data_1PI8
# 
_entry.id   1PI8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1PI8         
RCSB  RCSB019337   
WWPDB D_1000019337 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1PI7 
_pdbx_database_related.details        'Pentamer structure of channel-forming trans-membrane domain of Vpu' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1PI8 
_pdbx_database_status.recvd_initial_deposition_date   2003-05-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Park, S.H.'        1 
'Mrse, A.A.'        2 
'Nevzorov, A.A.'    3 
'Mesleh, M.F.'      4 
'Oblatt-Montal, M.' 5 
'Montal, M.'        6 
'Opella, S.J.'      7 
# 
_citation.id                        primary 
_citation.title                     
;Three-dimensional structure of the channel-forming trans-membrane domain of virus protein "u" (Vpu) from HIV-1
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            333 
_citation.page_first                409 
_citation.page_last                 424 
_citation.year                      2003 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14529626 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2003.08.048 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Park, S.H.'        1 
primary 'Mrse, A.A.'        2 
primary 'Nevzorov, A.A.'    3 
primary 'Mesleh, M.F.'      4 
primary 'Oblatt-Montal, M.' 5 
primary 'Montal, M.'        6 
primary 'Opella, S.J.'      7 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'VPU protein' 
_entity.formula_weight             3873.885 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              Y29G 
_entity.pdbx_fragment              'Trans-membrane domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'U ORF protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MQPIQIAIVALVVAIIIAIVVWSIVIIEGRGGKKKK 
_entity_poly.pdbx_seq_one_letter_code_can   MQPIQIAIVALVVAIIIAIVVWSIVIIEGRGGKKKK 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  GLN n 
1 3  PRO n 
1 4  ILE n 
1 5  GLN n 
1 6  ILE n 
1 7  ALA n 
1 8  ILE n 
1 9  VAL n 
1 10 ALA n 
1 11 LEU n 
1 12 VAL n 
1 13 VAL n 
1 14 ALA n 
1 15 ILE n 
1 16 ILE n 
1 17 ILE n 
1 18 ALA n 
1 19 ILE n 
1 20 VAL n 
1 21 VAL n 
1 22 TRP n 
1 23 SER n 
1 24 ILE n 
1 25 VAL n 
1 26 ILE n 
1 27 ILE n 
1 28 GLU n 
1 29 GLY n 
1 30 ARG n 
1 31 GLY n 
1 32 GLY n 
1 33 LYS n 
1 34 LYS n 
1 35 LYS n 
1 36 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Lentivirus 
_entity_src_gen.pdbx_gene_src_gene                 VPU 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Human immunodeficiency virus 1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11676 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BLR(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET-31b(+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    VPU_HV1LW 
_struct_ref.pdbx_db_accession          Q70625 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   MQPIQIAIVALVVAIIIAIVVWSIVIIEYR 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1PI8 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 30 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q70625 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  30 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       30 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1PI8 GLY A 29 ? UNP Q70625 TYR 29 ENGINEERED         29 1 
1 1PI8 GLY A 31 ? UNP Q70625 ?   ?  'CLONING ARTIFACT' 31 2 
1 1PI8 GLY A 32 ? UNP Q70625 ?   ?  'CLONING ARTIFACT' 32 3 
1 1PI8 LYS A 33 ? UNP Q70625 ?   ?  'CLONING ARTIFACT' 33 4 
1 1PI8 LYS A 34 ? UNP Q70625 ?   ?  'CLONING ARTIFACT' 34 5 
1 1PI8 LYS A 35 ? UNP Q70625 ?   ?  'CLONING ARTIFACT' 35 6 
1 1PI8 LYS A 36 ? UNP Q70625 ?   ?  'CLONING ARTIFACT' 36 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl.experiment_id   1 
_pdbx_nmr_exptl.solution_id     1 
_pdbx_nmr_exptl.conditions_id   1 
_pdbx_nmr_exptl.type            PISEMA 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         293 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'Completely aligned in glass plates: 3.5 mg Vpu2-30+ U-15N, 75 mg lipid mixture (DOPC:DOPG, 9:1)' 
_pdbx_nmr_sample_details.solvent_system   NA 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.field_strength    700 
# 
_pdbx_nmr_refine.entry_id           1PI8 
_pdbx_nmr_refine.method             'SCWRL 2.1' 
_pdbx_nmr_refine.details            
;This structure was constructed as a symmetric tetramer of the Vpu2-30+ trans-membrane construct based on the empirical minimization of energy upon the addition of sidechains to a backbone structure that was generated from solid-state NMR data using the program SCWRL.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1PI8 
_pdbx_nmr_details.text       'PISEMA: Polarization Inversion Spin Exchange at the Magic Angle' 
# 
_pdbx_nmr_ensemble.entry_id                                      1PI8 
_pdbx_nmr_ensemble.conformers_calculated_total_number            ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number             4 
_pdbx_nmr_ensemble.conformer_selection_criteria                  ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1PI8 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'minimized average structure' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
NMRPipe 2.1 processing 'Delaglio, F., Grzesiek, S., Vuister, G.W., Zhu, G., Pfeifer, J., Bax, A.' 1 
SCRWL   2.1 refinement 'Bower, M.J., Cohen, F.E., Dunbrack Jr., R.L.'                             2 
# 
_exptl.entry_id          1PI8 
_exptl.method            'SOLID-STATE NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1PI8 
_struct.title                     
;Structure of the channel-forming trans-membrane domain of Virus protein "u" (Vpu) from HIV-1
;
_struct.pdbx_descriptor           'VPU protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1PI8 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
_struct_keywords.text            'ALPHA HELIX, Viral protein' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       ALA 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        7 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       VAL 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        25 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ALA 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         7 
_struct_conf.end_auth_comp_id        VAL 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         25 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1PI8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1PI8 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N    . ALA A 1 7  ? 5.811   -1.563  -11.714 1.00 0.00 ? 7  ALA A N    1 
ATOM 2    C CA   . ALA A 1 7  ? 5.097   -0.569  -12.491 1.00 0.00 ? 7  ALA A CA   1 
ATOM 3    C C    . ALA A 1 7  ? 4.149   0.199   -11.585 1.00 0.00 ? 7  ALA A C    1 
ATOM 4    O O    . ALA A 1 7  ? 4.074   -0.060  -10.386 1.00 0.00 ? 7  ALA A O    1 
ATOM 5    C CB   . ALA A 1 7  ? 4.333   -1.256  -13.618 1.00 0.00 ? 7  ALA A CB   1 
ATOM 6    H H    . ALA A 1 7  ? 5.614   -1.634  -10.726 1.00 0.00 ? 7  ALA A H    1 
ATOM 7    H HA   . ALA A 1 7  ? 5.816   0.127   -12.923 1.00 0.00 ? 7  ALA A HA   1 
ATOM 8    H HB1  . ALA A 1 7  ? 3.807   -0.506  -14.210 1.00 0.00 ? 7  ALA A HB1  1 
ATOM 9    H HB2  . ALA A 1 7  ? 5.033   -1.796  -14.256 1.00 0.00 ? 7  ALA A HB2  1 
ATOM 10   H HB3  . ALA A 1 7  ? 3.612   -1.956  -13.195 1.00 0.00 ? 7  ALA A HB3  1 
ATOM 11   N N    . ILE A 1 8  ? 3.430   1.148   -12.178 1.00 0.00 ? 8  ILE A N    1 
ATOM 12   C CA   . ILE A 1 8  ? 2.475   1.973   -11.446 1.00 0.00 ? 8  ILE A CA   1 
ATOM 13   C C    . ILE A 1 8  ? 1.509   1.103   -10.661 1.00 0.00 ? 8  ILE A C    1 
ATOM 14   O O    . ILE A 1 8  ? 1.177   1.402   -9.517  1.00 0.00 ? 8  ILE A O    1 
ATOM 15   C CB   . ILE A 1 8  ? 1.648   2.857   -12.397 1.00 0.00 ? 8  ILE A CB   1 
ATOM 16   C CG1  . ILE A 1 8  ? 2.538   3.915   -13.052 1.00 0.00 ? 8  ILE A CG1  1 
ATOM 17   C CG2  . ILE A 1 8  ? 0.538   3.566   -11.636 1.00 0.00 ? 8  ILE A CG2  1 
ATOM 18   C CD1  . ILE A 1 8  ? 1.866   4.666   -14.180 1.00 0.00 ? 8  ILE A CD1  1 
ATOM 19   H H    . ILE A 1 8  ? 3.541   1.311   -13.168 1.00 0.00 ? 8  ILE A H    1 
ATOM 20   H HA   . ILE A 1 8  ? 3.029   2.610   -10.756 1.00 0.00 ? 8  ILE A HA   1 
ATOM 21   H HB   . ILE A 1 8  ? 1.209   2.227   -13.170 1.00 0.00 ? 8  ILE A HB   1 
ATOM 22   H HG12 . ILE A 1 8  ? 2.835   4.635   -12.289 1.00 0.00 ? 8  ILE A HG12 1 
ATOM 23   H HG13 . ILE A 1 8  ? 3.425   3.420   -13.449 1.00 0.00 ? 8  ILE A HG13 1 
ATOM 24   H HG21 . ILE A 1 8  ? -0.046  4.180   -12.321 1.00 0.00 ? 8  ILE A HG21 1 
ATOM 25   H HG22 . ILE A 1 8  ? -0.112  2.825   -11.170 1.00 0.00 ? 8  ILE A HG22 1 
ATOM 26   H HG23 . ILE A 1 8  ? 0.976   4.200   -10.865 1.00 0.00 ? 8  ILE A HG23 1 
ATOM 27   H HD11 . ILE A 1 8  ? 2.545   5.404   -14.606 1.00 0.00 ? 8  ILE A HD11 1 
ATOM 28   H HD12 . ILE A 1 8  ? 1.573   3.960   -14.957 1.00 0.00 ? 8  ILE A HD12 1 
ATOM 29   H HD13 . ILE A 1 8  ? 0.981   5.174   -13.797 1.00 0.00 ? 8  ILE A HD13 1 
ATOM 30   N N    . VAL A 1 9  ? 1.067   0.022   -11.295 1.00 0.00 ? 9  VAL A N    1 
ATOM 31   C CA   . VAL A 1 9  ? 0.135   -0.916  -10.679 1.00 0.00 ? 9  VAL A CA   1 
ATOM 32   C C    . VAL A 1 9  ? 0.773   -1.586  -9.477  1.00 0.00 ? 9  VAL A C    1 
ATOM 33   O O    . VAL A 1 9  ? 0.161   -1.694  -8.417  1.00 0.00 ? 9  VAL A O    1 
ATOM 34   C CB   . VAL A 1 9  ? -0.290  -2.019  -11.666 1.00 0.00 ? 9  VAL A CB   1 
ATOM 35   C CG1  . VAL A 1 9  ? -1.092  -3.095  -10.949 1.00 0.00 ? 9  VAL A CG1  1 
ATOM 36   C CG2  . VAL A 1 9  ? -1.152  -1.437  -12.776 1.00 0.00 ? 9  VAL A CG2  1 
ATOM 37   H H    . VAL A 1 9  ? 1.381   -0.166  -12.236 1.00 0.00 ? 9  VAL A H    1 
ATOM 38   H HA   . VAL A 1 9  ? -0.748  -0.364  -10.358 1.00 0.00 ? 9  VAL A HA   1 
ATOM 39   H HB   . VAL A 1 9  ? 0.604   -2.466  -12.101 1.00 0.00 ? 9  VAL A HB   1 
ATOM 40   H HG11 . VAL A 1 9  ? -1.379  -3.874  -11.655 1.00 0.00 ? 9  VAL A HG11 1 
ATOM 41   H HG12 . VAL A 1 9  ? -0.484  -3.533  -10.156 1.00 0.00 ? 9  VAL A HG12 1 
ATOM 42   H HG13 . VAL A 1 9  ? -1.988  -2.651  -10.516 1.00 0.00 ? 9  VAL A HG13 1 
ATOM 43   H HG21 . VAL A 1 9  ? -1.439  -2.225  -13.472 1.00 0.00 ? 9  VAL A HG21 1 
ATOM 44   H HG22 . VAL A 1 9  ? -2.048  -0.993  -12.343 1.00 0.00 ? 9  VAL A HG22 1 
ATOM 45   H HG23 . VAL A 1 9  ? -0.588  -0.672  -13.309 1.00 0.00 ? 9  VAL A HG23 1 
ATOM 46   N N    . ALA A 1 10 ? 2.008   -2.034  -9.659  1.00 0.00 ? 10 ALA A N    1 
ATOM 47   C CA   . ALA A 1 10 ? 2.758   -2.702  -8.603  1.00 0.00 ? 10 ALA A CA   1 
ATOM 48   C C    . ALA A 1 10 ? 2.858   -1.815  -7.378  1.00 0.00 ? 10 ALA A C    1 
ATOM 49   O O    . ALA A 1 10 ? 2.619   -2.259  -6.258  1.00 0.00 ? 10 ALA A O    1 
ATOM 50   C CB   . ALA A 1 10 ? 4.166   -3.028  -9.077  1.00 0.00 ? 10 ALA A CB   1 
ATOM 51   H H    . ALA A 1 10 ? 2.454   -1.914  -10.557 1.00 0.00 ? 10 ALA A H    1 
ATOM 52   H HA   . ALA A 1 10 ? 2.244   -3.626  -8.339  1.00 0.00 ? 10 ALA A HA   1 
ATOM 53   H HB1  . ALA A 1 10 ? 4.714   -3.541  -8.285  1.00 0.00 ? 10 ALA A HB1  1 
ATOM 54   H HB2  . ALA A 1 10 ? 4.113   -3.672  -9.954  1.00 0.00 ? 10 ALA A HB2  1 
ATOM 55   H HB3  . ALA A 1 10 ? 4.685   -2.105  -9.335  1.00 0.00 ? 10 ALA A HB3  1 
ATOM 56   N N    . LEU A 1 11 ? 3.209   -0.571  -7.604  1.00 0.00 ? 11 LEU A N    1 
ATOM 57   C CA   . LEU A 1 11 ? 3.348   0.405   -6.533  1.00 0.00 ? 11 LEU A CA   1 
ATOM 58   C C    . LEU A 1 11 ? 2.040   0.574   -5.796  1.00 0.00 ? 11 LEU A C    1 
ATOM 59   O O    . LEU A 1 11 ? 2.000   0.522   -4.569  1.00 0.00 ? 11 LEU A O    1 
ATOM 60   C CB   . LEU A 1 11 ? 3.763   1.765   -7.098  1.00 0.00 ? 11 LEU A CB   1 
ATOM 61   C CG   . LEU A 1 11 ? 5.199   1.875   -7.613  1.00 0.00 ? 11 LEU A CG   1 
ATOM 62   C CD1  . LEU A 1 11 ? 5.436   3.232   -8.259  1.00 0.00 ? 11 LEU A CD1  1 
ATOM 63   C CD2  . LEU A 1 11 ? 6.193   1.711   -6.474  1.00 0.00 ? 11 LEU A CD2  1 
ATOM 64   H H    . LEU A 1 11 ? 3.392   -0.269  -8.550  1.00 0.00 ? 11 LEU A H    1 
ATOM 65   H HA   . LEU A 1 11 ? 4.112   0.055   -5.838  1.00 0.00 ? 11 LEU A HA   1 
ATOM 66   H HB2  . LEU A 1 11 ? 3.095   1.998   -7.926  1.00 0.00 ? 11 LEU A HB2  1 
ATOM 67   H HB3  . LEU A 1 11 ? 3.636   2.505   -6.308  1.00 0.00 ? 11 LEU A HB3  1 
ATOM 68   H HG   . LEU A 1 11 ? 5.368   1.091   -8.351  1.00 0.00 ? 11 LEU A HG   1 
ATOM 69   H HD11 . LEU A 1 11 ? 6.459   3.293   -8.630  1.00 0.00 ? 11 LEU A HD11 1 
ATOM 70   H HD12 . LEU A 1 11 ? 4.743   3.363   -9.089  1.00 0.00 ? 11 LEU A HD12 1 
ATOM 71   H HD13 . LEU A 1 11 ? 5.273   4.018   -7.521  1.00 0.00 ? 11 LEU A HD13 1 
ATOM 72   H HD21 . LEU A 1 11 ? 7.212   1.780   -6.856  1.00 0.00 ? 11 LEU A HD21 1 
ATOM 73   H HD22 . LEU A 1 11 ? 6.031   2.497   -5.736  1.00 0.00 ? 11 LEU A HD22 1 
ATOM 74   H HD23 . LEU A 1 11 ? 6.050   0.737   -6.005  1.00 0.00 ? 11 LEU A HD23 1 
ATOM 75   N N    . VAL A 1 12 ? 0.987   0.774   -6.536  1.00 0.00 ? 12 VAL A N    1 
ATOM 76   C CA   . VAL A 1 12 ? -0.339  0.955   -5.977  1.00 0.00 ? 12 VAL A CA   1 
ATOM 77   C C    . VAL A 1 12 ? -0.711  -0.216  -5.096  1.00 0.00 ? 12 VAL A C    1 
ATOM 78   O O    . VAL A 1 12 ? -1.185  -0.040  -3.976  1.00 0.00 ? 12 VAL A O    1 
ATOM 79   C CB   . VAL A 1 12 ? -1.406  1.071   -7.081  1.00 0.00 ? 12 VAL A CB   1 
ATOM 80   C CG1  . VAL A 1 12 ? -2.802  1.052   -6.477  1.00 0.00 ? 12 VAL A CG1  1 
ATOM 81   C CG2  . VAL A 1 12 ? -1.234  2.371   -7.853  1.00 0.00 ? 12 VAL A CG2  1 
ATOM 82   H H    . VAL A 1 12 ? 1.087   0.806   -7.540  1.00 0.00 ? 12 VAL A H    1 
ATOM 83   H HA   . VAL A 1 12 ? -0.339  1.869   -5.382  1.00 0.00 ? 12 VAL A HA   1 
ATOM 84   H HB   . VAL A 1 12 ? -1.298  0.229   -7.765  1.00 0.00 ? 12 VAL A HB   1 
ATOM 85   H HG11 . VAL A 1 12 ? -3.548  1.126   -7.267  1.00 0.00 ? 12 VAL A HG11 1 
ATOM 86   H HG12 . VAL A 1 12 ? -2.947  0.121   -5.929  1.00 0.00 ? 12 VAL A HG12 1 
ATOM 87   H HG13 . VAL A 1 12 ? -2.913  1.895   -5.795  1.00 0.00 ? 12 VAL A HG13 1 
ATOM 88   H HG21 . VAL A 1 12 ? -1.988  2.438   -8.636  1.00 0.00 ? 12 VAL A HG21 1 
ATOM 89   H HG22 . VAL A 1 12 ? -1.344  3.214   -7.171  1.00 0.00 ? 12 VAL A HG22 1 
ATOM 90   H HG23 . VAL A 1 12 ? -0.241  2.396   -8.303  1.00 0.00 ? 12 VAL A HG23 1 
ATOM 91   N N    . VAL A 1 13 ? -0.490  -1.411  -5.620  1.00 0.00 ? 13 VAL A N    1 
ATOM 92   C CA   . VAL A 1 13 ? -0.793  -2.634  -4.901  1.00 0.00 ? 13 VAL A CA   1 
ATOM 93   C C    . VAL A 1 13 ? -0.038  -2.686  -3.587  1.00 0.00 ? 13 VAL A C    1 
ATOM 94   O O    . VAL A 1 13 ? -0.632  -2.839  -2.522  1.00 0.00 ? 13 VAL A O    1 
ATOM 95   C CB   . VAL A 1 13 ? -0.402  -3.880  -5.717  1.00 0.00 ? 13 VAL A CB   1 
ATOM 96   C CG1  . VAL A 1 13 ? -0.565  -5.139  -4.879  1.00 0.00 ? 13 VAL A CG1  1 
ATOM 97   C CG2  . VAL A 1 13 ? -1.283  -4.007  -6.951  1.00 0.00 ? 13 VAL A CG2  1 
ATOM 98   H H    . VAL A 1 13 ? -0.098  -1.486  -6.548  1.00 0.00 ? 13 VAL A H    1 
ATOM 99   H HA   . VAL A 1 13 ? -1.864  -2.659  -4.702  1.00 0.00 ? 13 VAL A HA   1 
ATOM 100  H HB   . VAL A 1 13 ? 0.639   -3.786  -6.026  1.00 0.00 ? 13 VAL A HB   1 
ATOM 101  H HG11 . VAL A 1 13 ? -0.277  -6.013  -5.463  1.00 0.00 ? 13 VAL A HG11 1 
ATOM 102  H HG12 . VAL A 1 13 ? 0.070   -5.071  -3.995  1.00 0.00 ? 13 VAL A HG12 1 
ATOM 103  H HG13 . VAL A 1 13 ? -1.606  -5.237  -4.571  1.00 0.00 ? 13 VAL A HG13 1 
ATOM 104  H HG21 . VAL A 1 13 ? -0.991  -4.887  -7.524  1.00 0.00 ? 13 VAL A HG21 1 
ATOM 105  H HG22 . VAL A 1 13 ? -2.324  -4.105  -6.644  1.00 0.00 ? 13 VAL A HG22 1 
ATOM 106  H HG23 . VAL A 1 13 ? -1.169  -3.117  -7.570  1.00 0.00 ? 13 VAL A HG23 1 
ATOM 107  N N    . ALA A 1 14 ? 1.270   -2.557  -3.682  1.00 0.00 ? 14 ALA A N    1 
ATOM 108  C CA   . ALA A 1 14 ? 2.137   -2.585  -2.512  1.00 0.00 ? 14 ALA A CA   1 
ATOM 109  C C    . ALA A 1 14 ? 1.932   -1.352  -1.665  1.00 0.00 ? 14 ALA A C    1 
ATOM 110  O O    . ALA A 1 14 ? 1.723   -1.440  -0.457  1.00 0.00 ? 14 ALA A O    1 
ATOM 111  C CB   . ALA A 1 14 ? 3.597   -2.638  -2.935  1.00 0.00 ? 14 ALA A CB   1 
ATOM 112  H H    . ALA A 1 14 ? 1.696   -2.435  -4.589  1.00 0.00 ? 14 ALA A H    1 
ATOM 113  H HA   . ALA A 1 14 ? 1.900   -3.471  -1.923  1.00 0.00 ? 14 ALA A HA   1 
ATOM 114  H HB1  . ALA A 1 14 ? 4.237   -2.675  -2.053  1.00 0.00 ? 14 ALA A HB1  1 
ATOM 115  H HB2  . ALA A 1 14 ? 3.767   -3.528  -3.541  1.00 0.00 ? 14 ALA A HB2  1 
ATOM 116  H HB3  . ALA A 1 14 ? 3.838   -1.750  -3.518  1.00 0.00 ? 14 ALA A HB3  1 
ATOM 117  N N    . ILE A 1 15 ? 1.997   -0.205  -2.317  1.00 0.00 ? 15 ILE A N    1 
ATOM 118  C CA   . ILE A 1 15 ? 1.823   1.067   -1.646  1.00 0.00 ? 15 ILE A CA   1 
ATOM 119  C C    . ILE A 1 15 ? 0.528   1.089   -0.873  1.00 0.00 ? 15 ILE A C    1 
ATOM 120  O O    . ILE A 1 15 ? 0.480   1.529   0.273   1.00 0.00 ? 15 ILE A O    1 
ATOM 121  C CB   . ILE A 1 15 ? 1.792   2.235   -2.649  1.00 0.00 ? 15 ILE A CB   1 
ATOM 122  C CG1  . ILE A 1 15 ? 3.164   2.412   -3.304  1.00 0.00 ? 15 ILE A CG1  1 
ATOM 123  C CG2  . ILE A 1 15 ? 1.423   3.532   -1.946  1.00 0.00 ? 15 ILE A CG2  1 
ATOM 124  C CD1  . ILE A 1 15 ? 3.162   3.369   -4.476  1.00 0.00 ? 15 ILE A CD1  1 
ATOM 125  H H    . ILE A 1 15 ? 2.172   -0.203  -3.311  1.00 0.00 ? 15 ILE A H    1 
ATOM 126  H HA   . ILE A 1 15 ? 2.657   1.209   -0.958  1.00 0.00 ? 15 ILE A HA   1 
ATOM 127  H HB   . ILE A 1 15 ? 1.051   2.019   -3.418  1.00 0.00 ? 15 ILE A HB   1 
ATOM 128  H HG12 . ILE A 1 15 ? 3.858   2.790   -2.553  1.00 0.00 ? 15 ILE A HG12 1 
ATOM 129  H HG13 . ILE A 1 15 ? 3.506   1.438   -3.656  1.00 0.00 ? 15 ILE A HG13 1 
ATOM 130  H HG21 . ILE A 1 15 ? 1.395   4.349   -2.667  1.00 0.00 ? 15 ILE A HG21 1 
ATOM 131  H HG22 . ILE A 1 15 ? 0.443   3.426   -1.481  1.00 0.00 ? 15 ILE A HG22 1 
ATOM 132  H HG23 . ILE A 1 15 ? 2.166   3.753   -1.179  1.00 0.00 ? 15 ILE A HG23 1 
ATOM 133  H HD11 . ILE A 1 15 ? 4.163   3.456   -4.900  1.00 0.00 ? 15 ILE A HD11 1 
ATOM 134  H HD12 . ILE A 1 15 ? 2.481   2.999   -5.241  1.00 0.00 ? 15 ILE A HD12 1 
ATOM 135  H HD13 . ILE A 1 15 ? 2.831   4.351   -4.138  1.00 0.00 ? 15 ILE A HD13 1 
ATOM 136  N N    . ILE A 1 16 ? -0.519  0.608   -1.517  1.00 0.00 ? 16 ILE A N    1 
ATOM 137  C CA   . ILE A 1 16 ? -1.834  0.560   -0.912  1.00 0.00 ? 16 ILE A CA   1 
ATOM 138  C C    . ILE A 1 16 ? -1.886  -0.496  0.171   1.00 0.00 ? 16 ILE A C    1 
ATOM 139  O O    . ILE A 1 16 ? -2.543  -0.322  1.194   1.00 0.00 ? 16 ILE A O    1 
ATOM 140  C CB   . ILE A 1 16 ? -2.921  0.224   -1.950  1.00 0.00 ? 16 ILE A CB   1 
ATOM 141  C CG1  . ILE A 1 16 ? -3.064  1.364   -2.961  1.00 0.00 ? 16 ILE A CG1  1 
ATOM 142  C CG2  . ILE A 1 16 ? -4.263  0.014   -1.267  1.00 0.00 ? 16 ILE A CG2  1 
ATOM 143  C CD1  . ILE A 1 16 ? -3.928  1.018   -4.153  1.00 0.00 ? 16 ILE A CD1  1 
ATOM 144  H H    . ILE A 1 16 ? -0.411  0.260   -2.459  1.00 0.00 ? 16 ILE A H    1 
ATOM 145  H HA   . ILE A 1 16 ? -2.046  1.536   -0.475  1.00 0.00 ? 16 ILE A HA   1 
ATOM 146  H HB   . ILE A 1 16 ? -2.637  -0.689  -2.474  1.00 0.00 ? 16 ILE A HB   1 
ATOM 147  H HG12 . ILE A 1 16 ? -3.506  2.221   -2.453  1.00 0.00 ? 16 ILE A HG12 1 
ATOM 148  H HG13 . ILE A 1 16 ? -2.070  1.629   -3.322  1.00 0.00 ? 16 ILE A HG13 1 
ATOM 149  H HG21 . ILE A 1 16 ? -5.021  -0.233  -2.009  1.00 0.00 ? 16 ILE A HG21 1 
ATOM 150  H HG22 . ILE A 1 16 ? -4.180  -0.803  -0.549  1.00 0.00 ? 16 ILE A HG22 1 
ATOM 151  H HG23 . ILE A 1 16 ? -4.551  0.927   -0.746  1.00 0.00 ? 16 ILE A HG23 1 
ATOM 152  H HD11 . ILE A 1 16 ? -3.994  1.865   -4.835  1.00 0.00 ? 16 ILE A HD11 1 
ATOM 153  H HD12 . ILE A 1 16 ? -3.492  0.168   -4.679  1.00 0.00 ? 16 ILE A HD12 1 
ATOM 154  H HD13 . ILE A 1 16 ? -4.928  0.758   -3.808  1.00 0.00 ? 16 ILE A HD13 1 
ATOM 155  N N    . ILE A 1 17 ? -1.185  -1.585  -0.072  1.00 0.00 ? 17 ILE A N    1 
ATOM 156  C CA   . ILE A 1 17 ? -1.132  -2.690  0.868   1.00 0.00 ? 17 ILE A CA   1 
ATOM 157  C C    . ILE A 1 17 ? -0.399  -2.289  2.132   1.00 0.00 ? 17 ILE A C    1 
ATOM 158  O O    . ILE A 1 17 ? -0.862  -2.550  3.240   1.00 0.00 ? 17 ILE A O    1 
ATOM 159  C CB   . ILE A 1 17 ? -0.401  -3.906  0.269   1.00 0.00 ? 17 ILE A CB   1 
ATOM 160  C CG1  . ILE A 1 17 ? -1.208  -4.495  -0.891  1.00 0.00 ? 17 ILE A CG1  1 
ATOM 161  C CG2  . ILE A 1 17 ? -0.213  -4.987  1.323   1.00 0.00 ? 17 ILE A CG2  1 
ATOM 162  C CD1  . ILE A 1 17 ? -0.455  -5.533  -1.693  1.00 0.00 ? 17 ILE A CD1  1 
ATOM 163  H H    . ILE A 1 17 ? -0.664  -1.664  -0.934  1.00 0.00 ? 17 ILE A H    1 
ATOM 164  H HA   . ILE A 1 17 ? -2.153  -2.975  1.119   1.00 0.00 ? 17 ILE A HA   1 
ATOM 165  H HB   . ILE A 1 17 ? 0.575   -3.586  -0.096  1.00 0.00 ? 17 ILE A HB   1 
ATOM 166  H HG12 . ILE A 1 17 ? -2.105  -4.960  -0.484  1.00 0.00 ? 17 ILE A HG12 1 
ATOM 167  H HG13 . ILE A 1 17 ? -1.491  -3.683  -1.560  1.00 0.00 ? 17 ILE A HG13 1 
ATOM 168  H HG21 . ILE A 1 17 ? 0.314   -5.838  0.891   1.00 0.00 ? 17 ILE A HG21 1 
ATOM 169  H HG22 . ILE A 1 17 ? 0.369   -4.586  2.153   1.00 0.00 ? 17 ILE A HG22 1 
ATOM 170  H HG23 . ILE A 1 17 ? -1.187  -5.312  1.687   1.00 0.00 ? 17 ILE A HG23 1 
ATOM 171  H HD11 . ILE A 1 17 ? -1.077  -5.917  -2.501  1.00 0.00 ? 17 ILE A HD11 1 
ATOM 172  H HD12 . ILE A 1 17 ? 0.442   -5.080  -2.116  1.00 0.00 ? 17 ILE A HD12 1 
ATOM 173  H HD13 . ILE A 1 17 ? -0.171  -6.357  -1.038  1.00 0.00 ? 17 ILE A HD13 1 
ATOM 174  N N    . ALA A 1 18 ? 0.733   -1.662  1.949   1.00 0.00 ? 18 ALA A N    1 
ATOM 175  C CA   . ALA A 1 18 ? 1.554   -1.213  3.061   1.00 0.00 ? 18 ALA A CA   1 
ATOM 176  C C    . ALA A 1 18 ? 0.857   -0.126  3.836   1.00 0.00 ? 18 ALA A C    1 
ATOM 177  O O    . ALA A 1 18 ? 0.655   -0.240  5.042   1.00 0.00 ? 18 ALA A O    1 
ATOM 178  C CB   . ALA A 1 18 ? 2.879   -0.664  2.554   1.00 0.00 ? 18 ALA A CB   1 
ATOM 179  H H    . ALA A 1 18 ? 1.058   -1.479  1.011   1.00 0.00 ? 18 ALA A H    1 
ATOM 180  H HA   . ALA A 1 18 ? 1.743   -2.061  3.720   1.00 0.00 ? 18 ALA A HA   1 
ATOM 181  H HB1  . ALA A 1 18 ? 3.495   -0.346  3.396   1.00 0.00 ? 18 ALA A HB1  1 
ATOM 182  H HB2  . ALA A 1 18 ? 3.404   -1.441  1.998   1.00 0.00 ? 18 ALA A HB2  1 
ATOM 183  H HB3  . ALA A 1 18 ? 2.692   0.188   1.901   1.00 0.00 ? 18 ALA A HB3  1 
ATOM 184  N N    . ILE A 1 19 ? 0.496   0.922   3.132   1.00 0.00 ? 19 ILE A N    1 
ATOM 185  C CA   . ILE A 1 19 ? -0.182  2.048   3.731   1.00 0.00 ? 19 ILE A CA   1 
ATOM 186  C C    . ILE A 1 19 ? -1.381  1.592   4.517   1.00 0.00 ? 19 ILE A C    1 
ATOM 187  O O    . ILE A 1 19 ? -1.579  1.989   5.663   1.00 0.00 ? 19 ILE A O    1 
ATOM 188  C CB   . ILE A 1 19 ? -0.671  3.045   2.664   1.00 0.00 ? 19 ILE A CB   1 
ATOM 189  C CG1  . ILE A 1 19 ? 0.519   3.716   1.975   1.00 0.00 ? 19 ILE A CG1  1 
ATOM 190  C CG2  . ILE A 1 19 ? -1.532  4.126   3.300   1.00 0.00 ? 19 ILE A CG2  1 
ATOM 191  C CD1  . ILE A 1 19 ? 0.142   4.522   0.752   1.00 0.00 ? 19 ILE A CD1  1 
ATOM 192  H H    . ILE A 1 19 ? 0.693   0.952   2.142   1.00 0.00 ? 19 ILE A H    1 
ATOM 193  H HA   . ILE A 1 19 ? 0.517   2.553   4.399   1.00 0.00 ? 19 ILE A HA   1 
ATOM 194  H HB   . ILE A 1 19 ? -1.260  2.506   1.922   1.00 0.00 ? 19 ILE A HB   1 
ATOM 195  H HG12 . ILE A 1 19 ? 1.000   4.383   2.691   1.00 0.00 ? 19 ILE A HG12 1 
ATOM 196  H HG13 . ILE A 1 19 ? 1.223   2.941   1.672   1.00 0.00 ? 19 ILE A HG13 1 
ATOM 197  H HG21 . ILE A 1 19 ? -1.880  4.819   2.535   1.00 0.00 ? 19 ILE A HG21 1 
ATOM 198  H HG22 . ILE A 1 19 ? -2.391  3.664   3.788   1.00 0.00 ? 19 ILE A HG22 1 
ATOM 199  H HG23 . ILE A 1 19 ? -0.943  4.670   4.040   1.00 0.00 ? 19 ILE A HG23 1 
ATOM 200  H HD11 . ILE A 1 19 ? 1.027   4.976   0.306   1.00 0.00 ? 19 ILE A HD11 1 
ATOM 201  H HD12 . ILE A 1 19 ? -0.330  3.866   0.021   1.00 0.00 ? 19 ILE A HD12 1 
ATOM 202  H HD13 . ILE A 1 19 ? -0.555  5.308   1.041   1.00 0.00 ? 19 ILE A HD13 1 
ATOM 203  N N    . VAL A 1 20 ? -2.174  0.755   3.884   1.00 0.00 ? 20 VAL A N    1 
ATOM 204  C CA   . VAL A 1 20 ? -3.366  0.225   4.501   1.00 0.00 ? 20 VAL A CA   1 
ATOM 205  C C    . VAL A 1 20 ? -3.020  -0.601  5.718   1.00 0.00 ? 20 VAL A C    1 
ATOM 206  O O    . VAL A 1 20 ? -3.627  -0.456  6.776   1.00 0.00 ? 20 VAL A O    1 
ATOM 207  C CB   . VAL A 1 20 ? -4.151  -0.677  3.530   1.00 0.00 ? 20 VAL A CB   1 
ATOM 208  C CG1  . VAL A 1 20 ? -5.283  -1.385  4.258   1.00 0.00 ? 20 VAL A CG1  1 
ATOM 209  C CG2  . VAL A 1 20 ? -4.748  0.149   2.401   1.00 0.00 ? 20 VAL A CG2  1 
ATOM 210  H H    . VAL A 1 20 ? -1.952  0.469   2.942   1.00 0.00 ? 20 VAL A H    1 
ATOM 211  H HA   . VAL A 1 20 ? -3.997  1.062   4.801   1.00 0.00 ? 20 VAL A HA   1 
ATOM 212  H HB   . VAL A 1 20 ? -3.471  -1.420  3.112   1.00 0.00 ? 20 VAL A HB   1 
ATOM 213  H HG11 . VAL A 1 20 ? -5.825  -2.026  3.564   1.00 0.00 ? 20 VAL A HG11 1 
ATOM 214  H HG12 . VAL A 1 20 ? -4.871  -1.993  5.065   1.00 0.00 ? 20 VAL A HG12 1 
ATOM 215  H HG13 . VAL A 1 20 ? -5.965  -0.644  4.674   1.00 0.00 ? 20 VAL A HG13 1 
ATOM 216  H HG21 . VAL A 1 20 ? -5.293  -0.501  1.717   1.00 0.00 ? 20 VAL A HG21 1 
ATOM 217  H HG22 . VAL A 1 20 ? -5.430  0.890   2.817   1.00 0.00 ? 20 VAL A HG22 1 
ATOM 218  H HG23 . VAL A 1 20 ? -3.948  0.654   1.860   1.00 0.00 ? 20 VAL A HG23 1 
ATOM 219  N N    . VAL A 1 21 ? -2.045  -1.460  5.549   1.00 0.00 ? 21 VAL A N    1 
ATOM 220  C CA   . VAL A 1 21 ? -1.595  -2.325  6.620   1.00 0.00 ? 21 VAL A CA   1 
ATOM 221  C C    . VAL A 1 21 ? -0.966  -1.529  7.734   1.00 0.00 ? 21 VAL A C    1 
ATOM 222  O O    . VAL A 1 21 ? -1.383  -1.609  8.887   1.00 0.00 ? 21 VAL A O    1 
ATOM 223  C CB   . VAL A 1 21 ? -0.547  -3.339  6.124   1.00 0.00 ? 21 VAL A CB   1 
ATOM 224  C CG1  . VAL A 1 21 ? 0.018   -4.135  7.291   1.00 0.00 ? 21 VAL A CG1  1 
ATOM 225  C CG2  . VAL A 1 21 ? -1.172  -4.311  5.136   1.00 0.00 ? 21 VAL A CG2  1 
ATOM 226  H H    . VAL A 1 21 ? -1.587  -1.530  4.652   1.00 0.00 ? 21 VAL A H    1 
ATOM 227  H HA   . VAL A 1 21 ? -2.459  -2.865  7.008   1.00 0.00 ? 21 VAL A HA   1 
ATOM 228  H HB   . VAL A 1 21 ? 0.262   -2.798  5.633   1.00 0.00 ? 21 VAL A HB   1 
ATOM 229  H HG11 . VAL A 1 21 ? 0.765   -4.842  6.930   1.00 0.00 ? 21 VAL A HG11 1 
ATOM 230  H HG12 . VAL A 1 21 ? 0.483   -3.453  8.004   1.00 0.00 ? 21 VAL A HG12 1 
ATOM 231  H HG13 . VAL A 1 21 ? -0.788  -4.680  7.782   1.00 0.00 ? 21 VAL A HG13 1 
ATOM 232  H HG21 . VAL A 1 21 ? -0.419  -5.017  4.786   1.00 0.00 ? 21 VAL A HG21 1 
ATOM 233  H HG22 . VAL A 1 21 ? -1.979  -4.856  5.626   1.00 0.00 ? 21 VAL A HG22 1 
ATOM 234  H HG23 . VAL A 1 21 ? -1.571  -3.757  4.287   1.00 0.00 ? 21 VAL A HG23 1 
ATOM 235  N N    . TRP A 1 22 ? 0.031   -0.769  7.369   1.00 0.00 ? 22 TRP A N    1 
ATOM 236  C CA   . TRP A 1 22 ? 0.738   0.056   8.319   1.00 0.00 ? 22 TRP A CA   1 
ATOM 237  C C    . TRP A 1 22 ? -0.213  0.909   9.102   1.00 0.00 ? 22 TRP A C    1 
ATOM 238  O O    . TRP A 1 22 ? 0.006   1.198   10.276  1.00 0.00 ? 22 TRP A O    1 
ATOM 239  C CB   . TRP A 1 22 ? 1.723   0.978   7.599   1.00 0.00 ? 22 TRP A CB   1 
ATOM 240  C CG   . TRP A 1 22 ? 2.514   1.851   8.524   1.00 0.00 ? 22 TRP A CG   1 
ATOM 241  C CD1  . TRP A 1 22 ? 3.668   1.523   9.175   1.00 0.00 ? 22 TRP A CD1  1 
ATOM 242  C CD2  . TRP A 1 22 ? 2.208   3.199   8.903   1.00 0.00 ? 22 TRP A CD2  1 
ATOM 243  N NE1  . TRP A 1 22 ? 4.102   2.581   9.936   1.00 0.00 ? 22 TRP A NE1  1 
ATOM 244  C CE2  . TRP A 1 22 ? 3.221   3.624   9.786   1.00 0.00 ? 22 TRP A CE2  1 
ATOM 245  C CE3  . TRP A 1 22 ? 1.178   4.088   8.583   1.00 0.00 ? 22 TRP A CE3  1 
ATOM 246  C CZ2  . TRP A 1 22 ? 3.234   4.898   10.351  1.00 0.00 ? 22 TRP A CZ2  1 
ATOM 247  C CZ3  . TRP A 1 22 ? 1.194   5.350   9.146   1.00 0.00 ? 22 TRP A CZ3  1 
ATOM 248  C CH2  . TRP A 1 22 ? 2.213   5.746   10.020  1.00 0.00 ? 22 TRP A CH2  1 
ATOM 249  H H    . TRP A 1 22 ? 0.323   -0.749  6.403   1.00 0.00 ? 22 TRP A H    1 
ATOM 250  H HA   . TRP A 1 22 ? 1.286   -0.593  9.003   1.00 0.00 ? 22 TRP A HA   1 
ATOM 251  H HB2  . TRP A 1 22 ? 2.416   0.365   7.022   1.00 0.00 ? 22 TRP A HB2  1 
ATOM 252  H HB3  . TRP A 1 22 ? 1.167   1.614   6.911   1.00 0.00 ? 22 TRP A HB3  1 
ATOM 253  H HD1  . TRP A 1 22 ? 4.168   0.568   9.103   1.00 0.00 ? 22 TRP A HD1  1 
ATOM 254  H HE1  . TRP A 1 22 ? 4.938   2.564   10.504  1.00 0.00 ? 22 TRP A HE1  1 
ATOM 255  H HE3  . TRP A 1 22 ? 0.387   3.795   7.910   1.00 0.00 ? 22 TRP A HE3  1 
ATOM 256  H HZ2  . TRP A 1 22 ? 4.021   5.204   11.025  1.00 0.00 ? 22 TRP A HZ2  1 
ATOM 257  H HZ3  . TRP A 1 22 ? 0.404   6.045   8.907   1.00 0.00 ? 22 TRP A HZ3  1 
ATOM 258  H HH2  . TRP A 1 22 ? 2.193   6.740   10.442  1.00 0.00 ? 22 TRP A HH2  1 
ATOM 259  N N    . SER A 1 23 ? -1.269  1.305   8.435   1.00 0.00 ? 23 SER A N    1 
ATOM 260  C CA   . SER A 1 23 ? -2.274  2.130   9.045   1.00 0.00 ? 23 SER A CA   1 
ATOM 261  C C    . SER A 1 23 ? -3.041  1.360   10.085  1.00 0.00 ? 23 SER A C    1 
ATOM 262  O O    . SER A 1 23 ? -3.319  1.861   11.172  1.00 0.00 ? 23 SER A O    1 
ATOM 263  C CB   . SER A 1 23 ? -3.265  2.632   7.994   1.00 0.00 ? 23 SER A CB   1 
ATOM 264  O OG   . SER A 1 23 ? -4.270  3.439   8.584   1.00 0.00 ? 23 SER A OG   1 
ATOM 265  H H    . SER A 1 23 ? -1.390  1.030   7.471   1.00 0.00 ? 23 SER A H    1 
ATOM 266  H HA   . SER A 1 23 ? -1.785  2.983   9.516   1.00 0.00 ? 23 SER A HA   1 
ATOM 267  H HB2  . SER A 1 23 ? -2.727  3.220   7.251   1.00 0.00 ? 23 SER A HB2  1 
ATOM 268  H HB3  . SER A 1 23 ? -3.735  1.776   7.511   1.00 0.00 ? 23 SER A HB3  1 
ATOM 269  H HG   . SER A 1 23 ? -4.873  3.736   7.899   1.00 0.00 ? 23 SER A HG   1 
ATOM 270  N N    . ILE A 1 24 ? -3.373  0.147   9.736   1.00 0.00 ? 24 ILE A N    1 
ATOM 271  C CA   . ILE A 1 24 ? -4.110  -0.719  10.623  1.00 0.00 ? 24 ILE A CA   1 
ATOM 272  C C    . ILE A 1 24 ? -3.419  -0.854  11.961  1.00 0.00 ? 24 ILE A C    1 
ATOM 273  O O    . ILE A 1 24 ? -4.047  -0.750  13.012  1.00 0.00 ? 24 ILE A O    1 
ATOM 274  C CB   . ILE A 1 24 ? -4.258  -2.135  10.035  1.00 0.00 ? 24 ILE A CB   1 
ATOM 275  C CG1  . ILE A 1 24 ? -5.155  -2.106  8.796   1.00 0.00 ? 24 ILE A CG1  1 
ATOM 276  C CG2  . ILE A 1 24 ? -4.880  -3.074  11.058  1.00 0.00 ? 24 ILE A CG2  1 
ATOM 277  C CD1  . ILE A 1 24 ? -5.157  -3.402  8.014   1.00 0.00 ? 24 ILE A CD1  1 
ATOM 278  H H    . ILE A 1 24 ? -3.112  -0.205  8.826   1.00 0.00 ? 24 ILE A H    1 
ATOM 279  H HA   . ILE A 1 24 ? -5.100  -0.289  10.773  1.00 0.00 ? 24 ILE A HA   1 
ATOM 280  H HB   . ILE A 1 24 ? -3.271  -2.507  9.758   1.00 0.00 ? 24 ILE A HB   1 
ATOM 281  H HG12 . ILE A 1 24 ? -6.175  -1.896  9.115   1.00 0.00 ? 24 ILE A HG12 1 
ATOM 282  H HG13 . ILE A 1 24 ? -4.808  -1.309  8.139   1.00 0.00 ? 24 ILE A HG13 1 
ATOM 283  H HG21 . ILE A 1 24 ? -4.970  -4.074  10.635  1.00 0.00 ? 24 ILE A HG21 1 
ATOM 284  H HG22 . ILE A 1 24 ? -4.247  -3.114  11.945  1.00 0.00 ? 24 ILE A HG22 1 
ATOM 285  H HG23 . ILE A 1 24 ? -5.868  -2.707  11.333  1.00 0.00 ? 24 ILE A HG23 1 
ATOM 286  H HD11 . ILE A 1 24 ? -5.811  -3.324  7.147   1.00 0.00 ? 24 ILE A HD11 1 
ATOM 287  H HD12 . ILE A 1 24 ? -4.143  -3.621  7.678   1.00 0.00 ? 24 ILE A HD12 1 
ATOM 288  H HD13 . ILE A 1 24 ? -5.509  -4.209  8.656   1.00 0.00 ? 24 ILE A HD13 1 
ATOM 289  N N    . VAL A 1 25 ? -2.146  -1.082  11.904  1.00 0.00 ? 25 VAL A N    1 
ATOM 290  C CA   . VAL A 1 25 ? -1.343  -1.237  13.101  1.00 0.00 ? 25 VAL A CA   1 
ATOM 291  C C    . VAL A 1 25 ? 0.108   -1.493  12.719  1.00 0.00 ? 25 VAL A C    1 
ATOM 292  O O    . VAL A 1 25 ? 0.441   -1.543  11.537  1.00 0.00 ? 25 VAL A O    1 
ATOM 293  C CB   . VAL A 1 25 ? -1.893  -2.389  13.937  1.00 0.00 ? 25 VAL A CB   1 
ATOM 294  C CG1  . VAL A 1 25 ? -1.060  -2.541  15.207  1.00 0.00 ? 25 VAL A CG1  1 
ATOM 295  C CG2  . VAL A 1 25 ? -3.343  -2.097  14.312  1.00 0.00 ? 25 VAL A CG2  1 
ATOM 296  H H    . VAL A 1 25 ? -1.689  -1.156  11.007  1.00 0.00 ? 25 VAL A H    1 
ATOM 297  H HA   . VAL A 1 25 ? -1.398  -0.318  13.685  1.00 0.00 ? 25 VAL A HA   1 
ATOM 298  H HB   . VAL A 1 25 ? -1.846  -3.312  13.359  1.00 0.00 ? 25 VAL A HB   1 
ATOM 299  H HG11 . VAL A 1 25 ? -1.453  -3.363  15.803  1.00 0.00 ? 25 VAL A HG11 1 
ATOM 300  H HG12 . VAL A 1 25 ? -0.024  -2.749  14.939  1.00 0.00 ? 25 VAL A HG12 1 
ATOM 301  H HG13 . VAL A 1 25 ? -1.107  -1.618  15.785  1.00 0.00 ? 25 VAL A HG13 1 
ATOM 302  H HG21 . VAL A 1 25 ? -3.737  -2.920  14.909  1.00 0.00 ? 25 VAL A HG21 1 
ATOM 303  H HG22 . VAL A 1 25 ? -3.390  -1.174  14.890  1.00 0.00 ? 25 VAL A HG22 1 
ATOM 304  H HG23 . VAL A 1 25 ? -3.938  -1.989  13.406  1.00 0.00 ? 25 VAL A HG23 1 
ATOM 305  N N    . ALA A 1 7  ? -5.162  -1.085  -11.714 1.00 0.00 ? 7  ALA A N    2 
ATOM 306  C CA   . ALA A 1 7  ? -6.156  -1.798  -12.491 1.00 0.00 ? 7  ALA A CA   2 
ATOM 307  C C    . ALA A 1 7  ? -6.924  -2.746  -11.585 1.00 0.00 ? 7  ALA A C    2 
ATOM 308  O O    . ALA A 1 7  ? -6.665  -2.821  -10.386 1.00 0.00 ? 7  ALA A O    2 
ATOM 309  C CB   . ALA A 1 7  ? -5.469  -2.563  -13.618 1.00 0.00 ? 7  ALA A CB   2 
ATOM 310  H H    . ALA A 1 7  ? -5.091  -1.281  -10.726 1.00 0.00 ? 7  ALA A H    2 
ATOM 311  H HA   . ALA A 1 7  ? -6.851  -1.079  -12.923 1.00 0.00 ? 7  ALA A HA   2 
ATOM 312  H HB1  . ALA A 1 7  ? -6.218  -3.088  -14.210 1.00 0.00 ? 7  ALA A HB1  2 
ATOM 313  H HB2  . ALA A 1 7  ? -4.928  -1.863  -14.256 1.00 0.00 ? 7  ALA A HB2  2 
ATOM 314  H HB3  . ALA A 1 7  ? -4.769  -3.283  -13.195 1.00 0.00 ? 7  ALA A HB3  2 
ATOM 315  N N    . ILE A 1 8  ? -7.873  -3.465  -12.178 1.00 0.00 ? 8  ILE A N    2 
ATOM 316  C CA   . ILE A 1 8  ? -8.698  -4.420  -11.446 1.00 0.00 ? 8  ILE A CA   2 
ATOM 317  C C    . ILE A 1 8  ? -7.828  -5.386  -10.661 1.00 0.00 ? 8  ILE A C    2 
ATOM 318  O O    . ILE A 1 8  ? -8.127  -5.718  -9.517  1.00 0.00 ? 8  ILE A O    2 
ATOM 319  C CB   . ILE A 1 8  ? -9.582  -5.247  -12.397 1.00 0.00 ? 8  ILE A CB   2 
ATOM 320  C CG1  . ILE A 1 8  ? -10.640 -4.357  -13.052 1.00 0.00 ? 8  ILE A CG1  2 
ATOM 321  C CG2  . ILE A 1 8  ? -10.291 -6.357  -11.636 1.00 0.00 ? 8  ILE A CG2  2 
ATOM 322  C CD1  . ILE A 1 8  ? -11.391 -5.029  -14.180 1.00 0.00 ? 8  ILE A CD1  2 
ATOM 323  H H    . ILE A 1 8  ? -8.036  -3.355  -13.168 1.00 0.00 ? 8  ILE A H    2 
ATOM 324  H HA   . ILE A 1 8  ? -9.335  -3.866  -10.756 1.00 0.00 ? 8  ILE A HA   2 
ATOM 325  H HB   . ILE A 1 8  ? -8.952  -5.687  -13.170 1.00 0.00 ? 8  ILE A HB   2 
ATOM 326  H HG12 . ILE A 1 8  ? -11.359 -4.060  -12.289 1.00 0.00 ? 8  ILE A HG12 2 
ATOM 327  H HG13 . ILE A 1 8  ? -10.145 -3.471  -13.449 1.00 0.00 ? 8  ILE A HG13 2 
ATOM 328  H HG21 . ILE A 1 8  ? -10.905 -6.942  -12.321 1.00 0.00 ? 8  ILE A HG21 2 
ATOM 329  H HG22 . ILE A 1 8  ? -9.550  -7.007  -11.170 1.00 0.00 ? 8  ILE A HG22 2 
ATOM 330  H HG23 . ILE A 1 8  ? -10.925 -5.920  -10.865 1.00 0.00 ? 8  ILE A HG23 2 
ATOM 331  H HD11 . ILE A 1 8  ? -12.129 -4.350  -14.606 1.00 0.00 ? 8  ILE A HD11 2 
ATOM 332  H HD12 . ILE A 1 8  ? -10.685 -5.323  -14.957 1.00 0.00 ? 8  ILE A HD12 2 
ATOM 333  H HD13 . ILE A 1 8  ? -11.898 -5.914  -13.797 1.00 0.00 ? 8  ILE A HD13 2 
ATOM 334  N N    . VAL A 1 9  ? -6.747  -5.828  -11.295 1.00 0.00 ? 9  VAL A N    2 
ATOM 335  C CA   . VAL A 1 9  ? -5.809  -6.760  -10.679 1.00 0.00 ? 9  VAL A CA   2 
ATOM 336  C C    . VAL A 1 9  ? -5.139  -6.122  -9.477  1.00 0.00 ? 9  VAL A C    2 
ATOM 337  O O    . VAL A 1 9  ? -5.031  -6.734  -8.417  1.00 0.00 ? 9  VAL A O    2 
ATOM 338  C CB   . VAL A 1 9  ? -4.706  -7.185  -11.666 1.00 0.00 ? 9  VAL A CB   2 
ATOM 339  C CG1  . VAL A 1 9  ? -3.630  -7.987  -10.949 1.00 0.00 ? 9  VAL A CG1  2 
ATOM 340  C CG2  . VAL A 1 9  ? -5.288  -8.047  -12.776 1.00 0.00 ? 9  VAL A CG2  2 
ATOM 341  H H    . VAL A 1 9  ? -6.558  -5.514  -12.236 1.00 0.00 ? 9  VAL A H    2 
ATOM 342  H HA   . VAL A 1 9  ? -6.361  -7.643  -10.358 1.00 0.00 ? 9  VAL A HA   2 
ATOM 343  H HB   . VAL A 1 9  ? -4.258  -6.291  -12.101 1.00 0.00 ? 9  VAL A HB   2 
ATOM 344  H HG11 . VAL A 1 9  ? -2.851  -8.275  -11.655 1.00 0.00 ? 9  VAL A HG11 2 
ATOM 345  H HG12 . VAL A 1 9  ? -3.192  -7.380  -10.156 1.00 0.00 ? 9  VAL A HG12 2 
ATOM 346  H HG13 . VAL A 1 9  ? -4.074  -8.884  -10.516 1.00 0.00 ? 9  VAL A HG13 2 
ATOM 347  H HG21 . VAL A 1 9  ? -4.500  -8.335  -13.472 1.00 0.00 ? 9  VAL A HG21 2 
ATOM 348  H HG22 . VAL A 1 9  ? -5.732  -8.943  -12.343 1.00 0.00 ? 9  VAL A HG22 2 
ATOM 349  H HG23 . VAL A 1 9  ? -6.053  -7.483  -13.309 1.00 0.00 ? 9  VAL A HG23 2 
ATOM 350  N N    . ALA A 1 10 ? -4.691  -4.887  -9.659  1.00 0.00 ? 10 ALA A N    2 
ATOM 351  C CA   . ALA A 1 10 ? -4.023  -4.137  -8.603  1.00 0.00 ? 10 ALA A CA   2 
ATOM 352  C C    . ALA A 1 10 ? -4.910  -4.037  -7.378  1.00 0.00 ? 10 ALA A C    2 
ATOM 353  O O    . ALA A 1 10 ? -4.466  -4.276  -6.258  1.00 0.00 ? 10 ALA A O    2 
ATOM 354  C CB   . ALA A 1 10 ? -3.697  -2.729  -9.077  1.00 0.00 ? 10 ALA A CB   2 
ATOM 355  H H    . ALA A 1 10 ? -4.811  -4.442  -10.557 1.00 0.00 ? 10 ALA A H    2 
ATOM 356  H HA   . ALA A 1 10 ? -3.099  -4.652  -8.339  1.00 0.00 ? 10 ALA A HA   2 
ATOM 357  H HB1  . ALA A 1 10 ? -3.184  -2.182  -8.285  1.00 0.00 ? 10 ALA A HB1  2 
ATOM 358  H HB2  . ALA A 1 10 ? -3.052  -2.782  -9.954  1.00 0.00 ? 10 ALA A HB2  2 
ATOM 359  H HB3  . ALA A 1 10 ? -4.620  -2.211  -9.335  1.00 0.00 ? 10 ALA A HB3  2 
ATOM 360  N N    . LEU A 1 11 ? -6.154  -3.686  -7.604  1.00 0.00 ? 11 LEU A N    2 
ATOM 361  C CA   . LEU A 1 11 ? -7.130  -3.547  -6.533  1.00 0.00 ? 11 LEU A CA   2 
ATOM 362  C C    . LEU A 1 11 ? -7.299  -4.855  -5.796  1.00 0.00 ? 11 LEU A C    2 
ATOM 363  O O    . LEU A 1 11 ? -7.247  -4.895  -4.569  1.00 0.00 ? 11 LEU A O    2 
ATOM 364  C CB   . LEU A 1 11 ? -8.490  -3.132  -7.098  1.00 0.00 ? 11 LEU A CB   2 
ATOM 365  C CG   . LEU A 1 11 ? -8.600  -1.696  -7.613  1.00 0.00 ? 11 LEU A CG   2 
ATOM 366  C CD1  . LEU A 1 11 ? -9.957  -1.459  -8.259  1.00 0.00 ? 11 LEU A CD1  2 
ATOM 367  C CD2  . LEU A 1 11 ? -8.436  -0.702  -6.474  1.00 0.00 ? 11 LEU A CD2  2 
ATOM 368  H H    . LEU A 1 11 ? -6.455  -3.504  -8.550  1.00 0.00 ? 11 LEU A H    2 
ATOM 369  H HA   . LEU A 1 11 ? -6.780  -2.783  -5.838  1.00 0.00 ? 11 LEU A HA   2 
ATOM 370  H HB2  . LEU A 1 11 ? -8.723  -3.801  -7.926  1.00 0.00 ? 11 LEU A HB2  2 
ATOM 371  H HB3  . LEU A 1 11 ? -9.230  -3.260  -6.308  1.00 0.00 ? 11 LEU A HB3  2 
ATOM 372  H HG   . LEU A 1 11 ? -7.816  -1.528  -8.351  1.00 0.00 ? 11 LEU A HG   2 
ATOM 373  H HD11 . LEU A 1 11 ? -10.018 -0.436  -8.630  1.00 0.00 ? 11 LEU A HD11 2 
ATOM 374  H HD12 . LEU A 1 11 ? -10.088 -2.153  -9.089  1.00 0.00 ? 11 LEU A HD12 2 
ATOM 375  H HD13 . LEU A 1 11 ? -10.742 -1.622  -7.521  1.00 0.00 ? 11 LEU A HD13 2 
ATOM 376  H HD21 . LEU A 1 11 ? -8.505  0.316   -6.856  1.00 0.00 ? 11 LEU A HD21 2 
ATOM 377  H HD22 . LEU A 1 11 ? -9.221  -0.864  -5.736  1.00 0.00 ? 11 LEU A HD22 2 
ATOM 378  H HD23 . LEU A 1 11 ? -7.462  -0.846  -6.005  1.00 0.00 ? 11 LEU A HD23 2 
ATOM 379  N N    . VAL A 1 12 ? -7.499  -5.908  -6.536  1.00 0.00 ? 12 VAL A N    2 
ATOM 380  C CA   . VAL A 1 12 ? -7.680  -7.234  -5.977  1.00 0.00 ? 12 VAL A CA   2 
ATOM 381  C C    . VAL A 1 12 ? -6.509  -7.606  -5.096  1.00 0.00 ? 12 VAL A C    2 
ATOM 382  O O    . VAL A 1 12 ? -6.685  -8.080  -3.976  1.00 0.00 ? 12 VAL A O    2 
ATOM 383  C CB   . VAL A 1 12 ? -7.796  -8.301  -7.081  1.00 0.00 ? 12 VAL A CB   2 
ATOM 384  C CG1  . VAL A 1 12 ? -7.777  -9.697  -6.477  1.00 0.00 ? 12 VAL A CG1  2 
ATOM 385  C CG2  . VAL A 1 12 ? -9.096  -8.129  -7.853  1.00 0.00 ? 12 VAL A CG2  2 
ATOM 386  H H    . VAL A 1 12 ? -7.531  -5.808  -7.540  1.00 0.00 ? 12 VAL A H    2 
ATOM 387  H HA   . VAL A 1 12 ? -8.593  -7.234  -5.382  1.00 0.00 ? 12 VAL A HA   2 
ATOM 388  H HB   . VAL A 1 12 ? -6.954  -8.194  -7.765  1.00 0.00 ? 12 VAL A HB   2 
ATOM 389  H HG11 . VAL A 1 12 ? -7.851  -10.443 -7.267  1.00 0.00 ? 12 VAL A HG11 2 
ATOM 390  H HG12 . VAL A 1 12 ? -6.845  -9.842  -5.929  1.00 0.00 ? 12 VAL A HG12 2 
ATOM 391  H HG13 . VAL A 1 12 ? -8.620  -9.808  -5.795  1.00 0.00 ? 12 VAL A HG13 2 
ATOM 392  H HG21 . VAL A 1 12 ? -9.163  -8.884  -8.636  1.00 0.00 ? 12 VAL A HG21 2 
ATOM 393  H HG22 . VAL A 1 12 ? -9.939  -8.240  -7.171  1.00 0.00 ? 12 VAL A HG22 2 
ATOM 394  H HG23 . VAL A 1 12 ? -9.121  -7.137  -8.303  1.00 0.00 ? 12 VAL A HG23 2 
ATOM 395  N N    . VAL A 1 13 ? -5.314  -7.385  -5.620  1.00 0.00 ? 13 VAL A N    2 
ATOM 396  C CA   . VAL A 1 13 ? -4.091  -7.688  -4.901  1.00 0.00 ? 13 VAL A CA   2 
ATOM 397  C C    . VAL A 1 13 ? -4.039  -6.933  -3.587  1.00 0.00 ? 13 VAL A C    2 
ATOM 398  O O    . VAL A 1 13 ? -3.886  -7.527  -2.522  1.00 0.00 ? 13 VAL A O    2 
ATOM 399  C CB   . VAL A 1 13 ? -2.845  -7.297  -5.717  1.00 0.00 ? 13 VAL A CB   2 
ATOM 400  C CG1  . VAL A 1 13 ? -1.586  -7.460  -4.879  1.00 0.00 ? 13 VAL A CG1  2 
ATOM 401  C CG2  . VAL A 1 13 ? -2.718  -8.178  -6.951  1.00 0.00 ? 13 VAL A CG2  2 
ATOM 402  H H    . VAL A 1 13 ? -5.239  -6.994  -6.548  1.00 0.00 ? 13 VAL A H    2 
ATOM 403  H HA   . VAL A 1 13 ? -4.066  -8.760  -4.702  1.00 0.00 ? 13 VAL A HA   2 
ATOM 404  H HB   . VAL A 1 13 ? -2.938  -6.256  -6.026  1.00 0.00 ? 13 VAL A HB   2 
ATOM 405  H HG11 . VAL A 1 13 ? -0.712  -7.172  -5.463  1.00 0.00 ? 13 VAL A HG11 2 
ATOM 406  H HG12 . VAL A 1 13 ? -1.654  -6.825  -3.995  1.00 0.00 ? 13 VAL A HG12 2 
ATOM 407  H HG13 . VAL A 1 13 ? -1.487  -8.501  -4.571  1.00 0.00 ? 13 VAL A HG13 2 
ATOM 408  H HG21 . VAL A 1 13 ? -1.838  -7.886  -7.524  1.00 0.00 ? 13 VAL A HG21 2 
ATOM 409  H HG22 . VAL A 1 13 ? -2.620  -9.220  -6.644  1.00 0.00 ? 13 VAL A HG22 2 
ATOM 410  H HG23 . VAL A 1 13 ? -3.607  -8.064  -7.570  1.00 0.00 ? 13 VAL A HG23 2 
ATOM 411  N N    . ALA A 1 14 ? -4.168  -5.625  -3.682  1.00 0.00 ? 14 ALA A N    2 
ATOM 412  C CA   . ALA A 1 14 ? -4.140  -4.758  -2.512  1.00 0.00 ? 14 ALA A CA   2 
ATOM 413  C C    . ALA A 1 14 ? -5.373  -4.963  -1.665  1.00 0.00 ? 14 ALA A C    2 
ATOM 414  O O    . ALA A 1 14 ? -5.285  -5.172  -0.457  1.00 0.00 ? 14 ALA A O    2 
ATOM 415  C CB   . ALA A 1 14 ? -4.087  -3.298  -2.935  1.00 0.00 ? 14 ALA A CB   2 
ATOM 416  H H    . ALA A 1 14 ? -4.289  -5.200  -4.589  1.00 0.00 ? 14 ALA A H    2 
ATOM 417  H HA   . ALA A 1 14 ? -3.254  -4.996  -1.923  1.00 0.00 ? 14 ALA A HA   2 
ATOM 418  H HB1  . ALA A 1 14 ? -4.049  -2.659  -2.053  1.00 0.00 ? 14 ALA A HB1  2 
ATOM 419  H HB2  . ALA A 1 14 ? -3.197  -3.129  -3.541  1.00 0.00 ? 14 ALA A HB2  2 
ATOM 420  H HB3  . ALA A 1 14 ? -4.975  -3.057  -3.518  1.00 0.00 ? 14 ALA A HB3  2 
ATOM 421  N N    . ILE A 1 15 ? -6.520  -4.898  -2.317  1.00 0.00 ? 15 ILE A N    2 
ATOM 422  C CA   . ILE A 1 15 ? -7.792  -5.072  -1.646  1.00 0.00 ? 15 ILE A CA   2 
ATOM 423  C C    . ILE A 1 15 ? -7.814  -6.367  -0.873  1.00 0.00 ? 15 ILE A C    2 
ATOM 424  O O    . ILE A 1 15 ? -8.254  -6.415  0.273   1.00 0.00 ? 15 ILE A O    2 
ATOM 425  C CB   . ILE A 1 15 ? -8.960  -5.103  -2.649  1.00 0.00 ? 15 ILE A CB   2 
ATOM 426  C CG1  . ILE A 1 15 ? -9.137  -3.731  -3.304  1.00 0.00 ? 15 ILE A CG1  2 
ATOM 427  C CG2  . ILE A 1 15 ? -10.257 -5.472  -1.946  1.00 0.00 ? 15 ILE A CG2  2 
ATOM 428  C CD1  . ILE A 1 15 ? -10.094 -3.733  -4.476  1.00 0.00 ? 15 ILE A CD1  2 
ATOM 429  H H    . ILE A 1 15 ? -6.522  -4.724  -3.311  1.00 0.00 ? 15 ILE A H    2 
ATOM 430  H HA   . ILE A 1 15 ? -7.933  -4.238  -0.958  1.00 0.00 ? 15 ILE A HA   2 
ATOM 431  H HB   . ILE A 1 15 ? -8.744  -5.844  -3.418  1.00 0.00 ? 15 ILE A HB   2 
ATOM 432  H HG12 . ILE A 1 15 ? -9.515  -3.038  -2.553  1.00 0.00 ? 15 ILE A HG12 2 
ATOM 433  H HG13 . ILE A 1 15 ? -8.163  -3.390  -3.656  1.00 0.00 ? 15 ILE A HG13 2 
ATOM 434  H HG21 . ILE A 1 15 ? -11.073 -5.501  -2.667  1.00 0.00 ? 15 ILE A HG21 2 
ATOM 435  H HG22 . ILE A 1 15 ? -10.150 -6.453  -1.481  1.00 0.00 ? 15 ILE A HG22 2 
ATOM 436  H HG23 . ILE A 1 15 ? -10.477 -4.729  -1.179  1.00 0.00 ? 15 ILE A HG23 2 
ATOM 437  H HD11 . ILE A 1 15 ? -10.181 -2.733  -4.900  1.00 0.00 ? 15 ILE A HD11 2 
ATOM 438  H HD12 . ILE A 1 15 ? -9.723  -4.415  -5.241  1.00 0.00 ? 15 ILE A HD12 2 
ATOM 439  H HD13 . ILE A 1 15 ? -11.075 -4.065  -4.138  1.00 0.00 ? 15 ILE A HD13 2 
ATOM 440  N N    . ILE A 1 16 ? -7.333  -7.414  -1.517  1.00 0.00 ? 16 ILE A N    2 
ATOM 441  C CA   . ILE A 1 16 ? -7.285  -8.729  -0.912  1.00 0.00 ? 16 ILE A CA   2 
ATOM 442  C C    . ILE A 1 16 ? -6.229  -8.781  0.171   1.00 0.00 ? 16 ILE A C    2 
ATOM 443  O O    . ILE A 1 16 ? -6.403  -9.438  1.194   1.00 0.00 ? 16 ILE A O    2 
ATOM 444  C CB   . ILE A 1 16 ? -6.949  -9.816  -1.950  1.00 0.00 ? 16 ILE A CB   2 
ATOM 445  C CG1  . ILE A 1 16 ? -8.089  -9.959  -2.961  1.00 0.00 ? 16 ILE A CG1  2 
ATOM 446  C CG2  . ILE A 1 16 ? -6.739  -11.158 -1.267  1.00 0.00 ? 16 ILE A CG2  2 
ATOM 447  C CD1  . ILE A 1 16 ? -7.743  -10.823 -4.153  1.00 0.00 ? 16 ILE A CD1  2 
ATOM 448  H H    . ILE A 1 16 ? -6.984  -7.307  -2.459  1.00 0.00 ? 16 ILE A H    2 
ATOM 449  H HA   . ILE A 1 16 ? -8.260  -8.942  -0.475  1.00 0.00 ? 16 ILE A HA   2 
ATOM 450  H HB   . ILE A 1 16 ? -6.036  -9.533  -2.474  1.00 0.00 ? 16 ILE A HB   2 
ATOM 451  H HG12 . ILE A 1 16 ? -8.945  -10.402 -2.453  1.00 0.00 ? 16 ILE A HG12 2 
ATOM 452  H HG13 . ILE A 1 16 ? -8.354  -8.966  -3.322  1.00 0.00 ? 16 ILE A HG13 2 
ATOM 453  H HG21 . ILE A 1 16 ? -6.492  -11.917 -2.009  1.00 0.00 ? 16 ILE A HG21 2 
ATOM 454  H HG22 . ILE A 1 16 ? -5.922  -11.075 -0.549  1.00 0.00 ? 16 ILE A HG22 2 
ATOM 455  H HG23 . ILE A 1 16 ? -7.652  -11.446 -0.746  1.00 0.00 ? 16 ILE A HG23 2 
ATOM 456  H HD11 . ILE A 1 16 ? -8.589  -10.890 -4.835  1.00 0.00 ? 16 ILE A HD11 2 
ATOM 457  H HD12 . ILE A 1 16 ? -6.893  -10.387 -4.679  1.00 0.00 ? 16 ILE A HD12 2 
ATOM 458  H HD13 . ILE A 1 16 ? -7.482  -11.824 -3.808  1.00 0.00 ? 16 ILE A HD13 2 
ATOM 459  N N    . ILE A 1 17 ? -5.140  -8.080  -0.072  1.00 0.00 ? 17 ILE A N    2 
ATOM 460  C CA   . ILE A 1 17 ? -4.035  -8.027  0.868   1.00 0.00 ? 17 ILE A CA   2 
ATOM 461  C C    . ILE A 1 17 ? -4.436  -7.294  2.132   1.00 0.00 ? 17 ILE A C    2 
ATOM 462  O O    . ILE A 1 17 ? -4.175  -7.757  3.240   1.00 0.00 ? 17 ILE A O    2 
ATOM 463  C CB   . ILE A 1 17 ? -2.819  -7.296  0.269   1.00 0.00 ? 17 ILE A CB   2 
ATOM 464  C CG1  . ILE A 1 17 ? -2.230  -8.103  -0.891  1.00 0.00 ? 17 ILE A CG1  2 
ATOM 465  C CG2  . ILE A 1 17 ? -1.738  -7.108  1.323   1.00 0.00 ? 17 ILE A CG2  2 
ATOM 466  C CD1  . ILE A 1 17 ? -1.192  -7.350  -1.693  1.00 0.00 ? 17 ILE A CD1  2 
ATOM 467  H H    . ILE A 1 17 ? -5.061  -7.560  -0.934  1.00 0.00 ? 17 ILE A H    2 
ATOM 468  H HA   . ILE A 1 17 ? -3.749  -9.049  1.119   1.00 0.00 ? 17 ILE A HA   2 
ATOM 469  H HB   . ILE A 1 17 ? -3.138  -6.320  -0.096  1.00 0.00 ? 17 ILE A HB   2 
ATOM 470  H HG12 . ILE A 1 17 ? -1.764  -9.001  -0.484  1.00 0.00 ? 17 ILE A HG12 2 
ATOM 471  H HG13 . ILE A 1 17 ? -3.042  -8.386  -1.560  1.00 0.00 ? 17 ILE A HG13 2 
ATOM 472  H HG21 . ILE A 1 17 ? -0.887  -6.581  0.891   1.00 0.00 ? 17 ILE A HG21 2 
ATOM 473  H HG22 . ILE A 1 17 ? -2.138  -6.526  2.153   1.00 0.00 ? 17 ILE A HG22 2 
ATOM 474  H HG23 . ILE A 1 17 ? -1.412  -8.083  1.687   1.00 0.00 ? 17 ILE A HG23 2 
ATOM 475  H HD11 . ILE A 1 17 ? -0.808  -7.972  -2.501  1.00 0.00 ? 17 ILE A HD11 2 
ATOM 476  H HD12 . ILE A 1 17 ? -1.645  -6.454  -2.116  1.00 0.00 ? 17 ILE A HD12 2 
ATOM 477  H HD13 . ILE A 1 17 ? -0.367  -7.067  -1.038  1.00 0.00 ? 17 ILE A HD13 2 
ATOM 478  N N    . ALA A 1 18 ? -5.063  -6.162  1.949   1.00 0.00 ? 18 ALA A N    2 
ATOM 479  C CA   . ALA A 1 18 ? -5.512  -5.341  3.061   1.00 0.00 ? 18 ALA A CA   2 
ATOM 480  C C    . ALA A 1 18 ? -6.599  -6.038  3.836   1.00 0.00 ? 18 ALA A C    2 
ATOM 481  O O    . ALA A 1 18 ? -6.485  -6.240  5.042   1.00 0.00 ? 18 ALA A O    2 
ATOM 482  C CB   . ALA A 1 18 ? -6.061  -4.016  2.554   1.00 0.00 ? 18 ALA A CB   2 
ATOM 483  H H    . ALA A 1 18 ? -5.245  -5.838  1.011   1.00 0.00 ? 18 ALA A H    2 
ATOM 484  H HA   . ALA A 1 18 ? -4.664  -5.152  3.720   1.00 0.00 ? 18 ALA A HA   2 
ATOM 485  H HB1  . ALA A 1 18 ? -6.379  -3.401  3.396   1.00 0.00 ? 18 ALA A HB1  2 
ATOM 486  H HB2  . ALA A 1 18 ? -5.284  -3.492  1.998   1.00 0.00 ? 18 ALA A HB2  2 
ATOM 487  H HB3  . ALA A 1 18 ? -6.913  -4.203  1.901   1.00 0.00 ? 18 ALA A HB3  2 
ATOM 488  N N    . ILE A 1 19 ? -7.647  -6.399  3.132   1.00 0.00 ? 19 ILE A N    2 
ATOM 489  C CA   . ILE A 1 19 ? -8.773  -7.077  3.731   1.00 0.00 ? 19 ILE A CA   2 
ATOM 490  C C    . ILE A 1 19 ? -8.317  -8.276  4.517   1.00 0.00 ? 19 ILE A C    2 
ATOM 491  O O    . ILE A 1 19 ? -8.714  -8.474  5.663   1.00 0.00 ? 19 ILE A O    2 
ATOM 492  C CB   . ILE A 1 19 ? -9.770  -7.566  2.664   1.00 0.00 ? 19 ILE A CB   2 
ATOM 493  C CG1  . ILE A 1 19 ? -10.441 -6.376  1.975   1.00 0.00 ? 19 ILE A CG1  2 
ATOM 494  C CG2  . ILE A 1 19 ? -10.851 -8.427  3.300   1.00 0.00 ? 19 ILE A CG2  2 
ATOM 495  C CD1  . ILE A 1 19 ? -11.247 -6.753  0.752   1.00 0.00 ? 19 ILE A CD1  2 
ATOM 496  H H    . ILE A 1 19 ? -7.677  -6.203  2.142   1.00 0.00 ? 19 ILE A H    2 
ATOM 497  H HA   . ILE A 1 19 ? -9.278  -6.379  4.399   1.00 0.00 ? 19 ILE A HA   2 
ATOM 498  H HB   . ILE A 1 19 ? -9.231  -8.155  1.922   1.00 0.00 ? 19 ILE A HB   2 
ATOM 499  H HG12 . ILE A 1 19 ? -11.107 -5.896  2.691   1.00 0.00 ? 19 ILE A HG12 2 
ATOM 500  H HG13 . ILE A 1 19 ? -9.665  -5.673  1.672   1.00 0.00 ? 19 ILE A HG13 2 
ATOM 501  H HG21 . ILE A 1 19 ? -11.544 -8.776  2.535   1.00 0.00 ? 19 ILE A HG21 2 
ATOM 502  H HG22 . ILE A 1 19 ? -10.389 -9.286  3.788   1.00 0.00 ? 19 ILE A HG22 2 
ATOM 503  H HG23 . ILE A 1 19 ? -11.394 -7.839  4.040   1.00 0.00 ? 19 ILE A HG23 2 
ATOM 504  H HD11 . ILE A 1 19 ? -11.701 -5.869  0.306   1.00 0.00 ? 19 ILE A HD11 2 
ATOM 505  H HD12 . ILE A 1 19 ? -10.591 -7.226  0.021   1.00 0.00 ? 19 ILE A HD12 2 
ATOM 506  H HD13 . ILE A 1 19 ? -12.033 -7.451  1.041   1.00 0.00 ? 19 ILE A HD13 2 
ATOM 507  N N    . VAL A 1 20 ? -7.480  -9.069  3.884   1.00 0.00 ? 20 VAL A N    2 
ATOM 508  C CA   . VAL A 1 20 ? -6.950  -10.261 4.501   1.00 0.00 ? 20 VAL A CA   2 
ATOM 509  C C    . VAL A 1 20 ? -6.124  -9.915  5.718   1.00 0.00 ? 20 VAL A C    2 
ATOM 510  O O    . VAL A 1 20 ? -6.269  -10.522 6.776   1.00 0.00 ? 20 VAL A O    2 
ATOM 511  C CB   . VAL A 1 20 ? -6.048  -11.046 3.530   1.00 0.00 ? 20 VAL A CB   2 
ATOM 512  C CG1  . VAL A 1 20 ? -5.340  -12.178 4.258   1.00 0.00 ? 20 VAL A CG1  2 
ATOM 513  C CG2  . VAL A 1 20 ? -6.874  -11.643 2.401   1.00 0.00 ? 20 VAL A CG2  2 
ATOM 514  H H    . VAL A 1 20 ? -7.193  -8.848  2.942   1.00 0.00 ? 20 VAL A H    2 
ATOM 515  H HA   . VAL A 1 20 ? -7.786  -10.892 4.801   1.00 0.00 ? 20 VAL A HA   2 
ATOM 516  H HB   . VAL A 1 20 ? -5.305  -10.367 3.112   1.00 0.00 ? 20 VAL A HB   2 
ATOM 517  H HG11 . VAL A 1 20 ? -4.698  -12.721 3.564   1.00 0.00 ? 20 VAL A HG11 2 
ATOM 518  H HG12 . VAL A 1 20 ? -4.732  -11.767 5.065   1.00 0.00 ? 20 VAL A HG12 2 
ATOM 519  H HG13 . VAL A 1 20 ? -6.081  -12.861 4.674   1.00 0.00 ? 20 VAL A HG13 2 
ATOM 520  H HG21 . VAL A 1 20 ? -6.224  -12.188 1.717   1.00 0.00 ? 20 VAL A HG21 2 
ATOM 521  H HG22 . VAL A 1 20 ? -7.615  -12.326 2.817   1.00 0.00 ? 20 VAL A HG22 2 
ATOM 522  H HG23 . VAL A 1 20 ? -7.379  -10.843 1.860   1.00 0.00 ? 20 VAL A HG23 2 
ATOM 523  N N    . VAL A 1 21 ? -5.265  -8.940  5.549   1.00 0.00 ? 21 VAL A N    2 
ATOM 524  C CA   . VAL A 1 21 ? -4.400  -8.490  6.620   1.00 0.00 ? 21 VAL A CA   2 
ATOM 525  C C    . VAL A 1 21 ? -5.196  -7.861  7.734   1.00 0.00 ? 21 VAL A C    2 
ATOM 526  O O    . VAL A 1 21 ? -5.116  -8.278  8.887   1.00 0.00 ? 21 VAL A O    2 
ATOM 527  C CB   . VAL A 1 21 ? -3.386  -7.442  6.124   1.00 0.00 ? 21 VAL A CB   2 
ATOM 528  C CG1  . VAL A 1 21 ? -2.590  -6.877  7.291   1.00 0.00 ? 21 VAL A CG1  2 
ATOM 529  C CG2  . VAL A 1 21 ? -2.414  -8.067  5.136   1.00 0.00 ? 21 VAL A CG2  2 
ATOM 530  H H    . VAL A 1 21 ? -5.195  -8.483  4.652   1.00 0.00 ? 21 VAL A H    2 
ATOM 531  H HA   . VAL A 1 21 ? -3.860  -9.354  7.008   1.00 0.00 ? 21 VAL A HA   2 
ATOM 532  H HB   . VAL A 1 21 ? -3.927  -6.633  5.633   1.00 0.00 ? 21 VAL A HB   2 
ATOM 533  H HG11 . VAL A 1 21 ? -1.882  -6.131  6.930   1.00 0.00 ? 21 VAL A HG11 2 
ATOM 534  H HG12 . VAL A 1 21 ? -3.271  -6.413  8.004   1.00 0.00 ? 21 VAL A HG12 2 
ATOM 535  H HG13 . VAL A 1 21 ? -2.044  -7.683  7.782   1.00 0.00 ? 21 VAL A HG13 2 
ATOM 536  H HG21 . VAL A 1 21 ? -1.707  -7.314  4.786   1.00 0.00 ? 21 VAL A HG21 2 
ATOM 537  H HG22 . VAL A 1 21 ? -1.868  -8.874  5.626   1.00 0.00 ? 21 VAL A HG22 2 
ATOM 538  H HG23 . VAL A 1 21 ? -2.967  -8.466  4.287   1.00 0.00 ? 21 VAL A HG23 2 
ATOM 539  N N    . TRP A 1 22 ? -5.956  -6.864  7.369   1.00 0.00 ? 22 TRP A N    2 
ATOM 540  C CA   . TRP A 1 22 ? -6.781  -6.157  8.319   1.00 0.00 ? 22 TRP A CA   2 
ATOM 541  C C    . TRP A 1 22 ? -7.634  -7.108  9.102   1.00 0.00 ? 22 TRP A C    2 
ATOM 542  O O    . TRP A 1 22 ? -7.923  -6.889  10.276  1.00 0.00 ? 22 TRP A O    2 
ATOM 543  C CB   . TRP A 1 22 ? -7.703  -5.172  7.599   1.00 0.00 ? 22 TRP A CB   2 
ATOM 544  C CG   . TRP A 1 22 ? -8.576  -4.381  8.524   1.00 0.00 ? 22 TRP A CG   2 
ATOM 545  C CD1  . TRP A 1 22 ? -8.248  -3.227  9.175   1.00 0.00 ? 22 TRP A CD1  2 
ATOM 546  C CD2  . TRP A 1 22 ? -9.924  -4.687  8.903   1.00 0.00 ? 22 TRP A CD2  2 
ATOM 547  N NE1  . TRP A 1 22 ? -9.306  -2.793  9.936   1.00 0.00 ? 22 TRP A NE1  2 
ATOM 548  C CE2  . TRP A 1 22 ? -10.349 -3.674  9.786   1.00 0.00 ? 22 TRP A CE2  2 
ATOM 549  C CE3  . TRP A 1 22 ? -10.813 -5.717  8.583   1.00 0.00 ? 22 TRP A CE3  2 
ATOM 550  C CZ2  . TRP A 1 22 ? -11.623 -3.661  10.351  1.00 0.00 ? 22 TRP A CZ2  2 
ATOM 551  C CZ3  . TRP A 1 22 ? -12.075 -5.701  9.146   1.00 0.00 ? 22 TRP A CZ3  2 
ATOM 552  C CH2  . TRP A 1 22 ? -12.471 -4.682  10.020  1.00 0.00 ? 22 TRP A CH2  2 
ATOM 553  H H    . TRP A 1 22 ? -5.976  -6.573  6.403   1.00 0.00 ? 22 TRP A H    2 
ATOM 554  H HA   . TRP A 1 22 ? -6.131  -5.610  9.003   1.00 0.00 ? 22 TRP A HA   2 
ATOM 555  H HB2  . TRP A 1 22 ? -7.090  -4.480  7.022   1.00 0.00 ? 22 TRP A HB2  2 
ATOM 556  H HB3  . TRP A 1 22 ? -8.338  -5.729  6.911   1.00 0.00 ? 22 TRP A HB3  2 
ATOM 557  H HD1  . TRP A 1 22 ? -7.293  -2.727  9.103   1.00 0.00 ? 22 TRP A HD1  2 
ATOM 558  H HE1  . TRP A 1 22 ? -9.289  -1.958  10.504  1.00 0.00 ? 22 TRP A HE1  2 
ATOM 559  H HE3  . TRP A 1 22 ? -10.519 -6.509  7.910   1.00 0.00 ? 22 TRP A HE3  2 
ATOM 560  H HZ2  . TRP A 1 22 ? -11.929 -2.875  11.025  1.00 0.00 ? 22 TRP A HZ2  2 
ATOM 561  H HZ3  . TRP A 1 22 ? -12.770 -6.492  8.907   1.00 0.00 ? 22 TRP A HZ3  2 
ATOM 562  H HH2  . TRP A 1 22 ? -13.465 -4.702  10.442  1.00 0.00 ? 22 TRP A HH2  2 
ATOM 563  N N    . SER A 1 23 ? -8.030  -8.164  8.435   1.00 0.00 ? 23 SER A N    2 
ATOM 564  C CA   . SER A 1 23 ? -8.855  -9.169  9.045   1.00 0.00 ? 23 SER A CA   2 
ATOM 565  C C    . SER A 1 23 ? -8.085  -9.936  10.085  1.00 0.00 ? 23 SER A C    2 
ATOM 566  O O    . SER A 1 23 ? -8.586  -10.214 11.172  1.00 0.00 ? 23 SER A O    2 
ATOM 567  C CB   . SER A 1 23 ? -9.357  -10.160 7.994   1.00 0.00 ? 23 SER A CB   2 
ATOM 568  O OG   . SER A 1 23 ? -10.164 -11.165 8.584   1.00 0.00 ? 23 SER A OG   2 
ATOM 569  H H    . SER A 1 23 ? -7.754  -8.285  7.471   1.00 0.00 ? 23 SER A H    2 
ATOM 570  H HA   . SER A 1 23 ? -9.708  -8.680  9.516   1.00 0.00 ? 23 SER A HA   2 
ATOM 571  H HB2  . SER A 1 23 ? -9.945  -9.623  7.251   1.00 0.00 ? 23 SER A HB2  2 
ATOM 572  H HB3  . SER A 1 23 ? -8.501  -10.630 7.511   1.00 0.00 ? 23 SER A HB3  2 
ATOM 573  H HG   . SER A 1 23 ? -10.461 -11.768 7.899   1.00 0.00 ? 23 SER A HG   2 
ATOM 574  N N    . ILE A 1 24 ? -6.872  -10.268 9.736   1.00 0.00 ? 24 ILE A N    2 
ATOM 575  C CA   . ILE A 1 24 ? -6.006  -11.005 10.623  1.00 0.00 ? 24 ILE A CA   2 
ATOM 576  C C    . ILE A 1 24 ? -5.871  -10.314 11.961  1.00 0.00 ? 24 ILE A C    2 
ATOM 577  O O    . ILE A 1 24 ? -5.975  -10.942 13.012  1.00 0.00 ? 24 ILE A O    2 
ATOM 578  C CB   . ILE A 1 24 ? -4.590  -11.153 10.035  1.00 0.00 ? 24 ILE A CB   2 
ATOM 579  C CG1  . ILE A 1 24 ? -4.619  -12.050 8.796   1.00 0.00 ? 24 ILE A CG1  2 
ATOM 580  C CG2  . ILE A 1 24 ? -3.651  -11.775 11.058  1.00 0.00 ? 24 ILE A CG2  2 
ATOM 581  C CD1  . ILE A 1 24 ? -3.323  -12.052 8.014   1.00 0.00 ? 24 ILE A CD1  2 
ATOM 582  H H    . ILE A 1 24 ? -6.520  -10.007 8.826   1.00 0.00 ? 24 ILE A H    2 
ATOM 583  H HA   . ILE A 1 24 ? -6.436  -11.995 10.773  1.00 0.00 ? 24 ILE A HA   2 
ATOM 584  H HB   . ILE A 1 24 ? -4.218  -10.167 9.758   1.00 0.00 ? 24 ILE A HB   2 
ATOM 585  H HG12 . ILE A 1 24 ? -4.829  -13.071 9.115   1.00 0.00 ? 24 ILE A HG12 2 
ATOM 586  H HG13 . ILE A 1 24 ? -5.416  -11.703 8.139   1.00 0.00 ? 24 ILE A HG13 2 
ATOM 587  H HG21 . ILE A 1 24 ? -2.650  -11.866 10.635  1.00 0.00 ? 24 ILE A HG21 2 
ATOM 588  H HG22 . ILE A 1 24 ? -3.611  -11.143 11.945  1.00 0.00 ? 24 ILE A HG22 2 
ATOM 589  H HG23 . ILE A 1 24 ? -4.018  -12.764 11.333  1.00 0.00 ? 24 ILE A HG23 2 
ATOM 590  H HD11 . ILE A 1 24 ? -3.401  -12.707 7.147   1.00 0.00 ? 24 ILE A HD11 2 
ATOM 591  H HD12 . ILE A 1 24 ? -3.103  -11.039 7.678   1.00 0.00 ? 24 ILE A HD12 2 
ATOM 592  H HD13 . ILE A 1 24 ? -2.515  -12.405 8.656   1.00 0.00 ? 24 ILE A HD13 2 
ATOM 593  N N    . VAL A 1 25 ? -5.643  -9.041  11.904  1.00 0.00 ? 25 VAL A N    2 
ATOM 594  C CA   . VAL A 1 25 ? -5.488  -8.238  13.101  1.00 0.00 ? 25 VAL A CA   2 
ATOM 595  C C    . VAL A 1 25 ? -5.232  -6.787  12.719  1.00 0.00 ? 25 VAL A C    2 
ATOM 596  O O    . VAL A 1 25 ? -5.182  -6.454  11.537  1.00 0.00 ? 25 VAL A O    2 
ATOM 597  C CB   . VAL A 1 25 ? -4.336  -8.788  13.937  1.00 0.00 ? 25 VAL A CB   2 
ATOM 598  C CG1  . VAL A 1 25 ? -4.184  -7.955  15.207  1.00 0.00 ? 25 VAL A CG1  2 
ATOM 599  C CG2  . VAL A 1 25 ? -4.627  -10.239 14.312  1.00 0.00 ? 25 VAL A CG2  2 
ATOM 600  H H    . VAL A 1 25 ? -5.569  -8.584  11.007  1.00 0.00 ? 25 VAL A H    2 
ATOM 601  H HA   . VAL A 1 25 ? -6.407  -8.294  13.685  1.00 0.00 ? 25 VAL A HA   2 
ATOM 602  H HB   . VAL A 1 25 ? -3.412  -8.741  13.359  1.00 0.00 ? 25 VAL A HB   2 
ATOM 603  H HG11 . VAL A 1 25 ? -3.361  -8.348  15.803  1.00 0.00 ? 25 VAL A HG11 2 
ATOM 604  H HG12 . VAL A 1 25 ? -3.976  -6.919  14.939  1.00 0.00 ? 25 VAL A HG12 2 
ATOM 605  H HG13 . VAL A 1 25 ? -5.107  -8.003  15.785  1.00 0.00 ? 25 VAL A HG13 2 
ATOM 606  H HG21 . VAL A 1 25 ? -3.805  -10.632 14.909  1.00 0.00 ? 25 VAL A HG21 2 
ATOM 607  H HG22 . VAL A 1 25 ? -5.550  -10.286 14.890  1.00 0.00 ? 25 VAL A HG22 2 
ATOM 608  H HG23 . VAL A 1 25 ? -4.736  -10.834 13.406  1.00 0.00 ? 25 VAL A HG23 2 
ATOM 609  N N    . ALA A 1 7  ? -5.640  -12.057 -11.714 1.00 0.00 ? 7  ALA A N    3 
ATOM 610  C CA   . ALA A 1 7  ? -4.927  -13.051 -12.491 1.00 0.00 ? 7  ALA A CA   3 
ATOM 611  C C    . ALA A 1 7  ? -3.979  -13.819 -11.585 1.00 0.00 ? 7  ALA A C    3 
ATOM 612  O O    . ALA A 1 7  ? -3.904  -13.560 -10.386 1.00 0.00 ? 7  ALA A O    3 
ATOM 613  C CB   . ALA A 1 7  ? -4.162  -12.364 -13.618 1.00 0.00 ? 7  ALA A CB   3 
ATOM 614  H H    . ALA A 1 7  ? -5.443  -11.986 -10.726 1.00 0.00 ? 7  ALA A H    3 
ATOM 615  H HA   . ALA A 1 7  ? -5.645  -13.747 -12.923 1.00 0.00 ? 7  ALA A HA   3 
ATOM 616  H HB1  . ALA A 1 7  ? -3.636  -13.114 -14.210 1.00 0.00 ? 7  ALA A HB1  3 
ATOM 617  H HB2  . ALA A 1 7  ? -4.862  -11.824 -14.256 1.00 0.00 ? 7  ALA A HB2  3 
ATOM 618  H HB3  . ALA A 1 7  ? -3.441  -11.664 -13.195 1.00 0.00 ? 7  ALA A HB3  3 
ATOM 619  N N    . ILE A 1 8  ? -3.260  -14.768 -12.178 1.00 0.00 ? 8  ILE A N    3 
ATOM 620  C CA   . ILE A 1 8  ? -2.305  -15.593 -11.446 1.00 0.00 ? 8  ILE A CA   3 
ATOM 621  C C    . ILE A 1 8  ? -1.339  -14.723 -10.661 1.00 0.00 ? 8  ILE A C    3 
ATOM 622  O O    . ILE A 1 8  ? -1.007  -15.022 -9.517  1.00 0.00 ? 8  ILE A O    3 
ATOM 623  C CB   . ILE A 1 8  ? -1.478  -16.477 -12.397 1.00 0.00 ? 8  ILE A CB   3 
ATOM 624  C CG1  . ILE A 1 8  ? -2.368  -17.535 -13.052 1.00 0.00 ? 8  ILE A CG1  3 
ATOM 625  C CG2  . ILE A 1 8  ? -0.368  -17.186 -11.636 1.00 0.00 ? 8  ILE A CG2  3 
ATOM 626  C CD1  . ILE A 1 8  ? -1.696  -18.286 -14.180 1.00 0.00 ? 8  ILE A CD1  3 
ATOM 627  H H    . ILE A 1 8  ? -3.370  -14.931 -13.168 1.00 0.00 ? 8  ILE A H    3 
ATOM 628  H HA   . ILE A 1 8  ? -2.858  -16.231 -10.756 1.00 0.00 ? 8  ILE A HA   3 
ATOM 629  H HB   . ILE A 1 8  ? -1.038  -15.847 -13.170 1.00 0.00 ? 8  ILE A HB   3 
ATOM 630  H HG12 . ILE A 1 8  ? -2.664  -18.255 -12.289 1.00 0.00 ? 8  ILE A HG12 3 
ATOM 631  H HG13 . ILE A 1 8  ? -3.254  -17.041 -13.449 1.00 0.00 ? 8  ILE A HG13 3 
ATOM 632  H HG21 . ILE A 1 8  ? 0.217   -17.800 -12.321 1.00 0.00 ? 8  ILE A HG21 3 
ATOM 633  H HG22 . ILE A 1 8  ? 0.283   -16.445 -11.170 1.00 0.00 ? 8  ILE A HG22 3 
ATOM 634  H HG23 . ILE A 1 8  ? -0.805  -17.821 -10.865 1.00 0.00 ? 8  ILE A HG23 3 
ATOM 635  H HD11 . ILE A 1 8  ? -2.375  -19.025 -14.606 1.00 0.00 ? 8  ILE A HD11 3 
ATOM 636  H HD12 . ILE A 1 8  ? -1.402  -17.581 -14.957 1.00 0.00 ? 8  ILE A HD12 3 
ATOM 637  H HD13 . ILE A 1 8  ? -0.810  -18.794 -13.797 1.00 0.00 ? 8  ILE A HD13 3 
ATOM 638  N N    . VAL A 1 9  ? -0.897  -13.642 -11.295 1.00 0.00 ? 9  VAL A N    3 
ATOM 639  C CA   . VAL A 1 9  ? 0.035   -12.704 -10.679 1.00 0.00 ? 9  VAL A CA   3 
ATOM 640  C C    . VAL A 1 9  ? -0.603  -12.034 -9.477  1.00 0.00 ? 9  VAL A C    3 
ATOM 641  O O    . VAL A 1 9  ? 0.009   -11.926 -8.417  1.00 0.00 ? 9  VAL A O    3 
ATOM 642  C CB   . VAL A 1 9  ? 0.460   -11.601 -11.666 1.00 0.00 ? 9  VAL A CB   3 
ATOM 643  C CG1  . VAL A 1 9  ? 1.262   -10.525 -10.949 1.00 0.00 ? 9  VAL A CG1  3 
ATOM 644  C CG2  . VAL A 1 9  ? 1.322   -12.183 -12.776 1.00 0.00 ? 9  VAL A CG2  3 
ATOM 645  H H    . VAL A 1 9  ? -1.210  -13.454 -12.236 1.00 0.00 ? 9  VAL A H    3 
ATOM 646  H HA   . VAL A 1 9  ? 0.919   -13.257 -10.358 1.00 0.00 ? 9  VAL A HA   3 
ATOM 647  H HB   . VAL A 1 9  ? -0.433  -11.154 -12.101 1.00 0.00 ? 9  VAL A HB   3 
ATOM 648  H HG11 . VAL A 1 9  ? 1.550   -9.746  -11.655 1.00 0.00 ? 9  VAL A HG11 3 
ATOM 649  H HG12 . VAL A 1 9  ? 0.655   -10.088 -10.156 1.00 0.00 ? 9  VAL A HG12 3 
ATOM 650  H HG13 . VAL A 1 9  ? 2.159   -10.969 -10.516 1.00 0.00 ? 9  VAL A HG13 3 
ATOM 651  H HG21 . VAL A 1 9  ? 1.610   -11.395 -13.472 1.00 0.00 ? 9  VAL A HG21 3 
ATOM 652  H HG22 . VAL A 1 9  ? 2.219   -12.628 -12.343 1.00 0.00 ? 9  VAL A HG22 3 
ATOM 653  H HG23 . VAL A 1 9  ? 0.758   -12.949 -13.309 1.00 0.00 ? 9  VAL A HG23 3 
ATOM 654  N N    . ALA A 1 10 ? -1.838  -11.586 -9.659  1.00 0.00 ? 10 ALA A N    3 
ATOM 655  C CA   . ALA A 1 10 ? -2.588  -10.918 -8.603  1.00 0.00 ? 10 ALA A CA   3 
ATOM 656  C C    . ALA A 1 10 ? -2.688  -11.805 -7.378  1.00 0.00 ? 10 ALA A C    3 
ATOM 657  O O    . ALA A 1 10 ? -2.449  -11.361 -6.258  1.00 0.00 ? 10 ALA A O    3 
ATOM 658  C CB   . ALA A 1 10 ? -3.996  -10.592 -9.077  1.00 0.00 ? 10 ALA A CB   3 
ATOM 659  H H    . ALA A 1 10 ? -2.283  -11.706 -10.557 1.00 0.00 ? 10 ALA A H    3 
ATOM 660  H HA   . ALA A 1 10 ? -2.073  -9.994  -8.339  1.00 0.00 ? 10 ALA A HA   3 
ATOM 661  H HB1  . ALA A 1 10 ? -4.543  -10.080 -8.285  1.00 0.00 ? 10 ALA A HB1  3 
ATOM 662  H HB2  . ALA A 1 10 ? -3.942  -9.948  -9.954  1.00 0.00 ? 10 ALA A HB2  3 
ATOM 663  H HB3  . ALA A 1 10 ? -4.514  -11.516 -9.335  1.00 0.00 ? 10 ALA A HB3  3 
ATOM 664  N N    . LEU A 1 11 ? -3.039  -13.049 -7.604  1.00 0.00 ? 11 LEU A N    3 
ATOM 665  C CA   . LEU A 1 11 ? -3.178  -14.025 -6.533  1.00 0.00 ? 11 LEU A CA   3 
ATOM 666  C C    . LEU A 1 11 ? -1.870  -14.194 -5.796  1.00 0.00 ? 11 LEU A C    3 
ATOM 667  O O    . LEU A 1 11 ? -1.830  -14.142 -4.569  1.00 0.00 ? 11 LEU A O    3 
ATOM 668  C CB   . LEU A 1 11 ? -3.593  -15.385 -7.098  1.00 0.00 ? 11 LEU A CB   3 
ATOM 669  C CG   . LEU A 1 11 ? -5.029  -15.495 -7.613  1.00 0.00 ? 11 LEU A CG   3 
ATOM 670  C CD1  . LEU A 1 11 ? -5.266  -16.852 -8.259  1.00 0.00 ? 11 LEU A CD1  3 
ATOM 671  C CD2  . LEU A 1 11 ? -6.023  -15.331 -6.474  1.00 0.00 ? 11 LEU A CD2  3 
ATOM 672  H H    . LEU A 1 11 ? -3.221  -13.351 -8.550  1.00 0.00 ? 11 LEU A H    3 
ATOM 673  H HA   . LEU A 1 11 ? -3.941  -13.675 -5.838  1.00 0.00 ? 11 LEU A HA   3 
ATOM 674  H HB2  . LEU A 1 11 ? -2.924  -15.619 -7.926  1.00 0.00 ? 11 LEU A HB2  3 
ATOM 675  H HB3  . LEU A 1 11 ? -3.465  -16.126 -6.308  1.00 0.00 ? 11 LEU A HB3  3 
ATOM 676  H HG   . LEU A 1 11 ? -5.197  -14.711 -8.351  1.00 0.00 ? 11 LEU A HG   3 
ATOM 677  H HD11 . LEU A 1 11 ? -6.288  -16.914 -8.630  1.00 0.00 ? 11 LEU A HD11 3 
ATOM 678  H HD12 . LEU A 1 11 ? -4.572  -16.984 -9.089  1.00 0.00 ? 11 LEU A HD12 3 
ATOM 679  H HD13 . LEU A 1 11 ? -5.102  -17.638 -7.521  1.00 0.00 ? 11 LEU A HD13 3 
ATOM 680  H HD21 . LEU A 1 11 ? -7.041  -15.400 -6.856  1.00 0.00 ? 11 LEU A HD21 3 
ATOM 681  H HD22 . LEU A 1 11 ? -5.860  -16.117 -5.736  1.00 0.00 ? 11 LEU A HD22 3 
ATOM 682  H HD23 . LEU A 1 11 ? -5.879  -14.357 -6.005  1.00 0.00 ? 11 LEU A HD23 3 
ATOM 683  N N    . VAL A 1 12 ? -0.817  -14.394 -6.536  1.00 0.00 ? 12 VAL A N    3 
ATOM 684  C CA   . VAL A 1 12 ? 0.509   -14.575 -5.977  1.00 0.00 ? 12 VAL A CA   3 
ATOM 685  C C    . VAL A 1 12 ? 0.881   -13.404 -5.096  1.00 0.00 ? 12 VAL A C    3 
ATOM 686  O O    . VAL A 1 12 ? 1.355   -13.580 -3.976  1.00 0.00 ? 12 VAL A O    3 
ATOM 687  C CB   . VAL A 1 12 ? 1.576   -14.691 -7.081  1.00 0.00 ? 12 VAL A CB   3 
ATOM 688  C CG1  . VAL A 1 12 ? 2.972   -14.672 -6.477  1.00 0.00 ? 12 VAL A CG1  3 
ATOM 689  C CG2  . VAL A 1 12 ? 1.404   -15.991 -7.853  1.00 0.00 ? 12 VAL A CG2  3 
ATOM 690  H H    . VAL A 1 12 ? -0.916  -14.426 -7.540  1.00 0.00 ? 12 VAL A H    3 
ATOM 691  H HA   . VAL A 1 12 ? 0.510   -15.489 -5.382  1.00 0.00 ? 12 VAL A HA   3 
ATOM 692  H HB   . VAL A 1 12 ? 1.469   -13.849 -7.765  1.00 0.00 ? 12 VAL A HB   3 
ATOM 693  H HG11 . VAL A 1 12 ? 3.719   -14.746 -7.267  1.00 0.00 ? 12 VAL A HG11 3 
ATOM 694  H HG12 . VAL A 1 12 ? 3.118   -13.741 -5.929  1.00 0.00 ? 12 VAL A HG12 3 
ATOM 695  H HG13 . VAL A 1 12 ? 3.084   -15.515 -5.795  1.00 0.00 ? 12 VAL A HG13 3 
ATOM 696  H HG21 . VAL A 1 12 ? 2.159   -16.058 -8.636  1.00 0.00 ? 12 VAL A HG21 3 
ATOM 697  H HG22 . VAL A 1 12 ? 1.515   -16.835 -7.171  1.00 0.00 ? 12 VAL A HG22 3 
ATOM 698  H HG23 . VAL A 1 12 ? 0.412   -16.016 -8.303  1.00 0.00 ? 12 VAL A HG23 3 
ATOM 699  N N    . VAL A 1 13 ? 0.660   -12.209 -5.620  1.00 0.00 ? 13 VAL A N    3 
ATOM 700  C CA   . VAL A 1 13 ? 0.963   -10.986 -4.901  1.00 0.00 ? 13 VAL A CA   3 
ATOM 701  C C    . VAL A 1 13 ? 0.208   -10.934 -3.587  1.00 0.00 ? 13 VAL A C    3 
ATOM 702  O O    . VAL A 1 13 ? 0.802   -10.781 -2.522  1.00 0.00 ? 13 VAL A O    3 
ATOM 703  C CB   . VAL A 1 13 ? 0.572   -9.740  -5.717  1.00 0.00 ? 13 VAL A CB   3 
ATOM 704  C CG1  . VAL A 1 13 ? 0.735   -8.481  -4.879  1.00 0.00 ? 13 VAL A CG1  3 
ATOM 705  C CG2  . VAL A 1 13 ? 1.453   -9.613  -6.951  1.00 0.00 ? 13 VAL A CG2  3 
ATOM 706  H H    . VAL A 1 13 ? 0.269   -12.135 -6.548  1.00 0.00 ? 13 VAL A H    3 
ATOM 707  H HA   . VAL A 1 13 ? 2.035   -10.962 -4.702  1.00 0.00 ? 13 VAL A HA   3 
ATOM 708  H HB   . VAL A 1 13 ? -0.469  -9.834  -6.026  1.00 0.00 ? 13 VAL A HB   3 
ATOM 709  H HG11 . VAL A 1 13 ? 0.448   -7.608  -5.463  1.00 0.00 ? 13 VAL A HG11 3 
ATOM 710  H HG12 . VAL A 1 13 ? 0.101   -8.549  -3.995  1.00 0.00 ? 13 VAL A HG12 3 
ATOM 711  H HG13 . VAL A 1 13 ? 1.777   -8.383  -4.571  1.00 0.00 ? 13 VAL A HG13 3 
ATOM 712  H HG21 . VAL A 1 13 ? 1.162   -8.733  -7.524  1.00 0.00 ? 13 VAL A HG21 3 
ATOM 713  H HG22 . VAL A 1 13 ? 2.495   -9.515  -6.644  1.00 0.00 ? 13 VAL A HG22 3 
ATOM 714  H HG23 . VAL A 1 13 ? 1.339   -10.503 -7.570  1.00 0.00 ? 13 VAL A HG23 3 
ATOM 715  N N    . ALA A 1 14 ? -1.100  -11.063 -3.682  1.00 0.00 ? 14 ALA A N    3 
ATOM 716  C CA   . ALA A 1 14 ? -1.967  -11.035 -2.512  1.00 0.00 ? 14 ALA A CA   3 
ATOM 717  C C    . ALA A 1 14 ? -1.762  -12.268 -1.665  1.00 0.00 ? 14 ALA A C    3 
ATOM 718  O O    . ALA A 1 14 ? -1.553  -12.180 -0.457  1.00 0.00 ? 14 ALA A O    3 
ATOM 719  C CB   . ALA A 1 14 ? -3.427  -10.982 -2.935  1.00 0.00 ? 14 ALA A CB   3 
ATOM 720  H H    . ALA A 1 14 ? -1.525  -11.185 -4.589  1.00 0.00 ? 14 ALA A H    3 
ATOM 721  H HA   . ALA A 1 14 ? -1.729  -10.149 -1.923  1.00 0.00 ? 14 ALA A HA   3 
ATOM 722  H HB1  . ALA A 1 14 ? -4.066  -10.945 -2.053  1.00 0.00 ? 14 ALA A HB1  3 
ATOM 723  H HB2  . ALA A 1 14 ? -3.596  -10.092 -3.541  1.00 0.00 ? 14 ALA A HB2  3 
ATOM 724  H HB3  . ALA A 1 14 ? -3.667  -11.871 -3.518  1.00 0.00 ? 14 ALA A HB3  3 
ATOM 725  N N    . ILE A 1 15 ? -1.827  -13.415 -2.317  1.00 0.00 ? 15 ILE A N    3 
ATOM 726  C CA   . ILE A 1 15 ? -1.653  -14.687 -1.646  1.00 0.00 ? 15 ILE A CA   3 
ATOM 727  C C    . ILE A 1 15 ? -0.358  -14.709 -0.873  1.00 0.00 ? 15 ILE A C    3 
ATOM 728  O O    . ILE A 1 15 ? -0.310  -15.149 0.273   1.00 0.00 ? 15 ILE A O    3 
ATOM 729  C CB   . ILE A 1 15 ? -1.622  -15.855 -2.649  1.00 0.00 ? 15 ILE A CB   3 
ATOM 730  C CG1  . ILE A 1 15 ? -2.994  -16.032 -3.304  1.00 0.00 ? 15 ILE A CG1  3 
ATOM 731  C CG2  . ILE A 1 15 ? -1.253  -17.152 -1.946  1.00 0.00 ? 15 ILE A CG2  3 
ATOM 732  C CD1  . ILE A 1 15 ? -2.992  -16.989 -4.476  1.00 0.00 ? 15 ILE A CD1  3 
ATOM 733  H H    . ILE A 1 15 ? -2.001  -13.417 -3.311  1.00 0.00 ? 15 ILE A H    3 
ATOM 734  H HA   . ILE A 1 15 ? -2.486  -14.829 -0.958  1.00 0.00 ? 15 ILE A HA   3 
ATOM 735  H HB   . ILE A 1 15 ? -0.880  -15.640 -3.418  1.00 0.00 ? 15 ILE A HB   3 
ATOM 736  H HG12 . ILE A 1 15 ? -3.687  -16.410 -2.553  1.00 0.00 ? 15 ILE A HG12 3 
ATOM 737  H HG13 . ILE A 1 15 ? -3.335  -15.059 -3.656  1.00 0.00 ? 15 ILE A HG13 3 
ATOM 738  H HG21 . ILE A 1 15 ? -1.224  -17.969 -2.667  1.00 0.00 ? 15 ILE A HG21 3 
ATOM 739  H HG22 . ILE A 1 15 ? -0.272  -17.046 -1.481  1.00 0.00 ? 15 ILE A HG22 3 
ATOM 740  H HG23 . ILE A 1 15 ? -1.995  -17.373 -1.179  1.00 0.00 ? 15 ILE A HG23 3 
ATOM 741  H HD11 . ILE A 1 15 ? -3.992  -17.076 -4.900  1.00 0.00 ? 15 ILE A HD11 3 
ATOM 742  H HD12 . ILE A 1 15 ? -2.310  -16.619 -5.241  1.00 0.00 ? 15 ILE A HD12 3 
ATOM 743  H HD13 . ILE A 1 15 ? -2.660  -17.971 -4.138  1.00 0.00 ? 15 ILE A HD13 3 
ATOM 744  N N    . ILE A 1 16 ? 0.689   -14.228 -1.517  1.00 0.00 ? 16 ILE A N    3 
ATOM 745  C CA   . ILE A 1 16 ? 2.004   -14.180 -0.912  1.00 0.00 ? 16 ILE A CA   3 
ATOM 746  C C    . ILE A 1 16 ? 2.056   -13.124 0.171   1.00 0.00 ? 16 ILE A C    3 
ATOM 747  O O    . ILE A 1 16 ? 2.713   -13.298 1.194   1.00 0.00 ? 16 ILE A O    3 
ATOM 748  C CB   . ILE A 1 16 ? 3.091   -13.844 -1.950  1.00 0.00 ? 16 ILE A CB   3 
ATOM 749  C CG1  . ILE A 1 16 ? 3.234   -14.984 -2.961  1.00 0.00 ? 16 ILE A CG1  3 
ATOM 750  C CG2  . ILE A 1 16 ? 4.433   -13.634 -1.267  1.00 0.00 ? 16 ILE A CG2  3 
ATOM 751  C CD1  . ILE A 1 16 ? 4.098   -14.638 -4.153  1.00 0.00 ? 16 ILE A CD1  3 
ATOM 752  H H    . ILE A 1 16 ? 0.582   -13.880 -2.459  1.00 0.00 ? 16 ILE A H    3 
ATOM 753  H HA   . ILE A 1 16 ? 2.217   -15.156 -0.475  1.00 0.00 ? 16 ILE A HA   3 
ATOM 754  H HB   . ILE A 1 16 ? 2.808   -12.931 -2.474  1.00 0.00 ? 16 ILE A HB   3 
ATOM 755  H HG12 . ILE A 1 16 ? 3.677   -15.841 -2.453  1.00 0.00 ? 16 ILE A HG12 3 
ATOM 756  H HG13 . ILE A 1 16 ? 2.241   -15.250 -3.322  1.00 0.00 ? 16 ILE A HG13 3 
ATOM 757  H HG21 . ILE A 1 16 ? 5.192   -13.387 -2.009  1.00 0.00 ? 16 ILE A HG21 3 
ATOM 758  H HG22 . ILE A 1 16 ? 4.351   -12.817 -0.549  1.00 0.00 ? 16 ILE A HG22 3 
ATOM 759  H HG23 . ILE A 1 16 ? 4.722   -14.547 -0.746  1.00 0.00 ? 16 ILE A HG23 3 
ATOM 760  H HD11 . ILE A 1 16 ? 4.165   -15.485 -4.835  1.00 0.00 ? 16 ILE A HD11 3 
ATOM 761  H HD12 . ILE A 1 16 ? 3.663   -13.789 -4.679  1.00 0.00 ? 16 ILE A HD12 3 
ATOM 762  H HD13 . ILE A 1 16 ? 5.099   -14.378 -3.808  1.00 0.00 ? 16 ILE A HD13 3 
ATOM 763  N N    . ILE A 1 17 ? 1.355   -12.035 -0.072  1.00 0.00 ? 17 ILE A N    3 
ATOM 764  C CA   . ILE A 1 17 ? 1.302   -10.930 0.868   1.00 0.00 ? 17 ILE A CA   3 
ATOM 765  C C    . ILE A 1 17 ? 0.569   -11.331 2.132   1.00 0.00 ? 17 ILE A C    3 
ATOM 766  O O    . ILE A 1 17 ? 1.032   -11.070 3.240   1.00 0.00 ? 17 ILE A O    3 
ATOM 767  C CB   . ILE A 1 17 ? 0.571   -9.714  0.269   1.00 0.00 ? 17 ILE A CB   3 
ATOM 768  C CG1  . ILE A 1 17 ? 1.378   -9.125  -0.891  1.00 0.00 ? 17 ILE A CG1  3 
ATOM 769  C CG2  . ILE A 1 17 ? 0.383   -8.633  1.323   1.00 0.00 ? 17 ILE A CG2  3 
ATOM 770  C CD1  . ILE A 1 17 ? 0.625   -8.087  -1.693  1.00 0.00 ? 17 ILE A CD1  3 
ATOM 771  H H    . ILE A 1 17 ? 0.835   -11.956 -0.934  1.00 0.00 ? 17 ILE A H    3 
ATOM 772  H HA   . ILE A 1 17 ? 2.324   -10.645 1.119   1.00 0.00 ? 17 ILE A HA   3 
ATOM 773  H HB   . ILE A 1 17 ? -0.404  -10.034 -0.096  1.00 0.00 ? 17 ILE A HB   3 
ATOM 774  H HG12 . ILE A 1 17 ? 2.276   -8.660  -0.484  1.00 0.00 ? 17 ILE A HG12 3 
ATOM 775  H HG13 . ILE A 1 17 ? 1.661   -9.937  -1.560  1.00 0.00 ? 17 ILE A HG13 3 
ATOM 776  H HG21 . ILE A 1 17 ? -0.143  -7.782  0.891   1.00 0.00 ? 17 ILE A HG21 3 
ATOM 777  H HG22 . ILE A 1 17 ? -0.198  -9.034  2.153   1.00 0.00 ? 17 ILE A HG22 3 
ATOM 778  H HG23 . ILE A 1 17 ? 1.358   -8.308  1.687   1.00 0.00 ? 17 ILE A HG23 3 
ATOM 779  H HD11 . ILE A 1 17 ? 1.247   -7.703  -2.501  1.00 0.00 ? 17 ILE A HD11 3 
ATOM 780  H HD12 . ILE A 1 17 ? -0.271  -8.540  -2.116  1.00 0.00 ? 17 ILE A HD12 3 
ATOM 781  H HD13 . ILE A 1 17 ? 0.342   -7.263  -1.038  1.00 0.00 ? 17 ILE A HD13 3 
ATOM 782  N N    . ALA A 1 18 ? -0.563  -11.958 1.949   1.00 0.00 ? 18 ALA A N    3 
ATOM 783  C CA   . ALA A 1 18 ? -1.384  -12.407 3.061   1.00 0.00 ? 18 ALA A CA   3 
ATOM 784  C C    . ALA A 1 18 ? -0.687  -13.494 3.836   1.00 0.00 ? 18 ALA A C    3 
ATOM 785  O O    . ALA A 1 18 ? -0.485  -13.380 5.042   1.00 0.00 ? 18 ALA A O    3 
ATOM 786  C CB   . ALA A 1 18 ? -2.709  -12.956 2.554   1.00 0.00 ? 18 ALA A CB   3 
ATOM 787  H H    . ALA A 1 18 ? -0.887  -12.141 1.011   1.00 0.00 ? 18 ALA A H    3 
ATOM 788  H HA   . ALA A 1 18 ? -1.572  -11.559 3.720   1.00 0.00 ? 18 ALA A HA   3 
ATOM 789  H HB1  . ALA A 1 18 ? -3.324  -13.275 3.396   1.00 0.00 ? 18 ALA A HB1  3 
ATOM 790  H HB2  . ALA A 1 18 ? -3.233  -12.180 1.998   1.00 0.00 ? 18 ALA A HB2  3 
ATOM 791  H HB3  . ALA A 1 18 ? -2.521  -13.808 1.901   1.00 0.00 ? 18 ALA A HB3  3 
ATOM 792  N N    . ILE A 1 19 ? -0.326  -14.542 3.132   1.00 0.00 ? 19 ILE A N    3 
ATOM 793  C CA   . ILE A 1 19 ? 0.352   -15.668 3.731   1.00 0.00 ? 19 ILE A CA   3 
ATOM 794  C C    . ILE A 1 19 ? 1.551   -15.212 4.517   1.00 0.00 ? 19 ILE A C    3 
ATOM 795  O O    . ILE A 1 19 ? 1.749   -15.609 5.663   1.00 0.00 ? 19 ILE A O    3 
ATOM 796  C CB   . ILE A 1 19 ? 0.841   -16.665 2.664   1.00 0.00 ? 19 ILE A CB   3 
ATOM 797  C CG1  . ILE A 1 19 ? -0.349  -17.336 1.975   1.00 0.00 ? 19 ILE A CG1  3 
ATOM 798  C CG2  . ILE A 1 19 ? 1.702   -17.746 3.300   1.00 0.00 ? 19 ILE A CG2  3 
ATOM 799  C CD1  . ILE A 1 19 ? 0.028   -18.142 0.752   1.00 0.00 ? 19 ILE A CD1  3 
ATOM 800  H H    . ILE A 1 19 ? -0.522  -14.572 2.142   1.00 0.00 ? 19 ILE A H    3 
ATOM 801  H HA   . ILE A 1 19 ? -0.346  -16.173 4.399   1.00 0.00 ? 19 ILE A HA   3 
ATOM 802  H HB   . ILE A 1 19 ? 1.430   -16.127 1.922   1.00 0.00 ? 19 ILE A HB   3 
ATOM 803  H HG12 . ILE A 1 19 ? -0.829  -18.003 2.691   1.00 0.00 ? 19 ILE A HG12 3 
ATOM 804  H HG13 . ILE A 1 19 ? -1.052  -16.561 1.672   1.00 0.00 ? 19 ILE A HG13 3 
ATOM 805  H HG21 . ILE A 1 19 ? 2.051   -18.439 2.535   1.00 0.00 ? 19 ILE A HG21 3 
ATOM 806  H HG22 . ILE A 1 19 ? 2.561   -17.285 3.788   1.00 0.00 ? 19 ILE A HG22 3 
ATOM 807  H HG23 . ILE A 1 19 ? 1.114   -18.290 4.040   1.00 0.00 ? 19 ILE A HG23 3 
ATOM 808  H HD11 . ILE A 1 19 ? -0.856  -18.596 0.306   1.00 0.00 ? 19 ILE A HD11 3 
ATOM 809  H HD12 . ILE A 1 19 ? 0.501   -17.487 0.021   1.00 0.00 ? 19 ILE A HD12 3 
ATOM 810  H HD13 . ILE A 1 19 ? 0.726   -18.928 1.041   1.00 0.00 ? 19 ILE A HD13 3 
ATOM 811  N N    . VAL A 1 20 ? 2.344   -14.375 3.884   1.00 0.00 ? 20 VAL A N    3 
ATOM 812  C CA   . VAL A 1 20 ? 3.536   -13.845 4.501   1.00 0.00 ? 20 VAL A CA   3 
ATOM 813  C C    . VAL A 1 20 ? 3.190   -13.019 5.718   1.00 0.00 ? 20 VAL A C    3 
ATOM 814  O O    . VAL A 1 20 ? 3.797   -13.164 6.776   1.00 0.00 ? 20 VAL A O    3 
ATOM 815  C CB   . VAL A 1 20 ? 4.321   -12.943 3.530   1.00 0.00 ? 20 VAL A CB   3 
ATOM 816  C CG1  . VAL A 1 20 ? 5.453   -12.235 4.258   1.00 0.00 ? 20 VAL A CG1  3 
ATOM 817  C CG2  . VAL A 1 20 ? 4.918   -13.769 2.401   1.00 0.00 ? 20 VAL A CG2  3 
ATOM 818  H H    . VAL A 1 20 ? 2.123   -14.089 2.942   1.00 0.00 ? 20 VAL A H    3 
ATOM 819  H HA   . VAL A 1 20 ? 4.168   -14.682 4.801   1.00 0.00 ? 20 VAL A HA   3 
ATOM 820  H HB   . VAL A 1 20 ? 3.642   -12.200 3.112   1.00 0.00 ? 20 VAL A HB   3 
ATOM 821  H HG11 . VAL A 1 20 ? 5.996   -11.594 3.564   1.00 0.00 ? 20 VAL A HG11 3 
ATOM 822  H HG12 . VAL A 1 20 ? 5.042   -11.628 5.065   1.00 0.00 ? 20 VAL A HG12 3 
ATOM 823  H HG13 . VAL A 1 20 ? 6.136   -12.976 4.674   1.00 0.00 ? 20 VAL A HG13 3 
ATOM 824  H HG21 . VAL A 1 20 ? 5.464   -13.120 1.717   1.00 0.00 ? 20 VAL A HG21 3 
ATOM 825  H HG22 . VAL A 1 20 ? 5.601   -14.511 2.817   1.00 0.00 ? 20 VAL A HG22 3 
ATOM 826  H HG23 . VAL A 1 20 ? 4.118   -14.275 1.860   1.00 0.00 ? 20 VAL A HG23 3 
ATOM 827  N N    . VAL A 1 21 ? 2.215   -12.160 5.549   1.00 0.00 ? 21 VAL A N    3 
ATOM 828  C CA   . VAL A 1 21 ? 1.765   -11.295 6.620   1.00 0.00 ? 21 VAL A CA   3 
ATOM 829  C C    . VAL A 1 21 ? 1.136   -12.091 7.734   1.00 0.00 ? 21 VAL A C    3 
ATOM 830  O O    . VAL A 1 21 ? 1.553   -12.011 8.887   1.00 0.00 ? 21 VAL A O    3 
ATOM 831  C CB   . VAL A 1 21 ? 0.717   -10.281 6.124   1.00 0.00 ? 21 VAL A CB   3 
ATOM 832  C CG1  . VAL A 1 21 ? 0.152   -9.485  7.291   1.00 0.00 ? 21 VAL A CG1  3 
ATOM 833  C CG2  . VAL A 1 21 ? 1.342   -9.309  5.136   1.00 0.00 ? 21 VAL A CG2  3 
ATOM 834  H H    . VAL A 1 21 ? 1.758   -12.091 4.652   1.00 0.00 ? 21 VAL A H    3 
ATOM 835  H HA   . VAL A 1 21 ? 2.629   -10.755 7.008   1.00 0.00 ? 21 VAL A HA   3 
ATOM 836  H HB   . VAL A 1 21 ? -0.091  -10.822 5.633   1.00 0.00 ? 21 VAL A HB   3 
ATOM 837  H HG11 . VAL A 1 21 ? -0.594  -8.778  6.930   1.00 0.00 ? 21 VAL A HG11 3 
ATOM 838  H HG12 . VAL A 1 21 ? -0.312  -10.167 8.004   1.00 0.00 ? 21 VAL A HG12 3 
ATOM 839  H HG13 . VAL A 1 21 ? 0.959   -8.940  7.782   1.00 0.00 ? 21 VAL A HG13 3 
ATOM 840  H HG21 . VAL A 1 21 ? 0.590   -8.603  4.786   1.00 0.00 ? 21 VAL A HG21 3 
ATOM 841  H HG22 . VAL A 1 21 ? 2.150   -8.764  5.626   1.00 0.00 ? 21 VAL A HG22 3 
ATOM 842  H HG23 . VAL A 1 21 ? 1.742   -9.863  4.287   1.00 0.00 ? 21 VAL A HG23 3 
ATOM 843  N N    . TRP A 1 22 ? 0.139   -12.851 7.369   1.00 0.00 ? 22 TRP A N    3 
ATOM 844  C CA   . TRP A 1 22 ? -0.568  -13.676 8.319   1.00 0.00 ? 22 TRP A CA   3 
ATOM 845  C C    . TRP A 1 22 ? 0.383   -14.529 9.102   1.00 0.00 ? 22 TRP A C    3 
ATOM 846  O O    . TRP A 1 22 ? 0.164   -14.818 10.276  1.00 0.00 ? 22 TRP A O    3 
ATOM 847  C CB   . TRP A 1 22 ? -1.553  -14.598 7.599   1.00 0.00 ? 22 TRP A CB   3 
ATOM 848  C CG   . TRP A 1 22 ? -2.344  -15.471 8.524   1.00 0.00 ? 22 TRP A CG   3 
ATOM 849  C CD1  . TRP A 1 22 ? -3.498  -15.143 9.175   1.00 0.00 ? 22 TRP A CD1  3 
ATOM 850  C CD2  . TRP A 1 22 ? -2.038  -16.819 8.903   1.00 0.00 ? 22 TRP A CD2  3 
ATOM 851  N NE1  . TRP A 1 22 ? -3.932  -16.201 9.936   1.00 0.00 ? 22 TRP A NE1  3 
ATOM 852  C CE2  . TRP A 1 22 ? -3.051  -17.244 9.786   1.00 0.00 ? 22 TRP A CE2  3 
ATOM 853  C CE3  . TRP A 1 22 ? -1.008  -17.708 8.583   1.00 0.00 ? 22 TRP A CE3  3 
ATOM 854  C CZ2  . TRP A 1 22 ? -3.064  -18.518 10.351  1.00 0.00 ? 22 TRP A CZ2  3 
ATOM 855  C CZ3  . TRP A 1 22 ? -1.024  -18.970 9.146   1.00 0.00 ? 22 TRP A CZ3  3 
ATOM 856  C CH2  . TRP A 1 22 ? -2.043  -19.366 10.020  1.00 0.00 ? 22 TRP A CH2  3 
ATOM 857  H H    . TRP A 1 22 ? -0.152  -12.871 6.403   1.00 0.00 ? 22 TRP A H    3 
ATOM 858  H HA   . TRP A 1 22 ? -1.115  -13.027 9.003   1.00 0.00 ? 22 TRP A HA   3 
ATOM 859  H HB2  . TRP A 1 22 ? -2.245  -13.986 7.022   1.00 0.00 ? 22 TRP A HB2  3 
ATOM 860  H HB3  . TRP A 1 22 ? -0.996  -15.234 6.911   1.00 0.00 ? 22 TRP A HB3  3 
ATOM 861  H HD1  . TRP A 1 22 ? -3.997  -14.189 9.103   1.00 0.00 ? 22 TRP A HD1  3 
ATOM 862  H HE1  . TRP A 1 22 ? -4.767  -16.185 10.504  1.00 0.00 ? 22 TRP A HE1  3 
ATOM 863  H HE3  . TRP A 1 22 ? -0.216  -17.415 7.910   1.00 0.00 ? 22 TRP A HE3  3 
ATOM 864  H HZ2  . TRP A 1 22 ? -3.850  -18.824 11.025  1.00 0.00 ? 22 TRP A HZ2  3 
ATOM 865  H HZ3  . TRP A 1 22 ? -0.233  -19.666 8.907   1.00 0.00 ? 22 TRP A HZ3  3 
ATOM 866  H HH2  . TRP A 1 22 ? -2.023  -20.360 10.442  1.00 0.00 ? 22 TRP A HH2  3 
ATOM 867  N N    . SER A 1 23 ? 1.439   -14.925 8.435   1.00 0.00 ? 23 SER A N    3 
ATOM 868  C CA   . SER A 1 23 ? 2.444   -15.750 9.045   1.00 0.00 ? 23 SER A CA   3 
ATOM 869  C C    . SER A 1 23 ? 3.211   -14.980 10.085  1.00 0.00 ? 23 SER A C    3 
ATOM 870  O O    . SER A 1 23 ? 3.489   -15.481 11.172  1.00 0.00 ? 23 SER A O    3 
ATOM 871  C CB   . SER A 1 23 ? 3.435   -16.252 7.994   1.00 0.00 ? 23 SER A CB   3 
ATOM 872  O OG   . SER A 1 23 ? 4.440   -17.059 8.584   1.00 0.00 ? 23 SER A OG   3 
ATOM 873  H H    . SER A 1 23 ? 1.560   -14.650 7.471   1.00 0.00 ? 23 SER A H    3 
ATOM 874  H HA   . SER A 1 23 ? 1.956   -16.603 9.516   1.00 0.00 ? 23 SER A HA   3 
ATOM 875  H HB2  . SER A 1 23 ? 2.898   -16.841 7.251   1.00 0.00 ? 23 SER A HB2  3 
ATOM 876  H HB3  . SER A 1 23 ? 3.906   -15.396 7.511   1.00 0.00 ? 23 SER A HB3  3 
ATOM 877  H HG   . SER A 1 23 ? 5.044   -17.357 7.899   1.00 0.00 ? 23 SER A HG   3 
ATOM 878  N N    . ILE A 1 24 ? 3.543   -13.767 9.736   1.00 0.00 ? 24 ILE A N    3 
ATOM 879  C CA   . ILE A 1 24 ? 4.280   -12.901 10.623  1.00 0.00 ? 24 ILE A CA   3 
ATOM 880  C C    . ILE A 1 24 ? 3.589   -12.766 11.961  1.00 0.00 ? 24 ILE A C    3 
ATOM 881  O O    . ILE A 1 24 ? 4.217   -12.870 13.012  1.00 0.00 ? 24 ILE A O    3 
ATOM 882  C CB   . ILE A 1 24 ? 4.428   -11.485 10.035  1.00 0.00 ? 24 ILE A CB   3 
ATOM 883  C CG1  . ILE A 1 24 ? 5.325   -11.514 8.796   1.00 0.00 ? 24 ILE A CG1  3 
ATOM 884  C CG2  . ILE A 1 24 ? 5.050   -10.546 11.058  1.00 0.00 ? 24 ILE A CG2  3 
ATOM 885  C CD1  . ILE A 1 24 ? 5.327   -10.218 8.014   1.00 0.00 ? 24 ILE A CD1  3 
ATOM 886  H H    . ILE A 1 24 ? 3.283   -13.415 8.826   1.00 0.00 ? 24 ILE A H    3 
ATOM 887  H HA   . ILE A 1 24 ? 5.271   -13.331 10.773  1.00 0.00 ? 24 ILE A HA   3 
ATOM 888  H HB   . ILE A 1 24 ? 3.442   -11.113 9.758   1.00 0.00 ? 24 ILE A HB   3 
ATOM 889  H HG12 . ILE A 1 24 ? 6.346   -11.724 9.115   1.00 0.00 ? 24 ILE A HG12 3 
ATOM 890  H HG13 . ILE A 1 24 ? 4.979   -12.311 8.139   1.00 0.00 ? 24 ILE A HG13 3 
ATOM 891  H HG21 . ILE A 1 24 ? 5.141   -9.546  10.635  1.00 0.00 ? 24 ILE A HG21 3 
ATOM 892  H HG22 . ILE A 1 24 ? 4.418   -10.507 11.945  1.00 0.00 ? 24 ILE A HG22 3 
ATOM 893  H HG23 . ILE A 1 24 ? 6.039   -10.913 11.333  1.00 0.00 ? 24 ILE A HG23 3 
ATOM 894  H HD11 . ILE A 1 24 ? 5.982   -10.296 7.147   1.00 0.00 ? 24 ILE A HD11 3 
ATOM 895  H HD12 . ILE A 1 24 ? 4.314   -9.999  7.678   1.00 0.00 ? 24 ILE A HD12 3 
ATOM 896  H HD13 . ILE A 1 24 ? 5.680   -9.411  8.656   1.00 0.00 ? 24 ILE A HD13 3 
ATOM 897  N N    . VAL A 1 25 ? 2.316   -12.538 11.904  1.00 0.00 ? 25 VAL A N    3 
ATOM 898  C CA   . VAL A 1 25 ? 1.513   -12.383 13.101  1.00 0.00 ? 25 VAL A CA   3 
ATOM 899  C C    . VAL A 1 25 ? 0.063   -12.127 12.719  1.00 0.00 ? 25 VAL A C    3 
ATOM 900  O O    . VAL A 1 25 ? -0.270  -12.078 11.537  1.00 0.00 ? 25 VAL A O    3 
ATOM 901  C CB   . VAL A 1 25 ? 2.064   -11.231 13.937  1.00 0.00 ? 25 VAL A CB   3 
ATOM 902  C CG1  . VAL A 1 25 ? 1.231   -11.080 15.207  1.00 0.00 ? 25 VAL A CG1  3 
ATOM 903  C CG2  . VAL A 1 25 ? 3.514   -11.523 14.312  1.00 0.00 ? 25 VAL A CG2  3 
ATOM 904  H H    . VAL A 1 25 ? 1.860   -12.464 11.007  1.00 0.00 ? 25 VAL A H    3 
ATOM 905  H HA   . VAL A 1 25 ? 1.569   -13.302 13.685  1.00 0.00 ? 25 VAL A HA   3 
ATOM 906  H HB   . VAL A 1 25 ? 2.017   -10.308 13.359  1.00 0.00 ? 25 VAL A HB   3 
ATOM 907  H HG11 . VAL A 1 25 ? 1.624   -10.257 15.803  1.00 0.00 ? 25 VAL A HG11 3 
ATOM 908  H HG12 . VAL A 1 25 ? 0.195   -10.871 14.939  1.00 0.00 ? 25 VAL A HG12 3 
ATOM 909  H HG13 . VAL A 1 25 ? 1.278   -12.003 15.785  1.00 0.00 ? 25 VAL A HG13 3 
ATOM 910  H HG21 . VAL A 1 25 ? 3.908   -10.700 14.909  1.00 0.00 ? 25 VAL A HG21 3 
ATOM 911  H HG22 . VAL A 1 25 ? 3.561   -12.446 14.890  1.00 0.00 ? 25 VAL A HG22 3 
ATOM 912  H HG23 . VAL A 1 25 ? 4.109   -11.631 13.406  1.00 0.00 ? 25 VAL A HG23 3 
ATOM 913  N N    . ALA A 1 7  ? 5.332   -12.536 -11.714 1.00 0.00 ? 7  ALA A N    4 
ATOM 914  C CA   . ALA A 1 7  ? 6.326   -11.822 -12.491 1.00 0.00 ? 7  ALA A CA   4 
ATOM 915  C C    . ALA A 1 7  ? 7.094   -10.874 -11.585 1.00 0.00 ? 7  ALA A C    4 
ATOM 916  O O    . ALA A 1 7  ? 6.835   -10.799 -10.386 1.00 0.00 ? 7  ALA A O    4 
ATOM 917  C CB   . ALA A 1 7  ? 5.639   -11.057 -13.618 1.00 0.00 ? 7  ALA A CB   4 
ATOM 918  H H    . ALA A 1 7  ? 5.261   -12.339 -10.726 1.00 0.00 ? 7  ALA A H    4 
ATOM 919  H HA   . ALA A 1 7  ? 7.022   -12.541 -12.923 1.00 0.00 ? 7  ALA A HA   4 
ATOM 920  H HB1  . ALA A 1 7  ? 6.389   -10.532 -14.210 1.00 0.00 ? 7  ALA A HB1  4 
ATOM 921  H HB2  . ALA A 1 7  ? 5.099   -11.757 -14.256 1.00 0.00 ? 7  ALA A HB2  4 
ATOM 922  H HB3  . ALA A 1 7  ? 4.940   -10.337 -13.195 1.00 0.00 ? 7  ALA A HB3  4 
ATOM 923  N N    . ILE A 1 8  ? 8.043   -10.155 -12.178 1.00 0.00 ? 8  ILE A N    4 
ATOM 924  C CA   . ILE A 1 8  ? 8.868   -9.200  -11.446 1.00 0.00 ? 8  ILE A CA   4 
ATOM 925  C C    . ILE A 1 8  ? 7.998   -8.234  -10.661 1.00 0.00 ? 8  ILE A C    4 
ATOM 926  O O    . ILE A 1 8  ? 8.297   -7.902  -9.517  1.00 0.00 ? 8  ILE A O    4 
ATOM 927  C CB   . ILE A 1 8  ? 9.752   -8.373  -12.397 1.00 0.00 ? 8  ILE A CB   4 
ATOM 928  C CG1  . ILE A 1 8  ? 10.810  -9.263  -13.052 1.00 0.00 ? 8  ILE A CG1  4 
ATOM 929  C CG2  . ILE A 1 8  ? 10.461  -7.263  -11.636 1.00 0.00 ? 8  ILE A CG2  4 
ATOM 930  C CD1  . ILE A 1 8  ? 11.561  -8.591  -14.180 1.00 0.00 ? 8  ILE A CD1  4 
ATOM 931  H H    . ILE A 1 8  ? 8.206   -10.265 -13.168 1.00 0.00 ? 8  ILE A H    4 
ATOM 932  H HA   . ILE A 1 8  ? 9.506   -9.754  -10.756 1.00 0.00 ? 8  ILE A HA   4 
ATOM 933  H HB   . ILE A 1 8  ? 9.123   -7.933  -13.170 1.00 0.00 ? 8  ILE A HB   4 
ATOM 934  H HG12 . ILE A 1 8  ? 11.530  -9.560  -12.289 1.00 0.00 ? 8  ILE A HG12 4 
ATOM 935  H HG13 . ILE A 1 8  ? 10.316  -10.149 -13.449 1.00 0.00 ? 8  ILE A HG13 4 
ATOM 936  H HG21 . ILE A 1 8  ? 11.076  -6.679  -12.321 1.00 0.00 ? 8  ILE A HG21 4 
ATOM 937  H HG22 . ILE A 1 8  ? 9.721   -6.613  -11.170 1.00 0.00 ? 8  ILE A HG22 4 
ATOM 938  H HG23 . ILE A 1 8  ? 11.096  -7.700  -10.865 1.00 0.00 ? 8  ILE A HG23 4 
ATOM 939  H HD11 . ILE A 1 8  ? 12.300  -9.270  -14.606 1.00 0.00 ? 8  ILE A HD11 4 
ATOM 940  H HD12 . ILE A 1 8  ? 10.856  -8.298  -14.957 1.00 0.00 ? 8  ILE A HD12 4 
ATOM 941  H HD13 . ILE A 1 8  ? 12.069  -7.706  -13.797 1.00 0.00 ? 8  ILE A HD13 4 
ATOM 942  N N    . VAL A 1 9  ? 6.917   -7.792  -11.295 1.00 0.00 ? 9  VAL A N    4 
ATOM 943  C CA   . VAL A 1 9  ? 5.979   -6.860  -10.679 1.00 0.00 ? 9  VAL A CA   4 
ATOM 944  C C    . VAL A 1 9  ? 5.309   -7.498  -9.477  1.00 0.00 ? 9  VAL A C    4 
ATOM 945  O O    . VAL A 1 9  ? 5.201   -6.886  -8.417  1.00 0.00 ? 9  VAL A O    4 
ATOM 946  C CB   . VAL A 1 9  ? 4.876   -6.435  -11.666 1.00 0.00 ? 9  VAL A CB   4 
ATOM 947  C CG1  . VAL A 1 9  ? 3.800   -5.633  -10.949 1.00 0.00 ? 9  VAL A CG1  4 
ATOM 948  C CG2  . VAL A 1 9  ? 5.458   -5.573  -12.776 1.00 0.00 ? 9  VAL A CG2  4 
ATOM 949  H H    . VAL A 1 9  ? 6.729   -8.106  -12.236 1.00 0.00 ? 9  VAL A H    4 
ATOM 950  H HA   . VAL A 1 9  ? 6.532   -5.977  -10.358 1.00 0.00 ? 9  VAL A HA   4 
ATOM 951  H HB   . VAL A 1 9  ? 4.429   -7.329  -12.101 1.00 0.00 ? 9  VAL A HB   4 
ATOM 952  H HG11 . VAL A 1 9  ? 3.022   -5.345  -11.655 1.00 0.00 ? 9  VAL A HG11 4 
ATOM 953  H HG12 . VAL A 1 9  ? 3.363   -6.241  -10.156 1.00 0.00 ? 9  VAL A HG12 4 
ATOM 954  H HG13 . VAL A 1 9  ? 4.245   -4.737  -10.516 1.00 0.00 ? 9  VAL A HG13 4 
ATOM 955  H HG21 . VAL A 1 9  ? 4.671   -5.286  -13.472 1.00 0.00 ? 9  VAL A HG21 4 
ATOM 956  H HG22 . VAL A 1 9  ? 5.903   -4.677  -12.343 1.00 0.00 ? 9  VAL A HG22 4 
ATOM 957  H HG23 . VAL A 1 9  ? 6.224   -6.137  -13.309 1.00 0.00 ? 9  VAL A HG23 4 
ATOM 958  N N    . ALA A 1 10 ? 4.861   -8.733  -9.659  1.00 0.00 ? 10 ALA A N    4 
ATOM 959  C CA   . ALA A 1 10 ? 4.193   -9.483  -8.603  1.00 0.00 ? 10 ALA A CA   4 
ATOM 960  C C    . ALA A 1 10 ? 5.080   -9.583  -7.378  1.00 0.00 ? 10 ALA A C    4 
ATOM 961  O O    . ALA A 1 10 ? 4.636   -9.344  -6.258  1.00 0.00 ? 10 ALA A O    4 
ATOM 962  C CB   . ALA A 1 10 ? 3.867   -10.891 -9.077  1.00 0.00 ? 10 ALA A CB   4 
ATOM 963  H H    . ALA A 1 10 ? 4.981   -9.179  -10.557 1.00 0.00 ? 10 ALA A H    4 
ATOM 964  H HA   . ALA A 1 10 ? 3.270   -8.968  -8.339  1.00 0.00 ? 10 ALA A HA   4 
ATOM 965  H HB1  . ALA A 1 10 ? 3.355   -11.438 -8.285  1.00 0.00 ? 10 ALA A HB1  4 
ATOM 966  H HB2  . ALA A 1 10 ? 3.223   -10.838 -9.954  1.00 0.00 ? 10 ALA A HB2  4 
ATOM 967  H HB3  . ALA A 1 10 ? 4.791   -11.410 -9.335  1.00 0.00 ? 10 ALA A HB3  4 
ATOM 968  N N    . LEU A 1 11 ? 6.324   -9.934  -7.604  1.00 0.00 ? 11 LEU A N    4 
ATOM 969  C CA   . LEU A 1 11 ? 7.300   -10.073 -6.533  1.00 0.00 ? 11 LEU A CA   4 
ATOM 970  C C    . LEU A 1 11 ? 7.469   -8.765  -5.796  1.00 0.00 ? 11 LEU A C    4 
ATOM 971  O O    . LEU A 1 11 ? 7.417   -8.725  -4.569  1.00 0.00 ? 11 LEU A O    4 
ATOM 972  C CB   . LEU A 1 11 ? 8.660   -10.488 -7.098  1.00 0.00 ? 11 LEU A CB   4 
ATOM 973  C CG   . LEU A 1 11 ? 8.770   -11.924 -7.613  1.00 0.00 ? 11 LEU A CG   4 
ATOM 974  C CD1  . LEU A 1 11 ? 10.127  -12.161 -8.259  1.00 0.00 ? 11 LEU A CD1  4 
ATOM 975  C CD2  . LEU A 1 11 ? 8.606   -12.918 -6.474  1.00 0.00 ? 11 LEU A CD2  4 
ATOM 976  H H    . LEU A 1 11 ? 6.626   -10.117 -8.550  1.00 0.00 ? 11 LEU A H    4 
ATOM 977  H HA   . LEU A 1 11 ? 6.951   -10.837 -5.838  1.00 0.00 ? 11 LEU A HA   4 
ATOM 978  H HB2  . LEU A 1 11 ? 8.894   -9.819  -7.926  1.00 0.00 ? 11 LEU A HB2  4 
ATOM 979  H HB3  . LEU A 1 11 ? 9.401   -10.361 -6.308  1.00 0.00 ? 11 LEU A HB3  4 
ATOM 980  H HG   . LEU A 1 11 ? 7.987   -12.092 -8.351  1.00 0.00 ? 11 LEU A HG   4 
ATOM 981  H HD11 . LEU A 1 11 ? 10.189  -13.184 -8.630  1.00 0.00 ? 11 LEU A HD11 4 
ATOM 982  H HD12 . LEU A 1 11 ? 10.259  -11.467 -9.089  1.00 0.00 ? 11 LEU A HD12 4 
ATOM 983  H HD13 . LEU A 1 11 ? 10.913  -11.998 -7.521  1.00 0.00 ? 11 LEU A HD13 4 
ATOM 984  H HD21 . LEU A 1 11 ? 8.676   -13.937 -6.856  1.00 0.00 ? 11 LEU A HD21 4 
ATOM 985  H HD22 . LEU A 1 11 ? 9.392   -12.756 -5.736  1.00 0.00 ? 11 LEU A HD22 4 
ATOM 986  H HD23 . LEU A 1 11 ? 7.633   -12.774 -6.005  1.00 0.00 ? 11 LEU A HD23 4 
ATOM 987  N N    . VAL A 1 12 ? 7.669   -7.712  -6.536  1.00 0.00 ? 12 VAL A N    4 
ATOM 988  C CA   . VAL A 1 12 ? 7.850   -6.386  -5.977  1.00 0.00 ? 12 VAL A CA   4 
ATOM 989  C C    . VAL A 1 12 ? 6.679   -6.014  -5.096  1.00 0.00 ? 12 VAL A C    4 
ATOM 990  O O    . VAL A 1 12 ? 6.855   -5.540  -3.976  1.00 0.00 ? 12 VAL A O    4 
ATOM 991  C CB   . VAL A 1 12 ? 7.966   -5.319  -7.081  1.00 0.00 ? 12 VAL A CB   4 
ATOM 992  C CG1  . VAL A 1 12 ? 7.947   -3.923  -6.477  1.00 0.00 ? 12 VAL A CG1  4 
ATOM 993  C CG2  . VAL A 1 12 ? 9.266   -5.491  -7.853  1.00 0.00 ? 12 VAL A CG2  4 
ATOM 994  H H    . VAL A 1 12 ? 7.702   -7.812  -7.540  1.00 0.00 ? 12 VAL A H    4 
ATOM 995  H HA   . VAL A 1 12 ? 8.764   -6.386  -5.382  1.00 0.00 ? 12 VAL A HA   4 
ATOM 996  H HB   . VAL A 1 12 ? 7.125   -5.427  -7.765  1.00 0.00 ? 12 VAL A HB   4 
ATOM 997  H HG11 . VAL A 1 12 ? 8.022   -3.177  -7.267  1.00 0.00 ? 12 VAL A HG11 4 
ATOM 998  H HG12 . VAL A 1 12 ? 7.016   -3.778  -5.929  1.00 0.00 ? 12 VAL A HG12 4 
ATOM 999  H HG13 . VAL A 1 12 ? 8.791   -3.812  -5.795  1.00 0.00 ? 12 VAL A HG13 4 
ATOM 1000 H HG21 . VAL A 1 12 ? 9.334   -4.737  -8.636  1.00 0.00 ? 12 VAL A HG21 4 
ATOM 1001 H HG22 . VAL A 1 12 ? 10.110  -5.380  -7.171  1.00 0.00 ? 12 VAL A HG22 4 
ATOM 1002 H HG23 . VAL A 1 12 ? 9.292   -6.483  -8.303  1.00 0.00 ? 12 VAL A HG23 4 
ATOM 1003 N N    . VAL A 1 13 ? 5.484   -6.235  -5.620  1.00 0.00 ? 13 VAL A N    4 
ATOM 1004 C CA   . VAL A 1 13 ? 4.261   -5.932  -4.901  1.00 0.00 ? 13 VAL A CA   4 
ATOM 1005 C C    . VAL A 1 13 ? 4.209   -6.687  -3.587  1.00 0.00 ? 13 VAL A C    4 
ATOM 1006 O O    . VAL A 1 13 ? 4.056   -6.093  -2.522  1.00 0.00 ? 13 VAL A O    4 
ATOM 1007 C CB   . VAL A 1 13 ? 3.015   -6.323  -5.717  1.00 0.00 ? 13 VAL A CB   4 
ATOM 1008 C CG1  . VAL A 1 13 ? 1.756   -6.160  -4.879  1.00 0.00 ? 13 VAL A CG1  4 
ATOM 1009 C CG2  . VAL A 1 13 ? 2.888   -5.442  -6.951  1.00 0.00 ? 13 VAL A CG2  4 
ATOM 1010 H H    . VAL A 1 13 ? 5.410   -6.626  -6.548  1.00 0.00 ? 13 VAL A H    4 
ATOM 1011 H HA   . VAL A 1 13 ? 4.237   -4.861  -4.702  1.00 0.00 ? 13 VAL A HA   4 
ATOM 1012 H HB   . VAL A 1 13 ? 3.109   -7.364  -6.026  1.00 0.00 ? 13 VAL A HB   4 
ATOM 1013 H HG11 . VAL A 1 13 ? 0.883   -6.448  -5.463  1.00 0.00 ? 13 VAL A HG11 4 
ATOM 1014 H HG12 . VAL A 1 13 ? 1.825   -6.795  -3.995  1.00 0.00 ? 13 VAL A HG12 4 
ATOM 1015 H HG13 . VAL A 1 13 ? 1.658   -5.119  -4.571  1.00 0.00 ? 13 VAL A HG13 4 
ATOM 1016 H HG21 . VAL A 1 13 ? 2.009   -5.734  -7.524  1.00 0.00 ? 13 VAL A HG21 4 
ATOM 1017 H HG22 . VAL A 1 13 ? 2.791   -4.401  -6.644  1.00 0.00 ? 13 VAL A HG22 4 
ATOM 1018 H HG23 . VAL A 1 13 ? 3.778   -5.556  -7.570  1.00 0.00 ? 13 VAL A HG23 4 
ATOM 1019 N N    . ALA A 1 14 ? 4.338   -7.995  -3.682  1.00 0.00 ? 14 ALA A N    4 
ATOM 1020 C CA   . ALA A 1 14 ? 4.310   -8.862  -2.512  1.00 0.00 ? 14 ALA A CA   4 
ATOM 1021 C C    . ALA A 1 14 ? 5.543   -8.657  -1.665  1.00 0.00 ? 14 ALA A C    4 
ATOM 1022 O O    . ALA A 1 14 ? 5.455   -8.448  -0.457  1.00 0.00 ? 14 ALA A O    4 
ATOM 1023 C CB   . ALA A 1 14 ? 4.257   -10.322 -2.935  1.00 0.00 ? 14 ALA A CB   4 
ATOM 1024 H H    . ALA A 1 14 ? 4.460   -8.420  -4.589  1.00 0.00 ? 14 ALA A H    4 
ATOM 1025 H HA   . ALA A 1 14 ? 3.425   -8.625  -1.923  1.00 0.00 ? 14 ALA A HA   4 
ATOM 1026 H HB1  . ALA A 1 14 ? 4.220   -10.962 -2.053  1.00 0.00 ? 14 ALA A HB1  4 
ATOM 1027 H HB2  . ALA A 1 14 ? 3.368   -10.491 -3.541  1.00 0.00 ? 14 ALA A HB2  4 
ATOM 1028 H HB3  . ALA A 1 14 ? 5.146   -10.563 -3.518  1.00 0.00 ? 14 ALA A HB3  4 
ATOM 1029 N N    . ILE A 1 15 ? 6.690   -8.722  -2.317  1.00 0.00 ? 15 ILE A N    4 
ATOM 1030 C CA   . ILE A 1 15 ? 7.962   -8.548  -1.646  1.00 0.00 ? 15 ILE A CA   4 
ATOM 1031 C C    . ILE A 1 15 ? 7.984   -7.253  -0.873  1.00 0.00 ? 15 ILE A C    4 
ATOM 1032 O O    . ILE A 1 15 ? 8.424   -7.205  0.273   1.00 0.00 ? 15 ILE A O    4 
ATOM 1033 C CB   . ILE A 1 15 ? 9.130   -8.517  -2.649  1.00 0.00 ? 15 ILE A CB   4 
ATOM 1034 C CG1  . ILE A 1 15 ? 9.307   -9.889  -3.304  1.00 0.00 ? 15 ILE A CG1  4 
ATOM 1035 C CG2  . ILE A 1 15 ? 10.427  -8.148  -1.946  1.00 0.00 ? 15 ILE A CG2  4 
ATOM 1036 C CD1  . ILE A 1 15 ? 10.264  -9.887  -4.476  1.00 0.00 ? 15 ILE A CD1  4 
ATOM 1037 H H    . ILE A 1 15 ? 6.693   -8.897  -3.311  1.00 0.00 ? 15 ILE A H    4 
ATOM 1038 H HA   . ILE A 1 15 ? 8.104   -9.382  -0.958  1.00 0.00 ? 15 ILE A HA   4 
ATOM 1039 H HB   . ILE A 1 15 ? 8.915   -7.776  -3.418  1.00 0.00 ? 15 ILE A HB   4 
ATOM 1040 H HG12 . ILE A 1 15 ? 9.686   -10.583 -2.553  1.00 0.00 ? 15 ILE A HG12 4 
ATOM 1041 H HG13 . ILE A 1 15 ? 8.334   -10.230 -3.656  1.00 0.00 ? 15 ILE A HG13 4 
ATOM 1042 H HG21 . ILE A 1 15 ? 11.244  -8.120  -2.667  1.00 0.00 ? 15 ILE A HG21 4 
ATOM 1043 H HG22 . ILE A 1 15 ? 10.321  -7.168  -1.481  1.00 0.00 ? 15 ILE A HG22 4 
ATOM 1044 H HG23 . ILE A 1 15 ? 10.648  -8.891  -1.179  1.00 0.00 ? 15 ILE A HG23 4 
ATOM 1045 H HD11 . ILE A 1 15 ? 10.352  -10.887 -4.900  1.00 0.00 ? 15 ILE A HD11 4 
ATOM 1046 H HD12 . ILE A 1 15 ? 9.894   -9.206  -5.241  1.00 0.00 ? 15 ILE A HD12 4 
ATOM 1047 H HD13 . ILE A 1 15 ? 11.246  -9.556  -4.138  1.00 0.00 ? 15 ILE A HD13 4 
ATOM 1048 N N    . ILE A 1 16 ? 7.503   -6.206  -1.517  1.00 0.00 ? 16 ILE A N    4 
ATOM 1049 C CA   . ILE A 1 16 ? 7.455   -4.891  -0.912  1.00 0.00 ? 16 ILE A CA   4 
ATOM 1050 C C    . ILE A 1 16 ? 6.399   -4.839  0.171   1.00 0.00 ? 16 ILE A C    4 
ATOM 1051 O O    . ILE A 1 16 ? 6.573   -4.182  1.194   1.00 0.00 ? 16 ILE A O    4 
ATOM 1052 C CB   . ILE A 1 16 ? 7.119   -3.804  -1.950  1.00 0.00 ? 16 ILE A CB   4 
ATOM 1053 C CG1  . ILE A 1 16 ? 8.259   -3.661  -2.961  1.00 0.00 ? 16 ILE A CG1  4 
ATOM 1054 C CG2  . ILE A 1 16 ? 6.909   -2.462  -1.267  1.00 0.00 ? 16 ILE A CG2  4 
ATOM 1055 C CD1  . ILE A 1 16 ? 7.913   -2.797  -4.153  1.00 0.00 ? 16 ILE A CD1  4 
ATOM 1056 H H    . ILE A 1 16 ? 7.155   -6.314  -2.459  1.00 0.00 ? 16 ILE A H    4 
ATOM 1057 H HA   . ILE A 1 16 ? 8.431   -4.679  -0.475  1.00 0.00 ? 16 ILE A HA   4 
ATOM 1058 H HB   . ILE A 1 16 ? 6.207   -4.087  -2.474  1.00 0.00 ? 16 ILE A HB   4 
ATOM 1059 H HG12 . ILE A 1 16 ? 9.116   -3.218  -2.453  1.00 0.00 ? 16 ILE A HG12 4 
ATOM 1060 H HG13 . ILE A 1 16 ? 8.525   -4.654  -3.322  1.00 0.00 ? 16 ILE A HG13 4 
ATOM 1061 H HG21 . ILE A 1 16 ? 6.662   -1.704  -2.009  1.00 0.00 ? 16 ILE A HG21 4 
ATOM 1062 H HG22 . ILE A 1 16 ? 6.093   -2.545  -0.549  1.00 0.00 ? 16 ILE A HG22 4 
ATOM 1063 H HG23 . ILE A 1 16 ? 7.822   -2.174  -0.746  1.00 0.00 ? 16 ILE A HG23 4 
ATOM 1064 H HD11 . ILE A 1 16 ? 8.760   -2.731  -4.835  1.00 0.00 ? 16 ILE A HD11 4 
ATOM 1065 H HD12 . ILE A 1 16 ? 7.064   -3.233  -4.679  1.00 0.00 ? 16 ILE A HD12 4 
ATOM 1066 H HD13 . ILE A 1 16 ? 7.653   -1.796  -3.808  1.00 0.00 ? 16 ILE A HD13 4 
ATOM 1067 N N    . ILE A 1 17 ? 5.310   -5.540  -0.072  1.00 0.00 ? 17 ILE A N    4 
ATOM 1068 C CA   . ILE A 1 17 ? 4.205   -5.593  0.868   1.00 0.00 ? 17 ILE A CA   4 
ATOM 1069 C C    . ILE A 1 17 ? 4.606   -6.326  2.132   1.00 0.00 ? 17 ILE A C    4 
ATOM 1070 O O    . ILE A 1 17 ? 4.345   -5.863  3.240   1.00 0.00 ? 17 ILE A O    4 
ATOM 1071 C CB   . ILE A 1 17 ? 2.989   -6.324  0.269   1.00 0.00 ? 17 ILE A CB   4 
ATOM 1072 C CG1  . ILE A 1 17 ? 2.400   -5.517  -0.891  1.00 0.00 ? 17 ILE A CG1  4 
ATOM 1073 C CG2  . ILE A 1 17 ? 1.908   -6.512  1.323   1.00 0.00 ? 17 ILE A CG2  4 
ATOM 1074 C CD1  . ILE A 1 17 ? 1.362   -6.270  -1.693  1.00 0.00 ? 17 ILE A CD1  4 
ATOM 1075 H H    . ILE A 1 17 ? 5.232   -6.061  -0.934  1.00 0.00 ? 17 ILE A H    4 
ATOM 1076 H HA   . ILE A 1 17 ? 3.920   -4.571  1.119   1.00 0.00 ? 17 ILE A HA   4 
ATOM 1077 H HB   . ILE A 1 17 ? 3.309   -7.300  -0.096  1.00 0.00 ? 17 ILE A HB   4 
ATOM 1078 H HG12 . ILE A 1 17 ? 1.935   -4.619  -0.484  1.00 0.00 ? 17 ILE A HG12 4 
ATOM 1079 H HG13 . ILE A 1 17 ? 3.213   -5.234  -1.560  1.00 0.00 ? 17 ILE A HG13 4 
ATOM 1080 H HG21 . ILE A 1 17 ? 1.058   -7.039  0.891   1.00 0.00 ? 17 ILE A HG21 4 
ATOM 1081 H HG22 . ILE A 1 17 ? 2.309   -7.094  2.153   1.00 0.00 ? 17 ILE A HG22 4 
ATOM 1082 H HG23 . ILE A 1 17 ? 1.583   -5.537  1.687   1.00 0.00 ? 17 ILE A HG23 4 
ATOM 1083 H HD11 . ILE A 1 17 ? 0.979   -5.648  -2.501  1.00 0.00 ? 17 ILE A HD11 4 
ATOM 1084 H HD12 . ILE A 1 17 ? 1.815   -7.167  -2.116  1.00 0.00 ? 17 ILE A HD12 4 
ATOM 1085 H HD13 . ILE A 1 17 ? 0.538   -6.554  -1.038  1.00 0.00 ? 17 ILE A HD13 4 
ATOM 1086 N N    . ALA A 1 18 ? 5.233   -7.458  1.949   1.00 0.00 ? 18 ALA A N    4 
ATOM 1087 C CA   . ALA A 1 18 ? 5.682   -8.279  3.061   1.00 0.00 ? 18 ALA A CA   4 
ATOM 1088 C C    . ALA A 1 18 ? 6.769   -7.582  3.836   1.00 0.00 ? 18 ALA A C    4 
ATOM 1089 O O    . ALA A 1 18 ? 6.655   -7.380  5.042   1.00 0.00 ? 18 ALA A O    4 
ATOM 1090 C CB   . ALA A 1 18 ? 6.231   -9.604  2.554   1.00 0.00 ? 18 ALA A CB   4 
ATOM 1091 H H    . ALA A 1 18 ? 5.416   -7.782  1.011   1.00 0.00 ? 18 ALA A H    4 
ATOM 1092 H HA   . ALA A 1 18 ? 4.835   -8.468  3.720   1.00 0.00 ? 18 ALA A HA   4 
ATOM 1093 H HB1  . ALA A 1 18 ? 6.550   -10.219 3.396   1.00 0.00 ? 18 ALA A HB1  4 
ATOM 1094 H HB2  . ALA A 1 18 ? 5.455   -10.129 1.998   1.00 0.00 ? 18 ALA A HB2  4 
ATOM 1095 H HB3  . ALA A 1 18 ? 7.084   -9.417  1.901   1.00 0.00 ? 18 ALA A HB3  4 
ATOM 1096 N N    . ILE A 1 19 ? 7.817   -7.221  3.132   1.00 0.00 ? 19 ILE A N    4 
ATOM 1097 C CA   . ILE A 1 19 ? 8.943   -6.543  3.731   1.00 0.00 ? 19 ILE A CA   4 
ATOM 1098 C C    . ILE A 1 19 ? 8.487   -5.344  4.517   1.00 0.00 ? 19 ILE A C    4 
ATOM 1099 O O    . ILE A 1 19 ? 8.884   -5.146  5.663   1.00 0.00 ? 19 ILE A O    4 
ATOM 1100 C CB   . ILE A 1 19 ? 9.940   -6.054  2.664   1.00 0.00 ? 19 ILE A CB   4 
ATOM 1101 C CG1  . ILE A 1 19 ? 10.611  -7.244  1.975   1.00 0.00 ? 19 ILE A CG1  4 
ATOM 1102 C CG2  . ILE A 1 19 ? 11.021  -5.193  3.300   1.00 0.00 ? 19 ILE A CG2  4 
ATOM 1103 C CD1  . ILE A 1 19 ? 11.417  -6.867  0.752   1.00 0.00 ? 19 ILE A CD1  4 
ATOM 1104 H H    . ILE A 1 19 ? 7.847   -7.417  2.142   1.00 0.00 ? 19 ILE A H    4 
ATOM 1105 H HA   . ILE A 1 19 ? 9.448   -7.241  4.399   1.00 0.00 ? 19 ILE A HA   4 
ATOM 1106 H HB   . ILE A 1 19 ? 9.402   -5.465  1.922   1.00 0.00 ? 19 ILE A HB   4 
ATOM 1107 H HG12 . ILE A 1 19 ? 11.278  -7.725  2.691   1.00 0.00 ? 19 ILE A HG12 4 
ATOM 1108 H HG13 . ILE A 1 19 ? 9.836   -7.948  1.672   1.00 0.00 ? 19 ILE A HG13 4 
ATOM 1109 H HG21 . ILE A 1 19 ? 11.715  -4.845  2.535   1.00 0.00 ? 19 ILE A HG21 4 
ATOM 1110 H HG22 . ILE A 1 19 ? 10.560  -4.334  3.788   1.00 0.00 ? 19 ILE A HG22 4 
ATOM 1111 H HG23 . ILE A 1 19 ? 11.565  -5.781  4.040   1.00 0.00 ? 19 ILE A HG23 4 
ATOM 1112 H HD11 . ILE A 1 19 ? 11.871  -7.752  0.306   1.00 0.00 ? 19 ILE A HD11 4 
ATOM 1113 H HD12 . ILE A 1 19 ? 10.762  -6.394  0.021   1.00 0.00 ? 19 ILE A HD12 4 
ATOM 1114 H HD13 . ILE A 1 19 ? 12.204  -6.169  1.041   1.00 0.00 ? 19 ILE A HD13 4 
ATOM 1115 N N    . VAL A 1 20 ? 7.650   -4.551  3.884   1.00 0.00 ? 20 VAL A N    4 
ATOM 1116 C CA   . VAL A 1 20 ? 7.120   -3.359  4.501   1.00 0.00 ? 20 VAL A CA   4 
ATOM 1117 C C    . VAL A 1 20 ? 6.294   -3.705  5.718   1.00 0.00 ? 20 VAL A C    4 
ATOM 1118 O O    . VAL A 1 20 ? 6.439   -3.098  6.776   1.00 0.00 ? 20 VAL A O    4 
ATOM 1119 C CB   . VAL A 1 20 ? 6.218   -2.574  3.530   1.00 0.00 ? 20 VAL A CB   4 
ATOM 1120 C CG1  . VAL A 1 20 ? 5.510   -1.442  4.258   1.00 0.00 ? 20 VAL A CG1  4 
ATOM 1121 C CG2  . VAL A 1 20 ? 7.044   -1.977  2.401   1.00 0.00 ? 20 VAL A CG2  4 
ATOM 1122 H H    . VAL A 1 20 ? 7.364   -4.772  2.942   1.00 0.00 ? 20 VAL A H    4 
ATOM 1123 H HA   . VAL A 1 20 ? 7.957   -2.728  4.801   1.00 0.00 ? 20 VAL A HA   4 
ATOM 1124 H HB   . VAL A 1 20 ? 5.475   -3.253  3.112   1.00 0.00 ? 20 VAL A HB   4 
ATOM 1125 H HG11 . VAL A 1 20 ? 4.869   -0.900  3.564   1.00 0.00 ? 20 VAL A HG11 4 
ATOM 1126 H HG12 . VAL A 1 20 ? 4.903   -1.854  5.065   1.00 0.00 ? 20 VAL A HG12 4 
ATOM 1127 H HG13 . VAL A 1 20 ? 6.251   -0.759  4.674   1.00 0.00 ? 20 VAL A HG13 4 
ATOM 1128 H HG21 . VAL A 1 20 ? 6.395   -1.432  1.717   1.00 0.00 ? 20 VAL A HG21 4 
ATOM 1129 H HG22 . VAL A 1 20 ? 7.786   -1.295  2.817   1.00 0.00 ? 20 VAL A HG22 4 
ATOM 1130 H HG23 . VAL A 1 20 ? 7.550   -2.777  1.860   1.00 0.00 ? 20 VAL A HG23 4 
ATOM 1131 N N    . VAL A 1 21 ? 5.435   -4.680  5.549   1.00 0.00 ? 21 VAL A N    4 
ATOM 1132 C CA   . VAL A 1 21 ? 4.570   -5.130  6.620   1.00 0.00 ? 21 VAL A CA   4 
ATOM 1133 C C    . VAL A 1 21 ? 5.366   -5.759  7.734   1.00 0.00 ? 21 VAL A C    4 
ATOM 1134 O O    . VAL A 1 21 ? 5.286   -5.342  8.887   1.00 0.00 ? 21 VAL A O    4 
ATOM 1135 C CB   . VAL A 1 21 ? 3.556   -6.178  6.124   1.00 0.00 ? 21 VAL A CB   4 
ATOM 1136 C CG1  . VAL A 1 21 ? 2.760   -6.743  7.291   1.00 0.00 ? 21 VAL A CG1  4 
ATOM 1137 C CG2  . VAL A 1 21 ? 2.584   -5.553  5.136   1.00 0.00 ? 21 VAL A CG2  4 
ATOM 1138 H H    . VAL A 1 21 ? 5.366   -5.138  4.652   1.00 0.00 ? 21 VAL A H    4 
ATOM 1139 H HA   . VAL A 1 21 ? 4.031   -4.266  7.008   1.00 0.00 ? 21 VAL A HA   4 
ATOM 1140 H HB   . VAL A 1 21 ? 4.098   -6.987  5.633   1.00 0.00 ? 21 VAL A HB   4 
ATOM 1141 H HG11 . VAL A 1 21 ? 2.053   -7.489  6.930   1.00 0.00 ? 21 VAL A HG11 4 
ATOM 1142 H HG12 . VAL A 1 21 ? 3.442   -7.207  8.004   1.00 0.00 ? 21 VAL A HG12 4 
ATOM 1143 H HG13 . VAL A 1 21 ? 2.215   -5.937  7.782   1.00 0.00 ? 21 VAL A HG13 4 
ATOM 1144 H HG21 . VAL A 1 21 ? 1.878   -6.306  4.786   1.00 0.00 ? 21 VAL A HG21 4 
ATOM 1145 H HG22 . VAL A 1 21 ? 2.039   -4.746  5.626   1.00 0.00 ? 21 VAL A HG22 4 
ATOM 1146 H HG23 . VAL A 1 21 ? 3.138   -5.154  4.287   1.00 0.00 ? 21 VAL A HG23 4 
ATOM 1147 N N    . TRP A 1 22 ? 6.126   -6.756  7.369   1.00 0.00 ? 22 TRP A N    4 
ATOM 1148 C CA   . TRP A 1 22 ? 6.951   -7.463  8.319   1.00 0.00 ? 22 TRP A CA   4 
ATOM 1149 C C    . TRP A 1 22 ? 7.804   -6.512  9.102   1.00 0.00 ? 22 TRP A C    4 
ATOM 1150 O O    . TRP A 1 22 ? 8.093   -6.731  10.276  1.00 0.00 ? 22 TRP A O    4 
ATOM 1151 C CB   . TRP A 1 22 ? 7.873   -8.448  7.599   1.00 0.00 ? 22 TRP A CB   4 
ATOM 1152 C CG   . TRP A 1 22 ? 8.746   -9.239  8.524   1.00 0.00 ? 22 TRP A CG   4 
ATOM 1153 C CD1  . TRP A 1 22 ? 8.418   -10.393 9.175   1.00 0.00 ? 22 TRP A CD1  4 
ATOM 1154 C CD2  . TRP A 1 22 ? 10.094  -8.933  8.903   1.00 0.00 ? 22 TRP A CD2  4 
ATOM 1155 N NE1  . TRP A 1 22 ? 9.476   -10.827 9.936   1.00 0.00 ? 22 TRP A NE1  4 
ATOM 1156 C CE2  . TRP A 1 22 ? 10.519  -9.946  9.786   1.00 0.00 ? 22 TRP A CE2  4 
ATOM 1157 C CE3  . TRP A 1 22 ? 10.983  -7.903  8.583   1.00 0.00 ? 22 TRP A CE3  4 
ATOM 1158 C CZ2  . TRP A 1 22 ? 11.793  -9.959  10.351  1.00 0.00 ? 22 TRP A CZ2  4 
ATOM 1159 C CZ3  . TRP A 1 22 ? 12.245  -7.919  9.146   1.00 0.00 ? 22 TRP A CZ3  4 
ATOM 1160 C CH2  . TRP A 1 22 ? 12.641  -8.938  10.020  1.00 0.00 ? 22 TRP A CH2  4 
ATOM 1161 H H    . TRP A 1 22 ? 6.146   -7.047  6.403   1.00 0.00 ? 22 TRP A H    4 
ATOM 1162 H HA   . TRP A 1 22 ? 6.302   -8.011  9.003   1.00 0.00 ? 22 TRP A HA   4 
ATOM 1163 H HB2  . TRP A 1 22 ? 7.261   -9.140  7.022   1.00 0.00 ? 22 TRP A HB2  4 
ATOM 1164 H HB3  . TRP A 1 22 ? 8.509   -7.892  6.911   1.00 0.00 ? 22 TRP A HB3  4 
ATOM 1165 H HD1  . TRP A 1 22 ? 7.464   -10.893 9.103   1.00 0.00 ? 22 TRP A HD1  4 
ATOM 1166 H HE1  . TRP A 1 22 ? 9.460   -11.662 10.504  1.00 0.00 ? 22 TRP A HE1  4 
ATOM 1167 H HE3  . TRP A 1 22 ? 10.690  -7.111  7.910   1.00 0.00 ? 22 TRP A HE3  4 
ATOM 1168 H HZ2  . TRP A 1 22 ? 12.099  -10.746 11.025  1.00 0.00 ? 22 TRP A HZ2  4 
ATOM 1169 H HZ3  . TRP A 1 22 ? 12.941  -7.128  8.907   1.00 0.00 ? 22 TRP A HZ3  4 
ATOM 1170 H HH2  . TRP A 1 22 ? 13.636  -8.918  10.442  1.00 0.00 ? 22 TRP A HH2  4 
ATOM 1171 N N    . SER A 1 23 ? 8.200   -5.456  8.435   1.00 0.00 ? 23 SER A N    4 
ATOM 1172 C CA   . SER A 1 23 ? 9.025   -4.451  9.045   1.00 0.00 ? 23 SER A CA   4 
ATOM 1173 C C    . SER A 1 23 ? 8.255   -3.684  10.085  1.00 0.00 ? 23 SER A C    4 
ATOM 1174 O O    . SER A 1 23 ? 8.756   -3.406  11.172  1.00 0.00 ? 23 SER A O    4 
ATOM 1175 C CB   . SER A 1 23 ? 9.527   -3.460  7.994   1.00 0.00 ? 23 SER A CB   4 
ATOM 1176 O OG   . SER A 1 23 ? 10.334  -2.455  8.584   1.00 0.00 ? 23 SER A OG   4 
ATOM 1177 H H    . SER A 1 23 ? 7.925   -5.335  7.471   1.00 0.00 ? 23 SER A H    4 
ATOM 1178 H HA   . SER A 1 23 ? 9.878   -4.940  9.516   1.00 0.00 ? 23 SER A HA   4 
ATOM 1179 H HB2  . SER A 1 23 ? 10.116  -3.997  7.251   1.00 0.00 ? 23 SER A HB2  4 
ATOM 1180 H HB3  . SER A 1 23 ? 8.672   -2.990  7.511   1.00 0.00 ? 23 SER A HB3  4 
ATOM 1181 H HG   . SER A 1 23 ? 10.632  -1.852  7.899   1.00 0.00 ? 23 SER A HG   4 
ATOM 1182 N N    . ILE A 1 24 ? 7.042   -3.352  9.736   1.00 0.00 ? 24 ILE A N    4 
ATOM 1183 C CA   . ILE A 1 24 ? 6.176   -2.615  10.623  1.00 0.00 ? 24 ILE A CA   4 
ATOM 1184 C C    . ILE A 1 24 ? 6.041   -3.306  11.961  1.00 0.00 ? 24 ILE A C    4 
ATOM 1185 O O    . ILE A 1 24 ? 6.145   -2.678  13.012  1.00 0.00 ? 24 ILE A O    4 
ATOM 1186 C CB   . ILE A 1 24 ? 4.760   -2.467  10.035  1.00 0.00 ? 24 ILE A CB   4 
ATOM 1187 C CG1  . ILE A 1 24 ? 4.789   -1.570  8.796   1.00 0.00 ? 24 ILE A CG1  4 
ATOM 1188 C CG2  . ILE A 1 24 ? 3.821   -1.845  11.058  1.00 0.00 ? 24 ILE A CG2  4 
ATOM 1189 C CD1  . ILE A 1 24 ? 3.493   -1.568  8.014   1.00 0.00 ? 24 ILE A CD1  4 
ATOM 1190 H H    . ILE A 1 24 ? 6.691   -3.613  8.826   1.00 0.00 ? 24 ILE A H    4 
ATOM 1191 H HA   . ILE A 1 24 ? 6.607   -1.625  10.773  1.00 0.00 ? 24 ILE A HA   4 
ATOM 1192 H HB   . ILE A 1 24 ? 4.388   -3.453  9.758   1.00 0.00 ? 24 ILE A HB   4 
ATOM 1193 H HG12 . ILE A 1 24 ? 5.000   -0.549  9.115   1.00 0.00 ? 24 ILE A HG12 4 
ATOM 1194 H HG13 . ILE A 1 24 ? 5.587   -1.917  8.139   1.00 0.00 ? 24 ILE A HG13 4 
ATOM 1195 H HG21 . ILE A 1 24 ? 2.821   -1.754  10.635  1.00 0.00 ? 24 ILE A HG21 4 
ATOM 1196 H HG22 . ILE A 1 24 ? 3.782   -2.478  11.945  1.00 0.00 ? 24 ILE A HG22 4 
ATOM 1197 H HG23 . ILE A 1 24 ? 4.189   -0.856  11.333  1.00 0.00 ? 24 ILE A HG23 4 
ATOM 1198 H HD11 . ILE A 1 24 ? 3.571   -0.913  7.147   1.00 0.00 ? 24 ILE A HD11 4 
ATOM 1199 H HD12 . ILE A 1 24 ? 3.274   -2.582  7.678   1.00 0.00 ? 24 ILE A HD12 4 
ATOM 1200 H HD13 . ILE A 1 24 ? 2.686   -1.215  8.656   1.00 0.00 ? 24 ILE A HD13 4 
ATOM 1201 N N    . VAL A 1 25 ? 5.813   -4.579  11.904  1.00 0.00 ? 25 VAL A N    4 
ATOM 1202 C CA   . VAL A 1 25 ? 5.658   -5.382  13.101  1.00 0.00 ? 25 VAL A CA   4 
ATOM 1203 C C    . VAL A 1 25 ? 5.403   -6.833  12.719  1.00 0.00 ? 25 VAL A C    4 
ATOM 1204 O O    . VAL A 1 25 ? 5.353   -7.166  11.537  1.00 0.00 ? 25 VAL A O    4 
ATOM 1205 C CB   . VAL A 1 25 ? 4.506   -4.832  13.937  1.00 0.00 ? 25 VAL A CB   4 
ATOM 1206 C CG1  . VAL A 1 25 ? 4.355   -5.665  15.207  1.00 0.00 ? 25 VAL A CG1  4 
ATOM 1207 C CG2  . VAL A 1 25 ? 4.798   -3.382  14.312  1.00 0.00 ? 25 VAL A CG2  4 
ATOM 1208 H H    . VAL A 1 25 ? 5.739   -5.036  11.007  1.00 0.00 ? 25 VAL A H    4 
ATOM 1209 H HA   . VAL A 1 25 ? 6.578   -5.326  13.685  1.00 0.00 ? 25 VAL A HA   4 
ATOM 1210 H HB   . VAL A 1 25 ? 3.583   -4.879  13.359  1.00 0.00 ? 25 VAL A HB   4 
ATOM 1211 H HG11 . VAL A 1 25 ? 3.532   -5.272  15.803  1.00 0.00 ? 25 VAL A HG11 4 
ATOM 1212 H HG12 . VAL A 1 25 ? 4.147   -6.701  14.939  1.00 0.00 ? 25 VAL A HG12 4 
ATOM 1213 H HG13 . VAL A 1 25 ? 5.278   -5.618  15.785  1.00 0.00 ? 25 VAL A HG13 4 
ATOM 1214 H HG21 . VAL A 1 25 ? 3.975   -2.988  14.909  1.00 0.00 ? 25 VAL A HG21 4 
ATOM 1215 H HG22 . VAL A 1 25 ? 5.721   -3.335  14.890  1.00 0.00 ? 25 VAL A HG22 4 
ATOM 1216 H HG23 . VAL A 1 25 ? 4.907   -2.787  13.406  1.00 0.00 ? 25 VAL A HG23 4 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  ?  ?   ?   A . n 
A 1 2  GLN 2  2  ?  ?   ?   A . n 
A 1 3  PRO 3  3  ?  ?   ?   A . n 
A 1 4  ILE 4  4  ?  ?   ?   A . n 
A 1 5  GLN 5  5  ?  ?   ?   A . n 
A 1 6  ILE 6  6  ?  ?   ?   A . n 
A 1 7  ALA 7  7  7  ALA ALA A . n 
A 1 8  ILE 8  8  8  ILE ILE A . n 
A 1 9  VAL 9  9  9  VAL VAL A . n 
A 1 10 ALA 10 10 10 ALA ALA A . n 
A 1 11 LEU 11 11 11 LEU LEU A . n 
A 1 12 VAL 12 12 12 VAL VAL A . n 
A 1 13 VAL 13 13 13 VAL VAL A . n 
A 1 14 ALA 14 14 14 ALA ALA A . n 
A 1 15 ILE 15 15 15 ILE ILE A . n 
A 1 16 ILE 16 16 16 ILE ILE A . n 
A 1 17 ILE 17 17 17 ILE ILE A . n 
A 1 18 ALA 18 18 18 ALA ALA A . n 
A 1 19 ILE 19 19 19 ILE ILE A . n 
A 1 20 VAL 20 20 20 VAL VAL A . n 
A 1 21 VAL 21 21 21 VAL VAL A . n 
A 1 22 TRP 22 22 22 TRP TRP A . n 
A 1 23 SER 23 23 23 SER SER A . n 
A 1 24 ILE 24 24 24 ILE ILE A . n 
A 1 25 VAL 25 25 25 VAL VAL A . n 
A 1 26 ILE 26 26 ?  ?   ?   A . n 
A 1 27 ILE 27 27 ?  ?   ?   A . n 
A 1 28 GLU 28 28 ?  ?   ?   A . n 
A 1 29 GLY 29 29 ?  ?   ?   A . n 
A 1 30 ARG 30 30 ?  ?   ?   A . n 
A 1 31 GLY 31 31 ?  ?   ?   A . n 
A 1 32 GLY 32 32 ?  ?   ?   A . n 
A 1 33 LYS 33 33 ?  ?   ?   A . n 
A 1 34 LYS 34 34 ?  ?   ?   A . n 
A 1 35 LYS 35 35 ?  ?   ?   A . n 
A 1 36 LYS 36 36 ?  ?   ?   A . n 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-11-11 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O A ILE 24 ? ? HG23 A VAL 25 ? ? 1.30 
2  1 O A LEU 11 ? ? H    A ILE 15 ? ? 1.46 
3  1 O A ALA 18 ? ? H    A TRP 22 ? ? 1.49 
4  1 O A VAL 13 ? ? HG13 A ILE 17 ? ? 1.54 
5  2 O A ILE 24 ? ? HG23 A VAL 25 ? ? 1.30 
6  2 O A LEU 11 ? ? H    A ILE 15 ? ? 1.46 
7  2 O A ALA 18 ? ? H    A TRP 22 ? ? 1.49 
8  2 O A VAL 13 ? ? HG13 A ILE 17 ? ? 1.54 
9  3 O A ILE 24 ? ? HG23 A VAL 25 ? ? 1.30 
10 3 O A LEU 11 ? ? H    A ILE 15 ? ? 1.46 
11 3 O A ALA 18 ? ? H    A TRP 22 ? ? 1.49 
12 3 O A VAL 13 ? ? HG13 A ILE 17 ? ? 1.54 
13 4 O A ILE 24 ? ? HG23 A VAL 25 ? ? 1.30 
14 4 O A LEU 11 ? ? H    A ILE 15 ? ? 1.46 
15 4 O A ALA 18 ? ? H    A TRP 22 ? ? 1.49 
16 4 O A VAL 13 ? ? HG13 A ILE 17 ? ? 1.54 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1  ? A MET 1  
2  1 Y 1 A GLN 2  ? A GLN 2  
3  1 Y 1 A PRO 3  ? A PRO 3  
4  1 Y 1 A ILE 4  ? A ILE 4  
5  1 Y 1 A GLN 5  ? A GLN 5  
6  1 Y 1 A ILE 6  ? A ILE 6  
7  1 Y 1 A ILE 26 ? A ILE 26 
8  1 Y 1 A ILE 27 ? A ILE 27 
9  1 Y 1 A GLU 28 ? A GLU 28 
10 1 Y 1 A GLY 29 ? A GLY 29 
11 1 Y 1 A ARG 30 ? A ARG 30 
12 1 Y 1 A GLY 31 ? A GLY 31 
13 1 Y 1 A GLY 32 ? A GLY 32 
14 1 Y 1 A LYS 33 ? A LYS 33 
15 1 Y 1 A LYS 34 ? A LYS 34 
16 1 Y 1 A LYS 35 ? A LYS 35 
17 1 Y 1 A LYS 36 ? A LYS 36 
18 2 Y 1 A MET 1  ? A MET 1  
19 2 Y 1 A GLN 2  ? A GLN 2  
20 2 Y 1 A PRO 3  ? A PRO 3  
21 2 Y 1 A ILE 4  ? A ILE 4  
22 2 Y 1 A GLN 5  ? A GLN 5  
23 2 Y 1 A ILE 6  ? A ILE 6  
24 2 Y 1 A ILE 26 ? A ILE 26 
25 2 Y 1 A ILE 27 ? A ILE 27 
26 2 Y 1 A GLU 28 ? A GLU 28 
27 2 Y 1 A GLY 29 ? A GLY 29 
28 2 Y 1 A ARG 30 ? A ARG 30 
29 2 Y 1 A GLY 31 ? A GLY 31 
30 2 Y 1 A GLY 32 ? A GLY 32 
31 2 Y 1 A LYS 33 ? A LYS 33 
32 2 Y 1 A LYS 34 ? A LYS 34 
33 2 Y 1 A LYS 35 ? A LYS 35 
34 2 Y 1 A LYS 36 ? A LYS 36 
35 3 Y 1 A MET 1  ? A MET 1  
36 3 Y 1 A GLN 2  ? A GLN 2  
37 3 Y 1 A PRO 3  ? A PRO 3  
38 3 Y 1 A ILE 4  ? A ILE 4  
39 3 Y 1 A GLN 5  ? A GLN 5  
40 3 Y 1 A ILE 6  ? A ILE 6  
41 3 Y 1 A ILE 26 ? A ILE 26 
42 3 Y 1 A ILE 27 ? A ILE 27 
43 3 Y 1 A GLU 28 ? A GLU 28 
44 3 Y 1 A GLY 29 ? A GLY 29 
45 3 Y 1 A ARG 30 ? A ARG 30 
46 3 Y 1 A GLY 31 ? A GLY 31 
47 3 Y 1 A GLY 32 ? A GLY 32 
48 3 Y 1 A LYS 33 ? A LYS 33 
49 3 Y 1 A LYS 34 ? A LYS 34 
50 3 Y 1 A LYS 35 ? A LYS 35 
51 3 Y 1 A LYS 36 ? A LYS 36 
52 4 Y 1 A MET 1  ? A MET 1  
53 4 Y 1 A GLN 2  ? A GLN 2  
54 4 Y 1 A PRO 3  ? A PRO 3  
55 4 Y 1 A ILE 4  ? A ILE 4  
56 4 Y 1 A GLN 5  ? A GLN 5  
57 4 Y 1 A ILE 6  ? A ILE 6  
58 4 Y 1 A ILE 26 ? A ILE 26 
59 4 Y 1 A ILE 27 ? A ILE 27 
60 4 Y 1 A GLU 28 ? A GLU 28 
61 4 Y 1 A GLY 29 ? A GLY 29 
62 4 Y 1 A ARG 30 ? A ARG 30 
63 4 Y 1 A GLY 31 ? A GLY 31 
64 4 Y 1 A GLY 32 ? A GLY 32 
65 4 Y 1 A LYS 33 ? A LYS 33 
66 4 Y 1 A LYS 34 ? A LYS 34 
67 4 Y 1 A LYS 35 ? A LYS 35 
68 4 Y 1 A LYS 36 ? A LYS 36 
#