ    . LYS A 1 272 ? 61.483  141.135 50.454  1.00 27.94 ? 272  LYS A NZ    1 
ATOM   2084  N  N     . GLY A 1 273 ? 58.862  144.128 44.993  1.00 13.94 ? 273  GLY A N     1 
ATOM   2085  C  CA    . GLY A 1 273 ? 58.749  144.565 43.614  1.00 13.07 ? 273  GLY A CA    1 
ATOM   2086  C  C     . GLY A 1 273 ? 57.983  143.642 42.681  1.00 13.70 ? 273  GLY A C     1 
ATOM   2087  O  O     . GLY A 1 273 ? 58.550  142.706 42.121  1.00 13.05 ? 273  GLY A O     1 
ATOM   2088  N  N     . VAL A 1 274 ? 56.695  143.914 42.506  1.00 12.36 ? 274  VAL A N     1 
ATOM   2089  C  CA    . VAL A 1 274 ? 55.863  143.116 41.614  1.00 11.89 ? 274  VAL A CA    1 
ATOM   2090  C  C     . VAL A 1 274 ? 56.333  143.386 40.191  1.00 11.92 ? 274  VAL A C     1 
ATOM   2091  O  O     . VAL A 1 274 ? 56.344  144.533 39.741  1.00 13.11 ? 274  VAL A O     1 
ATOM   2092  C  CB    . VAL A 1 274 ? 54.381  143.499 41.751  1.00 11.51 ? 274  VAL A CB    1 
ATOM   2093  C  CG1   . VAL A 1 274 ? 53.530  142.703 40.755  1.00 10.53 ? 274  VAL A CG1   1 
ATOM   2094  C  CG2   . VAL A 1 274 ? 53.924  143.248 43.170  1.00 11.03 ? 274  VAL A CG2   1 
ATOM   2095  N  N     . LEU A 1 275 ? 56.719  142.327 39.486  1.00 12.26 ? 275  LEU A N     1 
ATOM   2096  C  CA    . LEU A 1 275 ? 57.227  142.456 38.123  1.00 11.68 ? 275  LEU A CA    1 
ATOM   2097  C  C     . LEU A 1 275 ? 56.263  142.045 37.017  1.00 10.43 ? 275  LEU A C     1 
ATOM   2098  O  O     . LEU A 1 275 ? 55.658  140.971 37.050  1.00 11.27 ? 275  LEU A O     1 
ATOM   2099  C  CB    . LEU A 1 275 ? 58.532  141.656 37.985  1.00 11.01 ? 275  LEU A CB    1 
ATOM   2100  C  CG    . LEU A 1 275 ? 59.344  141.749 36.690  1.00 13.74 ? 275  LEU A CG    1 
ATOM   2101  C  CD1   . LEU A 1 275 ? 60.795  141.388 36.983  1.00 17.46 ? 275  LEU A CD1   1 
ATOM   2102  C  CD2   . LEU A 1 275 ? 58.761  140.832 35.613  1.00 14.57 ? 275  LEU A CD2   1 
ATOM   2103  N  N     . HIS A 1 276 ? 56.138  142.918 36.028  1.00 10.58 ? 276  HIS A N     1 
ATOM   2104  C  CA    . HIS A 1 276 ? 55.290  142.665 34.876  1.00 10.96 ? 276  HIS A CA    1 
ATOM   2105  C  C     . HIS A 1 276 ? 56.160  142.607 33.635  1.00 11.98 ? 276  HIS A C     1 
ATOM   2106  O  O     . HIS A 1 276 ? 57.106  143.386 33.508  1.00 13.05 ? 276  HIS A O     1 
ATOM   2107  C  CB    . HIS A 1 276 ? 54.257  143.783 34.727  1.00 10.08 ? 276  HIS A CB    1 
ATOM   2108  C  CG    . HIS A 1 276 ? 53.042  143.587 35.574  1.00 11.16 ? 276  HIS A CG    1 
ATOM   2109  N  ND1   . HIS A 1 276 ? 52.040  142.705 35.236  1.00 11.71 ? 276  HIS A ND1   1 
ATOM   2110  C  CD2   . HIS A 1 276 ? 52.686  144.126 36.764  1.00 10.65 ? 276  HIS A CD2   1 
ATOM   2111  C  CE1   . HIS A 1 276 ? 51.118  142.706 36.182  1.00 11.75 ? 276  HIS A CE1   1 
ATOM   2112  N  NE2   . HIS A 1 276 ? 51.486  143.560 37.121  1.00 10.59 ? 276  HIS A NE2   1 
ATOM   2113  N  N     . THR A 1 277 ? 55.863  141.675 32.732  1.00 12.64 ? 277  THR A N     1 
ATOM   2114  C  CA    . THR A 1 277 ? 56.626  141.602 31.504  1.00 12.88 ? 277  THR A CA    1 
ATOM   2115  C  C     . THR A 1 277 ? 55.908  142.431 30.439  1.00 14.02 ? 277  THR A C     1 
ATOM   2116  O  O     . THR A 1 277 ? 55.081  143.284 30.773  1.00 13.91 ? 277  THR A O     1 
ATOM   2117  C  CB    . THR A 1 277 ? 56.897  140.132 31.045  1.00 12.66 ? 277  THR A CB    1 
ATOM   2118  O  OG1   . THR A 1 277 ? 55.686  139.374 31.033  1.00 11.16 ? 277  THR A OG1   1 
ATOM   2119  C  CG2   . THR A 1 277 ? 57.903  139.468 31.992  1.00 12.78 ? 277  THR A CG2   1 
ATOM   2120  N  N     . THR A 1 278 ? 56.190  142.177 29.169  1.00 13.29 ? 278  THR A N     1 
ATOM   2121  C  CA    . THR A 1 278 ? 55.645  143.003 28.100  1.00 12.94 ? 278  THR A CA    1 
ATOM   2122  C  C     . THR A 1 278 ? 54.396  142.585 27.312  1.00 14.35 ? 278  THR A C     1 
ATOM   2123  O  O     . THR A 1 278 ? 53.404  143.316 27.291  1.00 13.31 ? 278  THR A O     1 
ATOM   2124  C  CB    . THR A 1 278 ? 56.776  143.312 27.093  1.00 13.98 ? 278  THR A CB    1 
ATOM   2125  O  OG1   . THR A 1 278 ? 57.938  143.758 27.807  1.00 12.98 ? 278  THR A OG1   1 
ATOM   2126  C  CG2   . THR A 1 278 ? 56.349  144.395 26.111  1.00 11.34 ? 278  THR A CG2   1 
ATOM   2127  N  N     . GLY A 1 279 ? 54.454  141.429 26.656  1.00 12.75 ? 279  GLY A N     1 
ATOM   2128  C  CA    . GLY A 1 279 ? 53.342  140.968 25.832  1.00 12.76 ? 279  GLY A CA    1 
ATOM   2129  C  C     . GLY A 1 279 ? 51.961  140.820 26.443  1.00 12.18 ? 279  GLY A C     1 
ATOM   2130  O  O     . GLY A 1 279 ? 51.031  141.558 26.100  1.00 12.73 ? 279  GLY A O     1 
ATOM   2131  N  N     . GLY A 1 280 ? 51.813  139.839 27.323  1.00 11.37 ? 280  GLY A N     1 
ATOM   2132  C  CA    . GLY A 1 280 ? 50.532  139.613 27.960  1.00 12.43 ? 280  GLY A CA    1 
ATOM   2133  C  C     . GLY A 1 280 ? 50.028  140.849 28.675  1.00 12.06 ? 280  GLY A C     1 
ATOM   2134  O  O     . GLY A 1 280 ? 48.844  141.187 28.598  1.00 13.13 ? 280  GLY A O     1 
ATOM   2135  N  N     . TYR A 1 281 ? 50.930  141.533 29.371  1.00 12.72 ? 281  TYR A N     1 
ATOM   2136  C  CA    . TYR A 1 281 ? 50.554  142.735 30.104  1.00 11.95 ? 281  TYR A CA    1 
ATOM   2137  C  C     . TYR A 1 281 ? 49.889  143.787 29.216  1.00 11.83 ? 281  TYR A C     1 
ATOM   2138  O  O     . TYR A 1 281 ? 48.818  144.300 29.549  1.00 11.05 ? 281  TYR A O     1 
ATOM   2139  C  CB    . TYR A 1 281 ? 51.780  143.361 30.782  1.00 11.86 ? 281  TYR A CB    1 
ATOM   2140  C  CG    . TYR A 1 281 ? 51.483  144.727 31.349  1.00 12.44 ? 281  TYR A CG    1 
ATOM   2141  C  CD1   . TYR A 1 281 ? 50.732  144.870 32.514  1.00 11.84 ? 281  TYR A CD1   1 
ATOM   2142  C  CD2   . TYR A 1 281 ? 51.850  145.882 30.651  1.00 10.91 ? 281  TYR A CD2   1 
ATOM   2143  C  CE1   . TYR A 1 281 ? 50.339  146.139 32.969  1.00 11.26 ? 281  TYR A CE1   1 
ATOM   2144  C  CE2   . TYR A 1 281 ? 51.464  147.146 31.094  1.00 9.96  ? 281  TYR A CE2   1 
ATOM   2145  C  CZ    . TYR A 1 281 ? 50.708  147.266 32.246  1.00 10.23 ? 281  TYR A CZ    1 
ATOM   2146  O  OH    . TYR A 1 281 ? 50.297  148.515 32.656  1.00 9.98  ? 281  TYR A OH    1 
ATOM   2147  N  N     . LEU A 1 282 ? 50.530  144.110 28.095  1.00 10.69 ? 282  LEU A N     1 
ATOM   2148  C  CA    . LEU A 1 282 ? 50.002  145.131 27.193  1.00 10.56 ? 282  LEU A CA    1 
ATOM   2149  C  C     . LEU A 1 282 ? 48.734  144.663 26.477  1.00 11.59 ? 282  LEU A C     1 
ATOM   2150  O  O     . LEU A 1 282 ? 47.813  145.454 26.266  1.00 9.86  ? 282  LEU A O     1 
ATOM   2151  C  CB    . LEU A 1 282 ? 51.078  145.557 26.184  1.00 10.06 ? 282  LEU A CB    1 
ATOM   2152  C  CG    . LEU A 1 282 ? 50.790  146.849 25.400  1.00 9.31  ? 282  LEU A CG    1 
ATOM   2153  C  CD1   . LEU A 1 282 ? 50.457  147.992 26.366  1.00 8.61  ? 282  LEU A CD1   1 
ATOM   2154  C  CD2   . LEU A 1 282 ? 52.009  147.199 24.556  1.00 11.98 ? 282  LEU A CD2   1 
ATOM   2155  N  N     . VAL A 1 283 ? 48.679  143.384 26.111  1.00 11.58 ? 283  VAL A N     1 
ATOM   2156  C  CA    . VAL A 1 283 ? 47.485  142.849 25.465  1.00 10.84 ? 283  VAL A CA    1 
ATOM   2157  C  C     . VAL A 1 283 ? 46.326  142.976 26.449  1.00 10.31 ? 283  VAL A C     1 
ATOM   2158  O  O     . VAL A 1 283 ? 45.236  143.417 26.090  1.00 11.78 ? 283  VAL A O     1 
ATOM   2159  C  CB    . VAL A 1 283 ? 47.632  141.342 25.104  1.00 12.66 ? 283  VAL A CB    1 
ATOM   2160  C  CG1   . VAL A 1 283 ? 46.254  140.739 24.798  1.00 11.14 ? 283  VAL A CG1   1 
ATOM   2161  C  CG2   . VAL A 1 283 ? 48.557  141.174 23.905  1.00 9.18  ? 283  VAL A CG2   1 
ATOM   2162  N  N     . TYR A 1 284 ? 46.574  142.606 27.699  1.00 10.19 ? 284  TYR A N     1 
ATOM   2163  C  CA    . TYR A 1 284 ? 45.528  142.648 28.716  1.00 11.85 ? 284  TYR A CA    1 
ATOM   2164  C  C     . TYR A 1 284 ? 45.090  144.068 29.076  1.00 12.22 ? 284  TYR A C     1 
ATOM   2165  O  O     . TYR A 1 284 ? 43.904  144.319 29.275  1.00 11.49 ? 284  TYR A O     1 
ATOM   2166  C  CB    . TYR A 1 284 ? 45.988  141.884 29.966  1.00 10.62 ? 284  TYR A CB    1 
ATOM   2167  C  CG    . TYR A 1 284 ? 44.846  141.377 30.824  1.00 10.22 ? 284  TYR A CG    1 
ATOM   2168  C  CD1   . TYR A 1 284 ? 44.559  141.961 32.061  1.00 10.73 ? 284  TYR A CD1   1 
ATOM   2169  C  CD2   . TYR A 1 284 ? 44.025  140.339 30.377  1.00 11.91 ? 284  TYR A CD2   1 
ATOM   2170  C  CE1   . TYR A 1 284 ? 43.474  141.526 32.833  1.00 11.32 ? 284  TYR A CE1   1 
ATOM   2171  C  CE2   . TYR A 1 284 ? 42.938  139.897 31.139  1.00 11.90 ? 284  TYR A CE2   1 
ATOM   2172  C  CZ    . TYR A 1 284 ? 42.669  140.497 32.361  1.00 12.39 ? 284  TYR A CZ    1 
ATOM   2173  O  OH    . TYR A 1 284 ? 41.581  140.089 33.096  1.00 13.83 ? 284  TYR A OH    1 
ATOM   2174  N  N     . ALA A 1 285 ? 46.038  144.999 29.149  1.00 10.37 ? 285  ALA A N     1 
ATOM   2175  C  CA    . ALA A 1 285 ? 45.711  146.382 29.488  1.00 11.29 ? 285  ALA A CA    1 
ATOM   2176  C  C     . ALA A 1 285 ? 44.894  147.047 28.380  1.00 12.00 ? 285  ALA A C     1 
ATOM   2177  O  O     . ALA A 1 285 ? 43.921  147.755 28.649  1.00 12.44 ? 285  ALA A O     1 
ATOM   2178  C  CB    . ALA A 1 285 ? 46.992  147.179 29.749  1.00 11.61 ? 285  ALA A CB    1 
ATOM   2179  N  N     . ALA A 1 286 ? 45.284  146.809 27.133  1.00 11.96 ? 286  ALA A N     1 
ATOM   2180  C  CA    . ALA A 1 286 ? 44.578  147.391 25.997  1.00 11.72 ? 286  ALA A CA    1 
ATOM   2181  C  C     . ALA A 1 286 ? 43.193  146.771 25.833  1.00 12.66 ? 286  ALA A C     1 
ATOM   2182  O  O     . ALA A 1 286 ? 42.219  147.463 25.524  1.00 12.63 ? 286  ALA A O     1 
ATOM   2183  C  CB    . ALA A 1 286 ? 45.392  147.190 24.716  1.00 12.33 ? 286  ALA A CB    1 
ATOM   2184  N  N     . THR A 1 287 ? 43.106  145.463 26.045  1.00 10.84 ? 287  THR A N     1 
ATOM   2185  C  CA    . THR A 1 287 ? 41.835  144.764 25.893  1.00 11.85 ? 287  THR A CA    1 
ATOM   2186  C  C     . THR A 1 287 ? 40.826  145.173 26.966  1.00 12.33 ? 287  THR A C     1 
ATOM   2187  O  O     . THR A 1 287 ? 39.668  145.456 26.660  1.00 11.69 ? 287  THR A O     1 
ATOM   2188  C  CB    . THR A 1 287 ? 42.051  143.242 25.934  1.00 12.57 ? 287  THR A CB    1 
ATOM   2189  O  OG1   . THR A 1 287 ? 42.912  142.862 24.853  1.00 14.01 ? 287  THR A OG1   1 
ATOM   2190  C  CG2   . THR A 1 287 ? 40.724  142.502 25.809  1.00 12.24 ? 287  THR A CG2   1 
ATOM   2191  N  N     . THR A 1 288 ? 41.268  145.198 28.220  1.00 11.24 ? 288  THR A N     1 
ATOM   2192  C  CA    . THR A 1 288 ? 40.397  145.586 29.322  1.00 12.43 ? 288  THR A CA    1 
ATOM   2193  C  C     . THR A 1 288 ? 39.984  147.056 29.190  1.00 11.19 ? 288  THR A C     1 
ATOM   2194  O  O     . THR A 1 288 ? 38.819  147.400 29.381  1.00 10.56 ? 288  THR A O     1 
ATOM   2195  C  CB    . THR A 1 288 ? 41.092  145.373 30.690  1.00 10.59 ? 288  THR A CB    1 
ATOM   2196  O  OG1   . THR A 1 288 ? 42.416  145.912 30.644  1.00 10.63 ? 288  THR A OG1   1 
ATOM   2197  C  CG2   . THR A 1 288 ? 41.173  143.887 31.029  1.00 12.51 ? 288  THR A CG2   1 
ATOM   2198  N  N     . PHE A 1 289 ? 40.934  147.927 28.866  1.00 11.06 ? 289  PHE A N     1 
ATOM   2199  C  CA    . PHE A 1 289 ? 40.620  149.347 28.715  1.00 10.39 ? 289  PHE A CA    1 
ATOM   2200  C  C     . PHE A 1 289 ? 39.530  149.556 27.660  1.00 13.20 ? 289  PHE A C     1 
ATOM   2201  O  O     . PHE A 1 289 ? 38.513  150.217 27.902  1.00 12.31 ? 289  PHE A O     1 
ATOM   2202  C  CB    . PHE A 1 289 ? 41.871  150.129 28.290  1.00 9.91  ? 289  PHE A CB    1 
ATOM   2203  C  CG    . PHE A 1 289 ? 41.574  151.521 27.809  1.00 11.31 ? 289  PHE A CG    1 
ATOM   2204  C  CD1   . PHE A 1 289 ? 41.358  152.555 28.715  1.00 11.20 ? 289  PHE A CD1   1 
ATOM   2205  C  CD2   . PHE A 1 289 ? 41.450  151.786 26.446  1.00 11.20 ? 289  PHE A CD2   1 
ATOM   2206  C  CE1   . PHE A 1 289 ? 41.017  153.837 28.272  1.00 11.28 ? 289  PHE A CE1   1 
ATOM   2207  C  CE2   . PHE A 1 289 ? 41.108  153.058 25.989  1.00 12.04 ? 289  PHE A CE2   1 
ATOM   2208  C  CZ    . PHE A 1 289 ? 40.890  154.090 26.907  1.00 12.99 ? 289  PHE A CZ    1 
ATOM   2209  N  N     . LYS A 1 290 ? 39.758  148.984 26.483  1.00 12.60 ? 290  LYS A N     1 
ATOM   2210  C  CA    . LYS A 1 290 ? 38.837  149.121 25.363  1.00 13.62 ? 290  LYS A CA    1 
ATOM   2211  C  C     . LYS A 1 290 ? 37.413  148.640 25.631  1.00 12.81 ? 290  LYS A C     1 
ATOM   2212  O  O     . LYS A 1 290 ? 36.450  149.378 25.419  1.00 14.09 ? 290  LYS A O     1 
ATOM   2213  C  CB    . LYS A 1 290 ? 39.410  148.380 24.155  1.00 14.58 ? 290  LYS A CB    1 
ATOM   2214  C  CG    . LYS A 1 290 ? 38.618  148.521 22.860  1.00 19.96 ? 290  LYS A CG    1 
ATOM   2215  C  CD    . LYS A 1 290 ? 39.352  147.777 21.753  1.00 22.25 ? 290  LYS A CD    1 
ATOM   2216  C  CE    . LYS A 1 290 ? 38.642  147.864 20.419  1.00 27.98 ? 290  LYS A CE    1 
ATOM   2217  N  NZ    . LYS A 1 290 ? 39.456  147.196 19.360  1.00 28.80 ? 290  LYS A NZ    1 
ATOM   2218  N  N     . TYR A 1 291 ? 37.279  147.406 26.098  1.00 14.21 ? 291  TYR A N     1 
ATOM   2219  C  CA    . TYR A 1 291 ? 35.964  146.831 26.346  1.00 12.66 ? 291  TYR A CA    1 
ATOM   2220  C  C     . TYR A 1 291 ? 35.248  147.314 27.597  1.00 13.49 ? 291  TYR A C     1 
ATOM   2221  O  O     . TYR A 1 291 ? 34.029  147.490 27.581  1.00 14.04 ? 291  TYR A O     1 
ATOM   2222  C  CB    . TYR A 1 291 ? 36.068  145.306 26.358  1.00 15.49 ? 291  TYR A CB    1 
ATOM   2223  C  CG    . TYR A 1 291 ? 36.437  144.739 25.006  1.00 17.27 ? 291  TYR A CG    1 
ATOM   2224  C  CD1   . TYR A 1 291 ? 37.318  143.664 24.894  1.00 22.78 ? 291  TYR A CD1   1 
ATOM   2225  C  CD2   . TYR A 1 291 ? 35.918  145.291 23.834  1.00 19.87 ? 291  TYR A CD2   1 
ATOM   2226  C  CE1   . TYR A 1 291 ? 37.677  143.155 23.646  1.00 24.61 ? 291  TYR A CE1   1 
ATOM   2227  C  CE2   . TYR A 1 291 ? 36.267  144.792 22.583  1.00 22.60 ? 291  TYR A CE2   1 
ATOM   2228  C  CZ    . TYR A 1 291 ? 37.148  143.725 22.495  1.00 25.71 ? 291  TYR A CZ    1 
ATOM   2229  O  OH    . TYR A 1 291 ? 37.499  143.232 21.260  1.00 27.98 ? 291  TYR A OH    1 
ATOM   2230  N  N     . VAL A 1 292 ? 35.988  147.548 28.675  1.00 11.77 ? 292  VAL A N     1 
ATOM   2231  C  CA    . VAL A 1 292 ? 35.351  148.000 29.907  1.00 13.16 ? 292  VAL A CA    1 
ATOM   2232  C  C     . VAL A 1 292 ? 34.940  149.469 29.844  1.00 13.02 ? 292  VAL A C     1 
ATOM   2233  O  O     . VAL A 1 292 ? 33.920  149.852 30.410  1.00 12.98 ? 292  VAL A O     1 
ATOM   2234  C  CB    . VAL A 1 292 ? 36.260  147.737 31.127  1.00 12.26 ? 292  VAL A CB    1 
ATOM   2235  C  CG1   . VAL A 1 292 ? 35.642  148.325 32.393  1.00 12.35 ? 292  VAL A CG1   1 
ATOM   2236  C  CG2   . VAL A 1 292 ? 36.446  146.232 31.293  1.00 13.57 ? 292  VAL A CG2   1 
ATOM   2237  N  N     . PHE A 1 293 ? 35.717  150.301 29.159  1.00 12.75 ? 293  PHE A N     1 
ATOM   2238  C  CA    . PHE A 1 293 ? 35.338  151.704 29.057  1.00 12.30 ? 293  PHE A CA    1 
ATOM   2239  C  C     . PHE A 1 293 ? 34.591  151.953 27.745  1.00 13.93 ? 293  PHE A C     1 
ATOM   2240  O  O     . PHE A 1 293 ? 34.179  153.080 27.448  1.00 14.57 ? 293  PHE A O     1 
ATOM   2241  C  CB    . PHE A 1 293 ? 36.575  152.606 29.173  1.00 13.84 ? 293  PHE A CB    1 
ATOM   2242  C  CG    . PHE A 1 293 ? 37.210  152.584 30.541  1.00 12.73 ? 293  PHE A CG    1 
ATOM   2243  C  CD1   . PHE A 1 293 ? 38.505  152.105 30.721  1.00 12.96 ? 293  PHE A CD1   1 
ATOM   2244  C  CD2   . PHE A 1 293 ? 36.495  153.012 31.656  1.00 12.41 ? 293  PHE A CD2   1 
ATOM   2245  C  CE1   . PHE A 1 293 ? 39.080  152.051 31.997  1.00 14.67 ? 293  PHE A CE1   1 
ATOM   2246  C  CE2   . PHE A 1 293 ? 37.055  152.964 32.932  1.00 12.93 ? 293  PHE A CE2   1 
ATOM   2247  C  CZ    . PHE A 1 293 ? 38.353  152.481 33.105  1.00 12.65 ? 293  PHE A CZ    1 
ATOM   2248  N  N     . ASP A 1 294 ? 34.410  150.884 26.971  1.00 14.36 ? 294  ASP A N     1 
ATOM   2249  C  CA    . ASP A 1 294 ? 33.709  150.942 25.690  1.00 14.81 ? 294  ASP A CA    1 
ATOM   2250  C  C     . ASP A 1 294 ? 34.298  152.056 24.833  1.00 15.04 ? 294  ASP A C     1 
ATOM   2251  O  O     . ASP A 1 294 ? 33.573  152.860 24.253  1.00 13.87 ? 294  ASP A O     1 
ATOM   2252  C  CB    . ASP A 1 294 ? 32.215  151.209 25.915  1.00 14.06 ? 294  ASP A CB    1 
ATOM   2253  C  CG    . ASP A 1 294 ? 31.376  150.852 24.706  1.00 15.02 ? 294  ASP A CG    1 
ATOM   2254  O  OD1   . ASP A 1 294 ? 30.515  151.665 24.307  1.00 14.97 ? 294  ASP A OD1   1 
ATOM   2255  O  OD2   . ASP A 1 294 ? 31.578  149.746 24.162  1.00 15.62 ? 294  ASP A OD2   1 
ATOM   2256  N  N     . TYR A 1 295 ? 35.620  152.088 24.747  1.00 16.65 ? 295  TYR A N     1 
ATOM   2257  C  CA    . TYR A 1 295 ? 36.301  153.133 24.001  1.00 16.98 ? 295  TYR A CA    1 
ATOM   2258  C  C     . TYR A 1 295 ? 36.053  153.194 22.501  1.00 18.42 ? 295  TYR A C     1 
ATOM   2259  O  O     . TYR A 1 295 ? 36.210  152.200 21.785  1.00 17.18 ? 295  TYR A O     1 
ATOM   2260  C  CB    . TYR A 1 295 ? 37.808  153.049 24.243  1.00 19.94 ? 295  TYR A CB    1 
ATOM   2261  C  CG    . TYR A 1 295 ? 38.581  154.001 23.369  1.00 19.45 ? 295  TYR A CG    1 
ATOM   2262  C  CD1   . TYR A 1 295 ? 38.633  155.360 23.661  1.00 21.11 ? 295  TYR A CD1   1 
ATOM   2263  C  CD2   . TYR A 1 295 ? 39.191  153.551 22.203  1.00 21.63 ? 295  TYR A CD2   1 
ATOM   2264  C  CE1   . TYR A 1 295 ? 39.273  156.253 22.804  1.00 22.52 ? 295  TYR A CE1   1 
ATOM   2265  C  CE2   . TYR A 1 295 ? 39.827  154.425 21.343  1.00 23.78 ? 295  TYR A CE2   1 
ATOM   2266  C  CZ    . TYR A 1 295 ? 39.866  155.774 21.646  1.00 22.13 ? 295  TYR A CZ    1 
ATOM   2267  O  OH    . TYR A 1 295 ? 40.502  156.625 20.773  1.00 26.54 ? 295  TYR A OH    1 
ATOM   2268  N  N     . HIS A 1 296 ? 35.678  154.385 22.035  1.00 18.49 ? 296  HIS A N     1 
ATOM   2269  C  CA    . HIS A 1 296 ? 35.447  154.643 20.617  1.00 18.88 ? 296  HIS A CA    1 
ATOM   2270  C  C     . HIS A 1 296 ? 36.397  155.763 20.218  1.00 19.38 ? 296  HIS A C     1 
ATOM   2271  O  O     . HIS A 1 296 ? 36.657  156.676 21.007  1.00 18.14 ? 296  HIS A O     1 
ATOM   2272  C  CB    . HIS A 1 296 ? 34.013  155.110 20.352  1.00 18.85 ? 296  HIS A CB    1 
ATOM   2273  C  CG    . HIS A 1 296 ? 32.991  154.022 20.436  1.00 21.32 ? 296  HIS A CG    1 
ATOM   2274  N  ND1   . HIS A 1 296 ? 32.700  153.361 21.609  1.00 22.02 ? 296  HIS A ND1   1 
ATOM   2275  C  CD2   . HIS A 1 296 ? 32.185  153.483 19.490  1.00 22.59 ? 296  HIS A CD2   1 
ATOM   2276  C  CE1   . HIS A 1 296 ? 31.758  152.463 21.384  1.00 24.19 ? 296  HIS A CE1   1 
ATOM   2277  N  NE2   . HIS A 1 296 ? 31.428  152.516 20.105  1.00 25.00 ? 296  HIS A NE2   1 
ATOM   2278  N  N     . PRO A 1 297 ? 36.939  155.705 18.995  1.00 19.79 ? 297  PRO A N     1 
ATOM   2279  C  CA    . PRO A 1 297 ? 37.851  156.774 18.592  1.00 21.11 ? 297  PRO A CA    1 
ATOM   2280  C  C     . PRO A 1 297 ? 37.229  158.141 18.828  1.00 20.40 ? 297  PRO A C     1 
ATOM   2281  O  O     . PRO A 1 297 ? 36.048  158.361 18.539  1.00 19.20 ? 297  PRO A O     1 
ATOM   2282  C  CB    . PRO A 1 297 ? 38.116  156.476 17.111  1.00 22.93 ? 297  PRO A CB    1 
ATOM   2283  C  CG    . PRO A 1 297 ? 36.990  155.566 16.704  1.00 25.30 ? 297  PRO A CG    1 
ATOM   2284  C  CD    . PRO A 1 297 ? 36.780  154.716 17.918  1.00 22.11 ? 297  PRO A CD    1 
ATOM   2285  N  N     . GLY A 1 298 ? 38.027  159.046 19.383  1.00 21.48 ? 298  GLY A N     1 
ATOM   2286  C  CA    . GLY A 1 298 ? 37.549  160.384 19.661  1.00 20.12 ? 298  GLY A CA    1 
ATOM   2287  C  C     . GLY A 1 298 ? 37.144  160.591 21.107  1.00 21.09 ? 298  GLY A C     1 
ATOM   2288  O  O     . GLY A 1 298 ? 37.088  161.729 21.573  1.00 22.04 ? 298  GLY A O     1 
ATOM   2289  N  N     . ASP A 1 299 ? 36.862  159.507 21.826  1.00 17.62 ? 299  ASP A N     1 
ATOM   2290  C  CA    . ASP A 1 299 ? 36.459  159.633 23.222  1.00 17.92 ? 299  ASP A CA    1 
ATOM   2291  C  C     . ASP A 1 299 ? 37.554  160.280 24.053  1.00 17.98 ? 299  ASP A C     1 
ATOM   2292  O  O     . ASP A 1 299 ? 38.740  159.977 23.882  1.00 20.25 ? 299  ASP A O     1 
ATOM   2293  C  CB    . ASP A 1 299 ? 36.131  158.265 23.833  1.00 17.58 ? 299  ASP A CB    1 
ATOM   2294  C  CG    . ASP A 1 299 ? 34.816  157.690 23.335  1.00 18.63 ? 299  ASP A CG    1 
ATOM   2295  O  OD1   . ASP A 1 299 ? 34.003  158.436 22.745  1.00 18.33 ? 299  ASP A OD1   1 
ATOM   2296  O  OD2   . ASP A 1 299 ? 34.588  156.481 23.554  1.00 18.63 ? 299  ASP A OD2   1 
ATOM   2297  N  N     . ILE A 1 300 ? 37.163  161.184 24.945  1.00 16.05 ? 300  ILE A N     1 
ATOM   2298  C  CA    . ILE A 1 300 ? 38.130  161.835 25.824  1.00 14.11 ? 300  ILE A CA    1 
ATOM   2299  C  C     . ILE A 1 300 ? 38.054  161.062 27.131  1.00 14.31 ? 300  ILE A C     1 
ATOM   2300  O  O     . ILE A 1 300 ? 37.014  161.057 27.795  1.00 14.07 ? 300  ILE A O     1 
ATOM   2301  C  CB    . ILE A 1 300 ? 37.774  163.304 26.093  1.00 14.79 ? 300  ILE A CB    1 
ATOM   2302  C  CG1   . ILE A 1 300 ? 37.694  164.074 24.769  1.00 16.06 ? 300  ILE A CG1   1 
ATOM   2303  C  CG2   . ILE A 1 300 ? 38.818  163.924 27.017  1.00 13.14 ? 300  ILE A CG2   1 
ATOM   2304  C  CD1   . ILE A 1 300 ? 38.921  163.912 23.880  1.00 16.94 ? 300  ILE A CD1   1 
ATOM   2305  N  N     . TYR A 1 301 ? 39.162  160.428 27.501  1.00 12.41 ? 301  TYR A N     1 
ATOM   2306  C  CA    . TYR A 1 301 ? 39.229  159.594 28.699  1.00 12.27 ? 301  TYR A CA    1 
ATOM   2307  C  C     . TYR A 1 301 ? 40.057  160.175 29.844  1.00 12.43 ? 301  TYR A C     1 
ATOM   2308  O  O     . TYR A 1 301 ? 41.146  160.703 29.621  1.00 11.74 ? 301  TYR A O     1 
ATOM   2309  C  CB    . TYR A 1 301 ? 39.780  158.221 28.286  1.00 12.94 ? 301  TYR A CB    1 
ATOM   2310  C  CG    . TYR A 1 301 ? 40.170  157.307 29.421  1.00 11.64 ? 301  TYR A CG    1 
ATOM   2311  C  CD1   . TYR A 1 301 ? 41.483  157.277 29.897  1.00 13.11 ? 301  TYR A CD1   1 
ATOM   2312  C  CD2   . TYR A 1 301 ? 39.230  156.461 30.012  1.00 11.24 ? 301  TYR A CD2   1 
ATOM   2313  C  CE1   . TYR A 1 301 ? 41.853  156.423 30.934  1.00 10.61 ? 301  TYR A CE1   1 
ATOM   2314  C  CE2   . TYR A 1 301 ? 39.588  155.603 31.048  1.00 12.19 ? 301  TYR A CE2   1 
ATOM   2315  C  CZ    . TYR A 1 301 ? 40.903  155.591 31.502  1.00 13.11 ? 301  TYR A CZ    1 
ATOM   2316  O  OH    . TYR A 1 301 ? 41.263  154.738 32.516  1.00 14.14 ? 301  TYR A OH    1 
ATOM   2317  N  N     . TRP A 1 302 ? 39.545  160.069 31.073  1.00 12.06 ? 302  TRP A N     1 
ATOM   2318  C  CA    . TRP A 1 302 ? 40.279  160.594 32.226  1.00 13.07 ? 302  TRP A CA    1 
ATOM   2319  C  C     . TRP A 1 302 ? 40.323  159.678 33.444  1.00 13.19 ? 302  TRP A C     1 
ATOM   2320  O  O     . TRP A 1 302 ? 39.305  159.442 34.089  1.00 14.47 ? 302  TRP A O     1 
ATOM   2321  C  CB    . TRP A 1 302 ? 39.712  161.961 32.653  1.00 12.34 ? 302  TRP A CB    1 
ATOM   2322  C  CG    . TRP A 1 302 ? 40.441  162.570 33.836  1.00 13.40 ? 302  TRP A CG    1 
ATOM   2323  C  CD1   . TRP A 1 302 ? 41.725  162.310 34.230  1.00 13.09 ? 302  TRP A CD1   1 
ATOM   2324  C  CD2   . TRP A 1 302 ? 39.930  163.543 34.764  1.00 13.03 ? 302  TRP A CD2   1 
ATOM   2325  N  NE1   . TRP A 1 302 ? 42.044  163.054 35.345  1.00 12.16 ? 302  TRP A NE1   1 
ATOM   2326  C  CE2   . TRP A 1 302 ? 40.964  163.821 35.692  1.00 14.21 ? 302  TRP A CE2   1 
ATOM   2327  C  CE3   . TRP A 1 302 ? 38.702  164.205 34.901  1.00 14.91 ? 302  TRP A CE3   1 
ATOM   2328  C  CZ2   . TRP A 1 302 ? 40.808  164.737 36.744  1.00 13.14 ? 302  TRP A CZ2   1 
ATOM   2329  C  CZ3   . TRP A 1 302 ? 38.545  165.118 35.953  1.00 13.75 ? 302  TRP A CZ3   1 
ATOM   2330  C  CH2   . TRP A 1 302 ? 39.593  165.373 36.857  1.00 13.41 ? 302  TRP A CH2   1 
ATOM   2331  N  N     . CYS A 1 303 ? 41.514  159.159 33.739  1.00 13.49 ? 303  CYS A N     1 
ATOM   2332  C  CA    . CYS A 1 303 ? 41.751  158.314 34.908  1.00 12.32 ? 303  CYS A CA    1 
ATOM   2333  C  C     . CYS A 1 303 ? 42.434  159.238 35.918  1.00 11.76 ? 303  CYS A C     1 
ATOM   2334  O  O     . CYS A 1 303 ? 43.442  159.859 35.602  1.00 12.83 ? 303  CYS A O     1 
ATOM   2335  C  CB    . CYS A 1 303 ? 42.688  157.149 34.565  1.00 12.07 ? 303  CYS A CB    1 
ATOM   2336  S  SG    . CYS A 1 303 ? 43.332  156.276 36.023  1.00 14.25 ? 303  CYS A SG    1 
ATOM   2337  N  N     . THR A 1 304 ? 41.885  159.334 37.126  1.00 13.34 ? 304  THR A N     1 
ATOM   2338  C  CA    . THR A 1 304 ? 42.446  160.224 38.141  1.00 13.12 ? 304  THR A CA    1 
ATOM   2339  C  C     . THR A 1 304 ? 43.590  159.628 38.954  1.00 13.93 ? 304  THR A C     1 
ATOM   2340  O  O     . THR A 1 304 ? 44.254  160.345 39.699  1.00 13.95 ? 304  THR A O     1 
ATOM   2341  C  CB    . THR A 1 304 ? 41.349  160.702 39.130  1.00 12.00 ? 304  THR A CB    1 
ATOM   2342  O  OG1   . THR A 1 304 ? 40.874  159.594 39.902  1.00 12.83 ? 304  THR A OG1   1 
ATOM   2343  C  CG2   . THR A 1 304 ? 40.174  161.305 38.370  1.00 13.13 ? 304  THR A CG2   1 
ATOM   2344  N  N     . ALA A 1 305 ? 43.826  158.328 38.801  1.00 14.27 ? 305  ALA A N     1 
ATOM   2345  C  CA    . ALA A 1 305 ? 44.876  157.639 39.553  1.00 13.83 ? 305  ALA A CA    1 
ATOM   2346  C  C     . ALA A 1 305 ? 46.279  158.146 39.243  1.00 13.47 ? 305  ALA A C     1 
ATOM   2347  O  O     . ALA A 1 305 ? 46.611  158.445 38.092  1.00 11.86 ? 305  ALA A O     1 
ATOM   2348  C  CB    . ALA A 1 305 ? 44.801  156.135 39.300  1.00 14.76 ? 305  ALA A CB    1 
ATOM   2349  N  N     . ASP A 1 306 ? 47.106  158.228 40.283  1.00 12.50 ? 306  ASP A N     1 
ATOM   2350  C  CA    . ASP A 1 306 ? 48.470  158.707 40.124  1.00 13.12 ? 306  ASP A CA    1 
ATOM   2351  C  C     . ASP A 1 306 ? 49.284  157.746 39.278  1.00 12.95 ? 306  ASP A C     1 
ATOM   2352  O  O     . ASP A 1 306 ? 49.094  156.530 39.331  1.00 11.81 ? 306  ASP A O     1 
ATOM   2353  C  CB    . ASP A 1 306 ? 49.136  158.888 41.491  1.00 12.98 ? 306  ASP A CB    1 
ATOM   2354  C  CG    . ASP A 1 306 ? 50.391  159.753 41.422  1.00 14.17 ? 306  ASP A CG    1 
ATOM   2355  O  OD1   . ASP A 1 306 ? 51.493  159.211 41.195  1.00 11.74 ? 306  ASP A OD1   1 
ATOM   2356  O  OD2   . ASP A 1 306 ? 50.266  160.982 41.588  1.00 13.59 ? 306  ASP A OD2   1 
ATOM   2357  N  N     . VAL A 1 307 ? 50.190  158.310 38.493  1.00 12.77 ? 307  VAL A N     1 
ATOM   2358  C  CA    . VAL A 1 307 ? 51.060  157.527 37.631  1.00 13.75 ? 307  VAL A CA    1 
ATOM   2359  C  C     . VAL A 1 307 ? 51.925  156.569 38.457  1.00 12.73 ? 307  VAL A C     1 
ATOM   2360  O  O     . VAL A 1 307 ? 52.388  155.545 37.952  1.00 14.09 ? 307  VAL A O     1 
ATOM   2361  C  CB    . VAL A 1 307 ? 51.963  158.473 36.797  1.00 14.77 ? 307  VAL A CB    1 
ATOM   2362  C  CG1   . VAL A 1 307 ? 52.894  159.250 37.722  1.00 15.62 ? 307  VAL A CG1   1 
ATOM   2363  C  CG2   . VAL A 1 307 ? 52.738  157.688 35.758  1.00 17.42 ? 307  VAL A CG2   1 
ATOM   2364  N  N     . GLY A 1 308 ? 52.131  156.897 39.731  1.00 12.31 ? 308  GLY A N     1 
ATOM   2365  C  CA    . GLY A 1 308 ? 52.951  156.062 40.597  1.00 12.35 ? 308  GLY A CA    1 
ATOM   2366  C  C     . GLY A 1 308 ? 52.327  154.745 41.026  1.00 13.06 ? 308  GLY A C     1 
ATOM   2367  O  O     . GLY A 1 308 ? 52.999  153.902 41.627  1.00 14.38 ? 308  GLY A O     1 
ATOM   2368  N  N     . TRP A 1 309 ? 51.048  154.559 40.712  1.00 12.62 ? 309  TRP A N     1 
ATOM   2369  C  CA    . TRP A 1 309 ? 50.331  153.336 41.079  1.00 12.21 ? 309  TRP A CA    1 
ATOM   2370  C  C     . TRP A 1 309 ? 50.038  152.498 39.841  1.00 10.91 ? 309  TRP A C     1 
ATOM   2371  O  O     . TRP A 1 309 ? 50.068  153.007 38.720  1.00 12.44 ? 309  TRP A O     1 
ATOM   2372  C  CB    . TRP A 1 309 ? 49.011  153.682 41.772  1.00 11.98 ? 309  TRP A CB    1 
ATOM   2373  C  CG    . TRP A 1 309 ? 49.159  154.589 42.966  1.00 15.47 ? 309  TRP A CG    1 
ATOM   2374  C  CD1   . TRP A 1 309 ? 48.544  155.793 43.163  1.00 14.96 ? 309  TRP A CD1   1 
ATOM   2375  C  CD2   . TRP A 1 309 ? 49.942  154.342 44.141  1.00 15.13 ? 309  TRP A CD2   1 
ATOM   2376  N  NE1   . TRP A 1 309 ? 48.893  156.311 44.387  1.00 15.64 ? 309  TRP A NE1   1 
ATOM   2377  C  CE2   . TRP A 1 309 ? 49.749  155.440 45.010  1.00 16.21 ? 309  TRP A CE2   1 
ATOM   2378  C  CE3   . TRP A 1 309 ? 50.789  153.298 44.545  1.00 14.93 ? 309  TRP A CE3   1 
ATOM   2379  C  CZ2   . TRP A 1 309 ? 50.369  155.523 46.263  1.00 18.45 ? 309  TRP A CZ2   1 
ATOM   2380  C  CZ3   . TRP A 1 309 ? 51.407  153.380 45.793  1.00 15.99 ? 309  TRP A CZ3   1 
ATOM   2381  C  CH2   . TRP A 1 309 ? 51.191  154.487 46.636  1.00 18.28 ? 309  TRP A CH2   1 
ATOM   2382  N  N     . VAL A 1 310 ? 49.740  151.218 40.045  1.00 10.76 ? 310  VAL A N     1 
ATOM   2383  C  CA    . VAL A 1 310 ? 49.456  150.342 38.919  1.00 11.78 ? 310  VAL A CA    1 
ATOM   2384  C  C     . VAL A 1 310 ? 48.282  150.860 38.079  1.00 12.63 ? 310  VAL A C     1 
ATOM   2385  O  O     . VAL A 1 310 ? 48.277  150.698 36.860  1.00 11.17 ? 310  VAL A O     1 
ATOM   2386  C  CB    . VAL A 1 310 ? 49.198  148.882 39.385  1.00 11.64 ? 310  VAL A CB    1 
ATOM   2387  C  CG1   . VAL A 1 310 ? 47.880  148.779 40.145  1.00 10.64 ? 310  VAL A CG1   1 
ATOM   2388  C  CG2   . VAL A 1 310 ? 49.209  147.950 38.175  1.00 13.03 ? 310  VAL A CG2   1 
ATOM   2389  N  N     . THR A 1 311 ? 47.300  151.502 38.711  1.00 11.91 ? 311  THR A N     1 
ATOM   2390  C  CA    . THR A 1 311 ? 46.167  152.030 37.952  1.00 12.27 ? 311  THR A CA    1 
ATOM   2391  C  C     . THR A 1 311 ? 46.651  153.088 36.968  1.00 12.52 ? 311  THR A C     1 
ATOM   2392  O  O     . THR A 1 311 ? 46.140  153.196 35.852  1.00 11.78 ? 311  THR A O     1 
ATOM   2393  C  CB    . THR A 1 311 ? 45.105  152.646 38.874  1.00 14.83 ? 311  THR A CB    1 
ATOM   2394  O  OG1   . THR A 1 311 ? 44.643  151.644 39.784  1.00 15.66 ? 311  THR A OG1   1 
ATOM   2395  C  CG2   . THR A 1 311 ? 43.913  153.156 38.059  1.00 14.63 ? 311  THR A CG2   1 
ATOM   2396  N  N     . GLY A 1 312 ? 47.636  153.874 37.393  1.00 11.90 ? 312  GLY A N     1 
ATOM   2397  C  CA    . GLY A 1 312 ? 48.196  154.893 36.526  1.00 11.25 ? 312  GLY A CA    1 
ATOM   2398  C  C     . GLY A 1 312 ? 48.970  154.250 35.387  1.00 12.38 ? 312  GLY A C     1 
ATOM   2399  O  O     . GLY A 1 312 ? 48.900  154.709 34.251  1.00 15.83 ? 312  GLY A O     1 
ATOM   2400  N  N     . HIS A 1 313 ? 49.709  153.183 35.673  1.00 11.06 ? 313  HIS A N     1 
ATOM   2401  C  CA    . HIS A 1 313 ? 50.469  152.519 34.612  1.00 10.63 ? 313  HIS A CA    1 
ATOM   2402  C  C     . HIS A 1 313 ? 49.538  151.926 33.558  1.00 11.03 ? 313  HIS A C     1 
ATOM   2403  O  O     . HIS A 1 313 ? 49.656  152.221 32.370  1.00 12.60 ? 313  HIS A O     1 
ATOM   2404  C  CB    . HIS A 1 313 ? 51.338  151.379 35.164  1.00 10.00 ? 313  HIS A CB    1 
ATOM   2405  C  CG    . HIS A 1 313 ? 52.501  151.838 35.985  1.00 13.12 ? 313  HIS A CG    1 
ATOM   2406  N  ND1   . HIS A 1 313 ? 53.672  151.116 36.087  1.00 14.28 ? 313  HIS A ND1   1 
ATOM   2407  C  CD2   . HIS A 1 313 ? 52.671  152.939 36.751  1.00 8.26  ? 313  HIS A CD2   1 
ATOM   2408  C  CE1   . HIS A 1 313 ? 54.513  151.756 36.879  1.00 10.35 ? 313  HIS A CE1   1 
ATOM   2409  N  NE2   . HIS A 1 313 ? 53.929  152.865 37.295  1.00 13.06 ? 313  HIS A NE2   1 
ATOM   2410  N  N     . SER A 1 314 ? 48.607  151.095 34.011  1.00 11.30 ? 314  SER A N     1 
ATOM   2411  C  CA    . SER A 1 314 ? 47.684  150.410 33.111  1.00 11.10 ? 314  SER A CA    1 
ATOM   2412  C  C     . SER A 1 314 ? 46.559  151.224 32.501  1.00 11.80 ? 314  SER A C     1 
ATOM   2413  O  O     . SER A 1 314 ? 46.230  151.043 31.326  1.00 10.89 ? 314  SER A O     1 
ATOM   2414  C  CB    . SER A 1 314 ? 47.062  149.208 33.824  1.00 12.77 ? 314  SER A CB    1 
ATOM   2415  O  OG    . SER A 1 314 ? 48.055  148.270 34.195  1.00 12.60 ? 314  SER A OG    1 
ATOM   2416  N  N     . TYR A 1 315 ? 45.965  152.116 33.282  1.00 11.95 ? 315  TYR A N     1 
ATOM   2417  C  CA    . TYR A 1 315 ? 44.838  152.862 32.764  1.00 12.55 ? 315  TYR A CA    1 
ATOM   2418  C  C     . TYR A 1 315 ? 44.955  154.364 32.636  1.00 13.78 ? 315  TYR A C     1 
ATOM   2419  O  O     . TYR A 1 315 ? 43.989  155.030 32.277  1.00 17.03 ? 315  TYR A O     1 
ATOM   2420  C  CB    . TYR A 1 315 ? 43.582  152.451 33.538  1.00 11.75 ? 315  TYR A CB    1 
ATOM   2421  C  CG    . TYR A 1 315 ? 43.380  150.952 33.441  1.00 12.37 ? 315  TYR A CG    1 
ATOM   2422  C  CD1   . TYR A 1 315 ? 43.770  150.103 34.481  1.00 11.33 ? 315  TYR A CD1   1 
ATOM   2423  C  CD2   . TYR A 1 315 ? 42.888  150.373 32.271  1.00 12.51 ? 315  TYR A CD2   1 
ATOM   2424  C  CE1   . TYR A 1 315 ? 43.677  148.711 34.354  1.00 10.42 ? 315  TYR A CE1   1 
ATOM   2425  C  CE2   . TYR A 1 315 ? 42.794  148.978 32.133  1.00 11.30 ? 315  TYR A CE2   1 
ATOM   2426  C  CZ    . TYR A 1 315 ? 43.187  148.161 33.177  1.00 11.85 ? 315  TYR A CZ    1 
ATOM   2427  O  OH    . TYR A 1 315 ? 43.065  146.795 33.060  1.00 12.10 ? 315  TYR A OH    1 
ATOM   2428  N  N     . LEU A 1 316 ? 46.126  154.911 32.933  1.00 12.85 ? 316  LEU A N     1 
ATOM   2429  C  CA    . LEU A 1 316 ? 46.313  156.334 32.717  1.00 12.98 ? 316  LEU A CA    1 
ATOM   2430  C  C     . LEU A 1 316 ? 47.115  156.376 31.421  1.00 13.28 ? 316  LEU A C     1 
ATOM   2431  O  O     . LEU A 1 316 ? 46.800  157.124 30.498  1.00 14.64 ? 316  LEU A O     1 
ATOM   2432  C  CB    . LEU A 1 316 ? 47.116  156.980 33.853  1.00 15.95 ? 316  LEU A CB    1 
ATOM   2433  C  CG    . LEU A 1 316 ? 47.339  158.501 33.843  1.00 22.14 ? 316  LEU A CG    1 
ATOM   2434  C  CD1   . LEU A 1 316 ? 48.134  158.911 32.621  1.00 23.71 ? 316  LEU A CD1   1 
ATOM   2435  C  CD2   . LEU A 1 316 ? 46.007  159.223 33.855  1.00 24.58 ? 316  LEU A CD2   1 
ATOM   2436  N  N     . LEU A 1 317 ? 48.121  155.511 31.333  1.00 11.19 ? 317  LEU A N     1 
ATOM   2437  C  CA    . LEU A 1 317 ? 48.993  155.513 30.174  1.00 12.84 ? 317  LEU A CA    1 
ATOM   2438  C  C     . LEU A 1 317 ? 48.961  154.381 29.158  1.00 11.84 ? 317  LEU A C     1 
ATOM   2439  O  O     . LEU A 1 317 ? 48.558  154.586 28.019  1.00 13.92 ? 317  LEU A O     1 
ATOM   2440  C  CB    . LEU A 1 317 ? 50.437  155.682 30.641  1.00 14.88 ? 317  LEU A CB    1 
ATOM   2441  C  CG    . LEU A 1 317 ? 50.775  156.983 31.370  1.00 20.04 ? 317  LEU A CG    1 
ATOM   2442  C  CD1   . LEU A 1 317 ? 52.239  156.941 31.810  1.00 19.26 ? 317  LEU A CD1   1 
ATOM   2443  C  CD2   . LEU A 1 317 ? 50.519  158.179 30.444  1.00 18.27 ? 317  LEU A CD2   1 
ATOM   2444  N  N     . TYR A 1 318 ? 49.397  153.193 29.565  1.00 12.50 ? 318  TYR A N     1 
ATOM   2445  C  CA    . TYR A 1 318 ? 49.507  152.068 28.641  1.00 10.95 ? 318  TYR A CA    1 
ATOM   2446  C  C     . TYR A 1 318 ? 48.253  151.559 27.936  1.00 12.00 ? 318  TYR A C     1 
ATOM   2447  O  O     . TYR A 1 318 ? 48.243  151.455 26.714  1.00 12.13 ? 318  TYR A O     1 
ATOM   2448  C  CB    . TYR A 1 318 ? 50.268  150.923 29.327  1.00 12.56 ? 318  TYR A CB    1 
ATOM   2449  C  CG    . TYR A 1 318 ? 51.685  151.321 29.710  1.00 12.75 ? 318  TYR A CG    1 
ATOM   2450  C  CD1   . TYR A 1 318 ? 52.425  152.187 28.898  1.00 12.30 ? 318  TYR A CD1   1 
ATOM   2451  C  CD2   . TYR A 1 318 ? 52.287  150.843 30.875  1.00 12.01 ? 318  TYR A CD2   1 
ATOM   2452  C  CE1   . TYR A 1 318 ? 53.716  152.568 29.234  1.00 13.24 ? 318  TYR A CE1   1 
ATOM   2453  C  CE2   . TYR A 1 318 ? 53.593  151.218 31.220  1.00 13.84 ? 318  TYR A CE2   1 
ATOM   2454  C  CZ    . TYR A 1 318 ? 54.296  152.082 30.390  1.00 14.02 ? 318  TYR A CZ    1 
ATOM   2455  O  OH    . TYR A 1 318 ? 55.577  152.467 30.704  1.00 15.25 ? 318  TYR A OH    1 
ATOM   2456  N  N     . GLY A 1 319 ? 47.202  151.244 28.683  1.00 11.98 ? 319  GLY A N     1 
ATOM   2457  C  CA    . GLY A 1 319 ? 45.980  150.781 28.046  1.00 13.29 ? 319  GLY A CA    1 
ATOM   2458  C  C     . GLY A 1 319 ? 45.428  151.807 27.062  1.00 14.06 ? 319  GLY A C     1 
ATOM   2459  O  O     . GLY A 1 319 ? 45.190  151.491 25.890  1.00 13.27 ? 319  GLY A O     1 
ATOM   2460  N  N     . PRO A 1 320 ? 45.221  153.058 27.503  1.00 13.31 ? 320  PRO A N     1 
ATOM   2461  C  CA    . PRO A 1 320 ? 44.689  154.079 26.595  1.00 13.78 ? 320  PRO A CA    1 
ATOM   2462  C  C     . PRO A 1 320 ? 45.560  154.400 25.381  1.00 13.56 ? 320  PRO A C     1 
ATOM   2463  O  O     . PRO A 1 320 ? 45.061  154.430 24.259  1.00 11.85 ? 320  PRO A O     1 
ATOM   2464  C  CB    . PRO A 1 320 ? 44.471  155.293 27.514  1.00 14.98 ? 320  PRO A CB    1 
ATOM   2465  C  CG    . PRO A 1 320 ? 45.409  155.056 28.646  1.00 18.85 ? 320  PRO A CG    1 
ATOM   2466  C  CD    . PRO A 1 320 ? 45.302  153.573 28.880  1.00 15.54 ? 320  PRO A CD    1 
ATOM   2467  N  N     . LEU A 1 321 ? 46.855  154.624 25.591  1.00 12.67 ? 321  LEU A N     1 
ATOM   2468  C  CA    . LEU A 1 321 ? 47.727  154.949 24.468  1.00 12.10 ? 321  LEU A CA    1 
ATOM   2469  C  C     . LEU A 1 321 ? 47.841  153.788 23.482  1.00 12.86 ? 321  LEU A C     1 
ATOM   2470  O  O     . LEU A 1 321 ? 47.906  154.005 22.270  1.00 13.06 ? 321  LEU A O     1 
ATOM   2471  C  CB    . LEU A 1 321 ? 49.114  155.375 24.967  1.00 12.19 ? 321  LEU A CB    1 
ATOM   2472  C  CG    . LEU A 1 321 ? 49.150  156.691 25.757  1.00 13.55 ? 321  LEU A CG    1 
ATOM   2473  C  CD1   . LEU A 1 321 ? 50.547  156.913 26.321  1.00 13.78 ? 321  LEU A CD1   1 
ATOM   2474  C  CD2   . LEU A 1 321 ? 48.737  157.854 24.863  1.00 14.73 ? 321  LEU A CD2   1 
ATOM   2475  N  N     . ALA A 1 322 ? 47.859  152.557 23.988  1.00 13.00 ? 322  ALA A N     1 
ATOM   2476  C  CA    . ALA A 1 322 ? 47.941  151.407 23.097  1.00 12.91 ? 322  ALA A CA    1 
ATOM   2477  C  C     . ALA A 1 322 ? 46.744  151.454 22.151  1.00 12.42 ? 322  ALA A C     1 
ATOM   2478  O  O     . ALA A 1 322 ? 46.856  151.097 20.980  1.00 12.77 ? 322  ALA A O     1 
ATOM   2479  C  CB    . ALA A 1 322 ? 47.931  150.095 23.894  1.00 12.98 ? 322  ALA A CB    1 
ATOM   2480  N  N     . CYS A 1 323 ? 45.606  151.919 22.660  1.00 11.18 ? 323  CYS A N     1 
ATOM   2481  C  CA    . CYS A 1 323 ? 44.388  151.998 21.859  1.00 12.63 ? 323  CYS A CA    1 
ATOM   2482  C  C     . CYS A 1 323 ? 44.225  153.291 21.054  1.00 13.26 ? 323  CYS A C     1 
ATOM   2483  O  O     . CYS A 1 323 ? 43.231  153.455 20.341  1.00 14.52 ? 323  CYS A O     1 
ATOM   2484  C  CB    . CYS A 1 323 ? 43.162  151.798 22.754  1.00 12.65 ? 323  CYS A CB    1 
ATOM   2485  S  SG    . CYS A 1 323 ? 42.985  150.109 23.397  1.00 14.92 ? 323  CYS A SG    1 
ATOM   2486  N  N     . GLY A 1 324 ? 45.194  154.199 21.169  1.00 11.96 ? 324  GLY A N     1 
ATOM   2487  C  CA    . GLY A 1 324 ? 45.134  155.455 20.435  1.00 12.76 ? 324  GLY A CA    1 
ATOM   2488  C  C     . GLY A 1 324 ? 44.162  156.488 20.984  1.00 13.24 ? 324  GLY A C     1 
ATOM   2489  O  O     . GLY A 1 324 ? 43.744  157.401 20.270  1.00 13.38 ? 324  GLY A O     1 
ATOM   2490  N  N     . ALA A 1 325 ? 43.815  156.361 22.258  1.00 13.07 ? 325  ALA A N     1 
ATOM   2491  C  CA    . ALA A 1 325 ? 42.877  157.283 22.891  1.00 13.67 ? 325  ALA A CA    1 
ATOM   2492  C  C     . ALA A 1 325 ? 43.535  158.584 23.335  1.00 14.81 ? 325  ALA A C     1 
ATOM   2493  O  O     . ALA A 1 325 ? 44.759  158.711 23.348  1.00 14.22 ? 325  ALA A O     1 
ATOM   2494  C  CB    . ALA A 1 325 ? 42.245  156.612 24.100  1.00 16.21 ? 325  ALA A CB    1 
ATOM   2495  N  N     . THR A 1 326 ? 42.701  159.557 23.680  1.00 14.44 ? 326  THR A N     1 
ATOM   2496  C  CA    . THR A 1 326 ? 43.197  160.816 24.207  1.00 11.88 ? 326  THR A CA    1 
ATOM   2497  C  C     . THR A 1 326 ? 43.042  160.579 25.706  1.00 12.97 ? 326  THR A C     1 
ATOM   2498  O  O     . THR A 1 326 ? 41.939  160.306 26.177  1.00 13.79 ? 326  THR A O     1 
ATOM   2499  C  CB    . THR A 1 326 ? 42.322  162.001 23.782  1.00 13.58 ? 326  THR A CB    1 
ATOM   2500  O  OG1   . THR A 1 326 ? 42.470  162.231 22.374  1.00 12.50 ? 326  THR A OG1   1 
ATOM   2501  C  CG2   . THR A 1 326 ? 42.728  163.258 24.545  1.00 13.66 ? 326  THR A CG2   1 
ATOM   2502  N  N     . THR A 1 327 ? 44.144  160.655 26.445  1.00 11.25 ? 327  THR A N     1 
ATOM   2503  C  CA    . THR A 1 327 ? 44.117  160.413 27.880  1.00 11.19 ? 327  THR A CA    1 
ATOM   2504  C  C     . THR A 1 327 ? 44.478  161.682 28.648  1.00 11.79 ? 327  THR A C     1 
ATOM   2505  O  O     . THR A 1 327 ? 45.373  162.428 28.256  1.00 13.45 ? 327  THR A O     1 
ATOM   2506  C  CB    . THR A 1 327 ? 45.072  159.237 28.242  1.00 12.02 ? 327  THR A CB    1 
ATOM   2507  O  OG1   . THR A 1 327 ? 44.790  158.778 29.569  1.00 12.07 ? 327  THR A OG1   1 
ATOM   2508  C  CG2   . THR A 1 327 ? 46.540  159.669 28.129  1.00 10.02 ? 327  THR A CG2   1 
ATOM   2509  N  N     . LEU A 1 328 ? 43.772  161.925 29.745  1.00 11.65 ? 328  LEU A N     1 
ATOM   2510  C  CA    . LEU A 1 328 ? 43.993  163.132 30.531  1.00 12.22 ? 328  LEU A CA    1 
ATOM   2511  C  C     . LEU A 1 328 ? 44.798  162.890 31.801  1.00 12.67 ? 328  LEU A C     1 
ATOM   2512  O  O     . LEU A 1 328 ? 44.474  162.021 32.605  1.00 13.55 ? 328  LEU A O     1 
ATOM   2513  C  CB    . LEU A 1 328 ? 42.634  163.767 30.873  1.00 12.45 ? 328  LEU A CB    1 
ATOM   2514  C  CG    . LEU A 1 328 ? 42.556  165.220 31.368  1.00 13.42 ? 328  LEU A CG    1 
ATOM   2515  C  CD1   . LEU A 1 328 ? 41.109  165.679 31.330  1.00 16.17 ? 328  LEU A CD1   1 
ATOM   2516  C  CD2   . LEU A 1 328 ? 43.115  165.341 32.781  1.00 13.44 ? 328  LEU A CD2   1 
ATOM   2517  N  N     . MET A 1 329 ? 45.867  163.660 31.962  1.00 12.21 ? 329  MET A N     1 
ATOM   2518  C  CA    . MET A 1 329 ? 46.700  163.563 33.147  1.00 11.92 ? 329  MET A CA    1 
ATOM   2519  C  C     . MET A 1 329 ? 46.490  164.841 33.940  1.00 10.60 ? 329  MET A C     1 
ATOM   2520  O  O     . MET A 1 329 ? 46.870  165.921 33.498  1.00 11.82 ? 329  MET A O     1 
ATOM   2521  C  CB    . MET A 1 329 ? 48.181  163.437 32.780  1.00 13.22 ? 329  MET A CB    1 
ATOM   2522  C  CG    . MET A 1 329 ? 49.096  163.461 34.003  1.00 14.59 ? 329  MET A CG    1 
ATOM   2523  S  SD    . MET A 1 329 ? 50.858  163.463 33.596  1.00 16.34 ? 329  MET A SD    1 
ATOM   2524  C  CE    . MET A 1 329 ? 51.123  161.732 33.258  1.00 14.57 ? 329  MET A CE    1 
ATOM   2525  N  N     . PHE A 1 330 ? 45.872  164.707 35.106  1.00 11.26 ? 330  PHE A N     1 
ATOM   2526  C  CA    . PHE A 1 330 ? 45.607  165.841 35.978  1.00 12.57 ? 330  PHE A CA    1 
ATOM   2527  C  C     . PHE A 1 330 ? 46.717  165.927 37.023  1.00 12.30 ? 330  PHE A C     1 
ATOM   2528  O  O     . PHE A 1 330 ? 47.055  164.938 37.661  1.00 11.68 ? 330  PHE A O     1 
ATOM   2529  C  CB    . PHE A 1 330 ? 44.238  165.654 36.639  1.00 12.15 ? 330  PHE A CB    1 
ATOM   2530  C  CG    . PHE A 1 330 ? 43.895  166.708 37.649  1.00 14.36 ? 330  PHE A CG    1 
ATOM   2531  C  CD1   . PHE A 1 330 ? 44.107  168.056 37.375  1.00 13.54 ? 330  PHE A CD1   1 
ATOM   2532  C  CD2   . PHE A 1 330 ? 43.324  166.351 38.866  1.00 13.62 ? 330  PHE A CD2   1 
ATOM   2533  C  CE1   . PHE A 1 330 ? 43.752  169.039 38.306  1.00 16.06 ? 330  PHE A CE1   1 
ATOM   2534  C  CE2   . PHE A 1 330 ? 42.964  167.321 39.799  1.00 15.45 ? 330  PHE A CE2   1 
ATOM   2535  C  CZ    . PHE A 1 330 ? 43.178  168.666 39.520  1.00 13.29 ? 330  PHE A CZ    1 
ATOM   2536  N  N     . GLU A 1 331 ? 47.284  167.116 37.190  1.00 11.83 ? 331  GLU A N     1 
ATOM   2537  C  CA    . GLU A 1 331 ? 48.380  167.308 38.135  1.00 12.04 ? 331  GLU A CA    1 
ATOM   2538  C  C     . GLU A 1 331 ? 47.978  167.395 39.610  1.00 12.79 ? 331  GLU A C     1 
ATOM   2539  O  O     . GLU A 1 331 ? 48.751  166.997 40.483  1.00 13.42 ? 331  GLU A O     1 
ATOM   2540  C  CB    . GLU A 1 331 ? 49.164  168.572 37.753  1.00 12.22 ? 331  GLU A CB    1 
ATOM   2541  C  CG    . GLU A 1 331 ? 50.339  168.905 38.679  1.00 12.94 ? 331  GLU A CG    1 
ATOM   2542  C  CD    . GLU A 1 331 ? 51.088  170.146 38.239  1.00 14.56 ? 331  GLU A CD    1 
ATOM   2543  O  OE1   . GLU A 1 331 ? 50.431  171.184 38.007  1.00 14.16 ? 331  GLU A OE1   1 
ATOM   2544  O  OE2   . GLU A 1 331 ? 52.333  170.086 38.130  1.00 15.44 ? 331  GLU A OE2   1 
ATOM   2545  N  N     . GLY A 1 332 ? 46.770  167.884 39.889  1.00 12.61 ? 332  GLY A N     1 
ATOM   2546  C  CA    . GLY A 1 332 ? 46.360  168.061 41.278  1.00 14.35 ? 332  GLY A CA    1 
ATOM   2547  C  C     . GLY A 1 332 ? 45.386  167.114 41.952  1.00 14.76 ? 332  GLY A C     1 
ATOM   2548  O  O     . GLY A 1 332 ? 45.482  165.891 41.828  1.00 15.12 ? 332  GLY A O     1 
ATOM   2549  N  N     . VAL A 1 333 ? 44.458  167.695 42.710  1.00 16.14 ? 333  VAL A N     1 
ATOM   2550  C  CA    . VAL A 1 333 ? 43.449  166.923 43.433  1.00 16.40 ? 333  VAL A CA    1 
ATOM   2551  C  C     . VAL A 1 333 ? 42.039  167.334 43.004  1.00 15.55 ? 333  VAL A C     1 
ATOM   2552  O  O     . VAL A 1 333 ? 41.798  168.486 42.632  1.00 14.15 ? 333  VAL A O     1 
ATOM   2553  C  CB    . VAL A 1 333 ? 43.593  167.097 44.972  1.00 15.33 ? 333  VAL A CB    1 
ATOM   2554  C  CG1   . VAL A 1 333 ? 44.954  166.603 45.427  1.00 18.00 ? 333  VAL A CG1   1 
ATOM   2555  C  CG2   . VAL A 1 333 ? 43.408  168.559 45.353  1.00 19.41 ? 333  VAL A CG2   1 
ATOM   2556  N  N     . PRO A 1 334 ? 41.088  166.387 43.053  1.00 16.89 ? 334  PRO A N     1 
ATOM   2557  C  CA    . PRO A 1 334 ? 39.682  166.568 42.677  1.00 18.72 ? 334  PRO A CA    1 
ATOM   2558  C  C     . PRO A 1 334 ? 38.935  167.678 43.401  1.00 17.77 ? 334  PRO A C     1 
ATOM   2559  O  O     . PRO A 1 334 ? 37.916  168.161 42.905  1.00 18.78 ? 334  PRO A O     1 
ATOM   2560  C  CB    . PRO A 1 334 ? 39.064  165.198 42.965  1.00 16.53 ? 334  PRO A CB    1 
ATOM   2561  C  CG    . PRO A 1 334 ? 40.212  164.267 42.786  1.00 21.92 ? 334  PRO A CG    1 
ATOM   2562  C  CD    . PRO A 1 334 ? 41.331  164.998 43.476  1.00 18.12 ? 334  PRO A CD    1 
ATOM   2563  N  N     . ASN A 1 335 ? 39.425  168.084 44.569  1.00 18.87 ? 335  ASN A N     1 
ATOM   2564  C  CA    . ASN A 1 335 ? 38.738  169.135 45.306  1.00 19.96 ? 335  ASN A CA    1 
ATOM   2565  C  C     . ASN A 1 335 ? 39.520  170.418 45.592  1.00 19.38 ? 335  ASN A C     1 
ATOM   2566  O  O     . ASN A 1 335 ? 39.247  171.104 46.575  1.00 20.09 ? 335  ASN A O     1 
ATOM   2567  C  CB    . ASN A 1 335 ? 38.143  168.567 46.607  1.00 21.45 ? 335  ASN A CB    1 
ATOM   2568  C  CG    . ASN A 1 335 ? 39.169  167.859 47.480  1.00 22.81 ? 335  ASN A CG    1 
ATOM   2569  O  OD1   . ASN A 1 335 ? 38.821  167.288 48.516  1.00 25.60 ? 335  ASN A OD1   1 
ATOM   2570  N  ND2   . ASN A 1 335 ? 40.427  167.889 47.072  1.00 21.75 ? 335  ASN A ND2   1 
ATOM   2571  N  N     . TRP A 1 336 ? 40.481  170.752 44.733  1.00 18.25 ? 336  TRP A N     1 
ATOM   2572  C  CA    . TRP A 1 336 ? 41.248  171.988 44.910  1.00 18.74 ? 336  TRP A CA    1 
ATOM   2573  C  C     . TRP A 1 336 ? 41.318  172.731 43.583  1.00 18.11 ? 336  TRP A C     1 
ATOM   2574  O  O     . TRP A 1 336 ? 41.621  172.137 42.549  1.00 17.66 ? 336  TRP A O     1 
ATOM   2575  C  CB    . TRP A 1 336 ? 42.668  171.699 45.404  1.00 20.33 ? 336  TRP A CB    1 
ATOM   2576  C  CG    . TRP A 1 336 ? 43.375  172.940 45.865  1.00 21.83 ? 336  TRP A CG    1 
ATOM   2577  C  CD1   . TRP A 1 336 ? 43.373  173.466 47.129  1.00 23.55 ? 336  TRP A CD1   1 
ATOM   2578  C  CD2   . TRP A 1 336 ? 44.123  173.854 45.053  1.00 23.26 ? 336  TRP A CD2   1 
ATOM   2579  N  NE1   . TRP A 1 336 ? 44.070  174.653 47.151  1.00 25.13 ? 336  TRP A NE1   1 
ATOM   2580  C  CE2   . TRP A 1 336 ? 44.541  174.914 45.891  1.00 24.19 ? 336  TRP A CE2   1 
ATOM   2581  C  CE3   . TRP A 1 336 ? 44.478  173.883 43.698  1.00 22.74 ? 336  TRP A CE3   1 
ATOM   2582  C  CZ2   . TRP A 1 336 ? 45.299  175.991 45.418  1.00 25.18 ? 336  TRP A CZ2   1 
ATOM   2583  C  CZ3   . TRP A 1 336 ? 45.232  174.955 43.226  1.00 24.32 ? 336  TRP A CZ3   1 
ATOM   2584  C  CH2   . TRP A 1 336 ? 45.634  175.995 44.087  1.00 24.22 ? 336  TRP A CH2   1 
ATOM   2585  N  N     . PRO A 1 337 ? 41.074  174.053 43.590  1.00 19.06 ? 337  PRO A N     1 
ATOM   2586  C  CA    . PRO A 1 337 ? 40.738  174.957 44.700  1.00 20.64 ? 337  PRO A CA    1 
ATOM   2587  C  C     . PRO A 1 337 ? 39.422  174.684 45.433  1.00 21.63 ? 337  PRO A C     1 
ATOM   2588  O  O     . PRO A 1 337 ? 39.289  175.023 46.614  1.00 22.43 ? 337  PRO A O     1 
ATOM   2589  C  CB    . PRO A 1 337 ? 40.717  176.335 44.034  1.00 20.36 ? 337  PRO A CB    1 
ATOM   2590  C  CG    . PRO A 1 337 ? 41.607  176.170 42.837  1.00 21.11 ? 337  PRO A CG    1 
ATOM   2591  C  CD    . PRO A 1 337 ? 41.208  174.813 42.336  1.00 18.95 ? 337  PRO A CD    1 
ATOM   2592  N  N     . THR A 1 338 ? 38.453  174.093 44.738  1.00 20.61 ? 338  THR A N     1 
ATOM   2593  C  CA    . THR A 1 338 ? 37.149  173.811 45.338  1.00 21.31 ? 338  THR A CA    1 
ATOM   2594  C  C     . THR A 1 338 ? 36.665  172.401 45.004  1.00 21.61 ? 338  THR A C     1 
ATOM   2595  O  O     . THR A 1 338 ? 37.175  171.758 44.084  1.00 20.96 ? 338  THR A O     1 
ATOM   2596  C  CB    . THR A 1 338 ? 36.076  174.814 44.848  1.00 19.93 ? 338  THR A CB    1 
ATOM   2597  O  OG1   . THR A 1 338 ? 35.709  174.505 43.496  1.00 20.14 ? 338  THR A OG1   1 
ATOM   2598  C  CG2   . THR A 1 338 ? 36.614  176.241 44.898  1.00 20.31 ? 338  THR A CG2   1 
ATOM   2599  N  N     . PRO A 1 339 ? 35.665  171.903 45.749  1.00 21.38 ? 339  PRO A N     1 
ATOM   2600  C  CA    . PRO A 1 339 ? 35.147  170.557 45.490  1.00 20.18 ? 339  PRO A CA    1 
ATOM   2601  C  C     . PRO A 1 339 ? 34.574  170.357 44.088  1.00 18.75 ? 339  PRO A C     1 
ATOM   2602  O  O     . PRO A 1 339 ? 34.371  169.223 43.647  1.00 16.49 ? 339  PRO A O     1 
ATOM   2603  C  CB    . PRO A 1 339 ? 34.107  170.358 46.601  1.00 21.45 ? 339  PRO A CB    1 
ATOM   2604  C  CG    . PRO A 1 339 ? 33.724  171.745 46.995  1.00 22.85 ? 339  PRO A CG    1 
ATOM   2605  C  CD    . PRO A 1 339 ? 35.018  172.504 46.929  1.00 22.02 ? 339  PRO A CD    1 
ATOM   2606  N  N     . ALA A 1 340 ? 34.324  171.454 43.381  1.00 16.94 ? 340  ALA A N     1 
ATOM   2607  C  CA    . ALA A 1 340 ? 33.792  171.356 42.030  1.00 17.30 ? 340  ALA A CA    1 
ATOM   2608  C  C     . ALA A 1 340 ? 34.897  171.170 40.989  1.00 16.00 ? 340  ALA A C     1 
ATOM   2609  O  O     . ALA A 1 340 ? 34.609  171.026 39.801  1.00 16.96 ? 340  ALA A O     1 
ATOM   2610  C  CB    . ALA A 1 340 ? 32.977  172.604 41.698  1.00 17.83 ? 340  ALA A CB    1 
ATOM   2611  N  N     . ARG A 1 341 ? 36.155  171.159 41.427  1.00 15.15 ? 341  ARG A N     1 
ATOM   2612  C  CA    . ARG A 1 341 ? 37.272  171.029 40.492  1.00 14.34 ? 341  ARG A CA    1 
ATOM   2613  C  C     . ARG A 1 341 ? 37.178  169.865 39.515  1.00 11.90 ? 341  ARG A C     1 
ATOM   2614  O  O     . ARG A 1 341 ? 37.334  170.054 38.306  1.00 13.91 ? 341  ARG A O     1 
ATOM   2615  C  CB    . ARG A 1 341 ? 38.610  170.938 41.238  1.00 15.39 ? 341  ARG A CB    1 
ATOM   2616  C  CG    . ARG A 1 341 ? 39.824  170.987 40.293  1.00 15.79 ? 341  ARG A CG    1 
ATOM   2617  C  CD    . ARG A 1 341 ? 39.826  172.292 39.502  1.00 15.35 ? 341  ARG A CD    1 
ATOM   2618  N  NE    . ARG A 1 341 ? 40.802  172.334 38.414  1.00 17.06 ? 341  ARG A NE    1 
ATOM   2619  C  CZ    . ARG A 1 341 ? 42.122  172.403 38.578  1.00 15.96 ? 341  ARG A CZ    1 
ATOM   2620  N  NH1   . ARG A 1 341 ? 42.647  172.431 39.793  1.00 13.42 ? 341  ARG A NH1   1 
ATOM   2621  N  NH2   . ARG A 1 341 ? 42.915  172.471 37.517  1.00 14.54 ? 341  ARG A NH2   1 
ATOM   2622  N  N     . MET A 1 342 ? 36.935  168.663 40.026  1.00 12.83 ? 342  MET A N     1 
ATOM   2623  C  CA    . MET A 1 342 ? 36.849  167.493 39.158  1.00 12.85 ? 342  MET A CA    1 
ATOM   2624  C  C     . MET A 1 342 ? 35.854  167.692 38.020  1.00 14.17 ? 342  MET A C     1 
ATOM   2625  O  O     . MET A 1 342 ? 36.179  167.455 36.853  1.00 13.52 ? 342  MET A O     1 
ATOM   2626  C  CB    . MET A 1 342 ? 36.462  166.246 39.958  1.00 13.60 ? 342  MET A CB    1 
ATOM   2627  C  CG    . MET A 1 342 ? 36.433  164.972 39.116  1.00 13.59 ? 342  MET A CG    1 
ATOM   2628  S  SD    . MET A 1 342 ? 35.990  163.491 40.060  1.00 16.33 ? 342  MET A SD    1 
ATOM   2629  C  CE    . MET A 1 342 ? 34.212  163.687 40.157  1.00 15.89 ? 342  MET A CE    1 
ATOM   2630  N  N     . CYS A 1 343 ? 34.644  168.137 38.348  1.00 14.29 ? 343  CYS A N     1 
ATOM   2631  C  CA    . CYS A 1 343 ? 33.640  168.344 37.315  1.00 15.03 ? 343  CYS A CA    1 
ATOM   2632  C  C     . CYS A 1 343 ? 33.980  169.522 36.414  1.00 14.56 ? 343  CYS A C     1 
ATOM   2633  O  O     . CYS A 1 343 ? 33.575  169.555 35.258  1.00 15.75 ? 343  CYS A O     1 
ATOM   2634  C  CB    . CYS A 1 343 ? 32.253  168.502 37.942  1.00 16.25 ? 343  CYS A CB    1 
ATOM   2635  S  SG    . CYS A 1 343 ? 31.632  166.943 38.619  1.00 16.17 ? 343  CYS A SG    1 
ATOM   2636  N  N     . GLN A 1 344 ? 34.729  170.487 36.937  1.00 16.17 ? 344  GLN A N     1 
ATOM   2637  C  CA    . GLN A 1 344 ? 35.148  171.625 36.126  1.00 15.47 ? 344  GLN A CA    1 
ATOM   2638  C  C     . GLN A 1 344 ? 36.139  171.120 35.069  1.00 14.07 ? 344  GLN A C     1 
ATOM   2639  O  O     . GLN A 1 344 ? 36.131  171.573 33.933  1.00 14.79 ? 344  GLN A O     1 
ATOM   2640  C  CB    . GLN A 1 344 ? 35.804  172.694 37.007  1.00 16.61 ? 344  GLN A CB    1 
ATOM   2641  C  CG    . GLN A 1 344 ? 34.794  173.470 37.858  1.00 18.51 ? 344  GLN A CG    1 
ATOM   2642  C  CD    . GLN A 1 344 ? 35.441  174.343 38.919  1.00 21.80 ? 344  GLN A CD    1 
ATOM   2643  O  OE1   . GLN A 1 344 ? 34.762  175.142 39.580  1.00 21.50 ? 344  GLN A OE1   1 
ATOM   2644  N  NE2   . GLN A 1 344 ? 36.751  174.194 39.098  1.00 16.25 ? 344  GLN A NE2   1 
ATOM   2645  N  N     . VAL A 1 345 ? 36.983  170.167 35.452  1.00 15.28 ? 345  VAL A N     1 
ATOM   2646  C  CA    . VAL A 1 345 ? 37.953  169.607 34.513  1.00 13.28 ? 345  VAL A CA    1 
ATOM   2647  C  C     . VAL A 1 345 ? 37.191  168.835 33.438  1.00 13.84 ? 345  VAL A C     1 
ATOM   2648  O  O     . VAL A 1 345 ? 37.518  168.916 32.255  1.00 13.34 ? 345  VAL A O     1 
ATOM   2649  C  CB    . VAL A 1 345 ? 38.957  168.674 35.240  1.00 15.64 ? 345  VAL A CB    1 
ATOM   2650  C  CG1   . VAL A 1 345 ? 39.857  167.973 34.225  1.00 14.39 ? 345  VAL A CG1   1 
ATOM   2651  C  CG2   . VAL A 1 345 ? 39.813  169.501 36.212  1.00 13.95 ? 345  VAL A CG2   1 
ATOM   2652  N  N     . VAL A 1 346 ? 36.166  168.099 33.863  1.00 12.86 ? 346  VAL A N     1 
ATOM   2653  C  CA    . VAL A 1 346 ? 35.324  167.335 32.953  1.00 13.41 ? 346  VAL A CA    1 
ATOM   2654  C  C     . VAL A 1 346 ? 34.718  168.271 31.901  1.00 14.47 ? 346  VAL A C     1 
ATOM   2655  O  O     . VAL A 1 346 ? 34.737  167.966 30.713  1.00 13.78 ? 346  VAL A O     1 
ATOM   2656  C  CB    . VAL A 1 346 ? 34.184  166.617 33.727  1.00 13.83 ? 346  VAL A CB    1 
ATOM   2657  C  CG1   . VAL A 1 346 ? 33.107  166.128 32.760  1.00 13.73 ? 346  VAL A CG1   1 
ATOM   2658  C  CG2   . VAL A 1 346 ? 34.756  165.437 34.509  1.00 12.90 ? 346  VAL A CG2   1 
ATOM   2659  N  N     . ASP A 1 347 ? 34.183  169.412 32.338  1.00 15.34 ? 347  ASP A N     1 
ATOM   2660  C  CA    . ASP A 1 347 ? 33.591  170.367 31.402  1.00 16.58 ? 347  ASP A CA    1 
ATOM   2661  C  C     . ASP A 1 347 ? 34.644  171.013 30.511  1.00 15.60 ? 347  ASP A C     1 
ATOM   2662  O  O     . ASP A 1 347 ? 34.474  171.115 29.295  1.00 16.72 ? 347  ASP A O     1 
ATOM   2663  C  CB    . ASP A 1 347 ? 32.844  171.487 32.141  1.00 16.58 ? 347  ASP A CB    1 
ATOM   2664  C  CG    . ASP A 1 347 ? 31.548  171.019 32.771  1.00 19.16 ? 347  ASP A CG    1 
ATOM   2665  O  OD1   . ASP A 1 347 ? 31.050  169.941 32.393  1.00 18.57 ? 347  ASP A OD1   1 
ATOM   2666  O  OD2   . ASP A 1 347 ? 31.019  171.746 33.640  1.00 20.94 ? 347  ASP A OD2   1 
ATOM   2667  N  N     . LYS A 1 348 ? 35.731  171.460 31.128  1.00 15.44 ? 348  LYS A N     1 
ATOM   2668  C  CA    . LYS A 1 348 ? 36.801  172.129 30.399  1.00 16.02 ? 348  LYS A CA    1 
ATOM   2669  C  C     . LYS A 1 348 ? 37.325  171.307 29.228  1.00 15.86 ? 348  LYS A C     1 
ATOM   2670  O  O     . LYS A 1 348 ? 37.520  171.832 28.130  1.00 14.28 ? 348  LYS A O     1 
ATOM   2671  C  CB    . LYS A 1 348 ? 37.956  172.461 31.353  1.00 14.96 ? 348  LYS A CB    1 
ATOM   2672  C  CG    . LYS A 1 348 ? 39.087  173.259 30.707  1.00 18.01 ? 348  LYS A CG    1 
ATOM   2673  C  CD    . LYS A 1 348 ? 40.231  173.484 31.685  1.00 17.60 ? 348  LYS A CD    1 
ATOM   2674  C  CE    . LYS A 1 348 ? 41.384  174.230 31.025  1.00 18.88 ? 348  LYS A CE    1 
ATOM   2675  N  NZ    . LYS A 1 348 ? 42.519  174.445 31.966  1.00 21.59 ? 348  LYS A NZ    1 
ATOM   2676  N  N     . HIS A 1 349 ? 37.547  170.016 29.459  1.00 15.17 ? 349  HIS A N     1 
ATOM   2677  C  CA    . HIS A 1 349 ? 38.078  169.149 28.412  1.00 16.36 ? 349  HIS A CA    1 
ATOM   2678  C  C     . HIS A 1 349 ? 37.063  168.200 27.789  1.00 15.46 ? 349  HIS A C     1 
ATOM   2679  O  O     . HIS A 1 349 ? 37.428  167.305 27.023  1.00 15.43 ? 349  HIS A O     1 
ATOM   2680  C  CB    . HIS A 1 349 ? 39.273  168.370 28.964  1.00 16.21 ? 349  HIS A CB    1 
ATOM   2681  C  CG    . HIS A 1 349 ? 40.382  169.253 29.441  1.00 14.44 ? 349  HIS A CG    1 
ATOM   2682  N  ND1   . HIS A 1 349 ? 41.047  170.124 28.606  1.00 14.69 ? 349  HIS A ND1   1 
ATOM   2683  C  CD2   . HIS A 1 349 ? 40.920  169.425 30.672  1.00 14.46 ? 349  HIS A CD2   1 
ATOM   2684  C  CE1   . HIS A 1 349 ? 41.947  170.797 29.301  1.00 14.61 ? 349  HIS A CE1   1 
ATOM   2685  N  NE2   . HIS A 1 349 ? 41.890  170.392 30.558  1.00 15.38 ? 349  HIS A NE2   1 
ATOM   2686  N  N     . GLN A 1 350 ? 35.789  168.407 28.114  1.00 14.69 ? 350  GLN A N     1 
ATOM   2687  C  CA    . GLN A 1 350 ? 34.708  167.590 27.574  1.00 15.40 ? 350  GLN A CA    1 
ATOM   2688  C  C     . GLN A 1 350 ? 34.988  166.096 27.715  1.00 15.93 ? 350  GLN A C     1 
ATOM   2689  O  O     . GLN A 1 350 ? 34.881  165.335 26.751  1.00 11.79 ? 350  GLN A O     1 
ATOM   2690  C  CB    . GLN A 1 350 ? 34.477  167.940 26.098  1.00 17.87 ? 350  GLN A CB    1 
ATOM   2691  C  CG    . GLN A 1 350 ? 33.892  169.331 25.859  1.00 19.26 ? 350  GLN A CG    1 
ATOM   2692  C  CD    . GLN A 1 350 ? 32.508  169.487 26.465  1.00 20.62 ? 350  GLN A CD    1 
ATOM   2693  O  OE1   . GLN A 1 350 ? 32.354  169.978 27.584  1.00 23.21 ? 350  GLN A OE1   1 
ATOM   2694  N  NE2   . GLN A 1 350 ? 31.497  169.054 25.733  1.00 19.56 ? 350  GLN A NE2   1 
ATOM   2695  N  N     . VAL A 1 351 ? 35.339  165.686 28.929  1.00 14.79 ? 351  VAL A N     1 
ATOM   2696  C  CA    . VAL A 1 351 ? 35.632  164.291 29.226  1.00 13.57 ? 351  VAL A CA    1 
ATOM   2697  C  C     . VAL A 1 351 ? 34.400  163.416 28.977  1.00 14.79 ? 351  VAL A C     1 
ATOM   2698  O  O     . VAL A 1 351 ? 33.289  163.775 29.368  1.00 13.65 ? 351  VAL A O     1 
ATOM   2699  C  CB    . VAL A 1 351 ? 36.071  164.136 30.700  1.00 13.15 ? 351  VAL A CB    1 
ATOM   2700  C  CG1   . VAL A 1 351 ? 36.303  162.662 31.030  1.00 12.79 ? 351  VAL A CG1   1 
ATOM   2701  C  CG2   . VAL A 1 351 ? 37.339  164.947 30.946  1.00 14.13 ? 351  VAL A CG2   1 
ATOM   2702  N  N     . ASN A 1 352 ? 34.604  162.269 28.329  1.00 12.74 ? 352  ASN A N     1 
ATOM   2703  C  CA    . ASN A 1 352 ? 33.509  161.343 28.036  1.00 13.84 ? 352  ASN A CA    1 
ATOM   2704  C  C     . ASN A 1 352 ? 33.537  160.134 28.961  1.00 13.61 ? 352  ASN A C     1 
ATOM   2705  O  O     . ASN A 1 352 ? 32.516  159.477 29.166  1.00 14.65 ? 352  ASN A O     1 
ATOM   2706  C  CB    . ASN A 1 352 ? 33.595  160.844 26.589  1.00 12.80 ? 352  ASN A CB    1 
ATOM   2707  C  CG    . ASN A 1 352 ? 33.611  161.970 25.584  1.00 13.32 ? 352  ASN A CG    1 
ATOM   2708  O  OD1   . ASN A 1 352 ? 34.545  162.087 24.790  1.00 13.87 ? 352  ASN A OD1   1 
ATOM   2709  N  ND2   . ASN A 1 352 ? 32.574  162.808 25.606  1.00 12.69 ? 352  ASN A ND2   1 
ATOM   2710  N  N     . ILE A 1 353 ? 34.713  159.834 29.503  1.00 12.91 ? 353  ILE A N     1 
ATOM   2711  C  CA    . ILE A 1 353 ? 34.880  158.693 30.397  1.00 14.18 ? 353  ILE A CA    1 
ATOM   2712  C  C     . ILE A 1 353 ? 35.671  159.135 31.624  1.00 14.60 ? 353  ILE A C     1 
ATOM   2713  O  O     . ILE A 1 353 ? 36.784  159.636 31.492  1.00 14.07 ? 353  ILE A O     1 
ATOM   2714  C  CB    . ILE A 1 353 ? 35.668  157.558 29.701  1.00 15.06 ? 353  ILE A CB    1 
ATOM   2715  C  CG1   . ILE A 1 353 ? 35.042  157.245 28.339  1.00 15.87 ? 353  ILE A CG1   1 
ATOM   2716  C  CG2   . ILE A 1 353 ? 35.670  156.310 30.573  1.00 13.18 ? 353  ILE A CG2   1 
ATOM   2717  C  CD1   . ILE A 1 353 ? 35.924  156.383 27.444  1.00 13.14 ? 353  ILE A CD1   1 
ATOM   2718  N  N     . LEU A 1 354 ? 35.099  158.945 32.809  1.00 15.54 ? 354  LEU A N     1 
ATOM   2719  C  CA    . LEU A 1 354 ? 35.760  159.327 34.059  1.00 14.14 ? 354  LEU A CA    1 
ATOM   2720  C  C     . LEU A 1 354 ? 35.987  158.096 34.924  1.00 13.77 ? 354  LEU A C     1 
ATOM   2721  O  O     . LEU A 1 354 ? 35.054  157.353 35.214  1.00 13.28 ? 354  LEU A O     1 
ATOM   2722  C  CB    . LEU A 1 354 ? 34.906  160.341 34.823  1.00 13.73 ? 354  LEU A CB    1 
ATOM   2723  C  CG    . LEU A 1 354 ? 35.400  160.700 36.229  1.00 11.83 ? 354  LEU A CG    1 
ATOM   2724  C  CD1   . LEU A 1 354 ? 36.750  161.417 36.143  1.00 12.73 ? 354  LEU A CD1   1 
ATOM   2725  C  CD2   . LEU A 1 354 ? 34.368  161.594 36.915  1.00 12.82 ? 354  LEU A CD2   1 
ATOM   2726  N  N     . TYR A 1 355 ? 37.232  157.887 35.336  1.00 12.64 ? 355  TYR A N     1 
ATOM   2727  C  CA    . TYR A 1 355 ? 37.599  156.728 36.140  1.00 12.01 ? 355  TYR A CA    1 
ATOM   2728  C  C     . TYR A 1 355 ? 38.318  157.222 37.397  1.00 13.09 ? 355  TYR A C     1 
ATOM   2729  O  O     . TYR A 1 355 ? 39.445  157.717 37.325  1.00 12.70 ? 355  TYR A O     1 
ATOM   2730  C  CB    . TYR A 1 355 ? 38.500  155.823 35.283  1.00 12.48 ? 355  TYR A CB    1 
ATOM   2731  C  CG    . TYR A 1 355 ? 38.947  154.519 35.903  1.00 12.15 ? 355  TYR A CG    1 
ATOM   2732  C  CD1   . TYR A 1 355 ? 38.062  153.714 36.629  1.00 11.60 ? 355  TYR A CD1   1 
ATOM   2733  C  CD2   . TYR A 1 355 ? 40.248  154.050 35.698  1.00 12.30 ? 355  TYR A CD2   1 
ATOM   2734  C  CE1   . TYR A 1 355 ? 38.464  152.472 37.131  1.00 9.72  ? 355  TYR A CE1   1 
ATOM   2735  C  CE2   . TYR A 1 355 ? 40.659  152.810 36.194  1.00 8.99  ? 355  TYR A CE2   1 
ATOM   2736  C  CZ    . TYR A 1 355 ? 39.764  152.029 36.906  1.00 9.36  ? 355  TYR A CZ    1 
ATOM   2737  O  OH    . TYR A 1 355 ? 40.169  150.806 37.382  1.00 11.48 ? 355  TYR A OH    1 
ATOM   2738  N  N     . THR A 1 356 ? 37.665  157.098 38.551  1.00 13.53 ? 356  THR A N     1 
ATOM   2739  C  CA    . THR A 1 356 ? 38.261  157.580 39.795  1.00 13.35 ? 356  THR A CA    1 
ATOM   2740  C  C     . THR A 1 356 ? 38.116  156.605 40.972  1.00 13.72 ? 356  THR A C     1 
ATOM   2741  O  O     . THR A 1 356 ? 37.719  155.455 40.787  1.00 14.68 ? 356  THR A O     1 
ATOM   2742  C  CB    . THR A 1 356 ? 37.683  158.989 40.160  1.00 14.16 ? 356  THR A CB    1 
ATOM   2743  O  OG1   . THR A 1 356 ? 38.500  159.596 41.167  1.00 13.80 ? 356  THR A OG1   1 
ATOM   2744  C  CG2   . THR A 1 356 ? 36.245  158.882 40.669  1.00 14.04 ? 356  THR A CG2   1 
ATOM   2745  N  N     . ALA A 1 357 ? 38.457  157.061 42.174  1.00 14.44 ? 357  ALA A N     1 
ATOM   2746  C  CA    . ALA A 1 357 ? 38.404  156.212 43.364  1.00 15.01 ? 357  ALA A CA    1 
ATOM   2747  C  C     . ALA A 1 357 ? 37.313  156.569 44.363  1.00 14.44 ? 357  ALA A C     1 
ATOM   2748  O  O     . ALA A 1 357 ? 36.925  157.729 44.487  1.00 13.59 ? 357  ALA A O     1 
ATOM   2749  C  CB    . ALA A 1 357 ? 39.752  156.238 44.066  1.00 17.80 ? 357  ALA A CB    1 
ATOM   2750  N  N     . PRO A 1 358 ? 36.813  155.563 45.103  1.00 14.10 ? 358  PRO A N     1 
ATOM   2751  C  CA    . PRO A 1 358 ? 35.762  155.777 46.100  1.00 14.99 ? 358  PRO A CA    1 
ATOM   2752  C  C     . PRO A 1 358 ? 36.118  156.840 47.142  1.00 16.55 ? 358  PRO A C     1 
ATOM   2753  O  O     . PRO A 1 358 ? 35.259  157.623 47.545  1.00 14.86 ? 358  PRO A O     1 
ATOM   2754  C  CB    . PRO A 1 358 ? 35.582  154.391 46.712  1.00 14.55 ? 358  PRO A CB    1 
ATOM   2755  C  CG    . PRO A 1 358 ? 35.834  153.482 45.526  1.00 14.11 ? 358  PRO A CG    1 
ATOM   2756  C  CD    . PRO A 1 358 ? 37.082  154.121 44.927  1.00 14.14 ? 358  PRO A CD    1 
ATOM   2757  N  N     . THR A 1 359 ? 37.374  156.872 47.585  1.00 15.95 ? 359  THR A N     1 
ATOM   2758  C  CA    . THR A 1 359 ? 37.767  157.872 48.577  1.00 15.84 ? 359  THR A CA    1 
ATOM   2759  C  C     . THR A 1 359 ? 37.533  159.277 48.032  1.00 14.00 ? 359  THR A C     1 
ATOM   2760  O  O     . THR A 1 359 ? 37.052  160.156 48.746  1.00 15.32 ? 359  THR A O     1 
ATOM   2761  C  CB    . THR A 1 359 ? 39.249  157.719 48.995  1.00 16.63 ? 359  THR A CB    1 
ATOM   2762  O  OG1   . THR A 1 359 ? 39.406  156.512 49.750  1.00 17.19 ? 359  THR A OG1   1 
ATOM   2763  C  CG2   . THR A 1 359 ? 39.686  158.900 49.860  1.00 17.72 ? 359  THR A CG2   1 
ATOM   2764  N  N     . ALA A 1 360 ? 37.870  159.487 46.765  1.00 14.57 ? 360  ALA A N     1 
ATOM   2765  C  CA    . ALA A 1 360 ? 37.673  160.789 46.139  1.00 13.45 ? 360  ALA A CA    1 
ATOM   2766  C  C     . ALA A 1 360 ? 36.178  161.066 46.035  1.00 14.14 ? 360  ALA A C     1 
ATOM   2767  O  O     . ALA A 1 360 ? 35.714  162.177 46.305  1.00 13.02 ? 360  ALA A O     1 
ATOM   2768  C  CB    . ALA A 1 360 ? 38.303  160.807 44.752  1.00 13.16 ? 360  ALA A CB    1 
ATOM   2769  N  N     . ILE A 1 361 ? 35.425  160.046 45.635  1.00 13.20 ? 361  ILE A N     1 
ATOM   2770  C  CA    . ILE A 1 361 ? 33.980  160.190 45.504  1.00 14.77 ? 361  ILE A CA    1 
ATOM   2771  C  C     . ILE A 1 361 ? 33.368  160.569 46.848  1.00 14.48 ? 361  ILE A C     1 
ATOM   2772  O  O     . ILE A 1 361 ? 32.510  161.453 46.916  1.00 15.90 ? 361  ILE A O     1 
ATOM   2773  C  CB    . ILE A 1 361 ? 33.338  158.879 44.980  1.00 14.02 ? 361  ILE A CB    1 
ATOM   2774  C  CG1   . ILE A 1 361 ? 33.738  158.675 43.517  1.00 13.78 ? 361  ILE A CG1   1 
ATOM   2775  C  CG2   . ILE A 1 361 ? 31.807  158.939 45.108  1.00 13.83 ? 361  ILE A CG2   1 
ATOM   2776  C  CD1   . ILE A 1 361 ? 33.344  157.327 42.936  1.00 16.27 ? 361  ILE A CD1   1 
ATOM   2777  N  N     . ARG A 1 362 ? 33.816  159.912 47.916  1.00 14.79 ? 362  ARG A N     1 
ATOM   2778  C  CA    . ARG A 1 362 ? 33.285  160.203 49.249  1.00 16.39 ? 362  ARG A CA    1 
ATOM   2779  C  C     . ARG A 1 362 ? 33.675  161.592 49.746  1.00 17.41 ? 362  ARG A C     1 
ATOM   2780  O  O     . ARG A 1 362 ? 32.898  162.245 50.450  1.00 18.42 ? 362  ARG A O     1 
ATOM   2781  C  CB    . ARG A 1 362 ? 33.747  159.146 50.252  1.00 17.66 ? 362  ARG A CB    1 
ATOM   2782  C  CG    . ARG A 1 362 ? 33.083  157.783 50.051  1.00 18.25 ? 362  ARG A CG    1 
ATOM   2783  C  CD    . ARG A 1 362 ? 33.459  156.820 51.164  1.00 19.27 ? 362  ARG A CD    1 
ATOM   2784  N  NE    . ARG A 1 362 ? 34.885  156.503 51.175  1.00 20.47 ? 362  ARG A NE    1 
ATOM   2785  C  CZ    . ARG A 1 362 ? 35.403  155.355 50.750  1.00 21.33 ? 362  ARG A CZ    1 
ATOM   2786  N  NH1   . ARG A 1 362 ? 34.616  154.398 50.272  1.00 20.78 ? 362  ARG A NH1   1 
ATOM   2787  N  NH2   . ARG A 1 362 ? 36.711  155.159 50.817  1.00 21.70 ? 362  ARG A NH2   1 
ATOM   2788  N  N     . ALA A 1 363 ? 34.870  162.045 49.376  1.00 15.02 ? 363  ALA A N     1 
ATOM   2789  C  CA    . ALA A 1 363 ? 35.339  163.365 49.784  1.00 15.12 ? 363  ALA A CA    1 
ATOM   2790  C  C     . ALA A 1 363 ? 34.490  164.444 49.122  1.00 15.88 ? 363  ALA A C     1 
ATOM   2791  O  O     . ALA A 1 363 ? 34.201  165.476 49.726  1.00 15.55 ? 363  ALA A O     1 
ATOM   2792  C  CB    . ALA A 1 363 ? 36.809  163.548 49.411  1.00 15.82 ? 363  ALA A CB    1 
ATOM   2793  N  N     . LEU A 1 364 ? 34.101  164.209 47.873  1.00 15.56 ? 364  LEU A N     1 
ATOM   2794  C  CA    . LEU A 1 364 ? 33.264  165.165 47.156  1.00 16.27 ? 364  LEU A CA    1 
ATOM   2795  C  C     . LEU A 1 364 ? 31.831  165.068 47.670  1.00 17.24 ? 364  LEU A C     1 
ATOM   2796  O  O     . LEU A 1 364 ? 31.156  166.084 47.853  1.00 17.19 ? 364  LEU A O     1 
ATOM   2797  C  CB    . LEU A 1 364 ? 33.280  164.877 45.654  1.00 17.19 ? 364  LEU A CB    1 
ATOM   2798  C  CG    . LEU A 1 364 ? 34.592  165.130 44.904  1.00 19.58 ? 364  LEU A CG    1 
ATOM   2799  C  CD1   . LEU A 1 364 ? 34.428  164.728 43.439  1.00 17.67 ? 364  LEU A CD1   1 
ATOM   2800  C  CD2   . LEU A 1 364 ? 34.976  166.598 45.011  1.00 19.47 ? 364  LEU A CD2   1 
ATOM   2801  N  N     . MET A 1 365 ? 31.376  163.842 47.902  1.00 16.30 ? 365  MET A N     1 
ATOM   2802  C  CA    . MET A 1 365 ? 30.018  163.612 48.389  1.00 19.03 ? 365  MET A CA    1 
ATOM   2803  C  C     . MET A 1 365 ? 29.801  164.315 49.725  1.00 19.64 ? 365  MET A C     1 
ATOM   2804  O  O     . MET A 1 365 ? 28.692  164.754 50.035  1.00 21.51 ? 365  MET A O     1 
ATOM   2805  C  CB    . MET A 1 365 ? 29.751  162.106 48.534  1.00 18.62 ? 365  MET A CB    1 
ATOM   2806  C  CG    . MET A 1 365 ? 28.353  161.764 49.046  1.00 22.81 ? 365  MET A CG    1 
ATOM   2807  S  SD    . MET A 1 365 ? 27.931  160.002 48.955  1.00 25.52 ? 365  MET A SD    1 
ATOM   2808  C  CE    . MET A 1 365 ? 28.720  159.359 50.428  1.00 26.03 ? 365  MET A CE    1 
ATOM   2809  N  N     . ALA A 1 366 ? 30.864  164.425 50.513  1.00 19.71 ? 366  ALA A N     1 
ATOM   2810  C  CA    . ALA A 1 366 ? 30.786  165.079 51.814  1.00 21.05 ? 366  ALA A CA    1 
ATOM   2811  C  C     . ALA A 1 366 ? 30.508  166.573 51.657  1.00 21.03 ? 366  ALA A C     1 
ATOM   2812  O  O     . ALA A 1 366 ? 30.111  167.242 52.610  1.00 22.46 ? 366  ALA A O     1 
ATOM   2813  C  CB    . ALA A 1 366 ? 32.082  164.864 52.584  1.00 19.46 ? 366  ALA A CB    1 
ATOM   2814  N  N     . GLU A 1 367 ? 30.721  167.093 50.453  1.00 20.60 ? 367  GLU A N     1 
ATOM   2815  C  CA    . GLU A 1 367 ? 30.487  168.503 50.183  1.00 22.42 ? 367  GLU A CA    1 
ATOM   2816  C  C     . GLU A 1 367 ? 29.160  168.700 49.461  1.00 22.46 ? 367  GLU A C     1 
ATOM   2817  O  O     . GLU A 1 367 ? 28.828  169.810 49.041  1.00 23.29 ? 367  GLU A O     1 
ATOM   2818  C  CB    . GLU A 1 367 ? 31.626  169.077 49.340  1.00 23.40 ? 367  GLU A CB    1 
ATOM   2819  C  CG    . GLU A 1 367 ? 32.995  169.018 50.008  1.00 25.50 ? 367  GLU A CG    1 
ATOM   2820  C  CD    . GLU A 1 367 ? 33.012  169.710 51.358  1.00 28.48 ? 367  GLU A CD    1 
ATOM   2821  O  OE1   . GLU A 1 367 ? 32.386  170.783 51.474  1.00 28.47 ? 367  GLU A OE1   1 
ATOM   2822  O  OE2   . GLU A 1 367 ? 33.653  169.188 52.298  1.00 27.39 ? 367  GLU A OE2   1 
ATOM   2823  N  N     . GLY A 1 368 ? 28.405  167.617 49.318  1.00 23.35 ? 368  GLY A N     1 
ATOM   2824  C  CA    . GLY A 1 368 ? 27.117  167.695 48.650  1.00 23.52 ? 368  GLY A CA    1 
ATOM   2825  C  C     . GLY A 1 368 ? 27.173  168.306 47.261  1.00 24.36 ? 368  GLY A C     1 
ATOM   2826  O  O     . GLY A 1 368 ? 28.114  168.072 46.496  1.00 23.88 ? 368  GLY A O     1 
ATOM   2827  N  N     . ASP A 1 369 ? 26.164  169.107 46.937  1.00 23.04 ? 369  ASP A N     1 
ATOM   2828  C  CA    . ASP A 1 369 ? 26.081  169.741 45.628  1.00 22.74 ? 369  ASP A CA    1 
ATOM   2829  C  C     . ASP A 1 369 ? 27.217  170.704 45.290  1.00 20.97 ? 369  ASP A C     1 
ATOM   2830  O  O     . ASP A 1 369 ? 27.342  171.140 44.145  1.00 20.65 ? 369  ASP A O     1 
ATOM   2831  C  CB    . ASP A 1 369 ? 24.731  170.451 45.476  1.00 23.66 ? 369  ASP A CB    1 
ATOM   2832  C  CG    . ASP A 1 369 ? 23.584  169.479 45.238  1.00 26.11 ? 369  ASP A CG    1 
ATOM   2833  O  OD1   . ASP A 1 369 ? 23.828  168.252 45.213  1.00 26.62 ? 369  ASP A OD1   1 
ATOM   2834  O  OD2   . ASP A 1 369 ? 22.437  169.942 45.071  1.00 29.37 ? 369  ASP A OD2   1 
ATOM   2835  N  N     . LYS A 1 370 ? 28.041  171.043 46.274  1.00 20.40 ? 370  LYS A N     1 
ATOM   2836  C  CA    . LYS A 1 370 ? 29.160  171.941 46.018  1.00 20.86 ? 370  LYS A CA    1 
ATOM   2837  C  C     . LYS A 1 370 ? 30.130  171.255 45.045  1.00 20.56 ? 370  LYS A C     1 
ATOM   2838  O  O     . LYS A 1 370 ? 30.931  171.913 44.379  1.00 20.89 ? 370  LYS A O     1 
ATOM   2839  C  CB    . LYS A 1 370 ? 29.872  172.284 47.327  1.00 21.77 ? 370  LYS A CB    1 
ATOM   2840  N  N     . ALA A 1 371 ? 30.044  169.929 44.965  1.00 20.02 ? 371  ALA A N     1 
ATOM   2841  C  CA    . ALA A 1 371 ? 30.906  169.156 44.073  1.00 19.77 ? 371  ALA A CA    1 
ATOM   2842  C  C     . ALA A 1 371 ? 30.516  169.309 42.602  1.00 19.68 ? 371  ALA A C     1 
ATOM   2843  O  O     . ALA A 1 371 ? 31.325  169.046 41.714  1.00 20.29 ? 371  ALA A O     1 
ATOM   2844  C  CB    . ALA A 1 371 ? 30.878  167.678 44.469  1.00 19.92 ? 371  ALA A CB    1 
ATOM   2845  N  N     . ILE A 1 372 ? 29.281  169.732 42.337  1.00 19.84 ? 372  ILE A N     1 
ATOM   2846  C  CA    . ILE A 1 372 ? 28.830  169.898 40.954  1.00 18.85 ? 372  ILE A CA    1 
ATOM   2847  C  C     . ILE A 1 372 ? 28.337  171.306 40.637  1.00 19.19 ? 372  ILE A C     1 
ATOM   2848  O  O     . ILE A 1 372 ? 27.983  171.611 39.496  1.00 16.76 ? 372  ILE A O     1 
ATOM   2849  C  CB    . ILE A 1 372 ? 27.699  168.906 40.603  1.00 20.50 ? 372  ILE A CB    1 
ATOM   2850  C  CG1   . ILE A 1 372 ? 26.475  169.174 41.486  1.00 19.46 ? 372  ILE A CG1   1 
ATOM   2851  C  CG2   . ILE A 1 372 ? 28.185  167.476 40.777  1.00 17.74 ? 372  ILE A CG2   1 
ATOM   2852  C  CD1   . ILE A 1 372 ? 25.279  168.316 41.142  1.00 21.99 ? 372  ILE A CD1   1 
ATOM   2853  N  N     . GLU A 1 373 ? 28.332  172.166 41.649  1.00 19.17 ? 373  GLU A N     1 
ATOM   2854  C  CA    . GLU A 1 373 ? 27.868  173.537 41.496  1.00 21.03 ? 373  GLU A CA    1 
ATOM   2855  C  C     . GLU A 1 373 ? 28.523  174.279 40.331  1.00 21.14 ? 373  GLU A C     1 
ATOM   2856  O  O     . GLU A 1 373 ? 29.746  174.411 40.269  1.00 21.21 ? 373  GLU A O     1 
ATOM   2857  C  CB    . GLU A 1 373 ? 28.108  174.302 42.800  1.00 24.92 ? 373  GLU A CB    1 
ATOM   2858  C  CG    . GLU A 1 373 ? 27.448  175.664 42.867  1.00 30.45 ? 373  GLU A CG    1 
ATOM   2859  C  CD    . GLU A 1 373 ? 27.618  176.309 44.230  1.00 33.58 ? 373  GLU A CD    1 
ATOM   2860  O  OE1   . GLU A 1 373 ? 27.312  175.644 45.244  1.00 35.53 ? 373  GLU A OE1   1 
ATOM   2861  O  OE2   . GLU A 1 373 ? 28.051  177.477 44.286  1.00 36.45 ? 373  GLU A OE2   1 
ATOM   2862  N  N     . GLY A 1 374 ? 27.694  174.759 39.409  1.00 19.97 ? 374  GLY A N     1 
ATOM   2863  C  CA    . GLY A 1 374 ? 28.192  175.503 38.267  1.00 21.11 ? 374  GLY A CA    1 
ATOM   2864  C  C     . GLY A 1 374 ? 28.767  174.672 37.136  1.00 21.34 ? 374  GLY A C     1 
ATOM   2865  O  O     . GLY A 1 374 ? 29.299  175.229 36.177  1.00 22.50 ? 374  GLY A O     1 
ATOM   2866  N  N     . THR A 1 375 ? 28.667  173.349 37.234  1.00 19.80 ? 375  THR A N     1 
ATOM   2867  C  CA    . THR A 1 375 ? 29.201  172.480 36.188  1.00 20.02 ? 375  THR A CA    1 
ATOM   2868  C  C     . THR A 1 375 ? 28.080  171.865 35.351  1.00 19.66 ? 375  THR A C     1 
ATOM   2869  O  O     . THR A 1 375 ? 26.931  171.791 35.790  1.00 18.86 ? 375  THR A O     1 
ATOM   2870  C  CB    . THR A 1 375 ? 30.087  171.357 36.787  1.00 19.42 ? 375  THR A CB    1 
ATOM   2871  O  OG1   . THR A 1 375 ? 29.276  170.424 37.511  1.00 19.94 ? 375  THR A OG1   1 
ATOM   2872  C  CG2   . THR A 1 375 ? 31.117  171.954 37.734  1.00 20.26 ? 375  THR A CG2   1 
ATOM   2873  N  N     . ASP A 1 376 ? 28.422  171.427 34.144  1.00 18.21 ? 376  ASP A N     1 
ATOM   2874  C  CA    . ASP A 1 376 ? 27.448  170.847 33.226  1.00 18.64 ? 376  ASP A CA    1 
ATOM   2875  C  C     . ASP A 1 376 ? 27.471  169.315 33.235  1.00 19.02 ? 376  ASP A C     1 
ATOM   2876  O  O     . ASP A 1 376 ? 26.433  168.675 33.412  1.00 16.76 ? 376  ASP A O     1 
ATOM   2877  C  CB    . ASP A 1 376 ? 27.710  171.380 31.815  1.00 21.24 ? 376  ASP A CB    1 
ATOM   2878  C  CG    . ASP A 1 376 ? 26.718  170.859 30.801  1.00 23.91 ? 376  ASP A CG    1 
ATOM   2879  O  OD1   . ASP A 1 376 ? 26.702  169.639 30.564  1.00 26.02 ? 376  ASP A OD1   1 
ATOM   2880  O  OD2   . ASP A 1 376 ? 25.949  171.668 30.241  1.00 28.38 ? 376  ASP A OD2   1 
ATOM   2881  N  N     . ARG A 1 377 ? 28.653  168.737 33.023  1.00 17.46 ? 377  ARG A N     1 
ATOM   2882  C  CA    . ARG A 1 377 ? 28.834  167.281 33.037  1.00 17.66 ? 377  ARG A CA    1 
ATOM   2883  C  C     . ARG A 1 377 ? 28.180  166.495 31.904  1.00 17.77 ? 377  ARG A C     1 
ATOM   2884  O  O     . ARG A 1 377 ? 28.257  165.266 31.892  1.00 16.38 ? 377  ARG A O     1 
ATOM   2885  C  CB    . ARG A 1 377 ? 28.329  166.705 34.368  1.00 18.50 ? 377  ARG A CB    1 
ATOM   2886  C  CG    . ARG A 1 377 ? 29.142  167.091 35.600  1.00 19.69 ? 377  ARG A CG    1 
ATOM   2887  C  CD    . ARG A 1 377 ? 28.253  167.090 36.844  1.00 18.70 ? 377  ARG A CD    1 
ATOM   2888  N  NE    . ARG A 1 377 ? 27.433  168.299 36.888  1.00 19.57 ? 377  ARG A NE    1 
ATOM   2889  C  CZ    . ARG A 1 377 ? 26.143  168.330 37.205  1.00 18.81 ? 377  ARG A CZ    1 
ATOM   2890  N  NH1   . ARG A 1 377 ? 25.496  167.216 37.515  1.00 16.11 ? 377  ARG A NH1   1 
ATOM   2891  N  NH2   . ARG A 1 377 ? 25.494  169.486 37.198  1.00 21.84 ? 377  ARG A NH2   1 
ATOM   2892  N  N     . SER A 1 378 ? 27.546  167.181 30.954  1.00 16.81 ? 378  SER A N     1 
ATOM   2893  C  CA    . SER A 1 378 ? 26.864  166.494 29.853  1.00 18.70 ? 378  SER A CA    1 
ATOM   2894  C  C     . SER A 1 378 ? 27.729  165.657 28.913  1.00 17.55 ? 378  SER A C     1 
ATOM   2895  O  O     . SER A 1 378 ? 27.215  164.786 28.212  1.00 16.49 ? 378  SER A O     1 
ATOM   2896  C  CB    . SER A 1 378 ? 26.064  167.495 29.012  1.00 19.06 ? 378  SER A CB    1 
ATOM   2897  O  OG    . SER A 1 378 ? 24.970  168.014 29.748  1.00 24.47 ? 378  SER A OG    1 
ATOM   2898  N  N     . SER A 1 379 ? 29.032  165.913 28.887  1.00 17.45 ? 379  SER A N     1 
ATOM   2899  C  CA    . SER A 1 379 ? 29.915  165.164 27.994  1.00 15.17 ? 379  SER A CA    1 
ATOM   2900  C  C     . SER A 1 379 ? 30.155  163.727 28.455  1.00 15.34 ? 379  SER A C     1 
ATOM   2901  O  O     . SER A 1 379 ? 30.516  162.861 27.654  1.00 15.63 ? 379  SER A O     1 
ATOM   2902  C  CB    . SER A 1 379 ? 31.253  165.898 27.836  1.00 13.68 ? 379  SER A CB    1 
ATOM   2903  O  OG    . SER A 1 379 ? 31.918  166.039 29.080  1.00 13.80 ? 379  SER A OG    1 
ATOM   2904  N  N     . LEU A 1 380 ? 29.934  163.461 29.738  1.00 15.20 ? 380  LEU A N     1 
ATOM   2905  C  CA    . LEU A 1 380 ? 30.151  162.119 30.261  1.00 15.23 ? 380  LEU A CA    1 
ATOM   2906  C  C     . LEU A 1 380 ? 29.178  161.071 29.727  1.00 15.74 ? 380  LEU A C     1 
ATOM   2907  O  O     . LEU A 1 380 ? 27.979  161.331 29.579  1.00 13.71 ? 380  LEU A O     1 
ATOM   2908  C  CB    . LEU A 1 380 ? 30.091  162.132 31.789  1.00 14.57 ? 380  LEU A CB    1 
ATOM   2909  C  CG    . LEU A 1 380 ? 31.215  162.901 32.488  1.00 13.46 ? 380  LEU A CG    1 
ATOM   2910  C  CD1   . LEU A 1 380 ? 30.921  162.992 33.970  1.00 11.72 ? 380  LEU A CD1   1 
ATOM   2911  C  CD2   . LEU A 1 380 ? 32.548  162.206 32.240  1.00 12.02 ? 380  LEU A CD2   1 
ATOM   2912  N  N     . ARG A 1 381 ? 29.722  159.889 29.437  1.00 15.70 ? 381  ARG A N     1 
ATOM   2913  C  CA    . ARG A 1 381 ? 28.960  158.745 28.947  1.00 16.10 ? 381  ARG A CA    1 
ATOM   2914  C  C     . ARG A 1 381 ? 29.262  157.512 29.793  1.00 15.15 ? 381  ARG A C     1 
ATOM   2915  O  O     . ARG A 1 381 ? 28.421  156.622 29.934  1.00 12.97 ? 381  ARG A O     1 
ATOM   2916  C  CB    . ARG A 1 381 ? 29.318  158.430 27.487  1.00 18.99 ? 381  ARG A CB    1 
ATOM   2917  C  CG    . ARG A 1 381 ? 28.711  159.368 26.456  1.00 24.40 ? 381  ARG A CG    1 
ATOM   2918  C  CD    . ARG A 1 381 ? 28.849  158.792 25.047  1.00 24.69 ? 381  ARG A CD    1 
ATOM   2919  N  NE    . ARG A 1 381 ? 30.198  158.933 24.502  1.00 25.99 ? 381  ARG A NE    1 
ATOM   2920  C  CZ    . ARG A 1 381 ? 30.678  160.054 23.969  1.00 27.57 ? 381  ARG A CZ    1 
ATOM   2921  N  NH1   . ARG A 1 381 ? 29.918  161.142 23.908  1.00 25.53 ? 381  ARG A NH1   1 
ATOM   2922  N  NH2   . ARG A 1 381 ? 31.916  160.086 23.490  1.00 22.90 ? 381  ARG A NH2   1 
ATOM   2923  N  N     . ILE A 1 382 ? 30.469  157.459 30.352  1.00 13.41 ? 382  ILE A N     1 
ATOM   2924  C  CA    . ILE A 1 382 ? 30.891  156.318 31.162  1.00 13.31 ? 382  ILE A CA    1 
ATOM   2925  C  C     . ILE A 1 382 ? 31.619  156.750 32.436  1.00 14.12 ? 382  ILE A C     1 
ATOM   2926  O  O     . ILE A 1 382 ? 32.443  157.664 32.411  1.00 14.16 ? 382  ILE A O     1 
ATOM   2927  C  CB    . ILE A 1 382 ? 31.854  155.396 30.356  1.00 13.94 ? 382  ILE A CB    1 
ATOM   2928  C  CG1   . ILE A 1 382 ? 31.159  154.874 29.093  1.00 14.45 ? 382  ILE A CG1   1 
ATOM   2929  C  CG2   . ILE A 1 382 ? 32.335  154.241 31.228  1.00 12.36 ? 382  ILE A CG2   1 
ATOM   2930  C  CD1   . ILE A 1 382 ? 30.014  153.919 29.361  1.00 15.18 ? 382  ILE A CD1   1 
ATOM   2931  N  N     . LEU A 1 383 ? 31.304  156.091 33.546  1.00 13.52 ? 383  LEU A N     1 
ATOM   2932  C  CA    . LEU A 1 383 ? 31.961  156.367 34.821  1.00 14.55 ? 383  LEU A CA    1 
ATOM   2933  C  C     . LEU A 1 383 ? 32.619  155.081 35.317  1.00 14.57 ? 383  LEU A C     1 
ATOM   2934  O  O     . LEU A 1 383 ? 32.156  153.987 35.005  1.00 14.68 ? 383  LEU A O     1 
ATOM   2935  C  CB    . LEU A 1 383 ? 30.956  156.840 35.870  1.00 14.86 ? 383  LEU A CB    1 
ATOM   2936  C  CG    . LEU A 1 383 ? 30.247  158.175 35.676  1.00 13.61 ? 383  LEU A CG    1 
ATOM   2937  C  CD1   . LEU A 1 383 ? 29.301  158.393 36.854  1.00 14.67 ? 383  LEU A CD1   1 
ATOM   2938  C  CD2   . LEU A 1 383 ? 31.258  159.306 35.586  1.00 14.55 ? 383  LEU A CD2   1 
ATOM   2939  N  N     . GLY A 1 384 ? 33.691  155.219 36.093  1.00 14.12 ? 384  GLY A N     1 
ATOM   2940  C  CA    . GLY A 1 384 ? 34.383  154.052 36.621  1.00 12.72 ? 384  GLY A CA    1 
ATOM   2941  C  C     . GLY A 1 384 ? 34.857  154.267 38.048  1.00 12.22 ? 384  GLY A C     1 
ATOM   2942  O  O     . GLY A 1 384 ? 35.077  155.401 38.473  1.00 12.51 ? 384  GLY A O     1 
ATOM   2943  N  N     . SER A 1 385 ? 35.011  153.174 38.789  1.00 12.93 ? 385  SER A N     1 
ATOM   2944  C  CA    . SER A 1 385 ? 35.461  153.232 40.177  1.00 14.10 ? 385  SER A CA    1 
ATOM   2945  C  C     . SER A 1 385 ? 36.514  152.150 40.412  1.00 13.47 ? 385  SER A C     1 
ATOM   2946  O  O     . SER A 1 385 ? 36.369  151.026 39.929  1.00 14.76 ? 385  SER A O     1 
ATOM   2947  C  CB    . SER A 1 385 ? 34.273  153.016 41.117  1.00 16.01 ? 385  SER A CB    1 
ATOM   2948  O  OG    . SER A 1 385 ? 34.664  153.120 42.474  1.00 15.83 ? 385  SER A OG    1 
ATOM   2949  N  N     . VAL A 1 386 ? 37.558  152.478 41.170  1.00 14.27 ? 386  VAL A N     1 
ATOM   2950  C  CA    . VAL A 1 386 ? 38.628  151.515 41.423  1.00 13.91 ? 386  VAL A CA    1 
ATOM   2951  C  C     . VAL A 1 386 ? 39.392  151.728 42.724  1.00 15.13 ? 386  VAL A C     1 
ATOM   2952  O  O     . VAL A 1 386 ? 39.399  152.829 43.280  1.00 14.67 ? 386  VAL A O     1 
ATOM   2953  C  CB    . VAL A 1 386 ? 39.674  151.568 40.290  1.00 14.86 ? 386  VAL A CB    1 
ATOM   2954  C  CG1   . VAL A 1 386 ? 40.251  152.982 40.189  1.00 14.36 ? 386  VAL A CG1   1 
ATOM   2955  C  CG2   . VAL A 1 386 ? 40.797  150.575 40.555  1.00 15.84 ? 386  VAL A CG2   1 
ATOM   2956  N  N     . GLY A 1 387 ? 40.032  150.659 43.201  1.00 16.54 ? 387  GLY A N     1 
ATOM   2957  C  CA    . GLY A 1 387 ? 40.880  150.764 44.375  1.00 17.32 ? 387  GLY A CA    1 
ATOM   2958  C  C     . GLY A 1 387 ? 40.423  150.295 45.737  1.00 18.16 ? 387  GLY A C     1 
ATOM   2959  O  O     . GLY A 1 387 ? 41.254  149.973 46.583  1.00 17.98 ? 387  GLY A O     1 
ATOM   2960  N  N     . GLU A 1 388 ? 39.118  150.234 45.951  1.00 17.93 ? 388  GLU A N     1 
ATOM   2961  C  CA    . GLU A 1 388 ? 38.595  149.848 47.251  1.00 18.82 ? 388  GLU A CA    1 
ATOM   2962  C  C     . GLU A 1 388 ? 37.106  149.639 47.104  1.00 17.46 ? 388  GLU A C     1 
ATOM   2963  O  O     . GLU A 1 388 ? 36.536  149.937 46.059  1.00 16.91 ? 388  GLU A O     1 
ATOM   2964  C  CB    . GLU A 1 388 ? 38.844  150.988 48.234  1.00 19.75 ? 388  GLU A CB    1 
ATOM   2965  C  CG    . GLU A 1 388 ? 38.271  152.301 47.713  1.00 20.59 ? 388  GLU A CG    1 
ATOM   2966  C  CD    . GLU A 1 388 ? 38.667  153.509 48.536  1.00 22.85 ? 388  GLU A CD    1 
ATOM   2967  O  OE1   . GLU A 1 388 ? 38.389  153.516 49.754  1.00 22.66 ? 388  GLU A OE1   1 
ATOM   2968  O  OE2   . GLU A 1 388 ? 39.245  154.455 47.952  1.00 20.12 ? 388  GLU A OE2   1 
ATOM   2969  N  N     . PRO A 1 389 ? 36.454  149.112 48.147  1.00 19.38 ? 389  PRO A N     1 
ATOM   2970  C  CA    . PRO A 1 389 ? 35.011  148.899 48.055  1.00 20.01 ? 389  PRO A CA    1 
ATOM   2971  C  C     . PRO A 1 389 ? 34.292  150.242 47.986  1.00 20.58 ? 389  PRO A C     1 
ATOM   2972  O  O     . PRO A 1 389 ? 34.817  151.265 48.426  1.00 19.94 ? 389  PRO A O     1 
ATOM   2973  C  CB    . PRO A 1 389 ? 34.689  148.153 49.349  1.00 20.70 ? 389  PRO A CB    1 
ATOM   2974  C  CG    . PRO A 1 389 ? 35.953  147.404 49.634  1.00 20.79 ? 389  PRO A CG    1 
ATOM   2975  C  CD    . PRO A 1 389 ? 37.008  148.444 49.340  1.00 19.32 ? 389  PRO A CD    1 
ATOM   2976  N  N     . ILE A 1 390 ? 33.097  150.237 47.410  1.00 20.99 ? 390  ILE A N     1 
ATOM   2977  C  CA    . ILE A 1 390 ? 32.289  151.441 47.323  1.00 21.65 ? 390  ILE A CA    1 
ATOM   2978  C  C     . ILE A 1 390 ? 30.903  150.999 47.768  1.00 22.94 ? 390  ILE A C     1 
ATOM   2979  O  O     . ILE A 1 390 ? 30.352  150.037 47.233  1.00 22.12 ? 390  ILE A O     1 
ATOM   2980  C  CB    . ILE A 1 390 ? 32.265  152.024 45.879  1.00 21.13 ? 390  ILE A CB    1 
ATOM   2981  C  CG1   . ILE A 1 390 ? 31.526  153.362 45.875  1.00 21.27 ? 390  ILE A CG1   1 
ATOM   2982  C  CG2   . ILE A 1 390 ? 31.602  151.054 44.913  1.00 22.01 ? 390  ILE A CG2   1 
ATOM   2983  C  CD1   . ILE A 1 390 ? 31.677  154.140 44.577  1.00 21.15 ? 390  ILE A CD1   1 
ATOM   2984  N  N     . ASN A 1 391 ? 30.361  151.673 48.777  1.00 23.53 ? 391  ASN A N     1 
ATOM   2985  C  CA    . ASN A 1 391 ? 29.049  151.310 49.293  1.00 25.48 ? 391  ASN A CA    1 
ATOM   2986  C  C     . ASN A 1 391 ? 27.956  151.814 48.366  1.00 24.05 ? 391  ASN A C     1 
ATOM   2987  O  O     . ASN A 1 391 ? 28.153  152.770 47.615  1.00 24.09 ? 391  ASN A O     1 
ATOM   2988  C  CB    . ASN A 1 391 ? 28.854  151.869 50.711  1.00 29.25 ? 391  ASN A CB    1 
ATOM   2989  C  CG    . ASN A 1 391 ? 28.488  153.339 50.718  1.00 31.95 ? 391  ASN A CG    1 
ATOM   2990  O  OD1   . ASN A 1 391 ? 29.049  154.137 49.971  1.00 35.44 ? 391  ASN A OD1   1 
ATOM   2991  N  ND2   . ASN A 1 391 ? 27.550  153.706 51.581  1.00 36.73 ? 391  ASN A ND2   1 
ATOM   2992  N  N     . PRO A 1 392 ? 26.787  151.162 48.396  1.00 24.25 ? 392  PRO A N     1 
ATOM   2993  C  CA    . PRO A 1 392 ? 25.660  151.550 47.546  1.00 23.54 ? 392  PRO A CA    1 
ATOM   2994  C  C     . PRO A 1 392 ? 25.350  153.046 47.559  1.00 22.19 ? 392  PRO A C     1 
ATOM   2995  O  O     . PRO A 1 392 ? 24.970  153.613 46.534  1.00 21.08 ? 392  PRO A O     1 
ATOM   2996  C  CB    . PRO A 1 392 ? 24.514  150.707 48.101  1.00 23.25 ? 392  PRO A CB    1 
ATOM   2997  C  CG    . PRO A 1 392 ? 25.213  149.447 48.501  1.00 23.61 ? 392  PRO A CG    1 
ATOM   2998  C  CD    . PRO A 1 392 ? 26.450  149.974 49.204  1.00 23.61 ? 392  PRO A CD    1 
ATOM   2999  N  N     . GLU A 1 393 ? 25.522  153.684 48.712  1.00 21.97 ? 393  GLU A N     1 
ATOM   3000  C  CA    . GLU A 1 393 ? 25.234  155.111 48.839  1.00 22.28 ? 393  GLU A CA    1 
ATOM   3001  C  C     . GLU A 1 393 ? 26.173  155.974 47.999  1.00 21.16 ? 393  GLU A C     1 
ATOM   3002  O  O     . GLU A 1 393 ? 25.730  156.860 47.268  1.00 20.15 ? 393  GLU A O     1 
ATOM   3003  C  CB    . GLU A 1 393 ? 25.336  155.542 50.301  1.00 26.00 ? 393  GLU A CB    1 
ATOM   3004  C  CG    . GLU A 1 393 ? 24.721  156.899 50.591  1.00 31.27 ? 393  GLU A CG    1 
ATOM   3005  C  CD    . GLU A 1 393 ? 24.983  157.363 52.012  1.00 34.79 ? 393  GLU A CD    1 
ATOM   3006  O  OE1   . GLU A 1 393 ? 24.845  156.542 52.943  1.00 36.42 ? 393  GLU A OE1   1 
ATOM   3007  O  OE2   . GLU A 1 393 ? 25.319  158.552 52.196  1.00 37.43 ? 393  GLU A OE2   1 
ATOM   3008  N  N     . ALA A 1 394 ? 27.472  155.719 48.108  1.00 20.13 ? 394  ALA A N     1 
ATOM   3009  C  CA    . ALA A 1 394 ? 28.458  156.485 47.356  1.00 20.02 ? 394  ALA A CA    1 
ATOM   3010  C  C     . ALA A 1 394 ? 28.313  156.206 45.862  1.00 18.70 ? 394  ALA A C     1 
ATOM   3011  O  O     . ALA A 1 394 ? 28.454  157.104 45.031  1.00 19.83 ? 394  ALA A O     1 
ATOM   3012  C  CB    . ALA A 1 394 ? 29.863  156.126 47.825  1.00 20.01 ? 394  ALA A CB    1 
ATOM   3013  N  N     . TRP A 1 395 ? 28.033  154.952 45.536  1.00 18.21 ? 395  TRP A N     1 
ATOM   3014  C  CA    . TRP A 1 395 ? 27.861  154.518 44.153  1.00 17.69 ? 395  TRP A CA    1 
ATOM   3015  C  C     . TRP A 1 395 ? 26.705  155.290 43.516  1.00 18.38 ? 395  TRP A C     1 
ATOM   3016  O  O     . TRP A 1 395 ? 26.840  155.837 42.425  1.00 16.96 ? 395  TRP A O     1 
ATOM   3017  C  CB    . TRP A 1 395 ? 27.560  153.016 44.125  1.00 18.51 ? 395  TRP A CB    1 
ATOM   3018  C  CG    . TRP A 1 395 ? 27.647  152.372 42.770  1.00 19.47 ? 395  TRP A CG    1 
ATOM   3019  C  CD1   . TRP A 1 395 ? 28.676  151.620 42.289  1.00 21.29 ? 395  TRP A CD1   1 
ATOM   3020  C  CD2   . TRP A 1 395 ? 26.654  152.403 41.735  1.00 19.76 ? 395  TRP A CD2   1 
ATOM   3021  N  NE1   . TRP A 1 395 ? 28.388  151.173 41.020  1.00 19.74 ? 395  TRP A NE1   1 
ATOM   3022  C  CE2   . TRP A 1 395 ? 27.153  151.640 40.656  1.00 21.27 ? 395  TRP A CE2   1 
ATOM   3023  C  CE3   . TRP A 1 395 ? 25.391  153.001 41.617  1.00 21.08 ? 395  TRP A CE3   1 
ATOM   3024  C  CZ2   . TRP A 1 395 ? 26.432  151.456 39.467  1.00 20.66 ? 395  TRP A CZ2   1 
ATOM   3025  C  CZ3   . TRP A 1 395 ? 24.672  152.820 40.432  1.00 21.20 ? 395  TRP A CZ3   1 
ATOM   3026  C  CH2   . TRP A 1 395 ? 25.198  152.053 39.374  1.00 20.62 ? 395  TRP A CH2   1 
ATOM   3027  N  N     . GLU A 1 396 ? 25.568  155.330 44.205  1.00 18.66 ? 396  GLU A N     1 
ATOM   3028  C  CA    . GLU A 1 396 ? 24.397  156.039 43.700  1.00 18.93 ? 396  GLU A CA    1 
ATOM   3029  C  C     . GLU A 1 396 ? 24.638  157.540 43.576  1.00 18.15 ? 396  GLU A C     1 
ATOM   3030  O  O     . GLU A 1 396 ? 24.220  158.164 42.599  1.00 18.10 ? 396  GLU A O     1 
ATOM   3031  C  CB    . GLU A 1 396 ? 23.186  155.786 44.607  1.00 22.68 ? 396  GLU A CB    1 
ATOM   3032  C  CG    . GLU A 1 396 ? 22.579  154.393 44.477  1.00 23.62 ? 396  GLU A CG    1 
ATOM   3033  C  CD    . GLU A 1 396 ? 22.104  154.088 43.066  1.00 26.74 ? 396  GLU A CD    1 
ATOM   3034  O  OE1   . GLU A 1 396 ? 21.589  155.007 42.394  1.00 28.79 ? 396  GLU A OE1   1 
ATOM   3035  O  OE2   . GLU A 1 396 ? 22.231  152.924 42.630  1.00 28.89 ? 396  GLU A OE2   1 
ATOM   3036  N  N     . TRP A 1 397 ? 25.307  158.124 44.565  1.00 16.96 ? 397  TRP A N     1 
ATOM   3037  C  CA    . TRP A 1 397 ? 25.594  159.554 44.523  1.00 16.58 ? 397  TRP A CA    1 
ATOM   3038  C  C     . TRP A 1 397 ? 26.447  159.830 43.286  1.00 15.55 ? 397  TRP A C     1 
ATOM   3039  O  O     . TRP A 1 397 ? 26.201  160.774 42.544  1.00 15.30 ? 397  TRP A O     1 
ATOM   3040  C  CB    . TRP A 1 397 ? 26.352  159.985 45.779  1.00 16.30 ? 397  TRP A CB    1 
ATOM   3041  C  CG    . TRP A 1 397 ? 26.563  161.461 45.864  1.00 18.53 ? 397  TRP A CG    1 
ATOM   3042  C  CD1   . TRP A 1 397 ? 25.722  162.384 46.425  1.00 18.11 ? 397  TRP A CD1   1 
ATOM   3043  C  CD2   . TRP A 1 397 ? 27.678  162.195 45.348  1.00 16.98 ? 397  TRP A CD2   1 
ATOM   3044  N  NE1   . TRP A 1 397 ? 26.250  163.647 46.290  1.00 18.76 ? 397  TRP A NE1   1 
ATOM   3045  C  CE2   . TRP A 1 397 ? 27.449  163.559 45.632  1.00 17.94 ? 397  TRP A CE2   1 
ATOM   3046  C  CE3   . TRP A 1 397 ? 28.851  161.831 44.671  1.00 17.95 ? 397  TRP A CE3   1 
ATOM   3047  C  CZ2   . TRP A 1 397 ? 28.350  164.564 45.262  1.00 17.48 ? 397  TRP A CZ2   1 
ATOM   3048  C  CZ3   . TRP A 1 397 ? 29.746  162.831 44.303  1.00 17.61 ? 397  TRP A CZ3   1 
ATOM   3049  C  CH2   . TRP A 1 397 ? 29.489  164.182 44.600  1.00 17.38 ? 397  TRP A CH2   1 
ATOM   3050  N  N     . TYR A 1 398 ? 27.452  158.988 43.075  1.00 15.80 ? 398  TYR A N     1 
ATOM   3051  C  CA    . TYR A 1 398 ? 28.348  159.106 41.926  1.00 15.26 ? 398  TYR A CA    1 
ATOM   3052  C  C     . TYR A 1 398 ? 27.524  159.003 40.638  1.00 15.85 ? 398  TYR A C     1 
ATOM   3053  O  O     . TYR A 1 398 ? 27.602  159.860 39.762  1.00 14.89 ? 398  TYR A O     1 
ATOM   3054  C  CB    . TYR A 1 398 ? 29.384  157.979 42.000  1.00 15.75 ? 398  TYR A CB    1 
ATOM   3055  C  CG    . TYR A 1 398 ? 30.465  157.984 40.941  1.00 15.39 ? 398  TYR A CG    1 
ATOM   3056  C  CD1   . TYR A 1 398 ? 31.121  159.163 40.584  1.00 15.63 ? 398  TYR A CD1   1 
ATOM   3057  C  CD2   . TYR A 1 398 ? 30.898  156.788 40.367  1.00 15.34 ? 398  TYR A CD2   1 
ATOM   3058  C  CE1   . TYR A 1 398 ? 32.189  159.149 39.684  1.00 16.12 ? 398  TYR A CE1   1 
ATOM   3059  C  CE2   . TYR A 1 398 ? 31.969  156.760 39.468  1.00 16.08 ? 398  TYR A CE2   1 
ATOM   3060  C  CZ    . TYR A 1 398 ? 32.609  157.944 39.135  1.00 14.79 ? 398  TYR A CZ    1 
ATOM   3061  O  OH    . TYR A 1 398 ? 33.682  157.923 38.277  1.00 14.08 ? 398  TYR A OH    1 
ATOM   3062  N  N     . TRP A 1 399 ? 26.720  157.949 40.553  1.00 16.39 ? 399  TRP A N     1 
ATOM   3063  C  CA    . TRP A 1 399 ? 25.864  157.690 39.397  1.00 15.62 ? 399  TRP A CA    1 
ATOM   3064  C  C     . TRP A 1 399 ? 24.865  158.820 39.114  1.00 16.73 ? 399  TRP A C     1 
ATOM   3065  O  O     . TRP A 1 399 ? 24.602  159.146 37.957  1.00 15.63 ? 399  TRP A O     1 
ATOM   3066  C  CB    . TRP A 1 399 ? 25.099  156.380 39.624  1.00 17.18 ? 399  TRP A CB    1 
ATOM   3067  C  CG    . TRP A 1 399 ? 24.269  155.934 38.466  1.00 18.14 ? 399  TRP A CG    1 
ATOM   3068  C  CD1   . TRP A 1 399 ? 24.710  155.332 37.324  1.00 20.82 ? 399  TRP A CD1   1 
ATOM   3069  C  CD2   . TRP A 1 399 ? 22.847  156.057 38.332  1.00 20.70 ? 399  TRP A CD2   1 
ATOM   3070  N  NE1   . TRP A 1 399 ? 23.651  155.069 36.487  1.00 23.33 ? 399  TRP A NE1   1 
ATOM   3071  C  CE2   . TRP A 1 399 ? 22.496  155.505 37.082  1.00 21.34 ? 399  TRP A CE2   1 
ATOM   3072  C  CE3   . TRP A 1 399 ? 21.835  156.580 39.150  1.00 22.22 ? 399  TRP A CE3   1 
ATOM   3073  C  CZ2   . TRP A 1 399 ? 21.172  155.460 36.626  1.00 22.92 ? 399  TRP A CZ2   1 
ATOM   3074  C  CZ3   . TRP A 1 399 ? 20.517  156.535 38.697  1.00 22.94 ? 399  TRP A CZ3   1 
ATOM   3075  C  CH2   . TRP A 1 399 ? 20.199  155.977 37.445  1.00 22.54 ? 399  TRP A CH2   1 
ATOM   3076  N  N     . LYS A 1 400 ? 24.316  159.417 40.168  1.00 16.67 ? 400  LYS A N     1 
ATOM   3077  C  CA    . LYS A 1 400 ? 23.329  160.487 40.016  1.00 18.37 ? 400  LYS A CA    1 
ATOM   3078  C  C     . LYS A 1 400 ? 23.883  161.896 39.827  1.00 17.22 ? 400  LYS A C     1 
ATOM   3079  O  O     . LYS A 1 400 ? 23.522  162.587 38.876  1.00 18.12 ? 400  LYS A O     1 
ATOM   3080  C  CB    . LYS A 1 400 ? 22.375  160.501 41.220  1.00 21.00 ? 400  LYS A CB    1 
ATOM   3081  C  CG    . LYS A 1 400 ? 21.403  161.681 41.210  1.00 25.90 ? 400  LYS A CG    1 
ATOM   3082  C  CD    . LYS A 1 400 ? 20.584  161.789 42.496  1.00 30.13 ? 400  LYS A CD    1 
ATOM   3083  C  CE    . LYS A 1 400 ? 19.595  160.644 42.642  1.00 33.24 ? 400  LYS A CE    1 
ATOM   3084  N  NZ    . LYS A 1 400 ? 18.678  160.850 43.805  1.00 37.14 ? 400  LYS A NZ    1 
ATOM   3085  N  N     . LYS A 1 401 ? 24.758  162.322 40.729  1.00 16.26 ? 401  LYS A N     1 
ATOM   3086  C  CA    . LYS A 1 401 ? 25.312  163.669 40.673  1.00 16.36 ? 401  LYS A CA    1 
ATOM   3087  C  C     . LYS A 1 401 ? 26.367  163.888 39.596  1.00 16.24 ? 401  LYS A C     1 
ATOM   3088  O  O     . LYS A 1 401 ? 26.372  164.919 38.925  1.00 16.03 ? 401  LYS A O     1 
ATOM   3089  C  CB    . LYS A 1 401 ? 25.888  164.042 42.037  1.00 17.72 ? 401  LYS A CB    1 
ATOM   3090  C  CG    . LYS A 1 401 ? 24.873  163.974 43.179  1.00 19.03 ? 401  LYS A CG    1 
ATOM   3091  C  CD    . LYS A 1 401 ? 23.793  165.032 43.049  1.00 21.53 ? 401  LYS A CD    1 
ATOM   3092  C  CE    . LYS A 1 401 ? 22.798  164.942 44.206  1.00 22.25 ? 401  LYS A CE    1 
ATOM   3093  N  NZ    . LYS A 1 401 ? 21.796  166.047 44.175  1.00 23.27 ? 401  LYS A NZ    1 
ATOM   3094  N  N     . ILE A 1 402 ? 27.261  162.922 39.429  1.00 15.52 ? 402  ILE A N     1 
ATOM   3095  C  CA    . ILE A 1 402 ? 28.311  163.060 38.434  1.00 14.29 ? 402  ILE A CA    1 
ATOM   3096  C  C     . ILE A 1 402 ? 27.859  162.542 37.072  1.00 14.48 ? 402  ILE A C     1 
ATOM   3097  O  O     . ILE A 1 402 ? 28.062  163.208 36.055  1.00 17.10 ? 402  ILE A O     1 
ATOM   3098  C  CB    . ILE A 1 402 ? 29.592  162.311 38.870  1.00 14.28 ? 402  ILE A CB    1 
ATOM   3099  C  CG1   . ILE A 1 402 ? 29.964  162.693 40.310  1.00 14.79 ? 402  ILE A CG1   1 
ATOM   3100  C  CG2   . ILE A 1 402 ? 30.745  162.661 37.932  1.00 14.04 ? 402  ILE A CG2   1 
ATOM   3101  C  CD1   . ILE A 1 402 ? 30.191  164.191 40.527  1.00 14.41 ? 402  ILE A CD1   1 
ATOM   3102  N  N     . GLY A 1 403 ? 27.235  161.366 37.057  1.00 15.55 ? 403  GLY A N     1 
ATOM   3103  C  CA    . GLY A 1 403 ? 26.773  160.787 35.807  1.00 14.38 ? 403  GLY A CA    1 
ATOM   3104  C  C     . GLY A 1 403 ? 25.391  161.236 35.362  1.00 16.14 ? 403  GLY A C     1 
ATOM   3105  O  O     . GLY A 1 403 ? 24.930  160.856 34.283  1.00 15.61 ? 403  GLY A O     1 
ATOM   3106  N  N     . LYS A 1 404 ? 24.721  162.033 36.190  1.00 17.49 ? 404  LYS A N     1 
ATOM   3107  C  CA    . LYS A 1 404 ? 23.387  162.530 35.864  1.00 18.97 ? 404  LYS A CA    1 
ATOM   3108  C  C     . LYS A 1 404 ? 22.419  161.399 35.506  1.00 19.48 ? 404  LYS A C     1 
ATOM   3109  O  O     . LYS A 1 404 ? 21.513  161.582 34.685  1.00 19.43 ? 404  LYS A O     1 
ATOM   3110  C  CB    . LYS A 1 404 ? 23.473  163.534 34.709  1.00 20.57 ? 404  LYS A CB    1 
ATOM   3111  C  CG    . LYS A 1 404 ? 24.300  164.767 35.045  1.00 22.68 ? 404  LYS A CG    1 
ATOM   3112  C  CD    . LYS A 1 404 ? 24.447  165.706 33.853  1.00 26.82 ? 404  LYS A CD    1 
ATOM   3113  C  CE    . LYS A 1 404 ? 23.169  166.471 33.571  1.00 29.46 ? 404  LYS A CE    1 
ATOM   3114  N  NZ    . LYS A 1 404 ? 23.326  167.326 32.359  1.00 32.66 ? 404  LYS A NZ    1 
ATOM   3115  N  N     . GLU A 1 405 ? 22.629  160.242 36.134  1.00 18.17 ? 405  GLU A N     1 
ATOM   3116  C  CA    . GLU A 1 405 ? 21.809  159.043 35.940  1.00 19.46 ? 405  GLU A CA    1 
ATOM   3117  C  C     . GLU A 1 405 ? 21.776  158.536 34.501  1.00 19.45 ? 405  GLU A C     1 
ATOM   3118  O  O     . GLU A 1 405 ? 20.842  157.844 34.109  1.00 19.11 ? 405  GLU A O     1 
ATOM   3119  C  CB    . GLU A 1 405 ? 20.369  159.300 36.400  1.00 20.98 ? 405  GLU A CB    1 
ATOM   3120  C  CG    . GLU A 1 405 ? 20.250  160.067 37.707  1.00 21.44 ? 405  GLU A CG    1 
ATOM   3121  C  CD    . GLU A 1 405 ? 18.816  160.129 38.209  1.00 23.32 ? 405  GLU A CD    1 
ATOM   3122  O  OE1   . GLU A 1 405 ? 18.473  161.088 38.931  1.00 25.74 ? 405  GLU A OE1   1 
ATOM   3123  O  OE2   . GLU A 1 405 ? 18.037  159.209 37.887  1.00 20.97 ? 405  GLU A OE2   1 
ATOM   3124  N  N     . LYS A 1 406 ? 22.796  158.861 33.718  1.00 19.51 ? 406  LYS A N     1 
ATOM   3125  C  CA    . LYS A 1 406 ? 22.830  158.442 32.323  1.00 18.64 ? 406  LYS A CA    1 
ATOM   3126  C  C     . LYS A 1 406 ? 24.056  157.610 31.980  1.00 18.65 ? 406  LYS A C     1 
ATOM   3127  O  O     . LYS A 1 406 ? 24.147  157.061 30.879  1.00 17.37 ? 406  LYS A O     1 
ATOM   3128  C  CB    . LYS A 1 406 ? 22.795  159.674 31.416  1.00 20.52 ? 406  LYS A CB    1 
ATOM   3129  C  CG    . LYS A 1 406 ? 21.535  160.512 31.568  1.00 23.83 ? 406  LYS A CG    1 
ATOM   3130  C  CD    . LYS A 1 406 ? 21.604  161.781 30.735  1.00 28.59 ? 406  LYS A CD    1 
ATOM   3131  C  CE    . LYS A 1 406 ? 20.325  162.598 30.876  1.00 30.90 ? 406  LYS A CE    1 
ATOM   3132  N  NZ    . LYS A 1 406 ? 20.402  163.889 30.135  1.00 34.05 ? 406  LYS A NZ    1 
ATOM   3133  N  N     . CYS A 1 407 ? 24.988  157.506 32.922  1.00 15.14 ? 407  CYS A N     1 
ATOM   3134  C  CA    . CYS A 1 407 ? 26.219  156.765 32.674  1.00 15.89 ? 407  CYS A CA    1 
ATOM   3135  C  C     . CYS A 1 407 ? 26.415  155.483 33.461  1.00 14.61 ? 407  CYS A C     1 
ATOM   3136  O  O     . CYS A 1 407 ? 26.270  155.460 34.682  1.00 15.09 ? 407  CYS A O     1 
ATOM   3137  C  CB    . CYS A 1 407 ? 27.433  157.658 32.954  1.00 15.75 ? 407  CYS A CB    1 
ATOM   3138  S  SG    . CYS A 1 407 ? 27.456  159.221 32.108  1.00 17.69 ? 407  CYS A SG    1 
ATOM   3139  N  N     . PRO A 1 408 ? 26.741  154.384 32.766  1.00 15.01 ? 408  PRO A N     1 
ATOM   3140  C  CA    . PRO A 1 408 ? 26.958  153.147 33.514  1.00 15.50 ? 408  PRO A CA    1 
ATOM   3141  C  C     . PRO A 1 408 ? 28.228  153.372 34.342  1.00 15.98 ? 408  PRO A C     1 
ATOM   3142  O  O     . PRO A 1 408 ? 29.107  154.133 33.937  1.00 15.66 ? 408  PRO A O     1 
ATOM   3143  C  CB    . PRO A 1 408 ? 27.179  152.115 32.413  1.00 17.25 ? 408  PRO A CB    1 
ATOM   3144  C  CG    . PRO A 1 408 ? 26.317  152.623 31.307  1.00 13.37 ? 408  PRO A CG    1 
ATOM   3145  C  CD    . PRO A 1 408 ? 26.599  154.111 31.325  1.00 14.23 ? 408  PRO A CD    1 
ATOM   3146  N  N     . VAL A 1 409 ? 28.309  152.735 35.502  1.00 15.53 ? 409  VAL A N     1 
ATOM   3147  C  CA    . VAL A 1 409 ? 29.479  152.853 36.368  1.00 14.98 ? 409  VAL A CA    1 
ATOM   3148  C  C     . VAL A 1 409 ? 30.202  151.514 36.353  1.00 15.39 ? 409  VAL A C     1 
ATOM   3149  O  O     . VAL A 1 409 ? 29.600  150.482 36.658  1.00 17.54 ? 409  VAL A O     1 
ATOM   3150  C  CB    . VAL A 1 409 ? 29.072  153.172 37.833  1.00 13.13 ? 409  VAL A CB    1 
ATOM   3151  C  CG1   . VAL A 1 409 ? 30.292  153.120 38.741  1.00 16.00 ? 409  VAL A CG1   1 
ATOM   3152  C  CG2   . VAL A 1 409 ? 28.412  154.540 37.909  1.00 14.69 ? 409  VAL A CG2   1 
ATOM   3153  N  N     . VAL A 1 410 ? 31.478  151.511 35.975  1.00 14.51 ? 410  VAL A N     1 
ATOM   3154  C  CA    . VAL A 1 410 ? 32.226  150.260 35.976  1.00 13.24 ? 410  VAL A CA    1 
ATOM   3155  C  C     . VAL A 1 410 ? 33.126  150.199 37.200  1.00 13.66 ? 410  VAL A C     1 
ATOM   3156  O  O     . VAL A 1 410 ? 34.122  150.911 37.294  1.00 13.87 ? 410  VAL A O     1 
ATOM   3157  C  CB    . VAL A 1 410 ? 33.075  150.062 34.676  1.00 13.49 ? 410  VAL A CB    1 
ATOM   3158  C  CG1   . VAL A 1 410 ? 32.149  149.894 33.482  1.00 15.68 ? 410  VAL A CG1   1 
ATOM   3159  C  CG2   . VAL A 1 410 ? 34.026  151.239 34.457  1.00 13.74 ? 410  VAL A CG2   1 
ATOM   3160  N  N     . ASP A 1 411 ? 32.734  149.363 38.156  1.00 13.73 ? 411  ASP A N     1 
ATOM   3161  C  CA    . ASP A 1 411 ? 33.485  149.165 39.388  1.00 14.92 ? 411  ASP A CA    1 
ATOM   3162  C  C     . ASP A 1 411 ? 34.445  148.017 39.091  1.00 13.57 ? 411  ASP A C     1 
ATOM   3163  O  O     . ASP A 1 411 ? 34.052  146.854 39.057  1.00 13.58 ? 411  ASP A O     1 
ATOM   3164  C  CB    . ASP A 1 411 ? 32.523  148.805 40.528  1.00 13.29 ? 411  ASP A CB    1 
ATOM   3165  C  CG    . ASP A 1 411 ? 33.238  148.476 41.822  1.00 15.60 ? 411  ASP A CG    1 
ATOM   3166  O  OD1   . ASP A 1 411 ? 34.461  148.713 41.907  1.00 14.05 ? 411  ASP A OD1   1 
ATOM   3167  O  OD2   . ASP A 1 411 ? 32.568  147.985 42.759  1.00 15.43 ? 411  ASP A OD2   1 
ATOM   3168  N  N     . THR A 1 412 ? 35.706  148.366 38.864  1.00 13.19 ? 412  THR A N     1 
ATOM   3169  C  CA    . THR A 1 412 ? 36.741  147.400 38.514  1.00 13.42 ? 412  THR A CA    1 
ATOM   3170  C  C     . THR A 1 412 ? 37.585  146.871 39.671  1.00 13.04 ? 412  THR A C     1 
ATOM   3171  O  O     . THR A 1 412 ? 38.320  147.626 40.309  1.00 12.37 ? 412  THR A O     1 
ATOM   3172  C  CB    . THR A 1 412 ? 37.716  148.011 37.482  1.00 12.57 ? 412  THR A CB    1 
ATOM   3173  O  OG1   . THR A 1 412 ? 38.445  149.082 38.100  1.00 12.58 ? 412  THR A OG1   1 
ATOM   3174  C  CG2   . THR A 1 412 ? 36.954  148.564 36.273  1.00 13.45 ? 412  THR A CG2   1 
ATOM   3175  N  N     . TRP A 1 413 ? 37.484  145.572 39.938  1.00 12.06 ? 413  TRP A N     1 
ATOM   3176  C  CA    . TRP A 1 413 ? 38.295  144.972 40.984  1.00 11.97 ? 413  TRP A CA    1 
ATOM   3177  C  C     . TRP A 1 413 ? 39.491  144.308 40.329  1.00 11.55 ? 413  TRP A C     1 
ATOM   3178  O  O     . TRP A 1 413 ? 39.347  143.573 39.356  1.00 12.37 ? 413  TRP A O     1 
ATOM   3179  C  CB    . TRP A 1 413 ? 37.540  143.895 41.772  1.00 12.23 ? 413  TRP A CB    1 
ATOM   3180  C  CG    . TRP A 1 413 ? 38.468  143.170 42.714  1.00 11.28 ? 413  TRP A CG    1 
ATOM   3181  C  CD1   . TRP A 1 413 ? 38.905  143.606 43.936  1.00 10.84 ? 413  TRP A CD1   1 
ATOM   3182  C  CD2   . TRP A 1 413 ? 39.183  141.951 42.448  1.00 12.26 ? 413  TRP A CD2   1 
ATOM   3183  N  NE1   . TRP A 1 413 ? 39.851  142.741 44.442  1.00 11.63 ? 413  TRP A NE1   1 
ATOM   3184  C  CE2   . TRP A 1 413 ? 40.041  141.719 43.549  1.00 11.77 ? 413  TRP A CE2   1 
ATOM   3185  C  CE3   . TRP A 1 413 ? 39.184  141.037 41.384  1.00 12.33 ? 413  TRP A CE3   1 
ATOM   3186  C  CZ2   . TRP A 1 413 ? 40.895  140.609 43.617  1.00 13.44 ? 413  TRP A CZ2   1 
ATOM   3187  C  CZ3   . TRP A 1 413 ? 40.034  139.931 41.451  1.00 13.90 ? 413  TRP A CZ3   1 
ATOM   3188  C  CH2   . TRP A 1 413 ? 40.878  139.728 42.561  1.00 13.69 ? 413  TRP A CH2   1 
ATOM   3189  N  N     . TRP A 1 414 ? 40.671  144.584 40.864  1.00 12.13 ? 414  TRP A N     1 
ATOM   3190  C  CA    . TRP A 1 414 ? 41.905  143.985 40.377  1.00 11.67 ? 414  TRP A CA    1 
ATOM   3191  C  C     . TRP A 1 414 ? 43.013  144.382 41.339  1.00 11.28 ? 414  TRP A C     1 
ATOM   3192  O  O     . TRP A 1 414 ? 42.730  144.973 42.383  1.00 12.47 ? 414  TRP A O     1 
ATOM   3193  C  CB    . TRP A 1 414 ? 42.215  144.416 38.930  1.00 11.35 ? 414  TRP A CB    1 
ATOM   3194  C  CG    . TRP A 1 414 ? 42.366  145.887 38.690  1.00 9.76  ? 414  TRP A CG    1 
ATOM   3195  C  CD1   . TRP A 1 414 ? 41.406  146.853 38.832  1.00 10.81 ? 414  TRP A CD1   1 
ATOM   3196  C  CD2   . TRP A 1 414 ? 43.543  146.556 38.222  1.00 11.24 ? 414  TRP A CD2   1 
ATOM   3197  N  NE1   . TRP A 1 414 ? 41.914  148.079 38.479  1.00 11.57 ? 414  TRP A NE1   1 
ATOM   3198  C  CE2   . TRP A 1 414 ? 43.224  147.929 38.104  1.00 10.54 ? 414  TRP A CE2   1 
ATOM   3199  C  CE3   . TRP A 1 414 ? 44.840  146.127 37.894  1.00 9.35  ? 414  TRP A CE3   1 
ATOM   3200  C  CZ2   . TRP A 1 414 ? 44.157  148.884 37.671  1.00 8.83  ? 414  TRP A CZ2   1 
ATOM   3201  C  CZ3   . TRP A 1 414 ? 45.771  147.078 37.461  1.00 10.94 ? 414  TRP A CZ3   1 
ATOM   3202  C  CH2   . TRP A 1 414 ? 45.420  148.440 37.356  1.00 8.88  ? 414  TRP A CH2   1 
ATOM   3203  N  N     . GLN A 1 415 ? 44.259  144.049 41.012  1.00 12.02 ? 415  GLN A N     1 
ATOM   3204  C  CA    . GLN A 1 415 ? 45.382  144.353 41.896  1.00 12.97 ? 415  GLN A CA    1 
ATOM   3205  C  C     . GLN A 1 415 ? 46.657  144.580 41.095  1.00 13.72 ? 415  GLN A C     1 
ATOM   3206  O  O     . GLN A 1 415 ? 46.720  144.286 39.898  1.00 12.77 ? 415  GLN A O     1 
ATOM   3207  C  CB    . GLN A 1 415 ? 45.650  143.181 42.845  1.00 14.39 ? 415  GLN A CB    1 
ATOM   3208  C  CG    . GLN A 1 415 ? 44.419  142.507 43.417  1.00 16.68 ? 415  GLN A CG    1 
ATOM   3209  C  CD    . GLN A 1 415 ? 44.767  141.257 44.196  1.00 17.11 ? 415  GLN A CD    1 
ATOM   3210  O  OE1   . GLN A 1 415 ? 45.223  140.259 43.628  1.00 16.66 ? 415  GLN A OE1   1 
ATOM   3211  N  NE2   . GLN A 1 415 ? 44.573  141.307 45.508  1.00 13.88 ? 415  GLN A NE2   1 
ATOM   3212  N  N     . THR A 1 416 ? 47.682  145.082 41.773  1.00 12.53 ? 416  THR A N     1 
ATOM   3213  C  CA    . THR A 1 416 ? 48.967  145.317 41.130  1.00 12.27 ? 416  THR A CA    1 
ATOM   3214  C  C     . THR A 1 416 ? 49.431  144.001 40.502  1.00 12.97 ? 416  THR A C     1 
ATOM   3215  O  O     . THR A 1 416 ? 49.954  143.976 39.383  1.00 14.26 ? 416  THR A O     1 
ATOM   3216  C  CB    . THR A 1 416 ? 50.030  145.778 42.155  1.00 12.05 ? 416  THR A CB    1 
ATOM   3217  O  OG1   . THR A 1 416 ? 49.599  146.992 42.783  1.00 10.73 ? 416  THR A OG1   1 
ATOM   3218  C  CG2   . THR A 1 416 ? 51.370  146.021 41.463  1.00 10.88 ? 416  THR A CG2   1 
ATOM   3219  N  N     . GLU A 1 417 ? 49.220  142.908 41.230  1.00 11.68 ? 417  GLU A N     1 
ATOM   3220  C  CA    . GLU A 1 417 ? 49.622  141.583 40.770  1.00 12.42 ? 417  GLU A CA    1 
ATOM   3221  C  C     . GLU A 1 417 ? 48.809  141.018 39.607  1.00 11.90 ? 417  GLU A C     1 
ATOM   3222  O  O     . GLU A 1 417 ? 49.179  139.989 39.053  1.00 11.04 ? 417  GLU A O     1 
ATOM   3223  C  CB    . GLU A 1 417 ? 49.582  140.580 41.933  1.00 12.70 ? 417  GLU A CB    1 
ATOM   3224  C  CG    . GLU A 1 417 ? 50.487  140.930 43.110  1.00 12.90 ? 417  GLU A CG    1 
ATOM   3225  C  CD    . GLU A 1 417 ? 49.789  141.753 44.177  1.00 14.05 ? 417  GLU A CD    1 
ATOM   3226  O  OE1   . GLU A 1 417 ? 48.813  142.463 43.850  1.00 12.42 ? 417  GLU A OE1   1 
ATOM   3227  O  OE2   . GLU A 1 417 ? 50.231  141.697 45.347  1.00 14.12 ? 417  GLU A OE2   1 
ATOM   3228  N  N     . THR A 1 418 ? 47.708  141.668 39.230  1.00 12.07 ? 418  THR A N     1 
ATOM   3229  C  CA    . THR A 1 418 ? 46.906  141.140 38.127  1.00 11.87 ? 418  THR A CA    1 
ATOM   3230  C  C     . THR A 1 418 ? 47.081  141.903 36.816  1.00 12.71 ? 418  THR A C     1 
ATOM   3231  O  O     . THR A 1 418 ? 46.561  141.489 35.775  1.00 12.12 ? 418  THR A O     1 
ATOM   3232  C  CB    . THR A 1 418 ? 45.398  141.080 38.492  1.00 12.99 ? 418  THR A CB    1 
ATOM   3233  O  OG1   . THR A 1 418 ? 44.843  142.399 38.496  1.00 12.68 ? 418  THR A OG1   1 
ATOM   3234  C  CG2   . THR A 1 418 ? 45.217  140.451 39.870  1.00 10.42 ? 418  THR A CG2   1 
ATOM   3235  N  N     . GLY A 1 419 ? 47.814  143.015 36.867  1.00 11.57 ? 419  GLY A N     1 
ATOM   3236  C  CA    . GLY A 1 419 ? 48.066  143.794 35.664  1.00 10.52 ? 419  GLY A CA    1 
ATOM   3237  C  C     . GLY A 1 419 ? 46.899  144.603 35.133  1.00 10.72 ? 419  GLY A C     1 
ATOM   3238  O  O     . GLY A 1 419 ? 47.084  145.751 34.725  1.00 11.94 ? 419  GLY A O     1 
ATOM   3239  N  N     . GLY A 1 420 ? 45.708  144.005 35.130  1.00 11.20 ? 420  GLY A N     1 
ATOM   3240  C  CA    . GLY A 1 420 ? 44.524  144.689 34.637  1.00 13.07 ? 420  GLY A CA    1 
ATOM   3241  C  C     . GLY A 1 420 ? 43.234  144.196 35.281  1.00 11.60 ? 420  GLY A C     1 
ATOM   3242  O  O     . GLY A 1 420 ? 43.265  143.318 36.135  1.00 11.80 ? 420  GLY A O     1 
ATOM   3243  N  N     . PHE A 1 421 ? 42.105  144.765 34.858  1.00 12.59 ? 421  PHE A N     1 
ATOM   3244  C  CA    . PHE A 1 421 ? 40.780  144.426 35.391  1.00 12.52 ? 421  PHE A CA    1 
ATOM   3245  C  C     . PHE A 1 421 ? 40.532  142.920 35.468  1.00 11.58 ? 421  PHE A C     1 
ATOM   3246  O  O     . PHE A 1 421 ? 40.830  142.186 34.522  1.00 11.56 ? 421  PHE A O     1 
ATOM   3247  C  CB    . PHE A 1 421 ? 39.688  145.061 34.526  1.00 10.87 ? 421  PHE A CB    1 
ATOM   3248  C  CG    . PHE A 1 421 ? 39.812  146.559 34.372  1.00 10.68 ? 421  PHE A CG    1 
ATOM   3249  C  CD1   . PHE A 1 421 ? 39.175  147.206 33.316  1.00 10.72 ? 421  PHE A CD1   1 
ATOM   3250  C  CD2   . PHE A 1 421 ? 40.548  147.320 35.282  1.00 9.60  ? 421  PHE A CD2   1 
ATOM   3251  C  CE1   . PHE A 1 421 ? 39.266  148.590 33.159  1.00 10.50 ? 421  PHE A CE1   1 
ATOM   3252  C  CE2   . PHE A 1 421 ? 40.645  148.708 35.137  1.00 9.32  ? 421  PHE A CE2   1 
ATOM   3253  C  CZ    . PHE A 1 421 ? 40.005  149.346 34.076  1.00 9.10  ? 421  PHE A CZ    1 
ATOM   3254  N  N     . MET A 1 422 ? 39.956  142.481 36.586  1.00 12.06 ? 422  MET A N     1 
ATOM   3255  C  CA    . MET A 1 422 ? 39.672  141.063 36.823  1.00 12.76 ? 422  MET A CA    1 
ATOM   3256  C  C     . MET A 1 422 ? 38.173  140.771 36.938  1.00 13.12 ? 422  MET A C     1 
ATOM   3257  O  O     . MET A 1 422 ? 37.663  139.849 36.305  1.00 13.81 ? 422  MET A O     1 
ATOM   3258  C  CB    . MET A 1 422 ? 40.390  140.603 38.094  1.00 12.64 ? 422  MET A CB    1 
ATOM   3259  C  CG    . MET A 1 422 ? 41.913  140.680 38.011  1.00 12.57 ? 422  MET A CG    1 
ATOM   3260  S  SD    . MET A 1 422 ? 42.583  139.624 36.704  1.00 14.46 ? 422  MET A SD    1 
ATOM   3261  C  CE    . MET A 1 422 ? 42.609  138.038 37.540  1.00 15.00 ? 422  MET A CE    1 
ATOM   3262  N  N     . ILE A 1 423 ? 37.477  141.534 37.774  1.00 13.17 ? 423  ILE A N     1 
ATOM   3263  C  CA    . ILE A 1 423 ? 36.034  141.372 37.932  1.00 13.89 ? 423  ILE A CA    1 
ATOM   3264  C  C     . ILE A 1 423 ? 35.521  142.780 37.724  1.00 15.43 ? 423  ILE A C     1 
ATOM   3265  O  O     . ILE A 1 423 ? 35.872  143.699 38.466  1.00 15.80 ? 423  ILE A O     1 
ATOM   3266  C  CB    . ILE A 1 423 ? 35.649  140.855 39.331  1.00 15.25 ? 423  ILE A CB    1 
ATOM   3267  C  CG1   . ILE A 1 423 ? 36.356  139.523 39.597  1.00 15.54 ? 423  ILE A CG1   1 
ATOM   3268  C  CG2   . ILE A 1 423 ? 34.125  140.669 39.415  1.00 12.43 ? 423  ILE A CG2   1 
ATOM   3269  C  CD1   . ILE A 1 423 ? 36.051  138.907 40.962  1.00 17.22 ? 423  ILE A CD1   1 
ATOM   3270  N  N     . THR A 1 424 ? 34.704  142.950 36.694  1.00 13.20 ? 424  THR A N     1 
ATOM   3271  C  CA    . THR A 1 424 ? 34.218  144.269 36.342  1.00 13.71 ? 424  THR A CA    1 
ATOM   3272  C  C     . THR A 1 424 ? 33.033  144.193 35.398  1.00 13.01 ? 424  THR A C     1 
ATOM   3273  O  O     . THR A 1 424 ? 32.851  143.201 34.694  1.00 14.16 ? 424  THR A O     1 
ATOM   3274  C  CB    . THR A 1 424 ? 35.332  145.054 35.608  1.00 13.85 ? 424  THR A CB    1 
ATOM   3275  O  OG1   . THR A 1 424 ? 34.793  146.248 35.032  1.00 13.37 ? 424  THR A OG1   1 
ATOM   3276  C  CG2   . THR A 1 424 ? 35.925  144.202 34.488  1.00 15.54 ? 424  THR A CG2   1 
ATOM   3277  N  N     . PRO A 1 425 ? 32.203  145.243 35.378  1.00 14.76 ? 425  PRO A N     1 
ATOM   3278  C  CA    . PRO A 1 425 ? 31.059  145.220 34.467  1.00 14.17 ? 425  PRO A CA    1 
ATOM   3279  C  C     . PRO A 1 425 ? 31.578  145.694 33.107  1.00 15.66 ? 425  PRO A C     1 
ATOM   3280  O  O     . PRO A 1 425 ? 32.660  146.284 33.019  1.00 14.08 ? 425  PRO A O     1 
ATOM   3281  C  CB    . PRO A 1 425 ? 30.108  146.272 35.052  1.00 15.49 ? 425  PRO A CB    1 
ATOM   3282  C  CG    . PRO A 1 425 ? 30.649  146.575 36.436  1.00 17.10 ? 425  PRO A CG    1 
ATOM   3283  C  CD    . PRO A 1 425 ? 32.126  146.395 36.293  1.00 15.10 ? 425  PRO A CD    1 
ATOM   3284  N  N     . LEU A 1 426 ? 30.826  145.400 32.056  1.00 15.15 ? 426  LEU A N     1 
ATOM   3285  C  CA    . LEU A 1 426 ? 31.129  145.899 30.720  1.00 15.85 ? 426  LEU A CA    1 
ATOM   3286  C  C     . LEU A 1 426 ? 29.845  146.714 30.564  1.00 16.32 ? 426  LEU A C     1 
ATOM   3287  O  O     . LEU A 1 426 ? 28.748  146.183 30.736  1.00 16.40 ? 426  LEU A O     1 
ATOM   3288  C  CB    . LEU A 1 426 ? 31.242  144.767 29.694  1.00 17.35 ? 426  LEU A CB    1 
ATOM   3289  C  CG    . LEU A 1 426 ? 32.688  144.274 29.497  1.00 17.70 ? 426  LEU A CG    1 
ATOM   3290  C  CD1   . LEU A 1 426 ? 33.177  143.579 30.760  1.00 16.98 ? 426  LEU A CD1   1 
ATOM   3291  C  CD2   . LEU A 1 426 ? 32.758  143.318 28.309  1.00 19.22 ? 426  LEU A CD2   1 
ATOM   3292  N  N     . PRO A 1 427 ? 29.968  148.016 30.262  1.00 14.78 ? 427  PRO A N     1 
ATOM   3293  C  CA    . PRO A 1 427 ? 28.825  148.923 30.114  1.00 15.14 ? 427  PRO A CA    1 
ATOM   3294  C  C     . PRO A 1 427 ? 27.632  148.511 29.269  1.00 15.36 ? 427  PRO A C     1 
ATOM   3295  O  O     . PRO A 1 427 ? 26.489  148.765 29.657  1.00 15.26 ? 427  PRO A O     1 
ATOM   3296  C  CB    . PRO A 1 427 ? 29.472  150.220 29.632  1.00 16.75 ? 427  PRO A CB    1 
ATOM   3297  C  CG    . PRO A 1 427 ? 30.651  149.741 28.870  1.00 16.75 ? 427  PRO A CG    1 
ATOM   3298  C  CD    . PRO A 1 427 ? 31.195  148.646 29.742  1.00 14.96 ? 427  PRO A CD    1 
ATOM   3299  N  N     . GLY A 1 428 ? 27.884  147.892 28.123  1.00 14.06 ? 428  GLY A N     1 
ATOM   3300  C  CA    . GLY A 1 428 ? 26.785  147.484 27.268  1.00 14.77 ? 428  GLY A CA    1 
ATOM   3301  C  C     . GLY A 1 428 ? 26.450  146.007 27.344  1.00 14.83 ? 428  GLY A C     1 
ATOM   3302  O  O     . GLY A 1 428 ? 25.654  145.518 26.549  1.00 14.35 ? 428  GLY A O     1 
ATOM   3303  N  N     . ALA A 1 429 ? 27.034  145.295 28.303  1.00 14.15 ? 429  ALA A N     1 
ATOM   3304  C  CA    . ALA A 1 429 ? 26.782  143.862 28.416  1.00 15.56 ? 429  ALA A CA    1 
ATOM   3305  C  C     . ALA A 1 429 ? 26.288  143.392 29.780  1.00 16.81 ? 429  ALA A C     1 
ATOM   3306  O  O     . ALA A 1 429 ? 25.655  142.340 29.881  1.00 16.72 ? 429  ALA A O     1 
ATOM   3307  C  CB    . ALA A 1 429 ? 28.046  143.095 28.042  1.00 15.51 ? 429  ALA A CB    1 
ATOM   3308  N  N     . ILE A 1 430 ? 26.570  144.165 30.824  1.00 16.98 ? 430  ILE A N     1 
ATOM   3309  C  CA    . ILE A 1 430 ? 26.179  143.767 32.171  1.00 18.11 ? 430  ILE A CA    1 
ATOM   3310  C  C     . ILE A 1 430 ? 25.355  144.812 32.919  1.00 18.67 ? 430  ILE A C     1 
ATOM   3311  O  O     . ILE A 1 430 ? 25.738  145.978 33.006  1.00 17.65 ? 430  ILE A O     1 
ATOM   3312  C  CB    . ILE A 1 430 ? 27.447  143.421 32.999  1.00 20.16 ? 430  ILE A CB    1 
ATOM   3313  C  CG1   . ILE A 1 430 ? 28.205  142.279 32.310  1.00 20.14 ? 430  ILE A CG1   1 
ATOM   3314  C  CG2   . ILE A 1 430 ? 27.070  143.040 34.425  1.00 19.70 ? 430  ILE A CG2   1 
ATOM   3315  C  CD1   . ILE A 1 430 ? 29.539  141.927 32.950  1.00 22.73 ? 430  ILE A CD1   1 
ATOM   3316  N  N     . GLU A 1 431 ? 24.211  144.387 33.452  1.00 18.88 ? 431  GLU A N     1 
ATOM   3317  C  CA    . GLU A 1 431 ? 23.359  145.287 34.216  1.00 18.93 ? 431  GLU A CA    1 
ATOM   3318  C  C     . GLU A 1 431 ? 24.062  145.482 35.554  1.00 17.15 ? 431  GLU A C     1 
ATOM   3319  O  O     . GLU A 1 431 ? 24.665  144.555 36.082  1.00 17.49 ? 431  GLU A O     1 
ATOM   3320  C  CB    . GLU A 1 431 ? 21.970  144.679 34.399  1.00 19.28 ? 431  GLU A CB    1 
ATOM   3321  C  CG    . GLU A 1 431 ? 21.260  144.431 33.080  1.00 22.03 ? 431  GLU A CG    1 
ATOM   3322  C  CD    . GLU A 1 431 ? 19.789  144.112 33.264  1.00 25.26 ? 431  GLU A CD    1 
ATOM   3323  O  OE1   . GLU A 1 431 ? 19.474  143.232 34.092  1.00 25.73 ? 431  GLU A OE1   1 
ATOM   3324  O  OE2   . GLU A 1 431 ? 18.953  144.743 32.578  1.00 24.18 ? 431  GLU A OE2   1 
ATOM   3325  N  N     . LEU A 1 432 ? 23.972  146.685 36.103  1.00 18.76 ? 432  LEU A N     1 
ATOM   3326  C  CA    . LEU A 1 432 ? 24.683  147.014 37.335  1.00 17.08 ? 432  LEU A CA    1 
ATOM   3327  C  C     . LEU A 1 432 ? 23.964  146.927 38.675  1.00 18.58 ? 432  LEU A C     1 
ATOM   3328  O  O     . LEU A 1 432 ? 22.755  147.117 38.765  1.00 18.57 ? 432  LEU A O     1 
ATOM   3329  C  CB    . LEU A 1 432 ? 25.245  148.426 37.204  1.00 16.47 ? 432  LEU A CB    1 
ATOM   3330  C  CG    . LEU A 1 432 ? 25.878  148.761 35.853  1.00 15.32 ? 432  LEU A CG    1 
ATOM   3331  C  CD1   . LEU A 1 432 ? 26.183  150.242 35.786  1.00 14.01 ? 432  LEU A CD1   1 
ATOM   3332  C  CD2   . LEU A 1 432 ? 27.132  147.929 35.657  1.00 13.88 ? 432  LEU A CD2   1 
ATOM   3333  N  N     . LYS A 1 433 ? 24.743  146.639 39.715  1.00 17.40 ? 433  LYS A N     1 
ATOM   3334  C  CA    . LYS A 1 433 ? 24.249  146.605 41.087  1.00 18.09 ? 433  LYS A CA    1 
ATOM   3335  C  C     . LYS A 1 433 ? 25.200  147.523 41.852  1.00 18.82 ? 433  LYS A C     1 
ATOM   3336  O  O     . LYS A 1 433 ? 26.415  147.308 41.853  1.00 18.41 ? 433  LYS A O     1 
ATOM   3337  C  CB    . LYS A 1 433 ? 24.304  145.193 41.672  1.00 17.91 ? 433  LYS A CB    1 
ATOM   3338  C  CG    . LYS A 1 433 ? 23.352  144.216 41.026  1.00 19.12 ? 433  LYS A CG    1 
ATOM   3339  C  CD    . LYS A 1 433 ? 23.384  142.874 41.742  1.00 19.81 ? 433  LYS A CD    1 
ATOM   3340  C  CE    . LYS A 1 433 ? 22.442  141.876 41.089  1.00 19.05 ? 433  LYS A CE    1 
ATOM   3341  N  NZ    . LYS A 1 433 ? 22.359  140.611 41.874  1.00 18.42 ? 433  LYS A NZ    1 
ATOM   3342  N  N     . ALA A 1 434 ? 24.658  148.559 42.480  1.00 17.20 ? 434  ALA A N     1 
ATOM   3343  C  CA    . ALA A 1 434 ? 25.481  149.502 43.225  1.00 17.67 ? 434  ALA A CA    1 
ATOM   3344  C  C     . ALA A 1 434 ? 26.334  148.805 44.282  1.00 18.55 ? 434  ALA A C     1 
ATOM   3345  O  O     . ALA A 1 434 ? 25.809  148.180 45.199  1.00 17.90 ? 434  ALA A O     1 
ATOM   3346  C  CB    . ALA A 1 434 ? 24.594  150.565 43.880  1.00 17.47 ? 434  ALA A CB    1 
ATOM   3347  N  N     . GLY A 1 435 ? 27.654  148.904 44.139  1.00 18.96 ? 435  GLY A N     1 
ATOM   3348  C  CA    . GLY A 1 435 ? 28.551  148.288 45.100  1.00 16.77 ? 435  GLY A CA    1 
ATOM   3349  C  C     . GLY A 1 435 ? 29.143  146.958 44.670  1.00 16.50 ? 435  GLY A C     1 
ATOM   3350  O  O     . GLY A 1 435 ? 30.006  146.411 45.355  1.00 16.66 ? 435  GLY A O     1 
ATOM   3351  N  N     . SER A 1 436 ? 28.692  146.438 43.532  1.00 14.90 ? 436  SER A N     1 
ATOM   3352  C  CA    . SER A 1 436 ? 29.173  145.154 43.032  1.00 15.36 ? 436  SER A CA    1 
ATOM   3353  C  C     . SER A 1 436 ? 30.109  145.274 41.832  1.00 15.05 ? 436  SER A C     1 
ATOM   3354  O  O     . SER A 1 436 ? 29.834  146.023 40.897  1.00 15.87 ? 436  SER A O     1 
ATOM   3355  C  CB    . SER A 1 436 ? 27.980  144.269 42.645  1.00 14.45 ? 436  SER A CB    1 
ATOM   3356  O  OG    . SER A 1 436 ? 28.412  143.022 42.124  1.00 16.94 ? 436  SER A OG    1 
ATOM   3357  N  N     . ALA A 1 437 ? 31.213  144.529 41.866  1.00 14.90 ? 437  ALA A N     1 
ATOM   3358  C  CA    . ALA A 1 437 ? 32.166  144.531 40.759  1.00 14.54 ? 437  ALA A CA    1 
ATOM   3359  C  C     . ALA A 1 437 ? 31.573  143.694 39.616  1.00 15.23 ? 437  ALA A C     1 
ATOM   3360  O  O     . ALA A 1 437 ? 32.026  143.756 38.473  1.00 14.38 ? 437  ALA A O     1 
ATOM   3361  C  CB    . ALA A 1 437 ? 33.498  143.945 41.214  1.00 14.96 ? 437  ALA A CB    1 
ATOM   3362  N  N     . THR A 1 438 ? 30.554  142.914 39.965  1.00 15.54 ? 438  THR A N     1 
ATOM   3363  C  CA    . THR A 1 438 ? 29.808  142.036 39.059  1.00 16.22 ? 438  THR A CA    1 
ATOM   3364  C  C     . THR A 1 438 ? 30.496  140.752 38.582  1.00 16.21 ? 438  THR A C     1 
ATOM   3365  O  O     . THR A 1 438 ? 30.805  139.881 39.399  1.00 16.43 ? 438  THR A O     1 
ATOM   3366  C  CB    . THR A 1 438 ? 29.227  142.812 37.823  1.00 16.57 ? 438  THR A CB    1 
ATOM   3367  O  OG1   . THR A 1 438 ? 30.265  143.134 36.890  1.00 17.86 ? 438  THR A OG1   1 
ATOM   3368  C  CG2   . THR A 1 438 ? 28.550  144.096 38.278  1.00 15.33 ? 438  THR A CG2   1 
ATOM   3369  N  N     . ARG A 1 439 ? 30.739  140.627 37.279  1.00 15.46 ? 439  ARG A N     1 
ATOM   3370  C  CA    . ARG A 1 439 ? 31.317  139.398 36.732  1.00 17.15 ? 439  ARG A CA    1 
ATOM   3371  C  C     . ARG A 1 439 ? 32.778  139.432 36.291  1.00 15.59 ? 439  ARG A C     1 
ATOM   3372  O  O     . ARG A 1 439 ? 33.331  140.492 36.004  1.00 14.60 ? 439  ARG A O     1 
ATOM   3373  C  CB    . ARG A 1 439 ? 30.471  138.923 35.543  1.00 19.69 ? 439  ARG A CB    1 
ATOM   3374  C  CG    . ARG A 1 439 ? 28.990  138.714 35.847  1.00 22.30 ? 439  ARG A CG    1 
ATOM   3375  C  CD    . ARG A 1 439 ? 28.277  138.108 34.639  1.00 26.98 ? 439  ARG A CD    1 
ATOM   3376  N  NE    . ARG A 1 439 ? 26.834  137.964 34.838  1.00 29.64 ? 439  ARG A NE    1 
ATOM   3377  C  CZ    . ARG A 1 439 ? 26.271  137.154 35.731  1.00 31.91 ? 439  ARG A CZ    1 
ATOM   3378  N  NH1   . ARG A 1 439 ? 27.024  136.401 36.522  1.00 31.62 ? 439  ARG A NH1   1 
ATOM   3379  N  NH2   . ARG A 1 439 ? 24.950  137.099 35.836  1.00 32.55 ? 439  ARG A NH2   1 
ATOM   3380  N  N     . PRO A 1 440 ? 33.415  138.252 36.213  1.00 14.83 ? 440  PRO A N     1 
ATOM   3381  C  CA    . PRO A 1 440 ? 34.817  138.189 35.794  1.00 13.70 ? 440  PRO A CA    1 
ATOM   3382  C  C     . PRO A 1 440 ? 35.006  138.571 34.333  1.00 14.21 ? 440  PRO A C     1 
ATOM   3383  O  O     . PRO A 1 440 ? 34.121  138.363 33.500  1.00 14.40 ? 440  PRO A O     1 
ATOM   3384  C  CB    . PRO A 1 440 ? 35.192  136.738 36.063  1.00 14.20 ? 440  PRO A CB    1 
ATOM   3385  C  CG    . PRO A 1 440 ? 33.900  136.008 35.819  1.00 14.97 ? 440  PRO A CG    1 
ATOM   3386  C  CD    . PRO A 1 440 ? 32.901  136.905 36.525  1.00 15.00 ? 440  PRO A CD    1 
ATOM   3387  N  N     . PHE A 1 441 ? 36.168  139.142 34.033  1.00 13.34 ? 441  PHE A N     1 
ATOM   3388  C  CA    . PHE A 1 441 ? 36.493  139.547 32.677  1.00 13.32 ? 441  PHE A CA    1 
ATOM   3389  C  C     . PHE A 1 441 ? 36.912  138.298 31.911  1.00 13.67 ? 441  PHE A C     1 
ATOM   3390  O  O     . PHE A 1 441 ? 37.081  137.231 32.497  1.00 13.52 ? 441  PHE A O     1 
ATOM   3391  C  CB    . PHE A 1 441 ? 37.650  140.552 32.696  1.00 13.30 ? 441  PHE A CB    1 
ATOM   3392  C  CG    . PHE A 1 441 ? 37.898  141.213 31.377  1.00 14.85 ? 441  PHE A CG    1 
ATOM   3393  C  CD1   . PHE A 1 441 ? 37.018  142.178 30.892  1.00 13.48 ? 441  PHE A CD1   1 
ATOM   3394  C  CD2   . PHE A 1 441 ? 39.008  140.868 30.608  1.00 13.48 ? 441  PHE A CD2   1 
ATOM   3395  C  CE1   . PHE A 1 441 ? 37.239  142.788 29.666  1.00 14.29 ? 441  PHE A CE1   1 
ATOM   3396  C  CE2   . PHE A 1 441 ? 39.236  141.474 29.376  1.00 14.24 ? 441  PHE A CE2   1 
ATOM   3397  C  CZ    . PHE A 1 441 ? 38.354  142.433 28.904  1.00 14.00 ? 441  PHE A CZ    1 
ATOM   3398  N  N     . PHE A 1 442 ? 37.070  138.440 30.599  1.00 15.20 ? 442  PHE A N     1 
ATOM   3399  C  CA    . PHE A 1 442 ? 37.493  137.341 29.746  1.00 15.90 ? 442  PHE A CA    1 
ATOM   3400  C  C     . PHE A 1 442 ? 38.799  136.769 30.277  1.00 15.74 ? 442  PHE A C     1 
ATOM   3401  O  O     . PHE A 1 442 ? 39.710  137.521 30.630  1.00 14.97 ? 442  PHE A O     1 
ATOM   3402  C  CB    . PHE A 1 442 ? 37.712  137.845 28.319  1.00 16.19 ? 442  PHE A CB    1 
ATOM   3403  C  CG    . PHE A 1 442 ? 36.521  138.547 27.738  1.00 18.66 ? 442  PHE A CG    1 
ATOM   3404  C  CD1   . PHE A 1 442 ? 36.679  139.716 26.999  1.00 18.80 ? 442  PHE A CD1   1 
ATOM   3405  C  CD2   . PHE A 1 442 ? 35.237  138.044 27.933  1.00 18.40 ? 442  PHE A CD2   1 
ATOM   3406  C  CE1   . PHE A 1 442 ? 35.574  140.378 26.462  1.00 19.41 ? 442  PHE A CE1   1 
ATOM   3407  C  CE2   . PHE A 1 442 ? 34.123  138.698 27.399  1.00 20.33 ? 442  PHE A CE2   1 
ATOM   3408  C  CZ    . PHE A 1 442 ? 34.294  139.869 26.662  1.00 19.92 ? 442  PHE A CZ    1 
ATOM   3409  N  N     . GLY A 1 443 ? 38.873  135.442 30.335  1.00 15.03 ? 443  GLY A N     1 
ATOM   3410  C  CA    . GLY A 1 443 ? 40.073  134.763 30.799  1.00 15.69 ? 443  GLY A CA    1 
ATOM   3411  C  C     . GLY A 1 443 ? 40.242  134.662 32.303  1.00 15.83 ? 443  GLY A C     1 
ATOM   3412  O  O     . GLY A 1 443 ? 41.217  134.076 32.782  1.00 17.43 ? 443  GLY A O     1 
ATOM   3413  N  N     . VAL A 1 444 ? 39.295  135.215 33.051  1.00 14.03 ? 444  VAL A N     1 
ATOM   3414  C  CA    . VAL A 1 444 ? 39.374  135.202 34.506  1.00 14.59 ? 444  VAL A CA    1 
ATOM   3415  C  C     . VAL A 1 444 ? 38.427  134.190 35.142  1.00 15.30 ? 444  VAL A C     1 
ATOM   3416  O  O     . VAL A 1 444 ? 37.217  134.253 34.937  1.00 14.84 ? 444  VAL A O     1 
ATOM   3417  C  CB    . VAL A 1 444 ? 39.067  136.601 35.072  1.00 14.25 ? 444  VAL A CB    1 
ATOM   3418  C  CG1   . VAL A 1 444 ? 39.174  136.590 36.591  1.00 12.52 ? 444  VAL A CG1   1 
ATOM   3419  C  CG2   . VAL A 1 444 ? 40.039  137.624 34.467  1.00 14.94 ? 444  VAL A CG2   1 
ATOM   3420  N  N     . GLN A 1 445 ? 38.988  133.259 35.913  1.00 15.99 ? 445  GLN A N     1 
ATOM   3421  C  CA    . GLN A 1 445 ? 38.189  132.237 36.579  1.00 16.55 ? 445  GLN A CA    1 
ATOM   3422  C  C     . GLN A 1 445 ? 38.251  132.370 38.101  1.00 17.01 ? 445  GLN A C     1 
ATOM   3423  O  O     . GLN A 1 445 ? 39.086  131.750 38.763  1.00 14.38 ? 445  GLN A O     1 
ATOM   3424  C  CB    . GLN A 1 445 ? 38.660  130.841 36.166  1.00 18.81 ? 445  GLN A CB    1 
ATOM   3425  C  CG    . GLN A 1 445 ? 38.505  130.540 34.684  1.00 23.66 ? 445  GLN A CG    1 
ATOM   3426  C  CD    . GLN A 1 445 ? 38.912  129.116 34.328  1.00 26.19 ? 445  GLN A CD    1 
ATOM   3427  O  OE1   . GLN A 1 445 ? 38.357  128.153 34.855  1.00 30.35 ? 445  GLN A OE1   1 
ATOM   3428  N  NE2   . GLN A 1 445 ? 39.882  128.981 33.430  1.00 26.37 ? 445  GLN A NE2   1 
ATOM   3429  N  N     . PRO A 1 446 ? 37.360  133.185 38.677  1.00 16.88 ? 446  PRO A N     1 
ATOM   3430  C  CA    . PRO A 1 446 ? 37.347  133.370 40.128  1.00 17.23 ? 446  PRO A CA    1 
ATOM   3431  C  C     . PRO A 1 446 ? 36.698  132.204 40.868  1.00 19.18 ? 446  PRO A C     1 
ATOM   3432  O  O     . PRO A 1 446 ? 35.967  131.403 40.282  1.00 17.53 ? 446  PRO A O     1 
ATOM   3433  C  CB    . PRO A 1 446 ? 36.565  134.669 40.297  1.00 17.63 ? 446  PRO A CB    1 
ATOM   3434  C  CG    . PRO A 1 446 ? 35.572  134.589 39.191  1.00 18.44 ? 446  PRO A CG    1 
ATOM   3435  C  CD    . PRO A 1 446 ? 36.392  134.084 38.022  1.00 16.64 ? 446  PRO A CD    1 
ATOM   3436  N  N     . ALA A 1 447 ? 36.988  132.108 42.159  1.00 19.55 ? 447  ALA A N     1 
ATOM   3437  C  CA    . ALA A 1 447 ? 36.412  131.074 43.007  1.00 18.78 ? 447  ALA A CA    1 
ATOM   3438  C  C     . ALA A 1 447 ? 36.468  131.580 44.437  1.00 19.18 ? 447  ALA A C     1 
ATOM   3439  O  O     . ALA A 1 447 ? 37.261  132.467 44.762  1.00 18.21 ? 447  ALA A O     1 
ATOM   3440  C  CB    . ALA A 1 447 ? 37.194  129.760 42.880  1.00 18.43 ? 447  ALA A CB    1 
ATOM   3441  N  N     . LEU A 1 448 ? 35.597  131.037 45.278  1.00 18.59 ? 448  LEU A N     1 
ATOM   3442  C  CA    . LEU A 1 448 ? 35.556  131.407 46.682  1.00 19.49 ? 448  LEU A CA    1 
ATOM   3443  C  C     . LEU A 1 448 ? 35.797  130.121 47.459  1.00 20.90 ? 448  LEU A C     1 
ATOM   3444  O  O     . LEU A 1 448 ? 35.069  129.144 47.292  1.00 20.91 ? 448  LEU A O     1 
ATOM   3445  C  CB    . LEU A 1 448 ? 34.192  132.008 47.045  1.00 17.91 ? 448  LEU A CB    1 
ATOM   3446  C  CG    . LEU A 1 448 ? 33.782  133.274 46.277  1.00 18.78 ? 448  LEU A CG    1 
ATOM   3447  C  CD1   . LEU A 1 448 ? 32.427  133.757 46.766  1.00 16.24 ? 448  LEU A CD1   1 
ATOM   3448  C  CD2   . LEU A 1 448 ? 34.831  134.365 46.463  1.00 15.95 ? 448  LEU A CD2   1 
ATOM   3449  N  N     . VAL A 1 449 ? 36.835  130.112 48.288  1.00 20.86 ? 449  VAL A N     1 
ATOM   3450  C  CA    . VAL A 1 449 ? 37.157  128.926 49.069  1.00 21.73 ? 449  VAL A CA    1 
ATOM   3451  C  C     . VAL A 1 449 ? 37.172  129.239 50.561  1.00 23.74 ? 449  VAL A C     1 
ATOM   3452  O  O     . VAL A 1 449 ? 37.411  130.382 50.959  1.00 21.85 ? 449  VAL A O     1 
ATOM   3453  C  CB    . VAL A 1 449 ? 38.545  128.365 48.676  1.00 22.24 ? 449  VAL A CB    1 
ATOM   3454  C  CG1   . VAL A 1 449 ? 38.558  127.985 47.206  1.00 20.55 ? 449  VAL A CG1   1 
ATOM   3455  C  CG2   . VAL A 1 449 ? 39.629  129.403 48.966  1.00 22.48 ? 449  VAL A CG2   1 
ATOM   3456  N  N     . ASP A 1 450 ? 36.902  128.231 51.386  1.00 23.42 ? 450  ASP A N     1 
ATOM   3457  C  CA    . ASP A 1 450 ? 36.936  128.435 52.828  1.00 26.29 ? 450  ASP A CA    1 
ATOM   3458  C  C     . ASP A 1 450 ? 38.406  128.445 53.243  1.00 26.66 ? 450  ASP A C     1 
ATOM   3459  O  O     . ASP A 1 450 ? 39.287  128.205 52.413  1.00 26.10 ? 450  ASP A O     1 
ATOM   3460  C  CB    . ASP A 1 450 ? 36.178  127.322 53.566  1.00 28.87 ? 450  ASP A CB    1 
ATOM   3461  C  CG    . ASP A 1 450 ? 36.659  125.931 53.192  1.00 31.04 ? 450  ASP A CG    1 
ATOM   3462  O  OD1   . ASP A 1 450 ? 37.874  125.750 52.969  1.00 30.36 ? 450  ASP A OD1   1 
ATOM   3463  O  OD2   . ASP A 1 450 ? 35.815  125.010 53.140  1.00 34.78 ? 450  ASP A OD2   1 
ATOM   3464  N  N     . ASN A 1 451 ? 38.676  128.723 54.515  1.00 27.05 ? 451  ASN A N     1 
ATOM   3465  C  CA    . ASN A 1 451 ? 40.052  128.771 54.990  1.00 28.16 ? 451  ASN A CA    1 
ATOM   3466  C  C     . ASN A 1 451 ? 40.800  127.457 54.816  1.00 28.95 ? 451  ASN A C     1 
ATOM   3467  O  O     . ASN A 1 451 ? 42.011  127.398 55.017  1.00 28.70 ? 451  ASN A O     1 
ATOM   3468  C  CB    . ASN A 1 451 ? 40.101  129.201 56.456  1.00 28.72 ? 451  ASN A CB    1 
ATOM   3469  C  CG    . ASN A 1 451 ? 39.682  130.641 56.648  1.00 30.72 ? 451  ASN A CG    1 
ATOM   3470  O  OD1   . ASN A 1 451 ? 39.867  131.475 55.759  1.00 31.06 ? 451  ASN A OD1   1 
ATOM   3471  N  ND2   . ASN A 1 451 ? 39.131  130.949 57.818  1.00 29.42 ? 451  ASN A ND2   1 
ATOM   3472  N  N     . GLU A 1 452 ? 40.077  126.409 54.437  1.00 30.48 ? 452  GLU A N     1 
ATOM   3473  C  CA    . GLU A 1 452 ? 40.673  125.098 54.223  1.00 31.72 ? 452  GLU A CA    1 
ATOM   3474  C  C     . GLU A 1 452 ? 40.956  124.860 52.741  1.00 30.45 ? 452  GLU A C     1 
ATOM   3475  O  O     . GLU A 1 452 ? 41.547  123.846 52.367  1.00 30.90 ? 452  GLU A O     1 
ATOM   3476  C  CB    . GLU A 1 452 ? 39.744  124.002 54.756  1.00 34.29 ? 452  GLU A CB    1 
ATOM   3477  C  CG    . GLU A 1 452 ? 39.594  123.980 56.274  1.00 39.88 ? 452  GLU A CG    1 
ATOM   3478  C  CD    . GLU A 1 452 ? 39.030  125.276 56.836  1.00 43.09 ? 452  GLU A CD    1 
ATOM   3479  O  OE1   . GLU A 1 452 ? 37.905  125.661 56.448  1.00 44.80 ? 452  GLU A OE1   1 
ATOM   3480  O  OE2   . GLU A 1 452 ? 39.717  125.909 57.669  1.00 44.64 ? 452  GLU A OE2   1 
ATOM   3481  N  N     . GLY A 1 453 ? 40.523  125.794 51.900  1.00 29.16 ? 453  GLY A N     1 
ATOM   3482  C  CA    . GLY A 1 453 ? 40.754  125.663 50.471  1.00 27.80 ? 453  GLY A CA    1 
ATOM   3483  C  C     . GLY A 1 453 ? 39.633  124.992 49.698  1.00 27.41 ? 453  GLY A C     1 
ATOM   3484  O  O     . GLY A 1 453 ? 39.768  124.741 48.502  1.00 26.16 ? 453  GLY A O     1 
ATOM   3485  N  N     . HIS A 1 454 ? 38.523  124.701 50.369  1.00 27.54 ? 454  HIS A N     1 
ATOM   3486  C  CA    . HIS A 1 454 ? 37.390  124.058 49.712  1.00 27.49 ? 454  HIS A CA    1 
ATOM   3487  C  C     . HIS A 1 454 ? 36.547  125.079 48.958  1.00 26.33 ? 454  HIS A C     1 
ATOM   3488  O  O     . HIS A 1 454 ? 36.072  126.055 49.538  1.00 27.12 ? 454  HIS A O     1 
ATOM   3489  C  CB    . HIS A 1 454 ? 36.497  123.348 50.737  1.00 28.71 ? 454  HIS A CB    1 
ATOM   3490  C  CG    . HIS A 1 454 ? 37.211  122.321 51.559  1.00 31.38 ? 454  HIS A CG    1 
ATOM   3491  N  ND1   . HIS A 1 454 ? 37.325  122.416 52.929  1.00 34.57 ? 454  HIS A ND1   1 
ATOM   3492  C  CD2   . HIS A 1 454 ? 37.844  121.177 51.206  1.00 32.93 ? 454  HIS A CD2   1 
ATOM   3493  C  CE1   . HIS A 1 454 ? 37.998  121.375 53.386  1.00 33.71 ? 454  HIS A CE1   1 
ATOM   3494  N  NE2   . HIS A 1 454 ? 38.325  120.608 52.360  1.00 34.83 ? 454  HIS A NE2   1 
ATOM   3495  N  N     . PRO A 1 455 ? 36.349  124.869 47.649  1.00 25.41 ? 455  PRO A N     1 
ATOM   3496  C  CA    . PRO A 1 455 ? 35.544  125.814 46.877  1.00 26.05 ? 455  PRO A CA    1 
ATOM   3497  C  C     . PRO A 1 455 ? 34.092  125.805 47.335  1.00 26.95 ? 455  PRO A C     1 
ATOM   3498  O  O     . PRO A 1 455 ? 33.517  124.744 47.588  1.00 26.04 ? 455  PRO A O     1 
ATOM   3499  C  CB    . PRO A 1 455 ? 35.714  125.319 45.443  1.00 26.21 ? 455  PRO A CB    1 
ATOM   3500  C  CG    . PRO A 1 455 ? 35.917  123.851 45.618  1.00 28.39 ? 455  PRO A CG    1 
ATOM   3501  C  CD    . PRO A 1 455 ? 36.867  123.794 46.786  1.00 27.32 ? 455  PRO A CD    1 
ATOM   3502  N  N     . GLN A 1 456 ? 33.510  126.994 47.451  1.00 26.73 ? 456  GLN A N     1 
ATOM   3503  C  CA    . GLN A 1 456 ? 32.125  127.148 47.879  1.00 28.39 ? 456  GLN A CA    1 
ATOM   3504  C  C     . GLN A 1 456 ? 31.276  127.524 46.668  1.00 28.70 ? 456  GLN A C     1 
ATOM   3505  O  O     . GLN A 1 456 ? 31.552  128.518 46.002  1.00 28.57 ? 456  GLN A O     1 
ATOM   3506  C  CB    . GLN A 1 456 ? 32.040  128.240 48.948  1.00 30.42 ? 456  GLN A CB    1 
ATOM   3507  C  CG    . GLN A 1 456 ? 33.052  128.057 50.069  1.00 30.81 ? 456  GLN A CG    1 
ATOM   3508  C  CD    . GLN A 1 456 ? 32.848  126.758 50.833  1.00 34.04 ? 456  GLN A CD    1 
ATOM   3509  O  OE1   . GLN A 1 456 ? 33.784  126.217 51.422  1.00 35.10 ? 456  GLN A OE1   1 
ATOM   3510  N  NE2   . GLN A 1 456 ? 31.617  126.259 50.835  1.00 34.29 ? 456  GLN A NE2   1 
ATOM   3511  N  N     . GLU A 1 457 ? 30.245  126.730 46.388  1.00 28.68 ? 457  GLU A N     1 
ATOM   3512  C  CA    . GLU A 1 457 ? 29.375  126.972 45.238  1.00 28.30 ? 457  GLU A CA    1 
ATOM   3513  C  C     . GLU A 1 457 ? 28.107  127.768 45.555  1.00 28.39 ? 457  GLU A C     1 
ATOM   3514  O  O     . GLU A 1 457 ? 27.706  127.897 46.714  1.00 27.88 ? 457  GLU A O     1 
ATOM   3515  C  CB    . GLU A 1 457 ? 29.000  125.640 44.589  1.00 29.53 ? 457  GLU A CB    1 
ATOM   3516  N  N     . GLY A 1 458 ? 27.482  128.303 44.508  1.00 28.63 ? 458  GLY A N     1 
ATOM   3517  C  CA    . GLY A 1 458 ? 26.266  129.079 44.676  1.00 28.08 ? 458  GLY A CA    1 
ATOM   3518  C  C     . GLY A 1 458 ? 26.470  130.365 45.450  1.00 27.72 ? 458  GLY A C     1 
ATOM   3519  O  O     . GLY A 1 458 ? 27.597  130.848 45.582  1.00 26.65 ? 458  GLY A O     1 
ATOM   3520  N  N     . ALA A 1 459 ? 25.375  130.927 45.955  1.00 27.03 ? 459  ALA A N     1 
ATOM   3521  C  CA    . ALA A 1 459 ? 25.430  132.160 46.732  1.00 27.80 ? 459  ALA A CA    1 
ATOM   3522  C  C     . ALA A 1 459 ? 26.172  131.852 48.024  1.00 27.94 ? 459  ALA A C     1 
ATOM   3523  O  O     . ALA A 1 459 ? 25.689  131.084 48.856  1.00 28.63 ? 459  ALA A O     1 
ATOM   3524  C  CB    . ALA A 1 459 ? 24.018  132.657 47.037  1.00 28.30 ? 459  ALA A CB    1 
ATOM   3525  N  N     . THR A 1 460 ? 27.347  132.451 48.188  1.00 26.59 ? 460  THR A N     1 
ATOM   3526  C  CA    . THR A 1 460 ? 28.162  132.207 49.371  1.00 26.04 ? 460  THR A CA    1 
ATOM   3527  C  C     . THR A 1 460 ? 29.276  133.248 49.474  1.00 25.23 ? 460  THR A C     1 
ATOM   3528  O  O     . THR A 1 460 ? 29.267  134.249 48.760  1.00 24.29 ? 460  THR A O     1 
ATOM   3529  C  CB    . THR A 1 460 ? 28.790  130.795 49.301  1.00 27.19 ? 460  THR A CB    1 
ATOM   3530  O  OG1   . THR A 1 460 ? 29.521  130.527 50.503  1.00 28.73 ? 460  THR A OG1   1 
ATOM   3531  C  CG2   . THR A 1 460 ? 29.726  130.687 48.104  1.00 27.65 ? 460  THR A CG2   1 
ATOM   3532  N  N     . GLU A 1 461 ? 30.224  133.014 50.373  1.00 24.59 ? 461  GLU A N     1 
ATOM   3533  C  CA    . GLU A 1 461 ? 31.343  133.926 50.548  1.00 24.61 ? 461  GLU A CA    1 
ATOM   3534  C  C     . GLU A 1 461 ? 32.579  133.171 51.008  1.00 23.18 ? 461  GLU A C     1 
ATOM   3535  O  O     . GLU A 1 461 ? 32.487  132.046 51.491  1.00 22.58 ? 461  GLU A O     1 
ATOM   3536  C  CB    . GLU A 1 461 ? 30.987  135.028 51.550  1.00 28.78 ? 461  GLU A CB    1 
ATOM   3537  C  CG    . GLU A 1 461 ? 30.582  134.547 52.927  1.00 35.23 ? 461  GLU A CG    1 
ATOM   3538  C  CD    . GLU A 1 461 ? 30.244  135.703 53.847  1.00 39.82 ? 461  GLU A CD    1 
ATOM   3539  O  OE1   . GLU A 1 461 ? 31.150  136.515 54.132  1.00 43.19 ? 461  GLU A OE1   1 
ATOM   3540  O  OE2   . GLU A 1 461 ? 29.075  135.811 54.276  1.00 43.36 ? 461  GLU A OE2   1 
ATOM   3541  N  N     . GLY A 1 462 ? 33.742  133.789 50.844  1.00 21.19 ? 462  GLY A N     1 
ATOM   3542  C  CA    . GLY A 1 462 ? 34.974  133.141 51.246  1.00 18.85 ? 462  GLY A CA    1 
ATOM   3543  C  C     . GLY A 1 462 ? 36.175  133.875 50.692  1.00 18.54 ? 462  GLY A C     1 
ATOM   3544  O  O     . GLY A 1 462 ? 36.070  135.035 50.296  1.00 17.43 ? 462  GLY A O     1 
ATOM   3545  N  N     . ASN A 1 463 ? 37.314  133.194 50.662  1.00 19.29 ? 463  ASN A N     1 
ATOM   3546  C  CA    . ASN A 1 463 ? 38.554  133.775 50.157  1.00 18.05 ? 463  ASN A CA    1 
ATOM   3547  C  C     . ASN A 1 463 ? 38.539  133.804 48.632  1.00 18.03 ? 463  ASN A C     1 
ATOM   3548  O  O     . ASN A 1 463 ? 38.281  132.789 47.994  1.00 18.58 ? 463  ASN A O     1 
ATOM   3549  C  CB    . ASN A 1 463 ? 39.737  132.951 50.662  1.00 18.03 ? 463  ASN A CB    1 
ATOM   3550  C  CG    . ASN A 1 463 ? 39.759  132.850 52.174  1.00 19.56 ? 463  ASN A CG    1 
ATOM   3551  O  OD1   . ASN A 1 463 ? 39.918  133.853 52.868  1.00 19.09 ? 463  ASN A OD1   1 
ATOM   3552  N  ND2   . ASN A 1 463 ? 39.584  131.636 52.695  1.00 19.92 ? 463  ASN A ND2   1 
ATOM   3553  N  N     . LEU A 1 464 ? 38.819  134.969 48.054  1.00 17.35 ? 464  LEU A N     1 
ATOM   3554  C  CA    . LEU A 1 464 ? 38.813  135.116 46.602  1.00 15.10 ? 464  LEU A CA    1 
ATOM   3555  C  C     . LEU A 1 464 ? 40.106  134.658 45.947  1.00 15.61 ? 464  LEU A C     1 
ATOM   3556  O  O     . LEU A 1 464 ? 41.182  135.203 46.204  1.00 13.58 ? 464  LEU A O     1 
ATOM   3557  C  CB    . LEU A 1 464 ? 38.530  136.576 46.220  1.00 14.23 ? 464  LEU A CB    1 
ATOM   3558  C  CG    . LEU A 1 464 ? 38.517  136.945 44.728  1.00 13.80 ? 464  LEU A CG    1 
ATOM   3559  C  CD1   . LEU A 1 464 ? 37.520  136.073 43.968  1.00 14.20 ? 464  LEU A CD1   1 
ATOM   3560  C  CD2   . LEU A 1 464 ? 38.152  138.422 44.587  1.00 14.15 ? 464  LEU A CD2   1 
ATOM   3561  N  N     . VAL A 1 465 ? 39.990  133.647 45.094  1.00 16.04 ? 465  VAL A N     1 
ATOM   3562  C  CA    . VAL A 1 465 ? 41.135  133.113 44.379  1.00 15.55 ? 465  VAL A CA    1 
ATOM   3563  C  C     . VAL A 1 465 ? 40.824  133.104 42.887  1.00 16.76 ? 465  VAL A C     1 
ATOM   3564  O  O     . VAL A 1 465 ? 39.665  133.239 42.481  1.00 14.06 ? 465  VAL A O     1 
ATOM   3565  C  CB    . VAL A 1 465 ? 41.448  131.657 44.811  1.00 17.07 ? 465  VAL A CB    1 
ATOM   3566  C  CG1   . VAL A 1 465 ? 41.795  131.605 46.290  1.00 16.64 ? 465  VAL A CG1   1 
ATOM   3567  C  CG2   . VAL A 1 465 ? 40.251  130.758 44.515  1.00 17.84 ? 465  VAL A CG2   1 
ATOM   3568  N  N     . ILE A 1 466 ? 41.868  132.970 42.077  1.00 15.10 ? 466  ILE A N     1 
ATOM   3569  C  CA    . ILE A 1 466 ? 41.717  132.888 40.628  1.00 14.85 ? 466  ILE A CA    1 
ATOM   3570  C  C     . ILE A 1 466 ? 42.362  131.539 40.305  1.00 14.91 ? 466  ILE A C     1 
ATOM   3571  O  O     . ILE A 1 466 ? 43.535  131.325 40.603  1.00 15.82 ? 466  ILE A O     1 
ATOM   3572  C  CB    . ILE A 1 466 ? 42.456  134.031 39.905  1.00 13.69 ? 466  ILE A CB    1 
ATOM   3573  C  CG1   . ILE A 1 466 ? 42.090  135.383 40.534  1.00 12.42 ? 466  ILE A CG1   1 
ATOM   3574  C  CG2   . ILE A 1 466 ? 42.065  134.029 38.431  1.00 13.83 ? 466  ILE A CG2   1 
ATOM   3575  C  CD1   . ILE A 1 466 ? 40.607  135.776 40.401  1.00 13.01 ? 466  ILE A CD1   1 
ATOM   3576  N  N     . THR A 1 467 ? 41.594  130.638 39.697  1.00 14.68 ? 467  THR A N     1 
ATOM   3577  C  CA    . THR A 1 467 ? 42.069  129.283 39.432  1.00 16.09 ? 467  THR A CA    1 
ATOM   3578  C  C     . THR A 1 467 ? 42.940  129.001 38.218  1.00 15.14 ? 467  THR A C     1 
ATOM   3579  O  O     . THR A 1 467 ? 43.338  127.856 38.000  1.00 14.95 ? 467  THR A O     1 
ATOM   3580  C  CB    . THR A 1 467 ? 40.878  128.304 39.413  1.00 16.11 ? 467  THR A CB    1 
ATOM   3581  O  OG1   . THR A 1 467 ? 40.044  128.586 38.287  1.00 17.44 ? 467  THR A OG1   1 
ATOM   3582  C  CG2   . THR A 1 467 ? 40.058  128.456 40.690  1.00 18.29 ? 467  THR A CG2   1 
ATOM   3583  N  N     . ASP A 1 468 ? 43.236  130.023 37.423  1.00 14.95 ? 468  ASP A N     1 
ATOM   3584  C  CA    . ASP A 1 468 ? 44.094  129.830 36.262  1.00 15.44 ? 468  ASP A CA    1 
ATOM   3585  C  C     . ASP A 1 468 ? 44.688  131.179 35.899  1.00 14.31 ? 468  ASP A C     1 
ATOM   3586  O  O     . ASP A 1 468 ? 44.252  132.205 36.408  1.00 13.85 ? 468  ASP A O     1 
ATOM   3587  C  CB    . ASP A 1 468 ? 43.308  129.259 35.078  1.00 17.64 ? 468  ASP A CB    1 
ATOM   3588  C  CG    . ASP A 1 468 ? 44.180  128.429 34.146  1.00 21.11 ? 468  ASP A CG    1 
ATOM   3589  O  OD1   . ASP A 1 468 ? 45.373  128.768 33.979  1.00 19.93 ? 468  ASP A OD1   1 
ATOM   3590  O  OD2   . ASP A 1 468 ? 43.672  127.439 33.571  1.00 22.40 ? 468  ASP A OD2   1 
ATOM   3591  N  N     . SER A 1 469 ? 45.680  131.183 35.019  1.00 13.31 ? 469  SER A N     1 
ATOM   3592  C  CA    . SER A 1 469 ? 46.331  132.434 34.637  1.00 13.29 ? 469  SER A CA    1 
ATOM   3593  C  C     . SER A 1 469 ? 45.516  133.237 33.624  1.00 14.20 ? 469  SER A C     1 
ATOM   3594  O  O     . SER A 1 469 ? 44.515  132.761 33.091  1.00 14.25 ? 469  SER A O     1 
ATOM   3595  C  CB    . SER A 1 469 ? 47.719  132.132 34.064  1.00 11.84 ? 469  SER A CB    1 
ATOM   3596  O  OG    . SER A 1 469 ? 48.519  133.301 33.966  1.00 12.03 ? 469  SER A OG    1 
ATOM   3597  N  N     . TRP A 1 470 ? 45.955  134.469 33.393  1.00 13.53 ? 470  TRP A N     1 
ATOM   3598  C  CA    . TRP A 1 470 ? 45.345  135.389 32.435  1.00 12.37 ? 470  TRP A CA    1 
ATOM   3599  C  C     . TRP A 1 470 ? 46.559  136.178 31.926  1.00 13.51 ? 470  TRP A C     1 
ATOM   3600  O  O     . TRP A 1 470 ? 47.556  136.304 32.637  1.00 12.14 ? 470  TRP A O     1 
ATOM   3601  C  CB    . TRP A 1 470 ? 44.308  136.286 33.126  1.00 11.83 ? 470  TRP A CB    1 
ATOM   3602  C  CG    . TRP A 1 470 ? 44.860  137.083 34.256  1.00 12.66 ? 470  TRP A CG    1 
ATOM   3603  C  CD1   . TRP A 1 470 ? 45.285  138.381 34.214  1.00 11.94 ? 470  TRP A CD1   1 
ATOM   3604  C  CD2   . TRP A 1 470 ? 45.112  136.618 35.583  1.00 12.03 ? 470  TRP A CD2   1 
ATOM   3605  N  NE1   . TRP A 1 470 ? 45.790  138.749 35.436  1.00 12.90 ? 470  TRP A NE1   1 
ATOM   3606  C  CE2   . TRP A 1 470 ? 45.698  137.687 36.296  1.00 12.35 ? 470  TRP A CE2   1 
ATOM   3607  C  CE3   . TRP A 1 470 ? 44.904  135.397 36.243  1.00 12.09 ? 470  TRP A CE3   1 
ATOM   3608  C  CZ2   . TRP A 1 470 ? 46.079  137.575 37.637  1.00 11.77 ? 470  TRP A CZ2   1 
ATOM   3609  C  CZ3   . TRP A 1 470 ? 45.283  135.285 37.576  1.00 12.95 ? 470  TRP A CZ3   1 
ATOM   3610  C  CH2   . TRP A 1 470 ? 45.864  136.369 38.259  1.00 11.50 ? 470  TRP A CH2   1 
ATOM   3611  N  N     . PRO A 1 471 ? 46.497  136.712 30.696  1.00 12.20 ? 471  PRO A N     1 
ATOM   3612  C  CA    . PRO A 1 471 ? 47.617  137.464 30.111  1.00 12.34 ? 471  PRO A CA    1 
ATOM   3613  C  C     . PRO A 1 471 ? 48.338  138.538 30.924  1.00 12.10 ? 471  PRO A C     1 
ATOM   3614  O  O     . PRO A 1 471 ? 49.569  138.633 30.868  1.00 11.19 ? 471  PRO A O     1 
ATOM   3615  C  CB    . PRO A 1 471 ? 47.017  138.036 28.826  1.00 12.82 ? 471  PRO A CB    1 
ATOM   3616  C  CG    . PRO A 1 471 ? 45.995  136.985 28.440  1.00 13.76 ? 471  PRO A CG    1 
ATOM   3617  C  CD    . PRO A 1 471 ? 45.344  136.689 29.777  1.00 11.46 ? 471  PRO A CD    1 
ATOM   3618  N  N     . GLY A 1 472 ? 47.585  139.344 31.667  1.00 12.43 ? 472  GLY A N     1 
ATOM   3619  C  CA    . GLY A 1 472 ? 48.201  140.421 32.425  1.00 12.87 ? 472  GLY A CA    1 
ATOM   3620  C  C     . GLY A 1 472 ? 48.763  140.111 33.800  1.00 12.70 ? 472  GLY A C     1 
ATOM   3621  O  O     . GLY A 1 472 ? 49.213  141.013 34.502  1.00 13.14 ? 472  GLY A O     1 
ATOM   3622  N  N     . GLN A 1 473 ? 48.764  138.842 34.185  1.00 13.93 ? 473  GLN A N     1 
ATOM   3623  C  CA    . GLN A 1 473 ? 49.258  138.458 35.501  1.00 12.06 ? 473  GLN A CA    1 
ATOM   3624  C  C     . GLN A 1 473 ? 50.740  138.745 35.753  1.00 12.18 ? 473  GLN A C     1 
ATOM   3625  O  O     . GLN A 1 473 ? 51.589  138.492 34.895  1.00 11.13 ? 473  GLN A O     1 
ATOM   3626  C  CB    . GLN A 1 473 ? 48.976  136.971 35.741  1.00 12.89 ? 473  GLN A CB    1 
ATOM   3627  C  CG    . GLN A 1 473 ? 49.531  136.444 37.052  1.00 10.45 ? 473  GLN A CG    1 
ATOM   3628  C  CD    . GLN A 1 473 ? 49.061  135.043 37.356  1.00 13.55 ? 473  GLN A CD    1 
ATOM   3629  O  OE1   . GLN A 1 473 ? 48.859  134.232 36.446  1.00 11.06 ? 473  GLN A OE1   1 
ATOM   3630  N  NE2   . GLN A 1 473 ? 48.892  134.741 38.645  1.00 12.49 ? 473  GLN A NE2   1 
ATOM   3631  N  N     . ALA A 1 474 ? 51.041  139.278 36.939  1.00 10.74 ? 474  ALA A N     1 
ATOM   3632  C  CA    . ALA A 1 474 ? 52.424  139.562 37.329  1.00 11.07 ? 474  ALA A CA    1 
ATOM   3633  C  C     . ALA A 1 474 ? 53.182  138.238 37.243  1.00 13.60 ? 474  ALA A C     1 
ATOM   3634  O  O     . ALA A 1 474 ? 52.665  137.193 37.649  1.00 13.81 ? 474  ALA A O     1 
ATOM   3635  C  CB    . ALA A 1 474 ? 52.473  140.103 38.750  1.00 13.38 ? 474  ALA A CB    1 
ATOM   3636  N  N     . ARG A 1 475 ? 54.411  138.284 36.735  1.00 12.49 ? 475  ARG A N     1 
ATOM   3637  C  CA    . ARG A 1 475 ? 55.203  137.072 36.558  1.00 12.89 ? 475  ARG A CA    1 
ATOM   3638  C  C     . ARG A 1 475 ? 56.056  136.637 37.747  1.00 13.06 ? 475  ARG A C     1 
ATOM   3639  O  O     . ARG A 1 475 ? 56.369  135.452 37.883  1.00 13.90 ? 475  ARG A O     1 
ATOM   3640  C  CB    . ARG A 1 475 ? 56.108  137.219 35.329  1.00 13.94 ? 475  ARG A CB    1 
ATOM   3641  C  CG    . ARG A 1 475 ? 55.368  137.574 34.029  1.00 13.02 ? 475  ARG A CG    1 
ATOM   3642  C  CD    . ARG A 1 475 ? 54.326  136.529 33.640  1.00 11.72 ? 475  ARG A CD    1 
ATOM   3643  N  NE    . ARG A 1 475 ? 54.023  136.597 32.210  1.00 11.79 ? 475  ARG A NE    1 
ATOM   3644  C  CZ    . ARG A 1 475 ? 52.914  137.108 31.683  1.00 11.13 ? 475  ARG A CZ    1 
ATOM   3645  N  NH1   . ARG A 1 475 ? 51.960  137.609 32.460  1.00 12.43 ? 475  ARG A NH1   1 
ATOM   3646  N  NH2   . ARG A 1 475 ? 52.765  137.130 30.365  1.00 10.79 ? 475  ARG A NH2   1 
ATOM   3647  N  N     . THR A 1 476 ? 56.442  137.579 38.598  1.00 12.09 ? 476  THR A N     1 
ATOM   3648  C  CA    . THR A 1 476 ? 57.276  137.244 39.750  1.00 13.31 ? 476  THR A CA    1 
ATOM   3649  C  C     . THR A 1 476 ? 57.462  138.479 40.616  1.00 14.36 ? 476  THR A C     1 
ATOM   3650  O  O     . THR A 1 476 ? 56.838  139.518 40.380  1.00 13.31 ? 476  THR A O     1 
ATOM   3651  C  CB    . THR A 1 476 ? 58.680  136.749 39.286  1.00 15.37 ? 476  THR A CB    1 
ATOM   3652  O  OG1   . THR A 1 476 ? 59.426  136.250 40.405  1.00 13.21 ? 476  THR A OG1   1 
ATOM   3653  C  CG2   . THR A 1 476 ? 59.466  137.894 38.637  1.00 14.14 ? 476  THR A CG2   1 
ATOM   3654  N  N     . LEU A 1 477 ? 58.294  138.336 41.642  1.00 14.22 ? 477  LEU A N     1 
ATOM   3655  C  CA    . LEU A 1 477 ? 58.650  139.438 42.522  1.00 13.14 ? 477  LEU A CA    1 
ATOM   3656  C  C     . LEU A 1 477 ? 60.125  139.623 42.201  1.00 13.26 ? 477  LEU A C     1 
ATOM   3657  O  O     . LEU A 1 477 ? 60.880  138.657 42.180  1.00 14.00 ? 477  LEU A O     1 
ATOM   3658  C  CB    . LEU A 1 477 ? 58.473  139.071 43.999  1.00 10.84 ? 477  LEU A CB    1 
ATOM   3659  C  CG    . LEU A 1 477 ? 57.031  138.905 44.486  1.00 12.26 ? 477  LEU A CG    1 
ATOM   3660  C  CD1   . LEU A 1 477 ? 57.015  138.651 45.994  1.00 13.59 ? 477  LEU A CD1   1 
ATOM   3661  C  CD2   . LEU A 1 477 ? 56.236  140.165 44.152  1.00 12.18 ? 477  LEU A CD2   1 
ATOM   3662  N  N     . PHE A 1 478 ? 60.525  140.857 41.927  1.00 12.30 ? 478  PHE A N     1 
ATOM   3663  C  CA    . PHE A 1 478 ? 61.904  141.140 41.572  1.00 13.51 ? 478  PHE A CA    1 
ATOM   3664  C  C     . PHE A 1 478 ? 62.902  140.503 42.535  1.00 14.15 ? 478  PHE A C     1 
ATOM   3665  O  O     . PHE A 1 478 ? 62.847  140.721 43.748  1.00 13.20 ? 478  PHE A O     1 
ATOM   3666  C  CB    . PHE A 1 478 ? 62.133  142.649 41.510  1.00 12.03 ? 478  PHE A CB    1 
ATOM   3667  C  CG    . PHE A 1 478 ? 63.467  143.030 40.932  1.00 15.05 ? 478  PHE A CG    1 
ATOM   3668  C  CD1   . PHE A 1 478 ? 63.689  142.959 39.563  1.00 13.69 ? 478  PHE A CD1   1 
ATOM   3669  C  CD2   . PHE A 1 478 ? 64.511  143.425 41.761  1.00 14.83 ? 478  PHE A CD2   1 
ATOM   3670  C  CE1   . PHE A 1 478 ? 64.939  143.277 39.023  1.00 16.43 ? 478  PHE A CE1   1 
ATOM   3671  C  CE2   . PHE A 1 478 ? 65.767  143.743 41.234  1.00 15.76 ? 478  PHE A CE2   1 
ATOM   3672  C  CZ    . PHE A 1 478 ? 65.979  143.669 39.865  1.00 15.90 ? 478  PHE A CZ    1 
ATOM   3673  N  N     . GLY A 1 479 ? 63.806  139.703 41.973  1.00 14.69 ? 479  GLY A N     1 
ATOM   3674  C  CA    . GLY A 1 479 ? 64.835  139.040 42.755  1.00 16.50 ? 479  GLY A CA    1 
ATOM   3675  C  C     . GLY A 1 479 ? 64.380  138.009 43.774  1.00 17.35 ? 479  GLY A C     1 
ATOM   3676  O  O     . GLY A 1 479 ? 65.188  137.546 44.583  1.00 17.02 ? 479  GLY A O     1 
ATOM   3677  N  N     . ASP A 1 480 ? 63.111  137.619 43.744  1.00 15.78 ? 480  ASP A N     1 
ATOM   3678  C  CA    . ASP A 1 480 ? 62.639  136.655 44.731  1.00 17.53 ? 480  ASP A CA    1 
ATOM   3679  C  C     . ASP A 1 480 ? 61.425  135.868 44.258  1.00 17.17 ? 480  ASP A C     1 
ATOM   3680  O  O     . ASP A 1 480 ? 60.309  136.077 44.742  1.00 16.96 ? 480  ASP A O     1 
ATOM   3681  C  CB    . ASP A 1 480 ? 62.293  137.390 46.027  1.00 17.05 ? 480  ASP A CB    1 
ATOM   3682  C  CG    . ASP A 1 480 ? 62.228  136.467 47.230  1.00 18.49 ? 480  ASP A CG    1 
ATOM   3683  O  OD1   . ASP A 1 480 ? 62.139  135.233 47.050  1.00 18.19 ? 480  ASP A OD1   1 
ATOM   3684  O  OD2   . ASP A 1 480 ? 62.254  136.989 48.364  1.00 20.97 ? 480  ASP A OD2   1 
ATOM   3685  N  N     . HIS A 1 481 ? 61.644  134.958 43.320  1.00 15.96 ? 481  HIS A N     1 
ATOM   3686  C  CA    . HIS A 1 481 ? 60.555  134.148 42.801  1.00 16.01 ? 481  HIS A CA    1 
ATOM   3687  C  C     . HIS A 1 481 ? 59.989  133.212 43.872  1.00 15.94 ? 481  HIS A C     1 
ATOM   3688  O  O     . HIS A 1 481 ? 58.803  132.893 43.853  1.00 16.02 ? 481  HIS A O     1 
ATOM   3689  C  CB    . HIS A 1 481 ? 61.026  133.330 41.596  1.00 16.71 ? 481  HIS A CB    1 
ATOM   3690  C  CG    . HIS A 1 481 ? 59.907  132.696 40.834  1.00 16.73 ? 481  HIS A CG    1 
ATOM   3691  N  ND1   . HIS A 1 481 ? 58.953  133.434 40.165  1.00 15.86 ? 481  HIS A ND1   1 
ATOM   3692  C  CD2   . HIS A 1 481 ? 59.568  131.396 40.661  1.00 17.53 ? 481  HIS A CD2   1 
ATOM   3693  C  CE1   . HIS A 1 481 ? 58.073  132.615 39.616  1.00 17.21 ? 481  HIS A CE1   1 
ATOM   3694  N  NE2   . HIS A 1 481 ? 58.423  131.374 39.902  1.00 18.53 ? 481  HIS A NE2   1 
ATOM   3695  N  N     . GLU A 1 482 ? 60.835  132.773 44.804  1.00 15.93 ? 482  GLU A N     1 
ATOM   3696  C  CA    . GLU A 1 482 ? 60.387  131.885 45.878  1.00 17.42 ? 482  GLU A CA    1 
ATOM   3697  C  C     . GLU A 1 482 ? 59.324  132.572 46.735  1.00 16.41 ? 482  GLU A C     1 
ATOM   3698  O  O     . GLU A 1 482 ? 58.325  131.958 47.115  1.00 15.84 ? 482  GLU A O     1 
ATOM   3699  C  CB    . GLU A 1 482 ? 61.571  131.468 46.754  1.00 20.36 ? 482  GLU A CB    1 
ATOM   3700  C  CG    . GLU A 1 482 ? 62.483  130.420 46.122  1.00 28.32 ? 482  GLU A CG    1 
ATOM   3701  C  CD    . GLU A 1 482 ? 63.848  130.353 46.796  1.00 35.05 ? 482  GLU A CD    1 
ATOM   3702  O  OE1   . GLU A 1 482 ? 63.907  130.385 48.044  1.00 37.93 ? 482  GLU A OE1   1 
ATOM   3703  O  OE2   . GLU A 1 482 ? 64.867  130.262 46.077  1.00 39.65 ? 482  GLU A OE2   1 
ATOM   3704  N  N     . ARG A 1 483 ? 59.537  133.849 47.037  1.00 14.92 ? 483  ARG A N     1 
ATOM   3705  C  CA    . ARG A 1 483 ? 58.580  134.600 47.841  1.00 15.49 ? 483  ARG A CA    1 
ATOM   3706  C  C     . ARG A 1 483 ? 57.276  134.800 47.060  1.00 14.75 ? 483  ARG A C     1 
ATOM   3707  O  O     . ARG A 1 483 ? 56.186  134.781 47.635  1.00 14.41 ? 483  ARG A O     1 
ATOM   3708  C  CB    . ARG A 1 483 ? 59.176  135.951 48.232  1.00 17.19 ? 483  ARG A CB    1 
ATOM   3709  C  CG    . ARG A 1 483 ? 58.288  136.785 49.137  1.00 24.88 ? 483  ARG A CG    1 
ATOM   3710  C  CD    . ARG A 1 483 ? 57.987  136.053 50.431  1.00 31.91 ? 483  ARG A CD    1 
ATOM   3711  N  NE    . ARG A 1 483 ? 58.214  136.898 51.599  1.00 38.62 ? 483  ARG A NE    1 
ATOM   3712  C  CZ    . ARG A 1 483 ? 59.394  137.416 51.930  1.00 39.64 ? 483  ARG A CZ    1 
ATOM   3713  N  NH1   . ARG A 1 483 ? 60.466  137.176 51.184  1.00 41.70 ? 483  ARG A NH1   1 
ATOM   3714  N  NH2   . ARG A 1 483 ? 59.501  138.178 53.009  1.00 42.43 ? 483  ARG A NH2   1 
ATOM   3715  N  N     . PHE A 1 484 ? 57.401  134.998 45.750  1.00 13.52 ? 484  PHE A N     1 
ATOM   3716  C  CA    . PHE A 1 484 ? 56.242  135.172 44.872  1.00 13.75 ? 484  PHE A CA    1 
ATOM   3717  C  C     . PHE A 1 484 ? 55.380  133.907 44.959  1.00 14.53 ? 484  PHE A C     1 
ATOM   3718  O  O     . PHE A 1 484 ? 54.160  133.967 45.135  1.00 12.99 ? 484  PHE A O     1 
ATOM   3719  C  CB    . PHE A 1 484 ? 56.730  135.379 43.431  1.00 14.58 ? 484  PHE A CB    1 
ATOM   3720  C  CG    . PHE A 1 484 ? 55.631  135.430 42.405  1.00 16.17 ? 484  PHE A CG    1 
ATOM   3721  C  CD1   . PHE A 1 484 ? 54.784  136.532 42.320  1.00 17.40 ? 484  PHE A CD1   1 
ATOM   3722  C  CD2   . PHE A 1 484 ? 55.465  134.385 41.496  1.00 16.03 ? 484  PHE A CD2   1 
ATOM   3723  C  CE1   . PHE A 1 484 ? 53.786  136.595 41.337  1.00 19.03 ? 484  PHE A CE1   1 
ATOM   3724  C  CE2   . PHE A 1 484 ? 54.479  134.435 40.516  1.00 17.88 ? 484  PHE A CE2   1 
ATOM   3725  C  CZ    . PHE A 1 484 ? 53.635  135.545 40.435  1.00 18.51 ? 484  PHE A CZ    1 
ATOM   3726  N  N     . GLU A 1 485 ? 56.030  132.756 44.847  1.00 15.16 ? 485  GLU A N     1 
ATOM   3727  C  CA    . GLU A 1 485 ? 55.331  131.478 44.910  1.00 16.41 ? 485  GLU A CA    1 
ATOM   3728  C  C     . GLU A 1 485 ? 54.668  131.247 46.265  1.00 16.69 ? 485  GLU A C     1 
ATOM   3729  O  O     . GLU A 1 485 ? 53.540  130.766 46.339  1.00 17.06 ? 485  GLU A O     1 
ATOM   3730  C  CB    . GLU A 1 485 ? 56.307  130.338 44.616  1.00 16.99 ? 485  GLU A CB    1 
ATOM   3731  C  CG    . GLU A 1 485 ? 56.947  130.430 43.248  1.00 18.81 ? 485  GLU A CG    1 
ATOM   3732  C  CD    . GLU A 1 485 ? 57.952  129.325 42.997  1.00 20.11 ? 485  GLU A CD    1 
ATOM   3733  O  OE1   . GLU A 1 485 ? 58.790  129.071 43.889  1.00 20.75 ? 485  GLU A OE1   1 
ATOM   3734  O  OE2   . GLU A 1 485 ? 57.912  128.724 41.905  1.00 19.38 ? 485  GLU A OE2   1 
ATOM   3735  N  N     . GLN A 1 486 ? 55.367  131.597 47.338  1.00 16.45 ? 486  GLN A N     1 
ATOM   3736  C  CA    . GLN A 1 486 ? 54.839  131.402 48.681  1.00 16.89 ? 486  GLN A CA    1 
ATOM   3737  C  C     . GLN A 1 486 ? 53.708  132.368 49.038  1.00 17.44 ? 486  GLN A C     1 
ATOM   3738  O  O     . GLN A 1 486 ? 52.673  131.969 49.581  1.00 15.88 ? 486  GLN A O     1 
ATOM   3739  C  CB    . GLN A 1 486 ? 55.972  131.541 49.699  1.00 21.70 ? 486  GLN A CB    1 
ATOM   3740  C  CG    . GLN A 1 486 ? 55.535  131.367 51.141  1.00 25.80 ? 486  GLN A CG    1 
ATOM   3741  C  CD    . GLN A 1 486 ? 56.704  131.394 52.098  1.00 28.47 ? 486  GLN A CD    1 
ATOM   3742  O  OE1   . GLN A 1 486 ? 57.556  130.501 52.083  1.00 30.09 ? 486  GLN A OE1   1 
ATOM   3743  N  NE2   . GLN A 1 486 ? 56.759  132.426 52.932  1.00 28.14 ? 486  GLN A NE2   1 
ATOM   3744  N  N     . THR A 1 487 ? 53.910  133.641 48.732  1.00 14.74 ? 487  THR A N     1 
ATOM   3745  C  CA    . THR A 1 487 ? 52.919  134.657 49.046  1.00 15.95 ? 487  THR A CA    1 
ATOM   3746  C  C     . THR A 1 487 ? 51.569  134.456 48.352  1.00 15.43 ? 487  THR A C     1 
ATOM   3747  O  O     . THR A 1 487 ? 50.519  134.560 48.986  1.00 15.90 ? 487  THR A O     1 
ATOM   3748  C  CB    . THR A 1 487 ? 53.453  136.069 48.685  1.00 17.14 ? 487  THR A CB    1 
ATOM   3749  O  OG1   . THR A 1 487 ? 54.680  136.310 49.387  1.00 17.98 ? 487  THR A OG1   1 
ATOM   3750  C  CG2   . THR A 1 487 ? 52.449  137.148 49.069  1.00 17.28 ? 487  THR A CG2   1 
ATOM   3751  N  N     . TYR A 1 488 ? 51.591  134.139 47.062  1.00 14.48 ? 488  TYR A N     1 
ATOM   3752  C  CA    . TYR A 1 488 ? 50.344  134.020 46.314  1.00 15.08 ? 488  TYR A CA    1 
ATOM   3753  C  C     . TYR A 1 488 ? 49.838  132.634 45.975  1.00 15.19 ? 488  TYR A C     1 
ATOM   3754  O  O     . TYR A 1 488 ? 48.653  132.472 45.681  1.00 15.16 ? 488  TYR A O     1 
ATOM   3755  C  CB    . TYR A 1 488 ? 50.448  134.810 45.004  1.00 15.51 ? 488  TYR A CB    1 
ATOM   3756  C  CG    . TYR A 1 488 ? 50.925  136.226 45.187  1.00 15.36 ? 488  TYR A CG    1 
ATOM   3757  C  CD1   . TYR A 1 488 ? 52.262  136.565 44.984  1.00 14.45 ? 488  TYR A CD1   1 
ATOM   3758  C  CD2   . TYR A 1 488 ? 50.047  137.224 45.610  1.00 14.04 ? 488  TYR A CD2   1 
ATOM   3759  C  CE1   . TYR A 1 488 ? 52.718  137.867 45.203  1.00 15.22 ? 488  TYR A CE1   1 
ATOM   3760  C  CE2   . TYR A 1 488 ? 50.492  138.527 45.833  1.00 14.91 ? 488  TYR A CE2   1 
ATOM   3761  C  CZ    . TYR A 1 488 ? 51.827  138.838 45.629  1.00 14.10 ? 488  TYR A CZ    1 
ATOM   3762  O  OH    . TYR A 1 488 ? 52.265  140.122 45.862  1.00 14.75 ? 488  TYR A OH    1 
ATOM   3763  N  N     . PHE A 1 489 ? 50.711  131.635 46.019  1.00 13.99 ? 489  PHE A N     1 
ATOM   3764  C  CA    . PHE A 1 489 ? 50.295  130.296 45.637  1.00 14.50 ? 489  PHE A CA    1 
ATOM   3765  C  C     . PHE A 1 489 ? 50.479  129.174 46.655  1.00 14.95 ? 489  PHE A C     1 
ATOM   3766  O  O     . PHE A 1 489 ? 50.356  128.002 46.296  1.00 17.53 ? 489  PHE A O     1 
ATOM   3767  C  CB    . PHE A 1 489 ? 50.995  129.902 44.330  1.00 13.24 ? 489  PHE A CB    1 
ATOM   3768  C  CG    . PHE A 1 489 ? 50.874  130.934 43.238  1.00 13.14 ? 489  PHE A CG    1 
ATOM   3769  C  CD1   . PHE A 1 489 ? 51.744  132.019 43.189  1.00 14.21 ? 489  PHE A CD1   1 
ATOM   3770  C  CD2   . PHE A 1 489 ? 49.883  130.826 42.265  1.00 14.52 ? 489  PHE A CD2   1 
ATOM   3771  C  CE1   . PHE A 1 489 ? 51.631  132.988 42.181  1.00 13.99 ? 489  PHE A CE1   1 
ATOM   3772  C  CE2   . PHE A 1 489 ? 49.760  131.786 41.254  1.00 13.37 ? 489  PHE A CE2   1 
ATOM   3773  C  CZ    . PHE A 1 489 ? 50.637  132.868 41.214  1.00 12.82 ? 489  PHE A CZ    1 
ATOM   3774  N  N     . SER A 1 490 ? 50.739  129.506 47.915  1.00 15.34 ? 490  SER A N     1 
ATOM   3775  C  CA    . SER A 1 490 ? 50.937  128.457 48.917  1.00 16.96 ? 490  SER A CA    1 
ATOM   3776  C  C     . SER A 1 490 ? 49.742  128.224 49.839  1.00 17.02 ? 490  SER A C     1 
ATOM   3777  O  O     . SER A 1 490 ? 49.544  127.112 50.327  1.00 18.16 ? 490  SER A O     1 
ATOM   3778  C  CB    . SER A 1 490 ? 52.181  128.758 49.762  1.00 14.75 ? 490  SER A CB    1 
ATOM   3779  O  OG    . SER A 1 490 ? 51.954  129.850 50.626  1.00 17.50 ? 490  SER A OG    1 
ATOM   3780  N  N     . THR A 1 491 ? 48.954  129.268 50.082  1.00 17.51 ? 491  THR A N     1 
ATOM   3781  C  CA    . THR A 1 491 ? 47.786  129.165 50.953  1.00 16.56 ? 491  THR A CA    1 
ATOM   3782  C  C     . THR A 1 491 ? 46.790  128.151 50.393  1.00 17.08 ? 491  THR A C     1 
ATOM   3783  O  O     . THR A 1 491 ? 46.313  127.268 51.107  1.00 15.48 ? 491  THR A O     1 
ATOM   3784  C  CB    . THR A 1 491 ? 47.094  130.538 51.101  1.00 17.18 ? 491  THR A CB    1 
ATOM   3785  O  OG1   . THR A 1 491 ? 48.053  131.503 51.548  1.00 17.27 ? 491  THR A OG1   1 
ATOM   3786  C  CG2   . THR A 1 491 ? 45.958  130.471 52.124  1.00 18.28 ? 491  THR A CG2   1 
ATOM   3787  N  N     . PHE A 1 492 ? 46.485  128.280 49.109  1.00 15.70 ? 492  PHE A N     1 
ATOM   3788  C  CA    . PHE A 1 492 ? 45.550  127.377 48.447  1.00 17.00 ? 492  PHE A CA    1 
ATOM   3789  C  C     . PHE A 1 492 ? 46.245  126.828 47.204  1.00 16.82 ? 492  PHE A C     1 
ATOM   3790  O  O     . PHE A 1 492 ? 46.369  127.514 46.191  1.00 18.28 ? 492  PHE A O     1 
ATOM   3791  C  CB    . PHE A 1 492 ? 44.282  128.146 48.083  1.00 17.40 ? 492  PHE A CB    1 
ATOM   3792  C  CG    . PHE A 1 492 ? 43.645  128.847 49.252  1.00 17.51 ? 492  PHE A CG    1 
ATOM   3793  C  CD1   . PHE A 1 492 ? 43.476  130.226 49.241  1.00 17.19 ? 492  PHE A CD1   1 
ATOM   3794  C  CD2   . PHE A 1 492 ? 43.216  128.127 50.366  1.00 18.39 ? 492  PHE A CD2   1 
ATOM   3795  C  CE1   . PHE A 1 492 ? 42.884  130.883 50.322  1.00 20.06 ? 492  PHE A CE1   1 
ATOM   3796  C  CE2   . PHE A 1 492 ? 42.624  128.774 51.451  1.00 16.83 ? 492  PHE A CE2   1 
ATOM   3797  C  CZ    . PHE A 1 492 ? 42.457  130.153 51.429  1.00 18.52 ? 492  PHE A CZ    1 
ATOM   3798  N  N     . LYS A 1 493 ? 46.701  125.584 47.297  1.00 18.04 ? 493  LYS A N     1 
ATOM   3799  C  CA    . LYS A 1 493 ? 47.434  124.941 46.218  1.00 17.83 ? 493  LYS A CA    1 
ATOM   3800  C  C     . LYS A 1 493 ? 46.798  125.010 44.838  1.00 18.77 ? 493  LYS A C     1 
ATOM   3801  O  O     . LYS A 1 493 ? 45.594  124.805 44.673  1.00 19.81 ? 493  LYS A O     1 
ATOM   3802  C  CB    . LYS A 1 493 ? 47.738  123.489 46.592  1.00 20.06 ? 493  LYS A CB    1 
ATOM   3803  C  CG    . LYS A 1 493 ? 48.775  123.367 47.700  1.00 22.14 ? 493  LYS A CG    1 
ATOM   3804  C  CD    . LYS A 1 493 ? 49.152  121.920 47.973  1.00 26.50 ? 493  LYS A CD    1 
ATOM   3805  C  CE    . LYS A 1 493 ? 50.289  121.830 48.987  1.00 26.20 ? 493  LYS A CE    1 
ATOM   3806  N  NZ    . LYS A 1 493 ? 49.908  122.440 50.293  1.00 28.96 ? 493  LYS A NZ    1 
ATOM   3807  N  N     . ASN A 1 494 ? 47.637  125.322 43.855  1.00 16.68 ? 494  ASN A N     1 
ATOM   3808  C  CA    . ASN A 1 494 ? 47.235  125.440 42.461  1.00 17.38 ? 494  ASN A CA    1 
ATOM   3809  C  C     . ASN A 1 494 ? 46.307  126.615 42.202  1.00 16.58 ? 494  ASN A C     1 
ATOM   3810  O  O     . ASN A 1 494 ? 45.616  126.654 41.183  1.00 17.95 ? 494  ASN A O     1 
ATOM   3811  C  CB    . ASN A 1 494 ? 46.573  124.141 41.989  1.00 20.67 ? 494  ASN A CB    1 
ATOM   3812  C  CG    . ASN A 1 494 ? 47.524  122.967 42.018  1.00 21.61 ? 494  ASN A CG    1 
ATOM   3813  O  OD1   . ASN A 1 494 ? 48.556  122.976 41.353  1.00 25.74 ? 494  ASN A OD1   1 
ATOM   3814  N  ND2   . ASN A 1 494 ? 47.184  121.950 42.796  1.00 26.09 ? 494  ASN A ND2   1 
ATOM   3815  N  N     . MET A 1 495 ? 46.298  127.580 43.114  1.00 16.38 ? 495  MET A N     1 
ATOM   3816  C  CA    . MET A 1 495 ? 45.437  128.743 42.951  1.00 17.18 ? 495  MET A CA    1 
ATOM   3817  C  C     . MET A 1 495 ? 46.141  130.034 43.334  1.00 16.33 ? 495  MET A C     1 
ATOM   3818  O  O     . MET A 1 495 ? 47.012  130.047 44.203  1.00 16.19 ? 495  MET A O     1 
ATOM   3819  C  CB    . MET A 1 495 ? 44.181  128.596 43.808  1.00 19.13 ? 495  MET A CB    1 
ATOM   3820  C  CG    . MET A 1 495 ? 43.393  127.317 43.553  1.00 24.49 ? 495  MET A CG    1 
ATOM   3821  S  SD    . MET A 1 495 ? 41.806  127.301 44.411  1.00 32.26 ? 495  MET A SD    1 
ATOM   3822  C  CE    . MET A 1 495 ? 42.283  126.898 46.018  1.00 34.60 ? 495  MET A CE    1 
ATOM   3823  N  N     . TYR A 1 496 ? 45.762  131.117 42.668  1.00 15.21 ? 496  TYR A N     1 
ATOM   3824  C  CA    . TYR A 1 496 ? 46.312  132.429 42.967  1.00 14.62 ? 496  TYR A CA    1 
ATOM   3825  C  C     . TYR A 1 496 ? 45.410  133.012 44.044  1.00 13.93 ? 496  TYR A C     1 
ATOM   3826  O  O     . TYR A 1 496 ? 44.214  133.172 43.820  1.00 14.65 ? 496  TYR A O     1 
ATOM   3827  C  CB    . TYR A 1 496 ? 46.254  133.347 41.742  1.00 13.62 ? 496  TYR A CB    1 
ATOM   3828  C  CG    . TYR A 1 496 ? 46.549  134.792 42.083  1.00 14.20 ? 496  TYR A CG    1 
ATOM   3829  C  CD1   . TYR A 1 496 ? 47.858  135.224 42.296  1.00 15.69 ? 496  TYR A CD1   1 
ATOM   3830  C  CD2   . TYR A 1 496 ? 45.516  135.719 42.242  1.00 14.39 ? 496  TYR A CD2   1 
ATOM   3831  C  CE1   . TYR A 1 496 ? 48.133  136.541 42.661  1.00 16.81 ? 496  TYR A CE1   1 
ATOM   3832  C  CE2   . TYR A 1 496 ? 45.779  137.040 42.608  1.00 14.23 ? 496  TYR A CE2   1 
ATOM   3833  C  CZ    . TYR A 1 496 ? 47.092  137.441 42.816  1.00 16.72 ? 496  TYR A CZ    1 
ATOM   3834  O  OH    . TYR A 1 496 ? 47.366  138.740 43.195  1.00 17.75 ? 496  TYR A OH    1 
ATOM   3835  N  N     . PHE A 1 497 ? 45.970  133.323 45.207  1.00 13.72 ? 497  PHE A N     1 
ATOM   3836  C  CA    . PHE A 1 497 ? 45.176  133.897 46.292  1.00 14.25 ? 497  PHE A CA    1 
ATOM   3837  C  C     . PHE A 1 497 ? 45.354  135.417 46.314  1.00 14.94 ? 497  PHE A C     1 
ATOM   3838  O  O     . PHE A 1 497 ? 46.457  135.919 46.501  1.00 15.12 ? 497  PHE A O     1 
ATOM   3839  C  CB    . PHE A 1 497 ? 45.590  133.284 47.637  1.00 13.29 ? 497  PHE A CB    1 
ATOM   3840  C  CG    . PHE A 1 497 ? 44.846  133.849 48.822  1.00 15.13 ? 497  PHE A CG    1 
ATOM   3841  C  CD1   . PHE A 1 497 ? 43.511  134.235 48.708  1.00 16.36 ? 497  PHE A CD1   1 
ATOM   3842  C  CD2   . PHE A 1 497 ? 45.472  133.959 50.061  1.00 16.64 ? 497  PHE A CD2   1 
ATOM   3843  C  CE1   . PHE A 1 497 ? 42.810  134.722 49.811  1.00 17.87 ? 497  PHE A CE1   1 
ATOM   3844  C  CE2   . PHE A 1 497 ? 44.780  134.443 51.170  1.00 18.38 ? 497  PHE A CE2   1 
ATOM   3845  C  CZ    . PHE A 1 497 ? 43.448  134.824 51.046  1.00 16.80 ? 497  PHE A CZ    1 
ATOM   3846  N  N     . SER A 1 498 ? 44.254  136.140 46.124  1.00 16.09 ? 498  SER A N     1 
ATOM   3847  C  CA    . SER A 1 498 ? 44.275  137.602 46.087  1.00 15.19 ? 498  SER A CA    1 
ATOM   3848  C  C     . SER A 1 498 ? 44.471  138.295 47.433  1.00 16.34 ? 498  SER A C     1 
ATOM   3849  O  O     . SER A 1 498 ? 44.902  139.450 47.482  1.00 16.43 ? 498  SER A O     1 
ATOM   3850  C  CB    . SER A 1 498 ? 42.969  138.117 45.485  1.00 14.70 ? 498  SER A CB    1 
ATOM   3851  O  OG    . SER A 1 498 ? 41.898  137.861 46.379  1.00 15.25 ? 498  SER A OG    1 
ATOM   3852  N  N     . GLY A 1 499 ? 44.140  137.606 48.520  1.00 15.54 ? 499  GLY A N     1 
ATOM   3853  C  CA    . GLY A 1 499 ? 44.256  138.217 49.829  1.00 16.11 ? 499  GLY A CA    1 
ATOM   3854  C  C     . GLY A 1 499 ? 42.964  138.938 50.176  1.00 15.30 ? 499  GLY A C     1 
ATOM   3855  O  O     . GLY A 1 499 ? 42.839  139.544 51.247  1.00 15.53 ? 499  GLY A O     1 
ATOM   3856  N  N     . ASP A 1 500 ? 41.999  138.880 49.259  1.00 14.05 ? 500  ASP A N     1 
ATOM   3857  C  CA    . ASP A 1 500 ? 40.703  139.520 49.463  1.00 14.37 ? 500  ASP A CA    1 
ATOM   3858  C  C     . ASP A 1 500 ? 39.637  138.507 49.800  1.00 14.39 ? 500  ASP A C     1 
ATOM   3859  O  O     . ASP A 1 500 ? 39.764  137.325 49.489  1.00 13.41 ? 500  ASP A O     1 
ATOM   3860  C  CB    . ASP A 1 500 ? 40.227  140.245 48.205  1.00 15.35 ? 500  ASP A CB    1 
ATOM   3861  C  CG    . ASP A 1 500 ? 40.894  141.573 48.008  1.00 16.19 ? 500  ASP A CG    1 
ATOM   3862  O  OD1   . ASP A 1 500 ? 40.888  142.388 48.957  1.00 15.67 ? 500  ASP A OD1   1 
ATOM   3863  O  OD2   . ASP A 1 500 ? 41.409  141.799 46.896  1.00 15.68 ? 500  ASP A OD2   1 
ATOM   3864  N  N     . GLY A 1 501 ? 38.573  139.002 50.418  1.00 15.33 ? 501  GLY A N     1 
ATOM   3865  C  CA    . GLY A 1 501 ? 37.441  138.168 50.753  1.00 15.96 ? 501  GLY A CA    1 
ATOM   3866  C  C     . GLY A 1 501 ? 36.308  138.700 49.898  1.00 17.29 ? 501  GLY A C     1 
ATOM   3867  O  O     . GLY A 1 501 ? 36.301  139.880 49.535  1.00 17.02 ? 501  GLY A O     1 
ATOM   3868  N  N     . ALA A 1 502 ? 35.352  137.848 49.553  1.00 17.76 ? 502  ALA A N     1 
ATOM   3869  C  CA    . ALA A 1 502 ? 34.242  138.306 48.737  1.00 17.86 ? 502  ALA A CA    1 
ATOM   3870  C  C     . ALA A 1 502 ? 33.047  137.386 48.861  1.00 18.66 ? 502  ALA A C     1 
ATOM   3871  O  O     . ALA A 1 502 ? 33.154  136.262 49.355  1.00 17.18 ? 502  ALA A O     1 
ATOM   3872  C  CB    . ALA A 1 502 ? 34.667  138.395 47.278  1.00 16.99 ? 502  ALA A CB    1 
ATOM   3873  N  N     . ARG A 1 503 ? 31.899  137.884 48.424  1.00 21.79 ? 503  ARG A N     1 
ATOM   3874  C  CA    . ARG A 1 503 ? 30.694  137.083 48.442  1.00 24.62 ? 503  ARG A CA    1 
ATOM   3875  C  C     . ARG A 1 503 ? 30.133  137.083 47.031  1.00 24.46 ? 503  ARG A C     1 
ATOM   3876  O  O     . ARG A 1 503 ? 30.379  138.006 46.252  1.00 23.55 ? 503  ARG A O     1 
ATOM   3877  C  CB    . ARG A 1 503 ? 29.667  137.642 49.433  1.00 28.89 ? 503  ARG A CB    1 
ATOM   3878  C  CG    . ARG A 1 503 ? 29.087  138.998 49.097  1.00 34.27 ? 503  ARG A CG    1 
ATOM   3879  C  CD    . ARG A 1 503 ? 27.910  139.297 50.025  1.00 37.04 ? 503  ARG A CD    1 
ATOM   3880  N  NE    . ARG A 1 503 ? 27.253  140.563 49.715  1.00 38.23 ? 503  ARG A NE    1 
ATOM   3881  C  CZ    . ARG A 1 503 ? 27.736  141.761 50.033  1.00 39.37 ? 503  ARG A CZ    1 
ATOM   3882  N  NH1   . ARG A 1 503 ? 28.890  141.867 50.681  1.00 38.08 ? 503  ARG A NH1   1 
ATOM   3883  N  NH2   . ARG A 1 503 ? 27.063  142.856 49.702  1.00 38.82 ? 503  ARG A NH2   1 
ATOM   3884  N  N     . ARG A 1 504 ? 29.415  136.022 46.693  1.00 22.75 ? 504  ARG A N     1 
ATOM   3885  C  CA    . ARG A 1 504 ? 28.802  135.904 45.380  1.00 24.15 ? 504  ARG A CA    1 
ATOM   3886  C  C     . ARG A 1 504 ? 27.310  135.760 45.653  1.00 23.29 ? 504  ARG A C     1 
ATOM   3887  O  O     . ARG A 1 504 ? 26.911  134.908 46.442  1.00 22.95 ? 504  ARG A O     1 
ATOM   3888  C  CB    . ARG A 1 504 ? 29.340  134.668 44.663  1.00 24.27 ? 504  ARG A CB    1 
ATOM   3889  C  CG    . ARG A 1 504 ? 28.895  134.524 43.216  1.00 24.56 ? 504  ARG A CG    1 
ATOM   3890  C  CD    . ARG A 1 504 ? 29.660  133.386 42.574  1.00 25.03 ? 504  ARG A CD    1 
ATOM   3891  N  NE    . ARG A 1 504 ? 29.503  132.161 43.348  1.00 24.51 ? 504  ARG A NE    1 
ATOM   3892  C  CZ    . ARG A 1 504 ? 30.480  131.300 43.609  1.00 25.36 ? 504  ARG A CZ    1 
ATOM   3893  N  NH1   . ARG A 1 504 ? 31.712  131.517 43.158  1.00 21.98 ? 504  ARG A NH1   1 
ATOM   3894  N  NH2   . ARG A 1 504 ? 30.221  130.216 44.330  1.00 25.74 ? 504  ARG A NH2   1 
ATOM   3895  N  N     . ASP A 1 505 ? 26.491  136.597 45.021  1.00 22.95 ? 505  ASP A N     1 
ATOM   3896  C  CA    . ASP A 1 505 ? 25.053  136.529 45.255  1.00 22.67 ? 505  ASP A CA    1 
ATOM   3897  C  C     . ASP A 1 505 ? 24.334  135.513 44.370  1.00 22.65 ? 505  ASP A C     1 
ATOM   3898  O  O     . ASP A 1 505 ? 24.962  134.783 43.601  1.00 21.45 ? 505  ASP A O     1 
ATOM   3899  C  CB    . ASP A 1 505 ? 24.404  137.916 45.105  1.00 22.70 ? 505  ASP A CB    1 
ATOM   3900  C  CG    . ASP A 1 505 ? 24.500  138.472 43.692  1.00 21.53 ? 505  ASP A CG    1 
ATOM   3901  O  OD1   . ASP A 1 505 ? 24.591  137.683 42.733  1.00 21.12 ? 505  ASP A OD1   1 
ATOM   3902  O  OD2   . ASP A 1 505 ? 24.461  139.709 43.543  1.00 24.36 ? 505  ASP A OD2   1 
ATOM   3903  N  N     . GLU A 1 506 ? 23.011  135.470 44.497  1.00 25.04 ? 506  GLU A N     1 
ATOM   3904  C  CA    . GLU A 1 506 ? 22.174  134.542 43.740  1.00 26.36 ? 506  GLU A CA    1 
ATOM   3905  C  C     . GLU A 1 506 ? 22.324  134.643 42.222  1.00 27.13 ? 506  GLU A C     1 
ATOM   3906  O  O     . GLU A 1 506 ? 22.033  133.684 41.504  1.00 28.61 ? 506  GLU A O     1 
ATOM   3907  C  CB    . GLU A 1 506 ? 20.708  134.744 44.131  1.00 27.17 ? 506  GLU A CB    1 
ATOM   3908  N  N     . ASP A 1 507 ? 22.774  135.795 41.731  1.00 24.95 ? 507  ASP A N     1 
ATOM   3909  C  CA    . ASP A 1 507 ? 22.940  135.988 40.292  1.00 24.31 ? 507  ASP A CA    1 
ATOM   3910  C  C     . ASP A 1 507 ? 24.352  135.701 39.804  1.00 23.37 ? 507  ASP A C     1 
ATOM   3911  O  O     . ASP A 1 507 ? 24.622  135.749 38.605  1.00 24.98 ? 507  ASP A O     1 
ATOM   3912  C  CB    . ASP A 1 507 ? 22.557  137.416 39.893  1.00 23.56 ? 507  ASP A CB    1 
ATOM   3913  C  CG    . ASP A 1 507 ? 21.107  137.729 40.182  1.00 25.95 ? 507  ASP A CG    1 
ATOM   3914  O  OD1   . ASP A 1 507 ? 20.268  136.805 40.087  1.00 24.67 ? 507  ASP A OD1   1 
ATOM   3915  O  OD2   . ASP A 1 507 ? 20.804  138.900 40.490  1.00 24.69 ? 507  ASP A OD2   1 
ATOM   3916  N  N     . GLY A 1 508 ? 25.250  135.398 40.731  1.00 21.66 ? 508  GLY A N     1 
ATOM   3917  C  CA    . GLY A 1 508 ? 26.620  135.125 40.348  1.00 20.84 ? 508  GLY A CA    1 
ATOM   3918  C  C     . GLY A 1 508 ? 27.481  136.376 40.365  1.00 19.37 ? 508  GLY A C     1 
ATOM   3919  O  O     . GLY A 1 508 ? 28.634  136.330 39.945  1.00 21.03 ? 508  GLY A O     1 
ATOM   3920  N  N     . TYR A 1 509 ? 26.924  137.491 40.841  1.00 18.78 ? 509  TYR A N     1 
ATOM   3921  C  CA    . TYR A 1 509 ? 27.663  138.756 40.926  1.00 18.47 ? 509  TYR A CA    1 
ATOM   3922  C  C     . TYR A 1 509 ? 28.584  138.736 42.135  1.00 19.29 ? 509  TYR A C     1 
ATOM   3923  O  O     . TYR A 1 509 ? 28.207  138.255 43.209  1.00 20.43 ? 509  TYR A O     1 
ATOM   3924  C  CB    . TYR A 1 509 ? 26.707  139.945 41.069  1.00 17.75 ? 509  TYR A CB    1 
ATOM   3925  C  CG    . TYR A 1 509 ? 26.113  140.453 39.774  1.00 19.72 ? 509  TYR A CG    1 
ATOM   3926  C  CD1   . TYR A 1 509 ? 25.584  139.574 38.832  1.00 20.18 ? 509  TYR A CD1   1 
ATOM   3927  C  CD2   . TYR A 1 509 ? 26.052  141.821 39.506  1.00 17.83 ? 509  TYR A CD2   1 
ATOM   3928  C  CE1   . TYR A 1 509 ? 25.007  140.046 37.652  1.00 21.74 ? 509  TYR A CE1   1 
ATOM   3929  C  CE2   . TYR A 1 509 ? 25.479  142.301 38.335  1.00 17.96 ? 509  TYR A CE2   1 
ATOM   3930  C  CZ    . TYR A 1 509 ? 24.958  141.407 37.412  1.00 20.02 ? 509  TYR A CZ    1 
ATOM   3931  O  OH    . TYR A 1 509 ? 24.389  141.876 36.248  1.00 22.09 ? 509  TYR A OH    1 
ATOM   3932  N  N     . TYR A 1 510 ? 29.790  139.265 41.966  1.00 17.97 ? 510  TYR A N     1 
ATOM   3933  C  CA    . TYR A 1 510 ? 30.741  139.297 43.064  1.00 18.94 ? 510  TYR A CA    1 
ATOM   3934  C  C     . TYR A 1 510 ? 30.741  140.623 43.803  1.00 17.07 ? 510  TYR A C     1 
ATOM   3935  O  O     . TYR A 1 510 ? 30.589  141.688 43.206  1.00 18.24 ? 510  TYR A O     1 
ATOM   3936  C  CB    . TYR A 1 510 ? 32.158  138.993 42.566  1.00 18.35 ? 510  TYR A CB    1 
ATOM   3937  C  CG    . TYR A 1 510 ? 32.387  137.537 42.235  1.00 16.38 ? 510  TYR A CG    1 
ATOM   3938  C  CD1   . TYR A 1 510 ? 32.085  137.031 40.972  1.00 18.60 ? 510  TYR A CD1   1 
ATOM   3939  C  CD2   . TYR A 1 510 ? 32.898  136.661 43.191  1.00 18.03 ? 510  TYR A CD2   1 
ATOM   3940  C  CE1   . TYR A 1 510 ? 32.289  135.685 40.667  1.00 18.55 ? 510  TYR A CE1   1 
ATOM   3941  C  CE2   . TYR A 1 510 ? 33.106  135.317 42.901  1.00 17.87 ? 510  TYR A CE2   1 
ATOM   3942  C  CZ    . TYR A 1 510 ? 32.800  134.836 41.638  1.00 18.48 ? 510  TYR A CZ    1 
ATOM   3943  O  OH    . TYR A 1 510 ? 33.012  133.510 41.349  1.00 19.47 ? 510  TYR A OH    1 
ATOM   3944  N  N     . TRP A 1 511 ? 30.898  140.536 45.118  1.00 16.58 ? 511  TRP A N     1 
ATOM   3945  C  CA    . TRP A 1 511 ? 30.949  141.704 45.977  1.00 17.78 ? 511  TRP A CA    1 
ATOM   3946  C  C     . TRP A 1 511 ? 32.230  141.567 46.792  1.00 18.22 ? 511  TRP A C     1 
ATOM   3947  O  O     . TRP A 1 511 ? 32.316  140.731 47.691  1.00 18.22 ? 511  TRP A O     1 
ATOM   3948  C  CB    . TRP A 1 511 ? 29.735  141.744 46.911  1.00 18.54 ? 511  TRP A CB    1 
ATOM   3949  C  CG    . TRP A 1 511 ? 28.417  141.781 46.192  1.00 18.06 ? 511  TRP A CG    1 
ATOM   3950  C  CD1   . TRP A 1 511 ? 27.828  140.758 45.503  1.00 18.15 ? 511  TRP A CD1   1 
ATOM   3951  C  CD2   . TRP A 1 511 ? 27.529  142.901 46.082  1.00 18.50 ? 511  TRP A CD2   1 
ATOM   3952  N  NE1   . TRP A 1 511 ? 26.629  141.170 44.972  1.00 17.17 ? 511  TRP A NE1   1 
ATOM   3953  C  CE2   . TRP A 1 511 ? 26.419  142.480 45.311  1.00 18.62 ? 511  TRP A CE2   1 
ATOM   3954  C  CE3   . TRP A 1 511 ? 27.561  144.218 46.559  1.00 17.73 ? 511  TRP A CE3   1 
ATOM   3955  C  CZ2   . TRP A 1 511 ? 25.351  143.330 45.007  1.00 17.71 ? 511  TRP A CZ2   1 
ATOM   3956  C  CZ3   . TRP A 1 511 ? 26.495  145.066 46.256  1.00 16.93 ? 511  TRP A CZ3   1 
ATOM   3957  C  CH2   . TRP A 1 511 ? 25.405  144.616 45.486  1.00 19.47 ? 511  TRP A CH2   1 
ATOM   3958  N  N     . ILE A 1 512 ? 33.231  142.371 46.455  1.00 20.50 ? 512  ILE A N     1 
ATOM   3959  C  CA    . ILE A 1 512 ? 34.508  142.325 47.153  1.00 21.25 ? 512  ILE A CA    1 
ATOM   3960  C  C     . ILE A 1 512 ? 34.393  143.084 48.464  1.00 21.21 ? 512  ILE A C     1 
ATOM   3961  O  O     . ILE A 1 512 ? 34.128  144.284 48.479  1.00 22.85 ? 512  ILE A O     1 
ATOM   3962  C  CB    . ILE A 1 512 ? 35.638  142.933 46.300  1.00 22.60 ? 512  ILE A CB    1 
ATOM   3963  C  CG1   . ILE A 1 512 ? 35.842  142.095 45.032  1.00 24.29 ? 512  ILE A CG1   1 
ATOM   3964  C  CG2   . ILE A 1 512 ? 36.936  142.952 47.098  1.00 20.75 ? 512  ILE A CG2   1 
ATOM   3965  C  CD1   . ILE A 1 512 ? 34.694  142.152 44.057  1.00 26.12 ? 512  ILE A CD1   1 
ATOM   3966  N  N     . THR A 1 513 ? 34.604  142.375 49.565  1.00 20.68 ? 513  THR A N     1 
ATOM   3967  C  CA    . THR A 1 513 ? 34.479  142.972 50.884  1.00 23.38 ? 513  THR A CA    1 
ATOM   3968  C  C     . THR A 1 513 ? 35.764  143.564 51.468  1.00 23.68 ? 513  THR A C     1 
ATOM   3969  O  O     . THR A 1 513 ? 35.711  144.323 52.436  1.00 25.62 ? 513  THR A O     1 
ATOM   3970  C  CB    . THR A 1 513 ? 33.860  141.950 51.868  1.00 22.99 ? 513  THR A CB    1 
ATOM   3971  O  OG1   . THR A 1 513 ? 34.575  140.710 51.798  1.00 25.12 ? 513  THR A OG1   1 
ATOM   3972  C  CG2   . THR A 1 513 ? 32.403  141.691 51.502  1.00 25.66 ? 513  THR A CG2   1 
ATOM   3973  N  N     . GLY A 1 514 ? 36.911  143.236 50.882  1.00 22.06 ? 514  GLY A N     1 
ATOM   3974  C  CA    . GLY A 1 514 ? 38.157  143.782 51.391  1.00 21.55 ? 514  GLY A CA    1 
ATOM   3975  C  C     . GLY A 1 514 ? 39.177  142.720 51.752  1.00 20.80 ? 514  GLY A C     1 
ATOM   3976  O  O     . GLY A 1 514 ? 38.890  141.524 51.697  1.00 18.17 ? 514  GLY A O     1 
ATOM   3977  N  N     . ARG A 1 515 ? 40.371  143.164 52.136  1.00 18.84 ? 515  ARG A N     1 
ATOM   3978  C  CA    . ARG A 1 515 ? 41.451  142.253 52.491  1.00 19.13 ? 515  ARG A CA    1 
ATOM   3979  C  C     . ARG A 1 515 ? 41.132  141.372 53.696  1.00 19.70 ? 515  ARG A C     1 
ATOM   3980  O  O     . ARG A 1 515 ? 40.526  141.822 54.671  1.00 18.28 ? 515  ARG A O     1 
ATOM   3981  C  CB    . ARG A 1 515 ? 42.732  143.040 52.788  1.00 19.20 ? 515  ARG A CB    1 
ATOM   3982  C  CG    . ARG A 1 515 ? 43.178  143.978 51.677  1.00 17.81 ? 515  ARG A CG    1 
ATOM   3983  C  CD    . ARG A 1 515 ? 43.627  143.237 50.423  1.00 17.16 ? 515  ARG A CD    1 
ATOM   3984  N  NE    . ARG A 1 515 ? 44.828  142.435 50.639  1.00 14.53 ? 515  ARG A NE    1 
ATOM   3985  C  CZ    . ARG A 1 515 ? 45.705  142.141 49.684  1.00 15.06 ? 515  ARG A CZ    1 
ATOM   3986  N  NH1   . ARG A 1 515 ? 45.516  142.590 48.448  1.00 13.72 ? 515  ARG A NH1   1 
ATOM   3987  N  NH2   . ARG A 1 515 ? 46.764  141.386 49.956  1.00 16.24 ? 515  ARG A NH2   1 
ATOM   3988  N  N     . VAL A 1 516 ? 41.548  140.114 53.618  1.00 19.63 ? 516  VAL A N     1 
ATOM   3989  C  CA    . VAL A 1 516 ? 41.346  139.175 54.712  1.00 21.11 ? 516  VAL A CA    1 
ATOM   3990  C  C     . VAL A 1 516 ? 42.695  138.910 55.369  1.00 21.40 ? 516  VAL A C     1 
ATOM   3991  O  O     . VAL A 1 516 ? 42.789  138.161 56.338  1.00 21.45 ? 516  VAL A O     1 
ATOM   3992  C  CB    . VAL A 1 516 ? 40.714  137.846 54.230  1.00 21.54 ? 516  VAL A CB    1 
ATOM   3993  C  CG1   . VAL A 1 516 ? 39.261  138.083 53.846  1.00 23.32 ? 516  VAL A CG1   1 
ATOM   3994  C  CG2   . VAL A 1 516 ? 41.488  137.288 53.043  1.00 21.56 ? 516  VAL A CG2   1 
ATOM   3995  N  N     . ASP A 1 517 ? 43.743  139.522 54.821  1.00 21.12 ? 517  ASP A N     1 
ATOM   3996  C  CA    . ASP A 1 517 ? 45.073  139.391 55.397  1.00 21.05 ? 517  ASP A CA    1 
ATOM   3997  C  C     . ASP A 1 517 ? 45.334  140.704 56.129  1.00 21.52 ? 517  ASP A C     1 
ATOM   3998  O  O     . ASP A 1 517 ? 44.421  141.514 56.273  1.00 23.94 ? 517  ASP A O     1 
ATOM   3999  C  CB    . ASP A 1 517 ? 46.136  139.103 54.320  1.00 19.43 ? 517  ASP A CB    1 
ATOM   4000  C  CG    . ASP A 1 517 ? 46.128  140.104 53.178  1.00 20.10 ? 517  ASP A CG    1 
ATOM   4001  O  OD1   . ASP A 1 517 ? 46.862  139.870 52.191  1.00 19.25 ? 517  ASP A OD1   1 
ATOM   4002  O  OD2   . ASP A 1 517 ? 45.407  141.119 53.255  1.00 17.77 ? 517  ASP A OD2   1 
ATOM   4003  N  N     . ASP A 1 518 ? 46.553  140.932 56.596  1.00 22.59 ? 518  ASP A N     1 
ATOM   4004  C  CA    . ASP A 1 518 ? 46.827  142.159 57.336  1.00 23.21 ? 518  ASP A CA    1 
ATOM   4005  C  C     . ASP A 1 518 ? 47.243  143.345 56.484  1.00 21.78 ? 518  ASP A C     1 
ATOM   4006  O  O     . ASP A 1 518 ? 48.244  144.009 56.753  1.00 23.58 ? 518  ASP A O     1 
ATOM   4007  C  CB    . ASP A 1 518 ? 47.872  141.884 58.412  1.00 25.26 ? 518  ASP A CB    1 
ATOM   4008  C  CG    . ASP A 1 518 ? 47.419  140.813 59.378  1.00 27.88 ? 518  ASP A CG    1 
ATOM   4009  O  OD1   . ASP A 1 518 ? 46.226  140.827 59.745  1.00 26.95 ? 518  ASP A OD1   1 
ATOM   4010  O  OD2   . ASP A 1 518 ? 48.247  139.965 59.768  1.00 32.19 ? 518  ASP A OD2   1 
ATOM   4011  N  N     . VAL A 1 519 ? 46.455  143.610 55.452  1.00 20.14 ? 519  VAL A N     1 
ATOM   4012  C  CA    . VAL A 1 519 ? 46.716  144.721 54.556  1.00 18.89 ? 519  VAL A CA    1 
ATOM   4013  C  C     . VAL A 1 519 ? 45.592  145.726 54.738  1.00 17.99 ? 519  VAL A C     1 
ATOM   4014  O  O     . VAL A 1 519 ? 44.420  145.352 54.822  1.00 16.52 ? 519  VAL A O     1 
ATOM   4015  C  CB    . VAL A 1 519 ? 46.768  144.241 53.092  1.00 18.10 ? 519  VAL A CB    1 
ATOM   4016  C  CG1   . VAL A 1 519 ? 46.873  145.426 52.157  1.00 19.36 ? 519  VAL A CG1   1 
ATOM   4017  C  CG2   . VAL A 1 519 ? 47.956  143.306 52.905  1.00 19.50 ? 519  VAL A CG2   1 
ATOM   4018  N  N     . LEU A 1 520 ? 45.951  147.003 54.811  1.00 17.26 ? 520  LEU A N     1 
ATOM   4019  C  CA    . LEU A 1 520 ? 44.966  148.049 55.011  1.00 18.32 ? 520  LEU A CA    1 
ATOM   4020  C  C     . LEU A 1 520 ? 44.618  148.800 53.738  1.00 17.41 ? 520  LEU A C     1 
ATOM   4021  O  O     . LEU A 1 520 ? 45.329  148.725 52.736  1.00 17.37 ? 520  LEU A O     1 
ATOM   4022  C  CB    . LEU A 1 520 ? 45.477  149.057 56.043  1.00 20.93 ? 520  LEU A CB    1 
ATOM   4023  C  CG    . LEU A 1 520 ? 45.824  148.537 57.437  1.00 22.35 ? 520  LEU A CG    1 
ATOM   4024  C  CD1   . LEU A 1 520 ? 46.366  149.680 58.271  1.00 24.38 ? 520  LEU A CD1   1 
ATOM   4025  C  CD2   . LEU A 1 520 ? 44.592  147.929 58.095  1.00 22.34 ? 520  LEU A CD2   1 
ATOM   4026  N  N     . ASN A 1 521 ? 43.503  149.519 53.797  1.00 18.58 ? 521  ASN A N     1 
ATOM   4027  C  CA    . ASN A 1 521 ? 43.052  150.354 52.695  1.00 19.76 ? 521  ASN A CA    1 
ATOM   4028  C  C     . ASN A 1 521 ? 42.884  151.744 53.284  1.00 18.40 ? 521  ASN A C     1 
ATOM   4029  O  O     . ASN A 1 521 ? 41.850  152.051 53.875  1.00 18.30 ? 521  ASN A O     1 
ATOM   4030  C  CB    . ASN A 1 521 ? 41.710  149.894 52.137  1.00 22.51 ? 521  ASN A CB    1 
ATOM   4031  C  CG    . ASN A 1 521 ? 41.043  150.972 51.301  1.00 24.94 ? 521  ASN A CG    1 
ATOM   4032  O  OD1   . ASN A 1 521 ? 41.663  151.541 50.396  1.00 24.81 ? 521  ASN A OD1   1 
ATOM   4033  N  ND2   . ASN A 1 521 ? 39.780  151.268 51.604  1.00 24.51 ? 521  ASN A ND2   1 
ATOM   4034  N  N     . VAL A 1 522 ? 43.908  152.575 53.132  1.00 18.39 ? 522  VAL A N     1 
ATOM   4035  C  CA    . VAL A 1 522 ? 43.881  153.932 53.665  1.00 19.04 ? 522  VAL A CA    1 
ATOM   4036  C  C     . VAL A 1 522 ? 43.746  154.937 52.527  1.00 19.73 ? 522  VAL A C     1 
ATOM   4037  O  O     . VAL A 1 522 ? 44.675  155.130 51.742  1.00 18.34 ? 522  VAL A O     1 
ATOM   4038  C  CB    . VAL A 1 522 ? 45.168  154.233 54.475  1.00 20.40 ? 522  VAL A CB    1 
ATOM   4039  C  CG1   . VAL A 1 522 ? 45.124  155.655 55.030  1.00 22.01 ? 522  VAL A CG1   1 
ATOM   4040  C  CG2   . VAL A 1 522 ? 45.307  153.233 55.614  1.00 21.36 ? 522  VAL A CG2   1 
ATOM   4041  N  N     . SER A 1 523 ? 42.579  155.573 52.452  1.00 18.81 ? 523  SER A N     1 
ATOM   4042  C  CA    . SER A 1 523 ? 42.284  156.555 51.414  1.00 19.84 ? 523  SER A CA    1 
ATOM   4043  C  C     . SER A 1 523 ? 42.501  155.981 50.021  1.00 19.66 ? 523  SER A C     1 
ATOM   4044  O  O     . SER A 1 523 ? 42.964  156.676 49.118  1.00 20.16 ? 523  SER A O     1 
ATOM   4045  C  CB    . SER A 1 523 ? 43.152  157.801 51.592  1.00 21.22 ? 523  SER A CB    1 
ATOM   4046  O  OG    . SER A 1 523 ? 42.857  158.436 52.820  1.00 27.09 ? 523  SER A OG    1 
ATOM   4047  N  N     . GLY A 1 524 ? 42.161  154.708 49.853  1.00 18.38 ? 524  GLY A N     1 
ATOM   4048  C  CA    . GLY A 1 524 ? 42.322  154.069 48.563  1.00 19.49 ? 524  GLY A CA    1 
ATOM   4049  C  C     . GLY A 1 524 ? 43.751  153.632 48.307  1.00 20.49 ? 524  GLY A C     1 
ATOM   4050  O  O     . GLY A 1 524 ? 44.130  153.394 47.162  1.00 22.34 ? 524  GLY A O     1 
ATOM   4051  N  N     . HIS A 1 525 ? 44.544  153.524 49.370  1.00 19.75 ? 525  HIS A N     1 
ATOM   4052  C  CA    . HIS A 1 525 ? 45.936  153.105 49.239  1.00 20.05 ? 525  HIS A CA    1 
ATOM   4053  C  C     . HIS A 1 525 ? 46.204  151.821 50.013  1.00 19.42 ? 525  HIS A C     1 
ATOM   4054  O  O     . HIS A 1 525 ? 45.764  151.659 51.153  1.00 18.84 ? 525  HIS A O     1 
ATOM   4055  C  CB    . HIS A 1 525 ? 46.887  154.199 49.734  1.00 21.58 ? 525  HIS A CB    1 
ATOM   4056  C  CG    . HIS A 1 525 ? 46.763  155.493 48.989  1.00 22.11 ? 525  HIS A CG    1 
ATOM   4057  N  ND1   . HIS A 1 525 ? 46.074  156.577 49.490  1.00 24.00 ? 525  HIS A ND1   1 
ATOM   4058  C  CD2   . HIS A 1 525 ? 47.239  155.875 47.780  1.00 22.46 ? 525  HIS A CD2   1 
ATOM   4059  C  CE1   . HIS A 1 525 ? 46.134  157.573 48.623  1.00 23.71 ? 525  HIS A CE1   1 
ATOM   4060  N  NE2   . HIS A 1 525 ? 46.836  157.173 47.577  1.00 23.74 ? 525  HIS A NE2   1 
ATOM   4061  N  N     . ARG A 1 526 ? 46.942  150.918 49.379  1.00 17.58 ? 526  ARG A N     1 
ATOM   4062  C  CA    . ARG A 1 526 ? 47.288  149.631 49.965  1.00 16.73 ? 526  ARG A CA    1 
ATOM   4063  C  C     . ARG A 1 526 ? 48.542  149.735 50.838  1.00 16.93 ? 526  ARG A C     1 
ATOM   4064  O  O     . ARG A 1 526 ? 49.616  150.090 50.357  1.00 17.51 ? 526  ARG A O     1 
ATOM   4065  C  CB    . ARG A 1 526 ? 47.490  148.623 48.833  1.00 17.16 ? 526  ARG A CB    1 
ATOM   4066  C  CG    . ARG A 1 526 ? 48.008  147.253 49.239  1.00 17.00 ? 526  ARG A CG    1 
ATOM   4067  C  CD    . ARG A 1 526 ? 48.035  146.353 48.011  1.00 16.12 ? 526  ARG A CD    1 
ATOM   4068  N  NE    . ARG A 1 526 ? 48.824  145.143 48.209  1.00 16.03 ? 526  ARG A NE    1 
ATOM   4069  C  CZ    . ARG A 1 526 ? 48.933  144.171 47.308  1.00 14.74 ? 526  ARG A CZ    1 
ATOM   4070  N  NH1   . ARG A 1 526 ? 48.292  144.266 46.147  1.00 14.17 ? 526  ARG A NH1   1 
ATOM   4071  N  NH2   . ARG A 1 526 ? 49.697  143.115 47.560  1.00 13.67 ? 526  ARG A NH2   1 
ATOM   4072  N  N     . LEU A 1 527 ? 48.390  149.426 52.124  1.00 17.81 ? 527  LEU A N     1 
ATOM   4073  C  CA    . LEU A 1 527 ? 49.493  149.482 53.089  1.00 20.02 ? 527  LEU A CA    1 
ATOM   4074  C  C     . LEU A 1 527 ? 49.478  148.270 54.015  1.00 19.91 ? 527  LEU A C     1 
ATOM   4075  O  O     . LEU A 1 527 ? 48.418  147.844 54.466  1.00 19.74 ? 527  LEU A O     1 
ATOM   4076  C  CB    . LEU A 1 527 ? 49.382  150.743 53.953  1.00 23.17 ? 527  LEU A CB    1 
ATOM   4077  C  CG    . LEU A 1 527 ? 49.537  152.113 53.296  1.00 24.95 ? 527  LEU A CG    1 
ATOM   4078  C  CD1   . LEU A 1 527 ? 49.235  153.204 54.316  1.00 25.59 ? 527  LEU A CD1   1 
ATOM   4079  C  CD2   . LEU A 1 527 ? 50.947  152.258 52.756  1.00 26.07 ? 527  LEU A CD2   1 
ATOM   4080  N  N     . GLY A 1 528 ? 50.652  147.731 54.322  1.00 17.48 ? 528  GLY A N     1 
ATOM   4081  C  CA    . GLY A 1 528 ? 50.713  146.577 55.204  1.00 17.89 ? 528  GLY A CA    1 
ATOM   4082  C  C     . GLY A 1 528 ? 50.816  146.986 56.662  1.00 19.24 ? 528  GLY A C     1 
ATOM   4083  O  O     . GLY A 1 528 ? 51.516  147.941 56.995  1.00 18.24 ? 528  GLY A O     1 
ATOM   4084  N  N     . THR A 1 529 ? 50.115  146.282 57.543  1.00 20.01 ? 529  THR A N     1 
ATOM   4085  C  CA    . THR A 1 529 ? 50.180  146.622 58.957  1.00 20.74 ? 529  THR A CA    1 
ATOM   4086  C  C     . THR A 1 529 ? 51.575  146.297 59.486  1.00 20.04 ? 529  THR A C     1 
ATOM   4087  O  O     . THR A 1 529 ? 52.130  147.044 60.289  1.00 17.79 ? 529  THR A O     1 
ATOM   4088  C  CB    . THR A 1 529 ? 49.123  145.851 59.781  1.00 22.77 ? 529  THR A CB    1 
ATOM   4089  O  OG1   . THR A 1 529 ? 49.244  144.450 59.530  1.00 24.64 ? 529  THR A OG1   1 
ATOM   4090  C  CG2   . THR A 1 529 ? 47.719  146.311 59.410  1.00 25.75 ? 529  THR A CG2   1 
ATOM   4091  N  N     . ALA A 1 530 ? 52.146  145.192 59.012  1.00 18.99 ? 530  ALA A N     1 
ATOM   4092  C  CA    . ALA A 1 530 ? 53.475  144.776 59.438  1.00 18.66 ? 530  ALA A CA    1 
ATOM   4093  C  C     . ALA A 1 530 ? 54.538  145.831 59.159  1.00 18.86 ? 530  ALA A C     1 
ATOM   4094  O  O     . ALA A 1 530 ? 55.381  146.109 60.013  1.00 18.34 ? 530  ALA A O     1 
ATOM   4095  C  CB    . ALA A 1 530 ? 53.858  143.466 58.759  1.00 19.54 ? 530  ALA A CB    1 
ATOM   4096  N  N     . GLU A 1 531 ? 54.506  146.425 57.972  1.00 18.18 ? 531  GLU A N     1 
ATOM   4097  C  CA    . GLU A 1 531 ? 55.508  147.428 57.643  1.00 18.15 ? 531  GLU A CA    1 
ATOM   4098  C  C     . GLU A 1 531 ? 55.375  148.685 58.502  1.00 17.73 ? 531  GLU A C     1 
ATOM   4099  O  O     . GLU A 1 531 ? 56.367  149.368 58.768  1.00 15.18 ? 531  GLU A O     1 
ATOM   4100  C  CB    . GLU A 1 531 ? 55.448  147.789 56.156  1.00 19.58 ? 531  GLU A CB    1 
ATOM   4101  C  CG    . GLU A 1 531 ? 54.244  148.589 55.732  1.00 22.73 ? 531  GLU A CG    1 
ATOM   4102  C  CD    . GLU A 1 531 ? 54.285  148.939 54.255  1.00 25.15 ? 531  GLU A CD    1 
ATOM   4103  O  OE1   . GLU A 1 531 ? 55.169  149.725 53.845  1.00 24.67 ? 531  GLU A OE1   1 
ATOM   4104  O  OE2   . GLU A 1 531 ? 53.434  148.419 53.504  1.00 25.15 ? 531  GLU A OE2   1 
ATOM   4105  N  N     . ILE A 1 532 ? 54.160  148.997 58.940  1.00 16.18 ? 532  ILE A N     1 
ATOM   4106  C  CA    . ILE A 1 532 ? 53.973  150.172 59.783  1.00 16.97 ? 532  ILE A CA    1 
ATOM   4107  C  C     . ILE A 1 532 ? 54.495  149.836 61.179  1.00 15.71 ? 532  ILE A C     1 
ATOM   4108  O  O     . ILE A 1 532 ? 55.116  150.665 61.841  1.00 14.56 ? 532  ILE A O     1 
ATOM   4109  C  CB    . ILE A 1 532 ? 52.491  150.595 59.853  1.00 16.96 ? 532  ILE A CB    1 
ATOM   4110  C  CG1   . ILE A 1 532 ? 51.994  150.943 58.446  1.00 19.83 ? 532  ILE A CG1   1 
ATOM   4111  C  CG2   . ILE A 1 532 ? 52.334  151.824 60.757  1.00 16.29 ? 532  ILE A CG2   1 
ATOM   4112  C  CD1   . ILE A 1 532 ? 50.515  151.299 58.375  1.00 19.19 ? 532  ILE A CD1   1 
ATOM   4113  N  N     . GLU A 1 533 ? 54.265  148.601 61.613  1.00 16.21 ? 533  GLU A N     1 
ATOM   4114  C  CA    . GLU A 1 533 ? 54.739  148.170 62.919  1.00 16.23 ? 533  GLU A CA    1 
ATOM   4115  C  C     . GLU A 1 533 ? 56.268  148.187 62.950  1.00 17.66 ? 533  GLU A C     1 
ATOM   4116  O  O     . GLU A 1 533 ? 56.864  148.650 63.919  1.00 16.70 ? 533  GLU A O     1 
ATOM   4117  C  CB    . GLU A 1 533 ? 54.190  146.777 63.230  1.00 16.42 ? 533  GLU A CB    1 
ATOM   4118  C  CG    . GLU A 1 533 ? 52.668  146.752 63.175  1.00 17.51 ? 533  GLU A CG    1 
ATOM   4119  C  CD    . GLU A 1 533 ? 52.079  145.380 63.408  1.00 18.60 ? 533  GLU A CD    1 
ATOM   4120  O  OE1   . GLU A 1 533 ? 52.787  144.380 63.165  1.00 17.63 ? 533  GLU A OE1   1 
ATOM   4121  O  OE2   . GLU A 1 533 ? 50.902  145.309 63.818  1.00 18.52 ? 533  GLU A OE2   1 
ATOM   4122  N  N     . SER A 1 534 ? 56.903  147.701 61.885  1.00 16.95 ? 534  SER A N     1 
ATOM   4123  C  CA    . SER A 1 534 ? 58.364  147.700 61.817  1.00 18.84 ? 534  SER A CA    1 
ATOM   4124  C  C     . SER A 1 534 ? 58.902  149.125 61.858  1.00 16.98 ? 534  SER A C     1 
ATOM   4125  O  O     . SER A 1 534 ? 59.927  149.395 62.481  1.00 18.11 ? 534  SER A O     1 
ATOM   4126  C  CB    . SER A 1 534 ? 58.850  147.031 60.528  1.00 20.24 ? 534  SER A CB    1 
ATOM   4127  O  OG    . SER A 1 534 ? 58.560  145.649 60.542  1.00 26.89 ? 534  SER A OG    1 
ATOM   4128  N  N     . ALA A 1 535 ? 58.212  150.035 61.179  1.00 16.00 ? 535  ALA A N     1 
ATOM   4129  C  CA    . ALA A 1 535 ? 58.634  151.428 61.157  1.00 15.46 ? 535  ALA A CA    1 
ATOM   4130  C  C     . ALA A 1 535 ? 58.585  151.989 62.575  1.00 13.55 ? 535  ALA A C     1 
ATOM   4131  O  O     . ALA A 1 535 ? 59.525  152.647 63.022  1.00 14.66 ? 535  ALA A O     1 
ATOM   4132  C  CB    . ALA A 1 535 ? 57.727  152.234 60.237  1.00 15.44 ? 535  ALA A CB    1 
ATOM   4133  N  N     . LEU A 1 536 ? 57.493  151.714 63.283  1.00 13.90 ? 536  LEU A N     1 
ATOM   4134  C  CA    . LEU A 1 536 ? 57.332  152.194 64.654  1.00 13.36 ? 536  LEU A CA    1 
ATOM   4135  C  C     . LEU A 1 536 ? 58.399  151.641 65.600  1.00 15.38 ? 536  LEU A C     1 
ATOM   4136  O  O     . LEU A 1 536 ? 59.043  152.390 66.329  1.00 15.55 ? 536  LEU A O     1 
ATOM   4137  C  CB    . LEU A 1 536 ? 55.935  151.833 65.174  1.00 14.97 ? 536  LEU A CB    1 
ATOM   4138  C  CG    . LEU A 1 536 ? 54.788  152.663 64.575  1.00 13.94 ? 536  LEU A CG    1 
ATOM   4139  C  CD1   . LEU A 1 536 ? 53.436  152.018 64.869  1.00 14.93 ? 536  LEU A CD1   1 
ATOM   4140  C  CD2   . LEU A 1 536 ? 54.855  154.070 65.150  1.00 15.39 ? 536  LEU A CD2   1 
ATOM   4141  N  N     . VAL A 1 537 ? 58.596  150.327 65.579  1.00 16.26 ? 537  VAL A N     1 
ATOM   4142  C  CA    . VAL A 1 537 ? 59.580  149.701 66.456  1.00 16.72 ? 537  VAL A CA    1 
ATOM   4143  C  C     . VAL A 1 537 ? 61.016  150.143 66.169  1.00 17.01 ? 537  VAL A C     1 
ATOM   4144  O  O     . VAL A 1 537 ? 61.888  150.032 67.032  1.00 17.59 ? 537  VAL A O     1 
ATOM   4145  C  CB    . VAL A 1 537 ? 59.467  148.160 66.380  1.00 17.47 ? 537  VAL A CB    1 
ATOM   4146  C  CG1   . VAL A 1 537 ? 60.575  147.499 67.189  1.00 20.11 ? 537  VAL A CG1   1 
ATOM   4147  C  CG2   . VAL A 1 537 ? 58.109  147.734 66.911  1.00 19.61 ? 537  VAL A CG2   1 
ATOM   4148  N  N     . ALA A 1 538 ? 61.261  150.654 64.967  1.00 16.81 ? 538  ALA A N     1 
ATOM   4149  C  CA    . ALA A 1 538 ? 62.595  151.120 64.609  1.00 17.27 ? 538  ALA A CA    1 
ATOM   4150  C  C     . ALA A 1 538 ? 62.958  152.347 65.440  1.00 17.68 ? 538  ALA A C     1 
ATOM   4151  O  O     . ALA A 1 538 ? 64.134  152.648 65.628  1.00 17.15 ? 538  ALA A O     1 
ATOM   4152  C  CB    . ALA A 1 538 ? 62.661  151.457 63.121  1.00 19.20 ? 538  ALA A CB    1 
ATOM   4153  N  N     . HIS A 1 539 ? 61.947  153.062 65.928  1.00 18.41 ? 539  HIS A N     1 
ATOM   4154  C  CA    . HIS A 1 539 ? 62.199  154.243 66.746  1.00 19.45 ? 539  HIS A CA    1 
ATOM   4155  C  C     . HIS A 1 539 ? 62.883  153.800 68.043  1.00 19.53 ? 539  HIS A C     1 
ATOM   4156  O  O     . HIS A 1 539 ? 62.448  152.844 68.690  1.00 18.35 ? 539  HIS A O     1 
ATOM   4157  C  CB    . HIS A 1 539 ? 60.889  154.974 67.052  1.00 19.47 ? 539  HIS A CB    1 
ATOM   4158  C  CG    . HIS A 1 539 ? 61.084  156.285 67.745  1.00 20.38 ? 539  HIS A CG    1 
ATOM   4159  N  ND1   . HIS A 1 539 ? 61.526  156.378 69.047  1.00 19.79 ? 539  HIS A ND1   1 
ATOM   4160  C  CD2   . HIS A 1 539 ? 60.935  157.558 67.306  1.00 20.66 ? 539  HIS A CD2   1 
ATOM   4161  C  CE1   . HIS A 1 539 ? 61.644  157.652 69.379  1.00 20.51 ? 539  HIS A CE1   1 
ATOM   4162  N  NE2   . HIS A 1 539 ? 61.291  158.389 68.341  1.00 19.67 ? 539  HIS A NE2   1 
ATOM   4163  N  N     . PRO A 1 540 ? 63.962  154.496 68.438  1.00 20.63 ? 540  PRO A N     1 
ATOM   4164  C  CA    . PRO A 1 540 ? 64.747  154.208 69.646  1.00 21.46 ? 540  PRO A CA    1 
ATOM   4165  C  C     . PRO A 1 540 ? 63.972  154.080 70.957  1.00 21.88 ? 540  PRO A C     1 
ATOM   4166  O  O     . PRO A 1 540 ? 64.424  153.401 71.886  1.00 22.52 ? 540  PRO A O     1 
ATOM   4167  C  CB    . PRO A 1 540 ? 65.741  155.369 69.696  1.00 24.24 ? 540  PRO A CB    1 
ATOM   4168  C  CG    . PRO A 1 540 ? 65.917  155.732 68.256  1.00 22.34 ? 540  PRO A CG    1 
ATOM   4169  C  CD    . PRO A 1 540 ? 64.502  155.681 67.745  1.00 21.72 ? 540  PRO A CD    1 
ATOM   4170  N  N     . LYS A 1 541 ? 62.817  154.733 71.044  1.00 19.43 ? 541  LYS A N     1 
ATOM   4171  C  CA    . LYS A 1 541 ? 62.026  154.691 72.271  1.00 18.94 ? 541  LYS A CA    1 
ATOM   4172  C  C     . LYS A 1 541 ? 60.863  153.700 72.251  1.00 17.63 ? 541  LYS A C     1 
ATOM   4173  O  O     . LYS A 1 541 ? 60.212  153.474 73.271  1.00 17.44 ? 541  LYS A O     1 
ATOM   4174  C  CB    . LYS A 1 541 ? 61.496  156.093 72.594  1.00 19.01 ? 541  LYS A CB    1 
ATOM   4175  C  CG    . LYS A 1 541 ? 62.570  157.082 73.051  1.00 20.79 ? 541  LYS A CG    1 
ATOM   4176  C  CD    . LYS A 1 541 ? 61.948  158.432 73.416  1.00 24.08 ? 541  LYS A CD    1 
ATOM   4177  C  CE    . LYS A 1 541 ? 62.965  159.393 74.026  1.00 27.11 ? 541  LYS A CE    1 
ATOM   4178  N  NZ    . LYS A 1 541 ? 64.016  159.823 73.062  1.00 30.29 ? 541  LYS A NZ    1 
ATOM   4179  N  N     . ILE A 1 542 ? 60.602  153.109 71.092  1.00 16.75 ? 542  ILE A N     1 
ATOM   4180  C  CA    . ILE A 1 542 ? 59.502  152.162 70.965  1.00 16.04 ? 542  ILE A CA    1 
ATOM   4181  C  C     . ILE A 1 542 ? 59.995  150.720 71.048  1.00 16.62 ? 542  ILE A C     1 
ATOM   4182  O  O     . ILE A 1 542 ? 60.951  150.331 70.373  1.00 17.43 ? 542  ILE A O     1 
ATOM   4183  C  CB    . ILE A 1 542 ? 58.737  152.383 69.633  1.00 14.96 ? 542  ILE A CB    1 
ATOM   4184  C  CG1   . ILE A 1 542 ? 58.142  153.798 69.619  1.00 15.46 ? 542  ILE A CG1   1 
ATOM   4185  C  CG2   . ILE A 1 542 ? 57.635  151.327 69.466  1.00 14.80 ? 542  ILE A CG2   1 
ATOM   4186  C  CD1   . ILE A 1 542 ? 57.325  154.132 68.369  1.00 15.92 ? 542  ILE A CD1   1 
ATOM   4187  N  N     . ALA A 1 543 ? 59.336  149.930 71.886  1.00 17.02 ? 543  ALA A N     1 
ATOM   4188  C  CA    . ALA A 1 543 ? 59.714  148.533 72.066  1.00 18.46 ? 543  ALA A CA    1 
ATOM   4189  C  C     . ALA A 1 543 ? 58.882  147.593 71.209  1.00 18.97 ? 543  ALA A C     1 
ATOM   4190  O  O     . ALA A 1 543 ? 59.394  146.613 70.674  1.00 17.68 ? 543  ALA A O     1 
ATOM   4191  C  CB    . ALA A 1 543 ? 59.570  148.144 73.528  1.00 19.20 ? 543  ALA A CB    1 
ATOM   4192  N  N     . GLU A 1 544 ? 57.596  147.896 71.082  1.00 19.51 ? 544  GLU A N     1 
ATOM   4193  C  CA    . GLU A 1 544 ? 56.694  147.048 70.318  1.00 20.42 ? 544  GLU A CA    1 
ATOM   4194  C  C     . GLU A 1 544 ? 55.475  147.835 69.841  1.00 20.43 ? 544  GLU A C     1 
ATOM   4195  O  O     . GLU A 1 544 ? 55.077  148.833 70.458  1.00 18.47 ? 544  GLU A O     1 
ATOM   4196  C  CB    . GLU A 1 544 ? 56.274  145.867 71.199  1.00 24.03 ? 544  GLU A CB    1 
ATOM   4197  C  CG    . GLU A 1 544 ? 55.429  144.803 70.528  1.00 29.31 ? 544  GLU A CG    1 
ATOM   4198  C  CD    . GLU A 1 544 ? 55.287  143.560 71.394  1.00 31.47 ? 544  GLU A CD    1 
ATOM   4199  O  OE1   . GLU A 1 544 ? 55.057  143.705 72.616  1.00 31.79 ? 544  GLU A OE1   1 
ATOM   4200  O  OE2   . GLU A 1 544 ? 55.400  142.440 70.853  1.00 34.49 ? 544  GLU A OE2   1 
ATOM   4201  N  N     . ALA A 1 545 ? 54.888  147.392 68.734  1.00 18.09 ? 545  ALA A N     1 
ATOM   4202  C  CA    . ALA A 1 545 ? 53.722  148.068 68.182  1.00 17.02 ? 545  ALA A CA    1 
ATOM   4203  C  C     . ALA A 1 545 ? 52.788  147.112 67.450  1.00 17.91 ? 545  ALA A C     1 
ATOM   4204  O  O     . ALA A 1 545 ? 53.228  146.137 66.845  1.00 17.91 ? 545  ALA A O     1 
ATOM   4205  C  CB    . ALA A 1 545 ? 54.173  149.172 67.239  1.00 17.04 ? 545  ALA A CB    1 
ATOM   4206  N  N     . ALA A 1 546 ? 51.494  147.402 67.523  1.00 17.02 ? 546  ALA A N     1 
ATOM   4207  C  CA    . ALA A 1 546 ? 50.478  146.607 66.848  1.00 18.28 ? 546  ALA A CA    1 
ATOM   4208  C  C     . ALA A 1 546 ? 49.596  147.612 66.125  1.00 17.61 ? 546  ALA A C     1 
ATOM   4209  O  O     . ALA A 1 546 ? 49.029  148.509 66.747  1.00 16.48 ? 546  ALA A O     1 
ATOM   4210  C  CB    . ALA A 1 546 ? 49.660  145.802 67.862  1.00 17.92 ? 546  ALA A CB    1 
ATOM   4211  N  N     . VAL A 1 547 ? 49.496  147.466 64.808  1.00 16.75 ? 547  VAL A N     1 
ATOM   4212  C  CA    . VAL A 1 547 ? 48.709  148.380 63.992  1.00 16.81 ? 547  VAL A CA    1 
ATOM   4213  C  C     . VAL A 1 547 ? 47.475  147.720 63.394  1.00 17.16 ? 547  VAL A C     1 
ATOM   4214  O  O     . VAL A 1 547 ? 47.543  146.611 62.870  1.00 15.85 ? 547  VAL A O     1 
ATOM   4215  C  CB    . VAL A 1 547 ? 49.567  148.963 62.837  1.00 15.31 ? 547  VAL A CB    1 
ATOM   4216  C  CG1   . VAL A 1 547 ? 48.704  149.812 61.913  1.00 17.63 ? 547  VAL A CG1   1 
ATOM   4217  C  CG2   . VAL A 1 547 ? 50.714  149.794 63.413  1.00 17.28 ? 547  VAL A CG2   1 
ATOM   4218  N  N     . VAL A 1 548 ? 46.346  148.415 63.483  1.00 18.05 ? 548  VAL A N     1 
ATOM   4219  C  CA    . VAL A 1 548 ? 45.095  147.926 62.929  1.00 18.20 ? 548  VAL A CA    1 
ATOM   4220  C  C     . VAL A 1 548 ? 44.394  149.077 62.232  1.00 18.78 ? 548  VAL A C     1 
ATOM   4221  O  O     . VAL A 1 548 ? 44.703  150.245 62.469  1.00 18.24 ? 548  VAL A O     1 
ATOM   4222  C  CB    . VAL A 1 548 ? 44.146  147.370 64.027  1.00 18.65 ? 548  VAL A CB    1 
ATOM   4223  C  CG1   . VAL A 1 548 ? 44.793  146.184 64.724  1.00 20.30 ? 548  VAL A CG1   1 
ATOM   4224  C  CG2   . VAL A 1 548 ? 43.802  148.463 65.034  1.00 18.91 ? 548  VAL A CG2   1 
ATOM   4225  N  N     . GLY A 1 549 ? 43.464  148.745 61.349  1.00 19.71 ? 549  GLY A N     1 
ATOM   4226  C  CA    . GLY A 1 549 ? 42.721  149.783 60.669  1.00 20.26 ? 549  GLY A CA    1 
ATOM   4227  C  C     . GLY A 1 549 ? 41.345  149.853 61.297  1.00 20.30 ? 549  GLY A C     1 
ATOM   4228  O  O     . GLY A 1 549 ? 40.839  148.850 61.797  1.00 22.50 ? 549  GLY A O     1 
ATOM   4229  N  N     . ILE A 1 550 ? 40.757  151.042 61.312  1.00 19.99 ? 550  ILE A N     1 
ATOM   4230  C  CA    . ILE A 1 550 ? 39.417  151.226 61.845  1.00 20.94 ? 550  ILE A CA    1 
ATOM   4231  C  C     . ILE A 1 550 ? 38.613  151.946 60.769  1.00 21.52 ? 550  ILE A C     1 
ATOM   4232  O  O     . ILE A 1 550 ? 39.165  152.712 59.973  1.00 20.68 ? 550  ILE A O     1 
ATOM   4233  C  CB    . ILE A 1 550 ? 39.408  152.066 63.148  1.00 21.57 ? 550  ILE A CB    1 
ATOM   4234  C  CG1   . ILE A 1 550 ? 40.043  153.434 62.901  1.00 22.41 ? 550  ILE A CG1   1 
ATOM   4235  C  CG2   . ILE A 1 550 ? 40.127  151.303 64.258  1.00 20.19 ? 550  ILE A CG2   1 
ATOM   4236  C  CD1   . ILE A 1 550 ? 40.050  154.342 64.124  1.00 24.86 ? 550  ILE A CD1   1 
ATOM   4237  N  N     . PRO A 1 551 ? 37.299  151.696 60.719  1.00 22.75 ? 551  PRO A N     1 
ATOM   4238  C  CA    . PRO A 1 551 ? 36.452  152.342 59.716  1.00 22.80 ? 551  PRO A CA    1 
ATOM   4239  C  C     . PRO A 1 551 ? 36.542  153.862 59.743  1.00 22.80 ? 551  PRO A C     1 
ATOM   4240  O  O     . PRO A 1 551 ? 36.636  154.472 60.810  1.00 22.83 ? 551  PRO A O     1 
ATOM   4241  C  CB    . PRO A 1 551 ? 35.054  151.844 60.077  1.00 22.09 ? 551  PRO A CB    1 
ATOM   4242  C  CG    . PRO A 1 551 ? 35.328  150.471 60.618  1.00 23.78 ? 551  PRO A CG    1 
ATOM   4243  C  CD    . PRO A 1 551 ? 36.528  150.720 61.509  1.00 23.05 ? 551  PRO A CD    1 
ATOM   4244  N  N     . HIS A 1 552 ? 36.535  154.460 58.557  1.00 22.57 ? 552  HIS A N     1 
ATOM   4245  C  CA    . HIS A 1 552 ? 36.570  155.910 58.412  1.00 23.86 ? 552  HIS A CA    1 
ATOM   4246  C  C     . HIS A 1 552 ? 35.619  156.230 57.266  1.00 23.37 ? 552  HIS A C     1 
ATOM   4247  O  O     . HIS A 1 552 ? 35.767  155.703 56.163  1.00 23.24 ? 552  HIS A O     1 
ATOM   4248  C  CB    . HIS A 1 552 ? 37.975  156.409 58.074  1.00 24.82 ? 552  HIS A CB    1 
ATOM   4249  C  CG    . HIS A 1 552 ? 38.108  157.898 58.145  1.00 26.09 ? 552  HIS A CG    1 
ATOM   4250  N  ND1   . HIS A 1 552 ? 38.441  158.561 59.307  1.00 28.07 ? 552  HIS A ND1   1 
ATOM   4251  C  CD2   . HIS A 1 552 ? 37.897  158.857 57.212  1.00 26.38 ? 552  HIS A CD2   1 
ATOM   4252  C  CE1   . HIS A 1 552 ? 38.432  159.863 59.086  1.00 27.79 ? 552  HIS A CE1   1 
ATOM   4253  N  NE2   . HIS A 1 552 ? 38.106  160.070 57.823  1.00 29.46 ? 552  HIS A NE2   1 
ATOM   4254  N  N     . ALA A 1 553 ? 34.642  157.089 57.533  1.00 24.30 ? 553  ALA A N     1 
ATOM   4255  C  CA    . ALA A 1 553 ? 33.631  157.452 56.545  1.00 24.97 ? 553  ALA A CA    1 
ATOM   4256  C  C     . ALA A 1 553 ? 34.160  158.001 55.223  1.00 25.05 ? 553  ALA A C     1 
ATOM   4257  O  O     . ALA A 1 553 ? 33.508  157.856 54.187  1.00 27.15 ? 553  ALA A O     1 
ATOM   4258  C  CB    . ALA A 1 553 ? 32.641  158.443 57.162  1.00 24.80 ? 553  ALA A CB    1 
ATOM   4259  N  N     . ILE A 1 554 ? 35.328  158.632 55.247  1.00 23.89 ? 554  ILE A N     1 
ATOM   4260  C  CA    . ILE A 1 554 ? 35.883  159.190 54.022  1.00 23.91 ? 554  ILE A CA    1 
ATOM   4261  C  C     . ILE A 1 554 ? 36.974  158.329 53.381  1.00 22.96 ? 554  ILE A C     1 
ATOM   4262  O  O     . ILE A 1 554 ? 36.877  157.968 52.209  1.00 22.18 ? 554  ILE A O     1 
ATOM   4263  C  CB    . ILE A 1 554 ? 36.455  160.605 54.263  1.00 24.83 ? 554  ILE A CB    1 
ATOM   4264  C  CG1   . ILE A 1 554 ? 35.347  161.543 54.755  1.00 26.72 ? 554  ILE A CG1   1 
ATOM   4265  C  CG2   . ILE A 1 554 ? 37.077  161.145 52.977  1.00 26.22 ? 554  ILE A CG2   1 
ATOM   4266  C  CD1   . ILE A 1 554 ? 34.173  161.669 53.810  1.00 27.79 ? 554  ILE A CD1   1 
ATOM   4267  N  N     . LYS A 1 555 ? 37.998  157.982 54.149  1.00 22.26 ? 555  LYS A N     1 
ATOM   4268  C  CA    . LYS A 1 555 ? 39.098  157.203 53.596  1.00 23.26 ? 555  LYS A CA    1 
ATOM   4269  C  C     . LYS A 1 555 ? 39.041  155.684 53.718  1.00 21.37 ? 555  LYS A C     1 
ATOM   4270  O  O     . LYS A 1 555 ? 40.030  155.009 53.450  1.00 21.14 ? 555  LYS A O     1 
ATOM   4271  C  CB    . LYS A 1 555 ? 40.420  157.726 54.158  1.00 25.58 ? 555  LYS A CB    1 
ATOM   4272  C  CG    . LYS A 1 555 ? 40.462  157.868 55.659  1.00 26.50 ? 555  LYS A CG    1 
ATOM   4273  C  CD    . LYS A 1 555 ? 41.642  158.734 56.074  1.00 31.79 ? 555  LYS A CD    1 
ATOM   4274  C  CE    . LYS A 1 555 ? 41.735  158.880 57.583  1.00 32.81 ? 555  LYS A CE    1 
ATOM   4275  N  NZ    . LYS A 1 555 ? 42.899  159.729 57.965  1.00 35.71 ? 555  LYS A NZ    1 
ATOM   4276  N  N     . GLY A 1 556 ? 37.888  155.141 54.094  1.00 20.87 ? 556  GLY A N     1 
ATOM   4277  C  CA    . GLY A 1 556 ? 37.764  153.697 54.212  1.00 19.20 ? 556  GLY A CA    1 
ATOM   4278  C  C     . GLY A 1 556 ? 38.264  153.204 55.551  1.00 18.20 ? 556  GLY A C     1 
ATOM   4279  O  O     . GLY A 1 556 ? 37.486  152.736 56.380  1.00 19.85 ? 556  GLY A O     1 
ATOM   4280  N  N     . GLN A 1 557 ? 39.572  153.294 55.758  1.00 17.14 ? 557  GLN A N     1 
ATOM   4281  C  CA    . GLN A 1 557 ? 40.172  152.890 57.020  1.00 17.86 ? 557  GLN A CA    1 
ATOM   4282  C  C     . GLN A 1 557 ? 41.155  153.945 57.492  1.00 17.39 ? 557  GLN A C     1 
ATOM   4283  O  O     . GLN A 1 557 ? 41.823  154.584 56.679  1.00 17.22 ? 557  GLN A O     1 
ATOM   4284  C  CB    . GLN A 1 557 ? 40.927  151.563 56.885  1.00 17.40 ? 557  GLN A CB    1 
ATOM   4285  C  CG    . GLN A 1 557 ? 40.059  150.334 56.708  1.00 18.33 ? 557  GLN A CG    1 
ATOM   4286  C  CD    . GLN A 1 557 ? 40.867  149.053 56.775  1.00 18.96 ? 557  GLN A CD    1 
ATOM   4287  O  OE1   . GLN A 1 557 ? 41.778  148.844 55.980  1.00 19.96 ? 557  GLN A OE1   1 
ATOM   4288  N  NE2   . GLN A 1 557 ? 40.537  148.187 57.730  1.00 21.02 ? 557  GLN A NE2   1 
ATOM   4289  N  N     . ALA A 1 558 ? 41.216  154.130 58.807  1.00 16.99 ? 558  ALA A N     1 
ATOM   4290  C  CA    . ALA A 1 558 ? 42.156  155.053 59.427  1.00 17.44 ? 558  ALA A CA    1 
ATOM   4291  C  C     . ALA A 1 558 ? 43.148  154.132 60.127  1.00 16.61 ? 558  ALA A C     1 
ATOM   4292  O  O     . ALA A 1 558 ? 42.819  152.983 60.436  1.00 16.82 ? 558  ALA A O     1 
ATOM   4293  C  CB    . ALA A 1 558 ? 41.453  155.955 60.447  1.00 16.91 ? 558  ALA A CB    1 
ATOM   4294  N  N     . ILE A 1 559 ? 44.351  154.633 60.373  1.00 16.10 ? 559  ILE A N     1 
ATOM   4295  C  CA    . ILE A 1 559 ? 45.401  153.849 61.012  1.00 16.92 ? 559  ILE A CA    1 
ATOM   4296  C  C     . ILE A 1 559 ? 45.424  154.046 62.522  1.00 16.25 ? 559  ILE A C     1 
ATOM   4297  O  O     . ILE A 1 559 ? 45.602  155.158 63.009  1.00 16.93 ? 559  ILE A O     1 
ATOM   4298  C  CB    . ILE A 1 559 ? 46.776  154.228 60.425  1.00 16.91 ? 559  ILE A CB    1 
ATOM   4299  C  CG1   . ILE A 1 559 ? 46.783  153.939 58.921  1.00 18.34 ? 559  ILE A CG1   1 
ATOM   4300  C  CG2   . ILE A 1 559 ? 47.888  153.461 61.137  1.00 17.29 ? 559  ILE A CG2   1 
ATOM   4301  C  CD1   . ILE A 1 559 ? 47.999  154.481 58.194  1.00 18.52 ? 559  ILE A CD1   1 
ATOM   4302  N  N     . TYR A 1 560 ? 45.249  152.951 63.254  1.00 18.38 ? 560  TYR A N     1 
ATOM   4303  C  CA    . TYR A 1 560 ? 45.237  152.975 64.715  1.00 17.45 ? 560  TYR A CA    1 
ATOM   4304  C  C     . TYR A 1 560 ? 46.424  152.144 65.205  1.00 17.36 ? 560  TYR A C     1 
ATOM   4305  O  O     . TYR A 1 560 ? 46.493  150.939 64.957  1.00 15.25 ? 560  TYR A O     1 
ATOM   4306  C  CB    . TYR A 1 560 ? 43.915  152.378 65.209  1.00 18.17 ? 560  TYR A CB    1 
ATOM   4307  C  CG    . TYR A 1 560 ? 43.630  152.545 66.685  1.00 20.32 ? 560  TYR A CG    1 
ATOM   4308  C  CD1   . TYR A 1 560 ? 44.386  151.875 67.648  1.00 18.83 ? 560  TYR A CD1   1 
ATOM   4309  C  CD2   . TYR A 1 560 ? 42.572  153.351 67.116  1.00 20.71 ? 560  TYR A CD2   1 
ATOM   4310  C  CE1   . TYR A 1 560 ? 44.093  151.996 69.006  1.00 19.74 ? 560  TYR A CE1   1 
ATOM   4311  C  CE2   . TYR A 1 560 ? 42.272  153.482 68.469  1.00 21.55 ? 560  TYR A CE2   1 
ATOM   4312  C  CZ    . TYR A 1 560 ? 43.031  152.802 69.408  1.00 21.65 ? 560  TYR A CZ    1 
ATOM   4313  O  OH    . TYR A 1 560 ? 42.712  152.912 70.743  1.00 21.53 ? 560  TYR A OH    1 
ATOM   4314  N  N     . ALA A 1 561 ? 47.357  152.789 65.899  1.00 16.19 ? 561  ALA A N     1 
ATOM   4315  C  CA    . ALA A 1 561 ? 48.544  152.099 66.382  1.00 16.46 ? 561  ALA A CA    1 
ATOM   4316  C  C     . ALA A 1 561 ? 48.666  151.991 67.893  1.00 15.63 ? 561  ALA A C     1 
ATOM   4317  O  O     . ALA A 1 561 ? 48.651  152.998 68.603  1.00 15.96 ? 561  ALA A O     1 
ATOM   4318  C  CB    . ALA A 1 561 ? 49.806  152.777 65.815  1.00 15.27 ? 561  ALA A CB    1 
ATOM   4319  N  N     . TYR A 1 562 ? 48.776  150.755 68.374  1.00 15.58 ? 562  TYR A N     1 
ATOM   4320  C  CA    . TYR A 1 562 ? 48.973  150.499 69.794  1.00 16.36 ? 562  TYR A CA    1 
ATOM   4321  C  C     . TYR A 1 562 ? 50.489  150.495 69.931  1.00 17.23 ? 562  TYR A C     1 
ATOM   4322  O  O     . TYR A 1 562 ? 51.174  149.750 69.231  1.00 17.42 ? 562  TYR A O     1 
ATOM   4323  C  CB    . TYR A 1 562 ? 48.422  149.133 70.194  1.00 17.07 ? 562  TYR A CB    1 
ATOM   4324  C  CG    . TYR A 1 562 ? 46.919  149.012 70.128  1.00 18.25 ? 562  TYR A CG    1 
ATOM   4325  C  CD1   . TYR A 1 562 ? 46.269  148.731 68.924  1.00 17.63 ? 562  TYR A CD1   1 
ATOM   4326  C  CD2   . TYR A 1 562 ? 46.147  149.141 71.281  1.00 19.05 ? 562  TYR A CD2   1 
ATOM   4327  C  CE1   . TYR A 1 562 ? 44.884  148.572 68.876  1.00 18.12 ? 562  TYR A CE1   1 
ATOM   4328  C  CE2   . TYR A 1 562 ? 44.763  148.986 71.245  1.00 18.59 ? 562  TYR A CE2   1 
ATOM   4329  C  CZ    . TYR A 1 562 ? 44.140  148.698 70.045  1.00 19.34 ? 562  TYR A CZ    1 
ATOM   4330  O  OH    . TYR A 1 562 ? 42.780  148.514 70.027  1.00 19.85 ? 562  TYR A OH    1 
ATOM   4331  N  N     . VAL A 1 563 ? 51.015  151.318 70.829  1.00 15.86 ? 563  VAL A N     1 
ATOM   4332  C  CA    . VAL A 1 563 ? 52.457  151.428 70.981  1.00 17.07 ? 563  VAL A CA    1 
ATOM   4333  C  C     . VAL A 1 563 ? 52.970  151.239 72.400  1.00 18.03 ? 563  VAL A C     1 
ATOM   4334  O  O     . VAL A 1 563 ? 52.468  151.860 73.336  1.00 17.18 ? 563  VAL A O     1 
ATOM   4335  C  CB    . VAL A 1 563 ? 52.934  152.809 70.471  1.00 16.78 ? 563  VAL A CB    1 
ATOM   4336  C  CG1   . VAL A 1 563 ? 54.441  152.941 70.623  1.00 17.16 ? 563  VAL A CG1   1 
ATOM   4337  C  CG2   . VAL A 1 563 ? 52.523  152.991 69.017  1.00 16.85 ? 563  VAL A CG2   1 
ATOM   4338  N  N     . THR A 1 564 ? 53.977  150.378 72.547  1.00 18.63 ? 564  THR A N     1 
ATOM   4339  C  CA    . THR A 1 564 ? 54.595  150.133 73.845  1.00 18.15 ? 564  THR A CA    1 
ATOM   4340  C  C     . THR A 1 564 ? 55.970  150.796 73.848  1.00 18.90 ? 564  THR A C     1 
ATOM   4341  O  O     . THR A 1 564 ? 56.831  150.473 73.027  1.00 19.75 ? 564  THR A O     1 
ATOM   4342  C  CB    . THR A 1 564 ? 54.778  148.622 74.128  1.00 17.64 ? 564  THR A CB    1 
ATOM   4343  O  OG1   . THR A 1 564 ? 53.501  147.974 74.133  1.00 20.72 ? 564  THR A OG1   1 
ATOM   4344  C  CG2   . THR A 1 564 ? 55.450  148.414 75.489  1.00 19.82 ? 564  THR A CG2   1 
ATOM   4345  N  N     . LEU A 1 565 ? 56.169  151.732 74.768  1.00 19.42 ? 565  LEU A N     1 
ATOM   4346  C  CA    . LEU A 1 565 ? 57.441  152.432 74.876  1.00 20.60 ? 565  LEU A CA    1 
ATOM   4347  C  C     . LEU A 1 565 ? 58.394  151.665 75.782  1.00 22.08 ? 565  LEU A C     1 
ATOM   4348  O  O     . LEU A 1 565 ? 57.961  150.892 76.636  1.00 21.81 ? 565  LEU A O     1 
ATOM   4349  C  CB    . LEU A 1 565 ? 57.225  153.827 75.458  1.00 20.32 ? 565  LEU A CB    1 
ATOM   4350  C  CG    . LEU A 1 565 ? 56.350  154.769 74.630  1.00 21.02 ? 565  LEU A CG    1 
ATOM   4351  C  CD1   . LEU A 1 565 ? 56.004  156.000 75.453  1.00 21.31 ? 565  LEU A CD1   1 
ATOM   4352  C  CD2   . LEU A 1 565 ? 57.082  155.146 73.353  1.00 19.75 ? 565  LEU A CD2   1 
ATOM   4353  N  N     . ASN A 1 566 ? 59.692  151.876 75.591  1.00 22.83 ? 566  ASN A N     1 
ATOM   4354  C  CA    . ASN A 1 566 ? 60.695  151.221 76.427  1.00 25.19 ? 566  ASN A CA    1 
ATOM   4355  C  C     . ASN A 1 566 ? 60.614  151.843 77.820  1.00 27.11 ? 566  ASN A C     1 
ATOM   4356  O  O     . ASN A 1 566 ? 60.064  152.933 77.980  1.00 26.55 ? 566  ASN A O     1 
ATOM   4357  C  CB    . ASN A 1 566 ? 62.100  151.446 75.860  1.00 26.16 ? 566  ASN A CB    1 
ATOM   4358  C  CG    . ASN A 1 566 ? 62.312  150.756 74.529  1.00 26.65 ? 566  ASN A CG    1 
ATOM   4359  O  OD1   . ASN A 1 566 ? 61.985  149.582 74.368  1.00 29.05 ? 566  ASN A OD1   1 
ATOM   4360  N  ND2   . ASN A 1 566 ? 62.879  151.479 73.570  1.00 28.97 ? 566  ASN A ND2   1 
ATOM   4361  N  N     . HIS A 1 567 ? 61.151  151.157 78.826  1.00 28.51 ? 567  HIS A N     1 
ATOM   4362  C  CA    . HIS A 1 567 ? 61.132  151.690 80.186  1.00 30.86 ? 567  HIS A CA    1 
ATOM   4363  C  C     . HIS A 1 567 ? 61.930  152.980 80.237  1.00 32.46 ? 567  HIS A C     1 
ATOM   4364  O  O     . HIS A 1 567 ? 62.933  153.134 79.539  1.00 33.46 ? 567  HIS A O     1 
ATOM   4365  C  CB    . HIS A 1 567 ? 61.717  150.681 81.179  1.00 30.47 ? 567  HIS A CB    1 
ATOM   4366  C  CG    . HIS A 1 567 ? 60.821  149.513 81.451  1.00 31.57 ? 567  HIS A CG    1 
ATOM   4367  N  ND1   . HIS A 1 567 ? 61.155  148.511 82.337  1.00 32.80 ? 567  HIS A ND1   1 
ATOM   4368  C  CD2   . HIS A 1 567 ? 59.606  149.184 80.953  1.00 32.56 ? 567  HIS A CD2   1 
ATOM   4369  C  CE1   . HIS A 1 567 ? 60.184  147.615 82.372  1.00 33.18 ? 567  HIS A CE1   1 
ATOM   4370  N  NE2   . HIS A 1 567 ? 59.232  148.000 81.541  1.00 33.58 ? 567  HIS A NE2   1 
ATOM   4371  N  N     . GLY A 1 568 ? 61.474  153.915 81.061  1.00 34.36 ? 568  GLY A N     1 
ATOM   4372  C  CA    . GLY A 1 568 ? 62.167  155.182 81.172  1.00 35.63 ? 568  GLY A CA    1 
ATOM   4373  C  C     . GLY A 1 568 ? 61.546  156.240 80.283  1.00 35.84 ? 568  GLY A C     1 
ATOM   4374  O  O     . GLY A 1 568 ? 61.800  157.434 80.459  1.00 36.39 ? 568  GLY A O     1 
ATOM   4375  N  N     . GLU A 1 569 ? 60.733  155.799 79.326  1.00 35.18 ? 569  GLU A N     1 
ATOM   4376  C  CA    . GLU A 1 569 ? 60.061  156.711 78.407  1.00 35.67 ? 569  GLU A CA    1 
ATOM   4377  C  C     . GLU A 1 569 ? 58.614  156.926 78.850  1.00 35.36 ? 569  GLU A C     1 
ATOM   4378  O  O     . GLU A 1 569 ? 57.977  156.022 79.396  1.00 36.62 ? 569  GLU A O     1 
ATOM   4379  C  CB    . GLU A 1 569 ? 60.076  156.145 76.985  1.00 35.68 ? 569  GLU A CB    1 
ATOM   4380  C  CG    . GLU A 1 569 ? 61.440  155.692 76.483  1.00 37.06 ? 569  GLU A CG    1 
ATOM   4381  C  CD    . GLU A 1 569 ? 62.522  156.737 76.675  1.00 38.42 ? 569  GLU A CD    1 
ATOM   4382  O  OE1   . GLU A 1 569 ? 62.237  157.938 76.485  1.00 39.84 ? 569  GLU A OE1   1 
ATOM   4383  O  OE2   . GLU A 1 569 ? 63.664  156.355 77.004  1.00 38.29 ? 569  GLU A OE2   1 
ATOM   4384  N  N     . GLU A 1 570 ? 58.096  158.124 78.608  1.00 33.54 ? 570  GLU A N     1 
ATOM   4385  C  CA    . GLU A 1 570 ? 56.729  158.444 78.984  1.00 32.74 ? 570  GLU A CA    1 
ATOM   4386  C  C     . GLU A 1 570 ? 56.074  159.260 77.880  1.00 31.05 ? 570  GLU A C     1 
ATOM   4387  O  O     . GLU A 1 570 ? 56.740  160.019 77.176  1.00 32.09 ? 570  GLU A O     1 
ATOM   4388  C  CB    . GLU A 1 570 ? 56.715  159.227 80.293  1.00 33.73 ? 570  GLU A CB    1 
ATOM   4389  N  N     . PRO A 1 571 ? 54.758  159.096 77.702  1.00 29.12 ? 571  PRO A N     1 
ATOM   4390  C  CA    . PRO A 1 571 ? 54.012  159.828 76.677  1.00 27.55 ? 571  PRO A CA    1 
ATOM   4391  C  C     . PRO A 1 571 ? 54.009  161.327 76.961  1.00 25.72 ? 571  PRO A C     1 
ATOM   4392  O  O     . PRO A 1 571 ? 54.042  161.751 78.115  1.00 25.43 ? 571  PRO A O     1 
ATOM   4393  C  CB    . PRO A 1 571 ? 52.612  159.230 76.780  1.00 27.54 ? 571  PRO A CB    1 
ATOM   4394  C  CG    . PRO A 1 571 ? 52.875  157.834 77.251  1.00 28.80 ? 571  PRO A CG    1 
ATOM   4395  C  CD    . PRO A 1 571 ? 53.916  158.053 78.312  1.00 28.39 ? 571  PRO A CD    1 
ATOM   4396  N  N     . SER A 1 572 ? 53.971  162.119 75.896  1.00 23.72 ? 572  SER A N     1 
ATOM   4397  C  CA    . SER A 1 572 ? 53.937  163.570 76.002  1.00 20.64 ? 572  SER A CA    1 
ATOM   4398  C  C     . SER A 1 572 ? 53.570  164.112 74.632  1.00 19.90 ? 572  SER A C     1 
ATOM   4399  O  O     . SER A 1 572 ? 53.657  163.396 73.629  1.00 17.68 ? 572  SER A O     1 
ATOM   4400  C  CB    . SER A 1 572 ? 55.302  164.125 76.422  1.00 20.47 ? 572  SER A CB    1 
ATOM   4401  O  OG    . SER A 1 572 ? 56.263  163.983 75.391  1.00 18.17 ? 572  SER A OG    1 
ATOM   4402  N  N     . PRO A 1 573 ? 53.129  165.376 74.569  1.00 18.37 ? 573  PRO A N     1 
ATOM   4403  C  CA    . PRO A 1 573 ? 52.774  165.933 73.263  1.00 16.93 ? 573  PRO A CA    1 
ATOM   4404  C  C     . PRO A 1 573 ? 53.950  165.824 72.287  1.00 15.41 ? 573  PRO A C     1 
ATOM   4405  O  O     . PRO A 1 573 ? 53.757  165.535 71.111  1.00 15.50 ? 573  PRO A O     1 
ATOM   4406  C  CB    . PRO A 1 573 ? 52.414  167.375 73.598  1.00 18.35 ? 573  PRO A CB    1 
ATOM   4407  C  CG    . PRO A 1 573 ? 51.780  167.234 74.962  1.00 17.98 ? 573  PRO A CG    1 
ATOM   4408  C  CD    . PRO A 1 573 ? 52.733  166.286 75.662  1.00 18.90 ? 573  PRO A CD    1 
ATOM   4409  N  N     . GLU A 1 574 ? 55.164  166.045 72.786  1.00 14.80 ? 574  GLU A N     1 
ATOM   4410  C  CA    . GLU A 1 574 ? 56.355  165.973 71.944  1.00 14.35 ? 574  GLU A CA    1 
ATOM   4411  C  C     . GLU A 1 574 ? 56.565  164.575 71.365  1.00 15.61 ? 574  GLU A C     1 
ATOM   4412  O  O     . GLU A 1 574 ? 56.814  164.421 70.166  1.00 12.84 ? 574  GLU A O     1 
ATOM   4413  C  CB    . GLU A 1 574 ? 57.596  166.395 72.745  1.00 15.64 ? 574  GLU A CB    1 
ATOM   4414  C  CG    . GLU A 1 574 ? 58.897  166.502 71.938  1.00 16.94 ? 574  GLU A CG    1 
ATOM   4415  C  CD    . GLU A 1 574 ? 59.506  165.154 71.584  1.00 18.64 ? 574  GLU A CD    1 
ATOM   4416  O  OE1   . GLU A 1 574 ? 59.418  164.227 72.416  1.00 18.63 ? 574  GLU A OE1   1 
ATOM   4417  O  OE2   . GLU A 1 574 ? 60.093  165.023 70.484  1.00 19.23 ? 574  GLU A OE2   1 
ATOM   4418  N  N     . LEU A 1 575 ? 56.460  163.557 72.214  1.00 14.80 ? 575  LEU A N     1 
ATOM   4419  C  CA    . LEU A 1 575 ? 56.663  162.184 71.760  1.00 16.45 ? 575  LEU A CA    1 
ATOM   4420  C  C     . LEU A 1 575 ? 55.558  161.737 70.807  1.00 15.24 ? 575  LEU A C     1 
ATOM   4421  O  O     . LEU A 1 575 ? 55.802  160.975 69.872  1.00 15.99 ? 575  LEU A O     1 
ATOM   4422  C  CB    . LEU A 1 575 ? 56.737  161.233 72.955  1.00 16.84 ? 575  LEU A CB    1 
ATOM   4423  C  CG    . LEU A 1 575 ? 57.148  159.804 72.591  1.00 19.64 ? 575  LEU A CG    1 
ATOM   4424  C  CD1   . LEU A 1 575 ? 58.508  159.833 71.903  1.00 17.28 ? 575  LEU A CD1   1 
ATOM   4425  C  CD2   . LEU A 1 575 ? 57.189  158.940 73.843  1.00 21.32 ? 575  LEU A CD2   1 
ATOM   4426  N  N     . TYR A 1 576 ? 54.343  162.217 71.046  1.00 14.82 ? 576  TYR A N     1 
ATOM   4427  C  CA    . TYR A 1 576 ? 53.210  161.882 70.193  1.00 16.14 ? 576  TYR A CA    1 
ATOM   4428  C  C     . TYR A 1 576 ? 53.530  162.380 68.781  1.00 16.59 ? 576  TYR A C     1 
ATOM   4429  O  O     . TYR A 1 576 ? 53.369  161.652 67.795  1.00 17.00 ? 576  TYR A O     1 
ATOM   4430  C  CB    . TYR A 1 576 ? 51.942  162.581 70.700  1.00 17.66 ? 576  TYR A CB    1 
ATOM   4431  C  CG    . TYR A 1 576 ? 50.657  162.017 70.134  1.00 20.20 ? 576  TYR A CG    1 
ATOM   4432  C  CD1   . TYR A 1 576 ? 50.001  160.963 70.768  1.00 20.95 ? 576  TYR A CD1   1 
ATOM   4433  C  CD2   . TYR A 1 576 ? 50.110  162.517 68.953  1.00 22.10 ? 576  TYR A CD2   1 
ATOM   4434  C  CE1   . TYR A 1 576 ? 48.836  160.420 70.245  1.00 22.93 ? 576  TYR A CE1   1 
ATOM   4435  C  CE2   . TYR A 1 576 ? 48.941  161.976 68.415  1.00 23.78 ? 576  TYR A CE2   1 
ATOM   4436  C  CZ    . TYR A 1 576 ? 48.312  160.928 69.070  1.00 24.18 ? 576  TYR A CZ    1 
ATOM   4437  O  OH    . TYR A 1 576 ? 47.161  160.381 68.556  1.00 27.17 ? 576  TYR A OH    1 
ATOM   4438  N  N     . ALA A 1 577 ? 53.990  163.626 68.700  1.00 14.45 ? 577  ALA A N     1 
ATOM   4439  C  CA    . ALA A 1 577 ? 54.329  164.242 67.422  1.00 14.92 ? 577  ALA A CA    1 
ATOM   4440  C  C     . ALA A 1 577 ? 55.539  163.568 66.784  1.00 15.11 ? 577  ALA A C     1 
ATOM   4441  O  O     . ALA A 1 577 ? 55.563  163.318 65.577  1.00 14.74 ? 577  ALA A O     1 
ATOM   4442  C  CB    . ALA A 1 577 ? 54.603  165.740 67.624  1.00 13.89 ? 577  ALA A CB    1 
ATOM   4443  N  N     . GLU A 1 578 ? 56.542  163.270 67.600  1.00 14.77 ? 578  GLU A N     1 
ATOM   4444  C  CA    . GLU A 1 578 ? 57.756  162.630 67.106  1.00 15.21 ? 578  GLU A CA    1 
ATOM   4445  C  C     . GLU A 1 578 ? 57.462  161.256 66.509  1.00 15.35 ? 578  GLU A C     1 
ATOM   4446  O  O     . GLU A 1 578 ? 57.989  160.904 65.456  1.00 15.96 ? 578  GLU A O     1 
ATOM   4447  C  CB    . GLU A 1 578 ? 58.780  162.482 68.232  1.00 13.76 ? 578  GLU A CB    1 
ATOM   4448  C  CG    . GLU A 1 578 ? 60.183  162.131 67.734  1.00 14.81 ? 578  GLU A CG    1 
ATOM   4449  C  CD    . GLU A 1 578 ? 61.172  161.938 68.868  1.00 18.15 ? 578  GLU A CD    1 
ATOM   4450  O  OE1   . GLU A 1 578 ? 61.205  162.791 69.781  1.00 17.76 ? 578  GLU A OE1   1 
ATOM   4451  O  OE2   . GLU A 1 578 ? 61.919  160.937 68.843  1.00 18.26 ? 578  GLU A OE2   1 
ATOM   4452  N  N     . VAL A 1 579 ? 56.619  160.483 67.183  1.00 15.15 ? 579  VAL A N     1 
ATOM   4453  C  CA    . VAL A 1 579 ? 56.276  159.146 66.705  1.00 14.81 ? 579  VAL A CA    1 
ATOM   4454  C  C     . VAL A 1 579 ? 55.469  159.193 65.412  1.00 15.68 ? 579  VAL A C     1 
ATOM   4455  O  O     . VAL A 1 579 ? 55.705  158.396 64.502  1.00 14.63 ? 579  VAL A O     1 
ATOM   4456  C  CB    . VAL A 1 579 ? 55.501  158.349 67.783  1.00 14.07 ? 579  VAL A CB    1 
ATOM   4457  C  CG1   . VAL A 1 579 ? 54.964  157.038 67.198  1.00 13.81 ? 579  VAL A CG1   1 
ATOM   4458  C  CG2   . VAL A 1 579 ? 56.432  158.045 68.954  1.00 15.24 ? 579  VAL A CG2   1 
ATOM   4459  N  N     . ARG A 1 580 ? 54.520  160.119 65.318  1.00 15.68 ? 580  ARG A N     1 
ATOM   4460  C  CA    . ARG A 1 580 ? 53.736  160.233 64.095  1.00 16.23 ? 580  ARG A CA    1 
ATOM   4461  C  C     . ARG A 1 580 ? 54.660  160.652 62.954  1.00 16.12 ? 580  ARG A C     1 
ATOM   4462  O  O     . ARG A 1 580 ? 54.569  160.117 61.851  1.00 17.14 ? 580  ARG A O     1 
ATOM   4463  C  CB    . ARG A 1 580 ? 52.614  161.266 64.242  1.00 18.87 ? 580  ARG A CB    1 
ATOM   4464  C  CG    . ARG A 1 580 ? 51.527  160.895 65.230  1.00 23.08 ? 580  ARG A CG    1 
ATOM   4465  C  CD    . ARG A 1 580 ? 50.165  161.252 64.666  1.00 26.27 ? 580  ARG A CD    1 
ATOM   4466  N  NE    . ARG A 1 580 ? 50.149  162.593 64.091  1.00 30.48 ? 580  ARG A NE    1 
ATOM   4467  C  CZ    . ARG A 1 580 ? 49.390  162.943 63.060  1.00 30.47 ? 580  ARG A CZ    1 
ATOM   4468  N  NH1   . ARG A 1 580 ? 48.592  162.048 62.496  1.00 32.42 ? 580  ARG A NH1   1 
ATOM   4469  N  NH2   . ARG A 1 580 ? 49.435  164.178 62.586  1.00 33.02 ? 580  ARG A NH2   1 
ATOM   4470  N  N     . ASN A 1 581 ? 55.553  161.603 63.216  1.00 15.78 ? 581  ASN A N     1 
ATOM   4471  C  CA    . ASN A 1 581 ? 56.479  162.062 62.183  1.00 16.45 ? 581  ASN A CA    1 
ATOM   4472  C  C     . ASN A 1 581 ? 57.517  161.009 61.841  1.00 16.24 ? 581  ASN A C     1 
ATOM   4473  O  O     . ASN A 1 581 ? 58.068  161.006 60.738  1.00 14.41 ? 581  ASN A O     1 
ATOM   4474  C  CB    . ASN A 1 581 ? 57.187  163.349 62.604  1.00 17.89 ? 581  ASN A CB    1 
ATOM   4475  C  CG    . ASN A 1 581 ? 56.294  164.555 62.487  1.00 22.23 ? 581  ASN A CG    1 
ATOM   4476  O  OD1   . ASN A 1 581 ? 55.293  164.520 61.772  1.00 24.13 ? 581  ASN A OD1   1 
ATOM   4477  N  ND2   . ASN A 1 581 ? 56.650  165.635 63.174  1.00 23.34 ? 581  ASN A ND2   1 
ATOM   4478  N  N     . TRP A 1 582 ? 57.790  160.123 62.791  1.00 15.39 ? 582  TRP A N     1 
ATOM   4479  C  CA    . TRP A 1 582 ? 58.749  159.055 62.565  1.00 14.91 ? 582  TRP A CA    1 
ATOM   4480  C  C     . TRP A 1 582 ? 58.207  158.128 61.475  1.00 15.75 ? 582  TRP A C     1 
ATOM   4481  O  O     . TRP A 1 582 ? 58.946  157.711 60.580  1.00 15.76 ? 582  TRP A O     1 
ATOM   4482  C  CB    . TRP A 1 582 ? 58.987  158.274 63.858  1.00 14.39 ? 582  TRP A CB    1 
ATOM   4483  C  CG    . TRP A 1 582 ? 59.921  157.123 63.689  1.00 14.63 ? 582  TRP A CG    1 
ATOM   4484  C  CD1   . TRP A 1 582 ? 59.583  155.815 63.500  1.00 15.02 ? 582  TRP A CD1   1 
ATOM   4485  C  CD2   . TRP A 1 582 ? 61.351  157.180 63.656  1.00 14.83 ? 582  TRP A CD2   1 
ATOM   4486  N  NE1   . TRP A 1 582 ? 60.715  155.052 63.353  1.00 15.53 ? 582  TRP A NE1   1 
ATOM   4487  C  CE2   . TRP A 1 582 ? 61.816  155.863 63.444  1.00 15.96 ? 582  TRP A CE2   1 
ATOM   4488  C  CE3   . TRP A 1 582 ? 62.286  158.217 63.784  1.00 17.03 ? 582  TRP A CE3   1 
ATOM   4489  C  CZ2   . TRP A 1 582 ? 63.179  155.549 63.356  1.00 16.58 ? 582  TRP A CZ2   1 
ATOM   4490  C  CZ3   . TRP A 1 582 ? 63.647  157.908 63.697  1.00 20.14 ? 582  TRP A CZ3   1 
ATOM   4491  C  CH2   . TRP A 1 582 ? 64.077  156.580 63.484  1.00 18.55 ? 582  TRP A CH2   1 
ATOM   4492  N  N     . VAL A 1 583 ? 56.920  157.803 61.544  1.00 14.57 ? 583  VAL A N     1 
ATOM   4493  C  CA    . VAL A 1 583 ? 56.338  156.937 60.522  1.00 15.57 ? 583  VAL A CA    1 
ATOM   4494  C  C     . VAL A 1 583 ? 56.317  157.670 59.187  1.00 15.35 ? 583  VAL A C     1 
ATOM   4495  O  O     . VAL A 1 583 ? 56.538  157.068 58.135  1.00 15.54 ? 583  VAL A O     1 
ATOM   4496  C  CB    . VAL A 1 583 ? 54.903  156.501 60.882  1.00 16.58 ? 583  VAL A CB    1 
ATOM   4497  C  CG1   . VAL A 1 583 ? 54.293  155.706 59.723  1.00 16.40 ? 583  VAL A CG1   1 
ATOM   4498  C  CG2   . VAL A 1 583 ? 54.923  155.647 62.146  1.00 17.69 ? 583  VAL A CG2   1 
ATOM   4499  N  N     . ARG A 1 584 ? 56.053  158.971 59.230  1.00 14.41 ? 584  ARG A N     1 
ATOM   4500  C  CA    . ARG A 1 584 ? 56.025  159.770 58.011  1.00 17.49 ? 584  ARG A CA    1 
ATOM   4501  C  C     . ARG A 1 584 ? 57.409  159.741 57.359  1.00 17.79 ? 584  ARG A C     1 
ATOM   4502  O  O     . ARG A 1 584 ? 57.531  159.724 56.135  1.00 18.12 ? 584  ARG A O     1 
ATOM   4503  C  CB    . ARG A 1 584 ? 55.633  161.214 58.335  1.00 16.99 ? 584  ARG A CB    1 
ATOM   4504  C  CG    . ARG A 1 584 ? 55.419  162.101 57.114  1.00 21.68 ? 584  ARG A CG    1 
ATOM   4505  C  CD    . ARG A 1 584 ? 55.007  163.513 57.530  1.00 24.94 ? 584  ARG A CD    1 
ATOM   4506  N  NE    . ARG A 1 584 ? 54.491  164.297 56.407  1.00 29.81 ? 584  ARG A NE    1 
ATOM   4507  C  CZ    . ARG A 1 584 ? 55.197  164.625 55.326  1.00 30.48 ? 584  ARG A CZ    1 
ATOM   4508  N  NH1   . ARG A 1 584 ? 56.464  164.240 55.211  1.00 31.00 ? 584  ARG A NH1   1 
ATOM   4509  N  NH2   . ARG A 1 584 ? 54.632  165.337 54.355  1.00 30.38 ? 584  ARG A NH2   1 
ATOM   4510  N  N     . LYS A 1 585 ? 58.448  159.727 58.189  1.00 16.92 ? 585  LYS A N     1 
ATOM   4511  C  CA    . LYS A 1 585 ? 59.822  159.704 57.708  1.00 19.29 ? 585  LYS A CA    1 
ATOM   4512  C  C     . LYS A 1 585 ? 60.239  158.318 57.220  1.00 17.92 ? 585  LYS A C     1 
ATOM   4513  O  O     . LYS A 1 585 ? 60.961  158.189 56.234  1.00 15.72 ? 585  LYS A O     1 
ATOM   4514  C  CB    . LYS A 1 585 ? 60.762  160.192 58.822  1.00 22.49 ? 585  LYS A CB    1 
ATOM   4515  C  CG    . LYS A 1 585 ? 62.250  160.006 58.556  1.00 29.11 ? 585  LYS A CG    1 
ATOM   4516  C  CD    . LYS A 1 585 ? 62.766  158.705 59.165  1.00 35.63 ? 585  LYS A CD    1 
ATOM   4517  C  CE    . LYS A 1 585 ? 64.271  158.560 58.978  1.00 38.48 ? 585  LYS A CE    1 
ATOM   4518  N  NZ    . LYS A 1 585 ? 64.777  157.256 59.496  1.00 39.65 ? 585  LYS A NZ    1 
ATOM   4519  N  N     . GLU A 1 586 ? 59.768  157.281 57.903  1.00 16.14 ? 586  GLU A N     1 
ATOM   4520  C  CA    . GLU A 1 586 ? 60.109  155.911 57.539  1.00 17.34 ? 586  GLU A CA    1 
ATOM   4521  C  C     . GLU A 1 586 ? 59.409  155.402 56.281  1.00 16.47 ? 586  GLU A C     1 
ATOM   4522  O  O     . GLU A 1 586 ? 60.004  154.682 55.484  1.00 16.78 ? 586  GLU A O     1 
ATOM   4523  C  CB    . GLU A 1 586 ? 59.789  154.973 58.710  1.00 18.63 ? 586  GLU A CB    1 
ATOM   4524  C  CG    . GLU A 1 586 ? 60.699  155.156 59.911  1.00 21.47 ? 586  GLU A CG    1 
ATOM   4525  C  CD    . GLU A 1 586 ? 62.045  154.489 59.720  1.00 26.71 ? 586  GLU A CD    1 
ATOM   4526  O  OE1   . GLU A 1 586 ? 62.176  153.303 60.083  1.00 32.27 ? 586  GLU A OE1   1 
ATOM   4527  O  OE2   . GLU A 1 586 ? 62.969  155.141 59.192  1.00 29.76 ? 586  GLU A OE2   1 
ATOM   4528  N  N     . ILE A 1 587 ? 58.147  155.778 56.101  1.00 15.75 ? 587  ILE A N     1 
ATOM   4529  C  CA    . ILE A 1 587 ? 57.374  155.306 54.956  1.00 15.88 ? 587  ILE A CA    1 
ATOM   4530  C  C     . ILE A 1 587 ? 56.843  156.418 54.064  1.00 15.70 ? 587  ILE A C     1 
ATOM   4531  O  O     . ILE A 1 587 ? 57.025  156.392 52.845  1.00 16.44 ? 587  ILE A O     1 
ATOM   4532  C  CB    . ILE A 1 587 ? 56.178  154.452 55.439  1.00 16.23 ? 587  ILE A CB    1 
ATOM   4533  C  CG1   . ILE A 1 587 ? 56.700  153.252 56.237  1.00 15.88 ? 587  ILE A CG1   1 
ATOM   4534  C  CG2   . ILE A 1 587 ? 55.316  154.015 54.242  1.00 14.20 ? 587  ILE A CG2   1 
ATOM   4535  C  CD1   . ILE A 1 587 ? 55.605  152.384 56.849  1.00 16.67 ? 587  ILE A CD1   1 
ATOM   4536  N  N     . GLY A 1 588 ? 56.181  157.388 54.682  1.00 15.14 ? 588  GLY A N     1 
ATOM   4537  C  CA    . GLY A 1 588 ? 55.604  158.498 53.947  1.00 14.20 ? 588  GLY A CA    1 
ATOM   4538  C  C     . GLY A 1 588 ? 54.339  158.933 54.666  1.00 15.25 ? 588  GLY A C     1 
ATOM   4539  O  O     . GLY A 1 588 ? 53.844  158.202 55.519  1.00 14.17 ? 588  GLY A O     1 
ATOM   4540  N  N     . PRO A 1 589 ? 53.790  160.115 54.349  1.00 15.83 ? 589  PRO A N     1 
ATOM   4541  C  CA    . PRO A 1 589 ? 52.573  160.621 54.993  1.00 16.83 ? 589  PRO A CA    1 
ATOM   4542  C  C     . PRO A 1 589 ? 51.322  159.747 54.896  1.00 18.05 ? 589  PRO A C     1 
ATOM   4543  O  O     . PRO A 1 589 ? 50.455  159.810 55.771  1.00 17.19 ? 589  PRO A O     1 
ATOM   4544  C  CB    . PRO A 1 589 ? 52.391  162.002 54.357  1.00 17.67 ? 589  PRO A CB    1 
ATOM   4545  C  CG    . PRO A 1 589 ? 53.095  161.882 53.037  1.00 19.51 ? 589  PRO A CG    1 
ATOM   4546  C  CD    . PRO A 1 589 ? 54.327  161.099 53.396  1.00 16.28 ? 589  PRO A CD    1 
ATOM   4547  N  N     . LEU A 1 590 ? 51.222  158.924 53.855  1.00 17.05 ? 590  LEU A N     1 
ATOM   4548  C  CA    . LEU A 1 590 ? 50.056  158.052 53.713  1.00 19.36 ? 590  LEU A CA    1 
ATOM   4549  C  C     . LEU A 1 590 ? 49.955  157.008 54.827  1.00 19.20 ? 590  LEU A C     1 
ATOM   4550  O  O     . LEU A 1 590 ? 48.877  156.472 55.081  1.00 17.76 ? 590  LEU A O     1 
ATOM   4551  C  CB    . LEU A 1 590 ? 50.081  157.322 52.371  1.00 21.32 ? 590  LEU A CB    1 
ATOM   4552  C  CG    . LEU A 1 590 ? 49.873  158.131 51.091  1.00 26.07 ? 590  LEU A CG    1 
ATOM   4553  C  CD1   . LEU A 1 590 ? 49.910  157.183 49.900  1.00 25.88 ? 590  LEU A CD1   1 
ATOM   4554  C  CD2   . LEU A 1 590 ? 48.544  158.871 51.144  1.00 25.63 ? 590  LEU A CD2   1 
ATOM   4555  N  N     . ALA A 1 591 ? 51.072  156.716 55.487  1.00 17.83 ? 591  ALA A N     1 
ATOM   4556  C  CA    . ALA A 1 591 ? 51.070  155.712 56.547  1.00 17.97 ? 591  ALA A CA    1 
ATOM   4557  C  C     . ALA A 1 591 ? 51.063  156.297 57.946  1.00 18.27 ? 591  ALA A C     1 
ATOM   4558  O  O     . ALA A 1 591 ? 51.169  155.563 58.926  1.00 18.29 ? 591  ALA A O     1 
ATOM   4559  C  CB    . ALA A 1 591 ? 52.275  154.780 56.389  1.00 18.48 ? 591  ALA A CB    1 
ATOM   4560  N  N     . THR A 1 592 ? 50.942  157.614 58.050  1.00 18.07 ? 592  THR A N     1 
ATOM   4561  C  CA    . THR A 1 592 ? 50.947  158.241 59.361  1.00 20.93 ? 592  THR A CA    1 
ATOM   4562  C  C     . THR A 1 592 ? 49.763  157.767 60.197  1.00 19.48 ? 592  THR A C     1 
ATOM   4563  O  O     . THR A 1 592 ? 48.615  157.839 59.762  1.00 18.37 ? 592  THR A O     1 
ATOM   4564  C  CB    . THR A 1 592 ? 50.885  159.770 59.254  1.00 23.34 ? 592  THR A CB    1 
ATOM   4565  O  OG1   . THR A 1 592 ? 51.901  160.230 58.353  1.00 26.27 ? 592  THR A OG1   1 
ATOM   4566  C  CG2   . THR A 1 592 ? 51.115  160.396 60.623  1.00 24.13 ? 592  THR A CG2   1 
ATOM   4567  N  N     . PRO A 1 593 ? 50.033  157.259 61.406  1.00 19.46 ? 593  PRO A N     1 
ATOM   4568  C  CA    . PRO A 1 593 ? 48.942  156.791 62.263  1.00 19.39 ? 593  PRO A CA    1 
ATOM   4569  C  C     . PRO A 1 593 ? 48.025  157.949 62.612  1.00 20.55 ? 593  PRO A C     1 
ATOM   4570  O  O     . PRO A 1 593 ? 48.491  159.052 62.902  1.00 19.97 ? 593  PRO A O     1 
ATOM   4571  C  CB    . PRO A 1 593 ? 49.672  156.253 63.492  1.00 18.47 ? 593  PRO A CB    1 
ATOM   4572  C  CG    . PRO A 1 593 ? 50.965  155.762 62.914  1.00 19.91 ? 593  PRO A CG    1 
ATOM   4573  C  CD    . PRO A 1 593 ? 51.338  156.892 61.980  1.00 18.93 ? 593  PRO A CD    1 
ATOM   4574  N  N     . ASP A 1 594 ? 46.723  157.698 62.574  1.00 20.78 ? 594  ASP A N     1 
ATOM   4575  C  CA    . ASP A 1 594 ? 45.738  158.717 62.906  1.00 21.57 ? 594  ASP A CA    1 
ATOM   4576  C  C     . ASP A 1 594 ? 45.538  158.720 64.416  1.00 20.99 ? 594  ASP A C     1 
ATOM   4577  O  O     . ASP A 1 594 ? 45.145  159.728 65.005  1.00 22.89 ? 594  ASP A O     1 
ATOM   4578  C  CB    . ASP A 1 594 ? 44.424  158.409 62.191  1.00 22.57 ? 594  ASP A CB    1 
ATOM   4579  C  CG    . ASP A 1 594 ? 44.572  158.436 60.685  1.00 26.21 ? 594  ASP A CG    1 
ATOM   4580  O  OD1   . ASP A 1 594 ? 44.738  159.543 60.132  1.00 26.13 ? 594  ASP A OD1   1 
ATOM   4581  O  OD2   . ASP A 1 594 ? 44.541  157.353 60.054  1.00 26.84 ? 594  ASP A OD2   1 
ATOM   4582  N  N     . VAL A 1 595 ? 45.830  157.583 65.037  1.00 19.19 ? 595  VAL A N     1 
ATOM   4583  C  CA    . VAL A 1 595 ? 45.698  157.432 66.479  1.00 18.87 ? 595  VAL A CA    1 
ATOM   4584  C  C     . VAL A 1 595 ? 46.874  156.649 67.062  1.00 18.68 ? 595  VAL A C     1 
ATOM   4585  O  O     . VAL A 1 595 ? 47.287  155.631 66.504  1.00 16.20 ? 595  VAL A O     1 
ATOM   4586  C  CB    . VAL A 1 595 ? 44.399  156.665 66.851  1.00 20.38 ? 595  VAL A CB    1 
ATOM   4587  C  CG1   . VAL A 1 595 ? 44.320  156.470 68.360  1.00 22.19 ? 595  VAL A CG1   1 
ATOM   4588  C  CG2   . VAL A 1 595 ? 43.180  157.415 66.348  1.00 22.61 ? 595  VAL A CG2   1 
ATOM   4589  N  N     . LEU A 1 596 ? 47.421  157.140 68.172  1.00 16.59 ? 596  LEU A N     1 
ATOM   4590  C  CA    . LEU A 1 596 ? 48.499  156.448 68.868  1.00 16.92 ? 596  LEU A CA    1 
ATOM   4591  C  C     . LEU A 1 596 ? 47.952  156.106 70.251  1.00 19.21 ? 596  LEU A C     1 
ATOM   4592  O  O     . LEU A 1 596 ? 47.601  156.998 71.030  1.00 19.03 ? 596  LEU A O     1 
ATOM   4593  C  CB    . LEU A 1 596 ? 49.742  157.330 69.010  1.00 16.96 ? 596  LEU A CB    1 
ATOM   4594  C  CG    . LEU A 1 596 ? 50.478  157.688 67.720  1.00 16.18 ? 596  LEU A CG    1 
ATOM   4595  C  CD1   . LEU A 1 596 ? 51.671  158.579 68.048  1.00 16.05 ? 596  LEU A CD1   1 
ATOM   4596  C  CD2   . LEU A 1 596 ? 50.933  156.419 67.012  1.00 16.31 ? 596  LEU A CD2   1 
ATOM   4597  N  N     . HIS A 1 597 ? 47.853  154.813 70.536  1.00 17.22 ? 597  HIS A N     1 
ATOM   4598  C  CA    . HIS A 1 597 ? 47.348  154.335 71.817  1.00 17.87 ? 597  HIS A CA    1 
ATOM   4599  C  C     . HIS A 1 597 ? 48.532  153.738 72.570  1.00 16.45 ? 597  HIS A C     1 
ATOM   4600  O  O     . HIS A 1 597 ? 49.013  152.658 72.226  1.00 16.92 ? 597  HIS A O     1 
ATOM   4601  C  CB    . HIS A 1 597 ? 46.250  153.290 71.557  1.00 18.90 ? 597  HIS A CB    1 
ATOM   4602  C  CG    . HIS A 1 597 ? 45.740  152.598 72.786  1.00 19.87 ? 597  HIS A CG    1 
ATOM   4603  N  ND1   . HIS A 1 597 ? 44.483  152.037 72.846  1.00 22.54 ? 597  HIS A ND1   1 
ATOM   4604  C  CD2   . HIS A 1 597 ? 46.334  152.311 73.969  1.00 21.06 ? 597  HIS A CD2   1 
ATOM   4605  C  CE1   . HIS A 1 597 ? 44.325  151.432 74.009  1.00 22.23 ? 597  HIS A CE1   1 
ATOM   4606  N  NE2   . HIS A 1 597 ? 45.434  151.583 74.709  1.00 22.51 ? 597  HIS A NE2   1 
ATOM   4607  N  N     . TRP A 1 598 ? 49.014  154.462 73.579  1.00 17.55 ? 598  TRP A N     1 
ATOM   4608  C  CA    . TRP A 1 598 ? 50.151  154.008 74.375  1.00 16.84 ? 598  TRP A CA    1 
ATOM   4609  C  C     . TRP A 1 598 ? 49.688  152.917 75.324  1.00 18.45 ? 598  TRP A C     1 
ATOM   4610  O  O     . TRP A 1 598 ? 48.695  153.085 76.025  1.00 17.71 ? 598  TRP A O     1 
ATOM   4611  C  CB    . TRP A 1 598 ? 50.740  155.156 75.199  1.00 18.42 ? 598  TRP A CB    1 
ATOM   4612  C  CG    . TRP A 1 598 ? 50.939  156.433 74.442  1.00 19.34 ? 598  TRP A CG    1 
ATOM   4613  C  CD1   . TRP A 1 598 ? 50.192  157.570 74.551  1.00 19.03 ? 598  TRP A CD1   1 
ATOM   4614  C  CD2   . TRP A 1 598 ? 51.964  156.715 73.479  1.00 19.93 ? 598  TRP A CD2   1 
ATOM   4615  N  NE1   . TRP A 1 598 ? 50.691  158.545 73.721  1.00 21.52 ? 598  TRP A NE1   1 
ATOM   4616  C  CE2   . TRP A 1 598 ? 51.778  158.048 73.051  1.00 20.98 ? 598  TRP A CE2   1 
ATOM   4617  C  CE3   . TRP A 1 598 ? 53.021  155.971 72.936  1.00 19.53 ? 598  TRP A CE3   1 
ATOM   4618  C  CZ2   . TRP A 1 598 ? 52.613  158.659 72.106  1.00 22.49 ? 598  TRP A CZ2   1 
ATOM   4619  C  CZ3   . TRP A 1 598 ? 53.853  156.577 71.993  1.00 20.02 ? 598  TRP A CZ3   1 
ATOM   4620  C  CH2   . TRP A 1 598 ? 53.642  157.910 71.589  1.00 20.88 ? 598  TRP A CH2   1 
ATOM   4621  N  N     . THR A 1 599 ? 50.416  151.809 75.362  1.00 20.05 ? 599  THR A N     1 
ATOM   4622  C  CA    . THR A 1 599 ? 50.034  150.711 76.234  1.00 23.64 ? 599  THR A CA    1 
ATOM   4623  C  C     . THR A 1 599 ? 51.186  149.761 76.533  1.00 26.04 ? 599  THR A C     1 
ATOM   4624  O  O     . THR A 1 599 ? 52.189  149.726 75.818  1.00 25.08 ? 599  THR A O     1 
ATOM   4625  C  CB    . THR A 1 599 ? 48.892  149.892 75.601  1.00 24.03 ? 599  THR A CB    1 
ATOM   4626  O  OG1   . THR A 1 599 ? 48.397  148.937 76.549  1.00 23.36 ? 599  THR A OG1   1 
ATOM   4627  C  CG2   . THR A 1 599 ? 49.397  149.155 74.364  1.00 23.40 ? 599  THR A CG2   1 
ATOM   4628  N  N     . ASP A 1 600 ? 51.023  148.993 77.604  1.00 29.88 ? 600  ASP A N     1 
ATOM   4629  C  CA    . ASP A 1 600 ? 52.004  147.995 78.018  1.00 33.76 ? 600  ASP A CA    1 
ATOM   4630  C  C     . ASP A 1 600 ? 51.230  146.684 78.097  1.00 34.73 ? 600  ASP A C     1 
ATOM   4631  O  O     . ASP A 1 600 ? 51.728  145.678 78.604  1.00 35.91 ? 600  ASP A O     1 
ATOM   4632  C  CB    . ASP A 1 600 ? 52.564  148.330 79.404  1.00 36.04 ? 600  ASP A CB    1 
ATOM   4633  C  CG    . ASP A 1 600 ? 53.381  149.604 79.414  1.00 39.60 ? 600  ASP A CG    1 
ATOM   4634  O  OD1   . ASP A 1 600 ? 54.425  149.645 78.725  1.00 42.49 ? 600  ASP A OD1   1 
ATOM   4635  O  OD2   . ASP A 1 600 ? 52.982  150.562 80.113  1.00 40.43 ? 600  ASP A OD2   1 
ATOM   4636  N  N     . SER A 1 601 ? 50.005  146.707 77.583  1.00 34.77 ? 601  SER A N     1 
ATOM   4637  C  CA    . SER A 1 601 ? 49.142  145.536 77.632  1.00 35.08 ? 601  SER A CA    1 
ATOM   4638  C  C     . SER A 1 601 ? 48.758  144.936 76.283  1.00 34.23 ? 601  SER A C     1 
ATOM   4639  O  O     . SER A 1 601 ? 47.576  144.711 76.022  1.00 34.82 ? 601  SER A O     1 
ATOM   4640  C  CB    . SER A 1 601 ? 47.871  145.885 78.410  1.00 35.50 ? 601  SER A CB    1 
ATOM   4641  O  OG    . SER A 1 601 ? 48.187  146.392 79.696  1.00 37.23 ? 601  SER A OG    1 
ATOM   4642  N  N     . LEU A 1 602 ? 49.739  144.668 75.427  1.00 32.53 ? 602  LEU A N     1 
ATOM   4643  C  CA    . LEU A 1 602 ? 49.434  144.065 74.130  1.00 30.67 ? 602  LEU A CA    1 
ATOM   4644  C  C     . LEU A 1 602 ? 49.053  142.594 74.308  1.00 31.03 ? 602  LEU A C     1 
ATOM   4645  O  O     . LEU A 1 602 ? 49.773  141.830 74.951  1.00 29.02 ? 602  LEU A O     1 
ATOM   4646  C  CB    . LEU A 1 602 ? 50.636  144.170 73.185  1.00 30.20 ? 602  LEU A CB    1 
ATOM   4647  C  CG    . LEU A 1 602 ? 50.958  145.551 72.609  1.00 27.49 ? 602  LEU A CG    1 
ATOM   4648  C  CD1   . LEU A 1 602 ? 52.213  145.467 71.758  1.00 28.08 ? 602  LEU A CD1   1 
ATOM   4649  C  CD2   . LEU A 1 602 ? 49.784  146.046 71.782  1.00 25.72 ? 602  LEU A CD2   1 
ATOM   4650  N  N     . PRO A 1 603 ? 47.905  142.183 73.746  1.00 31.10 ? 603  PRO A N     1 
ATOM   4651  C  CA    . PRO A 1 603 ? 47.444  140.795 73.850  1.00 32.08 ? 603  PRO A CA    1 
ATOM   4652  C  C     . PRO A 1 603 ? 48.324  139.854 73.031  1.00 33.05 ? 603  PRO A C     1 
ATOM   4653  O  O     . PRO A 1 603 ? 48.609  140.118 71.861  1.00 33.22 ? 603  PRO A O     1 
ATOM   4654  C  CB    . PRO A 1 603 ? 46.018  140.872 73.318  1.00 32.66 ? 603  PRO A CB    1 
ATOM   4655  C  CG    . PRO A 1 603 ? 46.115  141.954 72.287  1.00 32.36 ? 603  PRO A CG    1 
ATOM   4656  C  CD    . PRO A 1 603 ? 46.933  143.002 73.000  1.00 31.35 ? 603  PRO A CD    1 
ATOM   4657  N  N     . LYS A 1 604 ? 48.758  138.758 73.646  1.00 33.28 ? 604  LYS A N     1 
ATOM   4658  C  CA    . LYS A 1 604 ? 49.615  137.800 72.959  1.00 34.01 ? 604  LYS A CA    1 
ATOM   4659  C  C     . LYS A 1 604 ? 49.251  136.354 73.266  1.00 34.65 ? 604  LYS A C     1 
ATOM   4660  O  O     . LYS A 1 604 ? 48.557  136.068 74.244  1.00 34.57 ? 604  LYS A O     1 
ATOM   4661  C  CB    . LYS A 1 604 ? 51.079  138.032 73.347  1.00 35.05 ? 604  LYS A CB    1 
ATOM   4662  C  CG    . LYS A 1 604 ? 51.636  139.386 72.942  1.00 35.06 ? 604  LYS A CG    1 
ATOM   4663  C  CD    . LYS A 1 604 ? 53.057  139.548 73.448  1.00 37.23 ? 604  LYS A CD    1 
ATOM   4664  C  CE    . LYS A 1 604 ? 53.656  140.874 73.015  1.00 35.94 ? 604  LYS A CE    1 
ATOM   4665  N  NZ    . LYS A 1 604 ? 55.015  141.065 73.596  1.00 38.67 ? 604  LYS A NZ    1 
ATOM   4666  N  N     . THR A 1 605 ? 49.726  135.450 72.415  1.00 35.00 ? 605  THR A N     1 
ATOM   4667  C  CA    . THR A 1 605 ? 49.487  134.026 72.596  1.00 35.03 ? 605  THR A CA    1 
ATOM   4668  C  C     . THR A 1 605 ? 50.614  133.524 73.485  1.00 34.65 ? 605  THR A C     1 
ATOM   4669  O  O     . THR A 1 605 ? 51.611  134.218 73.681  1.00 34.16 ? 605  THR A O     1 
ATOM   4670  C  CB    . THR A 1 605 ? 49.542  133.262 71.261  1.00 34.55 ? 605  THR A CB    1 
ATOM   4671  O  OG1   . THR A 1 605 ? 50.873  133.313 70.732  1.00 36.19 ? 605  THR A OG1   1 
ATOM   4672  C  CG2   . THR A 1 605 ? 48.578  133.876 70.261  1.00 35.52 ? 605  THR A CG2   1 
ATOM   4673  N  N     . ARG A 1 606 ? 50.461  132.319 74.016  1.00 34.66 ? 606  ARG A N     1 
ATOM   4674  C  CA    . ARG A 1 606 ? 51.479  131.757 74.888  1.00 34.50 ? 606  ARG A CA    1 
ATOM   4675  C  C     . ARG A 1 606 ? 52.809  131.555 74.171  1.00 35.14 ? 606  ARG A C     1 
ATOM   4676  O  O     . ARG A 1 606 ? 53.863  131.495 74.807  1.00 33.96 ? 606  ARG A O     1 
ATOM   4677  C  CB    . ARG A 1 606 ? 50.973  130.445 75.477  1.00 35.84 ? 606  ARG A CB    1 
ATOM   4678  C  CG    . ARG A 1 606 ? 49.743  130.650 76.337  1.00 36.54 ? 606  ARG A CG    1 
ATOM   4679  C  CD    . ARG A 1 606 ? 49.264  129.369 76.980  1.00 40.21 ? 606  ARG A CD    1 
ATOM   4680  N  NE    . ARG A 1 606 ? 48.162  129.634 77.900  1.00 41.66 ? 606  ARG A NE    1 
ATOM   4681  C  CZ    . ARG A 1 606 ? 46.995  130.158 77.536  1.00 43.69 ? 606  ARG A CZ    1 
ATOM   4682  N  NH1   . ARG A 1 606 ? 46.771  130.473 76.265  1.00 45.08 ? 606  ARG A NH1   1 
ATOM   4683  N  NH2   . ARG A 1 606 ? 46.050  130.370 78.442  1.00 44.16 ? 606  ARG A NH2   1 
ATOM   4684  N  N     . SER A 1 607 ? 52.759  131.465 72.845  1.00 35.33 ? 607  SER A N     1 
ATOM   4685  C  CA    . SER A 1 607 ? 53.974  131.290 72.057  1.00 36.92 ? 607  SER A CA    1 
ATOM   4686  C  C     . SER A 1 607 ? 54.658  132.645 71.882  1.00 37.51 ? 607  SER A C     1 
ATOM   4687  O  O     . SER A 1 607 ? 55.811  132.722 71.452  1.00 37.23 ? 607  SER A O     1 
ATOM   4688  C  CB    . SER A 1 607 ? 53.645  130.687 70.689  1.00 37.79 ? 607  SER A CB    1 
ATOM   4689  O  OG    . SER A 1 607 ? 52.816  131.553 69.934  1.00 40.54 ? 607  SER A OG    1 
ATOM   4690  N  N     . GLY A 1 608 ? 53.934  133.711 72.217  1.00 37.82 ? 608  GLY A N     1 
ATOM   4691  C  CA    . GLY A 1 608 ? 54.486  135.051 72.114  1.00 38.26 ? 608  GLY A CA    1 
ATOM   4692  C  C     . GLY A 1 608 ? 54.021  135.855 70.914  1.00 38.93 ? 608  GLY A C     1 
ATOM   4693  O  O     . GLY A 1 608 ? 54.513  136.961 70.677  1.00 39.14 ? 608  GLY A O     1 
ATOM   4694  N  N     . LYS A 1 609 ? 53.070  135.314 70.158  1.00 38.14 ? 609  LYS A N     1 
ATOM   4695  C  CA    . LYS A 1 609 ? 52.558  135.995 68.975  1.00 38.74 ? 609  LYS A CA    1 
ATOM   4696  C  C     . LYS A 1 609 ? 51.408  136.933 69.329  1.00 39.19 ? 609  LYS A C     1 
ATOM   4697  O  O     . LYS A 1 609 ? 50.473  136.552 70.034  1.00 39.54 ? 609  LYS A O     1 
ATOM   4698  C  CB    . LYS A 1 609 ? 52.103  134.972 67.941  1.00 37.61 ? 609  LYS A CB    1 
ATOM   4699  N  N     . ILE A 1 610 ? 51.483  138.161 68.827  1.00 39.21 ? 610  ILE A N     1 
ATOM   4700  C  CA    . ILE A 1 610 ? 50.457  139.161 69.092  1.00 39.38 ? 610  ILE A CA    1 
ATOM   4701  C  C     . ILE A 1 610 ? 49.153  138.812 68.374  1.00 38.19 ? 610  ILE A C     1 
ATOM   4702  O  O     . ILE A 1 610 ? 49.163  138.377 67.222  1.00 37.49 ? 610  ILE A O     1 
ATOM   4703  C  CB    . ILE A 1 610 ? 50.954  140.570 68.654  1.00 40.14 ? 610  ILE A CB    1 
ATOM   4704  C  CG1   . ILE A 1 610 ? 49.983  141.660 69.123  1.00 40.02 ? 610  ILE A CG1   1 
ATOM   4705  C  CG2   . ILE A 1 610 ? 51.159  140.599 67.144  1.00 41.52 ? 610  ILE A CG2   1 
ATOM   4706  C  CD1   . ILE A 1 610 ? 48.710  141.782 68.319  1.00 40.98 ? 610  ILE A CD1   1 
ATOM   4707  N  N     . MET A 1 611 ? 48.034  138.996 69.071  1.00 38.14 ? 611  MET A N     1 
ATOM   4708  C  CA    . MET A 1 611 ? 46.712  138.715 68.519  1.00 38.64 ? 611  MET A CA    1 
ATOM   4709  C  C     . MET A 1 611 ? 46.041  140.030 68.129  1.00 39.62 ? 611  MET A C     1 
ATOM   4710  O  O     . MET A 1 611 ? 45.679  140.826 68.997  1.00 40.61 ? 611  MET A O     1 
ATOM   4711  C  CB    . MET A 1 611 ? 45.865  137.978 69.550  1.00 39.86 ? 611  MET A CB    1 
ATOM   4712  N  N     . ARG A 1 612 ? 45.868  140.251 66.827  1.00 39.12 ? 612  ARG A N     1 
ATOM   4713  C  CA    . ARG A 1 612 ? 45.263  141.488 66.331  1.00 38.05 ? 612  ARG A CA    1 
ATOM   4714  C  C     . ARG A 1 612 ? 43.742  141.496 66.213  1.00 36.37 ? 612  ARG A C     1 
ATOM   4715  O  O     . ARG A 1 612 ? 43.139  142.558 66.059  1.00 36.39 ? 612  ARG A O     1 
ATOM   4716  C  CB    . ARG A 1 612 ? 45.873  141.863 64.974  1.00 39.56 ? 612  ARG A CB    1 
ATOM   4717  C  CG    . ARG A 1 612 ? 47.369  142.139 65.027  1.00 41.53 ? 612  ARG A CG    1 
ATOM   4718  C  CD    . ARG A 1 612 ? 47.885  142.716 63.713  1.00 42.55 ? 612  ARG A CD    1 
ATOM   4719  N  NE    . ARG A 1 612 ? 49.337  142.870 63.722  1.00 41.97 ? 612  ARG A NE    1 
ATOM   4720  C  CZ    . ARG A 1 612 ? 50.192  141.857 63.824  1.00 44.61 ? 612  ARG A CZ    1 
ATOM   4721  N  NH1   . ARG A 1 612 ? 49.741  140.613 63.924  1.00 45.53 ? 612  ARG A NH1   1 
ATOM   4722  N  NH2   . ARG A 1 612 ? 51.499  142.083 63.831  1.00 45.33 ? 612  ARG A NH2   1 
ATOM   4723  N  N     . ARG A 1 613 ? 43.117  140.327 66.282  1.00 35.28 ? 613  ARG A N     1 
ATOM   4724  C  CA    . ARG A 1 613 ? 41.663  140.252 66.179  1.00 34.33 ? 613  ARG A CA    1 
ATOM   4725  C  C     . ARG A 1 613 ? 41.012  141.087 67.280  1.00 33.57 ? 613  ARG A C     1 
ATOM   4726  O  O     . ARG A 1 613 ? 40.108  141.883 67.023  1.00 33.60 ? 613  ARG A O     1 
ATOM   4727  C  CB    . ARG A 1 613 ? 41.205  138.796 66.279  1.00 35.58 ? 613  ARG A CB    1 
ATOM   4728  N  N     . ILE A 1 614 ? 41.487  140.903 68.507  1.00 32.40 ? 614  ILE A N     1 
ATOM   4729  C  CA    . ILE A 1 614 ? 40.965  141.628 69.659  1.00 31.79 ? 614  ILE A CA    1 
ATOM   4730  C  C     . ILE A 1 614 ? 41.273  143.126 69.574  1.00 30.44 ? 614  ILE A C     1 
ATOM   4731  O  O     . ILE A 1 614 ? 40.430  143.961 69.902  1.00 30.04 ? 614  ILE A O     1 
ATOM   4732  C  CB    . ILE A 1 614 ? 41.554  141.051 70.969  1.00 33.98 ? 614  ILE A CB    1 
ATOM   4733  C  CG1   . ILE A 1 614 ? 41.126  141.903 72.165  1.00 34.62 ? 614  ILE A CG1   1 
ATOM   4734  C  CG2   . ILE A 1 614 ? 43.070  140.972 70.869  1.00 33.31 ? 614  ILE A CG2   1 
ATOM   4735  C  CD1   . ILE A 1 614 ? 39.639  141.900 72.415  1.00 38.26 ? 614  ILE A CD1   1 
ATOM   4736  N  N     . LEU A 1 615 ? 42.478  143.465 69.130  1.00 28.61 ? 615  LEU A N     1 
ATOM   4737  C  CA    . LEU A 1 615 ? 42.868  144.868 69.008  1.00 26.72 ? 615  LEU A CA    1 
ATOM   4738  C  C     . LEU A 1 615 ? 42.009  145.587 67.973  1.00 26.15 ? 615  LEU A C     1 
ATOM   4739  O  O     . LEU A 1 615 ? 41.679  146.764 68.122  1.00 24.79 ? 615  LEU A O     1 
ATOM   4740  C  CB    . LEU A 1 615 ? 44.339  144.969 68.608  1.00 25.18 ? 615  LEU A CB    1 
ATOM   4741  C  CG    . LEU A 1 615 ? 45.343  144.425 69.625  1.00 24.77 ? 615  LEU A CG    1 
ATOM   4742  C  CD1   . LEU A 1 615 ? 46.750  144.539 69.064  1.00 24.04 ? 615  LEU A CD1   1 
ATOM   4743  C  CD2   . LEU A 1 615 ? 45.221  145.198 70.926  1.00 23.78 ? 615  LEU A CD2   1 
ATOM   4744  N  N     . ARG A 1 616 ? 41.656  144.860 66.920  1.00 26.60 ? 616  ARG A N     1 
ATOM   4745  C  CA    . ARG A 1 616 ? 40.844  145.393 65.837  1.00 28.05 ? 616  ARG A CA    1 
ATOM   4746  C  C     . ARG A 1 616 ? 39.456  145.794 66.350  1.00 28.19 ? 616  ARG A C     1 
ATOM   4747  O  O     . ARG A 1 616 ? 38.958  146.875 66.037  1.00 27.95 ? 616  ARG A O     1 
ATOM   4748  C  CB    . ARG A 1 616 ? 40.740  144.336 64.730  1.00 30.57 ? 616  ARG A CB    1 
ATOM   4749  C  CG    . ARG A 1 616 ? 40.240  144.845 63.393  1.00 35.65 ? 616  ARG A CG    1 
ATOM   4750  C  CD    . ARG A 1 616 ? 40.419  143.806 62.280  1.00 37.14 ? 616  ARG A CD    1 
ATOM   4751  N  NE    . ARG A 1 616 ? 41.806  143.670 61.823  1.00 39.72 ? 616  ARG A NE    1 
ATOM   4752  C  CZ    . ARG A 1 616 ? 42.654  142.727 62.228  1.00 40.46 ? 616  ARG A CZ    1 
ATOM   4753  N  NH1   . ARG A 1 616 ? 42.272  141.814 63.111  1.00 41.11 ? 616  ARG A NH1   1 
ATOM   4754  N  NH2   . ARG A 1 616 ? 43.888  142.691 61.738  1.00 40.79 ? 616  ARG A NH2   1 
ATOM   4755  N  N     . LYS A 1 617 ? 38.842  144.928 67.152  1.00 27.69 ? 617  LYS A N     1 
ATOM   4756  C  CA    . LYS A 1 617 ? 37.518  145.204 67.702  1.00 28.25 ? 617  LYS A CA    1 
ATOM   4757  C  C     . LYS A 1 617 ? 37.524  146.397 68.658  1.00 27.94 ? 617  LYS A C     1 
ATOM   4758  O  O     . LYS A 1 617 ? 36.667  147.275 68.575  1.00 27.65 ? 617  LYS A O     1 
ATOM   4759  C  CB    . LYS A 1 617 ? 36.982  143.968 68.417  1.00 28.29 ? 617  LYS A CB    1 
ATOM   4760  N  N     . ILE A 1 618 ? 38.493  146.428 69.566  1.00 29.20 ? 618  ILE A N     1 
ATOM   4761  C  CA    . ILE A 1 618 ? 38.591  147.516 70.535  1.00 28.23 ? 618  ILE A CA    1 
ATOM   4762  C  C     . ILE A 1 618 ? 38.770  148.875 69.861  1.00 27.58 ? 618  ILE A C     1 
ATOM   4763  O  O     . ILE A 1 618 ? 38.072  149.836 70.189  1.00 25.65 ? 618  ILE A O     1 
ATOM   4764  C  CB    . ILE A 1 618 ? 39.761  147.271 71.514  1.00 30.00 ? 618  ILE A CB    1 
ATOM   4765  C  CG1   . ILE A 1 618 ? 39.532  145.951 72.257  1.00 30.80 ? 618  ILE A CG1   1 
ATOM   4766  C  CG2   . ILE A 1 618 ? 39.875  148.432 72.498  1.00 29.60 ? 618  ILE A CG2   1 
ATOM   4767  C  CD1   . ILE A 1 618 ? 40.654  145.555 73.194  1.00 31.70 ? 618  ILE A CD1   1 
ATOM   4768  N  N     . ALA A 1 619 ? 39.704  148.956 68.918  1.00 26.36 ? 619  ALA A N     1 
ATOM   4769  C  CA    . ALA A 1 619 ? 39.958  150.209 68.213  1.00 27.07 ? 619  ALA A CA    1 
ATOM   4770  C  C     . ALA A 1 619 ? 38.708  150.694 67.483  1.00 28.46 ? 619  ALA A C     1 
ATOM   4771  O  O     . ALA A 1 619 ? 38.490  151.896 67.335  1.00 29.75 ? 619  ALA A O     1 
ATOM   4772  C  CB    . ALA A 1 619 ? 41.103  150.029 67.224  1.00 24.84 ? 619  ALA A CB    1 
ATOM   4773  N  N     . ALA A 1 620 ? 37.891  149.753 67.025  1.00 31.18 ? 620  ALA A N     1 
ATOM   4774  C  CA    . ALA A 1 620 ? 36.663  150.083 66.310  1.00 33.91 ? 620  ALA A CA    1 
ATOM   4775  C  C     . ALA A 1 620 ? 35.569  150.520 67.280  1.00 36.16 ? 620  ALA A C     1 
ATOM   4776  O  O     . ALA A 1 620 ? 34.694  151.313 66.930  1.00 36.69 ? 620  ALA A O     1 
ATOM   4777  C  CB    . ALA A 1 620 ? 36.196  148.877 65.500  1.00 33.15 ? 620  ALA A CB    1 
ATOM   4778  N  N     . GLY A 1 621 ? 35.627  149.998 68.501  1.00 38.32 ? 621  GLY A N     1 
ATOM   4779  C  CA    . GLY A 1 621 ? 34.635  150.340 69.506  1.00 40.91 ? 621  GLY A CA    1 
ATOM   4780  C  C     . GLY A 1 621 ? 33.791  149.141 69.893  1.00 42.47 ? 621  GLY A C     1 
ATOM   4781  O  O     . GLY A 1 621 ? 33.129  149.145 70.930  1.00 43.88 ? 621  GLY A O     1 
ATOM   4782  N  N     . ASP A 1 622 ? 33.817  148.110 69.053  1.00 43.54 ? 622  ASP A N     1 
ATOM   4783  C  CA    . ASP A 1 622 ? 33.053  146.893 69.295  1.00 43.99 ? 622  ASP A CA    1 
ATOM   4784  C  C     . ASP A 1 622 ? 33.553  146.182 70.547  1.00 44.47 ? 622  ASP A C     1 
ATOM   4785  O  O     . ASP A 1 622 ? 33.389  146.682 71.661  1.00 46.69 ? 622  ASP A O     1 
ATOM   4786  C  CB    . ASP A 1 622 ? 33.156  145.965 68.090  1.00 42.27 ? 622  ASP A CB    1 
ATOM   4787  N  N     . ALA A 1 633 ? 48.159  134.770 76.825  1.00 39.29 ? 633  ALA A N     1 
ATOM   4788  C  CA    . ALA A 1 633 ? 49.042  134.597 77.972  1.00 39.40 ? 633  ALA A CA    1 
ATOM   4789  C  C     . ALA A 1 633 ? 48.533  135.367 79.187  1.00 39.49 ? 633  ALA A C     1 
ATOM   4790  O  O     . ALA A 1 633 ? 48.661  134.905 80.320  1.00 39.93 ? 633  ALA A O     1 
ATOM   4791  C  CB    . ALA A 1 633 ? 50.453  135.054 77.618  1.00 39.38 ? 633  ALA A CB    1 
ATOM   4792  N  N     . ASP A 1 634 ? 47.961  136.542 78.947  1.00 39.33 ? 634  ASP A N     1 
ATOM   4793  C  CA    . ASP A 1 634 ? 47.430  137.367 80.026  1.00 39.09 ? 634  ASP A CA    1 
ATOM   4794  C  C     . ASP A 1 634 ? 46.100  137.999 79.627  1.00 39.49 ? 634  ASP A C     1 
ATOM   4795  O  O     . ASP A 1 634 ? 46.063  139.086 79.045  1.00 38.59 ? 634  ASP A O     1 
ATOM   4796  C  CB    . ASP A 1 634 ? 48.437  138.455 80.405  1.00 39.75 ? 634  ASP A CB    1 
ATOM   4797  C  CG    . ASP A 1 634 ? 47.904  139.400 81.466  1.00 39.50 ? 634  ASP A CG    1 
ATOM   4798  O  OD1   . ASP A 1 634 ? 46.967  139.015 82.196  1.00 39.40 ? 634  ASP A OD1   1 
ATOM   4799  O  OD2   . ASP A 1 634 ? 48.431  140.526 81.576  1.00 41.57 ? 634  ASP A OD2   1 
ATOM   4800  N  N     . PRO A 1 635 ? 45.012  137.306 79.952  1.00 39.09 ? 635  PRO A N     1 
ATOM   4801  C  CA    . PRO A 1 635 ? 43.665  137.765 79.628  1.00 38.37 ? 635  PRO A CA    1 
ATOM   4802  C  C     . PRO A 1 635 ? 43.307  139.097 80.277  1.00 37.60 ? 635  PRO A C     1 
ATOM   4803  O  O     . PRO A 1 635 ? 42.305  139.716 79.923  1.00 38.51 ? 635  PRO A O     1 
ATOM   4804  C  CB    . PRO A 1 635 ? 42.649  136.703 80.034  1.00 39.53 ? 635  PRO A CB    1 
ATOM   4805  N  N     . GLY A 1 636 ? 44.125  139.539 81.224  1.00 37.19 ? 636  GLY A N     1 
ATOM   4806  C  CA    . GLY A 1 636 ? 43.852  140.795 81.898  1.00 36.31 ? 636  GLY A CA    1 
ATOM   4807  C  C     . GLY A 1 636 ? 44.049  142.032 81.039  1.00 35.69 ? 636  GLY A C     1 
ATOM   4808  O  O     . GLY A 1 636 ? 43.467  143.081 81.315  1.00 36.62 ? 636  GLY A O     1 
ATOM   4809  N  N     . VAL A 1 637 ? 44.860  141.915 79.992  1.00 34.41 ? 637  VAL A N     1 
ATOM   4810  C  CA    . VAL A 1 637 ? 45.137  143.046 79.110  1.00 33.49 ? 637  VAL A CA    1 
ATOM   4811  C  C     . VAL A 1 637 ? 43.895  143.636 78.450  1.00 33.67 ? 637  VAL A C     1 
ATOM   4812  O  O     . VAL A 1 637 ? 43.835  144.839 78.194  1.00 34.45 ? 637  VAL A O     1 
ATOM   4813  C  CB    . VAL A 1 637 ? 46.130  142.657 77.991  1.00 31.82 ? 637  VAL A CB    1 
ATOM   4814  C  CG1   . VAL A 1 637 ? 47.436  142.170 78.599  1.00 32.35 ? 637  VAL A CG1   1 
ATOM   4815  C  CG2   . VAL A 1 637 ? 45.521  141.583 77.104  1.00 31.19 ? 637  VAL A CG2   1 
ATOM   4816  N  N     . VAL A 1 638 ? 42.907  142.790 78.172  1.00 33.86 ? 638  VAL A N     1 
ATOM   4817  C  CA    . VAL A 1 638 ? 41.679  143.235 77.520  1.00 33.70 ? 638  VAL A CA    1 
ATOM   4818  C  C     . VAL A 1 638 ? 40.967  144.364 78.257  1.00 33.63 ? 638  VAL A C     1 
ATOM   4819  O  O     . VAL A 1 638 ? 40.639  145.387 77.657  1.00 34.03 ? 638  VAL A O     1 
ATOM   4820  C  CB    . VAL A 1 638 ? 40.691  142.062 77.337  1.00 33.51 ? 638  VAL A CB    1 
ATOM   4821  C  CG1   . VAL A 1 638 ? 39.399  142.561 76.697  1.00 34.56 ? 638  VAL A CG1   1 
ATOM   4822  C  CG2   . VAL A 1 638 ? 41.325  140.988 76.465  1.00 33.74 ? 638  VAL A CG2   1 
ATOM   4823  N  N     . GLU A 1 639 ? 40.724  144.181 79.551  1.00 33.95 ? 639  GLU A N     1 
ATOM   4824  C  CA    . GLU A 1 639 ? 40.043  145.205 80.339  1.00 34.55 ? 639  GLU A CA    1 
ATOM   4825  C  C     . GLU A 1 639 ? 40.863  146.491 80.391  1.00 33.88 ? 639  GLU A C     1 
ATOM   4826  O  O     . GLU A 1 639 ? 40.314  147.591 80.318  1.00 34.42 ? 639  GLU A O     1 
ATOM   4827  C  CB    . GLU A 1 639 ? 39.778  144.695 81.760  1.00 36.69 ? 639  GLU A CB    1 
ATOM   4828  C  CG    . GLU A 1 639 ? 39.039  145.680 82.659  1.00 39.56 ? 639  GLU A CG    1 
ATOM   4829  C  CD    . GLU A 1 639 ? 37.783  146.244 82.012  1.00 41.09 ? 639  GLU A CD    1 
ATOM   4830  O  OE1   . GLU A 1 639 ? 37.063  145.482 81.331  1.00 42.75 ? 639  GLU A OE1   1 
ATOM   4831  O  OE2   . GLU A 1 639 ? 37.510  147.448 82.195  1.00 43.44 ? 639  GLU A OE2   1 
ATOM   4832  N  N     . LYS A 1 640 ? 42.179  146.349 80.514  1.00 33.25 ? 640  LYS A N     1 
ATOM   4833  C  CA    . LYS A 1 640 ? 43.061  147.507 80.564  1.00 32.29 ? 640  LYS A CA    1 
ATOM   4834  C  C     . LYS A 1 640 ? 42.975  148.266 79.245  1.00 32.14 ? 640  LYS A C     1 
ATOM   4835  O  O     . LYS A 1 640 ? 42.770  149.480 79.228  1.00 32.80 ? 640  LYS A O     1 
ATOM   4836  C  CB    . LYS A 1 640 ? 44.496  147.065 80.825  1.00 32.89 ? 640  LYS A CB    1 
ATOM   4837  N  N     . LEU A 1 641 ? 43.132  147.540 78.141  1.00 30.64 ? 641  LEU A N     1 
ATOM   4838  C  CA    . LEU A 1 641 ? 43.072  148.131 76.808  1.00 30.49 ? 641  LEU A CA    1 
ATOM   4839  C  C     . LEU A 1 641 ? 41.759  148.877 76.609  1.00 29.71 ? 641  LEU A C     1 
ATOM   4840  O  O     . LEU A 1 641 ? 41.733  149.983 76.064  1.00 29.40 ? 641  LEU A O     1 
ATOM   4841  C  CB    . LEU A 1 641 ? 43.217  147.039 75.739  1.00 28.24 ? 641  LEU A CB    1 
ATOM   4842  C  CG    . LEU A 1 641 ? 44.587  146.356 75.667  1.00 29.56 ? 641  LEU A CG    1 
ATOM   4843  C  CD1   . LEU A 1 641 ? 44.523  145.125 74.773  1.00 29.06 ? 641  LEU A CD1   1 
ATOM   4844  C  CD2   . LEU A 1 641 ? 45.614  147.351 75.149  1.00 29.08 ? 641  LEU A CD2   1 
ATOM   4845  N  N     . LEU A 1 642 ? 40.669  148.265 77.060  1.00 30.97 ? 642  LEU A N     1 
ATOM   4846  C  CA    . LEU A 1 642 ? 39.346  148.866 76.934  1.00 32.24 ? 642  LEU A CA    1 
ATOM   4847  C  C     . LEU A 1 642 ? 39.268  150.218 77.621  1.00 32.50 ? 642  LEU A C     1 
ATOM   4848  O  O     . LEU A 1 642 ? 38.779  151.190 77.048  1.00 32.80 ? 642  LEU A O     1 
ATOM   4849  C  CB    . LEU A 1 642 ? 38.287  147.938 77.532  1.00 33.15 ? 642  LEU A CB    1 
ATOM   4850  C  CG    . LEU A 1 642 ? 38.024  146.649 76.756  1.00 34.34 ? 642  LEU A CG    1 
ATOM   4851  C  CD1   . LEU A 1 642 ? 37.043  145.773 77.524  1.00 33.58 ? 642  LEU A CD1   1 
ATOM   4852  C  CD2   . LEU A 1 642 ? 37.473  146.993 75.379  1.00 34.22 ? 642  LEU A CD2   1 
ATOM   4853  N  N     . GLU A 1 643 ? 39.748  150.273 78.856  1.00 33.47 ? 643  GLU A N     1 
ATOM   4854  C  CA    . GLU A 1 643 ? 39.713  151.509 79.618  1.00 34.81 ? 643  GLU A CA    1 
ATOM   4855  C  C     . GLU A 1 643 ? 40.653  152.567 79.051  1.00 34.23 ? 643  GLU A C     1 
ATOM   4856  O  O     . GLU A 1 643 ? 40.341  153.756 79.075  1.00 34.83 ? 643  GLU A O     1 
ATOM   4857  C  CB    . GLU A 1 643 ? 40.022  151.208 81.087  1.00 37.21 ? 643  GLU A CB    1 
ATOM   4858  C  CG    . GLU A 1 643 ? 39.048  150.178 81.654  1.00 40.39 ? 643  GLU A CG    1 
ATOM   4859  C  CD    . GLU A 1 643 ? 38.798  150.327 83.142  1.00 43.33 ? 643  GLU A CD    1 
ATOM   4860  O  OE1   . GLU A 1 643 ? 38.594  151.472 83.600  1.00 44.95 ? 643  GLU A OE1   1 
ATOM   4861  O  OE2   . GLU A 1 643 ? 38.784  149.295 83.852  1.00 43.90 ? 643  GLU A OE2   1 
ATOM   4862  N  N     . GLU A 1 644 ? 41.798  152.139 78.528  1.00 34.02 ? 644  GLU A N     1 
ATOM   4863  C  CA    . GLU A 1 644 ? 42.737  153.088 77.939  1.00 33.93 ? 644  GLU A CA    1 
ATOM   4864  C  C     . GLU A 1 644 ? 42.082  153.664 76.689  1.00 34.41 ? 644  GLU A C     1 
ATOM   4865  O  O     . GLU A 1 644 ? 42.204  154.852 76.396  1.00 34.46 ? 644  GLU A O     1 
ATOM   4866  C  CB    . GLU A 1 644 ? 44.046  152.391 77.551  1.00 33.63 ? 644  GLU A CB    1 
ATOM   4867  C  CG    . GLU A 1 644 ? 44.723  151.630 78.679  1.00 33.29 ? 644  GLU A CG    1 
ATOM   4868  C  CD    . GLU A 1 644 ? 46.048  151.022 78.255  1.00 34.01 ? 644  GLU A CD    1 
ATOM   4869  O  OE1   . GLU A 1 644 ? 46.133  150.514 77.114  1.00 31.90 ? 644  GLU A OE1   1 
ATOM   4870  O  OE2   . GLU A 1 644 ? 47.002  151.041 79.062  1.00 33.22 ? 644  GLU A OE2   1 
ATOM   4871  N  N     . LYS A 1 645 ? 41.381  152.803 75.959  1.00 35.24 ? 645  LYS A N     1 
ATOM   4872  C  CA    . LYS A 1 645 ? 40.695  153.188 74.729  1.00 36.47 ? 645  LYS A CA    1 
ATOM   4873  C  C     . LYS A 1 645 ? 39.572  154.187 75.019  1.00 37.00 ? 645  LYS A C     1 
ATOM   4874  O  O     . LYS A 1 645 ? 39.353  155.130 74.261  1.00 37.50 ? 645  LYS A O     1 
ATOM   4875  C  CB    . LYS A 1 645 ? 40.119  151.937 74.057  1.00 37.06 ? 645  LYS A CB    1 
ATOM   4876  C  CG    . LYS A 1 645 ? 39.859  152.067 72.562  1.00 38.61 ? 645  LYS A CG    1 
ATOM   4877  C  CD    . LYS A 1 645 ? 38.684  152.969 72.257  1.00 37.58 ? 645  LYS A CD    1 
ATOM   4878  C  CE    . LYS A 1 645 ? 38.438  153.048 70.759  1.00 39.07 ? 645  LYS A CE    1 
ATOM   4879  N  NZ    . LYS A 1 645 ? 37.238  153.870 70.449  1.00 38.49 ? 645  LYS A NZ    1 
ATOM   4880  N  N     . GLN A 1 646 ? 38.868  153.976 76.123  1.00 36.99 ? 646  GLN A N     1 
ATOM   4881  C  CA    . GLN A 1 646 ? 37.768  154.854 76.500  1.00 39.20 ? 646  GLN A CA    1 
ATOM   4882  C  C     . GLN A 1 646 ? 38.258  156.287 76.697  1.00 40.36 ? 646  GLN A C     1 
ATOM   4883  O  O     . GLN A 1 646 ? 37.542  157.241 76.388  1.00 41.21 ? 646  GLN A O     1 
ATOM   4884  C  CB    . GLN A 1 646 ? 37.105  154.340 77.785  1.00 37.29 ? 646  GLN A CB    1 
ATOM   4885  C  CG    . GLN A 1 646 ? 35.786  155.017 78.137  1.00 40.03 ? 646  GLN A CG    1 
ATOM   4886  C  CD    . GLN A 1 646 ? 35.955  156.464 78.538  1.00 41.41 ? 646  GLN A CD    1 
ATOM   4887  O  OE1   . GLN A 1 646 ? 36.702  156.780 79.473  1.00 43.70 ? 646  GLN A OE1   1 
ATOM   4888  N  NE2   . GLN A 1 646 ? 35.260  157.361 77.837  1.00 41.50 ? 646  GLN A NE2   1 
ATOM   4889  N  N     . ALA A 1 647 ? 39.479  156.435 77.206  1.00 42.44 ? 647  ALA A N     1 
ATOM   4890  C  CA    . ALA A 1 647 ? 40.057  157.755 77.444  1.00 44.62 ? 647  ALA A CA    1 
ATOM   4891  C  C     . ALA A 1 647 ? 40.586  158.394 76.161  1.00 45.71 ? 647  ALA A C     1 
ATOM   4892  O  O     . ALA A 1 647 ? 40.452  157.774 75.082  1.00 47.09 ? 647  ALA A O     1 
ATOM   4893  C  CB    . ALA A 1 647 ? 41.174  157.654 78.473  1.00 44.67 ? 647  ALA A CB    1 
ATOM   4894  N  N     . HIS B 1 5   ? 98.836  125.503 81.967  1.00 40.64 ? 5    HIS B N     1 
ATOM   4895  C  CA    . HIS B 1 5   ? 99.536  124.544 81.068  1.00 39.33 ? 5    HIS B CA    1 
ATOM   4896  C  C     . HIS B 1 5   ? 98.631  124.167 79.900  1.00 38.89 ? 5    HIS B C     1 
ATOM   4897  O  O     . HIS B 1 5   ? 97.664  123.425 80.067  1.00 39.30 ? 5    HIS B O     1 
ATOM   4898  C  CB    . HIS B 1 5   ? 99.929  123.301 81.852  1.00 40.85 ? 5    HIS B CB    1 
ATOM   4899  N  N     . LYS B 1 6   ? 98.954  124.677 78.716  1.00 37.66 ? 6    LYS B N     1 
ATOM   4900  C  CA    . LYS B 1 6   ? 98.162  124.403 77.522  1.00 35.84 ? 6    LYS B CA    1 
ATOM   4901  C  C     . LYS B 1 6   ? 98.545  123.109 76.814  1.00 34.99 ? 6    LYS B C     1 
ATOM   4902  O  O     . LYS B 1 6   ? 99.721  122.758 76.725  1.00 34.17 ? 6    LYS B O     1 
ATOM   4903  C  CB    . LYS B 1 6   ? 98.295  125.551 76.519  1.00 36.20 ? 6    LYS B CB    1 
ATOM   4904  C  CG    . LYS B 1 6   ? 97.696  126.875 76.959  1.00 37.18 ? 6    LYS B CG    1 
ATOM   4905  C  CD    . LYS B 1 6   ? 97.926  127.932 75.886  1.00 36.72 ? 6    LYS B CD    1 
ATOM   4906  C  CE    . LYS B 1 6   ? 97.230  129.236 76.223  1.00 37.63 ? 6    LYS B CE    1 
ATOM   4907  N  NZ    . LYS B 1 6   ? 97.395  130.240 75.133  1.00 37.26 ? 6    LYS B NZ    1 
ATOM   4908  N  N     . HIS B 1 7   ? 97.535  122.408 76.308  1.00 32.89 ? 7    HIS B N     1 
ATOM   4909  C  CA    . HIS B 1 7   ? 97.745  121.175 75.563  1.00 31.80 ? 7    HIS B CA    1 
ATOM   4910  C  C     . HIS B 1 7   ? 97.698  121.557 74.091  1.00 30.59 ? 7    HIS B C     1 
ATOM   4911  O  O     . HIS B 1 7   ? 96.710  122.119 73.615  1.00 31.79 ? 7    HIS B O     1 
ATOM   4912  C  CB    . HIS B 1 7   ? 96.647  120.159 75.881  1.00 31.95 ? 7    HIS B CB    1 
ATOM   4913  C  CG    . HIS B 1 7   ? 96.888  119.379 77.136  1.00 34.16 ? 7    HIS B CG    1 
ATOM   4914  N  ND1   . HIS B 1 7   ? 97.671  118.245 77.168  1.00 33.92 ? 7    HIS B ND1   1 
ATOM   4915  C  CD2   . HIS B 1 7   ? 96.464  119.578 78.406  1.00 33.64 ? 7    HIS B CD2   1 
ATOM   4916  C  CE1   . HIS B 1 7   ? 97.716  117.778 78.403  1.00 34.72 ? 7    HIS B CE1   1 
ATOM   4917  N  NE2   . HIS B 1 7   ? 96.992  118.569 79.174  1.00 33.42 ? 7    HIS B NE2   1 
ATOM   4918  N  N     . ALA B 1 8   ? 98.772  121.261 73.372  1.00 27.69 ? 8    ALA B N     1 
ATOM   4919  C  CA    . ALA B 1 8   ? 98.854  121.600 71.958  1.00 27.21 ? 8    ALA B CA    1 
ATOM   4920  C  C     . ALA B 1 8   ? 97.789  120.922 71.103  1.00 26.69 ? 8    ALA B C     1 
ATOM   4921  O  O     . ALA B 1 8   ? 97.205  119.906 71.490  1.00 24.58 ? 8    ALA B O     1 
ATOM   4922  C  CB    . ALA B 1 8   ? 100.242 121.252 71.422  1.00 25.96 ? 8    ALA B CB    1 
ATOM   4923  N  N     . ILE B 1 9   ? 97.541  121.506 69.936  1.00 25.66 ? 9    ILE B N     1 
ATOM   4924  C  CA    . ILE B 1 9   ? 96.583  120.961 68.988  1.00 25.35 ? 9    ILE B CA    1 
ATOM   4925  C  C     . ILE B 1 9   ? 97.297  119.821 68.254  1.00 25.84 ? 9    ILE B C     1 
ATOM   4926  O  O     . ILE B 1 9   ? 98.339  120.034 67.634  1.00 25.12 ? 9    ILE B O     1 
ATOM   4927  C  CB    . ILE B 1 9   ? 96.149  122.039 67.967  1.00 25.29 ? 9    ILE B CB    1 
ATOM   4928  C  CG1   . ILE B 1 9   ? 95.408  123.165 68.694  1.00 25.37 ? 9    ILE B CG1   1 
ATOM   4929  C  CG2   . ILE B 1 9   ? 95.284  121.420 66.877  1.00 23.95 ? 9    ILE B CG2   1 
ATOM   4930  C  CD1   . ILE B 1 9   ? 95.069  124.354 67.813  1.00 26.90 ? 9    ILE B CD1   1 
ATOM   4931  N  N     . PRO B 1 10  ? 96.754  118.595 68.330  1.00 26.74 ? 10   PRO B N     1 
ATOM   4932  C  CA    . PRO B 1 10  ? 97.360  117.437 67.664  1.00 26.64 ? 10   PRO B CA    1 
ATOM   4933  C  C     . PRO B 1 10  ? 97.598  117.677 66.172  1.00 27.03 ? 10   PRO B C     1 
ATOM   4934  O  O     . PRO B 1 10  ? 96.773  118.288 65.492  1.00 26.24 ? 10   PRO B O     1 
ATOM   4935  C  CB    . PRO B 1 10  ? 96.342  116.329 67.914  1.00 27.69 ? 10   PRO B CB    1 
ATOM   4936  C  CG    . PRO B 1 10  ? 95.748  116.710 69.229  1.00 27.93 ? 10   PRO B CG    1 
ATOM   4937  C  CD    . PRO B 1 10  ? 95.544  118.198 69.070  1.00 26.83 ? 10   PRO B CD    1 
ATOM   4938  N  N     . ALA B 1 11  ? 98.726  117.181 65.670  1.00 26.95 ? 11   ALA B N     1 
ATOM   4939  C  CA    . ALA B 1 11  ? 99.085  117.338 64.265  1.00 26.71 ? 11   ALA B CA    1 
ATOM   4940  C  C     . ALA B 1 11  ? 98.000  116.819 63.321  1.00 26.25 ? 11   ALA B C     1 
ATOM   4941  O  O     . ALA B 1 11  ? 97.650  117.481 62.340  1.00 25.93 ? 11   ALA B O     1 
ATOM   4942  C  CB    . ALA B 1 11  ? 100.406 116.619 63.987  1.00 29.63 ? 11   ALA B CB    1 
ATOM   4943  N  N     . ASN B 1 12  ? 97.477  115.632 63.615  1.00 25.57 ? 12   ASN B N     1 
ATOM   4944  C  CA    . ASN B 1 12  ? 96.436  115.030 62.789  1.00 24.12 ? 12   ASN B CA    1 
ATOM   4945  C  C     . ASN B 1 12  ? 95.202  115.932 62.728  1.00 23.26 ? 12   ASN B C     1 
ATOM   4946  O  O     . ASN B 1 12  ? 94.548  116.035 61.692  1.00 22.78 ? 12   ASN B O     1 
ATOM   4947  C  CB    . ASN B 1 12  ? 96.052  113.655 63.343  1.00 24.78 ? 12   ASN B CB    1 
ATOM   4948  C  CG    . ASN B 1 12  ? 95.451  113.735 64.732  1.00 25.37 ? 12   ASN B CG    1 
ATOM   4949  O  OD1   . ASN B 1 12  ? 96.071  114.257 65.659  1.00 25.56 ? 12   ASN B OD1   1 
ATOM   4950  N  ND2   . ASN B 1 12  ? 94.236  113.214 64.885  1.00 25.21 ? 12   ASN B ND2   1 
ATOM   4951  N  N     . ILE B 1 13  ? 94.884  116.585 63.842  1.00 21.66 ? 13   ILE B N     1 
ATOM   4952  C  CA    . ILE B 1 13  ? 93.732  117.482 63.883  1.00 22.50 ? 13   ILE B CA    1 
ATOM   4953  C  C     . ILE B 1 13  ? 94.019  118.755 63.086  1.00 22.66 ? 13   ILE B C     1 
ATOM   4954  O  O     . ILE B 1 13  ? 93.186  119.207 62.304  1.00 21.83 ? 13   ILE B O     1 
ATOM   4955  C  CB    . ILE B 1 13  ? 93.363  117.861 65.341  1.00 22.09 ? 13   ILE B CB    1 
ATOM   4956  C  CG1   . ILE B 1 13  ? 92.872  116.617 66.092  1.00 22.17 ? 13   ILE B CG1   1 
ATOM   4957  C  CG2   . ILE B 1 13  ? 92.274  118.928 65.350  1.00 22.00 ? 13   ILE B CG2   1 
ATOM   4958  C  CD1   . ILE B 1 13  ? 91.610  115.999 65.513  1.00 21.59 ? 13   ILE B CD1   1 
ATOM   4959  N  N     . ALA B 1 14  ? 95.205  119.322 63.277  1.00 23.78 ? 14   ALA B N     1 
ATOM   4960  C  CA    . ALA B 1 14  ? 95.585  120.538 62.571  1.00 24.00 ? 14   ALA B CA    1 
ATOM   4961  C  C     . ALA B 1 14  ? 95.607  120.324 61.059  1.00 25.05 ? 14   ALA B C     1 
ATOM   4962  O  O     . ALA B 1 14  ? 95.333  121.247 60.293  1.00 24.61 ? 14   ALA B O     1 
ATOM   4963  C  CB    . ALA B 1 14  ? 96.952  121.020 63.055  1.00 25.27 ? 14   ALA B CB    1 
ATOM   4964  N  N     . ASP B 1 15  ? 95.923  119.105 60.632  1.00 25.64 ? 15   ASP B N     1 
ATOM   4965  C  CA    . ASP B 1 15  ? 95.983  118.784 59.208  1.00 27.67 ? 15   ASP B CA    1 
ATOM   4966  C  C     . ASP B 1 15  ? 94.629  118.770 58.501  1.00 29.17 ? 15   ASP B C     1 
ATOM   4967  O  O     . ASP B 1 15  ? 94.558  118.999 57.295  1.00 30.15 ? 15   ASP B O     1 
ATOM   4968  C  CB    . ASP B 1 15  ? 96.648  117.422 58.988  1.00 28.27 ? 15   ASP B CB    1 
ATOM   4969  C  CG    . ASP B 1 15  ? 98.162  117.478 59.093  1.00 30.73 ? 15   ASP B CG    1 
ATOM   4970  O  OD1   . ASP B 1 15  ? 98.724  118.589 59.219  1.00 29.38 ? 15   ASP B OD1   1 
ATOM   4971  O  OD2   . ASP B 1 15  ? 98.789  116.400 59.039  1.00 30.97 ? 15   ASP B OD2   1 
ATOM   4972  N  N     . ARG B 1 16  ? 93.555  118.502 59.236  1.00 30.37 ? 16   ARG B N     1 
ATOM   4973  C  CA    . ARG B 1 16  ? 92.243  118.439 58.603  1.00 30.14 ? 16   ARG B CA    1 
ATOM   4974  C  C     . ARG B 1 16  ? 91.144  119.298 59.208  1.00 27.82 ? 16   ARG B C     1 
ATOM   4975  O  O     . ARG B 1 16  ? 90.004  119.241 58.751  1.00 26.74 ? 16   ARG B O     1 
ATOM   4976  C  CB    . ARG B 1 16  ? 91.770  116.985 58.559  1.00 33.59 ? 16   ARG B CB    1 
ATOM   4977  C  CG    . ARG B 1 16  ? 91.940  116.237 59.874  1.00 37.73 ? 16   ARG B CG    1 
ATOM   4978  C  CD    . ARG B 1 16  ? 91.398  114.817 59.772  1.00 42.45 ? 16   ARG B CD    1 
ATOM   4979  N  NE    . ARG B 1 16  ? 89.940  114.775 59.854  1.00 43.56 ? 16   ARG B NE    1 
ATOM   4980  C  CZ    . ARG B 1 16  ? 89.198  113.737 59.480  1.00 45.59 ? 16   ARG B CZ    1 
ATOM   4981  N  NH1   . ARG B 1 16  ? 89.774  112.647 58.989  1.00 45.75 ? 16   ARG B NH1   1 
ATOM   4982  N  NH2   . ARG B 1 16  ? 87.878  113.782 59.609  1.00 45.66 ? 16   ARG B NH2   1 
ATOM   4983  N  N     . CYS B 1 17  ? 91.476  120.096 60.218  1.00 26.36 ? 17   CYS B N     1 
ATOM   4984  C  CA    . CYS B 1 17  ? 90.477  120.937 60.868  1.00 23.97 ? 17   CYS B CA    1 
ATOM   4985  C  C     . CYS B 1 17  ? 89.806  121.916 59.904  1.00 24.80 ? 17   CYS B C     1 
ATOM   4986  O  O     . CYS B 1 17  ? 90.412  122.374 58.932  1.00 22.05 ? 17   CYS B O     1 
ATOM   4987  C  CB    . CYS B 1 17  ? 91.097  121.707 62.043  1.00 23.78 ? 17   CYS B CB    1 
ATOM   4988  S  SG    . CYS B 1 17  ? 92.327  122.979 61.614  1.00 22.77 ? 17   CYS B SG    1 
ATOM   4989  N  N     . LEU B 1 18  ? 88.546  122.232 60.185  1.00 23.39 ? 18   LEU B N     1 
ATOM   4990  C  CA    . LEU B 1 18  ? 87.784  123.152 59.354  1.00 23.59 ? 18   LEU B CA    1 
ATOM   4991  C  C     . LEU B 1 18  ? 88.098  124.593 59.749  1.00 24.15 ? 18   LEU B C     1 
ATOM   4992  O  O     . LEU B 1 18  ? 87.971  125.512 58.938  1.00 24.71 ? 18   LEU B O     1 
ATOM   4993  C  CB    . LEU B 1 18  ? 86.281  122.893 59.518  1.00 23.32 ? 18   LEU B CB    1 
ATOM   4994  C  CG    . LEU B 1 18  ? 85.753  121.470 59.307  1.00 22.97 ? 18   LEU B CG    1 
ATOM   4995  C  CD1   . LEU B 1 18  ? 84.246  121.460 59.562  1.00 22.15 ? 18   LEU B CD1   1 
ATOM   4996  C  CD2   . LEU B 1 18  ? 86.062  120.987 57.897  1.00 23.25 ? 18   LEU B CD2   1 
ATOM   4997  N  N     . ILE B 1 19  ? 88.504  124.782 61.001  1.00 23.51 ? 19   ILE B N     1 
ATOM   4998  C  CA    . ILE B 1 19  ? 88.832  126.105 61.525  1.00 24.14 ? 19   ILE B CA    1 
ATOM   4999  C  C     . ILE B 1 19  ? 90.174  126.083 62.258  1.00 24.85 ? 19   ILE B C     1 
ATOM   5000  O  O     . ILE B 1 19  ? 90.319  125.393 63.272  1.00 22.35 ? 19   ILE B O     1 
ATOM   5001  C  CB    . ILE B 1 19  ? 87.760  126.588 62.534  1.00 23.73 ? 19   ILE B CB    1 
ATOM   5002  C  CG1   . ILE B 1 19  ? 86.373  126.565 61.889  1.00 25.71 ? 19   ILE B CG1   1 
ATOM   5003  C  CG2   . ILE B 1 19  ? 88.102  127.988 63.031  1.00 24.59 ? 19   ILE B CG2   1 
ATOM   5004  C  CD1   . ILE B 1 19  ? 86.203  127.539 60.752  1.00 23.73 ? 19   ILE B CD1   1 
ATOM   5005  N  N     . ASN B 1 20  ? 91.150  126.835 61.751  1.00 25.14 ? 20   ASN B N     1 
ATOM   5006  C  CA    . ASN B 1 20  ? 92.457  126.898 62.393  1.00 26.15 ? 20   ASN B CA    1 
ATOM   5007  C  C     . ASN B 1 20  ? 92.511  128.125 63.304  1.00 26.39 ? 20   ASN B C     1 
ATOM   5008  O  O     . ASN B 1 20  ? 91.581  128.935 63.317  1.00 25.92 ? 20   ASN B O     1 
ATOM   5009  C  CB    . ASN B 1 20  ? 93.576  126.966 61.346  1.00 27.73 ? 20   ASN B CB    1 
ATOM   5010  C  CG    . ASN B 1 20  ? 93.521  128.229 60.508  1.00 29.96 ? 20   ASN B CG    1 
ATOM   5011  O  OD1   . ASN B 1 20  ? 93.363  129.333 61.034  1.00 29.04 ? 20   ASN B OD1   1 
ATOM   5012  N  ND2   . ASN B 1 20  ? 93.664  128.073 59.196  1.00 30.40 ? 20   ASN B ND2   1 
ATOM   5013  N  N     . PRO B 1 21  ? 93.596  128.276 64.082  1.00 25.57 ? 21   PRO B N     1 
ATOM   5014  C  CA    . PRO B 1 21  ? 93.720  129.425 64.983  1.00 27.09 ? 21   PRO B CA    1 
ATOM   5015  C  C     . PRO B 1 21  ? 93.420  130.766 64.316  1.00 27.39 ? 21   PRO B C     1 
ATOM   5016  O  O     . PRO B 1 21  ? 92.613  131.554 64.814  1.00 27.05 ? 21   PRO B O     1 
ATOM   5017  C  CB    . PRO B 1 21  ? 95.168  129.332 65.459  1.00 26.68 ? 21   PRO B CB    1 
ATOM   5018  C  CG    . PRO B 1 21  ? 95.403  127.854 65.490  1.00 26.43 ? 21   PRO B CG    1 
ATOM   5019  C  CD    . PRO B 1 21  ? 94.770  127.389 64.199  1.00 25.77 ? 21   PRO B CD    1 
ATOM   5020  N  N     . GLU B 1 22  ? 94.079  131.020 63.191  1.00 28.41 ? 22   GLU B N     1 
ATOM   5021  C  CA    . GLU B 1 22  ? 93.900  132.272 62.461  1.00 29.68 ? 22   GLU B CA    1 
ATOM   5022  C  C     . GLU B 1 22  ? 92.458  132.473 61.998  1.00 29.30 ? 22   GLU B C     1 
ATOM   5023  O  O     . GLU B 1 22  ? 91.914  133.574 62.105  1.00 29.98 ? 22   GLU B O     1 
ATOM   5024  C  CB    . GLU B 1 22  ? 94.855  132.317 61.262  1.00 29.60 ? 22   GLU B CB    1 
ATOM   5025  N  N     . GLN B 1 23  ? 91.845  131.409 61.485  1.00 29.25 ? 23   GLN B N     1 
ATOM   5026  C  CA    . GLN B 1 23  ? 90.465  131.470 61.016  1.00 28.97 ? 23   GLN B CA    1 
ATOM   5027  C  C     . GLN B 1 23  ? 89.489  131.768 62.152  1.00 27.94 ? 23   GLN B C     1 
ATOM   5028  O  O     . GLN B 1 23  ? 88.527  132.514 61.968  1.00 28.22 ? 23   GLN B O     1 
ATOM   5029  C  CB    . GLN B 1 23  ? 90.090  130.159 60.326  1.00 31.11 ? 23   GLN B CB    1 
ATOM   5030  C  CG    . GLN B 1 23  ? 90.701  130.015 58.944  1.00 34.38 ? 23   GLN B CG    1 
ATOM   5031  C  CD    . GLN B 1 23  ? 90.638  128.597 58.415  1.00 35.83 ? 23   GLN B CD    1 
ATOM   5032  O  OE1   . GLN B 1 23  ? 90.837  128.361 57.224  1.00 39.30 ? 23   GLN B OE1   1 
ATOM   5033  N  NE2   . GLN B 1 23  ? 90.373  127.645 59.298  1.00 35.64 ? 23   GLN B NE2   1 
ATOM   5034  N  N     . TYR B 1 24  ? 89.730  131.185 63.323  1.00 25.60 ? 24   TYR B N     1 
ATOM   5035  C  CA    . TYR B 1 24  ? 88.864  131.441 64.465  1.00 24.94 ? 24   TYR B CA    1 
ATOM   5036  C  C     . TYR B 1 24  ? 88.923  132.924 64.817  1.00 24.22 ? 24   TYR B C     1 
ATOM   5037  O  O     . TYR B 1 24  ? 87.893  133.577 64.984  1.00 22.63 ? 24   TYR B O     1 
ATOM   5038  C  CB    . TYR B 1 24  ? 89.302  130.629 65.691  1.00 23.53 ? 24   TYR B CB    1 
ATOM   5039  C  CG    . TYR B 1 24  ? 88.660  131.123 66.969  1.00 23.23 ? 24   TYR B CG    1 
ATOM   5040  C  CD1   . TYR B 1 24  ? 87.330  130.819 67.272  1.00 22.33 ? 24   TYR B CD1   1 
ATOM   5041  C  CD2   . TYR B 1 24  ? 89.349  131.978 67.830  1.00 23.33 ? 24   TYR B CD2   1 
ATOM   5042  C  CE1   . TYR B 1 24  ? 86.704  131.363 68.397  1.00 22.74 ? 24   TYR B CE1   1 
ATOM   5043  C  CE2   . TYR B 1 24  ? 88.733  132.529 68.951  1.00 23.46 ? 24   TYR B CE2   1 
ATOM   5044  C  CZ    . TYR B 1 24  ? 87.411  132.220 69.228  1.00 22.79 ? 24   TYR B CZ    1 
ATOM   5045  O  OH    . TYR B 1 24  ? 86.800  132.797 70.320  1.00 19.80 ? 24   TYR B OH    1 
ATOM   5046  N  N     . GLU B 1 25  ? 90.139  133.448 64.936  1.00 25.38 ? 25   GLU B N     1 
ATOM   5047  C  CA    . GLU B 1 25  ? 90.338  134.849 65.293  1.00 25.50 ? 25   GLU B CA    1 
ATOM   5048  C  C     . GLU B 1 25  ? 89.631  135.819 64.351  1.00 25.60 ? 25   GLU B C     1 
ATOM   5049  O  O     . GLU B 1 25  ? 88.914  136.712 64.801  1.00 25.84 ? 25   GLU B O     1 
ATOM   5050  C  CB    . GLU B 1 25  ? 91.830  135.168 65.345  1.00 25.16 ? 25   GLU B CB    1 
ATOM   5051  N  N     . THR B 1 26  ? 89.826  135.642 63.048  1.00 26.85 ? 26   THR B N     1 
ATOM   5052  C  CA    . THR B 1 26  ? 89.211  136.532 62.067  1.00 28.39 ? 26   THR B CA    1 
ATOM   5053  C  C     . THR B 1 26  ? 87.696  136.391 62.019  1.00 27.44 ? 26   THR B C     1 
ATOM   5054  O  O     . THR B 1 26  ? 86.976  137.389 61.942  1.00 27.88 ? 26   THR B O     1 
ATOM   5055  C  CB    . THR B 1 26  ? 89.777  136.293 60.651  1.00 29.70 ? 26   THR B CB    1 
ATOM   5056  O  OG1   . THR B 1 26  ? 89.409  134.986 60.196  1.00 34.64 ? 26   THR B OG1   1 
ATOM   5057  C  CG2   . THR B 1 26  ? 91.292  136.407 60.665  1.00 28.65 ? 26   THR B CG2   1 
ATOM   5058  N  N     . LYS B 1 27  ? 87.209  135.156 62.066  1.00 25.88 ? 27   LYS B N     1 
ATOM   5059  C  CA    . LYS B 1 27  ? 85.772  134.923 62.030  1.00 24.44 ? 27   LYS B CA    1 
ATOM   5060  C  C     . LYS B 1 27  ? 85.092  135.441 63.291  1.00 22.21 ? 27   LYS B C     1 
ATOM   5061  O  O     . LYS B 1 27  ? 84.019  136.034 63.220  1.00 22.56 ? 27   LYS B O     1 
ATOM   5062  C  CB    . LYS B 1 27  ? 85.482  133.435 61.839  1.00 26.83 ? 27   LYS B CB    1 
ATOM   5063  C  CG    . LYS B 1 27  ? 85.781  132.953 60.432  1.00 30.18 ? 27   LYS B CG    1 
ATOM   5064  C  CD    . LYS B 1 27  ? 85.559  131.459 60.275  1.00 32.32 ? 27   LYS B CD    1 
ATOM   5065  C  CE    . LYS B 1 27  ? 85.878  131.031 58.850  1.00 35.10 ? 27   LYS B CE    1 
ATOM   5066  N  NZ    . LYS B 1 27  ? 85.788  129.559 58.650  1.00 37.84 ? 27   LYS B NZ    1 
ATOM   5067  N  N     . TYR B 1 28  ? 85.714  135.228 64.446  1.00 21.23 ? 28   TYR B N     1 
ATOM   5068  C  CA    . TYR B 1 28  ? 85.122  135.709 65.688  1.00 20.13 ? 28   TYR B CA    1 
ATOM   5069  C  C     . TYR B 1 28  ? 85.000  137.231 65.647  1.00 20.13 ? 28   TYR B C     1 
ATOM   5070  O  O     . TYR B 1 28  ? 83.966  137.796 66.010  1.00 19.15 ? 28   TYR B O     1 
ATOM   5071  C  CB    . TYR B 1 28  ? 85.970  135.311 66.901  1.00 18.19 ? 28   TYR B CB    1 
ATOM   5072  C  CG    . TYR B 1 28  ? 85.374  135.817 68.190  1.00 18.33 ? 28   TYR B CG    1 
ATOM   5073  C  CD1   . TYR B 1 28  ? 84.306  135.152 68.794  1.00 18.34 ? 28   TYR B CD1   1 
ATOM   5074  C  CD2   . TYR B 1 28  ? 85.815  137.007 68.763  1.00 18.16 ? 28   TYR B CD2   1 
ATOM   5075  C  CE1   . TYR B 1 28  ? 83.691  135.666 69.933  1.00 18.54 ? 28   TYR B CE1   1 
ATOM   5076  C  CE2   . TYR B 1 28  ? 85.205  137.531 69.901  1.00 18.28 ? 28   TYR B CE2   1 
ATOM   5077  C  CZ    . TYR B 1 28  ? 84.143  136.855 70.479  1.00 18.04 ? 28   TYR B CZ    1 
ATOM   5078  O  OH    . TYR B 1 28  ? 83.522  137.380 71.588  1.00 19.05 ? 28   TYR B OH    1 
ATOM   5079  N  N     . LYS B 1 29  ? 86.067  137.888 65.201  1.00 20.78 ? 29   LYS B N     1 
ATOM   5080  C  CA    . LYS B 1 29  ? 86.095  139.342 65.117  1.00 22.66 ? 29   LYS B CA    1 
ATOM   5081  C  C     . LYS B 1 29  ? 84.957  139.866 64.248  1.00 21.47 ? 29   LYS B C     1 
ATOM   5082  O  O     . LYS B 1 29  ? 84.271  140.816 64.620  1.00 23.87 ? 29   LYS B O     1 
ATOM   5083  C  CB    . LYS B 1 29  ? 87.441  139.811 64.552  1.00 24.48 ? 29   LYS B CB    1 
ATOM   5084  C  CG    . LYS B 1 29  ? 87.655  141.311 64.643  1.00 29.91 ? 29   LYS B CG    1 
ATOM   5085  C  CD    . LYS B 1 29  ? 89.045  141.709 64.155  1.00 32.64 ? 29   LYS B CD    1 
ATOM   5086  C  CE    . LYS B 1 29  ? 89.268  143.204 64.315  1.00 35.60 ? 29   LYS B CE    1 
ATOM   5087  N  NZ    . LYS B 1 29  ? 90.626  143.625 63.862  1.00 38.58 ? 29   LYS B NZ    1 
ATOM   5088  N  N     . GLN B 1 30  ? 84.756  139.242 63.094  1.00 22.01 ? 30   GLN B N     1 
ATOM   5089  C  CA    . GLN B 1 30  ? 83.693  139.653 62.187  1.00 22.63 ? 30   GLN B CA    1 
ATOM   5090  C  C     . GLN B 1 30  ? 82.313  139.342 62.763  1.00 22.02 ? 30   GLN B C     1 
ATOM   5091  O  O     . GLN B 1 30  ? 81.372  140.116 62.592  1.00 20.81 ? 30   GLN B O     1 
ATOM   5092  C  CB    . GLN B 1 30  ? 83.835  138.947 60.840  1.00 24.89 ? 30   GLN B CB    1 
ATOM   5093  C  CG    . GLN B 1 30  ? 82.864  139.461 59.786  1.00 28.74 ? 30   GLN B CG    1 
ATOM   5094  C  CD    . GLN B 1 30  ? 82.753  138.539 58.586  1.00 30.84 ? 30   GLN B CD    1 
ATOM   5095  O  OE1   . GLN B 1 30  ? 82.265  138.937 57.529  1.00 33.21 ? 30   GLN B OE1   1 
ATOM   5096  N  NE2   . GLN B 1 30  ? 83.194  137.298 58.747  1.00 33.10 ? 30   GLN B NE2   1 
ATOM   5097  N  N     . SER B 1 31  ? 82.192  138.205 63.443  1.00 21.37 ? 31   SER B N     1 
ATOM   5098  C  CA    . SER B 1 31  ? 80.911  137.809 64.025  1.00 21.10 ? 31   SER B CA    1 
ATOM   5099  C  C     . SER B 1 31  ? 80.450  138.808 65.076  1.00 22.34 ? 31   SER B C     1 
ATOM   5100  O  O     . SER B 1 31  ? 79.252  138.932 65.346  1.00 22.53 ? 31   SER B O     1 
ATOM   5101  C  CB    . SER B 1 31  ? 81.014  136.420 64.665  1.00 20.17 ? 31   SER B CB    1 
ATOM   5102  O  OG    . SER B 1 31  ? 81.718  136.463 65.896  1.00 19.54 ? 31   SER B OG    1 
ATOM   5103  N  N     . ILE B 1 32  ? 81.406  139.519 65.663  1.00 21.87 ? 32   ILE B N     1 
ATOM   5104  C  CA    . ILE B 1 32  ? 81.109  140.497 66.697  1.00 24.28 ? 32   ILE B CA    1 
ATOM   5105  C  C     . ILE B 1 32  ? 80.958  141.910 66.137  1.00 25.02 ? 32   ILE B C     1 
ATOM   5106  O  O     . ILE B 1 32  ? 80.018  142.626 66.489  1.00 25.27 ? 32   ILE B O     1 
ATOM   5107  C  CB    . ILE B 1 32  ? 82.215  140.496 67.778  1.00 25.43 ? 32   ILE B CB    1 
ATOM   5108  C  CG1   . ILE B 1 32  ? 82.328  139.096 68.392  1.00 25.57 ? 32   ILE B CG1   1 
ATOM   5109  C  CG2   . ILE B 1 32  ? 81.914  141.541 68.847  1.00 27.33 ? 32   ILE B CG2   1 
ATOM   5110  C  CD1   . ILE B 1 32  ? 81.008  138.509 68.863  1.00 23.59 ? 32   ILE B CD1   1 
ATOM   5111  N  N     . ASN B 1 33  ? 81.881  142.307 65.266  1.00 25.27 ? 33   ASN B N     1 
ATOM   5112  C  CA    . ASN B 1 33  ? 81.844  143.637 64.668  1.00 27.65 ? 33   ASN B CA    1 
ATOM   5113  C  C     . ASN B 1 33  ? 80.755  143.784 63.611  1.00 27.25 ? 33   ASN B C     1 
ATOM   5114  O  O     . ASN B 1 33  ? 80.164  144.859 63.466  1.00 26.63 ? 33   ASN B O     1 
ATOM   5115  C  CB    . ASN B 1 33  ? 83.203  143.979 64.046  1.00 30.08 ? 33   ASN B CB    1 
ATOM   5116  C  CG    . ASN B 1 33  ? 84.180  144.544 65.060  1.00 34.33 ? 33   ASN B CG    1 
ATOM   5117  O  OD1   . ASN B 1 33  ? 84.488  143.908 66.068  1.00 36.13 ? 33   ASN B OD1   1 
ATOM   5118  N  ND2   . ASN B 1 33  ? 84.672  145.751 64.796  1.00 36.14 ? 33   ASN B ND2   1 
ATOM   5119  N  N     . ASP B 1 34  ? 80.488  142.708 62.876  1.00 23.98 ? 34   ASP B N     1 
ATOM   5120  C  CA    . ASP B 1 34  ? 79.472  142.752 61.831  1.00 23.47 ? 34   ASP B CA    1 
ATOM   5121  C  C     . ASP B 1 34  ? 78.657  141.462 61.778  1.00 21.54 ? 34   ASP B C     1 
ATOM   5122  O  O     . ASP B 1 34  ? 78.789  140.669 60.846  1.00 19.30 ? 34   ASP B O     1 
ATOM   5123  C  CB    . ASP B 1 34  ? 80.133  143.006 60.472  1.00 24.41 ? 34   ASP B CB    1 
ATOM   5124  C  CG    . ASP B 1 34  ? 79.121  143.244 59.364  1.00 26.92 ? 34   ASP B CG    1 
ATOM   5125  O  OD1   . ASP B 1 34  ? 77.905  143.276 59.655  1.00 25.36 ? 34   ASP B OD1   1 
ATOM   5126  O  OD2   . ASP B 1 34  ? 79.546  143.403 58.198  1.00 27.36 ? 34   ASP B OD2   1 
ATOM   5127  N  N     . PRO B 1 35  ? 77.795  141.243 62.783  1.00 20.92 ? 35   PRO B N     1 
ATOM   5128  C  CA    . PRO B 1 35  ? 76.962  140.039 62.838  1.00 20.78 ? 35   PRO B CA    1 
ATOM   5129  C  C     . PRO B 1 35  ? 76.040  139.844 61.637  1.00 21.42 ? 35   PRO B C     1 
ATOM   5130  O  O     . PRO B 1 35  ? 75.798  138.709 61.225  1.00 20.87 ? 35   PRO B O     1 
ATOM   5131  C  CB    . PRO B 1 35  ? 76.195  140.206 64.149  1.00 21.66 ? 35   PRO B CB    1 
ATOM   5132  C  CG    . PRO B 1 35  ? 76.125  141.685 64.323  1.00 22.68 ? 35   PRO B CG    1 
ATOM   5133  C  CD    . PRO B 1 35  ? 77.516  142.120 63.933  1.00 21.33 ? 35   PRO B CD    1 
ATOM   5134  N  N     . ASP B 1 36  ? 75.524  140.936 61.076  1.00 21.11 ? 36   ASP B N     1 
ATOM   5135  C  CA    . ASP B 1 36  ? 74.638  140.823 59.920  1.00 21.65 ? 36   ASP B CA    1 
ATOM   5136  C  C     . ASP B 1 36  ? 75.336  140.142 58.755  1.00 21.54 ? 36   ASP B C     1 
ATOM   5137  O  O     . ASP B 1 36  ? 74.778  139.242 58.134  1.00 23.02 ? 36   ASP B O     1 
ATOM   5138  C  CB    . ASP B 1 36  ? 74.129  142.201 59.480  1.00 24.02 ? 36   ASP B CB    1 
ATOM   5139  C  CG    . ASP B 1 36  ? 72.903  142.639 60.252  1.00 26.56 ? 36   ASP B CG    1 
ATOM   5140  O  OD1   . ASP B 1 36  ? 72.443  143.781 60.049  1.00 30.28 ? 36   ASP B OD1   1 
ATOM   5141  O  OD2   . ASP B 1 36  ? 72.389  141.837 61.061  1.00 26.12 ? 36   ASP B OD2   1 
ATOM   5142  N  N     . THR B 1 37  ? 76.557  140.568 58.456  1.00 20.45 ? 37   THR B N     1 
ATOM   5143  C  CA    . THR B 1 37  ? 77.305  139.966 57.360  1.00 20.13 ? 37   THR B CA    1 
ATOM   5144  C  C     . THR B 1 37  ? 77.768  138.558 57.716  1.00 20.31 ? 37   THR B C     1 
ATOM   5145  O  O     . THR B 1 37  ? 77.650  137.634 56.912  1.00 20.89 ? 37   THR B O     1 
ATOM   5146  C  CB    . THR B 1 37  ? 78.534  140.819 56.996  1.00 21.89 ? 37   THR B CB    1 
ATOM   5147  O  OG1   . THR B 1 37  ? 78.089  142.068 56.454  1.00 20.74 ? 37   THR B OG1   1 
ATOM   5148  C  CG2   . THR B 1 37  ? 79.411  140.101 55.972  1.00 20.73 ? 37   THR B CG2   1 
ATOM   5149  N  N     . PHE B 1 38  ? 78.294  138.395 58.924  1.00 20.01 ? 38   PHE B N     1 
ATOM   5150  C  CA    . PHE B 1 38  ? 78.770  137.087 59.347  1.00 20.11 ? 38   PHE B CA    1 
ATOM   5151  C  C     . PHE B 1 38  ? 77.649  136.054 59.336  1.00 18.25 ? 38   PHE B C     1 
ATOM   5152  O  O     . PHE B 1 38  ? 77.761  135.010 58.697  1.00 17.54 ? 38   PHE B O     1 
ATOM   5153  C  CB    . PHE B 1 38  ? 79.362  137.144 60.755  1.00 21.16 ? 38   PHE B CB    1 
ATOM   5154  C  CG    . PHE B 1 38  ? 79.875  135.815 61.233  1.00 21.64 ? 38   PHE B CG    1 
ATOM   5155  C  CD1   . PHE B 1 38  ? 81.126  135.358 60.837  1.00 21.22 ? 38   PHE B CD1   1 
ATOM   5156  C  CD2   . PHE B 1 38  ? 79.075  134.988 62.021  1.00 21.25 ? 38   PHE B CD2   1 
ATOM   5157  C  CE1   . PHE B 1 38  ? 81.577  134.093 61.213  1.00 21.41 ? 38   PHE B CE1   1 
ATOM   5158  C  CE2   . PHE B 1 38  ? 79.513  133.725 62.401  1.00 19.22 ? 38   PHE B CE2   1 
ATOM   5159  C  CZ    . PHE B 1 38  ? 80.767  133.275 61.997  1.00 22.51 ? 38   PHE B CZ    1 
ATOM   5160  N  N     . TRP B 1 39  ? 76.569  136.346 60.051  1.00 18.25 ? 39   TRP B N     1 
ATOM   5161  C  CA    . TRP B 1 39  ? 75.458  135.409 60.117  1.00 18.24 ? 39   TRP B CA    1 
ATOM   5162  C  C     . TRP B 1 39  ? 74.645  135.360 58.834  1.00 18.04 ? 39   TRP B C     1 
ATOM   5163  O  O     . TRP B 1 39  ? 73.991  134.356 58.542  1.00 17.62 ? 39   TRP B O     1 
ATOM   5164  C  CB    . TRP B 1 39  ? 74.582  135.732 61.327  1.00 19.21 ? 39   TRP B CB    1 
ATOM   5165  C  CG    . TRP B 1 39  ? 75.269  135.364 62.614  1.00 16.95 ? 39   TRP B CG    1 
ATOM   5166  C  CD1   . TRP B 1 39  ? 75.698  136.214 63.592  1.00 17.23 ? 39   TRP B CD1   1 
ATOM   5167  C  CD2   . TRP B 1 39  ? 75.650  134.046 63.029  1.00 18.05 ? 39   TRP B CD2   1 
ATOM   5168  N  NE1   . TRP B 1 39  ? 76.329  135.506 64.593  1.00 16.08 ? 39   TRP B NE1   1 
ATOM   5169  C  CE2   . TRP B 1 39  ? 76.312  134.173 64.272  1.00 16.87 ? 39   TRP B CE2   1 
ATOM   5170  C  CE3   . TRP B 1 39  ? 75.497  132.768 62.471  1.00 16.83 ? 39   TRP B CE3   1 
ATOM   5171  C  CZ2   . TRP B 1 39  ? 76.821  133.069 64.968  1.00 16.60 ? 39   TRP B CZ2   1 
ATOM   5172  C  CZ3   . TRP B 1 39  ? 76.004  131.668 63.165  1.00 17.96 ? 39   TRP B CZ3   1 
ATOM   5173  C  CH2   . TRP B 1 39  ? 76.659  131.831 64.402  1.00 15.24 ? 39   TRP B CH2   1 
ATOM   5174  N  N     . GLY B 1 40  ? 74.687  136.439 58.061  1.00 18.61 ? 40   GLY B N     1 
ATOM   5175  C  CA    . GLY B 1 40  ? 73.968  136.445 56.802  1.00 18.60 ? 40   GLY B CA    1 
ATOM   5176  C  C     . GLY B 1 40  ? 74.581  135.387 55.900  1.00 19.58 ? 40   GLY B C     1 
ATOM   5177  O  O     . GLY B 1 40  ? 73.883  134.718 55.139  1.00 20.03 ? 40   GLY B O     1 
ATOM   5178  N  N     . GLU B 1 41  ? 75.898  135.227 55.996  1.00 20.43 ? 41   GLU B N     1 
ATOM   5179  C  CA    . GLU B 1 41  ? 76.610  134.243 55.189  1.00 21.12 ? 41   GLU B CA    1 
ATOM   5180  C  C     . GLU B 1 41  ? 76.540  132.839 55.793  1.00 20.72 ? 41   GLU B C     1 
ATOM   5181  O  O     . GLU B 1 41  ? 76.301  131.862 55.087  1.00 19.79 ? 41   GLU B O     1 
ATOM   5182  C  CB    . GLU B 1 41  ? 78.076  134.653 55.032  1.00 23.65 ? 41   GLU B CB    1 
ATOM   5183  C  CG    . GLU B 1 41  ? 78.282  135.941 54.247  1.00 28.99 ? 41   GLU B CG    1 
ATOM   5184  C  CD    . GLU B 1 41  ? 79.727  136.409 54.258  1.00 32.93 ? 41   GLU B CD    1 
ATOM   5185  O  OE1   . GLU B 1 41  ? 80.027  137.429 53.602  1.00 34.59 ? 41   GLU B OE1   1 
ATOM   5186  O  OE2   . GLU B 1 41  ? 80.560  135.760 54.925  1.00 36.16 ? 41   GLU B OE2   1 
ATOM   5187  N  N     . GLN B 1 42  ? 76.742  132.739 57.102  1.00 19.05 ? 42   GLN B N     1 
ATOM   5188  C  CA    . GLN B 1 42  ? 76.708  131.436 57.755  1.00 19.23 ? 42   GLN B CA    1 
ATOM   5189  C  C     . GLN B 1 42  ? 75.312  130.809 57.744  1.00 19.16 ? 42   GLN B C     1 
ATOM   5190  O  O     . GLN B 1 42  ? 75.170  129.589 57.846  1.00 17.81 ? 42   GLN B O     1 
ATOM   5191  C  CB    . GLN B 1 42  ? 77.221  131.549 59.196  1.00 19.19 ? 42   GLN B CB    1 
ATOM   5192  C  CG    . GLN B 1 42  ? 77.286  130.209 59.922  1.00 16.68 ? 42   GLN B CG    1 
ATOM   5193  C  CD    . GLN B 1 42  ? 78.127  129.180 59.183  1.00 19.53 ? 42   GLN B CD    1 
ATOM   5194  O  OE1   . GLN B 1 42  ? 77.881  127.975 59.280  1.00 18.58 ? 42   GLN B OE1   1 
ATOM   5195  N  NE2   . GLN B 1 42  ? 79.133  129.649 58.453  1.00 17.34 ? 42   GLN B NE2   1 
ATOM   5196  N  N     . GLY B 1 43  ? 74.284  131.642 57.621  1.00 19.97 ? 43   GLY B N     1 
ATOM   5197  C  CA    . GLY B 1 43  ? 72.926  131.127 57.593  1.00 19.47 ? 43   GLY B CA    1 
ATOM   5198  C  C     . GLY B 1 43  ? 72.699  130.219 56.398  1.00 20.48 ? 43   GLY B C     1 
ATOM   5199  O  O     . GLY B 1 43  ? 71.765  129.415 56.381  1.00 19.05 ? 43   GLY B O     1 
ATOM   5200  N  N     . LYS B 1 44  ? 73.565  130.337 55.395  1.00 20.43 ? 44   LYS B N     1 
ATOM   5201  C  CA    . LYS B 1 44  ? 73.455  129.523 54.190  1.00 19.93 ? 44   LYS B CA    1 
ATOM   5202  C  C     . LYS B 1 44  ? 73.775  128.053 54.443  1.00 18.51 ? 44   LYS B C     1 
ATOM   5203  O  O     . LYS B 1 44  ? 73.684  127.226 53.532  1.00 17.91 ? 44   LYS B O     1 
ATOM   5204  C  CB    . LYS B 1 44  ? 74.378  130.072 53.095  1.00 23.40 ? 44   LYS B CB    1 
ATOM   5205  C  CG    . LYS B 1 44  ? 74.102  131.524 52.721  1.00 26.93 ? 44   LYS B CG    1 
ATOM   5206  C  CD    . LYS B 1 44  ? 72.665  131.724 52.258  1.00 30.22 ? 44   LYS B CD    1 
ATOM   5207  C  CE    . LYS B 1 44  ? 72.408  133.181 51.882  1.00 33.15 ? 44   LYS B CE    1 
ATOM   5208  N  NZ    . LYS B 1 44  ? 71.003  133.411 51.445  1.00 37.05 ? 44   LYS B NZ    1 
ATOM   5209  N  N     . ILE B 1 45  ? 74.157  127.725 55.673  1.00 17.46 ? 45   ILE B N     1 
ATOM   5210  C  CA    . ILE B 1 45  ? 74.457  126.340 56.021  1.00 14.94 ? 45   ILE B CA    1 
ATOM   5211  C  C     . ILE B 1 45  ? 73.158  125.539 55.924  1.00 15.61 ? 45   ILE B C     1 
ATOM   5212  O  O     . ILE B 1 45  ? 73.174  124.307 55.876  1.00 15.92 ? 45   ILE B O     1 
ATOM   5213  C  CB    . ILE B 1 45  ? 75.031  126.229 57.458  1.00 16.76 ? 45   ILE B CB    1 
ATOM   5214  C  CG1   . ILE B 1 45  ? 75.500  124.798 57.724  1.00 15.37 ? 45   ILE B CG1   1 
ATOM   5215  C  CG2   . ILE B 1 45  ? 73.970  126.645 58.486  1.00 15.90 ? 45   ILE B CG2   1 
ATOM   5216  C  CD1   . ILE B 1 45  ? 76.210  124.635 59.050  1.00 17.72 ? 45   ILE B CD1   1 
ATOM   5217  N  N     . LEU B 1 46  ? 72.033  126.253 55.888  1.00 15.53 ? 46   LEU B N     1 
ATOM   5218  C  CA    . LEU B 1 46  ? 70.715  125.629 55.790  1.00 16.63 ? 46   LEU B CA    1 
ATOM   5219  C  C     . LEU B 1 46  ? 70.048  125.984 54.465  1.00 16.53 ? 46   LEU B C     1 
ATOM   5220  O  O     . LEU B 1 46  ? 70.416  126.973 53.826  1.00 16.81 ? 46   LEU B O     1 
ATOM   5221  C  CB    . LEU B 1 46  ? 69.793  126.117 56.915  1.00 15.47 ? 46   LEU B CB    1 
ATOM   5222  C  CG    . LEU B 1 46  ? 70.205  125.988 58.385  1.00 15.85 ? 46   LEU B CG    1 
ATOM   5223  C  CD1   . LEU B 1 46  ? 69.029  126.415 59.255  1.00 14.68 ? 46   LEU B CD1   1 
ATOM   5224  C  CD2   . LEU B 1 46  ? 70.608  124.556 58.703  1.00 15.60 ? 46   LEU B CD2   1 
ATOM   5225  N  N     . ASP B 1 47  ? 69.071  125.171 54.068  1.00 18.03 ? 47   ASP B N     1 
ATOM   5226  C  CA    . ASP B 1 47  ? 68.295  125.413 52.854  1.00 18.32 ? 47   ASP B CA    1 
ATOM   5227  C  C     . ASP B 1 47  ? 67.117  126.272 53.282  1.00 18.61 ? 47   ASP B C     1 
ATOM   5228  O  O     . ASP B 1 47  ? 66.420  125.940 54.246  1.00 18.52 ? 47   ASP B O     1 
ATOM   5229  C  CB    . ASP B 1 47  ? 67.736  124.114 52.261  1.00 20.16 ? 47   ASP B CB    1 
ATOM   5230  C  CG    . ASP B 1 47  ? 68.769  123.313 51.492  1.00 22.50 ? 47   ASP B CG    1 
ATOM   5231  O  OD1   . ASP B 1 47  ? 68.376  122.302 50.866  1.00 23.35 ? 47   ASP B OD1   1 
ATOM   5232  O  OD2   . ASP B 1 47  ? 69.961  123.683 51.509  1.00 23.79 ? 47   ASP B OD2   1 
ATOM   5233  N  N     . TRP B 1 48  ? 66.890  127.373 52.576  1.00 17.71 ? 48   TRP B N     1 
ATOM   5234  C  CA    . TRP B 1 48  ? 65.775  128.249 52.894  1.00 17.07 ? 48   TRP B CA    1 
ATOM   5235  C  C     . TRP B 1 48  ? 64.748  128.186 51.771  1.00 17.97 ? 48   TRP B C     1 
ATOM   5236  O  O     . TRP B 1 48  ? 65.109  128.208 50.592  1.00 20.27 ? 48   TRP B O     1 
ATOM   5237  C  CB    . TRP B 1 48  ? 66.264  129.690 53.085  1.00 16.61 ? 48   TRP B CB    1 
ATOM   5238  C  CG    . TRP B 1 48  ? 67.140  129.846 54.286  1.00 16.32 ? 48   TRP B CG    1 
ATOM   5239  C  CD1   . TRP B 1 48  ? 68.449  129.474 54.401  1.00 16.04 ? 48   TRP B CD1   1 
ATOM   5240  C  CD2   . TRP B 1 48  ? 66.743  130.327 55.575  1.00 14.00 ? 48   TRP B CD2   1 
ATOM   5241  N  NE1   . TRP B 1 48  ? 68.891  129.689 55.685  1.00 15.43 ? 48   TRP B NE1   1 
ATOM   5242  C  CE2   . TRP B 1 48  ? 67.863  130.210 56.427  1.00 15.17 ? 48   TRP B CE2   1 
ATOM   5243  C  CE3   . TRP B 1 48  ? 65.547  130.841 56.095  1.00 14.00 ? 48   TRP B CE3   1 
ATOM   5244  C  CZ2   . TRP B 1 48  ? 67.823  130.588 57.774  1.00 15.95 ? 48   TRP B CZ2   1 
ATOM   5245  C  CZ3   . TRP B 1 48  ? 65.507  131.217 57.436  1.00 14.33 ? 48   TRP B CZ3   1 
ATOM   5246  C  CH2   . TRP B 1 48  ? 66.639  131.087 58.259  1.00 14.05 ? 48   TRP B CH2   1 
ATOM   5247  N  N     . ILE B 1 49  ? 63.473  128.083 52.136  1.00 18.05 ? 49   ILE B N     1 
ATOM   5248  C  CA    . ILE B 1 49  ? 62.400  128.027 51.147  1.00 16.65 ? 49   ILE B CA    1 
ATOM   5249  C  C     . ILE B 1 49  ? 62.272  129.421 50.526  1.00 17.32 ? 49   ILE B C     1 
ATOM   5250  O  O     . ILE B 1 49  ? 62.121  129.558 49.314  1.00 19.13 ? 49   ILE B O     1 
ATOM   5251  C  CB    . ILE B 1 49  ? 61.092  127.561 51.803  1.00 18.27 ? 49   ILE B CB    1 
ATOM   5252  C  CG1   . ILE B 1 49  ? 61.300  126.138 52.351  1.00 19.33 ? 49   ILE B CG1   1 
ATOM   5253  C  CG2   . ILE B 1 49  ? 59.952  127.582 50.786  1.00 18.27 ? 49   ILE B CG2   1 
ATOM   5254  C  CD1   . ILE B 1 49  ? 60.139  125.571 53.124  1.00 19.19 ? 49   ILE B CD1   1 
ATOM   5255  N  N     . THR B 1 50  ? 62.321  130.449 51.363  1.00 16.26 ? 50   THR B N     1 
ATOM   5256  C  CA    . THR B 1 50  ? 62.321  131.829 50.883  1.00 18.10 ? 50   THR B CA    1 
ATOM   5257  C  C     . THR B 1 50  ? 63.485  132.446 51.641  1.00 17.99 ? 50   THR B C     1 
ATOM   5258  O  O     . THR B 1 50  ? 63.622  132.251 52.852  1.00 15.35 ? 50   THR B O     1 
ATOM   5259  C  CB    . THR B 1 50  ? 61.013  132.617 51.190  1.00 17.97 ? 50   THR B CB    1 
ATOM   5260  O  OG1   . THR B 1 50  ? 60.772  132.655 52.601  1.00 19.92 ? 50   THR B OG1   1 
ATOM   5261  C  CG2   . THR B 1 50  ? 59.833  131.990 50.471  1.00 16.47 ? 50   THR B CG2   1 
ATOM   5262  N  N     . PRO B 1 51  ? 64.352  133.183 50.936  1.00 20.25 ? 51   PRO B N     1 
ATOM   5263  C  CA    . PRO B 1 51  ? 65.519  133.823 51.547  1.00 20.56 ? 51   PRO B CA    1 
ATOM   5264  C  C     . PRO B 1 51  ? 65.189  134.924 52.540  1.00 20.70 ? 51   PRO B C     1 
ATOM   5265  O  O     . PRO B 1 51  ? 64.163  135.594 52.432  1.00 22.06 ? 51   PRO B O     1 
ATOM   5266  C  CB    . PRO B 1 51  ? 66.275  134.365 50.342  1.00 21.82 ? 51   PRO B CB    1 
ATOM   5267  C  CG    . PRO B 1 51  ? 65.145  134.777 49.431  1.00 21.67 ? 51   PRO B CG    1 
ATOM   5268  C  CD    . PRO B 1 51  ? 64.228  133.571 49.517  1.00 19.86 ? 51   PRO B CD    1 
ATOM   5269  N  N     . TYR B 1 52  ? 66.063  135.101 53.522  1.00 19.68 ? 52   TYR B N     1 
ATOM   5270  C  CA    . TYR B 1 52  ? 65.874  136.162 54.494  1.00 21.69 ? 52   TYR B CA    1 
ATOM   5271  C  C     . TYR B 1 52  ? 66.615  137.370 53.943  1.00 21.74 ? 52   TYR B C     1 
ATOM   5272  O  O     . TYR B 1 52  ? 67.480  137.228 53.086  1.00 23.79 ? 52   TYR B O     1 
ATOM   5273  C  CB    . TYR B 1 52  ? 66.469  135.767 55.847  1.00 19.01 ? 52   TYR B CB    1 
ATOM   5274  C  CG    . TYR B 1 52  ? 67.857  135.164 55.764  1.00 18.16 ? 52   TYR B CG    1 
ATOM   5275  C  CD1   . TYR B 1 52  ? 68.984  135.957 55.535  1.00 17.56 ? 52   TYR B CD1   1 
ATOM   5276  C  CD2   . TYR B 1 52  ? 68.037  133.791 55.903  1.00 16.38 ? 52   TYR B CD2   1 
ATOM   5277  C  CE1   . TYR B 1 52  ? 70.258  135.388 55.448  1.00 18.05 ? 52   TYR B CE1   1 
ATOM   5278  C  CE2   . TYR B 1 52  ? 69.292  133.215 55.817  1.00 17.98 ? 52   TYR B CE2   1 
ATOM   5279  C  CZ    . TYR B 1 52  ? 70.401  134.012 55.590  1.00 16.59 ? 52   TYR B CZ    1 
ATOM   5280  O  OH    . TYR B 1 52  ? 71.640  133.418 55.500  1.00 18.67 ? 52   TYR B OH    1 
ATOM   5281  N  N     . GLN B 1 53  ? 66.257  138.554 54.416  1.00 23.50 ? 53   GLN B N     1 
ATOM   5282  C  CA    . GLN B 1 53  ? 66.938  139.769 54.000  1.00 24.32 ? 53   GLN B CA    1 
ATOM   5283  C  C     . GLN B 1 53  ? 67.547  140.305 55.285  1.00 23.78 ? 53   GLN B C     1 
ATOM   5284  O  O     . GLN B 1 53  ? 68.749  140.546 55.367  1.00 25.92 ? 53   GLN B O     1 
ATOM   5285  C  CB    . GLN B 1 53  ? 65.950  140.774 53.410  1.00 25.03 ? 53   GLN B CB    1 
ATOM   5286  N  N     . LYS B 1 54  ? 66.700  140.463 56.297  1.00 23.32 ? 54   LYS B N     1 
ATOM   5287  C  CA    . LYS B 1 54  ? 67.133  140.946 57.600  1.00 22.29 ? 54   LYS B CA    1 
ATOM   5288  C  C     . LYS B 1 54  ? 67.804  139.792 58.339  1.00 21.34 ? 54   LYS B C     1 
ATOM   5289  O  O     . LYS B 1 54  ? 67.387  138.640 58.215  1.00 21.35 ? 54   LYS B O     1 
ATOM   5290  C  CB    . LYS B 1 54  ? 65.935  141.450 58.390  1.00 23.16 ? 54   LYS B CB    1 
ATOM   5291  N  N     . VAL B 1 55  ? 68.849  140.096 59.098  1.00 19.35 ? 55   VAL B N     1 
ATOM   5292  C  CA    . VAL B 1 55  ? 69.554  139.059 59.844  1.00 19.19 ? 55   VAL B CA    1 
ATOM   5293  C  C     . VAL B 1 55  ? 69.351  139.260 61.339  1.00 18.97 ? 55   VAL B C     1 
ATOM   5294  O  O     . VAL B 1 55  ? 68.508  138.602 61.945  1.00 21.22 ? 55   VAL B O     1 
ATOM   5295  C  CB    . VAL B 1 55  ? 71.061  139.067 59.504  1.00 17.72 ? 55   VAL B CB    1 
ATOM   5296  C  CG1   . VAL B 1 55  ? 71.801  138.020 60.335  1.00 15.55 ? 55   VAL B CG1   1 
ATOM   5297  C  CG2   . VAL B 1 55  ? 71.243  138.793 58.014  1.00 17.76 ? 55   VAL B CG2   1 
ATOM   5298  N  N     . LYS B 1 56  ? 70.105  140.184 61.926  1.00 18.93 ? 56   LYS B N     1 
ATOM   5299  C  CA    . LYS B 1 56  ? 70.001  140.468 63.354  1.00 18.85 ? 56   LYS B CA    1 
ATOM   5300  C  C     . LYS B 1 56  ? 69.012  141.591 63.685  1.00 19.95 ? 56   LYS B C     1 
ATOM   5301  O  O     . LYS B 1 56  ? 69.124  142.700 63.164  1.00 20.59 ? 56   LYS B O     1 
ATOM   5302  C  CB    . LYS B 1 56  ? 71.383  140.829 63.903  1.00 17.92 ? 56   LYS B CB    1 
ATOM   5303  C  CG    . LYS B 1 56  ? 71.431  141.051 65.407  1.00 18.27 ? 56   LYS B CG    1 
ATOM   5304  C  CD    . LYS B 1 56  ? 72.864  141.254 65.883  1.00 18.66 ? 56   LYS B CD    1 
ATOM   5305  C  CE    . LYS B 1 56  ? 72.942  141.380 67.396  1.00 17.38 ? 56   LYS B CE    1 
ATOM   5306  N  NZ    . LYS B 1 56  ? 72.219  142.584 67.896  1.00 19.22 ? 56   LYS B NZ    1 
ATOM   5307  N  N     . ASN B 1 57  ? 68.043  141.301 64.550  1.00 18.52 ? 57   ASN B N     1 
ATOM   5308  C  CA    . ASN B 1 57  ? 67.059  142.301 64.972  1.00 19.82 ? 57   ASN B CA    1 
ATOM   5309  C  C     . ASN B 1 57  ? 66.708  141.972 66.420  1.00 19.37 ? 57   ASN B C     1 
ATOM   5310  O  O     . ASN B 1 57  ? 65.670  141.375 66.705  1.00 19.43 ? 57   ASN B O     1 
ATOM   5311  C  CB    . ASN B 1 57  ? 65.817  142.246 64.071  1.00 19.03 ? 57   ASN B CB    1 
ATOM   5312  C  CG    . ASN B 1 57  ? 64.788  143.316 64.415  1.00 20.62 ? 57   ASN B CG    1 
ATOM   5313  O  OD1   . ASN B 1 57  ? 65.114  144.343 65.012  1.00 20.57 ? 57   ASN B OD1   1 
ATOM   5314  N  ND2   . ASN B 1 57  ? 63.538  143.086 64.018  1.00 20.87 ? 57   ASN B ND2   1 
ATOM   5315  N  N     . THR B 1 58  ? 67.589  142.379 67.330  1.00 19.25 ? 58   THR B N     1 
ATOM   5316  C  CA    . THR B 1 58  ? 67.421  142.087 68.748  1.00 19.73 ? 58   THR B CA    1 
ATOM   5317  C  C     . THR B 1 58  ? 67.558  143.278 69.697  1.00 19.90 ? 58   THR B C     1 
ATOM   5318  O  O     . THR B 1 58  ? 68.145  144.306 69.359  1.00 20.09 ? 58   THR B O     1 
ATOM   5319  C  CB    . THR B 1 58  ? 68.442  141.014 69.187  1.00 19.76 ? 58   THR B CB    1 
ATOM   5320  O  OG1   . THR B 1 58  ? 69.770  141.542 69.070  1.00 19.01 ? 58   THR B OG1   1 
ATOM   5321  C  CG2   . THR B 1 58  ? 68.333  139.781 68.294  1.00 18.43 ? 58   THR B CG2   1 
ATOM   5322  N  N     . SER B 1 59  ? 67.014  143.111 70.898  1.00 19.36 ? 59   SER B N     1 
ATOM   5323  C  CA    . SER B 1 59  ? 67.061  144.138 71.932  1.00 20.52 ? 59   SER B CA    1 
ATOM   5324  C  C     . SER B 1 59  ? 66.963  143.478 73.303  1.00 19.99 ? 59   SER B C     1 
ATOM   5325  O  O     . SER B 1 59  ? 66.119  142.608 73.515  1.00 20.33 ? 59   SER B O     1 
ATOM   5326  C  CB    . SER B 1 59  ? 65.899  145.123 71.752  1.00 20.36 ? 59   SER B CB    1 
ATOM   5327  O  OG    . SER B 1 59  ? 65.834  146.047 72.829  1.00 22.22 ? 59   SER B OG    1 
ATOM   5328  N  N     . PHE B 1 60  ? 67.839  143.880 74.222  1.00 19.58 ? 60   PHE B N     1 
ATOM   5329  C  CA    . PHE B 1 60  ? 67.834  143.342 75.580  1.00 20.33 ? 60   PHE B CA    1 
ATOM   5330  C  C     . PHE B 1 60  ? 67.296  144.385 76.560  1.00 22.08 ? 60   PHE B C     1 
ATOM   5331  O  O     . PHE B 1 60  ? 67.495  144.267 77.773  1.00 21.74 ? 60   PHE B O     1 
ATOM   5332  C  CB    . PHE B 1 60  ? 69.249  142.932 76.017  1.00 18.83 ? 60   PHE B CB    1 
ATOM   5333  C  CG    . PHE B 1 60  ? 69.741  141.641 75.410  1.00 17.66 ? 60   PHE B CG    1 
ATOM   5334  C  CD1   . PHE B 1 60  ? 71.032  141.187 75.684  1.00 17.89 ? 60   PHE B CD1   1 
ATOM   5335  C  CD2   . PHE B 1 60  ? 68.928  140.876 74.575  1.00 15.71 ? 60   PHE B CD2   1 
ATOM   5336  C  CE1   . PHE B 1 60  ? 71.509  139.991 75.136  1.00 16.79 ? 60   PHE B CE1   1 
ATOM   5337  C  CE2   . PHE B 1 60  ? 69.394  139.679 74.022  1.00 17.31 ? 60   PHE B CE2   1 
ATOM   5338  C  CZ    . PHE B 1 60  ? 70.684  139.237 74.302  1.00 17.96 ? 60   PHE B CZ    1 
ATOM   5339  N  N     . ALA B 1 61  ? 66.614  145.399 76.028  1.00 22.39 ? 61   ALA B N     1 
ATOM   5340  C  CA    . ALA B 1 61  ? 66.049  146.478 76.841  1.00 24.75 ? 61   ALA B CA    1 
ATOM   5341  C  C     . ALA B 1 61  ? 65.156  145.973 77.968  1.00 25.27 ? 61   ALA B C     1 
ATOM   5342  O  O     . ALA B 1 61  ? 64.310  145.102 77.766  1.00 27.28 ? 61   ALA B O     1 
ATOM   5343  C  CB    . ALA B 1 61  ? 65.265  147.447 75.956  1.00 25.24 ? 61   ALA B CB    1 
ATOM   5344  N  N     . PRO B 1 62  ? 65.325  146.534 79.174  1.00 26.33 ? 62   PRO B N     1 
ATOM   5345  C  CA    . PRO B 1 62  ? 64.561  146.175 80.375  1.00 26.59 ? 62   PRO B CA    1 
ATOM   5346  C  C     . PRO B 1 62  ? 63.059  145.996 80.149  1.00 28.07 ? 62   PRO B C     1 
ATOM   5347  O  O     . PRO B 1 62  ? 62.402  146.864 79.570  1.00 25.78 ? 62   PRO B O     1 
ATOM   5348  C  CB    . PRO B 1 62  ? 64.871  147.327 81.327  1.00 26.77 ? 62   PRO B CB    1 
ATOM   5349  C  CG    . PRO B 1 62  ? 66.292  147.643 80.981  1.00 26.57 ? 62   PRO B CG    1 
ATOM   5350  C  CD    . PRO B 1 62  ? 66.264  147.633 79.466  1.00 24.95 ? 62   PRO B CD    1 
ATOM   5351  N  N     . GLY B 1 63  ? 62.529  144.863 80.613  1.00 27.33 ? 63   GLY B N     1 
ATOM   5352  C  CA    . GLY B 1 63  ? 61.109  144.579 80.466  1.00 28.58 ? 63   GLY B CA    1 
ATOM   5353  C  C     . GLY B 1 63  ? 60.590  144.759 79.049  1.00 29.14 ? 63   GLY B C     1 
ATOM   5354  O  O     . GLY B 1 63  ? 59.383  144.897 78.829  1.00 25.94 ? 63   GLY B O     1 
ATOM   5355  N  N     . ASN B 1 64  ? 61.509  144.756 78.088  1.00 27.58 ? 64   ASN B N     1 
ATOM   5356  C  CA    . ASN B 1 64  ? 61.169  144.923 76.680  1.00 26.88 ? 64   ASN B CA    1 
ATOM   5357  C  C     . ASN B 1 64  ? 62.185  144.192 75.808  1.00 26.26 ? 64   ASN B C     1 
ATOM   5358  O  O     . ASN B 1 64  ? 62.842  144.787 74.955  1.00 26.53 ? 64   ASN B O     1 
ATOM   5359  C  CB    . ASN B 1 64  ? 61.141  146.409 76.326  1.00 25.39 ? 64   ASN B CB    1 
ATOM   5360  C  CG    . ASN B 1 64  ? 59.925  147.112 76.890  1.00 26.86 ? 64   ASN B CG    1 
ATOM   5361  O  OD1   . ASN B 1 64  ? 58.792  146.786 76.535  1.00 25.75 ? 64   ASN B OD1   1 
ATOM   5362  N  ND2   . ASN B 1 64  ? 60.151  148.079 77.775  1.00 26.46 ? 64   ASN B ND2   1 
ATOM   5363  N  N     . VAL B 1 65  ? 62.300  142.891 76.042  1.00 22.97 ? 65   VAL B N     1 
ATOM   5364  C  CA    . VAL B 1 65  ? 63.229  142.042 75.312  1.00 21.88 ? 65   VAL B CA    1 
ATOM   5365  C  C     . VAL B 1 65  ? 62.568  141.469 74.058  1.00 20.36 ? 65   VAL B C     1 
ATOM   5366  O  O     . VAL B 1 65  ? 61.460  140.939 74.117  1.00 21.98 ? 65   VAL B O     1 
ATOM   5367  C  CB    . VAL B 1 65  ? 63.714  140.884 76.217  1.00 19.76 ? 65   VAL B CB    1 
ATOM   5368  C  CG1   . VAL B 1 65  ? 64.597  139.925 75.435  1.00 20.04 ? 65   VAL B CG1   1 
ATOM   5369  C  CG2   . VAL B 1 65  ? 64.465  141.453 77.415  1.00 20.14 ? 65   VAL B CG2   1 
ATOM   5370  N  N     . SER B 1 66  ? 63.253  141.600 72.927  1.00 20.94 ? 66   SER B N     1 
ATOM   5371  C  CA    . SER B 1 66  ? 62.759  141.090 71.650  1.00 20.25 ? 66   SER B CA    1 
ATOM   5372  C  C     . SER B 1 66  ? 63.956  140.530 70.895  1.00 19.87 ? 66   SER B C     1 
ATOM   5373  O  O     . SER B 1 66  ? 64.935  141.237 70.659  1.00 20.73 ? 66   SER B O     1 
ATOM   5374  C  CB    . SER B 1 66  ? 62.102  142.212 70.836  1.00 20.42 ? 66   SER B CB    1 
ATOM   5375  O  OG    . SER B 1 66  ? 61.514  141.696 69.655  1.00 22.83 ? 66   SER B OG    1 
ATOM   5376  N  N     . ILE B 1 67  ? 63.877  139.256 70.525  1.00 18.28 ? 67   ILE B N     1 
ATOM   5377  C  CA    . ILE B 1 67  ? 64.967  138.587 69.824  1.00 17.18 ? 67   ILE B CA    1 
ATOM   5378  C  C     . ILE B 1 67  ? 64.492  137.966 68.509  1.00 18.44 ? 67   ILE B C     1 
ATOM   5379  O  O     . ILE B 1 67  ? 63.691  137.032 68.513  1.00 16.61 ? 67   ILE B O     1 
ATOM   5380  C  CB    . ILE B 1 67  ? 65.563  137.476 70.732  1.00 17.68 ? 67   ILE B CB    1 
ATOM   5381  C  CG1   . ILE B 1 67  ? 66.078  138.106 72.030  1.00 18.47 ? 67   ILE B CG1   1 
ATOM   5382  C  CG2   . ILE B 1 67  ? 66.680  136.738 70.023  1.00 15.82 ? 67   ILE B CG2   1 
ATOM   5383  C  CD1   . ILE B 1 67  ? 66.118  137.154 73.203  1.00 18.51 ? 67   ILE B CD1   1 
ATOM   5384  N  N     . LYS B 1 68  ? 64.991  138.486 67.389  1.00 16.26 ? 68   LYS B N     1 
ATOM   5385  C  CA    . LYS B 1 68  ? 64.622  137.971 66.072  1.00 17.91 ? 68   LYS B CA    1 
ATOM   5386  C  C     . LYS B 1 68  ? 65.843  137.825 65.168  1.00 16.89 ? 68   LYS B C     1 
ATOM   5387  O  O     . LYS B 1 68  ? 66.708  138.705 65.121  1.00 17.50 ? 68   LYS B O     1 
ATOM   5388  C  CB    . LYS B 1 68  ? 63.603  138.897 65.392  1.00 17.77 ? 68   LYS B CB    1 
ATOM   5389  C  CG    . LYS B 1 68  ? 62.304  139.064 66.152  1.00 20.35 ? 68   LYS B CG    1 
ATOM   5390  C  CD    . LYS B 1 68  ? 61.388  140.084 65.463  1.00 22.45 ? 68   LYS B CD    1 
ATOM   5391  C  CE    . LYS B 1 68  ? 60.138  140.344 66.285  1.00 24.35 ? 68   LYS B CE    1 
ATOM   5392  N  NZ    . LYS B 1 68  ? 59.243  141.365 65.663  1.00 26.19 ? 68   LYS B NZ    1 
ATOM   5393  N  N     . TRP B 1 69  ? 65.902  136.704 64.458  1.00 15.70 ? 69   TRP B N     1 
ATOM   5394  C  CA    . TRP B 1 69  ? 66.994  136.411 63.536  1.00 14.98 ? 69   TRP B CA    1 
ATOM   5395  C  C     . TRP B 1 69  ? 66.432  135.845 62.233  1.00 15.23 ? 69   TRP B C     1 
ATOM   5396  O  O     . TRP B 1 69  ? 65.561  134.974 62.259  1.00 14.60 ? 69   TRP B O     1 
ATOM   5397  C  CB    . TRP B 1 69  ? 67.960  135.389 64.146  1.00 15.46 ? 69   TRP B CB    1 
ATOM   5398  C  CG    . TRP B 1 69  ? 68.837  135.934 65.240  1.00 15.96 ? 69   TRP B CG    1 
ATOM   5399  C  CD1   . TRP B 1 69  ? 68.542  136.018 66.572  1.00 15.33 ? 69   TRP B CD1   1 
ATOM   5400  C  CD2   . TRP B 1 69  ? 70.158  136.464 65.087  1.00 15.33 ? 69   TRP B CD2   1 
ATOM   5401  N  NE1   . TRP B 1 69  ? 69.600  136.564 67.259  1.00 16.14 ? 69   TRP B NE1   1 
ATOM   5402  C  CE2   . TRP B 1 69  ? 70.605  136.848 66.371  1.00 16.42 ? 69   TRP B CE2   1 
ATOM   5403  C  CE3   . TRP B 1 69  ? 71.009  136.651 63.988  1.00 15.38 ? 69   TRP B CE3   1 
ATOM   5404  C  CZ2   . TRP B 1 69  ? 71.870  137.408 66.589  1.00 17.43 ? 69   TRP B CZ2   1 
ATOM   5405  C  CZ3   . TRP B 1 69  ? 72.269  137.208 64.203  1.00 15.55 ? 69   TRP B CZ3   1 
ATOM   5406  C  CH2   . TRP B 1 69  ? 72.687  137.580 65.495  1.00 15.75 ? 69   TRP B CH2   1 
ATOM   5407  N  N     . TYR B 1 70  ? 66.923  136.341 61.100  1.00 14.66 ? 70   TYR B N     1 
ATOM   5408  C  CA    . TYR B 1 70  ? 66.469  135.861 59.791  1.00 14.21 ? 70   TYR B CA    1 
ATOM   5409  C  C     . TYR B 1 70  ? 64.943  135.902 59.716  1.00 14.54 ? 70   TYR B C     1 
ATOM   5410  O  O     . TYR B 1 70  ? 64.325  135.106 59.006  1.00 13.99 ? 70   TYR B O     1 
ATOM   5411  C  CB    . TYR B 1 70  ? 66.917  134.413 59.584  1.00 13.92 ? 70   TYR B CB    1 
ATOM   5412  C  CG    . TYR B 1 70  ? 68.381  134.136 59.859  1.00 15.91 ? 70   TYR B CG    1 
ATOM   5413  C  CD1   . TYR B 1 70  ? 68.766  133.302 60.915  1.00 14.36 ? 70   TYR B CD1   1 
ATOM   5414  C  CD2   . TYR B 1 70  ? 69.380  134.650 59.027  1.00 13.24 ? 70   TYR B CD2   1 
ATOM   5415  C  CE1   . TYR B 1 70  ? 70.110  132.978 61.131  1.00 13.27 ? 70   TYR B CE1   1 
ATOM   5416  C  CE2   . TYR B 1 70  ? 70.724  134.332 59.233  1.00 13.83 ? 70   TYR B CE2   1 
ATOM   5417  C  CZ    . TYR B 1 70  ? 71.081  133.492 60.286  1.00 14.61 ? 70   TYR B CZ    1 
ATOM   5418  O  OH    . TYR B 1 70  ? 72.404  133.155 60.481  1.00 15.93 ? 70   TYR B OH    1 
ATOM   5419  N  N     . GLU B 1 71  ? 64.342  136.847 60.430  1.00 15.50 ? 71   GLU B N     1 
ATOM   5420  C  CA    . GLU B 1 71  ? 62.889  136.940 60.519  1.00 16.59 ? 71   GLU B CA    1 
ATOM   5421  C  C     . GLU B 1 71  ? 62.050  136.859 59.245  1.00 18.39 ? 71   GLU B C     1 
ATOM   5422  O  O     . GLU B 1 71  ? 60.945  136.324 59.281  1.00 18.91 ? 71   GLU B O     1 
ATOM   5423  C  CB    . GLU B 1 71  ? 62.502  138.195 61.300  1.00 18.04 ? 71   GLU B CB    1 
ATOM   5424  C  CG    . GLU B 1 71  ? 62.701  139.492 60.546  1.00 20.23 ? 71   GLU B CG    1 
ATOM   5425  C  CD    . GLU B 1 71  ? 62.479  140.692 61.432  1.00 22.84 ? 71   GLU B CD    1 
ATOM   5426  O  OE1   . GLU B 1 71  ? 63.338  140.953 62.299  1.00 21.01 ? 71   GLU B OE1   1 
ATOM   5427  O  OE2   . GLU B 1 71  ? 61.441  141.369 61.271  1.00 26.39 ? 71   GLU B OE2   1 
ATOM   5428  N  N     . ASP B 1 72  ? 62.556  137.368 58.125  1.00 17.94 ? 72   ASP B N     1 
ATOM   5429  C  CA    . ASP B 1 72  ? 61.777  137.335 56.891  1.00 20.40 ? 72   ASP B CA    1 
ATOM   5430  C  C     . ASP B 1 72  ? 62.009  136.119 56.001  1.00 19.75 ? 72   ASP B C     1 
ATOM   5431  O  O     . ASP B 1 72  ? 61.487  136.043 54.890  1.00 21.28 ? 72   ASP B O     1 
ATOM   5432  C  CB    . ASP B 1 72  ? 61.990  138.631 56.094  1.00 22.83 ? 72   ASP B CB    1 
ATOM   5433  C  CG    . ASP B 1 72  ? 63.453  138.977 55.904  1.00 26.68 ? 72   ASP B CG    1 
ATOM   5434  O  OD1   . ASP B 1 72  ? 64.315  138.395 56.598  1.00 26.43 ? 72   ASP B OD1   1 
ATOM   5435  O  OD2   . ASP B 1 72  ? 63.739  139.856 55.061  1.00 29.90 ? 72   ASP B OD2   1 
ATOM   5436  N  N     . GLY B 1 73  ? 62.791  135.164 56.490  1.00 19.23 ? 73   GLY B N     1 
ATOM   5437  C  CA    . GLY B 1 73  ? 63.033  133.965 55.716  1.00 17.09 ? 73   GLY B CA    1 
ATOM   5438  C  C     . GLY B 1 73  ? 62.112  132.855 56.187  1.00 16.54 ? 73   GLY B C     1 
ATOM   5439  O  O     . GLY B 1 73  ? 61.532  132.936 57.276  1.00 15.03 ? 73   GLY B O     1 
ATOM   5440  N  N     . THR B 1 74  ? 61.953  131.830 55.357  1.00 15.14 ? 74   THR B N     1 
ATOM   5441  C  CA    . THR B 1 74  ? 61.123  130.686 55.706  1.00 15.13 ? 74   THR B CA    1 
ATOM   5442  C  C     . THR B 1 74  ? 61.923  129.434 55.400  1.00 15.43 ? 74   THR B C     1 
ATOM   5443  O  O     . THR B 1 74  ? 62.788  129.437 54.522  1.00 15.73 ? 74   THR B O     1 
ATOM   5444  C  CB    . THR B 1 74  ? 59.801  130.647 54.908  1.00 15.98 ? 74   THR B CB    1 
ATOM   5445  O  OG1   . THR B 1 74  ? 60.080  130.451 53.515  1.00 17.23 ? 74   THR B OG1   1 
ATOM   5446  C  CG2   . THR B 1 74  ? 59.029  131.941 55.101  1.00 16.40 ? 74   THR B CG2   1 
ATOM   5447  N  N     . LEU B 1 75  ? 61.632  128.360 56.123  1.00 15.35 ? 75   LEU B N     1 
ATOM   5448  C  CA    . LEU B 1 75  ? 62.356  127.111 55.940  1.00 14.30 ? 75   LEU B CA    1 
ATOM   5449  C  C     . LEU B 1 75  ? 61.601  126.003 56.659  1.00 14.28 ? 75   LEU B C     1 
ATOM   5450  O  O     . LEU B 1 75  ? 60.560  126.240 57.264  1.00 14.15 ? 75   LEU B O     1 
ATOM   5451  C  CB    . LEU B 1 75  ? 63.764  127.231 56.547  1.00 13.41 ? 75   LEU B CB    1 
ATOM   5452  C  CG    . LEU B 1 75  ? 63.869  127.175 58.085  1.00 12.90 ? 75   LEU B CG    1 
ATOM   5453  C  CD1   . LEU B 1 75  ? 65.335  127.097 58.504  1.00 16.43 ? 75   LEU B CD1   1 
ATOM   5454  C  CD2   . LEU B 1 75  ? 63.205  128.390 58.712  1.00 15.15 ? 75   LEU B CD2   1 
ATOM   5455  N  N     . ASN B 1 76  ? 62.144  124.795 56.594  1.00 15.10 ? 76   ASN B N     1 
ATOM   5456  C  CA    . ASN B 1 76  ? 61.549  123.654 57.265  1.00 16.04 ? 76   ASN B CA    1 
ATOM   5457  C  C     . ASN B 1 76  ? 62.700  122.861 57.875  1.00 16.16 ? 76   ASN B C     1 
ATOM   5458  O  O     . ASN B 1 76  ? 63.624  122.458 57.169  1.00 15.79 ? 76   ASN B O     1 
ATOM   5459  C  CB    . ASN B 1 76  ? 60.782  122.778 56.273  1.00 14.47 ? 76   ASN B CB    1 
ATOM   5460  C  CG    . ASN B 1 76  ? 59.937  121.728 56.964  1.00 14.33 ? 76   ASN B CG    1 
ATOM   5461  O  OD1   . ASN B 1 76  ? 58.724  121.880 57.103  1.00 18.35 ? 76   ASN B OD1   1 
ATOM   5462  N  ND2   . ASN B 1 76  ? 60.578  120.664 57.421  1.00 12.48 ? 76   ASN B ND2   1 
ATOM   5463  N  N     . LEU B 1 77  ? 62.653  122.653 59.184  1.00 15.22 ? 77   LEU B N     1 
ATOM   5464  C  CA    . LEU B 1 77  ? 63.716  121.912 59.856  1.00 14.36 ? 77   LEU B CA    1 
ATOM   5465  C  C     . LEU B 1 77  ? 63.840  120.475 59.356  1.00 13.68 ? 77   LEU B C     1 
ATOM   5466  O  O     . LEU B 1 77  ? 64.947  119.995 59.111  1.00 12.10 ? 77   LEU B O     1 
ATOM   5467  C  CB    . LEU B 1 77  ? 63.501  121.930 61.376  1.00 14.30 ? 77   LEU B CB    1 
ATOM   5468  C  CG    . LEU B 1 77  ? 64.517  121.149 62.225  1.00 15.27 ? 77   LEU B CG    1 
ATOM   5469  C  CD1   . LEU B 1 77  ? 64.703  121.830 63.582  1.00 16.79 ? 77   LEU B CD1   1 
ATOM   5470  C  CD2   . LEU B 1 77  ? 64.046  119.714 62.387  1.00 14.34 ? 77   LEU B CD2   1 
ATOM   5471  N  N     . ALA B 1 78  ? 62.712  119.787 59.196  1.00 13.72 ? 78   ALA B N     1 
ATOM   5472  C  CA    . ALA B 1 78  ? 62.742  118.403 58.728  1.00 13.77 ? 78   ALA B CA    1 
ATOM   5473  C  C     . ALA B 1 78  ? 63.364  118.291 57.336  1.00 13.74 ? 78   ALA B C     1 
ATOM   5474  O  O     . ALA B 1 78  ? 64.083  117.333 57.043  1.00 14.80 ? 78   ALA B O     1 
ATOM   5475  C  CB    . ALA B 1 78  ? 61.334  117.816 58.728  1.00 13.61 ? 78   ALA B CB    1 
ATOM   5476  N  N     . ALA B 1 79  ? 63.097  119.268 56.476  1.00 15.13 ? 79   ALA B N     1 
ATOM   5477  C  CA    . ALA B 1 79  ? 63.669  119.248 55.133  1.00 15.82 ? 79   ALA B CA    1 
ATOM   5478  C  C     . ALA B 1 79  ? 65.188  119.383 55.216  1.00 16.04 ? 79   ALA B C     1 
ATOM   5479  O  O     . ALA B 1 79  ? 65.923  118.753 54.454  1.00 15.87 ? 79   ALA B O     1 
ATOM   5480  C  CB    . ALA B 1 79  ? 63.086  120.377 54.293  1.00 16.54 ? 79   ALA B CB    1 
ATOM   5481  N  N     . ASN B 1 80  ? 65.652  120.207 56.148  1.00 13.84 ? 80   ASN B N     1 
ATOM   5482  C  CA    . ASN B 1 80  ? 67.081  120.427 56.334  1.00 13.85 ? 80   ASN B CA    1 
ATOM   5483  C  C     . ASN B 1 80  ? 67.775  119.241 56.983  1.00 15.06 ? 80   ASN B C     1 
ATOM   5484  O  O     . ASN B 1 80  ? 68.963  119.012 56.763  1.00 13.71 ? 80   ASN B O     1 
ATOM   5485  C  CB    . ASN B 1 80  ? 67.314  121.677 57.183  1.00 15.24 ? 80   ASN B CB    1 
ATOM   5486  C  CG    . ASN B 1 80  ? 67.460  122.930 56.343  1.00 16.04 ? 80   ASN B CG    1 
ATOM   5487  O  OD1   . ASN B 1 80  ? 68.511  123.168 55.751  1.00 17.07 ? 80   ASN B OD1   1 
ATOM   5488  N  ND2   . ASN B 1 80  ? 66.400  123.732 56.276  1.00 14.76 ? 80   ASN B ND2   1 
ATOM   5489  N  N     . CYS B 1 81  ? 67.028  118.488 57.783  1.00 14.02 ? 81   CYS B N     1 
ATOM   5490  C  CA    . CYS B 1 81  ? 67.589  117.332 58.477  1.00 15.09 ? 81   CYS B CA    1 
ATOM   5491  C  C     . CYS B 1 81  ? 67.383  116.022 57.738  1.00 15.87 ? 81   CYS B C     1 
ATOM   5492  O  O     . CYS B 1 81  ? 67.985  115.008 58.088  1.00 16.29 ? 81   CYS B O     1 
ATOM   5493  C  CB    . CYS B 1 81  ? 66.970  117.203 59.871  1.00 14.32 ? 81   CYS B CB    1 
ATOM   5494  S  SG    . CYS B 1 81  ? 67.436  118.490 61.033  1.00 14.68 ? 81   CYS B SG    1 
ATOM   5495  N  N     . LEU B 1 82  ? 66.544  116.037 56.709  1.00 16.93 ? 82   LEU B N     1 
ATOM   5496  C  CA    . LEU B 1 82  ? 66.253  114.808 55.987  1.00 17.11 ? 82   LEU B CA    1 
ATOM   5497  C  C     . LEU B 1 82  ? 66.234  114.951 54.472  1.00 17.42 ? 82   LEU B C     1 
ATOM   5498  O  O     . LEU B 1 82  ? 67.167  114.534 53.785  1.00 17.06 ? 82   LEU B O     1 
ATOM   5499  C  CB    . LEU B 1 82  ? 64.901  114.258 56.457  1.00 15.05 ? 82   LEU B CB    1 
ATOM   5500  C  CG    . LEU B 1 82  ? 64.729  114.068 57.968  1.00 15.66 ? 82   LEU B CG    1 
ATOM   5501  C  CD1   . LEU B 1 82  ? 63.268  113.799 58.299  1.00 14.79 ? 82   LEU B CD1   1 
ATOM   5502  C  CD2   . LEU B 1 82  ? 65.610  112.914 58.439  1.00 16.33 ? 82   LEU B CD2   1 
ATOM   5503  N  N     . ASP B 1 83  ? 65.155  115.545 53.970  1.00 16.87 ? 83   ASP B N     1 
ATOM   5504  C  CA    . ASP B 1 83  ? 64.936  115.731 52.538  1.00 17.36 ? 83   ASP B CA    1 
ATOM   5505  C  C     . ASP B 1 83  ? 66.140  116.141 51.699  1.00 17.60 ? 83   ASP B C     1 
ATOM   5506  O  O     . ASP B 1 83  ? 66.466  115.474 50.718  1.00 17.64 ? 83   ASP B O     1 
ATOM   5507  C  CB    . ASP B 1 83  ? 63.801  116.738 52.317  1.00 17.43 ? 83   ASP B CB    1 
ATOM   5508  C  CG    . ASP B 1 83  ? 62.510  116.316 53.001  1.00 20.11 ? 83   ASP B CG    1 
ATOM   5509  O  OD1   . ASP B 1 83  ? 61.476  116.173 52.310  1.00 19.66 ? 83   ASP B OD1   1 
ATOM   5510  O  OD2   . ASP B 1 83  ? 62.532  116.126 54.235  1.00 16.45 ? 83   ASP B OD2   1 
ATOM   5511  N  N     . ARG B 1 84  ? 66.804  117.227 52.077  1.00 17.37 ? 84   ARG B N     1 
ATOM   5512  C  CA    . ARG B 1 84  ? 67.940  117.705 51.300  1.00 18.35 ? 84   ARG B CA    1 
ATOM   5513  C  C     . ARG B 1 84  ? 69.142  116.763 51.225  1.00 19.89 ? 84   ARG B C     1 
ATOM   5514  O  O     . ARG B 1 84  ? 70.040  116.967 50.406  1.00 19.22 ? 84   ARG B O     1 
ATOM   5515  C  CB    . ARG B 1 84  ? 68.392  119.070 51.817  1.00 18.88 ? 84   ARG B CB    1 
ATOM   5516  C  CG    . ARG B 1 84  ? 69.075  119.062 53.172  1.00 18.27 ? 84   ARG B CG    1 
ATOM   5517  C  CD    . ARG B 1 84  ? 69.709  120.422 53.389  1.00 19.55 ? 84   ARG B CD    1 
ATOM   5518  N  NE    . ARG B 1 84  ? 70.436  120.549 54.644  1.00 16.23 ? 84   ARG B NE    1 
ATOM   5519  C  CZ    . ARG B 1 84  ? 71.204  121.593 54.934  1.00 16.80 ? 84   ARG B CZ    1 
ATOM   5520  N  NH1   . ARG B 1 84  ? 71.334  122.576 54.051  1.00 15.93 ? 84   ARG B NH1   1 
ATOM   5521  N  NH2   . ARG B 1 84  ? 71.838  121.662 56.098  1.00 15.49 ? 84   ARG B NH2   1 
ATOM   5522  N  N     . HIS B 1 85  ? 69.163  115.733 52.067  1.00 18.90 ? 85   HIS B N     1 
ATOM   5523  C  CA    . HIS B 1 85  ? 70.272  114.780 52.071  1.00 19.67 ? 85   HIS B CA    1 
ATOM   5524  C  C     . HIS B 1 85  ? 69.975  113.530 51.244  1.00 20.32 ? 85   HIS B C     1 
ATOM   5525  O  O     . HIS B 1 85  ? 70.852  112.689 51.045  1.00 21.53 ? 85   HIS B O     1 
ATOM   5526  C  CB    . HIS B 1 85  ? 70.599  114.345 53.506  1.00 18.24 ? 85   HIS B CB    1 
ATOM   5527  C  CG    . HIS B 1 85  ? 70.950  115.475 54.423  1.00 16.00 ? 85   HIS B CG    1 
ATOM   5528  N  ND1   . HIS B 1 85  ? 72.030  116.303 54.208  1.00 16.70 ? 85   HIS B ND1   1 
ATOM   5529  C  CD2   . HIS B 1 85  ? 70.367  115.908 55.566  1.00 17.62 ? 85   HIS B CD2   1 
ATOM   5530  C  CE1   . HIS B 1 85  ? 72.099  117.198 55.178  1.00 18.38 ? 85   HIS B CE1   1 
ATOM   5531  N  NE2   . HIS B 1 85  ? 71.100  116.980 56.016  1.00 18.63 ? 85   HIS B NE2   1 
ATOM   5532  N  N     . LEU B 1 86  ? 68.745  113.411 50.759  1.00 21.43 ? 86   LEU B N     1 
ATOM   5533  C  CA    . LEU B 1 86  ? 68.332  112.239 49.991  1.00 22.70 ? 86   LEU B CA    1 
ATOM   5534  C  C     . LEU B 1 86  ? 69.009  112.014 48.645  1.00 24.99 ? 86   LEU B C     1 
ATOM   5535  O  O     . LEU B 1 86  ? 69.479  110.913 48.361  1.00 24.15 ? 86   LEU B O     1 
ATOM   5536  C  CB    . LEU B 1 86  ? 66.813  112.263 49.775  1.00 23.09 ? 86   LEU B CB    1 
ATOM   5537  C  CG    . LEU B 1 86  ? 65.953  112.227 51.041  1.00 24.30 ? 86   LEU B CG    1 
ATOM   5538  C  CD1   . LEU B 1 86  ? 64.481  112.218 50.661  1.00 22.94 ? 86   LEU B CD1   1 
ATOM   5539  C  CD2   . LEU B 1 86  ? 66.301  110.989 51.860  1.00 25.55 ? 86   LEU B CD2   1 
ATOM   5540  N  N     . GLN B 1 87  ? 69.057  113.051 47.816  1.00 27.07 ? 87   GLN B N     1 
ATOM   5541  C  CA    . GLN B 1 87  ? 69.638  112.922 46.485  1.00 29.03 ? 87   GLN B CA    1 
ATOM   5542  C  C     . GLN B 1 87  ? 71.068  112.385 46.465  1.00 29.37 ? 87   GLN B C     1 
ATOM   5543  O  O     . GLN B 1 87  ? 71.395  111.519 45.650  1.00 28.67 ? 87   GLN B O     1 
ATOM   5544  C  CB    . GLN B 1 87  ? 69.562  114.268 45.752  1.00 31.41 ? 87   GLN B CB    1 
ATOM   5545  C  CG    . GLN B 1 87  ? 69.759  114.162 44.245  1.00 35.82 ? 87   GLN B CG    1 
ATOM   5546  C  CD    . GLN B 1 87  ? 69.318  115.412 43.501  1.00 38.92 ? 87   GLN B CD    1 
ATOM   5547  O  OE1   . GLN B 1 87  ? 68.155  115.818 43.577  1.00 40.67 ? 87   GLN B OE1   1 
ATOM   5548  N  NE2   . GLN B 1 87  ? 70.244  116.025 42.772  1.00 40.53 ? 87   GLN B NE2   1 
ATOM   5549  N  N     . GLU B 1 88  ? 71.912  112.878 47.365  1.00 29.14 ? 88   GLU B N     1 
ATOM   5550  C  CA    . GLU B 1 88  ? 73.301  112.443 47.408  1.00 29.53 ? 88   GLU B CA    1 
ATOM   5551  C  C     . GLU B 1 88  ? 73.649  111.471 48.537  1.00 29.68 ? 88   GLU B C     1 
ATOM   5552  O  O     . GLU B 1 88  ? 74.604  110.699 48.417  1.00 29.03 ? 88   GLU B O     1 
ATOM   5553  C  CB    . GLU B 1 88  ? 74.218  113.664 47.477  1.00 30.75 ? 88   GLU B CB    1 
ATOM   5554  N  N     . ASN B 1 89  ? 72.888  111.498 49.628  1.00 28.03 ? 89   ASN B N     1 
ATOM   5555  C  CA    . ASN B 1 89  ? 73.186  110.614 50.754  1.00 27.16 ? 89   ASN B CA    1 
ATOM   5556  C  C     . ASN B 1 89  ? 71.990  109.869 51.343  1.00 26.46 ? 89   ASN B C     1 
ATOM   5557  O  O     . ASN B 1 89  ? 71.943  109.625 52.551  1.00 25.63 ? 89   ASN B O     1 
ATOM   5558  C  CB    . ASN B 1 89  ? 73.880  111.403 51.869  1.00 28.68 ? 89   ASN B CB    1 
ATOM   5559  C  CG    . ASN B 1 89  ? 75.181  112.035 51.416  1.00 31.38 ? 89   ASN B CG    1 
ATOM   5560  O  OD1   . ASN B 1 89  ? 75.230  113.218 51.068  1.00 33.97 ? 89   ASN B OD1   1 
ATOM   5561  N  ND2   . ASN B 1 89  ? 76.243  111.244 51.405  1.00 30.03 ? 89   ASN B ND2   1 
ATOM   5562  N  N     . GLY B 1 90  ? 71.034  109.502 50.497  1.00 24.66 ? 90   GLY B N     1 
ATOM   5563  C  CA    . GLY B 1 90  ? 69.869  108.781 50.980  1.00 25.18 ? 90   GLY B CA    1 
ATOM   5564  C  C     . GLY B 1 90  ? 70.214  107.429 51.589  1.00 25.29 ? 90   GLY B C     1 
ATOM   5565  O  O     . GLY B 1 90  ? 69.539  106.961 52.507  1.00 23.89 ? 90   GLY B O     1 
ATOM   5566  N  N     . ASP B 1 91  ? 71.271  106.798 51.087  1.00 25.25 ? 91   ASP B N     1 
ATOM   5567  C  CA    . ASP B 1 91  ? 71.678  105.494 51.593  1.00 25.45 ? 91   ASP B CA    1 
ATOM   5568  C  C     . ASP B 1 91  ? 72.583  105.597 52.815  1.00 24.97 ? 91   ASP B C     1 
ATOM   5569  O  O     . ASP B 1 91  ? 72.861  104.596 53.475  1.00 25.11 ? 91   ASP B O     1 
ATOM   5570  C  CB    . ASP B 1 91  ? 72.390  104.696 50.498  1.00 30.03 ? 91   ASP B CB    1 
ATOM   5571  C  CG    . ASP B 1 91  ? 71.513  104.468 49.283  1.00 34.75 ? 91   ASP B CG    1 
ATOM   5572  O  OD1   . ASP B 1 91  ? 70.350  104.052 49.461  1.00 37.89 ? 91   ASP B OD1   1 
ATOM   5573  O  OD2   . ASP B 1 91  ? 71.987  104.697 48.150  1.00 39.26 ? 91   ASP B OD2   1 
ATOM   5574  N  N     . ARG B 1 92  ? 73.048  106.803 53.116  1.00 22.36 ? 92   ARG B N     1 
ATOM   5575  C  CA    . ARG B 1 92  ? 73.908  106.996 54.274  1.00 22.56 ? 92   ARG B CA    1 
ATOM   5576  C  C     . ARG B 1 92  ? 73.109  106.763 55.552  1.00 20.53 ? 92   ARG B C     1 
ATOM   5577  O  O     . ARG B 1 92  ? 71.927  107.081 55.619  1.00 18.95 ? 92   ARG B O     1 
ATOM   5578  C  CB    . ARG B 1 92  ? 74.481  108.415 54.286  1.00 23.84 ? 92   ARG B CB    1 
ATOM   5579  C  CG    . ARG B 1 92  ? 75.197  108.782 55.580  1.00 27.68 ? 92   ARG B CG    1 
ATOM   5580  C  CD    . ARG B 1 92  ? 75.773  110.189 55.516  1.00 31.74 ? 92   ARG B CD    1 
ATOM   5581  N  NE    . ARG B 1 92  ? 76.772  110.322 54.458  1.00 34.95 ? 92   ARG B NE    1 
ATOM   5582  C  CZ    . ARG B 1 92  ? 77.409  111.453 54.169  1.00 38.28 ? 92   ARG B CZ    1 
ATOM   5583  N  NH1   . ARG B 1 92  ? 77.154  112.558 54.859  1.00 38.75 ? 92   ARG B NH1   1 
ATOM   5584  N  NH2   . ARG B 1 92  ? 78.302  111.482 53.188  1.00 39.26 ? 92   ARG B NH2   1 
ATOM   5585  N  N     . THR B 1 93  ? 73.756  106.202 56.566  1.00 18.18 ? 93   THR B N     1 
ATOM   5586  C  CA    . THR B 1 93  ? 73.076  105.966 57.829  1.00 17.52 ? 93   THR B CA    1 
ATOM   5587  C  C     . THR B 1 93  ? 72.866  107.301 58.528  1.00 17.72 ? 93   THR B C     1 
ATOM   5588  O  O     . THR B 1 93  ? 73.812  108.066 58.715  1.00 18.89 ? 93   THR B O     1 
ATOM   5589  C  CB    . THR B 1 93  ? 73.905  105.045 58.751  1.00 18.83 ? 93   THR B CB    1 
ATOM   5590  O  OG1   . THR B 1 93  ? 74.022  103.751 58.146  1.00 18.05 ? 93   THR B OG1   1 
ATOM   5591  C  CG2   . THR B 1 93  ? 73.231  104.903 60.116  1.00 16.87 ? 93   THR B CG2   1 
ATOM   5592  N  N     . ALA B 1 94  ? 71.624  107.588 58.898  1.00 15.49 ? 94   ALA B N     1 
ATOM   5593  C  CA    . ALA B 1 94  ? 71.324  108.829 59.598  1.00 16.25 ? 94   ALA B CA    1 
ATOM   5594  C  C     . ALA B 1 94  ? 71.464  108.559 61.091  1.00 15.26 ? 94   ALA B C     1 
ATOM   5595  O  O     . ALA B 1 94  ? 72.165  109.271 61.804  1.00 15.84 ? 94   ALA B O     1 
ATOM   5596  C  CB    . ALA B 1 94  ? 69.907  109.292 59.275  1.00 14.24 ? 94   ALA B CB    1 
ATOM   5597  N  N     . ILE B 1 95  ? 70.797  107.509 61.553  1.00 15.63 ? 95   ILE B N     1 
ATOM   5598  C  CA    . ILE B 1 95  ? 70.846  107.142 62.955  1.00 14.95 ? 95   ILE B CA    1 
ATOM   5599  C  C     . ILE B 1 95  ? 71.280  105.705 63.194  1.00 14.82 ? 95   ILE B C     1 
ATOM   5600  O  O     . ILE B 1 95  ? 70.755  104.775 62.584  1.00 14.71 ? 95   ILE B O     1 
ATOM   5601  C  CB    . ILE B 1 95  ? 69.463  107.320 63.632  1.00 16.36 ? 95   ILE B CB    1 
ATOM   5602  C  CG1   . ILE B 1 95  ? 69.038  108.789 63.574  1.00 16.78 ? 95   ILE B CG1   1 
ATOM   5603  C  CG2   . ILE B 1 95  ? 69.528  106.829 65.079  1.00 17.42 ? 95   ILE B CG2   1 
ATOM   5604  C  CD1   . ILE B 1 95  ? 67.646  109.048 64.101  1.00 15.01 ? 95   ILE B CD1   1 
ATOM   5605  N  N     . ILE B 1 96  ? 72.264  105.534 64.068  1.00 15.44 ? 96   ILE B N     1 
ATOM   5606  C  CA    . ILE B 1 96  ? 72.697  104.199 64.449  1.00 14.87 ? 96   ILE B CA    1 
ATOM   5607  C  C     . ILE B 1 96  ? 72.069  104.047 65.827  1.00 15.39 ? 96   ILE B C     1 
ATOM   5608  O  O     . ILE B 1 96  ? 72.341  104.845 66.720  1.00 13.94 ? 96   ILE B O     1 
ATOM   5609  C  CB    . ILE B 1 96  ? 74.225  104.088 64.611  1.00 17.57 ? 96   ILE B CB    1 
ATOM   5610  C  CG1   . ILE B 1 96  ? 74.904  104.090 63.240  1.00 16.98 ? 96   ILE B CG1   1 
ATOM   5611  C  CG2   . ILE B 1 96  ? 74.568  102.810 65.377  1.00 16.45 ? 96   ILE B CG2   1 
ATOM   5612  C  CD1   . ILE B 1 96  ? 76.419  104.079 63.320  1.00 20.14 ? 96   ILE B CD1   1 
ATOM   5613  N  N     . TRP B 1 97  ? 71.205  103.054 65.995  1.00 15.07 ? 97   TRP B N     1 
ATOM   5614  C  CA    . TRP B 1 97  ? 70.582  102.842 67.292  1.00 15.60 ? 97   TRP B CA    1 
ATOM   5615  C  C     . TRP B 1 97  ? 71.207  101.624 67.965  1.00 15.64 ? 97   TRP B C     1 
ATOM   5616  O  O     . TRP B 1 97  ? 71.241  100.532 67.388  1.00 14.66 ? 97   TRP B O     1 
ATOM   5617  C  CB    . TRP B 1 97  ? 69.076  102.629 67.144  1.00 16.14 ? 97   TRP B CB    1 
ATOM   5618  C  CG    . TRP B 1 97  ? 68.387  102.387 68.451  1.00 16.32 ? 97   TRP B CG    1 
ATOM   5619  C  CD1   . TRP B 1 97  ? 68.175  103.294 69.452  1.00 18.17 ? 97   TRP B CD1   1 
ATOM   5620  C  CD2   . TRP B 1 97  ? 67.842  101.146 68.911  1.00 16.78 ? 97   TRP B CD2   1 
ATOM   5621  N  NE1   . TRP B 1 97  ? 67.531  102.692 70.508  1.00 17.36 ? 97   TRP B NE1   1 
ATOM   5622  C  CE2   . TRP B 1 97  ? 67.314  101.374 70.202  1.00 17.78 ? 97   TRP B CE2   1 
ATOM   5623  C  CE3   . TRP B 1 97  ? 67.750  99.862  68.357  1.00 17.78 ? 97   TRP B CE3   1 
ATOM   5624  C  CZ2   . TRP B 1 97  ? 66.701  100.361 70.952  1.00 16.82 ? 97   TRP B CZ2   1 
ATOM   5625  C  CZ3   . TRP B 1 97  ? 67.140  98.854  69.103  1.00 17.96 ? 97   TRP B CZ3   1 
ATOM   5626  C  CH2   . TRP B 1 97  ? 66.624  99.113  70.387  1.00 18.06 ? 97   TRP B CH2   1 
ATOM   5627  N  N     . GLU B 1 98  ? 71.718  101.831 69.176  1.00 15.48 ? 98   GLU B N     1 
ATOM   5628  C  CA    . GLU B 1 98  ? 72.338  100.770 69.967  1.00 14.82 ? 98   GLU B CA    1 
ATOM   5629  C  C     . GLU B 1 98  ? 71.434  100.513 71.160  1.00 15.19 ? 98   GLU B C     1 
ATOM   5630  O  O     . GLU B 1 98  ? 71.237  101.394 71.999  1.00 14.15 ? 98   GLU B O     1 
ATOM   5631  C  CB    . GLU B 1 98  ? 73.725  101.207 70.450  1.00 14.79 ? 98   GLU B CB    1 
ATOM   5632  C  CG    . GLU B 1 98  ? 74.403  100.245 71.437  1.00 15.12 ? 98   GLU B CG    1 
ATOM   5633  C  CD    . GLU B 1 98  ? 74.874  98.942  70.806  1.00 15.91 ? 98   GLU B CD    1 
ATOM   5634  O  OE1   . GLU B 1 98  ? 74.729  98.768  69.579  1.00 17.89 ? 98   GLU B OE1   1 
ATOM   5635  O  OE2   . GLU B 1 98  ? 75.404  98.090  71.548  1.00 16.93 ? 98   GLU B OE2   1 
ATOM   5636  N  N     . GLY B 1 99  ? 70.878  99.308  71.232  1.00 15.71 ? 99   GLY B N     1 
ATOM   5637  C  CA    . GLY B 1 99  ? 69.988  98.982  72.332  1.00 15.94 ? 99   GLY B CA    1 
ATOM   5638  C  C     . GLY B 1 99  ? 70.665  98.789  73.677  1.00 16.76 ? 99   GLY B C     1 
ATOM   5639  O  O     . GLY B 1 99  ? 71.888  98.623  73.759  1.00 15.68 ? 99   GLY B O     1 
ATOM   5640  N  N     . ASP B 1 100 ? 69.859  98.818  74.737  1.00 15.74 ? 100  ASP B N     1 
ATOM   5641  C  CA    . ASP B 1 100 ? 70.351  98.614  76.092  1.00 18.17 ? 100  ASP B CA    1 
ATOM   5642  C  C     . ASP B 1 100 ? 71.063  97.263  76.087  1.00 19.24 ? 100  ASP B C     1 
ATOM   5643  O  O     . ASP B 1 100 ? 72.089  97.076  76.745  1.00 17.96 ? 100  ASP B O     1 
ATOM   5644  C  CB    . ASP B 1 100 ? 69.177  98.615  77.074  1.00 17.48 ? 100  ASP B CB    1 
ATOM   5645  C  CG    . ASP B 1 100 ? 69.623  98.557  78.516  1.00 18.28 ? 100  ASP B CG    1 
ATOM   5646  O  OD1   . ASP B 1 100 ? 70.411  99.434  78.934  1.00 15.93 ? 100  ASP B OD1   1 
ATOM   5647  O  OD2   . ASP B 1 100 ? 69.175  97.637  79.233  1.00 17.20 ? 100  ASP B OD2   1 
ATOM   5648  N  N     . ASP B 1 101 ? 70.503  96.321  75.336  1.00 20.79 ? 101  ASP B N     1 
ATOM   5649  C  CA    . ASP B 1 101 ? 71.113  95.008  75.183  1.00 23.00 ? 101  ASP B CA    1 
ATOM   5650  C  C     . ASP B 1 101 ? 71.804  95.113  73.827  1.00 23.31 ? 101  ASP B C     1 
ATOM   5651  O  O     . ASP B 1 101 ? 71.156  95.377  72.812  1.00 23.10 ? 101  ASP B O     1 
ATOM   5652  C  CB    . ASP B 1 101 ? 70.053  93.909  75.154  1.00 25.30 ? 101  ASP B CB    1 
ATOM   5653  C  CG    . ASP B 1 101 ? 70.658  92.524  75.246  1.00 29.35 ? 101  ASP B CG    1 
ATOM   5654  O  OD1   . ASP B 1 101 ? 71.378  92.123  74.304  1.00 30.89 ? 101  ASP B OD1   1 
ATOM   5655  O  OD2   . ASP B 1 101 ? 70.422  91.840  76.265  1.00 33.58 ? 101  ASP B OD2   1 
ATOM   5656  N  N     . THR B 1 102 ? 73.116  94.913  73.809  1.00 24.13 ? 102  THR B N     1 
ATOM   5657  C  CA    . THR B 1 102 ? 73.878  95.049  72.574  1.00 25.11 ? 102  THR B CA    1 
ATOM   5658  C  C     . THR B 1 102 ? 73.433  94.161  71.410  1.00 26.16 ? 102  THR B C     1 
ATOM   5659  O  O     . THR B 1 102 ? 73.769  94.437  70.255  1.00 26.99 ? 102  THR B O     1 
ATOM   5660  C  CB    . THR B 1 102 ? 75.383  94.841  72.835  1.00 25.05 ? 102  THR B CB    1 
ATOM   5661  O  OG1   . THR B 1 102 ? 76.118  95.231  71.668  1.00 25.86 ? 102  THR B OG1   1 
ATOM   5662  C  CG2   . THR B 1 102 ? 75.682  93.384  73.175  1.00 24.03 ? 102  THR B CG2   1 
ATOM   5663  N  N     . SER B 1 103 ? 72.678  93.107  71.702  1.00 25.48 ? 103  SER B N     1 
ATOM   5664  C  CA    . SER B 1 103 ? 72.198  92.221  70.646  1.00 25.30 ? 103  SER B CA    1 
ATOM   5665  C  C     . SER B 1 103 ? 71.147  92.948  69.804  1.00 24.58 ? 103  SER B C     1 
ATOM   5666  O  O     . SER B 1 103 ? 70.774  92.489  68.724  1.00 24.35 ? 103  SER B O     1 
ATOM   5667  C  CB    . SER B 1 103 ? 71.591  90.948  71.246  1.00 25.93 ? 103  SER B CB    1 
ATOM   5668  O  OG    . SER B 1 103 ? 70.448  91.244  72.030  1.00 27.51 ? 103  SER B OG    1 
ATOM   5669  N  N     . GLN B 1 104 ? 70.671  94.084  70.305  1.00 24.21 ? 104  GLN B N     1 
ATOM   5670  C  CA    . GLN B 1 104 ? 69.668  94.867  69.590  1.00 24.95 ? 104  GLN B CA    1 
ATOM   5671  C  C     . GLN B 1 104 ? 70.291  96.147  69.038  1.00 25.63 ? 104  GLN B C     1 
ATOM   5672  O  O     . GLN B 1 104 ? 70.846  96.947  69.791  1.00 25.44 ? 104  GLN B O     1 
ATOM   5673  C  CB    . GLN B 1 104 ? 68.510  95.227  70.525  1.00 25.98 ? 104  GLN B CB    1 
ATOM   5674  C  CG    . GLN B 1 104 ? 67.895  94.034  71.239  1.00 26.96 ? 104  GLN B CG    1 
ATOM   5675  C  CD    . GLN B 1 104 ? 67.480  92.938  70.281  1.00 27.56 ? 104  GLN B CD    1 
ATOM   5676  O  OE1   . GLN B 1 104 ? 66.730  93.178  69.336  1.00 28.31 ? 104  GLN B OE1   1 
ATOM   5677  N  NE2   . GLN B 1 104 ? 67.968  91.723  70.520  1.00 27.37 ? 104  GLN B NE2   1 
ATOM   5678  N  N     . SER B 1 105 ? 70.211  96.329  67.723  1.00 24.89 ? 105  SER B N     1 
ATOM   5679  C  CA    . SER B 1 105 ? 70.760  97.519  67.085  1.00 25.41 ? 105  SER B CA    1 
ATOM   5680  C  C     . SER B 1 105 ? 70.012  97.798  65.794  1.00 25.36 ? 105  SER B C     1 
ATOM   5681  O  O     . SER B 1 105 ? 69.263  96.953  65.301  1.00 25.24 ? 105  SER B O     1 
ATOM   5682  C  CB    . SER B 1 105 ? 72.251  97.335  66.782  1.00 26.27 ? 105  SER B CB    1 
ATOM   5683  O  OG    . SER B 1 105 ? 72.449  96.403  65.734  1.00 29.86 ? 105  SER B OG    1 
ATOM   5684  N  N     . LYS B 1 106 ? 70.220  98.987  65.245  1.00 24.23 ? 106  LYS B N     1 
ATOM   5685  C  CA    . LYS B 1 106 ? 69.560  99.377  64.012  1.00 23.87 ? 106  LYS B CA    1 
ATOM   5686  C  C     . LYS B 1 106 ? 70.351  100.468 63.311  1.00 21.98 ? 106  LYS B C     1 
ATOM   5687  O  O     . LYS B 1 106 ? 70.956  101.315 63.956  1.00 21.00 ? 106  LYS B O     1 
ATOM   5688  C  CB    . LYS B 1 106 ? 68.147  99.887  64.319  1.00 26.21 ? 106  LYS B CB    1 
ATOM   5689  C  CG    . LYS B 1 106 ? 67.059  99.191  63.527  1.00 29.69 ? 106  LYS B CG    1 
ATOM   5690  C  CD    . LYS B 1 106 ? 65.807  98.943  64.363  1.00 31.93 ? 106  LYS B CD    1 
ATOM   5691  C  CE    . LYS B 1 106 ? 64.944  100.181 64.517  1.00 33.07 ? 106  LYS B CE    1 
ATOM   5692  N  NZ    . LYS B 1 106 ? 63.610  99.826  65.096  1.00 31.61 ? 106  LYS B NZ    1 
ATOM   5693  N  N     . HIS B 1 107 ? 70.355  100.418 61.984  1.00 22.06 ? 107  HIS B N     1 
ATOM   5694  C  CA    . HIS B 1 107 ? 71.026  101.421 61.173  1.00 20.82 ? 107  HIS B CA    1 
ATOM   5695  C  C     . HIS B 1 107 ? 69.926  101.998 60.295  1.00 19.98 ? 107  HIS B C     1 
ATOM   5696  O  O     . HIS B 1 107 ? 69.464  101.348 59.362  1.00 20.21 ? 107  HIS B O     1 
ATOM   5697  C  CB    . HIS B 1 107 ? 72.121  100.788 60.310  1.00 21.23 ? 107  HIS B CB    1 
ATOM   5698  C  CG    . HIS B 1 107 ? 73.341  100.386 61.080  1.00 23.21 ? 107  HIS B CG    1 
ATOM   5699  N  ND1   . HIS B 1 107 ? 73.350  99.338  61.975  1.00 22.70 ? 107  HIS B ND1   1 
ATOM   5700  C  CD2   . HIS B 1 107 ? 74.594  100.900 61.090  1.00 23.08 ? 107  HIS B CD2   1 
ATOM   5701  C  CE1   . HIS B 1 107 ? 74.556  99.222  62.502  1.00 23.36 ? 107  HIS B CE1   1 
ATOM   5702  N  NE2   . HIS B 1 107 ? 75.330  100.158 61.981  1.00 21.76 ? 107  HIS B NE2   1 
ATOM   5703  N  N     . ILE B 1 108 ? 69.494  103.211 60.616  1.00 18.60 ? 108  ILE B N     1 
ATOM   5704  C  CA    . ILE B 1 108 ? 68.424  103.860 59.872  1.00 18.09 ? 108  ILE B CA    1 
ATOM   5705  C  C     . ILE B 1 108 ? 69.004  104.873 58.891  1.00 17.03 ? 108  ILE B C     1 
ATOM   5706  O  O     . ILE B 1 108 ? 69.604  105.858 59.301  1.00 17.81 ? 108  ILE B O     1 
ATOM   5707  C  CB    . ILE B 1 108 ? 67.459  104.557 60.850  1.00 18.54 ? 108  ILE B CB    1 
ATOM   5708  C  CG1   . ILE B 1 108 ? 66.962  103.534 61.878  1.00 19.78 ? 108  ILE B CG1   1 
ATOM   5709  C  CG2   . ILE B 1 108 ? 66.301  105.183 60.091  1.00 17.19 ? 108  ILE B CG2   1 
ATOM   5710  C  CD1   . ILE B 1 108 ? 66.242  104.144 63.072  1.00 22.74 ? 108  ILE B CD1   1 
ATOM   5711  N  N     . SER B 1 109 ? 68.833  104.616 57.596  1.00 17.59 ? 109  SER B N     1 
ATOM   5712  C  CA    . SER B 1 109 ? 69.361  105.512 56.566  1.00 17.40 ? 109  SER B CA    1 
ATOM   5713  C  C     . SER B 1 109 ? 68.535  106.781 56.473  1.00 15.93 ? 109  SER B C     1 
ATOM   5714  O  O     . SER B 1 109 ? 67.398  106.820 56.941  1.00 17.85 ? 109  SER B O     1 
ATOM   5715  C  CB    . SER B 1 109 ? 69.343  104.830 55.199  1.00 18.86 ? 109  SER B CB    1 
ATOM   5716  O  OG    . SER B 1 109 ? 68.010  104.716 54.723  1.00 19.00 ? 109  SER B OG    1 
ATOM   5717  N  N     . TYR B 1 110 ? 69.103  107.822 55.870  1.00 15.55 ? 110  TYR B N     1 
ATOM   5718  C  CA    . TYR B 1 110 ? 68.369  109.070 55.717  1.00 16.00 ? 110  TYR B CA    1 
ATOM   5719  C  C     . TYR B 1 110 ? 67.078  108.818 54.948  1.00 17.51 ? 110  TYR B C     1 
ATOM   5720  O  O     . TYR B 1 110 ? 66.046  109.427 55.224  1.00 15.60 ? 110  TYR B O     1 
ATOM   5721  C  CB    . TYR B 1 110 ? 69.220  110.122 54.992  1.00 15.59 ? 110  TYR B CB    1 
ATOM   5722  C  CG    . TYR B 1 110 ? 70.085  110.925 55.939  1.00 14.02 ? 110  TYR B CG    1 
ATOM   5723  C  CD1   . TYR B 1 110 ? 71.361  110.487 56.299  1.00 13.89 ? 110  TYR B CD1   1 
ATOM   5724  C  CD2   . TYR B 1 110 ? 69.592  112.083 56.540  1.00 14.94 ? 110  TYR B CD2   1 
ATOM   5725  C  CE1   . TYR B 1 110 ? 72.120  111.180 57.237  1.00 13.73 ? 110  TYR B CE1   1 
ATOM   5726  C  CE2   . TYR B 1 110 ? 70.341  112.783 57.480  1.00 14.49 ? 110  TYR B CE2   1 
ATOM   5727  C  CZ    . TYR B 1 110 ? 71.599  112.327 57.827  1.00 14.51 ? 110  TYR B CZ    1 
ATOM   5728  O  OH    . TYR B 1 110 ? 72.319  113.005 58.781  1.00 14.89 ? 110  TYR B OH    1 
ATOM   5729  N  N     . ARG B 1 111 ? 67.137  107.906 53.984  1.00 18.70 ? 111  ARG B N     1 
ATOM   5730  C  CA    . ARG B 1 111 ? 65.966  107.583 53.181  1.00 20.62 ? 111  ARG B CA    1 
ATOM   5731  C  C     . ARG B 1 111 ? 64.899  106.940 54.066  1.00 19.68 ? 111  ARG B C     1 
ATOM   5732  O  O     . ARG B 1 111 ? 63.716  107.287 53.994  1.00 18.10 ? 111  ARG B O     1 
ATOM   5733  C  CB    . ARG B 1 111 ? 66.365  106.631 52.051  1.00 24.09 ? 111  ARG B CB    1 
ATOM   5734  C  CG    . ARG B 1 111 ? 65.396  106.596 50.885  1.00 30.55 ? 111  ARG B CG    1 
ATOM   5735  C  CD    . ARG B 1 111 ? 65.884  105.630 49.807  1.00 35.55 ? 111  ARG B CD    1 
ATOM   5736  N  NE    . ARG B 1 111 ? 67.266  105.887 49.395  1.00 39.26 ? 111  ARG B NE    1 
ATOM   5737  C  CZ    . ARG B 1 111 ? 67.672  106.978 48.752  1.00 40.72 ? 111  ARG B CZ    1 
ATOM   5738  N  NH1   . ARG B 1 111 ? 66.804  107.931 48.436  1.00 40.80 ? 111  ARG B NH1   1 
ATOM   5739  N  NH2   . ARG B 1 111 ? 68.951  107.115 48.421  1.00 40.82 ? 111  ARG B NH2   1 
ATOM   5740  N  N     . GLU B 1 112 ? 65.323  106.005 54.909  1.00 19.49 ? 112  GLU B N     1 
ATOM   5741  C  CA    . GLU B 1 112 ? 64.400  105.319 55.808  1.00 19.76 ? 112  GLU B CA    1 
ATOM   5742  C  C     . GLU B 1 112 ? 63.803  106.287 56.830  1.00 17.51 ? 112  GLU B C     1 
ATOM   5743  O  O     . GLU B 1 112 ? 62.596  106.295 57.057  1.00 16.55 ? 112  GLU B O     1 
ATOM   5744  C  CB    . GLU B 1 112 ? 65.122  104.173 56.534  1.00 23.38 ? 112  GLU B CB    1 
ATOM   5745  C  CG    . GLU B 1 112 ? 65.634  103.071 55.613  1.00 29.26 ? 112  GLU B CG    1 
ATOM   5746  C  CD    . GLU B 1 112 ? 66.381  101.965 56.355  1.00 32.53 ? 112  GLU B CD    1 
ATOM   5747  O  OE1   . GLU B 1 112 ? 67.452  102.240 56.943  1.00 31.60 ? 112  GLU B OE1   1 
ATOM   5748  O  OE2   . GLU B 1 112 ? 65.891  100.814 56.347  1.00 35.15 ? 112  GLU B OE2   1 
ATOM   5749  N  N     . LEU B 1 113 ? 64.650  107.104 57.445  1.00 16.43 ? 113  LEU B N     1 
ATOM   5750  C  CA    . LEU B 1 113 ? 64.181  108.064 58.439  1.00 14.02 ? 113  LEU B CA    1 
ATOM   5751  C  C     . LEU B 1 113 ? 63.192  109.031 57.799  1.00 15.39 ? 113  LEU B C     1 
ATOM   5752  O  O     . LEU B 1 113 ? 62.151  109.348 58.375  1.00 15.21 ? 113  LEU B O     1 
ATOM   5753  C  CB    . LEU B 1 113 ? 65.372  108.824 59.035  1.00 15.46 ? 113  LEU B CB    1 
ATOM   5754  C  CG    . LEU B 1 113 ? 65.093  109.742 60.231  1.00 13.06 ? 113  LEU B CG    1 
ATOM   5755  C  CD1   . LEU B 1 113 ? 64.370  108.971 61.328  1.00 12.01 ? 113  LEU B CD1   1 
ATOM   5756  C  CD2   . LEU B 1 113 ? 66.413  110.306 60.750  1.00 13.88 ? 113  LEU B CD2   1 
ATOM   5757  N  N     . HIS B 1 114 ? 63.516  109.491 56.596  1.00 15.40 ? 114  HIS B N     1 
ATOM   5758  C  CA    . HIS B 1 114 ? 62.647  110.407 55.865  1.00 16.38 ? 114  HIS B CA    1 
ATOM   5759  C  C     . HIS B 1 114 ? 61.262  109.796 55.627  1.00 16.74 ? 114  HIS B C     1 
ATOM   5760  O  O     . HIS B 1 114 ? 60.235  110.439 55.865  1.00 16.40 ? 114  HIS B O     1 
ATOM   5761  C  CB    . HIS B 1 114 ? 63.307  110.784 54.530  1.00 17.05 ? 114  HIS B CB    1 
ATOM   5762  C  CG    . HIS B 1 114 ? 62.415  111.554 53.608  1.00 17.66 ? 114  HIS B CG    1 
ATOM   5763  N  ND1   . HIS B 1 114 ? 61.573  110.942 52.705  1.00 17.80 ? 114  HIS B ND1   1 
ATOM   5764  C  CD2   . HIS B 1 114 ? 62.214  112.886 53.467  1.00 19.56 ? 114  HIS B CD2   1 
ATOM   5765  C  CE1   . HIS B 1 114 ? 60.891  111.862 52.047  1.00 20.65 ? 114  HIS B CE1   1 
ATOM   5766  N  NE2   . HIS B 1 114 ? 61.261  113.051 52.490  1.00 18.47 ? 114  HIS B NE2   1 
ATOM   5767  N  N     . ARG B 1 115 ? 61.233  108.548 55.175  1.00 15.53 ? 115  ARG B N     1 
ATOM   5768  C  CA    . ARG B 1 115 ? 59.970  107.870 54.910  1.00 17.89 ? 115  ARG B CA    1 
ATOM   5769  C  C     . ARG B 1 115 ? 59.095  107.773 56.158  1.00 18.05 ? 115  ARG B C     1 
ATOM   5770  O  O     . ARG B 1 115 ? 57.901  108.063 56.101  1.00 17.65 ? 115  ARG B O     1 
ATOM   5771  C  CB    . ARG B 1 115 ? 60.223  106.469 54.345  1.00 18.97 ? 115  ARG B CB    1 
ATOM   5772  C  CG    . ARG B 1 115 ? 58.948  105.701 54.036  1.00 25.77 ? 115  ARG B CG    1 
ATOM   5773  C  CD    . ARG B 1 115 ? 59.219  104.458 53.196  1.00 31.65 ? 115  ARG B CD    1 
ATOM   5774  N  NE    . ARG B 1 115 ? 57.980  103.770 52.832  1.00 37.68 ? 115  ARG B NE    1 
ATOM   5775  C  CZ    . ARG B 1 115 ? 57.197  103.122 53.692  1.00 40.30 ? 115  ARG B CZ    1 
ATOM   5776  N  NH1   . ARG B 1 115 ? 57.521  103.062 54.976  1.00 43.32 ? 115  ARG B NH1   1 
ATOM   5777  N  NH2   . ARG B 1 115 ? 56.084  102.537 53.269  1.00 41.86 ? 115  ARG B NH2   1 
ATOM   5778  N  N     . ASP B 1 116 ? 59.685  107.369 57.282  1.00 18.01 ? 116  ASP B N     1 
ATOM   5779  C  CA    . ASP B 1 116 ? 58.923  107.255 58.522  1.00 17.99 ? 116  ASP B CA    1 
ATOM   5780  C  C     . ASP B 1 116 ? 58.477  108.603 59.065  1.00 16.62 ? 116  ASP B C     1 
ATOM   5781  O  O     . ASP B 1 116 ? 57.400  108.717 59.644  1.00 17.44 ? 116  ASP B O     1 
ATOM   5782  C  CB    . ASP B 1 116 ? 59.724  106.510 59.588  1.00 20.22 ? 116  ASP B CB    1 
ATOM   5783  C  CG    . ASP B 1 116 ? 59.797  105.021 59.318  1.00 26.05 ? 116  ASP B CG    1 
ATOM   5784  O  OD1   . ASP B 1 116 ? 58.800  104.462 58.812  1.00 27.94 ? 116  ASP B OD1   1 
ATOM   5785  O  OD2   . ASP B 1 116 ? 60.843  104.412 59.622  1.00 28.80 ? 116  ASP B OD2   1 
ATOM   5786  N  N     . VAL B 1 117 ? 59.303  109.627 58.888  1.00 15.89 ? 117  VAL B N     1 
ATOM   5787  C  CA    . VAL B 1 117 ? 58.927  110.953 59.352  1.00 15.24 ? 117  VAL B CA    1 
ATOM   5788  C  C     . VAL B 1 117 ? 57.735  111.451 58.531  1.00 14.84 ? 117  VAL B C     1 
ATOM   5789  O  O     . VAL B 1 117 ? 56.830  112.086 59.066  1.00 13.50 ? 117  VAL B O     1 
ATOM   5790  C  CB    . VAL B 1 117 ? 60.126  111.928 59.257  1.00 14.28 ? 117  VAL B CB    1 
ATOM   5791  C  CG1   . VAL B 1 117 ? 59.661  113.372 59.397  1.00 14.61 ? 117  VAL B CG1   1 
ATOM   5792  C  CG2   . VAL B 1 117 ? 61.122  111.595 60.363  1.00 15.64 ? 117  VAL B CG2   1 
ATOM   5793  N  N     . CYS B 1 118 ? 57.723  111.152 57.235  1.00 13.82 ? 118  CYS B N     1 
ATOM   5794  C  CA    . CYS B 1 118 ? 56.607  111.565 56.384  1.00 15.04 ? 118  CYS B CA    1 
ATOM   5795  C  C     . CYS B 1 118 ? 55.336  110.830 56.804  1.00 14.25 ? 118  CYS B C     1 
ATOM   5796  O  O     . CYS B 1 118 ? 54.261  111.426 56.892  1.00 12.58 ? 118  CYS B O     1 
ATOM   5797  C  CB    . CYS B 1 118 ? 56.911  111.268 54.911  1.00 16.30 ? 118  CYS B CB    1 
ATOM   5798  S  SG    . CYS B 1 118 ? 58.102  112.408 54.173  1.00 17.99 ? 118  CYS B SG    1 
ATOM   5799  N  N     . ARG B 1 119 ? 55.465  109.531 57.059  1.00 14.54 ? 119  ARG B N     1 
ATOM   5800  C  CA    . ARG B 1 119 ? 54.329  108.731 57.482  1.00 15.44 ? 119  ARG B CA    1 
ATOM   5801  C  C     . ARG B 1 119 ? 53.796  109.230 58.819  1.00 16.08 ? 119  ARG B C     1 
ATOM   5802  O  O     . ARG B 1 119 ? 52.582  109.315 59.011  1.00 16.98 ? 119  ARG B O     1 
ATOM   5803  C  CB    . ARG B 1 119 ? 54.710  107.245 57.600  1.00 17.78 ? 119  ARG B CB    1 
ATOM   5804  C  CG    . ARG B 1 119 ? 54.982  106.565 56.260  1.00 21.10 ? 119  ARG B CG    1 
ATOM   5805  C  CD    . ARG B 1 119 ? 54.800  105.051 56.335  1.00 25.64 ? 119  ARG B CD    1 
ATOM   5806  N  NE    . ARG B 1 119 ? 55.737  104.421 57.258  1.00 28.89 ? 119  ARG B NE    1 
ATOM   5807  C  CZ    . ARG B 1 119 ? 55.668  103.148 57.639  1.00 32.11 ? 119  ARG B CZ    1 
ATOM   5808  N  NH1   . ARG B 1 119 ? 54.701  102.364 57.176  1.00 31.75 ? 119  ARG B NH1   1 
ATOM   5809  N  NH2   . ARG B 1 119 ? 56.565  102.657 58.486  1.00 31.37 ? 119  ARG B NH2   1 
ATOM   5810  N  N     . PHE B 1 120 ? 54.691  109.565 59.746  1.00 15.59 ? 120  PHE B N     1 
ATOM   5811  C  CA    . PHE B 1 120 ? 54.223  110.040 61.044  1.00 15.71 ? 120  PHE B CA    1 
ATOM   5812  C  C     . PHE B 1 120 ? 53.672  111.461 60.935  1.00 14.34 ? 120  PHE B C     1 
ATOM   5813  O  O     . PHE B 1 120 ? 52.750  111.833 61.658  1.00 14.06 ? 120  PHE B O     1 
ATOM   5814  C  CB    . PHE B 1 120 ? 55.333  109.975 62.107  1.00 15.80 ? 120  PHE B CB    1 
ATOM   5815  C  CG    . PHE B 1 120 ? 54.799  109.951 63.517  1.00 16.76 ? 120  PHE B CG    1 
ATOM   5816  C  CD1   . PHE B 1 120 ? 54.146  108.823 64.004  1.00 19.01 ? 120  PHE B CD1   1 
ATOM   5817  C  CD2   . PHE B 1 120 ? 54.880  111.077 64.329  1.00 16.30 ? 120  PHE B CD2   1 
ATOM   5818  C  CE1   . PHE B 1 120 ? 53.574  108.815 65.282  1.00 17.10 ? 120  PHE B CE1   1 
ATOM   5819  C  CE2   . PHE B 1 120 ? 54.313  111.083 65.608  1.00 16.88 ? 120  PHE B CE2   1 
ATOM   5820  C  CZ    . PHE B 1 120 ? 53.659  109.949 66.083  1.00 16.44 ? 120  PHE B CZ    1 
ATOM   5821  N  N     . ALA B 1 121 ? 54.235  112.257 60.031  1.00 13.26 ? 121  ALA B N     1 
ATOM   5822  C  CA    . ALA B 1 121 ? 53.738  113.614 59.830  1.00 15.06 ? 121  ALA B CA    1 
ATOM   5823  C  C     . ALA B 1 121 ? 52.285  113.519 59.355  1.00 14.68 ? 121  ALA B C     1 
ATOM   5824  O  O     . ALA B 1 121 ? 51.415  114.257 59.823  1.00 13.89 ? 121  ALA B O     1 
ATOM   5825  C  CB    . ALA B 1 121 ? 54.582  114.337 58.800  1.00 15.94 ? 121  ALA B CB    1 
ATOM   5826  N  N     . ASN B 1 122 ? 52.019  112.609 58.421  1.00 15.23 ? 122  ASN B N     1 
ATOM   5827  C  CA    . ASN B 1 122 ? 50.657  112.434 57.927  1.00 16.41 ? 122  ASN B CA    1 
ATOM   5828  C  C     . ASN B 1 122 ? 49.770  111.873 59.034  1.00 17.22 ? 122  ASN B C     1 
ATOM   5829  O  O     . ASN B 1 122 ? 48.582  112.191 59.112  1.00 18.27 ? 122  ASN B O     1 
ATOM   5830  C  CB    . ASN B 1 122 ? 50.629  111.512 56.702  1.00 16.27 ? 122  ASN B CB    1 
ATOM   5831  C  CG    . ASN B 1 122 ? 51.019  112.238 55.423  1.00 17.17 ? 122  ASN B CG    1 
ATOM   5832  O  OD1   . ASN B 1 122 ? 50.627  113.386 55.215  1.00 18.22 ? 122  ASN B OD1   1 
ATOM   5833  N  ND2   . ASN B 1 122 ? 51.783  111.573 54.559  1.00 15.16 ? 122  ASN B ND2   1 
ATOM   5834  N  N     . THR B 1 123 ? 50.352  111.038 59.890  1.00 17.13 ? 123  THR B N     1 
ATOM   5835  C  CA    . THR B 1 123 ? 49.615  110.459 61.008  1.00 16.34 ? 123  THR B CA    1 
ATOM   5836  C  C     . THR B 1 123 ? 49.130  111.594 61.910  1.00 16.74 ? 123  THR B C     1 
ATOM   5837  O  O     . THR B 1 123 ? 47.967  111.626 62.310  1.00 16.26 ? 123  THR B O     1 
ATOM   5838  C  CB    . THR B 1 123 ? 50.508  109.503 61.831  1.00 15.22 ? 123  THR B CB    1 
ATOM   5839  O  OG1   . THR B 1 123 ? 50.784  108.325 61.061  1.00 14.89 ? 123  THR B OG1   1 
ATOM   5840  C  CG2   . THR B 1 123 ? 49.820  109.105 63.129  1.00 18.02 ? 123  THR B CG2   1 
ATOM   5841  N  N     . LEU B 1 124 ? 50.023  112.532 62.217  1.00 16.31 ? 124  LEU B N     1 
ATOM   5842  C  CA    . LEU B 1 124 ? 49.675  113.667 63.069  1.00 15.77 ? 124  LEU B CA    1 
ATOM   5843  C  C     . LEU B 1 124 ? 48.591  114.533 62.435  1.00 16.11 ? 124  LEU B C     1 
ATOM   5844  O  O     . LEU B 1 124 ? 47.630  114.929 63.098  1.00 16.38 ? 124  LEU B O     1 
ATOM   5845  C  CB    . LEU B 1 124 ? 50.917  114.524 63.350  1.00 14.07 ? 124  LEU B CB    1 
ATOM   5846  C  CG    . LEU B 1 124 ? 52.025  113.852 64.170  1.00 15.42 ? 124  LEU B CG    1 
ATOM   5847  C  CD1   . LEU B 1 124 ? 53.273  114.733 64.186  1.00 14.54 ? 124  LEU B CD1   1 
ATOM   5848  C  CD2   . LEU B 1 124 ? 51.527  113.601 65.590  1.00 16.41 ? 124  LEU B CD2   1 
ATOM   5849  N  N     . LEU B 1 125 ? 48.751  114.834 61.151  1.00 15.67 ? 125  LEU B N     1 
ATOM   5850  C  CA    . LEU B 1 125 ? 47.781  115.652 60.439  1.00 16.88 ? 125  LEU B CA    1 
ATOM   5851  C  C     . LEU B 1 125 ? 46.410  114.982 60.405  1.00 18.47 ? 125  LEU B C     1 
ATOM   5852  O  O     . LEU B 1 125 ? 45.386  115.635 60.620  1.00 20.23 ? 125  LEU B O     1 
ATOM   5853  C  CB    . LEU B 1 125 ? 48.263  115.909 59.012  1.00 17.86 ? 125  LEU B CB    1 
ATOM   5854  C  CG    . LEU B 1 125 ? 49.514  116.787 58.898  1.00 19.07 ? 125  LEU B CG    1 
ATOM   5855  C  CD1   . LEU B 1 125 ? 50.054  116.754 57.478  1.00 19.83 ? 125  LEU B CD1   1 
ATOM   5856  C  CD2   . LEU B 1 125 ? 49.164  118.209 59.312  1.00 18.28 ? 125  LEU B CD2   1 
ATOM   5857  N  N     . ASP B 1 126 ? 46.392  113.678 60.140  1.00 18.77 ? 126  ASP B N     1 
ATOM   5858  C  CA    . ASP B 1 126 ? 45.132  112.945 60.071  1.00 20.75 ? 126  ASP B CA    1 
ATOM   5859  C  C     . ASP B 1 126 ? 44.455  112.851 61.430  1.00 21.59 ? 126  ASP B C     1 
ATOM   5860  O  O     . ASP B 1 126 ? 43.247  112.617 61.515  1.00 21.14 ? 126  ASP B O     1 
ATOM   5861  C  CB    . ASP B 1 126 ? 45.360  111.536 59.511  1.00 22.89 ? 126  ASP B CB    1 
ATOM   5862  C  CG    . ASP B 1 126 ? 45.731  111.547 58.040  1.00 27.09 ? 126  ASP B CG    1 
ATOM   5863  O  OD1   . ASP B 1 126 ? 45.454  112.559 57.364  1.00 30.19 ? 126  ASP B OD1   1 
ATOM   5864  O  OD2   . ASP B 1 126 ? 46.289  110.541 57.556  1.00 29.82 ? 126  ASP B OD2   1 
ATOM   5865  N  N     . LEU B 1 127 ? 45.239  113.040 62.487  1.00 19.55 ? 127  LEU B N     1 
ATOM   5866  C  CA    . LEU B 1 127 ? 44.733  112.975 63.851  1.00 22.23 ? 127  LEU B CA    1 
ATOM   5867  C  C     . LEU B 1 127 ? 44.229  114.347 64.312  1.00 22.54 ? 127  LEU B C     1 
ATOM   5868  O  O     . LEU B 1 127 ? 43.687  114.489 65.412  1.00 24.03 ? 127  LEU B O     1 
ATOM   5869  C  CB    . LEU B 1 127 ? 45.843  112.471 64.778  1.00 24.15 ? 127  LEU B CB    1 
ATOM   5870  C  CG    . LEU B 1 127 ? 45.469  111.616 65.987  1.00 26.50 ? 127  LEU B CG    1 
ATOM   5871  C  CD1   . LEU B 1 127 ? 44.530  110.495 65.570  1.00 26.13 ? 127  LEU B CD1   1 
ATOM   5872  C  CD2   . LEU B 1 127 ? 46.744  111.040 66.599  1.00 27.82 ? 127  LEU B CD2   1 
ATOM   5873  N  N     . GLY B 1 128 ? 44.420  115.360 63.473  1.00 20.32 ? 128  GLY B N     1 
ATOM   5874  C  CA    . GLY B 1 128 ? 43.955  116.694 63.817  1.00 21.27 ? 128  GLY B CA    1 
ATOM   5875  C  C     . GLY B 1 128 ? 45.008  117.673 64.300  1.00 21.28 ? 128  GLY B C     1 
ATOM   5876  O  O     . GLY B 1 128 ? 44.690  118.822 64.624  1.00 21.61 ? 128  GLY B O     1 
ATOM   5877  N  N     . ILE B 1 129 ? 46.263  117.242 64.358  1.00 19.20 ? 129  ILE B N     1 
ATOM   5878  C  CA    . ILE B 1 129 ? 47.319  118.138 64.808  1.00 19.47 ? 129  ILE B CA    1 
ATOM   5879  C  C     . ILE B 1 129 ? 47.627  119.142 63.704  1.00 19.69 ? 129  ILE B C     1 
ATOM   5880  O  O     . ILE B 1 129 ? 47.749  118.778 62.533  1.00 19.86 ? 129  ILE B O     1 
ATOM   5881  C  CB    . ILE B 1 129 ? 48.607  117.361 65.171  1.00 19.33 ? 129  ILE B CB    1 
ATOM   5882  C  CG1   . ILE B 1 129 ? 48.304  116.346 66.277  1.00 20.01 ? 129  ILE B CG1   1 
ATOM   5883  C  CG2   . ILE B 1 129 ? 49.701  118.333 65.607  1.00 19.21 ? 129  ILE B CG2   1 
ATOM   5884  C  CD1   . ILE B 1 129 ? 47.699  116.959 67.540  1.00 20.71 ? 129  ILE B CD1   1 
ATOM   5885  N  N     . LYS B 1 130 ? 47.742  120.412 64.072  1.00 19.09 ? 130  LYS B N     1 
ATOM   5886  C  CA    . LYS B 1 130 ? 48.031  121.439 63.085  1.00 21.22 ? 130  LYS B CA    1 
ATOM   5887  C  C     . LYS B 1 130 ? 49.173  122.337 63.531  1.00 20.31 ? 130  LYS B C     1 
ATOM   5888  O  O     . LYS B 1 130 ? 49.566  122.331 64.697  1.00 19.26 ? 130  LYS B O     1 
ATOM   5889  C  CB    . LYS B 1 130 ? 46.781  122.284 62.817  1.00 25.87 ? 130  LYS B CB    1 
ATOM   5890  C  CG    . LYS B 1 130 ? 45.563  121.459 62.425  1.00 30.25 ? 130  LYS B CG    1 
ATOM   5891  C  CD    . LYS B 1 130 ? 44.420  122.333 61.944  1.00 34.02 ? 130  LYS B CD    1 
ATOM   5892  C  CE    . LYS B 1 130 ? 43.160  121.506 61.747  1.00 36.02 ? 130  LYS B CE    1 
ATOM   5893  N  NZ    . LYS B 1 130 ? 43.385  120.360 60.828  1.00 36.90 ? 130  LYS B NZ    1 
ATOM   5894  N  N     . LYS B 1 131 ? 49.705  123.103 62.585  1.00 19.45 ? 131  LYS B N     1 
ATOM   5895  C  CA    . LYS B 1 131 ? 50.795  124.019 62.869  1.00 19.49 ? 131  LYS B CA    1 
ATOM   5896  C  C     . LYS B 1 131 ? 50.439  124.867 64.085  1.00 19.26 ? 131  LYS B C     1 
ATOM   5897  O  O     . LYS B 1 131 ? 49.349  125.441 64.157  1.00 19.03 ? 131  LYS B O     1 
ATOM   5898  C  CB    . LYS B 1 131 ? 51.053  124.926 61.664  1.00 18.98 ? 131  LYS B CB    1 
ATOM   5899  C  CG    . LYS B 1 131 ? 52.084  126.013 61.933  1.00 19.62 ? 131  LYS B CG    1 
ATOM   5900  C  CD    . LYS B 1 131 ? 52.389  126.824 60.688  1.00 20.24 ? 131  LYS B CD    1 
ATOM   5901  C  CE    . LYS B 1 131 ? 53.340  127.967 61.017  1.00 20.79 ? 131  LYS B CE    1 
ATOM   5902  N  NZ    . LYS B 1 131 ? 53.715  128.748 59.807  1.00 21.65 ? 131  LYS B NZ    1 
ATOM   5903  N  N     . GLY B 1 132 ? 51.359  124.934 65.041  1.00 18.39 ? 132  GLY B N     1 
ATOM   5904  C  CA    . GLY B 1 132 ? 51.123  125.715 66.238  1.00 18.48 ? 132  GLY B CA    1 
ATOM   5905  C  C     . GLY B 1 132 ? 50.697  124.901 67.443  1.00 19.43 ? 132  GLY B C     1 
ATOM   5906  O  O     . GLY B 1 132 ? 50.902  125.328 68.583  1.00 19.42 ? 132  GLY B O     1 
ATOM   5907  N  N     . ASP B 1 133 ? 50.092  123.738 67.212  1.00 19.53 ? 133  ASP B N     1 
ATOM   5908  C  CA    . ASP B 1 133 ? 49.667  122.894 68.325  1.00 19.37 ? 133  ASP B CA    1 
ATOM   5909  C  C     . ASP B 1 133 ? 50.894  122.339 69.034  1.00 19.58 ? 133  ASP B C     1 
ATOM   5910  O  O     . ASP B 1 133 ? 51.926  122.101 68.408  1.00 20.61 ? 133  ASP B O     1 
ATOM   5911  C  CB    . ASP B 1 133 ? 48.823  121.707 67.848  1.00 20.38 ? 133  ASP B CB    1 
ATOM   5912  C  CG    . ASP B 1 133 ? 47.472  122.118 67.299  1.00 23.24 ? 133  ASP B CG    1 
ATOM   5913  O  OD1   . ASP B 1 133 ? 46.955  123.186 67.695  1.00 22.73 ? 133  ASP B OD1   1 
ATOM   5914  O  OD2   . ASP B 1 133 ? 46.920  121.351 66.481  1.00 23.36 ? 133  ASP B OD2   1 
ATOM   5915  N  N     . VAL B 1 134 ? 50.777  122.126 70.339  1.00 19.33 ? 134  VAL B N     1 
ATOM   5916  C  CA    . VAL B 1 134 ? 51.875  121.566 71.113  1.00 17.01 ? 134  VAL B CA    1 
ATOM   5917  C  C     . VAL B 1 134 ? 51.644  120.065 71.264  1.00 17.16 ? 134  VAL B C     1 
ATOM   5918  O  O     . VAL B 1 134 ? 50.536  119.624 71.576  1.00 17.32 ? 134  VAL B O     1 
ATOM   5919  C  CB    . VAL B 1 134 ? 51.970  122.203 72.522  1.00 18.50 ? 134  VAL B CB    1 
ATOM   5920  C  CG1   . VAL B 1 134 ? 53.084  121.534 73.322  1.00 17.52 ? 134  VAL B CG1   1 
ATOM   5921  C  CG2   . VAL B 1 134 ? 52.243  123.695 72.402  1.00 18.68 ? 134  VAL B CG2   1 
ATOM   5922  N  N     . VAL B 1 135 ? 52.694  119.288 71.019  1.00 14.94 ? 135  VAL B N     1 
ATOM   5923  C  CA    . VAL B 1 135 ? 52.636  117.839 71.129  1.00 14.91 ? 135  VAL B CA    1 
ATOM   5924  C  C     . VAL B 1 135 ? 53.638  117.424 72.200  1.00 14.99 ? 135  VAL B C     1 
ATOM   5925  O  O     . VAL B 1 135 ? 54.823  117.733 72.095  1.00 16.36 ? 135  VAL B O     1 
ATOM   5926  C  CB    . VAL B 1 135 ? 53.019  117.165 69.783  1.00 12.99 ? 135  VAL B CB    1 
ATOM   5927  C  CG1   . VAL B 1 135 ? 53.073  115.655 69.935  1.00 14.25 ? 135  VAL B CG1   1 
ATOM   5928  C  CG2   . VAL B 1 135 ? 52.018  117.551 68.711  1.00 14.59 ? 135  VAL B CG2   1 
ATOM   5929  N  N     . ALA B 1 136 ? 53.165  116.743 73.239  1.00 15.38 ? 136  ALA B N     1 
ATOM   5930  C  CA    . ALA B 1 136 ? 54.060  116.297 74.306  1.00 14.09 ? 136  ALA B CA    1 
ATOM   5931  C  C     . ALA B 1 136 ? 54.678  114.960 73.916  1.00 14.66 ? 136  ALA B C     1 
ATOM   5932  O  O     . ALA B 1 136 ? 53.983  114.063 73.431  1.00 12.70 ? 136  ALA B O     1 
ATOM   5933  C  CB    . ALA B 1 136 ? 53.297  116.156 75.620  1.00 15.02 ? 136  ALA B CB    1 
ATOM   5934  N  N     . ILE B 1 137 ? 55.986  114.844 74.116  1.00 13.16 ? 137  ILE B N     1 
ATOM   5935  C  CA    . ILE B 1 137 ? 56.717  113.628 73.791  1.00 13.95 ? 137  ILE B CA    1 
ATOM   5936  C  C     . ILE B 1 137 ? 57.437  113.128 75.039  1.00 14.27 ? 137  ILE B C     1 
ATOM   5937  O  O     . ILE B 1 137 ? 58.393  113.742 75.523  1.00 13.33 ? 137  ILE B O     1 
ATOM   5938  C  CB    . ILE B 1 137 ? 57.735  113.878 72.651  1.00 15.50 ? 137  ILE B CB    1 
ATOM   5939  C  CG1   . ILE B 1 137 ? 56.988  114.327 71.389  1.00 14.71 ? 137  ILE B CG1   1 
ATOM   5940  C  CG2   . ILE B 1 137 ? 58.524  112.600 72.360  1.00 16.01 ? 137  ILE B CG2   1 
ATOM   5941  C  CD1   . ILE B 1 137 ? 57.893  114.679 70.211  1.00 15.09 ? 137  ILE B CD1   1 
ATOM   5942  N  N     . TYR B 1 138 ? 56.955  112.000 75.551  1.00 13.00 ? 138  TYR B N     1 
ATOM   5943  C  CA    . TYR B 1 138 ? 57.488  111.378 76.757  1.00 12.53 ? 138  TYR B CA    1 
ATOM   5944  C  C     . TYR B 1 138 ? 58.024  110.014 76.323  1.00 14.10 ? 138  TYR B C     1 
ATOM   5945  O  O     . TYR B 1 138 ? 57.391  108.978 76.544  1.00 13.84 ? 138  TYR B O     1 
ATOM   5946  C  CB    . TYR B 1 138 ? 56.336  111.245 77.750  1.00 11.80 ? 138  TYR B CB    1 
ATOM   5947  C  CG    . TYR B 1 138 ? 56.684  110.768 79.137  1.00 12.96 ? 138  TYR B CG    1 
ATOM   5948  C  CD1   . TYR B 1 138 ? 57.644  111.421 79.911  1.00 12.24 ? 138  TYR B CD1   1 
ATOM   5949  C  CD2   . TYR B 1 138 ? 55.972  109.718 79.715  1.00 13.24 ? 138  TYR B CD2   1 
ATOM   5950  C  CE1   . TYR B 1 138 ? 57.877  111.043 81.235  1.00 13.45 ? 138  TYR B CE1   1 
ATOM   5951  C  CE2   . TYR B 1 138 ? 56.193  109.334 81.029  1.00 14.47 ? 138  TYR B CE2   1 
ATOM   5952  C  CZ    . TYR B 1 138 ? 57.140  109.999 81.785  1.00 13.81 ? 138  TYR B CZ    1 
ATOM   5953  O  OH    . TYR B 1 138 ? 57.322  109.630 83.096  1.00 16.06 ? 138  TYR B OH    1 
ATOM   5954  N  N     . MET B 1 139 ? 59.205  110.032 75.708  1.00 13.83 ? 139  MET B N     1 
ATOM   5955  C  CA    . MET B 1 139 ? 59.816  108.825 75.156  1.00 13.25 ? 139  MET B CA    1 
ATOM   5956  C  C     . MET B 1 139 ? 61.185  108.426 75.679  1.00 14.25 ? 139  MET B C     1 
ATOM   5957  O  O     . MET B 1 139 ? 61.937  109.251 76.207  1.00 12.97 ? 139  MET B O     1 
ATOM   5958  C  CB    . MET B 1 139 ? 59.941  108.984 73.638  1.00 14.17 ? 139  MET B CB    1 
ATOM   5959  C  CG    . MET B 1 139 ? 58.634  109.150 72.902  1.00 15.65 ? 139  MET B CG    1 
ATOM   5960  S  SD    . MET B 1 139 ? 57.820  107.574 72.700  1.00 17.47 ? 139  MET B SD    1 
ATOM   5961  C  CE    . MET B 1 139 ? 58.710  106.920 71.244  1.00 14.26 ? 139  MET B CE    1 
ATOM   5962  N  N     . PRO B 1 140 ? 61.529  107.137 75.520  1.00 14.20 ? 140  PRO B N     1 
ATOM   5963  C  CA    . PRO B 1 140 ? 62.819  106.611 75.956  1.00 14.63 ? 140  PRO B CA    1 
ATOM   5964  C  C     . PRO B 1 140 ? 63.776  106.840 74.782  1.00 14.20 ? 140  PRO B C     1 
ATOM   5965  O  O     . PRO B 1 140 ? 63.392  107.446 73.778  1.00 11.92 ? 140  PRO B O     1 
ATOM   5966  C  CB    . PRO B 1 140 ? 62.515  105.137 76.196  1.00 13.64 ? 140  PRO B CB    1 
ATOM   5967  C  CG    . PRO B 1 140 ? 61.555  104.826 75.090  1.00 15.77 ? 140  PRO B CG    1 
ATOM   5968  C  CD    . PRO B 1 140 ? 60.631  106.041 75.096  1.00 14.13 ? 140  PRO B CD    1 
ATOM   5969  N  N     . MET B 1 141 ? 65.009  106.361 74.897  1.00 13.81 ? 141  MET B N     1 
ATOM   5970  C  CA    . MET B 1 141 ? 65.980  106.545 73.823  1.00 14.91 ? 141  MET B CA    1 
ATOM   5971  C  C     . MET B 1 141 ? 65.840  105.501 72.715  1.00 14.41 ? 141  MET B C     1 
ATOM   5972  O  O     . MET B 1 141 ? 66.626  104.558 72.632  1.00 13.78 ? 141  MET B O     1 
ATOM   5973  C  CB    . MET B 1 141 ? 67.398  106.526 74.396  1.00 12.86 ? 141  MET B CB    1 
ATOM   5974  C  CG    . MET B 1 141 ? 67.777  107.816 75.133  1.00 14.47 ? 141  MET B CG    1 
ATOM   5975  S  SD    . MET B 1 141 ? 68.122  109.184 73.991  1.00 15.65 ? 141  MET B SD    1 
ATOM   5976  C  CE    . MET B 1 141 ? 69.868  108.977 73.766  1.00 15.05 ? 141  MET B CE    1 
ATOM   5977  N  N     . VAL B 1 142 ? 64.817  105.679 71.882  1.00 15.52 ? 142  VAL B N     1 
ATOM   5978  C  CA    . VAL B 1 142 ? 64.549  104.797 70.751  1.00 15.22 ? 142  VAL B CA    1 
ATOM   5979  C  C     . VAL B 1 142 ? 64.353  105.683 69.520  1.00 16.24 ? 142  VAL B C     1 
ATOM   5980  O  O     . VAL B 1 142 ? 63.967  106.841 69.646  1.00 15.80 ? 142  VAL B O     1 
ATOM   5981  C  CB    . VAL B 1 142 ? 63.281  103.942 70.974  1.00 16.12 ? 142  VAL B CB    1 
ATOM   5982  C  CG1   . VAL B 1 142 ? 63.496  102.992 72.146  1.00 15.29 ? 142  VAL B CG1   1 
ATOM   5983  C  CG2   . VAL B 1 142 ? 62.067  104.846 71.217  1.00 14.80 ? 142  VAL B CG2   1 
ATOM   5984  N  N     . PRO B 1 143 ? 64.612  105.147 68.314  1.00 17.00 ? 143  PRO B N     1 
ATOM   5985  C  CA    . PRO B 1 143 ? 64.471  105.898 67.058  1.00 16.79 ? 143  PRO B CA    1 
ATOM   5986  C  C     . PRO B 1 143 ? 63.129  106.610 66.889  1.00 16.24 ? 143  PRO B C     1 
ATOM   5987  O  O     . PRO B 1 143 ? 63.061  107.705 66.330  1.00 14.48 ? 143  PRO B O     1 
ATOM   5988  C  CB    . PRO B 1 143 ? 64.681  104.825 65.990  1.00 18.80 ? 143  PRO B CB    1 
ATOM   5989  C  CG    . PRO B 1 143 ? 65.603  103.871 66.647  1.00 17.32 ? 143  PRO B CG    1 
ATOM   5990  C  CD    . PRO B 1 143 ? 65.042  103.763 68.045  1.00 16.40 ? 143  PRO B CD    1 
ATOM   5991  N  N     . GLU B 1 144 ? 62.064  105.979 67.370  1.00 14.34 ? 144  GLU B N     1 
ATOM   5992  C  CA    . GLU B 1 144 ? 60.733  106.552 67.266  1.00 13.97 ? 144  GLU B CA    1 
ATOM   5993  C  C     . GLU B 1 144 ? 60.639  107.924 67.918  1.00 13.32 ? 144  GLU B C     1 
ATOM   5994  O  O     . GLU B 1 144 ? 59.838  108.758 67.496  1.00 13.83 ? 144  GLU B O     1 
ATOM   5995  C  CB    . GLU B 1 144 ? 59.699  105.608 67.880  1.00 15.18 ? 144  GLU B CB    1 
ATOM   5996  C  CG    . GLU B 1 144 ? 59.514  104.310 67.100  1.00 16.15 ? 144  GLU B CG    1 
ATOM   5997  C  CD    . GLU B 1 144 ? 60.555  103.250 67.425  1.00 17.47 ? 144  GLU B CD    1 
ATOM   5998  O  OE1   . GLU B 1 144 ? 61.465  103.512 68.237  1.00 16.89 ? 144  GLU B OE1   1 
ATOM   5999  O  OE2   . GLU B 1 144 ? 60.455  102.143 66.860  1.00 19.35 ? 144  GLU B OE2   1 
ATOM   6000  N  N     . ALA B 1 145 ? 61.448  108.163 68.947  1.00 11.96 ? 145  ALA B N     1 
ATOM   6001  C  CA    . ALA B 1 145 ? 61.429  109.465 69.607  1.00 12.05 ? 145  ALA B CA    1 
ATOM   6002  C  C     . ALA B 1 145 ? 61.853  110.527 68.593  1.00 11.41 ? 145  ALA B C     1 
ATOM   6003  O  O     . ALA B 1 145 ? 61.243  111.590 68.500  1.00 11.49 ? 145  ALA B O     1 
ATOM   6004  C  CB    . ALA B 1 145 ? 62.373  109.471 70.806  1.00 13.18 ? 145  ALA B CB    1 
ATOM   6005  N  N     . ALA B 1 146 ? 62.896  110.226 67.827  1.00 11.49 ? 146  ALA B N     1 
ATOM   6006  C  CA    . ALA B 1 146 ? 63.395  111.157 66.817  1.00 12.80 ? 146  ALA B CA    1 
ATOM   6007  C  C     . ALA B 1 146 ? 62.372  111.325 65.700  1.00 12.95 ? 146  ALA B C     1 
ATOM   6008  O  O     . ALA B 1 146 ? 62.174  112.429 65.183  1.00 14.69 ? 146  ALA B O     1 
ATOM   6009  C  CB    . ALA B 1 146 ? 64.721  110.653 66.244  1.00 12.60 ? 146  ALA B CB    1 
ATOM   6010  N  N     . VAL B 1 147 ? 61.727  110.225 65.321  1.00 13.57 ? 147  VAL B N     1 
ATOM   6011  C  CA    . VAL B 1 147 ? 60.715  110.279 64.271  1.00 13.39 ? 147  VAL B CA    1 
ATOM   6012  C  C     . VAL B 1 147 ? 59.608  111.235 64.695  1.00 12.80 ? 147  VAL B C     1 
ATOM   6013  O  O     . VAL B 1 147 ? 59.164  112.070 63.909  1.00 12.24 ? 147  VAL B O     1 
ATOM   6014  C  CB    . VAL B 1 147 ? 60.094  108.887 64.003  1.00 14.00 ? 147  VAL B CB    1 
ATOM   6015  C  CG1   . VAL B 1 147 ? 58.976  109.000 62.961  1.00 12.24 ? 147  VAL B CG1   1 
ATOM   6016  C  CG2   . VAL B 1 147 ? 61.168  107.928 63.520  1.00 15.07 ? 147  VAL B CG2   1 
ATOM   6017  N  N     . ALA B 1 148 ? 59.173  111.120 65.946  1.00 12.53 ? 148  ALA B N     1 
ATOM   6018  C  CA    . ALA B 1 148 ? 58.110  111.981 66.451  1.00 12.75 ? 148  ALA B CA    1 
ATOM   6019  C  C     . ALA B 1 148 ? 58.526  113.451 66.478  1.00 12.04 ? 148  ALA B C     1 
ATOM   6020  O  O     . ALA B 1 148 ? 57.752  114.323 66.085  1.00 11.95 ? 148  ALA B O     1 
ATOM   6021  C  CB    . ALA B 1 148 ? 57.677  111.525 67.853  1.00 12.25 ? 148  ALA B CB    1 
ATOM   6022  N  N     . MET B 1 149 ? 59.746  113.725 66.931  1.00 13.13 ? 149  MET B N     1 
ATOM   6023  C  CA    . MET B 1 149 ? 60.232  115.102 66.997  1.00 12.88 ? 149  MET B CA    1 
ATOM   6024  C  C     . MET B 1 149 ? 60.335  115.736 65.607  1.00 13.77 ? 149  MET B C     1 
ATOM   6025  O  O     . MET B 1 149 ? 59.845  116.844 65.382  1.00 13.10 ? 149  MET B O     1 
ATOM   6026  C  CB    . MET B 1 149 ? 61.593  115.141 67.696  1.00 13.92 ? 149  MET B CB    1 
ATOM   6027  C  CG    . MET B 1 149 ? 61.511  114.928 69.205  1.00 13.04 ? 149  MET B CG    1 
ATOM   6028  S  SD    . MET B 1 149 ? 63.107  114.612 69.963  1.00 14.71 ? 149  MET B SD    1 
ATOM   6029  C  CE    . MET B 1 149 ? 63.853  116.274 69.909  1.00 11.49 ? 149  MET B CE    1 
ATOM   6030  N  N     . LEU B 1 150 ? 60.967  115.027 64.679  1.00 13.12 ? 150  LEU B N     1 
ATOM   6031  C  CA    . LEU B 1 150 ? 61.132  115.514 63.313  1.00 12.07 ? 150  LEU B CA    1 
ATOM   6032  C  C     . LEU B 1 150 ? 59.792  115.702 62.592  1.00 12.81 ? 150  LEU B C     1 
ATOM   6033  O  O     . LEU B 1 150 ? 59.636  116.628 61.789  1.00 13.60 ? 150  LEU B O     1 
ATOM   6034  C  CB    . LEU B 1 150 ? 62.024  114.543 62.525  1.00 12.09 ? 150  LEU B CB    1 
ATOM   6035  C  CG    . LEU B 1 150 ? 63.516  114.560 62.886  1.00 13.42 ? 150  LEU B CG    1 
ATOM   6036  C  CD1   . LEU B 1 150 ? 64.182  113.256 62.446  1.00 11.75 ? 150  LEU B CD1   1 
ATOM   6037  C  CD2   . LEU B 1 150 ? 64.190  115.768 62.230  1.00 12.62 ? 150  LEU B CD2   1 
ATOM   6038  N  N     . ALA B 1 151 ? 58.828  114.826 62.870  1.00 12.00 ? 151  ALA B N     1 
ATOM   6039  C  CA    . ALA B 1 151 ? 57.514  114.931 62.239  1.00 12.93 ? 151  ALA B CA    1 
ATOM   6040  C  C     . ALA B 1 151 ? 56.775  116.171 62.731  1.00 12.87 ? 151  ALA B C     1 
ATOM   6041  O  O     . ALA B 1 151 ? 56.092  116.840 61.954  1.00 13.49 ? 151  ALA B O     1 
ATOM   6042  C  CB    . ALA B 1 151 ? 56.686  113.678 62.522  1.00 13.15 ? 151  ALA B CB    1 
ATOM   6043  N  N     . CYS B 1 152 ? 56.899  116.471 64.022  1.00 12.71 ? 152  CYS B N     1 
ATOM   6044  C  CA    . CYS B 1 152 ? 56.246  117.651 64.573  1.00 12.12 ? 152  CYS B CA    1 
ATOM   6045  C  C     . CYS B 1 152 ? 56.857  118.871 63.895  1.00 12.27 ? 152  CYS B C     1 
ATOM   6046  O  O     . CYS B 1 152 ? 56.142  119.758 63.418  1.00 12.91 ? 152  CYS B O     1 
ATOM   6047  C  CB    . CYS B 1 152 ? 56.459  117.742 66.089  1.00 11.48 ? 152  CYS B CB    1 
ATOM   6048  S  SG    . CYS B 1 152 ? 55.489  116.572 67.076  1.00 14.00 ? 152  CYS B SG    1 
ATOM   6049  N  N     . ALA B 1 153 ? 58.186  118.901 63.844  1.00 12.34 ? 153  ALA B N     1 
ATOM   6050  C  CA    . ALA B 1 153 ? 58.899  120.008 63.215  1.00 13.15 ? 153  ALA B CA    1 
ATOM   6051  C  C     . ALA B 1 153 ? 58.489  120.149 61.751  1.00 13.87 ? 153  ALA B C     1 
ATOM   6052  O  O     . ALA B 1 153 ? 58.346  121.260 61.245  1.00 15.27 ? 153  ALA B O     1 
ATOM   6053  C  CB    . ALA B 1 153 ? 60.413  119.789 63.313  1.00 11.66 ? 153  ALA B CB    1 
ATOM   6054  N  N     . ARG B 1 154 ? 58.300  119.022 61.074  1.00 14.48 ? 154  ARG B N     1 
ATOM   6055  C  CA    . ARG B 1 154 ? 57.925  119.046 59.667  1.00 14.65 ? 154  ARG B CA    1 
ATOM   6056  C  C     . ARG B 1 154 ? 56.595  119.759 59.414  1.00 14.83 ? 154  ARG B C     1 
ATOM   6057  O  O     . ARG B 1 154 ? 56.463  120.485 58.434  1.00 15.25 ? 154  ARG B O     1 
ATOM   6058  C  CB    . ARG B 1 154 ? 57.850  117.624 59.111  1.00 14.69 ? 154  ARG B CB    1 
ATOM   6059  C  CG    . ARG B 1 154 ? 57.842  117.551 57.582  1.00 15.75 ? 154  ARG B CG    1 
ATOM   6060  C  CD    . ARG B 1 154 ? 57.743  116.100 57.122  1.00 15.18 ? 154  ARG B CD    1 
ATOM   6061  N  NE    . ARG B 1 154 ? 57.827  115.939 55.669  1.00 15.68 ? 154  ARG B NE    1 
ATOM   6062  C  CZ    . ARG B 1 154 ? 58.960  115.964 54.971  1.00 18.09 ? 154  ARG B CZ    1 
ATOM   6063  N  NH1   . ARG B 1 154 ? 60.123  116.149 55.589  1.00 18.08 ? 154  ARG B NH1   1 
ATOM   6064  N  NH2   . ARG B 1 154 ? 58.934  115.783 53.655  1.00 14.70 ? 154  ARG B NH2   1 
ATOM   6065  N  N     . ILE B 1 155 ? 55.616  119.566 60.294  1.00 13.11 ? 155  ILE B N     1 
ATOM   6066  C  CA    . ILE B 1 155 ? 54.316  120.205 60.107  1.00 14.08 ? 155  ILE B CA    1 
ATOM   6067  C  C     . ILE B 1 155 ? 54.133  121.495 60.907  1.00 13.98 ? 155  ILE B C     1 
ATOM   6068  O  O     . ILE B 1 155 ? 53.058  122.093 60.890  1.00 16.66 ? 155  ILE B O     1 
ATOM   6069  C  CB    . ILE B 1 155 ? 53.149  119.234 60.452  1.00 13.43 ? 155  ILE B CB    1 
ATOM   6070  C  CG1   . ILE B 1 155 ? 53.143  118.922 61.950  1.00 13.19 ? 155  ILE B CG1   1 
ATOM   6071  C  CG2   . ILE B 1 155 ? 53.281  117.951 59.641  1.00 15.49 ? 155  ILE B CG2   1 
ATOM   6072  C  CD1   . ILE B 1 155 ? 51.972  118.047 62.390  1.00 16.22 ? 155  ILE B CD1   1 
ATOM   6073  N  N     . GLY B 1 156 ? 55.175  121.938 61.601  1.00 14.15 ? 156  GLY B N     1 
ATOM   6074  C  CA    . GLY B 1 156 ? 55.054  123.165 62.372  1.00 15.12 ? 156  GLY B CA    1 
ATOM   6075  C  C     . GLY B 1 156 ? 54.399  123.000 63.733  1.00 14.45 ? 156  GLY B C     1 
ATOM   6076  O  O     . GLY B 1 156 ? 53.997  123.984 64.354  1.00 14.84 ? 156  GLY B O     1 
ATOM   6077  N  N     . ALA B 1 157 ? 54.271  121.759 64.193  1.00 14.01 ? 157  ALA B N     1 
ATOM   6078  C  CA    . ALA B 1 157 ? 53.691  121.492 65.507  1.00 15.85 ? 157  ALA B CA    1 
ATOM   6079  C  C     . ALA B 1 157 ? 54.832  121.661 66.503  1.00 17.32 ? 157  ALA B C     1 
ATOM   6080  O  O     . ALA B 1 157 ? 55.933  121.167 66.279  1.00 20.78 ? 157  ALA B O     1 
ATOM   6081  C  CB    . ALA B 1 157 ? 53.138  120.065 65.573  1.00 15.31 ? 157  ALA B CB    1 
ATOM   6082  N  N     . VAL B 1 158 ? 54.571  122.358 67.598  1.00 17.58 ? 158  VAL B N     1 
ATOM   6083  C  CA    . VAL B 1 158 ? 55.597  122.599 68.599  1.00 15.27 ? 158  VAL B CA    1 
ATOM   6084  C  C     . VAL B 1 158 ? 55.732  121.387 69.512  1.00 15.92 ? 158  VAL B C     1 
ATOM   6085  O  O     . VAL B 1 158 ? 54.774  121.020 70.193  1.00 16.73 ? 158  VAL B O     1 
ATOM   6086  C  CB    . VAL B 1 158 ? 55.234  123.836 69.442  1.00 15.27 ? 158  VAL B CB    1 
ATOM   6087  C  CG1   . VAL B 1 158 ? 56.316  124.106 70.479  1.00 14.72 ? 158  VAL B CG1   1 
ATOM   6088  C  CG2   . VAL B 1 158 ? 55.047  125.045 68.526  1.00 14.01 ? 158  VAL B CG2   1 
ATOM   6089  N  N     . HIS B 1 159 ? 56.897  120.744 69.526  1.00 14.05 ? 159  HIS B N     1 
ATOM   6090  C  CA    . HIS B 1 159 ? 57.032  119.599 70.419  1.00 14.33 ? 159  HIS B CA    1 
ATOM   6091  C  C     . HIS B 1 159 ? 57.537  119.997 71.796  1.00 13.17 ? 159  HIS B C     1 
ATOM   6092  O  O     . HIS B 1 159 ? 58.335  120.922 71.954  1.00 11.54 ? 159  HIS B O     1 
ATOM   6093  C  CB    . HIS B 1 159 ? 57.888  118.459 69.810  1.00 13.34 ? 159  HIS B CB    1 
ATOM   6094  C  CG    . HIS B 1 159 ? 59.325  118.805 69.536  1.00 13.77 ? 159  HIS B CG    1 
ATOM   6095  N  ND1   . HIS B 1 159 ? 60.251  119.020 70.535  1.00 12.53 ? 159  HIS B ND1   1 
ATOM   6096  C  CD2   . HIS B 1 159 ? 60.013  118.868 68.370  1.00 12.82 ? 159  HIS B CD2   1 
ATOM   6097  C  CE1   . HIS B 1 159 ? 61.446  119.195 69.998  1.00 12.14 ? 159  HIS B CE1   1 
ATOM   6098  N  NE2   . HIS B 1 159 ? 61.329  119.108 68.685  1.00 12.82 ? 159  HIS B NE2   1 
ATOM   6099  N  N     . SER B 1 160 ? 57.003  119.317 72.800  1.00 13.20 ? 160  SER B N     1 
ATOM   6100  C  CA    . SER B 1 160 ? 57.370  119.555 74.185  1.00 13.40 ? 160  SER B CA    1 
ATOM   6101  C  C     . SER B 1 160 ? 57.844  118.211 74.712  1.00 13.60 ? 160  SER B C     1 
ATOM   6102  O  O     . SER B 1 160 ? 57.064  117.444 75.278  1.00 14.20 ? 160  SER B O     1 
ATOM   6103  C  CB    . SER B 1 160 ? 56.147  120.047 74.976  1.00 15.61 ? 160  SER B CB    1 
ATOM   6104  O  OG    . SER B 1 160 ? 56.461  120.268 76.341  1.00 18.00 ? 160  SER B OG    1 
ATOM   6105  N  N     . VAL B 1 161 ? 59.118  117.911 74.479  1.00 14.56 ? 161  VAL B N     1 
ATOM   6106  C  CA    . VAL B 1 161 ? 59.694  116.655 74.939  1.00 14.67 ? 161  VAL B CA    1 
ATOM   6107  C  C     . VAL B 1 161 ? 59.864  116.707 76.454  1.00 14.11 ? 161  VAL B C     1 
ATOM   6108  O  O     . VAL B 1 161 ? 60.303  117.716 77.010  1.00 14.25 ? 161  VAL B O     1 
ATOM   6109  C  CB    . VAL B 1 161 ? 61.061  116.389 74.272  1.00 16.07 ? 161  VAL B CB    1 
ATOM   6110  C  CG1   . VAL B 1 161 ? 61.702  115.128 74.854  1.00 14.70 ? 161  VAL B CG1   1 
ATOM   6111  C  CG2   . VAL B 1 161 ? 60.874  116.233 72.771  1.00 14.87 ? 161  VAL B CG2   1 
ATOM   6112  N  N     . ILE B 1 162 ? 59.495  115.614 77.112  1.00 13.32 ? 162  ILE B N     1 
ATOM   6113  C  CA    . ILE B 1 162 ? 59.594  115.504 78.560  1.00 13.08 ? 162  ILE B CA    1 
ATOM   6114  C  C     . ILE B 1 162 ? 60.465  114.301 78.891  1.00 13.62 ? 162  ILE B C     1 
ATOM   6115  O  O     . ILE B 1 162 ? 60.150  113.179 78.501  1.00 14.21 ? 162  ILE B O     1 
ATOM   6116  C  CB    . ILE B 1 162 ? 58.195  115.297 79.188  1.00 13.95 ? 162  ILE B CB    1 
ATOM   6117  C  CG1   . ILE B 1 162 ? 57.269  116.440 78.773  1.00 13.33 ? 162  ILE B CG1   1 
ATOM   6118  C  CG2   . ILE B 1 162 ? 58.304  115.200 80.706  1.00 12.20 ? 162  ILE B CG2   1 
ATOM   6119  C  CD1   . ILE B 1 162 ? 55.835  116.268 79.243  1.00 14.22 ? 162  ILE B CD1   1 
ATOM   6120  N  N     . PHE B 1 163 ? 61.563  114.544 79.598  1.00 14.04 ? 163  PHE B N     1 
ATOM   6121  C  CA    . PHE B 1 163 ? 62.492  113.490 79.997  1.00 14.80 ? 163  PHE B CA    1 
ATOM   6122  C  C     . PHE B 1 163 ? 61.740  112.346 80.686  1.00 13.94 ? 163  PHE B C     1 
ATOM   6123  O  O     . PHE B 1 163 ? 60.907  112.584 81.554  1.00 13.41 ? 163  PHE B O     1 
ATOM   6124  C  CB    . PHE B 1 163 ? 63.541  114.086 80.940  1.00 14.10 ? 163  PHE B CB    1 
ATOM   6125  C  CG    . PHE B 1 163 ? 64.506  113.086 81.496  1.00 14.23 ? 163  PHE B CG    1 
ATOM   6126  C  CD1   . PHE B 1 163 ? 65.325  112.342 80.653  1.00 14.76 ? 163  PHE B CD1   1 
ATOM   6127  C  CD2   . PHE B 1 163 ? 64.617  112.912 82.871  1.00 13.43 ? 163  PHE B CD2   1 
ATOM   6128  C  CE1   . PHE B 1 163 ? 66.248  111.437 81.169  1.00 14.68 ? 163  PHE B CE1   1 
ATOM   6129  C  CE2   . PHE B 1 163 ? 65.539  112.007 83.403  1.00 15.89 ? 163  PHE B CE2   1 
ATOM   6130  C  CZ    . PHE B 1 163 ? 66.356  111.269 82.547  1.00 15.95 ? 163  PHE B CZ    1 
ATOM   6131  N  N     . GLY B 1 164 ? 62.048  111.110 80.300  1.00 14.05 ? 164  GLY B N     1 
ATOM   6132  C  CA    . GLY B 1 164 ? 61.378  109.954 80.879  1.00 14.33 ? 164  GLY B CA    1 
ATOM   6133  C  C     . GLY B 1 164 ? 61.482  109.812 82.390  1.00 16.36 ? 164  GLY B C     1 
ATOM   6134  O  O     . GLY B 1 164 ? 60.704  109.072 83.002  1.00 15.78 ? 164  GLY B O     1 
ATOM   6135  N  N     . GLY B 1 165 ? 62.439  110.514 82.993  1.00 16.01 ? 165  GLY B N     1 
ATOM   6136  C  CA    . GLY B 1 165 ? 62.620  110.450 84.434  1.00 15.99 ? 165  GLY B CA    1 
ATOM   6137  C  C     . GLY B 1 165 ? 61.656  111.318 85.233  1.00 17.50 ? 165  GLY B C     1 
ATOM   6138  O  O     . GLY B 1 165 ? 61.670  111.284 86.463  1.00 19.34 ? 165  GLY B O     1 
ATOM   6139  N  N     . PHE B 1 166 ? 60.833  112.105 84.542  1.00 17.30 ? 166  PHE B N     1 
ATOM   6140  C  CA    . PHE B 1 166 ? 59.850  112.972 85.198  1.00 15.81 ? 166  PHE B CA    1 
ATOM   6141  C  C     . PHE B 1 166 ? 58.720  112.131 85.800  1.00 17.00 ? 166  PHE B C     1 
ATOM   6142  O  O     . PHE B 1 166 ? 58.260  111.166 85.189  1.00 14.69 ? 166  PHE B O     1 
ATOM   6143  C  CB    . PHE B 1 166 ? 59.237  113.954 84.189  1.00 17.20 ? 166  PHE B CB    1 
ATOM   6144  C  CG    . PHE B 1 166 ? 59.988  115.258 84.046  1.00 19.33 ? 166  PHE B CG    1 
ATOM   6145  C  CD1   . PHE B 1 166 ? 61.372  115.280 83.926  1.00 20.10 ? 166  PHE B CD1   1 
ATOM   6146  C  CD2   . PHE B 1 166 ? 59.294  116.466 84.000  1.00 19.32 ? 166  PHE B CD2   1 
ATOM   6147  C  CE1   . PHE B 1 166 ? 62.062  116.491 83.763  1.00 20.04 ? 166  PHE B CE1   1 
ATOM   6148  C  CE2   . PHE B 1 166 ? 59.971  117.683 83.837  1.00 21.75 ? 166  PHE B CE2   1 
ATOM   6149  C  CZ    . PHE B 1 166 ? 61.357  117.691 83.719  1.00 19.75 ? 166  PHE B CZ    1 
ATOM   6150  N  N     . SER B 1 167 ? 58.264  112.509 86.990  1.00 16.73 ? 167  SER B N     1 
ATOM   6151  C  CA    . SER B 1 167 ? 57.173  111.790 87.649  1.00 16.27 ? 167  SER B CA    1 
ATOM   6152  C  C     . SER B 1 167 ? 55.853  112.168 86.976  1.00 16.37 ? 167  SER B C     1 
ATOM   6153  O  O     . SER B 1 167 ? 55.798  113.118 86.185  1.00 17.65 ? 167  SER B O     1 
ATOM   6154  C  CB    . SER B 1 167 ? 57.097  112.186 89.122  1.00 15.98 ? 167  SER B CB    1 
ATOM   6155  O  OG    . SER B 1 167 ? 56.633  113.523 89.252  1.00 15.00 ? 167  SER B OG    1 
ATOM   6156  N  N     . PRO B 1 168 ? 54.769  111.429 87.280  1.00 14.54 ? 168  PRO B N     1 
ATOM   6157  C  CA    . PRO B 1 168 ? 53.461  111.726 86.689  1.00 14.26 ? 168  PRO B CA    1 
ATOM   6158  C  C     . PRO B 1 168 ? 53.039  113.163 87.003  1.00 14.62 ? 168  PRO B C     1 
ATOM   6159  O  O     . PRO B 1 168 ? 52.453  113.851 86.166  1.00 14.23 ? 168  PRO B O     1 
ATOM   6160  C  CB    . PRO B 1 168 ? 52.546  110.697 87.351  1.00 15.49 ? 168  PRO B CB    1 
ATOM   6161  C  CG    . PRO B 1 168 ? 53.465  109.501 87.489  1.00 14.79 ? 168  PRO B CG    1 
ATOM   6162  C  CD    . PRO B 1 168 ? 54.738  110.147 88.013  1.00 15.57 ? 168  PRO B CD    1 
ATOM   6163  N  N     . GLU B 1 169 ? 53.353  113.606 88.218  1.00 14.42 ? 169  GLU B N     1 
ATOM   6164  C  CA    . GLU B 1 169 ? 53.012  114.953 88.665  1.00 17.14 ? 169  GLU B CA    1 
ATOM   6165  C  C     . GLU B 1 169 ? 53.773  115.992 87.844  1.00 16.17 ? 169  GLU B C     1 
ATOM   6166  O  O     . GLU B 1 169 ? 53.216  117.024 87.457  1.00 16.07 ? 169  GLU B O     1 
ATOM   6167  C  CB    . GLU B 1 169 ? 53.350  115.102 90.153  1.00 18.18 ? 169  GLU B CB    1 
ATOM   6168  C  CG    . GLU B 1 169 ? 52.854  116.390 90.803  1.00 22.80 ? 169  GLU B CG    1 
ATOM   6169  C  CD    . GLU B 1 169 ? 51.341  116.522 90.775  1.00 25.74 ? 169  GLU B CD    1 
ATOM   6170  O  OE1   . GLU B 1 169 ? 50.646  115.497 90.943  1.00 26.48 ? 169  GLU B OE1   1 
ATOM   6171  O  OE2   . GLU B 1 169 ? 50.847  117.654 90.598  1.00 30.34 ? 169  GLU B OE2   1 
ATOM   6172  N  N     . ALA B 1 170 ? 55.048  115.718 87.583  1.00 15.53 ? 170  ALA B N     1 
ATOM   6173  C  CA    . ALA B 1 170 ? 55.877  116.623 86.796  1.00 15.91 ? 170  ALA B CA    1 
ATOM   6174  C  C     . ALA B 1 170 ? 55.372  116.656 85.352  1.00 17.37 ? 170  ALA B C     1 
ATOM   6175  O  O     . ALA B 1 170 ? 55.325  117.717 84.724  1.00 18.32 ? 170  ALA B O     1 
ATOM   6176  C  CB    . ALA B 1 170 ? 57.327  116.172 86.839  1.00 16.42 ? 170  ALA B CB    1 
ATOM   6177  N  N     . VAL B 1 171 ? 54.993  115.490 84.831  1.00 16.65 ? 171  VAL B N     1 
ATOM   6178  C  CA    . VAL B 1 171 ? 54.474  115.390 83.469  1.00 15.58 ? 171  VAL B CA    1 
ATOM   6179  C  C     . VAL B 1 171 ? 53.169  116.177 83.358  1.00 17.26 ? 171  VAL B C     1 
ATOM   6180  O  O     . VAL B 1 171 ? 52.957  116.915 82.397  1.00 15.23 ? 171  VAL B O     1 
ATOM   6181  C  CB    . VAL B 1 171 ? 54.204  113.923 83.078  1.00 16.81 ? 171  VAL B CB    1 
ATOM   6182  C  CG1   . VAL B 1 171 ? 53.446  113.865 81.751  1.00 15.11 ? 171  VAL B CG1   1 
ATOM   6183  C  CG2   . VAL B 1 171 ? 55.522  113.163 82.970  1.00 13.70 ? 171  VAL B CG2   1 
ATOM   6184  N  N     . ALA B 1 172 ? 52.294  116.014 84.346  1.00 16.43 ? 172  ALA B N     1 
ATOM   6185  C  CA    . ALA B 1 172 ? 51.024  116.730 84.355  1.00 17.33 ? 172  ALA B CA    1 
ATOM   6186  C  C     . ALA B 1 172 ? 51.295  118.233 84.315  1.00 17.15 ? 172  ALA B C     1 
ATOM   6187  O  O     . ALA B 1 172 ? 50.625  118.975 83.591  1.00 18.37 ? 172  ALA B O     1 
ATOM   6188  C  CB    . ALA B 1 172 ? 50.224  116.370 85.609  1.00 15.54 ? 172  ALA B CB    1 
ATOM   6189  N  N     . GLY B 1 173 ? 52.284  118.674 85.089  1.00 18.55 ? 173  GLY B N     1 
ATOM   6190  C  CA    . GLY B 1 173 ? 52.633  120.087 85.124  1.00 19.34 ? 173  GLY B CA    1 
ATOM   6191  C  C     . GLY B 1 173 ? 52.980  120.643 83.752  1.00 19.14 ? 173  GLY B C     1 
ATOM   6192  O  O     . GLY B 1 173 ? 52.520  121.726 83.383  1.00 18.06 ? 173  GLY B O     1 
ATOM   6193  N  N     . CYS B 1 174 ? 53.795  119.903 83.000  1.00 17.84 ? 174  CYS B N     1 
ATOM   6194  C  CA    . CYS B 1 174 ? 54.211  120.304 81.654  1.00 17.80 ? 174  CYS B CA    1 
ATOM   6195  C  C     . CYS B 1 174 ? 53.031  120.358 80.685  1.00 17.14 ? 174  CYS B C     1 
ATOM   6196  O  O     . CYS B 1 174 ? 52.865  121.330 79.950  1.00 17.11 ? 174  CYS B O     1 
ATOM   6197  C  CB    . CYS B 1 174 ? 55.251  119.320 81.100  1.00 18.42 ? 174  CYS B CB    1 
ATOM   6198  S  SG    . CYS B 1 174 ? 56.824  119.280 81.976  1.00 21.00 ? 174  CYS B SG    1 
ATOM   6199  N  N     . ILE B 1 175 ? 52.220  119.304 80.682  1.00 16.90 ? 175  ILE B N     1 
ATOM   6200  C  CA    . ILE B 1 175 ? 51.063  119.227 79.794  1.00 16.33 ? 175  ILE B CA    1 
ATOM   6201  C  C     . ILE B 1 175 ? 50.068  120.355 80.062  1.00 17.01 ? 175  ILE B C     1 
ATOM   6202  O  O     . ILE B 1 175 ? 49.497  120.932 79.132  1.00 17.45 ? 175  ILE B O     1 
ATOM   6203  C  CB    . ILE B 1 175 ? 50.341  117.865 79.951  1.00 16.80 ? 175  ILE B CB    1 
ATOM   6204  C  CG1   . ILE B 1 175 ? 51.251  116.738 79.446  1.00 16.96 ? 175  ILE B CG1   1 
ATOM   6205  C  CG2   . ILE B 1 175 ? 49.017  117.876 79.196  1.00 16.92 ? 175  ILE B CG2   1 
ATOM   6206  C  CD1   . ILE B 1 175 ? 50.668  115.350 79.628  1.00 17.64 ? 175  ILE B CD1   1 
ATOM   6207  N  N     . ILE B 1 176 ? 49.868  120.671 81.334  1.00 16.14 ? 176  ILE B N     1 
ATOM   6208  C  CA    . ILE B 1 176 ? 48.937  121.725 81.719  1.00 18.01 ? 176  ILE B CA    1 
ATOM   6209  C  C     . ILE B 1 176 ? 49.424  123.091 81.246  1.00 18.51 ? 176  ILE B C     1 
ATOM   6210  O  O     . ILE B 1 176 ? 48.650  123.890 80.710  1.00 19.59 ? 176  ILE B O     1 
ATOM   6211  C  CB    . ILE B 1 176 ? 48.744  121.746 83.259  1.00 17.68 ? 176  ILE B CB    1 
ATOM   6212  C  CG1   . ILE B 1 176 ? 47.978  120.490 83.690  1.00 18.46 ? 176  ILE B CG1   1 
ATOM   6213  C  CG2   . ILE B 1 176 ? 48.006  123.014 83.688  1.00 19.76 ? 176  ILE B CG2   1 
ATOM   6214  C  CD1   . ILE B 1 176 ? 47.906  120.288 85.200  1.00 17.73 ? 176  ILE B CD1   1 
ATOM   6215  N  N     . ASP B 1 177 ? 50.713  123.348 81.434  1.00 17.51 ? 177  ASP B N     1 
ATOM   6216  C  CA    . ASP B 1 177 ? 51.299  124.622 81.036  1.00 17.67 ? 177  ASP B CA    1 
ATOM   6217  C  C     . ASP B 1 177 ? 51.336  124.822 79.524  1.00 17.86 ? 177  ASP B C     1 
ATOM   6218  O  O     . ASP B 1 177 ? 51.145  125.934 79.037  1.00 18.21 ? 177  ASP B O     1 
ATOM   6219  C  CB    . ASP B 1 177 ? 52.718  124.746 81.600  1.00 18.53 ? 177  ASP B CB    1 
ATOM   6220  C  CG    . ASP B 1 177 ? 53.326  126.121 81.356  1.00 20.38 ? 177  ASP B CG    1 
ATOM   6221  O  OD1   . ASP B 1 177 ? 54.147  126.272 80.424  1.00 19.58 ? 177  ASP B OD1   1 
ATOM   6222  O  OD2   . ASP B 1 177 ? 52.969  127.059 82.098  1.00 21.04 ? 177  ASP B OD2   1 
ATOM   6223  N  N     . SER B 1 178 ? 51.575  123.744 78.785  1.00 16.89 ? 178  SER B N     1 
ATOM   6224  C  CA    . SER B 1 178 ? 51.667  123.823 77.328  1.00 17.27 ? 178  SER B CA    1 
ATOM   6225  C  C     . SER B 1 178 ? 50.371  123.525 76.594  1.00 17.32 ? 178  SER B C     1 
ATOM   6226  O  O     . SER B 1 178 ? 50.299  123.702 75.376  1.00 17.26 ? 178  SER B O     1 
ATOM   6227  C  CB    . SER B 1 178 ? 52.736  122.853 76.824  1.00 16.22 ? 178  SER B CB    1 
ATOM   6228  O  OG    . SER B 1 178 ? 52.375  121.514 77.135  1.00 16.09 ? 178  SER B OG    1 
ATOM   6229  N  N     . SER B 1 179 ? 49.353  123.077 77.327  1.00 18.66 ? 179  SER B N     1 
ATOM   6230  C  CA    . SER B 1 179 ? 48.077  122.710 76.715  1.00 18.40 ? 179  SER B CA    1 
ATOM   6231  C  C     . SER B 1 179 ? 48.320  121.723 75.572  1.00 17.33 ? 179  SER B C     1 
ATOM   6232  O  O     . SER B 1 179 ? 47.753  121.858 74.484  1.00 15.54 ? 179  SER B O     1 
ATOM   6233  C  CB    . SER B 1 179 ? 47.344  123.944 76.174  1.00 20.50 ? 179  SER B CB    1 
ATOM   6234  O  OG    . SER B 1 179 ? 46.762  124.694 77.223  1.00 21.33 ? 179  SER B OG    1 
ATOM   6235  N  N     . SER B 1 180 ? 49.170  120.731 75.821  1.00 17.43 ? 180  SER B N     1 
ATOM   6236  C  CA    . SER B 1 180 ? 49.474  119.729 74.808  1.00 17.57 ? 180  SER B CA    1 
ATOM   6237  C  C     . SER B 1 180 ? 48.196  119.028 74.362  1.00 17.33 ? 180  SER B C     1 
ATOM   6238  O  O     . SER B 1 180 ? 47.368  118.635 75.188  1.00 18.09 ? 180  SER B O     1 
ATOM   6239  C  CB    . SER B 1 180 ? 50.473  118.702 75.352  1.00 18.00 ? 180  SER B CB    1 
ATOM   6240  O  OG    . SER B 1 180 ? 51.720  119.315 75.641  1.00 22.08 ? 180  SER B OG    1 
ATOM   6241  N  N     . ARG B 1 181 ? 48.041  118.885 73.049  1.00 16.88 ? 181  ARG B N     1 
ATOM   6242  C  CA    . ARG B 1 181 ? 46.866  118.249 72.454  1.00 18.41 ? 181  ARG B CA    1 
ATOM   6243  C  C     . ARG B 1 181 ? 47.061  116.758 72.253  1.00 17.72 ? 181  ARG B C     1 
ATOM   6244  O  O     . ARG B 1 181 ? 46.101  116.018 72.019  1.00 17.35 ? 181  ARG B O     1 
ATOM   6245  C  CB    . ARG B 1 181 ? 46.560  118.865 71.088  1.00 21.51 ? 181  ARG B CB    1 
ATOM   6246  C  CG    . ARG B 1 181 ? 45.904  120.232 71.122  1.00 29.28 ? 181  ARG B CG    1 
ATOM   6247  C  CD    . ARG B 1 181 ? 45.493  120.643 69.714  1.00 33.32 ? 181  ARG B CD    1 
ATOM   6248  N  NE    . ARG B 1 181 ? 44.688  119.609 69.062  1.00 37.52 ? 181  ARG B NE    1 
ATOM   6249  C  CZ    . ARG B 1 181 ? 44.204  119.702 67.828  1.00 40.09 ? 181  ARG B CZ    1 
ATOM   6250  N  NH1   . ARG B 1 181 ? 44.439  120.786 67.098  1.00 40.52 ? 181  ARG B NH1   1 
ATOM   6251  N  NH2   . ARG B 1 181 ? 43.485  118.710 67.320  1.00 42.72 ? 181  ARG B NH2   1 
ATOM   6252  N  N     . LEU B 1 182 ? 48.313  116.328 72.334  1.00 17.82 ? 182  LEU B N     1 
ATOM   6253  C  CA    . LEU B 1 182 ? 48.658  114.934 72.123  1.00 16.83 ? 182  LEU B CA    1 
ATOM   6254  C  C     . LEU B 1 182 ? 49.863  114.544 72.961  1.00 17.20 ? 182  LEU B C     1 
ATOM   6255  O  O     . LEU B 1 182 ? 50.734  115.368 73.231  1.00 16.59 ? 182  LEU B O     1 
ATOM   6256  C  CB    . LEU B 1 182 ? 48.981  114.715 70.637  1.00 17.92 ? 182  LEU B CB    1 
ATOM   6257  C  CG    . LEU B 1 182 ? 49.631  113.404 70.180  1.00 17.72 ? 182  LEU B CG    1 
ATOM   6258  C  CD1   . LEU B 1 182 ? 48.660  112.260 70.380  1.00 20.06 ? 182  LEU B CD1   1 
ATOM   6259  C  CD2   . LEU B 1 182 ? 50.021  113.504 68.711  1.00 17.67 ? 182  LEU B CD2   1 
ATOM   6260  N  N     . VAL B 1 183 ? 49.899  113.289 73.387  1.00 16.72 ? 183  VAL B N     1 
ATOM   6261  C  CA    . VAL B 1 183 ? 51.037  112.785 74.144  1.00 16.45 ? 183  VAL B CA    1 
ATOM   6262  C  C     . VAL B 1 183 ? 51.549  111.566 73.385  1.00 15.99 ? 183  VAL B C     1 
ATOM   6263  O  O     . VAL B 1 183 ? 50.770  110.678 73.027  1.00 14.23 ? 183  VAL B O     1 
ATOM   6264  C  CB    . VAL B 1 183 ? 50.649  112.349 75.580  1.00 16.85 ? 183  VAL B CB    1 
ATOM   6265  C  CG1   . VAL B 1 183 ? 51.862  111.742 76.279  1.00 16.31 ? 183  VAL B CG1   1 
ATOM   6266  C  CG2   . VAL B 1 183 ? 50.128  113.549 76.374  1.00 16.24 ? 183  VAL B CG2   1 
ATOM   6267  N  N     . ILE B 1 184 ? 52.851  111.544 73.113  1.00 14.21 ? 184  ILE B N     1 
ATOM   6268  C  CA    . ILE B 1 184 ? 53.473  110.424 72.414  1.00 13.49 ? 184  ILE B CA    1 
ATOM   6269  C  C     . ILE B 1 184 ? 54.381  109.749 73.442  1.00 13.99 ? 184  ILE B C     1 
ATOM   6270  O  O     . ILE B 1 184 ? 55.275  110.387 73.997  1.00 12.01 ? 184  ILE B O     1 
ATOM   6271  C  CB    . ILE B 1 184 ? 54.306  110.915 71.208  1.00 13.71 ? 184  ILE B CB    1 
ATOM   6272  C  CG1   . ILE B 1 184 ? 53.402  111.684 70.236  1.00 15.97 ? 184  ILE B CG1   1 
ATOM   6273  C  CG2   . ILE B 1 184 ? 54.962  109.725 70.507  1.00 14.14 ? 184  ILE B CG2   1 
ATOM   6274  C  CD1   . ILE B 1 184 ? 54.116  112.230 69.001  1.00 13.94 ? 184  ILE B CD1   1 
ATOM   6275  N  N     . THR B 1 185 ? 54.151  108.463 73.703  1.00 12.77 ? 185  THR B N     1 
ATOM   6276  C  CA    . THR B 1 185 ? 54.945  107.753 74.705  1.00 12.73 ? 185  THR B CA    1 
ATOM   6277  C  C     . THR B 1 185 ? 55.119  106.282 74.323  1.00 13.43 ? 185  THR B C     1 
ATOM   6278  O  O     . THR B 1 185 ? 54.763  105.878 73.219  1.00 12.42 ? 185  THR B O     1 
ATOM   6279  C  CB    . THR B 1 185 ? 54.250  107.858 76.096  1.00 12.15 ? 185  THR B CB    1 
ATOM   6280  O  OG1   . THR B 1 185 ? 55.131  107.399 77.128  1.00 13.63 ? 185  THR B OG1   1 
ATOM   6281  C  CG2   . THR B 1 185 ? 52.976  107.015 76.119  1.00 14.06 ? 185  THR B CG2   1 
ATOM   6282  N  N     . ALA B 1 186 ? 55.683  105.485 75.222  1.00 12.82 ? 186  ALA B N     1 
ATOM   6283  C  CA    . ALA B 1 186 ? 55.853  104.057 74.950  1.00 14.25 ? 186  ALA B CA    1 
ATOM   6284  C  C     . ALA B 1 186 ? 55.319  103.309 76.163  1.00 14.32 ? 186  ALA B C     1 
ATOM   6285  O  O     . ALA B 1 186 ? 55.179  103.907 77.231  1.00 13.91 ? 186  ALA B O     1 
ATOM   6286  C  CB    . ALA B 1 186 ? 57.328  103.728 74.735  1.00 11.50 ? 186  ALA B CB    1 
ATOM   6287  N  N     . ASP B 1 187 ? 55.009  102.018 76.026  1.00 14.33 ? 187  ASP B N     1 
ATOM   6288  C  CA    . ASP B 1 187 ? 54.514  101.301 77.194  1.00 14.46 ? 187  ASP B CA    1 
ATOM   6289  C  C     . ASP B 1 187 ? 55.554  101.395 78.306  1.00 17.05 ? 187  ASP B C     1 
ATOM   6290  O  O     . ASP B 1 187 ? 55.230  101.767 79.441  1.00 18.56 ? 187  ASP B O     1 
ATOM   6291  C  CB    . ASP B 1 187 ? 54.164  99.829  76.884  1.00 15.42 ? 187  ASP B CB    1 
ATOM   6292  C  CG    . ASP B 1 187 ? 55.148  99.147  75.937  1.00 16.50 ? 187  ASP B CG    1 
ATOM   6293  O  OD1   . ASP B 1 187 ? 56.308  99.591  75.792  1.00 13.82 ? 187  ASP B OD1   1 
ATOM   6294  O  OD2   . ASP B 1 187 ? 54.741  98.124  75.342  1.00 17.95 ? 187  ASP B OD2   1 
ATOM   6295  N  N     . GLU B 1 188 ? 56.804  101.079 77.976  1.00 16.06 ? 188  GLU B N     1 
ATOM   6296  C  CA    . GLU B 1 188 ? 57.905  101.159 78.934  1.00 15.87 ? 188  GLU B CA    1 
ATOM   6297  C  C     . GLU B 1 188 ? 59.209  101.484 78.212  1.00 16.18 ? 188  GLU B C     1 
ATOM   6298  O  O     . GLU B 1 188 ? 59.327  101.291 77.005  1.00 16.61 ? 188  GLU B O     1 
ATOM   6299  C  CB    . GLU B 1 188 ? 58.094  99.832  79.677  1.00 17.21 ? 188  GLU B CB    1 
ATOM   6300  C  CG    . GLU B 1 188 ? 56.901  99.356  80.486  1.00 17.88 ? 188  GLU B CG    1 
ATOM   6301  C  CD    . GLU B 1 188 ? 57.193  98.056  81.217  1.00 20.66 ? 188  GLU B CD    1 
ATOM   6302  O  OE1   . GLU B 1 188 ? 57.786  97.148  80.596  1.00 17.80 ? 188  GLU B OE1   1 
ATOM   6303  O  OE2   . GLU B 1 188 ? 56.826  97.939  82.405  1.00 21.14 ? 188  GLU B OE2   1 
ATOM   6304  N  N     . GLY B 1 189 ? 60.181  101.989 78.965  1.00 16.87 ? 189  GLY B N     1 
ATOM   6305  C  CA    . GLY B 1 189 ? 61.484  102.286 78.406  1.00 15.39 ? 189  GLY B CA    1 
ATOM   6306  C  C     . GLY B 1 189 ? 62.404  101.202 78.939  1.00 16.73 ? 189  GLY B C     1 
ATOM   6307  O  O     . GLY B 1 189 ? 62.094  100.582 79.959  1.00 18.66 ? 189  GLY B O     1 
ATOM   6308  N  N     . VAL B 1 190 ? 63.514  100.951 78.252  1.00 16.63 ? 190  VAL B N     1 
ATOM   6309  C  CA    . VAL B 1 190 ? 64.468  99.928  78.676  1.00 17.36 ? 190  VAL B CA    1 
ATOM   6310  C  C     . VAL B 1 190 ? 65.789  100.609 79.018  1.00 18.40 ? 190  VAL B C     1 
ATOM   6311  O  O     . VAL B 1 190 ? 66.369  101.293 78.176  1.00 18.91 ? 190  VAL B O     1 
ATOM   6312  C  CB    . VAL B 1 190 ? 64.696  98.894  77.550  1.00 16.39 ? 190  VAL B CB    1 
ATOM   6313  C  CG1   . VAL B 1 190 ? 65.671  97.817  78.006  1.00 17.53 ? 190  VAL B CG1   1 
ATOM   6314  C  CG2   . VAL B 1 190 ? 63.361  98.279  77.146  1.00 19.11 ? 190  VAL B CG2   1 
ATOM   6315  N  N     . ARG B 1 191 ? 66.262  100.423 80.251  1.00 18.50 ? 191  ARG B N     1 
ATOM   6316  C  CA    . ARG B 1 191 ? 67.508  101.056 80.695  1.00 19.35 ? 191  ARG B CA    1 
ATOM   6317  C  C     . ARG B 1 191 ? 68.245  100.241 81.756  1.00 18.70 ? 191  ARG B C     1 
ATOM   6318  O  O     . ARG B 1 191 ? 67.707  99.980  82.828  1.00 20.98 ? 191  ARG B O     1 
ATOM   6319  C  CB    . ARG B 1 191 ? 67.190  102.450 81.246  1.00 19.00 ? 191  ARG B CB    1 
ATOM   6320  C  CG    . ARG B 1 191 ? 68.379  103.235 81.790  1.00 21.60 ? 191  ARG B CG    1 
ATOM   6321  C  CD    . ARG B 1 191 ? 67.927  104.627 82.231  1.00 23.60 ? 191  ARG B CD    1 
ATOM   6322  N  NE    . ARG B 1 191 ? 69.024  105.463 82.720  1.00 25.47 ? 191  ARG B NE    1 
ATOM   6323  C  CZ    . ARG B 1 191 ? 69.588  105.342 83.918  1.00 28.15 ? 191  ARG B CZ    1 
ATOM   6324  N  NH1   . ARG B 1 191 ? 69.163  104.417 84.770  1.00 29.47 ? 191  ARG B NH1   1 
ATOM   6325  N  NH2   . ARG B 1 191 ? 70.580  106.152 84.267  1.00 28.46 ? 191  ARG B NH2   1 
ATOM   6326  N  N     . ALA B 1 192 ? 69.478  99.849  81.451  1.00 18.98 ? 192  ALA B N     1 
ATOM   6327  C  CA    . ALA B 1 192 ? 70.300  99.067  82.372  1.00 20.58 ? 192  ALA B CA    1 
ATOM   6328  C  C     . ALA B 1 192 ? 69.636  97.752  82.771  1.00 21.55 ? 192  ALA B C     1 
ATOM   6329  O  O     . ALA B 1 192 ? 69.650  97.368  83.945  1.00 21.22 ? 192  ALA B O     1 
ATOM   6330  C  CB    . ALA B 1 192 ? 70.622  99.896  83.625  1.00 19.03 ? 192  ALA B CB    1 
ATOM   6331  N  N     . GLY B 1 193 ? 69.053  97.070  81.789  1.00 22.17 ? 193  GLY B N     1 
ATOM   6332  C  CA    . GLY B 1 193 ? 68.398  95.799  82.045  1.00 23.46 ? 193  GLY B CA    1 
ATOM   6333  C  C     . GLY B 1 193 ? 67.060  95.908  82.748  1.00 25.61 ? 193  GLY B C     1 
ATOM   6334  O  O     . GLY B 1 193 ? 66.424  94.895  83.048  1.00 26.50 ? 193  GLY B O     1 
ATOM   6335  N  N     . ARG B 1 194 ? 66.626  97.133  83.017  1.00 25.68 ? 194  ARG B N     1 
ATOM   6336  C  CA    . ARG B 1 194 ? 65.358  97.352  83.695  1.00 27.52 ? 194  ARG B CA    1 
ATOM   6337  C  C     . ARG B 1 194 ? 64.338  98.003  82.773  1.00 27.96 ? 194  ARG B C     1 
ATOM   6338  O  O     . ARG B 1 194 ? 64.699  98.698  81.819  1.00 26.10 ? 194  ARG B O     1 
ATOM   6339  C  CB    . ARG B 1 194 ? 65.550  98.254  84.917  1.00 30.52 ? 194  ARG B CB    1 
ATOM   6340  C  CG    . ARG B 1 194 ? 66.364  97.662  86.055  1.00 35.01 ? 194  ARG B CG    1 
ATOM   6341  C  CD    . ARG B 1 194 ? 66.323  98.608  87.242  1.00 37.98 ? 194  ARG B CD    1 
ATOM   6342  N  NE    . ARG B 1 194 ? 66.760  97.985  88.487  1.00 42.87 ? 194  ARG B NE    1 
ATOM   6343  C  CZ    . ARG B 1 194 ? 68.023  97.915  88.896  1.00 45.90 ? 194  ARG B CZ    1 
ATOM   6344  N  NH1   . ARG B 1 194 ? 68.996  98.434  88.157  1.00 47.79 ? 194  ARG B NH1   1 
ATOM   6345  N  NH2   . ARG B 1 194 ? 68.313  97.330  90.053  1.00 47.09 ? 194  ARG B NH2   1 
ATOM   6346  N  N     . SER B 1 195 ? 63.062  97.773  83.066  1.00 26.26 ? 195  SER B N     1 
ATOM   6347  C  CA    . SER B 1 195 ? 61.981  98.367  82.293  1.00 26.59 ? 195  SER B CA    1 
ATOM   6348  C  C     . SER B 1 195 ? 61.451  99.524  83.119  1.00 26.44 ? 195  SER B C     1 
ATOM   6349  O  O     . SER B 1 195 ? 61.148  99.360  84.300  1.00 29.74 ? 195  SER B O     1 
ATOM   6350  C  CB    . SER B 1 195 ? 60.870  97.346  82.041  1.00 26.35 ? 195  SER B CB    1 
ATOM   6351  O  OG    . SER B 1 195 ? 61.310  96.341  81.147  1.00 29.31 ? 195  SER B OG    1 
ATOM   6352  N  N     . ILE B 1 196 ? 61.359  100.695 82.505  1.00 25.01 ? 196  ILE B N     1 
ATOM   6353  C  CA    . ILE B 1 196 ? 60.875  101.877 83.197  1.00 24.85 ? 196  ILE B CA    1 
ATOM   6354  C  C     . ILE B 1 196 ? 59.486  102.232 82.699  1.00 23.86 ? 196  ILE B C     1 
ATOM   6355  O  O     . ILE B 1 196 ? 59.282  102.482 81.514  1.00 22.70 ? 196  ILE B O     1 
ATOM   6356  C  CB    . ILE B 1 196 ? 61.830  103.069 82.977  1.00 26.90 ? 196  ILE B CB    1 
ATOM   6357  C  CG1   . ILE B 1 196 ? 63.215  102.712 83.522  1.00 29.90 ? 196  ILE B CG1   1 
ATOM   6358  C  CG2   . ILE B 1 196 ? 61.288  104.312 83.672  1.00 28.32 ? 196  ILE B CG2   1 
ATOM   6359  C  CD1   . ILE B 1 196 ? 64.283  103.735 83.227  1.00 33.35 ? 196  ILE B CD1   1 
ATOM   6360  N  N     . PRO B 1 197 ? 58.503  102.252 83.605  1.00 24.32 ? 197  PRO B N     1 
ATOM   6361  C  CA    . PRO B 1 197 ? 57.147  102.585 83.176  1.00 22.18 ? 197  PRO B CA    1 
ATOM   6362  C  C     . PRO B 1 197 ? 57.086  103.996 82.607  1.00 20.86 ? 197  PRO B C     1 
ATOM   6363  O  O     . PRO B 1 197 ? 57.767  104.901 83.092  1.00 20.88 ? 197  PRO B O     1 
ATOM   6364  C  CB    . PRO B 1 197 ? 56.340  102.439 84.462  1.00 23.66 ? 197  PRO B CB    1 
ATOM   6365  C  CG    . PRO B 1 197 ? 57.324  102.885 85.510  1.00 26.00 ? 197  PRO B CG    1 
ATOM   6366  C  CD    . PRO B 1 197 ? 58.581  102.154 85.074  1.00 25.32 ? 197  PRO B CD    1 
ATOM   6367  N  N     . LEU B 1 198 ? 56.298  104.165 81.552  1.00 17.58 ? 198  LEU B N     1 
ATOM   6368  C  CA    . LEU B 1 198 ? 56.109  105.470 80.933  1.00 16.71 ? 198  LEU B CA    1 
ATOM   6369  C  C     . LEU B 1 198 ? 54.618  105.689 80.705  1.00 15.17 ? 198  LEU B C     1 
ATOM   6370  O  O     . LEU B 1 198 ? 54.054  106.677 81.172  1.00 14.81 ? 198  LEU B O     1 
ATOM   6371  C  CB    . LEU B 1 198 ? 56.871  105.566 79.608  1.00 15.98 ? 198  LEU B CB    1 
ATOM   6372  C  CG    . LEU B 1 198 ? 58.400  105.672 79.706  1.00 18.09 ? 198  LEU B CG    1 
ATOM   6373  C  CD1   . LEU B 1 198 ? 58.998  105.671 78.306  1.00 15.65 ? 198  LEU B CD1   1 
ATOM   6374  C  CD2   . LEU B 1 198 ? 58.797  106.946 80.453  1.00 16.93 ? 198  LEU B CD2   1 
ATOM   6375  N  N     . LYS B 1 199 ? 53.976  104.755 80.009  1.00 15.36 ? 199  LYS B N     1 
ATOM   6376  C  CA    . LYS B 1 199 ? 52.545  104.871 79.724  1.00 16.47 ? 199  LYS B CA    1 
ATOM   6377  C  C     . LYS B 1 199 ? 51.745  105.002 81.015  1.00 15.57 ? 199  LYS B C     1 
ATOM   6378  O  O     . LYS B 1 199 ? 50.846  105.835 81.111  1.00 15.89 ? 199  LYS B O     1 
ATOM   6379  C  CB    . LYS B 1 199 ? 52.066  103.652 78.917  1.00 18.67 ? 199  LYS B CB    1 
ATOM   6380  C  CG    . LYS B 1 199 ? 50.541  103.487 78.783  1.00 23.24 ? 199  LYS B CG    1 
ATOM   6381  C  CD    . LYS B 1 199 ? 49.882  104.614 78.006  1.00 23.71 ? 199  LYS B CD    1 
ATOM   6382  C  CE    . LYS B 1 199 ? 48.487  104.215 77.486  1.00 21.41 ? 199  LYS B CE    1 
ATOM   6383  N  NZ    . LYS B 1 199 ? 47.448  103.967 78.533  1.00 18.63 ? 199  LYS B NZ    1 
ATOM   6384  N  N     . LYS B 1 200 ? 52.082  104.190 82.014  1.00 16.40 ? 200  LYS B N     1 
ATOM   6385  C  CA    . LYS B 1 200 ? 51.370  104.242 83.290  1.00 16.91 ? 200  LYS B CA    1 
ATOM   6386  C  C     . LYS B 1 200 ? 51.516  105.632 83.900  1.00 15.75 ? 200  LYS B C     1 
ATOM   6387  O  O     . LYS B 1 200 ? 50.575  106.158 84.498  1.00 16.33 ? 200  LYS B O     1 
ATOM   6388  C  CB    . LYS B 1 200 ? 51.914  103.186 84.257  1.00 17.28 ? 200  LYS B CB    1 
ATOM   6389  C  CG    . LYS B 1 200 ? 51.154  103.123 85.579  1.00 19.98 ? 200  LYS B CG    1 
ATOM   6390  C  CD    . LYS B 1 200 ? 51.758  102.094 86.527  1.00 23.58 ? 200  LYS B CD    1 
ATOM   6391  C  CE    . LYS B 1 200 ? 51.063  102.109 87.888  1.00 25.59 ? 200  LYS B CE    1 
ATOM   6392  N  NZ    . LYS B 1 200 ? 49.618  101.764 87.788  1.00 25.36 ? 200  LYS B NZ    1 
ATOM   6393  N  N     . ASN B 1 201 ? 52.698  106.225 83.749  1.00 15.64 ? 201  ASN B N     1 
ATOM   6394  C  CA    . ASN B 1 201 ? 52.938  107.568 84.269  1.00 15.64 ? 201  ASN B CA    1 
ATOM   6395  C  C     . ASN B 1 201 ? 52.055  108.580 83.540  1.00 14.63 ? 201  ASN B C     1 
ATOM   6396  O  O     . ASN B 1 201 ? 51.538  109.516 84.150  1.00 14.47 ? 201  ASN B O     1 
ATOM   6397  C  CB    . ASN B 1 201 ? 54.417  107.950 84.124  1.00 13.45 ? 201  ASN B CB    1 
ATOM   6398  C  CG    . ASN B 1 201 ? 55.301  107.264 85.150  1.00 16.76 ? 201  ASN B CG    1 
ATOM   6399  O  OD1   . ASN B 1 201 ? 54.806  106.602 86.070  1.00 16.32 ? 201  ASN B OD1   1 
ATOM   6400  N  ND2   . ASN B 1 201 ? 56.615  107.424 85.007  1.00 17.32 ? 201  ASN B ND2   1 
ATOM   6401  N  N     . VAL B 1 202 ? 51.879  108.392 82.235  1.00 14.97 ? 202  VAL B N     1 
ATOM   6402  C  CA    . VAL B 1 202 ? 51.029  109.288 81.457  1.00 13.50 ? 202  VAL B CA    1 
ATOM   6403  C  C     . VAL B 1 202 ? 49.582  109.126 81.930  1.00 14.11 ? 202  VAL B C     1 
ATOM   6404  O  O     . VAL B 1 202 ? 48.870  110.110 82.109  1.00 14.59 ? 202  VAL B O     1 
ATOM   6405  C  CB    . VAL B 1 202 ? 51.123  108.981 79.941  1.00 12.31 ? 202  VAL B CB    1 
ATOM   6406  C  CG1   . VAL B 1 202 ? 50.060  109.768 79.176  1.00 14.82 ? 202  VAL B CG1   1 
ATOM   6407  C  CG2   . VAL B 1 202 ? 52.519  109.346 79.427  1.00 13.66 ? 202  VAL B CG2   1 
ATOM   6408  N  N     . ASP B 1 203 ? 49.154  107.880 82.134  1.00 14.36 ? 203  ASP B N     1 
ATOM   6409  C  CA    . ASP B 1 203 ? 47.798  107.609 82.609  1.00 15.00 ? 203  ASP B CA    1 
ATOM   6410  C  C     . ASP B 1 203 ? 47.553  108.383 83.901  1.00 15.51 ? 203  ASP B C     1 
ATOM   6411  O  O     . ASP B 1 203 ? 46.537  109.064 84.053  1.00 15.38 ? 203  ASP B O     1 
ATOM   6412  C  CB    . ASP B 1 203 ? 47.595  106.112 82.902  1.00 14.47 ? 203  ASP B CB    1 
ATOM   6413  C  CG    . ASP B 1 203 ? 47.462  105.268 81.643  1.00 18.48 ? 203  ASP B CG    1 
ATOM   6414  O  OD1   . ASP B 1 203 ? 47.306  105.832 80.545  1.00 16.70 ? 203  ASP B OD1   1 
ATOM   6415  O  OD2   . ASP B 1 203 ? 47.503  104.025 81.762  1.00 18.92 ? 203  ASP B OD2   1 
ATOM   6416  N  N     . ASP B 1 204 ? 48.490  108.263 84.837  1.00 16.86 ? 204  ASP B N     1 
ATOM   6417  C  CA    . ASP B 1 204 ? 48.369  108.932 86.128  1.00 17.41 ? 204  ASP B CA    1 
ATOM   6418  C  C     . ASP B 1 204 ? 48.400  110.446 85.994  1.00 18.85 ? 204  ASP B C     1 
ATOM   6419  O  O     . ASP B 1 204 ? 47.732  111.159 86.747  1.00 19.77 ? 204  ASP B O     1 
ATOM   6420  C  CB    . ASP B 1 204 ? 49.481  108.461 87.073  1.00 17.58 ? 204  ASP B CB    1 
ATOM   6421  C  CG    . ASP B 1 204 ? 49.328  107.005 87.469  1.00 19.61 ? 204  ASP B CG    1 
ATOM   6422  O  OD1   . ASP B 1 204 ? 50.236  106.464 88.139  1.00 20.08 ? 204  ASP B OD1   1 
ATOM   6423  O  OD2   . ASP B 1 204 ? 48.296  106.399 87.111  1.00 20.78 ? 204  ASP B OD2   1 
ATOM   6424  N  N     . ALA B 1 205 ? 49.173  110.938 85.032  1.00 16.12 ? 205  ALA B N     1 
ATOM   6425  C  CA    . ALA B 1 205 ? 49.268  112.376 84.807  1.00 17.66 ? 205  ALA B CA    1 
ATOM   6426  C  C     . ALA B 1 205 ? 47.958  112.923 84.244  1.00 17.82 ? 205  ALA B C     1 
ATOM   6427  O  O     . ALA B 1 205 ? 47.515  114.007 84.620  1.00 18.81 ? 205  ALA B O     1 
ATOM   6428  C  CB    . ALA B 1 205 ? 50.417  112.679 83.847  1.00 15.38 ? 205  ALA B CB    1 
ATOM   6429  N  N     . LEU B 1 206 ? 47.336  112.165 83.347  1.00 19.02 ? 206  LEU B N     1 
ATOM   6430  C  CA    . LEU B 1 206 ? 46.092  112.598 82.734  1.00 19.81 ? 206  LEU B CA    1 
ATOM   6431  C  C     . LEU B 1 206 ? 44.891  112.517 83.676  1.00 21.54 ? 206  LEU B C     1 
ATOM   6432  O  O     . LEU B 1 206 ? 43.798  112.967 83.331  1.00 22.54 ? 206  LEU B O     1 
ATOM   6433  C  CB    . LEU B 1 206 ? 45.827  111.795 81.452  1.00 19.38 ? 206  LEU B CB    1 
ATOM   6434  C  CG    . LEU B 1 206 ? 46.913  111.896 80.369  1.00 23.35 ? 206  LEU B CG    1 
ATOM   6435  C  CD1   . LEU B 1 206 ? 46.469  111.157 79.109  1.00 23.60 ? 206  LEU B CD1   1 
ATOM   6436  C  CD2   . LEU B 1 206 ? 47.193  113.347 80.045  1.00 21.40 ? 206  LEU B CD2   1 
ATOM   6437  N  N     . LYS B 1 207 ? 45.087  111.938 84.858  1.00 21.78 ? 207  LYS B N     1 
ATOM   6438  C  CA    . LYS B 1 207 ? 44.001  111.847 85.827  1.00 24.67 ? 207  LYS B CA    1 
ATOM   6439  C  C     . LYS B 1 207 ? 43.857  113.197 86.525  1.00 25.30 ? 207  LYS B C     1 
ATOM   6440  O  O     . LYS B 1 207 ? 42.868  113.456 87.205  1.00 25.42 ? 207  LYS B O     1 
ATOM   6441  C  CB    . LYS B 1 207 ? 44.281  110.751 86.859  1.00 26.09 ? 207  LYS B CB    1 
ATOM   6442  C  CG    . LYS B 1 207 ? 44.229  109.348 86.287  1.00 27.08 ? 207  LYS B CG    1 
ATOM   6443  C  CD    . LYS B 1 207 ? 44.537  108.303 87.342  1.00 29.26 ? 207  LYS B CD    1 
ATOM   6444  C  CE    . LYS B 1 207 ? 44.515  106.908 86.739  1.00 30.53 ? 207  LYS B CE    1 
ATOM   6445  N  NZ    . LYS B 1 207 ? 44.811  105.854 87.743  1.00 31.75 ? 207  LYS B NZ    1 
ATOM   6446  N  N     . ASN B 1 208 ? 44.855  114.058 86.353  1.00 25.80 ? 208  ASN B N     1 
ATOM   6447  C  CA    . ASN B 1 208 ? 44.806  115.381 86.959  1.00 25.58 ? 208  ASN B CA    1 
ATOM   6448  C  C     . ASN B 1 208 ? 43.633  116.120 86.318  1.00 26.82 ? 208  ASN B C     1 
ATOM   6449  O  O     . ASN B 1 208 ? 43.596  116.299 85.103  1.00 26.50 ? 208  ASN B O     1 
ATOM   6450  C  CB    . ASN B 1 208 ? 46.112  116.136 86.700  1.00 25.06 ? 208  ASN B CB    1 
ATOM   6451  C  CG    . ASN B 1 208 ? 46.204  117.425 87.494  1.00 25.28 ? 208  ASN B CG    1 
ATOM   6452  O  OD1   . ASN B 1 208 ? 45.331  118.288 87.401  1.00 25.85 ? 208  ASN B OD1   1 
ATOM   6453  N  ND2   . ASN B 1 208 ? 47.262  117.560 88.280  1.00 25.08 ? 208  ASN B ND2   1 
ATOM   6454  N  N     . PRO B 1 209 ? 42.655  116.553 87.129  1.00 28.37 ? 209  PRO B N     1 
ATOM   6455  C  CA    . PRO B 1 209 ? 41.478  117.268 86.624  1.00 28.70 ? 209  PRO B CA    1 
ATOM   6456  C  C     . PRO B 1 209 ? 41.789  118.525 85.813  1.00 29.25 ? 209  PRO B C     1 
ATOM   6457  O  O     . PRO B 1 209 ? 40.949  119.004 85.044  1.00 28.90 ? 209  PRO B O     1 
ATOM   6458  C  CB    . PRO B 1 209 ? 40.688  117.571 87.897  1.00 29.44 ? 209  PRO B CB    1 
ATOM   6459  C  CG    . PRO B 1 209 ? 41.760  117.712 88.931  1.00 29.14 ? 209  PRO B CG    1 
ATOM   6460  C  CD    . PRO B 1 209 ? 42.669  116.548 88.603  1.00 28.53 ? 209  PRO B CD    1 
ATOM   6461  N  N     . ASN B 1 210 ? 42.994  119.057 85.983  1.00 29.46 ? 210  ASN B N     1 
ATOM   6462  C  CA    . ASN B 1 210 ? 43.393  120.258 85.260  1.00 30.13 ? 210  ASN B CA    1 
ATOM   6463  C  C     . ASN B 1 210 ? 43.890  119.960 83.846  1.00 29.74 ? 210  ASN B C     1 
ATOM   6464  O  O     . ASN B 1 210 ? 44.113  120.877 83.055  1.00 30.47 ? 210  ASN B O     1 
ATOM   6465  C  CB    . ASN B 1 210 ? 44.462  121.010 86.052  1.00 31.73 ? 210  ASN B CB    1 
ATOM   6466  C  CG    . ASN B 1 210 ? 43.932  121.550 87.367  1.00 33.59 ? 210  ASN B CG    1 
ATOM   6467  O  OD1   . ASN B 1 210 ? 43.024  122.382 87.387  1.00 33.55 ? 210  ASN B OD1   1 
ATOM   6468  N  ND2   . ASN B 1 210 ? 44.491  121.073 88.472  1.00 34.20 ? 210  ASN B ND2   1 
ATOM   6469  N  N     . VAL B 1 211 ? 44.069  118.681 83.529  1.00 28.30 ? 211  VAL B N     1 
ATOM   6470  C  CA    . VAL B 1 211 ? 44.518  118.296 82.195  1.00 26.49 ? 211  VAL B CA    1 
ATOM   6471  C  C     . VAL B 1 211 ? 43.282  118.087 81.330  1.00 26.37 ? 211  VAL B C     1 
ATOM   6472  O  O     . VAL B 1 211 ? 42.575  117.086 81.471  1.00 26.29 ? 211  VAL B O     1 
ATOM   6473  C  CB    . VAL B 1 211 ? 45.335  116.985 82.219  1.00 26.44 ? 211  VAL B CB    1 
ATOM   6474  C  CG1   . VAL B 1 211 ? 45.657  116.552 80.793  1.00 26.14 ? 211  VAL B CG1   1 
ATOM   6475  C  CG2   . VAL B 1 211 ? 46.612  117.181 83.010  1.00 25.02 ? 211  VAL B CG2   1 
ATOM   6476  N  N     . THR B 1 212 ? 43.025  119.028 80.430  1.00 25.23 ? 212  THR B N     1 
ATOM   6477  C  CA    . THR B 1 212 ? 41.853  118.951 79.569  1.00 26.92 ? 212  THR B CA    1 
ATOM   6478  C  C     . THR B 1 212 ? 42.174  119.132 78.091  1.00 25.50 ? 212  THR B C     1 
ATOM   6479  O  O     . THR B 1 212 ? 41.277  119.107 77.250  1.00 27.43 ? 212  THR B O     1 
ATOM   6480  C  CB    . THR B 1 212 ? 40.833  120.033 79.959  1.00 29.01 ? 212  THR B CB    1 
ATOM   6481  O  OG1   . THR B 1 212 ? 41.374  121.326 79.649  1.00 29.91 ? 212  THR B OG1   1 
ATOM   6482  C  CG2   . THR B 1 212 ? 40.531  119.969 81.453  1.00 29.46 ? 212  THR B CG2   1 
ATOM   6483  N  N     . SER B 1 213 ? 43.449  119.308 77.771  1.00 24.15 ? 213  SER B N     1 
ATOM   6484  C  CA    . SER B 1 213 ? 43.858  119.524 76.388  1.00 21.88 ? 213  SER B CA    1 
ATOM   6485  C  C     . SER B 1 213 ? 44.215  118.275 75.584  1.00 20.43 ? 213  SER B C     1 
ATOM   6486  O  O     . SER B 1 213 ? 44.194  118.306 74.356  1.00 20.38 ? 213  SER B O     1 
ATOM   6487  C  CB    . SER B 1 213 ? 45.047  120.485 76.355  1.00 21.29 ? 213  SER B CB    1 
ATOM   6488  O  OG    . SER B 1 213 ? 46.138  119.947 77.082  1.00 17.43 ? 213  SER B OG    1 
ATOM   6489  N  N     . VAL B 1 214 ? 44.545  117.184 76.269  1.00 19.75 ? 214  VAL B N     1 
ATOM   6490  C  CA    . VAL B 1 214 ? 44.944  115.951 75.591  1.00 20.99 ? 214  VAL B CA    1 
ATOM   6491  C  C     . VAL B 1 214 ? 43.792  115.189 74.952  1.00 21.54 ? 214  VAL B C     1 
ATOM   6492  O  O     . VAL B 1 214 ? 42.889  114.717 75.639  1.00 21.86 ? 214  VAL B O     1 
ATOM   6493  C  CB    . VAL B 1 214 ? 45.681  114.994 76.558  1.00 20.41 ? 214  VAL B CB    1 
ATOM   6494  C  CG1   . VAL B 1 214 ? 46.161  113.765 75.802  1.00 19.47 ? 214  VAL B CG1   1 
ATOM   6495  C  CG2   . VAL B 1 214 ? 46.850  115.715 77.211  1.00 19.99 ? 214  VAL B CG2   1 
ATOM   6496  N  N     . GLU B 1 215 ? 43.844  115.057 73.631  1.00 20.23 ? 215  GLU B N     1 
ATOM   6497  C  CA    . GLU B 1 215 ? 42.802  114.360 72.889  1.00 20.89 ? 215  GLU B CA    1 
ATOM   6498  C  C     . GLU B 1 215 ? 43.185  112.910 72.613  1.00 20.49 ? 215  GLU B C     1 
ATOM   6499  O  O     . GLU B 1 215 ? 42.320  112.032 72.534  1.00 19.76 ? 215  GLU B O     1 
ATOM   6500  C  CB    . GLU B 1 215 ? 42.531  115.097 71.573  1.00 23.38 ? 215  GLU B CB    1 
ATOM   6501  C  CG    . GLU B 1 215 ? 42.139  116.553 71.791  1.00 28.44 ? 215  GLU B CG    1 
ATOM   6502  C  CD    . GLU B 1 215 ? 42.173  117.387 70.521  1.00 31.25 ? 215  GLU B CD    1 
ATOM   6503  O  OE1   . GLU B 1 215 ? 42.138  118.631 70.636  1.00 34.24 ? 215  GLU B OE1   1 
ATOM   6504  O  OE2   . GLU B 1 215 ? 42.231  116.810 69.417  1.00 32.32 ? 215  GLU B OE2   1 
ATOM   6505  N  N     . HIS B 1 216 ? 44.483  112.658 72.475  1.00 19.25 ? 216  HIS B N     1 
ATOM   6506  C  CA    . HIS B 1 216 ? 44.968  111.311 72.197  1.00 19.41 ? 216  HIS B CA    1 
ATOM   6507  C  C     . HIS B 1 216 ? 46.331  111.041 72.815  1.00 18.97 ? 216  HIS B C     1 
ATOM   6508  O  O     . HIS B 1 216 ? 47.061  111.962 73.185  1.00 17.82 ? 216  HIS B O     1 
ATOM   6509  C  CB    . HIS B 1 216 ? 45.081  111.088 70.684  1.00 20.92 ? 216  HIS B CB    1 
ATOM   6510  C  CG    . HIS B 1 216 ? 43.768  111.077 69.968  1.00 21.91 ? 216  HIS B CG    1 
ATOM   6511  N  ND1   . HIS B 1 216 ? 42.845  110.064 70.121  1.00 22.19 ? 216  HIS B ND1   1 
ATOM   6512  C  CD2   . HIS B 1 216 ? 43.214  111.965 69.108  1.00 23.62 ? 216  HIS B CD2   1 
ATOM   6513  C  CE1   . HIS B 1 216 ? 41.778  110.331 69.389  1.00 23.40 ? 216  HIS B CE1   1 
ATOM   6514  N  NE2   . HIS B 1 216 ? 41.976  111.479 68.765  1.00 21.75 ? 216  HIS B NE2   1 
ATOM   6515  N  N     . VAL B 1 217 ? 46.654  109.761 72.929  1.00 17.27 ? 217  VAL B N     1 
ATOM   6516  C  CA    . VAL B 1 217 ? 47.945  109.319 73.440  1.00 17.31 ? 217  VAL B CA    1 
ATOM   6517  C  C     . VAL B 1 217 ? 48.392  108.232 72.471  1.00 17.07 ? 217  VAL B C     1 
ATOM   6518  O  O     . VAL B 1 217 ? 47.730  107.204 72.341  1.00 18.41 ? 217  VAL B O     1 
ATOM   6519  C  CB    . VAL B 1 217 ? 47.852  108.698 74.860  1.00 16.78 ? 217  VAL B CB    1 
ATOM   6520  C  CG1   . VAL B 1 217 ? 49.212  108.113 75.264  1.00 16.91 ? 217  VAL B CG1   1 
ATOM   6521  C  CG2   . VAL B 1 217 ? 47.427  109.752 75.870  1.00 15.42 ? 217  VAL B CG2   1 
ATOM   6522  N  N     . ILE B 1 218 ? 49.483  108.477 71.755  1.00 15.36 ? 218  ILE B N     1 
ATOM   6523  C  CA    . ILE B 1 218 ? 50.010  107.483 70.829  1.00 13.74 ? 218  ILE B CA    1 
ATOM   6524  C  C     . ILE B 1 218 ? 51.003  106.674 71.651  1.00 14.05 ? 218  ILE B C     1 
ATOM   6525  O  O     . ILE B 1 218 ? 51.865  107.246 72.327  1.00 13.94 ? 218  ILE B O     1 
ATOM   6526  C  CB    . ILE B 1 218 ? 50.727  108.142 69.630  1.00 14.21 ? 218  ILE B CB    1 
ATOM   6527  C  CG1   . ILE B 1 218 ? 49.705  108.865 68.749  1.00 14.19 ? 218  ILE B CG1   1 
ATOM   6528  C  CG2   . ILE B 1 218 ? 51.467  107.086 68.821  1.00 12.10 ? 218  ILE B CG2   1 
ATOM   6529  C  CD1   . ILE B 1 218 ? 50.332  109.729 67.666  1.00 16.28 ? 218  ILE B CD1   1 
ATOM   6530  N  N     . VAL B 1 219 ? 50.874  105.352 71.607  1.00 12.30 ? 219  VAL B N     1 
ATOM   6531  C  CA    . VAL B 1 219 ? 51.740  104.480 72.391  1.00 12.86 ? 219  VAL B CA    1 
ATOM   6532  C  C     . VAL B 1 219 ? 52.567  103.518 71.559  1.00 14.30 ? 219  VAL B C     1 
ATOM   6533  O  O     . VAL B 1 219 ? 52.029  102.745 70.760  1.00 15.29 ? 219  VAL B O     1 
ATOM   6534  C  CB    . VAL B 1 219 ? 50.914  103.623 73.390  1.00 14.48 ? 219  VAL B CB    1 
ATOM   6535  C  CG1   . VAL B 1 219 ? 51.848  102.888 74.350  1.00 14.65 ? 219  VAL B CG1   1 
ATOM   6536  C  CG2   . VAL B 1 219 ? 49.936  104.499 74.150  1.00 14.62 ? 219  VAL B CG2   1 
ATOM   6537  N  N     . LEU B 1 220 ? 53.881  103.563 71.756  1.00 14.31 ? 220  LEU B N     1 
ATOM   6538  C  CA    . LEU B 1 220 ? 54.789  102.663 71.058  1.00 14.52 ? 220  LEU B CA    1 
ATOM   6539  C  C     . LEU B 1 220 ? 54.928  101.412 71.911  1.00 16.43 ? 220  LEU B C     1 
ATOM   6540  O  O     . LEU B 1 220 ? 55.126  101.509 73.125  1.00 15.59 ? 220  LEU B O     1 
ATOM   6541  C  CB    . LEU B 1 220 ? 56.176  103.289 70.904  1.00 15.38 ? 220  LEU B CB    1 
ATOM   6542  C  CG    . LEU B 1 220 ? 57.258  102.307 70.436  1.00 16.50 ? 220  LEU B CG    1 
ATOM   6543  C  CD1   . LEU B 1 220 ? 56.961  101.866 69.006  1.00 17.19 ? 220  LEU B CD1   1 
ATOM   6544  C  CD2   . LEU B 1 220 ? 58.632  102.951 70.524  1.00 15.11 ? 220  LEU B CD2   1 
ATOM   6545  N  N     . LYS B 1 221 ? 54.816  100.241 71.291  1.00 15.58 ? 221  LYS B N     1 
ATOM   6546  C  CA    . LYS B 1 221 ? 54.984  99.008  72.045  1.00 17.34 ? 221  LYS B CA    1 
ATOM   6547  C  C     . LYS B 1 221 ? 56.471  98.688  72.028  1.00 15.85 ? 221  LYS B C     1 
ATOM   6548  O  O     . LYS B 1 221 ? 56.995  98.172  71.039  1.00 15.83 ? 221  LYS B O     1 
ATOM   6549  C  CB    . LYS B 1 221 ? 54.192  97.849  71.422  1.00 19.06 ? 221  LYS B CB    1 
ATOM   6550  C  CG    . LYS B 1 221 ? 54.159  96.615  72.329  1.00 22.81 ? 221  LYS B CG    1 
ATOM   6551  C  CD    . LYS B 1 221 ? 53.253  95.504  71.810  1.00 26.40 ? 221  LYS B CD    1 
ATOM   6552  C  CE    . LYS B 1 221 ? 53.873  94.736  70.658  1.00 31.29 ? 221  LYS B CE    1 
ATOM   6553  N  NZ    . LYS B 1 221 ? 53.039  93.543  70.285  1.00 31.26 ? 221  LYS B NZ    1 
ATOM   6554  N  N     . ARG B 1 222 ? 57.149  99.014  73.123  1.00 14.23 ? 222  ARG B N     1 
ATOM   6555  C  CA    . ARG B 1 222 ? 58.581  98.770  73.243  1.00 15.00 ? 222  ARG B CA    1 
ATOM   6556  C  C     . ARG B 1 222 ? 58.893  97.496  74.022  1.00 14.72 ? 222  ARG B C     1 
ATOM   6557  O  O     . ARG B 1 222 ? 59.855  96.799  73.708  1.00 14.61 ? 222  ARG B O     1 
ATOM   6558  C  CB    . ARG B 1 222 ? 59.270  99.959  73.932  1.00 13.93 ? 222  ARG B CB    1 
ATOM   6559  C  CG    . ARG B 1 222 ? 60.752  99.720  74.231  1.00 14.49 ? 222  ARG B CG    1 
ATOM   6560  C  CD    . ARG B 1 222 ? 61.583  99.673  72.951  1.00 13.24 ? 222  ARG B CD    1 
ATOM   6561  N  NE    . ARG B 1 222 ? 62.962  99.246  73.184  1.00 12.38 ? 222  ARG B NE    1 
ATOM   6562  C  CZ    . ARG B 1 222 ? 63.361  97.976  73.234  1.00 15.96 ? 222  ARG B CZ    1 
ATOM   6563  N  NH1   . ARG B 1 222 ? 62.486  96.988  73.066  1.00 14.69 ? 222  ARG B NH1   1 
ATOM   6564  N  NH2   . ARG B 1 222 ? 64.637  97.690  73.449  1.00 13.97 ? 222  ARG B NH2   1 
ATOM   6565  N  N     . THR B 1 223 ? 58.095  97.196  75.045  1.00 15.35 ? 223  THR B N     1 
ATOM   6566  C  CA    . THR B 1 223 ? 58.334  95.999  75.854  1.00 15.22 ? 223  THR B CA    1 
ATOM   6567  C  C     . THR B 1 223 ? 57.158  95.023  75.880  1.00 15.07 ? 223  THR B C     1 
ATOM   6568  O  O     . THR B 1 223 ? 57.305  93.885  76.326  1.00 14.85 ? 223  THR B O     1 
ATOM   6569  C  CB    . THR B 1 223 ? 58.652  96.363  77.315  1.00 15.61 ? 223  THR B CB    1 
ATOM   6570  O  OG1   . THR B 1 223 ? 57.479  96.907  77.933  1.00 17.31 ? 223  THR B OG1   1 
ATOM   6571  C  CG2   . THR B 1 223 ? 59.784  97.381  77.378  1.00 15.70 ? 223  THR B CG2   1 
ATOM   6572  N  N     . GLY B 1 224 ? 55.995  95.476  75.427  1.00 14.29 ? 224  GLY B N     1 
ATOM   6573  C  CA    . GLY B 1 224 ? 54.824  94.617  75.418  1.00 16.28 ? 224  GLY B CA    1 
ATOM   6574  C  C     . GLY B 1 224 ? 54.272  94.312  76.799  1.00 16.75 ? 224  GLY B C     1 
ATOM   6575  O  O     . GLY B 1 224 ? 53.504  93.362  76.966  1.00 14.98 ? 224  GLY B O     1 
ATOM   6576  N  N     . SER B 1 225 ? 54.650  95.109  77.794  1.00 17.75 ? 225  SER B N     1 
ATOM   6577  C  CA    . SER B 1 225 ? 54.165  94.890  79.151  1.00 20.08 ? 225  SER B CA    1 
ATOM   6578  C  C     . SER B 1 225 ? 52.676  95.194  79.277  1.00 20.60 ? 225  SER B C     1 
ATOM   6579  O  O     . SER B 1 225 ? 52.109  95.940  78.479  1.00 19.04 ? 225  SER B O     1 
ATOM   6580  C  CB    . SER B 1 225 ? 54.949  95.745  80.148  1.00 21.55 ? 225  SER B CB    1 
ATOM   6581  O  OG    . SER B 1 225 ? 56.215  95.172  80.409  1.00 25.74 ? 225  SER B OG    1 
ATOM   6582  N  N     . ASP B 1 226 ? 52.038  94.606  80.281  1.00 21.09 ? 226  ASP B N     1 
ATOM   6583  C  CA    . ASP B 1 226 ? 50.616  94.836  80.485  1.00 23.29 ? 226  ASP B CA    1 
ATOM   6584  C  C     . ASP B 1 226 ? 50.366  96.265  80.935  1.00 22.81 ? 226  ASP B C     1 
ATOM   6585  O  O     . ASP B 1 226 ? 50.889  96.710  81.956  1.00 23.32 ? 226  ASP B O     1 
ATOM   6586  C  CB    . ASP B 1 226 ? 50.057  93.857  81.523  1.00 26.34 ? 226  ASP B CB    1 
ATOM   6587  C  CG    . ASP B 1 226 ? 50.269  92.415  81.122  1.00 29.81 ? 226  ASP B CG    1 
ATOM   6588  O  OD1   . ASP B 1 226 ? 49.966  92.082  79.956  1.00 31.78 ? 226  ASP B OD1   1 
ATOM   6589  O  OD2   . ASP B 1 226 ? 50.736  91.620  81.967  1.00 35.01 ? 226  ASP B OD2   1 
ATOM   6590  N  N     . ILE B 1 227 ? 49.573  96.991  80.158  1.00 20.83 ? 227  ILE B N     1 
ATOM   6591  C  CA    . ILE B 1 227 ? 49.249  98.367  80.494  1.00 20.22 ? 227  ILE B CA    1 
ATOM   6592  C  C     . ILE B 1 227 ? 47.746  98.555  80.428  1.00 19.41 ? 227  ILE B C     1 
ATOM   6593  O  O     . ILE B 1 227 ? 47.030  97.719  79.876  1.00 19.91 ? 227  ILE B O     1 
ATOM   6594  C  CB    . ILE B 1 227 ? 49.901  99.378  79.512  1.00 19.41 ? 227  ILE B CB    1 
ATOM   6595  C  CG1   . ILE B 1 227 ? 49.469  99.065  78.078  1.00 19.81 ? 227  ILE B CG1   1 
ATOM   6596  C  CG2   . ILE B 1 227 ? 51.417  99.339  79.645  1.00 19.33 ? 227  ILE B CG2   1 
ATOM   6597  C  CD1   . ILE B 1 227 ? 49.765  100.184 77.089  1.00 20.41 ? 227  ILE B CD1   1 
ATOM   6598  N  N     . ASP B 1 228 ? 47.273  99.650  81.006  1.00 19.71 ? 228  ASP B N     1 
ATOM   6599  C  CA    . ASP B 1 228 ? 45.858  99.980  80.982  1.00 18.97 ? 228  ASP B CA    1 
ATOM   6600  C  C     . ASP B 1 228 ? 45.629  100.697 79.659  1.00 20.29 ? 228  ASP B C     1 
ATOM   6601  O  O     . ASP B 1 228 ? 46.568  101.237 79.072  1.00 18.84 ? 228  ASP B O     1 
ATOM   6602  C  CB    . ASP B 1 228 ? 45.520  100.882 82.162  1.00 20.18 ? 228  ASP B CB    1 
ATOM   6603  C  CG    . ASP B 1 228 ? 45.701  100.179 83.489  1.00 20.90 ? 228  ASP B CG    1 
ATOM   6604  O  OD1   . ASP B 1 228 ? 46.225  100.803 84.432  1.00 22.99 ? 228  ASP B OD1   1 
ATOM   6605  O  OD2   . ASP B 1 228 ? 45.313  98.998  83.585  1.00 19.81 ? 228  ASP B OD2   1 
ATOM   6606  N  N     . TRP B 1 229 ? 44.391  100.709 79.187  1.00 20.37 ? 229  TRP B N     1 
ATOM   6607  C  CA    . TRP B 1 229 ? 44.094  101.332 77.906  1.00 20.22 ? 229  TRP B CA    1 
ATOM   6608  C  C     . TRP B 1 229 ? 42.757  102.056 77.940  1.00 21.59 ? 229  TRP B C     1 
ATOM   6609  O  O     . TRP B 1 229 ? 41.761  101.515 78.426  1.00 21.02 ? 229  TRP B O     1 
ATOM   6610  C  CB    . TRP B 1 229 ? 44.086  100.239 76.833  1.00 22.04 ? 229  TRP B CB    1 
ATOM   6611  C  CG    . TRP B 1 229 ? 44.162  100.717 75.411  1.00 21.08 ? 229  TRP B CG    1 
ATOM   6612  C  CD1   . TRP B 1 229 ? 43.121  100.898 74.545  1.00 22.01 ? 229  TRP B CD1   1 
ATOM   6613  C  CD2   . TRP B 1 229 ? 45.354  101.013 74.674  1.00 21.32 ? 229  TRP B CD2   1 
ATOM   6614  N  NE1   . TRP B 1 229 ? 43.592  101.280 73.311  1.00 21.78 ? 229  TRP B NE1   1 
ATOM   6615  C  CE2   . TRP B 1 229 ? 44.960  101.359 73.362  1.00 21.09 ? 229  TRP B CE2   1 
ATOM   6616  C  CE3   . TRP B 1 229 ? 46.719  101.017 74.994  1.00 19.41 ? 229  TRP B CE3   1 
ATOM   6617  C  CZ2   . TRP B 1 229 ? 45.882  101.704 72.369  1.00 19.23 ? 229  TRP B CZ2   1 
ATOM   6618  C  CZ3   . TRP B 1 229 ? 47.636  101.362 74.006  1.00 20.24 ? 229  TRP B CZ3   1 
ATOM   6619  C  CH2   . TRP B 1 229 ? 47.210  101.700 72.708  1.00 19.78 ? 229  TRP B CH2   1 
ATOM   6620  N  N     . GLN B 1 230 ? 42.741  103.287 77.439  1.00 19.14 ? 230  GLN B N     1 
ATOM   6621  C  CA    . GLN B 1 230 ? 41.520  104.084 77.394  1.00 19.67 ? 230  GLN B CA    1 
ATOM   6622  C  C     . GLN B 1 230 ? 41.023  104.147 75.957  1.00 20.08 ? 230  GLN B C     1 
ATOM   6623  O  O     . GLN B 1 230 ? 41.612  104.822 75.116  1.00 19.29 ? 230  GLN B O     1 
ATOM   6624  C  CB    . GLN B 1 230 ? 41.780  105.501 77.916  1.00 20.06 ? 230  GLN B CB    1 
ATOM   6625  C  CG    . GLN B 1 230 ? 40.628  106.479 77.693  1.00 21.38 ? 230  GLN B CG    1 
ATOM   6626  C  CD    . GLN B 1 230 ? 39.321  106.019 78.327  1.00 24.19 ? 230  GLN B CD    1 
ATOM   6627  O  OE1   . GLN B 1 230 ? 39.236  105.839 79.543  1.00 25.19 ? 230  GLN B OE1   1 
ATOM   6628  N  NE2   . GLN B 1 230 ? 38.295  105.832 77.502  1.00 22.75 ? 230  GLN B NE2   1 
ATOM   6629  N  N     . GLU B 1 231 ? 39.937  103.433 75.680  1.00 19.94 ? 231  GLU B N     1 
ATOM   6630  C  CA    . GLU B 1 231 ? 39.352  103.402 74.343  1.00 19.40 ? 231  GLU B CA    1 
ATOM   6631  C  C     . GLU B 1 231 ? 39.139  104.811 73.796  1.00 19.90 ? 231  GLU B C     1 
ATOM   6632  O  O     . GLU B 1 231 ? 38.781  105.729 74.539  1.00 18.63 ? 231  GLU B O     1 
ATOM   6633  C  CB    . GLU B 1 231 ? 38.016  102.660 74.380  1.00 19.87 ? 231  GLU B CB    1 
ATOM   6634  C  CG    . GLU B 1 231 ? 36.949  103.356 75.217  1.00 20.93 ? 231  GLU B CG    1 
ATOM   6635  C  CD    . GLU B 1 231 ? 35.721  102.486 75.439  1.00 22.05 ? 231  GLU B CD    1 
ATOM   6636  O  OE1   . GLU B 1 231 ? 35.492  101.568 74.625  1.00 24.90 ? 231  GLU B OE1   1 
ATOM   6637  O  OE2   . GLU B 1 231 ? 34.983  102.729 76.419  1.00 23.25 ? 231  GLU B OE2   1 
ATOM   6638  N  N     . GLY B 1 232 ? 39.362  104.974 72.496  1.00 19.94 ? 232  GLY B N     1 
ATOM   6639  C  CA    . GLY B 1 232 ? 39.186  106.271 71.873  1.00 21.30 ? 232  GLY B CA    1 
ATOM   6640  C  C     . GLY B 1 232 ? 40.395  107.177 72.014  1.00 21.58 ? 232  GLY B C     1 
ATOM   6641  O  O     . GLY B 1 232 ? 40.889  107.715 71.024  1.00 23.88 ? 232  GLY B O     1 
ATOM   6642  N  N     . ARG B 1 233 ? 40.876  107.348 73.241  1.00 20.90 ? 233  ARG B N     1 
ATOM   6643  C  CA    . ARG B 1 233 ? 42.030  108.209 73.488  1.00 18.92 ? 233  ARG B CA    1 
ATOM   6644  C  C     . ARG B 1 233 ? 43.358  107.575 73.090  1.00 19.46 ? 233  ARG B C     1 
ATOM   6645  O  O     . ARG B 1 233 ? 44.162  108.194 72.389  1.00 19.32 ? 233  ARG B O     1 
ATOM   6646  C  CB    . ARG B 1 233 ? 42.102  108.595 74.967  1.00 18.36 ? 233  ARG B CB    1 
ATOM   6647  C  CG    . ARG B 1 233 ? 43.234  109.572 75.289  1.00 18.10 ? 233  ARG B CG    1 
ATOM   6648  C  CD    . ARG B 1 233 ? 43.522  109.621 76.784  1.00 18.31 ? 233  ARG B CD    1 
ATOM   6649  N  NE    . ARG B 1 233 ? 44.212  108.420 77.248  1.00 19.01 ? 233  ARG B NE    1 
ATOM   6650  C  CZ    . ARG B 1 233 ? 44.452  108.138 78.526  1.00 20.41 ? 233  ARG B CZ    1 
ATOM   6651  N  NH1   . ARG B 1 233 ? 44.054  108.972 79.479  1.00 20.51 ? 233  ARG B NH1   1 
ATOM   6652  N  NH2   . ARG B 1 233 ? 45.091  107.024 78.853  1.00 20.88 ? 233  ARG B NH2   1 
ATOM   6653  N  N     . ASP B 1 234 ? 43.588  106.344 73.539  1.00 17.89 ? 234  ASP B N     1 
ATOM   6654  C  CA    . ASP B 1 234 ? 44.842  105.658 73.250  1.00 17.53 ? 234  ASP B CA    1 
ATOM   6655  C  C     . ASP B 1 234 ? 44.892  104.972 71.889  1.00 17.67 ? 234  ASP B C     1 
ATOM   6656  O  O     . ASP B 1 234 ? 43.922  104.347 71.457  1.00 17.72 ? 234  ASP B O     1 
ATOM   6657  C  CB    . ASP B 1 234 ? 45.150  104.647 74.358  1.00 17.05 ? 234  ASP B CB    1 
ATOM   6658  C  CG    . ASP B 1 234 ? 45.236  105.298 75.726  1.00 18.28 ? 234  ASP B CG    1 
ATOM   6659  O  OD1   . ASP B 1 234 ? 45.511  106.511 75.780  1.00 18.80 ? 234  ASP B OD1   1 
ATOM   6660  O  OD2   . ASP B 1 234 ? 45.042  104.604 76.746  1.00 18.14 ? 234  ASP B OD2   1 
ATOM   6661  N  N     . LEU B 1 235 ? 46.039  105.095 71.226  1.00 16.49 ? 235  LEU B N     1 
ATOM   6662  C  CA    . LEU B 1 235 ? 46.265  104.511 69.906  1.00 18.13 ? 235  LEU B CA    1 
ATOM   6663  C  C     . LEU B 1 235 ? 47.679  103.944 69.806  1.00 17.85 ? 235  LEU B C     1 
ATOM   6664  O  O     . LEU B 1 235 ? 48.622  104.528 70.338  1.00 17.82 ? 235  LEU B O     1 
ATOM   6665  C  CB    . LEU B 1 235 ? 46.088  105.578 68.826  1.00 18.70 ? 235  LEU B CB    1 
ATOM   6666  C  CG    . LEU B 1 235 ? 44.731  106.276 68.734  1.00 21.15 ? 235  LEU B CG    1 
ATOM   6667  C  CD1   . LEU B 1 235 ? 44.836  107.450 67.777  1.00 21.92 ? 235  LEU B CD1   1 
ATOM   6668  C  CD2   . LEU B 1 235 ? 43.668  105.288 68.276  1.00 21.55 ? 235  LEU B CD2   1 
ATOM   6669  N  N     . TRP B 1 236 ? 47.825  102.813 69.116  1.00 17.80 ? 236  TRP B N     1 
ATOM   6670  C  CA    . TRP B 1 236 ? 49.135  102.190 68.944  1.00 17.24 ? 236  TRP B CA    1 
ATOM   6671  C  C     . TRP B 1 236 ? 49.917  102.831 67.798  1.00 17.40 ? 236  TRP B C     1 
ATOM   6672  O  O     . TRP B 1 236 ? 49.382  103.052 66.708  1.00 16.41 ? 236  TRP B O     1 
ATOM   6673  C  CB    . TRP B 1 236 ? 49.000  100.686 68.666  1.00 19.05 ? 236  TRP B CB    1 
ATOM   6674  C  CG    . TRP B 1 236 ? 48.578  99.854  69.849  1.00 18.95 ? 236  TRP B CG    1 
ATOM   6675  C  CD1   . TRP B 1 236 ? 47.391  99.194  70.006  1.00 19.01 ? 236  TRP B CD1   1 
ATOM   6676  C  CD2   . TRP B 1 236 ? 49.349  99.577  71.027  1.00 18.27 ? 236  TRP B CD2   1 
ATOM   6677  N  NE1   . TRP B 1 236 ? 47.377  98.522  71.204  1.00 19.85 ? 236  TRP B NE1   1 
ATOM   6678  C  CE2   . TRP B 1 236 ? 48.564  98.740  71.852  1.00 19.19 ? 236  TRP B CE2   1 
ATOM   6679  C  CE3   . TRP B 1 236 ? 50.625  99.955  71.466  1.00 17.64 ? 236  TRP B CE3   1 
ATOM   6680  C  CZ2   . TRP B 1 236 ? 49.015  98.272  73.094  1.00 20.35 ? 236  TRP B CZ2   1 
ATOM   6681  C  CZ3   . TRP B 1 236 ? 51.075  99.490  72.701  1.00 19.41 ? 236  TRP B CZ3   1 
ATOM   6682  C  CH2   . TRP B 1 236 ? 50.270  98.657  73.500  1.00 19.65 ? 236  TRP B CH2   1 
ATOM   6683  N  N     . TRP B 1 237 ? 51.189  103.118 68.060  1.00 16.83 ? 237  TRP B N     1 
ATOM   6684  C  CA    . TRP B 1 237 ? 52.080  103.724 67.077  1.00 17.25 ? 237  TRP B CA    1 
ATOM   6685  C  C     . TRP B 1 237 ? 52.050  102.942 65.769  1.00 18.96 ? 237  TRP B C     1 
ATOM   6686  O  O     . TRP B 1 237 ? 51.793  103.499 64.703  1.00 17.67 ? 237  TRP B O     1 
ATOM   6687  C  CB    . TRP B 1 237 ? 53.511  103.764 67.642  1.00 18.45 ? 237  TRP B CB    1 
ATOM   6688  C  CG    . TRP B 1 237 ? 54.573  104.235 66.680  1.00 18.27 ? 237  TRP B CG    1 
ATOM   6689  C  CD1   . TRP B 1 237 ? 55.075  103.552 65.605  1.00 18.83 ? 237  TRP B CD1   1 
ATOM   6690  C  CD2   . TRP B 1 237 ? 55.273  105.485 66.722  1.00 17.97 ? 237  TRP B CD2   1 
ATOM   6691  N  NE1   . TRP B 1 237 ? 56.045  104.300 64.977  1.00 18.06 ? 237  TRP B NE1   1 
ATOM   6692  C  CE2   . TRP B 1 237 ? 56.185  105.491 65.643  1.00 18.49 ? 237  TRP B CE2   1 
ATOM   6693  C  CE3   . TRP B 1 237 ? 55.218  106.601 67.570  1.00 20.37 ? 237  TRP B CE3   1 
ATOM   6694  C  CZ2   . TRP B 1 237 ? 57.037  106.572 65.387  1.00 17.21 ? 237  TRP B CZ2   1 
ATOM   6695  C  CZ3   . TRP B 1 237 ? 56.068  107.678 67.315  1.00 19.82 ? 237  TRP B CZ3   1 
ATOM   6696  C  CH2   . TRP B 1 237 ? 56.964  107.652 66.230  1.00 18.42 ? 237  TRP B CH2   1 
ATOM   6697  N  N     . ARG B 1 238 ? 52.287  101.640 65.861  1.00 19.54 ? 238  ARG B N     1 
ATOM   6698  C  CA    . ARG B 1 238 ? 52.307  100.792 64.679  1.00 23.11 ? 238  ARG B CA    1 
ATOM   6699  C  C     . ARG B 1 238 ? 51.010  100.827 63.867  1.00 22.74 ? 238  ARG B C     1 
ATOM   6700  O  O     . ARG B 1 238 ? 51.054  100.936 62.641  1.00 22.89 ? 238  ARG B O     1 
ATOM   6701  C  CB    . ARG B 1 238 ? 52.637  99.355  65.086  1.00 25.41 ? 238  ARG B CB    1 
ATOM   6702  C  CG    . ARG B 1 238 ? 52.892  98.431  63.918  1.00 31.18 ? 238  ARG B CG    1 
ATOM   6703  C  CD    . ARG B 1 238 ? 53.377  97.073  64.388  1.00 35.43 ? 238  ARG B CD    1 
ATOM   6704  N  NE    . ARG B 1 238 ? 53.670  96.191  63.262  1.00 40.30 ? 238  ARG B NE    1 
ATOM   6705  C  CZ    . ARG B 1 238 ? 54.188  94.974  63.382  1.00 42.23 ? 238  ARG B CZ    1 
ATOM   6706  N  NH1   . ARG B 1 238 ? 54.474  94.488  64.584  1.00 43.82 ? 238  ARG B NH1   1 
ATOM   6707  N  NH2   . ARG B 1 238 ? 54.423  94.243  62.301  1.00 42.84 ? 238  ARG B NH2   1 
ATOM   6708  N  N     . ASP B 1 239 ? 49.862  100.743 64.536  1.00 22.65 ? 239  ASP B N     1 
ATOM   6709  C  CA    . ASP B 1 239 ? 48.585  100.764 63.823  1.00 23.47 ? 239  ASP B CA    1 
ATOM   6710  C  C     . ASP B 1 239 ? 48.399  102.043 63.014  1.00 23.06 ? 239  ASP B C     1 
ATOM   6711  O  O     . ASP B 1 239 ? 47.894  102.011 61.891  1.00 22.69 ? 239  ASP B O     1 
ATOM   6712  C  CB    . ASP B 1 239 ? 47.404  100.619 64.790  1.00 24.13 ? 239  ASP B CB    1 
ATOM   6713  C  CG    . ASP B 1 239 ? 47.384  99.281  65.496  1.00 25.70 ? 239  ASP B CG    1 
ATOM   6714  O  OD1   . ASP B 1 239 ? 47.919  98.303  64.935  1.00 26.27 ? 239  ASP B OD1   1 
ATOM   6715  O  OD2   . ASP B 1 239 ? 46.817  99.207  66.606  1.00 26.21 ? 239  ASP B OD2   1 
ATOM   6716  N  N     . LEU B 1 240 ? 48.817  103.166 63.585  1.00 21.69 ? 240  LEU B N     1 
ATOM   6717  C  CA    . LEU B 1 240 ? 48.677  104.455 62.921  1.00 22.99 ? 240  LEU B CA    1 
ATOM   6718  C  C     . LEU B 1 240 ? 49.644  104.696 61.765  1.00 24.47 ? 240  LEU B C     1 
ATOM   6719  O  O     . LEU B 1 240 ? 49.229  105.075 60.669  1.00 25.43 ? 240  LEU B O     1 
ATOM   6720  C  CB    . LEU B 1 240 ? 48.838  105.588 63.941  1.00 22.92 ? 240  LEU B CB    1 
ATOM   6721  C  CG    . LEU B 1 240 ? 47.785  105.700 65.046  1.00 22.75 ? 240  LEU B CG    1 
ATOM   6722  C  CD1   . LEU B 1 240 ? 48.143  106.851 65.984  1.00 23.47 ? 240  LEU B CD1   1 
ATOM   6723  C  CD2   . LEU B 1 240 ? 46.414  105.925 64.424  1.00 22.61 ? 240  LEU B CD2   1 
ATOM   6724  N  N     . ILE B 1 241 ? 50.930  104.476 62.007  1.00 25.62 ? 241  ILE B N     1 
ATOM   6725  C  CA    . ILE B 1 241 ? 51.941  104.734 60.990  1.00 27.81 ? 241  ILE B CA    1 
ATOM   6726  C  C     . ILE B 1 241 ? 51.895  103.804 59.782  1.00 29.51 ? 241  ILE B C     1 
ATOM   6727  O  O     . ILE B 1 241 ? 52.241  104.208 58.673  1.00 29.34 ? 241  ILE B O     1 
ATOM   6728  C  CB    . ILE B 1 241 ? 53.359  104.704 61.607  1.00 27.77 ? 241  ILE B CB    1 
ATOM   6729  C  CG1   . ILE B 1 241 ? 54.349  105.391 60.663  1.00 28.70 ? 241  ILE B CG1   1 
ATOM   6730  C  CG2   . ILE B 1 241 ? 53.786  103.268 61.877  1.00 28.04 ? 241  ILE B CG2   1 
ATOM   6731  C  CD1   . ILE B 1 241 ? 55.729  105.613 61.264  1.00 29.10 ? 241  ILE B CD1   1 
ATOM   6732  N  N     . GLU B 1 242 ? 51.458  102.565 59.990  1.00 30.83 ? 242  GLU B N     1 
ATOM   6733  C  CA    . GLU B 1 242 ? 51.388  101.601 58.899  1.00 32.60 ? 242  GLU B CA    1 
ATOM   6734  C  C     . GLU B 1 242 ? 50.317  101.922 57.865  1.00 32.27 ? 242  GLU B C     1 
ATOM   6735  O  O     . GLU B 1 242 ? 50.401  101.479 56.719  1.00 32.01 ? 242  GLU B O     1 
ATOM   6736  C  CB    . GLU B 1 242 ? 51.163  100.191 59.450  1.00 34.82 ? 242  GLU B CB    1 
ATOM   6737  C  CG    . GLU B 1 242 ? 52.446  99.417  59.703  1.00 39.05 ? 242  GLU B CG    1 
ATOM   6738  C  CD    . GLU B 1 242 ? 52.186  98.002  60.191  1.00 41.99 ? 242  GLU B CD    1 
ATOM   6739  O  OE1   . GLU B 1 242 ? 51.316  97.318  59.610  1.00 43.10 ? 242  GLU B OE1   1 
ATOM   6740  O  OE2   . GLU B 1 242 ? 52.858  97.570  61.150  1.00 43.69 ? 242  GLU B OE2   1 
ATOM   6741  N  N     . LYS B 1 243 ? 49.317  102.698 58.265  1.00 32.42 ? 243  LYS B N     1 
ATOM   6742  C  CA    . LYS B 1 243 ? 48.234  103.061 57.361  1.00 32.94 ? 243  LYS B CA    1 
ATOM   6743  C  C     . LYS B 1 243 ? 48.427  104.458 56.778  1.00 32.70 ? 243  LYS B C     1 
ATOM   6744  O  O     . LYS B 1 243 ? 47.698  104.866 55.875  1.00 33.83 ? 243  LYS B O     1 
ATOM   6745  C  CB    . LYS B 1 243 ? 46.895  103.000 58.098  1.00 34.22 ? 243  LYS B CB    1 
ATOM   6746  C  CG    . LYS B 1 243 ? 46.762  104.021 59.207  1.00 36.43 ? 243  LYS B CG    1 
ATOM   6747  C  CD    . LYS B 1 243 ? 45.377  104.004 59.826  1.00 38.93 ? 243  LYS B CD    1 
ATOM   6748  C  CE    . LYS B 1 243 ? 45.225  105.133 60.835  1.00 39.78 ? 243  LYS B CE    1 
ATOM   6749  N  NZ    . LYS B 1 243 ? 43.884  105.143 61.477  1.00 41.06 ? 243  LYS B NZ    1 
ATOM   6750  N  N     . ALA B 1 244 ? 49.409  105.188 57.295  1.00 30.65 ? 244  ALA B N     1 
ATOM   6751  C  CA    . ALA B 1 244 ? 49.678  106.542 56.821  1.00 29.57 ? 244  ALA B CA    1 
ATOM   6752  C  C     . ALA B 1 244 ? 50.475  106.537 55.523  1.00 28.30 ? 244  ALA B C     1 
ATOM   6753  O  O     . ALA B 1 244 ? 51.239  105.612 55.248  1.00 29.12 ? 244  ALA B O     1 
ATOM   6754  C  CB    . ALA B 1 244 ? 50.432  107.331 57.891  1.00 28.39 ? 244  ALA B CB    1 
ATOM   6755  N  N     . SER B 1 245 ? 50.297  107.584 54.728  1.00 27.65 ? 245  SER B N     1 
ATOM   6756  C  CA    . SER B 1 245 ? 51.004  107.709 53.461  1.00 25.23 ? 245  SER B CA    1 
ATOM   6757  C  C     . SER B 1 245 ? 52.444  108.149 53.684  1.00 25.09 ? 245  SER B C     1 
ATOM   6758  O  O     . SER B 1 245 ? 52.708  109.045 54.485  1.00 23.61 ? 245  SER B O     1 
ATOM   6759  C  CB    . SER B 1 245 ? 50.304  108.734 52.567  1.00 25.73 ? 245  SER B CB    1 
ATOM   6760  O  OG    . SER B 1 245 ? 51.099  109.038 51.437  1.00 25.79 ? 245  SER B OG    1 
ATOM   6761  N  N     . PRO B 1 246 ? 53.398  107.517 52.983  1.00 24.76 ? 246  PRO B N     1 
ATOM   6762  C  CA    . PRO B 1 246 ? 54.808  107.883 53.132  1.00 25.31 ? 246  PRO B CA    1 
ATOM   6763  C  C     . PRO B 1 246 ? 55.131  109.119 52.296  1.00 25.07 ? 246  PRO B C     1 
ATOM   6764  O  O     . PRO B 1 246 ? 56.288  109.519 52.179  1.00 25.38 ? 246  PRO B O     1 
ATOM   6765  C  CB    . PRO B 1 246 ? 55.536  106.637 52.640  1.00 25.75 ? 246  PRO B CB    1 
ATOM   6766  C  CG    . PRO B 1 246 ? 54.639  106.158 51.541  1.00 25.38 ? 246  PRO B CG    1 
ATOM   6767  C  CD    . PRO B 1 246 ? 53.255  106.306 52.151  1.00 26.27 ? 246  PRO B CD    1 
ATOM   6768  N  N     . GLU B 1 247 ? 54.093  109.715 51.718  1.00 25.43 ? 247  GLU B N     1 
ATOM   6769  C  CA    . GLU B 1 247 ? 54.241  110.903 50.882  1.00 27.11 ? 247  GLU B CA    1 
ATOM   6770  C  C     . GLU B 1 247 ? 53.805  112.150 51.645  1.00 24.15 ? 247  GLU B C     1 
ATOM   6771  O  O     . GLU B 1 247 ? 52.652  112.256 52.052  1.00 24.45 ? 247  GLU B O     1 
ATOM   6772  C  CB    . GLU B 1 247 ? 53.374  110.771 49.623  1.00 30.66 ? 247  GLU B CB    1 
ATOM   6773  C  CG    . GLU B 1 247 ? 53.590  109.488 48.835  1.00 37.09 ? 247  GLU B CG    1 
ATOM   6774  C  CD    . GLU B 1 247 ? 54.900  109.479 48.080  1.00 41.75 ? 247  GLU B CD    1 
ATOM   6775  O  OE1   . GLU B 1 247 ? 55.050  110.296 47.146  1.00 45.64 ? 247  GLU B OE1   1 
ATOM   6776  O  OE2   . GLU B 1 247 ? 55.780  108.658 48.419  1.00 45.67 ? 247  GLU B OE2   1 
ATOM   6777  N  N     . HIS B 1 248 ? 54.724  113.090 51.844  1.00 21.91 ? 248  HIS B N     1 
ATOM   6778  C  CA    . HIS B 1 248 ? 54.389  114.330 52.540  1.00 20.02 ? 248  HIS B CA    1 
ATOM   6779  C  C     . HIS B 1 248 ? 55.282  115.474 52.089  1.00 19.66 ? 248  HIS B C     1 
ATOM   6780  O  O     . HIS B 1 248 ? 56.505  115.377 52.138  1.00 17.71 ? 248  HIS B O     1 
ATOM   6781  C  CB    . HIS B 1 248 ? 54.524  114.183 54.058  1.00 18.73 ? 248  HIS B CB    1 
ATOM   6782  C  CG    . HIS B 1 248 ? 54.209  115.445 54.801  1.00 16.14 ? 248  HIS B CG    1 
ATOM   6783  N  ND1   . HIS B 1 248 ? 52.919  115.835 55.086  1.00 17.01 ? 248  HIS B ND1   1 
ATOM   6784  C  CD2   . HIS B 1 248 ? 55.008  116.455 55.220  1.00 13.28 ? 248  HIS B CD2   1 
ATOM   6785  C  CE1   . HIS B 1 248 ? 52.937  117.033 55.645  1.00 16.06 ? 248  HIS B CE1   1 
ATOM   6786  N  NE2   . HIS B 1 248 ? 54.192  117.432 55.735  1.00 17.86 ? 248  HIS B NE2   1 
ATOM   6787  N  N     . GLN B 1 249 ? 54.659  116.562 51.654  1.00 21.06 ? 249  GLN B N     1 
ATOM   6788  C  CA    . GLN B 1 249 ? 55.395  117.735 51.202  1.00 23.17 ? 249  GLN B CA    1 
ATOM   6789  C  C     . GLN B 1 249 ? 55.619  118.693 52.360  1.00 22.88 ? 249  GLN B C     1 
ATOM   6790  O  O     . GLN B 1 249 ? 54.673  119.098 53.034  1.00 21.91 ? 249  GLN B O     1 
ATOM   6791  C  CB    . GLN B 1 249 ? 54.620  118.435 50.084  1.00 25.19 ? 249  GLN B CB    1 
ATOM   6792  C  CG    . GLN B 1 249 ? 54.450  117.557 48.863  1.00 30.45 ? 249  GLN B CG    1 
ATOM   6793  C  CD    . GLN B 1 249 ? 55.782  117.193 48.235  1.00 33.25 ? 249  GLN B CD    1 
ATOM   6794  O  OE1   . GLN B 1 249 ? 55.939  116.110 47.671  1.00 36.60 ? 249  GLN B OE1   1 
ATOM   6795  N  NE2   . GLN B 1 249 ? 56.749  118.105 48.321  1.00 34.19 ? 249  GLN B NE2   1 
ATOM   6796  N  N     . PRO B 1 250 ? 56.882  119.068 52.607  1.00 22.91 ? 250  PRO B N     1 
ATOM   6797  C  CA    . PRO B 1 250 ? 57.201  119.988 53.702  1.00 23.37 ? 250  PRO B CA    1 
ATOM   6798  C  C     . PRO B 1 250 ? 56.690  121.394 53.401  1.00 24.58 ? 250  PRO B C     1 
ATOM   6799  O  O     . PRO B 1 250 ? 56.964  121.942 52.333  1.00 24.19 ? 250  PRO B O     1 
ATOM   6800  C  CB    . PRO B 1 250 ? 58.734  119.960 53.763  1.00 24.08 ? 250  PRO B CB    1 
ATOM   6801  C  CG    . PRO B 1 250 ? 59.131  118.735 52.964  1.00 25.12 ? 250  PRO B CG    1 
ATOM   6802  C  CD    . PRO B 1 250 ? 58.098  118.675 51.880  1.00 22.20 ? 250  PRO B CD    1 
ATOM   6803  N  N     . GLU B 1 251 ? 55.940  121.969 54.332  1.00 23.32 ? 251  GLU B N     1 
ATOM   6804  C  CA    . GLU B 1 251 ? 55.438  123.324 54.152  1.00 23.66 ? 251  GLU B CA    1 
ATOM   6805  C  C     . GLU B 1 251 ? 56.477  124.274 54.751  1.00 21.87 ? 251  GLU B C     1 
ATOM   6806  O  O     . GLU B 1 251 ? 57.283  123.881 55.598  1.00 19.89 ? 251  GLU B O     1 
ATOM   6807  C  CB    . GLU B 1 251 ? 54.096  123.510 54.865  1.00 24.32 ? 251  GLU B CB    1 
ATOM   6808  C  CG    . GLU B 1 251 ? 52.930  122.708 54.285  1.00 27.35 ? 251  GLU B CG    1 
ATOM   6809  C  CD    . GLU B 1 251 ? 52.580  123.109 52.860  1.00 28.55 ? 251  GLU B CD    1 
ATOM   6810  O  OE1   . GLU B 1 251 ? 52.644  124.317 52.542  1.00 27.89 ? 251  GLU B OE1   1 
ATOM   6811  O  OE2   . GLU B 1 251 ? 52.225  122.219 52.058  1.00 29.18 ? 251  GLU B OE2   1 
ATOM   6812  N  N     . ALA B 1 252 ? 56.454  125.525 54.312  1.00 20.58 ? 252  ALA B N     1 
ATOM   6813  C  CA    . ALA B 1 252 ? 57.401  126.511 54.804  1.00 19.64 ? 252  ALA B CA    1 
ATOM   6814  C  C     . ALA B 1 252 ? 57.004  127.087 56.160  1.00 18.05 ? 252  ALA B C     1 
ATOM   6815  O  O     . ALA B 1 252 ? 55.844  127.419 56.393  1.00 18.88 ? 252  ALA B O     1 
ATOM   6816  C  CB    . ALA B 1 252 ? 57.551  127.634 53.782  1.00 19.02 ? 252  ALA B CB    1 
ATOM   6817  N  N     . MET B 1 253 ? 57.983  127.197 57.051  1.00 16.79 ? 253  MET B N     1 
ATOM   6818  C  CA    . MET B 1 253 ? 57.766  127.755 58.380  1.00 16.43 ? 253  MET B CA    1 
ATOM   6819  C  C     . MET B 1 253 ? 58.539  129.070 58.466  1.00 16.89 ? 253  MET B C     1 
ATOM   6820  O  O     . MET B 1 253 ? 59.615  129.191 57.885  1.00 16.57 ? 253  MET B O     1 
ATOM   6821  C  CB    . MET B 1 253 ? 58.296  126.794 59.450  1.00 16.75 ? 253  MET B CB    1 
ATOM   6822  C  CG    . MET B 1 253 ? 57.672  125.407 59.419  1.00 15.56 ? 253  MET B CG    1 
ATOM   6823  S  SD    . MET B 1 253 ? 55.886  125.484 59.620  1.00 17.99 ? 253  MET B SD    1 
ATOM   6824  C  CE    . MET B 1 253 ? 55.358  124.070 58.638  1.00 19.32 ? 253  MET B CE    1 
ATOM   6825  N  N     . ASN B 1 254 ? 57.998  130.055 59.176  1.00 17.51 ? 254  ASN B N     1 
ATOM   6826  C  CA    . ASN B 1 254 ? 58.704  131.327 59.327  1.00 17.71 ? 254  ASN B CA    1 
ATOM   6827  C  C     . ASN B 1 254 ? 59.903  131.065 60.230  1.00 16.98 ? 254  ASN B C     1 
ATOM   6828  O  O     . ASN B 1 254 ? 59.860  130.169 61.075  1.00 15.64 ? 254  ASN B O     1 
ATOM   6829  C  CB    . ASN B 1 254 ? 57.816  132.385 59.987  1.00 20.03 ? 254  ASN B CB    1 
ATOM   6830  C  CG    . ASN B 1 254 ? 56.619  132.749 59.148  1.00 24.58 ? 254  ASN B CG    1 
ATOM   6831  O  OD1   . ASN B 1 254 ? 55.475  132.542 59.560  1.00 30.40 ? 254  ASN B OD1   1 
ATOM   6832  N  ND2   . ASN B 1 254 ? 56.869  133.298 57.963  1.00 24.71 ? 254  ASN B ND2   1 
ATOM   6833  N  N     . ALA B 1 255 ? 60.966  131.843 60.055  1.00 15.34 ? 255  ALA B N     1 
ATOM   6834  C  CA    . ALA B 1 255 ? 62.168  131.668 60.869  1.00 15.72 ? 255  ALA B CA    1 
ATOM   6835  C  C     . ALA B 1 255 ? 61.836  131.774 62.352  1.00 15.30 ? 255  ALA B C     1 
ATOM   6836  O  O     . ALA B 1 255 ? 62.441  131.090 63.180  1.00 14.05 ? 255  ALA B O     1 
ATOM   6837  C  CB    . ALA B 1 255 ? 63.218  132.713 60.491  1.00 14.43 ? 255  ALA B CB    1 
ATOM   6838  N  N     . GLU B 1 256 ? 60.876  132.631 62.691  1.00 14.74 ? 256  GLU B N     1 
ATOM   6839  C  CA    . GLU B 1 256 ? 60.492  132.799 64.087  1.00 15.53 ? 256  GLU B CA    1 
ATOM   6840  C  C     . GLU B 1 256 ? 59.279  131.983 64.548  1.00 15.55 ? 256  GLU B C     1 
ATOM   6841  O  O     . GLU B 1 256 ? 58.722  132.258 65.610  1.00 16.28 ? 256  GLU B O     1 
ATOM   6842  C  CB    . GLU B 1 256 ? 60.266  134.280 64.406  1.00 16.59 ? 256  GLU B CB    1 
ATOM   6843  C  CG    . GLU B 1 256 ? 61.536  135.133 64.400  1.00 16.35 ? 256  GLU B CG    1 
ATOM   6844  C  CD    . GLU B 1 256 ? 62.613  134.622 65.351  1.00 17.02 ? 256  GLU B CD    1 
ATOM   6845  O  OE1   . GLU B 1 256 ? 62.266  134.056 66.410  1.00 15.00 ? 256  GLU B OE1   1 
ATOM   6846  O  OE2   . GLU B 1 256 ? 63.811  134.805 65.049  1.00 16.34 ? 256  GLU B OE2   1 
ATOM   6847  N  N     . ASP B 1 257 ? 58.858  130.994 63.764  1.00 14.69 ? 257  ASP B N     1 
ATOM   6848  C  CA    . ASP B 1 257 ? 57.736  130.158 64.192  1.00 16.08 ? 257  ASP B CA    1 
ATOM   6849  C  C     . ASP B 1 257 ? 58.283  129.282 65.312  1.00 15.23 ? 257  ASP B C     1 
ATOM   6850  O  O     . ASP B 1 257 ? 59.413  128.812 65.235  1.00 14.81 ? 257  ASP B O     1 
ATOM   6851  C  CB    . ASP B 1 257 ? 57.227  129.250 63.063  1.00 14.51 ? 257  ASP B CB    1 
ATOM   6852  C  CG    . ASP B 1 257 ? 56.277  129.960 62.120  1.00 18.99 ? 257  ASP B CG    1 
ATOM   6853  O  OD1   . ASP B 1 257 ? 55.671  130.975 62.532  1.00 18.33 ? 257  ASP B OD1   1 
ATOM   6854  O  OD2   . ASP B 1 257 ? 56.124  129.489 60.971  1.00 18.45 ? 257  ASP B OD2   1 
ATOM   6855  N  N     . PRO B 1 258 ? 57.494  129.062 66.375  1.00 16.10 ? 258  PRO B N     1 
ATOM   6856  C  CA    . PRO B 1 258 ? 57.991  128.221 67.470  1.00 15.11 ? 258  PRO B CA    1 
ATOM   6857  C  C     . PRO B 1 258 ? 58.317  126.808 67.007  1.00 14.98 ? 258  PRO B C     1 
ATOM   6858  O  O     . PRO B 1 258 ? 57.569  126.211 66.231  1.00 16.05 ? 258  PRO B O     1 
ATOM   6859  C  CB    . PRO B 1 258 ? 56.848  128.264 68.487  1.00 15.42 ? 258  PRO B CB    1 
ATOM   6860  C  CG    . PRO B 1 258 ? 55.634  128.468 67.631  1.00 16.43 ? 258  PRO B CG    1 
ATOM   6861  C  CD    . PRO B 1 258 ? 56.117  129.511 66.638  1.00 15.90 ? 258  PRO B CD    1 
ATOM   6862  N  N     . LEU B 1 259 ? 59.446  126.289 67.481  1.00 14.57 ? 259  LEU B N     1 
ATOM   6863  C  CA    . LEU B 1 259 ? 59.898  124.944 67.137  1.00 14.37 ? 259  LEU B CA    1 
ATOM   6864  C  C     . LEU B 1 259 ? 59.676  123.974 68.300  1.00 14.03 ? 259  LEU B C     1 
ATOM   6865  O  O     . LEU B 1 259 ? 59.075  122.911 68.125  1.00 12.47 ? 259  LEU B O     1 
ATOM   6866  C  CB    . LEU B 1 259 ? 61.384  124.958 66.769  1.00 14.28 ? 259  LEU B CB    1 
ATOM   6867  C  CG    . LEU B 1 259 ? 62.001  123.603 66.408  1.00 12.45 ? 259  LEU B CG    1 
ATOM   6868  C  CD1   . LEU B 1 259 ? 61.348  123.043 65.149  1.00 15.81 ? 259  LEU B CD1   1 
ATOM   6869  C  CD2   . LEU B 1 259 ? 63.500  123.768 66.201  1.00 13.27 ? 259  LEU B CD2   1 
ATOM   6870  N  N     . PHE B 1 260 ? 60.168  124.334 69.484  1.00 12.01 ? 260  PHE B N     1 
ATOM   6871  C  CA    . PHE B 1 260 ? 60.000  123.463 70.638  1.00 12.93 ? 260  PHE B CA    1 
ATOM   6872  C  C     . PHE B 1 260 ? 60.124  124.165 71.983  1.00 14.02 ? 260  PHE B C     1 
ATOM   6873  O  O     . PHE B 1 260 ? 60.617  125.293 72.084  1.00 13.79 ? 260  PHE B O     1 
ATOM   6874  C  CB    . PHE B 1 260 ? 60.991  122.280 70.566  1.00 13.38 ? 260  PHE B CB    1 
ATOM   6875  C  CG    . PHE B 1 260 ? 62.424  122.640 70.872  1.00 15.47 ? 260  PHE B CG    1 
ATOM   6876  C  CD1   . PHE B 1 260 ? 62.827  122.937 72.176  1.00 14.59 ? 260  PHE B CD1   1 
ATOM   6877  C  CD2   . PHE B 1 260 ? 63.380  122.654 69.861  1.00 13.56 ? 260  PHE B CD2   1 
ATOM   6878  C  CE1   . PHE B 1 260 ? 64.161  123.240 72.466  1.00 15.18 ? 260  PHE B CE1   1 
ATOM   6879  C  CE2   . PHE B 1 260 ? 64.712  122.954 70.136  1.00 14.91 ? 260  PHE B CE2   1 
ATOM   6880  C  CZ    . PHE B 1 260 ? 65.108  123.249 71.442  1.00 15.99 ? 260  PHE B CZ    1 
ATOM   6881  N  N     . ILE B 1 261 ? 59.661  123.472 73.013  1.00 12.86 ? 261  ILE B N     1 
ATOM   6882  C  CA    . ILE B 1 261 ? 59.707  123.964 74.377  1.00 14.62 ? 261  ILE B CA    1 
ATOM   6883  C  C     . ILE B 1 261 ? 60.343  122.891 75.247  1.00 14.60 ? 261  ILE B C     1 
ATOM   6884  O  O     . ILE B 1 261 ? 60.077  121.706 75.064  1.00 15.68 ? 261  ILE B O     1 
ATOM   6885  C  CB    . ILE B 1 261 ? 58.293  124.213 74.909  1.00 17.33 ? 261  ILE B CB    1 
ATOM   6886  C  CG1   . ILE B 1 261 ? 57.628  125.335 74.115  1.00 18.08 ? 261  ILE B CG1   1 
ATOM   6887  C  CG2   . ILE B 1 261 ? 58.341  124.532 76.388  1.00 21.11 ? 261  ILE B CG2   1 
ATOM   6888  C  CD1   . ILE B 1 261 ? 56.131  125.325 74.270  1.00 25.39 ? 261  ILE B CD1   1 
ATOM   6889  N  N     . LEU B 1 262 ? 61.192  123.310 76.179  1.00 13.03 ? 262  LEU B N     1 
ATOM   6890  C  CA    . LEU B 1 262 ? 61.831  122.390 77.113  1.00 14.38 ? 262  LEU B CA    1 
ATOM   6891  C  C     . LEU B 1 262 ? 61.700  122.982 78.506  1.00 13.86 ? 262  LEU B C     1 
ATOM   6892  O  O     . LEU B 1 262 ? 62.190  124.078 78.771  1.00 15.56 ? 262  LEU B O     1 
ATOM   6893  C  CB    . LEU B 1 262 ? 63.312  122.172 76.774  1.00 13.99 ? 262  LEU B CB    1 
ATOM   6894  C  CG    . LEU B 1 262 ? 63.635  121.103 75.720  1.00 15.73 ? 262  LEU B CG    1 
ATOM   6895  C  CD1   . LEU B 1 262 ? 65.135  121.049 75.483  1.00 15.60 ? 262  LEU B CD1   1 
ATOM   6896  C  CD2   . LEU B 1 262 ? 63.134  119.745 76.193  1.00 14.37 ? 262  LEU B CD2   1 
ATOM   6897  N  N     . TYR B 1 263 ? 61.016  122.268 79.394  1.00 15.50 ? 263  TYR B N     1 
ATOM   6898  C  CA    . TYR B 1 263 ? 60.846  122.760 80.750  1.00 17.37 ? 263  TYR B CA    1 
ATOM   6899  C  C     . TYR B 1 263 ? 62.169  122.665 81.491  1.00 17.95 ? 263  TYR B C     1 
ATOM   6900  O  O     . TYR B 1 263 ? 62.808  121.609 81.553  1.00 19.94 ? 263  TYR B O     1 
ATOM   6901  C  CB    . TYR B 1 263 ? 59.702  122.019 81.449  1.00 16.51 ? 263  TYR B CB    1 
ATOM   6902  C  CG    . TYR B 1 263 ? 58.371  122.459 80.879  1.00 15.90 ? 263  TYR B CG    1 
ATOM   6903  C  CD1   . TYR B 1 263 ? 57.872  121.899 79.699  1.00 15.23 ? 263  TYR B CD1   1 
ATOM   6904  C  CD2   . TYR B 1 263 ? 57.684  123.538 81.435  1.00 13.79 ? 263  TYR B CD2   1 
ATOM   6905  C  CE1   . TYR B 1 263 ? 56.729  122.415 79.083  1.00 14.72 ? 263  TYR B CE1   1 
ATOM   6906  C  CE2   . TYR B 1 263 ? 56.547  124.060 80.829  1.00 14.70 ? 263  TYR B CE2   1 
ATOM   6907  C  CZ    . TYR B 1 263 ? 56.077  123.499 79.653  1.00 14.79 ? 263  TYR B CZ    1 
ATOM   6908  O  OH    . TYR B 1 263 ? 54.978  124.046 79.032  1.00 17.60 ? 263  TYR B OH    1 
ATOM   6909  N  N     . THR B 1 264 ? 62.574  123.804 82.039  1.00 18.31 ? 264  THR B N     1 
ATOM   6910  C  CA    . THR B 1 264 ? 63.853  123.945 82.710  1.00 17.53 ? 264  THR B CA    1 
ATOM   6911  C  C     . THR B 1 264 ? 63.732  124.513 84.117  1.00 17.10 ? 264  THR B C     1 
ATOM   6912  O  O     . THR B 1 264 ? 62.995  125.475 84.348  1.00 17.32 ? 264  THR B O     1 
ATOM   6913  C  CB    . THR B 1 264 ? 64.736  124.870 81.868  1.00 19.05 ? 264  THR B CB    1 
ATOM   6914  O  OG1   . THR B 1 264 ? 64.626  124.478 80.493  1.00 18.48 ? 264  THR B OG1   1 
ATOM   6915  C  CG2   . THR B 1 264 ? 66.185  124.795 82.306  1.00 17.51 ? 264  THR B CG2   1 
ATOM   6916  N  N     . SER B 1 265 ? 64.471  123.918 85.047  1.00 18.31 ? 265  SER B N     1 
ATOM   6917  C  CA    . SER B 1 265 ? 64.453  124.350 86.440  1.00 19.55 ? 265  SER B CA    1 
ATOM   6918  C  C     . SER B 1 265 ? 65.114  125.708 86.603  1.00 20.29 ? 265  SER B C     1 
ATOM   6919  O  O     . SER B 1 265 ? 66.134  125.997 85.974  1.00 20.81 ? 265  SER B O     1 
ATOM   6920  C  CB    . SER B 1 265 ? 65.174  123.331 87.327  1.00 18.60 ? 265  SER B CB    1 
ATOM   6921  O  OG    . SER B 1 265 ? 64.530  122.070 87.303  1.00 18.20 ? 265  SER B OG    1 
ATOM   6922  N  N     . GLY B 1 266 ? 64.526  126.533 87.458  1.00 21.35 ? 266  GLY B N     1 
ATOM   6923  C  CA    . GLY B 1 266 ? 65.065  127.855 87.702  1.00 24.29 ? 266  GLY B CA    1 
ATOM   6924  C  C     . GLY B 1 266 ? 65.394  128.034 89.169  1.00 27.20 ? 266  GLY B C     1 
ATOM   6925  O  O     . GLY B 1 266 ? 65.081  127.170 89.991  1.00 25.17 ? 266  GLY B O     1 
ATOM   6926  N  N     . SER B 1 267 ? 66.035  129.155 89.490  1.00 30.19 ? 267  SER B N     1 
ATOM   6927  C  CA    . SER B 1 267 ? 66.412  129.473 90.860  1.00 33.15 ? 267  SER B CA    1 
ATOM   6928  C  C     . SER B 1 267 ? 65.169  129.515 91.742  1.00 34.66 ? 267  SER B C     1 
ATOM   6929  O  O     . SER B 1 267 ? 65.235  129.209 92.931  1.00 36.14 ? 267  SER B O     1 
ATOM   6930  C  CB    . SER B 1 267 ? 67.127  130.828 90.906  1.00 33.19 ? 267  SER B CB    1 
ATOM   6931  O  OG    . SER B 1 267 ? 67.577  131.138 92.217  1.00 36.46 ? 267  SER B OG    1 
ATOM   6932  N  N     . THR B 1 268 ? 64.038  129.892 91.157  1.00 35.21 ? 268  THR B N     1 
ATOM   6933  C  CA    . THR B 1 268 ? 62.794  129.968 91.910  1.00 35.82 ? 268  THR B CA    1 
ATOM   6934  C  C     . THR B 1 268 ? 61.644  129.369 91.113  1.00 35.67 ? 268  THR B C     1 
ATOM   6935  O  O     . THR B 1 268 ? 61.737  129.198 89.897  1.00 36.62 ? 268  THR B O     1 
ATOM   6936  C  CB    . THR B 1 268 ? 62.436  131.428 92.239  1.00 37.92 ? 268  THR B CB    1 
ATOM   6937  O  OG1   . THR B 1 268 ? 62.191  132.139 91.021  1.00 38.98 ? 268  THR B OG1   1 
ATOM   6938  C  CG2   . THR B 1 268 ? 63.574  132.104 92.989  1.00 39.44 ? 268  THR B CG2   1 
ATOM   6939  N  N     . GLY B 1 269 ? 60.562  129.044 91.811  1.00 34.22 ? 269  GLY B N     1 
ATOM   6940  C  CA    . GLY B 1 269 ? 59.385  128.491 91.166  1.00 33.06 ? 269  GLY B CA    1 
ATOM   6941  C  C     . GLY B 1 269 ? 59.568  127.156 90.472  1.00 31.63 ? 269  GLY B C     1 
ATOM   6942  O  O     . GLY B 1 269 ? 60.639  126.554 90.533  1.00 32.29 ? 269  GLY B O     1 
ATOM   6943  N  N     . LYS B 1 270 ? 58.506  126.691 89.817  1.00 30.70 ? 270  LYS B N     1 
ATOM   6944  C  CA    . LYS B 1 270 ? 58.521  125.420 89.091  1.00 29.17 ? 270  LYS B CA    1 
ATOM   6945  C  C     . LYS B 1 270 ? 59.176  125.622 87.723  1.00 27.16 ? 270  LYS B C     1 
ATOM   6946  O  O     . LYS B 1 270 ? 59.386  126.755 87.293  1.00 25.77 ? 270  LYS B O     1 
ATOM   6947  C  CB    . LYS B 1 270 ? 57.093  124.897 88.919  1.00 30.15 ? 270  LYS B CB    1 
ATOM   6948  N  N     . PRO B 1 271 ? 59.508  124.523 87.025  1.00 25.00 ? 271  PRO B N     1 
ATOM   6949  C  CA    . PRO B 1 271 ? 60.142  124.613 85.704  1.00 23.57 ? 271  PRO B CA    1 
ATOM   6950  C  C     . PRO B 1 271 ? 59.318  125.408 84.697  1.00 20.70 ? 271  PRO B C     1 
ATOM   6951  O  O     . PRO B 1 271 ? 58.093  125.311 84.669  1.00 18.26 ? 271  PRO B O     1 
ATOM   6952  C  CB    . PRO B 1 271 ? 60.291  123.149 85.295  1.00 22.77 ? 271  PRO B CB    1 
ATOM   6953  C  CG    . PRO B 1 271 ? 60.491  122.463 86.610  1.00 24.54 ? 271  PRO B CG    1 
ATOM   6954  C  CD    . PRO B 1 271 ? 59.430  123.119 87.464  1.00 25.35 ? 271  PRO B CD    1 
ATOM   6955  N  N     . LYS B 1 272 ? 60.005  126.195 83.875  1.00 17.79 ? 272  LYS B N     1 
ATOM   6956  C  CA    . LYS B 1 272 ? 59.359  127.006 82.854  1.00 17.20 ? 272  LYS B CA    1 
ATOM   6957  C  C     . LYS B 1 272 ? 59.732  126.468 81.479  1.00 15.26 ? 272  LYS B C     1 
ATOM   6958  O  O     . LYS B 1 272 ? 60.826  125.930 81.294  1.00 14.77 ? 272  LYS B O     1 
ATOM   6959  C  CB    . LYS B 1 272 ? 59.810  128.464 82.973  1.00 20.50 ? 272  LYS B CB    1 
ATOM   6960  C  CG    . LYS B 1 272 ? 59.535  129.097 84.334  1.00 23.75 ? 272  LYS B CG    1 
ATOM   6961  C  CD    . LYS B 1 272 ? 58.057  129.081 84.679  1.00 28.23 ? 272  LYS B CD    1 
ATOM   6962  C  CE    . LYS B 1 272 ? 57.800  129.747 86.027  1.00 29.65 ? 272  LYS B CE    1 
ATOM   6963  N  NZ    . LYS B 1 272 ? 56.357  129.748 86.387  1.00 33.67 ? 272  LYS B NZ    1 
ATOM   6964  N  N     . GLY B 1 273 ? 58.823  126.625 80.521  1.00 14.80 ? 273  GLY B N     1 
ATOM   6965  C  CA    . GLY B 1 273 ? 59.068  126.144 79.172  1.00 16.10 ? 273  GLY B CA    1 
ATOM   6966  C  C     . GLY B 1 273 ? 59.910  127.069 78.306  1.00 15.25 ? 273  GLY B C     1 
ATOM   6967  O  O     . GLY B 1 273 ? 59.394  128.021 77.718  1.00 14.28 ? 273  GLY B O     1 
ATOM   6968  N  N     . VAL B 1 274 ? 61.208  126.788 78.229  1.00 14.15 ? 274  VAL B N     1 
ATOM   6969  C  CA    . VAL B 1 274 ? 62.120  127.590 77.419  1.00 14.28 ? 274  VAL B CA    1 
ATOM   6970  C  C     . VAL B 1 274 ? 61.742  127.338 75.965  1.00 15.05 ? 274  VAL B C     1 
ATOM   6971  O  O     . VAL B 1 274 ? 61.761  126.197 75.494  1.00 13.68 ? 274  VAL B O     1 
ATOM   6972  C  CB    . VAL B 1 274 ? 63.592  127.181 77.664  1.00 13.06 ? 274  VAL B CB    1 
ATOM   6973  C  CG1   . VAL B 1 274 ? 64.531  128.019 76.796  1.00 12.96 ? 274  VAL B CG1   1 
ATOM   6974  C  CG2   . VAL B 1 274 ? 63.934  127.363 79.139  1.00 13.50 ? 274  VAL B CG2   1 
ATOM   6975  N  N     . LEU B 1 275 ? 61.390  128.405 75.255  1.00 13.72 ? 275  LEU B N     1 
ATOM   6976  C  CA    . LEU B 1 275 ? 60.964  128.266 73.871  1.00 12.39 ? 275  LEU B CA    1 
ATOM   6977  C  C     . LEU B 1 275 ? 61.993  128.679 72.835  1.00 13.46 ? 275  LEU B C     1 
ATOM   6978  O  O     . LEU B 1 275 ? 62.578  129.759 72.912  1.00 13.38 ? 275  LEU B O     1 
ATOM   6979  C  CB    . LEU B 1 275 ? 59.672  129.061 73.645  1.00 13.08 ? 275  LEU B CB    1 
ATOM   6980  C  CG    . LEU B 1 275 ? 58.959  128.843 72.300  1.00 16.13 ? 275  LEU B CG    1 
ATOM   6981  C  CD1   . LEU B 1 275 ? 57.460  129.035 72.482  1.00 16.99 ? 275  LEU B CD1   1 
ATOM   6982  C  CD2   . LEU B 1 275 ? 59.511  129.792 71.242  1.00 15.73 ? 275  LEU B CD2   1 
ATOM   6983  N  N     . HIS B 1 276 ? 62.209  127.798 71.864  1.00 11.92 ? 276  HIS B N     1 
ATOM   6984  C  CA    . HIS B 1 276 ? 63.128  128.066 70.770  1.00 10.94 ? 276  HIS B CA    1 
ATOM   6985  C  C     . HIS B 1 276 ? 62.336  128.142 69.478  1.00 12.23 ? 276  HIS B C     1 
ATOM   6986  O  O     . HIS B 1 276 ? 61.377  127.384 69.287  1.00 13.82 ? 276  HIS B O     1 
ATOM   6987  C  CB    . HIS B 1 276 ? 64.169  126.953 70.662  1.00 11.93 ? 276  HIS B CB    1 
ATOM   6988  C  CG    . HIS B 1 276 ? 65.328  127.124 71.590  1.00 13.14 ? 276  HIS B CG    1 
ATOM   6989  N  ND1   . HIS B 1 276 ? 66.322  128.052 71.371  1.00 13.74 ? 276  HIS B ND1   1 
ATOM   6990  C  CD2   . HIS B 1 276 ? 65.632  126.514 72.760  1.00 13.15 ? 276  HIS B CD2   1 
ATOM   6991  C  CE1   . HIS B 1 276 ? 67.190  128.009 72.366  1.00 14.00 ? 276  HIS B CE1   1 
ATOM   6992  N  NE2   . HIS B 1 276 ? 66.795  127.083 73.222  1.00 15.06 ? 276  HIS B NE2   1 
ATOM   6993  N  N     . THR B 1 277 ? 62.711  129.070 68.600  1.00 12.01 ? 277  THR B N     1 
ATOM   6994  C  CA    . THR B 1 277 ? 62.033  129.162 67.321  1.00 11.99 ? 277  THR B CA    1 
ATOM   6995  C  C     . THR B 1 277 ? 62.823  128.333 66.307  1.00 13.14 ? 277  THR B C     1 
ATOM   6996  O  O     . THR B 1 277 ? 63.646  127.508 66.697  1.00 12.53 ? 277  THR B O     1 
ATOM   6997  C  CB    . THR B 1 277 ? 61.824  130.635 66.853  1.00 12.41 ? 277  THR B CB    1 
ATOM   6998  O  OG1   . THR B 1 277 ? 63.051  131.367 66.933  1.00 13.92 ? 277  THR B OG1   1 
ATOM   6999  C  CG2   . THR B 1 277 ? 60.769  131.310 67.730  1.00 11.97 ? 277  THR B CG2   1 
ATOM   7000  N  N     . THR B 1 278 ? 62.604  128.570 65.020  1.00 13.76 ? 278  THR B N     1 
ATOM   7001  C  CA    . THR B 1 278 ? 63.212  127.740 63.987  1.00 13.54 ? 278  THR B CA    1 
ATOM   7002  C  C     . THR B 1 278 ? 64.523  128.112 63.295  1.00 14.56 ? 278  THR B C     1 
ATOM   7003  O  O     . THR B 1 278 ? 65.498  127.360 63.372  1.00 14.09 ? 278  THR B O     1 
ATOM   7004  C  CB    . THR B 1 278 ? 62.143  127.461 62.902  1.00 14.62 ? 278  THR B CB    1 
ATOM   7005  O  OG1   . THR B 1 278 ? 60.952  126.980 63.539  1.00 14.13 ? 278  THR B OG1   1 
ATOM   7006  C  CG2   . THR B 1 278 ? 62.628  126.415 61.898  1.00 12.98 ? 278  THR B CG2   1 
ATOM   7007  N  N     . GLY B 1 279 ? 64.537  129.250 62.608  1.00 13.73 ? 279  GLY B N     1 
ATOM   7008  C  CA    . GLY B 1 279 ? 65.713  129.669 61.861  1.00 13.59 ? 279  GLY B CA    1 
ATOM   7009  C  C     . GLY B 1 279 ? 67.042  129.803 62.576  1.00 12.90 ? 279  GLY B C     1 
ATOM   7010  O  O     . GLY B 1 279 ? 67.975  129.031 62.323  1.00 13.92 ? 279  GLY B O     1 
ATOM   7011  N  N     . GLY B 1 280 ? 67.141  130.800 63.446  1.00 12.68 ? 280  GLY B N     1 
ATOM   7012  C  CA    . GLY B 1 280 ? 68.375  131.020 64.176  1.00 12.13 ? 280  GLY B CA    1 
ATOM   7013  C  C     . GLY B 1 280 ? 68.807  129.784 64.941  1.00 12.83 ? 280  GLY B C     1 
ATOM   7014  O  O     . GLY B 1 280 ? 69.989  129.434 64.951  1.00 13.23 ? 280  GLY B O     1 
ATOM   7015  N  N     . TYR B 1 281 ? 67.853  129.121 65.585  1.00 13.09 ? 281  TYR B N     1 
ATOM   7016  C  CA    . TYR B 1 281 ? 68.172  127.922 66.349  1.00 13.68 ? 281  TYR B CA    1 
ATOM   7017  C  C     . TYR B 1 281 ? 68.859  126.857 65.502  1.00 13.78 ? 281  TYR B C     1 
ATOM   7018  O  O     . TYR B 1 281 ? 69.912  126.335 65.880  1.00 13.52 ? 281  TYR B O     1 
ATOM   7019  C  CB    . TYR B 1 281 ? 66.910  127.303 66.965  1.00 12.92 ? 281  TYR B CB    1 
ATOM   7020  C  CG    . TYR B 1 281 ? 67.184  125.933 67.549  1.00 14.29 ? 281  TYR B CG    1 
ATOM   7021  C  CD1   . TYR B 1 281 ? 67.878  125.791 68.753  1.00 12.92 ? 281  TYR B CD1   1 
ATOM   7022  C  CD2   . TYR B 1 281 ? 66.832  124.779 66.851  1.00 13.55 ? 281  TYR B CD2   1 
ATOM   7023  C  CE1   . TYR B 1 281 ? 68.220  124.521 69.246  1.00 14.17 ? 281  TYR B CE1   1 
ATOM   7024  C  CE2   . TYR B 1 281 ? 67.172  123.512 67.329  1.00 12.17 ? 281  TYR B CE2   1 
ATOM   7025  C  CZ    . TYR B 1 281 ? 67.862  123.390 68.522  1.00 12.58 ? 281  TYR B CZ    1 
ATOM   7026  O  OH    . TYR B 1 281 ? 68.199  122.138 68.979  1.00 12.34 ? 281  TYR B OH    1 
ATOM   7027  N  N     . LEU B 1 282 ? 68.266  126.523 64.360  1.00 12.30 ? 282  LEU B N     1 
ATOM   7028  C  CA    . LEU B 1 282 ? 68.839  125.478 63.522  1.00 11.85 ? 282  LEU B CA    1 
ATOM   7029  C  C     . LEU B 1 282 ? 70.173  125.878 62.907  1.00 12.92 ? 282  LEU B C     1 
ATOM   7030  O  O     . LEU B 1 282 ? 71.071  125.050 62.791  1.00 11.80 ? 282  LEU B O     1 
ATOM   7031  C  CB    . LEU B 1 282 ? 67.838  125.051 62.439  1.00 12.64 ? 282  LEU B CB    1 
ATOM   7032  C  CG    . LEU B 1 282 ? 68.206  123.785 61.649  1.00 11.11 ? 282  LEU B CG    1 
ATOM   7033  C  CD1   . LEU B 1 282 ? 68.466  122.619 62.609  1.00 13.09 ? 282  LEU B CD1   1 
ATOM   7034  C  CD2   . LEU B 1 282 ? 67.076  123.438 60.692  1.00 12.46 ? 282  LEU B CD2   1 
ATOM   7035  N  N     . VAL B 1 283 ? 70.309  127.140 62.513  1.00 12.37 ? 283  VAL B N     1 
ATOM   7036  C  CA    . VAL B 1 283 ? 71.573  127.603 61.947  1.00 13.17 ? 283  VAL B CA    1 
ATOM   7037  C  C     . VAL B 1 283 ? 72.664  127.459 63.014  1.00 13.47 ? 283  VAL B C     1 
ATOM   7038  O  O     . VAL B 1 283 ? 73.749  126.938 62.752  1.00 14.27 ? 283  VAL B O     1 
ATOM   7039  C  CB    . VAL B 1 283 ? 71.507  129.092 61.530  1.00 13.57 ? 283  VAL B CB    1 
ATOM   7040  C  CG1   . VAL B 1 283 ? 72.906  129.603 61.192  1.00 14.14 ? 283  VAL B CG1   1 
ATOM   7041  C  CG2   . VAL B 1 283 ? 70.594  129.263 60.328  1.00 12.65 ? 283  VAL B CG2   1 
ATOM   7042  N  N     . TYR B 1 284 ? 72.355  127.909 64.225  1.00 12.86 ? 284  TYR B N     1 
ATOM   7043  C  CA    . TYR B 1 284 ? 73.315  127.867 65.318  1.00 13.80 ? 284  TYR B CA    1 
ATOM   7044  C  C     . TYR B 1 284 ? 73.683  126.443 65.730  1.00 13.68 ? 284  TYR B C     1 
ATOM   7045  O  O     . TYR B 1 284 ? 74.850  126.154 65.994  1.00 12.83 ? 284  TYR B O     1 
ATOM   7046  C  CB    . TYR B 1 284 ? 72.774  128.657 66.517  1.00 13.86 ? 284  TYR B CB    1 
ATOM   7047  C  CG    . TYR B 1 284 ? 73.855  129.161 67.449  1.00 15.54 ? 284  TYR B CG    1 
ATOM   7048  C  CD1   . TYR B 1 284 ? 74.018  128.618 68.726  1.00 13.41 ? 284  TYR B CD1   1 
ATOM   7049  C  CD2   . TYR B 1 284 ? 74.741  130.154 67.036  1.00 13.92 ? 284  TYR B CD2   1 
ATOM   7050  C  CE1   . TYR B 1 284 ? 75.044  129.051 69.568  1.00 14.92 ? 284  TYR B CE1   1 
ATOM   7051  C  CE2   . TYR B 1 284 ? 75.773  130.595 67.869  1.00 14.78 ? 284  TYR B CE2   1 
ATOM   7052  C  CZ    . TYR B 1 284 ? 75.921  130.038 69.131  1.00 13.82 ? 284  TYR B CZ    1 
ATOM   7053  O  OH    . TYR B 1 284 ? 76.959  130.446 69.936  1.00 13.04 ? 284  TYR B OH    1 
ATOM   7054  N  N     . ALA B 1 285 ? 72.696  125.551 65.774  1.00 11.87 ? 285  ALA B N     1 
ATOM   7055  C  CA    . ALA B 1 285 ? 72.956  124.163 66.151  1.00 12.25 ? 285  ALA B CA    1 
ATOM   7056  C  C     . ALA B 1 285 ? 73.836  123.471 65.113  1.00 13.38 ? 285  ALA B C     1 
ATOM   7057  O  O     . ALA B 1 285 ? 74.765  122.735 65.457  1.00 14.17 ? 285  ALA B O     1 
ATOM   7058  C  CB    . ALA B 1 285 ? 71.643  123.404 66.305  1.00 12.42 ? 285  ALA B CB    1 
ATOM   7059  N  N     . ALA B 1 286 ? 73.542  123.702 63.839  1.00 13.28 ? 286  ALA B N     1 
ATOM   7060  C  CA    . ALA B 1 286 ? 74.321  123.089 62.767  1.00 13.77 ? 286  ALA B CA    1 
ATOM   7061  C  C     . ALA B 1 286 ? 75.728  123.674 62.715  1.00 12.66 ? 286  ALA B C     1 
ATOM   7062  O  O     . ALA B 1 286 ? 76.707  122.944 62.535  1.00 12.67 ? 286  ALA B O     1 
ATOM   7063  C  CB    . ALA B 1 286 ? 73.619  123.285 61.428  1.00 14.56 ? 286  ALA B CB    1 
ATOM   7064  N  N     . THR B 1 287 ? 75.822  124.989 62.884  1.00 12.21 ? 287  THR B N     1 
ATOM   7065  C  CA    . THR B 1 287 ? 77.108  125.684 62.853  1.00 13.45 ? 287  THR B CA    1 
ATOM   7066  C  C     . THR B 1 287 ? 78.023  125.263 64.005  1.00 13.53 ? 287  THR B C     1 
ATOM   7067  O  O     . THR B 1 287 ? 79.193  124.949 63.789  1.00 13.63 ? 287  THR B O     1 
ATOM   7068  C  CB    . THR B 1 287 ? 76.902  127.214 62.893  1.00 13.41 ? 287  THR B CB    1 
ATOM   7069  O  OG1   . THR B 1 287 ? 76.157  127.619 61.737  1.00 15.60 ? 287  THR B OG1   1 
ATOM   7070  C  CG2   . THR B 1 287 ? 78.244  127.942 62.918  1.00 14.30 ? 287  THR B CG2   1 
ATOM   7071  N  N     . THR B 1 288 ? 77.494  125.259 65.227  1.00 14.42 ? 288  THR B N     1 
ATOM   7072  C  CA    . THR B 1 288 ? 78.285  124.853 66.385  1.00 13.99 ? 288  THR B CA    1 
ATOM   7073  C  C     . THR B 1 288 ? 78.685  123.381 66.284  1.00 14.72 ? 288  THR B C     1 
ATOM   7074  O  O     . THR B 1 288 ? 79.821  123.016 66.583  1.00 13.84 ? 288  THR B O     1 
ATOM   7075  C  CB    . THR B 1 288 ? 77.517  125.060 67.706  1.00 12.61 ? 288  THR B CB    1 
ATOM   7076  O  OG1   . THR B 1 288 ? 76.179  124.565 67.563  1.00 12.35 ? 288  THR B OG1   1 
ATOM   7077  C  CG2   . THR B 1 288 ? 77.494  126.536 68.088  1.00 14.18 ? 288  THR B CG2   1 
ATOM   7078  N  N     . PHE B 1 289 ? 77.754  122.532 65.862  1.00 16.16 ? 289  PHE B N     1 
ATOM   7079  C  CA    . PHE B 1 289 ? 78.052  121.106 65.739  1.00 16.51 ? 289  PHE B CA    1 
ATOM   7080  C  C     . PHE B 1 289 ? 79.209  120.854 64.778  1.00 17.20 ? 289  PHE B C     1 
ATOM   7081  O  O     . PHE B 1 289 ? 80.163  120.138 65.091  1.00 17.04 ? 289  PHE B O     1 
ATOM   7082  C  CB    . PHE B 1 289 ? 76.830  120.336 65.230  1.00 16.43 ? 289  PHE B CB    1 
ATOM   7083  C  CG    . PHE B 1 289 ? 77.150  118.938 64.781  1.00 17.16 ? 289  PHE B CG    1 
ATOM   7084  C  CD1   . PHE B 1 289 ? 77.312  117.912 65.709  1.00 17.54 ? 289  PHE B CD1   1 
ATOM   7085  C  CD2   . PHE B 1 289 ? 77.349  118.661 63.434  1.00 16.04 ? 289  PHE B CD2   1 
ATOM   7086  C  CE1   . PHE B 1 289 ? 77.672  116.629 65.296  1.00 16.87 ? 289  PHE B CE1   1 
ATOM   7087  C  CE2   . PHE B 1 289 ? 77.710  117.389 63.013  1.00 17.10 ? 289  PHE B CE2   1 
ATOM   7088  C  CZ    . PHE B 1 289 ? 77.873  116.368 63.948  1.00 17.06 ? 289  PHE B CZ    1 
ATOM   7089  N  N     . LYS B 1 290 ? 79.101  121.446 63.598  1.00 15.87 ? 290  LYS B N     1 
ATOM   7090  C  CA    . LYS B 1 290 ? 80.093  121.286 62.546  1.00 18.50 ? 290  LYS B CA    1 
ATOM   7091  C  C     . LYS B 1 290 ? 81.510  121.732 62.908  1.00 17.67 ? 290  LYS B C     1 
ATOM   7092  O  O     . LYS B 1 290 ? 82.470  120.980 62.740  1.00 19.14 ? 290  LYS B O     1 
ATOM   7093  C  CB    . LYS B 1 290 ? 79.613  122.041 61.311  1.00 17.31 ? 290  LYS B CB    1 
ATOM   7094  C  CG    . LYS B 1 290 ? 80.446  121.846 60.059  1.00 21.27 ? 290  LYS B CG    1 
ATOM   7095  C  CD    . LYS B 1 290 ? 79.759  122.561 58.909  1.00 22.69 ? 290  LYS B CD    1 
ATOM   7096  C  CE    . LYS B 1 290 ? 80.442  122.320 57.583  1.00 25.99 ? 290  LYS B CE    1 
ATOM   7097  N  NZ    . LYS B 1 290 ? 79.688  123.012 56.500  1.00 26.26 ? 290  LYS B NZ    1 
ATOM   7098  N  N     . TYR B 1 291 ? 81.639  122.952 63.413  1.00 18.31 ? 291  TYR B N     1 
ATOM   7099  C  CA    . TYR B 1 291 ? 82.944  123.497 63.760  1.00 19.03 ? 291  TYR B CA    1 
ATOM   7100  C  C     . TYR B 1 291 ? 83.555  123.026 65.074  1.00 19.58 ? 291  TYR B C     1 
ATOM   7101  O  O     . TYR B 1 291 ? 84.769  122.842 65.159  1.00 19.88 ? 291  TYR B O     1 
ATOM   7102  C  CB    . TYR B 1 291 ? 82.871  125.025 63.720  1.00 20.59 ? 291  TYR B CB    1 
ATOM   7103  C  CG    . TYR B 1 291 ? 82.602  125.538 62.321  1.00 22.25 ? 291  TYR B CG    1 
ATOM   7104  C  CD1   . TYR B 1 291 ? 81.688  126.564 62.090  1.00 25.83 ? 291  TYR B CD1   1 
ATOM   7105  C  CD2   . TYR B 1 291 ? 83.246  124.969 61.222  1.00 24.83 ? 291  TYR B CD2   1 
ATOM   7106  C  CE1   . TYR B 1 291 ? 81.417  127.007 60.789  1.00 27.96 ? 291  TYR B CE1   1 
ATOM   7107  C  CE2   . TYR B 1 291 ? 82.986  125.400 59.926  1.00 27.32 ? 291  TYR B CE2   1 
ATOM   7108  C  CZ    . TYR B 1 291 ? 82.069  126.417 59.714  1.00 29.45 ? 291  TYR B CZ    1 
ATOM   7109  O  OH    . TYR B 1 291 ? 81.801  126.825 58.426  1.00 31.53 ? 291  TYR B OH    1 
ATOM   7110  N  N     . VAL B 1 292 ? 82.735  122.821 66.097  1.00 18.39 ? 292  VAL B N     1 
ATOM   7111  C  CA    . VAL B 1 292 ? 83.274  122.371 67.372  1.00 17.68 ? 292  VAL B CA    1 
ATOM   7112  C  C     . VAL B 1 292 ? 83.671  120.895 67.328  1.00 18.79 ? 292  VAL B C     1 
ATOM   7113  O  O     . VAL B 1 292 ? 84.684  120.504 67.912  1.00 19.08 ? 292  VAL B O     1 
ATOM   7114  C  CB    . VAL B 1 292 ? 82.278  122.635 68.516  1.00 17.47 ? 292  VAL B CB    1 
ATOM   7115  C  CG1   . VAL B 1 292 ? 82.782  122.025 69.814  1.00 18.51 ? 292  VAL B CG1   1 
ATOM   7116  C  CG2   . VAL B 1 292 ? 82.108  124.133 68.692  1.00 17.95 ? 292  VAL B CG2   1 
ATOM   7117  N  N     . PHE B 1 293 ? 82.893  120.074 66.630  1.00 16.86 ? 293  PHE B N     1 
ATOM   7118  C  CA    . PHE B 1 293 ? 83.227  118.659 66.525  1.00 17.70 ? 293  PHE B CA    1 
ATOM   7119  C  C     . PHE B 1 293 ? 84.035  118.378 65.264  1.00 18.69 ? 293  PHE B C     1 
ATOM   7120  O  O     . PHE B 1 293 ? 84.346  117.226 64.956  1.00 16.30 ? 293  PHE B O     1 
ATOM   7121  C  CB    . PHE B 1 293 ? 81.961  117.803 66.550  1.00 16.25 ? 293  PHE B CB    1 
ATOM   7122  C  CG    . PHE B 1 293 ? 81.249  117.834 67.872  1.00 16.43 ? 293  PHE B CG    1 
ATOM   7123  C  CD1   . PHE B 1 293 ? 79.936  118.281 67.961  1.00 14.64 ? 293  PHE B CD1   1 
ATOM   7124  C  CD2   . PHE B 1 293 ? 81.907  117.444 69.037  1.00 15.31 ? 293  PHE B CD2   1 
ATOM   7125  C  CE1   . PHE B 1 293 ? 79.287  118.343 69.193  1.00 16.22 ? 293  PHE B CE1   1 
ATOM   7126  C  CE2   . PHE B 1 293 ? 81.265  117.502 70.274  1.00 16.76 ? 293  PHE B CE2   1 
ATOM   7127  C  CZ    . PHE B 1 293 ? 79.949  117.955 70.350  1.00 12.47 ? 293  PHE B CZ    1 
ATOM   7128  N  N     . ASP B 1 294 ? 84.383  119.449 64.552  1.00 18.07 ? 294  ASP B N     1 
ATOM   7129  C  CA    . ASP B 1 294 ? 85.174  119.352 63.327  1.00 18.88 ? 294  ASP B CA    1 
ATOM   7130  C  C     . ASP B 1 294 ? 84.637  118.246 62.432  1.00 19.48 ? 294  ASP B C     1 
ATOM   7131  O  O     . ASP B 1 294 ? 85.395  117.426 61.914  1.00 18.68 ? 294  ASP B O     1 
ATOM   7132  C  CB    . ASP B 1 294 ? 86.635  119.056 63.667  1.00 19.75 ? 294  ASP B CB    1 
ATOM   7133  C  CG    . ASP B 1 294 ? 87.576  119.419 62.535  1.00 22.25 ? 294  ASP B CG    1 
ATOM   7134  O  OD1   . ASP B 1 294 ? 88.459  118.599 62.195  1.00 22.73 ? 294  ASP B OD1   1 
ATOM   7135  O  OD2   . ASP B 1 294 ? 87.430  120.534 61.992  1.00 22.92 ? 294  ASP B OD2   1 
ATOM   7136  N  N     . TYR B 1 295 ? 83.324  118.241 62.245  1.00 19.19 ? 295  TYR B N     1 
ATOM   7137  C  CA    . TYR B 1 295 ? 82.662  117.224 61.444  1.00 20.37 ? 295  TYR B CA    1 
ATOM   7138  C  C     . TYR B 1 295 ? 83.061  117.157 59.969  1.00 21.09 ? 295  TYR B C     1 
ATOM   7139  O  O     . TYR B 1 295 ? 83.009  118.154 59.247  1.00 20.03 ? 295  TYR B O     1 
ATOM   7140  C  CB    . TYR B 1 295 ? 81.145  117.405 61.535  1.00 22.15 ? 295  TYR B CB    1 
ATOM   7141  C  CG    . TYR B 1 295 ? 80.402  116.506 60.586  1.00 23.68 ? 295  TYR B CG    1 
ATOM   7142  C  CD1   . TYR B 1 295 ? 80.292  115.142 60.832  1.00 25.15 ? 295  TYR B CD1   1 
ATOM   7143  C  CD2   . TYR B 1 295 ? 79.877  117.008 59.396  1.00 26.27 ? 295  TYR B CD2   1 
ATOM   7144  C  CE1   . TYR B 1 295 ? 79.682  114.294 59.914  1.00 26.19 ? 295  TYR B CE1   1 
ATOM   7145  C  CE2   . TYR B 1 295 ? 79.268  116.170 58.469  1.00 27.36 ? 295  TYR B CE2   1 
ATOM   7146  C  CZ    . TYR B 1 295 ? 79.176  114.815 58.734  1.00 27.24 ? 295  TYR B CZ    1 
ATOM   7147  O  OH    . TYR B 1 295 ? 78.594  113.986 57.806  1.00 29.72 ? 295  TYR B OH    1 
ATOM   7148  N  N     . HIS B 1 296 ? 83.451  115.961 59.537  1.00 21.52 ? 296  HIS B N     1 
ATOM   7149  C  CA    . HIS B 1 296 ? 83.820  115.700 58.150  1.00 23.14 ? 296  HIS B CA    1 
ATOM   7150  C  C     . HIS B 1 296 ? 82.902  114.597 57.646  1.00 22.60 ? 296  HIS B C     1 
ATOM   7151  O  O     . HIS B 1 296 ? 82.591  113.664 58.383  1.00 22.06 ? 296  HIS B O     1 
ATOM   7152  C  CB    . HIS B 1 296 ? 85.268  115.219 58.038  1.00 23.87 ? 296  HIS B CB    1 
ATOM   7153  C  CG    . HIS B 1 296 ? 86.282  116.296 58.247  1.00 24.94 ? 296  HIS B CG    1 
ATOM   7154  N  ND1   . HIS B 1 296 ? 86.456  116.930 59.459  1.00 23.93 ? 296  HIS B ND1   1 
ATOM   7155  C  CD2   . HIS B 1 296 ? 87.178  116.852 57.397  1.00 25.87 ? 296  HIS B CD2   1 
ATOM   7156  C  CE1   . HIS B 1 296 ? 87.417  117.830 59.347  1.00 25.60 ? 296  HIS B CE1   1 
ATOM   7157  N  NE2   . HIS B 1 296 ? 87.871  117.803 58.106  1.00 26.87 ? 296  HIS B NE2   1 
ATOM   7158  N  N     . PRO B 1 297 ? 82.454  114.688 56.386  1.00 23.62 ? 297  PRO B N     1 
ATOM   7159  C  CA    . PRO B 1 297 ? 81.569  113.652 55.846  1.00 24.55 ? 297  PRO B CA    1 
ATOM   7160  C  C     . PRO B 1 297 ? 82.082  112.253 56.173  1.00 25.45 ? 297  PRO B C     1 
ATOM   7161  O  O     . PRO B 1 297 ? 83.250  111.942 55.944  1.00 26.86 ? 297  PRO B O     1 
ATOM   7162  C  CB    . PRO B 1 297 ? 81.585  113.940 54.349  1.00 24.77 ? 297  PRO B CB    1 
ATOM   7163  C  CG    . PRO B 1 297 ? 81.691  115.432 54.312  1.00 24.37 ? 297  PRO B CG    1 
ATOM   7164  C  CD    . PRO B 1 297 ? 82.751  115.709 55.365  1.00 23.20 ? 297  PRO B CD    1 
ATOM   7165  N  N     . GLY B 1 298 ? 81.206  111.418 56.720  1.00 26.05 ? 298  GLY B N     1 
ATOM   7166  C  CA    . GLY B 1 298 ? 81.598  110.065 57.062  1.00 24.66 ? 298  GLY B CA    1 
ATOM   7167  C  C     . GLY B 1 298 ? 81.957  109.847 58.521  1.00 23.73 ? 298  GLY B C     1 
ATOM   7168  O  O     . GLY B 1 298 ? 82.083  108.702 58.955  1.00 25.16 ? 298  GLY B O     1 
ATOM   7169  N  N     . ASP B 1 299 ? 82.132  110.923 59.284  1.00 20.82 ? 299  ASP B N     1 
ATOM   7170  C  CA    . ASP B 1 299 ? 82.472  110.778 60.696  1.00 20.20 ? 299  ASP B CA    1 
ATOM   7171  C  C     . ASP B 1 299 ? 81.315  110.144 61.463  1.00 19.57 ? 299  ASP B C     1 
ATOM   7172  O  O     . ASP B 1 299 ? 80.152  110.461 61.216  1.00 21.43 ? 299  ASP B O     1 
ATOM   7173  C  CB    . ASP B 1 299 ? 82.804  112.136 61.326  1.00 19.97 ? 299  ASP B CB    1 
ATOM   7174  C  CG    . ASP B 1 299 ? 84.164  112.671 60.899  1.00 21.95 ? 299  ASP B CG    1 
ATOM   7175  O  OD1   . ASP B 1 299 ? 84.923  111.936 60.233  1.00 21.73 ? 299  ASP B OD1   1 
ATOM   7176  O  OD2   . ASP B 1 299 ? 84.476  113.830 61.242  1.00 21.97 ? 299  ASP B OD2   1 
ATOM   7177  N  N     . ILE B 1 300 ? 81.635  109.235 62.378  1.00 18.71 ? 300  ILE B N     1 
ATOM   7178  C  CA    . ILE B 1 300 ? 80.614  108.587 63.193  1.00 18.59 ? 300  ILE B CA    1 
ATOM   7179  C  C     . ILE B 1 300 ? 80.570  109.379 64.488  1.00 17.26 ? 300  ILE B C     1 
ATOM   7180  O  O     . ILE B 1 300 ? 81.546  109.416 65.237  1.00 17.49 ? 300  ILE B O     1 
ATOM   7181  C  CB    . ILE B 1 300 ? 80.969  107.122 63.503  1.00 20.46 ? 300  ILE B CB    1 
ATOM   7182  C  CG1   . ILE B 1 300 ? 81.148  106.337 62.198  1.00 21.29 ? 300  ILE B CG1   1 
ATOM   7183  C  CG2   . ILE B 1 300 ? 79.867  106.491 64.352  1.00 19.69 ? 300  ILE B CG2   1 
ATOM   7184  C  CD1   . ILE B 1 300 ? 79.923  106.322 61.306  1.00 20.55 ? 300  ILE B CD1   1 
ATOM   7185  N  N     . TYR B 1 301 ? 79.429  110.003 64.750  1.00 15.42 ? 301  TYR B N     1 
ATOM   7186  C  CA    . TYR B 1 301 ? 79.267  110.850 65.921  1.00 14.87 ? 301  TYR B CA    1 
ATOM   7187  C  C     . TYR B 1 301 ? 78.330  110.291 66.984  1.00 13.75 ? 301  TYR B C     1 
ATOM   7188  O  O     . TYR B 1 301 ? 77.243  109.792 66.675  1.00 12.27 ? 301  TYR B O     1 
ATOM   7189  C  CB    . TYR B 1 301 ? 78.789  112.230 65.451  1.00 14.98 ? 301  TYR B CB    1 
ATOM   7190  C  CG    . TYR B 1 301 ? 78.347  113.161 66.548  1.00 14.36 ? 301  TYR B CG    1 
ATOM   7191  C  CD1   . TYR B 1 301 ? 77.014  113.206 66.953  1.00 15.21 ? 301  TYR B CD1   1 
ATOM   7192  C  CD2   . TYR B 1 301 ? 79.262  113.998 67.184  1.00 13.02 ? 301  TYR B CD2   1 
ATOM   7193  C  CE1   . TYR B 1 301 ? 76.603  114.067 67.967  1.00 15.43 ? 301  TYR B CE1   1 
ATOM   7194  C  CE2   . TYR B 1 301 ? 78.865  114.861 68.198  1.00 15.44 ? 301  TYR B CE2   1 
ATOM   7195  C  CZ    . TYR B 1 301 ? 77.536  114.891 68.583  1.00 15.41 ? 301  TYR B CZ    1 
ATOM   7196  O  OH    . TYR B 1 301 ? 77.139  115.757 69.569  1.00 15.10 ? 301  TYR B OH    1 
ATOM   7197  N  N     . TRP B 1 302 ? 78.756  110.387 68.240  1.00 12.13 ? 302  TRP B N     1 
ATOM   7198  C  CA    . TRP B 1 302 ? 77.950  109.892 69.346  1.00 13.67 ? 302  TRP B CA    1 
ATOM   7199  C  C     . TRP B 1 302 ? 77.881  110.834 70.541  1.00 14.07 ? 302  TRP B C     1 
ATOM   7200  O  O     . TRP B 1 302 ? 78.877  111.073 71.222  1.00 14.60 ? 302  TRP B O     1 
ATOM   7201  C  CB    . TRP B 1 302 ? 78.463  108.520 69.810  1.00 13.05 ? 302  TRP B CB    1 
ATOM   7202  C  CG    . TRP B 1 302 ? 77.666  107.928 70.950  1.00 14.03 ? 302  TRP B CG    1 
ATOM   7203  C  CD1   . TRP B 1 302 ? 76.370  108.210 71.278  1.00 14.72 ? 302  TRP B CD1   1 
ATOM   7204  C  CD2   . TRP B 1 302 ? 78.104  106.925 71.881  1.00 14.00 ? 302  TRP B CD2   1 
ATOM   7205  N  NE1   . TRP B 1 302 ? 75.974  107.450 72.354  1.00 14.40 ? 302  TRP B NE1   1 
ATOM   7206  C  CE2   . TRP B 1 302 ? 77.017  106.652 72.744  1.00 13.85 ? 302  TRP B CE2   1 
ATOM   7207  C  CE3   . TRP B 1 302 ? 79.307  106.232 72.069  1.00 14.45 ? 302  TRP B CE3   1 
ATOM   7208  C  CZ2   . TRP B 1 302 ? 77.097  105.713 73.782  1.00 13.37 ? 302  TRP B CZ2   1 
ATOM   7209  C  CZ3   . TRP B 1 302 ? 79.388  105.297 73.102  1.00 15.13 ? 302  TRP B CZ3   1 
ATOM   7210  C  CH2   . TRP B 1 302 ? 78.285  105.048 73.945  1.00 13.73 ? 302  TRP B CH2   1 
ATOM   7211  N  N     . CYS B 1 303 ? 76.685  111.366 70.770  1.00 13.05 ? 303  CYS B N     1 
ATOM   7212  C  CA    . CYS B 1 303 ? 76.389  112.238 71.900  1.00 12.67 ? 303  CYS B CA    1 
ATOM   7213  C  C     . CYS B 1 303 ? 75.599  111.328 72.838  1.00 13.08 ? 303  CYS B C     1 
ATOM   7214  O  O     . CYS B 1 303 ? 74.625  110.707 72.414  1.00 13.85 ? 303  CYS B O     1 
ATOM   7215  C  CB    . CYS B 1 303 ? 75.517  113.416 71.449  1.00 13.85 ? 303  CYS B CB    1 
ATOM   7216  S  SG    . CYS B 1 303 ? 74.680  114.299 72.799  1.00 15.64 ? 303  CYS B SG    1 
ATOM   7217  N  N     . THR B 1 304 ? 76.017  111.235 74.099  1.00 13.74 ? 304  THR B N     1 
ATOM   7218  C  CA    . THR B 1 304 ? 75.342  110.359 75.057  1.00 15.19 ? 304  THR B CA    1 
ATOM   7219  C  C     . THR B 1 304 ? 74.154  110.988 75.786  1.00 15.56 ? 304  THR B C     1 
ATOM   7220  O  O     . THR B 1 304 ? 73.432  110.298 76.504  1.00 16.14 ? 304  THR B O     1 
ATOM   7221  C  CB    . THR B 1 304 ? 76.324  109.844 76.138  1.00 15.00 ? 304  THR B CB    1 
ATOM   7222  O  OG1   . THR B 1 304 ? 76.759  110.941 76.953  1.00 15.06 ? 304  THR B OG1   1 
ATOM   7223  C  CG2   . THR B 1 304 ? 77.540  109.184 75.495  1.00 15.29 ? 304  THR B CG2   1 
ATOM   7224  N  N     . ALA B 1 305 ? 73.950  112.288 75.607  1.00 14.53 ? 305  ALA B N     1 
ATOM   7225  C  CA    . ALA B 1 305 ? 72.857  112.981 76.284  1.00 15.02 ? 305  ALA B CA    1 
ATOM   7226  C  C     . ALA B 1 305 ? 71.483  112.472 75.868  1.00 15.11 ? 305  ALA B C     1 
ATOM   7227  O  O     . ALA B 1 305 ? 71.245  112.169 74.698  1.00 15.39 ? 305  ALA B O     1 
ATOM   7228  C  CB    . ALA B 1 305 ? 72.952  114.482 76.031  1.00 13.82 ? 305  ALA B CB    1 
ATOM   7229  N  N     . ASP B 1 306 ? 70.573  112.393 76.833  1.00 14.75 ? 306  ASP B N     1 
ATOM   7230  C  CA    . ASP B 1 306 ? 69.226  111.922 76.559  1.00 13.52 ? 306  ASP B CA    1 
ATOM   7231  C  C     . ASP B 1 306 ? 68.499  112.902 75.648  1.00 13.96 ? 306  ASP B C     1 
ATOM   7232  O  O     . ASP B 1 306 ? 68.723  114.116 75.706  1.00 12.79 ? 306  ASP B O     1 
ATOM   7233  C  CB    . ASP B 1 306 ? 68.449  111.745 77.871  1.00 13.52 ? 306  ASP B CB    1 
ATOM   7234  C  CG    . ASP B 1 306 ? 67.177  110.929 77.695  1.00 14.74 ? 306  ASP B CG    1 
ATOM   7235  O  OD1   . ASP B 1 306 ? 66.104  111.519 77.455  1.00 14.16 ? 306  ASP B OD1   1 
ATOM   7236  O  OD2   . ASP B 1 306 ? 67.253  109.687 77.793  1.00 13.64 ? 306  ASP B OD2   1 
ATOM   7237  N  N     . VAL B 1 307 ? 67.628  112.357 74.806  1.00 14.08 ? 307  VAL B N     1 
ATOM   7238  C  CA    . VAL B 1 307 ? 66.846  113.147 73.874  1.00 15.62 ? 307  VAL B CA    1 
ATOM   7239  C  C     . VAL B 1 307 ? 65.940  114.124 74.629  1.00 14.54 ? 307  VAL B C     1 
ATOM   7240  O  O     . VAL B 1 307 ? 65.526  115.147 74.082  1.00 15.36 ? 307  VAL B O     1 
ATOM   7241  C  CB    . VAL B 1 307 ? 66.000  112.210 72.956  1.00 17.22 ? 307  VAL B CB    1 
ATOM   7242  C  CG1   . VAL B 1 307 ? 64.967  111.444 73.783  1.00 16.64 ? 307  VAL B CG1   1 
ATOM   7243  C  CG2   . VAL B 1 307 ? 65.334  113.011 71.860  1.00 18.96 ? 307  VAL B CG2   1 
ATOM   7244  N  N     . GLY B 1 308 ? 65.662  113.824 75.897  1.00 13.88 ? 308  GLY B N     1 
ATOM   7245  C  CA    . GLY B 1 308 ? 64.804  114.686 76.697  1.00 13.57 ? 308  GLY B CA    1 
ATOM   7246  C  C     . GLY B 1 308 ? 65.450  115.976 77.179  1.00 13.55 ? 308  GLY B C     1 
ATOM   7247  O  O     . GLY B 1 308 ? 64.785  116.836 77.757  1.00 14.26 ? 308  GLY B O     1 
ATOM   7248  N  N     . TRP B 1 309 ? 66.748  116.116 76.947  1.00 12.74 ? 309  TRP B N     1 
ATOM   7249  C  CA    . TRP B 1 309 ? 67.470  117.312 77.368  1.00 13.21 ? 309  TRP B CA    1 
ATOM   7250  C  C     . TRP B 1 309 ? 67.844  118.150 76.147  1.00 12.96 ? 309  TRP B C     1 
ATOM   7251  O  O     . TRP B 1 309 ? 67.839  117.656 75.020  1.00 13.74 ? 309  TRP B O     1 
ATOM   7252  C  CB    . TRP B 1 309 ? 68.735  116.920 78.130  1.00 12.52 ? 309  TRP B CB    1 
ATOM   7253  C  CG    . TRP B 1 309 ? 68.490  116.027 79.314  1.00 15.37 ? 309  TRP B CG    1 
ATOM   7254  C  CD1   . TRP B 1 309 ? 69.081  114.826 79.566  1.00 17.04 ? 309  TRP B CD1   1 
ATOM   7255  C  CD2   . TRP B 1 309 ? 67.614  116.283 80.419  1.00 16.32 ? 309  TRP B CD2   1 
ATOM   7256  N  NE1   . TRP B 1 309 ? 68.634  114.317 80.760  1.00 18.16 ? 309  TRP B NE1   1 
ATOM   7257  C  CE2   . TRP B 1 309 ? 67.732  115.192 81.306  1.00 16.53 ? 309  TRP B CE2   1 
ATOM   7258  C  CE3   . TRP B 1 309 ? 66.741  117.332 80.746  1.00 17.56 ? 309  TRP B CE3   1 
ATOM   7259  C  CZ2   . TRP B 1 309 ? 67.010  115.116 82.503  1.00 17.78 ? 309  TRP B CZ2   1 
ATOM   7260  C  CZ3   . TRP B 1 309 ? 66.021  117.259 81.939  1.00 18.01 ? 309  TRP B CZ3   1 
ATOM   7261  C  CH2   . TRP B 1 309 ? 66.162  116.155 82.802  1.00 17.42 ? 309  TRP B CH2   1 
ATOM   7262  N  N     . VAL B 1 310 ? 68.181  119.414 76.371  1.00 12.17 ? 310  VAL B N     1 
ATOM   7263  C  CA    . VAL B 1 310 ? 68.540  120.281 75.259  1.00 11.86 ? 310  VAL B CA    1 
ATOM   7264  C  C     . VAL B 1 310 ? 69.762  119.739 74.523  1.00 12.20 ? 310  VAL B C     1 
ATOM   7265  O  O     . VAL B 1 310 ? 69.870  119.886 73.307  1.00 11.73 ? 310  VAL B O     1 
ATOM   7266  C  CB    . VAL B 1 310 ? 68.810  121.743 75.725  1.00 10.99 ? 310  VAL B CB    1 
ATOM   7267  C  CG1   . VAL B 1 310 ? 70.079  121.819 76.571  1.00 12.79 ? 310  VAL B CG1   1 
ATOM   7268  C  CG2   . VAL B 1 310 ? 68.910  122.659 74.504  1.00 10.91 ? 310  VAL B CG2   1 
ATOM   7269  N  N     . THR B 1 311 ? 70.678  119.097 75.245  1.00 12.03 ? 311  THR B N     1 
ATOM   7270  C  CA    . THR B 1 311 ? 71.856  118.548 74.582  1.00 13.74 ? 311  THR B CA    1 
ATOM   7271  C  C     . THR B 1 311 ? 71.409  117.493 73.576  1.00 14.17 ? 311  THR B C     1 
ATOM   7272  O  O     . THR B 1 311 ? 71.995  117.360 72.504  1.00 12.79 ? 311  THR B O     1 
ATOM   7273  C  CB    . THR B 1 311 ? 72.847  117.921 75.590  1.00 15.15 ? 311  THR B CB    1 
ATOM   7274  O  OG1   . THR B 1 311 ? 73.270  118.922 76.520  1.00 17.66 ? 311  THR B OG1   1 
ATOM   7275  C  CG2   . THR B 1 311 ? 74.081  117.382 74.869  1.00 17.17 ? 311  THR B CG2   1 
ATOM   7276  N  N     . GLY B 1 312 ? 70.364  116.748 73.927  1.00 13.77 ? 312  GLY B N     1 
ATOM   7277  C  CA    . GLY B 1 312 ? 69.843  115.733 73.028  1.00 14.11 ? 312  GLY B CA    1 
ATOM   7278  C  C     . GLY B 1 312 ? 69.188  116.364 71.807  1.00 14.29 ? 312  GLY B C     1 
ATOM   7279  O  O     . GLY B 1 312 ? 69.349  115.882 70.690  1.00 16.09 ? 312  GLY B O     1 
ATOM   7280  N  N     . HIS B 1 313 ? 68.449  117.449 72.016  1.00 13.41 ? 313  HIS B N     1 
ATOM   7281  C  CA    . HIS B 1 313 ? 67.785  118.135 70.912  1.00 12.75 ? 313  HIS B CA    1 
ATOM   7282  C  C     . HIS B 1 313 ? 68.809  118.683 69.922  1.00 12.61 ? 313  HIS B C     1 
ATOM   7283  O  O     . HIS B 1 313 ? 68.802  118.347 68.738  1.00 13.28 ? 313  HIS B O     1 
ATOM   7284  C  CB    . HIS B 1 313 ? 66.947  119.318 71.425  1.00 13.02 ? 313  HIS B CB    1 
ATOM   7285  C  CG    . HIS B 1 313 ? 65.651  118.928 72.066  1.00 13.34 ? 313  HIS B CG    1 
ATOM   7286  N  ND1   . HIS B 1 313 ? 65.542  117.876 72.950  1.00 13.43 ? 313  HIS B ND1   1 
ATOM   7287  C  CD2   . HIS B 1 313 ? 64.417  119.482 71.984  1.00 13.41 ? 313  HIS B CD2   1 
ATOM   7288  C  CE1   . HIS B 1 313 ? 64.296  117.799 73.386  1.00 13.65 ? 313  HIS B CE1   1 
ATOM   7289  N  NE2   . HIS B 1 313 ? 63.594  118.762 72.817  1.00 12.51 ? 313  HIS B NE2   1 
ATOM   7290  N  N     . SER B 1 314 ? 69.705  119.520 70.428  1.00 12.93 ? 314  SER B N     1 
ATOM   7291  C  CA    . SER B 1 314 ? 70.693  120.170 69.585  1.00 13.30 ? 314  SER B CA    1 
ATOM   7292  C  C     . SER B 1 314 ? 71.856  119.333 69.074  1.00 14.55 ? 314  SER B C     1 
ATOM   7293  O  O     . SER B 1 314 ? 72.276  119.509 67.933  1.00 15.16 ? 314  SER B O     1 
ATOM   7294  C  CB    . SER B 1 314 ? 71.255  121.401 70.305  1.00 11.69 ? 314  SER B CB    1 
ATOM   7295  O  OG    . SER B 1 314 ? 70.218  122.291 70.686  1.00 14.06 ? 314  SER B OG    1 
ATOM   7296  N  N     . TYR B 1 315 ? 72.372  118.420 69.892  1.00 14.42 ? 315  TYR B N     1 
ATOM   7297  C  CA    . TYR B 1 315 ? 73.532  117.658 69.454  1.00 15.06 ? 315  TYR B CA    1 
ATOM   7298  C  C     . TYR B 1 315 ? 73.420  116.154 69.311  1.00 15.16 ? 315  TYR B C     1 
ATOM   7299  O  O     . TYR B 1 315 ? 74.408  115.480 69.043  1.00 19.21 ? 315  TYR B O     1 
ATOM   7300  C  CB    . TYR B 1 315 ? 74.732  118.037 70.323  1.00 14.74 ? 315  TYR B CB    1 
ATOM   7301  C  CG    . TYR B 1 315 ? 74.994  119.521 70.241  1.00 14.01 ? 315  TYR B CG    1 
ATOM   7302  C  CD1   . TYR B 1 315 ? 74.557  120.381 71.244  1.00 13.20 ? 315  TYR B CD1   1 
ATOM   7303  C  CD2   . TYR B 1 315 ? 75.571  120.079 69.099  1.00 14.28 ? 315  TYR B CD2   1 
ATOM   7304  C  CE1   . TYR B 1 315 ? 74.680  121.768 71.108  1.00 13.84 ? 315  TYR B CE1   1 
ATOM   7305  C  CE2   . TYR B 1 315 ? 75.699  121.466 68.954  1.00 13.71 ? 315  TYR B CE2   1 
ATOM   7306  C  CZ    . TYR B 1 315 ? 75.248  122.299 69.964  1.00 12.16 ? 315  TYR B CZ    1 
ATOM   7307  O  OH    . TYR B 1 315 ? 75.360  123.663 69.841  1.00 12.00 ? 315  TYR B OH    1 
ATOM   7308  N  N     . LEU B 1 316 ? 72.227  115.618 69.505  1.00 16.38 ? 316  LEU B N     1 
ATOM   7309  C  CA    . LEU B 1 316 ? 72.045  114.198 69.282  1.00 15.37 ? 316  LEU B CA    1 
ATOM   7310  C  C     . LEU B 1 316 ? 71.312  114.175 67.945  1.00 14.36 ? 316  LEU B C     1 
ATOM   7311  O  O     . LEU B 1 316 ? 71.654  113.417 67.042  1.00 14.43 ? 316  LEU B O     1 
ATOM   7312  C  CB    . LEU B 1 316 ? 71.177  113.561 70.373  1.00 16.14 ? 316  LEU B CB    1 
ATOM   7313  C  CG    . LEU B 1 316 ? 71.146  112.028 70.441  1.00 23.73 ? 316  LEU B CG    1 
ATOM   7314  C  CD1   . LEU B 1 316 ? 70.116  111.606 71.480  1.00 23.57 ? 316  LEU B CD1   1 
ATOM   7315  C  CD2   . LEU B 1 316 ? 70.798  111.427 69.086  1.00 23.61 ? 316  LEU B CD2   1 
ATOM   7316  N  N     . LEU B 1 317 ? 70.335  115.065 67.798  1.00 12.68 ? 317  LEU B N     1 
ATOM   7317  C  CA    . LEU B 1 317 ? 69.543  115.087 66.575  1.00 14.00 ? 317  LEU B CA    1 
ATOM   7318  C  C     . LEU B 1 317 ? 69.665  116.237 65.576  1.00 13.08 ? 317  LEU B C     1 
ATOM   7319  O  O     . LEU B 1 317 ? 70.207  116.066 64.488  1.00 13.94 ? 317  LEU B O     1 
ATOM   7320  C  CB    . LEU B 1 317 ? 68.057  114.936 66.929  1.00 16.23 ? 317  LEU B CB    1 
ATOM   7321  C  CG    . LEU B 1 317 ? 67.621  113.650 67.633  1.00 20.44 ? 317  LEU B CG    1 
ATOM   7322  C  CD1   . LEU B 1 317 ? 66.101  113.675 67.827  1.00 20.50 ? 317  LEU B CD1   1 
ATOM   7323  C  CD2   . LEU B 1 317 ? 68.032  112.437 66.803  1.00 19.45 ? 317  LEU B CD2   1 
ATOM   7324  N  N     . TYR B 1 318 ? 69.155  117.405 65.943  1.00 14.48 ? 318  TYR B N     1 
ATOM   7325  C  CA    . TYR B 1 318 ? 69.115  118.531 65.017  1.00 13.18 ? 318  TYR B CA    1 
ATOM   7326  C  C     . TYR B 1 318 ? 70.405  119.029 64.386  1.00 13.85 ? 318  TYR B C     1 
ATOM   7327  O  O     . TYR B 1 318 ? 70.467  119.178 63.163  1.00 13.09 ? 318  TYR B O     1 
ATOM   7328  C  CB    . TYR B 1 318 ? 68.324  119.676 65.654  1.00 13.00 ? 318  TYR B CB    1 
ATOM   7329  C  CG    . TYR B 1 318 ? 66.887  119.270 65.944  1.00 13.23 ? 318  TYR B CG    1 
ATOM   7330  C  CD1   . TYR B 1 318 ? 66.226  118.359 65.114  1.00 14.64 ? 318  TYR B CD1   1 
ATOM   7331  C  CD2   . TYR B 1 318 ? 66.186  119.797 67.028  1.00 12.96 ? 318  TYR B CD2   1 
ATOM   7332  C  CE1   . TYR B 1 318 ? 64.904  117.980 65.355  1.00 14.32 ? 318  TYR B CE1   1 
ATOM   7333  C  CE2   . TYR B 1 318 ? 64.854  119.427 67.278  1.00 14.23 ? 318  TYR B CE2   1 
ATOM   7334  C  CZ    . TYR B 1 318 ? 64.224  118.517 66.432  1.00 15.23 ? 318  TYR B CZ    1 
ATOM   7335  O  OH    . TYR B 1 318 ? 62.910  118.155 66.646  1.00 15.25 ? 318  TYR B OH    1 
ATOM   7336  N  N     . GLY B 1 319 ? 71.427  119.284 65.194  1.00 13.18 ? 319  GLY B N     1 
ATOM   7337  C  CA    . GLY B 1 319 ? 72.688  119.743 64.638  1.00 13.80 ? 319  GLY B CA    1 
ATOM   7338  C  C     . GLY B 1 319 ? 73.310  118.712 63.705  1.00 14.73 ? 319  GLY B C     1 
ATOM   7339  O  O     . GLY B 1 319 ? 73.634  119.025 62.556  1.00 14.72 ? 319  GLY B O     1 
ATOM   7340  N  N     . PRO B 1 320 ? 73.507  117.468 64.170  1.00 15.06 ? 320  PRO B N     1 
ATOM   7341  C  CA    . PRO B 1 320 ? 74.105  116.452 63.295  1.00 15.25 ? 320  PRO B CA    1 
ATOM   7342  C  C     . PRO B 1 320 ? 73.285  116.077 62.059  1.00 15.58 ? 320  PRO B C     1 
ATOM   7343  O  O     . PRO B 1 320 ? 73.846  115.928 60.978  1.00 15.70 ? 320  PRO B O     1 
ATOM   7344  C  CB    . PRO B 1 320 ? 74.358  115.269 64.239  1.00 17.46 ? 320  PRO B CB    1 
ATOM   7345  C  CG    . PRO B 1 320 ? 73.442  115.513 65.400  1.00 20.08 ? 320  PRO B CG    1 
ATOM   7346  C  CD    . PRO B 1 320 ? 73.461  117.006 65.568  1.00 15.99 ? 320  PRO B CD    1 
ATOM   7347  N  N     . LEU B 1 321 ? 71.967  115.935 62.193  1.00 12.97 ? 321  LEU B N     1 
ATOM   7348  C  CA    . LEU B 1 321 ? 71.160  115.587 61.024  1.00 14.56 ? 321  LEU B CA    1 
ATOM   7349  C  C     . LEU B 1 321 ? 71.131  116.727 60.010  1.00 14.51 ? 321  LEU B C     1 
ATOM   7350  O  O     . LEU B 1 321 ? 71.108  116.490 58.803  1.00 13.45 ? 321  LEU B O     1 
ATOM   7351  C  CB    . LEU B 1 321 ? 69.735  115.204 61.431  1.00 14.13 ? 321  LEU B CB    1 
ATOM   7352  C  CG    . LEU B 1 321 ? 69.615  113.875 62.185  1.00 14.41 ? 321  LEU B CG    1 
ATOM   7353  C  CD1   . LEU B 1 321 ? 68.149  113.592 62.500  1.00 13.40 ? 321  LEU B CD1   1 
ATOM   7354  C  CD2   . LEU B 1 321 ? 70.204  112.741 61.353  1.00 15.39 ? 321  LEU B CD2   1 
ATOM   7355  N  N     . ALA B 1 322 ? 71.132  117.966 60.486  1.00 14.17 ? 322  ALA B N     1 
ATOM   7356  C  CA    . ALA B 1 322 ? 71.139  119.091 59.557  1.00 14.84 ? 322  ALA B CA    1 
ATOM   7357  C  C     . ALA B 1 322 ? 72.426  119.035 58.727  1.00 15.26 ? 322  ALA B C     1 
ATOM   7358  O  O     . ALA B 1 322 ? 72.424  119.378 57.549  1.00 16.19 ? 322  ALA B O     1 
ATOM   7359  C  CB    . ALA B 1 322 ? 71.051  120.425 60.317  1.00 14.15 ? 322  ALA B CB    1 
ATOM   7360  N  N     . CYS B 1 323 ? 73.520  118.586 59.340  1.00 16.50 ? 323  CYS B N     1 
ATOM   7361  C  CA    . CYS B 1 323 ? 74.802  118.500 58.639  1.00 16.25 ? 323  CYS B CA    1 
ATOM   7362  C  C     . CYS B 1 323 ? 74.987  117.203 57.858  1.00 17.12 ? 323  CYS B C     1 
ATOM   7363  O  O     . CYS B 1 323 ? 76.022  117.004 57.221  1.00 16.93 ? 323  CYS B O     1 
ATOM   7364  C  CB    . CYS B 1 323 ? 75.964  118.675 59.623  1.00 15.60 ? 323  CYS B CB    1 
ATOM   7365  S  SG    . CYS B 1 323 ? 76.117  120.347 60.291  1.00 17.57 ? 323  CYS B SG    1 
ATOM   7366  N  N     . GLY B 1 324 ? 73.987  116.325 57.912  1.00 17.07 ? 324  GLY B N     1 
ATOM   7367  C  CA    . GLY B 1 324 ? 74.053  115.067 57.189  1.00 18.14 ? 324  GLY B CA    1 
ATOM   7368  C  C     . GLY B 1 324 ? 74.956  114.017 57.810  1.00 19.18 ? 324  GLY B C     1 
ATOM   7369  O  O     . GLY B 1 324 ? 75.397  113.085 57.134  1.00 18.60 ? 324  GLY B O     1 
ATOM   7370  N  N     . ALA B 1 325 ? 75.211  114.147 59.105  1.00 17.65 ? 325  ALA B N     1 
ATOM   7371  C  CA    . ALA B 1 325 ? 76.084  113.210 59.805  1.00 17.71 ? 325  ALA B CA    1 
ATOM   7372  C  C     . ALA B 1 325 ? 75.388  111.925 60.231  1.00 17.87 ? 325  ALA B C     1 
ATOM   7373  O  O     . ALA B 1 325 ? 74.163  111.812 60.165  1.00 16.28 ? 325  ALA B O     1 
ATOM   7374  C  CB    . ALA B 1 325 ? 76.680  113.890 61.035  1.00 18.91 ? 325  ALA B CB    1 
ATOM   7375  N  N     . THR B 1 326 ? 76.191  110.948 60.644  1.00 16.22 ? 326  THR B N     1 
ATOM   7376  C  CA    . THR B 1 326 ? 75.664  109.694 61.160  1.00 16.19 ? 326  THR B CA    1 
ATOM   7377  C  C     . THR B 1 326 ? 75.731  109.918 62.667  1.00 16.07 ? 326  THR B C     1 
ATOM   7378  O  O     . THR B 1 326 ? 76.811  110.122 63.226  1.00 15.39 ? 326  THR B O     1 
ATOM   7379  C  CB    . THR B 1 326 ? 76.549  108.489 60.779  1.00 16.65 ? 326  THR B CB    1 
ATOM   7380  O  OG1   . THR B 1 326 ? 76.494  108.282 59.360  1.00 15.08 ? 326  THR B OG1   1 
ATOM   7381  C  CG2   . THR B 1 326 ? 76.063  107.230 61.491  1.00 16.99 ? 326  THR B CG2   1 
ATOM   7382  N  N     . THR B 1 327 ? 74.576  109.912 63.318  1.00 15.40 ? 327  THR B N     1 
ATOM   7383  C  CA    . THR B 1 327 ? 74.519  110.145 64.752  1.00 15.10 ? 327  THR B CA    1 
ATOM   7384  C  C     . THR B 1 327 ? 74.036  108.886 65.467  1.00 14.47 ? 327  THR B C     1 
ATOM   7385  O  O     . THR B 1 327 ? 73.135  108.193 64.993  1.00 13.95 ? 327  THR B O     1 
ATOM   7386  C  CB    . THR B 1 327 ? 73.606  111.356 65.063  1.00 14.38 ? 327  THR B CB    1 
ATOM   7387  O  OG1   . THR B 1 327 ? 73.705  111.690 66.451  1.00 14.77 ? 327  THR B OG1   1 
ATOM   7388  C  CG2   . THR B 1 327 ? 72.159  111.049 64.689  1.00 14.27 ? 327  THR B CG2   1 
ATOM   7389  N  N     . LEU B 1 328 ? 74.647  108.599 66.611  1.00 14.75 ? 328  LEU B N     1 
ATOM   7390  C  CA    . LEU B 1 328 ? 74.333  107.399 67.374  1.00 14.55 ? 328  LEU B CA    1 
ATOM   7391  C  C     . LEU B 1 328 ? 73.429  107.648 68.575  1.00 15.05 ? 328  LEU B C     1 
ATOM   7392  O  O     . LEU B 1 328 ? 73.692  108.523 69.400  1.00 14.45 ? 328  LEU B O     1 
ATOM   7393  C  CB    . LEU B 1 328 ? 75.640  106.739 67.833  1.00 15.84 ? 328  LEU B CB    1 
ATOM   7394  C  CG    . LEU B 1 328 ? 75.642  105.273 68.287  1.00 14.87 ? 328  LEU B CG    1 
ATOM   7395  C  CD1   . LEU B 1 328 ? 77.063  104.753 68.199  1.00 14.36 ? 328  LEU B CD1   1 
ATOM   7396  C  CD2   . LEU B 1 328 ? 75.105  105.131 69.707  1.00 14.08 ? 328  LEU B CD2   1 
ATOM   7397  N  N     . MET B 1 329 ? 72.351  106.873 68.653  1.00 15.13 ? 329  MET B N     1 
ATOM   7398  C  CA    . MET B 1 329 ? 71.409  106.974 69.761  1.00 14.98 ? 329  MET B CA    1 
ATOM   7399  C  C     . MET B 1 329 ? 71.512  105.696 70.572  1.00 15.01 ? 329  MET B C     1 
ATOM   7400  O  O     . MET B 1 329 ? 71.117  104.629 70.108  1.00 14.83 ? 329  MET B O     1 
ATOM   7401  C  CB    . MET B 1 329 ? 69.972  107.122 69.261  1.00 16.07 ? 329  MET B CB    1 
ATOM   7402  C  CG    . MET B 1 329 ? 68.962  107.237 70.399  1.00 17.20 ? 329  MET B CG    1 
ATOM   7403  S  SD    . MET B 1 329 ? 67.247  107.182 69.856  1.00 19.18 ? 329  MET B SD    1 
ATOM   7404  C  CE    . MET B 1 329 ? 66.887  108.920 69.667  1.00 20.58 ? 329  MET B CE    1 
ATOM   7405  N  N     . PHE B 1 330 ? 72.055  105.820 71.777  1.00 13.65 ? 330  PHE B N     1 
ATOM   7406  C  CA    . PHE B 1 330 ? 72.230  104.695 72.683  1.00 13.65 ? 330  PHE B CA    1 
ATOM   7407  C  C     . PHE B 1 330 ? 71.039  104.654 73.637  1.00 14.13 ? 330  PHE B C     1 
ATOM   7408  O  O     . PHE B 1 330 ? 70.688  105.658 74.261  1.00 13.85 ? 330  PHE B O     1 
ATOM   7409  C  CB    . PHE B 1 330 ? 73.548  104.863 73.451  1.00 14.03 ? 330  PHE B CB    1 
ATOM   7410  C  CG    . PHE B 1 330 ? 73.814  103.782 74.463  1.00 16.04 ? 330  PHE B CG    1 
ATOM   7411  C  CD1   . PHE B 1 330 ? 73.643  102.440 74.134  1.00 15.58 ? 330  PHE B CD1   1 
ATOM   7412  C  CD2   . PHE B 1 330 ? 74.270  104.108 75.737  1.00 15.17 ? 330  PHE B CD2   1 
ATOM   7413  C  CE1   . PHE B 1 330 ? 73.923  101.433 75.060  1.00 17.38 ? 330  PHE B CE1   1 
ATOM   7414  C  CE2   . PHE B 1 330 ? 74.553  103.109 76.670  1.00 17.94 ? 330  PHE B CE2   1 
ATOM   7415  C  CZ    . PHE B 1 330 ? 74.379  101.768 76.329  1.00 16.98 ? 330  PHE B CZ    1 
ATOM   7416  N  N     . GLU B 1 331 ? 70.413  103.488 73.736  1.00 15.45 ? 331  GLU B N     1 
ATOM   7417  C  CA    . GLU B 1 331 ? 69.242  103.319 74.585  1.00 13.93 ? 331  GLU B CA    1 
ATOM   7418  C  C     . GLU B 1 331 ? 69.538  103.227 76.082  1.00 15.69 ? 331  GLU B C     1 
ATOM   7419  O  O     . GLU B 1 331 ? 68.700  103.613 76.899  1.00 16.44 ? 331  GLU B O     1 
ATOM   7420  C  CB    . GLU B 1 331 ? 68.470  102.067 74.143  1.00 14.62 ? 331  GLU B CB    1 
ATOM   7421  C  CG    . GLU B 1 331 ? 67.243  101.737 74.996  1.00 14.50 ? 331  GLU B CG    1 
ATOM   7422  C  CD    . GLU B 1 331 ? 66.474  100.523 74.488  1.00 15.62 ? 331  GLU B CD    1 
ATOM   7423  O  OE1   . GLU B 1 331 ? 67.106  99.472  74.268  1.00 16.07 ? 331  GLU B OE1   1 
ATOM   7424  O  OE2   . GLU B 1 331 ? 65.237  100.620 74.319  1.00 14.66 ? 331  GLU B OE2   1 
ATOM   7425  N  N     . GLY B 1 332 ? 70.732  102.754 76.441  1.00 12.51 ? 332  GLY B N     1 
ATOM   7426  C  CA    . GLY B 1 332 ? 71.045  102.559 77.852  1.00 15.00 ? 332  GLY B CA    1 
ATOM   7427  C  C     . GLY B 1 332 ? 71.993  103.483 78.585  1.00 16.27 ? 332  GLY B C     1 
ATOM   7428  O  O     . GLY B 1 332 ? 71.951  104.700 78.411  1.00 17.04 ? 332  GLY B O     1 
ATOM   7429  N  N     . VAL B 1 333 ? 72.836  102.894 79.433  1.00 16.25 ? 333  VAL B N     1 
ATOM   7430  C  CA    . VAL B 1 333 ? 73.802  103.657 80.222  1.00 17.30 ? 333  VAL B CA    1 
ATOM   7431  C  C     . VAL B 1 333 ? 75.230  103.198 79.909  1.00 17.11 ? 333  VAL B C     1 
ATOM   7432  O  O     . VAL B 1 333 ? 75.461  102.030 79.592  1.00 17.00 ? 333  VAL B O     1 
ATOM   7433  C  CB    . VAL B 1 333 ? 73.524  103.506 81.740  1.00 17.06 ? 333  VAL B CB    1 
ATOM   7434  C  CG1   . VAL B 1 333 ? 72.089  103.938 82.049  1.00 18.83 ? 333  VAL B CG1   1 
ATOM   7435  C  CG2   . VAL B 1 333 ? 73.762  102.071 82.179  1.00 18.25 ? 333  VAL B CG2   1 
ATOM   7436  N  N     . PRO B 1 334 ? 76.208  104.111 80.016  1.00 17.91 ? 334  PRO B N     1 
ATOM   7437  C  CA    . PRO B 1 334 ? 77.619  103.820 79.732  1.00 18.58 ? 334  PRO B CA    1 
ATOM   7438  C  C     . PRO B 1 334 ? 78.308  102.723 80.534  1.00 18.56 ? 334  PRO B C     1 
ATOM   7439  O  O     . PRO B 1 334 ? 79.367  102.247 80.126  1.00 19.17 ? 334  PRO B O     1 
ATOM   7440  C  CB    . PRO B 1 334 ? 78.296  105.178 79.923  1.00 18.95 ? 334  PRO B CB    1 
ATOM   7441  C  CG    . PRO B 1 334 ? 77.462  105.810 80.995  1.00 20.56 ? 334  PRO B CG    1 
ATOM   7442  C  CD    . PRO B 1 334 ? 76.056  105.485 80.529  1.00 18.87 ? 334  PRO B CD    1 
ATOM   7443  N  N     . ASN B 1 335 ? 77.722  102.320 81.660  1.00 19.05 ? 335  ASN B N     1 
ATOM   7444  C  CA    . ASN B 1 335 ? 78.337  101.284 82.488  1.00 19.91 ? 335  ASN B CA    1 
ATOM   7445  C  C     . ASN B 1 335 ? 77.501  100.024 82.733  1.00 19.55 ? 335  ASN B C     1 
ATOM   7446  O  O     . ASN B 1 335 ? 77.684  99.333  83.740  1.00 17.53 ? 335  ASN B O     1 
ATOM   7447  C  CB    . ASN B 1 335 ? 78.786  101.877 83.832  1.00 19.68 ? 335  ASN B CB    1 
ATOM   7448  C  CG    . ASN B 1 335 ? 77.660  102.560 84.582  1.00 22.10 ? 335  ASN B CG    1 
ATOM   7449  O  OD1   . ASN B 1 335 ? 77.855  103.066 85.686  1.00 25.08 ? 335  ASN B OD1   1 
ATOM   7450  N  ND2   . ASN B 1 335 ? 76.479  102.584 83.986  1.00 21.98 ? 335  ASN B ND2   1 
ATOM   7451  N  N     . TRP B 1 336 ? 76.581  99.725  81.821  1.00 19.01 ? 336  TRP B N     1 
ATOM   7452  C  CA    . TRP B 1 336 ? 75.781  98.510  81.942  1.00 20.15 ? 336  TRP B CA    1 
ATOM   7453  C  C     . TRP B 1 336 ? 75.818  97.782  80.606  1.00 20.46 ? 336  TRP B C     1 
ATOM   7454  O  O     . TRP B 1 336 ? 75.621  98.388  79.557  1.00 20.13 ? 336  TRP B O     1 
ATOM   7455  C  CB    . TRP B 1 336 ? 74.325  98.813  82.305  1.00 19.25 ? 336  TRP B CB    1 
ATOM   7456  C  CG    . TRP B 1 336 ? 73.574  97.565  82.672  1.00 21.44 ? 336  TRP B CG    1 
ATOM   7457  C  CD1   . TRP B 1 336 ? 73.511  96.984  83.906  1.00 22.11 ? 336  TRP B CD1   1 
ATOM   7458  C  CD2   . TRP B 1 336 ? 72.858  96.695  81.784  1.00 22.95 ? 336  TRP B CD2   1 
ATOM   7459  N  NE1   . TRP B 1 336 ? 72.805  95.805  83.844  1.00 22.91 ? 336  TRP B NE1   1 
ATOM   7460  C  CE2   . TRP B 1 336 ? 72.393  95.603  82.553  1.00 24.31 ? 336  TRP B CE2   1 
ATOM   7461  C  CE3   . TRP B 1 336 ? 72.567  96.730  80.415  1.00 24.24 ? 336  TRP B CE3   1 
ATOM   7462  C  CZ2   . TRP B 1 336 ? 71.651  94.552  81.996  1.00 23.72 ? 336  TRP B CZ2   1 
ATOM   7463  C  CZ3   . TRP B 1 336 ? 71.831  95.686  79.861  1.00 25.33 ? 336  TRP B CZ3   1 
ATOM   7464  C  CH2   . TRP B 1 336 ? 71.382  94.612  80.655  1.00 26.02 ? 336  TRP B CH2   1 
ATOM   7465  N  N     . PRO B 1 337 ? 76.016  96.457  80.630  1.00 22.56 ? 337  PRO B N     1 
ATOM   7466  C  CA    . PRO B 1 337 ? 76.197  95.632  81.830  1.00 22.61 ? 337  PRO B CA    1 
ATOM   7467  C  C     . PRO B 1 337 ? 77.508  95.791  82.607  1.00 21.58 ? 337  PRO B C     1 
ATOM   7468  O  O     . PRO B 1 337 ? 77.576  95.412  83.775  1.00 20.85 ? 337  PRO B O     1 
ATOM   7469  C  CB    . PRO B 1 337 ? 75.988  94.215  81.303  1.00 23.13 ? 337  PRO B CB    1 
ATOM   7470  C  CG    . PRO B 1 337 ? 76.491  94.298  79.910  1.00 26.06 ? 337  PRO B CG    1 
ATOM   7471  C  CD    . PRO B 1 337 ? 75.956  95.621  79.418  1.00 23.58 ? 337  PRO B CD    1 
ATOM   7472  N  N     . THR B 1 338 ? 78.542  96.339  81.972  1.00 20.60 ? 338  THR B N     1 
ATOM   7473  C  CA    . THR B 1 338 ? 79.822  96.536  82.653  1.00 20.46 ? 338  THR B CA    1 
ATOM   7474  C  C     . THR B 1 338 ? 80.371  97.935  82.380  1.00 21.43 ? 338  THR B C     1 
ATOM   7475  O  O     . THR B 1 338 ? 79.901  98.632  81.476  1.00 20.73 ? 338  THR B O     1 
ATOM   7476  C  CB    . THR B 1 338 ? 80.891  95.499  82.209  1.00 19.92 ? 338  THR B CB    1 
ATOM   7477  O  OG1   . THR B 1 338 ? 81.363  95.815  80.893  1.00 19.02 ? 338  THR B OG1   1 
ATOM   7478  C  CG2   . THR B 1 338 ? 80.305  94.095  82.211  1.00 19.71 ? 338  THR B CG2   1 
ATOM   7479  N  N     . PRO B 1 339 ? 81.371  98.368  83.168  1.00 21.13 ? 339  PRO B N     1 
ATOM   7480  C  CA    . PRO B 1 339 ? 81.986  99.689  83.007  1.00 20.47 ? 339  PRO B CA    1 
ATOM   7481  C  C     . PRO B 1 339 ? 82.596  99.919  81.623  1.00 19.38 ? 339  PRO B C     1 
ATOM   7482  O  O     . PRO B 1 339 ? 82.819  101.056 81.216  1.00 18.63 ? 339  PRO B O     1 
ATOM   7483  C  CB    . PRO B 1 339 ? 83.041  99.711  84.112  1.00 21.92 ? 339  PRO B CB    1 
ATOM   7484  C  CG    . PRO B 1 339 ? 82.406  98.893  85.188  1.00 22.21 ? 339  PRO B CG    1 
ATOM   7485  C  CD    . PRO B 1 339 ? 81.860  97.716  84.398  1.00 21.10 ? 339  PRO B CD    1 
ATOM   7486  N  N     . ALA B 1 340 ? 82.865  98.836  80.903  1.00 17.25 ? 340  ALA B N     1 
ATOM   7487  C  CA    . ALA B 1 340 ? 83.452  98.947  79.575  1.00 17.21 ? 340  ALA B CA    1 
ATOM   7488  C  C     . ALA B 1 340 ? 82.423  99.170  78.465  1.00 15.96 ? 340  ALA B C     1 
ATOM   7489  O  O     . ALA B 1 340 ? 82.792  99.342  77.307  1.00 17.68 ? 340  ALA B O     1 
ATOM   7490  C  CB    . ALA B 1 340 ? 84.279  97.700  79.271  1.00 17.01 ? 340  ALA B CB    1 
ATOM   7491  N  N     . ARG B 1 341 ? 81.139  99.182  78.809  1.00 16.51 ? 341  ARG B N     1 
ATOM   7492  C  CA    . ARG B 1 341 ? 80.100  99.359  77.795  1.00 16.76 ? 341  ARG B CA    1 
ATOM   7493  C  C     . ARG B 1 341 ? 80.315  100.548 76.861  1.00 15.78 ? 341  ARG B C     1 
ATOM   7494  O  O     . ARG B 1 341 ? 80.294  100.385 75.642  1.00 16.19 ? 341  ARG B O     1 
ATOM   7495  C  CB    . ARG B 1 341 ? 78.711  99.475  78.437  1.00 17.41 ? 341  ARG B CB    1 
ATOM   7496  C  CG    . ARG B 1 341 ? 77.568  99.464  77.406  1.00 18.04 ? 341  ARG B CG    1 
ATOM   7497  C  CD    . ARG B 1 341 ? 77.577  98.154  76.607  1.00 16.54 ? 341  ARG B CD    1 
ATOM   7498  N  NE    . ARG B 1 341 ? 76.670  98.131  75.455  1.00 16.25 ? 341  ARG B NE    1 
ATOM   7499  C  CZ    . ARG B 1 341 ? 75.343  98.051  75.525  1.00 17.06 ? 341  ARG B CZ    1 
ATOM   7500  N  NH1   . ARG B 1 341 ? 74.726  97.996  76.701  1.00 15.36 ? 341  ARG B NH1   1 
ATOM   7501  N  NH2   . ARG B 1 341 ? 74.628  97.990  74.408  1.00 16.66 ? 341  ARG B NH2   1 
ATOM   7502  N  N     . MET B 1 342 ? 80.520  101.740 77.415  1.00 16.21 ? 342  MET B N     1 
ATOM   7503  C  CA    . MET B 1 342 ? 80.717  102.913 76.567  1.00 16.22 ? 342  MET B CA    1 
ATOM   7504  C  C     . MET B 1 342 ? 81.782  102.669 75.505  1.00 17.12 ? 342  MET B C     1 
ATOM   7505  O  O     . MET B 1 342 ? 81.549  102.900 74.319  1.00 16.52 ? 342  MET B O     1 
ATOM   7506  C  CB    . MET B 1 342 ? 81.098  104.144 77.395  1.00 18.12 ? 342  MET B CB    1 
ATOM   7507  C  CG    . MET B 1 342 ? 81.179  105.415 76.555  1.00 17.01 ? 342  MET B CG    1 
ATOM   7508  S  SD    . MET B 1 342 ? 81.586  106.897 77.502  1.00 17.34 ? 342  MET B SD    1 
ATOM   7509  C  CE    . MET B 1 342 ? 83.360  106.673 77.728  1.00 19.29 ? 342  MET B CE    1 
ATOM   7510  N  N     . CYS B 1 343 ? 82.946  102.186 75.924  1.00 17.24 ? 343  CYS B N     1 
ATOM   7511  C  CA    . CYS B 1 343 ? 84.020  101.929 74.976  1.00 17.74 ? 343  CYS B CA    1 
ATOM   7512  C  C     . CYS B 1 343 ? 83.724  100.753 74.047  1.00 16.72 ? 343  CYS B C     1 
ATOM   7513  O  O     . CYS B 1 343 ? 84.244  100.695 72.936  1.00 17.94 ? 343  CYS B O     1 
ATOM   7514  C  CB    . CYS B 1 343 ? 85.345  101.735 75.720  1.00 18.76 ? 343  CYS B CB    1 
ATOM   7515  S  SG    . CYS B 1 343 ? 85.980  103.293 76.406  1.00 18.54 ? 343  CYS B SG    1 
ATOM   7516  N  N     . GLN B 1 344 ? 82.883  99.820  74.489  1.00 17.75 ? 344  GLN B N     1 
ATOM   7517  C  CA    . GLN B 1 344 ? 82.514  98.692  73.640  1.00 16.62 ? 344  GLN B CA    1 
ATOM   7518  C  C     . GLN B 1 344 ? 81.622  99.220  72.511  1.00 17.38 ? 344  GLN B C     1 
ATOM   7519  O  O     . GLN B 1 344 ? 81.702  98.756  71.376  1.00 17.29 ? 344  GLN B O     1 
ATOM   7520  C  CB    . GLN B 1 344 ? 81.778  97.624  74.457  1.00 18.00 ? 344  GLN B CB    1 
ATOM   7521  C  CG    . GLN B 1 344 ? 82.711  96.835  75.369  1.00 17.41 ? 344  GLN B CG    1 
ATOM   7522  C  CD    . GLN B 1 344 ? 81.993  95.960  76.375  1.00 20.28 ? 344  GLN B CD    1 
ATOM   7523  O  OE1   . GLN B 1 344 ? 82.616  95.113  77.019  1.00 22.88 ? 344  GLN B OE1   1 
ATOM   7524  N  NE2   . GLN B 1 344 ? 80.689  96.161  76.528  1.00 16.16 ? 344  GLN B NE2   1 
ATOM   7525  N  N     . VAL B 1 345 ? 80.778  100.199 72.828  1.00 16.30 ? 345  VAL B N     1 
ATOM   7526  C  CA    . VAL B 1 345 ? 79.897  100.800 71.828  1.00 15.68 ? 345  VAL B CA    1 
ATOM   7527  C  C     . VAL B 1 345 ? 80.772  101.548 70.816  1.00 16.25 ? 345  VAL B C     1 
ATOM   7528  O  O     . VAL B 1 345 ? 80.552  101.467 69.604  1.00 16.96 ? 345  VAL B O     1 
ATOM   7529  C  CB    . VAL B 1 345 ? 78.893  101.790 72.483  1.00 15.04 ? 345  VAL B CB    1 
ATOM   7530  C  CG1   . VAL B 1 345 ? 78.076  102.501 71.415  1.00 14.22 ? 345  VAL B CG1   1 
ATOM   7531  C  CG2   . VAL B 1 345 ? 77.970  101.037 73.440  1.00 15.67 ? 345  VAL B CG2   1 
ATOM   7532  N  N     . VAL B 1 346 ? 81.767  102.269 71.325  1.00 15.26 ? 346  VAL B N     1 
ATOM   7533  C  CA    . VAL B 1 346 ? 82.691  103.011 70.478  1.00 16.67 ? 346  VAL B CA    1 
ATOM   7534  C  C     . VAL B 1 346 ? 83.374  102.080 69.469  1.00 17.70 ? 346  VAL B C     1 
ATOM   7535  O  O     . VAL B 1 346 ? 83.463  102.407 68.283  1.00 18.30 ? 346  VAL B O     1 
ATOM   7536  C  CB    . VAL B 1 346 ? 83.758  103.735 71.333  1.00 17.36 ? 346  VAL B CB    1 
ATOM   7537  C  CG1   . VAL B 1 346 ? 84.864  104.277 70.449  1.00 16.85 ? 346  VAL B CG1   1 
ATOM   7538  C  CG2   . VAL B 1 346 ? 83.110  104.875 72.105  1.00 15.32 ? 346  VAL B CG2   1 
ATOM   7539  N  N     . ASP B 1 347 ? 83.859  100.927 69.930  1.00 17.26 ? 347  ASP B N     1 
ATOM   7540  C  CA    . ASP B 1 347 ? 84.509  99.976  69.023  1.00 17.67 ? 347  ASP B CA    1 
ATOM   7541  C  C     . ASP B 1 347 ? 83.506  99.348  68.053  1.00 17.36 ? 347  ASP B C     1 
ATOM   7542  O  O     . ASP B 1 347 ? 83.774  99.236  66.856  1.00 19.00 ? 347  ASP B O     1 
ATOM   7543  C  CB    . ASP B 1 347 ? 85.187  98.830  69.790  1.00 18.33 ? 347  ASP B CB    1 
ATOM   7544  C  CG    . ASP B 1 347 ? 86.404  99.272  70.574  1.00 20.91 ? 347  ASP B CG    1 
ATOM   7545  O  OD1   . ASP B 1 347 ? 87.006  100.309 70.228  1.00 20.86 ? 347  ASP B OD1   1 
ATOM   7546  O  OD2   . ASP B 1 347 ? 86.772  98.557  71.533  1.00 22.57 ? 347  ASP B OD2   1 
ATOM   7547  N  N     . LYS B 1 348 ? 82.359  98.928  68.580  1.00 16.96 ? 348  LYS B N     1 
ATOM   7548  C  CA    . LYS B 1 348 ? 81.335  98.280  67.766  1.00 16.13 ? 348  LYS B CA    1 
ATOM   7549  C  C     . LYS B 1 348 ? 80.903  99.107  66.561  1.00 17.33 ? 348  LYS B C     1 
ATOM   7550  O  O     . LYS B 1 348 ? 80.749  98.581  65.455  1.00 17.07 ? 348  LYS B O     1 
ATOM   7551  C  CB    . LYS B 1 348 ? 80.104  97.957  68.620  1.00 16.30 ? 348  LYS B CB    1 
ATOM   7552  C  CG    . LYS B 1 348 ? 79.002  97.222  67.867  1.00 16.96 ? 348  LYS B CG    1 
ATOM   7553  C  CD    . LYS B 1 348 ? 77.779  96.974  68.755  1.00 18.09 ? 348  LYS B CD    1 
ATOM   7554  C  CE    . LYS B 1 348 ? 76.673  96.264  67.990  1.00 17.12 ? 348  LYS B CE    1 
ATOM   7555  N  NZ    . LYS B 1 348 ? 75.435  96.116  68.809  1.00 19.83 ? 348  LYS B NZ    1 
ATOM   7556  N  N     . HIS B 1 349 ? 80.715  100.402 66.771  1.00 15.83 ? 349  HIS B N     1 
ATOM   7557  C  CA    . HIS B 1 349 ? 80.268  101.271 65.696  1.00 16.62 ? 349  HIS B CA    1 
ATOM   7558  C  C     . HIS B 1 349 ? 81.339  102.205 65.153  1.00 16.98 ? 349  HIS B C     1 
ATOM   7559  O  O     . HIS B 1 349 ? 81.046  103.085 64.345  1.00 19.09 ? 349  HIS B O     1 
ATOM   7560  C  CB    . HIS B 1 349 ? 79.050  102.059 66.173  1.00 16.80 ? 349  HIS B CB    1 
ATOM   7561  C  CG    . HIS B 1 349 ? 77.903  101.184 66.571  1.00 18.42 ? 349  HIS B CG    1 
ATOM   7562  N  ND1   . HIS B 1 349 ? 77.265  100.350 65.679  1.00 16.19 ? 349  HIS B ND1   1 
ATOM   7563  C  CD2   . HIS B 1 349 ? 77.313  100.974 67.772  1.00 18.37 ? 349  HIS B CD2   1 
ATOM   7564  C  CE1   . HIS B 1 349 ? 76.332  99.661  66.312  1.00 16.34 ? 349  HIS B CE1   1 
ATOM   7565  N  NE2   . HIS B 1 349 ? 76.341  100.020 67.584  1.00 18.73 ? 349  HIS B NE2   1 
ATOM   7566  N  N     . GLN B 1 350 ? 82.577  101.997 65.594  1.00 16.82 ? 350  GLN B N     1 
ATOM   7567  C  CA    . GLN B 1 350 ? 83.711  102.800 65.149  1.00 17.70 ? 350  GLN B CA    1 
ATOM   7568  C  C     . GLN B 1 350 ? 83.447  104.296 65.288  1.00 18.62 ? 350  GLN B C     1 
ATOM   7569  O  O     . GLN B 1 350 ? 83.651  105.072 64.349  1.00 19.13 ? 350  GLN B O     1 
ATOM   7570  C  CB    . GLN B 1 350 ? 84.054  102.454 63.698  1.00 18.20 ? 350  GLN B CB    1 
ATOM   7571  C  CG    . GLN B 1 350 ? 84.572  101.021 63.498  1.00 20.20 ? 350  GLN B CG    1 
ATOM   7572  C  CD    . GLN B 1 350 ? 85.911  100.770 64.181  1.00 21.85 ? 350  GLN B CD    1 
ATOM   7573  O  OE1   . GLN B 1 350 ? 85.971  100.291 65.315  1.00 25.40 ? 350  GLN B OE1   1 
ATOM   7574  N  NE2   . GLN B 1 350 ? 86.991  101.106 63.494  1.00 20.72 ? 350  GLN B NE2   1 
ATOM   7575  N  N     . VAL B 1 351 ? 82.988  104.690 66.472  1.00 16.99 ? 351  VAL B N     1 
ATOM   7576  C  CA    . VAL B 1 351 ? 82.695  106.086 66.771  1.00 16.35 ? 351  VAL B CA    1 
ATOM   7577  C  C     . VAL B 1 351 ? 83.962  106.937 66.650  1.00 16.65 ? 351  VAL B C     1 
ATOM   7578  O  O     . VAL B 1 351 ? 85.020  106.571 67.170  1.00 17.07 ? 351  VAL B O     1 
ATOM   7579  C  CB    . VAL B 1 351 ? 82.119  106.208 68.198  1.00 14.88 ? 351  VAL B CB    1 
ATOM   7580  C  CG1   . VAL B 1 351 ? 81.903  107.672 68.571  1.00 16.08 ? 351  VAL B CG1   1 
ATOM   7581  C  CG2   . VAL B 1 351 ? 80.805  105.437 68.279  1.00 14.42 ? 351  VAL B CG2   1 
ATOM   7582  N  N     . ASN B 1 352 ? 83.854  108.068 65.959  1.00 16.53 ? 352  ASN B N     1 
ATOM   7583  C  CA    . ASN B 1 352 ? 84.998  108.963 65.776  1.00 17.15 ? 352  ASN B CA    1 
ATOM   7584  C  C     . ASN B 1 352 ? 84.930  110.162 66.713  1.00 17.96 ? 352  ASN B C     1 
ATOM   7585  O  O     . ASN B 1 352 ? 85.954  110.759 67.048  1.00 18.84 ? 352  ASN B O     1 
ATOM   7586  C  CB    . ASN B 1 352 ? 85.052  109.475 64.336  1.00 17.50 ? 352  ASN B CB    1 
ATOM   7587  C  CG    . ASN B 1 352 ? 85.143  108.358 63.324  1.00 17.82 ? 352  ASN B CG    1 
ATOM   7588  O  OD1   . ASN B 1 352 ? 84.341  108.285 62.396  1.00 19.16 ? 352  ASN B OD1   1 
ATOM   7589  N  ND2   . ASN B 1 352 ? 86.126  107.483 63.492  1.00 16.66 ? 352  ASN B ND2   1 
ATOM   7590  N  N     . ILE B 1 353 ? 83.718  110.514 67.123  1.00 16.68 ? 353  ILE B N     1 
ATOM   7591  C  CA    . ILE B 1 353 ? 83.509  111.651 68.010  1.00 17.94 ? 353  ILE B CA    1 
ATOM   7592  C  C     . ILE B 1 353 ? 82.614  111.228 69.164  1.00 17.01 ? 353  ILE B C     1 
ATOM   7593  O  O     . ILE B 1 353 ? 81.496  110.777 68.947  1.00 16.43 ? 353  ILE B O     1 
ATOM   7594  C  CB    . ILE B 1 353 ? 82.821  112.812 67.263  1.00 18.53 ? 353  ILE B CB    1 
ATOM   7595  C  CG1   . ILE B 1 353 ? 83.655  113.212 66.041  1.00 17.75 ? 353  ILE B CG1   1 
ATOM   7596  C  CG2   . ILE B 1 353 ? 82.643  114.007 68.199  1.00 19.63 ? 353  ILE B CG2   1 
ATOM   7597  C  CD1   . ILE B 1 353 ? 82.885  114.040 65.026  1.00 20.72 ? 353  ILE B CD1   1 
ATOM   7598  N  N     . LEU B 1 354 ? 83.117  111.379 70.385  1.00 17.44 ? 354  LEU B N     1 
ATOM   7599  C  CA    . LEU B 1 354 ? 82.368  111.021 71.584  1.00 16.69 ? 354  LEU B CA    1 
ATOM   7600  C  C     . LEU B 1 354 ? 82.129  112.274 72.411  1.00 16.99 ? 354  LEU B C     1 
ATOM   7601  O  O     . LEU B 1 354 ? 83.073  112.972 72.784  1.00 16.07 ? 354  LEU B O     1 
ATOM   7602  C  CB    . LEU B 1 354 ? 83.148  109.997 72.415  1.00 15.02 ? 354  LEU B CB    1 
ATOM   7603  C  CG    . LEU B 1 354 ? 82.509  109.618 73.753  1.00 15.33 ? 354  LEU B CG    1 
ATOM   7604  C  CD1   . LEU B 1 354 ? 81.137  108.999 73.510  1.00 16.02 ? 354  LEU B CD1   1 
ATOM   7605  C  CD2   . LEU B 1 354 ? 83.416  108.647 74.501  1.00 15.09 ? 354  LEU B CD2   1 
ATOM   7606  N  N     . TYR B 1 355 ? 80.863  112.544 72.707  1.00 16.42 ? 355  TYR B N     1 
ATOM   7607  C  CA    . TYR B 1 355 ? 80.473  113.724 73.470  1.00 16.35 ? 355  TYR B CA    1 
ATOM   7608  C  C     . TYR B 1 355 ? 79.648  113.246 74.668  1.00 16.57 ? 355  TYR B C     1 
ATOM   7609  O  O     . TYR B 1 355 ? 78.527  112.759 74.499  1.00 16.11 ? 355  TYR B O     1 
ATOM   7610  C  CB    . TYR B 1 355 ? 79.654  114.630 72.545  1.00 15.41 ? 355  TYR B CB    1 
ATOM   7611  C  CG    . TYR B 1 355 ? 79.165  115.938 73.122  1.00 15.05 ? 355  TYR B CG    1 
ATOM   7612  C  CD1   . TYR B 1 355 ? 80.001  116.759 73.878  1.00 15.45 ? 355  TYR B CD1   1 
ATOM   7613  C  CD2   . TYR B 1 355 ? 77.879  116.394 72.831  1.00 13.68 ? 355  TYR B CD2   1 
ATOM   7614  C  CE1   . TYR B 1 355 ? 79.566  118.012 74.327  1.00 15.60 ? 355  TYR B CE1   1 
ATOM   7615  C  CE2   . TYR B 1 355 ? 77.438  117.635 73.269  1.00 13.62 ? 355  TYR B CE2   1 
ATOM   7616  C  CZ    . TYR B 1 355 ? 78.284  118.439 74.016  1.00 12.73 ? 355  TYR B CZ    1 
ATOM   7617  O  OH    . TYR B 1 355 ? 77.834  119.667 74.444  1.00 14.70 ? 355  TYR B OH    1 
ATOM   7618  N  N     . THR B 1 356 ? 80.199  113.376 75.873  1.00 15.98 ? 356  THR B N     1 
ATOM   7619  C  CA    . THR B 1 356 ? 79.492  112.899 77.062  1.00 16.49 ? 356  THR B CA    1 
ATOM   7620  C  C     . THR B 1 356 ? 79.583  113.839 78.271  1.00 17.37 ? 356  THR B C     1 
ATOM   7621  O  O     . THR B 1 356 ? 80.024  114.982 78.145  1.00 15.91 ? 356  THR B O     1 
ATOM   7622  C  CB    . THR B 1 356 ? 79.983  111.468 77.435  1.00 15.87 ? 356  THR B CB    1 
ATOM   7623  O  OG1   . THR B 1 356 ? 79.130  110.909 78.443  1.00 17.36 ? 356  THR B OG1   1 
ATOM   7624  C  CG2   . THR B 1 356 ? 81.420  111.499 77.937  1.00 18.15 ? 356  THR B CG2   1 
ATOM   7625  N  N     . ALA B 1 357 ? 79.160  113.364 79.441  1.00 16.88 ? 357  ALA B N     1 
ATOM   7626  C  CA    . ALA B 1 357 ? 79.163  114.201 80.641  1.00 17.63 ? 357  ALA B CA    1 
ATOM   7627  C  C     . ALA B 1 357 ? 80.173  113.822 81.722  1.00 16.87 ? 357  ALA B C     1 
ATOM   7628  O  O     . ALA B 1 357 ? 80.503  112.651 81.900  1.00 14.44 ? 357  ALA B O     1 
ATOM   7629  C  CB    . ALA B 1 357 ? 77.766  114.219 81.245  1.00 18.19 ? 357  ALA B CB    1 
ATOM   7630  N  N     . PRO B 1 358 ? 80.668  114.825 82.471  1.00 18.29 ? 358  PRO B N     1 
ATOM   7631  C  CA    . PRO B 1 358 ? 81.638  114.582 83.542  1.00 16.45 ? 358  PRO B CA    1 
ATOM   7632  C  C     . PRO B 1 358 ? 81.158  113.537 84.553  1.00 16.95 ? 358  PRO B C     1 
ATOM   7633  O  O     . PRO B 1 358 ? 81.943  112.717 85.011  1.00 15.28 ? 358  PRO B O     1 
ATOM   7634  C  CB    . PRO B 1 358 ? 81.810  115.966 84.163  1.00 17.58 ? 358  PRO B CB    1 
ATOM   7635  C  CG    . PRO B 1 358 ? 81.711  116.852 82.966  1.00 17.48 ? 358  PRO B CG    1 
ATOM   7636  C  CD    . PRO B 1 358 ? 80.507  116.274 82.242  1.00 16.69 ? 358  PRO B CD    1 
ATOM   7637  N  N     . THR B 1 359 ? 79.872  113.556 84.897  1.00 17.57 ? 359  THR B N     1 
ATOM   7638  C  CA    . THR B 1 359 ? 79.364  112.577 85.854  1.00 17.70 ? 359  THR B CA    1 
ATOM   7639  C  C     . THR B 1 359 ? 79.574  111.154 85.342  1.00 17.97 ? 359  THR B C     1 
ATOM   7640  O  O     . THR B 1 359 ? 79.992  110.277 86.097  1.00 18.26 ? 359  THR B O     1 
ATOM   7641  C  CB    . THR B 1 359 ? 77.860  112.800 86.172  1.00 20.14 ? 359  THR B CB    1 
ATOM   7642  O  OG1   . THR B 1 359 ? 77.715  113.964 86.995  1.00 18.99 ? 359  THR B OG1   1 
ATOM   7643  C  CG2   . THR B 1 359 ? 77.281  111.592 86.921  1.00 20.10 ? 359  THR B CG2   1 
ATOM   7644  N  N     . ALA B 1 360 ? 79.297  110.923 84.061  1.00 16.80 ? 360  ALA B N     1 
ATOM   7645  C  CA    . ALA B 1 360 ? 79.485  109.591 83.485  1.00 17.27 ? 360  ALA B CA    1 
ATOM   7646  C  C     . ALA B 1 360 ? 80.976  109.253 83.489  1.00 17.02 ? 360  ALA B C     1 
ATOM   7647  O  O     . ALA B 1 360 ? 81.374  108.124 83.785  1.00 16.87 ? 360  ALA B O     1 
ATOM   7648  C  CB    . ALA B 1 360 ? 78.939  109.546 82.058  1.00 16.55 ? 360  ALA B CB    1 
ATOM   7649  N  N     . ILE B 1 361 ? 81.795  110.245 83.157  1.00 16.84 ? 361  ILE B N     1 
ATOM   7650  C  CA    . ILE B 1 361 ? 83.240  110.070 83.125  1.00 16.24 ? 361  ILE B CA    1 
ATOM   7651  C  C     . ILE B 1 361 ? 83.751  109.670 84.505  1.00 14.92 ? 361  ILE B C     1 
ATOM   7652  O  O     . ILE B 1 361 ? 84.548  108.743 84.635  1.00 15.69 ? 361  ILE B O     1 
ATOM   7653  C  CB    . ILE B 1 361 ? 83.934  111.370 82.657  1.00 16.87 ? 361  ILE B CB    1 
ATOM   7654  C  CG1   . ILE B 1 361 ? 83.617  111.605 81.176  1.00 15.97 ? 361  ILE B CG1   1 
ATOM   7655  C  CG2   . ILE B 1 361 ? 85.441  111.288 82.891  1.00 16.80 ? 361  ILE B CG2   1 
ATOM   7656  C  CD1   . ILE B 1 361 ? 84.065  112.956 80.645  1.00 18.85 ? 361  ILE B CD1   1 
ATOM   7657  N  N     . ARG B 1 362 ? 83.276  110.360 85.535  1.00 16.07 ? 362  ARG B N     1 
ATOM   7658  C  CA    . ARG B 1 362 ? 83.692  110.060 86.901  1.00 16.43 ? 362  ARG B CA    1 
ATOM   7659  C  C     . ARG B 1 362 ? 83.174  108.696 87.354  1.00 17.09 ? 362  ARG B C     1 
ATOM   7660  O  O     . ARG B 1 362 ? 83.831  108.003 88.127  1.00 16.69 ? 362  ARG B O     1 
ATOM   7661  C  CB    . ARG B 1 362 ? 83.210  111.158 87.852  1.00 15.90 ? 362  ARG B CB    1 
ATOM   7662  C  CG    . ARG B 1 362 ? 83.875  112.510 87.599  1.00 18.48 ? 362  ARG B CG    1 
ATOM   7663  C  CD    . ARG B 1 362 ? 83.486  113.528 88.654  1.00 20.42 ? 362  ARG B CD    1 
ATOM   7664  N  NE    . ARG B 1 362 ? 82.055  113.816 88.649  1.00 21.26 ? 362  ARG B NE    1 
ATOM   7665  C  CZ    . ARG B 1 362 ? 81.518  114.942 88.190  1.00 22.27 ? 362  ARG B CZ    1 
ATOM   7666  N  NH1   . ARG B 1 362 ? 82.291  115.902 87.694  1.00 20.81 ? 362  ARG B NH1   1 
ATOM   7667  N  NH2   . ARG B 1 362 ? 80.204  115.110 88.231  1.00 22.60 ? 362  ARG B NH2   1 
ATOM   7668  N  N     . ALA B 1 363 ? 81.997  108.312 86.866  1.00 17.21 ? 363  ALA B N     1 
ATOM   7669  C  CA    . ALA B 1 363 ? 81.411  107.023 87.221  1.00 18.04 ? 363  ALA B CA    1 
ATOM   7670  C  C     . ALA B 1 363 ? 82.289  105.913 86.659  1.00 19.15 ? 363  ALA B C     1 
ATOM   7671  O  O     . ALA B 1 363 ? 82.495  104.879 87.299  1.00 18.43 ? 363  ALA B O     1 
ATOM   7672  C  CB    . ALA B 1 363 ? 79.998  106.913 86.657  1.00 18.41 ? 363  ALA B CB    1 
ATOM   7673  N  N     . LEU B 1 364 ? 82.807  106.135 85.455  1.00 17.83 ? 364  LEU B N     1 
ATOM   7674  C  CA    . LEU B 1 364 ? 83.677  105.159 84.810  1.00 19.58 ? 364  LEU B CA    1 
ATOM   7675  C  C     . LEU B 1 364 ? 85.076  105.204 85.410  1.00 20.30 ? 364  LEU B C     1 
ATOM   7676  O  O     . LEU B 1 364 ? 85.717  104.165 85.592  1.00 21.56 ? 364  LEU B O     1 
ATOM   7677  C  CB    . LEU B 1 364 ? 83.761  105.428 83.306  1.00 17.71 ? 364  LEU B CB    1 
ATOM   7678  C  CG    . LEU B 1 364 ? 82.492  105.202 82.482  1.00 18.04 ? 364  LEU B CG    1 
ATOM   7679  C  CD1   . LEU B 1 364 ? 82.768  105.544 81.021  1.00 19.06 ? 364  LEU B CD1   1 
ATOM   7680  C  CD2   . LEU B 1 364 ? 82.040  103.762 82.610  1.00 18.68 ? 364  LEU B CD2   1 
ATOM   7681  N  N     . MET B 1 365 ? 85.548  106.411 85.711  1.00 19.49 ? 365  MET B N     1 
ATOM   7682  C  CA    . MET B 1 365 ? 86.876  106.591 86.288  1.00 21.40 ? 365  MET B CA    1 
ATOM   7683  C  C     . MET B 1 365 ? 86.983  105.868 87.627  1.00 20.93 ? 365  MET B C     1 
ATOM   7684  O  O     . MET B 1 365 ? 88.049  105.361 87.988  1.00 21.06 ? 365  MET B O     1 
ATOM   7685  C  CB    . MET B 1 365 ? 87.176  108.087 86.459  1.00 20.74 ? 365  MET B CB    1 
ATOM   7686  C  CG    . MET B 1 365 ? 88.499  108.408 87.151  1.00 24.41 ? 365  MET B CG    1 
ATOM   7687  S  SD    . MET B 1 365 ? 88.916  110.173 87.059  1.00 27.11 ? 365  MET B SD    1 
ATOM   7688  C  CE    . MET B 1 365 ? 87.661  110.877 88.109  1.00 28.37 ? 365  MET B CE    1 
ATOM   7689  N  N     . ALA B 1 366 ? 85.875  105.807 88.357  1.00 21.08 ? 366  ALA B N     1 
ATOM   7690  C  CA    . ALA B 1 366 ? 85.852  105.139 89.653  1.00 22.89 ? 366  ALA B CA    1 
ATOM   7691  C  C     . ALA B 1 366 ? 86.130  103.644 89.512  1.00 23.94 ? 366  ALA B C     1 
ATOM   7692  O  O     . ALA B 1 366 ? 86.533  102.990 90.472  1.00 23.85 ? 366  ALA B O     1 
ATOM   7693  C  CB    . ALA B 1 366 ? 84.503  105.352 90.329  1.00 23.36 ? 366  ALA B CB    1 
ATOM   7694  N  N     . GLU B 1 367 ? 85.913  103.108 88.316  1.00 23.85 ? 367  GLU B N     1 
ATOM   7695  C  CA    . GLU B 1 367 ? 86.139  101.689 88.061  1.00 24.47 ? 367  GLU B CA    1 
ATOM   7696  C  C     . GLU B 1 367 ? 87.518  101.456 87.463  1.00 25.06 ? 367  GLU B C     1 
ATOM   7697  O  O     . GLU B 1 367 ? 87.892  100.322 87.165  1.00 25.30 ? 367  GLU B O     1 
ATOM   7698  C  CB    . GLU B 1 367 ? 85.076  101.139 87.110  1.00 25.94 ? 367  GLU B CB    1 
ATOM   7699  C  CG    . GLU B 1 367 ? 83.653  101.260 87.618  1.00 27.39 ? 367  GLU B CG    1 
ATOM   7700  C  CD    . GLU B 1 367 ? 83.463  100.606 88.973  1.00 31.45 ? 367  GLU B CD    1 
ATOM   7701  O  OE1   . GLU B 1 367 ? 83.900  99.448  89.140  1.00 30.77 ? 367  GLU B OE1   1 
ATOM   7702  O  OE2   . GLU B 1 367 ? 82.872  101.251 89.867  1.00 31.70 ? 367  GLU B OE2   1 
ATOM   7703  N  N     . GLY B 1 368 ? 88.267  102.537 87.283  1.00 24.06 ? 368  GLY B N     1 
ATOM   7704  C  CA    . GLY B 1 368 ? 89.604  102.426 86.731  1.00 24.28 ? 368  GLY B CA    1 
ATOM   7705  C  C     . GLY B 1 368 ? 89.668  101.843 85.332  1.00 24.10 ? 368  GLY B C     1 
ATOM   7706  O  O     . GLY B 1 368 ? 88.817  102.122 84.487  1.00 23.35 ? 368  GLY B O     1 
ATOM   7707  N  N     . ASP B 1 369 ? 90.682  101.019 85.092  1.00 24.30 ? 369  ASP B N     1 
ATOM   7708  C  CA    . ASP B 1 369 ? 90.879  100.402 83.786  1.00 25.51 ? 369  ASP B CA    1 
ATOM   7709  C  C     . ASP B 1 369 ? 89.770  99.446  83.364  1.00 24.60 ? 369  ASP B C     1 
ATOM   7710  O  O     . ASP B 1 369 ? 89.715  99.018  82.209  1.00 24.52 ? 369  ASP B O     1 
ATOM   7711  C  CB    . ASP B 1 369 ? 92.238  99.698  83.750  1.00 27.94 ? 369  ASP B CB    1 
ATOM   7712  C  CG    . ASP B 1 369 ? 93.381  100.663 83.482  1.00 30.90 ? 369  ASP B CG    1 
ATOM   7713  O  OD1   . ASP B 1 369 ? 93.272  101.843 83.873  1.00 30.25 ? 369  ASP B OD1   1 
ATOM   7714  O  OD2   . ASP B 1 369 ? 94.393  100.241 82.887  1.00 35.22 ? 369  ASP B OD2   1 
ATOM   7715  N  N     . LYS B 1 370 ? 88.880  99.115  84.292  1.00 24.57 ? 370  LYS B N     1 
ATOM   7716  C  CA    . LYS B 1 370 ? 87.772  98.232  83.969  1.00 24.36 ? 370  LYS B CA    1 
ATOM   7717  C  C     . LYS B 1 370 ? 86.887  98.909  82.919  1.00 23.95 ? 370  LYS B C     1 
ATOM   7718  O  O     . LYS B 1 370 ? 86.131  98.245  82.217  1.00 22.50 ? 370  LYS B O     1 
ATOM   7719  C  CB    . LYS B 1 370 ? 86.954  97.925  85.225  1.00 26.53 ? 370  LYS B CB    1 
ATOM   7720  C  CG    . LYS B 1 370 ? 87.679  97.050  86.244  1.00 29.64 ? 370  LYS B CG    1 
ATOM   7721  C  CD    . LYS B 1 370 ? 86.960  97.052  87.587  1.00 31.84 ? 370  LYS B CD    1 
ATOM   7722  C  CE    . LYS B 1 370 ? 85.538  96.537  87.462  1.00 33.97 ? 370  LYS B CE    1 
ATOM   7723  N  NZ    . LYS B 1 370 ? 84.745  96.824  88.686  1.00 35.11 ? 370  LYS B NZ    1 
ATOM   7724  N  N     . ALA B 1 371 ? 86.993  100.231 82.807  1.00 21.52 ? 371  ALA B N     1 
ATOM   7725  C  CA    . ALA B 1 371 ? 86.193  100.974 81.836  1.00 22.33 ? 371  ALA B CA    1 
ATOM   7726  C  C     . ALA B 1 371 ? 86.723  100.844 80.407  1.00 21.95 ? 371  ALA B C     1 
ATOM   7727  O  O     . ALA B 1 371 ? 86.011  101.144 79.446  1.00 22.92 ? 371  ALA B O     1 
ATOM   7728  C  CB    . ALA B 1 371 ? 86.119  102.454 82.232  1.00 21.05 ? 371  ALA B CB    1 
ATOM   7729  N  N     . ILE B 1 372 ? 87.966  100.401 80.256  1.00 22.33 ? 372  ILE B N     1 
ATOM   7730  C  CA    . ILE B 1 372 ? 88.548  100.261 78.920  1.00 21.91 ? 372  ILE B CA    1 
ATOM   7731  C  C     . ILE B 1 372 ? 89.054  98.855  78.627  1.00 23.36 ? 372  ILE B C     1 
ATOM   7732  O  O     . ILE B 1 372 ? 89.508  98.566  77.519  1.00 23.11 ? 372  ILE B O     1 
ATOM   7733  C  CB    . ILE B 1 372 ? 89.726  101.240 78.709  1.00 22.81 ? 372  ILE B CB    1 
ATOM   7734  C  CG1   . ILE B 1 372 ? 90.866  100.905 79.672  1.00 23.05 ? 372  ILE B CG1   1 
ATOM   7735  C  CG2   . ILE B 1 372 ? 89.257  102.672 78.906  1.00 20.26 ? 372  ILE B CG2   1 
ATOM   7736  C  CD1   . ILE B 1 372 ? 92.121  101.707 79.423  1.00 24.71 ? 372  ILE B CD1   1 
ATOM   7737  N  N     . GLU B 1 373 ? 88.959  97.981  79.619  1.00 24.84 ? 373  GLU B N     1 
ATOM   7738  C  CA    . GLU B 1 373 ? 89.429  96.608  79.481  1.00 27.29 ? 373  GLU B CA    1 
ATOM   7739  C  C     . GLU B 1 373 ? 88.830  95.866  78.290  1.00 26.68 ? 373  GLU B C     1 
ATOM   7740  O  O     . GLU B 1 373 ? 87.610  95.742  78.164  1.00 27.64 ? 373  GLU B O     1 
ATOM   7741  C  CB    . GLU B 1 373 ? 89.141  95.832  80.765  1.00 29.09 ? 373  GLU B CB    1 
ATOM   7742  C  CG    . GLU B 1 373 ? 89.803  94.467  80.819  1.00 35.68 ? 373  GLU B CG    1 
ATOM   7743  C  CD    . GLU B 1 373 ? 89.561  93.762  82.136  1.00 38.52 ? 373  GLU B CD    1 
ATOM   7744  O  OE1   . GLU B 1 373 ? 89.898  94.344  83.190  1.00 41.36 ? 373  GLU B OE1   1 
ATOM   7745  O  OE2   . GLU B 1 373 ? 89.037  92.628  82.116  1.00 41.96 ? 373  GLU B OE2   1 
ATOM   7746  N  N     . GLY B 1 374 ? 89.705  95.376  77.418  1.00 26.04 ? 374  GLY B N     1 
ATOM   7747  C  CA    . GLY B 1 374 ? 89.261  94.638  76.249  1.00 25.01 ? 374  GLY B CA    1 
ATOM   7748  C  C     . GLY B 1 374 ? 88.797  95.499  75.089  1.00 25.03 ? 374  GLY B C     1 
ATOM   7749  O  O     . GLY B 1 374 ? 88.402  94.973  74.050  1.00 24.72 ? 374  GLY B O     1 
ATOM   7750  N  N     . THR B 1 375 ? 88.842  96.818  75.250  1.00 23.90 ? 375  THR B N     1 
ATOM   7751  C  CA    . THR B 1 375 ? 88.404  97.711  74.182  1.00 21.87 ? 375  THR B CA    1 
ATOM   7752  C  C     . THR B 1 375 ? 89.592  98.331  73.447  1.00 22.15 ? 375  THR B C     1 
ATOM   7753  O  O     . THR B 1 375 ? 90.675  98.476  74.010  1.00 22.93 ? 375  THR B O     1 
ATOM   7754  C  CB    . THR B 1 375 ? 87.501  98.836  74.728  1.00 21.32 ? 375  THR B CB    1 
ATOM   7755  O  OG1   . THR B 1 375 ? 88.283  99.753  75.500  1.00 21.39 ? 375  THR B OG1   1 
ATOM   7756  C  CG2   . THR B 1 375 ? 86.406  98.255  75.610  1.00 19.70 ? 375  THR B CG2   1 
ATOM   7757  N  N     . ASP B 1 376 ? 89.371  98.699  72.190  1.00 22.27 ? 376  ASP B N     1 
ATOM   7758  C  CA    . ASP B 1 376 ? 90.406  99.280  71.341  1.00 22.37 ? 376  ASP B CA    1 
ATOM   7759  C  C     . ASP B 1 376 ? 90.438  100.811 71.411  1.00 21.64 ? 376  ASP B C     1 
ATOM   7760  O  O     . ASP B 1 376 ? 91.475  101.407 71.717  1.00 20.18 ? 376  ASP B O     1 
ATOM   7761  C  CB    . ASP B 1 376 ? 90.176  98.833  69.896  1.00 24.16 ? 376  ASP B CB    1 
ATOM   7762  C  CG    . ASP B 1 376 ? 91.328  99.186  68.985  1.00 26.58 ? 376  ASP B CG    1 
ATOM   7763  O  OD1   . ASP B 1 376 ? 92.325  98.435  68.960  1.00 32.03 ? 376  ASP B OD1   1 
ATOM   7764  O  OD2   . ASP B 1 376 ? 91.241  100.218 68.298  1.00 29.75 ? 376  ASP B OD2   1 
ATOM   7765  N  N     . ARG B 1 377 ? 89.304  101.436 71.099  1.00 19.29 ? 377  ARG B N     1 
ATOM   7766  C  CA    . ARG B 1 377 ? 89.161  102.891 71.137  1.00 18.74 ? 377  ARG B CA    1 
ATOM   7767  C  C     . ARG B 1 377 ? 89.921  103.673 70.060  1.00 19.56 ? 377  ARG B C     1 
ATOM   7768  O  O     . ARG B 1 377 ? 89.908  104.903 70.072  1.00 19.29 ? 377  ARG B O     1 
ATOM   7769  C  CB    . ARG B 1 377 ? 89.581  103.412 72.520  1.00 19.06 ? 377  ARG B CB    1 
ATOM   7770  C  CG    . ARG B 1 377 ? 88.640  103.026 73.659  1.00 19.93 ? 377  ARG B CG    1 
ATOM   7771  C  CD    . ARG B 1 377 ? 89.388  102.931 74.982  1.00 19.88 ? 377  ARG B CD    1 
ATOM   7772  N  NE    . ARG B 1 377 ? 90.276  101.767 75.001  1.00 22.25 ? 377  ARG B NE    1 
ATOM   7773  C  CZ    . ARG B 1 377 ? 91.570  101.814 75.304  1.00 22.21 ? 377  ARG B CZ    1 
ATOM   7774  N  NH1   . ARG B 1 377 ? 92.138  102.973 75.618  1.00 20.84 ? 377  ARG B NH1   1 
ATOM   7775  N  NH2   . ARG B 1 377 ? 92.299  100.705 75.276  1.00 21.63 ? 377  ARG B NH2   1 
ATOM   7776  N  N     . SER B 1 378 ? 90.558  102.977 69.122  1.00 20.20 ? 378  SER B N     1 
ATOM   7777  C  CA    . SER B 1 378 ? 91.346  103.644 68.080  1.00 20.62 ? 378  SER B CA    1 
ATOM   7778  C  C     . SER B 1 378 ? 90.596  104.513 67.074  1.00 20.48 ? 378  SER B C     1 
ATOM   7779  O  O     . SER B 1 378 ? 91.202  105.363 66.423  1.00 20.20 ? 378  SER B O     1 
ATOM   7780  C  CB    . SER B 1 378 ? 92.180  102.617 67.308  1.00 22.52 ? 378  SER B CB    1 
ATOM   7781  O  OG    . SER B 1 378 ? 93.108  101.970 68.161  1.00 27.13 ? 378  SER B OG    1 
ATOM   7782  N  N     . SER B 1 379 ? 89.291  104.309 66.935  1.00 20.81 ? 379  SER B N     1 
ATOM   7783  C  CA    . SER B 1 379 ? 88.514  105.098 65.984  1.00 19.91 ? 379  SER B CA    1 
ATOM   7784  C  C     . SER B 1 379 ? 88.266  106.541 66.445  1.00 19.92 ? 379  SER B C     1 
ATOM   7785  O  O     . SER B 1 379 ? 87.963  107.410 65.630  1.00 18.28 ? 379  SER B O     1 
ATOM   7786  C  CB    . SER B 1 379 ? 87.174  104.405 65.690  1.00 21.44 ? 379  SER B CB    1 
ATOM   7787  O  OG    . SER B 1 379 ? 86.405  104.232 66.868  1.00 20.52 ? 379  SER B OG    1 
ATOM   7788  N  N     . LEU B 1 380 ? 88.413  106.798 67.742  1.00 19.23 ? 380  LEU B N     1 
ATOM   7789  C  CA    . LEU B 1 380 ? 88.184  108.136 68.287  1.00 19.50 ? 380  LEU B CA    1 
ATOM   7790  C  C     . LEU B 1 380 ? 89.226  109.168 67.864  1.00 20.55 ? 380  LEU B C     1 
ATOM   7791  O  O     . LEU B 1 380 ? 90.423  108.880 67.830  1.00 21.23 ? 380  LEU B O     1 
ATOM   7792  C  CB    . LEU B 1 380 ? 88.137  108.084 69.815  1.00 18.21 ? 380  LEU B CB    1 
ATOM   7793  C  CG    . LEU B 1 380 ? 86.984  107.311 70.465  1.00 18.06 ? 380  LEU B CG    1 
ATOM   7794  C  CD1   . LEU B 1 380 ? 87.251  107.171 71.955  1.00 17.71 ? 380  LEU B CD1   1 
ATOM   7795  C  CD2   . LEU B 1 380 ? 85.667  108.035 70.220  1.00 18.36 ? 380  LEU B CD2   1 
ATOM   7796  N  N     . ARG B 1 381 ? 88.754  110.373 67.552  1.00 20.72 ? 381  ARG B N     1 
ATOM   7797  C  CA    . ARG B 1 381 ? 89.621  111.478 67.148  1.00 21.19 ? 381  ARG B CA    1 
ATOM   7798  C  C     . ARG B 1 381 ? 89.283  112.723 67.959  1.00 19.96 ? 381  ARG B C     1 
ATOM   7799  O  O     . ARG B 1 381 ? 90.155  113.542 68.247  1.00 19.29 ? 381  ARG B O     1 
ATOM   7800  C  CB    . ARG B 1 381 ? 89.435  111.801 65.664  1.00 23.68 ? 381  ARG B CB    1 
ATOM   7801  C  CG    . ARG B 1 381 ? 89.778  110.671 64.706  1.00 28.26 ? 381  ARG B CG    1 
ATOM   7802  C  CD    . ARG B 1 381 ? 89.190  110.961 63.333  1.00 33.33 ? 381  ARG B CD    1 
ATOM   7803  N  NE    . ARG B 1 381 ? 89.229  109.801 62.445  1.00 38.18 ? 381  ARG B NE    1 
ATOM   7804  C  CZ    . ARG B 1 381 ? 88.334  109.568 61.489  1.00 39.46 ? 381  ARG B CZ    1 
ATOM   7805  N  NH1   . ARG B 1 381 ? 87.327  110.410 61.298  1.00 38.99 ? 381  ARG B NH1   1 
ATOM   7806  N  NH2   . ARG B 1 381 ? 88.446  108.493 60.720  1.00 42.41 ? 381  ARG B NH2   1 
ATOM   7807  N  N     . ILE B 1 382 ? 88.009  112.860 68.319  1.00 17.41 ? 382  ILE B N     1 
ATOM   7808  C  CA    . ILE B 1 382 ? 87.540  114.016 69.080  1.00 17.46 ? 382  ILE B CA    1 
ATOM   7809  C  C     . ILE B 1 382 ? 86.691  113.606 70.282  1.00 16.97 ? 382  ILE B C     1 
ATOM   7810  O  O     . ILE B 1 382 ? 85.818  112.748 70.166  1.00 17.27 ? 382  ILE B O     1 
ATOM   7811  C  CB    . ILE B 1 382 ? 86.665  114.941 68.203  1.00 18.38 ? 382  ILE B CB    1 
ATOM   7812  C  CG1   . ILE B 1 382 ? 87.456  115.432 66.983  1.00 17.83 ? 382  ILE B CG1   1 
ATOM   7813  C  CG2   . ILE B 1 382 ? 86.151  116.112 69.031  1.00 17.38 ? 382  ILE B CG2   1 
ATOM   7814  C  CD1   . ILE B 1 382 ? 88.577  116.384 67.308  1.00 20.11 ? 382  ILE B CD1   1 
ATOM   7815  N  N     . LEU B 1 383 ? 86.954  114.226 71.427  1.00 16.46 ? 383  LEU B N     1 
ATOM   7816  C  CA    . LEU B 1 383 ? 86.191  113.970 72.645  1.00 16.87 ? 383  LEU B CA    1 
ATOM   7817  C  C     . LEU B 1 383 ? 85.503  115.266 73.057  1.00 16.85 ? 383  LEU B C     1 
ATOM   7818  O  O     . LEU B 1 383 ? 85.959  116.359 72.707  1.00 15.99 ? 383  LEU B O     1 
ATOM   7819  C  CB    . LEU B 1 383 ? 87.107  113.511 73.784  1.00 17.18 ? 383  LEU B CB    1 
ATOM   7820  C  CG    . LEU B 1 383 ? 87.839  112.178 73.636  1.00 19.70 ? 383  LEU B CG    1 
ATOM   7821  C  CD1   . LEU B 1 383 ? 88.704  111.942 74.873  1.00 19.04 ? 383  LEU B CD1   1 
ATOM   7822  C  CD2   . LEU B 1 383 ? 86.833  111.050 73.460  1.00 17.63 ? 383  LEU B CD2   1 
ATOM   7823  N  N     . GLY B 1 384 ? 84.410  115.140 73.803  1.00 16.68 ? 384  GLY B N     1 
ATOM   7824  C  CA    . GLY B 1 384 ? 83.681  116.310 74.259  1.00 15.78 ? 384  GLY B CA    1 
ATOM   7825  C  C     . GLY B 1 384 ? 83.090  116.101 75.638  1.00 16.03 ? 384  GLY B C     1 
ATOM   7826  O  O     . GLY B 1 384 ? 82.855  114.961 76.054  1.00 15.02 ? 384  GLY B O     1 
ATOM   7827  N  N     . SER B 1 385 ? 82.842  117.198 76.349  1.00 15.23 ? 385  SER B N     1 
ATOM   7828  C  CA    . SER B 1 385 ? 82.273  117.137 77.695  1.00 16.46 ? 385  SER B CA    1 
ATOM   7829  C  C     . SER B 1 385 ? 81.228  118.242 77.857  1.00 15.63 ? 385  SER B C     1 
ATOM   7830  O  O     . SER B 1 385 ? 81.446  119.377 77.434  1.00 13.78 ? 385  SER B O     1 
ATOM   7831  C  CB    . SER B 1 385 ? 83.385  117.303 78.736  1.00 15.88 ? 385  SER B CB    1 
ATOM   7832  O  OG    . SER B 1 385 ? 82.858  117.302 80.052  1.00 19.28 ? 385  SER B OG    1 
ATOM   7833  N  N     . VAL B 1 386 ? 80.101  117.920 78.484  1.00 15.96 ? 386  VAL B N     1 
ATOM   7834  C  CA    . VAL B 1 386 ? 79.041  118.909 78.650  1.00 17.64 ? 386  VAL B CA    1 
ATOM   7835  C  C     . VAL B 1 386 ? 78.188  118.718 79.897  1.00 18.95 ? 386  VAL B C     1 
ATOM   7836  O  O     . VAL B 1 386 ? 78.130  117.623 80.458  1.00 18.28 ? 386  VAL B O     1 
ATOM   7837  C  CB    . VAL B 1 386 ? 78.089  118.871 77.433  1.00 16.95 ? 386  VAL B CB    1 
ATOM   7838  C  CG1   . VAL B 1 386 ? 77.477  117.483 77.310  1.00 17.87 ? 386  VAL B CG1   1 
ATOM   7839  C  CG2   . VAL B 1 386 ? 76.991  119.925 77.575  1.00 16.89 ? 386  VAL B CG2   1 
ATOM   7840  N  N     . GLY B 1 387 ? 77.536  119.799 80.326  1.00 19.83 ? 387  GLY B N     1 
ATOM   7841  C  CA    . GLY B 1 387 ? 76.623  119.729 81.454  1.00 20.57 ? 387  GLY B CA    1 
ATOM   7842  C  C     . GLY B 1 387 ? 77.060  120.175 82.834  1.00 21.06 ? 387  GLY B C     1 
ATOM   7843  O  O     . GLY B 1 387 ? 76.216  120.489 83.675  1.00 21.05 ? 387  GLY B O     1 
ATOM   7844  N  N     . GLU B 1 388 ? 78.361  120.218 83.071  1.00 20.96 ? 388  GLU B N     1 
ATOM   7845  C  CA    . GLU B 1 388 ? 78.871  120.584 84.382  1.00 22.59 ? 388  GLU B CA    1 
ATOM   7846  C  C     . GLU B 1 388 ? 80.379  120.746 84.297  1.00 22.09 ? 388  GLU B C     1 
ATOM   7847  O  O     . GLU B 1 388 ? 80.991  120.412 83.282  1.00 21.10 ? 388  GLU B O     1 
ATOM   7848  C  CB    . GLU B 1 388 ? 78.533  119.469 85.379  1.00 23.62 ? 388  GLU B CB    1 
ATOM   7849  C  CG    . GLU B 1 388 ? 79.160  118.133 84.998  1.00 24.24 ? 388  GLU B CG    1 
ATOM   7850  C  CD    . GLU B 1 388 ? 78.623  116.960 85.800  1.00 25.73 ? 388  GLU B CD    1 
ATOM   7851  O  OE1   . GLU B 1 388 ? 78.712  116.996 87.044  1.00 27.78 ? 388  GLU B OE1   1 
ATOM   7852  O  OE2   . GLU B 1 388 ? 78.117  115.998 85.178  1.00 23.37 ? 388  GLU B OE2   1 
ATOM   7853  N  N     . PRO B 1 389 ? 80.997  121.275 85.363  1.00 23.31 ? 389  PRO B N     1 
ATOM   7854  C  CA    . PRO B 1 389 ? 82.448  121.463 85.377  1.00 25.38 ? 389  PRO B CA    1 
ATOM   7855  C  C     . PRO B 1 389 ? 83.153  120.109 85.385  1.00 25.46 ? 389  PRO B C     1 
ATOM   7856  O  O     . PRO B 1 389 ? 82.577  119.100 85.792  1.00 25.21 ? 389  PRO B O     1 
ATOM   7857  C  CB    . PRO B 1 389 ? 82.685  122.226 86.681  1.00 25.46 ? 389  PRO B CB    1 
ATOM   7858  C  CG    . PRO B 1 389 ? 81.399  122.976 86.881  1.00 26.47 ? 389  PRO B CG    1 
ATOM   7859  C  CD    . PRO B 1 389 ? 80.376  121.928 86.529  1.00 25.27 ? 389  PRO B CD    1 
ATOM   7860  N  N     . ILE B 1 390 ? 84.396  120.091 84.925  1.00 26.62 ? 390  ILE B N     1 
ATOM   7861  C  CA    . ILE B 1 390 ? 85.179  118.865 84.916  1.00 27.38 ? 390  ILE B CA    1 
ATOM   7862  C  C     . ILE B 1 390 ? 86.550  119.203 85.490  1.00 29.36 ? 390  ILE B C     1 
ATOM   7863  O  O     . ILE B 1 390 ? 87.282  120.019 84.930  1.00 30.25 ? 390  ILE B O     1 
ATOM   7864  C  CB    . ILE B 1 390 ? 85.305  118.281 83.478  1.00 26.00 ? 390  ILE B CB    1 
ATOM   7865  C  CG1   . ILE B 1 390 ? 86.104  116.976 83.518  1.00 24.68 ? 390  ILE B CG1   1 
ATOM   7866  C  CG2   . ILE B 1 390 ? 85.945  119.296 82.540  1.00 24.63 ? 390  ILE B CG2   1 
ATOM   7867  C  CD1   . ILE B 1 390 ? 86.180  116.267 82.182  1.00 23.81 ? 390  ILE B CD1   1 
ATOM   7868  N  N     . ASN B 1 391 ? 86.883  118.599 86.628  1.00 30.92 ? 391  ASN B N     1 
ATOM   7869  C  CA    . ASN B 1 391 ? 88.164  118.858 87.277  1.00 32.21 ? 391  ASN B CA    1 
ATOM   7870  C  C     . ASN B 1 391 ? 89.318  118.282 86.465  1.00 31.84 ? 391  ASN B C     1 
ATOM   7871  O  O     . ASN B 1 391 ? 89.126  117.375 85.656  1.00 31.40 ? 391  ASN B O     1 
ATOM   7872  C  CB    . ASN B 1 391 ? 88.179  118.267 88.692  1.00 34.98 ? 391  ASN B CB    1 
ATOM   7873  C  CG    . ASN B 1 391 ? 88.134  116.751 88.693  1.00 36.82 ? 391  ASN B CG    1 
ATOM   7874  O  OD1   . ASN B 1 391 ? 88.985  116.092 88.094  1.00 38.20 ? 391  ASN B OD1   1 
ATOM   7875  N  ND2   . ASN B 1 391 ? 87.143  116.189 89.375  1.00 39.02 ? 391  ASN B ND2   1 
ATOM   7876  N  N     . PRO B 1 392 ? 90.537  118.803 86.674  1.00 31.70 ? 392  PRO B N     1 
ATOM   7877  C  CA    . PRO B 1 392 ? 91.733  118.343 85.962  1.00 31.48 ? 392  PRO B CA    1 
ATOM   7878  C  C     . PRO B 1 392 ? 91.924  116.826 85.968  1.00 30.93 ? 392  PRO B C     1 
ATOM   7879  O  O     . PRO B 1 392 ? 92.272  116.237 84.947  1.00 31.47 ? 392  PRO B O     1 
ATOM   7880  C  CB    . PRO B 1 392 ? 92.860  119.071 86.685  1.00 32.93 ? 392  PRO B CB    1 
ATOM   7881  C  CG    . PRO B 1 392 ? 92.220  120.375 87.042  1.00 33.73 ? 392  PRO B CG    1 
ATOM   7882  C  CD    . PRO B 1 392 ? 90.868  119.930 87.568  1.00 33.20 ? 392  PRO B CD    1 
ATOM   7883  N  N     . GLU B 1 393 ? 91.693  116.199 87.118  1.00 29.22 ? 393  GLU B N     1 
ATOM   7884  C  CA    . GLU B 1 393 ? 91.850  114.753 87.241  1.00 29.43 ? 393  GLU B CA    1 
ATOM   7885  C  C     . GLU B 1 393 ? 90.951  113.983 86.272  1.00 26.69 ? 393  GLU B C     1 
ATOM   7886  O  O     . GLU B 1 393 ? 91.418  113.098 85.555  1.00 25.85 ? 393  GLU B O     1 
ATOM   7887  C  CB    . GLU B 1 393 ? 91.552  114.309 88.674  1.00 32.26 ? 393  GLU B CB    1 
ATOM   7888  C  CG    . GLU B 1 393 ? 91.642  112.809 88.879  1.00 36.70 ? 393  GLU B CG    1 
ATOM   7889  C  CD    . GLU B 1 393 ? 91.292  112.391 90.292  1.00 41.07 ? 393  GLU B CD    1 
ATOM   7890  O  OE1   . GLU B 1 393 ? 90.172  112.709 90.753  1.00 43.51 ? 393  GLU B OE1   1 
ATOM   7891  O  OE2   . GLU B 1 393 ? 92.137  111.740 90.941  1.00 43.49 ? 393  GLU B OE2   1 
ATOM   7892  N  N     . ALA B 1 394 ? 89.664  114.314 86.258  1.00 24.93 ? 394  ALA B N     1 
ATOM   7893  C  CA    . ALA B 1 394 ? 88.715  113.643 85.371  1.00 23.48 ? 394  ALA B CA    1 
ATOM   7894  C  C     . ALA B 1 394 ? 89.049  113.955 83.914  1.00 22.26 ? 394  ALA B C     1 
ATOM   7895  O  O     . ALA B 1 394 ? 89.003  113.076 83.056  1.00 21.08 ? 394  ALA B O     1 
ATOM   7896  C  CB    . ALA B 1 394 ? 87.285  114.083 85.695  1.00 22.79 ? 394  ALA B CB    1 
ATOM   7897  N  N     . TRP B 1 395 ? 89.390  115.212 83.641  1.00 22.21 ? 395  TRP B N     1 
ATOM   7898  C  CA    . TRP B 1 395 ? 89.745  115.634 82.290  1.00 21.71 ? 395  TRP B CA    1 
ATOM   7899  C  C     . TRP B 1 395 ? 90.913  114.782 81.798  1.00 21.76 ? 395  TRP B C     1 
ATOM   7900  O  O     . TRP B 1 395 ? 90.903  114.275 80.675  1.00 22.37 ? 395  TRP B O     1 
ATOM   7901  C  CB    . TRP B 1 395 ? 90.157  117.110 82.293  1.00 22.04 ? 395  TRP B CB    1 
ATOM   7902  C  CG    . TRP B 1 395 ? 90.401  117.687 80.930  1.00 22.86 ? 395  TRP B CG    1 
ATOM   7903  C  CD1   . TRP B 1 395 ? 89.527  118.422 80.183  1.00 24.16 ? 395  TRP B CD1   1 
ATOM   7904  C  CD2   . TRP B 1 395 ? 91.602  117.578 80.150  1.00 22.59 ? 395  TRP B CD2   1 
ATOM   7905  N  NE1   . TRP B 1 395 ? 90.109  118.783 78.989  1.00 22.05 ? 395  TRP B NE1   1 
ATOM   7906  C  CE2   . TRP B 1 395 ? 91.381  118.277 78.943  1.00 23.57 ? 395  TRP B CE2   1 
ATOM   7907  C  CE3   . TRP B 1 395 ? 92.843  116.958 80.356  1.00 23.19 ? 395  TRP B CE3   1 
ATOM   7908  C  CZ2   . TRP B 1 395 ? 92.355  118.374 77.942  1.00 25.03 ? 395  TRP B CZ2   1 
ATOM   7909  C  CZ3   . TRP B 1 395 ? 93.812  117.055 79.363  1.00 23.80 ? 395  TRP B CZ3   1 
ATOM   7910  C  CH2   . TRP B 1 395 ? 93.560  117.759 78.169  1.00 26.19 ? 395  TRP B CH2   1 
ATOM   7911  N  N     . GLU B 1 396 ? 91.916  114.628 82.655  1.00 21.02 ? 396  GLU B N     1 
ATOM   7912  C  CA    . GLU B 1 396 ? 93.107  113.852 82.331  1.00 21.11 ? 396  GLU B CA    1 
ATOM   7913  C  C     . GLU B 1 396 ? 92.795  112.376 82.100  1.00 20.11 ? 396  GLU B C     1 
ATOM   7914  O  O     . GLU B 1 396 ? 93.282  111.772 81.141  1.00 20.72 ? 396  GLU B O     1 
ATOM   7915  C  CB    . GLU B 1 396 ? 94.141  113.998 83.454  1.00 22.16 ? 396  GLU B CB    1 
ATOM   7916  N  N     . TRP B 1 397 ? 91.994  111.790 82.987  1.00 18.74 ? 397  TRP B N     1 
ATOM   7917  C  CA    . TRP B 1 397 ? 91.631  110.382 82.864  1.00 18.35 ? 397  TRP B CA    1 
ATOM   7918  C  C     . TRP B 1 397 ? 90.884  110.169 81.548  1.00 17.65 ? 397  TRP B C     1 
ATOM   7919  O  O     . TRP B 1 397 ? 91.160  109.225 80.810  1.00 17.64 ? 397  TRP B O     1 
ATOM   7920  C  CB    . TRP B 1 397 ? 90.743  109.960 84.038  1.00 18.54 ? 397  TRP B CB    1 
ATOM   7921  C  CG    . TRP B 1 397 ? 90.418  108.498 84.055  1.00 20.40 ? 397  TRP B CG    1 
ATOM   7922  C  CD1   . TRP B 1 397 ? 91.113  107.507 84.691  1.00 20.31 ? 397  TRP B CD1   1 
ATOM   7923  C  CD2   . TRP B 1 397 ? 89.327  107.857 83.386  1.00 20.69 ? 397  TRP B CD2   1 
ATOM   7924  N  NE1   . TRP B 1 397 ? 90.521  106.290 84.459  1.00 22.26 ? 397  TRP B NE1   1 
ATOM   7925  C  CE2   . TRP B 1 397 ? 89.422  106.475 83.661  1.00 20.88 ? 397  TRP B CE2   1 
ATOM   7926  C  CE3   . TRP B 1 397 ? 88.278  108.317 82.579  1.00 20.73 ? 397  TRP B CE3   1 
ATOM   7927  C  CZ2   . TRP B 1 397 ? 88.507  105.547 83.158  1.00 21.21 ? 397  TRP B CZ2   1 
ATOM   7928  C  CZ3   . TRP B 1 397 ? 87.367  107.391 82.078  1.00 20.33 ? 397  TRP B CZ3   1 
ATOM   7929  C  CH2   . TRP B 1 397 ? 87.488  106.023 82.371  1.00 21.25 ? 397  TRP B CH2   1 
ATOM   7930  N  N     . TYR B 1 398 ? 89.937  111.058 81.271  1.00 16.80 ? 398  TYR B N     1 
ATOM   7931  C  CA    . TYR B 1 398 ? 89.136  111.004 80.050  1.00 16.00 ? 398  TYR B CA    1 
ATOM   7932  C  C     . TYR B 1 398 ? 90.066  111.128 78.844  1.00 16.74 ? 398  TYR B C     1 
ATOM   7933  O  O     . TYR B 1 398 ? 90.019  110.326 77.911  1.00 15.79 ? 398  TYR B O     1 
ATOM   7934  C  CB    . TYR B 1 398 ? 88.127  112.157 80.075  1.00 17.04 ? 398  TYR B CB    1 
ATOM   7935  C  CG    . TYR B 1 398 ? 87.145  112.227 78.922  1.00 17.49 ? 398  TYR B CG    1 
ATOM   7936  C  CD1   . TYR B 1 398 ? 86.505  111.081 78.445  1.00 15.56 ? 398  TYR B CD1   1 
ATOM   7937  C  CD2   . TYR B 1 398 ? 86.789  113.457 78.369  1.00 16.40 ? 398  TYR B CD2   1 
ATOM   7938  C  CE1   . TYR B 1 398 ? 85.528  111.164 77.448  1.00 15.57 ? 398  TYR B CE1   1 
ATOM   7939  C  CE2   . TYR B 1 398 ? 85.812  113.553 77.375  1.00 15.86 ? 398  TYR B CE2   1 
ATOM   7940  C  CZ    . TYR B 1 398 ? 85.186  112.403 76.922  1.00 15.49 ? 398  TYR B CZ    1 
ATOM   7941  O  OH    . TYR B 1 398 ? 84.208  112.497 75.959  1.00 13.83 ? 398  TYR B OH    1 
ATOM   7942  N  N     . TRP B 1 399 ? 90.922  112.139 78.889  1.00 17.87 ? 399  TRP B N     1 
ATOM   7943  C  CA    . TRP B 1 399 ? 91.881  112.411 77.826  1.00 21.20 ? 399  TRP B CA    1 
ATOM   7944  C  C     . TRP B 1 399 ? 92.859  111.252 77.603  1.00 21.10 ? 399  TRP B C     1 
ATOM   7945  O  O     . TRP B 1 399 ? 93.182  110.912 76.461  1.00 21.04 ? 399  TRP B O     1 
ATOM   7946  C  CB    . TRP B 1 399 ? 92.656  113.684 78.180  1.00 23.38 ? 399  TRP B CB    1 
ATOM   7947  C  CG    . TRP B 1 399 ? 93.677  114.103 77.178  1.00 27.40 ? 399  TRP B CG    1 
ATOM   7948  C  CD1   . TRP B 1 399 ? 93.449  114.706 75.975  1.00 28.40 ? 399  TRP B CD1   1 
ATOM   7949  C  CD2   . TRP B 1 399 ? 95.095  113.965 77.296  1.00 28.37 ? 399  TRP B CD2   1 
ATOM   7950  N  NE1   . TRP B 1 399 ? 94.639  114.954 75.336  1.00 29.25 ? 399  TRP B NE1   1 
ATOM   7951  C  CE2   . TRP B 1 399 ? 95.667  114.509 76.124  1.00 28.26 ? 399  TRP B CE2   1 
ATOM   7952  C  CE3   . TRP B 1 399 ? 95.941  113.434 78.279  1.00 28.65 ? 399  TRP B CE3   1 
ATOM   7953  C  CZ2   . TRP B 1 399 ? 97.049  114.539 75.906  1.00 30.17 ? 399  TRP B CZ2   1 
ATOM   7954  C  CZ3   . TRP B 1 399 ? 97.321  113.465 78.062  1.00 29.86 ? 399  TRP B CZ3   1 
ATOM   7955  C  CH2   . TRP B 1 399 ? 97.856  114.014 76.883  1.00 28.11 ? 399  TRP B CH2   1 
ATOM   7956  N  N     . LYS B 1 400 ? 93.319  110.641 78.692  1.00 20.63 ? 400  LYS B N     1 
ATOM   7957  C  CA    . LYS B 1 400 ? 94.285  109.544 78.600  1.00 21.46 ? 400  LYS B CA    1 
ATOM   7958  C  C     . LYS B 1 400 ? 93.710  108.156 78.349  1.00 20.75 ? 400  LYS B C     1 
ATOM   7959  O  O     . LYS B 1 400 ? 94.145  107.454 77.439  1.00 22.55 ? 400  LYS B O     1 
ATOM   7960  C  CB    . LYS B 1 400 ? 95.143  109.478 79.867  1.00 21.91 ? 400  LYS B CB    1 
ATOM   7961  C  CG    . LYS B 1 400 ? 96.129  108.310 79.863  1.00 24.73 ? 400  LYS B CG    1 
ATOM   7962  C  CD    . LYS B 1 400 ? 96.770  108.092 81.224  1.00 28.37 ? 400  LYS B CD    1 
ATOM   7963  C  CE    . LYS B 1 400 ? 97.632  109.268 81.636  1.00 31.05 ? 400  LYS B CE    1 
ATOM   7964  N  NZ    . LYS B 1 400 ? 98.247  109.029 82.967  1.00 34.54 ? 400  LYS B NZ    1 
ATOM   7965  N  N     . LYS B 1 401 ? 92.744  107.759 79.168  1.00 20.32 ? 401  LYS B N     1 
ATOM   7966  C  CA    . LYS B 1 401 ? 92.141  106.437 79.054  1.00 19.84 ? 401  LYS B CA    1 
ATOM   7967  C  C     . LYS B 1 401 ? 91.190  106.262 77.874  1.00 18.48 ? 401  LYS B C     1 
ATOM   7968  O  O     . LYS B 1 401 ? 91.218  105.237 77.191  1.00 19.35 ? 401  LYS B O     1 
ATOM   7969  C  CB    . LYS B 1 401 ? 91.411  106.100 80.354  1.00 20.35 ? 401  LYS B CB    1 
ATOM   7970  C  CG    . LYS B 1 401 ? 92.310  106.116 81.578  1.00 21.63 ? 401  LYS B CG    1 
ATOM   7971  C  CD    . LYS B 1 401 ? 93.321  104.980 81.542  1.00 23.30 ? 401  LYS B CD    1 
ATOM   7972  C  CE    . LYS B 1 401 ? 94.243  105.019 82.751  1.00 24.16 ? 401  LYS B CE    1 
ATOM   7973  N  NZ    . LYS B 1 401 ? 95.141  103.828 82.797  1.00 26.06 ? 401  LYS B NZ    1 
ATOM   7974  N  N     . ILE B 1 402 ? 90.337  107.249 77.635  1.00 17.90 ? 402  ILE B N     1 
ATOM   7975  C  CA    . ILE B 1 402 ? 89.397  107.140 76.529  1.00 17.49 ? 402  ILE B CA    1 
ATOM   7976  C  C     . ILE B 1 402 ? 90.026  107.590 75.211  1.00 17.28 ? 402  ILE B C     1 
ATOM   7977  O  O     . ILE B 1 402 ? 89.961  106.875 74.212  1.00 17.08 ? 402  ILE B O     1 
ATOM   7978  C  CB    . ILE B 1 402 ? 88.116  107.960 76.810  1.00 16.42 ? 402  ILE B CB    1 
ATOM   7979  C  CG1   . ILE B 1 402 ? 87.570  107.596 78.192  1.00 15.26 ? 402  ILE B CG1   1 
ATOM   7980  C  CG2   . ILE B 1 402 ? 87.057  107.673 75.749  1.00 15.15 ? 402  ILE B CG2   1 
ATOM   7981  C  CD1   . ILE B 1 402 ? 87.284  106.104 78.377  1.00 16.87 ? 402  ILE B CD1   1 
ATOM   7982  N  N     . GLY B 1 403 ? 90.660  108.759 75.226  1.00 18.00 ? 403  GLY B N     1 
ATOM   7983  C  CA    . GLY B 1 403 ? 91.276  109.292 74.020  1.00 18.08 ? 403  GLY B CA    1 
ATOM   7984  C  C     . GLY B 1 403 ? 92.705  108.868 73.735  1.00 20.11 ? 403  GLY B C     1 
ATOM   7985  O  O     . GLY B 1 403 ? 93.275  109.270 72.717  1.00 19.86 ? 403  GLY B O     1 
ATOM   7986  N  N     . LYS B 1 404 ? 93.288  108.065 74.621  1.00 21.24 ? 404  LYS B N     1 
ATOM   7987  C  CA    . LYS B 1 404 ? 94.657  107.579 74.446  1.00 22.25 ? 404  LYS B CA    1 
ATOM   7988  C  C     . LYS B 1 404 ? 95.649  108.719 74.197  1.00 23.38 ? 404  LYS B C     1 
ATOM   7989  O  O     . LYS B 1 404 ? 96.632  108.563 73.464  1.00 21.57 ? 404  LYS B O     1 
ATOM   7990  C  CB    . LYS B 1 404 ? 94.693  106.569 73.294  1.00 23.99 ? 404  LYS B CB    1 
ATOM   7991  C  CG    . LYS B 1 404 ? 93.819  105.343 73.561  1.00 25.99 ? 404  LYS B CG    1 
ATOM   7992  C  CD    . LYS B 1 404 ? 93.594  104.490 72.322  1.00 29.73 ? 404  LYS B CD    1 
ATOM   7993  C  CE    . LYS B 1 404 ? 94.845  103.756 71.893  1.00 31.72 ? 404  LYS B CE    1 
ATOM   7994  N  NZ    . LYS B 1 404 ? 94.543  102.824 70.768  1.00 32.53 ? 404  LYS B NZ    1 
ATOM   7995  N  N     . GLU B 1 405 ? 95.378  109.860 74.827  1.00 22.95 ? 405  GLU B N     1 
ATOM   7996  C  CA    . GLU B 1 405 ? 96.210  111.055 74.715  1.00 25.17 ? 405  GLU B CA    1 
ATOM   7997  C  C     . GLU B 1 405 ? 96.354  111.539 73.277  1.00 25.80 ? 405  GLU B C     1 
ATOM   7998  O  O     . GLU B 1 405 ? 97.342  112.188 72.932  1.00 27.87 ? 405  GLU B O     1 
ATOM   7999  C  CB    . GLU B 1 405 ? 97.601  110.786 75.303  1.00 26.60 ? 405  GLU B CB    1 
ATOM   8000  C  CG    . GLU B 1 405 ? 97.585  110.329 76.753  1.00 26.75 ? 405  GLU B CG    1 
ATOM   8001  C  CD    . GLU B 1 405 ? 98.970  110.292 77.377  1.00 27.53 ? 405  GLU B CD    1 
ATOM   8002  O  OE1   . GLU B 1 405 ? 99.086  109.845 78.537  1.00 27.63 ? 405  GLU B OE1   1 
ATOM   8003  O  OE2   . GLU B 1 405 ? 99.940  110.715 76.715  1.00 26.77 ? 405  GLU B OE2   1 
ATOM   8004  N  N     . LYS B 1 406 ? 95.365  111.240 72.442  1.00 24.94 ? 406  LYS B N     1 
ATOM   8005  C  CA    . LYS B 1 406 ? 95.418  111.639 71.040  1.00 24.69 ? 406  LYS B CA    1 
ATOM   8006  C  C     . LYS B 1 406 ? 94.258  112.525 70.597  1.00 23.48 ? 406  LYS B C     1 
ATOM   8007  O  O     . LYS B 1 406 ? 94.283  113.079 69.498  1.00 23.30 ? 406  LYS B O     1 
ATOM   8008  C  CB    . LYS B 1 406 ? 95.458  110.387 70.162  1.00 26.22 ? 406  LYS B CB    1 
ATOM   8009  C  CG    . LYS B 1 406 ? 96.635  109.475 70.461  1.00 28.37 ? 406  LYS B CG    1 
ATOM   8010  C  CD    . LYS B 1 406 ? 96.498  108.111 69.786  1.00 32.26 ? 406  LYS B CD    1 
ATOM   8011  C  CE    . LYS B 1 406 ? 96.520  108.220 68.272  1.00 33.96 ? 406  LYS B CE    1 
ATOM   8012  N  NZ    . LYS B 1 406 ? 96.581  106.879 67.624  1.00 38.78 ? 406  LYS B NZ    1 
ATOM   8013  N  N     . CYS B 1 407 ? 93.253  112.677 71.454  1.00 22.67 ? 407  CYS B N     1 
ATOM   8014  C  CA    . CYS B 1 407 ? 92.076  113.464 71.099  1.00 20.55 ? 407  CYS B CA    1 
ATOM   8015  C  C     . CYS B 1 407 ? 91.862  114.753 71.879  1.00 20.78 ? 407  CYS B C     1 
ATOM   8016  O  O     . CYS B 1 407 ? 91.994  114.786 73.103  1.00 20.27 ? 407  CYS B O     1 
ATOM   8017  C  CB    . CYS B 1 407 ? 90.811  112.612 71.261  1.00 21.39 ? 407  CYS B CB    1 
ATOM   8018  S  SG    . CYS B 1 407 ? 90.861  110.984 70.480  1.00 20.01 ? 407  CYS B SG    1 
ATOM   8019  N  N     . PRO B 1 408 ? 91.534  115.844 71.170  1.00 18.84 ? 408  PRO B N     1 
ATOM   8020  C  CA    . PRO B 1 408 ? 91.295  117.105 71.871  1.00 19.60 ? 408  PRO B CA    1 
ATOM   8021  C  C     . PRO B 1 408 ? 89.982  116.906 72.633  1.00 19.45 ? 408  PRO B C     1 
ATOM   8022  O  O     . PRO B 1 408 ? 89.133  116.124 72.206  1.00 19.80 ? 408  PRO B O     1 
ATOM   8023  C  CB    . PRO B 1 408 ? 91.132  118.110 70.731  1.00 18.42 ? 408  PRO B CB    1 
ATOM   8024  C  CG    . PRO B 1 408 ? 91.933  117.518 69.619  1.00 20.68 ? 408  PRO B CG    1 
ATOM   8025  C  CD    . PRO B 1 408 ? 91.593  116.053 69.713  1.00 19.96 ? 408  PRO B CD    1 
ATOM   8026  N  N     . VAL B 1 409 ? 89.819  117.596 73.755  1.00 20.04 ? 409  VAL B N     1 
ATOM   8027  C  CA    . VAL B 1 409 ? 88.589  117.494 74.530  1.00 19.07 ? 409  VAL B CA    1 
ATOM   8028  C  C     . VAL B 1 409 ? 87.843  118.822 74.438  1.00 18.21 ? 409  VAL B C     1 
ATOM   8029  O  O     . VAL B 1 409 ? 88.321  119.831 74.952  1.00 19.13 ? 409  VAL B O     1 
ATOM   8030  C  CB    . VAL B 1 409 ? 88.882  117.194 76.024  1.00 18.77 ? 409  VAL B CB    1 
ATOM   8031  C  CG1   . VAL B 1 409 ? 87.594  117.279 76.838  1.00 19.39 ? 409  VAL B CG1   1 
ATOM   8032  C  CG2   . VAL B 1 409 ? 89.504  115.814 76.168  1.00 20.85 ? 409  VAL B CG2   1 
ATOM   8033  N  N     . VAL B 1 410 ? 86.690  118.841 73.772  1.00 17.69 ? 410  VAL B N     1 
ATOM   8034  C  CA    . VAL B 1 410 ? 85.929  120.080 73.682  1.00 17.63 ? 410  VAL B CA    1 
ATOM   8035  C  C     . VAL B 1 410 ? 84.950  120.168 74.845  1.00 17.93 ? 410  VAL B C     1 
ATOM   8036  O  O     . VAL B 1 410 ? 83.951  119.447 74.904  1.00 19.66 ? 410  VAL B O     1 
ATOM   8037  C  CB    . VAL B 1 410 ? 85.173  120.238 72.317  1.00 16.12 ? 410  VAL B CB    1 
ATOM   8038  C  CG1   . VAL B 1 410 ? 86.180  120.432 71.191  1.00 19.37 ? 410  VAL B CG1   1 
ATOM   8039  C  CG2   . VAL B 1 410 ? 84.291  119.031 72.031  1.00 16.59 ? 410  VAL B CG2   1 
ATOM   8040  N  N     . ASP B 1 411 ? 85.279  121.047 75.787  1.00 16.91 ? 411  ASP B N     1 
ATOM   8041  C  CA    . ASP B 1 411 ? 84.479  121.297 76.981  1.00 15.45 ? 411  ASP B CA    1 
ATOM   8042  C  C     . ASP B 1 411 ? 83.522  122.428 76.612  1.00 14.78 ? 411  ASP B C     1 
ATOM   8043  O  O     . ASP B 1 411 ? 83.889  123.600 76.642  1.00 14.74 ? 411  ASP B O     1 
ATOM   8044  C  CB    . ASP B 1 411 ? 85.407  121.725 78.124  1.00 14.56 ? 411  ASP B CB    1 
ATOM   8045  C  CG    . ASP B 1 411 ? 84.668  122.018 79.408  1.00 16.62 ? 411  ASP B CG    1 
ATOM   8046  O  OD1   . ASP B 1 411 ? 83.426  121.867 79.444  1.00 15.37 ? 411  ASP B OD1   1 
ATOM   8047  O  OD2   . ASP B 1 411 ? 85.341  122.403 80.392  1.00 16.89 ? 411  ASP B OD2   1 
ATOM   8048  N  N     . THR B 1 412 ? 82.295  122.062 76.264  1.00 15.39 ? 412  THR B N     1 
ATOM   8049  C  CA    . THR B 1 412 ? 81.299  123.032 75.833  1.00 14.11 ? 412  THR B CA    1 
ATOM   8050  C  C     . THR B 1 412 ? 80.394  123.594 76.916  1.00 14.63 ? 412  THR B C     1 
ATOM   8051  O  O     . THR B 1 412 ? 79.629  122.854 77.535  1.00 15.48 ? 412  THR B O     1 
ATOM   8052  C  CB    . THR B 1 412 ? 80.383  122.422 74.764  1.00 13.99 ? 412  THR B CB    1 
ATOM   8053  O  OG1   . THR B 1 412 ? 79.551  121.424 75.371  1.00 15.49 ? 412  THR B OG1   1 
ATOM   8054  C  CG2   . THR B 1 412 ? 81.205  121.775 73.656  1.00 12.57 ? 412  THR B CG2   1 
ATOM   8055  N  N     . TRP B 1 413 ? 80.471  124.903 77.142  1.00 11.67 ? 413  TRP B N     1 
ATOM   8056  C  CA    . TRP B 1 413 ? 79.592  125.525 78.120  1.00 13.03 ? 413  TRP B CA    1 
ATOM   8057  C  C     . TRP B 1 413 ? 78.454  126.202 77.370  1.00 13.85 ? 413  TRP B C     1 
ATOM   8058  O  O     . TRP B 1 413 ? 78.684  126.911 76.391  1.00 14.31 ? 413  TRP B O     1 
ATOM   8059  C  CB    . TRP B 1 413 ? 80.300  126.597 78.960  1.00 13.65 ? 413  TRP B CB    1 
ATOM   8060  C  CG    . TRP B 1 413 ? 79.312  127.342 79.836  1.00 12.60 ? 413  TRP B CG    1 
ATOM   8061  C  CD1   . TRP B 1 413 ? 78.802  126.924 81.031  1.00 12.86 ? 413  TRP B CD1   1 
ATOM   8062  C  CD2   . TRP B 1 413 ? 78.634  128.570 79.522  1.00 13.39 ? 413  TRP B CD2   1 
ATOM   8063  N  NE1   . TRP B 1 413 ? 77.849  127.808 81.478  1.00 13.71 ? 413  TRP B NE1   1 
ATOM   8064  C  CE2   . TRP B 1 413 ? 77.725  128.826 80.572  1.00 13.06 ? 413  TRP B CE2   1 
ATOM   8065  C  CE3   . TRP B 1 413 ? 78.706  129.476 78.452  1.00 14.84 ? 413  TRP B CE3   1 
ATOM   8066  C  CZ2   . TRP B 1 413 ? 76.888  129.951 80.588  1.00 14.72 ? 413  TRP B CZ2   1 
ATOM   8067  C  CZ3   . TRP B 1 413 ? 77.872  130.598 78.465  1.00 14.12 ? 413  TRP B CZ3   1 
ATOM   8068  C  CH2   . TRP B 1 413 ? 76.976  130.823 79.528  1.00 15.12 ? 413  TRP B CH2   1 
ATOM   8069  N  N     . TRP B 1 414 ? 77.232  125.952 77.824  1.00 13.85 ? 414  TRP B N     1 
ATOM   8070  C  CA    . TRP B 1 414 ? 76.033  126.561 77.260  1.00 13.53 ? 414  TRP B CA    1 
ATOM   8071  C  C     . TRP B 1 414 ? 74.859  126.180 78.146  1.00 14.41 ? 414  TRP B C     1 
ATOM   8072  O  O     . TRP B 1 414 ? 75.061  125.595 79.217  1.00 15.72 ? 414  TRP B O     1 
ATOM   8073  C  CB    . TRP B 1 414 ? 75.794  126.143 75.799  1.00 12.81 ? 414  TRP B CB    1 
ATOM   8074  C  CG    . TRP B 1 414 ? 75.658  124.680 75.544  1.00 13.06 ? 414  TRP B CG    1 
ATOM   8075  C  CD1   . TRP B 1 414 ? 76.616  123.720 75.725  1.00 14.31 ? 414  TRP B CD1   1 
ATOM   8076  C  CD2   . TRP B 1 414 ? 74.512  124.010 75.007  1.00 13.80 ? 414  TRP B CD2   1 
ATOM   8077  N  NE1   . TRP B 1 414 ? 76.135  122.493 75.329  1.00 14.05 ? 414  TRP B NE1   1 
ATOM   8078  C  CE2   . TRP B 1 414 ? 74.846  122.642 74.886  1.00 13.41 ? 414  TRP B CE2   1 
ATOM   8079  C  CE3   . TRP B 1 414 ? 73.233  124.432 74.616  1.00 13.94 ? 414  TRP B CE3   1 
ATOM   8080  C  CZ2   . TRP B 1 414 ? 73.946  121.689 74.390  1.00 13.58 ? 414  TRP B CZ2   1 
ATOM   8081  C  CZ3   . TRP B 1 414 ? 72.335  123.477 74.120  1.00 14.56 ? 414  TRP B CZ3   1 
ATOM   8082  C  CH2   . TRP B 1 414 ? 72.703  122.125 74.014  1.00 11.66 ? 414  TRP B CH2   1 
ATOM   8083  N  N     . GLN B 1 415 ? 73.645  126.520 77.724  1.00 12.94 ? 415  GLN B N     1 
ATOM   8084  C  CA    . GLN B 1 415 ? 72.454  126.242 78.524  1.00 14.30 ? 415  GLN B CA    1 
ATOM   8085  C  C     . GLN B 1 415 ? 71.243  126.040 77.629  1.00 14.73 ? 415  GLN B C     1 
ATOM   8086  O  O     . GLN B 1 415 ? 71.279  126.355 76.436  1.00 15.14 ? 415  GLN B O     1 
ATOM   8087  C  CB    . GLN B 1 415 ? 72.150  127.422 79.456  1.00 16.85 ? 415  GLN B CB    1 
ATOM   8088  C  CG    . GLN B 1 415 ? 73.360  128.081 80.096  1.00 19.80 ? 415  GLN B CG    1 
ATOM   8089  C  CD    . GLN B 1 415 ? 72.984  129.328 80.874  1.00 18.60 ? 415  GLN B CD    1 
ATOM   8090  O  OE1   . GLN B 1 415 ? 72.584  130.342 80.297  1.00 20.52 ? 415  GLN B OE1   1 
ATOM   8091  N  NE2   . GLN B 1 415 ? 73.099  129.256 82.192  1.00 20.32 ? 415  GLN B NE2   1 
ATOM   8092  N  N     . THR B 1 416 ? 70.164  125.533 78.219  1.00 14.29 ? 416  THR B N     1 
ATOM   8093  C  CA    . THR B 1 416 ? 68.929  125.307 77.480  1.00 12.19 ? 416  THR B CA    1 
ATOM   8094  C  C     . THR B 1 416 ? 68.526  126.622 76.821  1.00 14.58 ? 416  THR B C     1 
ATOM   8095  O  O     . THR B 1 416 ? 68.046  126.645 75.680  1.00 13.00 ? 416  THR B O     1 
ATOM   8096  C  CB    . THR B 1 416 ? 67.789  124.859 78.428  1.00 14.79 ? 416  THR B CB    1 
ATOM   8097  O  OG1   . THR B 1 416 ? 68.175  123.652 79.095  1.00 14.32 ? 416  THR B OG1   1 
ATOM   8098  C  CG2   . THR B 1 416 ? 66.498  124.617 77.648  1.00 15.26 ? 416  THR B CG2   1 
ATOM   8099  N  N     . GLU B 1 417 ? 68.747  127.718 77.544  1.00 12.38 ? 417  GLU B N     1 
ATOM   8100  C  CA    . GLU B 1 417 ? 68.403  129.051 77.056  1.00 13.31 ? 417  GLU B CA    1 
ATOM   8101  C  C     . GLU B 1 417 ? 69.292  129.595 75.937  1.00 13.76 ? 417  GLU B C     1 
ATOM   8102  O  O     . GLU B 1 417 ? 68.965  130.625 75.336  1.00 13.92 ? 417  GLU B O     1 
ATOM   8103  C  CB    . GLU B 1 417 ? 68.405  130.056 78.220  1.00 13.84 ? 417  GLU B CB    1 
ATOM   8104  C  CG    . GLU B 1 417 ? 67.391  129.754 79.315  1.00 15.19 ? 417  GLU B CG    1 
ATOM   8105  C  CD    . GLU B 1 417 ? 67.959  128.914 80.445  1.00 14.50 ? 417  GLU B CD    1 
ATOM   8106  O  OE1   . GLU B 1 417 ? 68.922  128.153 80.213  1.00 14.86 ? 417  GLU B OE1   1 
ATOM   8107  O  OE2   . GLU B 1 417 ? 67.427  129.013 81.573  1.00 15.22 ? 417  GLU B OE2   1 
ATOM   8108  N  N     . THR B 1 418 ? 70.409  128.936 75.644  1.00 13.36 ? 418  THR B N     1 
ATOM   8109  C  CA    . THR B 1 418 ? 71.282  129.454 74.595  1.00 13.07 ? 418  THR B CA    1 
ATOM   8110  C  C     . THR B 1 418 ? 71.216  128.679 73.280  1.00 13.40 ? 418  THR B C     1 
ATOM   8111  O  O     . THR B 1 418 ? 71.854  129.060 72.299  1.00 13.63 ? 418  THR B O     1 
ATOM   8112  C  CB    . THR B 1 418 ? 72.752  129.544 75.074  1.00 11.93 ? 418  THR B CB    1 
ATOM   8113  O  OG1   . THR B 1 418 ? 73.341  128.238 75.118  1.00 12.42 ? 418  THR B OG1   1 
ATOM   8114  C  CG2   . THR B 1 418 ? 72.811  130.170 76.457  1.00 11.77 ? 418  THR B CG2   1 
ATOM   8115  N  N     . GLY B 1 419 ? 70.441  127.596 73.265  1.00 13.60 ? 419  GLY B N     1 
ATOM   8116  C  CA    . GLY B 1 419 ? 70.274  126.808 72.056  1.00 13.05 ? 419  GLY B CA    1 
ATOM   8117  C  C     . GLY B 1 419 ? 71.458  125.963 71.628  1.00 15.13 ? 419  GLY B C     1 
ATOM   8118  O  O     . GLY B 1 419 ? 71.280  124.823 71.201  1.00 14.75 ? 419  GLY B O     1 
ATOM   8119  N  N     . GLY B 1 420 ? 72.660  126.526 71.732  1.00 14.40 ? 420  GLY B N     1 
ATOM   8120  C  CA    . GLY B 1 420 ? 73.861  125.802 71.349  1.00 15.46 ? 420  GLY B CA    1 
ATOM   8121  C  C     . GLY B 1 420 ? 75.093  126.283 72.098  1.00 14.74 ? 420  GLY B C     1 
ATOM   8122  O  O     . GLY B 1 420 ? 75.002  127.171 72.948  1.00 15.22 ? 420  GLY B O     1 
ATOM   8123  N  N     . PHE B 1 421 ? 76.244  125.701 71.770  1.00 13.74 ? 421  PHE B N     1 
ATOM   8124  C  CA    . PHE B 1 421 ? 77.525  126.036 72.404  1.00 13.99 ? 421  PHE B CA    1 
ATOM   8125  C  C     . PHE B 1 421 ? 77.772  127.545 72.486  1.00 13.83 ? 421  PHE B C     1 
ATOM   8126  O  O     . PHE B 1 421 ? 77.533  128.267 71.521  1.00 13.54 ? 421  PHE B O     1 
ATOM   8127  C  CB    . PHE B 1 421 ? 78.670  125.371 71.632  1.00 12.46 ? 421  PHE B CB    1 
ATOM   8128  C  CG    . PHE B 1 421 ? 78.537  123.878 71.508  1.00 12.72 ? 421  PHE B CG    1 
ATOM   8129  C  CD1   . PHE B 1 421 ? 79.188  123.196 70.484  1.00 13.78 ? 421  PHE B CD1   1 
ATOM   8130  C  CD2   . PHE B 1 421 ? 77.745  123.151 72.401  1.00 11.16 ? 421  PHE B CD2   1 
ATOM   8131  C  CE1   . PHE B 1 421 ? 79.051  121.815 70.343  1.00 12.92 ? 421  PHE B CE1   1 
ATOM   8132  C  CE2   . PHE B 1 421 ? 77.604  121.769 72.268  1.00 11.71 ? 421  PHE B CE2   1 
ATOM   8133  C  CZ    . PHE B 1 421 ? 78.255  121.101 71.240  1.00 12.78 ? 421  PHE B CZ    1 
ATOM   8134  N  N     . MET B 1 422 ? 78.261  128.007 73.639  1.00 11.91 ? 422  MET B N     1 
ATOM   8135  C  CA    . MET B 1 422 ? 78.533  129.430 73.863  1.00 14.04 ? 422  MET B CA    1 
ATOM   8136  C  C     . MET B 1 422 ? 80.021  129.705 74.091  1.00 14.64 ? 422  MET B C     1 
ATOM   8137  O  O     . MET B 1 422 ? 80.599  130.580 73.451  1.00 15.05 ? 422  MET B O     1 
ATOM   8138  C  CB    . MET B 1 422 ? 77.720  129.934 75.060  1.00 14.14 ? 422  MET B CB    1 
ATOM   8139  C  CG    . MET B 1 422 ? 76.211  129.851 74.852  1.00 13.33 ? 422  MET B CG    1 
ATOM   8140  S  SD    . MET B 1 422 ? 75.638  130.925 73.506  1.00 15.04 ? 422  MET B SD    1 
ATOM   8141  C  CE    . MET B 1 422 ? 75.641  132.506 74.358  1.00 13.89 ? 422  MET B CE    1 
ATOM   8142  N  N     . ILE B 1 423 ? 80.626  128.978 75.026  1.00 15.41 ? 423  ILE B N     1 
ATOM   8143  C  CA    . ILE B 1 423 ? 82.056  129.112 75.298  1.00 16.33 ? 423  ILE B CA    1 
ATOM   8144  C  C     . ILE B 1 423 ? 82.573  127.692 75.132  1.00 16.71 ? 423  ILE B C     1 
ATOM   8145  O  O     . ILE B 1 423 ? 82.150  126.773 75.838  1.00 15.45 ? 423  ILE B O     1 
ATOM   8146  C  CB    . ILE B 1 423 ? 82.340  129.621 76.723  1.00 14.98 ? 423  ILE B CB    1 
ATOM   8147  C  CG1   . ILE B 1 423 ? 81.686  130.999 76.917  1.00 15.41 ? 423  ILE B CG1   1 
ATOM   8148  C  CG2   . ILE B 1 423 ? 83.852  129.729 76.939  1.00 15.73 ? 423  ILE B CG2   1 
ATOM   8149  C  CD1   . ILE B 1 423 ? 81.870  131.592 78.305  1.00 14.62 ? 423  ILE B CD1   1 
ATOM   8150  N  N     . THR B 1 424 ? 83.483  127.510 74.190  1.00 15.86 ? 424  THR B N     1 
ATOM   8151  C  CA    . THR B 1 424 ? 83.968  126.178 73.901  1.00 17.13 ? 424  THR B CA    1 
ATOM   8152  C  C     . THR B 1 424 ? 85.184  126.229 73.011  1.00 16.84 ? 424  THR B C     1 
ATOM   8153  O  O     . THR B 1 424 ? 85.382  127.186 72.267  1.00 16.73 ? 424  THR B O     1 
ATOM   8154  C  CB    . THR B 1 424 ? 82.890  125.384 73.145  1.00 18.44 ? 424  THR B CB    1 
ATOM   8155  O  OG1   . THR B 1 424 ? 83.408  124.113 72.741  1.00 19.65 ? 424  THR B OG1   1 
ATOM   8156  C  CG2   . THR B 1 424 ? 82.453  126.158 71.899  1.00 18.26 ? 424  THR B CG2   1 
ATOM   8157  N  N     . PRO B 1 425 ? 86.031  125.200 73.082  1.00 19.64 ? 425  PRO B N     1 
ATOM   8158  C  CA    . PRO B 1 425 ? 87.184  125.279 72.195  1.00 19.93 ? 425  PRO B CA    1 
ATOM   8159  C  C     . PRO B 1 425 ? 86.804  124.696 70.838  1.00 20.45 ? 425  PRO B C     1 
ATOM   8160  O  O     . PRO B 1 425 ? 85.740  124.081 70.685  1.00 18.48 ? 425  PRO B O     1 
ATOM   8161  C  CB    . PRO B 1 425 ? 88.230  124.440 72.922  1.00 22.93 ? 425  PRO B CB    1 
ATOM   8162  C  CG    . PRO B 1 425 ? 87.412  123.386 73.591  1.00 21.31 ? 425  PRO B CG    1 
ATOM   8163  C  CD    . PRO B 1 425 ? 86.219  124.162 74.113  1.00 19.77 ? 425  PRO B CD    1 
ATOM   8164  N  N     . LEU B 1 426 ? 87.641  124.952 69.843  1.00 19.62 ? 426  LEU B N     1 
ATOM   8165  C  CA    . LEU B 1 426 ? 87.462  124.384 68.518  1.00 20.10 ? 426  LEU B CA    1 
ATOM   8166  C  C     . LEU B 1 426 ? 88.731  123.551 68.470  1.00 21.02 ? 426  LEU B C     1 
ATOM   8167  O  O     . LEU B 1 426 ? 89.820  124.071 68.709  1.00 21.08 ? 426  LEU B O     1 
ATOM   8168  C  CB    . LEU B 1 426 ? 87.446  125.463 67.430  1.00 21.22 ? 426  LEU B CB    1 
ATOM   8169  C  CG    . LEU B 1 426 ? 86.039  125.944 67.048  1.00 22.33 ? 426  LEU B CG    1 
ATOM   8170  C  CD1   . LEU B 1 426 ? 85.384  126.631 68.236  1.00 20.25 ? 426  LEU B CD1   1 
ATOM   8171  C  CD2   . LEU B 1 426 ? 86.118  126.891 65.856  1.00 22.87 ? 426  LEU B CD2   1 
ATOM   8172  N  N     . PRO B 1 427 ? 88.603  122.246 68.185  1.00 21.34 ? 427  PRO B N     1 
ATOM   8173  C  CA    . PRO B 1 427 ? 89.709  121.285 68.117  1.00 22.39 ? 427  PRO B CA    1 
ATOM   8174  C  C     . PRO B 1 427 ? 90.996  121.690 67.413  1.00 22.56 ? 427  PRO B C     1 
ATOM   8175  O  O     . PRO B 1 427 ? 92.087  121.435 67.929  1.00 21.31 ? 427  PRO B O     1 
ATOM   8176  C  CB    . PRO B 1 427 ? 89.057  120.044 67.498  1.00 21.77 ? 427  PRO B CB    1 
ATOM   8177  C  CG    . PRO B 1 427 ? 87.929  120.606 66.696  1.00 23.04 ? 427  PRO B CG    1 
ATOM   8178  C  CD    . PRO B 1 427 ? 87.378  121.664 67.610  1.00 22.60 ? 427  PRO B CD    1 
ATOM   8179  N  N     . GLY B 1 428 ? 90.884  122.319 66.249  1.00 23.12 ? 428  GLY B N     1 
ATOM   8180  C  CA    . GLY B 1 428 ? 92.085  122.711 65.532  1.00 23.09 ? 428  GLY B CA    1 
ATOM   8181  C  C     . GLY B 1 428 ? 92.407  124.189 65.610  1.00 23.78 ? 428  GLY B C     1 
ATOM   8182  O  O     . GLY B 1 428 ? 93.284  124.673 64.893  1.00 25.03 ? 428  GLY B O     1 
ATOM   8183  N  N     . ALA B 1 429 ? 91.725  124.911 66.491  1.00 22.75 ? 429  ALA B N     1 
ATOM   8184  C  CA    . ALA B 1 429 ? 91.955  126.345 66.607  1.00 22.84 ? 429  ALA B CA    1 
ATOM   8185  C  C     . ALA B 1 429 ? 92.363  126.831 67.991  1.00 23.16 ? 429  ALA B C     1 
ATOM   8186  O  O     . ALA B 1 429 ? 93.071  127.831 68.112  1.00 23.51 ? 429  ALA B O     1 
ATOM   8187  C  CB    . ALA B 1 429 ? 90.711  127.095 66.149  1.00 22.55 ? 429  ALA B CB    1 
ATOM   8188  N  N     . ILE B 1 430 ? 91.930  126.130 69.035  1.00 23.09 ? 430  ILE B N     1 
ATOM   8189  C  CA    . ILE B 1 430 ? 92.243  126.550 70.399  1.00 22.32 ? 430  ILE B CA    1 
ATOM   8190  C  C     . ILE B 1 430 ? 92.964  125.498 71.238  1.00 23.22 ? 430  ILE B C     1 
ATOM   8191  O  O     . ILE B 1 430 ? 92.530  124.347 71.321  1.00 22.83 ? 430  ILE B O     1 
ATOM   8192  C  CB    . ILE B 1 430 ? 90.946  126.985 71.131  1.00 22.89 ? 430  ILE B CB    1 
ATOM   8193  C  CG1   . ILE B 1 430 ? 90.337  128.193 70.408  1.00 23.27 ? 430  ILE B CG1   1 
ATOM   8194  C  CG2   . ILE B 1 430 ? 91.238  127.316 72.594  1.00 22.45 ? 430  ILE B CG2   1 
ATOM   8195  C  CD1   . ILE B 1 430 ? 88.989  128.628 70.944  1.00 23.43 ? 430  ILE B CD1   1 
ATOM   8196  N  N     . GLU B 1 431 ? 94.074  125.902 71.854  1.00 22.37 ? 431  GLU B N     1 
ATOM   8197  C  CA    . GLU B 1 431 ? 94.836  124.998 72.706  1.00 21.18 ? 431  GLU B CA    1 
ATOM   8198  C  C     . GLU B 1 431 ? 94.035  124.817 73.982  1.00 19.96 ? 431  GLU B C     1 
ATOM   8199  O  O     . GLU B 1 431 ? 93.412  125.759 74.474  1.00 19.17 ? 431  GLU B O     1 
ATOM   8200  C  CB    . GLU B 1 431 ? 96.216  125.575 73.022  1.00 22.25 ? 431  GLU B CB    1 
ATOM   8201  C  CG    . GLU B 1 431 ? 97.125  125.694 71.812  1.00 25.16 ? 431  GLU B CG    1 
ATOM   8202  C  CD    . GLU B 1 431 ? 98.580  125.867 72.201  1.00 26.75 ? 431  GLU B CD    1 
ATOM   8203  O  OE1   . GLU B 1 431 ? 98.876  126.763 73.016  1.00 27.91 ? 431  GLU B OE1   1 
ATOM   8204  O  OE2   . GLU B 1 431 ? 99.428  125.105 71.692  1.00 29.55 ? 431  GLU B OE2   1 
ATOM   8205  N  N     . LEU B 1 432 ? 94.072  123.607 74.525  1.00 19.52 ? 432  LEU B N     1 
ATOM   8206  C  CA    . LEU B 1 432 ? 93.293  123.273 75.709  1.00 19.69 ? 432  LEU B CA    1 
ATOM   8207  C  C     . LEU B 1 432 ? 93.944  123.388 77.079  1.00 19.90 ? 432  LEU B C     1 
ATOM   8208  O  O     . LEU B 1 432 ? 95.139  123.140 77.253  1.00 22.03 ? 432  LEU B O     1 
ATOM   8209  C  CB    . LEU B 1 432 ? 92.751  121.850 75.548  1.00 17.87 ? 432  LEU B CB    1 
ATOM   8210  C  CG    . LEU B 1 432 ? 92.130  121.517 74.189  1.00 17.45 ? 432  LEU B CG    1 
ATOM   8211  C  CD1   . LEU B 1 432 ? 91.790  120.034 74.150  1.00 16.90 ? 432  LEU B CD1   1 
ATOM   8212  C  CD2   . LEU B 1 432 ? 90.887  122.367 73.950  1.00 18.64 ? 432  LEU B CD2   1 
ATOM   8213  N  N     . LYS B 1 433 ? 93.123  123.768 78.051  1.00 19.74 ? 433  LYS B N     1 
ATOM   8214  C  CA    . LYS B 1 433 ? 93.532  123.864 79.443  1.00 19.53 ? 433  LYS B CA    1 
ATOM   8215  C  C     . LYS B 1 433 ? 92.531  122.959 80.154  1.00 20.54 ? 433  LYS B C     1 
ATOM   8216  O  O     . LYS B 1 433 ? 91.318  123.153 80.045  1.00 19.18 ? 433  LYS B O     1 
ATOM   8217  C  CB    . LYS B 1 433 ? 93.413  125.298 79.971  1.00 20.51 ? 433  LYS B CB    1 
ATOM   8218  C  CG    . LYS B 1 433 ? 94.433  126.276 79.383  1.00 21.46 ? 433  LYS B CG    1 
ATOM   8219  C  CD    . LYS B 1 433 ? 94.392  127.620 80.102  1.00 21.23 ? 433  LYS B CD    1 
ATOM   8220  C  CE    . LYS B 1 433 ? 95.329  128.635 79.455  1.00 21.20 ? 433  LYS B CE    1 
ATOM   8221  N  NZ    . LYS B 1 433 ? 95.376  129.915 80.232  1.00 20.80 ? 433  LYS B NZ    1 
ATOM   8222  N  N     . ALA B 1 434 ? 93.034  121.955 80.860  1.00 21.14 ? 434  ALA B N     1 
ATOM   8223  C  CA    . ALA B 1 434 ? 92.163  121.019 81.559  1.00 19.65 ? 434  ALA B CA    1 
ATOM   8224  C  C     . ALA B 1 434 ? 91.191  121.729 82.492  1.00 19.86 ? 434  ALA B C     1 
ATOM   8225  O  O     . ALA B 1 434 ? 91.606  122.423 83.424  1.00 20.78 ? 434  ALA B O     1 
ATOM   8226  C  CB    . ALA B 1 434 ? 93.006  120.012 82.340  1.00 21.01 ? 434  ALA B CB    1 
ATOM   8227  N  N     . GLY B 1 435 ? 89.896  121.559 82.230  1.00 17.44 ? 435  GLY B N     1 
ATOM   8228  C  CA    . GLY B 1 435 ? 88.875  122.172 83.062  1.00 17.10 ? 435  GLY B CA    1 
ATOM   8229  C  C     . GLY B 1 435 ? 88.325  123.496 82.562  1.00 16.37 ? 435  GLY B C     1 
ATOM   8230  O  O     . GLY B 1 435 ? 87.401  124.052 83.161  1.00 16.14 ? 435  GLY B O     1 
ATOM   8231  N  N     . SER B 1 436 ? 88.873  124.002 81.464  1.00 15.11 ? 436  SER B N     1 
ATOM   8232  C  CA    . SER B 1 436 ? 88.426  125.285 80.912  1.00 15.22 ? 436  SER B CA    1 
ATOM   8233  C  C     . SER B 1 436 ? 87.594  125.177 79.632  1.00 13.26 ? 436  SER B C     1 
ATOM   8234  O  O     . SER B 1 436 ? 87.949  124.442 78.714  1.00 14.22 ? 436  SER B O     1 
ATOM   8235  C  CB    . SER B 1 436 ? 89.639  126.181 80.636  1.00 14.37 ? 436  SER B CB    1 
ATOM   8236  O  OG    . SER B 1 436 ? 89.242  127.382 79.994  1.00 18.61 ? 436  SER B OG    1 
ATOM   8237  N  N     . ALA B 1 437 ? 86.490  125.921 79.577  1.00 16.25 ? 437  ALA B N     1 
ATOM   8238  C  CA    . ALA B 1 437 ? 85.628  125.932 78.392  1.00 16.20 ? 437  ALA B CA    1 
ATOM   8239  C  C     . ALA B 1 437 ? 86.327  126.750 77.297  1.00 16.67 ? 437  ALA B C     1 
ATOM   8240  O  O     . ALA B 1 437 ? 85.959  126.704 76.119  1.00 16.10 ? 437  ALA B O     1 
ATOM   8241  C  CB    . ALA B 1 437 ? 84.274  126.550 78.731  1.00 15.70 ? 437  ALA B CB    1 
ATOM   8242  N  N     . THR B 1 438 ? 87.345  127.491 77.725  1.00 16.02 ? 438  THR B N     1 
ATOM   8243  C  CA    . THR B 1 438 ? 88.189  128.341 76.887  1.00 16.87 ? 438  THR B CA    1 
ATOM   8244  C  C     . THR B 1 438 ? 87.563  129.629 76.336  1.00 15.97 ? 438  THR B C     1 
ATOM   8245  O  O     . THR B 1 438 ? 87.179  130.501 77.113  1.00 17.00 ? 438  THR B O     1 
ATOM   8246  C  CB    . THR B 1 438 ? 88.874  127.529 75.730  1.00 15.81 ? 438  THR B CB    1 
ATOM   8247  O  OG1   . THR B 1 438 ? 87.936  127.238 74.689  1.00 17.98 ? 438  THR B OG1   1 
ATOM   8248  C  CG2   . THR B 1 438 ? 89.446  126.215 76.273  1.00 15.28 ? 438  THR B CG2   1 
ATOM   8249  N  N     . ARG B 1 439 ? 87.455  129.754 75.015  1.00 17.07 ? 439  ARG B N     1 
ATOM   8250  C  CA    . ARG B 1 439 ? 86.932  130.983 74.407  1.00 17.96 ? 439  ARG B CA    1 
ATOM   8251  C  C     . ARG B 1 439 ? 85.511  130.958 73.844  1.00 16.51 ? 439  ARG B C     1 
ATOM   8252  O  O     . ARG B 1 439 ? 84.987  129.908 73.478  1.00 17.41 ? 439  ARG B O     1 
ATOM   8253  C  CB    . ARG B 1 439 ? 87.874  131.436 73.290  1.00 19.20 ? 439  ARG B CB    1 
ATOM   8254  C  CG    . ARG B 1 439 ? 89.316  131.660 73.714  1.00 22.74 ? 439  ARG B CG    1 
ATOM   8255  C  CD    . ARG B 1 439 ? 90.157  132.029 72.499  1.00 25.20 ? 439  ARG B CD    1 
ATOM   8256  N  NE    . ARG B 1 439 ? 91.582  132.132 72.803  1.00 28.48 ? 439  ARG B NE    1 
ATOM   8257  C  CZ    . ARG B 1 439 ? 92.115  133.045 73.609  1.00 29.50 ? 439  ARG B CZ    1 
ATOM   8258  N  NH1   . ARG B 1 439 ? 91.344  133.947 74.204  1.00 30.87 ? 439  ARG B NH1   1 
ATOM   8259  N  NH2   . ARG B 1 439 ? 93.425  133.059 73.814  1.00 31.55 ? 439  ARG B NH2   1 
ATOM   8260  N  N     . PRO B 1 440 ? 84.874  132.137 73.750  1.00 16.42 ? 440  PRO B N     1 
ATOM   8261  C  CA    . PRO B 1 440 ? 83.510  132.207 73.217  1.00 16.47 ? 440  PRO B CA    1 
ATOM   8262  C  C     . PRO B 1 440 ? 83.419  131.807 71.744  1.00 16.04 ? 440  PRO B C     1 
ATOM   8263  O  O     . PRO B 1 440 ? 84.366  131.995 70.974  1.00 15.33 ? 440  PRO B O     1 
ATOM   8264  C  CB    . PRO B 1 440 ? 83.128  133.667 73.441  1.00 14.96 ? 440  PRO B CB    1 
ATOM   8265  C  CG    . PRO B 1 440 ? 84.465  134.387 73.315  1.00 16.09 ? 440  PRO B CG    1 
ATOM   8266  C  CD    . PRO B 1 440 ? 85.353  133.476 74.144  1.00 17.51 ? 440  PRO B CD    1 
ATOM   8267  N  N     . PHE B 1 441 ? 82.273  131.251 71.365  1.00 15.37 ? 441  PHE B N     1 
ATOM   8268  C  CA    . PHE B 1 441 ? 82.027  130.841 69.983  1.00 14.92 ? 441  PHE B CA    1 
ATOM   8269  C  C     . PHE B 1 441 ? 81.684  132.088 69.166  1.00 14.73 ? 441  PHE B C     1 
ATOM   8270  O  O     . PHE B 1 441 ? 81.441  133.160 69.723  1.00 15.09 ? 441  PHE B O     1 
ATOM   8271  C  CB    . PHE B 1 441 ? 80.847  129.860 69.919  1.00 13.79 ? 441  PHE B CB    1 
ATOM   8272  C  CG    . PHE B 1 441 ? 80.689  129.182 68.584  1.00 15.44 ? 441  PHE B CG    1 
ATOM   8273  C  CD1   . PHE B 1 441 ? 81.615  128.235 68.160  1.00 15.89 ? 441  PHE B CD1   1 
ATOM   8274  C  CD2   . PHE B 1 441 ? 79.629  129.507 67.743  1.00 15.57 ? 441  PHE B CD2   1 
ATOM   8275  C  CE1   . PHE B 1 441 ? 81.489  127.622 66.915  1.00 17.10 ? 441  PHE B CE1   1 
ATOM   8276  C  CE2   . PHE B 1 441 ? 79.494  128.898 66.494  1.00 15.31 ? 441  PHE B CE2   1 
ATOM   8277  C  CZ    . PHE B 1 441 ? 80.425  127.957 66.080  1.00 16.21 ? 441  PHE B CZ    1 
ATOM   8278  N  N     . PHE B 1 442 ? 81.663  131.940 67.846  1.00 16.34 ? 442  PHE B N     1 
ATOM   8279  C  CA    . PHE B 1 442 ? 81.333  133.048 66.953  1.00 15.59 ? 442  PHE B CA    1 
ATOM   8280  C  C     . PHE B 1 442 ? 79.991  133.662 67.347  1.00 15.76 ? 442  PHE B C     1 
ATOM   8281  O  O     . PHE B 1 442 ? 79.025  132.939 67.595  1.00 15.28 ? 442  PHE B O     1 
ATOM   8282  C  CB    . PHE B 1 442 ? 81.241  132.536 65.516  1.00 17.72 ? 442  PHE B CB    1 
ATOM   8283  C  CG    . PHE B 1 442 ? 82.476  131.828 65.043  1.00 17.74 ? 442  PHE B CG    1 
ATOM   8284  C  CD1   . PHE B 1 442 ? 82.375  130.676 64.269  1.00 19.12 ? 442  PHE B CD1   1 
ATOM   8285  C  CD2   . PHE B 1 442 ? 83.741  132.321 65.354  1.00 20.59 ? 442  PHE B CD2   1 
ATOM   8286  C  CE1   . PHE B 1 442 ? 83.517  130.022 63.811  1.00 21.93 ? 442  PHE B CE1   1 
ATOM   8287  C  CE2   . PHE B 1 442 ? 84.890  131.674 64.900  1.00 22.13 ? 442  PHE B CE2   1 
ATOM   8288  C  CZ    . PHE B 1 442 ? 84.779  130.523 64.128  1.00 20.84 ? 442  PHE B CZ    1 
ATOM   8289  N  N     . GLY B 1 443 ? 79.943  134.990 67.407  1.00 15.10 ? 443  GLY B N     1 
ATOM   8290  C  CA    . GLY B 1 443 ? 78.715  135.688 67.745  1.00 14.94 ? 443  GLY B CA    1 
ATOM   8291  C  C     . GLY B 1 443 ? 78.398  135.793 69.225  1.00 15.82 ? 443  GLY B C     1 
ATOM   8292  O  O     . GLY B 1 443 ? 77.386  136.380 69.604  1.00 16.72 ? 443  GLY B O     1 
ATOM   8293  N  N     . VAL B 1 444 ? 79.261  135.238 70.066  1.00 14.91 ? 444  VAL B N     1 
ATOM   8294  C  CA    . VAL B 1 444 ? 79.044  135.265 71.508  1.00 14.39 ? 444  VAL B CA    1 
ATOM   8295  C  C     . VAL B 1 444 ? 79.964  136.272 72.183  1.00 15.13 ? 444  VAL B C     1 
ATOM   8296  O  O     . VAL B 1 444 ? 81.186  136.171 72.075  1.00 15.30 ? 444  VAL B O     1 
ATOM   8297  C  CB    . VAL B 1 444 ? 79.298  133.866 72.130  1.00 15.48 ? 444  VAL B CB    1 
ATOM   8298  C  CG1   . VAL B 1 444 ? 79.014  133.894 73.628  1.00 14.29 ? 444  VAL B CG1   1 
ATOM   8299  C  CG2   . VAL B 1 444 ? 78.423  132.827 71.435  1.00 14.52 ? 444  VAL B CG2   1 
ATOM   8300  N  N     . GLN B 1 445 ? 79.370  137.241 72.873  1.00 16.46 ? 445  GLN B N     1 
ATOM   8301  C  CA    . GLN B 1 445 ? 80.146  138.256 73.578  1.00 18.07 ? 445  GLN B CA    1 
ATOM   8302  C  C     . GLN B 1 445 ? 79.960  138.107 75.083  1.00 16.99 ? 445  GLN B C     1 
ATOM   8303  O  O     . GLN B 1 445 ? 79.052  138.700 75.667  1.00 16.76 ? 445  GLN B O     1 
ATOM   8304  C  CB    . GLN B 1 445 ? 79.712  139.662 73.155  1.00 20.31 ? 445  GLN B CB    1 
ATOM   8305  C  CG    . GLN B 1 445 ? 79.882  139.965 71.673  1.00 24.35 ? 445  GLN B CG    1 
ATOM   8306  C  CD    . GLN B 1 445 ? 79.762  141.457 71.365  1.00 27.32 ? 445  GLN B CD    1 
ATOM   8307  O  OE1   . GLN B 1 445 ? 80.599  142.257 71.787  1.00 31.29 ? 445  GLN B OE1   1 
ATOM   8308  N  NE2   . GLN B 1 445 ? 78.720  141.832 70.634  1.00 26.84 ? 445  GLN B NE2   1 
ATOM   8309  N  N     . PRO B 1 446 ? 80.818  137.305 75.732  1.00 16.54 ? 446  PRO B N     1 
ATOM   8310  C  CA    . PRO B 1 446 ? 80.711  137.106 77.179  1.00 16.56 ? 446  PRO B CA    1 
ATOM   8311  C  C     . PRO B 1 446 ? 81.356  138.243 77.961  1.00 17.78 ? 446  PRO B C     1 
ATOM   8312  O  O     . PRO B 1 446 ? 82.185  138.979 77.429  1.00 18.95 ? 446  PRO B O     1 
ATOM   8313  C  CB    . PRO B 1 446 ? 81.441  135.785 77.395  1.00 16.75 ? 446  PRO B CB    1 
ATOM   8314  C  CG    . PRO B 1 446 ? 82.559  135.888 76.401  1.00 17.61 ? 446  PRO B CG    1 
ATOM   8315  C  CD    . PRO B 1 446 ? 81.869  136.442 75.160  1.00 16.56 ? 446  PRO B CD    1 
ATOM   8316  N  N     . ALA B 1 447 ? 80.957  138.384 79.220  1.00 16.86 ? 447  ALA B N     1 
ATOM   8317  C  CA    . ALA B 1 447 ? 81.513  139.400 80.099  1.00 17.74 ? 447  ALA B CA    1 
ATOM   8318  C  C     . ALA B 1 447 ? 81.307  138.947 81.535  1.00 17.06 ? 447  ALA B C     1 
ATOM   8319  O  O     . ALA B 1 447 ? 80.445  138.116 81.811  1.00 17.50 ? 447  ALA B O     1 
ATOM   8320  C  CB    . ALA B 1 447 ? 80.830  140.746 79.871  1.00 18.48 ? 447  ALA B CB    1 
ATOM   8321  N  N     . LEU B 1 448 ? 82.120  139.477 82.441  1.00 15.82 ? 448  LEU B N     1 
ATOM   8322  C  CA    . LEU B 1 448 ? 82.005  139.149 83.854  1.00 16.00 ? 448  LEU B CA    1 
ATOM   8323  C  C     . LEU B 1 448 ? 81.702  140.457 84.569  1.00 16.30 ? 448  LEU B C     1 
ATOM   8324  O  O     . LEU B 1 448 ? 82.452  141.423 84.450  1.00 16.50 ? 448  LEU B O     1 
ATOM   8325  C  CB    . LEU B 1 448 ? 83.314  138.548 84.374  1.00 16.15 ? 448  LEU B CB    1 
ATOM   8326  C  CG    . LEU B 1 448 ? 83.816  137.295 83.651  1.00 17.30 ? 448  LEU B CG    1 
ATOM   8327  C  CD1   . LEU B 1 448 ? 85.148  136.870 84.247  1.00 18.82 ? 448  LEU B CD1   1 
ATOM   8328  C  CD2   . LEU B 1 448 ? 82.788  136.174 83.768  1.00 18.26 ? 448  LEU B CD2   1 
ATOM   8329  N  N     . VAL B 1 449 ? 80.590  140.494 85.293  1.00 15.78 ? 449  VAL B N     1 
ATOM   8330  C  CA    . VAL B 1 449 ? 80.197  141.701 86.004  1.00 17.02 ? 449  VAL B CA    1 
ATOM   8331  C  C     . VAL B 1 449 ? 80.064  141.440 87.496  1.00 18.46 ? 449  VAL B C     1 
ATOM   8332  O  O     . VAL B 1 449 ? 79.745  140.325 87.910  1.00 18.53 ? 449  VAL B O     1 
ATOM   8333  C  CB    . VAL B 1 449 ? 78.845  142.245 85.469  1.00 16.20 ? 449  VAL B CB    1 
ATOM   8334  C  CG1   . VAL B 1 449 ? 78.979  142.623 84.004  1.00 16.83 ? 449  VAL B CG1   1 
ATOM   8335  C  CG2   . VAL B 1 449 ? 77.747  141.196 85.647  1.00 15.62 ? 449  VAL B CG2   1 
ATOM   8336  N  N     . ASP B 1 450 ? 80.329  142.457 88.310  1.00 17.14 ? 450  ASP B N     1 
ATOM   8337  C  CA    . ASP B 1 450 ? 80.187  142.288 89.748  1.00 19.37 ? 450  ASP B CA    1 
ATOM   8338  C  C     . ASP B 1 450 ? 78.695  142.302 90.069  1.00 22.13 ? 450  ASP B C     1 
ATOM   8339  O  O     . ASP B 1 450 ? 77.862  142.284 89.157  1.00 22.00 ? 450  ASP B O     1 
ATOM   8340  C  CB    . ASP B 1 450 ? 80.929  143.393 90.520  1.00 20.22 ? 450  ASP B CB    1 
ATOM   8341  C  CG    . ASP B 1 450 ? 80.537  144.796 90.082  1.00 21.44 ? 450  ASP B CG    1 
ATOM   8342  O  OD1   . ASP B 1 450 ? 79.366  145.010 89.715  1.00 19.01 ? 450  ASP B OD1   1 
ATOM   8343  O  OD2   . ASP B 1 450 ? 81.403  145.696 90.133  1.00 22.57 ? 450  ASP B OD2   1 
ATOM   8344  N  N     . ASN B 1 451 ? 78.345  142.325 91.350  1.00 22.24 ? 451  ASN B N     1 
ATOM   8345  C  CA    . ASN B 1 451 ? 76.937  142.318 91.720  1.00 24.84 ? 451  ASN B CA    1 
ATOM   8346  C  C     . ASN B 1 451 ? 76.212  143.624 91.422  1.00 25.42 ? 451  ASN B C     1 
ATOM   8347  O  O     . ASN B 1 451 ? 74.991  143.703 91.553  1.00 25.43 ? 451  ASN B O     1 
ATOM   8348  C  CB    . ASN B 1 451 ? 76.773  141.936 93.193  1.00 25.31 ? 451  ASN B CB    1 
ATOM   8349  C  CG    . ASN B 1 451 ? 77.138  140.486 93.454  1.00 26.62 ? 451  ASN B CG    1 
ATOM   8350  O  OD1   . ASN B 1 451 ? 76.967  139.629 92.587  1.00 26.24 ? 451  ASN B OD1   1 
ATOM   8351  N  ND2   . ASN B 1 451 ? 77.628  140.201 94.654  1.00 28.30 ? 451  ASN B ND2   1 
ATOM   8352  N  N     . GLU B 1 452 ? 76.968  144.638 91.012  1.00 26.97 ? 452  GLU B N     1 
ATOM   8353  C  CA    . GLU B 1 452 ? 76.395  145.935 90.664  1.00 28.67 ? 452  GLU B CA    1 
ATOM   8354  C  C     . GLU B 1 452 ? 76.244  146.049 89.151  1.00 27.38 ? 452  GLU B C     1 
ATOM   8355  O  O     . GLU B 1 452 ? 75.742  147.052 88.640  1.00 27.60 ? 452  GLU B O     1 
ATOM   8356  C  CB    . GLU B 1 452 ? 77.281  147.079 91.167  1.00 32.17 ? 452  GLU B CB    1 
ATOM   8357  C  CG    . GLU B 1 452 ? 77.002  147.530 92.592  1.00 37.25 ? 452  GLU B CG    1 
ATOM   8358  C  CD    . GLU B 1 452 ? 77.359  146.485 93.624  1.00 40.74 ? 452  GLU B CD    1 
ATOM   8359  O  OE1   . GLU B 1 452 ? 78.523  146.028 93.629  1.00 41.90 ? 452  GLU B OE1   1 
ATOM   8360  O  OE2   . GLU B 1 452 ? 76.478  146.125 94.434  1.00 42.24 ? 452  GLU B OE2   1 
ATOM   8361  N  N     . GLY B 1 453 ? 76.691  145.022 88.435  1.00 25.76 ? 453  GLY B N     1 
ATOM   8362  C  CA    . GLY B 1 453 ? 76.587  145.036 86.989  1.00 23.03 ? 453  GLY B CA    1 
ATOM   8363  C  C     . GLY B 1 453 ? 77.765  145.685 86.288  1.00 22.95 ? 453  GLY B C     1 
ATOM   8364  O  O     . GLY B 1 453 ? 77.755  145.838 85.067  1.00 20.85 ? 453  GLY B O     1 
ATOM   8365  N  N     . HIS B 1 454 ? 78.787  146.069 87.046  1.00 22.15 ? 454  HIS B N     1 
ATOM   8366  C  CA    . HIS B 1 454 ? 79.958  146.700 86.448  1.00 23.67 ? 454  HIS B CA    1 
ATOM   8367  C  C     . HIS B 1 454 ? 80.889  145.647 85.850  1.00 22.60 ? 454  HIS B C     1 
ATOM   8368  O  O     . HIS B 1 454 ? 81.291  144.699 86.527  1.00 22.55 ? 454  HIS B O     1 
ATOM   8369  C  CB    . HIS B 1 454 ? 80.724  147.521 87.492  1.00 24.84 ? 454  HIS B CB    1 
ATOM   8370  C  CG    . HIS B 1 454 ? 79.885  148.544 88.192  1.00 29.27 ? 454  HIS B CG    1 
ATOM   8371  N  ND1   . HIS B 1 454 ? 79.130  149.480 87.517  1.00 29.89 ? 454  HIS B ND1   1 
ATOM   8372  C  CD2   . HIS B 1 454 ? 79.682  148.779 89.511  1.00 30.84 ? 454  HIS B CD2   1 
ATOM   8373  C  CE1   . HIS B 1 454 ? 78.498  150.245 88.389  1.00 29.71 ? 454  HIS B CE1   1 
ATOM   8374  N  NE2   . HIS B 1 454 ? 78.816  149.842 89.606  1.00 29.52 ? 454  HIS B NE2   1 
ATOM   8375  N  N     . PRO B 1 455 ? 81.242  145.800 84.567  1.00 24.07 ? 455  PRO B N     1 
ATOM   8376  C  CA    . PRO B 1 455 ? 82.134  144.839 83.917  1.00 23.66 ? 455  PRO B CA    1 
ATOM   8377  C  C     . PRO B 1 455 ? 83.507  144.795 84.576  1.00 24.01 ? 455  PRO B C     1 
ATOM   8378  O  O     . PRO B 1 455 ? 84.082  145.833 84.904  1.00 23.77 ? 455  PRO B O     1 
ATOM   8379  C  CB    . PRO B 1 455 ? 82.197  145.344 82.476  1.00 25.58 ? 455  PRO B CB    1 
ATOM   8380  C  CG    . PRO B 1 455 ? 81.995  146.823 82.627  1.00 27.57 ? 455  PRO B CG    1 
ATOM   8381  C  CD    . PRO B 1 455 ? 80.872  146.881 83.638  1.00 26.23 ? 455  PRO B CD    1 
ATOM   8382  N  N     . GLN B 1 456 ? 84.016  143.583 84.778  1.00 22.34 ? 456  GLN B N     1 
ATOM   8383  C  CA    . GLN B 1 456 ? 85.326  143.378 85.387  1.00 22.99 ? 456  GLN B CA    1 
ATOM   8384  C  C     . GLN B 1 456 ? 86.282  143.026 84.254  1.00 23.94 ? 456  GLN B C     1 
ATOM   8385  O  O     . GLN B 1 456 ? 86.015  142.109 83.477  1.00 24.82 ? 456  GLN B O     1 
ATOM   8386  C  CB    . GLN B 1 456 ? 85.259  142.232 86.399  1.00 21.34 ? 456  GLN B CB    1 
ATOM   8387  C  CG    . GLN B 1 456 ? 84.180  142.394 87.467  1.00 21.27 ? 456  GLN B CG    1 
ATOM   8388  C  CD    . GLN B 1 456 ? 84.362  143.651 88.304  1.00 24.79 ? 456  GLN B CD    1 
ATOM   8389  O  OE1   . GLN B 1 456 ? 83.678  144.660 88.101  1.00 25.31 ? 456  GLN B OE1   1 
ATOM   8390  N  NE2   . GLN B 1 456 ? 85.297  143.598 89.244  1.00 24.60 ? 456  GLN B NE2   1 
ATOM   8391  N  N     . GLU B 1 457 ? 87.396  143.747 84.159  1.00 24.71 ? 457  GLU B N     1 
ATOM   8392  C  CA    . GLU B 1 457 ? 88.357  143.517 83.084  1.00 26.21 ? 457  GLU B CA    1 
ATOM   8393  C  C     . GLU B 1 457 ? 89.584  142.706 83.483  1.00 25.58 ? 457  GLU B C     1 
ATOM   8394  O  O     . GLU B 1 457 ? 89.873  142.534 84.666  1.00 25.57 ? 457  GLU B O     1 
ATOM   8395  C  CB    . GLU B 1 457 ? 88.812  144.858 82.499  1.00 29.12 ? 457  GLU B CB    1 
ATOM   8396  C  CG    . GLU B 1 457 ? 87.679  145.776 82.054  1.00 35.02 ? 457  GLU B CG    1 
ATOM   8397  C  CD    . GLU B 1 457 ? 86.705  145.098 81.101  1.00 38.05 ? 457  GLU B CD    1 
ATOM   8398  O  OE1   . GLU B 1 457 ? 87.161  144.423 80.153  1.00 40.61 ? 457  GLU B OE1   1 
ATOM   8399  O  OE2   . GLU B 1 457 ? 85.482  145.248 81.296  1.00 40.79 ? 457  GLU B OE2   1 
ATOM   8400  N  N     . GLY B 1 458 ? 90.303  142.220 82.474  1.00 24.88 ? 458  GLY B N     1 
ATOM   8401  C  CA    . GLY B 1 458 ? 91.501  141.433 82.701  1.00 25.67 ? 458  GLY B CA    1 
ATOM   8402  C  C     . GLY B 1 458 ? 91.217  140.110 83.387  1.00 25.02 ? 458  GLY B C     1 
ATOM   8403  O  O     . GLY B 1 458 ? 90.070  139.663 83.432  1.00 25.11 ? 458  GLY B O     1 
ATOM   8404  N  N     . ALA B 1 459 ? 92.263  139.476 83.909  1.00 23.15 ? 459  ALA B N     1 
ATOM   8405  C  CA    . ALA B 1 459 ? 92.104  138.207 84.615  1.00 23.83 ? 459  ALA B CA    1 
ATOM   8406  C  C     . ALA B 1 459 ? 91.312  138.521 85.878  1.00 23.46 ? 459  ALA B C     1 
ATOM   8407  O  O     . ALA B 1 459 ? 91.813  139.197 86.775  1.00 24.07 ? 459  ALA B O     1 
ATOM   8408  C  CB    . ALA B 1 459 ? 93.469  137.629 84.972  1.00 24.36 ? 459  ALA B CB    1 
ATOM   8409  N  N     . THR B 1 460 ? 90.076  138.037 85.946  1.00 21.47 ? 460  THR B N     1 
ATOM   8410  C  CA    . THR B 1 460 ? 89.221  138.315 87.094  1.00 21.79 ? 460  THR B CA    1 
ATOM   8411  C  C     . THR B 1 460 ? 88.097  137.282 87.180  1.00 21.45 ? 460  THR B C     1 
ATOM   8412  O  O     . THR B 1 460 ? 88.177  136.216 86.567  1.00 20.63 ? 460  THR B O     1 
ATOM   8413  C  CB    . THR B 1 460 ? 88.626  139.747 86.964  1.00 21.73 ? 460  THR B CB    1 
ATOM   8414  O  OG1   . THR B 1 460 ? 87.850  140.076 88.123  1.00 24.29 ? 460  THR B OG1   1 
ATOM   8415  C  CG2   . THR B 1 460 ? 87.761  139.842 85.721  1.00 21.31 ? 460  THR B CG2   1 
ATOM   8416  N  N     . GLU B 1 461 ? 87.063  137.585 87.957  1.00 20.74 ? 461  GLU B N     1 
ATOM   8417  C  CA    . GLU B 1 461 ? 85.928  136.677 88.092  1.00 22.68 ? 461  GLU B CA    1 
ATOM   8418  C  C     . GLU B 1 461 ? 84.671  137.448 88.458  1.00 20.92 ? 461  GLU B C     1 
ATOM   8419  O  O     . GLU B 1 461 ? 84.742  138.535 89.031  1.00 22.00 ? 461  GLU B O     1 
ATOM   8420  C  CB    . GLU B 1 461 ? 86.197  135.601 89.156  1.00 26.25 ? 461  GLU B CB    1 
ATOM   8421  C  CG    . GLU B 1 461 ? 86.544  136.124 90.544  1.00 33.65 ? 461  GLU B CG    1 
ATOM   8422  C  CD    . GLU B 1 461 ? 88.006  136.505 90.672  1.00 38.24 ? 461  GLU B CD    1 
ATOM   8423  O  OE1   . GLU B 1 461 ? 88.866  135.665 90.328  1.00 40.70 ? 461  GLU B OE1   1 
ATOM   8424  O  OE2   . GLU B 1 461 ? 88.298  137.635 91.120  1.00 41.17 ? 461  GLU B OE2   1 
ATOM   8425  N  N     . GLY B 1 462 ? 83.519  136.880 88.119  1.00 18.91 ? 462  GLY B N     1 
ATOM   8426  C  CA    . GLY B 1 462 ? 82.262  137.531 88.428  1.00 17.46 ? 462  GLY B CA    1 
ATOM   8427  C  C     . GLY B 1 462 ? 81.086  136.789 87.824  1.00 17.75 ? 462  GLY B C     1 
ATOM   8428  O  O     . GLY B 1 462 ? 81.181  135.608 87.488  1.00 17.60 ? 462  GLY B O     1 
ATOM   8429  N  N     . ASN B 1 463 ? 79.972  137.490 87.684  1.00 17.65 ? 463  ASN B N     1 
ATOM   8430  C  CA    . ASN B 1 463 ? 78.770  136.900 87.116  1.00 18.21 ? 463  ASN B CA    1 
ATOM   8431  C  C     . ASN B 1 463 ? 78.900  136.835 85.599  1.00 18.25 ? 463  ASN B C     1 
ATOM   8432  O  O     . ASN B 1 463 ? 79.211  137.835 84.951  1.00 16.41 ? 463  ASN B O     1 
ATOM   8433  C  CB    . ASN B 1 463 ? 77.563  137.734 87.533  1.00 17.79 ? 463  ASN B CB    1 
ATOM   8434  C  CG    . ASN B 1 463 ? 77.415  137.803 89.040  1.00 19.23 ? 463  ASN B CG    1 
ATOM   8435  O  OD1   . ASN B 1 463 ? 77.178  136.787 89.692  1.00 20.65 ? 463  ASN B OD1   1 
ATOM   8436  N  ND2   . ASN B 1 463 ? 77.569  138.998 89.603  1.00 16.38 ? 463  ASN B ND2   1 
ATOM   8437  N  N     . LEU B 1 464 ? 78.667  135.652 85.035  1.00 16.61 ? 464  LEU B N     1 
ATOM   8438  C  CA    . LEU B 1 464 ? 78.781  135.462 83.593  1.00 18.28 ? 464  LEU B CA    1 
ATOM   8439  C  C     . LEU B 1 464 ? 77.539  135.927 82.841  1.00 17.79 ? 464  LEU B C     1 
ATOM   8440  O  O     . LEU B 1 464 ? 76.439  135.408 83.046  1.00 16.80 ? 464  LEU B O     1 
ATOM   8441  C  CB    . LEU B 1 464 ? 79.056  133.986 83.275  1.00 18.10 ? 464  LEU B CB    1 
ATOM   8442  C  CG    . LEU B 1 464 ? 79.178  133.591 81.800  1.00 17.02 ? 464  LEU B CG    1 
ATOM   8443  C  CD1   . LEU B 1 464 ? 80.245  134.430 81.111  1.00 17.44 ? 464  LEU B CD1   1 
ATOM   8444  C  CD2   . LEU B 1 464 ? 79.517  132.110 81.705  1.00 17.47 ? 464  LEU B CD2   1 
ATOM   8445  N  N     . VAL B 1 465 ? 77.732  136.915 81.972  1.00 17.93 ? 465  VAL B N     1 
ATOM   8446  C  CA    . VAL B 1 465 ? 76.647  137.463 81.167  1.00 15.73 ? 465  VAL B CA    1 
ATOM   8447  C  C     . VAL B 1 465 ? 77.061  137.469 79.696  1.00 16.72 ? 465  VAL B C     1 
ATOM   8448  O  O     . VAL B 1 465 ? 78.241  137.328 79.371  1.00 15.94 ? 465  VAL B O     1 
ATOM   8449  C  CB    . VAL B 1 465 ? 76.306  138.922 81.586  1.00 16.47 ? 465  VAL B CB    1 
ATOM   8450  C  CG1   . VAL B 1 465 ? 75.832  138.956 83.032  1.00 16.92 ? 465  VAL B CG1   1 
ATOM   8451  C  CG2   . VAL B 1 465 ? 77.529  139.824 81.403  1.00 15.72 ? 465  VAL B CG2   1 
ATOM   8452  N  N     . ILE B 1 466 ? 76.076  137.602 78.814  1.00 15.12 ? 466  ILE B N     1 
ATOM   8453  C  CA    . ILE B 1 466 ? 76.328  137.678 77.379  1.00 14.78 ? 466  ILE B CA    1 
ATOM   8454  C  C     . ILE B 1 466 ? 75.720  139.037 77.045  1.00 13.96 ? 466  ILE B C     1 
ATOM   8455  O  O     . ILE B 1 466 ? 74.540  139.269 77.301  1.00 14.33 ? 466  ILE B O     1 
ATOM   8456  C  CB    . ILE B 1 466 ? 75.607  136.551 76.606  1.00 14.29 ? 466  ILE B CB    1 
ATOM   8457  C  CG1   . ILE B 1 466 ? 75.945  135.187 77.222  1.00 12.46 ? 466  ILE B CG1   1 
ATOM   8458  C  CG2   . ILE B 1 466 ? 76.031  136.581 75.138  1.00 14.85 ? 466  ILE B CG2   1 
ATOM   8459  C  CD1   . ILE B 1 466 ? 77.431  134.808 77.162  1.00 14.02 ? 466  ILE B CD1   1 
ATOM   8460  N  N     . THR B 1 467 ? 76.529  139.934 76.492  1.00 15.20 ? 467  THR B N     1 
ATOM   8461  C  CA    . THR B 1 467 ? 76.080  141.294 76.220  1.00 15.79 ? 467  THR B CA    1 
ATOM   8462  C  C     . THR B 1 467 ? 75.300  141.584 74.950  1.00 16.32 ? 467  THR B C     1 
ATOM   8463  O  O     . THR B 1 467 ? 74.873  142.717 74.736  1.00 16.66 ? 467  THR B O     1 
ATOM   8464  C  CB    . THR B 1 467 ? 77.264  142.271 76.299  1.00 16.87 ? 467  THR B CB    1 
ATOM   8465  O  OG1   . THR B 1 467 ? 78.238  141.938 75.301  1.00 14.07 ? 467  THR B OG1   1 
ATOM   8466  C  CG2   . THR B 1 467 ? 77.907  142.191 77.681  1.00 19.70 ? 467  THR B CG2   1 
ATOM   8467  N  N     . ASP B 1 468 ? 75.118  140.579 74.107  1.00 16.11 ? 468  ASP B N     1 
ATOM   8468  C  CA    . ASP B 1 468 ? 74.348  140.765 72.885  1.00 17.95 ? 468  ASP B CA    1 
ATOM   8469  C  C     . ASP B 1 468 ? 73.766  139.418 72.510  1.00 15.85 ? 468  ASP B C     1 
ATOM   8470  O  O     . ASP B 1 468 ? 74.152  138.394 73.072  1.00 15.98 ? 468  ASP B O     1 
ATOM   8471  C  CB    . ASP B 1 468 ? 75.218  141.278 71.738  1.00 18.00 ? 468  ASP B CB    1 
ATOM   8472  C  CG    . ASP B 1 468 ? 74.422  142.109 70.738  1.00 22.44 ? 468  ASP B CG    1 
ATOM   8473  O  OD1   . ASP B 1 468 ? 73.222  141.814 70.529  1.00 20.21 ? 468  ASP B OD1   1 
ATOM   8474  O  OD2   . ASP B 1 468 ? 74.996  143.059 70.161  1.00 23.93 ? 468  ASP B OD2   1 
ATOM   8475  N  N     . SER B 1 469 ? 72.849  139.421 71.551  1.00 15.81 ? 469  SER B N     1 
ATOM   8476  C  CA    . SER B 1 469 ? 72.201  138.190 71.121  1.00 15.29 ? 469  SER B CA    1 
ATOM   8477  C  C     . SER B 1 469 ? 73.045  137.352 70.164  1.00 15.62 ? 469  SER B C     1 
ATOM   8478  O  O     . SER B 1 469 ? 74.065  137.810 69.637  1.00 16.33 ? 469  SER B O     1 
ATOM   8479  C  CB    . SER B 1 469 ? 70.858  138.523 70.463  1.00 13.82 ? 469  SER B CB    1 
ATOM   8480  O  OG    . SER B 1 469 ? 70.091  137.357 70.222  1.00 14.16 ? 469  SER B OG    1 
ATOM   8481  N  N     . TRP B 1 470 ? 72.612  136.107 69.978  1.00 15.12 ? 470  TRP B N     1 
ATOM   8482  C  CA    . TRP B 1 470 ? 73.240  135.152 69.068  1.00 14.22 ? 470  TRP B CA    1 
ATOM   8483  C  C     . TRP B 1 470 ? 72.044  134.397 68.469  1.00 14.33 ? 470  TRP B C     1 
ATOM   8484  O  O     . TRP B 1 470 ? 70.986  134.307 69.094  1.00 14.02 ? 470  TRP B O     1 
ATOM   8485  C  CB    . TRP B 1 470 ? 74.205  134.222 69.824  1.00 16.15 ? 470  TRP B CB    1 
ATOM   8486  C  CG    . TRP B 1 470 ? 73.578  133.449 70.931  1.00 14.40 ? 470  TRP B CG    1 
ATOM   8487  C  CD1   . TRP B 1 470 ? 73.174  132.142 70.894  1.00 15.59 ? 470  TRP B CD1   1 
ATOM   8488  C  CD2   . TRP B 1 470 ? 73.245  133.938 72.233  1.00 14.99 ? 470  TRP B CD2   1 
ATOM   8489  N  NE1   . TRP B 1 470 ? 72.609  131.790 72.095  1.00 12.47 ? 470  TRP B NE1   1 
ATOM   8490  C  CE2   . TRP B 1 470 ? 72.636  132.873 72.935  1.00 13.36 ? 470  TRP B CE2   1 
ATOM   8491  C  CE3   . TRP B 1 470 ? 73.398  135.175 72.877  1.00 15.36 ? 470  TRP B CE3   1 
ATOM   8492  C  CZ2   . TRP B 1 470 ? 72.180  133.006 74.247  1.00 13.03 ? 470  TRP B CZ2   1 
ATOM   8493  C  CZ3   . TRP B 1 470 ? 72.944  135.307 74.187  1.00 16.08 ? 470  TRP B CZ3   1 
ATOM   8494  C  CH2   . TRP B 1 470 ? 72.342  134.227 74.857  1.00 14.65 ? 470  TRP B CH2   1 
ATOM   8495  N  N     . PRO B 1 471 ? 72.192  133.847 67.254  1.00 14.94 ? 471  PRO B N     1 
ATOM   8496  C  CA    . PRO B 1 471 ? 71.109  133.125 66.576  1.00 15.21 ? 471  PRO B CA    1 
ATOM   8497  C  C     . PRO B 1 471 ? 70.328  132.052 67.316  1.00 14.80 ? 471  PRO B C     1 
ATOM   8498  O  O     . PRO B 1 471 ? 69.115  131.952 67.144  1.00 15.16 ? 471  PRO B O     1 
ATOM   8499  C  CB    . PRO B 1 471 ? 71.792  132.568 65.324  1.00 13.82 ? 471  PRO B CB    1 
ATOM   8500  C  CG    . PRO B 1 471 ? 72.858  133.579 65.053  1.00 16.54 ? 471  PRO B CG    1 
ATOM   8501  C  CD    . PRO B 1 471 ? 73.416  133.825 66.437  1.00 15.19 ? 471  PRO B CD    1 
ATOM   8502  N  N     . GLY B 1 472 ? 71.008  131.252 68.130  1.00 14.65 ? 472  GLY B N     1 
ATOM   8503  C  CA    . GLY B 1 472 ? 70.323  130.180 68.829  1.00 13.71 ? 472  GLY B CA    1 
ATOM   8504  C  C     . GLY B 1 472 ? 69.672  130.538 70.147  1.00 14.91 ? 472  GLY B C     1 
ATOM   8505  O  O     . GLY B 1 472 ? 69.125  129.667 70.819  1.00 15.10 ? 472  GLY B O     1 
ATOM   8506  N  N     . GLN B 1 473 ? 69.698  131.814 70.514  1.00 15.10 ? 473  GLN B N     1 
ATOM   8507  C  CA    . GLN B 1 473 ? 69.123  132.241 71.786  1.00 14.43 ? 473  GLN B CA    1 
ATOM   8508  C  C     . GLN B 1 473 ? 67.629  131.945 71.946  1.00 13.79 ? 473  GLN B C     1 
ATOM   8509  O  O     . GLN B 1 473 ? 66.836  132.157 71.028  1.00 14.05 ? 473  GLN B O     1 
ATOM   8510  C  CB    . GLN B 1 473 ? 69.382  133.743 72.001  1.00 14.81 ? 473  GLN B CB    1 
ATOM   8511  C  CG    . GLN B 1 473 ? 68.810  134.288 73.308  1.00 13.32 ? 473  GLN B CG    1 
ATOM   8512  C  CD    . GLN B 1 473 ? 69.315  135.681 73.647  1.00 17.08 ? 473  GLN B CD    1 
ATOM   8513  O  OE1   . GLN B 1 473 ? 69.564  136.498 72.761  1.00 15.37 ? 473  GLN B OE1   1 
ATOM   8514  N  NE2   . GLN B 1 473 ? 69.450  135.962 74.941  1.00 15.87 ? 473  GLN B NE2   1 
ATOM   8515  N  N     . ALA B 1 474 ? 67.246  131.443 73.116  1.00 13.32 ? 474  ALA B N     1 
ATOM   8516  C  CA    . ALA B 1 474 ? 65.836  131.163 73.382  1.00 13.90 ? 474  ALA B CA    1 
ATOM   8517  C  C     . ALA B 1 474 ? 65.102  132.490 73.228  1.00 13.99 ? 474  ALA B C     1 
ATOM   8518  O  O     . ALA B 1 474 ? 65.627  133.535 73.610  1.00 13.37 ? 474  ALA B O     1 
ATOM   8519  C  CB    . ALA B 1 474 ? 65.655  130.622 74.793  1.00 13.96 ? 474  ALA B CB    1 
ATOM   8520  N  N     . ARG B 1 475 ? 63.890  132.447 72.683  1.00 14.29 ? 475  ARG B N     1 
ATOM   8521  C  CA    . ARG B 1 475 ? 63.128  133.668 72.446  1.00 14.00 ? 475  ARG B CA    1 
ATOM   8522  C  C     . ARG B 1 475 ? 62.203  134.102 73.579  1.00 14.73 ? 475  ARG B C     1 
ATOM   8523  O  O     . ARG B 1 475 ? 61.888  135.282 73.706  1.00 13.63 ? 475  ARG B O     1 
ATOM   8524  C  CB    . ARG B 1 475 ? 62.316  133.522 71.156  1.00 14.04 ? 475  ARG B CB    1 
ATOM   8525  C  CG    . ARG B 1 475 ? 63.133  133.106 69.932  1.00 13.78 ? 475  ARG B CG    1 
ATOM   8526  C  CD    . ARG B 1 475 ? 64.259  134.093 69.610  1.00 12.12 ? 475  ARG B CD    1 
ATOM   8527  N  NE    . ARG B 1 475 ? 64.620  134.027 68.194  1.00 14.34 ? 475  ARG B NE    1 
ATOM   8528  C  CZ    . ARG B 1 475 ? 65.754  133.530 67.709  1.00 14.71 ? 475  ARG B CZ    1 
ATOM   8529  N  NH1   . ARG B 1 475 ? 66.686  133.040 68.520  1.00 14.30 ? 475  ARG B NH1   1 
ATOM   8530  N  NH2   . ARG B 1 475 ? 65.954  133.516 66.398  1.00 13.92 ? 475  ARG B NH2   1 
ATOM   8531  N  N     . THR B 1 476 ? 61.758  133.156 74.397  1.00 15.43 ? 476  THR B N     1 
ATOM   8532  C  CA    . THR B 1 476 ? 60.867  133.491 75.498  1.00 14.60 ? 476  THR B CA    1 
ATOM   8533  C  C     . THR B 1 476 ? 60.622  132.269 76.366  1.00 14.84 ? 476  THR B C     1 
ATOM   8534  O  O     . THR B 1 476 ? 61.234  131.216 76.169  1.00 14.33 ? 476  THR B O     1 
ATOM   8535  C  CB    . THR B 1 476 ? 59.505  133.997 74.958  1.00 15.82 ? 476  THR B CB    1 
ATOM   8536  O  OG1   . THR B 1 476 ? 58.698  134.482 76.038  1.00 14.75 ? 476  THR B OG1   1 
ATOM   8537  C  CG2   . THR B 1 476 ? 58.765  132.873 74.244  1.00 17.77 ? 476  THR B CG2   1 
ATOM   8538  N  N     . LEU B 1 477 ? 59.748  132.433 77.350  1.00 14.15 ? 477  LEU B N     1 
ATOM   8539  C  CA    . LEU B 1 477 ? 59.346  131.337 78.214  1.00 14.94 ? 477  LEU B CA    1 
ATOM   8540  C  C     . LEU B 1 477 ? 57.883  131.164 77.833  1.00 16.22 ? 477  LEU B C     1 
ATOM   8541  O  O     . LEU B 1 477 ? 57.121  132.135 77.841  1.00 14.72 ? 477  LEU B O     1 
ATOM   8542  C  CB    . LEU B 1 477 ? 59.470  131.711 79.692  1.00 14.59 ? 477  LEU B CB    1 
ATOM   8543  C  CG    . LEU B 1 477 ? 60.877  131.880 80.268  1.00 15.47 ? 477  LEU B CG    1 
ATOM   8544  C  CD1   . LEU B 1 477 ? 60.775  132.116 81.770  1.00 13.98 ? 477  LEU B CD1   1 
ATOM   8545  C  CD2   . LEU B 1 477 ? 61.718  130.633 79.986  1.00 16.15 ? 477  LEU B CD2   1 
ATOM   8546  N  N     . PHE B 1 478 ? 57.492  129.943 77.482  1.00 15.61 ? 478  PHE B N     1 
ATOM   8547  C  CA    . PHE B 1 478 ? 56.122  129.697 77.064  1.00 16.40 ? 478  PHE B CA    1 
ATOM   8548  C  C     . PHE B 1 478 ? 55.085  130.292 78.009  1.00 16.71 ? 478  PHE B C     1 
ATOM   8549  O  O     . PHE B 1 478 ? 55.098  130.033 79.215  1.00 16.34 ? 478  PHE B O     1 
ATOM   8550  C  CB    . PHE B 1 478 ? 55.852  128.202 76.915  1.00 14.59 ? 478  PHE B CB    1 
ATOM   8551  C  CG    . PHE B 1 478 ? 54.557  127.900 76.220  1.00 18.02 ? 478  PHE B CG    1 
ATOM   8552  C  CD1   . PHE B 1 478 ? 54.458  128.015 74.838  1.00 16.93 ? 478  PHE B CD1   1 
ATOM   8553  C  CD2   . PHE B 1 478 ? 53.427  127.531 76.948  1.00 17.60 ? 478  PHE B CD2   1 
ATOM   8554  C  CE1   . PHE B 1 478 ? 53.254  127.766 74.184  1.00 19.93 ? 478  PHE B CE1   1 
ATOM   8555  C  CE2   . PHE B 1 478 ? 52.221  127.281 76.309  1.00 19.33 ? 478  PHE B CE2   1 
ATOM   8556  C  CZ    . PHE B 1 478 ? 52.132  127.397 74.922  1.00 20.33 ? 478  PHE B CZ    1 
ATOM   8557  N  N     . GLY B 1 479 ? 54.195  131.099 77.441  1.00 16.89 ? 479  GLY B N     1 
ATOM   8558  C  CA    . GLY B 1 479 ? 53.136  131.730 78.208  1.00 18.27 ? 479  GLY B CA    1 
ATOM   8559  C  C     . GLY B 1 479 ? 53.568  132.733 79.262  1.00 18.98 ? 479  GLY B C     1 
ATOM   8560  O  O     . GLY B 1 479 ? 52.728  133.200 80.032  1.00 18.91 ? 479  GLY B O     1 
ATOM   8561  N  N     . ASP B 1 480 ? 54.850  133.089 79.303  1.00 18.36 ? 480  ASP B N     1 
ATOM   8562  C  CA    . ASP B 1 480 ? 55.309  134.037 80.319  1.00 17.53 ? 480  ASP B CA    1 
ATOM   8563  C  C     . ASP B 1 480 ? 56.525  134.845 79.889  1.00 17.26 ? 480  ASP B C     1 
ATOM   8564  O  O     . ASP B 1 480 ? 57.633  134.641 80.397  1.00 15.82 ? 480  ASP B O     1 
ATOM   8565  C  CB    . ASP B 1 480 ? 55.641  133.293 81.614  1.00 17.84 ? 480  ASP B CB    1 
ATOM   8566  C  CG    . ASP B 1 480 ? 55.499  134.172 82.847  1.00 21.40 ? 480  ASP B CG    1 
ATOM   8567  O  OD1   . ASP B 1 480 ? 55.619  135.413 82.730  1.00 19.60 ? 480  ASP B OD1   1 
ATOM   8568  O  OD2   . ASP B 1 480 ? 55.278  133.617 83.940  1.00 22.94 ? 480  ASP B OD2   1 
ATOM   8569  N  N     . HIS B 1 481 ? 56.320  135.776 78.965  1.00 16.03 ? 481  HIS B N     1 
ATOM   8570  C  CA    . HIS B 1 481 ? 57.423  136.595 78.495  1.00 16.99 ? 481  HIS B CA    1 
ATOM   8571  C  C     . HIS B 1 481 ? 57.927  137.518 79.599  1.00 17.07 ? 481  HIS B C     1 
ATOM   8572  O  O     . HIS B 1 481 ? 59.109  137.852 79.641  1.00 17.80 ? 481  HIS B O     1 
ATOM   8573  C  CB    . HIS B 1 481 ? 56.998  137.440 77.294  1.00 18.59 ? 481  HIS B CB    1 
ATOM   8574  C  CG    . HIS B 1 481 ? 58.145  138.110 76.606  1.00 18.29 ? 481  HIS B CG    1 
ATOM   8575  N  ND1   . HIS B 1 481 ? 59.094  137.407 75.895  1.00 19.08 ? 481  HIS B ND1   1 
ATOM   8576  C  CD2   . HIS B 1 481 ? 58.518  139.410 76.550  1.00 17.19 ? 481  HIS B CD2   1 
ATOM   8577  C  CE1   . HIS B 1 481 ? 60.002  138.246 75.430  1.00 18.18 ? 481  HIS B CE1   1 
ATOM   8578  N  NE2   . HIS B 1 481 ? 59.678  139.467 75.814  1.00 16.82 ? 481  HIS B NE2   1 
ATOM   8579  N  N     . GLU B 1 482 ? 57.028  137.943 80.485  1.00 18.14 ? 482  GLU B N     1 
ATOM   8580  C  CA    . GLU B 1 482 ? 57.429  138.826 81.573  1.00 18.61 ? 482  GLU B CA    1 
ATOM   8581  C  C     . GLU B 1 482 ? 58.462  138.111 82.438  1.00 17.91 ? 482  GLU B C     1 
ATOM   8582  O  O     . GLU B 1 482 ? 59.468  138.700 82.826  1.00 16.31 ? 482  GLU B O     1 
ATOM   8583  C  CB    . GLU B 1 482 ? 56.223  139.227 82.429  1.00 20.11 ? 482  GLU B CB    1 
ATOM   8584  C  CG    . GLU B 1 482 ? 55.158  140.024 81.689  1.00 26.87 ? 482  GLU B CG    1 
ATOM   8585  C  CD    . GLU B 1 482 ? 53.992  140.412 82.587  1.00 32.98 ? 482  GLU B CD    1 
ATOM   8586  O  OE1   . GLU B 1 482 ? 53.817  141.622 82.852  1.00 35.91 ? 482  GLU B OE1   1 
ATOM   8587  O  OE2   . GLU B 1 482 ? 53.252  139.504 83.030  1.00 35.03 ? 482  GLU B OE2   1 
ATOM   8588  N  N     . ARG B 1 483 ? 58.210  136.843 82.742  1.00 16.73 ? 483  ARG B N     1 
ATOM   8589  C  CA    . ARG B 1 483 ? 59.149  136.080 83.555  1.00 17.80 ? 483  ARG B CA    1 
ATOM   8590  C  C     . ARG B 1 483 ? 60.468  135.914 82.800  1.00 15.59 ? 483  ARG B C     1 
ATOM   8591  O  O     . ARG B 1 483 ? 61.542  135.922 83.398  1.00 16.29 ? 483  ARG B O     1 
ATOM   8592  C  CB    . ARG B 1 483 ? 58.558  134.715 83.919  1.00 20.28 ? 483  ARG B CB    1 
ATOM   8593  C  CG    . ARG B 1 483 ? 59.500  133.841 84.725  1.00 26.93 ? 483  ARG B CG    1 
ATOM   8594  C  CD    . ARG B 1 483 ? 58.751  133.022 85.764  1.00 32.17 ? 483  ARG B CD    1 
ATOM   8595  N  NE    . ARG B 1 483 ? 58.352  133.835 86.911  1.00 37.37 ? 483  ARG B NE    1 
ATOM   8596  C  CZ    . ARG B 1 483 ? 57.093  134.072 87.268  1.00 40.01 ? 483  ARG B CZ    1 
ATOM   8597  N  NH1   . ARG B 1 483 ? 56.087  133.559 86.569  1.00 39.68 ? 483  ARG B NH1   1 
ATOM   8598  N  NH2   . ARG B 1 483 ? 56.840  134.825 88.331  1.00 41.80 ? 483  ARG B NH2   1 
ATOM   8599  N  N     . PHE B 1 484 ? 60.380  135.777 81.481  1.00 15.30 ? 484  PHE B N     1 
ATOM   8600  C  CA    . PHE B 1 484 ? 61.567  135.636 80.637  1.00 14.69 ? 484  PHE B CA    1 
ATOM   8601  C  C     . PHE B 1 484 ? 62.435  136.886 80.795  1.00 14.84 ? 484  PHE B C     1 
ATOM   8602  O  O     . PHE B 1 484 ? 63.635  136.802 81.063  1.00 14.91 ? 484  PHE B O     1 
ATOM   8603  C  CB    . PHE B 1 484 ? 61.139  135.480 79.173  1.00 14.89 ? 484  PHE B CB    1 
ATOM   8604  C  CG    . PHE B 1 484 ? 62.287  135.395 78.196  1.00 14.90 ? 484  PHE B CG    1 
ATOM   8605  C  CD1   . PHE B 1 484 ? 63.136  134.290 78.184  1.00 16.03 ? 484  PHE B CD1   1 
ATOM   8606  C  CD2   . PHE B 1 484 ? 62.491  136.405 77.261  1.00 14.89 ? 484  PHE B CD2   1 
ATOM   8607  C  CE1   . PHE B 1 484 ? 64.169  134.188 77.252  1.00 16.16 ? 484  PHE B CE1   1 
ATOM   8608  C  CE2   . PHE B 1 484 ? 63.520  136.319 76.321  1.00 15.76 ? 484  PHE B CE2   1 
ATOM   8609  C  CZ    . PHE B 1 484 ? 64.364  135.205 76.313  1.00 15.94 ? 484  PHE B CZ    1 
ATOM   8610  N  N     . GLU B 1 485 ? 61.818  138.052 80.632  1.00 16.17 ? 485  GLU B N     1 
ATOM   8611  C  CA    . GLU B 1 485 ? 62.544  139.312 80.748  1.00 17.04 ? 485  GLU B CA    1 
ATOM   8612  C  C     . GLU B 1 485 ? 63.145  139.492 82.144  1.00 16.07 ? 485  GLU B C     1 
ATOM   8613  O  O     . GLU B 1 485 ? 64.307  139.863 82.285  1.00 15.81 ? 485  GLU B O     1 
ATOM   8614  C  CB    . GLU B 1 485 ? 61.606  140.483 80.423  1.00 19.31 ? 485  GLU B CB    1 
ATOM   8615  C  CG    . GLU B 1 485 ? 60.934  140.355 79.065  1.00 22.91 ? 485  GLU B CG    1 
ATOM   8616  C  CD    . GLU B 1 485 ? 59.929  141.454 78.785  1.00 27.20 ? 485  GLU B CD    1 
ATOM   8617  O  OE1   . GLU B 1 485 ? 59.045  141.688 79.641  1.00 26.95 ? 485  GLU B OE1   1 
ATOM   8618  O  OE2   . GLU B 1 485 ? 60.017  142.076 77.700  1.00 29.04 ? 485  GLU B OE2   1 
ATOM   8619  N  N     . GLN B 1 486 ? 62.359  139.217 83.179  1.00 17.00 ? 486  GLN B N     1 
ATOM   8620  C  CA    . GLN B 1 486 ? 62.852  139.379 84.543  1.00 17.57 ? 486  GLN B CA    1 
ATOM   8621  C  C     . GLN B 1 486 ? 63.947  138.396 84.939  1.00 17.43 ? 486  GLN B C     1 
ATOM   8622  O  O     . GLN B 1 486 ? 64.988  138.794 85.462  1.00 16.21 ? 486  GLN B O     1 
ATOM   8623  C  CB    . GLN B 1 486 ? 61.700  139.276 85.546  1.00 19.47 ? 486  GLN B CB    1 
ATOM   8624  C  CG    . GLN B 1 486 ? 62.168  139.279 87.000  1.00 22.88 ? 486  GLN B CG    1 
ATOM   8625  C  CD    . GLN B 1 486 ? 61.019  139.245 87.991  1.00 25.44 ? 486  GLN B CD    1 
ATOM   8626  O  OE1   . GLN B 1 486 ? 60.370  140.261 88.243  1.00 24.43 ? 486  GLN B OE1   1 
ATOM   8627  N  NE2   . GLN B 1 486 ? 60.755  138.069 88.550  1.00 26.33 ? 486  GLN B NE2   1 
ATOM   8628  N  N     . THR B 1 487 ? 63.712  137.113 84.694  1.00 16.69 ? 487  THR B N     1 
ATOM   8629  C  CA    . THR B 1 487 ? 64.682  136.085 85.057  1.00 15.63 ? 487  THR B CA    1 
ATOM   8630  C  C     . THR B 1 487 ? 66.063  136.281 84.437  1.00 16.31 ? 487  THR B C     1 
ATOM   8631  O  O     . THR B 1 487 ? 67.082  136.193 85.126  1.00 16.62 ? 487  THR B O     1 
ATOM   8632  C  CB    . THR B 1 487 ? 64.168  134.676 84.656  1.00 15.02 ? 487  THR B CB    1 
ATOM   8633  O  OG1   . THR B 1 487 ? 62.946  134.400 85.349  1.00 13.63 ? 487  THR B OG1   1 
ATOM   8634  C  CG2   . THR B 1 487 ? 65.196  133.602 85.002  1.00 16.43 ? 487  THR B CG2   1 
ATOM   8635  N  N     . TYR B 1 488 ? 66.105  136.573 83.141  1.00 15.37 ? 488  TYR B N     1 
ATOM   8636  C  CA    . TYR B 1 488 ? 67.383  136.707 82.457  1.00 15.77 ? 488  TYR B CA    1 
ATOM   8637  C  C     . TYR B 1 488 ? 67.908  138.103 82.147  1.00 16.97 ? 488  TYR B C     1 
ATOM   8638  O  O     . TYR B 1 488 ? 69.105  138.267 81.910  1.00 16.57 ? 488  TYR B O     1 
ATOM   8639  C  CB    . TYR B 1 488 ? 67.345  135.911 81.150  1.00 16.06 ? 488  TYR B CB    1 
ATOM   8640  C  CG    . TYR B 1 488 ? 66.837  134.497 81.314  1.00 16.09 ? 488  TYR B CG    1 
ATOM   8641  C  CD1   . TYR B 1 488 ? 65.504  134.178 81.056  1.00 17.51 ? 488  TYR B CD1   1 
ATOM   8642  C  CD2   . TYR B 1 488 ? 67.686  133.483 81.757  1.00 17.69 ? 488  TYR B CD2   1 
ATOM   8643  C  CE1   . TYR B 1 488 ? 65.026  132.876 81.238  1.00 17.51 ? 488  TYR B CE1   1 
ATOM   8644  C  CE2   . TYR B 1 488 ? 67.223  132.187 81.942  1.00 17.86 ? 488  TYR B CE2   1 
ATOM   8645  C  CZ    . TYR B 1 488 ? 65.896  131.889 81.684  1.00 18.53 ? 488  TYR B CZ    1 
ATOM   8646  O  OH    . TYR B 1 488 ? 65.437  130.610 81.898  1.00 18.46 ? 488  TYR B OH    1 
ATOM   8647  N  N     . PHE B 1 489 ? 67.044  139.110 82.148  1.00 16.61 ? 489  PHE B N     1 
ATOM   8648  C  CA    . PHE B 1 489 ? 67.511  140.444 81.796  1.00 17.46 ? 489  PHE B CA    1 
ATOM   8649  C  C     . PHE B 1 489 ? 67.248  141.569 82.788  1.00 17.92 ? 489  PHE B C     1 
ATOM   8650  O  O     . PHE B 1 489 ? 67.414  142.734 82.434  1.00 20.09 ? 489  PHE B O     1 
ATOM   8651  C  CB    . PHE B 1 489 ? 66.925  140.851 80.437  1.00 16.30 ? 489  PHE B CB    1 
ATOM   8652  C  CG    . PHE B 1 489 ? 67.105  139.815 79.354  1.00 16.44 ? 489  PHE B CG    1 
ATOM   8653  C  CD1   . PHE B 1 489 ? 66.218  138.746 79.237  1.00 15.92 ? 489  PHE B CD1   1 
ATOM   8654  C  CD2   . PHE B 1 489 ? 68.155  139.917 78.445  1.00 15.98 ? 489  PHE B CD2   1 
ATOM   8655  C  CE1   . PHE B 1 489 ? 66.376  137.794 78.221  1.00 16.72 ? 489  PHE B CE1   1 
ATOM   8656  C  CE2   . PHE B 1 489 ? 68.322  138.969 77.427  1.00 16.15 ? 489  PHE B CE2   1 
ATOM   8657  C  CZ    . PHE B 1 489 ? 67.429  137.909 77.317  1.00 15.60 ? 489  PHE B CZ    1 
ATOM   8658  N  N     . SER B 1 490 ? 66.848  141.252 84.016  1.00 18.06 ? 490  SER B N     1 
ATOM   8659  C  CA    . SER B 1 490 ? 66.575  142.318 84.984  1.00 18.54 ? 490  SER B CA    1 
ATOM   8660  C  C     . SER B 1 490 ? 67.667  142.530 86.034  1.00 18.12 ? 490  SER B C     1 
ATOM   8661  O  O     . SER B 1 490 ? 67.738  143.595 86.649  1.00 17.42 ? 490  SER B O     1 
ATOM   8662  C  CB    . SER B 1 490 ? 65.240  142.068 85.693  1.00 16.57 ? 490  SER B CB    1 
ATOM   8663  O  OG    . SER B 1 490 ? 65.337  140.983 86.597  1.00 17.80 ? 490  SER B OG    1 
ATOM   8664  N  N     . THR B 1 491 ? 68.512  141.523 86.243  1.00 18.82 ? 491  THR B N     1 
ATOM   8665  C  CA    . THR B 1 491 ? 69.587  141.626 87.230  1.00 18.89 ? 491  THR B CA    1 
ATOM   8666  C  C     . THR B 1 491 ? 70.651  142.609 86.753  1.00 19.05 ? 491  THR B C     1 
ATOM   8667  O  O     . THR B 1 491 ? 71.095  143.486 87.499  1.00 19.08 ? 491  THR B O     1 
ATOM   8668  C  CB    . THR B 1 491 ? 70.249  140.254 87.479  1.00 20.08 ? 491  THR B CB    1 
ATOM   8669  O  OG1   . THR B 1 491 ? 69.250  139.318 87.901  1.00 20.40 ? 491  THR B OG1   1 
ATOM   8670  C  CG2   . THR B 1 491 ? 71.321  140.363 88.567  1.00 20.77 ? 491  THR B CG2   1 
ATOM   8671  N  N     . PHE B 1 492 ? 71.051  142.454 85.500  1.00 19.23 ? 492  PHE B N     1 
ATOM   8672  C  CA    . PHE B 1 492 ? 72.049  143.321 84.896  1.00 18.55 ? 492  PHE B CA    1 
ATOM   8673  C  C     . PHE B 1 492 ? 71.429  143.879 83.617  1.00 19.65 ? 492  PHE B C     1 
ATOM   8674  O  O     . PHE B 1 492 ? 71.316  143.189 82.604  1.00 19.18 ? 492  PHE B O     1 
ATOM   8675  C  CB    . PHE B 1 492 ? 73.317  142.513 84.614  1.00 19.26 ? 492  PHE B CB    1 
ATOM   8676  C  CG    . PHE B 1 492 ? 73.843  141.784 85.824  1.00 19.70 ? 492  PHE B CG    1 
ATOM   8677  C  CD1   . PHE B 1 492 ? 73.946  140.396 85.829  1.00 19.03 ? 492  PHE B CD1   1 
ATOM   8678  C  CD2   . PHE B 1 492 ? 74.208  142.486 86.970  1.00 19.84 ? 492  PHE B CD2   1 
ATOM   8679  C  CE1   . PHE B 1 492 ? 74.403  139.714 86.958  1.00 21.83 ? 492  PHE B CE1   1 
ATOM   8680  C  CE2   . PHE B 1 492 ? 74.668  141.816 88.106  1.00 19.81 ? 492  PHE B CE2   1 
ATOM   8681  C  CZ    . PHE B 1 492 ? 74.766  140.427 88.101  1.00 21.27 ? 492  PHE B CZ    1 
ATOM   8682  N  N     . LYS B 1 493 ? 71.011  145.137 83.685  1.00 18.69 ? 493  LYS B N     1 
ATOM   8683  C  CA    . LYS B 1 493 ? 70.358  145.798 82.564  1.00 19.93 ? 493  LYS B CA    1 
ATOM   8684  C  C     . LYS B 1 493 ? 71.037  145.649 81.217  1.00 19.20 ? 493  LYS B C     1 
ATOM   8685  O  O     . LYS B 1 493 ? 72.246  145.820 81.093  1.00 18.66 ? 493  LYS B O     1 
ATOM   8686  C  CB    . LYS B 1 493 ? 70.185  147.285 82.863  1.00 22.26 ? 493  LYS B CB    1 
ATOM   8687  C  CG    . LYS B 1 493 ? 69.484  147.556 84.170  1.00 27.36 ? 493  LYS B CG    1 
ATOM   8688  C  CD    . LYS B 1 493 ? 68.147  146.857 84.228  1.00 29.64 ? 493  LYS B CD    1 
ATOM   8689  C  CE    . LYS B 1 493 ? 67.484  147.110 85.564  1.00 34.15 ? 493  LYS B CE    1 
ATOM   8690  N  NZ    . LYS B 1 493 ? 67.305  148.562 85.824  1.00 34.68 ? 493  LYS B NZ    1 
ATOM   8691  N  N     . ASN B 1 494 ? 70.227  145.330 80.210  1.00 18.35 ? 494  ASN B N     1 
ATOM   8692  C  CA    . ASN B 1 494 ? 70.686  145.186 78.835  1.00 19.26 ? 494  ASN B CA    1 
ATOM   8693  C  C     . ASN B 1 494 ? 71.646  144.037 78.603  1.00 17.78 ? 494  ASN B C     1 
ATOM   8694  O  O     . ASN B 1 494 ? 72.370  144.024 77.613  1.00 17.26 ? 494  ASN B O     1 
ATOM   8695  C  CB    . ASN B 1 494 ? 71.332  146.491 78.358  1.00 21.72 ? 494  ASN B CB    1 
ATOM   8696  C  CG    . ASN B 1 494 ? 70.406  147.684 78.497  1.00 26.18 ? 494  ASN B CG    1 
ATOM   8697  O  OD1   . ASN B 1 494 ? 69.277  147.668 78.006  1.00 28.30 ? 494  ASN B OD1   1 
ATOM   8698  N  ND2   . ASN B 1 494 ? 70.882  148.731 79.167  1.00 29.44 ? 494  ASN B ND2   1 
ATOM   8699  N  N     . MET B 1 495 ? 71.650  143.067 79.510  1.00 18.42 ? 495  MET B N     1 
ATOM   8700  C  CA    . MET B 1 495 ? 72.535  141.916 79.373  1.00 17.46 ? 495  MET B CA    1 
ATOM   8701  C  C     . MET B 1 495 ? 71.779  140.639 79.692  1.00 17.09 ? 495  MET B C     1 
ATOM   8702  O  O     . MET B 1 495 ? 70.830  140.651 80.477  1.00 16.39 ? 495  MET B O     1 
ATOM   8703  C  CB    . MET B 1 495 ? 73.712  142.018 80.342  1.00 19.53 ? 495  MET B CB    1 
ATOM   8704  C  CG    . MET B 1 495 ? 74.568  143.261 80.209  1.00 21.86 ? 495  MET B CG    1 
ATOM   8705  S  SD    . MET B 1 495 ? 75.821  143.272 81.512  1.00 26.00 ? 495  MET B SD    1 
ATOM   8706  C  CE    . MET B 1 495 ? 75.195  144.564 82.608  1.00 30.53 ? 495  MET B CE    1 
ATOM   8707  N  N     . TYR B 1 496 ? 72.207  139.541 79.080  1.00 16.12 ? 496  TYR B N     1 
ATOM   8708  C  CA    . TYR B 1 496 ? 71.610  138.239 79.337  1.00 15.20 ? 496  TYR B CA    1 
ATOM   8709  C  C     . TYR B 1 496 ? 72.408  137.637 80.490  1.00 15.74 ? 496  TYR B C     1 
ATOM   8710  O  O     . TYR B 1 496 ? 73.610  137.434 80.354  1.00 13.50 ? 496  TYR B O     1 
ATOM   8711  C  CB    . TYR B 1 496 ? 71.750  137.326 78.112  1.00 15.57 ? 496  TYR B CB    1 
ATOM   8712  C  CG    . TYR B 1 496 ? 71.418  135.883 78.416  1.00 15.60 ? 496  TYR B CG    1 
ATOM   8713  C  CD1   . TYR B 1 496 ? 70.096  135.481 78.590  1.00 15.44 ? 496  TYR B CD1   1 
ATOM   8714  C  CD2   . TYR B 1 496 ? 72.431  134.932 78.597  1.00 16.64 ? 496  TYR B CD2   1 
ATOM   8715  C  CE1   . TYR B 1 496 ? 69.779  134.173 78.942  1.00 16.98 ? 496  TYR B CE1   1 
ATOM   8716  C  CE2   . TYR B 1 496 ? 72.126  133.608 78.954  1.00 15.78 ? 496  TYR B CE2   1 
ATOM   8717  C  CZ    . TYR B 1 496 ? 70.794  133.241 79.125  1.00 18.18 ? 496  TYR B CZ    1 
ATOM   8718  O  OH    . TYR B 1 496 ? 70.467  131.953 79.495  1.00 18.06 ? 496  TYR B OH    1 
ATOM   8719  N  N     . PHE B 1 497 ? 71.758  137.366 81.621  1.00 14.87 ? 497  PHE B N     1 
ATOM   8720  C  CA    . PHE B 1 497 ? 72.457  136.775 82.766  1.00 15.55 ? 497  PHE B CA    1 
ATOM   8721  C  C     . PHE B 1 497 ? 72.250  135.257 82.784  1.00 15.22 ? 497  PHE B C     1 
ATOM   8722  O  O     . PHE B 1 497 ? 71.121  134.772 82.872  1.00 14.54 ? 497  PHE B O     1 
ATOM   8723  C  CB    . PHE B 1 497 ? 71.965  137.402 84.079  1.00 14.89 ? 497  PHE B CB    1 
ATOM   8724  C  CG    . PHE B 1 497 ? 72.622  136.835 85.312  1.00 14.20 ? 497  PHE B CG    1 
ATOM   8725  C  CD1   . PHE B 1 497 ? 73.955  136.428 85.288  1.00 14.90 ? 497  PHE B CD1   1 
ATOM   8726  C  CD2   . PHE B 1 497 ? 71.917  136.738 86.507  1.00 16.41 ? 497  PHE B CD2   1 
ATOM   8727  C  CE1   . PHE B 1 497 ? 74.576  135.932 86.436  1.00 15.37 ? 497  PHE B CE1   1 
ATOM   8728  C  CE2   . PHE B 1 497 ? 72.527  136.243 87.665  1.00 16.53 ? 497  PHE B CE2   1 
ATOM   8729  C  CZ    . PHE B 1 497 ? 73.859  135.840 87.626  1.00 15.82 ? 497  PHE B CZ    1 
ATOM   8730  N  N     . SER B 1 498 ? 73.352  134.519 82.700  1.00 15.35 ? 498  SER B N     1 
ATOM   8731  C  CA    . SER B 1 498 ? 73.324  133.060 82.666  1.00 15.59 ? 498  SER B CA    1 
ATOM   8732  C  C     . SER B 1 498 ? 72.998  132.378 83.988  1.00 16.84 ? 498  SER B C     1 
ATOM   8733  O  O     . SER B 1 498 ? 72.557  131.230 83.996  1.00 19.36 ? 498  SER B O     1 
ATOM   8734  C  CB    . SER B 1 498 ? 74.675  132.533 82.181  1.00 14.96 ? 498  SER B CB    1 
ATOM   8735  O  OG    . SER B 1 498 ? 75.678  132.773 83.153  1.00 14.31 ? 498  SER B OG    1 
ATOM   8736  N  N     . GLY B 1 499 ? 73.222  133.067 85.102  1.00 17.10 ? 499  GLY B N     1 
ATOM   8737  C  CA    . GLY B 1 499 ? 72.966  132.460 86.397  1.00 16.71 ? 499  GLY B CA    1 
ATOM   8738  C  C     . GLY B 1 499 ? 74.208  131.714 86.861  1.00 18.10 ? 499  GLY B C     1 
ATOM   8739  O  O     . GLY B 1 499 ? 74.216  131.089 87.927  1.00 18.43 ? 499  GLY B O     1 
ATOM   8740  N  N     . ASP B 1 500 ? 75.258  131.778 86.042  1.00 15.86 ? 500  ASP B N     1 
ATOM   8741  C  CA    . ASP B 1 500 ? 76.540  131.137 86.327  1.00 15.51 ? 500  ASP B CA    1 
ATOM   8742  C  C     . ASP B 1 500 ? 77.591  132.155 86.711  1.00 16.22 ? 500  ASP B C     1 
ATOM   8743  O  O     . ASP B 1 500 ? 77.507  133.319 86.334  1.00 15.83 ? 500  ASP B O     1 
ATOM   8744  C  CB    . ASP B 1 500 ? 77.090  130.407 85.101  1.00 16.40 ? 500  ASP B CB    1 
ATOM   8745  C  CG    . ASP B 1 500 ? 76.509  129.028 84.921  1.00 17.43 ? 500  ASP B CG    1 
ATOM   8746  O  OD1   . ASP B 1 500 ? 76.482  128.258 85.904  1.00 16.01 ? 500  ASP B OD1   1 
ATOM   8747  O  OD2   . ASP B 1 500 ? 76.105  128.717 83.781  1.00 18.77 ? 500  ASP B OD2   1 
ATOM   8748  N  N     . GLY B 1 501 ? 78.593  131.688 87.445  1.00 17.64 ? 501  GLY B N     1 
ATOM   8749  C  CA    . GLY B 1 501 ? 79.700  132.535 87.836  1.00 16.78 ? 501  GLY B CA    1 
ATOM   8750  C  C     . GLY B 1 501 ? 80.889  131.961 87.091  1.00 17.37 ? 501  GLY B C     1 
ATOM   8751  O  O     . GLY B 1 501 ? 80.879  130.784 86.719  1.00 18.28 ? 501  GLY B O     1 
ATOM   8752  N  N     . ALA B 1 502 ? 81.912  132.769 86.851  1.00 18.09 ? 502  ALA B N     1 
ATOM   8753  C  CA    . ALA B 1 502 ? 83.076  132.272 86.134  1.00 18.63 ? 502  ALA B CA    1 
ATOM   8754  C  C     . ALA B 1 502 ? 84.280  133.177 86.305  1.00 19.46 ? 502  ALA B C     1 
ATOM   8755  O  O     . ALA B 1 502 ? 84.160  134.324 86.738  1.00 18.52 ? 502  ALA B O     1 
ATOM   8756  C  CB    . ALA B 1 502 ? 82.748  132.137 84.650  1.00 19.30 ? 502  ALA B CB    1 
ATOM   8757  N  N     . ARG B 1 503 ? 85.449  132.643 85.978  1.00 20.75 ? 503  ARG B N     1 
ATOM   8758  C  CA    . ARG B 1 503 ? 86.666  133.427 86.044  1.00 23.07 ? 503  ARG B CA    1 
ATOM   8759  C  C     . ARG B 1 503 ? 87.301  133.379 84.664  1.00 22.55 ? 503  ARG B C     1 
ATOM   8760  O  O     . ARG B 1 503 ? 87.061  132.452 83.894  1.00 22.34 ? 503  ARG B O     1 
ATOM   8761  C  CB    . ARG B 1 503 ? 87.632  132.890 87.113  1.00 26.49 ? 503  ARG B CB    1 
ATOM   8762  C  CG    . ARG B 1 503 ? 88.167  131.490 86.902  1.00 31.19 ? 503  ARG B CG    1 
ATOM   8763  C  CD    . ARG B 1 503 ? 89.293  131.205 87.905  1.00 34.64 ? 503  ARG B CD    1 
ATOM   8764  N  NE    . ARG B 1 503 ? 89.771  129.825 87.840  1.00 37.08 ? 503  ARG B NE    1 
ATOM   8765  C  CZ    . ARG B 1 503 ? 89.075  128.773 88.262  1.00 36.50 ? 503  ARG B CZ    1 
ATOM   8766  N  NH1   . ARG B 1 503 ? 87.869  128.943 88.786  1.00 36.96 ? 503  ARG B NH1   1 
ATOM   8767  N  NH2   . ARG B 1 503 ? 89.581  127.552 88.156  1.00 37.89 ? 503  ARG B NH2   1 
ATOM   8768  N  N     . ARG B 1 504 ? 88.083  134.402 84.345  1.00 21.65 ? 504  ARG B N     1 
ATOM   8769  C  CA    . ARG B 1 504 ? 88.756  134.489 83.058  1.00 22.07 ? 504  ARG B CA    1 
ATOM   8770  C  C     . ARG B 1 504 ? 90.217  134.730 83.392  1.00 22.45 ? 504  ARG B C     1 
ATOM   8771  O  O     . ARG B 1 504 ? 90.521  135.602 84.205  1.00 24.09 ? 504  ARG B O     1 
ATOM   8772  C  CB    . ARG B 1 504 ? 88.192  135.665 82.251  1.00 21.08 ? 504  ARG B CB    1 
ATOM   8773  C  CG    . ARG B 1 504 ? 88.705  135.778 80.819  1.00 22.40 ? 504  ARG B CG    1 
ATOM   8774  C  CD    . ARG B 1 504 ? 88.062  136.975 80.114  1.00 23.14 ? 504  ARG B CD    1 
ATOM   8775  N  NE    . ARG B 1 504 ? 88.277  138.202 80.873  1.00 20.60 ? 504  ARG B NE    1 
ATOM   8776  C  CZ    . ARG B 1 504 ? 87.331  139.093 81.157  1.00 20.77 ? 504  ARG B CZ    1 
ATOM   8777  N  NH1   . ARG B 1 504 ? 86.083  138.908 80.742  1.00 19.76 ? 504  ARG B NH1   1 
ATOM   8778  N  NH2   . ARG B 1 504 ? 87.631  140.163 81.882  1.00 19.82 ? 504  ARG B NH2   1 
ATOM   8779  N  N     . ASP B 1 505 ? 91.117  133.957 82.791  1.00 22.06 ? 505  ASP B N     1 
ATOM   8780  C  CA    . ASP B 1 505 ? 92.537  134.129 83.078  1.00 22.60 ? 505  ASP B CA    1 
ATOM   8781  C  C     . ASP B 1 505 ? 93.229  135.131 82.158  1.00 23.64 ? 505  ASP B C     1 
ATOM   8782  O  O     . ASP B 1 505 ? 92.582  135.807 81.352  1.00 21.22 ? 505  ASP B O     1 
ATOM   8783  C  CB    . ASP B 1 505 ? 93.280  132.783 83.037  1.00 23.19 ? 505  ASP B CB    1 
ATOM   8784  C  CG    . ASP B 1 505 ? 93.179  132.083 81.693  1.00 22.84 ? 505  ASP B CG    1 
ATOM   8785  O  OD1   . ASP B 1 505 ? 93.065  132.768 80.658  1.00 23.15 ? 505  ASP B OD1   1 
ATOM   8786  O  OD2   . ASP B 1 505 ? 93.236  130.833 81.674  1.00 23.56 ? 505  ASP B OD2   1 
ATOM   8787  N  N     . GLU B 1 506 ? 94.549  135.221 82.296  1.00 24.49 ? 506  GLU B N     1 
ATOM   8788  C  CA    . GLU B 1 506 ? 95.362  136.147 81.512  1.00 25.54 ? 506  GLU B CA    1 
ATOM   8789  C  C     . GLU B 1 506 ? 95.261  135.931 80.005  1.00 26.24 ? 506  GLU B C     1 
ATOM   8790  O  O     . GLU B 1 506 ? 95.447  136.872 79.231  1.00 26.44 ? 506  GLU B O     1 
ATOM   8791  C  CB    . GLU B 1 506 ? 96.825  136.053 81.953  1.00 25.78 ? 506  GLU B CB    1 
ATOM   8792  N  N     . ASP B 1 507 ? 94.977  134.700 79.588  1.00 25.57 ? 507  ASP B N     1 
ATOM   8793  C  CA    . ASP B 1 507 ? 94.861  134.394 78.164  1.00 25.76 ? 507  ASP B CA    1 
ATOM   8794  C  C     . ASP B 1 507 ? 93.446  134.593 77.638  1.00 23.93 ? 507  ASP B C     1 
ATOM   8795  O  O     . ASP B 1 507 ? 93.191  134.410 76.449  1.00 24.59 ? 507  ASP B O     1 
ATOM   8796  C  CB    . ASP B 1 507 ? 95.297  132.955 77.877  1.00 27.98 ? 507  ASP B CB    1 
ATOM   8797  C  CG    . ASP B 1 507 ? 96.779  132.736 78.102  1.00 30.73 ? 507  ASP B CG    1 
ATOM   8798  O  OD1   . ASP B 1 507 ? 97.583  133.557 77.608  1.00 31.48 ? 507  ASP B OD1   1 
ATOM   8799  O  OD2   . ASP B 1 507 ? 97.138  131.739 78.764  1.00 30.18 ? 507  ASP B OD2   1 
ATOM   8800  N  N     . GLY B 1 508 ? 92.525  134.958 78.522  1.00 22.18 ? 508  GLY B N     1 
ATOM   8801  C  CA    . GLY B 1 508 ? 91.154  135.174 78.091  1.00 21.36 ? 508  GLY B CA    1 
ATOM   8802  C  C     . GLY B 1 508 ? 90.300  133.921 78.149  1.00 19.51 ? 508  GLY B C     1 
ATOM   8803  O  O     . GLY B 1 508 ? 89.148  133.929 77.713  1.00 21.21 ? 508  GLY B O     1 
ATOM   8804  N  N     . TYR B 1 509 ? 90.865  132.839 78.678  1.00 18.16 ? 509  TYR B N     1 
ATOM   8805  C  CA    . TYR B 1 509 ? 90.131  131.583 78.807  1.00 19.12 ? 509  TYR B CA    1 
ATOM   8806  C  C     . TYR B 1 509 ? 89.142  131.688 79.952  1.00 18.93 ? 509  TYR B C     1 
ATOM   8807  O  O     . TYR B 1 509 ? 89.454  132.248 81.005  1.00 20.18 ? 509  TYR B O     1 
ATOM   8808  C  CB    . TYR B 1 509 ? 91.083  130.423 79.097  1.00 18.55 ? 509  TYR B CB    1 
ATOM   8809  C  CG    . TYR B 1 509 ? 91.793  129.870 77.884  1.00 20.86 ? 509  TYR B CG    1 
ATOM   8810  C  CD1   . TYR B 1 509 ? 92.431  130.716 76.977  1.00 22.06 ? 509  TYR B CD1   1 
ATOM   8811  C  CD2   . TYR B 1 509 ? 91.854  128.496 77.658  1.00 20.78 ? 509  TYR B CD2   1 
ATOM   8812  C  CE1   . TYR B 1 509 ? 93.112  130.204 75.877  1.00 21.22 ? 509  TYR B CE1   1 
ATOM   8813  C  CE2   . TYR B 1 509 ? 92.534  127.975 76.561  1.00 20.54 ? 509  TYR B CE2   1 
ATOM   8814  C  CZ    . TYR B 1 509 ? 93.162  128.835 75.677  1.00 20.75 ? 509  TYR B CZ    1 
ATOM   8815  O  OH    . TYR B 1 509 ? 93.853  128.326 74.600  1.00 21.43 ? 509  TYR B OH    1 
ATOM   8816  N  N     . TYR B 1 510 ? 87.948  131.145 79.752  1.00 18.32 ? 510  TYR B N     1 
ATOM   8817  C  CA    . TYR B 1 510 ? 86.944  131.179 80.797  1.00 17.20 ? 510  TYR B CA    1 
ATOM   8818  C  C     . TYR B 1 510 ? 86.917  129.870 81.564  1.00 17.30 ? 510  TYR B C     1 
ATOM   8819  O  O     . TYR B 1 510 ? 87.162  128.794 81.010  1.00 19.08 ? 510  TYR B O     1 
ATOM   8820  C  CB    . TYR B 1 510 ? 85.555  131.464 80.216  1.00 17.27 ? 510  TYR B CB    1 
ATOM   8821  C  CG    . TYR B 1 510 ? 85.355  132.903 79.804  1.00 17.14 ? 510  TYR B CG    1 
ATOM   8822  C  CD1   . TYR B 1 510 ? 85.820  133.372 78.576  1.00 18.04 ? 510  TYR B CD1   1 
ATOM   8823  C  CD2   . TYR B 1 510 ? 84.728  133.806 80.662  1.00 17.71 ? 510  TYR B CD2   1 
ATOM   8824  C  CE1   . TYR B 1 510 ? 85.668  134.710 78.211  1.00 17.86 ? 510  TYR B CE1   1 
ATOM   8825  C  CE2   . TYR B 1 510 ? 84.572  135.138 80.311  1.00 16.95 ? 510  TYR B CE2   1 
ATOM   8826  C  CZ    . TYR B 1 510 ? 85.043  135.584 79.086  1.00 19.57 ? 510  TYR B CZ    1 
ATOM   8827  O  OH    . TYR B 1 510 ? 84.886  136.904 78.752  1.00 19.58 ? 510  TYR B OH    1 
ATOM   8828  N  N     . TRP B 1 511 ? 86.629  129.979 82.853  1.00 17.56 ? 511  TRP B N     1 
ATOM   8829  C  CA    . TRP B 1 511 ? 86.544  128.826 83.732  1.00 19.06 ? 511  TRP B CA    1 
ATOM   8830  C  C     . TRP B 1 511 ? 85.212  128.935 84.461  1.00 18.88 ? 511  TRP B C     1 
ATOM   8831  O  O     . TRP B 1 511 ? 85.048  129.778 85.340  1.00 19.26 ? 511  TRP B O     1 
ATOM   8832  C  CB    . TRP B 1 511 ? 87.707  128.834 84.732  1.00 18.80 ? 511  TRP B CB    1 
ATOM   8833  C  CG    . TRP B 1 511 ? 89.064  128.823 84.083  1.00 19.69 ? 511  TRP B CG    1 
ATOM   8834  C  CD1   . TRP B 1 511 ? 89.694  129.870 83.467  1.00 18.72 ? 511  TRP B CD1   1 
ATOM   8835  C  CD2   . TRP B 1 511 ? 89.947  127.701 83.966  1.00 19.06 ? 511  TRP B CD2   1 
ATOM   8836  N  NE1   . TRP B 1 511 ? 90.915  129.468 82.976  1.00 19.27 ? 511  TRP B NE1   1 
ATOM   8837  C  CE2   . TRP B 1 511 ? 91.095  128.141 83.269  1.00 20.46 ? 511  TRP B CE2   1 
ATOM   8838  C  CE3   . TRP B 1 511 ? 89.879  126.364 84.384  1.00 21.17 ? 511  TRP B CE3   1 
ATOM   8839  C  CZ2   . TRP B 1 511 ? 92.171  127.292 82.981  1.00 19.94 ? 511  TRP B CZ2   1 
ATOM   8840  C  CZ3   . TRP B 1 511 ? 90.951  125.517 84.096  1.00 20.56 ? 511  TRP B CZ3   1 
ATOM   8841  C  CH2   . TRP B 1 511 ? 92.080  125.988 83.401  1.00 21.28 ? 511  TRP B CH2   1 
ATOM   8842  N  N     . ILE B 1 512 ? 84.256  128.091 84.080  1.00 20.04 ? 512  ILE B N     1 
ATOM   8843  C  CA    . ILE B 1 512 ? 82.934  128.109 84.696  1.00 20.65 ? 512  ILE B CA    1 
ATOM   8844  C  C     . ILE B 1 512 ? 82.999  127.495 86.090  1.00 22.76 ? 512  ILE B C     1 
ATOM   8845  O  O     . ILE B 1 512 ? 83.378  126.336 86.241  1.00 24.15 ? 512  ILE B O     1 
ATOM   8846  C  CB    . ILE B 1 512 ? 81.923  127.307 83.854  1.00 21.39 ? 512  ILE B CB    1 
ATOM   8847  C  CG1   . ILE B 1 512 ? 82.020  127.719 82.384  1.00 20.42 ? 512  ILE B CG1   1 
ATOM   8848  C  CG2   . ILE B 1 512 ? 80.514  127.530 84.386  1.00 20.55 ? 512  ILE B CG2   1 
ATOM   8849  C  CD1   . ILE B 1 512 ? 81.730  129.184 82.135  1.00 15.43 ? 512  ILE B CD1   1 
ATOM   8850  N  N     . THR B 1 513 ? 82.620  128.264 87.105  1.00 21.95 ? 513  THR B N     1 
ATOM   8851  C  CA    . THR B 1 513 ? 82.666  127.764 88.474  1.00 25.61 ? 513  THR B CA    1 
ATOM   8852  C  C     . THR B 1 513 ? 81.319  127.277 89.005  1.00 26.34 ? 513  THR B C     1 
ATOM   8853  O  O     . THR B 1 513 ? 81.230  126.807 90.136  1.00 28.82 ? 513  THR B O     1 
ATOM   8854  C  CB    . THR B 1 513 ? 83.229  128.829 89.441  1.00 25.94 ? 513  THR B CB    1 
ATOM   8855  O  OG1   . THR B 1 513 ? 82.395  129.994 89.423  1.00 27.07 ? 513  THR B OG1   1 
ATOM   8856  C  CG2   . THR B 1 513 ? 84.645  129.217 89.030  1.00 26.39 ? 513  THR B CG2   1 
ATOM   8857  N  N     . GLY B 1 514 ? 80.272  127.391 88.197  1.00 24.58 ? 514  GLY B N     1 
ATOM   8858  C  CA    . GLY B 1 514 ? 78.973  126.920 88.641  1.00 23.50 ? 514  GLY B CA    1 
ATOM   8859  C  C     . GLY B 1 514 ? 77.934  128.000 88.853  1.00 21.48 ? 514  GLY B C     1 
ATOM   8860  O  O     . GLY B 1 514 ? 78.231  129.189 88.762  1.00 21.08 ? 514  GLY B O     1 
ATOM   8861  N  N     . ARG B 1 515 ? 76.707  127.571 89.140  1.00 20.51 ? 515  ARG B N     1 
ATOM   8862  C  CA    . ARG B 1 515 ? 75.586  128.478 89.363  1.00 19.24 ? 515  ARG B CA    1 
ATOM   8863  C  C     . ARG B 1 515 ? 75.776  129.371 90.583  1.00 20.50 ? 515  ARG B C     1 
ATOM   8864  O  O     . ARG B 1 515 ? 76.253  128.922 91.628  1.00 20.27 ? 515  ARG B O     1 
ATOM   8865  C  CB    . ARG B 1 515 ? 74.290  127.679 89.540  1.00 17.79 ? 515  ARG B CB    1 
ATOM   8866  C  CG    . ARG B 1 515 ? 73.951  126.754 88.384  1.00 17.48 ? 515  ARG B CG    1 
ATOM   8867  C  CD    . ARG B 1 515 ? 73.605  127.510 87.109  1.00 16.38 ? 515  ARG B CD    1 
ATOM   8868  N  NE    . ARG B 1 515 ? 72.380  128.296 87.236  1.00 17.43 ? 515  ARG B NE    1 
ATOM   8869  C  CZ    . ARG B 1 515 ? 71.570  128.572 86.217  1.00 18.26 ? 515  ARG B CZ    1 
ATOM   8870  N  NH1   . ARG B 1 515 ? 71.857  128.120 85.004  1.00 16.12 ? 515  ARG B NH1   1 
ATOM   8871  N  NH2   . ARG B 1 515 ? 70.473  129.298 86.406  1.00 18.89 ? 515  ARG B NH2   1 
ATOM   8872  N  N     . VAL B 1 516 ? 75.395  130.638 90.443  1.00 20.16 ? 516  VAL B N     1 
ATOM   8873  C  CA    . VAL B 1 516 ? 75.493  131.587 91.540  1.00 21.92 ? 516  VAL B CA    1 
ATOM   8874  C  C     . VAL B 1 516 ? 74.093  131.852 92.079  1.00 22.20 ? 516  VAL B C     1 
ATOM   8875  O  O     . VAL B 1 516 ? 73.917  132.593 93.045  1.00 23.70 ? 516  VAL B O     1 
ATOM   8876  C  CB    . VAL B 1 516 ? 76.162  132.917 91.102  1.00 21.03 ? 516  VAL B CB    1 
ATOM   8877  C  CG1   . VAL B 1 516 ? 77.627  132.666 90.777  1.00 22.03 ? 516  VAL B CG1   1 
ATOM   8878  C  CG2   . VAL B 1 516 ? 75.440  133.509 89.894  1.00 22.24 ? 516  VAL B CG2   1 
ATOM   8879  N  N     . ASP B 1 517 ? 73.092  131.251 91.440  1.00 21.90 ? 517  ASP B N     1 
ATOM   8880  C  CA    . ASP B 1 517 ? 71.722  131.390 91.914  1.00 23.21 ? 517  ASP B CA    1 
ATOM   8881  C  C     . ASP B 1 517 ? 71.401  130.073 92.617  1.00 24.56 ? 517  ASP B C     1 
ATOM   8882  O  O     . ASP B 1 517 ? 72.303  129.262 92.839  1.00 25.13 ? 517  ASP B O     1 
ATOM   8883  C  CB    . ASP B 1 517 ? 70.742  131.687 90.763  1.00 22.46 ? 517  ASP B CB    1 
ATOM   8884  C  CG    . ASP B 1 517 ? 70.828  130.688 89.623  1.00 22.92 ? 517  ASP B CG    1 
ATOM   8885  O  OD1   . ASP B 1 517 ? 70.109  130.896 88.620  1.00 20.97 ? 517  ASP B OD1   1 
ATOM   8886  O  OD2   . ASP B 1 517 ? 71.599  129.708 89.719  1.00 21.60 ? 517  ASP B OD2   1 
ATOM   8887  N  N     . ASP B 1 518 ? 70.143  129.841 92.968  1.00 25.93 ? 518  ASP B N     1 
ATOM   8888  C  CA    . ASP B 1 518 ? 69.810  128.615 93.686  1.00 27.79 ? 518  ASP B CA    1 
ATOM   8889  C  C     . ASP B 1 518 ? 69.473  127.420 92.806  1.00 27.34 ? 518  ASP B C     1 
ATOM   8890  O  O     . ASP B 1 518 ? 68.437  126.780 92.976  1.00 30.02 ? 518  ASP B O     1 
ATOM   8891  C  CB    . ASP B 1 518 ? 68.674  128.896 94.667  1.00 29.29 ? 518  ASP B CB    1 
ATOM   8892  C  CG    . ASP B 1 518 ? 69.023  130.005 95.642  1.00 31.65 ? 518  ASP B CG    1 
ATOM   8893  O  OD1   . ASP B 1 518 ? 70.095  129.911 96.278  1.00 32.23 ? 518  ASP B OD1   1 
ATOM   8894  O  OD2   . ASP B 1 518 ? 68.238  130.968 95.771  1.00 34.22 ? 518  ASP B OD2   1 
ATOM   8895  N  N     . VAL B 1 519 ? 70.368  127.125 91.870  1.00 25.62 ? 519  VAL B N     1 
ATOM   8896  C  CA    . VAL B 1 519 ? 70.197  126.008 90.954  1.00 22.83 ? 519  VAL B CA    1 
ATOM   8897  C  C     . VAL B 1 519 ? 71.305  124.998 91.210  1.00 21.91 ? 519  VAL B C     1 
ATOM   8898  O  O     . VAL B 1 519 ? 72.483  125.353 91.278  1.00 19.48 ? 519  VAL B O     1 
ATOM   8899  C  CB    . VAL B 1 519 ? 70.256  126.482 89.490  1.00 21.66 ? 519  VAL B CB    1 
ATOM   8900  C  CG1   . VAL B 1 519 ? 70.257  125.289 88.549  1.00 23.70 ? 519  VAL B CG1   1 
ATOM   8901  C  CG2   . VAL B 1 519 ? 69.066  127.380 89.197  1.00 23.11 ? 519  VAL B CG2   1 
ATOM   8902  N  N     . LEU B 1 520 ? 70.917  123.737 91.355  1.00 20.51 ? 520  LEU B N     1 
ATOM   8903  C  CA    . LEU B 1 520 ? 71.872  122.673 91.624  1.00 21.56 ? 520  LEU B CA    1 
ATOM   8904  C  C     . LEU B 1 520 ? 72.276  121.918 90.364  1.00 20.95 ? 520  LEU B C     1 
ATOM   8905  O  O     . LEU B 1 520 ? 71.615  121.996 89.330  1.00 21.85 ? 520  LEU B O     1 
ATOM   8906  C  CB    . LEU B 1 520 ? 71.277  121.675 92.621  1.00 23.05 ? 520  LEU B CB    1 
ATOM   8907  C  CG    . LEU B 1 520 ? 70.731  122.227 93.939  1.00 25.09 ? 520  LEU B CG    1 
ATOM   8908  C  CD1   . LEU B 1 520 ? 70.165  121.077 94.755  1.00 26.22 ? 520  LEU B CD1   1 
ATOM   8909  C  CD2   . LEU B 1 520 ? 71.834  122.944 94.711  1.00 25.33 ? 520  LEU B CD2   1 
ATOM   8910  N  N     . ASN B 1 521 ? 73.369  121.176 90.469  1.00 21.42 ? 521  ASN B N     1 
ATOM   8911  C  CA    . ASN B 1 521 ? 73.853  120.368 89.362  1.00 22.31 ? 521  ASN B CA    1 
ATOM   8912  C  C     . ASN B 1 521 ? 74.077  118.977 89.947  1.00 21.28 ? 521  ASN B C     1 
ATOM   8913  O  O     . ASN B 1 521 ? 75.133  118.688 90.518  1.00 20.48 ? 521  ASN B O     1 
ATOM   8914  C  CB    . ASN B 1 521 ? 75.155  120.952 88.811  1.00 25.82 ? 521  ASN B CB    1 
ATOM   8915  C  CG    . ASN B 1 521 ? 75.471  120.453 87.414  1.00 31.32 ? 521  ASN B CG    1 
ATOM   8916  O  OD1   . ASN B 1 521 ? 75.917  121.221 86.556  1.00 33.56 ? 521  ASN B OD1   1 
ATOM   8917  N  ND2   . ASN B 1 521 ? 75.250  119.159 87.178  1.00 29.19 ? 521  ASN B ND2   1 
ATOM   8918  N  N     . VAL B 1 522 ? 73.060  118.129 89.826  1.00 20.83 ? 522  VAL B N     1 
ATOM   8919  C  CA    . VAL B 1 522 ? 73.117  116.774 90.358  1.00 20.45 ? 522  VAL B CA    1 
ATOM   8920  C  C     . VAL B 1 522 ? 73.280  115.751 89.240  1.00 20.01 ? 522  VAL B C     1 
ATOM   8921  O  O     . VAL B 1 522 ? 72.389  115.583 88.409  1.00 19.04 ? 522  VAL B O     1 
ATOM   8922  C  CB    . VAL B 1 522 ? 71.836  116.447 91.159  1.00 20.79 ? 522  VAL B CB    1 
ATOM   8923  C  CG1   . VAL B 1 522 ? 71.974  115.088 91.847  1.00 21.53 ? 522  VAL B CG1   1 
ATOM   8924  C  CG2   . VAL B 1 522 ? 71.577  117.539 92.181  1.00 21.82 ? 522  VAL B CG2   1 
ATOM   8925  N  N     . SER B 1 523 ? 74.426  115.075 89.235  1.00 20.65 ? 523  SER B N     1 
ATOM   8926  C  CA    . SER B 1 523 ? 74.743  114.065 88.230  1.00 21.04 ? 523  SER B CA    1 
ATOM   8927  C  C     . SER B 1 523 ? 74.612  114.627 86.823  1.00 21.58 ? 523  SER B C     1 
ATOM   8928  O  O     . SER B 1 523 ? 74.207  113.925 85.899  1.00 21.23 ? 523  SER B O     1 
ATOM   8929  C  CB    . SER B 1 523 ? 73.831  112.851 88.392  1.00 23.62 ? 523  SER B CB    1 
ATOM   8930  O  OG    . SER B 1 523 ? 74.098  112.193 89.615  1.00 26.63 ? 523  SER B OG    1 
ATOM   8931  N  N     . GLY B 1 524 ? 74.955  115.901 86.671  1.00 20.58 ? 524  GLY B N     1 
ATOM   8932  C  CA    . GLY B 1 524 ? 74.871  116.537 85.370  1.00 21.94 ? 524  GLY B CA    1 
ATOM   8933  C  C     . GLY B 1 524 ? 73.463  116.974 85.025  1.00 21.90 ? 524  GLY B C     1 
ATOM   8934  O  O     . GLY B 1 524 ? 73.151  117.206 83.856  1.00 23.61 ? 524  GLY B O     1 
ATOM   8935  N  N     . HIS B 1 525 ? 72.608  117.081 86.039  1.00 22.31 ? 525  HIS B N     1 
ATOM   8936  C  CA    . HIS B 1 525 ? 71.223  117.499 85.834  1.00 22.66 ? 525  HIS B CA    1 
ATOM   8937  C  C     . HIS B 1 525 ? 70.906  118.795 86.564  1.00 23.44 ? 525  HIS B C     1 
ATOM   8938  O  O     . HIS B 1 525 ? 71.174  118.939 87.757  1.00 23.19 ? 525  HIS B O     1 
ATOM   8939  C  CB    . HIS B 1 525 ? 70.250  116.420 86.312  1.00 24.46 ? 525  HIS B CB    1 
ATOM   8940  C  CG    . HIS B 1 525 ? 70.368  115.127 85.570  1.00 24.53 ? 525  HIS B CG    1 
ATOM   8941  N  ND1   . HIS B 1 525 ? 70.809  113.965 86.168  1.00 26.87 ? 525  HIS B ND1   1 
ATOM   8942  C  CD2   . HIS B 1 525 ? 70.110  114.812 84.279  1.00 24.90 ? 525  HIS B CD2   1 
ATOM   8943  C  CE1   . HIS B 1 525 ? 70.819  112.990 85.276  1.00 26.44 ? 525  HIS B CE1   1 
ATOM   8944  N  NE2   . HIS B 1 525 ? 70.400  113.478 84.122  1.00 25.58 ? 525  HIS B NE2   1 
ATOM   8945  N  N     . ARG B 1 526 ? 70.306  119.728 85.837  1.00 21.90 ? 526  ARG B N     1 
ATOM   8946  C  CA    . ARG B 1 526 ? 69.936  121.023 86.383  1.00 19.78 ? 526  ARG B CA    1 
ATOM   8947  C  C     . ARG B 1 526 ? 68.632  120.926 87.171  1.00 19.08 ? 526  ARG B C     1 
ATOM   8948  O  O     . ARG B 1 526 ? 67.595  120.544 86.627  1.00 19.85 ? 526  ARG B O     1 
ATOM   8949  C  CB    . ARG B 1 526 ? 69.798  122.017 85.235  1.00 17.86 ? 526  ARG B CB    1 
ATOM   8950  C  CG    . ARG B 1 526 ? 69.285  123.382 85.611  1.00 18.94 ? 526  ARG B CG    1 
ATOM   8951  C  CD    . ARG B 1 526 ? 69.324  124.275 84.382  1.00 16.56 ? 526  ARG B CD    1 
ATOM   8952  N  NE    . ARG B 1 526 ? 68.591  125.519 84.570  1.00 17.58 ? 526  ARG B NE    1 
ATOM   8953  C  CZ    . ARG B 1 526 ? 68.578  126.508 83.682  1.00 16.24 ? 526  ARG B CZ    1 
ATOM   8954  N  NH1   . ARG B 1 526 ? 69.267  126.395 82.552  1.00 14.07 ? 526  ARG B NH1   1 
ATOM   8955  N  NH2   . ARG B 1 526 ? 67.857  127.595 83.912  1.00 16.73 ? 526  ARG B NH2   1 
ATOM   8956  N  N     . LEU B 1 527 ? 68.697  121.275 88.454  1.00 18.52 ? 527  LEU B N     1 
ATOM   8957  C  CA    . LEU B 1 527 ? 67.537  121.221 89.338  1.00 20.50 ? 527  LEU B CA    1 
ATOM   8958  C  C     . LEU B 1 527 ? 67.395  122.489 90.170  1.00 20.66 ? 527  LEU B C     1 
ATOM   8959  O  O     . LEU B 1 527 ? 68.386  123.103 90.558  1.00 21.69 ? 527  LEU B O     1 
ATOM   8960  C  CB    . LEU B 1 527 ? 67.646  120.021 90.285  1.00 21.13 ? 527  LEU B CB    1 
ATOM   8961  C  CG    . LEU B 1 527 ? 67.483  118.627 89.682  1.00 23.38 ? 527  LEU B CG    1 
ATOM   8962  C  CD1   . LEU B 1 527 ? 67.841  117.575 90.724  1.00 25.60 ? 527  LEU B CD1   1 
ATOM   8963  C  CD2   . LEU B 1 527 ? 66.051  118.445 89.203  1.00 23.54 ? 527  LEU B CD2   1 
ATOM   8964  N  N     . GLY B 1 528 ? 66.154  122.864 90.455  1.00 20.84 ? 528  GLY B N     1 
ATOM   8965  C  CA    . GLY B 1 528 ? 65.910  124.053 91.247  1.00 21.77 ? 528  GLY B CA    1 
ATOM   8966  C  C     . GLY B 1 528 ? 65.812  123.761 92.731  1.00 22.72 ? 528  GLY B C     1 
ATOM   8967  O  O     . GLY B 1 528 ? 65.107  122.844 93.153  1.00 22.01 ? 528  GLY B O     1 
ATOM   8968  N  N     . THR B 1 529 ? 66.533  124.538 93.530  1.00 23.62 ? 529  THR B N     1 
ATOM   8969  C  CA    . THR B 1 529 ? 66.498  124.373 94.977  1.00 24.21 ? 529  THR B CA    1 
ATOM   8970  C  C     . THR B 1 529 ? 65.073  124.589 95.484  1.00 23.30 ? 529  THR B C     1 
ATOM   8971  O  O     . THR B 1 529 ? 64.536  123.771 96.242  1.00 22.37 ? 529  THR B O     1 
ATOM   8972  C  CB    . THR B 1 529 ? 67.427  125.393 95.668  1.00 26.33 ? 529  THR B CB    1 
ATOM   8973  O  OG1   . THR B 1 529 ? 68.789  125.073 95.367  1.00 29.41 ? 529  THR B OG1   1 
ATOM   8974  C  CG2   . THR B 1 529 ? 67.224  125.373 97.172  1.00 28.26 ? 529  THR B CG2   1 
ATOM   8975  N  N     . ALA B 1 530 ? 64.463  125.690 95.053  1.00 22.36 ? 530  ALA B N     1 
ATOM   8976  C  CA    . ALA B 1 530 ? 63.107  126.041 95.469  1.00 21.73 ? 530  ALA B CA    1 
ATOM   8977  C  C     . ALA B 1 530 ? 62.055  124.982 95.143  1.00 22.04 ? 530  ALA B C     1 
ATOM   8978  O  O     . ALA B 1 530 ? 61.175  124.704 95.960  1.00 20.21 ? 530  ALA B O     1 
ATOM   8979  C  CB    . ALA B 1 530 ? 62.702  127.380 94.850  1.00 22.70 ? 530  ALA B CB    1 
ATOM   8980  N  N     . GLU B 1 531 ? 62.134  124.389 93.955  1.00 20.43 ? 531  GLU B N     1 
ATOM   8981  C  CA    . GLU B 1 531 ? 61.149  123.379 93.576  1.00 20.43 ? 531  GLU B CA    1 
ATOM   8982  C  C     . GLU B 1 531 ? 61.229  122.129 94.453  1.00 18.14 ? 531  GLU B C     1 
ATOM   8983  O  O     . GLU B 1 531 ? 60.211  121.494 94.727  1.00 17.08 ? 531  GLU B O     1 
ATOM   8984  C  CB    . GLU B 1 531 ? 61.305  122.998 92.101  1.00 22.39 ? 531  GLU B CB    1 
ATOM   8985  C  CG    . GLU B 1 531 ? 62.582  122.270 91.763  1.00 27.94 ? 531  GLU B CG    1 
ATOM   8986  C  CD    . GLU B 1 531 ? 62.656  121.891 90.295  1.00 31.50 ? 531  GLU B CD    1 
ATOM   8987  O  OE1   . GLU B 1 531 ? 61.818  121.077 89.844  1.00 32.14 ? 531  GLU B OE1   1 
ATOM   8988  O  OE2   . GLU B 1 531 ? 63.550  122.412 89.598  1.00 30.11 ? 531  GLU B OE2   1 
ATOM   8989  N  N     . ILE B 1 532 ? 62.429  121.767 94.892  1.00 16.36 ? 532  ILE B N     1 
ATOM   8990  C  CA    . ILE B 1 532 ? 62.572  120.597 95.751  1.00 15.08 ? 532  ILE B CA    1 
ATOM   8991  C  C     . ILE B 1 532 ? 61.997  120.936 97.127  1.00 15.69 ? 532  ILE B C     1 
ATOM   8992  O  O     . ILE B 1 532 ? 61.314  120.120 97.743  1.00 13.51 ? 532  ILE B O     1 
ATOM   8993  C  CB    . ILE B 1 532 ? 64.043  120.162 95.875  1.00 15.05 ? 532  ILE B CB    1 
ATOM   8994  C  CG1   . ILE B 1 532 ? 64.573  119.778 94.489  1.00 15.16 ? 532  ILE B CG1   1 
ATOM   8995  C  CG2   . ILE B 1 532 ? 64.159  118.965 96.829  1.00 14.50 ? 532  ILE B CG2   1 
ATOM   8996  C  CD1   . ILE B 1 532 ? 66.036  119.377 94.463  1.00 16.17 ? 532  ILE B CD1   1 
ATOM   8997  N  N     . GLU B 1 533 ? 62.264  122.150 97.597  1.00 14.81 ? 533  GLU B N     1 
ATOM   8998  C  CA    . GLU B 1 533 ? 61.740  122.594 98.883  1.00 16.02 ? 533  GLU B CA    1 
ATOM   8999  C  C     . GLU B 1 533 ? 60.215  122.618 98.832  1.00 16.54 ? 533  GLU B C     1 
ATOM   9000  O  O     . GLU B 1 533 ? 59.553  122.159 99.759  1.00 15.82 ? 533  GLU B O     1 
ATOM   9001  C  CB    . GLU B 1 533 ? 62.285  123.983 99.220  1.00 15.93 ? 533  GLU B CB    1 
ATOM   9002  C  CG    . GLU B 1 533 ? 63.799  123.991 99.349  1.00 15.76 ? 533  GLU B CG    1 
ATOM   9003  C  CD    . GLU B 1 533 ? 64.366  125.372 99.590  1.00 17.10 ? 533  GLU B CD    1 
ATOM   9004  O  OE1   . GLU B 1 533 ? 63.664  126.363 99.307  1.00 18.70 ? 533  GLU B OE1   1 
ATOM   9005  O  OE2   . GLU B 1 533 ? 65.521  125.461 100.047 1.00 18.80 ? 533  GLU B OE2   1 
ATOM   9006  N  N     . SER B 1 534 ? 59.659  123.142 97.742  1.00 17.21 ? 534  SER B N     1 
ATOM   9007  C  CA    . SER B 1 534 ? 58.208  123.191 97.593  1.00 17.74 ? 534  SER B CA    1 
ATOM   9008  C  C     . SER B 1 534 ? 57.619  121.784 97.594  1.00 17.74 ? 534  SER B C     1 
ATOM   9009  O  O     . SER B 1 534 ? 56.554  121.550 98.163  1.00 16.88 ? 534  SER B O     1 
ATOM   9010  C  CB    . SER B 1 534 ? 57.820  123.901 96.295  1.00 20.21 ? 534  SER B CB    1 
ATOM   9011  O  OG    . SER B 1 534 ? 58.104  125.284 96.378  1.00 24.18 ? 534  SER B OG    1 
ATOM   9012  N  N     . ALA B 1 535 ? 58.309  120.852 96.941  1.00 16.26 ? 535  ALA B N     1 
ATOM   9013  C  CA    . ALA B 1 535 ? 57.845  119.470 96.888  1.00 15.58 ? 535  ALA B CA    1 
ATOM   9014  C  C     . ALA B 1 535 ? 57.810  118.894 98.301  1.00 14.76 ? 535  ALA B C     1 
ATOM   9015  O  O     . ALA B 1 535 ? 56.839  118.243 98.699  1.00 15.42 ? 535  ALA B O     1 
ATOM   9016  C  CB    . ALA B 1 535 ? 58.771  118.642 96.007  1.00 15.88 ? 535  ALA B CB    1 
ATOM   9017  N  N     . LEU B 1 536 ? 58.869  119.151 99.060  1.00 14.66 ? 536  LEU B N     1 
ATOM   9018  C  CA    . LEU B 1 536 ? 58.971  118.660 100.430 1.00 15.41 ? 536  LEU B CA    1 
ATOM   9019  C  C     . LEU B 1 536 ? 57.888  119.215 101.350 1.00 15.68 ? 536  LEU B C     1 
ATOM   9020  O  O     . LEU B 1 536 ? 57.245  118.467 102.086 1.00 15.77 ? 536  LEU B O     1 
ATOM   9021  C  CB    . LEU B 1 536 ? 60.351  118.995 100.998 1.00 14.90 ? 536  LEU B CB    1 
ATOM   9022  C  CG    . LEU B 1 536 ? 61.488  118.113 100.473 1.00 12.49 ? 536  LEU B CG    1 
ATOM   9023  C  CD1   . LEU B 1 536 ? 62.831  118.742 100.803 1.00 13.72 ? 536  LEU B CD1   1 
ATOM   9024  C  CD2   . LEU B 1 536 ? 61.365  116.716 101.079 1.00 13.35 ? 536  LEU B CD2   1 
ATOM   9025  N  N     . VAL B 1 537 ? 57.681  120.527 101.296 1.00 15.69 ? 537  VAL B N     1 
ATOM   9026  C  CA    . VAL B 1 537 ? 56.693  121.173 102.149 1.00 15.66 ? 537  VAL B CA    1 
ATOM   9027  C  C     . VAL B 1 537 ? 55.262  120.765 101.803 1.00 16.91 ? 537  VAL B C     1 
ATOM   9028  O  O     . VAL B 1 537 ? 54.356  120.891 102.632 1.00 14.79 ? 537  VAL B O     1 
ATOM   9029  C  CB    . VAL B 1 537 ? 56.843  122.711 102.078 1.00 16.93 ? 537  VAL B CB    1 
ATOM   9030  C  CG1   . VAL B 1 537 ? 55.807  123.392 102.964 1.00 18.45 ? 537  VAL B CG1   1 
ATOM   9031  C  CG2   . VAL B 1 537 ? 58.249  123.098 102.518 1.00 18.05 ? 537  VAL B CG2   1 
ATOM   9032  N  N     . ALA B 1 538 ? 55.066  120.266 100.585 1.00 15.50 ? 538  ALA B N     1 
ATOM   9033  C  CA    . ALA B 1 538 ? 53.748  119.826 100.150 1.00 16.18 ? 538  ALA B CA    1 
ATOM   9034  C  C     . ALA B 1 538 ? 53.335  118.592 100.949 1.00 17.91 ? 538  ALA B C     1 
ATOM   9035  O  O     . ALA B 1 538 ? 52.145  118.289 101.066 1.00 16.73 ? 538  ALA B O     1 
ATOM   9036  C  CB    . ALA B 1 538 ? 53.759  119.510 98.652  1.00 16.92 ? 538  ALA B CB    1 
ATOM   9037  N  N     . HIS B 1 539 ? 54.317  117.882 101.498 1.00 15.95 ? 539  HIS B N     1 
ATOM   9038  C  CA    . HIS B 1 539 ? 54.028  116.694 102.296 1.00 15.83 ? 539  HIS B CA    1 
ATOM   9039  C  C     . HIS B 1 539 ? 53.332  117.136 103.588 1.00 16.86 ? 539  HIS B C     1 
ATOM   9040  O  O     . HIS B 1 539 ? 53.799  118.048 104.267 1.00 15.74 ? 539  HIS B O     1 
ATOM   9041  C  CB    . HIS B 1 539 ? 55.319  115.939 102.623 1.00 15.58 ? 539  HIS B CB    1 
ATOM   9042  C  CG    . HIS B 1 539 ? 55.082  114.612 103.275 1.00 17.82 ? 539  HIS B CG    1 
ATOM   9043  N  ND1   . HIS B 1 539 ? 54.660  114.489 104.582 1.00 17.68 ? 539  HIS B ND1   1 
ATOM   9044  C  CD2   . HIS B 1 539 ? 55.137  113.354 102.777 1.00 17.30 ? 539  HIS B CD2   1 
ATOM   9045  C  CE1   . HIS B 1 539 ? 54.463  113.212 104.860 1.00 18.87 ? 539  HIS B CE1   1 
ATOM   9046  N  NE2   . HIS B 1 539 ? 54.745  112.503 103.781 1.00 19.30 ? 539  HIS B NE2   1 
ATOM   9047  N  N     . PRO B 1 540 ? 52.210  116.484 103.945 1.00 17.66 ? 540  PRO B N     1 
ATOM   9048  C  CA    . PRO B 1 540 ? 51.420  116.792 105.145 1.00 19.19 ? 540  PRO B CA    1 
ATOM   9049  C  C     . PRO B 1 540 ? 52.163  116.868 106.479 1.00 19.35 ? 540  PRO B C     1 
ATOM   9050  O  O     . PRO B 1 540 ? 51.746  117.596 107.377 1.00 20.75 ? 540  PRO B O     1 
ATOM   9051  C  CB    . PRO B 1 540 ? 50.359  115.690 105.154 1.00 19.85 ? 540  PRO B CB    1 
ATOM   9052  C  CG    . PRO B 1 540 ? 50.183  115.382 103.708 1.00 21.69 ? 540  PRO B CG    1 
ATOM   9053  C  CD    . PRO B 1 540 ? 51.611  115.352 103.215 1.00 19.29 ? 540  PRO B CD    1 
ATOM   9054  N  N     . LYS B 1 541 ? 53.253  116.121 106.616 1.00 17.67 ? 541  LYS B N     1 
ATOM   9055  C  CA    . LYS B 1 541 ? 54.001  116.120 107.870 1.00 17.18 ? 541  LYS B CA    1 
ATOM   9056  C  C     . LYS B 1 541 ? 55.190  117.073 107.915 1.00 16.83 ? 541  LYS B C     1 
ATOM   9057  O  O     . LYS B 1 541 ? 55.852  117.200 108.943 1.00 16.98 ? 541  LYS B O     1 
ATOM   9058  C  CB    . LYS B 1 541 ? 54.468  114.697 108.189 1.00 18.23 ? 541  LYS B CB    1 
ATOM   9059  C  CG    . LYS B 1 541 ? 53.316  113.714 108.328 1.00 21.99 ? 541  LYS B CG    1 
ATOM   9060  C  CD    . LYS B 1 541 ? 53.793  112.314 108.674 1.00 23.67 ? 541  LYS B CD    1 
ATOM   9061  C  CE    . LYS B 1 541 ? 52.608  111.365 108.846 1.00 27.99 ? 541  LYS B CE    1 
ATOM   9062  N  NZ    . LYS B 1 541 ? 53.040  109.978 109.197 1.00 31.57 ? 541  LYS B NZ    1 
ATOM   9063  N  N     . ILE B 1 542 ? 55.453  117.753 106.805 1.00 17.06 ? 542  ILE B N     1 
ATOM   9064  C  CA    . ILE B 1 542 ? 56.577  118.675 106.745 1.00 16.34 ? 542  ILE B CA    1 
ATOM   9065  C  C     . ILE B 1 542 ? 56.124  120.129 106.811 1.00 16.12 ? 542  ILE B C     1 
ATOM   9066  O  O     . ILE B 1 542 ? 55.232  120.550 106.077 1.00 17.13 ? 542  ILE B O     1 
ATOM   9067  C  CB    . ILE B 1 542 ? 57.403  118.440 105.465 1.00 16.69 ? 542  ILE B CB    1 
ATOM   9068  C  CG1   . ILE B 1 542 ? 58.016  117.031 105.509 1.00 14.96 ? 542  ILE B CG1   1 
ATOM   9069  C  CG2   . ILE B 1 542 ? 58.487  119.503 105.335 1.00 15.86 ? 542  ILE B CG2   1 
ATOM   9070  C  CD1   . ILE B 1 542 ? 58.896  116.701 104.327 1.00 13.02 ? 542  ILE B CD1   1 
ATOM   9071  N  N     . ALA B 1 543 ? 56.753  120.890 107.699 1.00 16.82 ? 543  ALA B N     1 
ATOM   9072  C  CA    . ALA B 1 543 ? 56.414  122.294 107.883 1.00 17.10 ? 543  ALA B CA    1 
ATOM   9073  C  C     . ALA B 1 543 ? 57.281  123.232 107.058 1.00 16.93 ? 543  ALA B C     1 
ATOM   9074  O  O     . ALA B 1 543 ? 56.798  124.225 106.522 1.00 16.50 ? 543  ALA B O     1 
ATOM   9075  C  CB    . ALA B 1 543 ? 56.526  122.663 109.354 1.00 17.59 ? 543  ALA B CB    1 
ATOM   9076  N  N     . GLU B 1 544 ? 58.567  122.923 106.967 1.00 17.98 ? 544  GLU B N     1 
ATOM   9077  C  CA    . GLU B 1 544 ? 59.491  123.771 106.234 1.00 17.72 ? 544  GLU B CA    1 
ATOM   9078  C  C     . GLU B 1 544 ? 60.703  122.958 105.791 1.00 17.12 ? 544  GLU B C     1 
ATOM   9079  O  O     . GLU B 1 544 ? 60.989  121.904 106.358 1.00 15.82 ? 544  GLU B O     1 
ATOM   9080  C  CB    . GLU B 1 544 ? 59.914  124.936 107.140 1.00 21.06 ? 544  GLU B CB    1 
ATOM   9081  C  CG    . GLU B 1 544 ? 60.811  125.979 106.501 1.00 27.45 ? 544  GLU B CG    1 
ATOM   9082  C  CD    . GLU B 1 544 ? 60.915  127.242 107.349 1.00 30.59 ? 544  GLU B CD    1 
ATOM   9083  O  OE1   . GLU B 1 544 ? 61.000  127.123 108.591 1.00 28.59 ? 544  GLU B OE1   1 
ATOM   9084  O  OE2   . GLU B 1 544 ? 60.919  128.353 106.772 1.00 34.21 ? 544  GLU B OE2   1 
ATOM   9085  N  N     . ALA B 1 545 ? 61.406  123.445 104.773 1.00 16.27 ? 545  ALA B N     1 
ATOM   9086  C  CA    . ALA B 1 545 ? 62.584  122.748 104.267 1.00 15.95 ? 545  ALA B CA    1 
ATOM   9087  C  C     . ALA B 1 545 ? 63.555  123.694 103.578 1.00 16.37 ? 545  ALA B C     1 
ATOM   9088  O  O     . ALA B 1 545 ? 63.157  124.707 102.999 1.00 16.82 ? 545  ALA B O     1 
ATOM   9089  C  CB    . ALA B 1 545 ? 62.164  121.648 103.296 1.00 18.02 ? 545  ALA B CB    1 
ATOM   9090  N  N     . ALA B 1 546 ? 64.837  123.358 103.658 1.00 16.47 ? 546  ALA B N     1 
ATOM   9091  C  CA    . ALA B 1 546 ? 65.891  124.139 103.026 1.00 16.12 ? 546  ALA B CA    1 
ATOM   9092  C  C     . ALA B 1 546 ? 66.808  123.127 102.343 1.00 16.82 ? 546  ALA B C     1 
ATOM   9093  O  O     . ALA B 1 546 ? 67.403  122.272 103.001 1.00 17.91 ? 546  ALA B O     1 
ATOM   9094  C  CB    . ALA B 1 546 ? 66.658  124.939 104.070 1.00 14.97 ? 546  ALA B CB    1 
ATOM   9095  N  N     . VAL B 1 547 ? 66.908  123.225 101.023 1.00 16.60 ? 547  VAL B N     1 
ATOM   9096  C  CA    . VAL B 1 547 ? 67.723  122.299 100.244 1.00 16.97 ? 547  VAL B CA    1 
ATOM   9097  C  C     . VAL B 1 547 ? 69.016  122.937 99.748  1.00 17.77 ? 547  VAL B C     1 
ATOM   9098  O  O     . VAL B 1 547 ? 69.007  124.048 99.221  1.00 17.06 ? 547  VAL B O     1 
ATOM   9099  C  CB    . VAL B 1 547 ? 66.928  121.772 99.020  1.00 16.09 ? 547  VAL B CB    1 
ATOM   9100  C  CG1   . VAL B 1 547 ? 67.828  120.922 98.122  1.00 15.08 ? 547  VAL B CG1   1 
ATOM   9101  C  CG2   . VAL B 1 547 ? 65.736  120.954 99.492  1.00 15.79 ? 547  VAL B CG2   1 
ATOM   9102  N  N     . VAL B 1 548 ? 70.128  122.228 99.922  1.00 18.33 ? 548  VAL B N     1 
ATOM   9103  C  CA    . VAL B 1 548 ? 71.419  122.720 99.466  1.00 18.00 ? 548  VAL B CA    1 
ATOM   9104  C  C     . VAL B 1 548 ? 72.158  121.592 98.775  1.00 18.72 ? 548  VAL B C     1 
ATOM   9105  O  O     . VAL B 1 548 ? 71.855  120.414 98.984  1.00 18.27 ? 548  VAL B O     1 
ATOM   9106  C  CB    . VAL B 1 548 ? 72.297  123.234 100.637 1.00 19.27 ? 548  VAL B CB    1 
ATOM   9107  C  CG1   . VAL B 1 548 ? 71.549  124.309 101.418 1.00 19.18 ? 548  VAL B CG1   1 
ATOM   9108  C  CG2   . VAL B 1 548 ? 72.696  122.082 101.544 1.00 20.49 ? 548  VAL B CG2   1 
ATOM   9109  N  N     . GLY B 1 549 ? 73.110  121.960 97.928  1.00 18.68 ? 549  GLY B N     1 
ATOM   9110  C  CA    . GLY B 1 549 ? 73.897  120.964 97.235  1.00 19.93 ? 549  GLY B CA    1 
ATOM   9111  C  C     . GLY B 1 549 ? 75.208  120.826 97.980  1.00 20.50 ? 549  GLY B C     1 
ATOM   9112  O  O     . GLY B 1 549 ? 75.726  121.811 98.506  1.00 20.67 ? 549  GLY B O     1 
ATOM   9113  N  N     . ILE B 1 550 ? 75.733  119.608 98.056  1.00 19.02 ? 550  ILE B N     1 
ATOM   9114  C  CA    . ILE B 1 550 ? 77.002  119.370 98.734  1.00 20.29 ? 550  ILE B CA    1 
ATOM   9115  C  C     . ILE B 1 550 ? 77.901  118.618 97.765  1.00 19.84 ? 550  ILE B C     1 
ATOM   9116  O  O     . ILE B 1 550 ? 77.420  117.890 96.901  1.00 19.87 ? 550  ILE B O     1 
ATOM   9117  C  CB    . ILE B 1 550 ? 76.833  118.511 100.010 1.00 20.35 ? 550  ILE B CB    1 
ATOM   9118  C  CG1   . ILE B 1 550 ? 76.210  117.158 99.650  1.00 22.91 ? 550  ILE B CG1   1 
ATOM   9119  C  CG2   . ILE B 1 550 ? 75.973  119.253 101.024 1.00 22.68 ? 550  ILE B CG2   1 
ATOM   9120  C  CD1   . ILE B 1 550 ? 76.136  116.185 100.808 1.00 24.83 ? 550  ILE B CD1   1 
ATOM   9121  N  N     . PRO B 1 551 ? 79.222  118.784 97.896  1.00 21.09 ? 551  PRO B N     1 
ATOM   9122  C  CA    . PRO B 1 551 ? 80.143  118.089 96.994  1.00 20.99 ? 551  PRO B CA    1 
ATOM   9123  C  C     . PRO B 1 551 ? 79.958  116.577 97.021  1.00 21.96 ? 551  PRO B C     1 
ATOM   9124  O  O     . PRO B 1 551 ? 79.675  115.996 98.069  1.00 22.64 ? 551  PRO B O     1 
ATOM   9125  C  CB    . PRO B 1 551 ? 81.519  118.506 97.515  1.00 20.99 ? 551  PRO B CB    1 
ATOM   9126  C  CG    . PRO B 1 551 ? 81.265  119.863 98.080  1.00 21.27 ? 551  PRO B CG    1 
ATOM   9127  C  CD    . PRO B 1 551 ? 79.957  119.664 98.819  1.00 20.20 ? 551  PRO B CD    1 
ATOM   9128  N  N     . HIS B 1 552 ? 80.105  115.954 95.857  1.00 22.89 ? 552  HIS B N     1 
ATOM   9129  C  CA    . HIS B 1 552 ? 79.999  114.507 95.726  1.00 23.57 ? 552  HIS B CA    1 
ATOM   9130  C  C     . HIS B 1 552 ? 80.988  114.104 94.639  1.00 23.99 ? 552  HIS B C     1 
ATOM   9131  O  O     . HIS B 1 552 ? 80.908  114.582 93.510  1.00 21.65 ? 552  HIS B O     1 
ATOM   9132  C  CB    . HIS B 1 552 ? 78.589  114.083 95.318  1.00 25.27 ? 552  HIS B CB    1 
ATOM   9133  C  CG    . HIS B 1 552 ? 78.349  112.610 95.441  1.00 26.20 ? 552  HIS B CG    1 
ATOM   9134  N  ND1   . HIS B 1 552 ? 77.954  112.014 96.621  1.00 28.40 ? 552  HIS B ND1   1 
ATOM   9135  C  CD2   . HIS B 1 552 ? 78.491  111.606 94.544  1.00 26.44 ? 552  HIS B CD2   1 
ATOM   9136  C  CE1   . HIS B 1 552 ? 77.862  110.709 96.444  1.00 26.50 ? 552  HIS B CE1   1 
ATOM   9137  N  NE2   . HIS B 1 552 ? 78.182  110.435 95.192  1.00 29.17 ? 552  HIS B NE2   1 
ATOM   9138  N  N     . ALA B 1 553 ? 81.917  113.221 94.988  1.00 24.46 ? 553  ALA B N     1 
ATOM   9139  C  CA    . ALA B 1 553 ? 82.952  112.765 94.065  1.00 24.53 ? 553  ALA B CA    1 
ATOM   9140  C  C     . ALA B 1 553 ? 82.450  112.282 92.709  1.00 24.33 ? 553  ALA B C     1 
ATOM   9141  O  O     . ALA B 1 553 ? 83.154  112.412 91.707  1.00 26.23 ? 553  ALA B O     1 
ATOM   9142  C  CB    . ALA B 1 553 ? 83.783  111.668 94.727  1.00 24.49 ? 553  ALA B CB    1 
ATOM   9143  N  N     . ILE B 1 554 ? 81.245  111.726 92.671  1.00 23.59 ? 554  ILE B N     1 
ATOM   9144  C  CA    . ILE B 1 554 ? 80.697  111.217 91.418  1.00 24.92 ? 554  ILE B CA    1 
ATOM   9145  C  C     . ILE B 1 554 ? 79.612  112.096 90.806  1.00 23.84 ? 554  ILE B C     1 
ATOM   9146  O  O     . ILE B 1 554 ? 79.672  112.438 89.625  1.00 22.94 ? 554  ILE B O     1 
ATOM   9147  C  CB    . ILE B 1 554 ? 80.106  109.798 91.602  1.00 27.24 ? 554  ILE B CB    1 
ATOM   9148  C  CG1   . ILE B 1 554 ? 81.207  108.815 92.014  1.00 28.28 ? 554  ILE B CG1   1 
ATOM   9149  C  CG2   . ILE B 1 554 ? 79.437  109.341 90.312  1.00 27.00 ? 554  ILE B CG2   1 
ATOM   9150  C  CD1   . ILE B 1 554 ? 82.296  108.637 90.981  1.00 30.94 ? 554  ILE B CD1   1 
ATOM   9151  N  N     . LYS B 1 555 ? 78.622  112.452 91.618  1.00 22.78 ? 555  LYS B N     1 
ATOM   9152  C  CA    . LYS B 1 555 ? 77.488  113.254 91.169  1.00 22.73 ? 555  LYS B CA    1 
ATOM   9153  C  C     . LYS B 1 555 ? 77.741  114.747 90.980  1.00 21.22 ? 555  LYS B C     1 
ATOM   9154  O  O     . LYS B 1 555 ? 76.902  115.448 90.422  1.00 21.36 ? 555  LYS B O     1 
ATOM   9155  C  CB    . LYS B 1 555 ? 76.325  113.091 92.148  1.00 23.61 ? 555  LYS B CB    1 
ATOM   9156  C  CG    . LYS B 1 555 ? 75.865  111.658 92.363  1.00 28.32 ? 555  LYS B CG    1 
ATOM   9157  C  CD    . LYS B 1 555 ? 74.714  111.617 93.364  1.00 30.34 ? 555  LYS B CD    1 
ATOM   9158  C  CE    . LYS B 1 555 ? 74.234  110.195 93.603  1.00 34.86 ? 555  LYS B CE    1 
ATOM   9159  N  NZ    . LYS B 1 555 ? 73.012  110.158 94.453  1.00 36.27 ? 555  LYS B NZ    1 
ATOM   9160  N  N     . GLY B 1 556 ? 78.886  115.235 91.439  1.00 20.39 ? 556  GLY B N     1 
ATOM   9161  C  CA    . GLY B 1 556 ? 79.163  116.655 91.327  1.00 19.75 ? 556  GLY B CA    1 
ATOM   9162  C  C     . GLY B 1 556 ? 78.590  117.265 92.591  1.00 18.04 ? 556  GLY B C     1 
ATOM   9163  O  O     . GLY B 1 556 ? 79.325  117.775 93.433  1.00 19.08 ? 556  GLY B O     1 
ATOM   9164  N  N     . GLN B 1 557 ? 77.267  117.203 92.716  1.00 18.09 ? 557  GLN B N     1 
ATOM   9165  C  CA    . GLN B 1 557 ? 76.566  117.692 93.895  1.00 18.30 ? 557  GLN B CA    1 
ATOM   9166  C  C     . GLN B 1 557 ? 75.539  116.655 94.329  1.00 18.37 ? 557  GLN B C     1 
ATOM   9167  O  O     . GLN B 1 557 ? 74.904  116.016 93.493  1.00 19.22 ? 557  GLN B O     1 
ATOM   9168  C  CB    . GLN B 1 557 ? 75.823  119.008 93.619  1.00 18.87 ? 557  GLN B CB    1 
ATOM   9169  C  CG    . GLN B 1 557 ? 76.700  120.252 93.555  1.00 20.74 ? 557  GLN B CG    1 
ATOM   9170  C  CD    . GLN B 1 557 ? 75.880  121.527 93.628  1.00 22.52 ? 557  GLN B CD    1 
ATOM   9171  O  OE1   . GLN B 1 557 ? 75.021  121.776 92.780  1.00 23.54 ? 557  GLN B OE1   1 
ATOM   9172  N  NE2   . GLN B 1 557 ? 76.138  122.340 94.649  1.00 21.57 ? 557  GLN B NE2   1 
ATOM   9173  N  N     . ALA B 1 558 ? 75.393  116.480 95.636  1.00 19.06 ? 558  ALA B N     1 
ATOM   9174  C  CA    . ALA B 1 558 ? 74.402  115.556 96.169  1.00 18.97 ? 558  ALA B CA    1 
ATOM   9175  C  C     . ALA B 1 558 ? 73.361  116.457 96.822  1.00 18.78 ? 558  ALA B C     1 
ATOM   9176  O  O     . ALA B 1 558 ? 73.690  117.556 97.272  1.00 19.06 ? 558  ALA B O     1 
ATOM   9177  C  CB    . ALA B 1 558 ? 75.034  114.625 97.201  1.00 19.88 ? 558  ALA B CB    1 
ATOM   9178  N  N     . ILE B 1 559 ? 72.113  116.007 96.872  1.00 17.58 ? 559  ILE B N     1 
ATOM   9179  C  CA    . ILE B 1 559 ? 71.044  116.805 97.461  1.00 17.39 ? 559  ILE B CA    1 
ATOM   9180  C  C     . ILE B 1 559 ? 70.959  116.596 98.969  1.00 18.42 ? 559  ILE B C     1 
ATOM   9181  O  O     . ILE B 1 559 ? 70.721  115.482 99.439  1.00 19.46 ? 559  ILE B O     1 
ATOM   9182  C  CB    . ILE B 1 559 ? 69.686  116.450 96.818  1.00 17.69 ? 559  ILE B CB    1 
ATOM   9183  C  CG1   . ILE B 1 559 ? 69.766  116.682 95.308  1.00 19.36 ? 559  ILE B CG1   1 
ATOM   9184  C  CG2   . ILE B 1 559 ? 68.567  117.298 97.436  1.00 17.96 ? 559  ILE B CG2   1 
ATOM   9185  C  CD1   . ILE B 1 559 ? 68.580  116.153 94.532  1.00 18.42 ? 559  ILE B CD1   1 
ATOM   9186  N  N     . TYR B 1 560 ? 71.158  117.679 99.717  1.00 17.04 ? 560  TYR B N     1 
ATOM   9187  C  CA    . TYR B 1 560 ? 71.109  117.657 101.177 1.00 17.47 ? 560  TYR B CA    1 
ATOM   9188  C  C     . TYR B 1 560 ? 69.909  118.500 101.603 1.00 15.86 ? 560  TYR B C     1 
ATOM   9189  O  O     . TYR B 1 560 ? 69.878  119.703 101.352 1.00 16.88 ? 560  TYR B O     1 
ATOM   9190  C  CB    . TYR B 1 560 ? 72.410  118.246 101.737 1.00 18.66 ? 560  TYR B CB    1 
ATOM   9191  C  CG    . TYR B 1 560 ? 72.610  118.068 103.228 1.00 22.19 ? 560  TYR B CG    1 
ATOM   9192  C  CD1   . TYR B 1 560 ? 71.848  118.787 104.149 1.00 21.81 ? 560  TYR B CD1   1 
ATOM   9193  C  CD2   . TYR B 1 560 ? 73.569  117.178 103.717 1.00 23.15 ? 560  TYR B CD2   1 
ATOM   9194  C  CE1   . TYR B 1 560 ? 72.037  118.627 105.521 1.00 23.46 ? 560  TYR B CE1   1 
ATOM   9195  C  CE2   . TYR B 1 560 ? 73.764  117.009 105.089 1.00 23.99 ? 560  TYR B CE2   1 
ATOM   9196  C  CZ    . TYR B 1 560 ? 72.996  117.736 105.983 1.00 25.42 ? 560  TYR B CZ    1 
ATOM   9197  O  OH    . TYR B 1 560 ? 73.184  117.570 107.336 1.00 26.72 ? 560  TYR B OH    1 
ATOM   9198  N  N     . ALA B 1 561 ? 68.922  117.874 102.241 1.00 14.43 ? 561  ALA B N     1 
ATOM   9199  C  CA    . ALA B 1 561 ? 67.721  118.593 102.656 1.00 15.52 ? 561  ALA B CA    1 
ATOM   9200  C  C     . ALA B 1 561 ? 67.489  118.704 104.159 1.00 16.50 ? 561  ALA B C     1 
ATOM   9201  O  O     . ALA B 1 561 ? 67.378  117.694 104.857 1.00 16.42 ? 561  ALA B O     1 
ATOM   9202  C  CB    . ALA B 1 561 ? 66.490  117.958 102.000 1.00 14.09 ? 561  ALA B CB    1 
ATOM   9203  N  N     . TYR B 1 562 ? 67.426  119.940 104.653 1.00 16.53 ? 562  TYR B N     1 
ATOM   9204  C  CA    . TYR B 1 562 ? 67.144  120.182 106.066 1.00 18.55 ? 562  TYR B CA    1 
ATOM   9205  C  C     . TYR B 1 562 ? 65.622  120.198 106.114 1.00 18.22 ? 562  TYR B C     1 
ATOM   9206  O  O     . TYR B 1 562 ? 64.988  120.948 105.370 1.00 18.31 ? 562  TYR B O     1 
ATOM   9207  C  CB    . TYR B 1 562 ? 67.668  121.549 106.526 1.00 18.22 ? 562  TYR B CB    1 
ATOM   9208  C  CG    . TYR B 1 562 ? 69.166  121.707 106.488 1.00 20.99 ? 562  TYR B CG    1 
ATOM   9209  C  CD1   . TYR B 1 562 ? 69.836  121.955 105.288 1.00 20.75 ? 562  TYR B CD1   1 
ATOM   9210  C  CD2   . TYR B 1 562 ? 69.918  121.631 107.658 1.00 21.73 ? 562  TYR B CD2   1 
ATOM   9211  C  CE1   . TYR B 1 562 ? 71.218  122.130 105.258 1.00 23.04 ? 562  TYR B CE1   1 
ATOM   9212  C  CE2   . TYR B 1 562 ? 71.296  121.800 107.638 1.00 24.90 ? 562  TYR B CE2   1 
ATOM   9213  C  CZ    . TYR B 1 562 ? 71.940  122.051 106.437 1.00 24.16 ? 562  TYR B CZ    1 
ATOM   9214  O  OH    . TYR B 1 562 ? 73.302  122.228 106.427 1.00 27.34 ? 562  TYR B OH    1 
ATOM   9215  N  N     . VAL B 1 563 ? 65.036  119.379 106.978 1.00 18.24 ? 563  VAL B N     1 
ATOM   9216  C  CA    . VAL B 1 563 ? 63.584  119.310 107.056 1.00 18.08 ? 563  VAL B CA    1 
ATOM   9217  C  C     . VAL B 1 563 ? 63.036  119.516 108.456 1.00 18.62 ? 563  VAL B C     1 
ATOM   9218  O  O     . VAL B 1 563 ? 63.479  118.874 109.407 1.00 18.54 ? 563  VAL B O     1 
ATOM   9219  C  CB    . VAL B 1 563 ? 63.072  117.947 106.544 1.00 18.29 ? 563  VAL B CB    1 
ATOM   9220  C  CG1   . VAL B 1 563 ? 61.552  117.903 106.605 1.00 18.33 ? 563  VAL B CG1   1 
ATOM   9221  C  CG2   . VAL B 1 563 ? 63.556  117.708 105.120 1.00 17.97 ? 563  VAL B CG2   1 
ATOM   9222  N  N     . THR B 1 564 ? 62.073  120.423 108.576 1.00 18.18 ? 564  THR B N     1 
ATOM   9223  C  CA    . THR B 1 564 ? 61.435  120.680 109.858 1.00 18.44 ? 564  THR B CA    1 
ATOM   9224  C  C     . THR B 1 564 ? 60.080  119.996 109.807 1.00 18.55 ? 564  THR B C     1 
ATOM   9225  O  O     . THR B 1 564 ? 59.263  120.285 108.935 1.00 18.14 ? 564  THR B O     1 
ATOM   9226  C  CB    . THR B 1 564 ? 61.237  122.181 110.106 1.00 18.91 ? 564  THR B CB    1 
ATOM   9227  O  OG1   . THR B 1 564 ? 62.511  122.832 110.124 1.00 20.53 ? 564  THR B OG1   1 
ATOM   9228  C  CG2   . THR B 1 564 ? 60.549  122.409 111.445 1.00 19.68 ? 564  THR B CG2   1 
ATOM   9229  N  N     . LEU B 1 565 ? 59.848  119.073 110.732 1.00 19.35 ? 565  LEU B N     1 
ATOM   9230  C  CA    . LEU B 1 565 ? 58.588  118.339 110.776 1.00 19.19 ? 565  LEU B CA    1 
ATOM   9231  C  C     . LEU B 1 565 ? 57.558  119.027 111.657 1.00 19.76 ? 565  LEU B C     1 
ATOM   9232  O  O     . LEU B 1 565 ? 57.911  119.707 112.616 1.00 19.71 ? 565  LEU B O     1 
ATOM   9233  C  CB    . LEU B 1 565 ? 58.822  116.926 111.318 1.00 18.75 ? 565  LEU B CB    1 
ATOM   9234  C  CG    . LEU B 1 565 ? 59.768  116.015 110.532 1.00 17.48 ? 565  LEU B CG    1 
ATOM   9235  C  CD1   . LEU B 1 565 ? 60.034  114.730 111.319 1.00 17.53 ? 565  LEU B CD1   1 
ATOM   9236  C  CD2   . LEU B 1 565 ? 59.151  115.705 109.175 1.00 18.42 ? 565  LEU B CD2   1 
ATOM   9237  N  N     . ASN B 1 566 ? 56.283  118.857 111.324 1.00 19.75 ? 566  ASN B N     1 
ATOM   9238  C  CA    . ASN B 1 566 ? 55.221  119.422 112.140 1.00 20.88 ? 566  ASN B CA    1 
ATOM   9239  C  C     . ASN B 1 566 ? 55.232  118.638 113.450 1.00 22.75 ? 566  ASN B C     1 
ATOM   9240  O  O     . ASN B 1 566 ? 55.796  117.545 113.516 1.00 21.37 ? 566  ASN B O     1 
ATOM   9241  C  CB    . ASN B 1 566 ? 53.862  119.256 111.459 1.00 21.48 ? 566  ASN B CB    1 
ATOM   9242  C  CG    . ASN B 1 566 ? 53.672  120.212 110.304 1.00 22.28 ? 566  ASN B CG    1 
ATOM   9243  O  OD1   . ASN B 1 566 ? 53.907  121.412 110.439 1.00 23.51 ? 566  ASN B OD1   1 
ATOM   9244  N  ND2   . ASN B 1 566 ? 53.237  119.690 109.164 1.00 21.32 ? 566  ASN B ND2   1 
ATOM   9245  N  N     . HIS B 1 567 ? 54.608  119.188 114.485 1.00 23.87 ? 567  HIS B N     1 
ATOM   9246  C  CA    . HIS B 1 567 ? 54.565  118.524 115.782 1.00 26.33 ? 567  HIS B CA    1 
ATOM   9247  C  C     . HIS B 1 567 ? 53.803  117.206 115.729 1.00 29.00 ? 567  HIS B C     1 
ATOM   9248  O  O     . HIS B 1 567 ? 52.918  117.017 114.892 1.00 28.05 ? 567  HIS B O     1 
ATOM   9249  C  CB    . HIS B 1 567 ? 53.924  119.440 116.827 1.00 25.32 ? 567  HIS B CB    1 
ATOM   9250  C  CG    . HIS B 1 567 ? 54.768  120.619 117.193 1.00 24.26 ? 567  HIS B CG    1 
ATOM   9251  N  ND1   . HIS B 1 567 ? 54.390  121.536 118.150 1.00 24.53 ? 567  HIS B ND1   1 
ATOM   9252  C  CD2   . HIS B 1 567 ? 55.978  121.025 116.740 1.00 24.60 ? 567  HIS B CD2   1 
ATOM   9253  C  CE1   . HIS B 1 567 ? 55.331  122.455 118.272 1.00 22.19 ? 567  HIS B CE1   1 
ATOM   9254  N  NE2   . HIS B 1 567 ? 56.305  122.168 117.428 1.00 23.76 ? 567  HIS B NE2   1 
ATOM   9255  N  N     . GLY B 1 568 ? 54.154  116.299 116.635 1.00 31.61 ? 568  GLY B N     1 
ATOM   9256  C  CA    . GLY B 1 568 ? 53.493  115.010 116.680 1.00 34.33 ? 568  GLY B CA    1 
ATOM   9257  C  C     . GLY B 1 568 ? 54.131  114.048 115.704 1.00 36.77 ? 568  GLY B C     1 
ATOM   9258  O  O     . GLY B 1 568 ? 53.952  112.833 115.804 1.00 37.86 ? 568  GLY B O     1 
ATOM   9259  N  N     . GLU B 1 569 ? 54.877  114.600 114.752 1.00 37.53 ? 569  GLU B N     1 
ATOM   9260  C  CA    . GLU B 1 569 ? 55.558  113.793 113.750 1.00 39.24 ? 569  GLU B CA    1 
ATOM   9261  C  C     . GLU B 1 569 ? 56.985  113.549 114.231 1.00 38.89 ? 569  GLU B C     1 
ATOM   9262  O  O     . GLU B 1 569 ? 57.760  114.494 114.403 1.00 40.03 ? 569  GLU B O     1 
ATOM   9263  C  CB    . GLU B 1 569 ? 55.583  114.522 112.401 1.00 39.86 ? 569  GLU B CB    1 
ATOM   9264  C  CG    . GLU B 1 569 ? 54.248  115.120 111.977 1.00 42.74 ? 569  GLU B CG    1 
ATOM   9265  C  CD    . GLU B 1 569 ? 53.099  114.134 112.079 1.00 45.28 ? 569  GLU B CD    1 
ATOM   9266  O  OE1   . GLU B 1 569 ? 53.203  113.032 111.501 1.00 47.28 ? 569  GLU B OE1   1 
ATOM   9267  O  OE2   . GLU B 1 569 ? 52.088  114.464 112.736 1.00 47.11 ? 569  GLU B OE2   1 
ATOM   9268  N  N     . GLU B 1 570 ? 57.323  112.285 114.457 1.00 37.09 ? 570  GLU B N     1 
ATOM   9269  C  CA    . GLU B 1 570 ? 58.655  111.928 114.922 1.00 35.69 ? 570  GLU B CA    1 
ATOM   9270  C  C     . GLU B 1 570 ? 59.434  111.175 113.843 1.00 34.12 ? 570  GLU B C     1 
ATOM   9271  O  O     . GLU B 1 570 ? 58.865  110.386 113.086 1.00 34.16 ? 570  GLU B O     1 
ATOM   9272  C  CB    . GLU B 1 570 ? 58.554  111.081 116.188 1.00 36.66 ? 570  GLU B CB    1 
ATOM   9273  N  N     . PRO B 1 571 ? 60.749  111.427 113.750 1.00 31.42 ? 571  PRO B N     1 
ATOM   9274  C  CA    . PRO B 1 571 ? 61.595  110.761 112.756 1.00 29.14 ? 571  PRO B CA    1 
ATOM   9275  C  C     . PRO B 1 571 ? 61.657  109.251 112.978 1.00 27.40 ? 571  PRO B C     1 
ATOM   9276  O  O     . PRO B 1 571 ? 61.867  108.787 114.098 1.00 27.06 ? 571  PRO B O     1 
ATOM   9277  C  CB    . PRO B 1 571 ? 62.954  111.425 112.961 1.00 29.90 ? 571  PRO B CB    1 
ATOM   9278  C  CG    . PRO B 1 571 ? 62.583  112.803 113.423 1.00 30.49 ? 571  PRO B CG    1 
ATOM   9279  C  CD    . PRO B 1 571 ? 61.491  112.507 114.421 1.00 31.29 ? 571  PRO B CD    1 
ATOM   9280  N  N     . SER B 1 572 ? 61.469  108.494 111.905 1.00 23.39 ? 572  SER B N     1 
ATOM   9281  C  CA    . SER B 1 572 ? 61.512  107.041 111.971 1.00 21.67 ? 572  SER B CA    1 
ATOM   9282  C  C     . SER B 1 572 ? 61.999  106.532 110.624 1.00 19.73 ? 572  SER B C     1 
ATOM   9283  O  O     . SER B 1 572 ? 62.049  107.287 109.654 1.00 19.74 ? 572  SER B O     1 
ATOM   9284  C  CB    . SER B 1 572 ? 60.116  106.475 112.249 1.00 21.86 ? 572  SER B CB    1 
ATOM   9285  O  OG    . SER B 1 572 ? 59.228  106.776 111.182 1.00 21.23 ? 572  SER B OG    1 
ATOM   9286  N  N     . PRO B 1 573 ? 62.389  105.249 110.552 1.00 18.02 ? 573  PRO B N     1 
ATOM   9287  C  CA    . PRO B 1 573 ? 62.858  104.706 109.272 1.00 16.50 ? 573  PRO B CA    1 
ATOM   9288  C  C     . PRO B 1 573 ? 61.768  104.878 108.206 1.00 14.73 ? 573  PRO B C     1 
ATOM   9289  O  O     . PRO B 1 573 ? 62.053  105.175 107.045 1.00 15.69 ? 573  PRO B O     1 
ATOM   9290  C  CB    . PRO B 1 573 ? 63.114  103.239 109.600 1.00 15.10 ? 573  PRO B CB    1 
ATOM   9291  C  CG    . PRO B 1 573 ? 63.585  103.304 111.038 1.00 17.92 ? 573  PRO B CG    1 
ATOM   9292  C  CD    . PRO B 1 573 ? 62.601  104.286 111.651 1.00 16.70 ? 573  PRO B CD    1 
ATOM   9293  N  N     . GLU B 1 574 ? 60.518  104.699 108.621 1.00 14.01 ? 574  GLU B N     1 
ATOM   9294  C  CA    . GLU B 1 574 ? 59.381  104.821 107.719 1.00 14.34 ? 574  GLU B CA    1 
ATOM   9295  C  C     . GLU B 1 574 ? 59.244  106.243 107.183 1.00 17.07 ? 574  GLU B C     1 
ATOM   9296  O  O     . GLU B 1 574 ? 59.056  106.446 105.980 1.00 16.42 ? 574  GLU B O     1 
ATOM   9297  C  CB    . GLU B 1 574 ? 58.091  104.413 108.439 1.00 16.59 ? 574  GLU B CB    1 
ATOM   9298  C  CG    . GLU B 1 574 ? 56.842  104.336 107.551 1.00 15.58 ? 574  GLU B CG    1 
ATOM   9299  C  CD    . GLU B 1 574 ? 56.282  105.701 107.175 1.00 16.68 ? 574  GLU B CD    1 
ATOM   9300  O  OE1   . GLU B 1 574 ? 56.288  106.607 108.035 1.00 17.29 ? 574  GLU B OE1   1 
ATOM   9301  O  OE2   . GLU B 1 574 ? 55.818  105.863 106.024 1.00 16.99 ? 574  GLU B OE2   1 
ATOM   9302  N  N     . LEU B 1 575 ? 59.341  107.223 108.075 1.00 16.34 ? 575  LEU B N     1 
ATOM   9303  C  CA    . LEU B 1 575 ? 59.207  108.616 107.667 1.00 18.24 ? 575  LEU B CA    1 
ATOM   9304  C  C     . LEU B 1 575 ? 60.343  109.046 106.741 1.00 17.24 ? 575  LEU B C     1 
ATOM   9305  O  O     . LEU B 1 575 ? 60.130  109.819 105.808 1.00 16.42 ? 575  LEU B O     1 
ATOM   9306  C  CB    . LEU B 1 575 ? 59.160  109.530 108.894 1.00 19.44 ? 575  LEU B CB    1 
ATOM   9307  C  CG    . LEU B 1 575 ? 58.842  110.998 108.580 1.00 22.18 ? 575  LEU B CG    1 
ATOM   9308  C  CD1   . LEU B 1 575 ? 57.511  111.081 107.843 1.00 22.56 ? 575  LEU B CD1   1 
ATOM   9309  C  CD2   . LEU B 1 575 ? 58.797  111.813 109.866 1.00 23.66 ? 575  LEU B CD2   1 
ATOM   9310  N  N     . TYR B 1 576 ? 61.546  108.541 107.005 1.00 16.86 ? 576  TYR B N     1 
ATOM   9311  C  CA    . TYR B 1 576 ? 62.717  108.860 106.191 1.00 18.05 ? 576  TYR B CA    1 
ATOM   9312  C  C     . TYR B 1 576 ? 62.456  108.377 104.764 1.00 17.61 ? 576  TYR B C     1 
ATOM   9313  O  O     . TYR B 1 576 ? 62.675  109.106 103.791 1.00 17.63 ? 576  TYR B O     1 
ATOM   9314  C  CB    . TYR B 1 576 ? 63.955  108.152 106.758 1.00 19.87 ? 576  TYR B CB    1 
ATOM   9315  C  CG    . TYR B 1 576 ? 65.280  108.762 106.347 1.00 22.01 ? 576  TYR B CG    1 
ATOM   9316  C  CD1   . TYR B 1 576 ? 65.896  109.732 107.138 1.00 22.66 ? 576  TYR B CD1   1 
ATOM   9317  C  CD2   . TYR B 1 576 ? 65.915  108.376 105.165 1.00 23.51 ? 576  TYR B CD2   1 
ATOM   9318  C  CE1   . TYR B 1 576 ? 67.113  110.305 106.764 1.00 23.63 ? 576  TYR B CE1   1 
ATOM   9319  C  CE2   . TYR B 1 576 ? 67.132  108.946 104.779 1.00 23.28 ? 576  TYR B CE2   1 
ATOM   9320  C  CZ    . TYR B 1 576 ? 67.722  109.908 105.583 1.00 24.22 ? 576  TYR B CZ    1 
ATOM   9321  O  OH    . TYR B 1 576 ? 68.915  110.486 105.202 1.00 27.72 ? 576  TYR B OH    1 
ATOM   9322  N  N     . ALA B 1 577 ? 61.979  107.140 104.649 1.00 15.81 ? 577  ALA B N     1 
ATOM   9323  C  CA    . ALA B 1 577 ? 61.680  106.547 103.351 1.00 15.23 ? 577  ALA B CA    1 
ATOM   9324  C  C     . ALA B 1 577 ? 60.520  107.268 102.675 1.00 15.36 ? 577  ALA B C     1 
ATOM   9325  O  O     . ALA B 1 577 ? 60.565  107.553 101.476 1.00 14.48 ? 577  ALA B O     1 
ATOM   9326  C  CB    . ALA B 1 577 ? 61.345  105.058 103.516 1.00 15.99 ? 577  ALA B CB    1 
ATOM   9327  N  N     . GLU B 1 578 ? 59.479  107.564 103.447 1.00 14.16 ? 578  GLU B N     1 
ATOM   9328  C  CA    . GLU B 1 578 ? 58.309  108.242 102.903 1.00 14.70 ? 578  GLU B CA    1 
ATOM   9329  C  C     . GLU B 1 578 ? 58.642  109.619 102.338 1.00 14.69 ? 578  GLU B C     1 
ATOM   9330  O  O     . GLU B 1 578 ? 58.138  109.998 101.282 1.00 14.77 ? 578  GLU B O     1 
ATOM   9331  C  CB    . GLU B 1 578 ? 57.226  108.389 103.975 1.00 16.05 ? 578  GLU B CB    1 
ATOM   9332  C  CG    . GLU B 1 578 ? 55.886  108.802 103.403 1.00 15.82 ? 578  GLU B CG    1 
ATOM   9333  C  CD    . GLU B 1 578 ? 54.826  108.976 104.466 1.00 20.14 ? 578  GLU B CD    1 
ATOM   9334  O  OE1   . GLU B 1 578 ? 54.721  108.103 105.354 1.00 19.24 ? 578  GLU B OE1   1 
ATOM   9335  O  OE2   . GLU B 1 578 ? 54.087  109.983 104.409 1.00 21.01 ? 578  GLU B OE2   1 
ATOM   9336  N  N     . VAL B 1 579 ? 59.479  110.367 103.049 1.00 15.12 ? 579  VAL B N     1 
ATOM   9337  C  CA    . VAL B 1 579 ? 59.862  111.704 102.605 1.00 17.43 ? 579  VAL B CA    1 
ATOM   9338  C  C     . VAL B 1 579 ? 60.682  111.640 101.321 1.00 17.34 ? 579  VAL B C     1 
ATOM   9339  O  O     . VAL B 1 579 ? 60.434  112.400 100.387 1.00 16.30 ? 579  VAL B O     1 
ATOM   9340  C  CB    . VAL B 1 579 ? 60.656  112.453 103.704 1.00 16.82 ? 579  VAL B CB    1 
ATOM   9341  C  CG1   . VAL B 1 579 ? 61.276  113.727 103.140 1.00 18.63 ? 579  VAL B CG1   1 
ATOM   9342  C  CG2   . VAL B 1 579 ? 59.725  112.804 104.853 1.00 18.15 ? 579  VAL B CG2   1 
ATOM   9343  N  N     . ARG B 1 580 ? 61.651  110.732 101.265 1.00 19.52 ? 580  ARG B N     1 
ATOM   9344  C  CA    . ARG B 1 580 ? 62.467  110.595 100.062 1.00 21.74 ? 580  ARG B CA    1 
ATOM   9345  C  C     . ARG B 1 580 ? 61.576  110.216 98.881  1.00 21.16 ? 580  ARG B C     1 
ATOM   9346  O  O     . ARG B 1 580 ? 61.652  110.830 97.818  1.00 21.22 ? 580  ARG B O     1 
ATOM   9347  C  CB    . ARG B 1 580 ? 63.561  109.535 100.261 1.00 23.94 ? 580  ARG B CB    1 
ATOM   9348  C  CG    . ARG B 1 580 ? 64.526  109.861 101.394 1.00 28.34 ? 580  ARG B CG    1 
ATOM   9349  C  CD    . ARG B 1 580 ? 65.698  108.885 101.471 1.00 31.81 ? 580  ARG B CD    1 
ATOM   9350  N  NE    . ARG B 1 580 ? 66.609  109.013 100.335 1.00 33.47 ? 580  ARG B NE    1 
ATOM   9351  C  CZ    . ARG B 1 580 ? 66.719  108.122 99.353  1.00 34.80 ? 580  ARG B CZ    1 
ATOM   9352  N  NH1   . ARG B 1 580 ? 65.976  107.025 99.356  1.00 34.39 ? 580  ARG B NH1   1 
ATOM   9353  N  NH2   . ARG B 1 580 ? 67.575  108.330 98.364  1.00 36.13 ? 580  ARG B NH2   1 
ATOM   9354  N  N     . ASN B 1 581 ? 60.718  109.217 99.072  1.00 19.87 ? 581  ASN B N     1 
ATOM   9355  C  CA    . ASN B 1 581 ? 59.826  108.788 98.001  1.00 20.46 ? 581  ASN B CA    1 
ATOM   9356  C  C     . ASN B 1 581 ? 58.807  109.853 97.617  1.00 19.02 ? 581  ASN B C     1 
ATOM   9357  O  O     . ASN B 1 581 ? 58.295  109.846 96.497  1.00 19.66 ? 581  ASN B O     1 
ATOM   9358  C  CB    . ASN B 1 581 ? 59.095  107.496 98.381  1.00 23.27 ? 581  ASN B CB    1 
ATOM   9359  C  CG    . ASN B 1 581 ? 60.016  106.291 98.397  1.00 27.87 ? 581  ASN B CG    1 
ATOM   9360  O  OD1   . ASN B 1 581 ? 61.046  106.275 97.719  1.00 28.75 ? 581  ASN B OD1   1 
ATOM   9361  N  ND2   . ASN B 1 581 ? 59.642  105.264 99.159  1.00 29.54 ? 581  ASN B ND2   1 
ATOM   9362  N  N     . TRP B 1 582 ? 58.503  110.763 98.540  1.00 16.75 ? 582  TRP B N     1 
ATOM   9363  C  CA    . TRP B 1 582 ? 57.552  111.829 98.247  1.00 16.74 ? 582  TRP B CA    1 
ATOM   9364  C  C     . TRP B 1 582 ? 58.139  112.743 97.175  1.00 16.59 ? 582  TRP B C     1 
ATOM   9365  O  O     . TRP B 1 582 ? 57.441  113.168 96.256  1.00 17.16 ? 582  TRP B O     1 
ATOM   9366  C  CB    . TRP B 1 582 ? 57.239  112.636 99.512  1.00 18.21 ? 582  TRP B CB    1 
ATOM   9367  C  CG    . TRP B 1 582 ? 56.310  113.803 99.280  1.00 17.55 ? 582  TRP B CG    1 
ATOM   9368  C  CD1   . TRP B 1 582 ? 56.660  115.115 99.145  1.00 18.57 ? 582  TRP B CD1   1 
ATOM   9369  C  CD2   . TRP B 1 582 ? 54.886  113.750 99.145  1.00 18.14 ? 582  TRP B CD2   1 
ATOM   9370  N  NE1   . TRP B 1 582 ? 55.540  115.886 98.936  1.00 17.91 ? 582  TRP B NE1   1 
ATOM   9371  C  CE2   . TRP B 1 582 ? 54.437  115.072 98.931  1.00 19.35 ? 582  TRP B CE2   1 
ATOM   9372  C  CE3   . TRP B 1 582 ? 53.944  112.713 99.183  1.00 21.15 ? 582  TRP B CE3   1 
ATOM   9373  C  CZ2   . TRP B 1 582 ? 53.086  115.385 98.756  1.00 19.30 ? 582  TRP B CZ2   1 
ATOM   9374  C  CZ3   . TRP B 1 582 ? 52.596  113.026 99.008  1.00 21.01 ? 582  TRP B CZ3   1 
ATOM   9375  C  CH2   . TRP B 1 582 ? 52.183  114.351 98.798  1.00 20.73 ? 582  TRP B CH2   1 
ATOM   9376  N  N     . VAL B 1 583 ? 59.423  113.054 97.296  1.00 17.05 ? 583  VAL B N     1 
ATOM   9377  C  CA    . VAL B 1 583 ? 60.075  113.902 96.307  1.00 17.59 ? 583  VAL B CA    1 
ATOM   9378  C  C     . VAL B 1 583 ? 60.144  113.154 94.981  1.00 17.69 ? 583  VAL B C     1 
ATOM   9379  O  O     . VAL B 1 583 ? 59.994  113.746 93.910  1.00 17.75 ? 583  VAL B O     1 
ATOM   9380  C  CB    . VAL B 1 583 ? 61.493  114.292 96.756  1.00 19.38 ? 583  VAL B CB    1 
ATOM   9381  C  CG1   . VAL B 1 583 ? 62.214  115.042 95.637  1.00 18.96 ? 583  VAL B CG1   1 
ATOM   9382  C  CG2   . VAL B 1 583 ? 61.405  115.172 98.000  1.00 18.78 ? 583  VAL B CG2   1 
ATOM   9383  N  N     . ARG B 1 584 ? 60.363  111.846 95.055  1.00 16.72 ? 584  ARG B N     1 
ATOM   9384  C  CA    . ARG B 1 584 ? 60.432  111.030 93.852  1.00 17.45 ? 584  ARG B CA    1 
ATOM   9385  C  C     . ARG B 1 584 ? 59.084  111.086 93.123  1.00 18.27 ? 584  ARG B C     1 
ATOM   9386  O  O     . ARG B 1 584 ? 59.031  111.095 91.895  1.00 16.33 ? 584  ARG B O     1 
ATOM   9387  C  CB    . ARG B 1 584 ? 60.775  109.583 94.220  1.00 20.99 ? 584  ARG B CB    1 
ATOM   9388  C  CG    . ARG B 1 584 ? 61.084  108.688 93.029  1.00 25.05 ? 584  ARG B CG    1 
ATOM   9389  C  CD    . ARG B 1 584 ? 61.325  107.248 93.468  1.00 29.73 ? 584  ARG B CD    1 
ATOM   9390  N  NE    . ARG B 1 584 ? 61.877  106.431 92.391  1.00 33.47 ? 584  ARG B NE    1 
ATOM   9391  C  CZ    . ARG B 1 584 ? 61.272  106.205 91.228  1.00 35.18 ? 584  ARG B CZ    1 
ATOM   9392  N  NH1   . ARG B 1 584 ? 60.081  106.735 90.977  1.00 35.11 ? 584  ARG B NH1   1 
ATOM   9393  N  NH2   . ARG B 1 584 ? 61.863  105.444 90.313  1.00 34.61 ? 584  ARG B NH2   1 
ATOM   9394  N  N     . LYS B 1 585 ? 57.996  111.137 93.887  1.00 16.26 ? 585  LYS B N     1 
ATOM   9395  C  CA    . LYS B 1 585 ? 56.661  111.191 93.308  1.00 17.81 ? 585  LYS B CA    1 
ATOM   9396  C  C     . LYS B 1 585 ? 56.324  112.585 92.785  1.00 18.58 ? 585  LYS B C     1 
ATOM   9397  O  O     . LYS B 1 585 ? 55.704  112.734 91.732  1.00 17.19 ? 585  LYS B O     1 
ATOM   9398  C  CB    . LYS B 1 585 ? 55.615  110.782 94.355  1.00 21.61 ? 585  LYS B CB    1 
ATOM   9399  C  CG    . LYS B 1 585 ? 54.183  110.881 93.856  1.00 26.32 ? 585  LYS B CG    1 
ATOM   9400  C  CD    . LYS B 1 585 ? 53.172  110.528 94.938  1.00 30.63 ? 585  LYS B CD    1 
ATOM   9401  C  CE    . LYS B 1 585 ? 51.750  110.646 94.400  1.00 34.51 ? 585  LYS B CE    1 
ATOM   9402  N  NZ    . LYS B 1 585 ? 50.712  110.368 95.428  1.00 36.12 ? 585  LYS B NZ    1 
ATOM   9403  N  N     . GLU B 1 586 ? 56.733  113.607 93.528  1.00 16.45 ? 586  GLU B N     1 
ATOM   9404  C  CA    . GLU B 1 586 ? 56.449  114.982 93.145  1.00 18.71 ? 586  GLU B CA    1 
ATOM   9405  C  C     . GLU B 1 586 ? 57.231  115.488 91.935  1.00 17.36 ? 586  GLU B C     1 
ATOM   9406  O  O     . GLU B 1 586 ? 56.680  116.189 91.087  1.00 18.15 ? 586  GLU B O     1 
ATOM   9407  C  CB    . GLU B 1 586 ? 56.700  115.913 94.335  1.00 21.55 ? 586  GLU B CB    1 
ATOM   9408  C  CG    . GLU B 1 586 ? 55.780  115.651 95.516  1.00 24.97 ? 586  GLU B CG    1 
ATOM   9409  C  CD    . GLU B 1 586 ? 54.323  115.889 95.173  1.00 30.48 ? 586  GLU B CD    1 
ATOM   9410  O  OE1   . GLU B 1 586 ? 53.941  117.063 94.995  1.00 32.90 ? 586  GLU B OE1   1 
ATOM   9411  O  OE2   . GLU B 1 586 ? 53.560  114.904 95.073  1.00 32.47 ? 586  GLU B OE2   1 
ATOM   9412  N  N     . ILE B 1 587 ? 58.504  115.122 91.849  1.00 16.72 ? 587  ILE B N     1 
ATOM   9413  C  CA    . ILE B 1 587 ? 59.360  115.585 90.759  1.00 16.58 ? 587  ILE B CA    1 
ATOM   9414  C  C     . ILE B 1 587 ? 59.943  114.452 89.921  1.00 18.19 ? 587  ILE B C     1 
ATOM   9415  O  O     . ILE B 1 587 ? 59.853  114.456 88.690  1.00 16.59 ? 587  ILE B O     1 
ATOM   9416  C  CB    . ILE B 1 587 ? 60.535  116.417 91.322  1.00 17.56 ? 587  ILE B CB    1 
ATOM   9417  C  CG1   . ILE B 1 587 ? 59.996  117.648 92.053  1.00 16.87 ? 587  ILE B CG1   1 
ATOM   9418  C  CG2   . ILE B 1 587 ? 61.490  116.826 90.194  1.00 17.26 ? 587  ILE B CG2   1 
ATOM   9419  C  CD1   . ILE B 1 587 ? 61.087  118.474 92.733  1.00 17.56 ? 587  ILE B CD1   1 
ATOM   9420  N  N     . GLY B 1 588 ? 60.554  113.492 90.601  1.00 16.86 ? 588  GLY B N     1 
ATOM   9421  C  CA    . GLY B 1 588 ? 61.168  112.372 89.919  1.00 16.73 ? 588  GLY B CA    1 
ATOM   9422  C  C     . GLY B 1 588 ? 62.385  111.903 90.691  1.00 16.67 ? 588  GLY B C     1 
ATOM   9423  O  O     . GLY B 1 588 ? 62.877  112.617 91.567  1.00 15.10 ? 588  GLY B O     1 
ATOM   9424  N  N     . PRO B 1 589 ? 62.902  110.705 90.385  1.00 16.56 ? 589  PRO B N     1 
ATOM   9425  C  CA    . PRO B 1 589 ? 64.072  110.158 91.076  1.00 16.88 ? 589  PRO B CA    1 
ATOM   9426  C  C     . PRO B 1 589 ? 65.344  111.009 91.038  1.00 18.18 ? 589  PRO B C     1 
ATOM   9427  O  O     . PRO B 1 589 ? 66.161  110.934 91.954  1.00 17.93 ? 589  PRO B O     1 
ATOM   9428  C  CB    . PRO B 1 589 ? 64.251  108.782 90.423  1.00 17.70 ? 589  PRO B CB    1 
ATOM   9429  C  CG    . PRO B 1 589 ? 63.650  108.956 89.063  1.00 18.65 ? 589  PRO B CG    1 
ATOM   9430  C  CD    . PRO B 1 589 ? 62.419  109.777 89.349  1.00 18.85 ? 589  PRO B CD    1 
ATOM   9431  N  N     . LEU B 1 590 ? 65.520  111.821 89.999  1.00 17.81 ? 590  LEU B N     1 
ATOM   9432  C  CA    . LEU B 1 590 ? 66.714  112.663 89.923  1.00 20.43 ? 590  LEU B CA    1 
ATOM   9433  C  C     . LEU B 1 590 ? 66.759  113.729 91.019  1.00 19.45 ? 590  LEU B C     1 
ATOM   9434  O  O     . LEU B 1 590 ? 67.830  114.228 91.358  1.00 20.44 ? 590  LEU B O     1 
ATOM   9435  C  CB    . LEU B 1 590 ? 66.801  113.359 88.562  1.00 23.13 ? 590  LEU B CB    1 
ATOM   9436  C  CG    . LEU B 1 590 ? 67.064  112.496 87.326  1.00 26.85 ? 590  LEU B CG    1 
ATOM   9437  C  CD1   . LEU B 1 590 ? 67.163  113.401 86.106  1.00 26.25 ? 590  LEU B CD1   1 
ATOM   9438  C  CD2   . LEU B 1 590 ? 68.352  111.700 87.503  1.00 27.95 ? 590  LEU B CD2   1 
ATOM   9439  N  N     . ALA B 1 591 ? 65.603  114.078 91.573  1.00 18.55 ? 591  ALA B N     1 
ATOM   9440  C  CA    . ALA B 1 591 ? 65.548  115.106 92.608  1.00 20.47 ? 591  ALA B CA    1 
ATOM   9441  C  C     . ALA B 1 591 ? 65.478  114.557 94.026  1.00 21.68 ? 591  ALA B C     1 
ATOM   9442  O  O     . ALA B 1 591 ? 65.345  115.318 94.983  1.00 21.73 ? 591  ALA B O     1 
ATOM   9443  C  CB    . ALA B 1 591 ? 64.360  116.029 92.357  1.00 21.34 ? 591  ALA B CB    1 
ATOM   9444  N  N     . THR B 1 592 ? 65.580  113.240 94.165  1.00 22.75 ? 592  THR B N     1 
ATOM   9445  C  CA    . THR B 1 592 ? 65.506  112.615 95.480  1.00 24.87 ? 592  THR B CA    1 
ATOM   9446  C  C     . THR B 1 592 ? 66.658  113.009 96.398  1.00 22.39 ? 592  THR B C     1 
ATOM   9447  O  O     . THR B 1 592 ? 67.825  112.873 96.039  1.00 21.54 ? 592  THR B O     1 
ATOM   9448  C  CB    . THR B 1 592 ? 65.485  111.082 95.368  1.00 26.71 ? 592  THR B CB    1 
ATOM   9449  O  OG1   . THR B 1 592 ? 64.416  110.685 94.499  1.00 27.81 ? 592  THR B OG1   1 
ATOM   9450  C  CG2   . THR B 1 592 ? 65.277  110.453 96.751  1.00 26.38 ? 592  THR B CG2   1 
ATOM   9451  N  N     . PRO B 1 593 ? 66.338  113.519 97.597  1.00 22.42 ? 593  PRO B N     1 
ATOM   9452  C  CA    . PRO B 1 593 ? 67.372  113.925 98.554  1.00 21.58 ? 593  PRO B CA    1 
ATOM   9453  C  C     . PRO B 1 593 ? 68.262  112.747 98.944  1.00 22.26 ? 593  PRO B C     1 
ATOM   9454  O  O     . PRO B 1 593 ? 67.770  111.656 99.241  1.00 20.82 ? 593  PRO B O     1 
ATOM   9455  C  CB    . PRO B 1 593 ? 66.560  114.444 99.738  1.00 21.78 ? 593  PRO B CB    1 
ATOM   9456  C  CG    . PRO B 1 593 ? 65.335  114.995 99.083  1.00 22.68 ? 593  PRO B CG    1 
ATOM   9457  C  CD    . PRO B 1 593 ? 65.003  113.938 98.057  1.00 21.62 ? 593  PRO B CD    1 
ATOM   9458  N  N     . ASP B 1 594 ? 69.571  112.970 98.938  1.00 22.01 ? 594  ASP B N     1 
ATOM   9459  C  CA    . ASP B 1 594 ? 70.517  111.926 99.304  1.00 24.16 ? 594  ASP B CA    1 
ATOM   9460  C  C     . ASP B 1 594 ? 70.646  111.916 100.817 1.00 24.71 ? 594  ASP B C     1 
ATOM   9461  O  O     . ASP B 1 594 ? 70.949  110.890 101.426 1.00 24.80 ? 594  ASP B O     1 
ATOM   9462  C  CB    . ASP B 1 594 ? 71.876  112.198 98.655  1.00 26.13 ? 594  ASP B CB    1 
ATOM   9463  C  CG    . ASP B 1 594 ? 71.805  112.179 97.140  1.00 29.02 ? 594  ASP B CG    1 
ATOM   9464  O  OD1   . ASP B 1 594 ? 71.515  111.103 96.580  1.00 28.74 ? 594  ASP B OD1   1 
ATOM   9465  O  OD2   . ASP B 1 594 ? 72.026  113.237 96.511  1.00 31.03 ? 594  ASP B OD2   1 
ATOM   9466  N  N     . VAL B 1 595 ? 70.405  113.074 101.417 1.00 23.47 ? 595  VAL B N     1 
ATOM   9467  C  CA    . VAL B 1 595 ? 70.488  113.211 102.859 1.00 23.87 ? 595  VAL B CA    1 
ATOM   9468  C  C     . VAL B 1 595 ? 69.320  114.029 103.399 1.00 23.07 ? 595  VAL B C     1 
ATOM   9469  O  O     . VAL B 1 595 ? 68.973  115.077 102.849 1.00 21.55 ? 595  VAL B O     1 
ATOM   9470  C  CB    . VAL B 1 595 ? 71.802  113.906 103.279 1.00 25.41 ? 595  VAL B CB    1 
ATOM   9471  C  CG1   . VAL B 1 595 ? 71.861  114.043 104.795 1.00 26.44 ? 595  VAL B CG1   1 
ATOM   9472  C  CG2   . VAL B 1 595 ? 72.997  113.117 102.769 1.00 25.42 ? 595  VAL B CG2   1 
ATOM   9473  N  N     . LEU B 1 596 ? 68.700  113.523 104.459 1.00 21.46 ? 596  LEU B N     1 
ATOM   9474  C  CA    . LEU B 1 596 ? 67.606  114.225 105.115 1.00 20.74 ? 596  LEU B CA    1 
ATOM   9475  C  C     . LEU B 1 596 ? 68.116  114.524 106.517 1.00 22.05 ? 596  LEU B C     1 
ATOM   9476  O  O     . LEU B 1 596 ? 68.486  113.614 107.264 1.00 21.65 ? 596  LEU B O     1 
ATOM   9477  C  CB    . LEU B 1 596 ? 66.346  113.358 105.197 1.00 19.30 ? 596  LEU B CB    1 
ATOM   9478  C  CG    . LEU B 1 596 ? 65.627  112.986 103.900 1.00 19.22 ? 596  LEU B CG    1 
ATOM   9479  C  CD1   . LEU B 1 596 ? 64.401  112.153 104.233 1.00 20.16 ? 596  LEU B CD1   1 
ATOM   9480  C  CD2   . LEU B 1 596 ? 65.219  114.248 103.150 1.00 18.87 ? 596  LEU B CD2   1 
ATOM   9481  N  N     . HIS B 1 597 ? 68.158  115.805 106.856 1.00 20.74 ? 597  HIS B N     1 
ATOM   9482  C  CA    . HIS B 1 597 ? 68.626  116.255 108.159 1.00 21.79 ? 597  HIS B CA    1 
ATOM   9483  C  C     . HIS B 1 597 ? 67.447  116.888 108.886 1.00 20.56 ? 597  HIS B C     1 
ATOM   9484  O  O     . HIS B 1 597 ? 67.028  117.997 108.554 1.00 18.29 ? 597  HIS B O     1 
ATOM   9485  C  CB    . HIS B 1 597 ? 69.764  117.267 107.960 1.00 24.45 ? 597  HIS B CB    1 
ATOM   9486  C  CG    . HIS B 1 597 ? 70.219  117.947 109.216 1.00 28.21 ? 597  HIS B CG    1 
ATOM   9487  N  ND1   . HIS B 1 597 ? 71.320  118.776 109.247 1.00 31.85 ? 597  HIS B ND1   1 
ATOM   9488  C  CD2   . HIS B 1 597 ? 69.700  117.966 110.467 1.00 30.34 ? 597  HIS B CD2   1 
ATOM   9489  C  CE1   . HIS B 1 597 ? 71.458  119.279 110.461 1.00 30.96 ? 597  HIS B CE1   1 
ATOM   9490  N  NE2   . HIS B 1 597 ? 70.487  118.804 111.220 1.00 31.02 ? 597  HIS B NE2   1 
ATOM   9491  N  N     . TRP B 1 598 ? 66.906  116.172 109.870 1.00 21.43 ? 598  TRP B N     1 
ATOM   9492  C  CA    . TRP B 1 598 ? 65.765  116.671 110.636 1.00 22.23 ? 598  TRP B CA    1 
ATOM   9493  C  C     . TRP B 1 598 ? 66.229  117.772 111.577 1.00 22.71 ? 598  TRP B C     1 
ATOM   9494  O  O     . TRP B 1 598 ? 67.207  117.599 112.303 1.00 22.32 ? 598  TRP B O     1 
ATOM   9495  C  CB    . TRP B 1 598 ? 65.136  115.546 111.463 1.00 23.71 ? 598  TRP B CB    1 
ATOM   9496  C  CG    . TRP B 1 598 ? 64.930  114.268 110.714 1.00 24.09 ? 598  TRP B CG    1 
ATOM   9497  C  CD1   . TRP B 1 598 ? 65.598  113.094 110.904 1.00 25.90 ? 598  TRP B CD1   1 
ATOM   9498  C  CD2   . TRP B 1 598 ? 63.976  114.025 109.675 1.00 24.67 ? 598  TRP B CD2   1 
ATOM   9499  N  NE1   . TRP B 1 598 ? 65.116  112.129 110.051 1.00 27.15 ? 598  TRP B NE1   1 
ATOM   9500  C  CE2   . TRP B 1 598 ? 64.119  112.674 109.285 1.00 25.79 ? 598  TRP B CE2   1 
ATOM   9501  C  CE3   . TRP B 1 598 ? 63.013  114.816 109.036 1.00 22.22 ? 598  TRP B CE3   1 
ATOM   9502  C  CZ2   . TRP B 1 598 ? 63.332  112.095 108.281 1.00 25.55 ? 598  TRP B CZ2   1 
ATOM   9503  C  CZ3   . TRP B 1 598 ? 62.230  114.242 108.037 1.00 25.74 ? 598  TRP B CZ3   1 
ATOM   9504  C  CH2   . TRP B 1 598 ? 62.395  112.892 107.670 1.00 24.92 ? 598  TRP B CH2   1 
ATOM   9505  N  N     . THR B 1 599 ? 65.522  118.896 111.580 1.00 23.40 ? 599  THR B N     1 
ATOM   9506  C  CA    . THR B 1 599 ? 65.902  120.005 112.443 1.00 25.66 ? 599  THR B CA    1 
ATOM   9507  C  C     . THR B 1 599 ? 64.766  120.984 112.680 1.00 27.92 ? 599  THR B C     1 
ATOM   9508  O  O     . THR B 1 599 ? 63.777  121.008 111.945 1.00 28.14 ? 599  THR B O     1 
ATOM   9509  C  CB    . THR B 1 599 ? 67.095  120.791 111.841 1.00 27.25 ? 599  THR B CB    1 
ATOM   9510  O  OG1   . THR B 1 599 ? 67.537  121.792 112.768 1.00 27.42 ? 599  THR B OG1   1 
ATOM   9511  C  CG2   . THR B 1 599 ? 66.682  121.467 110.542 1.00 26.30 ? 599  THR B CG2   1 
ATOM   9512  N  N     . ASP B 1 600 ? 64.919  121.782 113.730 1.00 30.23 ? 600  ASP B N     1 
ATOM   9513  C  CA    . ASP B 1 600 ? 63.955  122.815 114.080 1.00 33.65 ? 600  ASP B CA    1 
ATOM   9514  C  C     . ASP B 1 600 ? 64.779  124.091 114.191 1.00 33.96 ? 600  ASP B C     1 
ATOM   9515  O  O     . ASP B 1 600 ? 64.297  125.128 114.646 1.00 35.39 ? 600  ASP B O     1 
ATOM   9516  C  CB    . ASP B 1 600 ? 63.294  122.515 115.428 1.00 36.86 ? 600  ASP B CB    1 
ATOM   9517  C  CG    . ASP B 1 600 ? 62.413  121.279 115.389 1.00 40.40 ? 600  ASP B CG    1 
ATOM   9518  O  OD1   . ASP B 1 600 ? 61.529  121.205 114.508 1.00 42.30 ? 600  ASP B OD1   1 
ATOM   9519  O  OD2   . ASP B 1 600 ? 62.598  120.387 116.247 1.00 41.77 ? 600  ASP B OD2   1 
ATOM   9520  N  N     . SER B 1 601 ? 66.036  124.000 113.763 1.00 34.33 ? 601  SER B N     1 
ATOM   9521  C  CA    . SER B 1 601 ? 66.961  125.124 113.834 1.00 34.06 ? 601  SER B CA    1 
ATOM   9522  C  C     . SER B 1 601 ? 67.286  125.804 112.504 1.00 32.67 ? 601  SER B C     1 
ATOM   9523  O  O     . SER B 1 601 ? 68.439  126.173 112.270 1.00 32.22 ? 601  SER B O     1 
ATOM   9524  C  CB    . SER B 1 601 ? 68.268  124.670 114.494 1.00 34.79 ? 601  SER B CB    1 
ATOM   9525  O  OG    . SER B 1 601 ? 68.035  124.139 115.788 1.00 36.11 ? 601  SER B OG    1 
ATOM   9526  N  N     . LEU B 1 602 ? 66.291  125.986 111.638 1.00 30.14 ? 602  LEU B N     1 
ATOM   9527  C  CA    . LEU B 1 602 ? 66.553  126.646 110.357 1.00 28.45 ? 602  LEU B CA    1 
ATOM   9528  C  C     . LEU B 1 602 ? 66.902  128.124 110.545 1.00 26.77 ? 602  LEU B C     1 
ATOM   9529  O  O     . LEU B 1 602 ? 66.157  128.879 111.172 1.00 27.21 ? 602  LEU B O     1 
ATOM   9530  C  CB    . LEU B 1 602 ? 65.351  126.514 109.413 1.00 26.15 ? 602  LEU B CB    1 
ATOM   9531  C  CG    . LEU B 1 602 ? 65.062  125.115 108.856 1.00 25.88 ? 602  LEU B CG    1 
ATOM   9532  C  CD1   . LEU B 1 602 ? 63.957  125.219 107.822 1.00 22.78 ? 602  LEU B CD1   1 
ATOM   9533  C  CD2   . LEU B 1 602 ? 66.316  124.516 108.219 1.00 24.15 ? 602  LEU B CD2   1 
ATOM   9534  N  N     . PRO B 1 603 ? 68.043  128.555 109.988 1.00 25.14 ? 603  PRO B N     1 
ATOM   9535  C  CA    . PRO B 1 603 ? 68.517  129.939 110.085 1.00 24.97 ? 603  PRO B CA    1 
ATOM   9536  C  C     . PRO B 1 603 ? 67.729  130.929 109.232 1.00 24.86 ? 603  PRO B C     1 
ATOM   9537  O  O     . PRO B 1 603 ? 67.556  130.730 108.029 1.00 24.72 ? 603  PRO B O     1 
ATOM   9538  C  CB    . PRO B 1 603 ? 69.973  129.828 109.652 1.00 23.99 ? 603  PRO B CB    1 
ATOM   9539  C  CG    . PRO B 1 603 ? 69.919  128.755 108.614 1.00 26.18 ? 603  PRO B CG    1 
ATOM   9540  C  CD    . PRO B 1 603 ? 69.004  127.721 109.242 1.00 24.78 ? 603  PRO B CD    1 
ATOM   9541  N  N     . LYS B 1 604 ? 67.257  131.999 109.863 1.00 24.06 ? 604  LYS B N     1 
ATOM   9542  C  CA    . LYS B 1 604 ? 66.487  133.013 109.158 1.00 24.61 ? 604  LYS B CA    1 
ATOM   9543  C  C     . LYS B 1 604 ? 66.919  134.423 109.536 1.00 24.09 ? 604  LYS B C     1 
ATOM   9544  O  O     . LYS B 1 604 ? 67.468  134.649 110.616 1.00 22.50 ? 604  LYS B O     1 
ATOM   9545  C  CB    . LYS B 1 604 ? 64.994  132.860 109.471 1.00 27.72 ? 604  LYS B CB    1 
ATOM   9546  C  CG    . LYS B 1 604 ? 64.363  131.545 109.020 1.00 30.15 ? 604  LYS B CG    1 
ATOM   9547  C  CD    . LYS B 1 604 ? 62.854  131.573 109.248 1.00 33.01 ? 604  LYS B CD    1 
ATOM   9548  C  CE    . LYS B 1 604 ? 62.192  130.231 108.948 1.00 32.88 ? 604  LYS B CE    1 
ATOM   9549  N  NZ    . LYS B 1 604 ? 62.501  129.191 109.977 1.00 35.97 ? 604  LYS B NZ    1 
ATOM   9550  N  N     . THR B 1 605 ? 66.671  135.370 108.637 1.00 23.00 ? 605  THR B N     1 
ATOM   9551  C  CA    . THR B 1 605 ? 66.994  136.766 108.900 1.00 21.99 ? 605  THR B CA    1 
ATOM   9552  C  C     . THR B 1 605 ? 65.890  137.249 109.836 1.00 22.11 ? 605  THR B C     1 
ATOM   9553  O  O     . THR B 1 605 ? 64.906  136.539 110.058 1.00 20.70 ? 605  THR B O     1 
ATOM   9554  C  CB    . THR B 1 605 ? 66.960  137.617 107.615 1.00 23.35 ? 605  THR B CB    1 
ATOM   9555  O  OG1   . THR B 1 605 ? 65.626  137.627 107.087 1.00 22.97 ? 605  THR B OG1   1 
ATOM   9556  C  CG2   . THR B 1 605 ? 67.914  137.045 106.567 1.00 23.37 ? 605  THR B CG2   1 
ATOM   9557  N  N     . ARG B 1 606 ? 66.043  138.449 110.382 1.00 21.97 ? 606  ARG B N     1 
ATOM   9558  C  CA    . ARG B 1 606 ? 65.037  138.976 111.291 1.00 22.86 ? 606  ARG B CA    1 
ATOM   9559  C  C     . ARG B 1 606 ? 63.711  139.239 110.588 1.00 24.69 ? 606  ARG B C     1 
ATOM   9560  O  O     . ARG B 1 606 ? 62.657  139.292 111.232 1.00 22.75 ? 606  ARG B O     1 
ATOM   9561  C  CB    . ARG B 1 606 ? 65.568  140.238 111.970 1.00 24.53 ? 606  ARG B CB    1 
ATOM   9562  C  CG    . ARG B 1 606 ? 66.754  139.931 112.872 1.00 25.08 ? 606  ARG B CG    1 
ATOM   9563  C  CD    . ARG B 1 606 ? 67.267  141.142 113.625 1.00 29.29 ? 606  ARG B CD    1 
ATOM   9564  N  NE    . ARG B 1 606 ? 68.427  140.790 114.443 1.00 33.70 ? 606  ARG B NE    1 
ATOM   9565  C  CZ    . ARG B 1 606 ? 69.599  140.392 113.952 1.00 35.06 ? 606  ARG B CZ    1 
ATOM   9566  N  NH1   . ARG B 1 606 ? 69.776  140.294 112.641 1.00 37.17 ? 606  ARG B NH1   1 
ATOM   9567  N  NH2   . ARG B 1 606 ? 70.597  140.084 114.774 1.00 35.30 ? 606  ARG B NH2   1 
ATOM   9568  N  N     . SER B 1 607 ? 63.759  139.387 109.265 1.00 25.25 ? 607  SER B N     1 
ATOM   9569  C  CA    . SER B 1 607 ? 62.547  139.619 108.489 1.00 28.16 ? 607  SER B CA    1 
ATOM   9570  C  C     . SER B 1 607 ? 61.901  138.282 108.135 1.00 28.98 ? 607  SER B C     1 
ATOM   9571  O  O     . SER B 1 607 ? 60.806  138.241 107.574 1.00 31.23 ? 607  SER B O     1 
ATOM   9572  C  CB    . SER B 1 607 ? 62.857  140.408 107.211 1.00 29.47 ? 607  SER B CB    1 
ATOM   9573  O  OG    . SER B 1 607 ? 63.694  139.671 106.340 1.00 31.59 ? 607  SER B OG    1 
ATOM   9574  N  N     . GLY B 1 608 ? 62.592  137.190 108.457 1.00 28.36 ? 608  GLY B N     1 
ATOM   9575  C  CA    . GLY B 1 608 ? 62.058  135.865 108.193 1.00 28.51 ? 608  GLY B CA    1 
ATOM   9576  C  C     . GLY B 1 608 ? 62.589  135.113 106.985 1.00 28.95 ? 608  GLY B C     1 
ATOM   9577  O  O     . GLY B 1 608 ? 62.146  133.999 106.714 1.00 30.09 ? 608  GLY B O     1 
ATOM   9578  N  N     . LYS B 1 609 ? 63.534  135.701 106.261 1.00 29.13 ? 609  LYS B N     1 
ATOM   9579  C  CA    . LYS B 1 609 ? 64.097  135.057 105.077 1.00 29.79 ? 609  LYS B CA    1 
ATOM   9580  C  C     . LYS B 1 609 ? 65.101  133.963 105.424 1.00 30.07 ? 609  LYS B C     1 
ATOM   9581  O  O     . LYS B 1 609 ? 65.952  134.141 106.295 1.00 30.61 ? 609  LYS B O     1 
ATOM   9582  C  CB    . LYS B 1 609 ? 64.757  136.098 104.184 1.00 28.94 ? 609  LYS B CB    1 
ATOM   9583  N  N     . ILE B 1 610 ? 64.997  132.831 104.732 1.00 30.31 ? 610  ILE B N     1 
ATOM   9584  C  CA    . ILE B 1 610 ? 65.903  131.712 104.958 1.00 30.13 ? 610  ILE B CA    1 
ATOM   9585  C  C     . ILE B 1 610 ? 67.300  132.066 104.462 1.00 31.07 ? 610  ILE B C     1 
ATOM   9586  O  O     . ILE B 1 610 ? 67.458  132.758 103.457 1.00 30.38 ? 610  ILE B O     1 
ATOM   9587  C  CB    . ILE B 1 610 ? 65.394  130.469 104.237 1.00 30.56 ? 610  ILE B CB    1 
ATOM   9588  N  N     . MET B 1 611 ? 68.307  131.584 105.183 1.00 32.58 ? 611  MET B N     1 
ATOM   9589  C  CA    . MET B 1 611 ? 69.704  131.829 104.843 1.00 33.73 ? 611  MET B CA    1 
ATOM   9590  C  C     . MET B 1 611 ? 70.343  130.496 104.462 1.00 34.39 ? 611  MET B C     1 
ATOM   9591  O  O     . MET B 1 611 ? 70.652  129.684 105.332 1.00 34.00 ? 611  MET B O     1 
ATOM   9592  C  CB    . MET B 1 611 ? 70.431  132.430 106.048 1.00 35.10 ? 611  MET B CB    1 
ATOM   9593  C  CG    . MET B 1 611 ? 69.954  133.820 106.434 1.00 39.62 ? 611  MET B CG    1 
ATOM   9594  S  SD    . MET B 1 611 ? 70.488  135.079 105.252 1.00 46.03 ? 611  MET B SD    1 
ATOM   9595  C  CE    . MET B 1 611 ? 72.093  135.509 105.948 1.00 43.83 ? 611  MET B CE    1 
ATOM   9596  N  N     . ARG B 1 612 ? 70.546  130.274 103.166 1.00 34.47 ? 612  ARG B N     1 
ATOM   9597  C  CA    . ARG B 1 612 ? 71.119  129.014 102.705 1.00 35.80 ? 612  ARG B CA    1 
ATOM   9598  C  C     . ARG B 1 612 ? 72.642  128.944 102.685 1.00 35.16 ? 612  ARG B C     1 
ATOM   9599  O  O     . ARG B 1 612 ? 73.206  127.858 102.797 1.00 35.89 ? 612  ARG B O     1 
ATOM   9600  C  CB    . ARG B 1 612 ? 70.582  128.662 101.314 1.00 36.37 ? 612  ARG B CB    1 
ATOM   9601  C  CG    . ARG B 1 612 ? 69.062  128.594 101.227 1.00 38.78 ? 612  ARG B CG    1 
ATOM   9602  C  CD    . ARG B 1 612 ? 68.611  127.735 100.051 1.00 39.25 ? 612  ARG B CD    1 
ATOM   9603  N  NE    . ARG B 1 612 ? 67.357  128.203 99.463  1.00 40.02 ? 612  ARG B NE    1 
ATOM   9604  C  CZ    . ARG B 1 612 ? 66.218  128.357 100.130 1.00 41.21 ? 612  ARG B CZ    1 
ATOM   9605  N  NH1   . ARG B 1 612 ? 66.155  128.080 101.427 1.00 42.72 ? 612  ARG B NH1   1 
ATOM   9606  N  NH2   . ARG B 1 612 ? 65.139  128.798 99.496  1.00 40.56 ? 612  ARG B NH2   1 
ATOM   9607  N  N     . ARG B 1 613 ? 73.309  130.085 102.545 1.00 35.10 ? 613  ARG B N     1 
ATOM   9608  C  CA    . ARG B 1 613 ? 74.770  130.097 102.506 1.00 34.80 ? 613  ARG B CA    1 
ATOM   9609  C  C     . ARG B 1 613 ? 75.373  129.343 103.686 1.00 33.95 ? 613  ARG B C     1 
ATOM   9610  O  O     . ARG B 1 613 ? 76.257  128.502 103.510 1.00 34.33 ? 613  ARG B O     1 
ATOM   9611  C  CB    . ARG B 1 613 ? 75.296  131.535 102.492 1.00 37.02 ? 613  ARG B CB    1 
ATOM   9612  C  CG    . ARG B 1 613 ? 76.816  131.631 102.527 1.00 40.63 ? 613  ARG B CG    1 
ATOM   9613  C  CD    . ARG B 1 613 ? 77.278  133.077 102.516 1.00 43.86 ? 613  ARG B CD    1 
ATOM   9614  N  NE    . ARG B 1 613 ? 77.092  133.707 101.213 1.00 47.17 ? 613  ARG B NE    1 
ATOM   9615  C  CZ    . ARG B 1 613 ? 77.140  135.020 101.006 1.00 49.68 ? 613  ARG B CZ    1 
ATOM   9616  N  NH1   . ARG B 1 613 ? 77.360  135.845 102.022 1.00 49.96 ? 613  ARG B NH1   1 
ATOM   9617  N  NH2   . ARG B 1 613 ? 76.976  135.510 99.782  1.00 50.07 ? 613  ARG B NH2   1 
ATOM   9618  N  N     . ILE B 1 614 ? 74.897  129.641 104.890 1.00 31.94 ? 614  ILE B N     1 
ATOM   9619  C  CA    . ILE B 1 614 ? 75.401  128.969 106.080 1.00 30.94 ? 614  ILE B CA    1 
ATOM   9620  C  C     . ILE B 1 614 ? 74.998  127.502 106.087 1.00 28.17 ? 614  ILE B C     1 
ATOM   9621  O  O     . ILE B 1 614 ? 75.768  126.641 106.509 1.00 27.10 ? 614  ILE B O     1 
ATOM   9622  C  CB    . ILE B 1 614 ? 74.885  129.637 107.374 1.00 32.89 ? 614  ILE B CB    1 
ATOM   9623  C  CG1   . ILE B 1 614 ? 73.393  129.938 107.247 1.00 33.87 ? 614  ILE B CG1   1 
ATOM   9624  C  CG2   . ILE B 1 614 ? 75.678  130.903 107.657 1.00 34.51 ? 614  ILE B CG2   1 
ATOM   9625  C  CD1   . ILE B 1 614 ? 72.819  130.663 108.437 1.00 36.25 ? 614  ILE B CD1   1 
ATOM   9626  N  N     . LEU B 1 615 ? 73.790  127.215 105.614 1.00 26.74 ? 615  LEU B N     1 
ATOM   9627  C  CA    . LEU B 1 615 ? 73.319  125.838 105.570 1.00 25.94 ? 615  LEU B CA    1 
ATOM   9628  C  C     . LEU B 1 615 ? 74.187  125.029 104.619 1.00 26.29 ? 615  LEU B C     1 
ATOM   9629  O  O     . LEU B 1 615 ? 74.526  123.876 104.895 1.00 25.53 ? 615  LEU B O     1 
ATOM   9630  C  CB    . LEU B 1 615 ? 71.863  125.781 105.111 1.00 24.45 ? 615  LEU B CB    1 
ATOM   9631  C  CG    . LEU B 1 615 ? 70.834  126.309 106.111 1.00 24.74 ? 615  LEU B CG    1 
ATOM   9632  C  CD1   . LEU B 1 615 ? 69.440  126.211 105.501 1.00 24.07 ? 615  LEU B CD1   1 
ATOM   9633  C  CD2   . LEU B 1 615 ? 70.914  125.503 107.407 1.00 23.13 ? 615  LEU B CD2   1 
ATOM   9634  N  N     . ARG B 1 616 ? 74.548  125.645 103.499 1.00 27.45 ? 616  ARG B N     1 
ATOM   9635  C  CA    . ARG B 1 616 ? 75.381  124.987 102.504 1.00 29.64 ? 616  ARG B CA    1 
ATOM   9636  C  C     . ARG B 1 616 ? 76.755  124.670 103.079 1.00 30.33 ? 616  ARG B C     1 
ATOM   9637  O  O     . ARG B 1 616 ? 77.246  123.549 102.963 1.00 29.09 ? 616  ARG B O     1 
ATOM   9638  C  CB    . ARG B 1 616 ? 75.534  125.886 101.278 1.00 31.85 ? 616  ARG B CB    1 
ATOM   9639  C  CG    . ARG B 1 616 ? 76.324  125.265 100.140 1.00 36.56 ? 616  ARG B CG    1 
ATOM   9640  C  CD    . ARG B 1 616 ? 76.307  126.182 98.932  1.00 38.35 ? 616  ARG B CD    1 
ATOM   9641  N  NE    . ARG B 1 616 ? 74.946  126.600 98.600  1.00 41.71 ? 616  ARG B NE    1 
ATOM   9642  C  CZ    . ARG B 1 616 ? 74.504  127.850 98.688  1.00 41.65 ? 616  ARG B CZ    1 
ATOM   9643  N  NH1   . ARG B 1 616 ? 75.320  128.814 99.097  1.00 41.59 ? 616  ARG B NH1   1 
ATOM   9644  N  NH2   . ARG B 1 616 ? 73.250  128.139 98.364  1.00 42.81 ? 616  ARG B NH2   1 
ATOM   9645  N  N     . LYS B 1 617 ? 77.376  125.661 103.707 1.00 31.55 ? 617  LYS B N     1 
ATOM   9646  C  CA    . LYS B 1 617 ? 78.701  125.459 104.278 1.00 32.67 ? 617  LYS B CA    1 
ATOM   9647  C  C     . LYS B 1 617 ? 78.700  124.371 105.348 1.00 32.12 ? 617  LYS B C     1 
ATOM   9648  O  O     . LYS B 1 617 ? 79.610  123.547 105.400 1.00 32.16 ? 617  LYS B O     1 
ATOM   9649  C  CB    . LYS B 1 617 ? 79.230  126.773 104.856 1.00 34.16 ? 617  LYS B CB    1 
ATOM   9650  C  CG    . LYS B 1 617 ? 79.220  127.911 103.847 1.00 37.42 ? 617  LYS B CG    1 
ATOM   9651  C  CD    . LYS B 1 617 ? 80.535  128.678 103.828 1.00 40.04 ? 617  LYS B CD    1 
ATOM   9652  C  CE    . LYS B 1 617 ? 80.773  129.433 105.123 1.00 41.65 ? 617  LYS B CE    1 
ATOM   9653  N  NZ    . LYS B 1 617 ? 82.073  130.168 105.109 1.00 45.33 ? 617  LYS B NZ    1 
ATOM   9654  N  N     . ILE B 1 618 ? 77.673  124.362 106.192 1.00 32.73 ? 618  ILE B N     1 
ATOM   9655  C  CA    . ILE B 1 618 ? 77.576  123.367 107.254 1.00 32.10 ? 618  ILE B CA    1 
ATOM   9656  C  C     . ILE B 1 618 ? 77.412  121.961 106.689 1.00 32.05 ? 618  ILE B C     1 
ATOM   9657  O  O     . ILE B 1 618 ? 78.027  121.010 107.174 1.00 31.56 ? 618  ILE B O     1 
ATOM   9658  C  CB    . ILE B 1 618 ? 76.390  123.674 108.199 1.00 32.09 ? 618  ILE B CB    1 
ATOM   9659  C  CG1   . ILE B 1 618 ? 76.687  124.940 109.006 1.00 32.11 ? 618  ILE B CG1   1 
ATOM   9660  C  CG2   . ILE B 1 618 ? 76.144  122.499 109.136 1.00 32.71 ? 618  ILE B CG2   1 
ATOM   9661  C  CD1   . ILE B 1 618 ? 75.577  125.334 109.962 1.00 33.62 ? 618  ILE B CD1   1 
ATOM   9662  N  N     . ALA B 1 619 ? 76.587  121.838 105.657 1.00 32.06 ? 619  ALA B N     1 
ATOM   9663  C  CA    . ALA B 1 619 ? 76.334  120.547 105.027 1.00 31.96 ? 619  ALA B CA    1 
ATOM   9664  C  C     . ALA B 1 619 ? 77.587  119.981 104.363 1.00 33.08 ? 619  ALA B C     1 
ATOM   9665  O  O     . ALA B 1 619 ? 77.781  118.767 104.325 1.00 33.17 ? 619  ALA B O     1 
ATOM   9666  C  CB    . ALA B 1 619 ? 75.215  120.684 104.001 1.00 29.83 ? 619  ALA B CB    1 
ATOM   9667  N  N     . ALA B 1 620 ? 78.432  120.863 103.843 1.00 34.37 ? 620  ALA B N     1 
ATOM   9668  C  CA    . ALA B 1 620 ? 79.661  120.442 103.181 1.00 36.09 ? 620  ALA B CA    1 
ATOM   9669  C  C     . ALA B 1 620 ? 80.774  120.168 104.186 1.00 38.26 ? 620  ALA B C     1 
ATOM   9670  O  O     . ALA B 1 620 ? 81.770  119.521 103.860 1.00 38.70 ? 620  ALA B O     1 
ATOM   9671  C  CB    . ALA B 1 620 ? 80.107  121.507 102.190 1.00 35.41 ? 620  ALA B CB    1 
ATOM   9672  N  N     . GLY B 1 621 ? 80.601  120.661 105.409 1.00 39.56 ? 621  GLY B N     1 
ATOM   9673  C  CA    . GLY B 1 621 ? 81.607  120.462 106.436 1.00 41.65 ? 621  GLY B CA    1 
ATOM   9674  C  C     . GLY B 1 621 ? 82.412  121.722 106.703 1.00 42.40 ? 621  GLY B C     1 
ATOM   9675  O  O     . GLY B 1 621 ? 83.092  121.828 107.725 1.00 43.55 ? 621  GLY B O     1 
ATOM   9676  N  N     . ASP B 1 622 ? 82.334  122.679 105.783 1.00 42.82 ? 622  ASP B N     1 
ATOM   9677  C  CA    . ASP B 1 622 ? 83.057  123.940 105.920 1.00 42.60 ? 622  ASP B CA    1 
ATOM   9678  C  C     . ASP B 1 622 ? 82.338  124.868 106.890 1.00 42.74 ? 622  ASP B C     1 
ATOM   9679  O  O     . ASP B 1 622 ? 82.971  125.618 107.632 1.00 44.56 ? 622  ASP B O     1 
ATOM   9680  C  CB    . ASP B 1 622 ? 83.196  124.615 104.559 1.00 41.76 ? 622  ASP B CB    1 
ATOM   9681  N  N     . GLY B 1 627 ? 80.002  133.435 108.970 1.00 37.06 ? 627  GLY B N     1 
ATOM   9682  C  CA    . GLY B 1 627 ? 80.218  134.814 108.577 1.00 37.74 ? 627  GLY B CA    1 
ATOM   9683  C  C     . GLY B 1 627 ? 78.945  135.636 108.637 1.00 39.06 ? 627  GLY B C     1 
ATOM   9684  O  O     . GLY B 1 627 ? 78.985  136.853 108.816 1.00 40.05 ? 627  GLY B O     1 
ATOM   9685  N  N     . ASP B 1 628 ? 77.806  134.968 108.494 1.00 39.51 ? 628  ASP B N     1 
ATOM   9686  C  CA    . ASP B 1 628 ? 76.518  135.646 108.524 1.00 39.22 ? 628  ASP B CA    1 
ATOM   9687  C  C     . ASP B 1 628 ? 75.776  135.386 109.832 1.00 39.03 ? 628  ASP B C     1 
ATOM   9688  O  O     . ASP B 1 628 ? 74.626  135.787 109.992 1.00 39.55 ? 628  ASP B O     1 
ATOM   9689  C  CB    . ASP B 1 628 ? 75.669  135.185 107.342 1.00 40.12 ? 628  ASP B CB    1 
ATOM   9690  N  N     . THR B 1 629 ? 76.439  134.721 110.769 1.00 37.62 ? 629  THR B N     1 
ATOM   9691  C  CA    . THR B 1 629 ? 75.821  134.398 112.046 1.00 36.82 ? 629  THR B CA    1 
ATOM   9692  C  C     . THR B 1 629 ? 75.126  135.585 112.712 1.00 36.95 ? 629  THR B C     1 
ATOM   9693  O  O     . THR B 1 629 ? 74.017  135.444 113.230 1.00 36.32 ? 629  THR B O     1 
ATOM   9694  C  CB    . THR B 1 629 ? 76.860  133.815 113.020 1.00 37.25 ? 629  THR B CB    1 
ATOM   9695  O  OG1   . THR B 1 629 ? 77.459  132.654 112.430 1.00 36.97 ? 629  THR B OG1   1 
ATOM   9696  C  CG2   . THR B 1 629 ? 76.201  133.423 114.340 1.00 36.74 ? 629  THR B CG2   1 
ATOM   9697  N  N     . SER B 1 630 ? 75.769  136.750 112.686 1.00 36.91 ? 630  SER B N     1 
ATOM   9698  C  CA    . SER B 1 630 ? 75.213  137.951 113.309 1.00 37.08 ? 630  SER B CA    1 
ATOM   9699  C  C     . SER B 1 630 ? 73.937  138.485 112.656 1.00 37.06 ? 630  SER B C     1 
ATOM   9700  O  O     . SER B 1 630 ? 73.126  139.130 113.320 1.00 38.19 ? 630  SER B O     1 
ATOM   9701  C  CB    . SER B 1 630 ? 76.269  139.064 113.340 1.00 36.78 ? 630  SER B CB    1 
ATOM   9702  O  OG    . SER B 1 630 ? 76.640  139.456 112.029 1.00 36.19 ? 630  SER B OG    1 
ATOM   9703  N  N     . THR B 1 631 ? 73.755  138.224 111.364 1.00 36.77 ? 631  THR B N     1 
ATOM   9704  C  CA    . THR B 1 631 ? 72.566  138.703 110.660 1.00 36.47 ? 631  THR B CA    1 
ATOM   9705  C  C     . THR B 1 631 ? 71.342  137.819 110.901 1.00 35.12 ? 631  THR B C     1 
ATOM   9706  O  O     . THR B 1 631 ? 70.227  138.166 110.518 1.00 35.75 ? 631  THR B O     1 
ATOM   9707  C  CB    . THR B 1 631 ? 72.805  138.787 109.136 1.00 37.95 ? 631  THR B CB    1 
ATOM   9708  O  OG1   . THR B 1 631 ? 71.646  139.341 108.500 1.00 40.70 ? 631  THR B OG1   1 
ATOM   9709  C  CG2   . THR B 1 631 ? 73.056  137.412 108.559 1.00 38.32 ? 631  THR B CG2   1 
ATOM   9710  N  N     . LEU B 1 632 ? 71.554  136.676 111.539 1.00 32.46 ? 632  LEU B N     1 
ATOM   9711  C  CA    . LEU B 1 632 ? 70.463  135.753 111.816 1.00 30.57 ? 632  LEU B CA    1 
ATOM   9712  C  C     . LEU B 1 632 ? 69.603  136.237 112.973 1.00 29.44 ? 632  LEU B C     1 
ATOM   9713  O  O     . LEU B 1 632 ? 70.090  136.908 113.882 1.00 27.57 ? 632  LEU B O     1 
ATOM   9714  C  CB    . LEU B 1 632 ? 71.018  134.370 112.147 1.00 30.76 ? 632  LEU B CB    1 
ATOM   9715  C  CG    . LEU B 1 632 ? 71.778  133.653 111.031 1.00 31.62 ? 632  LEU B CG    1 
ATOM   9716  C  CD1   . LEU B 1 632 ? 72.356  132.356 111.573 1.00 30.91 ? 632  LEU B CD1   1 
ATOM   9717  C  CD2   . LEU B 1 632 ? 70.844  133.385 109.858 1.00 31.42 ? 632  LEU B CD2   1 
ATOM   9718  N  N     . ALA B 1 633 ? 68.320  135.892 112.929 1.00 26.60 ? 633  ALA B N     1 
ATOM   9719  C  CA    . ALA B 1 633 ? 67.392  136.273 113.980 1.00 25.87 ? 633  ALA B CA    1 
ATOM   9720  C  C     . ALA B 1 633 ? 67.756  135.496 115.244 1.00 26.86 ? 633  ALA B C     1 
ATOM   9721  O  O     . ALA B 1 633 ? 67.539  135.964 116.358 1.00 25.76 ? 633  ALA B O     1 
ATOM   9722  C  CB    . ALA B 1 633 ? 65.955  135.958 113.554 1.00 25.16 ? 633  ALA B CB    1 
ATOM   9723  N  N     . ASP B 1 634 ? 68.307  134.300 115.057 1.00 27.88 ? 634  ASP B N     1 
ATOM   9724  C  CA    . ASP B 1 634 ? 68.723  133.459 116.172 1.00 30.23 ? 634  ASP B CA    1 
ATOM   9725  C  C     . ASP B 1 634 ? 70.031  132.762 115.823 1.00 31.72 ? 634  ASP B C     1 
ATOM   9726  O  O     . ASP B 1 634 ? 70.036  131.655 115.282 1.00 31.38 ? 634  ASP B O     1 
ATOM   9727  C  CB    . ASP B 1 634 ? 67.649  132.419 116.506 1.00 31.79 ? 634  ASP B CB    1 
ATOM   9728  C  CG    . ASP B 1 634 ? 68.094  131.446 117.590 1.00 34.24 ? 634  ASP B CG    1 
ATOM   9729  O  OD1   . ASP B 1 634 ? 68.984  131.806 118.391 1.00 32.55 ? 634  ASP B OD1   1 
ATOM   9730  O  OD2   . ASP B 1 634 ? 67.547  130.323 117.646 1.00 35.19 ? 634  ASP B OD2   1 
ATOM   9731  N  N     . PRO B 1 635 ? 71.137  133.430 116.135 1.00 33.10 ? 635  PRO B N     1 
ATOM   9732  C  CA    . PRO B 1 635 ? 72.470  132.907 115.862 1.00 34.64 ? 635  PRO B CA    1 
ATOM   9733  C  C     . PRO B 1 635 ? 72.702  131.541 116.507 1.00 35.44 ? 635  PRO B C     1 
ATOM   9734  O  O     . PRO B 1 635 ? 73.576  130.786 116.079 1.00 36.61 ? 635  PRO B O     1 
ATOM   9735  C  CB    . PRO B 1 635 ? 73.519  133.901 116.352 1.00 35.24 ? 635  PRO B CB    1 
ATOM   9736  N  N     . GLY B 1 636 ? 71.915  131.227 117.531 1.00 35.07 ? 636  GLY B N     1 
ATOM   9737  C  CA    . GLY B 1 636 ? 72.060  129.956 118.218 1.00 35.71 ? 636  GLY B CA    1 
ATOM   9738  C  C     . GLY B 1 636 ? 71.732  128.725 117.389 1.00 36.07 ? 636  GLY B C     1 
ATOM   9739  O  O     . GLY B 1 636 ? 72.046  127.605 117.796 1.00 37.99 ? 636  GLY B O     1 
ATOM   9740  N  N     . VAL B 1 637 ? 71.106  128.913 116.232 1.00 33.18 ? 637  VAL B N     1 
ATOM   9741  C  CA    . VAL B 1 637 ? 70.755  127.774 115.389 1.00 32.58 ? 637  VAL B CA    1 
ATOM   9742  C  C     . VAL B 1 637 ? 71.981  127.160 114.725 1.00 32.10 ? 637  VAL B C     1 
ATOM   9743  O  O     . VAL B 1 637 ? 72.007  125.964 114.441 1.00 31.17 ? 637  VAL B O     1 
ATOM   9744  C  CB    . VAL B 1 637 ? 69.753  128.170 114.288 1.00 31.14 ? 637  VAL B CB    1 
ATOM   9745  C  CG1   . VAL B 1 637 ? 68.448  128.625 114.916 1.00 31.77 ? 637  VAL B CG1   1 
ATOM   9746  C  CG2   . VAL B 1 637 ? 70.344  129.261 113.417 1.00 30.48 ? 637  VAL B CG2   1 
ATOM   9747  N  N     . VAL B 1 638 ? 72.994  127.985 114.483 1.00 32.68 ? 638  VAL B N     1 
ATOM   9748  C  CA    . VAL B 1 638 ? 74.222  127.522 113.846 1.00 34.13 ? 638  VAL B CA    1 
ATOM   9749  C  C     . VAL B 1 638 ? 74.917  126.432 114.661 1.00 34.63 ? 638  VAL B C     1 
ATOM   9750  O  O     . VAL B 1 638 ? 75.201  125.347 114.149 1.00 34.32 ? 638  VAL B O     1 
ATOM   9751  C  CB    . VAL B 1 638 ? 75.205  128.695 113.628 1.00 33.40 ? 638  VAL B CB    1 
ATOM   9752  C  CG1   . VAL B 1 638 ? 76.433  128.215 112.870 1.00 35.77 ? 638  VAL B CG1   1 
ATOM   9753  C  CG2   . VAL B 1 638 ? 74.517  129.809 112.861 1.00 33.52 ? 638  VAL B CG2   1 
ATOM   9754  N  N     . GLU B 1 639 ? 75.186  126.720 115.931 1.00 35.53 ? 639  GLU B N     1 
ATOM   9755  C  CA    . GLU B 1 639 ? 75.855  125.762 116.806 1.00 36.06 ? 639  GLU B CA    1 
ATOM   9756  C  C     . GLU B 1 639 ? 75.094  124.444 116.898 1.00 35.65 ? 639  GLU B C     1 
ATOM   9757  O  O     . GLU B 1 639 ? 75.700  123.374 116.945 1.00 36.88 ? 639  GLU B O     1 
ATOM   9758  C  CB    . GLU B 1 639 ? 76.037  126.363 118.198 1.00 37.33 ? 639  GLU B CB    1 
ATOM   9759  N  N     . LYS B 1 640 ? 73.765  124.520 116.921 1.00 35.26 ? 640  LYS B N     1 
ATOM   9760  C  CA    . LYS B 1 640 ? 72.936  123.322 117.000 1.00 34.16 ? 640  LYS B CA    1 
ATOM   9761  C  C     . LYS B 1 640 ? 73.012  122.521 115.702 1.00 34.68 ? 640  LYS B C     1 
ATOM   9762  O  O     . LYS B 1 640 ? 73.170  121.300 115.727 1.00 34.74 ? 640  LYS B O     1 
ATOM   9763  C  CB    . LYS B 1 640 ? 71.487  123.702 117.297 1.00 33.08 ? 640  LYS B CB    1 
ATOM   9764  N  N     . LEU B 1 641 ? 72.896  123.210 114.570 1.00 34.47 ? 641  LEU B N     1 
ATOM   9765  C  CA    . LEU B 1 641 ? 72.962  122.552 113.267 1.00 35.36 ? 641  LEU B CA    1 
ATOM   9766  C  C     . LEU B 1 641 ? 74.270  121.792 113.110 1.00 36.73 ? 641  LEU B C     1 
ATOM   9767  O  O     . LEU B 1 641 ? 74.304  120.708 112.524 1.00 37.37 ? 641  LEU B O     1 
ATOM   9768  C  CB    . LEU B 1 641 ? 72.837  123.581 112.140 1.00 34.54 ? 641  LEU B CB    1 
ATOM   9769  C  CG    . LEU B 1 641 ? 71.466  124.231 111.950 1.00 33.91 ? 641  LEU B CG    1 
ATOM   9770  C  CD1   . LEU B 1 641 ? 71.574  125.364 110.945 1.00 33.80 ? 641  LEU B CD1   1 
ATOM   9771  C  CD2   . LEU B 1 641 ? 70.464  123.184 111.485 1.00 34.28 ? 641  LEU B CD2   1 
ATOM   9772  N  N     . LEU B 1 642 ? 75.345  122.373 113.631 1.00 38.20 ? 642  LEU B N     1 
ATOM   9773  C  CA    . LEU B 1 642 ? 76.664  121.758 113.560 1.00 40.13 ? 642  LEU B CA    1 
ATOM   9774  C  C     . LEU B 1 642 ? 76.662  120.412 114.276 1.00 40.67 ? 642  LEU B C     1 
ATOM   9775  O  O     . LEU B 1 642 ? 77.117  119.405 113.731 1.00 41.35 ? 642  LEU B O     1 
ATOM   9776  C  CB    . LEU B 1 642 ? 77.705  122.680 114.199 1.00 40.46 ? 642  LEU B CB    1 
ATOM   9777  C  CG    . LEU B 1 642 ? 77.929  124.020 113.495 1.00 42.11 ? 642  LEU B CG    1 
ATOM   9778  C  CD1   . LEU B 1 642 ? 78.764  124.933 114.375 1.00 42.78 ? 642  LEU B CD1   1 
ATOM   9779  C  CD2   . LEU B 1 642 ? 78.611  123.786 112.154 1.00 42.25 ? 642  LEU B CD2   1 
ATOM   9780  N  N     . GLU B 1 643 ? 76.141  120.406 115.500 1.00 40.54 ? 643  GLU B N     1 
ATOM   9781  C  CA    . GLU B 1 643 ? 76.074  119.191 116.299 1.00 40.78 ? 643  GLU B CA    1 
ATOM   9782  C  C     . GLU B 1 643 ? 75.232  118.116 115.617 1.00 41.14 ? 643  GLU B C     1 
ATOM   9783  O  O     . GLU B 1 643 ? 75.593  116.940 115.621 1.00 42.24 ? 643  GLU B O     1 
ATOM   9784  C  CB    . GLU B 1 643 ? 75.504  119.506 117.674 1.00 41.39 ? 643  GLU B CB    1 
ATOM   9785  N  N     . GLU B 1 644 ? 74.109  118.521 115.030 1.00 40.16 ? 644  GLU B N     1 
ATOM   9786  C  CA    . GLU B 1 644 ? 73.231  117.576 114.349 1.00 39.72 ? 644  GLU B CA    1 
ATOM   9787  C  C     . GLU B 1 644 ? 73.929  117.022 113.104 1.00 40.60 ? 644  GLU B C     1 
ATOM   9788  O  O     . GLU B 1 644 ? 73.841  115.830 112.809 1.00 40.08 ? 644  GLU B O     1 
ATOM   9789  C  CB    . GLU B 1 644 ? 71.920  118.265 113.953 1.00 39.48 ? 644  GLU B CB    1 
ATOM   9790  C  CG    . GLU B 1 644 ? 71.244  119.030 115.086 1.00 37.05 ? 644  GLU B CG    1 
ATOM   9791  C  CD    . GLU B 1 644 ? 69.941  119.686 114.659 1.00 37.31 ? 644  GLU B CD    1 
ATOM   9792  O  OE1   . GLU B 1 644 ? 69.898  120.268 113.554 1.00 36.38 ? 644  GLU B OE1   1 
ATOM   9793  O  OE2   . GLU B 1 644 ? 68.959  119.634 115.433 1.00 35.20 ? 644  GLU B OE2   1 
ATOM   9794  N  N     . LYS B 1 645 ? 74.628  117.893 112.381 1.00 41.59 ? 645  LYS B N     1 
ATOM   9795  C  CA    . LYS B 1 645 ? 75.348  117.490 111.175 1.00 42.76 ? 645  LYS B CA    1 
ATOM   9796  C  C     . LYS B 1 645 ? 76.476  116.524 111.524 1.00 43.78 ? 645  LYS B C     1 
ATOM   9797  O  O     . LYS B 1 645 ? 76.841  115.658 110.720 1.00 43.91 ? 645  LYS B O     1 
ATOM   9798  C  CB    . LYS B 1 645 ? 75.920  118.723 110.468 1.00 42.43 ? 645  LYS B CB    1 
ATOM   9799  C  CG    . LYS B 1 645 ? 76.945  118.423 109.378 1.00 41.94 ? 645  LYS B CG    1 
ATOM   9800  C  CD    . LYS B 1 645 ? 76.381  117.522 108.291 1.00 42.19 ? 645  LYS B CD    1 
ATOM   9801  C  CE    . LYS B 1 645 ? 77.389  117.326 107.166 1.00 43.24 ? 645  LYS B CE    1 
ATOM   9802  N  NZ    . LYS B 1 645 ? 78.684  116.775 107.655 1.00 42.49 ? 645  LYS B NZ    1 
ATOM   9803  N  N     . GLN B 1 646 ? 77.025  116.673 112.726 1.00 45.75 ? 646  GLN B N     1 
ATOM   9804  C  CA    . GLN B 1 646 ? 78.117  115.815 113.194 1.00 46.91 ? 646  GLN B CA    1 
ATOM   9805  C  C     . GLN B 1 646 ? 77.637  114.389 113.429 1.00 47.14 ? 646  GLN B C     1 
ATOM   9806  O  O     . GLN B 1 646 ? 78.366  113.429 113.179 1.00 46.99 ? 646  GLN B O     1 
ATOM   9807  C  CB    . GLN B 1 646 ? 78.707  116.380 114.499 1.00 48.07 ? 646  GLN B CB    1 
ATOM   9808  C  CG    . GLN B 1 646 ? 79.871  115.585 115.076 1.00 50.24 ? 646  GLN B CG    1 
ATOM   9809  C  CD    . GLN B 1 646 ? 80.404  116.196 116.340 1.00 52.27 ? 646  GLN B CD    1 
ATOM   9810  O  OE1   . GLN B 1 646 ? 80.881  117.344 116.344 1.00 53.41 ? 646  GLN B OE1   1 
ATOM   9811  N  NE2   . GLN B 1 646 ? 80.348  115.444 117.418 1.00 52.69 ? 646  GLN B NE2   1 
ATOM   9812  N  N     . ALA B 1 647 ? 76.406  114.255 113.908 1.00 47.36 ? 647  ALA B N     1 
ATOM   9813  C  CA    . ALA B 1 647 ? 75.845  112.941 114.182 1.00 47.57 ? 647  ALA B CA    1 
ATOM   9814  C  C     . ALA B 1 647 ? 75.472  112.218 112.890 1.00 47.80 ? 647  ALA B C     1 
ATOM   9815  O  O     . ALA B 1 647 ? 75.640  112.816 111.804 1.00 48.24 ? 647  ALA B O     1 
ATOM   9816  C  CB    . ALA B 1 647 ? 74.626  113.077 115.082 1.00 47.40 ? 647  ALA B CB    1 
HETATM 9817  CL CL    . CL  C 2 .   ? 64.583  170.861 33.115  1.00 20.61 ? 902  CL  A CL    1 
HETATM 9818  MG MG    . MG  D 3 .   ? 62.862  150.461 69.143  1.00 19.63 ? 904  MG  A MG    1 
HETATM 9819  N  N1A   . COA E 4 .   ? 52.713  163.329 46.608  1.00 24.67 ? 990  COA A N1A   1 
HETATM 9820  C  C2A   . COA E 4 .   ? 53.182  163.675 47.808  1.00 24.15 ? 990  COA A C2A   1 
HETATM 9821  N  N3A   . COA E 4 .   ? 52.476  163.653 48.985  1.00 24.57 ? 990  COA A N3A   1 
HETATM 9822  C  C4A   . COA E 4 .   ? 51.154  163.222 48.832  1.00 25.36 ? 990  COA A C4A   1 
HETATM 9823  C  C5A   . COA E 4 .   ? 50.599  162.846 47.624  1.00 25.40 ? 990  COA A C5A   1 
HETATM 9824  C  C6A   . COA E 4 .   ? 51.450  162.912 46.435  1.00 24.59 ? 990  COA A C6A   1 
HETATM 9825  N  N6A   . COA E 4 .   ? 51.004  162.572 45.225  1.00 25.04 ? 990  COA A N6A   1 
HETATM 9826  N  N7A   . COA E 4 .   ? 49.265  162.466 47.814  1.00 24.81 ? 990  COA A N7A   1 
HETATM 9827  C  C8A   . COA E 4 .   ? 49.063  162.619 49.094  1.00 26.29 ? 990  COA A C8A   1 
HETATM 9828  N  N9A   . COA E 4 .   ? 50.168  163.078 49.790  1.00 27.65 ? 990  COA A N9A   1 
HETATM 9829  C  C1B   . COA E 4 .   ? 50.295  163.359 51.194  1.00 30.68 ? 990  COA A C1B   1 
HETATM 9830  C  C2B   . COA E 4 .   ? 49.591  164.656 51.657  1.00 34.73 ? 990  COA A C2B   1 
HETATM 9831  O  O2B   . COA E 4 .   ? 50.401  165.815 51.349  1.00 36.50 ? 990  COA A O2B   1 
HETATM 9832  C  C3B   . COA E 4 .   ? 49.326  164.370 53.155  1.00 36.95 ? 990  COA A C3B   1 
HETATM 9833  O  O3B   . COA E 4 .   ? 50.507  164.702 53.906  1.00 41.75 ? 990  COA A O3B   1 
HETATM 9834  P  P3B   . COA E 4 .   ? 50.665  165.975 54.864  1.00 44.86 ? 990  COA A P3B   1 
HETATM 9835  O  O7A   . COA E 4 .   ? 51.903  165.651 55.641  1.00 44.85 ? 990  COA A O7A   1 
HETATM 9836  O  O8A   . COA E 4 .   ? 50.872  167.116 53.976  1.00 45.43 ? 990  COA A O8A   1 
HETATM 9837  O  O9A   . COA E 4 .   ? 49.433  166.045 55.692  1.00 43.47 ? 990  COA A O9A   1 
HETATM 9838  C  C4B   . COA E 4 .   ? 49.055  162.894 53.211  1.00 36.46 ? 990  COA A C4B   1 
HETATM 9839  O  O4B   . COA E 4 .   ? 49.689  162.371 51.996  1.00 32.26 ? 990  COA A O4B   1 
HETATM 9840  C  C5B   . COA E 4 .   ? 47.573  162.541 53.240  1.00 37.73 ? 990  COA A C5B   1 
HETATM 9841  O  O5B   . COA E 4 .   ? 47.037  162.522 51.905  1.00 41.31 ? 990  COA A O5B   1 
HETATM 9842  P  P1A   . COA E 4 .   ? 45.611  161.879 51.541  1.00 43.00 ? 990  COA A P1A   1 
HETATM 9843  O  O1A   . COA E 4 .   ? 45.250  160.932 52.608  1.00 42.56 ? 990  COA A O1A   1 
HETATM 9844  O  O2A   . COA E 4 .   ? 45.615  161.414 50.099  1.00 42.47 ? 990  COA A O2A   1 
HETATM 9845  O  O3A   . COA E 4 .   ? 44.684  163.212 51.793  1.00 42.68 ? 990  COA A O3A   1 
HETATM 9846  P  P2A   . COA E 4 .   ? 44.456  164.386 50.775  1.00 45.26 ? 990  COA A P2A   1 
HETATM 9847  O  O4A   . COA E 4 .   ? 45.809  164.807 50.387  1.00 44.53 ? 990  COA A O4A   1 
HETATM 9848  O  O5A   . COA E 4 .   ? 43.493  165.349 51.387  1.00 46.13 ? 990  COA A O5A   1 
HETATM 9849  O  O6A   . COA E 4 .   ? 43.765  163.733 49.537  1.00 44.13 ? 990  COA A O6A   1 
HETATM 9850  C  CBP   . COA E 4 .   ? 42.020  162.452 48.319  1.00 41.28 ? 990  COA A CBP   1 
HETATM 9851  C  CCP   . COA E 4 .   ? 42.379  163.190 49.592  1.00 41.51 ? 990  COA A CCP   1 
HETATM 9852  C  CDP   . COA E 4 .   ? 42.183  163.469 47.135  1.00 40.53 ? 990  COA A CDP   1 
HETATM 9853  C  CEP   . COA E 4 .   ? 40.552  161.977 48.399  1.00 40.26 ? 990  COA A CEP   1 
HETATM 9854  C  CAP   . COA E 4 .   ? 43.023  161.230 48.136  1.00 40.43 ? 990  COA A CAP   1 
HETATM 9855  O  OAP   . COA E 4 .   ? 43.154  160.465 49.325  1.00 41.02 ? 990  COA A OAP   1 
HETATM 9856  C  C9P   . COA E 4 .   ? 42.761  160.289 46.924  1.00 39.91 ? 990  COA A C9P   1 
HETATM 9857  O  O9P   . COA E 4 .   ? 42.796  160.687 45.764  1.00 41.21 ? 990  COA A O9P   1 
HETATM 9858  N  N8P   . COA E 4 .   ? 42.491  158.975 47.233  1.00 38.55 ? 990  COA A N8P   1 
HETATM 9859  C  C7P   . COA E 4 .   ? 42.212  157.903 46.243  1.00 37.39 ? 990  COA A C7P   1 
HETATM 9860  C  C6P   . COA E 4 .   ? 43.435  157.051 45.843  1.00 36.02 ? 990  COA A C6P   1 
HETATM 9861  C  C5P   . COA E 4 .   ? 43.233  156.377 44.511  1.00 37.35 ? 990  COA A C5P   1 
HETATM 9862  O  O5P   . COA E 4 .   ? 43.259  157.045 43.441  1.00 34.17 ? 990  COA A O5P   1 
HETATM 9863  N  N4P   . COA E 4 .   ? 43.014  155.069 44.470  1.00 35.81 ? 990  COA A N4P   1 
HETATM 9864  C  C3P   . COA E 4 .   ? 42.775  154.120 43.367  1.00 35.88 ? 990  COA A C3P   1 
HETATM 9865  C  C2P   . COA E 4 .   ? 43.946  153.131 43.386  1.00 35.60 ? 990  COA A C2P   1 
HETATM 9866  S  S1P   . COA E 4 .   ? 45.454  154.105 42.850  1.00 36.37 ? 990  COA A S1P   1 
HETATM 9867  O  "O2'" . PRX F 5 .   ? 41.476  144.799 48.492  1.00 17.26 ? 999  PRX A "O2'" 1 
HETATM 9868  C  "C2'" . PRX F 5 .   ? 41.375  145.012 47.092  1.00 14.45 ? 999  PRX A "C2'" 1 
HETATM 9869  C  "C1'" . PRX F 5 .   ? 41.341  146.598 46.810  1.00 15.36 ? 999  PRX A "C1'" 1 
HETATM 9870  O  "O4'" . PRX F 5 .   ? 42.707  147.004 46.512  1.00 13.69 ? 999  PRX A "O4'" 1 
HETATM 9871  C  "C4'" . PRX F 5 .   ? 43.603  145.828 46.482  1.00 14.44 ? 999  PRX A "C4'" 1 
HETATM 9872  C  "C5'" . PRX F 5 .   ? 44.615  145.968 45.345  1.00 12.65 ? 999  PRX A "C5'" 1 
HETATM 9873  O  "O5'" . PRX F 5 .   ? 45.472  147.094 45.688  1.00 14.75 ? 999  PRX A "O5'" 1 
HETATM 9874  P  P     . PRX F 5 .   ? 46.589  147.539 44.596  1.00 14.86 ? 999  PRX A P     1 
HETATM 9875  O  O1P   . PRX F 5 .   ? 47.433  146.339 44.474  1.00 13.91 ? 999  PRX A O1P   1 
HETATM 9876  O  O2P   . PRX F 5 .   ? 47.295  148.710 45.188  1.00 14.37 ? 999  PRX A O2P   1 
HETATM 9877  O  O3P   . PRX F 5 .   ? 45.813  147.862 43.327  1.00 13.21 ? 999  PRX A O3P   1 
HETATM 9878  C  C1P   . PRX F 5 .   ? 44.933  149.027 43.176  1.00 19.49 ? 999  PRX A C1P   1 
HETATM 9879  C  C2P   . PRX F 5 .   ? 44.210  149.161 41.852  1.00 19.66 ? 999  PRX A C2P   1 
HETATM 9880  C  C3P   . PRX F 5 .   ? 43.290  147.993 41.615  1.00 19.34 ? 999  PRX A C3P   1 
HETATM 9881  C  "C3'" . PRX F 5 .   ? 42.642  144.498 46.264  1.00 13.28 ? 999  PRX A "C3'" 1 
HETATM 9882  O  "O3'" . PRX F 5 .   ? 43.409  143.349 46.828  1.00 14.19 ? 999  PRX A "O3'" 1 
HETATM 9883  N  N9    . PRX F 5 .   ? 40.470  146.900 45.635  1.00 15.27 ? 999  PRX A N9    1 
HETATM 9884  C  C8    . PRX F 5 .   ? 40.844  147.315 44.343  1.00 15.21 ? 999  PRX A C8    1 
HETATM 9885  N  N7    . PRX F 5 .   ? 39.850  147.534 43.447  1.00 15.97 ? 999  PRX A N7    1 
HETATM 9886  C  C5    . PRX F 5 .   ? 38.756  147.224 44.259  1.00 15.18 ? 999  PRX A C5    1 
HETATM 9887  C  C4    . PRX F 5 .   ? 39.116  146.836 45.585  1.00 14.17 ? 999  PRX A C4    1 
HETATM 9888  N  N3    . PRX F 5 .   ? 38.303  146.471 46.610  1.00 15.93 ? 999  PRX A N3    1 
HETATM 9889  C  C2    . PRX F 5 .   ? 36.999  146.503 46.262  1.00 15.03 ? 999  PRX A C2    1 
HETATM 9890  N  N1    . PRX F 5 .   ? 36.530  146.856 45.045  1.00 16.28 ? 999  PRX A N1    1 
HETATM 9891  C  C6    . PRX F 5 .   ? 37.353  147.232 43.987  1.00 15.66 ? 999  PRX A C6    1 
HETATM 9892  N  N6    . PRX F 5 .   ? 36.909  147.598 42.733  1.00 16.59 ? 999  PRX A N6    1 
HETATM 9893  C  C1    . EDO G 6 .   ? 56.162  151.881 44.622  1.00 17.01 ? 1801 EDO A C1    1 
HETATM 9894  O  O1    . EDO G 6 .   ? 56.779  151.393 43.415  1.00 17.48 ? 1801 EDO A O1    1 
HETATM 9895  C  C2    . EDO G 6 .   ? 54.867  152.542 44.289  1.00 14.96 ? 1801 EDO A C2    1 
HETATM 9896  O  O2    . EDO G 6 .   ? 54.962  153.635 43.328  1.00 13.13 ? 1801 EDO A O2    1 
HETATM 9897  C  C1    . EDO H 6 .   ? 41.789  141.714 17.756  1.00 37.71 ? 1802 EDO A C1    1 
HETATM 9898  O  O1    . EDO H 6 .   ? 40.464  141.430 18.244  1.00 40.05 ? 1802 EDO A O1    1 
HETATM 9899  C  C2    . EDO H 6 .   ? 41.890  143.161 17.411  1.00 38.50 ? 1802 EDO A C2    1 
HETATM 9900  O  O2    . EDO H 6 .   ? 41.810  144.081 18.540  1.00 39.19 ? 1802 EDO A O2    1 
HETATM 9901  C  C1    . EDO I 6 .   ? 57.156  162.108 51.622  1.00 28.82 ? 1803 EDO A C1    1 
HETATM 9902  O  O1    . EDO I 6 .   ? 58.450  162.541 52.090  1.00 31.25 ? 1803 EDO A O1    1 
HETATM 9903  C  C2    . EDO I 6 .   ? 56.800  162.819 50.357  1.00 29.61 ? 1803 EDO A C2    1 
HETATM 9904  O  O2    . EDO I 6 .   ? 56.876  164.277 50.418  1.00 30.17 ? 1803 EDO A O2    1 
HETATM 9905  CL CL    . CL  J 2 .   ? 53.301  100.026 68.456  1.00 20.03 ? 901  CL  B CL    1 
HETATM 9906  MG MG    . MG  K 3 .   ? 53.363  120.452 104.605 1.00 17.00 ? 903  MG  B MG    1 
HETATM 9907  N  N1A   . COA L 4 .   ? 64.350  107.417 82.654  1.00 21.73 ? 991  COA B N1A   1 
HETATM 9908  C  C2A   . COA L 4 .   ? 63.771  107.116 83.815  1.00 22.32 ? 991  COA B C2A   1 
HETATM 9909  N  N3A   . COA L 4 .   ? 64.384  107.110 85.039  1.00 23.26 ? 991  COA B N3A   1 
HETATM 9910  C  C4A   . COA L 4 .   ? 65.737  107.464 84.984  1.00 25.63 ? 991  COA B C4A   1 
HETATM 9911  C  C5A   . COA L 4 .   ? 66.405  107.791 83.820  1.00 24.73 ? 991  COA B C5A   1 
HETATM 9912  C  C6A   . COA L 4 .   ? 65.645  107.759 82.572  1.00 23.78 ? 991  COA B C6A   1 
HETATM 9913  N  N6A   . COA L 4 .   ? 66.202  108.055 81.396  1.00 23.13 ? 991  COA B N6A   1 
HETATM 9914  N  N7A   . COA L 4 .   ? 67.739  108.095 84.109  1.00 26.25 ? 991  COA B N7A   1 
HETATM 9915  C  C8A   . COA L 4 .   ? 67.831  107.947 85.404  1.00 26.63 ? 991  COA B C8A   1 
HETATM 9916  N  N9A   . COA L 4 .   ? 66.652  107.562 86.012  1.00 28.89 ? 991  COA B N9A   1 
HETATM 9917  C  C1B   . COA L 4 .   ? 66.398  107.310 87.397  1.00 32.74 ? 991  COA B C1B   1 
HETATM 9918  C  C2B   . COA L 4 .   ? 66.930  105.955 87.896  1.00 36.98 ? 991  COA B C2B   1 
HETATM 9919  O  O2B   . COA L 4 .   ? 65.992  104.908 87.547  1.00 41.79 ? 991  COA B O2B   1 
HETATM 9920  C  C3B   . COA L 4 .   ? 67.151  106.218 89.406  1.00 39.67 ? 991  COA B C3B   1 
HETATM 9921  O  O3B   . COA L 4 .   ? 65.909  105.986 90.090  1.00 44.83 ? 991  COA B O3B   1 
HETATM 9922  P  P3B   . COA L 4 .   ? 65.620  104.787 91.115  1.00 47.90 ? 991  COA B P3B   1 
HETATM 9923  O  O7A   . COA L 4 .   ? 66.904  104.673 91.892  1.00 47.66 ? 991  COA B O7A   1 
HETATM 9924  O  O8A   . COA L 4 .   ? 65.374  103.610 90.290  1.00 47.36 ? 991  COA B O8A   1 
HETATM 9925  O  O9A   . COA L 4 .   ? 64.458  105.215 91.936  1.00 47.77 ? 991  COA B O9A   1 
HETATM 9926  C  C4B   . COA L 4 .   ? 67.542  107.667 89.491  1.00 38.76 ? 991  COA B C4B   1 
HETATM 9927  O  O4B   . COA L 4 .   ? 67.038  108.241 88.241  1.00 34.77 ? 991  COA B O4B   1 
HETATM 9928  C  C5B   . COA L 4 .   ? 69.043  107.896 89.621  1.00 40.63 ? 991  COA B C5B   1 
HETATM 9929  O  O5B   . COA L 4 .   ? 69.626  108.119 88.325  1.00 44.02 ? 991  COA B O5B   1 
HETATM 9930  P  P1A   . COA L 4 .   ? 71.113  108.696 88.119  1.00 46.62 ? 991  COA B P1A   1 
HETATM 9931  O  O1A   . COA L 4 .   ? 71.363  109.651 89.216  1.00 46.63 ? 991  COA B O1A   1 
HETATM 9932  O  O2A   . COA L 4 .   ? 71.272  109.163 86.685  1.00 45.30 ? 991  COA B O2A   1 
HETATM 9933  O  O3A   . COA L 4 .   ? 71.993  107.323 88.440  1.00 45.59 ? 991  COA B O3A   1 
HETATM 9934  P  P2A   . COA L 4 .   ? 72.293  106.122 87.407  1.00 47.53 ? 991  COA B P2A   1 
HETATM 9935  O  O4A   . COA L 4 .   ? 70.965  105.696 86.913  1.00 47.05 ? 991  COA B O4A   1 
HETATM 9936  O  O5A   . COA L 4 .   ? 73.228  105.124 88.014  1.00 47.22 ? 991  COA B O5A   1 
HETATM 9937  O  O6A   . COA L 4 .   ? 73.084  106.781 86.240  1.00 46.33 ? 991  COA B O6A   1 
HETATM 9938  C  CBP   . COA L 4 .   ? 75.047  107.865 85.150  1.00 45.25 ? 991  COA B CBP   1 
HETATM 9939  C  CCP   . COA L 4 .   ? 74.544  107.131 86.364  1.00 45.36 ? 991  COA B CCP   1 
HETATM 9940  C  CDP   . COA L 4 .   ? 75.111  106.798 84.001  1.00 44.50 ? 991  COA B CDP   1 
HETATM 9941  C  CEP   . COA L 4 .   ? 76.435  108.454 85.417  1.00 44.22 ? 991  COA B CEP   1 
HETATM 9942  C  CAP   . COA L 4 .   ? 74.017  109.030 84.838  1.00 45.41 ? 991  COA B CAP   1 
HETATM 9943  O  OAP   . COA L 4 .   ? 73.808  109.800 86.010  1.00 45.21 ? 991  COA B OAP   1 
HETATM 9944  C  C9P   . COA L 4 .   ? 74.347  109.964 83.650  1.00 44.18 ? 991  COA B C9P   1 
HETATM 9945  O  O9P   . COA L 4 .   ? 74.208  109.608 82.487  1.00 44.85 ? 991  COA B O9P   1 
HETATM 9946  N  N8P   . COA L 4 .   ? 74.807  111.215 83.987  1.00 43.08 ? 991  COA B N8P   1 
HETATM 9947  C  C7P   . COA L 4 .   ? 75.188  112.257 83.007  1.00 41.70 ? 991  COA B C7P   1 
HETATM 9948  C  C6P   . COA L 4 .   ? 74.135  113.351 82.775  1.00 39.66 ? 991  COA B C6P   1 
HETATM 9949  C  C5P   . COA L 4 .   ? 74.288  114.046 81.439  1.00 38.57 ? 991  COA B C5P   1 
HETATM 9950  O  O5P   . COA L 4 .   ? 74.095  113.432 80.351  1.00 36.27 ? 991  COA B O5P   1 
HETATM 9951  N  N4P   . COA L 4 .   ? 74.612  115.328 81.422  1.00 36.95 ? 991  COA B N4P   1 
HETATM 9952  C  C3P   . COA L 4 .   ? 74.828  116.311 80.344  1.00 37.26 ? 991  COA B C3P   1 
HETATM 9953  C  C2P   . COA L 4 .   ? 73.612  117.252 80.405  1.00 37.91 ? 991  COA B C2P   1 
HETATM 9954  S  S1P   . COA L 4 .   ? 72.205  116.318 79.587  1.00 37.70 ? 991  COA B S1P   1 
HETATM 9955  O  "O2'" . PRX M 5 .   ? 75.838  125.738 85.431  1.00 15.36 ? 998  PRX B "O2'" 1 
HETATM 9956  C  "C2'" . PRX M 5 .   ? 76.099  125.532 84.058  1.00 14.81 ? 998  PRX B "C2'" 1 
HETATM 9957  C  "C1'" . PRX M 5 .   ? 76.144  123.945 83.779  1.00 15.38 ? 998  PRX B "C1'" 1 
HETATM 9958  O  "O4'" . PRX M 5 .   ? 74.803  123.556 83.380  1.00 15.53 ? 998  PRX B "O4'" 1 
HETATM 9959  C  "C4'" . PRX M 5 .   ? 73.931  124.745 83.210  1.00 14.84 ? 998  PRX B "C4'" 1 
HETATM 9960  C  "C5'" . PRX M 5 .   ? 73.061  124.590 81.948  1.00 15.28 ? 998  PRX B "C5'" 1 
HETATM 9961  O  "O5'" . PRX M 5 .   ? 72.100  123.538 82.254  1.00 16.71 ? 998  PRX B "O5'" 1 
HETATM 9962  P  P     . PRX M 5 .   ? 71.024  123.101 81.111  1.00 17.80 ? 998  PRX B P     1 
HETATM 9963  O  O1P   . PRX M 5 .   ? 70.199  124.314 80.964  1.00 15.02 ? 998  PRX B O1P   1 
HETATM 9964  O  O2P   . PRX M 5 .   ? 70.281  121.944 81.687  1.00 15.34 ? 998  PRX B O2P   1 
HETATM 9965  O  O3P   . PRX M 5 .   ? 71.830  122.746 79.868  1.00 18.27 ? 998  PRX B O3P   1 
HETATM 9966  C  C1P   . PRX M 5 .   ? 72.688  121.561 79.750  1.00 20.21 ? 998  PRX B C1P   1 
HETATM 9967  C  C2P   . PRX M 5 .   ? 73.556  121.477 78.511  1.00 22.02 ? 998  PRX B C2P   1 
HETATM 9968  C  C3P   . PRX M 5 .   ? 74.536  122.621 78.452  1.00 21.83 ? 998  PRX B C3P   1 
HETATM 9969  C  "C3'" . PRX M 5 .   ? 74.933  126.064 83.100  1.00 13.59 ? 998  PRX B "C3'" 1 
HETATM 9970  O  "O3'" . PRX M 5 .   ? 74.125  127.231 83.594  1.00 14.51 ? 998  PRX B "O3'" 1 
HETATM 9971  N  N9    . PRX M 5 .   ? 77.092  123.636 82.673  1.00 15.69 ? 998  PRX B N9    1 
HETATM 9972  C  C8    . PRX M 5 .   ? 76.800  123.237 81.361  1.00 15.18 ? 998  PRX B C8    1 
HETATM 9973  N  N7    . PRX M 5 .   ? 77.841  123.005 80.537  1.00 15.18 ? 998  PRX B N7    1 
HETATM 9974  C  C5    . PRX M 5 .   ? 78.882  123.287 81.413  1.00 15.10 ? 998  PRX B C5    1 
HETATM 9975  C  C4    . PRX M 5 .   ? 78.449  123.674 82.713  1.00 15.66 ? 998  PRX B C4    1 
HETATM 9976  N  N3    . PRX M 5 .   ? 79.207  124.014 83.788  1.00 15.32 ? 998  PRX B N3    1 
HETATM 9977  C  C2    . PRX M 5 .   ? 80.530  123.955 83.520  1.00 15.98 ? 998  PRX B C2    1 
HETATM 9978  N  N1    . PRX M 5 .   ? 81.064  123.601 82.335  1.00 14.73 ? 998  PRX B N1    1 
HETATM 9979  C  C6    . PRX M 5 .   ? 80.292  123.250 81.226  1.00 15.39 ? 998  PRX B C6    1 
HETATM 9980  N  N6    . PRX M 5 .   ? 80.792  122.882 79.998  1.00 17.34 ? 998  PRX B N6    1 
HETATM 9981  C  C1    . EDO N 6 .   ? 62.751  118.141 80.106  1.00 19.17 ? 1800 EDO B C1    1 
HETATM 9982  O  O1    . EDO N 6 .   ? 62.588  117.043 79.191  1.00 14.83 ? 1800 EDO B O1    1 
HETATM 9983  C  C2    . EDO N 6 .   ? 61.421  118.776 80.360  1.00 20.54 ? 1800 EDO B C2    1 
HETATM 9984  O  O2    . EDO N 6 .   ? 60.797  119.417 79.203  1.00 21.12 ? 1800 EDO B O2    1 
HETATM 9985  C  C1    . EDO O 6 .   ? 64.195  94.630  78.677  1.00 37.09 ? 1804 EDO B C1    1 
HETATM 9986  O  O1    . EDO O 6 .   ? 65.238  93.657  78.488  1.00 37.54 ? 1804 EDO B O1    1 
HETATM 9987  C  C2    . EDO O 6 .   ? 63.538  94.406  79.995  1.00 37.39 ? 1804 EDO B C2    1 
HETATM 9988  O  O2    . EDO O 6 .   ? 64.311  94.808  81.165  1.00 39.18 ? 1804 EDO B O2    1 
HETATM 9989  O  O     . HOH P 7 .   ? 44.818  162.279 36.258  1.00 10.97 ? 1804 HOH A O     1 
HETATM 9990  O  O     . HOH P 7 .   ? 51.605  166.327 40.732  1.00 13.56 ? 1805 HOH A O     1 
HETATM 9991  O  O     . HOH P 7 .   ? 35.683  150.677 43.446  1.00 15.00 ? 1806 HOH A O     1 
HETATM 9992  O  O     . HOH P 7 .   ? 43.591  159.479 32.063  1.00 10.67 ? 1807 HOH A O     1 
HETATM 9993  O  O     . HOH P 7 .   ? 52.933  140.659 33.451  1.00 11.85 ? 1808 HOH A O     1 
HETATM 9994  O  O     . HOH P 7 .   ? 57.198  151.009 37.409  1.00 9.44  ? 1809 HOH A O     1 
HETATM 9995  O  O     . HOH P 7 .   ? 33.734  168.010 41.233  1.00 13.98 ? 1810 HOH A O     1 
HETATM 9996  O  O     . HOH P 7 .   ? 47.216  130.224 47.163  1.00 14.93 ? 1811 HOH A O     1 
HETATM 9997  O  O     . HOH P 7 .   ? 58.735  147.574 24.889  1.00 16.54 ? 1812 HOH A O     1 
HETATM 9998  O  O     . HOH P 7 .   ? 53.238  140.227 30.601  1.00 13.27 ? 1813 HOH A O     1 
HETATM 9999  O  O     . HOH P 7 .   ? 53.489  168.397 39.916  1.00 13.55 ? 1814 HOH A O     1 
HETATM 10000 O  O     . HOH P 7 .   ? 44.677  162.886 38.954  1.00 15.23 ? 1815 HOH A O     1 
HETATM 10001 O  O     . HOH P 7 .   ? 59.503  145.789 26.876  1.00 12.73 ? 1816 HOH A O     1 
HETATM 10002 O  O     . HOH P 7 .   ? 25.389  157.928 35.683  1.00 15.17 ? 1817 HOH A O     1 
HETATM 10003 O  O     . HOH P 7 .   ? 55.903  167.678 75.090  1.00 17.04 ? 1818 HOH A O     1 
HETATM 10004 O  O     . HOH P 7 .   ? 56.469  158.658 40.288  1.00 13.34 ? 1819 HOH A O     1 
HETATM 10005 O  O     . HOH P 7 .   ? 44.212  170.542 42.288  1.00 14.52 ? 1820 HOH A O     1 
HETATM 10006 O  O     . HOH P 7 .   ? 47.494  144.230 32.014  1.00 14.67 ? 1821 HOH A O     1 
HETATM 10007 O  O     . HOH P 7 .   ? 53.997  138.088 27.679  1.00 13.12 ? 1822 HOH A O     1 
HETATM 10008 O  O     . HOH P 7 .   ? 53.899  160.297 41.913  1.00 13.97 ? 1823 HOH A O     1 
HETATM 10009 O  O     . HOH P 7 .   ? 25.849  157.216 28.770  1.00 16.38 ? 1824 HOH A O     1 
HETATM 10010 O  O     . HOH P 7 .   ? 29.468  149.333 38.930  1.00 16.27 ? 1825 HOH A O     1 
HETATM 10011 O  O     . HOH P 7 .   ? 65.129  174.009 40.735  1.00 15.31 ? 1826 HOH A O     1 
HETATM 10012 O  O     . HOH P 7 .   ? 60.193  156.357 15.257  1.00 21.48 ? 1827 HOH A O     1 
HETATM 10013 O  O     . HOH P 7 .   ? 30.636  168.121 30.490  1.00 17.60 ? 1828 HOH A O     1 
HETATM 10014 O  O     . HOH P 7 .   ? 27.691  147.138 39.471  1.00 17.08 ? 1829 HOH A O     1 
HETATM 10015 O  O     . HOH P 7 .   ? 23.606  146.290 22.094  1.00 21.19 ? 1830 HOH A O     1 
HETATM 10016 O  O     . HOH P 7 .   ? 47.874  162.060 41.808  1.00 18.77 ? 1831 HOH A O     1 
HETATM 10017 O  O     . HOH P 7 .   ? 48.208  155.242 12.349  1.00 17.98 ? 1832 HOH A O     1 
HETATM 10018 O  O     . HOH P 7 .   ? 49.063  126.481 30.345  1.00 18.32 ? 1833 HOH A O     1 
HETATM 10019 O  O     . HOH P 7 .   ? 22.062  157.202 29.079  1.00 18.02 ? 1834 HOH A O     1 
HETATM 10020 O  O     . HOH P 7 .   ? 31.717  153.840 50.130  1.00 19.62 ? 1835 HOH A O     1 
HETATM 10021 O  O     . HOH P 7 .   ? 23.564  146.264 24.954  1.00 18.34 ? 1836 HOH A O     1 
HETATM 10022 O  O     . HOH P 7 .   ? 55.565  145.932 18.327  1.00 15.48 ? 1837 HOH A O     1 
HETATM 10023 O  O     . HOH P 7 .   ? 70.183  148.385 25.114  1.00 18.66 ? 1838 HOH A O     1 
HETATM 10024 O  O     . HOH P 7 .   ? 32.225  147.313 25.561  1.00 15.92 ? 1839 HOH A O     1 
HETATM 10025 O  O     . HOH P 7 .   ? 53.504  131.500 26.084  1.00 18.13 ? 1840 HOH A O     1 
HETATM 10026 O  O     . HOH P 7 .   ? 29.955  146.704 26.888  1.00 15.04 ? 1841 HOH A O     1 
HETATM 10027 O  O     . HOH P 7 .   ? 61.135  146.723 28.850  1.00 14.25 ? 1842 HOH A O     1 
HETATM 10028 O  O     . HOH P 7 .   ? 26.969  163.420 33.402  1.00 19.83 ? 1843 HOH A O     1 
HETATM 10029 O  O     . HOH P 7 .   ? 72.625  162.995 47.903  1.00 18.24 ? 1844 HOH A O     1 
HETATM 10030 O  O     . HOH P 7 .   ? 58.906  150.579 41.254  1.00 14.74 ? 1845 HOH A O     1 
HETATM 10031 O  O     . HOH P 7 .   ? 49.198  175.511 41.989  1.00 22.32 ? 1846 HOH A O     1 
HETATM 10032 O  O     . HOH P 7 .   ? 31.761  175.659 38.985  1.00 22.78 ? 1847 HOH A O     1 
HETATM 10033 O  O     . HOH P 7 .   ? 32.246  144.633 44.816  1.00 16.20 ? 1848 HOH A O     1 
HETATM 10034 O  O     . HOH P 7 .   ? 63.030  159.376 55.225  1.00 16.99 ? 1849 HOH A O     1 
HETATM 10035 O  O     . HOH P 7 .   ? 41.763  132.789 35.173  1.00 16.01 ? 1850 HOH A O     1 
HETATM 10036 O  O     . HOH P 7 .   ? 50.345  149.673 42.404  1.00 16.89 ? 1851 HOH A O     1 
HETATM 10037 O  O     . HOH P 7 .   ? 47.918  127.746 34.934  1.00 30.54 ? 1852 HOH A O     1 
HETATM 10038 O  O     . HOH P 7 .   ? 55.564  128.158 31.821  1.00 16.78 ? 1853 HOH A O     1 
HETATM 10039 O  O     . HOH P 7 .   ? 52.170  162.584 42.580  1.00 22.36 ? 1854 HOH A O     1 
HETATM 10040 O  O     . HOH P 7 .   ? 49.707  174.054 37.593  1.00 17.24 ? 1855 HOH A O     1 
HETATM 10041 O  O     . HOH P 7 .   ? 25.961  162.251 31.093  1.00 17.49 ? 1856 HOH A O     1 
HETATM 10042 O  O     . HOH P 7 .   ? 35.060  174.133 33.560  1.00 19.33 ? 1857 HOH A O     1 
HETATM 10043 O  O     . HOH P 7 .   ? 61.251  143.134 45.520  1.00 21.67 ? 1858 HOH A O     1 
HETATM 10044 O  O     . HOH P 7 .   ? 49.152  132.008 49.043  1.00 20.96 ? 1859 HOH A O     1 
HETATM 10045 O  O     . HOH P 7 .   ? 41.739  146.261 54.856  1.00 20.22 ? 1860 HOH A O     1 
HETATM 10046 O  O     . HOH P 7 .   ? 71.417  147.871 45.338  1.00 23.38 ? 1861 HOH A O     1 
HETATM 10047 O  O     . HOH P 7 .   ? 63.074  169.180 46.379  1.00 16.87 ? 1862 HOH A O     1 
HETATM 10048 O  O     . HOH P 7 .   ? 44.390  176.011 30.683  1.00 23.87 ? 1863 HOH A O     1 
HETATM 10049 O  O     . HOH P 7 .   ? 46.783  164.160 40.372  1.00 16.29 ? 1864 HOH A O     1 
HETATM 10050 O  O     . HOH P 7 .   ? 64.226  150.051 21.023  1.00 21.40 ? 1865 HOH A O     1 
HETATM 10051 O  O     . HOH P 7 .   ? 53.918  127.735 46.305  1.00 19.79 ? 1866 HOH A O     1 
HETATM 10052 O  O     . HOH P 7 .   ? 69.837  168.061 49.497  1.00 23.29 ? 1867 HOH A O     1 
HETATM 10053 O  O     . HOH P 7 .   ? 34.157  165.112 24.200  1.00 26.47 ? 1868 HOH A O     1 
HETATM 10054 O  O     . HOH P 7 .   ? 56.393  132.989 36.341  1.00 20.76 ? 1869 HOH A O     1 
HETATM 10055 O  O     . HOH P 7 .   ? 71.669  150.666 45.307  1.00 19.99 ? 1870 HOH A O     1 
HETATM 10056 O  O     . HOH P 7 .   ? 32.284  147.430 46.798  1.00 24.94 ? 1871 HOH A O     1 
HETATM 10057 O  O     . HOH P 7 .   ? 53.026  158.205 51.734  1.00 23.36 ? 1872 HOH A O     1 
HETATM 10058 O  O     . HOH P 7 .   ? 40.675  170.196 25.992  1.00 16.83 ? 1873 HOH A O     1 
HETATM 10059 O  O     . HOH P 7 .   ? 45.376  160.821 42.106  1.00 16.00 ? 1874 HOH A O     1 
HETATM 10060 O  O     . HOH P 7 .   ? 60.222  162.095 64.220  1.00 19.40 ? 1875 HOH A O     1 
HETATM 10061 O  O     . HOH P 7 .   ? 62.155  158.081 15.048  1.00 22.20 ? 1876 HOH A O     1 
HETATM 10062 O  O     . HOH P 7 .   ? 64.968  150.890 67.857  1.00 27.98 ? 1877 HOH A O     1 
HETATM 10063 O  O     . HOH P 7 .   ? 54.535  123.683 28.952  1.00 24.94 ? 1878 HOH A O     1 
HETATM 10064 O  O     . HOH P 7 .   ? 41.592  155.138 18.649  1.00 30.94 ? 1879 HOH A O     1 
HETATM 10065 O  O     . HOH P 7 .   ? 64.043  133.611 45.856  1.00 25.71 ? 1880 HOH A O     1 
HETATM 10066 O  O     . HOH P 7 .   ? 39.301  136.734 21.033  1.00 26.34 ? 1881 HOH A O     1 
HETATM 10067 O  O     . HOH P 7 .   ? 50.336  126.241 44.314  1.00 14.95 ? 1882 HOH A O     1 
HETATM 10068 O  O     . HOH P 7 .   ? 45.779  158.187 42.973  1.00 21.19 ? 1883 HOH A O     1 
HETATM 10069 O  O     . HOH P 7 .   ? 50.160  123.192 37.481  1.00 25.74 ? 1884 HOH A O     1 
HETATM 10070 O  O     . HOH P 7 .   ? 39.747  172.733 35.866  1.00 19.03 ? 1885 HOH A O     1 
HETATM 10071 O  O     . HOH P 7 .   ? 63.671  144.362 29.562  1.00 17.71 ? 1886 HOH A O     1 
HETATM 10072 O  O     . HOH P 7 .   ? 33.853  146.946 44.738  1.00 19.15 ? 1887 HOH A O     1 
HETATM 10073 O  O     . HOH P 7 .   ? 47.820  138.659 76.774  1.00 26.84 ? 1888 HOH A O     1 
HETATM 10074 O  O     . HOH P 7 .   ? 51.556  166.399 69.806  1.00 19.82 ? 1889 HOH A O     1 
HETATM 10075 O  O     . HOH P 7 .   ? 29.876  148.825 42.312  1.00 19.02 ? 1890 HOH A O     1 
HETATM 10076 O  O     . HOH P 7 .   ? 39.976  144.288 20.244  1.00 19.65 ? 1891 HOH A O     1 
HETATM 10077 O  O     . HOH P 7 .   ? 73.254  152.564 26.446  1.00 18.28 ? 1892 HOH A O     1 
HETATM 10078 O  O     . HOH P 7 .   ? 64.465  141.369 45.901  1.00 20.10 ? 1893 HOH A O     1 
HETATM 10079 O  O     . HOH P 7 .   ? 23.849  150.648 33.171  1.00 19.01 ? 1894 HOH A O     1 
HETATM 10080 O  O     . HOH P 7 .   ? 69.248  156.418 18.024  1.00 28.09 ? 1895 HOH A O     1 
HETATM 10081 O  O     . HOH P 7 .   ? 33.664  129.351 44.103  1.00 20.33 ? 1896 HOH A O     1 
HETATM 10082 O  O     . HOH P 7 .   ? 23.401  153.514 34.077  1.00 25.13 ? 1897 HOH A O     1 
HETATM 10083 O  O     . HOH P 7 .   ? 65.602  147.379 50.148  1.00 25.75 ? 1898 HOH A O     1 
HETATM 10084 O  O     . HOH P 7 .   ? 25.132  145.121 20.141  1.00 19.79 ? 1899 HOH A O     1 
HETATM 10085 O  O     . HOH P 7 .   ? 46.435  173.032 26.454  1.00 27.54 ? 1900 HOH A O     1 
HETATM 10086 O  O     . HOH P 7 .   ? 75.334  156.226 49.473  1.00 32.94 ? 1901 HOH A O     1 
HETATM 10087 O  O     . HOH P 7 .   ? 47.469  158.650 45.269  1.00 18.63 ? 1902 HOH A O     1 
HETATM 10088 O  O     . HOH P 7 .   ? 52.130  155.077 11.957  1.00 19.63 ? 1903 HOH A O     1 
HETATM 10089 O  O     . HOH P 7 .   ? 59.959  177.661 43.200  1.00 20.53 ? 1904 HOH A O     1 
HETATM 10090 O  O     . HOH P 7 .   ? 23.574  141.591 33.293  1.00 21.16 ? 1905 HOH A O     1 
HETATM 10091 O  O     . HOH P 7 .   ? 25.660  148.850 32.254  1.00 17.37 ? 1906 HOH A O     1 
HETATM 10092 O  O     . HOH P 7 .   ? 47.605  140.918 46.963  1.00 19.26 ? 1907 HOH A O     1 
HETATM 10093 O  O     . HOH P 7 .   ? 53.562  144.611 55.789  1.00 19.81 ? 1908 HOH A O     1 
HETATM 10094 O  O     . HOH P 7 .   ? 54.842  123.711 37.305  1.00 20.87 ? 1909 HOH A O     1 
HETATM 10095 O  O     . HOH P 7 .   ? 64.180  150.423 71.434  1.00 33.94 ? 1910 HOH A O     1 
HETATM 10096 O  O     . HOH P 7 .   ? 42.523  165.291 19.295  1.00 23.71 ? 1911 HOH A O     1 
HETATM 10097 O  O     . HOH P 7 .   ? 57.121  162.260 16.030  1.00 26.49 ? 1912 HOH A O     1 
HETATM 10098 O  O     . HOH P 7 .   ? 33.963  159.250 20.168  1.00 22.88 ? 1913 HOH A O     1 
HETATM 10099 O  O     . HOH P 7 .   ? 30.586  154.429 24.596  1.00 28.95 ? 1914 HOH A O     1 
HETATM 10100 O  O     . HOH P 7 .   ? 19.626  146.089 30.185  1.00 21.92 ? 1915 HOH A O     1 
HETATM 10101 O  O     . HOH P 7 .   ? 72.209  161.685 27.764  1.00 22.87 ? 1916 HOH A O     1 
HETATM 10102 O  O     . HOH P 7 .   ? 47.639  163.996 44.136  1.00 31.81 ? 1917 HOH A O     1 
HETATM 10103 O  O     . HOH P 7 .   ? 23.218  147.674 45.757  1.00 25.80 ? 1918 HOH A O     1 
HETATM 10104 O  O     . HOH P 7 .   ? 67.613  154.680 16.414  1.00 28.46 ? 1919 HOH A O     1 
HETATM 10105 O  O     . HOH P 7 .   ? 54.672  145.666 52.863  1.00 19.25 ? 1920 HOH A O     1 
HETATM 10106 O  O     . HOH P 7 .   ? 38.542  163.692 20.391  1.00 27.16 ? 1921 HOH A O     1 
HETATM 10107 O  O     . HOH P 7 .   ? 33.590  141.309 32.971  1.00 23.18 ? 1922 HOH A O     1 
HETATM 10108 O  O     . HOH P 7 .   ? 46.504  151.745 41.466  1.00 24.23 ? 1923 HOH A O     1 
HETATM 10109 O  O     . HOH P 7 .   ? 29.635  170.041 28.924  1.00 26.52 ? 1924 HOH A O     1 
HETATM 10110 O  O     . HOH P 7 .   ? 38.992  167.934 24.796  1.00 21.70 ? 1925 HOH A O     1 
HETATM 10111 O  O     . HOH P 7 .   ? 57.919  135.199 32.305  1.00 29.75 ? 1926 HOH A O     1 
HETATM 10112 O  O     . HOH P 7 .   ? 28.061  145.100 19.962  1.00 22.10 ? 1927 HOH A O     1 
HETATM 10113 O  O     . HOH P 7 .   ? 43.805  125.779 39.557  1.00 25.10 ? 1928 HOH A O     1 
HETATM 10114 O  O     . HOH P 7 .   ? 72.468  169.486 33.340  1.00 22.94 ? 1929 HOH A O     1 
HETATM 10115 O  O     . HOH P 7 .   ? 68.783  167.319 51.988  1.00 25.82 ? 1930 HOH A O     1 
HETATM 10116 O  O     . HOH P 7 .   ? 67.962  169.472 46.856  1.00 28.17 ? 1931 HOH A O     1 
HETATM 10117 O  O     . HOH P 7 .   ? 50.327  134.975 15.859  1.00 29.95 ? 1932 HOH A O     1 
HETATM 10118 O  O     . HOH P 7 .   ? 44.218  147.917 50.222  1.00 23.47 ? 1933 HOH A O     1 
HETATM 10119 O  O     . HOH P 7 .   ? 65.086  163.303 55.145  1.00 31.33 ? 1934 HOH A O     1 
HETATM 10120 O  O     . HOH P 7 .   ? 48.846  149.199 79.489  1.00 31.59 ? 1935 HOH A O     1 
HETATM 10121 O  O     . HOH P 7 .   ? 60.817  152.415 54.400  1.00 28.09 ? 1936 HOH A O     1 
HETATM 10122 O  O     . HOH P 7 .   ? 17.362  150.058 35.465  1.00 26.71 ? 1937 HOH A O     1 
HETATM 10123 O  O     . HOH P 7 .   ? 74.517  155.399 44.410  1.00 25.57 ? 1938 HOH A O     1 
HETATM 10124 O  O     . HOH P 7 .   ? 53.873  149.089 15.762  1.00 29.34 ? 1939 HOH A O     1 
HETATM 10125 O  O     . HOH P 7 .   ? 47.212  145.640 15.900  1.00 24.35 ? 1940 HOH A O     1 
HETATM 10126 O  O     . HOH P 7 .   ? 74.964  160.105 45.245  1.00 26.15 ? 1941 HOH A O     1 
HETATM 10127 O  O     . HOH P 7 .   ? 72.465  174.375 37.189  1.00 31.61 ? 1942 HOH A O     1 
HETATM 10128 O  O     . HOH P 7 .   ? 71.144  145.393 31.114  1.00 35.82 ? 1943 HOH A O     1 
HETATM 10129 O  O     . HOH P 7 .   ? 43.315  126.568 24.923  1.00 22.81 ? 1944 HOH A O     1 
HETATM 10130 O  O     . HOH P 7 .   ? 36.300  149.967 72.318  1.00 28.01 ? 1945 HOH A O     1 
HETATM 10131 O  O     . HOH P 7 .   ? 51.069  149.044 48.214  1.00 17.91 ? 1946 HOH A O     1 
HETATM 10132 O  O     . HOH P 7 .   ? 24.709  140.286 19.038  1.00 21.16 ? 1947 HOH A O     1 
HETATM 10133 O  O     . HOH P 7 .   ? 48.377  124.444 39.140  1.00 28.01 ? 1948 HOH A O     1 
HETATM 10134 O  O     . HOH P 7 .   ? 76.968  156.406 25.869  1.00 28.45 ? 1949 HOH A O     1 
HETATM 10135 O  O     . HOH P 7 .   ? 45.758  154.806 15.481  1.00 31.75 ? 1950 HOH A O     1 
HETATM 10136 O  O     . HOH P 7 .   ? 37.894  174.696 41.739  1.00 22.08 ? 1951 HOH A O     1 
HETATM 10137 O  O     . HOH P 7 .   ? 36.169  151.672 50.565  1.00 27.34 ? 1952 HOH A O     1 
HETATM 10138 O  O     . HOH P 7 .   ? 44.306  147.971 18.089  1.00 31.13 ? 1953 HOH A O     1 
HETATM 10139 O  O     . HOH P 7 .   ? 63.628  160.330 70.499  1.00 35.20 ? 1954 HOH A O     1 
HETATM 10140 O  O     . HOH P 7 .   ? 68.790  145.683 38.558  1.00 24.33 ? 1955 HOH A O     1 
HETATM 10141 O  O     . HOH P 7 .   ? 60.343  148.963 30.301  1.00 25.62 ? 1956 HOH A O     1 
HETATM 10142 O  O     . HOH P 7 .   ? 27.397  162.118 25.456  1.00 45.99 ? 1957 HOH A O     1 
HETATM 10143 O  O     . HOH P 7 .   ? 58.527  153.341 14.252  1.00 33.56 ? 1958 HOH A O     1 
HETATM 10144 O  O     . HOH P 7 .   ? 30.932  161.309 52.013  1.00 27.46 ? 1959 HOH A O     1 
HETATM 10145 O  O     . HOH P 7 .   ? 69.861  148.122 37.106  1.00 25.62 ? 1960 HOH A O     1 
HETATM 10146 O  O     . HOH P 7 .   ? 60.403  164.840 52.935  1.00 29.37 ? 1961 HOH A O     1 
HETATM 10147 O  O     . HOH P 7 .   ? 19.654  156.599 25.672  1.00 26.01 ? 1962 HOH A O     1 
HETATM 10148 O  O     . HOH P 7 .   ? 37.291  132.247 17.404  1.00 29.95 ? 1963 HOH A O     1 
HETATM 10149 O  O     . HOH P 7 .   ? 63.756  165.621 52.128  1.00 30.08 ? 1964 HOH A O     1 
HETATM 10150 O  O     . HOH P 7 .   ? 22.537  139.742 20.297  1.00 32.36 ? 1965 HOH A O     1 
HETATM 10151 O  O     . HOH P 7 .   ? 72.301  167.031 50.480  1.00 36.14 ? 1966 HOH A O     1 
HETATM 10152 O  O     . HOH P 7 .   ? 38.048  139.076 21.788  1.00 29.64 ? 1967 HOH A O     1 
HETATM 10153 O  O     . HOH P 7 .   ? 62.519  171.315 47.962  1.00 28.33 ? 1968 HOH A O     1 
HETATM 10154 O  O     . HOH P 7 .   ? 55.472  142.397 51.679  1.00 27.95 ? 1969 HOH A O     1 
HETATM 10155 O  O     . HOH P 7 .   ? 48.386  126.232 25.893  1.00 32.76 ? 1970 HOH A O     1 
HETATM 10156 O  O     . HOH P 7 .   ? 34.245  163.069 22.180  1.00 45.75 ? 1971 HOH A O     1 
HETATM 10157 O  O     . HOH P 7 .   ? 24.911  166.120 46.973  1.00 27.39 ? 1972 HOH A O     1 
HETATM 10158 O  O     . HOH P 7 .   ? 23.305  158.171 47.588  1.00 29.71 ? 1973 HOH A O     1 
HETATM 10159 O  O     . HOH P 7 .   ? 42.575  138.590 15.720  1.00 27.97 ? 1974 HOH A O     1 
HETATM 10160 O  O     . HOH P 7 .   ? 62.202  139.667 48.464  1.00 30.88 ? 1975 HOH A O     1 
HETATM 10161 O  O     . HOH P 7 .   ? 64.027  134.785 41.856  1.00 33.56 ? 1976 HOH A O     1 
HETATM 10162 O  O     . HOH P 7 .   ? 47.739  125.563 32.537  1.00 36.73 ? 1977 HOH A O     1 
HETATM 10163 O  O     . HOH P 7 .   ? 59.619  169.642 29.593  1.00 31.80 ? 1978 HOH A O     1 
HETATM 10164 O  O     . HOH P 7 .   ? 24.728  163.878 29.335  1.00 26.58 ? 1979 HOH A O     1 
HETATM 10165 O  O     . HOH P 7 .   ? 46.105  162.332 63.214  1.00 37.23 ? 1980 HOH A O     1 
HETATM 10166 O  O     . HOH P 7 .   ? 46.221  126.960 53.777  1.00 35.77 ? 1981 HOH A O     1 
HETATM 10167 O  O     . HOH P 7 .   ? 40.041  144.332 55.633  1.00 24.76 ? 1982 HOH A O     1 
HETATM 10168 O  O     . HOH P 7 .   ? 51.100  142.230 14.302  1.00 25.88 ? 1983 HOH A O     1 
HETATM 10169 O  O     . HOH P 7 .   ? 20.747  150.930 43.923  1.00 37.88 ? 1984 HOH A O     1 
HETATM 10170 O  O     . HOH P 7 .   ? 40.531  177.254 32.419  1.00 45.04 ? 1985 HOH A O     1 
HETATM 10171 O  O     . HOH P 7 .   ? 62.674  147.098 85.142  1.00 48.83 ? 1986 HOH A O     1 
HETATM 10172 O  O     . HOH P 7 .   ? 35.686  130.469 37.739  1.00 26.74 ? 1987 HOH A O     1 
HETATM 10173 O  O     . HOH P 7 .   ? 69.142  173.390 26.468  1.00 41.40 ? 1988 HOH A O     1 
HETATM 10174 O  O     . HOH P 7 .   ? 19.285  152.795 35.507  1.00 28.26 ? 1989 HOH A O     1 
HETATM 10175 O  O     . HOH P 7 .   ? 19.334  148.214 26.530  1.00 26.89 ? 1990 HOH A O     1 
HETATM 10176 O  O     . HOH P 7 .   ? 21.179  145.848 25.937  1.00 29.12 ? 1991 HOH A O     1 
HETATM 10177 O  O     . HOH P 7 .   ? 25.815  158.669 23.865  1.00 25.33 ? 1992 HOH A O     1 
HETATM 10178 O  O     . HOH P 7 .   ? 20.127  141.549 25.938  1.00 47.72 ? 1993 HOH A O     1 
HETATM 10179 O  O     . HOH P 7 .   ? 34.670  134.228 21.069  1.00 33.83 ? 1994 HOH A O     1 
HETATM 10180 O  O     . HOH P 7 .   ? 43.316  125.734 20.890  1.00 29.19 ? 1995 HOH A O     1 
HETATM 10181 O  O     . HOH P 7 .   ? 39.555  138.665 19.001  1.00 28.67 ? 1996 HOH A O     1 
HETATM 10182 O  O     . HOH P 7 .   ? 37.887  135.084 19.694  1.00 40.88 ? 1997 HOH A O     1 
HETATM 10183 O  O     . HOH P 7 .   ? 55.972  147.342 16.117  1.00 20.89 ? 1998 HOH A O     1 
HETATM 10184 O  O     . HOH P 7 .   ? 55.719  145.950 13.772  1.00 30.52 ? 1999 HOH A O     1 
HETATM 10185 O  O     . HOH P 7 .   ? 58.147  148.627 15.922  1.00 24.77 ? 2000 HOH A O     1 
HETATM 10186 O  O     . HOH P 7 .   ? 51.213  137.685 16.752  1.00 22.34 ? 2001 HOH A O     1 
HETATM 10187 O  O     . HOH P 7 .   ? 50.878  139.181 14.624  1.00 29.88 ? 2002 HOH A O     1 
HETATM 10188 O  O     . HOH P 7 .   ? 53.885  139.925 13.593  1.00 35.85 ? 2003 HOH A O     1 
HETATM 10189 O  O     . HOH P 7 .   ? 54.160  125.912 32.860  1.00 28.18 ? 2004 HOH A O     1 
HETATM 10190 O  O     . HOH P 7 .   ? 47.877  125.813 36.781  1.00 28.60 ? 2005 HOH A O     1 
HETATM 10191 O  O     . HOH P 7 .   ? 55.785  124.546 34.785  1.00 28.84 ? 2006 HOH A O     1 
HETATM 10192 O  O     . HOH P 7 .   ? 53.320  125.800 48.099  1.00 23.94 ? 2007 HOH A O     1 
HETATM 10193 O  O     . HOH P 7 .   ? 57.782  127.118 30.985  1.00 28.50 ? 2008 HOH A O     1 
HETATM 10194 O  O     . HOH P 7 .   ? 55.013  151.190 14.534  1.00 28.41 ? 2009 HOH A O     1 
HETATM 10195 O  O     . HOH P 7 .   ? 57.698  150.897 14.467  1.00 29.89 ? 2010 HOH A O     1 
HETATM 10196 O  O     . HOH P 7 .   ? 45.990  162.948 12.695  1.00 37.74 ? 2011 HOH A O     1 
HETATM 10197 O  O     . HOH P 7 .   ? 46.688  150.885 15.476  1.00 36.02 ? 2012 HOH A O     1 
HETATM 10198 O  O     . HOH P 7 .   ? 45.009  150.925 17.793  1.00 35.09 ? 2013 HOH A O     1 
HETATM 10199 O  O     . HOH P 7 .   ? 53.885  155.870 8.048   1.00 41.06 ? 2014 HOH A O     1 
HETATM 10200 O  O     . HOH P 7 .   ? 54.282  156.550 10.553  1.00 41.78 ? 2015 HOH A O     1 
HETATM 10201 O  O     . HOH P 7 .   ? 54.201  159.167 10.348  1.00 46.68 ? 2016 HOH A O     1 
HETATM 10202 O  O     . HOH P 7 .   ? 51.107  167.139 15.638  1.00 33.54 ? 2017 HOH A O     1 
HETATM 10203 O  O     . HOH P 7 .   ? 46.918  167.484 19.705  1.00 30.65 ? 2018 HOH A O     1 
HETATM 10204 O  O     . HOH P 7 .   ? 47.932  177.997 42.011  1.00 41.61 ? 2019 HOH A O     1 
HETATM 10205 O  O     . HOH P 7 .   ? 43.107  175.944 39.660  1.00 29.12 ? 2020 HOH A O     1 
HETATM 10206 O  O     . HOH P 7 .   ? 48.894  175.248 25.360  1.00 46.56 ? 2021 HOH A O     1 
HETATM 10207 O  O     . HOH P 7 .   ? 49.320  181.393 33.340  1.00 39.78 ? 2022 HOH A O     1 
HETATM 10208 O  O     . HOH P 7 .   ? 50.493  180.888 31.232  1.00 39.26 ? 2023 HOH A O     1 
HETATM 10209 O  O     . HOH P 7 .   ? 71.105  161.390 20.377  1.00 25.21 ? 2024 HOH A O     1 
HETATM 10210 O  O     . HOH P 7 .   ? 71.116  163.578 25.693  1.00 34.26 ? 2025 HOH A O     1 
HETATM 10211 O  O     . HOH P 7 .   ? 75.849  151.754 27.084  1.00 25.41 ? 2026 HOH A O     1 
HETATM 10212 O  O     . HOH P 7 .   ? 72.215  149.691 23.950  1.00 34.56 ? 2027 HOH A O     1 
HETATM 10213 O  O     . HOH P 7 .   ? 65.643  142.430 29.964  1.00 23.88 ? 2028 HOH A O     1 
HETATM 10214 O  O     . HOH P 7 .   ? 66.469  141.830 32.422  1.00 31.74 ? 2029 HOH A O     1 
HETATM 10215 O  O     . HOH P 7 .   ? 70.988  143.312 32.609  1.00 44.81 ? 2030 HOH A O     1 
HETATM 10216 O  O     . HOH P 7 .   ? 67.735  148.667 23.797  1.00 24.44 ? 2031 HOH A O     1 
HETATM 10217 O  O     . HOH P 7 .   ? 66.883  150.441 21.885  1.00 29.56 ? 2032 HOH A O     1 
HETATM 10218 O  O     . HOH P 7 .   ? 63.609  151.341 42.584  1.00 31.56 ? 2033 HOH A O     1 
HETATM 10219 O  O     . HOH P 7 .   ? 53.095  155.884 50.704  1.00 41.50 ? 2034 HOH A O     1 
HETATM 10220 O  O     . HOH P 7 .   ? 58.315  161.781 54.703  1.00 29.91 ? 2035 HOH A O     1 
HETATM 10221 O  O     . HOH P 7 .   ? 65.599  158.564 56.189  1.00 39.89 ? 2036 HOH A O     1 
HETATM 10222 O  O     . HOH P 7 .   ? 67.854  158.301 54.342  1.00 42.10 ? 2037 HOH A O     1 
HETATM 10223 O  O     . HOH P 7 .   ? 67.121  142.314 44.580  1.00 34.99 ? 2038 HOH A O     1 
HETATM 10224 O  O     . HOH P 7 .   ? 69.170  144.269 42.793  1.00 34.16 ? 2039 HOH A O     1 
HETATM 10225 O  O     . HOH P 7 .   ? 73.070  165.760 48.054  1.00 29.85 ? 2040 HOH A O     1 
HETATM 10226 O  O     . HOH P 7 .   ? 67.182  170.759 49.246  1.00 34.69 ? 2041 HOH A O     1 
HETATM 10227 O  O     . HOH P 7 .   ? 69.729  160.642 54.355  1.00 28.42 ? 2042 HOH A O     1 
HETATM 10228 O  O     . HOH P 7 .   ? 67.638  155.938 53.917  1.00 29.49 ? 2043 HOH A O     1 
HETATM 10229 O  O     . HOH P 7 .   ? 74.526  148.107 43.613  1.00 38.54 ? 2044 HOH A O     1 
HETATM 10230 O  O     . HOH P 7 .   ? 74.326  157.420 46.151  1.00 37.19 ? 2045 HOH A O     1 
HETATM 10231 O  O     . HOH P 7 .   ? 61.567  172.907 32.476  1.00 38.06 ? 2046 HOH A O     1 
HETATM 10232 O  O     . HOH P 7 .   ? 58.137  172.187 33.829  1.00 22.25 ? 2047 HOH A O     1 
HETATM 10233 O  O     . HOH P 7 .   ? 59.733  175.637 31.474  1.00 29.25 ? 2048 HOH A O     1 
HETATM 10234 O  O     . HOH P 7 .   ? 57.072  174.457 32.501  1.00 19.27 ? 2049 HOH A O     1 
HETATM 10235 O  O     . HOH P 7 .   ? 75.730  168.822 36.331  1.00 36.17 ? 2050 HOH A O     1 
HETATM 10236 O  O     . HOH P 7 .   ? 69.124  158.890 16.051  1.00 32.06 ? 2051 HOH A O     1 
HETATM 10237 O  O     . HOH P 7 .   ? 41.182  164.529 21.389  1.00 25.30 ? 2052 HOH A O     1 
HETATM 10238 O  O     . HOH P 7 .   ? 44.762  163.455 42.993  1.00 35.30 ? 2053 HOH A O     1 
HETATM 10239 O  O     . HOH P 7 .   ? 48.075  150.652 43.619  1.00 18.09 ? 2054 HOH A O     1 
HETATM 10240 O  O     . HOH P 7 .   ? 52.125  149.374 44.168  1.00 27.85 ? 2055 HOH A O     1 
HETATM 10241 O  O     . HOH P 7 .   ? 50.022  149.085 45.838  1.00 28.81 ? 2056 HOH A O     1 
HETATM 10242 O  O     . HOH P 7 .   ? 41.686  151.320 19.477  1.00 37.12 ? 2057 HOH A O     1 
HETATM 10243 O  O     . HOH P 7 .   ? 42.320  148.808 19.566  1.00 30.34 ? 2058 HOH A O     1 
HETATM 10244 O  O     . HOH P 7 .   ? 30.339  172.475 29.969  1.00 40.10 ? 2059 HOH A O     1 
HETATM 10245 O  O     . HOH P 7 .   ? 34.755  173.420 27.078  1.00 35.75 ? 2060 HOH A O     1 
HETATM 10246 O  O     . HOH P 7 .   ? 35.862  167.751 48.603  1.00 34.20 ? 2061 HOH A O     1 
HETATM 10247 O  O     . HOH P 7 .   ? 35.339  166.285 51.953  1.00 33.49 ? 2062 HOH A O     1 
HETATM 10248 O  O     . HOH P 7 .   ? 28.595  162.287 52.895  1.00 32.00 ? 2063 HOH A O     1 
HETATM 10249 O  O     . HOH P 7 .   ? 25.462  160.089 28.279  1.00 34.84 ? 2064 HOH A O     1 
HETATM 10250 O  O     . HOH P 7 .   ? 25.355  139.477 33.204  1.00 32.05 ? 2065 HOH A O     1 
HETATM 10251 O  O     . HOH P 7 .   ? 22.836  141.948 30.515  1.00 32.68 ? 2066 HOH A O     1 
HETATM 10252 O  O     . HOH P 7 .   ? 20.512  142.190 29.324  1.00 37.75 ? 2067 HOH A O     1 
HETATM 10253 O  O     . HOH P 7 .   ? 21.890  148.837 42.286  1.00 23.49 ? 2068 HOH A O     1 
HETATM 10254 O  O     . HOH P 7 .   ? 55.983  128.215 48.034  1.00 25.82 ? 2069 HOH A O     1 
HETATM 10255 O  O     . HOH P 7 .   ? 51.379  124.968 50.039  1.00 28.01 ? 2070 HOH A O     1 
HETATM 10256 O  O     . HOH P 7 .   ? 48.141  124.862 51.322  1.00 26.88 ? 2071 HOH A O     1 
HETATM 10257 O  O     . HOH P 7 .   ? 40.449  146.165 52.495  1.00 23.30 ? 2072 HOH A O     1 
HETATM 10258 O  O     . HOH P 7 .   ? 37.972  147.301 52.706  1.00 38.16 ? 2073 HOH A O     1 
HETATM 10259 O  O     . HOH P 7 .   ? 50.790  143.142 61.080  1.00 35.68 ? 2074 HOH A O     1 
HETATM 10260 O  O     . HOH P 7 .   ? 43.316  149.997 48.872  1.00 36.11 ? 2075 HOH A O     1 
HETATM 10261 O  O     . HOH P 7 .   ? 37.915  150.036 53.549  1.00 37.31 ? 2076 HOH A O     1 
HETATM 10262 O  O     . HOH P 7 .   ? 47.097  153.106 45.519  1.00 31.41 ? 2077 HOH A O     1 
HETATM 10263 O  O     . HOH P 7 .   ? 46.219  150.891 46.461  1.00 27.01 ? 2078 HOH A O     1 
HETATM 10264 O  O     . HOH P 7 .   ? 50.825  140.534 60.593  1.00 48.03 ? 2079 HOH A O     1 
HETATM 10265 O  O     . HOH P 7 .   ? 58.020  150.071 54.617  1.00 34.47 ? 2080 HOH A O     1 
HETATM 10266 O  O     . HOH P 7 .   ? 61.766  147.538 63.152  1.00 25.70 ? 2081 HOH A O     1 
HETATM 10267 O  O     . HOH P 7 .   ? 57.113  143.572 61.268  1.00 43.72 ? 2082 HOH A O     1 
HETATM 10268 O  O     . HOH P 7 .   ? 66.744  152.399 72.110  1.00 37.07 ? 2083 HOH A O     1 
HETATM 10269 O  O     . HOH P 7 .   ? 56.053  144.982 67.402  1.00 29.55 ? 2084 HOH A O     1 
HETATM 10270 O  O     . HOH P 7 .   ? 43.494  145.610 60.775  1.00 26.95 ? 2085 HOH A O     1 
HETATM 10271 O  O     . HOH P 7 .   ? 46.147  144.556 61.297  1.00 39.43 ? 2086 HOH A O     1 
HETATM 10272 O  O     . HOH P 7 .   ? 41.986  145.459 58.364  1.00 25.76 ? 2087 HOH A O     1 
HETATM 10273 O  O     . HOH P 7 .   ? 34.603  158.537 60.205  1.00 35.07 ? 2088 HOH A O     1 
HETATM 10274 O  O     . HOH P 7 .   ? 50.518  166.017 67.363  1.00 26.75 ? 2089 HOH A O     1 
HETATM 10275 O  O     . HOH P 7 .   ? 62.894  162.249 55.975  1.00 36.31 ? 2090 HOH A O     1 
HETATM 10276 O  O     . HOH P 7 .   ? 60.725  163.204 54.989  1.00 43.08 ? 2091 HOH A O     1 
HETATM 10277 O  O     . HOH P 7 .   ? 52.269  129.457 67.751  1.00 45.08 ? 2092 HOH A O     1 
HETATM 10278 O  O     . HOH P 7 .   ? 20.015  152.788 32.931  1.00 35.70 ? 2093 HOH A O     1 
HETATM 10279 O  O     . HOH P 7 .   ? 20.223  144.420 28.223  1.00 35.18 ? 2094 HOH A O     1 
HETATM 10280 O  O     . HOH P 7 .   ? 17.066  146.731 29.098  1.00 31.72 ? 2095 HOH A O     1 
HETATM 10281 O  O     . HOH P 7 .   ? 17.383  149.548 28.843  1.00 39.91 ? 2096 HOH A O     1 
HETATM 10282 O  O     . HOH P 7 .   ? 17.496  153.882 27.443  1.00 28.40 ? 2097 HOH A O     1 
HETATM 10283 O  O     . HOH P 7 .   ? 21.266  159.299 27.557  1.00 33.67 ? 2098 HOH A O     1 
HETATM 10284 O  O     . HOH P 7 .   ? 21.455  155.090 32.783  1.00 34.05 ? 2099 HOH A O     1 
HETATM 10285 O  O     . HOH P 7 .   ? 29.436  152.675 17.836  1.00 33.39 ? 2100 HOH A O     1 
HETATM 10286 O  O     . HOH P 7 .   ? 30.314  144.858 18.216  1.00 46.13 ? 2101 HOH A O     1 
HETATM 10287 O  O     . HOH P 7 .   ? 28.485  146.284 17.117  1.00 37.90 ? 2102 HOH A O     1 
HETATM 10288 O  O     . HOH P 7 .   ? 37.336  128.047 20.412  1.00 32.41 ? 2103 HOH A O     1 
HETATM 10289 O  O     . HOH P 7 .   ? 35.384  127.142 22.580  1.00 35.56 ? 2104 HOH A O     1 
HETATM 10290 O  O     . HOH P 7 .   ? 31.797  130.391 23.216  1.00 26.82 ? 2105 HOH A O     1 
HETATM 10291 O  O     . HOH P 7 .   ? 40.864  127.154 30.943  1.00 36.25 ? 2106 HOH A O     1 
HETATM 10292 O  O     . HOH P 7 .   ? 57.964  125.715 28.657  1.00 29.82 ? 2107 HOH A O     1 
HETATM 10293 O  O     . HOH P 7 .   ? 60.105  125.718 39.041  1.00 36.72 ? 2108 HOH A O     1 
HETATM 10294 O  O     . HOH P 7 .   ? 59.222  128.063 38.240  1.00 44.85 ? 2109 HOH A O     1 
HETATM 10295 O  O     . HOH P 7 .   ? 54.245  152.479 12.486  1.00 38.06 ? 2110 HOH A O     1 
HETATM 10296 O  O     . HOH P 7 .   ? 56.336  154.081 12.049  1.00 47.40 ? 2111 HOH A O     1 
HETATM 10297 O  O     . HOH P 7 .   ? 51.485  152.997 10.434  1.00 37.80 ? 2112 HOH A O     1 
HETATM 10298 O  O     . HOH P 7 .   ? 49.719  151.717 12.053  1.00 32.34 ? 2113 HOH A O     1 
HETATM 10299 O  O     . HOH P 7 .   ? 49.258  167.002 9.602   1.00 46.14 ? 2114 HOH A O     1 
HETATM 10300 O  O     . HOH P 7 .   ? 50.964  176.201 39.786  1.00 28.48 ? 2115 HOH A O     1 
HETATM 10301 O  O     . HOH P 7 .   ? 40.679  176.077 38.988  1.00 35.13 ? 2116 HOH A O     1 
HETATM 10302 O  O     . HOH P 7 .   ? 49.423  172.529 24.261  1.00 30.69 ? 2117 HOH A O     1 
HETATM 10303 O  O     . HOH P 7 .   ? 51.609  174.832 29.336  1.00 34.87 ? 2118 HOH A O     1 
HETATM 10304 O  O     . HOH P 7 .   ? 62.072  168.241 19.180  1.00 45.54 ? 2119 HOH A O     1 
HETATM 10305 O  O     . HOH P 7 .   ? 66.788  167.527 20.399  1.00 37.17 ? 2120 HOH A O     1 
HETATM 10306 O  O     . HOH P 7 .   ? 74.755  161.917 28.141  1.00 33.11 ? 2121 HOH A O     1 
HETATM 10307 O  O     . HOH P 7 .   ? 72.844  162.981 23.774  1.00 45.69 ? 2122 HOH A O     1 
HETATM 10308 O  O     . HOH P 7 .   ? 74.315  148.666 32.071  1.00 37.38 ? 2123 HOH A O     1 
HETATM 10309 O  O     . HOH P 7 .   ? 75.664  150.473 30.599  1.00 38.14 ? 2124 HOH A O     1 
HETATM 10310 O  O     . HOH P 7 .   ? 71.427  144.881 27.709  1.00 29.06 ? 2125 HOH A O     1 
HETATM 10311 O  O     . HOH P 7 .   ? 65.842  143.645 22.216  1.00 25.27 ? 2126 HOH A O     1 
HETATM 10312 O  O     . HOH P 7 .   ? 69.732  144.393 23.271  1.00 45.47 ? 2127 HOH A O     1 
HETATM 10313 O  O     . HOH P 7 .   ? 67.369  146.235 22.192  1.00 27.55 ? 2128 HOH A O     1 
HETATM 10314 O  O     . HOH P 7 .   ? 67.640  141.786 28.333  1.00 40.15 ? 2129 HOH A O     1 
HETATM 10315 O  O     . HOH P 7 .   ? 65.985  143.470 34.514  1.00 40.48 ? 2130 HOH A O     1 
HETATM 10316 O  O     . HOH P 7 .   ? 74.930  146.334 31.023  1.00 33.44 ? 2131 HOH A O     1 
HETATM 10317 O  O     . HOH P 7 .   ? 49.532  165.434 42.809  1.00 30.79 ? 2132 HOH A O     1 
HETATM 10318 O  O     . HOH P 7 .   ? 54.316  163.791 44.393  1.00 26.56 ? 2133 HOH A O     1 
HETATM 10319 O  O     . HOH P 7 .   ? 53.761  165.481 51.305  1.00 30.54 ? 2134 HOH A O     1 
HETATM 10320 O  O     . HOH P 7 .   ? 62.539  151.076 52.991  1.00 43.44 ? 2135 HOH A O     1 
HETATM 10321 O  O     . HOH P 7 .   ? 59.141  151.334 52.532  1.00 33.91 ? 2136 HOH A O     1 
HETATM 10322 O  O     . HOH P 7 .   ? 57.157  152.224 51.235  1.00 40.70 ? 2137 HOH A O     1 
HETATM 10323 O  O     . HOH P 7 .   ? 54.718  151.615 51.776  1.00 32.40 ? 2138 HOH A O     1 
HETATM 10324 O  O     . HOH P 7 .   ? 60.686  150.722 50.339  1.00 35.53 ? 2139 HOH A O     1 
HETATM 10325 O  O     . HOH P 7 .   ? 64.968  151.861 53.195  1.00 44.36 ? 2140 HOH A O     1 
HETATM 10326 O  O     . HOH P 7 .   ? 67.120  151.079 54.011  1.00 51.97 ? 2141 HOH A O     1 
HETATM 10327 O  O     . HOH P 7 .   ? 72.745  156.749 35.353  1.00 22.22 ? 2142 HOH A O     1 
HETATM 10328 O  O     . HOH P 7 .   ? 74.072  155.268 33.581  1.00 39.57 ? 2143 HOH A O     1 
HETATM 10329 O  O     . HOH P 7 .   ? 46.302  172.866 49.801  1.00 34.66 ? 2144 HOH A O     1 
HETATM 10330 O  O     . HOH P 7 .   ? 53.023  175.628 44.510  1.00 32.70 ? 2145 HOH A O     1 
HETATM 10331 O  O     . HOH P 7 .   ? 62.441  167.477 53.567  1.00 40.42 ? 2146 HOH A O     1 
HETATM 10332 O  O     . HOH P 7 .   ? 66.945  166.535 54.874  1.00 24.81 ? 2147 HOH A O     1 
HETATM 10333 O  O     . HOH P 7 .   ? 69.477  151.041 54.670  1.00 38.58 ? 2148 HOH A O     1 
HETATM 10334 O  O     . HOH P 7 .   ? 78.328  158.492 33.346  1.00 34.12 ? 2149 HOH A O     1 
HETATM 10335 O  O     . HOH P 7 .   ? 77.493  156.313 34.410  1.00 39.89 ? 2150 HOH A O     1 
HETATM 10336 O  O     . HOH P 7 .   ? 61.782  171.168 30.586  1.00 43.84 ? 2151 HOH A O     1 
HETATM 10337 O  O     . HOH P 7 .   ? 66.526  175.830 39.391  1.00 30.43 ? 2152 HOH A O     1 
HETATM 10338 O  O     . HOH P 7 .   ? 63.578  178.539 46.290  1.00 36.20 ? 2153 HOH A O     1 
HETATM 10339 O  O     . HOH P 7 .   ? 78.666  169.541 43.366  1.00 36.51 ? 2154 HOH A O     1 
HETATM 10340 O  O     . HOH P 7 .   ? 65.837  173.710 33.035  1.00 34.56 ? 2155 HOH A O     1 
HETATM 10341 O  O     . HOH P 7 .   ? 74.065  168.464 31.239  1.00 38.45 ? 2156 HOH A O     1 
HETATM 10342 O  O     . HOH P 7 .   ? 71.190  171.217 25.797  1.00 41.38 ? 2157 HOH A O     1 
HETATM 10343 O  O     . HOH P 7 .   ? 67.273  151.247 17.581  1.00 25.46 ? 2158 HOH A O     1 
HETATM 10344 O  O     . HOH P 7 .   ? 68.137  151.769 20.048  1.00 28.73 ? 2159 HOH A O     1 
HETATM 10345 O  O     . HOH P 7 .   ? 64.934  144.213 16.762  1.00 33.73 ? 2160 HOH A O     1 
HETATM 10346 O  O     . HOH P 7 .   ? 54.375  142.651 49.121  1.00 33.58 ? 2161 HOH A O     1 
HETATM 10347 O  O     . HOH P 7 .   ? 42.268  159.100 42.078  1.00 21.04 ? 2162 HOH A O     1 
HETATM 10348 O  O     . HOH P 7 .   ? 42.130  161.615 43.259  1.00 35.73 ? 2163 HOH A O     1 
HETATM 10349 O  O     . HOH P 7 .   ? 45.336  162.479 45.635  1.00 32.14 ? 2164 HOH A O     1 
HETATM 10350 O  O     . HOH P 7 .   ? 32.447  174.030 44.529  1.00 36.56 ? 2165 HOH A O     1 
HETATM 10351 O  O     . HOH P 7 .   ? 33.438  175.958 42.952  1.00 32.67 ? 2166 HOH A O     1 
HETATM 10352 O  O     . HOH P 7 .   ? 36.483  169.891 50.262  1.00 29.82 ? 2167 HOH A O     1 
HETATM 10353 O  O     . HOH P 7 .   ? 37.910  171.924 48.714  1.00 31.08 ? 2168 HOH A O     1 
HETATM 10354 O  O     . HOH P 7 .   ? 32.272  175.778 36.343  1.00 30.69 ? 2169 HOH A O     1 
HETATM 10355 O  O     . HOH P 7 .   ? 32.433  173.989 34.541  1.00 27.02 ? 2170 HOH A O     1 
HETATM 10356 O  O     . HOH P 7 .   ? 38.416  175.407 37.554  1.00 38.52 ? 2171 HOH A O     1 
HETATM 10357 O  O     . HOH P 7 .   ? 38.706  175.099 34.998  1.00 36.14 ? 2172 HOH A O     1 
HETATM 10358 O  O     . HOH P 7 .   ? 28.340  169.064 26.637  1.00 48.55 ? 2173 HOH A O     1 
HETATM 10359 O  O     . HOH P 7 .   ? 30.885  164.884 23.850  1.00 33.27 ? 2174 HOH A O     1 
HETATM 10360 O  O     . HOH P 7 .   ? 31.837  167.871 23.293  1.00 38.30 ? 2175 HOH A O     1 
HETATM 10361 O  O     . HOH P 7 .   ? 30.313  156.153 51.557  1.00 31.23 ? 2176 HOH A O     1 
HETATM 10362 O  O     . HOH P 7 .   ? 43.826  150.380 45.972  1.00 42.68 ? 2177 HOH A O     1 
HETATM 10363 O  O     . HOH P 7 .   ? 35.278  151.237 52.912  1.00 35.41 ? 2178 HOH A O     1 
HETATM 10364 O  O     . HOH P 7 .   ? 30.725  148.833 50.791  1.00 38.99 ? 2179 HOH A O     1 
HETATM 10365 O  O     . HOH P 7 .   ? 28.997  147.406 48.599  1.00 36.71 ? 2180 HOH A O     1 
HETATM 10366 O  O     . HOH P 7 .   ? 25.403  152.384 51.650  1.00 29.22 ? 2181 HOH A O     1 
HETATM 10367 O  O     . HOH P 7 .   ? 21.474  156.255 48.196  1.00 37.00 ? 2182 HOH A O     1 
HETATM 10368 O  O     . HOH P 7 .   ? 27.930  156.685 52.399  1.00 40.71 ? 2183 HOH A O     1 
HETATM 10369 O  O     . HOH P 7 .   ? 21.109  157.673 42.601  1.00 34.80 ? 2184 HOH A O     1 
HETATM 10370 O  O     . HOH P 7 .   ? 22.265  160.100 45.613  1.00 37.34 ? 2185 HOH A O     1 
HETATM 10371 O  O     . HOH P 7 .   ? 18.995  154.598 41.355  1.00 35.12 ? 2186 HOH A O     1 
HETATM 10372 O  O     . HOH P 7 .   ? 23.711  169.692 33.595  1.00 36.52 ? 2187 HOH A O     1 
HETATM 10373 O  O     . HOH P 7 .   ? 31.457  145.499 48.509  1.00 37.32 ? 2188 HOH A O     1 
HETATM 10374 O  O     . HOH P 7 .   ? 29.652  135.636 36.630  1.00 47.27 ? 2189 HOH A O     1 
HETATM 10375 O  O     . HOH P 7 .   ? 32.213  133.076 38.828  1.00 27.24 ? 2190 HOH A O     1 
HETATM 10376 O  O     . HOH P 7 .   ? 33.282  132.177 36.563  1.00 33.90 ? 2191 HOH A O     1 
HETATM 10377 O  O     . HOH P 7 .   ? 40.176  134.298 55.645  1.00 40.29 ? 2192 HOH A O     1 
HETATM 10378 O  O     . HOH P 7 .   ? 62.399  136.373 39.776  1.00 22.51 ? 2193 HOH A O     1 
HETATM 10379 O  O     . HOH P 7 .   ? 55.577  138.839 49.332  1.00 26.95 ? 2194 HOH A O     1 
HETATM 10380 O  O     . HOH P 7 .   ? 56.744  139.600 51.741  1.00 41.35 ? 2195 HOH A O     1 
HETATM 10381 O  O     . HOH P 7 .   ? 54.783  134.969 52.190  1.00 33.94 ? 2196 HOH A O     1 
HETATM 10382 O  O     . HOH P 7 .   ? 56.153  127.877 50.643  1.00 38.54 ? 2197 HOH A O     1 
HETATM 10383 O  O     . HOH P 7 .   ? 43.824  123.509 46.239  1.00 40.16 ? 2198 HOH A O     1 
HETATM 10384 O  O     . HOH P 7 .   ? 36.647  140.688 53.233  1.00 31.75 ? 2199 HOH A O     1 
HETATM 10385 O  O     . HOH P 7 .   ? 33.302  138.261 52.515  1.00 42.48 ? 2200 HOH A O     1 
HETATM 10386 O  O     . HOH P 7 .   ? 41.714  146.878 50.327  1.00 26.39 ? 2201 HOH A O     1 
HETATM 10387 O  O     . HOH P 7 .   ? 43.668  144.010 57.177  1.00 40.12 ? 2202 HOH A O     1 
HETATM 10388 O  O     . HOH P 7 .   ? 49.074  151.931 47.389  1.00 38.45 ? 2203 HOH A O     1 
HETATM 10389 O  O     . HOH P 7 .   ? 58.638  149.624 57.197  1.00 26.29 ? 2204 HOH A O     1 
HETATM 10390 O  O     . HOH P 7 .   ? 61.668  149.296 59.414  1.00 40.19 ? 2205 HOH A O     1 
HETATM 10391 O  O     . HOH P 7 .   ? 57.425  144.677 64.802  1.00 34.84 ? 2206 HOH A O     1 
HETATM 10392 O  O     . HOH P 7 .   ? 64.948  148.545 66.641  1.00 39.20 ? 2207 HOH A O     1 
HETATM 10393 O  O     . HOH P 7 .   ? 63.553  148.034 69.200  1.00 35.38 ? 2208 HOH A O     1 
HETATM 10394 O  O     . HOH P 7 .   ? 59.039  144.260 68.742  1.00 26.70 ? 2209 HOH A O     1 
HETATM 10395 O  O     . HOH P 7 .   ? 38.948  148.096 63.584  1.00 26.77 ? 2210 HOH A O     1 
HETATM 10396 O  O     . HOH P 7 .   ? 37.217  147.118 61.452  1.00 38.79 ? 2211 HOH A O     1 
HETATM 10397 O  O     . HOH P 7 .   ? 38.148  149.004 59.251  1.00 31.45 ? 2212 HOH A O     1 
HETATM 10398 O  O     . HOH P 7 .   ? 36.226  154.254 63.596  1.00 31.48 ? 2213 HOH A O     1 
HETATM 10399 O  O     . HOH P 7 .   ? 35.159  151.812 56.050  1.00 41.14 ? 2214 HOH A O     1 
HETATM 10400 O  O     . HOH P 7 .   ? 54.314  152.037 76.925  1.00 35.87 ? 2215 HOH A O     1 
HETATM 10401 O  O     . HOH P 7 .   ? 52.315  152.949 78.374  1.00 42.82 ? 2216 HOH A O     1 
HETATM 10402 O  O     . HOH P 7 .   ? 64.893  150.665 78.303  1.00 27.06 ? 2217 HOH A O     1 
HETATM 10403 O  O     . HOH P 7 .   ? 65.893  151.427 76.132  1.00 34.81 ? 2218 HOH A O     1 
HETATM 10404 O  O     . HOH P 7 .   ? 58.154  162.322 76.504  1.00 29.45 ? 2219 HOH A O     1 
HETATM 10405 O  O     . HOH P 7 .   ? 60.617  161.551 75.140  1.00 43.70 ? 2220 HOH A O     1 
HETATM 10406 O  O     . HOH P 7 .   ? 55.214  168.420 77.765  1.00 32.12 ? 2221 HOH A O     1 
HETATM 10407 O  O     . HOH P 7 .   ? 61.765  162.493 72.469  1.00 28.94 ? 2222 HOH A O     1 
HETATM 10408 O  O     . HOH P 7 .   ? 64.247  163.148 69.960  1.00 40.92 ? 2223 HOH A O     1 
HETATM 10409 O  O     . HOH P 7 .   ? 58.701  163.265 59.546  1.00 32.91 ? 2224 HOH A O     1 
HETATM 10410 O  O     . HOH P 7 .   ? 47.400  157.835 57.129  1.00 27.71 ? 2225 HOH A O     1 
HETATM 10411 O  O     . HOH P 7 .   ? 47.754  161.311 45.130  1.00 45.95 ? 2226 HOH A O     1 
HETATM 10412 O  O     . HOH P 7 .   ? 58.682  128.730 47.087  1.00 36.59 ? 2227 HOH A O     1 
HETATM 10413 O  O     . HOH P 7 .   ? 49.789  123.264 33.384  1.00 36.75 ? 2228 HOH A O     1 
HETATM 10414 O  O     . HOH P 7 .   ? 60.175  127.847 40.713  1.00 35.91 ? 2229 HOH A O     1 
HETATM 10415 O  O     . HOH P 7 .   ? 59.824  133.872 31.075  1.00 31.02 ? 2230 HOH A O     1 
HETATM 10416 O  O     . HOH P 7 .   ? 59.951  133.062 28.428  1.00 32.28 ? 2231 HOH A O     1 
HETATM 10417 O  O     . HOH P 7 .   ? 47.583  162.064 10.775  1.00 44.72 ? 2232 HOH A O     1 
HETATM 10418 O  O     . HOH P 7 .   ? 51.943  176.974 42.299  1.00 32.27 ? 2233 HOH A O     1 
HETATM 10419 O  O     . HOH P 7 .   ? 44.439  178.013 40.284  1.00 35.64 ? 2234 HOH A O     1 
HETATM 10420 O  O     . HOH P 7 .   ? 71.544  157.017 20.996  1.00 38.34 ? 2235 HOH A O     1 
HETATM 10421 O  O     . HOH P 7 .   ? 72.404  154.560 20.659  1.00 30.93 ? 2236 HOH A O     1 
HETATM 10422 O  O     . HOH P 7 .   ? 77.681  152.870 31.372  1.00 30.80 ? 2237 HOH A O     1 
HETATM 10423 O  O     . HOH P 7 .   ? 52.354  165.379 43.014  1.00 34.39 ? 2238 HOH A O     1 
HETATM 10424 O  O     . HOH P 7 .   ? 68.178  153.563 56.755  1.00 39.73 ? 2239 HOH A O     1 
HETATM 10425 O  O     . HOH P 7 .   ? 63.227  150.054 13.983  1.00 43.00 ? 2240 HOH A O     1 
HETATM 10426 O  O     . HOH P 7 .   ? 60.600  147.783