data_1PJF
# 
_entry.id   1PJF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1PJF         
RCSB  RCSB019360   
WWPDB D_1000019360 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1PJF 
_pdbx_database_status.recvd_initial_deposition_date   2003-06-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Thiriot, D.S.'  1 
'Nevzorov, A.A.' 2 
'Zagyanskiy, L.' 3 
'Wu, C.H.'       4 
'Opella, S.J.'   5 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the coat protein in Pf1 bacteriophage determined by solid-state NMR spectroscopy.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            341 
_citation.page_first                869 
_citation.page_last                 879 
_citation.year                      2004 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15288792 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2004.06.038 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Thiriot, D.S.'  1 
primary 'Nevzorov, A.A.' 2 
primary 'Zagyanskiy, L.' 3 
primary 'Wu, C.H.'       4 
primary 'Opella, S.J.'   5 
# 
_cell.entry_id           1PJF 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1PJF 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 nat 
_entity.pdbx_description           'COAT PROTEIN B' 
_entity.formula_weight             4612.393 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Major coat protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA 
_entity_poly.pdbx_seq_one_letter_code_can   GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  VAL n 
1 3  ILE n 
1 4  ASP n 
1 5  THR n 
1 6  SER n 
1 7  ALA n 
1 8  VAL n 
1 9  GLU n 
1 10 SER n 
1 11 ALA n 
1 12 ILE n 
1 13 THR n 
1 14 ASP n 
1 15 GLY n 
1 16 GLN n 
1 17 GLY n 
1 18 ASP n 
1 19 MET n 
1 20 LYS n 
1 21 ALA n 
1 22 ILE n 
1 23 GLY n 
1 24 GLY n 
1 25 TYR n 
1 26 ILE n 
1 27 VAL n 
1 28 GLY n 
1 29 ALA n 
1 30 LEU n 
1 31 VAL n 
1 32 ILE n 
1 33 LEU n 
1 34 ALA n 
1 35 VAL n 
1 36 ALA n 
1 37 GLY n 
1 38 LEU n 
1 39 ILE n 
1 40 TYR n 
1 41 SER n 
1 42 MET n 
1 43 LEU n 
1 44 ARG n 
1 45 LYS n 
1 46 ALA n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Pseudomonas phage Pf1' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      10871 
_entity_src_nat.genus                      Inovirus 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    'Pseudomonas aeruginosa (ATCC #25102) was the host bacteria.' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    COATB_BPPF1 
_struct_ref.pdbx_db_accession          P03621 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA 
_struct_ref.pdbx_align_begin           37 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1PJF 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 46 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P03621 
_struct_ref_seq.db_align_beg                  37 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  82 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       46 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl.experiment_id   1 
_pdbx_nmr_exptl.conditions_id   1 
_pdbx_nmr_exptl.type            PISEMA 
_pdbx_nmr_exptl.solution_id     1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.pressure            AMBIENT 
_pdbx_nmr_exptl_sample_conditions.pH                  8 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '50 MG/ML PF1 MAJOR COAT PROTEIN, U-15N, 5 MM SODIUM BORATE BUFFER' 
_pdbx_nmr_sample_details.solvent_system   ? 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    750 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           1PJF 
_pdbx_nmr_refine.method             
'CONSTRUCTION OF BACTERIOPHAGE MODEL BASED ON THE SOLID STATE NMR STRUCTURE OF THE MAJOR COAT PROTEIN MONOMER' 
_pdbx_nmr_refine.details            
;SIDECHAINS WERE ADDED TO THE SOLID STATE NMR BACKBONE STRUCTURE USING THE PROGRAM SCWRL. A BACTERIOPHAGE MODEL WAS CONSTRUCTED BY APPLYING PUBLISHED X- RAY FIBER AND NEUTRON DIFFRACTION SYMMETRY AND DISTANCE CONSTRAINTS (INITIAL PHAGE), WHICH WAS FURTHER REFINED BY COMPARING THE REPULSIVE AMBER ENERGY (USING SCWRL) OF MANY CONFIGURATIONS IN WHICH THE MONOMERS HAD BEEN SYMMETRICALLY ROTATED AND TRANSLATED WITH RESPECT TO THE INITIAL PHAGE.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1PJF 
_pdbx_nmr_details.text       
;MODEL 1 IS THE BASIC SOLID-STATE NMR STRUCTURE (NO SIDECHAINS), WHILE MODELS 2-27 ARE IDENTICAL TRANSLATED AND ROTATED COPIES OF MODEL 1 (WITH SIDECHAINS ADDED AND ENERGY MINIMIZED) INCLUDED TO PRESENT THE MODEL OF THE WHOLE BACTERIOPHAGE ASSEMBLY.
;
# 
_pdbx_nmr_ensemble.entry_id                                      1PJF 
_pdbx_nmr_ensemble.conformers_calculated_total_number            116 
_pdbx_nmr_ensemble.conformers_submitted_total_number             27 
_pdbx_nmr_ensemble.conformer_selection_criteria                  ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1PJF 
_pdbx_nmr_representative.conformer_id         ? 
_pdbx_nmr_representative.selection_criteria   
;nearest structure to the average of the 60 best ramachandran structures (based on a statistical ramachandran potential) out of 1000 total structures.
;
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           'MATLAB SCRIPTS 6.5, SCWRL' '2.95 (BLUE HORIZON MODIFIED)' 
'NEVZOROV, THIRIOT (MATLAB SCRIPTS), BOWER, COHEN, DUNBRACK, MAJUMDAR, CHUKKAPALLI (SCWRL)' 1 
'structure solution' FELIX                       2000.1                         ? 2 
'structure solution' XWINNMR                     ?                              ? 3 
'structure solution' 'MATLAB SCRIPT'             6.5                            ? 4 
# 
_exptl.entry_id          1PJF 
_exptl.method            'SOLID-STATE NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1PJF 
_struct.title                     'Solid State NMR structure of the Pf1 Major Coat Protein in Magnetically Aligned Bacteriophage' 
_struct.pdbx_descriptor           'Coat protein B precursor' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1PJF 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
_struct_keywords.text            'Viral protein, Helical virus' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_database_PDB_matrix.entry_id          1PJF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1PJF 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     C CA   . GLY A 1 1  ? -11.318 8.443   27.815  1.00 0.00 ? 1  GLY A CA   1  
ATOM 2     C C    . GLY A 1 1  ? -10.388 8.853   26.685  1.00 0.00 ? 1  GLY A C    1  
ATOM 3     N N    . VAL A 1 2  ? -10.098 10.150  26.620  1.00 0.00 ? 2  VAL A N    1  
ATOM 4     C CA   . VAL A 1 2  ? -9.219  10.702  25.594  1.00 0.00 ? 2  VAL A CA   1  
ATOM 5     C C    . VAL A 1 2  ? -7.784  10.257  25.825  1.00 0.00 ? 2  VAL A C    1  
ATOM 6     N N    . ILE A 1 3  ? -7.360  10.316  27.084  1.00 0.00 ? 3  ILE A N    1  
ATOM 7     C CA   . ILE A 1 3  ? -6.009  9.923   27.471  1.00 0.00 ? 3  ILE A CA   1  
ATOM 8     C C    . ILE A 1 3  ? -5.808  8.431   27.263  1.00 0.00 ? 3  ILE A C    1  
ATOM 9     N N    . ASP A 1 4  ? -6.841  7.661   27.591  1.00 0.00 ? 4  ASP A N    1  
ATOM 10    C CA   . ASP A 1 4  ? -6.807  6.209   27.451  1.00 0.00 ? 4  ASP A CA   1  
ATOM 11    C C    . ASP A 1 4  ? -6.375  5.819   26.046  1.00 0.00 ? 4  ASP A C    1  
ATOM 12    N N    . THR A 1 5  ? -6.886  6.557   25.063  1.00 0.00 ? 5  THR A N    1  
ATOM 13    C CA   . THR A 1 5  ? -6.570  6.311   23.659  1.00 0.00 ? 5  THR A CA   1  
ATOM 14    C C    . THR A 1 5  ? -5.423  7.201   23.208  1.00 0.00 ? 5  THR A C    1  
ATOM 15    N N    . SER A 1 6  ? -4.945  8.033   24.129  1.00 0.00 ? 6  SER A N    1  
ATOM 16    C CA   . SER A 1 6  ? -3.845  8.952   23.853  1.00 0.00 ? 6  SER A CA   1  
ATOM 17    C C    . SER A 1 6  ? -2.694  8.220   23.181  1.00 0.00 ? 6  SER A C    1  
ATOM 18    N N    . ALA A 1 7  ? -2.163  7.221   23.880  1.00 0.00 ? 7  ALA A N    1  
ATOM 19    C CA   . ALA A 1 7  ? -1.052  6.420   23.374  1.00 0.00 ? 7  ALA A CA   1  
ATOM 20    C C    . ALA A 1 7  ? -1.441  5.728   22.077  1.00 0.00 ? 7  ALA A C    1  
ATOM 21    N N    . VAL A 1 8  ? -2.667  5.213   22.046  1.00 0.00 ? 8  VAL A N    1  
ATOM 22    C CA   . VAL A 1 8  ? -3.191  4.518   20.874  1.00 0.00 ? 8  VAL A CA   1  
ATOM 23    C C    . VAL A 1 8  ? -3.276  5.464   19.688  1.00 0.00 ? 8  VAL A C    1  
ATOM 24    N N    . GLU A 1 9  ? -3.725  6.687   19.958  1.00 0.00 ? 9  GLU A N    1  
ATOM 25    C CA   . GLU A 1 9  ? -3.864  7.713   18.928  1.00 0.00 ? 9  GLU A CA   1  
ATOM 26    C C    . GLU A 1 9  ? -2.535  7.951   18.231  1.00 0.00 ? 9  GLU A C    1  
ATOM 27    N N    . SER A 1 10 ? -1.463  7.933   19.017  1.00 0.00 ? 10 SER A N    1  
ATOM 28    C CA   . SER A 1 10 ? -0.113  8.145   18.501  1.00 0.00 ? 10 SER A CA   1  
ATOM 29    C C    . SER A 1 10 ? 0.435   6.862   17.900  1.00 0.00 ? 10 SER A C    1  
ATOM 30    N N    . ALA A 1 11 ? 0.299   5.771   18.651  1.00 0.00 ? 11 ALA A N    1  
ATOM 31    C CA   . ALA A 1 11 ? 0.773   4.461   18.216  1.00 0.00 ? 11 ALA A CA   1  
ATOM 32    C C    . ALA A 1 11 ? -0.028  3.974   17.020  1.00 0.00 ? 11 ALA A C    1  
ATOM 33    N N    . ILE A 1 12 ? -1.332  4.236   17.056  1.00 0.00 ? 12 ILE A N    1  
ATOM 34    C CA   . ILE A 1 12 ? -2.238  3.836   15.985  1.00 0.00 ? 12 ILE A CA   1  
ATOM 35    C C    . ILE A 1 12 ? -1.932  4.607   14.712  1.00 0.00 ? 12 ILE A C    1  
ATOM 36    N N    . THR A 1 13 ? -1.751  5.917   14.863  1.00 0.00 ? 13 THR A N    1  
ATOM 37    C CA   . THR A 1 13 ? -1.450  6.798   13.738  1.00 0.00 ? 13 THR A CA   1  
ATOM 38    C C    . THR A 1 13 ? -0.101  6.445   13.132  1.00 0.00 ? 13 THR A C    1  
ATOM 39    N N    . ASP A 1 14 ? 0.870   6.181   14.003  1.00 0.00 ? 14 ASP A N    1  
ATOM 40    C CA   . ASP A 1 14 ? 2.221   5.826   13.581  1.00 0.00 ? 14 ASP A CA   1  
ATOM 41    C C    . ASP A 1 14 ? 2.230   4.458   12.920  1.00 0.00 ? 14 ASP A C    1  
ATOM 42    N N    . GLY A 1 15 ? 1.624   3.488   13.598  1.00 0.00 ? 15 GLY A N    1  
ATOM 43    C CA   . GLY A 1 15 ? 1.546   2.118   13.098  1.00 0.00 ? 15 GLY A CA   1  
ATOM 44    C C    . GLY A 1 15 ? 0.389   1.972   12.123  1.00 0.00 ? 15 GLY A C    1  
ATOM 45    N N    . GLN A 1 16 ? -0.826  2.083   12.652  1.00 0.00 ? 16 GLN A N    1  
ATOM 46    C CA   . GLN A 1 16 ? -2.040  1.968   11.850  1.00 0.00 ? 16 GLN A CA   1  
ATOM 47    C C    . GLN A 1 16 ? -1.944  2.843   10.610  1.00 0.00 ? 16 GLN A C    1  
ATOM 48    N N    . GLY A 1 17 ? -1.669  4.125   10.832  1.00 0.00 ? 17 GLY A N    1  
ATOM 49    C CA   . GLY A 1 17 ? -1.544  5.094   9.747   1.00 0.00 ? 17 GLY A CA   1  
ATOM 50    C C    . GLY A 1 17 ? -0.584  4.584   8.685   1.00 0.00 ? 17 GLY A C    1  
ATOM 51    N N    . ASP A 1 18 ? 0.568   4.096   9.138   1.00 0.00 ? 18 ASP A N    1  
ATOM 52    C CA   . ASP A 1 18 ? 1.596   3.567   8.246   1.00 0.00 ? 18 ASP A CA   1  
ATOM 53    C C    . ASP A 1 18 ? 1.022   2.467   7.367   1.00 0.00 ? 18 ASP A C    1  
ATOM 54    N N    . MET A 1 19 ? -0.157  1.984   7.746   1.00 0.00 ? 19 MET A N    1  
ATOM 55    C CA   . MET A 1 19 ? -0.841  0.926   7.009   1.00 0.00 ? 19 MET A CA   1  
ATOM 56    C C    . MET A 1 19 ? -1.223  1.407   5.619   1.00 0.00 ? 19 MET A C    1  
ATOM 57    N N    . LYS A 1 20 ? -1.723  2.637   5.554   1.00 0.00 ? 20 LYS A N    1  
ATOM 58    C CA   . LYS A 1 20 ? -2.138  3.245   4.293   1.00 0.00 ? 20 LYS A CA   1  
ATOM 59    C C    . LYS A 1 20 ? -0.979  3.276   3.310   1.00 0.00 ? 20 LYS A C    1  
ATOM 60    N N    . ALA A 1 21 ? 0.201   3.617   3.823   1.00 0.00 ? 21 ALA A N    1  
ATOM 61    C CA   . ALA A 1 21 ? 1.412   3.693   3.011   1.00 0.00 ? 21 ALA A CA   1  
ATOM 62    C C    . ALA A 1 21 ? 1.834   2.307   2.553   1.00 0.00 ? 21 ALA A C    1  
ATOM 63    N N    . ILE A 1 22 ? 1.739   1.345   3.468   1.00 0.00 ? 22 ILE A N    1  
ATOM 64    C CA   . ILE A 1 22 ? 2.106   -0.039  3.185   1.00 0.00 ? 22 ILE A CA   1  
ATOM 65    C C    . ILE A 1 22 ? 1.191   -0.626  2.123   1.00 0.00 ? 22 ILE A C    1  
ATOM 66    N N    . GLY A 1 23 ? -0.111  -0.453  2.327   1.00 0.00 ? 23 GLY A N    1  
ATOM 67    C CA   . GLY A 1 23 ? -1.121  -0.956  1.399   1.00 0.00 ? 23 GLY A CA   1  
ATOM 68    C C    . GLY A 1 23 ? -1.031  -0.227  0.068   1.00 0.00 ? 23 GLY A C    1  
ATOM 69    N N    . GLY A 1 24 ? -0.886  1.093   0.145   1.00 0.00 ? 24 GLY A N    1  
ATOM 70    C CA   . GLY A 1 24 ? -0.785  1.936   -1.042  1.00 0.00 ? 24 GLY A CA   1  
ATOM 71    C C    . GLY A 1 24 ? 0.515   1.663   -1.781  1.00 0.00 ? 24 GLY A C    1  
ATOM 72    N N    . TYR A 1 25 ? 1.623   1.769   -1.053  1.00 0.00 ? 25 TYR A N    1  
ATOM 73    C CA   . TYR A 1 25 ? 2.950   1.538   -1.615  1.00 0.00 ? 25 TYR A CA   1  
ATOM 74    C C    . TYR A 1 25 ? 3.029   0.157   -2.244  1.00 0.00 ? 25 TYR A C    1  
ATOM 75    N N    . ILE A 1 26 ? 2.415   -0.815  -1.576  1.00 0.00 ? 26 ILE A N    1  
ATOM 76    C CA   . ILE A 1 26 ? 2.399   -2.197  -2.048  1.00 0.00 ? 26 ILE A CA   1  
ATOM 77    C C    . ILE A 1 26 ? 1.440   -2.348  -3.218  1.00 0.00 ? 26 ILE A C    1  
ATOM 78    N N    . VAL A 1 27 ? 0.258   -1.757  -3.072  1.00 0.00 ? 27 VAL A N    1  
ATOM 79    C CA   . VAL A 1 27 ? -0.774  -1.810  -4.105  1.00 0.00 ? 27 VAL A CA   1  
ATOM 80    C C    . VAL A 1 27 ? -0.421  -0.881  -5.256  1.00 0.00 ? 27 VAL A C    1  
ATOM 81    N N    . GLY A 1 28 ? 0.276   0.202   -4.928  1.00 0.00 ? 28 GLY A N    1  
ATOM 82    C CA   . GLY A 1 28 ? 0.692   1.192   -5.917  1.00 0.00 ? 28 GLY A CA   1  
ATOM 83    C C    . GLY A 1 28 ? 1.852   0.662   -6.745  1.00 0.00 ? 28 GLY A C    1  
ATOM 84    N N    . ALA A 1 29 ? 2.581   -0.289  -6.169  1.00 0.00 ? 29 ALA A N    1  
ATOM 85    C CA   . ALA A 1 29 ? 3.729   -0.900  -6.831  1.00 0.00 ? 29 ALA A CA   1  
ATOM 86    C C    . ALA A 1 29 ? 3.279   -2.037  -7.736  1.00 0.00 ? 29 ALA A C    1  
ATOM 87    N N    . LEU A 1 30 ? 2.218   -2.719  -7.315  1.00 0.00 ? 30 LEU A N    1  
ATOM 88    C CA   . LEU A 1 30 ? 1.662   -3.839  -8.070  1.00 0.00 ? 30 LEU A CA   1  
ATOM 89    C C    . LEU A 1 30 ? 1.324   -3.409  -9.488  1.00 0.00 ? 30 LEU A C    1  
ATOM 90    N N    . VAL A 1 31 ? 0.963   -2.137  -9.633  1.00 0.00 ? 31 VAL A N    1  
ATOM 91    C CA   . VAL A 1 31 ? 0.608   -1.569  -10.931 1.00 0.00 ? 31 VAL A CA   1  
ATOM 92    C C    . VAL A 1 31 ? 1.728   -1.791  -11.933 1.00 0.00 ? 31 VAL A C    1  
ATOM 93    N N    . ILE A 1 32 ? 2.962   -1.731  -11.439 1.00 0.00 ? 32 ILE A N    1  
ATOM 94    C CA   . ILE A 1 32 ? 4.146   -1.922  -12.272 1.00 0.00 ? 32 ILE A CA   1  
ATOM 95    C C    . ILE A 1 32 ? 4.195   -3.343  -12.810 1.00 0.00 ? 32 ILE A C    1  
ATOM 96    N N    . LEU A 1 33 ? 3.878   -4.298  -11.940 1.00 0.00 ? 33 LEU A N    1  
ATOM 97    C CA   . LEU A 1 33 ? 3.878   -5.713  -12.301 1.00 0.00 ? 33 LEU A CA   1  
ATOM 98    C C    . LEU A 1 33 ? 2.855   -5.983  -13.392 1.00 0.00 ? 33 LEU A C    1  
ATOM 99    N N    . ALA A 1 34 ? 1.646   -5.469  -13.186 1.00 0.00 ? 34 ALA A N    1  
ATOM 100   C CA   . ALA A 1 34 ? 0.553   -5.640  -14.140 1.00 0.00 ? 34 ALA A CA   1  
ATOM 101   C C    . ALA A 1 34 ? 0.934   -5.067  -15.495 1.00 0.00 ? 34 ALA A C    1  
ATOM 102   N N    . VAL A 1 35 ? 1.589   -3.910  -15.466 1.00 0.00 ? 35 VAL A N    1  
ATOM 103   C CA   . VAL A 1 35 ? 2.026   -3.230  -16.682 1.00 0.00 ? 35 VAL A CA   1  
ATOM 104   C C    . VAL A 1 35 ? 2.896   -4.149  -17.523 1.00 0.00 ? 35 VAL A C    1  
ATOM 105   N N    . ALA A 1 36 ? 3.805   -4.850  -16.853 1.00 0.00 ? 36 ALA A N    1  
ATOM 106   C CA   . ALA A 1 36 ? 4.718   -5.778  -17.515 1.00 0.00 ? 36 ALA A CA   1  
ATOM 107   C C    . ALA A 1 36 ? 3.948   -6.935  -18.129 1.00 0.00 ? 36 ALA A C    1  
ATOM 108   N N    . GLY A 1 37 ? 3.029   -7.494  -17.347 1.00 0.00 ? 37 GLY A N    1  
ATOM 109   C CA   . GLY A 1 37 ? 2.205   -8.615  -17.788 1.00 0.00 ? 37 GLY A CA   1  
ATOM 110   C C    . GLY A 1 37 ? 1.590   -8.321  -19.147 1.00 0.00 ? 37 GLY A C    1  
ATOM 111   N N    . LEU A 1 38 ? 0.802   -7.251  -19.201 1.00 0.00 ? 38 LEU A N    1  
ATOM 112   C CA   . LEU A 1 38 ? 0.135   -6.834  -20.432 1.00 0.00 ? 38 LEU A CA   1  
ATOM 113   C C    . LEU A 1 38 ? 1.159   -6.523  -21.511 1.00 0.00 ? 38 LEU A C    1  
ATOM 114   N N    . ILE A 1 39 ? 2.254   -5.891  -21.100 1.00 0.00 ? 39 ILE A N    1  
ATOM 115   C CA   . ILE A 1 39 ? 3.332   -5.522  -22.013 1.00 0.00 ? 39 ILE A CA   1  
ATOM 116   C C    . ILE A 1 39 ? 3.887   -6.753  -22.708 1.00 0.00 ? 39 ILE A C    1  
ATOM 117   N N    . TYR A 1 40 ? 4.096   -7.808  -21.926 1.00 0.00 ? 40 TYR A N    1  
ATOM 118   C CA   . TYR A 1 40 ? 4.626   -9.068  -22.441 1.00 0.00 ? 40 TYR A CA   1  
ATOM 119   C C    . TYR A 1 40 ? 3.608   -9.746  -23.342 1.00 0.00 ? 40 TYR A C    1  
ATOM 120   N N    . SER A 1 41 ? 2.348   -9.712  -22.914 1.00 0.00 ? 41 SER A N    1  
ATOM 121   C CA   . SER A 1 41 ? 1.253   -10.317 -23.665 1.00 0.00 ? 41 SER A CA   1  
ATOM 122   C C    . SER A 1 41 ? 1.139   -9.686  -25.043 1.00 0.00 ? 41 SER A C    1  
ATOM 123   N N    . MET A 1 42 ? 1.113   -8.356  -25.065 1.00 0.00 ? 42 MET A N    1  
ATOM 124   C CA   . MET A 1 42 ? 1.008   -7.599  -26.309 1.00 0.00 ? 42 MET A CA   1  
ATOM 125   C C    . MET A 1 42 ? 2.229   -7.834  -27.182 1.00 0.00 ? 42 MET A C    1  
ATOM 126   N N    . LEU A 1 43 ? 3.395   -7.861  -26.543 1.00 0.00 ? 43 LEU A N    1  
ATOM 127   C CA   . LEU A 1 43 ? 4.661   -8.077  -27.237 1.00 0.00 ? 43 LEU A CA   1  
ATOM 128   C C    . LEU A 1 43 ? 4.811   -9.538  -27.628 1.00 0.00 ? 43 LEU A C    1  
ATOM 129   N N    . ARG A 1 44 ? 4.401   -10.421 -26.722 1.00 0.00 ? 44 ARG A N    1  
ATOM 130   C CA   . ARG A 1 44 ? 4.478   -11.861 -26.945 1.00 0.00 ? 44 ARG A CA   1  
ATOM 131   C C    . ARG A 1 44 ? 3.291   -12.337 -27.766 1.00 0.00 ? 44 ARG A C    1  
ATOM 132   N N    . LYS A 1 45 ? 2.151   -11.683 -27.560 1.00 0.00 ? 45 LYS A N    1  
ATOM 133   C CA   . LYS A 1 45 ? 0.920   -12.018 -28.270 1.00 0.00 ? 45 LYS A CA   1  
ATOM 134   C C    . LYS A 1 45 ? 0.994   -11.551 -29.714 1.00 0.00 ? 45 LYS A C    1  
ATOM 135   N N    . ALA A 1 46 ? 1.441   -10.311 -29.895 1.00 0.00 ? 46 ALA A N    1  
ATOM 136   C CA   . ALA A 1 46 ? 1.571   -9.714  -31.221 1.00 0.00 ? 46 ALA A CA   1  
ATOM 137   N N    . GLY A 1 1  ? -29.900 -21.022 30.672  1.00 0.00 ? 1  GLY A N    2  
ATOM 138   C CA   . GLY A 1 1  ? -31.120 -20.242 30.715  1.00 0.00 ? 1  GLY A CA   2  
ATOM 139   C C    . GLY A 1 1  ? -31.127 -19.225 29.585  1.00 0.00 ? 1  GLY A C    2  
ATOM 140   O O    . GLY A 1 1  ? -30.187 -19.150 28.798  1.00 0.00 ? 1  GLY A O    2  
ATOM 141   H H1   . GLY A 1 1  ? -29.226 -20.823 29.947  1.00 0.00 ? 1  GLY A H1   2  
ATOM 142   H HA2  . GLY A 1 1  ? -31.978 -20.906 30.609  1.00 0.00 ? 1  GLY A HA2  2  
ATOM 143   H HA3  . GLY A 1 1  ? -31.184 -19.721 31.671  1.00 0.00 ? 1  GLY A HA3  2  
ATOM 144   N N    . VAL A 1 2  ? -32.203 -18.446 29.520  1.00 0.00 ? 2  VAL A N    2  
ATOM 145   C CA   . VAL A 1 2  ? -32.363 -17.420 28.494  1.00 0.00 ? 2  VAL A CA   2  
ATOM 146   C C    . VAL A 1 2  ? -31.386 -16.279 28.725  1.00 0.00 ? 2  VAL A C    2  
ATOM 147   O O    . VAL A 1 2  ? -30.752 -15.785 27.793  1.00 0.00 ? 2  VAL A O    2  
ATOM 148   C CB   . VAL A 1 2  ? -33.787 -16.833 28.500  1.00 0.00 ? 2  VAL A CB   2  
ATOM 149   C CG1  . VAL A 1 2  ? -33.876 -15.643 27.557  1.00 0.00 ? 2  VAL A CG1  2  
ATOM 150   C CG2  . VAL A 1 2  ? -34.796 -17.878 28.053  1.00 0.00 ? 2  VAL A CG2  2  
ATOM 151   H H    . VAL A 1 2  ? -32.942 -18.559 30.200  1.00 0.00 ? 2  VAL A H    2  
ATOM 152   H HA   . VAL A 1 2  ? -32.168 -17.872 27.522  1.00 0.00 ? 2  VAL A HA   2  
ATOM 153   H HB   . VAL A 1 2  ? -34.031 -16.508 29.512  1.00 0.00 ? 2  VAL A HB   2  
ATOM 154   H HG11 . VAL A 1 2  ? -34.885 -15.230 27.576  1.00 0.00 ? 2  VAL A HG11 2  
ATOM 155   H HG12 . VAL A 1 2  ? -33.167 -14.877 27.872  1.00 0.00 ? 2  VAL A HG12 2  
ATOM 156   H HG13 . VAL A 1 2  ? -33.637 -15.965 26.544  1.00 0.00 ? 2  VAL A HG13 2  
ATOM 157   H HG21 . VAL A 1 2  ? -35.800 -17.453 28.070  1.00 0.00 ? 2  VAL A HG21 2  
ATOM 158   H HG22 . VAL A 1 2  ? -34.558 -18.201 27.040  1.00 0.00 ? 2  VAL A HG22 2  
ATOM 159   H HG23 . VAL A 1 2  ? -34.754 -18.733 28.727  1.00 0.00 ? 2  VAL A HG23 2  
ATOM 160   N N    . ILE A 1 3  ? -31.272 -15.866 29.984  1.00 0.00 ? 3  ILE A N    2  
ATOM 161   C CA   . ILE A 1 3  ? -30.376 -14.781 30.371  1.00 0.00 ? 3  ILE A CA   2  
ATOM 162   C C    . ILE A 1 3  ? -28.926 -15.187 30.163  1.00 0.00 ? 3  ILE A C    2  
ATOM 163   O O    . ILE A 1 3  ? -28.100 -14.392 29.719  1.00 0.00 ? 3  ILE A O    2  
ATOM 164   C CB   . ILE A 1 3  ? -30.554 -14.404 31.854  1.00 0.00 ? 3  ILE A CB   2  
ATOM 165   C CG1  . ILE A 1 3  ? -31.935 -13.790 32.086  1.00 0.00 ? 3  ILE A CG1  2  
ATOM 166   C CG2  . ILE A 1 3  ? -29.499 -13.392 32.276  1.00 0.00 ? 3  ILE A CG2  2  
ATOM 167   C CD1  . ILE A 1 3  ? -32.289 -13.617 33.547  1.00 0.00 ? 3  ILE A CD1  2  
ATOM 168   H H    . ILE A 1 3  ? -31.820 -16.312 30.706  1.00 0.00 ? 3  ILE A H    2  
ATOM 169   H HA   . ILE A 1 3  ? -30.601 -13.912 29.752  1.00 0.00 ? 3  ILE A HA   2  
ATOM 170   H HB   . ILE A 1 3  ? -30.454 -15.303 32.461  1.00 0.00 ? 3  ILE A HB   2  
ATOM 171   H HG12 . ILE A 1 3  ? -31.961 -12.810 31.608  1.00 0.00 ? 3  ILE A HG12 2  
ATOM 172   H HG13 . ILE A 1 3  ? -32.682 -14.438 31.627  1.00 0.00 ? 3  ILE A HG13 2  
ATOM 173   H HG21 . ILE A 1 3  ? -29.629 -13.140 33.329  1.00 0.00 ? 3  ILE A HG21 2  
ATOM 174   H HG22 . ILE A 1 3  ? -28.508 -13.818 32.126  1.00 0.00 ? 3  ILE A HG22 2  
ATOM 175   H HG23 . ILE A 1 3  ? -29.602 -12.489 31.674  1.00 0.00 ? 3  ILE A HG23 2  
ATOM 176   H HD11 . ILE A 1 3  ? -33.281 -13.175 33.651  1.00 0.00 ? 3  ILE A HD11 2  
ATOM 177   H HD12 . ILE A 1 3  ? -32.279 -14.590 34.038  1.00 0.00 ? 3  ILE A HD12 2  
ATOM 178   H HD13 . ILE A 1 3  ? -31.556 -12.963 34.020  1.00 0.00 ? 3  ILE A HD13 2  
ATOM 179   N N    . ASP A 1 4  ? -28.629 -16.441 30.491  1.00 0.00 ? 4  ASP A N    2  
ATOM 180   C CA   . ASP A 1 4  ? -27.282 -16.985 30.351  1.00 0.00 ? 4  ASP A CA   2  
ATOM 181   C C    . ASP A 1 4  ? -26.753 -16.743 28.946  1.00 0.00 ? 4  ASP A C    2  
ATOM 182   O O    . ASP A 1 4  ? -25.585 -16.406 28.755  1.00 0.00 ? 4  ASP A O    2  
ATOM 183   C CB   . ASP A 1 4  ? -27.283 -18.492 30.614  1.00 0.00 ? 4  ASP A CB   2  
ATOM 184   C CG   . ASP A 1 4  ? -27.498 -18.828 32.077  1.00 0.00 ? 4  ASP A CG   2  
ATOM 185   O OD1  . ASP A 1 4  ? -27.372 -20.017 32.438  1.00 0.00 ? 4  ASP A OD1  2  
ATOM 186   O OD2  . ASP A 1 4  ? -27.794 -17.902 32.862  1.00 0.00 ? 4  ASP A OD2  2  
ATOM 187   H H    . ASP A 1 4  ? -29.353 -17.046 30.851  1.00 0.00 ? 4  ASP A H    2  
ATOM 188   H HA   . ASP A 1 4  ? -26.630 -16.493 31.073  1.00 0.00 ? 4  ASP A HA   2  
ATOM 189   H HB2  . ASP A 1 4  ? -28.081 -18.949 30.029  1.00 0.00 ? 4  ASP A HB2  2  
ATOM 190   H HB3  . ASP A 1 4  ? -26.325 -18.903 30.298  1.00 0.00 ? 4  ASP A HB3  2  
ATOM 191   H HD2  . ASP A 1 4  ? -27.916 -18.185 33.771  1.00 0.00 ? 4  ASP A HD2  2  
ATOM 192   N N    . THR A 1 5  ? -27.632 -16.919 27.963  1.00 0.00 ? 5  THR A N    2  
ATOM 193   C CA   . THR A 1 5  ? -27.281 -16.727 26.559  1.00 0.00 ? 5  THR A CA   2  
ATOM 194   C C    . THR A 1 5  ? -27.644 -15.321 26.108  1.00 0.00 ? 5  THR A C    2  
ATOM 195   O O    . THR A 1 5  ? -27.412 -14.941 24.962  1.00 0.00 ? 5  THR A O    2  
ATOM 196   C CB   . THR A 1 5  ? -28.025 -17.723 25.650  1.00 0.00 ? 5  THR A CB   2  
ATOM 197   O OG1  . THR A 1 5  ? -29.438 -17.516 25.765  1.00 0.00 ? 5  THR A OG1  2  
ATOM 198   C CG2  . THR A 1 5  ? -27.702 -19.154 26.052  1.00 0.00 ? 5  THR A CG2  2  
ATOM 199   H H    . THR A 1 5  ? -28.579 -17.194 28.185  1.00 0.00 ? 5  THR A H    2  
ATOM 200   H HA   . THR A 1 5  ? -26.207 -16.876 26.449  1.00 0.00 ? 5  THR A HA   2  
ATOM 201   H HB   . THR A 1 5  ? -27.718 -17.561 24.617  1.00 0.00 ? 5  THR A HB   2  
ATOM 202   H HG1  . THR A 1 5  ? -29.887 -18.137 25.188  1.00 0.00 ? 5  THR A HG1  2  
ATOM 203   H HG21 . THR A 1 5  ? -28.233 -19.848 25.401  1.00 0.00 ? 5  THR A HG21 2  
ATOM 204   H HG22 . THR A 1 5  ? -26.629 -19.322 25.962  1.00 0.00 ? 5  THR A HG22 2  
ATOM 205   H HG23 . THR A 1 5  ? -28.011 -19.319 27.084  1.00 0.00 ? 5  THR A HG23 2  
ATOM 206   N N    . SER A 1 6  ? -28.219 -14.553 27.029  1.00 0.00 ? 6  SER A N    2  
ATOM 207   C CA   . SER A 1 6  ? -28.627 -13.179 26.753  1.00 0.00 ? 6  SER A CA   2  
ATOM 208   C C    . SER A 1 6  ? -27.499 -12.412 26.081  1.00 0.00 ? 6  SER A C    2  
ATOM 209   O O    . SER A 1 6  ? -27.643 -11.917 24.964  1.00 0.00 ? 6  SER A O    2  
ATOM 210   C CB   . SER A 1 6  ? -28.995 -12.458 28.052  1.00 0.00 ? 6  SER A CB   2  
ATOM 211   O OG   . SER A 1 6  ? -29.384 -11.119 27.799  1.00 0.00 ? 6  SER A OG   2  
ATOM 212   H H    . SER A 1 6  ? -28.383 -14.922 27.955  1.00 0.00 ? 6  SER A H    2  
ATOM 213   H HA   . SER A 1 6  ? -29.495 -13.197 26.093  1.00 0.00 ? 6  SER A HA   2  
ATOM 214   H HB2  . SER A 1 6  ? -29.822 -12.984 28.530  1.00 0.00 ? 6  SER A HB2  2  
ATOM 215   H HB3  . SER A 1 6  ? -28.132 -12.457 28.717  1.00 0.00 ? 6  SER A HB3  2  
ATOM 216   H HG   . SER A 1 6  ? -29.608 -10.696 28.632  1.00 0.00 ? 6  SER A HG   2  
ATOM 217   N N    . ALA A 1 7  ? -26.371 -12.320 26.780  1.00 0.00 ? 7  ALA A N    2  
ATOM 218   C CA   . ALA A 1 7  ? -25.196 -11.617 26.274  1.00 0.00 ? 7  ALA A CA   2  
ATOM 219   C C    . ALA A 1 7  ? -24.715 -12.248 24.977  1.00 0.00 ? 7  ALA A C    2  
ATOM 220   O O    . ALA A 1 7  ? -24.344 -11.555 24.031  1.00 0.00 ? 7  ALA A O    2  
ATOM 221   C CB   . ALA A 1 7  ? -24.064 -11.678 27.288  1.00 0.00 ? 7  ALA A CB   2  
ATOM 222   H H    . ALA A 1 7  ? -26.315 -12.746 27.694  1.00 0.00 ? 7  ALA A H    2  
ATOM 223   H HA   . ALA A 1 7  ? -25.463 -10.575 26.093  1.00 0.00 ? 7  ALA A HA   2  
ATOM 224   H HB1  . ALA A 1 7  ? -23.198 -11.137 26.907  1.00 0.00 ? 7  ALA A HB1  2  
ATOM 225   H HB2  . ALA A 1 7  ? -24.391 -11.223 28.223  1.00 0.00 ? 7  ALA A HB2  2  
ATOM 226   H HB3  . ALA A 1 7  ? -23.793 -12.718 27.466  1.00 0.00 ? 7  ALA A HB3  2  
ATOM 227   N N    . VAL A 1 8  ? -24.727 -13.578 24.946  1.00 0.00 ? 8  VAL A N    2  
ATOM 228   C CA   . VAL A 1 8  ? -24.297 -14.335 23.774  1.00 0.00 ? 8  VAL A CA   2  
ATOM 229   C C    . VAL A 1 8  ? -25.199 -14.038 22.588  1.00 0.00 ? 8  VAL A C    2  
ATOM 230   O O    . VAL A 1 8  ? -24.735 -13.878 21.460  1.00 0.00 ? 8  VAL A O    2  
ATOM 231   C CB   . VAL A 1 8  ? -24.342 -15.852 24.034  1.00 0.00 ? 8  VAL A CB   2  
ATOM 232   C CG1  . VAL A 1 8  ? -24.094 -16.621 22.746  1.00 0.00 ? 8  VAL A CG1  2  
ATOM 233   C CG2  . VAL A 1 8  ? -23.277 -16.251 25.045  1.00 0.00 ? 8  VAL A CG2  2  
ATOM 234   H H    . VAL A 1 8  ? -25.043 -14.091 25.756  1.00 0.00 ? 8  VAL A H    2  
ATOM 235   H HA   . VAL A 1 8  ? -23.275 -14.044 23.533  1.00 0.00 ? 8  VAL A HA   2  
ATOM 236   H HB   . VAL A 1 8  ? -25.326 -16.113 24.425  1.00 0.00 ? 8  VAL A HB   2  
ATOM 237   H HG11 . VAL A 1 8  ? -24.137 -17.692 22.941  1.00 0.00 ? 8  VAL A HG11 2  
ATOM 238   H HG12 . VAL A 1 8  ? -24.857 -16.356 22.014  1.00 0.00 ? 8  VAL A HG12 2  
ATOM 239   H HG13 . VAL A 1 8  ? -23.110 -16.364 22.355  1.00 0.00 ? 8  VAL A HG13 2  
ATOM 240   H HG21 . VAL A 1 8  ? -23.325 -17.324 25.228  1.00 0.00 ? 8  VAL A HG21 2  
ATOM 241   H HG22 . VAL A 1 8  ? -22.293 -15.993 24.655  1.00 0.00 ? 8  VAL A HG22 2  
ATOM 242   H HG23 . VAL A 1 8  ? -23.448 -15.717 25.980  1.00 0.00 ? 8  VAL A HG23 2  
ATOM 243   N N    . GLU A 1 9  ? -26.500 -13.966 22.858  1.00 0.00 ? 9  GLU A N    2  
ATOM 244   C CA   . GLU A 1 9  ? -27.497 -13.687 21.828  1.00 0.00 ? 9  GLU A CA   2  
ATOM 245   C C    . GLU A 1 9  ? -27.189 -12.372 21.131  1.00 0.00 ? 9  GLU A C    2  
ATOM 246   O O    . GLU A 1 9  ? -27.346 -12.243 19.918  1.00 0.00 ? 9  GLU A O    2  
ATOM 247   C CB   . GLU A 1 9  ? -28.893 -13.591 22.446  1.00 0.00 ? 9  GLU A CB   2  
ATOM 248   C CG   . GLU A 1 9  ? -30.006 -13.371 21.434  1.00 0.00 ? 9  GLU A CG   2  
ATOM 249   C CD   . GLU A 1 9  ? -31.379 -13.332 22.077  1.00 0.00 ? 9  GLU A CD   2  
ATOM 250   O OE1  . GLU A 1 9  ? -31.459 -13.475 23.315  1.00 0.00 ? 9  GLU A OE1  2  
ATOM 251   O OE2  . GLU A 1 9  ? -32.374 -13.158 21.342  1.00 0.00 ? 9  GLU A OE2  2  
ATOM 252   H H    . GLU A 1 9  ? -26.820 -14.107 23.806  1.00 0.00 ? 9  GLU A H    2  
ATOM 253   H HA   . GLU A 1 9  ? -27.482 -14.495 21.098  1.00 0.00 ? 9  GLU A HA   2  
ATOM 254   H HB2  . GLU A 1 9  ? -29.096 -14.519 22.981  1.00 0.00 ? 9  GLU A HB2  2  
ATOM 255   H HB3  . GLU A 1 9  ? -28.900 -12.757 23.149  1.00 0.00 ? 9  GLU A HB3  2  
ATOM 256   H HG2  . GLU A 1 9  ? -29.833 -12.424 20.922  1.00 0.00 ? 9  GLU A HG2  2  
ATOM 257   H HG3  . GLU A 1 9  ? -29.984 -14.181 20.706  1.00 0.00 ? 9  GLU A HG3  2  
ATOM 258   H HE2  . GLU A 1 9  ? -33.210 -13.144 21.815  1.00 0.00 ? 9  GLU A HE2  2  
ATOM 259   N N    . SER A 1 10 ? -26.748 -11.395 21.917  1.00 0.00 ? 10 SER A N    2  
ATOM 260   C CA   . SER A 1 10 ? -26.408 -10.072 21.401  1.00 0.00 ? 10 SER A CA   2  
ATOM 261   C C    . SER A 1 10 ? -25.012 -10.076 20.800  1.00 0.00 ? 10 SER A C    2  
ATOM 262   O O    . SER A 1 10 ? -24.795 -9.591  19.691  1.00 0.00 ? 10 SER A O    2  
ATOM 263   C CB   . SER A 1 10 ? -26.447 -9.033  22.523  1.00 0.00 ? 10 SER A CB   2  
ATOM 264   O OG   . SER A 1 10 ? -27.756 -8.900  23.049  1.00 0.00 ? 10 SER A OG   2  
ATOM 265   H H    . SER A 1 10 ? -26.640 -11.562 22.907  1.00 0.00 ? 10 SER A H    2  
ATOM 266   H HA   . SER A 1 10 ? -27.132 -9.799  20.633  1.00 0.00 ? 10 SER A HA   2  
ATOM 267   H HB2  . SER A 1 10 ? -25.773 -9.344  23.321  1.00 0.00 ? 10 SER A HB2  2  
ATOM 268   H HB3  . SER A 1 10 ? -26.123 -8.070  22.129  1.00 0.00 ? 10 SER A HB3  2  
ATOM 269   H HG   . SER A 1 10 ? -27.746 -8.242  23.749  1.00 0.00 ? 10 SER A HG   2  
ATOM 270   N N    . ALA A 1 11 ? -24.065 -10.634 21.551  1.00 0.00 ? 11 ALA A N    2  
ATOM 271   C CA   . ALA A 1 11 ? -22.674 -10.717 21.116  1.00 0.00 ? 11 ALA A CA   2  
ATOM 272   C C    . ALA A 1 11 ? -22.545 -11.646 19.920  1.00 0.00 ? 11 ALA A C    2  
ATOM 273   O O    . ALA A 1 11 ? -21.783 -11.384 18.991  1.00 0.00 ? 11 ALA A O    2  
ATOM 274   C CB   . ALA A 1 11 ? -21.798 -11.252 22.239  1.00 0.00 ? 11 ALA A CB   2  
ATOM 275   H H    . ALA A 1 11 ? -24.306 -11.015 22.455  1.00 0.00 ? 11 ALA A H    2  
ATOM 276   H HA   . ALA A 1 11 ? -22.335 -9.719  20.837  1.00 0.00 ? 11 ALA A HA   2  
ATOM 277   H HB1  . ALA A 1 11 ? -20.760 -11.296 21.909  1.00 0.00 ? 11 ALA A HB1  2  
ATOM 278   H HB2  . ALA A 1 11 ? -21.875 -10.592 23.104  1.00 0.00 ? 11 ALA A HB2  2  
ATOM 279   H HB3  . ALA A 1 11 ? -22.133 -12.252 22.514  1.00 0.00 ? 11 ALA A HB3  2  
ATOM 280   N N    . ILE A 1 12 ? -23.302 -12.738 19.956  1.00 0.00 ? 12 ILE A N    2  
ATOM 281   C CA   . ILE A 1 12 ? -23.293 -13.730 18.885  1.00 0.00 ? 12 ILE A CA   2  
ATOM 282   C C    . ILE A 1 12 ? -23.880 -13.143 17.612  1.00 0.00 ? 12 ILE A C    2  
ATOM 283   O O    . ILE A 1 12 ? -23.328 -13.302 16.524  1.00 0.00 ? 12 ILE A O    2  
ATOM 284   C CB   . ILE A 1 12 ? -24.122 -14.973 19.260  1.00 0.00 ? 12 ILE A CB   2  
ATOM 285   C CG1  . ILE A 1 12 ? -23.461 -15.726 20.416  1.00 0.00 ? 12 ILE A CG1  2  
ATOM 286   C CG2  . ILE A 1 12 ? -24.234 -15.916 18.072  1.00 0.00 ? 12 ILE A CG2  2  
ATOM 287   C CD1  . ILE A 1 12 ? -22.068 -16.226 20.101  1.00 0.00 ? 12 ILE A CD1  2  
ATOM 288   H H    . ILE A 1 12 ? -23.910 -12.896 20.747  1.00 0.00 ? 12 ILE A H    2  
ATOM 289   H HA   . ILE A 1 12 ? -22.262 -14.030 18.703  1.00 0.00 ? 12 ILE A HA   2  
ATOM 290   H HB   . ILE A 1 12 ? -25.120 -14.654 19.562  1.00 0.00 ? 12 ILE A HB   2  
ATOM 291   H HG12 . ILE A 1 12 ? -23.400 -15.055 21.273  1.00 0.00 ? 12 ILE A HG12 2  
ATOM 292   H HG13 . ILE A 1 12 ? -24.085 -16.583 20.669  1.00 0.00 ? 12 ILE A HG13 2  
ATOM 293   H HG21 . ILE A 1 12 ? -24.831 -16.786 18.346  1.00 0.00 ? 12 ILE A HG21 2  
ATOM 294   H HG22 . ILE A 1 12 ? -24.713 -15.396 17.242  1.00 0.00 ? 12 ILE A HG22 2  
ATOM 295   H HG23 . ILE A 1 12 ? -23.238 -16.240 17.772  1.00 0.00 ? 12 ILE A HG23 2  
ATOM 296   H HD11 . ILE A 1 12 ? -21.648 -16.751 20.958  1.00 0.00 ? 12 ILE A HD11 2  
ATOM 297   H HD12 . ILE A 1 12 ? -22.114 -16.907 19.252  1.00 0.00 ? 12 ILE A HD12 2  
ATOM 298   H HD13 . ILE A 1 12 ? -21.429 -15.378 19.853  1.00 0.00 ? 12 ILE A HD13 2  
ATOM 299   N N    . THR A 1 13 ? -25.011 -12.458 17.763  1.00 0.00 ? 13 THR A N    2  
ATOM 300   C CA   . THR A 1 13 ? -25.701 -11.832 16.638  1.00 0.00 ? 13 THR A CA   2  
ATOM 301   C C    . THR A 1 13 ? -24.842 -10.734 16.032  1.00 0.00 ? 13 THR A C    2  
ATOM 302   O O    . THR A 1 13 ? -24.748 -10.600 14.813  1.00 0.00 ? 13 THR A O    2  
ATOM 303   C CB   . THR A 1 13 ? -27.037 -11.202 17.075  1.00 0.00 ? 13 THR A CB   2  
ATOM 304   O OG1  . THR A 1 13 ? -27.906 -12.222 17.582  1.00 0.00 ? 13 THR A OG1  2  
ATOM 305   C CG2  . THR A 1 13 ? -27.714 -10.519 15.897  1.00 0.00 ? 13 THR A CG2  2  
ATOM 306   H H    . THR A 1 13 ? -25.415 -12.360 18.684  1.00 0.00 ? 13 THR A H    2  
ATOM 307   H HA   . THR A 1 13 ? -25.897 -12.595 15.885  1.00 0.00 ? 13 THR A HA   2  
ATOM 308   H HB   . THR A 1 13 ? -26.847 -10.466 17.856  1.00 0.00 ? 13 THR A HB   2  
ATOM 309   H HG1  . THR A 1 13 ? -28.731 -11.813 17.857  1.00 0.00 ? 13 THR A HG1  2  
ATOM 310   H HG21 . THR A 1 13 ? -28.657 -10.076 16.220  1.00 0.00 ? 13 THR A HG21 2  
ATOM 311   H HG22 . THR A 1 13 ? -27.062 -9.737  15.508  1.00 0.00 ? 13 THR A HG22 2  
ATOM 312   H HG23 . THR A 1 13 ? -27.909 -11.253 15.115  1.00 0.00 ? 13 THR A HG23 2  
ATOM 313   N N    . ASP A 1 14 ? -24.215 -9.947  16.903  1.00 0.00 ? 14 ASP A N    2  
ATOM 314   C CA   . ASP A 1 14 ? -23.354 -8.847  16.481  1.00 0.00 ? 14 ASP A CA   2  
ATOM 315   C C    . ASP A 1 14 ? -22.095 -9.381  15.820  1.00 0.00 ? 14 ASP A C    2  
ATOM 316   O O    . ASP A 1 14 ? -21.720 -8.955  14.728  1.00 0.00 ? 14 ASP A O    2  
ATOM 317   C CB   . ASP A 1 14 ? -22.945 -7.995  17.684  1.00 0.00 ? 14 ASP A CB   2  
ATOM 318   C CG   . ASP A 1 14 ? -24.094 -7.174  18.235  1.00 0.00 ? 14 ASP A CG   2  
ATOM 319   O OD1  . ASP A 1 14 ? -23.851 -6.337  19.129  1.00 0.00 ? 14 ASP A OD1  2  
ATOM 320   O OD2  . ASP A 1 14 ? -25.238 -7.367  17.771  1.00 0.00 ? 14 ASP A OD2  2  
ATOM 321   H H    . ASP A 1 14 ? -24.333 -10.107 17.893  1.00 0.00 ? 14 ASP A H    2  
ATOM 322   H HA   . ASP A 1 14 ? -23.901 -8.227  15.770  1.00 0.00 ? 14 ASP A HA   2  
ATOM 323   H HB2  . ASP A 1 14 ? -22.577 -8.653  18.471  1.00 0.00 ? 14 ASP A HB2  2  
ATOM 324   H HB3  . ASP A 1 14 ? -22.147 -7.318  17.379  1.00 0.00 ? 14 ASP A HB3  2  
ATOM 325   H HD2  . ASP A 1 14 ? -25.917 -6.813  18.165  1.00 0.00 ? 14 ASP A HD2  2  
ATOM 326   N N    . GLY A 1 15 ? -21.443 -10.321 16.498  1.00 0.00 ? 15 GLY A N    2  
ATOM 327   C CA   . GLY A 1 15 ? -20.217 -10.935 15.998  1.00 0.00 ? 15 GLY A CA   2  
ATOM 328   C C    . GLY A 1 15 ? -20.541 -12.056 15.023  1.00 0.00 ? 15 GLY A C    2  
ATOM 329   O O    . GLY A 1 15 ? -20.271 -11.956 13.827  1.00 0.00 ? 15 GLY A O    2  
ATOM 330   H H    . GLY A 1 15 ? -21.800 -10.628 17.392  1.00 0.00 ? 15 GLY A H    2  
ATOM 331   H HA2  . GLY A 1 15 ? -19.618 -10.179 15.490  1.00 0.00 ? 15 GLY A HA2  2  
ATOM 332   H HA3  . GLY A 1 15 ? -19.651 -11.340 16.836  1.00 0.00 ? 15 GLY A HA3  2  
ATOM 333   N N    . GLN A 1 16 ? -21.124 -13.127 15.552  1.00 0.00 ? 16 GLN A N    2  
ATOM 334   C CA   . GLN A 1 16 ? -21.499 -14.287 14.750  1.00 0.00 ? 16 GLN A CA   2  
ATOM 335   C C    . GLN A 1 16 ? -22.264 -13.853 13.510  1.00 0.00 ? 16 GLN A C    2  
ATOM 336   O O    . GLN A 1 16 ? -21.900 -14.193 12.386  1.00 0.00 ? 16 GLN A O    2  
ATOM 337   C CB   . GLN A 1 16 ? -22.388 -15.233 15.559  1.00 0.00 ? 16 GLN A CB   2  
ATOM 338   C CG   . GLN A 1 16 ? -22.792 -16.495 14.814  1.00 0.00 ? 16 GLN A CG   2  
ATOM 339   C CD   . GLN A 1 16 ? -21.608 -17.383 14.486  1.00 0.00 ? 16 GLN A CD   2  
ATOM 340   O OE1  . GLN A 1 16 ? -20.845 -17.768 15.372  1.00 0.00 ? 16 GLN A OE1  2  
ATOM 341   N NE2  . GLN A 1 16 ? -21.451 -17.710 13.209  1.00 0.00 ? 16 GLN A NE2  2  
ATOM 342   H H    . GLN A 1 16 ? -21.319 -13.149 16.543  1.00 0.00 ? 16 GLN A H    2  
ATOM 343   H HA   . GLN A 1 16 ? -20.593 -14.812 14.450  1.00 0.00 ? 16 GLN A HA   2  
ATOM 344   H HB2  . GLN A 1 16 ? -21.847 -15.525 16.459  1.00 0.00 ? 16 GLN A HB2  2  
ATOM 345   H HB3  . GLN A 1 16 ? -23.295 -14.695 15.839  1.00 0.00 ? 16 GLN A HB3  2  
ATOM 346   H HG2  . GLN A 1 16 ? -23.492 -17.058 15.432  1.00 0.00 ? 16 GLN A HG2  2  
ATOM 347   H HG3  . GLN A 1 16 ? -23.285 -16.209 13.884  1.00 0.00 ? 16 GLN A HG3  2  
ATOM 348   H HE21 . GLN A 1 16 ? -22.104 -17.368 12.518  1.00 0.00 ? 16 GLN A HE21 2  
ATOM 349   H HE22 . GLN A 1 16 ? -20.680 -18.299 12.931  1.00 0.00 ? 16 GLN A HE22 2  
ATOM 350   N N    . GLY A 1 17 ? -23.333 -13.093 13.732  1.00 0.00 ? 17 GLY A N    2  
ATOM 351   C CA   . GLY A 1 17 ? -24.174 -12.594 12.647  1.00 0.00 ? 17 GLY A CA   2  
ATOM 352   C C    . GLY A 1 17 ? -23.324 -11.914 11.585  1.00 0.00 ? 17 GLY A C    2  
ATOM 353   O O    . GLY A 1 17 ? -23.480 -12.163 10.391  1.00 0.00 ? 17 GLY A O    2  
ATOM 354   H H    . GLY A 1 17 ? -23.581 -12.846 14.680  1.00 0.00 ? 17 GLY A H    2  
ATOM 355   H HA2  . GLY A 1 17 ? -24.713 -13.428 12.197  1.00 0.00 ? 17 GLY A HA2  2  
ATOM 356   H HA3  . GLY A 1 17 ? -24.891 -11.876 13.048  1.00 0.00 ? 17 GLY A HA3  2  
ATOM 357   N N    . ASP A 1 18 ? -22.420 -11.050 12.038  1.00 0.00 ? 18 ASP A N    2  
ATOM 358   C CA   . ASP A 1 18 ? -21.527 -10.316 11.146  1.00 0.00 ? 18 ASP A CA   2  
ATOM 359   C C    . ASP A 1 18 ? -20.745 -11.278 10.267  1.00 0.00 ? 18 ASP A C    2  
ATOM 360   O O    . ASP A 1 18 ? -20.137 -10.882 9.274   1.00 0.00 ? 18 ASP A O    2  
ATOM 361   C CB   . ASP A 1 18 ? -20.532 -9.480  11.953  1.00 0.00 ? 18 ASP A CB   2  
ATOM 362   C CG   . ASP A 1 18 ? -21.188 -8.303  12.647  1.00 0.00 ? 18 ASP A CG   2  
ATOM 363   O OD1  . ASP A 1 18 ? -20.564 -7.222  12.702  1.00 0.00 ? 18 ASP A OD1  2  
ATOM 364   O OD2  . ASP A 1 18 ? -22.326 -8.461  13.136  1.00 0.00 ? 18 ASP A OD2  2  
ATOM 365   H H    . ASP A 1 18 ? -22.341 -10.887 13.032  1.00 0.00 ? 18 ASP A H    2  
ATOM 366   H HA   . ASP A 1 18 ? -22.126 -9.656  10.517  1.00 0.00 ? 18 ASP A HA   2  
ATOM 367   H HB2  . ASP A 1 18 ? -20.069 -10.117 12.706  1.00 0.00 ? 18 ASP A HB2  2  
ATOM 368   H HB3  . ASP A 1 18 ? -19.763 -9.104  11.279  1.00 0.00 ? 18 ASP A HB3  2  
ATOM 369   H HD2  . ASP A 1 18 ? -22.681 -7.676  13.560  1.00 0.00 ? 18 ASP A HD2  2  
ATOM 370   N N    . MET A 1 19 ? -20.768 -12.552 10.646  1.00 0.00 ? 19 MET A N    2  
ATOM 371   C CA   . MET A 1 19 ? -20.067 -13.599 9.909   1.00 0.00 ? 19 MET A CA   2  
ATOM 372   C C    . MET A 1 19 ? -20.660 -13.760 8.519   1.00 0.00 ? 19 MET A C    2  
ATOM 373   O O    . MET A 1 19 ? -19.940 -13.906 7.533   1.00 0.00 ? 19 MET A O    2  
ATOM 374   C CB   . MET A 1 19 ? -20.181 -14.938 10.641  1.00 0.00 ? 19 MET A CB   2  
ATOM 375   C CG   . MET A 1 19 ? -19.407 -16.071 9.987   1.00 0.00 ? 19 MET A CG   2  
ATOM 376   S SD   . MET A 1 19 ? -19.556 -17.626 10.887  1.00 0.00 ? 19 MET A SD   2  
ATOM 377   C CE   . MET A 1 19 ? -18.617 -17.252 12.366  1.00 0.00 ? 19 MET A CE   2  
ATOM 378   H H    . MET A 1 19 ? -21.285 -12.815 11.473  1.00 0.00 ? 19 MET A H    2  
ATOM 379   H HA   . MET A 1 19 ? -19.016 -13.323 9.824   1.00 0.00 ? 19 MET A HA   2  
ATOM 380   H HB2  . MET A 1 19 ? -19.805 -14.806 11.656  1.00 0.00 ? 19 MET A HB2  2  
ATOM 381   H HB3  . MET A 1 19 ? -21.234 -15.219 10.678  1.00 0.00 ? 19 MET A HB3  2  
ATOM 382   H HG2  . MET A 1 19 ? -19.782 -16.214 8.974   1.00 0.00 ? 19 MET A HG2  2  
ATOM 383   H HG3  . MET A 1 19 ? -18.354 -15.795 9.935   1.00 0.00 ? 19 MET A HG3  2  
ATOM 384   H HE1  . MET A 1 19 ? -18.612 -18.115 13.032  1.00 0.00 ? 19 MET A HE1  2  
ATOM 385   H HE2  . MET A 1 19 ? -17.593 -17.002 12.091  1.00 0.00 ? 19 MET A HE2  2  
ATOM 386   H HE3  . MET A 1 19 ? -19.072 -16.404 12.879  1.00 0.00 ? 19 MET A HE3  2  
ATOM 387   N N    . LYS A 1 20 ? -21.988 -13.731 8.454   1.00 0.00 ? 20 LYS A N    2  
ATOM 388   C CA   . LYS A 1 20 ? -22.711 -13.872 7.193   1.00 0.00 ? 20 LYS A CA   2  
ATOM 389   C C    . LYS A 1 20 ? -22.280 -12.795 6.210   1.00 0.00 ? 20 LYS A C    2  
ATOM 390   O O    . LYS A 1 20 ? -22.093 -13.055 5.023   1.00 0.00 ? 20 LYS A O    2  
ATOM 391   C CB   . LYS A 1 20 ? -24.218 -13.743 7.422   1.00 0.00 ? 20 LYS A CB   2  
ATOM 392   C CG   . LYS A 1 20 ? -25.056 -13.939 6.169   1.00 0.00 ? 20 LYS A CG   2  
ATOM 393   C CD   . LYS A 1 20 ? -26.541 -13.854 6.479   1.00 0.00 ? 20 LYS A CD   2  
ATOM 394   C CE   . LYS A 1 20 ? -27.378 -14.036 5.223   1.00 0.00 ? 20 LYS A CE   2  
ATOM 395   N NZ   . LYS A 1 20 ? -28.837 -13.966 5.513   1.00 0.00 ? 20 LYS A NZ   2  
ATOM 396   H H    . LYS A 1 20 ? -22.526 -13.607 9.300   1.00 0.00 ? 20 LYS A H    2  
ATOM 397   H HA   . LYS A 1 20 ? -22.494 -14.853 6.772   1.00 0.00 ? 20 LYS A HA   2  
ATOM 398   H HB2  . LYS A 1 20 ? -24.518 -14.492 8.155   1.00 0.00 ? 20 LYS A HB2  2  
ATOM 399   H HB3  . LYS A 1 20 ? -24.421 -12.747 7.817   1.00 0.00 ? 20 LYS A HB3  2  
ATOM 400   H HG2  . LYS A 1 20 ? -24.800 -13.165 5.446   1.00 0.00 ? 20 LYS A HG2  2  
ATOM 401   H HG3  . LYS A 1 20 ? -24.838 -14.919 5.745   1.00 0.00 ? 20 LYS A HG3  2  
ATOM 402   H HD2  . LYS A 1 20 ? -26.800 -14.634 7.195   1.00 0.00 ? 20 LYS A HD2  2  
ATOM 403   H HD3  . LYS A 1 20 ? -26.759 -12.877 6.912   1.00 0.00 ? 20 LYS A HD3  2  
ATOM 404   H HE2  . LYS A 1 20 ? -27.122 -13.252 4.510   1.00 0.00 ? 20 LYS A HE2  2  
ATOM 405   H HE3  . LYS A 1 20 ? -27.151 -15.007 4.785   1.00 0.00 ? 20 LYS A HE3  2  
ATOM 406   H HZ1  . LYS A 1 20 ? -29.362 -14.090 4.659   1.00 0.00 ? 20 LYS A HZ1  2  
ATOM 407   H HZ2  . LYS A 1 20 ? -29.085 -14.694 6.167   1.00 0.00 ? 20 LYS A HZ2  2  
ATOM 408   H HZ3  . LYS A 1 20 ? -29.058 -13.065 5.913   1.00 0.00 ? 20 LYS A HZ3  2  
ATOM 409   N N    . ALA A 1 21 ? -22.125 -11.577 6.723   1.00 0.00 ? 21 ALA A N    2  
ATOM 410   C CA   . ALA A 1 21 ? -21.716 -10.435 5.911   1.00 0.00 ? 21 ALA A CA   2  
ATOM 411   C C    . ALA A 1 21 ? -20.276 -10.596 5.453   1.00 0.00 ? 21 ALA A C    2  
ATOM 412   O O    . ALA A 1 21 ? -19.937 -10.306 4.307   1.00 0.00 ? 21 ALA A O    2  
ATOM 413   C CB   . ALA A 1 21 ? -21.825 -9.148  6.713   1.00 0.00 ? 21 ALA A CB   2  
ATOM 414   H H    . ALA A 1 21 ? -22.295 -11.426 7.707   1.00 0.00 ? 21 ALA A H    2  
ATOM 415   H HA   . ALA A 1 21 ? -22.368 -10.373 5.040   1.00 0.00 ? 21 ALA A HA   2  
ATOM 416   H HB1  . ALA A 1 21 ? -21.532 -8.300  6.093   1.00 0.00 ? 21 ALA A HB1  2  
ATOM 417   H HB2  . ALA A 1 21 ? -22.855 -9.013  7.045   1.00 0.00 ? 21 ALA A HB2  2  
ATOM 418   H HB3  . ALA A 1 21 ? -21.169 -9.205  7.581   1.00 0.00 ? 21 ALA A HB3  2  
ATOM 419   N N    . ILE A 1 22 ? -19.431 -11.065 6.368   1.00 0.00 ? 22 ILE A N    2  
ATOM 420   C CA   . ILE A 1 22 ? -18.014 -11.275 6.085   1.00 0.00 ? 22 ILE A CA   2  
ATOM 421   C C    . ILE A 1 22 ? -17.838 -12.349 5.023   1.00 0.00 ? 22 ILE A C    2  
ATOM 422   O O    . ILE A 1 22 ? -17.113 -12.164 4.047   1.00 0.00 ? 22 ILE A O    2  
ATOM 423   C CB   . ILE A 1 22 ? -17.247 -11.722 7.343   1.00 0.00 ? 22 ILE A CB   2  
ATOM 424   C CG1  . ILE A 1 22 ? -17.203 -10.590 8.372   1.00 0.00 ? 22 ILE A CG1  2  
ATOM 425   C CG2  . ILE A 1 22 ? -15.819 -12.107 6.989   1.00 0.00 ? 22 ILE A CG2  2  
ATOM 426   C CD1  . ILE A 1 22 ? -16.688 -11.018 9.729   1.00 0.00 ? 22 ILE A CD1  2  
ATOM 427   H H    . ILE A 1 22 ? -19.771 -11.287 7.293   1.00 0.00 ? 22 ILE A H    2  
ATOM 428   H HA   . ILE A 1 22 ? -17.593 -10.336 5.724   1.00 0.00 ? 22 ILE A HA   2  
ATOM 429   H HB   . ILE A 1 22 ? -17.755 -12.583 7.777   1.00 0.00 ? 22 ILE A HB   2  
ATOM 430   H HG12 . ILE A 1 22 ? -16.553 -9.803  7.990   1.00 0.00 ? 22 ILE A HG12 2  
ATOM 431   H HG13 . ILE A 1 22 ? -18.213 -10.198 8.496   1.00 0.00 ? 22 ILE A HG13 2  
ATOM 432   H HG21 . ILE A 1 22 ? -15.291 -12.431 7.885   1.00 0.00 ? 22 ILE A HG21 2  
ATOM 433   H HG22 . ILE A 1 22 ? -15.833 -12.920 6.264   1.00 0.00 ? 22 ILE A HG22 2  
ATOM 434   H HG23 . ILE A 1 22 ? -15.308 -11.245 6.559   1.00 0.00 ? 22 ILE A HG23 2  
ATOM 435   H HD11 . ILE A 1 22 ? -16.678 -10.173 10.418  1.00 0.00 ? 22 ILE A HD11 2  
ATOM 436   H HD12 . ILE A 1 22 ? -17.336 -11.798 10.130  1.00 0.00 ? 22 ILE A HD12 2  
ATOM 437   H HD13 . ILE A 1 22 ? -15.675 -11.405 9.624   1.00 0.00 ? 22 ILE A HD13 2  
ATOM 438   N N    . GLY A 1 23 ? -18.512 -13.476 5.227   1.00 0.00 ? 23 GLY A N    2  
ATOM 439   C CA   . GLY A 1 23 ? -18.450 -14.602 4.299   1.00 0.00 ? 23 GLY A CA   2  
ATOM 440   C C    . GLY A 1 23 ? -19.084 -14.231 2.968   1.00 0.00 ? 23 GLY A C    2  
ATOM 441   O O    . GLY A 1 23 ? -18.547 -14.528 1.902   1.00 0.00 ? 23 GLY A O    2  
ATOM 442   H H    . GLY A 1 23 ? -19.091 -13.567 6.050   1.00 0.00 ? 23 GLY A H    2  
ATOM 443   H HA2  . GLY A 1 23 ? -17.408 -14.876 4.137   1.00 0.00 ? 23 GLY A HA2  2  
ATOM 444   H HA3  . GLY A 1 23 ? -18.984 -15.450 4.727   1.00 0.00 ? 23 GLY A HA3  2  
ATOM 445   N N    . GLY A 1 24 ? -20.238 -13.574 3.045   1.00 0.00 ? 24 GLY A N    2  
ATOM 446   C CA   . GLY A 1 24 ? -20.973 -13.148 1.858   1.00 0.00 ? 24 GLY A CA   2  
ATOM 447   C C    . GLY A 1 24 ? -20.207 -12.062 1.119   1.00 0.00 ? 24 GLY A C    2  
ATOM 448   O O    . GLY A 1 24 ? -19.933 -12.177 -0.074  1.00 0.00 ? 24 GLY A O    2  
ATOM 449   H H    . GLY A 1 24 ? -20.629 -13.357 3.951   1.00 0.00 ? 24 GLY A H    2  
ATOM 450   H HA2  . GLY A 1 24 ? -21.114 -14.002 1.196   1.00 0.00 ? 24 GLY A HA2  2  
ATOM 451   H HA3  . GLY A 1 24 ? -21.947 -12.760 2.158   1.00 0.00 ? 24 GLY A HA3  2  
ATOM 452   N N    . TYR A 1 25 ? -19.866 -11.003 1.847   1.00 0.00 ? 25 TYR A N    2  
ATOM 453   C CA   . TYR A 1 25 ? -19.128 -9.875  1.285   1.00 0.00 ? 25 TYR A CA   2  
ATOM 454   C C    . TYR A 1 25 ? -17.829 -10.350 0.656   1.00 0.00 ? 25 TYR A C    2  
ATOM 455   O O    . TYR A 1 25 ? -17.423 -9.873  -0.403  1.00 0.00 ? 25 TYR A O    2  
ATOM 456   C CB   . TYR A 1 25 ? -18.793 -8.857  2.377   1.00 0.00 ? 25 TYR A CB   2  
ATOM 457   C CG   . TYR A 1 25 ? -18.014 -7.660  1.880   1.00 0.00 ? 25 TYR A CG   2  
ATOM 458   C CD1  . TYR A 1 25 ? -18.649 -6.631  1.196   1.00 0.00 ? 25 TYR A CD1  2  
ATOM 459   C CD2  . TYR A 1 25 ? -16.645 -7.563  2.096   1.00 0.00 ? 25 TYR A CD2  2  
ATOM 460   C CE1  . TYR A 1 25 ? -17.945 -5.534  0.738   1.00 0.00 ? 25 TYR A CE1  2  
ATOM 461   C CE2  . TYR A 1 25 ? -15.925 -6.473  1.645   1.00 0.00 ? 25 TYR A CE2  2  
ATOM 462   C CZ   . TYR A 1 25 ? -16.588 -5.454  0.962   1.00 0.00 ? 25 TYR A CZ   2  
ATOM 463   O OH   . TYR A 1 25 ? -15.885 -4.363  0.507   1.00 0.00 ? 25 TYR A OH   2  
ATOM 464   H H    . TYR A 1 25 ? -20.123 -10.966 2.823   1.00 0.00 ? 25 TYR A H    2  
ATOM 465   H HA   . TYR A 1 25 ? -19.745 -9.397  0.524   1.00 0.00 ? 25 TYR A HA   2  
ATOM 466   H HB2  . TYR A 1 25 ? -19.725 -8.504  2.820   1.00 0.00 ? 25 TYR A HB2  2  
ATOM 467   H HB3  . TYR A 1 25 ? -18.207 -9.355  3.148   1.00 0.00 ? 25 TYR A HB3  2  
ATOM 468   H HD1  . TYR A 1 25 ? -19.713 -6.689  1.019   1.00 0.00 ? 25 TYR A HD1  2  
ATOM 469   H HD2  . TYR A 1 25 ? -16.135 -8.353  2.626   1.00 0.00 ? 25 TYR A HD2  2  
ATOM 470   H HE1  . TYR A 1 25 ? -18.456 -4.743  0.207   1.00 0.00 ? 25 TYR A HE1  2  
ATOM 471   H HE2  . TYR A 1 25 ? -14.861 -6.411  1.820   1.00 0.00 ? 25 TYR A HE2  2  
ATOM 472   H HH   . TYR A 1 25 ? -14.949 -4.406  0.714   1.00 0.00 ? 25 TYR A HH   2  
ATOM 473   N N    . ILE A 1 26 ? -17.179 -11.299 1.324   1.00 0.00 ? 26 ILE A N    2  
ATOM 474   C CA   . ILE A 1 26 ? -15.917 -11.861 0.852   1.00 0.00 ? 26 ILE A CA   2  
ATOM 475   C C    . ILE A 1 26 ? -16.158 -12.801 -0.318  1.00 0.00 ? 26 ILE A C    2  
ATOM 476   O O    . ILE A 1 26 ? -15.452 -12.759 -1.324  1.00 0.00 ? 26 ILE A O    2  
ATOM 477   C CB   . ILE A 1 26 ? -15.204 -12.658 1.961   1.00 0.00 ? 26 ILE A CB   2  
ATOM 478   C CG1  . ILE A 1 26 ? -14.752 -11.722 3.083   1.00 0.00 ? 26 ILE A CG1  2  
ATOM 479   C CG2  . ILE A 1 26 ? -13.980 -13.368 1.403   1.00 0.00 ? 26 ILE A CG2  2  
ATOM 480   C CD1  . ILE A 1 26 ? -14.265 -12.443 4.321   1.00 0.00 ? 26 ILE A CD1  2  
ATOM 481   H H    . ILE A 1 26 ? -17.564 -11.651 2.189   1.00 0.00 ? 26 ILE A H    2  
ATOM 482   H HA   . ILE A 1 26 ? -15.274 -11.041 0.531   1.00 0.00 ? 26 ILE A HA   2  
ATOM 483   H HB   . ILE A 1 26 ? -15.896 -13.397 2.365   1.00 0.00 ? 26 ILE A HB   2  
ATOM 484   H HG12 . ILE A 1 26 ? -13.940 -11.100 2.706   1.00 0.00 ? 26 ILE A HG12 2  
ATOM 485   H HG13 . ILE A 1 26 ? -15.595 -11.089 3.363   1.00 0.00 ? 26 ILE A HG13 2  
ATOM 486   H HG21 . ILE A 1 26 ? -13.490 -13.935 2.194   1.00 0.00 ? 26 ILE A HG21 2  
ATOM 487   H HG22 . ILE A 1 26 ? -14.287 -14.047 0.608   1.00 0.00 ? 26 ILE A HG22 2  
ATOM 488   H HG23 . ILE A 1 26 ? -13.285 -12.630 1.003   1.00 0.00 ? 26 ILE A HG23 2  
ATOM 489   H HD11 . ILE A 1 26 ? -13.956 -11.728 5.084   1.00 0.00 ? 26 ILE A HD11 2  
ATOM 490   H HD12 . ILE A 1 26 ? -15.071 -13.061 4.717   1.00 0.00 ? 26 ILE A HD12 2  
ATOM 491   H HD13 . ILE A 1 26 ? -13.417 -13.074 4.059   1.00 0.00 ? 26 ILE A HD13 2  
ATOM 492   N N    . VAL A 1 27 ? -17.169 -13.653 -0.172  1.00 0.00 ? 27 VAL A N    2  
ATOM 493   C CA   . VAL A 1 27 ? -17.529 -14.621 -1.205  1.00 0.00 ? 27 VAL A CA   2  
ATOM 494   C C    . VAL A 1 27 ? -18.242 -13.930 -2.356  1.00 0.00 ? 27 VAL A C    2  
ATOM 495   O O    . VAL A 1 27 ? -18.146 -14.350 -3.508  1.00 0.00 ? 27 VAL A O    2  
ATOM 496   C CB   . VAL A 1 27 ? -18.466 -15.712 -0.654  1.00 0.00 ? 27 VAL A CB   2  
ATOM 497   C CG1  . VAL A 1 27 ? -19.858 -15.148 -0.414  1.00 0.00 ? 27 VAL A CG1  2  
ATOM 498   C CG2  . VAL A 1 27 ? -18.578 -16.865 -1.640  1.00 0.00 ? 27 VAL A CG2  2  
ATOM 499   H H    . VAL A 1 27 ? -17.714 -13.638 0.679   1.00 0.00 ? 27 VAL A H    2  
ATOM 500   H HA   . VAL A 1 27 ? -16.616 -15.087 -1.573  1.00 0.00 ? 27 VAL A HA   2  
ATOM 501   H HB   . VAL A 1 27 ? -18.061 -16.082 0.288   1.00 0.00 ? 27 VAL A HB   2  
ATOM 502   H HG11 . VAL A 1 27 ? -20.509 -15.926 -0.016  1.00 0.00 ? 27 VAL A HG11 2  
ATOM 503   H HG12 . VAL A 1 27 ? -19.799 -14.327 0.301   1.00 0.00 ? 27 VAL A HG12 2  
ATOM 504   H HG13 . VAL A 1 27 ? -20.268 -14.780 -1.355  1.00 0.00 ? 27 VAL A HG13 2  
ATOM 505   H HG21 . VAL A 1 27 ? -19.236 -17.634 -1.236  1.00 0.00 ? 27 VAL A HG21 2  
ATOM 506   H HG22 . VAL A 1 27 ? -18.987 -16.498 -2.582  1.00 0.00 ? 27 VAL A HG22 2  
ATOM 507   H HG23 . VAL A 1 27 ? -17.590 -17.289 -1.814  1.00 0.00 ? 27 VAL A HG23 2  
ATOM 508   N N    . GLY A 1 28 ? -18.961 -12.860 -2.028  1.00 0.00 ? 28 GLY A N    2  
ATOM 509   C CA   . GLY A 1 28 ? -19.705 -12.087 -3.017  1.00 0.00 ? 28 GLY A CA   2  
ATOM 510   C C    . GLY A 1 28 ? -18.759 -11.231 -3.845  1.00 0.00 ? 28 GLY A C    2  
ATOM 511   O O    . GLY A 1 28 ? -19.070 -10.847 -4.971  1.00 0.00 ? 28 GLY A O    2  
ATOM 512   H H    . GLY A 1 28 ? -19.001 -12.563 -1.063  1.00 0.00 ? 28 GLY A H    2  
ATOM 513   H HA2  . GLY A 1 28 ? -20.243 -12.769 -3.676  1.00 0.00 ? 28 GLY A HA2  2  
ATOM 514   H HA3  . GLY A 1 28 ? -20.420 -11.441 -2.506  1.00 0.00 ? 28 GLY A HA3  2  
ATOM 515   N N    . ALA A 1 29 ? -17.596 -10.938 -3.269  1.00 0.00 ? 29 ALA A N    2  
ATOM 516   C CA   . ALA A 1 29 ? -16.581 -10.126 -3.931  1.00 0.00 ? 29 ALA A CA   2  
ATOM 517   C C    . ALA A 1 29 ? -15.715 -10.990 -4.836  1.00 0.00 ? 29 ALA A C    2  
ATOM 518   O O    . ALA A 1 29 ? -15.248 -10.545 -5.883  1.00 0.00 ? 29 ALA A O    2  
ATOM 519   C CB   . ALA A 1 29 ? -15.684 -9.456  -2.902  1.00 0.00 ? 29 ALA A CB   2  
ATOM 520   H H    . ALA A 1 29 ? -17.400 -11.284 -2.341  1.00 0.00 ? 29 ALA A H    2  
ATOM 521   H HA   . ALA A 1 29 ? -17.079 -9.362  -4.528  1.00 0.00 ? 29 ALA A HA   2  
ATOM 522   H HB1  . ALA A 1 29 ? -14.939 -8.840  -3.406  1.00 0.00 ? 29 ALA A HB1  2  
ATOM 523   H HB2  . ALA A 1 29 ? -16.290 -8.827  -2.248  1.00 0.00 ? 29 ALA A HB2  2  
ATOM 524   H HB3  . ALA A 1 29 ? -15.181 -10.219 -2.308  1.00 0.00 ? 29 ALA A HB3  2  
ATOM 525   N N    . LEU A 1 30 ? -15.509 -12.234 -4.415  1.00 0.00 ? 30 LEU A N    2  
ATOM 526   C CA   . LEU A 1 30 ? -14.701 -13.188 -5.170  1.00 0.00 ? 30 LEU A CA   2  
ATOM 527   C C    . LEU A 1 30 ? -15.230 -13.329 -6.588  1.00 0.00 ? 30 LEU A C    2  
ATOM 528   O O    . LEU A 1 30 ? -14.476 -13.586 -7.525  1.00 0.00 ? 30 LEU A O    2  
ATOM 529   C CB   . LEU A 1 30 ? -14.734 -14.564 -4.503  1.00 0.00 ? 30 LEU A CB   2  
ATOM 530   C CG   . LEU A 1 30 ? -13.993 -14.689 -3.170  1.00 0.00 ? 30 LEU A CG   2  
ATOM 531   C CD1  . LEU A 1 30 ? -14.214 -16.065 -2.559  1.00 0.00 ? 30 LEU A CD1  2  
ATOM 532   C CD2  . LEU A 1 30 ? -12.498 -14.490 -3.364  1.00 0.00 ? 30 LEU A CD2  2  
ATOM 533   H H    . LEU A 1 30 ? -15.921 -12.540 -3.545  1.00 0.00 ? 30 LEU A H    2  
ATOM 534   H HA   . LEU A 1 30 ? -13.673 -12.827 -5.202  1.00 0.00 ? 30 LEU A HA   2  
ATOM 535   H HB2  . LEU A 1 30 ? -15.779 -14.823 -4.328  1.00 0.00 ? 30 LEU A HB2  2  
ATOM 536   H HB3  . LEU A 1 30 ? -14.293 -15.279 -5.197  1.00 0.00 ? 30 LEU A HB3  2  
ATOM 537   H HG   . LEU A 1 30 ? -14.371 -13.928 -2.487  1.00 0.00 ? 30 LEU A HG   2  
ATOM 538   H HD11 . LEU A 1 30 ? -13.691 -16.137 -1.606  1.00 0.00 ? 30 LEU A HD11 2  
ATOM 539   H HD12 . LEU A 1 30 ? -15.281 -16.221 -2.397  1.00 0.00 ? 30 LEU A HD12 2  
ATOM 540   H HD13 . LEU A 1 30 ? -13.834 -16.828 -3.238  1.00 0.00 ? 30 LEU A HD13 2  
ATOM 541   H HD21 . LEU A 1 30 ? -11.985 -14.570 -2.406  1.00 0.00 ? 30 LEU A HD21 2  
ATOM 542   H HD22 . LEU A 1 30 ? -12.117 -15.253 -4.042  1.00 0.00 ? 30 LEU A HD22 2  
ATOM 543   H HD23 . LEU A 1 30 ? -12.317 -13.502 -3.788  1.00 0.00 ? 30 LEU A HD23 2  
ATOM 544   N N    . VAL A 1 31 ? -16.540 -13.156 -6.733  1.00 0.00 ? 31 VAL A N    2  
ATOM 545   C CA   . VAL A 1 31 ? -17.202 -13.257 -8.031  1.00 0.00 ? 31 VAL A CA   2  
ATOM 546   C C    . VAL A 1 31 ? -16.555 -12.316 -9.033  1.00 0.00 ? 31 VAL A C    2  
ATOM 547   O O    . VAL A 1 31 ? -16.451 -12.624 -10.219 1.00 0.00 ? 31 VAL A O    2  
ATOM 548   C CB   . VAL A 1 31 ? -18.695 -12.891 -7.933  1.00 0.00 ? 31 VAL A CB   2  
ATOM 549   C CG1  . VAL A 1 31 ? -19.308 -12.780 -9.321  1.00 0.00 ? 31 VAL A CG1  2  
ATOM 550   C CG2  . VAL A 1 31 ? -19.454 -13.955 -7.156  1.00 0.00 ? 31 VAL A CG2  2  
ATOM 551   H H    . VAL A 1 31 ? -17.107 -12.947 -5.924  1.00 0.00 ? 31 VAL A H    2  
ATOM 552   H HA   . VAL A 1 31 ? -17.109 -14.283 -8.386  1.00 0.00 ? 31 VAL A HA   2  
ATOM 553   H HB   . VAL A 1 31 ? -18.791 -11.934 -7.420  1.00 0.00 ? 31 VAL A HB   2  
ATOM 554   H HG11 . VAL A 1 31 ? -20.362 -12.512 -9.239  1.00 0.00 ? 31 VAL A HG11 2  
ATOM 555   H HG12 . VAL A 1 31 ? -18.784 -12.011 -9.889  1.00 0.00 ? 31 VAL A HG12 2  
ATOM 556   H HG13 . VAL A 1 31 ? -19.218 -13.737 -9.835  1.00 0.00 ? 31 VAL A HG13 2  
ATOM 557   H HG21 . VAL A 1 31 ? -20.507 -13.681 -7.086  1.00 0.00 ? 31 VAL A HG21 2  
ATOM 558   H HG22 . VAL A 1 31 ? -19.364 -14.912 -7.669  1.00 0.00 ? 31 VAL A HG22 2  
ATOM 559   H HG23 . VAL A 1 31 ? -19.035 -14.039 -6.153  1.00 0.00 ? 31 VAL A HG23 2  
ATOM 560   N N    . ILE A 1 32 ? -16.121 -11.160 -8.539  1.00 0.00 ? 32 ILE A N    2  
ATOM 561   C CA   . ILE A 1 32 ? -15.477 -10.148 -9.372  1.00 0.00 ? 32 ILE A CA   2  
ATOM 562   C C    . ILE A 1 32 ? -14.153 -10.666 -9.910  1.00 0.00 ? 32 ILE A C    2  
ATOM 563   O O    . ILE A 1 32 ? -13.819 -10.467 -11.077 1.00 0.00 ? 32 ILE A O    2  
ATOM 564   C CB   . ILE A 1 32 ? -15.194 -8.860  -8.577  1.00 0.00 ? 32 ILE A CB   2  
ATOM 565   C CG1  . ILE A 1 32 ? -16.505 -8.177  -8.183  1.00 0.00 ? 32 ILE A CG1  2  
ATOM 566   C CG2  . ILE A 1 32 ? -14.377 -7.887  -9.414  1.00 0.00 ? 32 ILE A CG2  2  
ATOM 567   C CD1  . ILE A 1 32 ? -16.331 -7.044  -7.196  1.00 0.00 ? 32 ILE A CD1  2  
ATOM 568   H H    . ILE A 1 32 ? -16.235 -10.965 -7.554  1.00 0.00 ? 32 ILE A H    2  
ATOM 569   H HA   . ILE A 1 32 ? -16.140 -9.915  -10.205 1.00 0.00 ? 32 ILE A HA   2  
ATOM 570   H HB   . ILE A 1 32 ? -14.637 -9.116  -7.676  1.00 0.00 ? 32 ILE A HB   2  
ATOM 571   H HG12 . ILE A 1 32 ? -16.970 -7.778  -9.085  1.00 0.00 ? 32 ILE A HG12 2  
ATOM 572   H HG13 . ILE A 1 32 ? -17.161 -8.923  -7.736  1.00 0.00 ? 32 ILE A HG13 2  
ATOM 573   H HG21 . ILE A 1 32 ? -14.175 -6.983  -8.838  1.00 0.00 ? 32 ILE A HG21 2  
ATOM 574   H HG22 . ILE A 1 32 ? -13.434 -8.355  -9.695  1.00 0.00 ? 32 ILE A HG22 2  
ATOM 575   H HG23 . ILE A 1 32 ? -14.936 -7.624  -10.313 1.00 0.00 ? 32 ILE A HG23 2  
ATOM 576   H HD11 . ILE A 1 32 ? -17.295 -6.596  -6.954  1.00 0.00 ? 32 ILE A HD11 2  
ATOM 577   H HD12 . ILE A 1 32 ? -15.877 -7.428  -6.283  1.00 0.00 ? 32 ILE A HD12 2  
ATOM 578   H HD13 . ILE A 1 32 ? -15.684 -6.283  -7.632  1.00 0.00 ? 32 ILE A HD13 2  
ATOM 579   N N    . LEU A 1 33 ? -13.402 -11.335 -9.040  1.00 0.00 ? 33 LEU A N    2  
ATOM 580   C CA   . LEU A 1 33 ? -12.103 -11.896 -9.401  1.00 0.00 ? 33 LEU A CA   2  
ATOM 581   C C    . LEU A 1 33 ? -12.260 -12.942 -10.492 1.00 0.00 ? 33 LEU A C    2  
ATOM 582   O O    . LEU A 1 33 ? -11.544 -12.932 -11.492 1.00 0.00 ? 33 LEU A O    2  
ATOM 583   C CB   . LEU A 1 33 ? -11.449 -12.558 -8.187  1.00 0.00 ? 33 LEU A CB   2  
ATOM 584   C CG   . LEU A 1 33 ? -10.929 -11.616 -7.099  1.00 0.00 ? 33 LEU A CG   2  
ATOM 585   C CD1  . LEU A 1 33 ? -10.423 -12.405 -5.901  1.00 0.00 ? 33 LEU A CD1  2  
ATOM 586   C CD2  . LEU A 1 33 ? -9.783  -10.766 -7.626  1.00 0.00 ? 33 LEU A CD2  2  
ATOM 587   H H    . LEU A 1 33 ? -13.732 -11.465 -8.094  1.00 0.00 ? 33 LEU A H    2  
ATOM 588   H HA   . LEU A 1 33 ? -11.463 -11.091 -9.761  1.00 0.00 ? 33 LEU A HA   2  
ATOM 589   H HB2  . LEU A 1 33 ? -12.188 -13.217 -7.730  1.00 0.00 ? 33 LEU A HB2  2  
ATOM 590   H HB3  . LEU A 1 33 ? -10.607 -13.149 -8.545  1.00 0.00 ? 33 LEU A HB3  2  
ATOM 591   H HG   . LEU A 1 33 ? -11.743 -10.964 -6.782  1.00 0.00 ? 33 LEU A HG   2  
ATOM 592   H HD11 . LEU A 1 33 ? -10.066 -11.722 -5.130  1.00 0.00 ? 33 LEU A HD11 2  
ATOM 593   H HD12 . LEU A 1 33 ? -11.235 -13.010 -5.498  1.00 0.00 ? 33 LEU A HD12 2  
ATOM 594   H HD13 . LEU A 1 33 ? -9.606  -13.054 -6.214  1.00 0.00 ? 33 LEU A HD13 2  
ATOM 595   H HD21 . LEU A 1 33 ? -9.430  -10.092 -6.845  1.00 0.00 ? 33 LEU A HD21 2  
ATOM 596   H HD22 . LEU A 1 33 ? -8.966  -11.415 -7.939  1.00 0.00 ? 33 LEU A HD22 2  
ATOM 597   H HD23 . LEU A 1 33 ? -10.129 -10.180 -8.478  1.00 0.00 ? 33 LEU A HD23 2  
ATOM 598   N N    . ALA A 1 34 ? -13.210 -13.849 -10.286 1.00 0.00 ? 34 ALA A N    2  
ATOM 599   C CA   . ALA A 1 34 ? -13.487 -14.920 -11.240 1.00 0.00 ? 34 ALA A CA   2  
ATOM 600   C C    . ALA A 1 34 ? -13.862 -14.343 -12.595 1.00 0.00 ? 34 ALA A C    2  
ATOM 601   O O    . ALA A 1 34 ? -13.439 -14.840 -13.638 1.00 0.00 ? 34 ALA A O    2  
ATOM 602   C CB   . ALA A 1 34 ? -14.639 -15.783 -10.749 1.00 0.00 ? 34 ALA A CB   2  
ATOM 603   H H    . ALA A 1 34 ? -13.765 -13.805 -9.443  1.00 0.00 ? 34 ALA A H    2  
ATOM 604   H HA   . ALA A 1 34 ? -12.594 -15.535 -11.344 1.00 0.00 ? 34 ALA A HA   2  
ATOM 605   H HB1  . ALA A 1 34 ? -14.828 -16.587 -11.460 1.00 0.00 ? 34 ALA A HB1  2  
ATOM 606   H HB2  . ALA A 1 34 ? -14.384 -16.210 -9.779  1.00 0.00 ? 34 ALA A HB2  2  
ATOM 607   H HB3  . ALA A 1 34 ? -15.535 -15.169 -10.651 1.00 0.00 ? 34 ALA A HB3  2  
ATOM 608   N N    . VAL A 1 35 ? -14.665 -13.283 -12.566 1.00 0.00 ? 35 VAL A N    2  
ATOM 609   C CA   . VAL A 1 35 ? -15.116 -12.613 -13.782 1.00 0.00 ? 35 VAL A CA   2  
ATOM 610   C C    . VAL A 1 35 ? -13.928 -12.178 -14.623 1.00 0.00 ? 35 VAL A C    2  
ATOM 611   O O    . VAL A 1 35 ? -13.917 -12.342 -15.842 1.00 0.00 ? 35 VAL A O    2  
ATOM 612   C CB   . VAL A 1 35 ? -15.951 -11.360 -13.459 1.00 0.00 ? 35 VAL A CB   2  
ATOM 613   C CG1  . VAL A 1 35 ? -16.232 -10.566 -14.726 1.00 0.00 ? 35 VAL A CG1  2  
ATOM 614   C CG2  . VAL A 1 35 ? -17.281 -11.752 -12.834 1.00 0.00 ? 35 VAL A CG2  2  
ATOM 615   H H    . VAL A 1 35 ? -14.980 -12.920 -11.677 1.00 0.00 ? 35 VAL A H    2  
ATOM 616   H HA   . VAL A 1 35 ? -15.727 -13.311 -14.353 1.00 0.00 ? 35 VAL A HA   2  
ATOM 617   H HB   . VAL A 1 35 ? -15.395 -10.736 -12.759 1.00 0.00 ? 35 VAL A HB   2  
ATOM 618   H HG11 . VAL A 1 35 ? -16.816 -9.677  -14.484 1.00 0.00 ? 35 VAL A HG11 2  
ATOM 619   H HG12 . VAL A 1 35 ? -15.289 -10.265 -15.182 1.00 0.00 ? 35 VAL A HG12 2  
ATOM 620   H HG13 . VAL A 1 35 ? -16.792 -11.186 -15.426 1.00 0.00 ? 35 VAL A HG13 2  
ATOM 621   H HG21 . VAL A 1 35 ? -17.859 -10.857 -12.602 1.00 0.00 ? 35 VAL A HG21 2  
ATOM 622   H HG22 . VAL A 1 35 ? -17.842 -12.372 -13.533 1.00 0.00 ? 35 VAL A HG22 2  
ATOM 623   H HG23 . VAL A 1 35 ? -17.099 -12.312 -11.917 1.00 0.00 ? 35 VAL A HG23 2  
ATOM 624   N N    . ALA A 1 36 ? -12.923 -11.621 -13.953 1.00 0.00 ? 36 ALA A N    2  
ATOM 625   C CA   . ALA A 1 36 ? -11.710 -11.150 -14.615 1.00 0.00 ? 36 ALA A CA   2  
ATOM 626   C C    . ALA A 1 36 ? -10.952 -12.315 -15.229 1.00 0.00 ? 36 ALA A C    2  
ATOM 627   O O    . ALA A 1 36 ? -10.513 -12.255 -16.377 1.00 0.00 ? 36 ALA A O    2  
ATOM 628   C CB   . ALA A 1 36 ? -10.798 -10.454 -13.617 1.00 0.00 ? 36 ALA A CB   2  
ATOM 629   H H    . ALA A 1 36 ? -12.992 -11.514 -12.951 1.00 0.00 ? 36 ALA A H    2  
ATOM 630   H HA   . ALA A 1 36 ? -11.990 -10.447 -15.400 1.00 0.00 ? 36 ALA A HA   2  
ATOM 631   H HB1  . ALA A 1 36 ? -9.903  -10.093 -14.124 1.00 0.00 ? 36 ALA A HB1  2  
ATOM 632   H HB2  . ALA A 1 36 ? -11.326 -9.610  -13.171 1.00 0.00 ? 36 ALA A HB2  2  
ATOM 633   H HB3  . ALA A 1 36 ? -10.513 -11.157 -12.835 1.00 0.00 ? 36 ALA A HB3  2  
ATOM 634   N N    . GLY A 1 37 ? -10.804 -13.381 -14.447 1.00 0.00 ? 37 GLY A N    2  
ATOM 635   C CA   . GLY A 1 37 ? -10.100 -14.581 -14.888 1.00 0.00 ? 37 GLY A CA   2  
ATOM 636   C C    . GLY A 1 37 ? -10.614 -15.030 -16.247 1.00 0.00 ? 37 GLY A C    2  
ATOM 637   O O    . GLY A 1 37 ? -9.864  -15.102 -17.219 1.00 0.00 ? 37 GLY A O    2  
ATOM 638   H H    . GLY A 1 37 ? -11.189 -13.370 -13.513 1.00 0.00 ? 37 GLY A H    2  
ATOM 639   H HA2  . GLY A 1 37 ? -9.034  -14.366 -14.960 1.00 0.00 ? 37 GLY A HA2  2  
ATOM 640   H HA3  . GLY A 1 37 ? -10.260 -15.378 -14.162 1.00 0.00 ? 37 GLY A HA3  2  
ATOM 641   N N    . LEU A 1 38 ? -11.908 -15.330 -16.301 1.00 0.00 ? 38 LEU A N    2  
ATOM 642   C CA   . LEU A 1 38 ? -12.556 -15.776 -17.532 1.00 0.00 ? 38 LEU A CA   2  
ATOM 643   C C    . LEU A 1 38 ? -12.436 -14.713 -18.611 1.00 0.00 ? 38 LEU A C    2  
ATOM 644   O O    . LEU A 1 38 ? -12.218 -15.018 -19.782 1.00 0.00 ? 38 LEU A O    2  
ATOM 645   C CB   . LEU A 1 38 ? -14.041 -16.051 -17.287 1.00 0.00 ? 38 LEU A CB   2  
ATOM 646   C CG   . LEU A 1 38 ? -14.372 -17.285 -16.445 1.00 0.00 ? 38 LEU A CG   2  
ATOM 647   C CD1  . LEU A 1 38 ? -15.866 -17.366 -16.174 1.00 0.00 ? 38 LEU A CD1  2  
ATOM 648   C CD2  . LEU A 1 38 ? -13.950 -18.556 -17.167 1.00 0.00 ? 38 LEU A CD2  2  
ATOM 649   H H    . LEU A 1 38 ? -12.473 -15.250 -15.467 1.00 0.00 ? 38 LEU A H    2  
ATOM 650   H HA   . LEU A 1 38 ? -12.072 -16.691 -17.871 1.00 0.00 ? 38 LEU A HA   2  
ATOM 651   H HB2  . LEU A 1 38 ? -14.461 -15.181 -16.781 1.00 0.00 ? 38 LEU A HB2  2  
ATOM 652   H HB3  . LEU A 1 38 ? -14.521 -16.173 -18.258 1.00 0.00 ? 38 LEU A HB3  2  
ATOM 653   H HG   . LEU A 1 38 ? -13.839 -17.216 -15.497 1.00 0.00 ? 38 LEU A HG   2  
ATOM 654   H HD11 . LEU A 1 38 ? -16.087 -18.243 -15.565 1.00 0.00 ? 38 LEU A HD11 2  
ATOM 655   H HD12 . LEU A 1 38 ? -16.187 -16.469 -15.643 1.00 0.00 ? 38 LEU A HD12 2  
ATOM 656   H HD13 . LEU A 1 38 ? -16.403 -17.439 -17.120 1.00 0.00 ? 38 LEU A HD13 2  
ATOM 657   H HD21 . LEU A 1 38 ? -14.181 -19.426 -16.553 1.00 0.00 ? 38 LEU A HD21 2  
ATOM 658   H HD22 . LEU A 1 38 ? -14.487 -18.630 -18.113 1.00 0.00 ? 38 LEU A HD22 2  
ATOM 659   H HD23 . LEU A 1 38 ? -12.878 -18.524 -17.359 1.00 0.00 ? 38 LEU A HD23 2  
ATOM 660   N N    . ILE A 1 39 ? -12.582 -13.457 -18.200 1.00 0.00 ? 39 ILE A N    2  
ATOM 661   C CA   . ILE A 1 39 ? -12.495 -12.321 -19.113 1.00 0.00 ? 39 ILE A CA   2  
ATOM 662   C C    . ILE A 1 39 ? -11.144 -12.299 -19.808 1.00 0.00 ? 39 ILE A C    2  
ATOM 663   O O    . ILE A 1 39 ? -11.053 -12.084 -21.016 1.00 0.00 ? 39 ILE A O    2  
ATOM 664   C CB   . ILE A 1 39 ? -12.666 -10.984 -18.368 1.00 0.00 ? 39 ILE A CB   2  
ATOM 665   C CG1  . ILE A 1 39 ? -14.093 -10.851 -17.831 1.00 0.00 ? 39 ILE A CG1  2  
ATOM 666   C CG2  . ILE A 1 39 ? -12.392 -9.815  -19.302 1.00 0.00 ? 39 ILE A CG2  2  
ATOM 667   C CD1  . ILE A 1 39 ? -15.155 -10.873 -18.909 1.00 0.00 ? 39 ILE A CD1  2  
ATOM 668   H H    . ILE A 1 39 ? -12.759 -13.270 -17.223 1.00 0.00 ? 39 ILE A H    2  
ATOM 669   H HA   . ILE A 1 39 ? -13.284 -12.417 -19.859 1.00 0.00 ? 39 ILE A HA   2  
ATOM 670   H HB   . ILE A 1 39 ? -11.964 -10.951 -17.535 1.00 0.00 ? 39 ILE A HB   2  
ATOM 671   H HG12 . ILE A 1 39 ? -14.282 -11.677 -17.146 1.00 0.00 ? 39 ILE A HG12 2  
ATOM 672   H HG13 . ILE A 1 39 ? -14.171 -9.907  -17.291 1.00 0.00 ? 39 ILE A HG13 2  
ATOM 673   H HG21 . ILE A 1 39 ? -12.507 -8.875  -18.761 1.00 0.00 ? 39 ILE A HG21 2  
ATOM 674   H HG22 . ILE A 1 39 ? -11.375 -9.889  -19.686 1.00 0.00 ? 39 ILE A HG22 2  
ATOM 675   H HG23 . ILE A 1 39 ? -13.097 -9.842  -20.133 1.00 0.00 ? 39 ILE A HG23 2  
ATOM 676   H HD11 . ILE A 1 39 ? -16.148 -10.776 -18.470 1.00 0.00 ? 39 ILE A HD11 2  
ATOM 677   H HD12 . ILE A 1 39 ? -14.987 -10.044 -19.597 1.00 0.00 ? 39 ILE A HD12 2  
ATOM 678   H HD13 . ILE A 1 39 ? -15.096 -11.815 -19.453 1.00 0.00 ? 39 ILE A HD13 2  
ATOM 679   N N    . TYR A 1 40 ? -10.092 -12.526 -19.026 1.00 0.00 ? 40 TYR A N    2  
ATOM 680   C CA   . TYR A 1 40 ? -8.726  -12.538 -19.541 1.00 0.00 ? 40 TYR A CA   2  
ATOM 681   C C    . TYR A 1 40 ? -8.507  -13.741 -20.442 1.00 0.00 ? 40 TYR A C    2  
ATOM 682   O O    . TYR A 1 40 ? -7.877  -13.642 -21.494 1.00 0.00 ? 40 TYR A O    2  
ATOM 683   C CB   . TYR A 1 40 ? -7.720  -12.607 -18.390 1.00 0.00 ? 40 TYR A CB   2  
ATOM 684   C CG   . TYR A 1 40 ? -6.276  -12.597 -18.838 1.00 0.00 ? 40 TYR A CG   2  
ATOM 685   C CD1  . TYR A 1 40 ? -5.660  -11.414 -19.228 1.00 0.00 ? 40 TYR A CD1  2  
ATOM 686   C CD2  . TYR A 1 40 ? -5.532  -13.770 -18.868 1.00 0.00 ? 40 TYR A CD2  2  
ATOM 687   C CE1  . TYR A 1 40 ? -4.341  -11.396 -19.639 1.00 0.00 ? 40 TYR A CE1  2  
ATOM 688   C CE2  . TYR A 1 40 ? -4.212  -13.770 -19.275 1.00 0.00 ? 40 TYR A CE2  2  
ATOM 689   C CZ   . TYR A 1 40 ? -3.619  -12.569 -19.662 1.00 0.00 ? 40 TYR A CZ   2  
ATOM 690   O OH   . TYR A 1 40 ? -2.305  -12.553 -20.070 1.00 0.00 ? 40 TYR A OH   2  
ATOM 691   H H    . TYR A 1 40 ? -10.232 -12.695 -18.040 1.00 0.00 ? 40 TYR A H    2  
ATOM 692   H HA   . TYR A 1 40 ? -8.560  -11.624 -20.111 1.00 0.00 ? 40 TYR A HA   2  
ATOM 693   H HB2  . TYR A 1 40 ? -7.885  -11.752 -17.734 1.00 0.00 ? 40 TYR A HB2  2  
ATOM 694   H HB3  . TYR A 1 40 ? -7.901  -13.521 -17.825 1.00 0.00 ? 40 TYR A HB3  2  
ATOM 695   H HD1  . TYR A 1 40 ? -6.223  -10.492 -19.209 1.00 0.00 ? 40 TYR A HD1  2  
ATOM 696   H HD2  . TYR A 1 40 ? -5.995  -14.698 -18.567 1.00 0.00 ? 40 TYR A HD2  2  
ATOM 697   H HE1  . TYR A 1 40 ? -3.879  -10.467 -19.941 1.00 0.00 ? 40 TYR A HE1  2  
ATOM 698   H HE2  . TYR A 1 40 ? -3.647  -14.689 -19.293 1.00 0.00 ? 40 TYR A HE2  2  
ATOM 699   H HH   . TYR A 1 40 ? -1.895  -13.420 -20.049 1.00 0.00 ? 40 TYR A HH   2  
ATOM 700   N N    . SER A 1 41 ? -9.036  -14.885 -20.014 1.00 0.00 ? 41 SER A N    2  
ATOM 701   C CA   . SER A 1 41 ? -8.915  -16.130 -20.765 1.00 0.00 ? 41 SER A CA   2  
ATOM 702   C C    . SER A 1 41 ? -9.540  -15.985 -22.143 1.00 0.00 ? 41 SER A C    2  
ATOM 703   O O    . SER A 1 41 ? -8.928  -16.317 -23.157 1.00 0.00 ? 41 SER A O    2  
ATOM 704   C CB   . SER A 1 41 ? -9.624  -17.270 -20.031 1.00 0.00 ? 41 SER A CB   2  
ATOM 705   O OG   . SER A 1 41 ? -8.982  -17.563 -18.802 1.00 0.00 ? 41 SER A OG   2  
ATOM 706   H H    . SER A 1 41 ? -9.542  -14.903 -19.140 1.00 0.00 ? 41 SER A H    2  
ATOM 707   H HA   . SER A 1 41 ? -7.858  -16.372 -20.871 1.00 0.00 ? 41 SER A HA   2  
ATOM 708   H HB2  . SER A 1 41 ? -10.656 -16.978 -19.833 1.00 0.00 ? 41 SER A HB2  2  
ATOM 709   H HB3  . SER A 1 41 ? -9.612  -18.160 -20.659 1.00 0.00 ? 41 SER A HB3  2  
ATOM 710   H HG   . SER A 1 41 ? -9.451  -18.280 -18.369 1.00 0.00 ? 41 SER A HG   2  
ATOM 711   N N    . MET A 1 42 ? -10.771 -15.481 -22.165 1.00 0.00 ? 42 MET A N    2  
ATOM 712   C CA   . MET A 1 42 ? -11.508 -15.278 -23.409 1.00 0.00 ? 42 MET A CA   2  
ATOM 713   C C    . MET A 1 42 ? -10.808 -14.250 -24.282 1.00 0.00 ? 42 MET A C    2  
ATOM 714   O O    . MET A 1 42 ? -10.709 -14.409 -25.498 1.00 0.00 ? 42 MET A O    2  
ATOM 715   C CB   . MET A 1 42 ? -12.925 -14.779 -23.117 1.00 0.00 ? 42 MET A CB   2  
ATOM 716   C CG   . MET A 1 42 ? -13.794 -14.620 -24.354 1.00 0.00 ? 42 MET A CG   2  
ATOM 717   S SD   . MET A 1 42 ? -15.463 -14.062 -23.964 1.00 0.00 ? 42 MET A SD   2  
ATOM 718   C CE   . MET A 1 42 ? -15.147 -12.370 -23.467 1.00 0.00 ? 42 MET A CE   2  
ATOM 719   H H    . MET A 1 42 ? -11.221 -15.227 -21.297 1.00 0.00 ? 42 MET A H    2  
ATOM 720   H HA   . MET A 1 42 ? -11.563 -16.227 -23.942 1.00 0.00 ? 42 MET A HA   2  
ATOM 721   H HB2  . MET A 1 42 ? -13.409 -15.491 -22.448 1.00 0.00 ? 42 MET A HB2  2  
ATOM 722   H HB3  . MET A 1 42 ? -12.852 -13.809 -22.624 1.00 0.00 ? 42 MET A HB3  2  
ATOM 723   H HG2  . MET A 1 42 ? -13.329 -13.894 -25.021 1.00 0.00 ? 42 MET A HG2  2  
ATOM 724   H HG3  . MET A 1 42 ? -13.856 -15.579 -24.868 1.00 0.00 ? 42 MET A HG3  2  
ATOM 725   H HE1  . MET A 1 42 ? -16.083 -11.881 -23.193 1.00 0.00 ? 42 MET A HE1  2  
ATOM 726   H HE2  . MET A 1 42 ? -14.473 -12.364 -22.610 1.00 0.00 ? 42 MET A HE2  2  
ATOM 727   H HE3  . MET A 1 42 ? -14.688 -11.829 -24.294 1.00 0.00 ? 42 MET A HE3  2  
ATOM 728   N N    . LEU A 1 43 ? -10.322 -13.190 -23.643 1.00 0.00 ? 43 LEU A N    2  
ATOM 729   C CA   . LEU A 1 43 ? -9.622  -12.113 -24.337 1.00 0.00 ? 43 LEU A CA   2  
ATOM 730   C C    . LEU A 1 43 ? -8.221  -12.554 -24.728 1.00 0.00 ? 43 LEU A C    2  
ATOM 731   O O    . LEU A 1 43 ? -7.738  -12.248 -25.817 1.00 0.00 ? 43 LEU A O    2  
ATOM 732   C CB   . LEU A 1 43 ? -9.508  -10.881 -23.437 1.00 0.00 ? 43 LEU A CB   2  
ATOM 733   C CG   . LEU A 1 43 ? -10.806 -10.121 -23.160 1.00 0.00 ? 43 LEU A CG   2  
ATOM 734   C CD1  . LEU A 1 43 ? -10.571 -9.003  -22.156 1.00 0.00 ? 43 LEU A CD1  2  
ATOM 735   C CD2  . LEU A 1 43 ? -11.352 -9.504  -24.439 1.00 0.00 ? 43 LEU A CD2  2  
ATOM 736   H H    . LEU A 1 43 ? -10.436 -13.117 -22.642 1.00 0.00 ? 43 LEU A H    2  
ATOM 737   H HA   . LEU A 1 43 ? -10.183 -11.852 -25.235 1.00 0.00 ? 43 LEU A HA   2  
ATOM 738   H HB2  . LEU A 1 43 ? -9.103  -11.206 -22.479 1.00 0.00 ? 43 LEU A HB2  2  
ATOM 739   H HB3  . LEU A 1 43 ? -8.812  -10.188 -23.910 1.00 0.00 ? 43 LEU A HB3  2  
ATOM 740   H HG   . LEU A 1 43 ? -11.541 -10.817 -22.756 1.00 0.00 ? 43 LEU A HG   2  
ATOM 741   H HD11 . LEU A 1 43 ? -11.506 -8.476  -21.959 1.00 0.00 ? 43 LEU A HD11 2  
ATOM 742   H HD12 . LEU A 1 43 ? -10.194 -9.426  -21.225 1.00 0.00 ? 43 LEU A HD12 2  
ATOM 743   H HD13 . LEU A 1 43 ? -9.841  -8.301  -22.559 1.00 0.00 ? 43 LEU A HD13 2  
ATOM 744   H HD21 . LEU A 1 43 ? -12.283 -8.975  -24.230 1.00 0.00 ? 43 LEU A HD21 2  
ATOM 745   H HD22 . LEU A 1 43 ? -10.623 -8.802  -24.843 1.00 0.00 ? 43 LEU A HD22 2  
ATOM 746   H HD23 . LEU A 1 43 ? -11.542 -10.291 -25.168 1.00 0.00 ? 43 LEU A HD23 2  
ATOM 747   N N    . ARG A 1 44 ? -7.573  -13.280 -23.822 1.00 0.00 ? 44 ARG A N    2  
ATOM 748   C CA   . ARG A 1 44 ? -6.219  -13.780 -24.045 1.00 0.00 ? 44 ARG A CA   2  
ATOM 749   C C    . ARG A 1 44 ? -6.253  -15.059 -24.866 1.00 0.00 ? 44 ARG A C    2  
ATOM 750   O O    . ARG A 1 44 ? -5.355  -15.328 -25.662 1.00 0.00 ? 44 ARG A O    2  
ATOM 751   C CB   . ARG A 1 44 ? -5.532  -14.079 -22.711 1.00 0.00 ? 44 ARG A CB   2  
ATOM 752   C CG   . ARG A 1 44 ? -4.083  -14.519 -22.844 1.00 0.00 ? 44 ARG A CG   2  
ATOM 753   C CD   . ARG A 1 44 ? -3.209  -13.392 -23.369 1.00 0.00 ? 44 ARG A CD   2  
ATOM 754   N NE   . ARG A 1 44 ? -1.810  -13.793 -23.488 1.00 0.00 ? 44 ARG A NE   2  
ATOM 755   C CZ   . ARG A 1 44 ? -0.869  -13.060 -24.073 1.00 0.00 ? 44 ARG A CZ   2  
ATOM 756   N NH1  . ARG A 1 44 ? -1.177  -11.881 -24.596 1.00 0.00 ? 44 ARG A NH1  2  
ATOM 757   N NH2  . ARG A 1 44 ? 0.378   -13.506 -24.134 1.00 0.00 ? 44 ARG A NH2  2  
ATOM 758   H H    . ARG A 1 44 ? -8.024  -13.498 -22.945 1.00 0.00 ? 44 ARG A H    2  
ATOM 759   H HA   . ARG A 1 44 ? -5.650  -13.021 -24.582 1.00 0.00 ? 44 ARG A HA   2  
ATOM 760   H HB2  . ARG A 1 44 ? -5.562  -13.176 -22.101 1.00 0.00 ? 44 ARG A HB2  2  
ATOM 761   H HB3  . ARG A 1 44 ? -6.087  -14.873 -22.211 1.00 0.00 ? 44 ARG A HB3  2  
ATOM 762   H HG2  . ARG A 1 44 ? -3.715  -14.827 -21.865 1.00 0.00 ? 44 ARG A HG2  2  
ATOM 763   H HG3  . ARG A 1 44 ? -4.030  -15.360 -23.534 1.00 0.00 ? 44 ARG A HG3  2  
ATOM 764   H HD2  . ARG A 1 44 ? -3.574  -13.090 -24.351 1.00 0.00 ? 44 ARG A HD2  2  
ATOM 765   H HD3  . ARG A 1 44 ? -3.277  -12.545 -22.686 1.00 0.00 ? 44 ARG A HD3  2  
ATOM 766   H HE   . ARG A 1 44 ? -1.553  -14.687 -23.097 1.00 0.00 ? 44 ARG A HE   2  
ATOM 767   H HH11 . ARG A 1 44 ? -2.127  -11.540 -24.549 1.00 0.00 ? 44 ARG A HH11 2  
ATOM 768   H HH12 . ARG A 1 44 ? -0.462  -11.323 -25.041 1.00 0.00 ? 44 ARG A HH12 2  
ATOM 769   H HH21 . ARG A 1 44 ? 0.613   -14.403 -23.736 1.00 0.00 ? 44 ARG A HH21 2  
ATOM 770   H HH22 . ARG A 1 44 ? 1.092   -12.948 -24.579 1.00 0.00 ? 44 ARG A HH22 2  
ATOM 771   N N    . LYS A 1 45 ? -7.305  -15.846 -24.660 1.00 0.00 ? 45 LYS A N    2  
ATOM 772   C CA   . LYS A 1 45 ? -7.485  -17.109 -25.370 1.00 0.00 ? 45 LYS A CA   2  
ATOM 773   C C    . LYS A 1 45 ? -7.884  -16.856 -26.814 1.00 0.00 ? 45 LYS A C    2  
ATOM 774   O O    . LYS A 1 45 ? -7.340  -17.457 -27.739 1.00 0.00 ? 45 LYS A O    2  
ATOM 775   C CB   . LYS A 1 45 ? -8.580  -17.946 -24.706 1.00 0.00 ? 45 LYS A CB   2  
ATOM 776   C CG   . LYS A 1 45 ? -8.799  -19.305 -25.350 1.00 0.00 ? 45 LYS A CG   2  
ATOM 777   C CD   . LYS A 1 45 ? -9.858  -20.103 -24.607 1.00 0.00 ? 45 LYS A CD   2  
ATOM 778   C CE   . LYS A 1 45 ? -10.088 -21.457 -25.260 1.00 0.00 ? 45 LYS A CE   2  
ATOM 779   N NZ   . LYS A 1 45 ? -11.115 -22.255 -24.536 1.00 0.00 ? 45 LYS A NZ   2  
ATOM 780   H H    . LYS A 1 45 ? -8.010  -15.570 -23.991 1.00 0.00 ? 45 LYS A H    2  
ATOM 781   H HA   . LYS A 1 45 ? -6.546  -17.660 -25.346 1.00 0.00 ? 45 LYS A HA   2  
ATOM 782   H HB2  . LYS A 1 45 ? -8.307  -18.101 -23.662 1.00 0.00 ? 45 LYS A HB2  2  
ATOM 783   H HB3  . LYS A 1 45 ? -9.516  -17.388 -24.757 1.00 0.00 ? 45 LYS A HB3  2  
ATOM 784   H HG2  . LYS A 1 45 ? -9.121  -19.161 -26.381 1.00 0.00 ? 45 LYS A HG2  2  
ATOM 785   H HG3  . LYS A 1 45 ? -7.862  -19.860 -25.336 1.00 0.00 ? 45 LYS A HG3  2  
ATOM 786   H HD2  . LYS A 1 45 ? -9.532  -20.255 -23.578 1.00 0.00 ? 45 LYS A HD2  2  
ATOM 787   H HD3  . LYS A 1 45 ? -10.794 -19.543 -24.612 1.00 0.00 ? 45 LYS A HD3  2  
ATOM 788   H HE2  . LYS A 1 45 ? -10.420 -21.302 -26.287 1.00 0.00 ? 45 LYS A HE2  2  
ATOM 789   H HE3  . LYS A 1 45 ? -9.150  -22.011 -25.266 1.00 0.00 ? 45 LYS A HE3  2  
ATOM 790   H HZ1  . LYS A 1 45 ? -11.243 -23.145 -24.996 1.00 0.00 ? 45 LYS A HZ1  2  
ATOM 791   H HZ2  . LYS A 1 45 ? -10.812 -22.409 -23.585 1.00 0.00 ? 45 LYS A HZ2  2  
ATOM 792   H HZ3  . LYS A 1 45 ? -11.991 -21.751 -24.533 1.00 0.00 ? 45 LYS A HZ3  2  
ATOM 793   N N    . ALA A 1 46 ? -8.846  -15.955 -26.995 1.00 0.00 ? 46 ALA A N    2  
ATOM 794   C CA   . ALA A 1 46 ? -9.342  -15.599 -28.321 1.00 0.00 ? 46 ALA A CA   2  
ATOM 795   C C    . ALA A 1 46 ? -10.433 -14.544 -28.198 1.00 0.00 ? 46 ALA A C    2  
ATOM 796   O O    . ALA A 1 46 ? -10.772 -14.123 -27.094 1.00 0.00 ? 46 ALA A O    2  
ATOM 797   C CB   . ALA A 1 46 ? -9.874  -16.848 -29.017 1.00 0.00 ? 46 ALA A CB   2  
ATOM 798   H H    . ALA A 1 46 ? -9.255  -15.495 -26.194 1.00 0.00 ? 46 ALA A H    2  
ATOM 799   H HA   . ALA A 1 46 ? -8.520  -15.189 -28.907 1.00 0.00 ? 46 ALA A HA   2  
ATOM 800   H HB1  . ALA A 1 46 ? -10.230 -16.584 -30.013 1.00 0.00 ? 46 ALA A HB1  2  
ATOM 801   H HB2  . ALA A 1 46 ? -9.075  -17.585 -29.100 1.00 0.00 ? 46 ALA A HB2  2  
ATOM 802   H HB3  . ALA A 1 46 ? -10.696 -17.267 -28.436 1.00 0.00 ? 46 ALA A HB3  2  
ATOM 803   N N    . GLY A 1 1  ? -11.424 -48.973 33.572  1.00 0.00 ? 1  GLY A N    3  
ATOM 804   C CA   . GLY A 1 1  ? -12.623 -49.786 33.615  1.00 0.00 ? 1  GLY A CA   3  
ATOM 805   C C    . GLY A 1 1  ? -13.560 -49.390 32.485  1.00 0.00 ? 1  GLY A C    3  
ATOM 806   O O    . GLY A 1 1  ? -13.257 -48.496 31.698  1.00 0.00 ? 1  GLY A O    3  
ATOM 807   H H1   . GLY A 1 1  ? -11.339 -48.276 32.846  1.00 0.00 ? 1  GLY A H1   3  
ATOM 808   H HA2  . GLY A 1 1  ? -12.353 -50.836 33.509  1.00 0.00 ? 1  GLY A HA2  3  
ATOM 809   H HA3  . GLY A 1 1  ? -13.127 -49.637 34.571  1.00 0.00 ? 1  GLY A HA3  3  
ATOM 810   N N    . VAL A 1 2  ? -14.702 -50.070 32.420  1.00 0.00 ? 2  VAL A N    3  
ATOM 811   C CA   . VAL A 1 2  ? -15.707 -49.810 31.394  1.00 0.00 ? 2  VAL A CA   3  
ATOM 812   C C    . VAL A 1 2  ? -16.368 -48.460 31.625  1.00 0.00 ? 2  VAL A C    3  
ATOM 813   O O    . VAL A 1 2  ? -16.570 -47.683 30.693  1.00 0.00 ? 2  VAL A O    3  
ATOM 814   C CB   . VAL A 1 2  ? -16.811 -50.884 31.400  1.00 0.00 ? 2  VAL A CB   3  
ATOM 815   C CG1  . VAL A 1 2  ? -17.938 -50.495 30.456  1.00 0.00 ? 2  VAL A CG1  3  
ATOM 816   C CG2  . VAL A 1 2  ? -16.250 -52.226 30.952  1.00 0.00 ? 2  VAL A CG2  3  
ATOM 817   H H    . VAL A 1 2  ? -14.890 -50.793 33.099  1.00 0.00 ? 2  VAL A H    3  
ATOM 818   H HA   . VAL A 1 2  ? -15.215 -49.809 30.422  1.00 0.00 ? 2  VAL A HA   3  
ATOM 819   H HB   . VAL A 1 2  ? -17.206 -50.978 32.412  1.00 0.00 ? 2  VAL A HB   3  
ATOM 820   H HG11 . VAL A 1 2  ? -18.717 -51.257 30.475  1.00 0.00 ? 2  VAL A HG11 3  
ATOM 821   H HG12 . VAL A 1 2  ? -18.361 -49.540 30.770  1.00 0.00 ? 2  VAL A HG12 3  
ATOM 822   H HG13 . VAL A 1 2  ? -17.547 -50.403 29.443  1.00 0.00 ? 2  VAL A HG13 3  
ATOM 823   H HG21 . VAL A 1 2  ? -17.038 -52.979 30.969  1.00 0.00 ? 2  VAL A HG21 3  
ATOM 824   H HG22 . VAL A 1 2  ? -15.858 -52.134 29.939  1.00 0.00 ? 2  VAL A HG22 3  
ATOM 825   H HG23 . VAL A 1 2  ? -15.448 -52.526 31.626  1.00 0.00 ? 2  VAL A HG23 3  
ATOM 826   N N    . ILE A 1 3  ? -16.702 -48.192 32.884  1.00 0.00 ? 3  ILE A N    3  
ATOM 827   C CA   . ILE A 1 3  ? -17.344 -46.940 33.271  1.00 0.00 ? 3  ILE A CA   3  
ATOM 828   C C    . ILE A 1 3  ? -16.396 -45.770 33.063  1.00 0.00 ? 3  ILE A C    3  
ATOM 829   O O    . ILE A 1 3  ? -16.799 -44.696 32.619  1.00 0.00 ? 3  ILE A O    3  
ATOM 830   C CB   . ILE A 1 3  ? -17.761 -46.954 34.753  1.00 0.00 ? 3  ILE A CB   3  
ATOM 831   C CG1  . ILE A 1 3  ? -18.872 -47.980 34.985  1.00 0.00 ? 3  ILE A CG1  3  
ATOM 832   C CG2  . ILE A 1 3  ? -18.273 -45.586 35.176  1.00 0.00 ? 3  ILE A CG2  3  
ATOM 833   C CD1  . ILE A 1 3  ? -19.171 -48.237 36.446  1.00 0.00 ? 3  ILE A CD1  3  
ATOM 834   H H    . ILE A 1 3  ? -16.509 -48.871 33.606  1.00 0.00 ? 3  ILE A H    3  
ATOM 835   H HA   . ILE A 1 3  ? -18.231 -46.801 32.652  1.00 0.00 ? 3  ILE A HA   3  
ATOM 836   H HB   . ILE A 1 3  ? -16.896 -47.217 35.360  1.00 0.00 ? 3  ILE A HB   3  
ATOM 837   H HG12 . ILE A 1 3  ? -19.782 -47.616 34.507  1.00 0.00 ? 3  ILE A HG12 3  
ATOM 838   H HG13 . ILE A 1 3  ? -18.572 -48.921 34.525  1.00 0.00 ? 3  ILE A HG13 3  
ATOM 839   H HG21 . ILE A 1 3  ? -18.556 -45.605 36.229  1.00 0.00 ? 3  ILE A HG21 3  
ATOM 840   H HG22 . ILE A 1 3  ? -17.489 -44.843 35.026  1.00 0.00 ? 3  ILE A HG22 3  
ATOM 841   H HG23 . ILE A 1 3  ? -19.143 -45.322 34.574  1.00 0.00 ? 3  ILE A HG23 3  
ATOM 842   H HD11 . ILE A 1 3  ? -19.969 -48.972 36.550  1.00 0.00 ? 3  ILE A HD11 3  
ATOM 843   H HD12 . ILE A 1 3  ? -18.273 -48.612 36.937  1.00 0.00 ? 3  ILE A HD12 3  
ATOM 844   H HD13 . ILE A 1 3  ? -19.482 -47.305 36.919  1.00 0.00 ? 3  ILE A HD13 3  
ATOM 845   N N    . ASP A 1 4  ? -15.127 -45.993 33.391  1.00 0.00 ? 4  ASP A N    3  
ATOM 846   C CA   . ASP A 1 4  ? -14.094 -44.972 33.251  1.00 0.00 ? 4  ASP A CA   3  
ATOM 847   C C    . ASP A 1 4  ? -14.107 -44.390 31.846  1.00 0.00 ? 4  ASP A C    3  
ATOM 848   O O    . ASP A 1 4  ? -13.954 -43.185 31.655  1.00 0.00 ? 4  ASP A O    3  
ATOM 849   C CB   . ASP A 1 4  ? -12.710 -45.570 33.514  1.00 0.00 ? 4  ASP A CB   3  
ATOM 850   C CG   . ASP A 1 4  ? -12.487 -45.901 34.976  1.00 0.00 ? 4  ASP A CG   3  
ATOM 851   O OD1  . ASP A 1 4  ? -11.345 -46.256 35.337  1.00 0.00 ? 4  ASP A OD1  3  
ATOM 852   O OD2  . ASP A 1 4  ? -13.454 -45.806 35.761  1.00 0.00 ? 4  ASP A OD2  3  
ATOM 853   H H    . ASP A 1 4  ? -14.858 -46.897 33.752  1.00 0.00 ? 4  ASP A H    3  
ATOM 854   H HA   . ASP A 1 4  ? -14.287 -44.178 33.973  1.00 0.00 ? 4  ASP A HA   3  
ATOM 855   H HB2  . ASP A 1 4  ? -12.606 -46.483 32.928  1.00 0.00 ? 4  ASP A HB2  3  
ATOM 856   H HB3  . ASP A 1 4  ? -11.953 -44.852 33.198  1.00 0.00 ? 4  ASP A HB3  3  
ATOM 857   H HD2  . ASP A 1 4  ? -13.242 -46.030 36.670  1.00 0.00 ? 4  ASP A HD2  3  
ATOM 858   N N    . THR A 1 5  ? -14.293 -45.267 30.863  1.00 0.00 ? 5  THR A N    3  
ATOM 859   C CA   . THR A 1 5  ? -14.331 -44.869 29.459  1.00 0.00 ? 5  THR A CA   3  
ATOM 860   C C    . THR A 1 5  ? -15.765 -44.645 29.008  1.00 0.00 ? 5  THR A C    3  
ATOM 861   O O    . THR A 1 5  ? -16.022 -44.282 27.862  1.00 0.00 ? 5  THR A O    3  
ATOM 862   C CB   . THR A 1 5  ? -13.712 -45.947 28.550  1.00 0.00 ? 5  THR A CB   3  
ATOM 863   O OG1  . THR A 1 5  ? -14.462 -47.162 28.666  1.00 0.00 ? 5  THR A OG1  3  
ATOM 864   C CG2  . THR A 1 5  ? -12.270 -46.218 28.951  1.00 0.00 ? 5  THR A CG2  3  
ATOM 865   H H    . THR A 1 5  ? -14.414 -46.245 31.085  1.00 0.00 ? 5  THR A H    3  
ATOM 866   H HA   . THR A 1 5  ? -13.768 -43.942 29.348  1.00 0.00 ? 5  THR A HA   3  
ATOM 867   H HB   . THR A 1 5  ? -13.740 -45.601 27.517  1.00 0.00 ? 5  THR A HB   3  
ATOM 868   H HG1  . THR A 1 5  ? -14.070 -47.820 28.089  1.00 0.00 ? 5  THR A HG1  3  
ATOM 869   H HG21 . THR A 1 5  ? -11.844 -46.980 28.300  1.00 0.00 ? 5  THR A HG21 3  
ATOM 870   H HG22 . THR A 1 5  ? -11.691 -45.299 28.861  1.00 0.00 ? 5  THR A HG22 3  
ATOM 871   H HG23 . THR A 1 5  ? -12.241 -46.566 29.983  1.00 0.00 ? 5  THR A HG23 3  
ATOM 872   N N    . SER A 1 6  ? -16.699 -44.869 29.929  1.00 0.00 ? 6  SER A N    3  
ATOM 873   C CA   . SER A 1 6  ? -18.122 -44.700 29.653  1.00 0.00 ? 6  SER A CA   3  
ATOM 874   C C    . SER A 1 6  ? -18.379 -43.360 28.981  1.00 0.00 ? 6  SER A C    3  
ATOM 875   O O    . SER A 1 6  ? -18.890 -43.296 27.864  1.00 0.00 ? 6  SER A O    3  
ATOM 876   C CB   . SER A 1 6  ? -18.930 -44.752 30.951  1.00 0.00 ? 6  SER A CB   3  
ATOM 877   O OG   . SER A 1 6  ? -20.313 -44.580 30.699  1.00 0.00 ? 6  SER A OG   3  
ATOM 878   H H    . SER A 1 6  ? -16.425 -45.165 30.855  1.00 0.00 ? 6  SER A H    3  
ATOM 879   H HA   . SER A 1 6  ? -18.449 -45.503 28.993  1.00 0.00 ? 6  SER A HA   3  
ATOM 880   H HB2  . SER A 1 6  ? -18.774 -45.718 31.430  1.00 0.00 ? 6  SER A HB2  3  
ATOM 881   H HB3  . SER A 1 6  ? -18.589 -43.958 31.615  1.00 0.00 ? 6  SER A HB3  3  
ATOM 882   H HG   . SER A 1 6  ? -20.789 -44.617 31.532  1.00 0.00 ? 6  SER A HG   3  
ATOM 883   N N    . ALA A 1 7  ? -18.017 -42.288 29.680  1.00 0.00 ? 7  ALA A N    3  
ATOM 884   C CA   . ALA A 1 7  ? -18.197 -40.930 29.174  1.00 0.00 ? 7  ALA A CA   3  
ATOM 885   C C    . ALA A 1 7  ? -17.427 -40.739 27.877  1.00 0.00 ? 7  ALA A C    3  
ATOM 886   O O    . ALA A 1 7  ? -17.916 -40.123 26.931  1.00 0.00 ? 7  ALA A O    3  
ATOM 887   C CB   . ALA A 1 7  ? -17.692 -39.915 30.188  1.00 0.00 ? 7  ALA A CB   3  
ATOM 888   H H    . ALA A 1 7  ? -17.604 -42.405 30.594  1.00 0.00 ? 7  ALA A H    3  
ATOM 889   H HA   . ALA A 1 7  ? -19.259 -40.761 28.993  1.00 0.00 ? 7  ALA A HA   3  
ATOM 890   H HB1  . ALA A 1 7  ? -17.845 -38.905 29.807  1.00 0.00 ? 7  ALA A HB1  3  
ATOM 891   H HB2  . ALA A 1 7  ? -18.239 -40.034 31.124  1.00 0.00 ? 7  ALA A HB2  3  
ATOM 892   H HB3  . ALA A 1 7  ? -16.629 -40.078 30.365  1.00 0.00 ? 7  ALA A HB3  3  
ATOM 893   N N    . VAL A 1 8  ? -16.211 -41.277 27.846  1.00 0.00 ? 8  VAL A N    3  
ATOM 894   C CA   . VAL A 1 8  ? -15.345 -41.181 26.674  1.00 0.00 ? 8  VAL A CA   3  
ATOM 895   C C    . VAL A 1 8  ? -15.976 -41.892 25.488  1.00 0.00 ? 8  VAL A C    3  
ATOM 896   O O    . VAL A 1 8  ? -15.938 -41.403 24.360  1.00 0.00 ? 8  VAL A O    3  
ATOM 897   C CB   . VAL A 1 8  ? -13.969 -41.823 26.935  1.00 0.00 ? 8  VAL A CB   3  
ATOM 898   C CG1  . VAL A 1 8  ? -13.165 -41.899 25.646  1.00 0.00 ? 8  VAL A CG1  3  
ATOM 899   C CG2  . VAL A 1 8  ? -13.182 -41.003 27.945  1.00 0.00 ? 8  VAL A CG2  3  
ATOM 900   H H    . VAL A 1 8  ? -15.865 -41.771 28.656  1.00 0.00 ? 8  VAL A H    3  
ATOM 901   H HA   . VAL A 1 8  ? -15.208 -40.127 26.433  1.00 0.00 ? 8  VAL A HA   3  
ATOM 902   H HB   . VAL A 1 8  ? -14.118 -42.829 27.326  1.00 0.00 ? 8  VAL A HB   3  
ATOM 903   H HG11 . VAL A 1 8  ? -12.198 -42.362 25.841  1.00 0.00 ? 8  VAL A HG11 3  
ATOM 904   H HG12 . VAL A 1 8  ? -13.710 -42.494 24.914  1.00 0.00 ? 8  VAL A HG12 3  
ATOM 905   H HG13 . VAL A 1 8  ? -13.012 -40.893 25.255  1.00 0.00 ? 8  VAL A HG13 3  
ATOM 906   H HG21 . VAL A 1 8  ? -12.215 -41.471 28.128  1.00 0.00 ? 8  VAL A HG21 3  
ATOM 907   H HG22 . VAL A 1 8  ? -13.029 -39.997 27.554  1.00 0.00 ? 8  VAL A HG22 3  
ATOM 908   H HG23 . VAL A 1 8  ? -13.740 -40.948 28.880  1.00 0.00 ? 8  VAL A HG23 3  
ATOM 909   N N    . GLU A 1 9  ? -16.557 -43.058 25.758  1.00 0.00 ? 9  GLU A N    3  
ATOM 910   C CA   . GLU A 1 9  ? -17.207 -43.863 24.728  1.00 0.00 ? 9  GLU A CA   3  
ATOM 911   C C    . GLU A 1 9  ? -18.293 -43.060 24.031  1.00 0.00 ? 9  GLU A C    3  
ATOM 912   O O    . GLU A 1 9  ? -18.474 -43.152 22.818  1.00 0.00 ? 9  GLU A O    3  
ATOM 913   C CB   . GLU A 1 9  ? -17.847 -45.108 25.345  1.00 0.00 ? 9  GLU A CB   3  
ATOM 914   C CG   . GLU A 1 9  ? -18.489 -46.043 24.333  1.00 0.00 ? 9  GLU A CG   3  
ATOM 915   C CD   . GLU A 1 9  ? -19.068 -47.288 24.975  1.00 0.00 ? 9  GLU A CD   3  
ATOM 916   O OE1  . GLU A 1 9  ? -18.968 -47.419 26.214  1.00 0.00 ? 9  GLU A OE1  3  
ATOM 917   O OE2  . GLU A 1 9  ? -19.621 -48.133 24.241  1.00 0.00 ? 9  GLU A OE2  3  
ATOM 918   H H    . GLU A 1 9  ? -16.555 -43.407 26.706  1.00 0.00 ? 9  GLU A H    3  
ATOM 919   H HA   . GLU A 1 9  ? -16.458 -44.168 23.998  1.00 0.00 ? 9  GLU A HA   3  
ATOM 920   H HB2  . GLU A 1 9  ? -17.075 -45.660 25.880  1.00 0.00 ? 9  GLU A HB2  3  
ATOM 921   H HB3  . GLU A 1 9  ? -18.615 -44.785 26.048  1.00 0.00 ? 9  GLU A HB3  3  
ATOM 922   H HG2  . GLU A 1 9  ? -19.290 -45.508 23.821  1.00 0.00 ? 9  GLU A HG2  3  
ATOM 923   H HG3  . GLU A 1 9  ? -17.735 -46.342 23.605  1.00 0.00 ? 9  GLU A HG3  3  
ATOM 924   H HE2  . GLU A 1 9  ? -19.965 -48.895 24.713  1.00 0.00 ? 9  GLU A HE2  3  
ATOM 925   N N    . SER A 1 10 ? -19.016 -42.267 24.817  1.00 0.00 ? 10 SER A N    3  
ATOM 926   C CA   . SER A 1 10 ? -20.096 -41.431 24.301  1.00 0.00 ? 10 SER A CA   3  
ATOM 927   C C    . SER A 1 10 ? -19.539 -40.152 23.700  1.00 0.00 ? 10 SER A C    3  
ATOM 928   O O    . SER A 1 10 ? -19.899 -39.760 22.591  1.00 0.00 ? 10 SER A O    3  
ATOM 929   C CB   . SER A 1 10 ? -21.066 -41.055 25.423  1.00 0.00 ? 10 SER A CB   3  
ATOM 930   O OG   . SER A 1 10 ? -21.706 -42.204 25.950  1.00 0.00 ? 10 SER A OG   3  
ATOM 931   H H    . SER A 1 10 ? -18.819 -42.233 25.807  1.00 0.00 ? 10 SER A H    3  
ATOM 932   H HA   . SER A 1 10 ? -20.633 -41.987 23.533  1.00 0.00 ? 10 SER A HA   3  
ATOM 933   H HB2  . SER A 1 10 ? -20.514 -40.558 26.221  1.00 0.00 ? 10 SER A HB2  3  
ATOM 934   H HB3  . SER A 1 10 ? -21.823 -40.376 25.028  1.00 0.00 ? 10 SER A HB3  3  
ATOM 935   H HG   . SER A 1 10 ? -22.306 -41.933 26.649  1.00 0.00 ? 10 SER A HG   3  
ATOM 936   N N    . ALA A 1 11 ? -18.652 -39.503 24.451  1.00 0.00 ? 11 ALA A N    3  
ATOM 937   C CA   . ALA A 1 11 ? -18.025 -38.259 24.016  1.00 0.00 ? 11 ALA A CA   3  
ATOM 938   C C    . ALA A 1 11 ? -17.120 -38.507 22.820  1.00 0.00 ? 11 ALA A C    3  
ATOM 939   O O    . ALA A 1 11 ? -17.059 -37.704 21.891  1.00 0.00 ? 11 ALA A O    3  
ATOM 940   C CB   . ALA A 1 11 ? -17.187 -37.667 25.139  1.00 0.00 ? 11 ALA A CB   3  
ATOM 941   H H    . ALA A 1 11 ? -18.398 -39.875 25.355  1.00 0.00 ? 11 ALA A H    3  
ATOM 942   H HA   . ALA A 1 11 ? -18.807 -37.552 23.738  1.00 0.00 ? 11 ALA A HA   3  
ATOM 943   H HB1  . ALA A 1 11 ? -16.736 -36.731 24.810  1.00 0.00 ? 11 ALA A HB1  3  
ATOM 944   H HB2  . ALA A 1 11 ? -17.823 -37.476 26.004  1.00 0.00 ? 11 ALA A HB2  3  
ATOM 945   H HB3  . ALA A 1 11 ? -16.401 -38.370 25.414  1.00 0.00 ? 11 ALA A HB3  3  
ATOM 946   N N    . ILE A 1 12 ? -16.417 -39.635 22.856  1.00 0.00 ? 12 ILE A N    3  
ATOM 947   C CA   . ILE A 1 12 ? -15.504 -40.020 21.785  1.00 0.00 ? 12 ILE A CA   3  
ATOM 948   C C    . ILE A 1 12 ? -16.275 -40.326 20.512  1.00 0.00 ? 12 ILE A C    3  
ATOM 949   O O    . ILE A 1 12 ? -15.910 -39.883 19.424  1.00 0.00 ? 12 ILE A O    3  
ATOM 950   C CB   . ILE A 1 12 ? -14.692 -41.274 22.159  1.00 0.00 ? 12 ILE A CB   3  
ATOM 951   C CG1  . ILE A 1 12 ? -13.738 -40.966 23.315  1.00 0.00 ? 12 ILE A CG1  3  
ATOM 952   C CG2  . ILE A 1 12 ? -13.871 -41.751 20.971  1.00 0.00 ? 12 ILE A CG2  3  
ATOM 953   C CD1  . ILE A 1 12 ? -12.726 -39.886 23.000  1.00 0.00 ? 12 ILE A CD1  3  
ATOM 954   H H    . ILE A 1 12 ? -16.512 -40.255 23.648  1.00 0.00 ? 12 ILE A H    3  
ATOM 955   H HA   . ILE A 1 12 ? -14.819 -39.192 21.603  1.00 0.00 ? 12 ILE A HA   3  
ATOM 956   H HB   . ILE A 1 12 ? -15.381 -42.063 22.461  1.00 0.00 ? 12 ILE A HB   3  
ATOM 957   H HG12 . ILE A 1 12 ? -14.329 -40.643 24.172  1.00 0.00 ? 12 ILE A HG12 3  
ATOM 958   H HG13 . ILE A 1 12 ? -13.199 -41.878 23.568  1.00 0.00 ? 12 ILE A HG13 3  
ATOM 959   H HG21 . ILE A 1 12 ? -13.309 -42.643 21.245  1.00 0.00 ? 12 ILE A HG21 3  
ATOM 960   H HG22 . ILE A 1 12 ? -14.538 -41.984 20.141  1.00 0.00 ? 12 ILE A HG22 3  
ATOM 961   H HG23 . ILE A 1 12 ? -13.178 -40.965 20.671  1.00 0.00 ? 12 ILE A HG23 3  
ATOM 962   H HD11 . ILE A 1 12 ? -12.077 -39.708 23.857  1.00 0.00 ? 12 ILE A HD11 3  
ATOM 963   H HD12 . ILE A 1 12 ? -12.119 -40.198 22.151  1.00 0.00 ? 12 ILE A HD12 3  
ATOM 964   H HD13 . ILE A 1 12 ? -13.250 -38.962 22.752  1.00 0.00 ? 12 ILE A HD13 3  
ATOM 965   N N    . THR A 1 13 ? -17.351 -41.094 20.663  1.00 0.00 ? 13 THR A N    3  
ATOM 966   C CA   . THR A 1 13 ? -18.199 -41.479 19.538  1.00 0.00 ? 13 THR A CA   3  
ATOM 967   C C    . THR A 1 13 ? -18.868 -40.256 18.932  1.00 0.00 ? 13 THR A C    3  
ATOM 968   O O    . THR A 1 13 ? -18.954 -40.117 17.713  1.00 0.00 ? 13 THR A O    3  
ATOM 969   C CB   . THR A 1 13 ? -19.306 -42.456 19.974  1.00 0.00 ? 13 THR A CB   3  
ATOM 970   O OG1  . THR A 1 13 ? -18.714 -43.659 20.481  1.00 0.00 ? 13 THR A OG1  3  
ATOM 971   C CG2  . THR A 1 13 ? -20.202 -42.807 18.796  1.00 0.00 ? 13 THR A CG2  3  
ATOM 972   H H    . THR A 1 13 ? -17.600 -41.427 21.584  1.00 0.00 ? 13 THR A H    3  
ATOM 973   H HA   . THR A 1 13 ? -17.575 -41.960 18.785  1.00 0.00 ? 13 THR A HA   3  
ATOM 974   H HB   . THR A 1 13 ? -19.906 -41.989 20.756  1.00 0.00 ? 13 THR A HB   3  
ATOM 975   H HG1  . THR A 1 13 ? -19.416 -44.253 20.756  1.00 0.00 ? 13 THR A HG1  3  
ATOM 976   H HG21 . THR A 1 13 ? -20.982 -43.496 19.118  1.00 0.00 ? 13 THR A HG21 3  
ATOM 977   H HG22 . THR A 1 13 ? -20.662 -41.898 18.407  1.00 0.00 ? 13 THR A HG22 3  
ATOM 978   H HG23 . THR A 1 13 ? -19.606 -43.276 18.014  1.00 0.00 ? 13 THR A HG23 3  
ATOM 979   N N    . ASP A 1 14 ? -19.342 -39.369 19.803  1.00 0.00 ? 14 ASP A N    3  
ATOM 980   C CA   . ASP A 1 14 ? -20.011 -38.142 19.381  1.00 0.00 ? 14 ASP A CA   3  
ATOM 981   C C    . ASP A 1 14 ? -19.022 -37.197 18.720  1.00 0.00 ? 14 ASP A C    3  
ATOM 982   O O    . ASP A 1 14 ? -19.264 -36.685 17.628  1.00 0.00 ? 14 ASP A O    3  
ATOM 983   C CB   . ASP A 1 14 ? -20.631 -37.429 20.584  1.00 0.00 ? 14 ASP A CB   3  
ATOM 984   C CG   . ASP A 1 14 ? -21.840 -38.159 21.135  1.00 0.00 ? 14 ASP A CG   3  
ATOM 985   O OD1  . ASP A 1 14 ? -22.513 -37.604 22.029  1.00 0.00 ? 14 ASP A OD1  3  
ATOM 986   O OD2  . ASP A 1 14 ? -22.116 -39.285 20.671  1.00 0.00 ? 14 ASP A OD2  3  
ATOM 987   H H    . ASP A 1 14 ? -19.242 -39.540 20.793  1.00 0.00 ? 14 ASP A H    3  
ATOM 988   H HA   . ASP A 1 14 ? -20.797 -38.398 18.670  1.00 0.00 ? 14 ASP A HA   3  
ATOM 989   H HB2  . ASP A 1 14 ? -19.881 -37.351 21.371  1.00 0.00 ? 14 ASP A HB2  3  
ATOM 990   H HB3  . ASP A 1 14 ? -20.936 -36.427 20.279  1.00 0.00 ? 14 ASP A HB3  3  
ATOM 991   H HD2  . ASP A 1 14 ? -22.893 -39.688 21.064  1.00 0.00 ? 14 ASP A HD2  3  
ATOM 992   N N    . GLY A 1 15 ? -17.901 -36.972 19.398  1.00 0.00 ? 15 GLY A N    3  
ATOM 993   C CA   . GLY A 1 15 ? -16.851 -36.089 18.898  1.00 0.00 ? 15 GLY A CA   3  
ATOM 994   C C    . GLY A 1 15 ? -15.950 -36.830 17.923  1.00 0.00 ? 15 GLY A C    3  
ATOM 995   O O    . GLY A 1 15 ? -15.935 -36.542 16.727  1.00 0.00 ? 15 GLY A O    3  
ATOM 996   H H    . GLY A 1 15 ? -17.761 -37.422 20.291  1.00 0.00 ? 15 GLY A H    3  
ATOM 997   H HA2  . GLY A 1 15 ? -17.308 -35.239 18.390  1.00 0.00 ? 15 GLY A HA2  3  
ATOM 998   H HA3  . GLY A 1 15 ? -16.255 -35.729 19.737  1.00 0.00 ? 15 GLY A HA3  3  
ATOM 999   N N    . GLN A 1 16 ? -15.198 -37.790 18.452  1.00 0.00 ? 16 GLN A N    3  
ATOM 1000  C CA   . GLN A 1 16 ? -14.281 -38.594 17.650  1.00 0.00 ? 16 GLN A CA   3  
ATOM 1001  C C    . GLN A 1 16 ? -14.983 -39.124 16.410  1.00 0.00 ? 16 GLN A C    3  
ATOM 1002  O O    . GLN A 1 16 ? -14.526 -38.925 15.286  1.00 0.00 ? 16 GLN A O    3  
ATOM 1003  C CB   . GLN A 1 16 ? -13.764 -39.785 18.460  1.00 0.00 ? 16 GLN A CB   3  
ATOM 1004  C CG   . GLN A 1 16 ? -12.766 -40.656 17.714  1.00 0.00 ? 16 GLN A CG   3  
ATOM 1005  C CD   . GLN A 1 16 ? -11.482 -39.920 17.387  1.00 0.00 ? 16 GLN A CD   3  
ATOM 1006  O OE1  . GLN A 1 16 ? -10.826 -39.372 18.273  1.00 0.00 ? 16 GLN A OE1  3  
ATOM 1007  N NE2  . GLN A 1 16 ? -11.119 -39.906 16.109  1.00 0.00 ? 16 GLN A NE2  3  
ATOM 1008  H H    . GLN A 1 16 ? -15.255 -37.977 19.443  1.00 0.00 ? 16 GLN A H    3  
ATOM 1009  H HA   . GLN A 1 16 ? -13.440 -37.969 17.350  1.00 0.00 ? 16 GLN A HA   3  
ATOM 1010  H HB2  . GLN A 1 16 ? -13.281 -39.403 19.359  1.00 0.00 ? 16 GLN A HB2  3  
ATOM 1011  H HB3  . GLN A 1 16 ? -14.617 -40.404 18.741  1.00 0.00 ? 16 GLN A HB3  3  
ATOM 1012  H HG2  . GLN A 1 16 ? -12.527 -41.521 18.331  1.00 0.00 ? 16 GLN A HG2  3  
ATOM 1013  H HG3  . GLN A 1 16 ? -13.223 -40.994 16.784  1.00 0.00 ? 16 GLN A HG3  3  
ATOM 1014  H HE21 . GLN A 1 16 ? -11.691 -40.370 15.418  1.00 0.00 ? 16 GLN A HE21 3  
ATOM 1015  H HE22 . GLN A 1 16 ? -10.273 -39.430 15.831  1.00 0.00 ? 16 GLN A HE22 3  
ATOM 1016  N N    . GLY A 1 17 ? -16.104 -39.805 16.632  1.00 0.00 ? 17 GLY A N    3  
ATOM 1017  C CA   . GLY A 1 17 ? -16.895 -40.379 15.547  1.00 0.00 ? 17 GLY A CA   3  
ATOM 1018  C C    . GLY A 1 17 ? -17.183 -39.330 14.485  1.00 0.00 ? 17 GLY A C    3  
ATOM 1019  O O    . GLY A 1 17 ? -17.016 -39.571 13.291  1.00 0.00 ? 17 GLY A O    3  
ATOM 1020  H H    . GLY A 1 17 ? -16.429 -39.935 17.580  1.00 0.00 ? 17 GLY A H    3  
ATOM 1021  H HA2  . GLY A 1 17 ? -16.343 -41.203 15.097  1.00 0.00 ? 17 GLY A HA2  3  
ATOM 1022  H HA3  . GLY A 1 17 ? -17.838 -40.752 15.948  1.00 0.00 ? 17 GLY A HA3  3  
ATOM 1023  N N    . ASP A 1 18 ? -17.618 -38.157 14.938  1.00 0.00 ? 18 ASP A N    3  
ATOM 1024  C CA   . ASP A 1 18 ? -17.939 -37.047 14.046  1.00 0.00 ? 18 ASP A CA   3  
ATOM 1025  C C    . ASP A 1 18 ? -16.745 -36.709 13.167  1.00 0.00 ? 18 ASP A C    3  
ATOM 1026  O O    . ASP A 1 18 ? -16.868 -35.994 12.174  1.00 0.00 ? 18 ASP A O    3  
ATOM 1027  C CB   . ASP A 1 18 ? -18.314 -35.802 14.853  1.00 0.00 ? 18 ASP A CB   3  
ATOM 1028  C CG   . ASP A 1 18 ? -19.655 -35.940 15.547  1.00 0.00 ? 18 ASP A CG   3  
ATOM 1029  O OD1  . ASP A 1 18 ? -20.401 -34.939 15.601  1.00 0.00 ? 18 ASP A OD1  3  
ATOM 1030  O OD2  . ASP A 1 18 ? -19.960 -37.048 16.036  1.00 0.00 ? 18 ASP A OD2  3  
ATOM 1031  H H    . ASP A 1 18 ? -17.735 -38.019 15.932  1.00 0.00 ? 18 ASP A H    3  
ATOM 1032  H HA   . ASP A 1 18 ? -18.782 -37.335 13.417  1.00 0.00 ? 18 ASP A HA   3  
ATOM 1033  H HB2  . ASP A 1 18 ? -17.546 -35.627 15.607  1.00 0.00 ? 18 ASP A HB2  3  
ATOM 1034  H HB3  . ASP A 1 18 ? -18.356 -34.946 14.179  1.00 0.00 ? 18 ASP A HB3  3  
ATOM 1035  H HD2  . ASP A 1 18 ? -20.822 -37.063 16.459  1.00 0.00 ? 18 ASP A HD2  3  
ATOM 1036  N N    . MET A 1 19 ? -15.584 -37.235 13.546  1.00 0.00 ? 19 MET A N    3  
ATOM 1037  C CA   . MET A 1 19 ? -14.345 -37.006 12.809  1.00 0.00 ? 19 MET A CA   3  
ATOM 1038  C C    . MET A 1 19 ? -14.433 -37.615 11.419  1.00 0.00 ? 19 MET A C    3  
ATOM 1039  O O    . MET A 1 19 ? -14.013 -37.011 10.433  1.00 0.00 ? 19 MET A O    3  
ATOM 1040  C CB   . MET A 1 19 ? -13.161 -37.640 13.541  1.00 0.00 ? 19 MET A CB   3  
ATOM 1041  C CG   . MET A 1 19 ? -11.814 -37.379 12.887  1.00 0.00 ? 19 MET A CG   3  
ATOM 1042  S SD   . MET A 1 19 ? -10.445 -38.131 13.788  1.00 0.00 ? 19 MET A SD   3  
ATOM 1043  C CE   . MET A 1 19 ? -10.417 -37.120 15.266  1.00 0.00 ? 19 MET A CE   3  
ATOM 1044  H H    . MET A 1 19 ? -15.547 -37.814 14.373  1.00 0.00 ? 19 MET A H    3  
ATOM 1045  H HA   . MET A 1 19 ? -14.182 -35.931 12.723  1.00 0.00 ? 19 MET A HA   3  
ATOM 1046  H HB2  . MET A 1 19 ? -13.133 -37.241 14.555  1.00 0.00 ? 19 MET A HB2  3  
ATOM 1047  H HB3  . MET A 1 19 ? -13.320 -38.717 13.579  1.00 0.00 ? 19 MET A HB3  3  
ATOM 1048  H HG2  . MET A 1 19 ? -11.831 -37.780 11.874  1.00 0.00 ? 19 MET A HG2  3  
ATOM 1049  H HG3  . MET A 1 19 ? -11.651 -36.302 12.834  1.00 0.00 ? 19 MET A HG3  3  
ATOM 1050  H HE1  . MET A 1 19 ? -9.623  -37.456 15.932  1.00 0.00 ? 19 MET A HE1  3  
ATOM 1051  H HE2  . MET A 1 19 ? -10.240 -36.080 14.990  1.00 0.00 ? 19 MET A HE2  3  
ATOM 1052  H HE3  . MET A 1 19 ? -11.376 -37.201 15.779  1.00 0.00 ? 19 MET A HE3  3  
ATOM 1053  N N    . LYS A 1 20 ? -14.985 -38.823 11.354  1.00 0.00 ? 20 LYS A N    3  
ATOM 1054  C CA   . LYS A 1 20 ? -15.142 -39.542 10.093  1.00 0.00 ? 20 LYS A CA   3  
ATOM 1055  C C    . LYS A 1 20 ? -15.961 -38.720 9.110   1.00 0.00 ? 20 LYS A C    3  
ATOM 1056  O O    . LYS A 1 20 ? -15.647 -38.651 7.923   1.00 0.00 ? 20 LYS A O    3  
ATOM 1057  C CB   . LYS A 1 20 ? -15.857 -40.875 10.322  1.00 0.00 ? 20 LYS A CB   3  
ATOM 1058  C CG   . LYS A 1 20 ? -16.008 -41.722 9.068   1.00 0.00 ? 20 LYS A CG   3  
ATOM 1059  C CD   . LYS A 1 20 ? -16.674 -43.052 9.378   1.00 0.00 ? 20 LYS A CD   3  
ATOM 1060  C CE   . LYS A 1 20 ? -16.839 -43.892 8.122   1.00 0.00 ? 20 LYS A CE   3  
ATOM 1061  N NZ   . LYS A 1 20 ? -17.480 -45.205 8.411   1.00 0.00 ? 20 LYS A NZ   3  
ATOM 1062  H H    . LYS A 1 20 ? -15.311 -39.267 12.200  1.00 0.00 ? 20 LYS A H    3  
ATOM 1063  H HA   . LYS A 1 20 ? -14.155 -39.730 9.672   1.00 0.00 ? 20 LYS A HA   3  
ATOM 1064  H HB2  . LYS A 1 20 ? -15.289 -41.446 11.055  1.00 0.00 ? 20 LYS A HB2  3  
ATOM 1065  H HB3  . LYS A 1 20 ? -16.852 -40.666 10.716  1.00 0.00 ? 20 LYS A HB3  3  
ATOM 1066  H HG2  . LYS A 1 20 ? -16.617 -41.180 8.345   1.00 0.00 ? 20 LYS A HG2  3  
ATOM 1067  H HG3  . LYS A 1 20 ? -15.022 -41.909 8.645   1.00 0.00 ? 20 LYS A HG3  3  
ATOM 1068  H HD2  . LYS A 1 20 ? -16.060 -43.599 10.093  1.00 0.00 ? 20 LYS A HD2  3  
ATOM 1069  H HD3  . LYS A 1 20 ? -17.657 -42.864 9.812   1.00 0.00 ? 20 LYS A HD3  3  
ATOM 1070  H HE2  . LYS A 1 20 ? -17.458 -43.345 7.410   1.00 0.00 ? 20 LYS A HE2  3  
ATOM 1071  H HE3  . LYS A 1 20 ? -15.857 -44.067 7.683   1.00 0.00 ? 20 LYS A HE3  3  
ATOM 1072  H HZ1  . LYS A 1 20 ? -17.574 -45.734 7.556   1.00 0.00 ? 20 LYS A HZ1  3  
ATOM 1073  H HZ2  . LYS A 1 20 ? -16.909 -45.721 9.064   1.00 0.00 ? 20 LYS A HZ2  3  
ATOM 1074  H HZ3  . LYS A 1 20 ? -18.395 -45.051 8.812   1.00 0.00 ? 20 LYS A HZ3  3  
ATOM 1075  N N    . ALA A 1 21 ? -17.018 -38.095 9.623   1.00 0.00 ? 21 ALA A N    3  
ATOM 1076  C CA   . ALA A 1 21 ? -17.904 -37.267 8.811   1.00 0.00 ? 21 ALA A CA   3  
ATOM 1077  C C    . ALA A 1 21 ? -17.186 -36.009 8.353   1.00 0.00 ? 21 ALA A C    3  
ATOM 1078  O O    . ALA A 1 21 ? -17.317 -35.582 7.207   1.00 0.00 ? 21 ALA A O    3  
ATOM 1079  C CB   . ALA A 1 21 ? -19.130 -36.857 9.613   1.00 0.00 ? 21 ALA A CB   3  
ATOM 1080  H H    . ALA A 1 21 ? -17.224 -38.190 10.607  1.00 0.00 ? 21 ALA A H    3  
ATOM 1081  H HA   . ALA A 1 21 ? -18.219 -37.841 7.940   1.00 0.00 ? 21 ALA A HA   3  
ATOM 1082  H HB1  . ALA A 1 21 ? -19.792 -36.251 8.993   1.00 0.00 ? 21 ALA A HB1  3  
ATOM 1083  H HB2  . ALA A 1 21 ? -19.662 -37.749 9.944   1.00 0.00 ? 21 ALA A HB2  3  
ATOM 1084  H HB3  . ALA A 1 21 ? -18.818 -36.276 10.481  1.00 0.00 ? 21 ALA A HB3  3  
ATOM 1085  N N    . ILE A 1 22 ? -16.421 -35.418 9.268   1.00 0.00 ? 22 ILE A N    3  
ATOM 1086  C CA   . ILE A 1 22 ? -15.666 -34.200 8.985   1.00 0.00 ? 22 ILE A CA   3  
ATOM 1087  C C    . ILE A 1 22 ? -14.611 -34.464 7.923   1.00 0.00 ? 22 ILE A C    3  
ATOM 1088  O O    . ILE A 1 22 ? -14.493 -33.725 6.947   1.00 0.00 ? 22 ILE A O    3  
ATOM 1089  C CB   . ILE A 1 22 ? -14.951 -33.674 10.243  1.00 0.00 ? 22 ILE A CB   3  
ATOM 1090  C CG1  . ILE A 1 22 ? -15.972 -33.185 11.272  1.00 0.00 ? 22 ILE A CG1  3  
ATOM 1091  C CG2  . ILE A 1 22 ? -14.031 -32.515 9.889   1.00 0.00 ? 22 ILE A CG2  3  
ATOM 1092  C CD1  . ILE A 1 22 ? -15.375 -32.882 12.629  1.00 0.00 ? 22 ILE A CD1  3  
ATOM 1093  H H    . ILE A 1 22 ? -16.353 -35.817 10.193  1.00 0.00 ? 22 ILE A H    3  
ATOM 1094  H HA   . ILE A 1 22 ? -16.360 -33.440 8.625   1.00 0.00 ? 22 ILE A HA   3  
ATOM 1095  H HB   . ILE A 1 22 ? -14.362 -34.481 10.677  1.00 0.00 ? 22 ILE A HB   3  
ATOM 1096  H HG12 . ILE A 1 22 ? -16.437 -32.275 10.891  1.00 0.00 ? 22 ILE A HG12 3  
ATOM 1097  H HG13 . ILE A 1 22 ? -16.732 -33.956 11.396  1.00 0.00 ? 22 ILE A HG13 3  
ATOM 1098  H HG21 . ILE A 1 22 ? -13.524 -32.158 10.785  1.00 0.00 ? 22 ILE A HG21 3  
ATOM 1099  H HG22 . ILE A 1 22 ? -13.290 -32.849 9.163   1.00 0.00 ? 22 ILE A HG22 3  
ATOM 1100  H HG23 . ILE A 1 22 ? -14.619 -31.703 9.460   1.00 0.00 ? 22 ILE A HG23 3  
ATOM 1101  H HD11 . ILE A 1 22 ? -16.147 -32.537 13.318  1.00 0.00 ? 22 ILE A HD11 3  
ATOM 1102  H HD12 . ILE A 1 22 ? -14.916 -33.785 13.030  1.00 0.00 ? 22 ILE A HD12 3  
ATOM 1103  H HD13 . ILE A 1 22 ? -14.618 -32.105 12.524  1.00 0.00 ? 22 ILE A HD13 3  
ATOM 1104  N N    . GLY A 1 23 ? -13.843 -35.530 8.127   1.00 0.00 ? 23 GLY A N    3  
ATOM 1105  C CA   . GLY A 1 23 ? -12.784 -35.918 7.199   1.00 0.00 ? 23 GLY A CA   3  
ATOM 1106  C C    . GLY A 1 23 ? -13.376 -36.354 5.868   1.00 0.00 ? 23 GLY A C    3  
ATOM 1107  O O    . GLY A 1 23 ? -12.890 -35.978 4.802   1.00 0.00 ? 23 GLY A O    3  
ATOM 1108  H H    . GLY A 1 23 ? -13.989 -36.098 8.949   1.00 0.00 ? 23 GLY A H    3  
ATOM 1109  H HA2  . GLY A 1 23 ? -12.120 -35.069 7.036   1.00 0.00 ? 23 GLY A HA2  3  
ATOM 1110  H HA3  . GLY A 1 23 ? -12.216 -36.743 7.627   1.00 0.00 ? 23 GLY A HA3  3  
ATOM 1111  N N    . GLY A 1 24 ? -14.436 -37.153 5.945   1.00 0.00 ? 24 GLY A N    3  
ATOM 1112  C CA   . GLY A 1 24 ? -15.118 -37.659 4.758   1.00 0.00 ? 24 GLY A CA   3  
ATOM 1113  C C    . GLY A 1 24 ? -15.812 -36.526 4.019   1.00 0.00 ? 24 GLY A C    3  
ATOM 1114  O O    . GLY A 1 24 ? -15.598 -36.319 2.826   1.00 0.00 ? 24 GLY A O    3  
ATOM 1115  H H    . GLY A 1 24 ? -14.790 -37.425 6.851   1.00 0.00 ? 24 GLY A H    3  
ATOM 1116  H HA2  . GLY A 1 24 ? -14.389 -38.126 4.096   1.00 0.00 ? 24 GLY A HA2  3  
ATOM 1117  H HA3  . GLY A 1 24 ? -15.860 -38.399 5.058   1.00 0.00 ? 24 GLY A HA3  3  
ATOM 1118  N N    . TYR A 1 25 ? -16.650 -35.793 4.747   1.00 0.00 ? 25 TYR A N    3  
ATOM 1119  C CA   . TYR A 1 25 ? -17.393 -34.669 4.185   1.00 0.00 ? 25 TYR A CA   3  
ATOM 1120  C C    . TYR A 1 25 ? -16.442 -33.664 3.556   1.00 0.00 ? 25 TYR A C    3  
ATOM 1121  O O    . TYR A 1 25 ? -16.720 -33.102 2.497   1.00 0.00 ? 25 TYR A O    3  
ATOM 1122  C CB   . TYR A 1 25 ? -18.196 -33.958 5.276   1.00 0.00 ? 25 TYR A CB   3  
ATOM 1123  C CG   . TYR A 1 25 ? -18.986 -32.769 4.779   1.00 0.00 ? 25 TYR A CG   3  
ATOM 1124  C CD1  . TYR A 1 25 ? -20.182 -32.945 4.095   1.00 0.00 ? 25 TYR A CD1  3  
ATOM 1125  C CD2  . TYR A 1 25 ? -18.533 -31.473 4.995   1.00 0.00 ? 25 TYR A CD2  3  
ATOM 1126  C CE1  . TYR A 1 25 ? -20.910 -31.864 3.637   1.00 0.00 ? 25 TYR A CE1  3  
ATOM 1127  C CE2  . TYR A 1 25 ? -19.248 -30.380 4.545   1.00 0.00 ? 25 TYR A CE2  3  
ATOM 1128  C CZ   . TYR A 1 25 ? -20.446 -30.586 3.861   1.00 0.00 ? 25 TYR A CZ   3  
ATOM 1129  O OH   . TYR A 1 25 ? -21.170 -29.507 3.406   1.00 0.00 ? 25 TYR A OH   3  
ATOM 1130  H H    . TYR A 1 25 ? -16.786 -36.013 5.723   1.00 0.00 ? 25 TYR A H    3  
ATOM 1131  H HA   . TYR A 1 25 ? -18.076 -35.046 3.424   1.00 0.00 ? 25 TYR A HA   3  
ATOM 1132  H HB2  . TYR A 1 25 ? -18.890 -34.673 5.718   1.00 0.00 ? 25 TYR A HB2  3  
ATOM 1133  H HB3  . TYR A 1 25 ? -17.507 -33.616 6.048   1.00 0.00 ? 25 TYR A HB3  3  
ATOM 1134  H HD1  . TYR A 1 25 ? -20.550 -33.945 3.918   1.00 0.00 ? 25 TYR A HD1  3  
ATOM 1135  H HD2  . TYR A 1 25 ? -17.605 -31.317 5.525   1.00 0.00 ? 25 TYR A HD2  3  
ATOM 1136  H HE1  . TYR A 1 25 ? -21.838 -32.019 3.106   1.00 0.00 ? 25 TYR A HE1  3  
ATOM 1137  H HE2  . TYR A 1 25 ? -18.884 -29.378 4.721   1.00 0.00 ? 25 TYR A HE2  3  
ATOM 1138  H HH   . TYR A 1 25 ? -20.760 -28.664 3.614   1.00 0.00 ? 25 TYR A HH   3  
ATOM 1139  N N    . ILE A 1 26 ? -15.314 -33.444 4.224   1.00 0.00 ? 26 ILE A N    3  
ATOM 1140  C CA   . ILE A 1 26 ? -14.297 -32.507 3.752   1.00 0.00 ? 26 ILE A CA   3  
ATOM 1141  C C    . ILE A 1 26 ? -13.530 -33.101 2.582   1.00 0.00 ? 26 ILE A C    3  
ATOM 1142  O O    . ILE A 1 26 ? -13.290 -32.436 1.576   1.00 0.00 ? 26 ILE A O    3  
ATOM 1143  C CB   . ILE A 1 26 ? -13.283 -32.169 4.861   1.00 0.00 ? 26 ILE A CB   3  
ATOM 1144  C CG1  . ILE A 1 26 ? -13.963 -31.383 5.984   1.00 0.00 ? 26 ILE A CG1  3  
ATOM 1145  C CG2  . ILE A 1 26 ? -12.146 -31.326 4.304   1.00 0.00 ? 26 ILE A CG2  3  
ATOM 1146  C CD1  . ILE A 1 26 ? -13.108 -31.222 7.221   1.00 0.00 ? 26 ILE A CD1  3  
ATOM 1147  H H    . ILE A 1 26 ? -15.144 -33.937 5.089   1.00 0.00 ? 26 ILE A H    3  
ATOM 1148  H HA   . ILE A 1 26 ? -14.795 -31.591 3.431   1.00 0.00 ? 26 ILE A HA   3  
ATOM 1149  H HB   . ILE A 1 26 ? -12.879 -33.097 5.265   1.00 0.00 ? 26 ILE A HB   3  
ATOM 1150  H HG12 . ILE A 1 26 ? -14.213 -30.391 5.608   1.00 0.00 ? 26 ILE A HG12 3  
ATOM 1151  H HG13 . ILE A 1 26 ? -14.878 -31.905 6.265   1.00 0.00 ? 26 ILE A HG13 3  
ATOM 1152  H HG21 . ILE A 1 26 ? -11.431 -31.101 5.095   1.00 0.00 ? 26 ILE A HG21 3  
ATOM 1153  H HG22 . ILE A 1 26 ? -11.644 -31.875 3.508   1.00 0.00 ? 26 ILE A HG22 3  
ATOM 1154  H HG23 . ILE A 1 26 ? -12.548 -30.394 3.905   1.00 0.00 ? 26 ILE A HG23 3  
ATOM 1155  H HD11 . ILE A 1 26 ? -13.642 -30.655 7.984   1.00 0.00 ? 26 ILE A HD11 3  
ATOM 1156  H HD12 . ILE A 1 26 ? -12.859 -32.206 7.617   1.00 0.00 ? 26 ILE A HD12 3  
ATOM 1157  H HD13 . ILE A 1 26 ? -12.192 -30.693 6.959   1.00 0.00 ? 26 ILE A HD13 3  
ATOM 1158  N N    . VAL A 1 27 ? -13.148 -34.366 2.728   1.00 0.00 ? 27 VAL A N    3  
ATOM 1159  C CA   . VAL A 1 27 ? -12.402 -35.080 1.695   1.00 0.00 ? 27 VAL A CA   3  
ATOM 1160  C C    . VAL A 1 27 ? -13.319 -35.461 0.544   1.00 0.00 ? 27 VAL A C    3  
ATOM 1161  O O    . VAL A 1 27 ? -12.895 -35.540 -0.608  1.00 0.00 ? 27 VAL A O    3  
ATOM 1162  C CB   . VAL A 1 27 ? -11.771 -36.372 2.246   1.00 0.00 ? 27 VAL A CB   3  
ATOM 1163  C CG1  . VAL A 1 27 ? -12.841 -37.427 2.486   1.00 0.00 ? 27 VAL A CG1  3  
ATOM 1164  C CG2  . VAL A 1 27 ? -10.757 -36.933 1.260   1.00 0.00 ? 27 VAL A CG2  3  
ATOM 1165  H H    . VAL A 1 27 ? -13.377 -34.859 3.579   1.00 0.00 ? 27 VAL A H    3  
ATOM 1166  H HA   . VAL A 1 27 ? -11.612 -34.425 1.327   1.00 0.00 ? 27 VAL A HA   3  
ATOM 1167  H HB   . VAL A 1 27 ? -11.271 -36.146 3.188   1.00 0.00 ? 27 VAL A HB   3  
ATOM 1168  H HG11 . VAL A 1 27 ? -12.385 -38.333 2.884   1.00 0.00 ? 27 VAL A HG11 3  
ATOM 1169  H HG12 . VAL A 1 27 ? -13.571 -37.046 3.201   1.00 0.00 ? 27 VAL A HG12 3  
ATOM 1170  H HG13 . VAL A 1 27 ? -13.341 -37.657 1.545   1.00 0.00 ? 27 VAL A HG13 3  
ATOM 1171  H HG21 . VAL A 1 27 ? -10.312 -37.841 1.665   1.00 0.00 ? 27 VAL A HG21 3  
ATOM 1172  H HG22 . VAL A 1 27 ? -11.257 -37.163 0.319   1.00 0.00 ? 27 VAL A HG22 3  
ATOM 1173  H HG23 . VAL A 1 27 ? -9.975  -36.194 1.085   1.00 0.00 ? 27 VAL A HG23 3  
ATOM 1174  N N    . GLY A 1 28 ? -14.586 -35.697 0.872   1.00 0.00 ? 28 GLY A N    3  
ATOM 1175  C CA   . GLY A 1 28 ? -15.591 -36.075 -0.117  1.00 0.00 ? 28 GLY A CA   3  
ATOM 1176  C C    . GLY A 1 28 ? -16.002 -34.867 -0.945  1.00 0.00 ? 28 GLY A C    3  
ATOM 1177  O O    . GLY A 1 28 ? -16.478 -35.000 -2.071  1.00 0.00 ? 28 GLY A O    3  
ATOM 1178  H H    . GLY A 1 28 ? -14.874 -35.614 1.837   1.00 0.00 ? 28 GLY A H    3  
ATOM 1179  H HA2  . GLY A 1 28 ? -15.178 -36.838 -0.776  1.00 0.00 ? 28 GLY A HA2  3  
ATOM 1180  H HA3  . GLY A 1 28 ? -16.467 -36.475 0.395   1.00 0.00 ? 28 GLY A HA3  3  
ATOM 1181  N N    . ALA A 1 29 ? -15.810 -33.684 -0.369  1.00 0.00 ? 29 ALA A N    3  
ATOM 1182  C CA   . ALA A 1 29 ? -16.153 -32.429 -1.031  1.00 0.00 ? 29 ALA A CA   3  
ATOM 1183  C C    . ALA A 1 29 ? -15.018 -31.977 -1.936  1.00 0.00 ? 29 ALA A C    3  
ATOM 1184  O O    . ALA A 1 29 ? -15.241 -31.371 -2.983  1.00 0.00 ? 29 ALA A O    3  
ATOM 1185  C CB   . ALA A 1 29 ? -16.411 -31.340 -0.001  1.00 0.00 ? 29 ALA A CB   3  
ATOM 1186  H H    . ALA A 1 29 ? -15.415 -33.640 0.559   1.00 0.00 ? 29 ALA A H    3  
ATOM 1187  H HA   . ALA A 1 29 ? -17.053 -32.582 -1.628  1.00 0.00 ? 29 ALA A HA   3  
ATOM 1188  H HB1  . ALA A 1 29 ? -16.681 -30.411 -0.504  1.00 0.00 ? 29 ALA A HB1  3  
ATOM 1189  H HB2  . ALA A 1 29 ? -17.228 -31.646 0.653   1.00 0.00 ? 29 ALA A HB2  3  
ATOM 1190  H HB3  . ALA A 1 29 ? -15.511 -31.181 0.592   1.00 0.00 ? 29 ALA A HB3  3  
ATOM 1191  N N    . LEU A 1 30 ? -13.794 -32.280 -1.515  1.00 0.00 ? 30 LEU A N    3  
ATOM 1192  C CA   . LEU A 1 30 ? -12.597 -31.916 -2.270  1.00 0.00 ? 30 LEU A CA   3  
ATOM 1193  C C    . LEU A 1 30 ? -12.678 -32.457 -3.688  1.00 0.00 ? 30 LEU A C    3  
ATOM 1194  O O    . LEU A 1 30 ? -12.143 -31.867 -4.625  1.00 0.00 ? 30 LEU A O    3  
ATOM 1195  C CB   . LEU A 1 30 ? -11.347 -32.493 -1.603  1.00 0.00 ? 30 LEU A CB   3  
ATOM 1196  C CG   . LEU A 1 30 ? -10.938 -31.863 -0.269  1.00 0.00 ? 30 LEU A CG   3  
ATOM 1197  C CD1  . LEU A 1 30 ? -9.763  -32.611 0.341   1.00 0.00 ? 30 LEU A CD1  3  
ATOM 1198  C CD2  . LEU A 1 30 ? -10.529 -30.411 -0.463  1.00 0.00 ? 30 LEU A CD2  3  
ATOM 1199  H H    . LEU A 1 30 ? -13.676 -32.778 -0.645  1.00 0.00 ? 30 LEU A H    3  
ATOM 1200  H HA   . LEU A 1 30 ? -12.520 -30.829 -2.301  1.00 0.00 ? 30 LEU A HA   3  
ATOM 1201  H HB2  . LEU A 1 30 ? -11.524 -33.554 -1.429  1.00 0.00 ? 30 LEU A HB2  3  
ATOM 1202  H HB3  . LEU A 1 30 ? -10.515 -32.372 -2.296  1.00 0.00 ? 30 LEU A HB3  3  
ATOM 1203  H HG   . LEU A 1 30 ? -11.786 -31.908 0.414   1.00 0.00 ? 30 LEU A HG   3  
ATOM 1204  H HD11 . LEU A 1 30 ? -9.489  -32.159 1.295   1.00 0.00 ? 30 LEU A HD11 3  
ATOM 1205  H HD12 . LEU A 1 30 ? -10.042 -33.652 0.503   1.00 0.00 ? 30 LEU A HD12 3  
ATOM 1206  H HD13 . LEU A 1 30 ? -8.912  -32.563 -0.338  1.00 0.00 ? 30 LEU A HD13 3  
ATOM 1207  H HD21 . LEU A 1 30 ? -10.252 -29.971 0.495   1.00 0.00 ? 30 LEU A HD21 3  
ATOM 1208  H HD22 . LEU A 1 30 ? -9.678  -30.362 -1.142  1.00 0.00 ? 30 LEU A HD22 3  
ATOM 1209  H HD23 . LEU A 1 30 ? -11.365 -29.853 -0.887  1.00 0.00 ? 30 LEU A HD23 3  
ATOM 1210  N N    . VAL A 1 31 ? -13.355 -33.592 -3.833  1.00 0.00 ? 31 VAL A N    3  
ATOM 1211  C CA   . VAL A 1 31 ? -13.525 -34.240 -5.131  1.00 0.00 ? 31 VAL A CA   3  
ATOM 1212  C C    . VAL A 1 31 ? -14.133 -33.273 -6.133  1.00 0.00 ? 31 VAL A C    3  
ATOM 1213  O O    . VAL A 1 31 ? -13.808 -33.299 -7.319  1.00 0.00 ? 31 VAL A O    3  
ATOM 1214  C CB   . VAL A 1 31 ? -14.453 -35.465 -5.033  1.00 0.00 ? 31 VAL A CB   3  
ATOM 1215  C CG1  . VAL A 1 31 ? -14.798 -35.985 -6.420  1.00 0.00 ? 31 VAL A CG1  3  
ATOM 1216  C CG2  . VAL A 1 31 ? -13.777 -36.584 -4.255  1.00 0.00 ? 31 VAL A CG2  3  
ATOM 1217  H H    . VAL A 1 31 ? -13.771 -34.030 -3.023  1.00 0.00 ? 31 VAL A H    3  
ATOM 1218  H HA   . VAL A 1 31 ? -12.546 -34.561 -5.486  1.00 0.00 ? 31 VAL A HA   3  
ATOM 1219  H HB   . VAL A 1 31 ? -15.370 -35.172 -4.520  1.00 0.00 ? 31 VAL A HB   3  
ATOM 1220  H HG11 . VAL A 1 31 ? -15.462 -36.845 -6.338  1.00 0.00 ? 31 VAL A HG11 3  
ATOM 1221  H HG12 . VAL A 1 31 ? -15.296 -35.198 -6.988  1.00 0.00 ? 31 VAL A HG12 3  
ATOM 1222  H HG13 . VAL A 1 31 ? -13.884 -36.281 -6.934  1.00 0.00 ? 31 VAL A HG13 3  
ATOM 1223  H HG21 . VAL A 1 31 ? -14.446 -37.441 -4.184  1.00 0.00 ? 31 VAL A HG21 3  
ATOM 1224  H HG22 . VAL A 1 31 ? -12.863 -36.880 -4.768  1.00 0.00 ? 31 VAL A HG22 3  
ATOM 1225  H HG23 . VAL A 1 31 ? -13.534 -36.232 -3.252  1.00 0.00 ? 31 VAL A HG23 3  
ATOM 1226  N N    . ILE A 1 32 ? -15.022 -32.417 -5.639  1.00 0.00 ? 32 ILE A N    3  
ATOM 1227  C CA   . ILE A 1 32 ? -15.696 -31.424 -6.472  1.00 0.00 ? 32 ILE A CA   3  
ATOM 1228  C C    . ILE A 1 32 ? -14.697 -30.414 -7.010  1.00 0.00 ? 32 ILE A C    3  
ATOM 1229  O O    . ILE A 1 32 ? -14.747 -30.028 -8.177  1.00 0.00 ? 32 ILE A O    3  
ATOM 1230  C CB   . ILE A 1 32 ? -16.766 -30.653 -5.677  1.00 0.00 ? 32 ILE A CB   3  
ATOM 1231  C CG1  . ILE A 1 32 ? -17.913 -31.587 -5.283  1.00 0.00 ? 32 ILE A CG1  3  
ATOM 1232  C CG2  . ILE A 1 32 ? -17.336 -29.517 -6.513  1.00 0.00 ? 32 ILE A CG2  3  
ATOM 1233  C CD1  . ILE A 1 32 ? -18.884 -30.978 -4.295  1.00 0.00 ? 32 ILE A CD1  3  
ATOM 1234  H H    . ILE A 1 32 ? -15.247 -32.444 -4.654  1.00 0.00 ? 32 ILE A H    3  
ATOM 1235  H HA   . ILE A 1 32 ? -16.173 -31.940 -7.305  1.00 0.00 ? 32 ILE A HA   3  
ATOM 1236  H HB   . ILE A 1 32 ? -16.310 -30.243 -4.776  1.00 0.00 ? 32 ILE A HB   3  
ATOM 1237  H HG12 . ILE A 1 32 ? -18.464 -31.855 -6.185  1.00 0.00 ? 32 ILE A HG12 3  
ATOM 1238  H HG13 . ILE A 1 32 ? -17.488 -32.485 -4.836  1.00 0.00 ? 32 ILE A HG13 3  
ATOM 1239  H HG21 . ILE A 1 32 ? -18.085 -28.973 -5.937  1.00 0.00 ? 32 ILE A HG21 3  
ATOM 1240  H HG22 . ILE A 1 32 ? -16.533 -28.836 -6.794  1.00 0.00 ? 32 ILE A HG22 3  
ATOM 1241  H HG23 . ILE A 1 32 ? -17.799 -29.925 -7.412  1.00 0.00 ? 32 ILE A HG23 3  
ATOM 1242  H HD11 . ILE A 1 32 ? -19.678 -31.685 -4.053  1.00 0.00 ? 32 ILE A HD11 3  
ATOM 1243  H HD12 . ILE A 1 32 ? -18.351 -30.713 -3.382  1.00 0.00 ? 32 ILE A HD12 3  
ATOM 1244  H HD13 . ILE A 1 32 ? -19.326 -30.081 -4.730  1.00 0.00 ? 32 ILE A HD13 3  
ATOM 1245  N N    . LEU A 1 33 ? -13.785 -29.989 -6.140  1.00 0.00 ? 33 LEU A N    3  
ATOM 1246  C CA   . LEU A 1 33 ? -12.755 -29.018 -6.501  1.00 0.00 ? 33 LEU A CA   3  
ATOM 1247  C C    . LEU A 1 33 ? -11.857 -29.577 -7.592  1.00 0.00 ? 33 LEU A C    3  
ATOM 1248  O O    . LEU A 1 33 ? -11.583 -28.915 -8.592  1.00 0.00 ? 33 LEU A O    3  
ATOM 1249  C CB   . LEU A 1 33 ? -11.888 -28.680 -5.286  1.00 0.00 ? 33 LEU A CB   3  
ATOM 1250  C CG   . LEU A 1 33 ? -12.547 -27.829 -4.199  1.00 0.00 ? 33 LEU A CG   3  
ATOM 1251  C CD1  . LEU A 1 33 ? -11.622 -27.678 -3.001  1.00 0.00 ? 33 LEU A CD1  3  
ATOM 1252  C CD2  . LEU A 1 33 ? -12.874 -26.441 -4.726  1.00 0.00 ? 33 LEU A CD2  3  
ATOM 1253  H H    . LEU A 1 33 ? -13.796 -30.343 -5.194  1.00 0.00 ? 33 LEU A H    3  
ATOM 1254  H HA   . LEU A 1 33 ? -13.240 -28.110 -6.861  1.00 0.00 ? 33 LEU A HA   3  
ATOM 1255  H HB2  . LEU A 1 33 ? -11.576 -29.619 -4.829  1.00 0.00 ? 33 LEU A HB2  3  
ATOM 1256  H HB3  . LEU A 1 33 ? -11.011 -28.140 -5.644  1.00 0.00 ? 33 LEU A HB3  3  
ATOM 1257  H HG   . LEU A 1 33 ? -13.469 -28.318 -3.882  1.00 0.00 ? 33 LEU A HG   3  
ATOM 1258  H HD11 . LEU A 1 33 ? -12.107 -27.079 -2.230  1.00 0.00 ? 33 LEU A HD11 3  
ATOM 1259  H HD12 . LEU A 1 33 ? -11.388 -28.663 -2.598  1.00 0.00 ? 33 LEU A HD12 3  
ATOM 1260  H HD13 . LEU A 1 33 ? -10.702 -27.185 -3.314  1.00 0.00 ? 33 LEU A HD13 3  
ATOM 1261  H HD21 . LEU A 1 33 ? -13.353 -25.849 -3.945  1.00 0.00 ? 33 LEU A HD21 3  
ATOM 1262  H HD22 . LEU A 1 33 ? -11.955 -25.946 -5.039  1.00 0.00 ? 33 LEU A HD22 3  
ATOM 1263  H HD23 . LEU A 1 33 ? -13.549 -26.527 -5.578  1.00 0.00 ? 33 LEU A HD23 3  
ATOM 1264  N N    . ALA A 1 34 ? -11.401 -30.809 -7.386  1.00 0.00 ? 34 ALA A N    3  
ATOM 1265  C CA   . ALA A 1 34 ? -10.526 -31.487 -8.340  1.00 0.00 ? 34 ALA A CA   3  
ATOM 1266  C C    . ALA A 1 34 ? -11.205 -31.603 -9.695  1.00 0.00 ? 34 ALA A C    3  
ATOM 1267  O O    . ALA A 1 34 ? -10.581 -31.411 -10.738 1.00 0.00 ? 34 ALA A O    3  
ATOM 1268  C CB   . ALA A 1 34 ? -10.189 -32.886 -7.848  1.00 0.00 ? 34 ALA A CB   3  
ATOM 1269  H H    . ALA A 1 34 ? -11.662 -31.302 -6.544  1.00 0.00 ? 34 ALA A H    3  
ATOM 1270  H HA   . ALA A 1 34 ? -9.608  -30.909 -8.444  1.00 0.00 ? 34 ALA A HA   3  
ATOM 1271  H HB1  . ALA A 1 34 ? -9.525  -33.377 -8.559  1.00 0.00 ? 34 ALA A HB1  3  
ATOM 1272  H HB2  . ALA A 1 34 ? -9.696  -32.819 -6.878  1.00 0.00 ? 34 ALA A HB2  3  
ATOM 1273  H HB3  . ALA A 1 34 ? -11.107 -33.466 -7.750  1.00 0.00 ? 34 ALA A HB3  3  
ATOM 1274  N N    . VAL A 1 35 ? -12.496 -31.920 -9.666  1.00 0.00 ? 35 VAL A N    3  
ATOM 1275  C CA   . VAL A 1 35 ? -13.290 -32.069 -10.882 1.00 0.00 ? 35 VAL A CA   3  
ATOM 1276  C C    . VAL A 1 35 ? -13.218 -30.806 -11.723 1.00 0.00 ? 35 VAL A C    3  
ATOM 1277  O O    . VAL A 1 35 ? -13.064 -30.861 -12.942 1.00 0.00 ? 35 VAL A O    3  
ATOM 1278  C CB   . VAL A 1 35 ? -14.771 -32.339 -10.559 1.00 0.00 ? 35 VAL A CB   3  
ATOM 1279  C CG1  . VAL A 1 35 ? -15.611 -32.282 -11.826 1.00 0.00 ? 35 VAL A CG1  3  
ATOM 1280  C CG2  . VAL A 1 35 ? -14.938 -33.715 -9.933  1.00 0.00 ? 35 VAL A CG2  3  
ATOM 1281  H H    . VAL A 1 35 ? -12.954 -32.065 -8.777  1.00 0.00 ? 35 VAL A H    3  
ATOM 1282  H HA   . VAL A 1 35 ? -12.891 -32.906 -11.453 1.00 0.00 ? 35 VAL A HA   3  
ATOM 1283  H HB   . VAL A 1 35 ? -15.124 -31.580 -9.859  1.00 0.00 ? 35 VAL A HB   3  
ATOM 1284  H HG11 . VAL A 1 35 ? -16.658 -32.465 -11.584 1.00 0.00 ? 35 VAL A HG11 3  
ATOM 1285  H HG12 . VAL A 1 35 ? -15.514 -31.296 -12.282 1.00 0.00 ? 35 VAL A HG12 3  
ATOM 1286  H HG13 . VAL A 1 35 ? -15.264 -33.042 -12.526 1.00 0.00 ? 35 VAL A HG13 3  
ATOM 1287  H HG21 . VAL A 1 35 ? -15.989 -33.890 -9.701  1.00 0.00 ? 35 VAL A HG21 3  
ATOM 1288  H HG22 . VAL A 1 35 ? -14.591 -34.475 -10.632 1.00 0.00 ? 35 VAL A HG22 3  
ATOM 1289  H HG23 . VAL A 1 35 ? -14.352 -33.769 -9.016  1.00 0.00 ? 35 VAL A HG23 3  
ATOM 1290  N N    . ALA A 1 36 ? -13.333 -29.663 -11.053 1.00 0.00 ? 36 ALA A N    3  
ATOM 1291  C CA   . ALA A 1 36 ? -13.284 -28.362 -11.715 1.00 0.00 ? 36 ALA A CA   3  
ATOM 1292  C C    . ALA A 1 36 ? -11.914 -28.128 -12.329 1.00 0.00 ? 36 ALA A C    3  
ATOM 1293  O O    . ALA A 1 36 ? -11.796 -27.701 -13.477 1.00 0.00 ? 36 ALA A O    3  
ATOM 1294  C CB   . ALA A 1 36 ? -13.561 -27.248 -10.717 1.00 0.00 ? 36 ALA A CB   3  
ATOM 1295  H H    . ALA A 1 36 ? -13.460 -29.683 -10.051 1.00 0.00 ? 36 ALA A H    3  
ATOM 1296  H HA   . ALA A 1 36 ? -14.041 -28.339 -12.499 1.00 0.00 ? 36 ALA A HA   3  
ATOM 1297  H HB1  . ALA A 1 36 ? -13.537 -26.283 -11.224 1.00 0.00 ? 36 ALA A HB1  3  
ATOM 1298  H HB2  . ALA A 1 36 ? -14.545 -27.397 -10.271 1.00 0.00 ? 36 ALA A HB2  3  
ATOM 1299  H HB3  . ALA A 1 36 ? -12.802 -27.264 -9.935  1.00 0.00 ? 36 ALA A HB3  3  
ATOM 1300  N N    . GLY A 1 37 ? -10.877 -28.414 -11.547 1.00 0.00 ? 37 GLY A N    3  
ATOM 1301  C CA   . GLY A 1 37 ? -9.496  -28.243 -11.988 1.00 0.00 ? 37 GLY A CA   3  
ATOM 1302  C C    . GLY A 1 37 ? -9.288  -28.893 -13.347 1.00 0.00 ? 37 GLY A C    3  
ATOM 1303  O O    . GLY A 1 37 ? -8.924  -28.232 -14.319 1.00 0.00 ? 37 GLY A O    3  
ATOM 1304  H H    . GLY A 1 37 ? -11.040 -28.762 -10.613 1.00 0.00 ? 37 GLY A H    3  
ATOM 1305  H HA2  . GLY A 1 37 ? -9.271  -27.178 -12.060 1.00 0.00 ? 37 GLY A HA2  3  
ATOM 1306  H HA3  . GLY A 1 37 ? -8.827  -28.705 -11.262 1.00 0.00 ? 37 GLY A HA3  3  
ATOM 1307  N N    . LEU A 1 38 ? -9.525  -30.200 -13.401 1.00 0.00 ? 38 LEU A N    3  
ATOM 1308  C CA   . LEU A 1 38 ? -9.371  -30.971 -14.632 1.00 0.00 ? 38 LEU A CA   3  
ATOM 1309  C C    . LEU A 1 38 ? -10.300 -30.440 -15.711 1.00 0.00 ? 38 LEU A C    3  
ATOM 1310  O O    . LEU A 1 38 ? -9.934  -30.360 -16.882 1.00 0.00 ? 38 LEU A O    3  
ATOM 1311  C CB   . LEU A 1 38 ? -9.705  -32.444 -14.387 1.00 0.00 ? 38 LEU A CB   3  
ATOM 1312  C CG   . LEU A 1 38 ? -8.702  -33.236 -13.546 1.00 0.00 ? 38 LEU A CG   3  
ATOM 1313  C CD1  . LEU A 1 38 ? -9.219  -34.641 -13.275 1.00 0.00 ? 38 LEU A CD1  3  
ATOM 1314  C CD2  . LEU A 1 38 ? -7.368  -33.350 -14.267 1.00 0.00 ? 38 LEU A CD2  3  
ATOM 1315  H H    . LEU A 1 38 ? -9.823  -30.686 -12.567 1.00 0.00 ? 38 LEU A H    3  
ATOM 1316  H HA   . LEU A 1 38 ? -8.339  -30.887 -14.970 1.00 0.00 ? 38 LEU A HA   3  
ATOM 1317  H HB2  . LEU A 1 38 ? -10.670 -32.485 -13.880 1.00 0.00 ? 38 LEU A HB2  3  
ATOM 1318  H HB3  . LEU A 1 38 ? -9.784  -32.932 -15.358 1.00 0.00 ? 38 LEU A HB3  3  
ATOM 1319  H HG   . LEU A 1 38 ? -8.555  -32.718 -12.598 1.00 0.00 ? 38 LEU A HG   3  
ATOM 1320  H HD11 . LEU A 1 38 ? -8.501  -35.190 -12.667 1.00 0.00 ? 38 LEU A HD11 3  
ATOM 1321  H HD12 . LEU A 1 38 ? -10.170 -34.580 -12.744 1.00 0.00 ? 38 LEU A HD12 3  
ATOM 1322  H HD13 . LEU A 1 38 ? -9.364  -35.162 -14.221 1.00 0.00 ? 38 LEU A HD13 3  
ATOM 1323  H HD21 . LEU A 1 38 ? -6.660  -33.906 -13.653 1.00 0.00 ? 38 LEU A HD21 3  
ATOM 1324  H HD22 . LEU A 1 38 ? -7.512  -33.871 -15.213 1.00 0.00 ? 38 LEU A HD22 3  
ATOM 1325  H HD23 . LEU A 1 38 ? -6.974  -32.352 -14.458 1.00 0.00 ? 38 LEU A HD23 3  
ATOM 1326  N N    . ILE A 1 39 ? -11.511 -30.077 -15.300 1.00 0.00 ? 39 ILE A N    3  
ATOM 1327  C CA   . ILE A 1 39 ? -12.519 -29.547 -16.213 1.00 0.00 ? 39 ILE A CA   3  
ATOM 1328  C C    . ILE A 1 39 ? -12.005 -28.298 -16.908 1.00 0.00 ? 39 ILE A C    3  
ATOM 1329  O O    . ILE A 1 39 ? -12.167 -28.129 -18.116 1.00 0.00 ? 39 ILE A O    3  
ATOM 1330  C CB   . ILE A 1 39 ? -13.815 -29.174 -15.469 1.00 0.00 ? 39 ILE A CB   3  
ATOM 1331  C CG1  . ILE A 1 39 ? -14.502 -30.432 -14.932 1.00 0.00 ? 39 ILE A CG1  3  
ATOM 1332  C CG2  . ILE A 1 39 ? -14.779 -28.459 -16.403 1.00 0.00 ? 39 ILE A CG2  3  
ATOM 1333  C CD1  . ILE A 1 39 ? -14.902 -31.416 -16.010 1.00 0.00 ? 39 ILE A CD1  3  
ATOM 1334  H H    . ILE A 1 39 ? -11.753 -30.165 -14.323 1.00 0.00 ? 39 ILE A H    3  
ATOM 1335  H HA   . ILE A 1 39 ? -12.743 -30.309 -16.959 1.00 0.00 ? 39 ILE A HA   3  
ATOM 1336  H HB   . ILE A 1 39 ? -13.567 -28.516 -14.636 1.00 0.00 ? 39 ILE A HB   3  
ATOM 1337  H HG12 . ILE A 1 39 ? -13.818 -30.932 -14.247 1.00 0.00 ? 39 ILE A HG12 3  
ATOM 1338  H HG13 . ILE A 1 39 ? -15.400 -30.130 -14.392 1.00 0.00 ? 39 ILE A HG13 3  
ATOM 1339  H HG21 . ILE A 1 39 ? -15.688 -28.191 -15.863 1.00 0.00 ? 39 ILE A HG21 3  
ATOM 1340  H HG22 . ILE A 1 39 ? -14.308 -27.554 -16.787 1.00 0.00 ? 39 ILE A HG22 3  
ATOM 1341  H HG23 . ILE A 1 39 ? -15.034 -29.116 -17.234 1.00 0.00 ? 39 ILE A HG23 3  
ATOM 1342  H HD11 . ILE A 1 39 ? -15.384 -32.289 -15.571 1.00 0.00 ? 39 ILE A HD11 3  
ATOM 1343  H HD12 . ILE A 1 39 ? -15.597 -30.933 -16.698 1.00 0.00 ? 39 ILE A HD12 3  
ATOM 1344  H HD13 . ILE A 1 39 ? -14.014 -31.734 -16.554 1.00 0.00 ? 39 ILE A HD13 3  
ATOM 1345  N N    . TYR A 1 40 ? -11.380 -27.422 -16.126 1.00 0.00 ? 40 TYR A N    3  
ATOM 1346  C CA   . TYR A 1 40 ? -10.828 -26.172 -16.641 1.00 0.00 ? 40 TYR A CA   3  
ATOM 1347  C C    . TYR A 1 40 ? -9.636  -26.447 -17.542 1.00 0.00 ? 40 TYR A C    3  
ATOM 1348  O O    . TYR A 1 40 ? -9.478  -25.830 -18.594 1.00 0.00 ? 40 TYR A O    3  
ATOM 1349  C CB   . TYR A 1 40 ? -10.367 -25.275 -15.490 1.00 0.00 ? 40 TYR A CB   3  
ATOM 1350  C CG   . TYR A 1 40 ? -9.804  -23.945 -15.937 1.00 0.00 ? 40 TYR A CG   3  
ATOM 1351  C CD1  . TYR A 1 40 ? -10.647 -22.912 -16.328 1.00 0.00 ? 40 TYR A CD1  3  
ATOM 1352  C CD2  . TYR A 1 40 ? -8.433  -23.727 -15.967 1.00 0.00 ? 40 TYR A CD2  3  
ATOM 1353  C CE1  . TYR A 1 40 ? -10.141 -21.693 -16.738 1.00 0.00 ? 40 TYR A CE1  3  
ATOM 1354  C CE2  . TYR A 1 40 ? -7.910  -22.514 -16.375 1.00 0.00 ? 40 TYR A CE2  3  
ATOM 1355  C CZ   . TYR A 1 40 ? -8.778  -21.494 -16.762 1.00 0.00 ? 40 TYR A CZ   3  
ATOM 1356  O OH   . TYR A 1 40 ? -8.272  -20.281 -17.170 1.00 0.00 ? 40 TYR A OH   3  
ATOM 1357  H H    . TYR A 1 40 ? -11.280 -27.617 -15.140 1.00 0.00 ? 40 TYR A H    3  
ATOM 1358  H HA   . TYR A 1 40 ? -11.602 -25.657 -17.211 1.00 0.00 ? 40 TYR A HA   3  
ATOM 1359  H HB2  . TYR A 1 40 ? -11.218 -25.087 -14.834 1.00 0.00 ? 40 TYR A HB2  3  
ATOM 1360  H HB3  . TYR A 1 40 ? -9.600  -25.803 -14.925 1.00 0.00 ? 40 TYR A HB3  3  
ATOM 1361  H HD1  . TYR A 1 40 ? -11.717 -23.064 -16.311 1.00 0.00 ? 40 TYR A HD1  3  
ATOM 1362  H HD2  . TYR A 1 40 ? -7.764  -24.519 -15.666 1.00 0.00 ? 40 TYR A HD2  3  
ATOM 1363  H HE1  . TYR A 1 40 ? -10.811 -20.900 -17.038 1.00 0.00 ? 40 TYR A HE1  3  
ATOM 1364  H HE2  . TYR A 1 40 ? -6.842  -22.358 -16.393 1.00 0.00 ? 40 TYR A HE2  3  
ATOM 1365  H HH   . TYR A 1 40 ? -7.313  -20.247 -17.150 1.00 0.00 ? 40 TYR A HH   3  
ATOM 1366  N N    . SER A 1 41 ? -8.796  -27.387 -17.114 1.00 0.00 ? 41 SER A N    3  
ATOM 1367  C CA   . SER A 1 41 ? -7.605  -27.768 -17.865 1.00 0.00 ? 41 SER A CA   3  
ATOM 1368  C C    . SER A 1 41 ? -7.985  -28.284 -19.243 1.00 0.00 ? 41 SER A C    3  
ATOM 1369  O O    . SER A 1 41 ? -7.438  -27.855 -20.257 1.00 0.00 ? 41 SER A O    3  
ATOM 1370  C CB   . SER A 1 41 ? -6.839  -28.870 -17.131 1.00 0.00 ? 41 SER A CB   3  
ATOM 1371  O OG   . SER A 1 41 ? -6.315  -28.397 -15.903 1.00 0.00 ? 41 SER A OG   3  
ATOM 1372  H H    . SER A 1 41 ? -8.981  -27.859 -16.241 1.00 0.00 ? 41 SER A H    3  
ATOM 1373  H HA   . SER A 1 41 ? -6.964  -26.892 -17.971 1.00 0.00 ? 41 SER A HA   3  
ATOM 1374  H HB2  . SER A 1 41 ? -7.515  -29.701 -16.932 1.00 0.00 ? 41 SER A HB2  3  
ATOM 1375  H HB3  . SER A 1 41 ? -6.017  -29.211 -17.760 1.00 0.00 ? 41 SER A HB3  3  
ATOM 1376  H HG   . SER A 1 41 ? -5.843  -29.111 -15.470 1.00 0.00 ? 41 SER A HG   3  
ATOM 1377  N N    . MET A 1 42 ? -8.935  -29.216 -19.265 1.00 0.00 ? 42 MET A N    3  
ATOM 1378  C CA   . MET A 1 42 ? -9.413  -29.812 -20.509 1.00 0.00 ? 42 MET A CA   3  
ATOM 1379  C C    . MET A 1 42 ? -10.080 -28.762 -21.382 1.00 0.00 ? 42 MET A C    3  
ATOM 1380  O O    . MET A 1 42 ? -9.895  -28.734 -22.598 1.00 0.00 ? 42 MET A O    3  
ATOM 1381  C CB   . MET A 1 42 ? -10.432 -30.916 -20.218 1.00 0.00 ? 42 MET A CB   3  
ATOM 1382  C CG   . MET A 1 42 ? -10.922 -31.650 -21.455 1.00 0.00 ? 42 MET A CG   3  
ATOM 1383  S SD   . MET A 1 42 ? -12.096 -32.962 -21.065 1.00 0.00 ? 42 MET A SD   3  
ATOM 1384  C CE   . MET A 1 42 ? -13.524 -32.003 -20.568 1.00 0.00 ? 42 MET A CE   3  
ATOM 1385  H H    . MET A 1 42 ? -9.346  -29.529 -18.397 1.00 0.00 ? 42 MET A H    3  
ATOM 1386  H HA   . MET A 1 42 ? -8.563  -30.237 -21.042 1.00 0.00 ? 42 MET A HA   3  
ATOM 1387  H HB2  . MET A 1 42 ? -9.969  -31.642 -19.550 1.00 0.00 ? 42 MET A HB2  3  
ATOM 1388  H HB3  . MET A 1 42 ? -11.294 -30.465 -19.724 1.00 0.00 ? 42 MET A HB3  3  
ATOM 1389  H HG2  . MET A 1 42 ? -11.404 -30.934 -22.122 1.00 0.00 ? 42 MET A HG2  3  
ATOM 1390  H HG3  . MET A 1 42 ? -10.066 -32.086 -21.969 1.00 0.00 ? 42 MET A HG3  3  
ATOM 1391  H HE1  . MET A 1 42 ? -14.343 -32.668 -20.294 1.00 0.00 ? 42 MET A HE1  3  
ATOM 1392  H HE2  . MET A 1 42 ? -13.263 -31.381 -19.711 1.00 0.00 ? 42 MET A HE2  3  
ATOM 1393  H HE3  . MET A 1 42 ? -13.839 -31.366 -21.395 1.00 0.00 ? 42 MET A HE3  3  
ATOM 1394  N N    . LEU A 1 43 ? -10.861 -27.896 -20.743 1.00 0.00 ? 43 LEU A N    3  
ATOM 1395  C CA   . LEU A 1 43 ? -11.573 -26.827 -21.437 1.00 0.00 ? 43 LEU A CA   3  
ATOM 1396  C C    . LEU A 1 43 ? -10.613 -25.715 -21.828 1.00 0.00 ? 43 LEU A C    3  
ATOM 1397  O O    . LEU A 1 43 ? -10.703 -25.151 -22.917 1.00 0.00 ? 43 LEU A O    3  
ATOM 1398  C CB   . LEU A 1 43 ? -12.659 -26.234 -20.537 1.00 0.00 ? 43 LEU A CB   3  
ATOM 1399  C CG   . LEU A 1 43 ? -13.871 -27.126 -20.260 1.00 0.00 ? 43 LEU A CG   3  
ATOM 1400  C CD1  . LEU A 1 43 ? -14.805 -26.467 -19.256 1.00 0.00 ? 43 LEU A CD1  3  
ATOM 1401  C CD2  . LEU A 1 43 ? -14.653 -27.383 -21.539 1.00 0.00 ? 43 LEU A CD2  3  
ATOM 1402  H H    . LEU A 1 43 ? -10.973 -27.971 -19.742 1.00 0.00 ? 43 LEU A H    3  
ATOM 1403  H HA   . LEU A 1 43 ? -12.035 -27.239 -22.335 1.00 0.00 ? 43 LEU A HA   3  
ATOM 1404  H HB2  . LEU A 1 43 ? -12.200 -25.990 -19.579 1.00 0.00 ? 43 LEU A HB2  3  
ATOM 1405  H HB3  . LEU A 1 43 ? -13.020 -25.320 -21.010 1.00 0.00 ? 43 LEU A HB3  3  
ATOM 1406  H HG   . LEU A 1 43 ? -13.522 -28.076 -19.856 1.00 0.00 ? 43 LEU A HG   3  
ATOM 1407  H HD11 . LEU A 1 43 ? -15.659 -27.116 -19.060 1.00 0.00 ? 43 LEU A HD11 3  
ATOM 1408  H HD12 . LEU A 1 43 ? -14.268 -26.287 -18.325 1.00 0.00 ? 43 LEU A HD12 3  
ATOM 1409  H HD13 . LEU A 1 43 ? -15.160 -25.518 -19.659 1.00 0.00 ? 43 LEU A HD13 3  
ATOM 1410  H HD21 . LEU A 1 43 ? -15.507 -28.028 -21.330 1.00 0.00 ? 43 LEU A HD21 3  
ATOM 1411  H HD22 . LEU A 1 43 ? -15.009 -26.434 -21.943 1.00 0.00 ? 43 LEU A HD22 3  
ATOM 1412  H HD23 . LEU A 1 43 ? -14.005 -27.868 -22.268 1.00 0.00 ? 43 LEU A HD23 3  
ATOM 1413  N N    . ARG A 1 44 ? -9.690  -25.407 -20.922 1.00 0.00 ? 44 ARG A N    3  
ATOM 1414  C CA   . ARG A 1 44 ? -8.695  -24.363 -21.145 1.00 0.00 ? 44 ARG A CA   3  
ATOM 1415  C C    . ARG A 1 44 ? -7.534  -24.900 -21.966 1.00 0.00 ? 44 ARG A C    3  
ATOM 1416  O O    . ARG A 1 44 ? -6.931  -24.182 -22.762 1.00 0.00 ? 44 ARG A O    3  
ATOM 1417  C CB   . ARG A 1 44 ? -8.148  -23.851 -19.811 1.00 0.00 ? 44 ARG A CB   3  
ATOM 1418  C CG   . ARG A 1 44 ? -7.169  -22.695 -19.945 1.00 0.00 ? 44 ARG A CG   3  
ATOM 1419  C CD   . ARG A 1 44 ? -7.858  -21.446 -20.469 1.00 0.00 ? 44 ARG A CD   3  
ATOM 1420  N NE   . ARG A 1 44 ? -6.935  -20.320 -20.588 1.00 0.00 ? 44 ARG A NE   3  
ATOM 1421  C CZ   . ARG A 1 44 ? -7.235  -19.166 -21.173 1.00 0.00 ? 44 ARG A CZ   3  
ATOM 1422  N NH1  . ARG A 1 44 ? -8.440  -18.982 -21.696 1.00 0.00 ? 44 ARG A NH1  3  
ATOM 1423  N NH2  . ARG A 1 44 ? -6.331  -18.198 -21.234 1.00 0.00 ? 44 ARG A NH2  3  
ATOM 1424  H H    . ARG A 1 44 ? -9.669  -25.906 -20.044 1.00 0.00 ? 44 ARG A H    3  
ATOM 1425  H HA   . ARG A 1 44 ? -9.167  -23.539 -21.681 1.00 0.00 ? 44 ARG A HA   3  
ATOM 1426  H HB2  . ARG A 1 44 ? -8.989  -23.519 -19.201 1.00 0.00 ? 44 ARG A HB2  3  
ATOM 1427  H HB3  . ARG A 1 44 ? -7.639  -24.674 -19.311 1.00 0.00 ? 44 ARG A HB3  3  
ATOM 1428  H HG2  . ARG A 1 44 ? -6.739  -22.479 -18.967 1.00 0.00 ? 44 ARG A HG2  3  
ATOM 1429  H HG3  . ARG A 1 44 ? -6.376  -22.979 -20.636 1.00 0.00 ? 44 ARG A HG3  3  
ATOM 1430  H HD2  . ARG A 1 44 ? -8.281  -21.661 -21.450 1.00 0.00 ? 44 ARG A HD2  3  
ATOM 1431  H HD3  . ARG A 1 44 ? -8.662  -21.172 -19.785 1.00 0.00 ? 44 ARG A HD3  3  
ATOM 1432  H HE   . ARG A 1 44 ? -6.012  -20.438 -20.197 1.00 0.00 ? 44 ARG A HE   3  
ATOM 1433  H HH11 . ARG A 1 44 ? -9.129  -19.719 -21.649 1.00 0.00 ? 44 ARG A HH11 3  
ATOM 1434  H HH12 . ARG A 1 44 ? -8.669  -18.104 -22.141 1.00 0.00 ? 44 ARG A HH12 3  
ATOM 1435  H HH21 . ARG A 1 44 ? -5.414  -18.338 -20.836 1.00 0.00 ? 44 ARG A HH21 3  
ATOM 1436  H HH22 . ARG A 1 44 ? -6.560  -17.320 -21.679 1.00 0.00 ? 44 ARG A HH22 3  
ATOM 1437  N N    . LYS A 1 45 ? -7.228  -26.178 -21.760 1.00 0.00 ? 45 LYS A N    3  
ATOM 1438  C CA   . LYS A 1 45 ? -6.139  -26.843 -22.470 1.00 0.00 ? 45 LYS A CA   3  
ATOM 1439  C C    . LYS A 1 45 ? -6.530  -27.109 -23.914 1.00 0.00 ? 45 LYS A C    3  
ATOM 1440  O O    . LYS A 1 45 ? -5.762  -26.848 -24.839 1.00 0.00 ? 45 LYS A O    3  
ATOM 1441  C CB   . LYS A 1 45 ? -5.804  -28.180 -21.806 1.00 0.00 ? 45 LYS A CB   3  
ATOM 1442  C CG   . LYS A 1 45 ? -4.642  -28.919 -22.449 1.00 0.00 ? 45 LYS A CG   3  
ATOM 1443  C CD   . LYS A 1 45 ? -4.328  -30.207 -21.707 1.00 0.00 ? 45 LYS A CD   3  
ATOM 1444  C CE   . LYS A 1 45 ? -3.175  -30.954 -22.360 1.00 0.00 ? 45 LYS A CE   3  
ATOM 1445  N NZ   . LYS A 1 45 ? -2.848  -32.213 -21.636 1.00 0.00 ? 45 LYS A NZ   3  
ATOM 1446  H H    . LYS A 1 45 ? -7.761  -26.716 -21.092 1.00 0.00 ? 45 LYS A H    3  
ATOM 1447  H HA   . LYS A 1 45 ? -5.261  -26.198 -22.446 1.00 0.00 ? 45 LYS A HA   3  
ATOM 1448  H HB2  . LYS A 1 45 ? -5.554  -27.990 -20.762 1.00 0.00 ? 45 LYS A HB2  3  
ATOM 1449  H HB3  . LYS A 1 45 ? -6.687  -28.818 -21.858 1.00 0.00 ? 45 LYS A HB3  3  
ATOM 1450  H HG2  . LYS A 1 45 ? -4.901  -29.157 -23.481 1.00 0.00 ? 45 LYS A HG2  3  
ATOM 1451  H HG3  . LYS A 1 45 ? -3.762  -28.277 -22.434 1.00 0.00 ? 45 LYS A HG3  3  
ATOM 1452  H HD2  . LYS A 1 45 ? -4.059  -29.967 -20.678 1.00 0.00 ? 45 LYS A HD2  3  
ATOM 1453  H HD3  . LYS A 1 45 ? -5.213  -30.844 -21.712 1.00 0.00 ? 45 LYS A HD3  3  
ATOM 1454  H HE2  . LYS A 1 45 ? -3.448  -31.197 -23.387 1.00 0.00 ? 45 LYS A HE2  3  
ATOM 1455  H HE3  . LYS A 1 45 ? -2.295  -30.310 -22.366 1.00 0.00 ? 45 LYS A HE3  3  
ATOM 1456  H HZ1  . LYS A 1 45 ? -2.081  -32.681 -22.096 1.00 0.00 ? 45 LYS A HZ1  3  
ATOM 1457  H HZ2  . LYS A 1 45 ? -2.587  -31.995 -20.685 1.00 0.00 ? 45 LYS A HZ2  3  
ATOM 1458  H HZ3  . LYS A 1 45 ? -3.657  -32.818 -21.633 1.00 0.00 ? 45 LYS A HZ3  3  
ATOM 1459  N N    . ALA A 1 46 ? -7.738  -27.636 -24.095 1.00 0.00 ? 46 ALA A N    3  
ATOM 1460  C CA   . ALA A 1 46 ? -8.261  -27.951 -25.421 1.00 0.00 ? 46 ALA A CA   3  
ATOM 1461  C C    . ALA A 1 46 ? -9.661  -28.535 -25.298 1.00 0.00 ? 46 ALA A C    3  
ATOM 1462  O O    . ALA A 1 46 ? -10.182 -28.679 -24.194 1.00 0.00 ? 46 ALA A O    3  
ATOM 1463  C CB   . ALA A 1 46 ? -7.324  -28.933 -26.117 1.00 0.00 ? 46 ALA A CB   3  
ATOM 1464  H H    . ALA A 1 46 ? -8.322  -27.829 -23.294 1.00 0.00 ? 46 ALA A H    3  
ATOM 1465  H HA   . ALA A 1 46 ? -8.311  -27.033 -26.007 1.00 0.00 ? 46 ALA A HA   3  
ATOM 1466  H HB1  . ALA A 1 46 ? -7.708  -29.156 -27.112 1.00 0.00 ? 46 ALA A HB1  3  
ATOM 1467  H HB2  . ALA A 1 46 ? -6.331  -28.492 -26.200 1.00 0.00 ? 46 ALA A HB2  3  
ATOM 1468  H HB3  . ALA A 1 46 ? -7.265  -29.853 -25.535 1.00 0.00 ? 46 ALA A HB3  3  
ATOM 1469  N N    . GLY A 1 1  ? 21.560  -43.080 36.472  1.00 0.00 ? 1  GLY A N    4  
ATOM 1470  C CA   . GLY A 1 1  ? 21.830  -44.504 36.515  1.00 0.00 ? 1  GLY A CA   4  
ATOM 1471  C C    . GLY A 1 1  ? 21.096  -45.207 35.385  1.00 0.00 ? 1  GLY A C    4  
ATOM 1472  O O    . GLY A 1 1  ? 20.396  -44.573 34.597  1.00 0.00 ? 1  GLY A O    4  
ATOM 1473  H H1   . GLY A 1 1  ? 20.954  -42.726 35.745  1.00 0.00 ? 1  GLY A H1   4  
ATOM 1474  H HA2  . GLY A 1 1  ? 22.901  -44.672 36.410  1.00 0.00 ? 1  GLY A HA2  4  
ATOM 1475  H HA3  . GLY A 1 1  ? 21.493  -44.906 37.470  1.00 0.00 ? 1  GLY A HA3  4  
ATOM 1476  N N    . VAL A 1 2  ? 21.267  -46.525 35.320  1.00 0.00 ? 2  VAL A N    4  
ATOM 1477  C CA   . VAL A 1 2  ? 20.630  -47.345 34.294  1.00 0.00 ? 2  VAL A CA   4  
ATOM 1478  C C    . VAL A 1 2  ? 19.130  -47.417 34.525  1.00 0.00 ? 2  VAL A C    4  
ATOM 1479  O O    . VAL A 1 2  ? 18.336  -47.295 33.593  1.00 0.00 ? 2  VAL A O    4  
ATOM 1480  C CB   . VAL A 1 2  ? 21.179  -48.784 34.300  1.00 0.00 ? 2  VAL A CB   4  
ATOM 1481  C CG1  . VAL A 1 2  ? 20.375  -49.665 33.356  1.00 0.00 ? 2  VAL A CG1  4  
ATOM 1482  C CG2  . VAL A 1 2  ? 22.633  -48.801 33.852  1.00 0.00 ? 2  VAL A CG2  4  
ATOM 1483  H H    . VAL A 1 2  ? 21.856  -46.984 36.000  1.00 0.00 ? 2  VAL A H    4  
ATOM 1484  H HA   . VAL A 1 2  ? 20.824  -46.892 33.322  1.00 0.00 ? 2  VAL A HA   4  
ATOM 1485  H HB   . VAL A 1 2  ? 21.109  -49.183 35.312  1.00 0.00 ? 2  VAL A HB   4  
ATOM 1486  H HG11 . VAL A 1 2  ? 20.767  -50.681 33.375  1.00 0.00 ? 2  VAL A HG11 4  
ATOM 1487  H HG12 . VAL A 1 2  ? 19.331  -49.674 33.670  1.00 0.00 ? 2  VAL A HG12 4  
ATOM 1488  H HG13 . VAL A 1 2  ? 20.446  -49.269 32.343  1.00 0.00 ? 2  VAL A HG13 4  
ATOM 1489  H HG21 . VAL A 1 2  ? 23.013  -49.822 33.869  1.00 0.00 ? 2  VAL A HG21 4  
ATOM 1490  H HG22 . VAL A 1 2  ? 22.704  -48.405 32.839  1.00 0.00 ? 2  VAL A HG22 4  
ATOM 1491  H HG23 . VAL A 1 2  ? 23.226  -48.183 34.526  1.00 0.00 ? 2  VAL A HG23 4  
ATOM 1492  N N    . ILE A 1 3  ? 18.751  -47.618 35.784  1.00 0.00 ? 3  ILE A N    4  
ATOM 1493  C CA   . ILE A 1 3  ? 17.347  -47.711 36.171  1.00 0.00 ? 3  ILE A CA   4  
ATOM 1494  C C    . ILE A 1 3  ? 16.648  -46.378 35.963  1.00 0.00 ? 3  ILE A C    4  
ATOM 1495  O O    . ILE A 1 3  ? 15.502  -46.322 35.519  1.00 0.00 ? 3  ILE A O    4  
ATOM 1496  C CB   . ILE A 1 3  ? 17.195  -48.099 37.654  1.00 0.00 ? 3  ILE A CB   4  
ATOM 1497  C CG1  . ILE A 1 3  ? 17.696  -49.526 37.886  1.00 0.00 ? 3  ILE A CG1  4  
ATOM 1498  C CG2  . ILE A 1 3  ? 15.735  -48.027 38.076  1.00 0.00 ? 3  ILE A CG2  4  
ATOM 1499  C CD1  . ILE A 1 3  ? 17.814  -49.901 39.347  1.00 0.00 ? 3  ILE A CD1  4  
ATOM 1500  H H    . ILE A 1 3  ? 19.451  -47.709 36.506  1.00 0.00 ? 3  ILE A H    4  
ATOM 1501  H HA   . ILE A 1 3  ? 16.868  -48.470 35.552  1.00 0.00 ? 3  ILE A HA   4  
ATOM 1502  H HB   . ILE A 1 3  ? 17.779  -47.408 38.261  1.00 0.00 ? 3  ILE A HB   4  
ATOM 1503  H HG12 . ILE A 1 3  ? 17.000  -50.216 37.409  1.00 0.00 ? 3  ILE A HG12 4  
ATOM 1504  H HG13 . ILE A 1 3  ? 18.679  -49.624 37.426  1.00 0.00 ? 3  ILE A HG13 4  
ATOM 1505  H HG21 . ILE A 1 3  ? 15.640  -48.293 39.129  1.00 0.00 ? 3  ILE A HG21 4  
ATOM 1506  H HG22 . ILE A 1 3  ? 15.364  -47.013 37.926  1.00 0.00 ? 3  ILE A HG22 4  
ATOM 1507  H HG23 . ILE A 1 3  ? 15.149  -48.720 37.474  1.00 0.00 ? 3  ILE A HG23 4  
ATOM 1508  H HD11 . ILE A 1 3  ? 18.172  -50.924 39.451  1.00 0.00 ? 3  ILE A HD11 4  
ATOM 1509  H HD12 . ILE A 1 3  ? 18.515  -49.225 39.837  1.00 0.00 ? 3  ILE A HD12 4  
ATOM 1510  H HD13 . ILE A 1 3  ? 16.836  -49.815 39.821  1.00 0.00 ? 3  ILE A HD13 4  
ATOM 1511  N N    . ASP A 1 4  ? 17.356  -45.301 36.291  1.00 0.00 ? 4  ASP A N    4  
ATOM 1512  C CA   . ASP A 1 4  ? 16.827  -43.948 36.151  1.00 0.00 ? 4  ASP A CA   4  
ATOM 1513  C C    . ASP A 1 4  ? 16.288  -43.729 34.746  1.00 0.00 ? 4  ASP A C    4  
ATOM 1514  O O    . ASP A 1 4  ? 15.242  -43.111 34.555  1.00 0.00 ? 4  ASP A O    4  
ATOM 1515  C CB   . ASP A 1 4  ? 17.924  -42.914 36.415  1.00 0.00 ? 4  ASP A CB   4  
ATOM 1516  C CG   . ASP A 1 4  ? 18.316  -42.840 37.877  1.00 0.00 ? 4  ASP A CG   4  
ATOM 1517  O OD1  . ASP A 1 4  ? 19.093  -41.932 38.239  1.00 0.00 ? 4  ASP A OD1  4  
ATOM 1518  O OD2  . ASP A 1 4  ? 17.845  -43.691 38.662  1.00 0.00 ? 4  ASP A OD2  4  
ATOM 1519  H H    . ASP A 1 4  ? 18.293  -45.411 36.651  1.00 0.00 ? 4  ASP A H    4  
ATOM 1520  H HA   . ASP A 1 4  ? 16.021  -43.811 36.873  1.00 0.00 ? 4  ASP A HA   4  
ATOM 1521  H HB2  . ASP A 1 4  ? 18.804  -43.179 35.830  1.00 0.00 ? 4  ASP A HB2  4  
ATOM 1522  H HB3  . ASP A 1 4  ? 17.565  -41.934 36.099  1.00 0.00 ? 4  ASP A HB3  4  
ATOM 1523  H HD2  . ASP A 1 4  ? 18.134  -43.585 39.571  1.00 0.00 ? 4  ASP A HD2  4  
ATOM 1524  N N    . THR A 1 5  ? 17.020  -44.248 33.763  1.00 0.00 ? 5  THR A N    4  
ATOM 1525  C CA   . THR A 1 5  ? 16.639  -44.124 32.359  1.00 0.00 ? 5  THR A CA   4  
ATOM 1526  C C    . THR A 1 5  ? 15.866  -45.353 31.908  1.00 0.00 ? 5  THR A C    4  
ATOM 1527  O O    . THR A 1 5  ? 15.430  -45.445 30.762  1.00 0.00 ? 5  THR A O    4  
ATOM 1528  C CB   . THR A 1 5  ? 17.874  -43.980 31.450  1.00 0.00 ? 5  THR A CB   4  
ATOM 1529  O OG1  . THR A 1 5  ? 18.694  -45.150 31.564  1.00 0.00 ? 5  THR A OG1  4  
ATOM 1530  C CG2  . THR A 1 5  ? 18.693  -42.764 31.852  1.00 0.00 ? 5  THR A CG2  4  
ATOM 1531  H H    . THR A 1 5  ? 17.869  -44.747 33.985  1.00 0.00 ? 5  THR A H    4  
ATOM 1532  H HA   . THR A 1 5  ? 16.010  -43.240 32.249  1.00 0.00 ? 5  THR A HA   4  
ATOM 1533  H HB   . THR A 1 5  ? 17.545  -43.866 30.417  1.00 0.00 ? 5  THR A HB   4  
ATOM 1534  H HG1  . THR A 1 5  ? 19.454  -45.048 30.987  1.00 0.00 ? 5  THR A HG1  4  
ATOM 1535  H HG21 . THR A 1 5  ? 19.561  -42.672 31.200  1.00 0.00 ? 5  THR A HG21 4  
ATOM 1536  H HG22 . THR A 1 5  ? 18.078  -41.868 31.763  1.00 0.00 ? 5  THR A HG22 4  
ATOM 1537  H HG23 . THR A 1 5  ? 19.025  -42.875 32.884  1.00 0.00 ? 5  THR A HG23 4  
ATOM 1538  N N    . SER A 1 6  ? 15.701  -46.299 32.829  1.00 0.00 ? 6  SER A N    4  
ATOM 1539  C CA   . SER A 1 6  ? 14.982  -47.538 32.553  1.00 0.00 ? 6  SER A CA   4  
ATOM 1540  C C    . SER A 1 6  ? 13.650  -47.244 31.881  1.00 0.00 ? 6  SER A C    4  
ATOM 1541  O O    . SER A 1 6  ? 13.389  -47.688 30.764  1.00 0.00 ? 6  SER A O    4  
ATOM 1542  C CB   . SER A 1 6  ? 14.710  -48.300 33.851  1.00 0.00 ? 6  SER A CB   4  
ATOM 1543  O OG   . SER A 1 6  ? 14.003  -49.502 33.599  1.00 0.00 ? 6  SER A OG   4  
ATOM 1544  H H    . SER A 1 6  ? 16.082  -46.164 33.755  1.00 0.00 ? 6  SER A H    4  
ATOM 1545  H HA   . SER A 1 6  ? 15.590  -48.156 31.893  1.00 0.00 ? 6  SER A HA   4  
ATOM 1546  H HB2  . SER A 1 6  ? 15.659  -48.539 34.329  1.00 0.00 ? 6  SER A HB2  4  
ATOM 1547  H HB3  . SER A 1 6  ? 14.117  -47.671 34.516  1.00 0.00 ? 6  SER A HB3  4  
ATOM 1548  H HG   . SER A 1 6  ? 13.849  -49.953 34.432  1.00 0.00 ? 6  SER A HG   4  
ATOM 1549  N N    . ALA A 1 7  ? 12.809  -46.487 32.580  1.00 0.00 ? 7  ALA A N    4  
ATOM 1550  C CA   . ALA A 1 7  ? 11.491  -46.114 32.074  1.00 0.00 ? 7  ALA A CA   4  
ATOM 1551  C C    . ALA A 1 7  ? 11.620  -45.331 30.777  1.00 0.00 ? 7  ALA A C    4  
ATOM 1552  O O    . ALA A 1 7  ? 10.861  -45.537 29.831  1.00 0.00 ? 7  ALA A O    4  
ATOM 1553  C CB   . ALA A 1 7  ? 10.759  -45.249 33.088  1.00 0.00 ? 7  ALA A CB   4  
ATOM 1554  H H    . ALA A 1 7  ? 13.080  -46.153 33.494  1.00 0.00 ? 7  ALA A H    4  
ATOM 1555  H HA   . ALA A 1 7  ? 10.916  -47.022 31.892  1.00 0.00 ? 7  ALA A HA   4  
ATOM 1556  H HB1  . ALA A 1 7  ? 9.771   -44.988 32.707  1.00 0.00 ? 7  ALA A HB1  4  
ATOM 1557  H HB2  . ALA A 1 7  ? 10.652  -45.798 34.023  1.00 0.00 ? 7  ALA A HB2  4  
ATOM 1558  H HB3  . ALA A 1 7  ? 11.329  -44.337 33.266  1.00 0.00 ? 7  ALA A HB3  4  
ATOM 1559  N N    . VAL A 1 8  ? 12.596  -44.428 30.746  1.00 0.00 ? 8  VAL A N    4  
ATOM 1560  C CA   . VAL A 1 8  ? 12.851  -43.595 29.574  1.00 0.00 ? 8  VAL A CA   4  
ATOM 1561  C C    . VAL A 1 8  ? 13.254  -44.455 28.388  1.00 0.00 ? 8  VAL A C    4  
ATOM 1562  O O    . VAL A 1 8  ? 12.819  -44.228 27.260  1.00 0.00 ? 8  VAL A O    4  
ATOM 1563  C CB   . VAL A 1 8  ? 13.985  -42.586 29.835  1.00 0.00 ? 8  VAL A CB   4  
ATOM 1564  C CG1  . VAL A 1 8  ? 14.374  -41.877 28.546  1.00 0.00 ? 8  VAL A CG1  4  
ATOM 1565  C CG2  . VAL A 1 8  ? 13.544  -41.539 30.845  1.00 0.00 ? 8  VAL A CG2  4  
ATOM 1566  H H    . VAL A 1 8  ? 13.187  -44.305 31.556  1.00 0.00 ? 8  VAL A H    4  
ATOM 1567  H HA   . VAL A 1 8  ? 11.937  -43.051 29.333  1.00 0.00 ? 8  VAL A HA   4  
ATOM 1568  H HB   . VAL A 1 8  ? 14.850  -43.121 30.226  1.00 0.00 ? 8  VAL A HB   4  
ATOM 1569  H HG11 . VAL A 1 8  ? 15.182  -41.172 28.741  1.00 0.00 ? 8  VAL A HG11 4  
ATOM 1570  H HG12 . VAL A 1 8  ? 14.705  -42.612 27.813  1.00 0.00 ? 8  VAL A HG12 4  
ATOM 1571  H HG13 . VAL A 1 8  ? 13.511  -41.337 28.155  1.00 0.00 ? 8  VAL A HG13 4  
ATOM 1572  H HG21 . VAL A 1 8  ? 14.356  -40.836 31.028  1.00 0.00 ? 8  VAL A HG21 4  
ATOM 1573  H HG22 . VAL A 1 8  ? 12.681  -40.999 30.454  1.00 0.00 ? 8  VAL A HG22 4  
ATOM 1574  H HG23 . VAL A 1 8  ? 13.272  -42.029 31.780  1.00 0.00 ? 8  VAL A HG23 4  
ATOM 1575  N N    . GLU A 1 9  ? 14.094  -45.451 28.658  1.00 0.00 ? 9  GLU A N    4  
ATOM 1576  C CA   . GLU A 1 9  ? 14.576  -46.367 27.628  1.00 0.00 ? 9  GLU A CA   4  
ATOM 1577  C C    . GLU A 1 9  ? 13.408  -47.046 26.931  1.00 0.00 ? 9  GLU A C    4  
ATOM 1578  O O    . GLU A 1 9  ? 13.422  -47.249 25.718  1.00 0.00 ? 9  GLU A O    4  
ATOM 1579  C CB   . GLU A 1 9  ? 15.465  -47.448 28.246  1.00 0.00 ? 9  GLU A CB   4  
ATOM 1580  C CG   . GLU A 1 9  ? 16.070  -48.408 27.234  1.00 0.00 ? 9  GLU A CG   4  
ATOM 1581  C CD   . GLU A 1 9  ? 16.984  -49.432 27.876  1.00 0.00 ? 9  GLU A CD   4  
ATOM 1582  O OE1  . GLU A 1 9  ? 17.143  -49.392 29.114  1.00 0.00 ? 9  GLU A OE1  4  
ATOM 1583  O OE2  . GLU A 1 9  ? 17.541  -50.275 27.142  1.00 0.00 ? 9  GLU A OE2  4  
ATOM 1584  H H    . GLU A 1 9  ? 14.415  -45.587 29.606  1.00 0.00 ? 9  GLU A H    4  
ATOM 1585  H HA   . GLU A 1 9  ? 15.153  -45.800 26.898  1.00 0.00 ? 9  GLU A HA   4  
ATOM 1586  H HB2  . GLU A 1 9  ? 16.278  -46.957 28.781  1.00 0.00 ? 9  GLU A HB2  4  
ATOM 1587  H HB3  . GLU A 1 9  ? 14.864  -48.025 28.949  1.00 0.00 ? 9  GLU A HB3  4  
ATOM 1588  H HG2  . GLU A 1 9  ? 15.262  -48.931 26.722  1.00 0.00 ? 9  GLU A HG2  4  
ATOM 1589  H HG3  . GLU A 1 9  ? 16.643  -47.834 26.506  1.00 0.00 ? 9  GLU A HG3  4  
ATOM 1590  H HE2  . GLU A 1 9  ? 18.104  -50.891 27.615  1.00 0.00 ? 9  GLU A HE2  4  
ATOM 1591  N N    . SER A 1 10 ? 12.395  -47.396 27.717  1.00 0.00 ? 10 SER A N    4  
ATOM 1592  C CA   . SER A 1 10 ? 11.199  -48.056 27.201  1.00 0.00 ? 10 SER A CA   4  
ATOM 1593  C C    . SER A 1 10 ? 10.245  -47.038 26.600  1.00 0.00 ? 10 SER A C    4  
ATOM 1594  O O    . SER A 1 10 ? 9.743   -47.213 25.491  1.00 0.00 ? 10 SER A O    4  
ATOM 1595  C CB   . SER A 1 10 ? 10.470  -48.797 28.323  1.00 0.00 ? 10 SER A CB   4  
ATOM 1596  O OG   . SER A 1 10 ? 11.270  -49.841 28.850  1.00 0.00 ? 10 SER A OG   4  
ATOM 1597  H H    . SER A 1 10 ? 12.443  -47.202 28.707  1.00 0.00 ? 10 SER A H    4  
ATOM 1598  H HA   . SER A 1 10 ? 11.497  -48.769 26.433  1.00 0.00 ? 10 SER A HA   4  
ATOM 1599  H HB2  . SER A 1 10 ? 10.234  -48.092 29.121  1.00 0.00 ? 10 SER A HB2  4  
ATOM 1600  H HB3  . SER A 1 10 ? 9.547   -49.221 27.929  1.00 0.00 ? 10 SER A HB3  4  
ATOM 1601  H HG   . SER A 1 10 ? 10.783  -50.283 29.550  1.00 0.00 ? 10 SER A HG   4  
ATOM 1602  N N    . ALA A 1 11 ? 10.000  -45.967 27.351  1.00 0.00 ? 11 ALA A N    4  
ATOM 1603  C CA   . ALA A 1 11 ? 9.106   -44.898 26.916  1.00 0.00 ? 11 ALA A CA   4  
ATOM 1604  C C    . ALA A 1 11 ? 9.693   -44.166 25.720  1.00 0.00 ? 11 ALA A C    4  
ATOM 1605  O O    . ALA A 1 11 ? 8.979   -43.792 24.791  1.00 0.00 ? 11 ALA A O    4  
ATOM 1606  C CB   . ALA A 1 11 ? 8.894   -43.894 28.039  1.00 0.00 ? 11 ALA A CB   4  
ATOM 1607  H H    . ALA A 1 11 ? 10.441  -45.881 28.255  1.00 0.00 ? 11 ALA A H    4  
ATOM 1608  H HA   . ALA A 1 11 ? 8.147   -45.335 26.637  1.00 0.00 ? 11 ALA A HA   4  
ATOM 1609  H HB1  . ALA A 1 11 ? 8.213   -43.108 27.709  1.00 0.00 ? 11 ALA A HB1  4  
ATOM 1610  H HB2  . ALA A 1 11 ? 8.466   -44.402 28.904  1.00 0.00 ? 11 ALA A HB2  4  
ATOM 1611  H HB3  . ALA A 1 11 ? 9.851   -43.450 28.315  1.00 0.00 ? 11 ALA A HB3  4  
ATOM 1612  N N    . ILE A 1 12 ? 11.007  -43.967 25.756  1.00 0.00 ? 12 ILE A N    4  
ATOM 1613  C CA   . ILE A 1 12 ? 11.722  -43.281 24.685  1.00 0.00 ? 12 ILE A CA   4  
ATOM 1614  C C    . ILE A 1 12 ? 11.698  -44.110 23.412  1.00 0.00 ? 12 ILE A C    4  
ATOM 1615  O O    . ILE A 1 12 ? 11.435  -43.599 22.324  1.00 0.00 ? 12 ILE A O    4  
ATOM 1616  C CB   . ILE A 1 12 ? 13.195  -43.031 25.059  1.00 0.00 ? 12 ILE A CB   4  
ATOM 1617  C CG1  . ILE A 1 12 ? 13.290  -42.033 26.215  1.00 0.00 ? 12 ILE A CG1  4  
ATOM 1618  C CG2  . ILE A 1 12 ? 13.958  -42.467 23.871  1.00 0.00 ? 12 ILE A CG2  4  
ATOM 1619  C CD1  . ILE A 1 12 ? 12.699  -40.677 25.900  1.00 0.00 ? 12 ILE A CD1  4  
ATOM 1620  H H    . ILE A 1 12 ? 11.539  -44.299 26.548  1.00 0.00 ? 12 ILE A H    4  
ATOM 1621  H HA   . ILE A 1 12 ? 11.232  -42.324 24.503  1.00 0.00 ? 12 ILE A HA   4  
ATOM 1622  H HB   . ILE A 1 12 ? 13.647  -43.975 25.361  1.00 0.00 ? 12 ILE A HB   4  
ATOM 1623  H HG12 . ILE A 1 12 ? 12.760  -42.447 27.072  1.00 0.00 ? 12 ILE A HG12 4  
ATOM 1624  H HG13 . ILE A 1 12 ? 14.341  -41.898 26.468  1.00 0.00 ? 12 ILE A HG13 4  
ATOM 1625  H HG21 . ILE A 1 12 ? 15.000  -42.304 24.145  1.00 0.00 ? 12 ILE A HG21 4  
ATOM 1626  H HG22 . ILE A 1 12 ? 13.908  -43.172 23.041  1.00 0.00 ? 12 ILE A HG22 4  
ATOM 1627  H HG23 . ILE A 1 12 ? 13.511  -41.519 23.570  1.00 0.00 ? 12 ILE A HG23 4  
ATOM 1628  H HD11 . ILE A 1 12 ? 12.793  -40.010 26.757  1.00 0.00 ? 12 ILE A HD11 4  
ATOM 1629  H HD12 . ILE A 1 12 ? 13.226  -40.243 25.050  1.00 0.00 ? 12 ILE A HD12 4  
ATOM 1630  H HD13 . ILE A 1 12 ? 11.643  -40.792 25.653  1.00 0.00 ? 12 ILE A HD13 4  
ATOM 1631  N N    . THR A 1 13 ? 11.976  -45.402 23.563  1.00 0.00 ? 13 THR A N    4  
ATOM 1632  C CA   . THR A 1 13 ? 11.994  -46.334 22.438  1.00 0.00 ? 13 THR A CA   4  
ATOM 1633  C C    . THR A 1 13 ? 10.606  -46.463 21.832  1.00 0.00 ? 13 THR A C    4  
ATOM 1634  O O    . THR A 1 13 ? 10.444  -46.487 20.613  1.00 0.00 ? 13 THR A O    4  
ATOM 1635  C CB   . THR A 1 13 ? 12.452  -47.738 22.875  1.00 0.00 ? 13 THR A CB   4  
ATOM 1636  O OG1  . THR A 1 13 ? 13.791  -47.670 23.383  1.00 0.00 ? 13 THR A OG1  4  
ATOM 1637  C CG2  . THR A 1 13 ? 12.420  -48.699 21.697  1.00 0.00 ? 13 THR A CG2  4  
ATOM 1638  H H    . THR A 1 13 ? 12.182  -45.762 24.484  1.00 0.00 ? 13 THR A H    4  
ATOM 1639  H HA   . THR A 1 13 ? 12.683  -45.951 21.685  1.00 0.00 ? 13 THR A HA   4  
ATOM 1640  H HB   . THR A 1 13 ? 11.785  -48.104 23.656  1.00 0.00 ? 13 THR A HB   4  
ATOM 1641  H HG1  . THR A 1 13 ? 14.059  -48.549 23.658  1.00 0.00 ? 13 THR A HG1  4  
ATOM 1642  H HG21 . THR A 1 13 ? 12.744  -49.688 22.020  1.00 0.00 ? 13 THR A HG21 4  
ATOM 1643  H HG22 . THR A 1 13 ? 11.403  -48.760 21.307  1.00 0.00 ? 13 THR A HG22 4  
ATOM 1644  H HG23 . THR A 1 13 ? 13.087  -48.336 20.915  1.00 0.00 ? 13 THR A HG23 4  
ATOM 1645  N N    . ASP A 1 14 ? 9.604   -46.547 22.703  1.00 0.00 ? 14 ASP A N    4  
ATOM 1646  C CA   . ASP A 1 14 ? 8.213   -46.676 22.281  1.00 0.00 ? 14 ASP A CA   4  
ATOM 1647  C C    . ASP A 1 14 ? 7.736   -45.393 21.620  1.00 0.00 ? 14 ASP A C    4  
ATOM 1648  O O    . ASP A 1 14 ? 7.170   -45.413 20.528  1.00 0.00 ? 14 ASP A O    4  
ATOM 1649  C CB   . ASP A 1 14 ? 7.313   -46.964 23.484  1.00 0.00 ? 14 ASP A CB   4  
ATOM 1650  C CG   . ASP A 1 14 ? 7.505   -48.363 24.034  1.00 0.00 ? 14 ASP A CG   4  
ATOM 1651  O OD1  . ASP A 1 14 ? 6.730   -48.762 24.929  1.00 0.00 ? 14 ASP A OD1  4  
ATOM 1652  O OD2  . ASP A 1 14 ? 8.430   -49.062 23.570  1.00 0.00 ? 14 ASP A OD2  4  
ATOM 1653  H H    . ASP A 1 14 ? 9.801   -46.522 23.693  1.00 0.00 ? 14 ASP A H    4  
ATOM 1654  H HA   . ASP A 1 14 ? 8.138   -47.498 21.570  1.00 0.00 ? 14 ASP A HA   4  
ATOM 1655  H HB2  . ASP A 1 14 ? 7.538   -46.244 24.271  1.00 0.00 ? 14 ASP A HB2  4  
ATOM 1656  H HB3  . ASP A 1 14 ? 6.272   -46.847 23.179  1.00 0.00 ? 14 ASP A HB3  4  
ATOM 1657  H HD2  . ASP A 1 14 ? 8.493   -49.935 23.963  1.00 0.00 ? 14 ASP A HD2  4  
ATOM 1658  N N    . GLY A 1 15 ? 7.973   -44.274 22.298  1.00 0.00 ? 15 GLY A N    4  
ATOM 1659  C CA   . GLY A 1 15 ? 7.579   -42.961 21.798  1.00 0.00 ? 15 GLY A CA   4  
ATOM 1660  C C    . GLY A 1 15 ? 8.616   -42.427 20.823  1.00 0.00 ? 15 GLY A C    4  
ATOM 1661  O O    . GLY A 1 15 ? 8.358   -42.299 19.627  1.00 0.00 ? 15 GLY A O    4  
ATOM 1662  H H    . GLY A 1 15 ? 8.441   -44.323 23.192  1.00 0.00 ? 15 GLY A H    4  
ATOM 1663  H HA2  . GLY A 1 15 ? 6.618   -43.043 21.290  1.00 0.00 ? 15 GLY A HA2  4  
ATOM 1664  H HA3  . GLY A 1 15 ? 7.485   -42.270 22.637  1.00 0.00 ? 15 GLY A HA3  4  
ATOM 1665  N N    . GLN A 1 16 ? 9.795   -42.116 21.352  1.00 0.00 ? 16 GLN A N    4  
ATOM 1666  C CA   . GLN A 1 16 ? 10.897  -41.593 20.550  1.00 0.00 ? 16 GLN A CA   4  
ATOM 1667  C C    . GLN A 1 16 ? 11.106  -42.448 19.310  1.00 0.00 ? 16 GLN A C    4  
ATOM 1668  O O    . GLN A 1 16 ? 11.104  -41.949 18.186  1.00 0.00 ? 16 GLN A O    4  
ATOM 1669  C CB   . GLN A 1 16 ? 12.195  -41.590 21.360  1.00 0.00 ? 16 GLN A CB   4  
ATOM 1670  C CG   . GLN A 1 16 ? 13.391  -41.020 20.615  1.00 0.00 ? 16 GLN A CG   4  
ATOM 1671  C CD   . GLN A 1 16 ? 13.224  -39.549 20.287  1.00 0.00 ? 16 GLN A CD   4  
ATOM 1672  O OE1  . GLN A 1 16 ? 12.981  -38.729 21.172  1.00 0.00 ? 16 GLN A OE1  4  
ATOM 1673  N NE2  . GLN A 1 16 ? 13.356  -39.210 19.009  1.00 0.00 ? 16 GLN A NE2  4  
ATOM 1674  H H    . GLN A 1 16 ? 9.944   -42.241 22.343  1.00 0.00 ? 16 GLN A H    4  
ATOM 1675  H HA   . GLN A 1 16 ? 10.657  -40.573 20.250  1.00 0.00 ? 16 GLN A HA   4  
ATOM 1676  H HB2  . GLN A 1 16 ? 12.036  -40.994 22.259  1.00 0.00 ? 16 GLN A HB2  4  
ATOM 1677  H HB3  . GLN A 1 16 ? 12.425  -42.617 21.642  1.00 0.00 ? 16 GLN A HB3  4  
ATOM 1678  H HG2  . GLN A 1 16 ? 14.280  -41.142 21.233  1.00 0.00 ? 16 GLN A HG2  4  
ATOM 1679  H HG3  . GLN A 1 16 ? 13.521  -41.574 19.685  1.00 0.00 ? 16 GLN A HG3  4  
ATOM 1680  H HE21 . GLN A 1 16 ? 13.555  -39.918 18.318  1.00 0.00 ? 16 GLN A HE21 4  
ATOM 1681  H HE22 . GLN A 1 16 ? 13.255  -38.244 18.731  1.00 0.00 ? 16 GLN A HE22 4  
ATOM 1682  N N    . GLY A 1 17 ? 11.286  -43.747 19.532  1.00 0.00 ? 17 GLY A N    4  
ATOM 1683  C CA   . GLY A 1 17 ? 11.500  -44.700 18.447  1.00 0.00 ? 17 GLY A CA   4  
ATOM 1684  C C    . GLY A 1 17 ? 10.423  -44.549 17.385  1.00 0.00 ? 17 GLY A C    4  
ATOM 1685  O O    . GLY A 1 17 ? 10.711  -44.492 16.191  1.00 0.00 ? 17 GLY A O    4  
ATOM 1686  H H    . GLY A 1 17 ? 11.276  -44.096 20.480  1.00 0.00 ? 17 GLY A H    4  
ATOM 1687  H HA2  . GLY A 1 17 ? 12.476  -44.518 17.997  1.00 0.00 ? 17 GLY A HA2  4  
ATOM 1688  H HA3  . GLY A 1 17 ? 11.470  -45.713 18.848  1.00 0.00 ? 17 GLY A HA3  4  
ATOM 1689  N N    . ASP A 1 18 ? 9.174   -44.484 17.838  1.00 0.00 ? 18 ASP A N    4  
ATOM 1690  C CA   . ASP A 1 18 ? 8.027   -44.339 16.946  1.00 0.00 ? 18 ASP A CA   4  
ATOM 1691  C C    . ASP A 1 18 ? 8.190   -43.109 16.067  1.00 0.00 ? 18 ASP A C    4  
ATOM 1692  O O    . ASP A 1 18 ? 7.485   -42.939 15.074  1.00 0.00 ? 18 ASP A O    4  
ATOM 1693  C CB   . ASP A 1 18 ? 6.736   -44.190 17.753  1.00 0.00 ? 18 ASP A CB   4  
ATOM 1694  C CG   . ASP A 1 18 ? 6.331   -45.475 18.447  1.00 0.00 ? 18 ASP A CG   4  
ATOM 1695  O OD1  . ASP A 1 18 ? 5.117   -45.763 18.503  1.00 0.00 ? 18 ASP A OD1  4  
ATOM 1696  O OD2  . ASP A 1 18 ? 7.228   -46.194 18.936  1.00 0.00 ? 18 ASP A OD2  4  
ATOM 1697  H H    . ASP A 1 18 ? 9.001   -44.536 18.832  1.00 0.00 ? 18 ASP A H    4  
ATOM 1698  H HA   . ASP A 1 18 ? 7.958   -45.226 16.317  1.00 0.00 ? 18 ASP A HA   4  
ATOM 1699  H HB2  . ASP A 1 18 ? 6.880   -43.415 18.506  1.00 0.00 ? 18 ASP A HB2  4  
ATOM 1700  H HB3  . ASP A 1 18 ? 5.934   -43.888 17.079  1.00 0.00 ? 18 ASP A HB3  4  
ATOM 1701  H HD2  . ASP A 1 18 ? 6.901   -46.990 19.360  1.00 0.00 ? 18 ASP A HD2  4  
ATOM 1702  N N    . MET A 1 19 ? 9.133   -42.252 16.446  1.00 0.00 ? 19 MET A N    4  
ATOM 1703  C CA   . MET A 1 19 ? 9.414   -41.023 15.709  1.00 0.00 ? 19 MET A CA   4  
ATOM 1704  C C    . MET A 1 19 ? 9.938   -41.345 14.319  1.00 0.00 ? 19 MET A C    4  
ATOM 1705  O O    . MET A 1 19 ? 9.549   -40.720 13.333  1.00 0.00 ? 19 MET A O    4  
ATOM 1706  C CB   . MET A 1 19 ? 10.466  -40.188 16.441  1.00 0.00 ? 19 MET A CB   4  
ATOM 1707  C CG   . MET A 1 19 ? 10.760  -38.847 15.787  1.00 0.00 ? 19 MET A CG   4  
ATOM 1708  S SD   . MET A 1 19 ? 11.993  -37.889 16.688  1.00 0.00 ? 19 MET A SD   4  
ATOM 1709  C CE   . MET A 1 19 ? 11.077  -37.463 18.167  1.00 0.00 ? 19 MET A CE   4  
ATOM 1710  H H    . MET A 1 19 ? 9.679   -42.447 17.273  1.00 0.00 ? 19 MET A H    4  
ATOM 1711  H HA   . MET A 1 19 ? 8.492   -40.447 15.624  1.00 0.00 ? 19 MET A HA   4  
ATOM 1712  H HB2  . MET A 1 19 ? 10.112  -40.004 17.456  1.00 0.00 ? 19 MET A HB2  4  
ATOM 1713  H HB3  . MET A 1 19 ? 11.392  -40.760 16.478  1.00 0.00 ? 19 MET A HB3  4  
ATOM 1714  H HG2  . MET A 1 19 ? 11.122  -39.020 14.774  1.00 0.00 ? 19 MET A HG2  4  
ATOM 1715  H HG3  . MET A 1 19 ? 9.836   -38.270 15.734  1.00 0.00 ? 19 MET A HG3  4  
ATOM 1716  H HE1  . MET A 1 19 ? 11.701  -36.867 18.833  1.00 0.00 ? 19 MET A HE1  4  
ATOM 1717  H HE2  . MET A 1 19 ? 10.192  -36.888 17.892  1.00 0.00 ? 19 MET A HE2  4  
ATOM 1718  H HE3  . MET A 1 19 ? 10.772  -38.375 18.680  1.00 0.00 ? 19 MET A HE3  4  
ATOM 1719  N N    . LYS A 1 20 ? 10.828  -42.330 14.254  1.00 0.00 ? 20 LYS A N    4  
ATOM 1720  C CA   . LYS A 1 20 ? 11.426  -42.759 12.993  1.00 0.00 ? 20 LYS A CA   4  
ATOM 1721  C C    . LYS A 1 20 ? 10.347  -43.185 12.010  1.00 0.00 ? 20 LYS A C    4  
ATOM 1722  O O    . LYS A 1 20 ? 10.408  -42.870 10.823  1.00 0.00 ? 20 LYS A O    4  
ATOM 1723  C CB   . LYS A 1 20 ? 12.367  -43.944 13.222  1.00 0.00 ? 20 LYS A CB   4  
ATOM 1724  C CG   . LYS A 1 20 ? 13.084  -44.418 11.968  1.00 0.00 ? 20 LYS A CG   4  
ATOM 1725  C CD   . LYS A 1 20 ? 14.042  -45.557 12.278  1.00 0.00 ? 20 LYS A CD   4  
ATOM 1726  C CE   . LYS A 1 20 ? 14.748  -46.041 11.022  1.00 0.00 ? 20 LYS A CE   4  
ATOM 1727  N NZ   . LYS A 1 20 ? 15.699  -47.150 11.311  1.00 0.00 ? 20 LYS A NZ   4  
ATOM 1728  H H    . LYS A 1 20 ? 11.107  -42.805 15.100  1.00 0.00 ? 20 LYS A H    4  
ATOM 1729  H HA   . LYS A 1 20 ? 11.990  -41.926 12.572  1.00 0.00 ? 20 LYS A HA   4  
ATOM 1730  H HB2  . LYS A 1 20 ? 13.117  -43.648 13.955  1.00 0.00 ? 20 LYS A HB2  4  
ATOM 1731  H HB3  . LYS A 1 20 ? 11.781  -44.774 13.617  1.00 0.00 ? 20 LYS A HB3  4  
ATOM 1732  H HG2  . LYS A 1 20 ? 12.344  -44.762 11.245  1.00 0.00 ? 20 LYS A HG2  4  
ATOM 1733  H HG3  . LYS A 1 20 ? 13.646  -43.586 11.544  1.00 0.00 ? 20 LYS A HG3  4  
ATOM 1734  H HD2  . LYS A 1 20 ? 14.787  -45.209 12.993  1.00 0.00 ? 20 LYS A HD2  4  
ATOM 1735  H HD3  . LYS A 1 20 ? 13.481  -46.384 12.712  1.00 0.00 ? 20 LYS A HD3  4  
ATOM 1736  H HE2  . LYS A 1 20 ? 14.001  -46.392 10.310  1.00 0.00 ? 20 LYS A HE2  4  
ATOM 1737  H HE3  . LYS A 1 20 ? 15.298  -45.208 10.583  1.00 0.00 ? 20 LYS A HE3  4  
ATOM 1738  H HZ1  . LYS A 1 20 ? 16.148  -47.445 10.456  1.00 0.00 ? 20 LYS A HZ1  4  
ATOM 1739  H HZ2  . LYS A 1 20 ? 16.399  -46.830 11.965  1.00 0.00 ? 20 LYS A HZ2  4  
ATOM 1740  H HZ3  . LYS A 1 20 ? 15.195  -47.928 11.711  1.00 0.00 ? 20 LYS A HZ3  4  
ATOM 1741  N N    . ALA A 1 21 ? 9.355   -43.908 12.523  1.00 0.00 ? 21 ALA A N    4  
ATOM 1742  C CA   . ALA A 1 21 ? 8.243   -44.394 11.711  1.00 0.00 ? 21 ALA A CA   4  
ATOM 1743  C C    . ALA A 1 21 ? 7.372   -43.236 11.253  1.00 0.00 ? 21 ALA A C    4  
ATOM 1744  O O    . ALA A 1 21 ? 6.929   -43.188 10.107  1.00 0.00 ? 21 ALA A O    4  
ATOM 1745  C CB   . ALA A 1 21 ? 7.381   -45.357 12.514  1.00 0.00 ? 21 ALA A CB   4  
ATOM 1746  H H    . ALA A 1 21 ? 9.361   -44.135 13.507  1.00 0.00 ? 21 ALA A H    4  
ATOM 1747  H HA   . ALA A 1 21 ? 8.645   -44.910 10.840  1.00 0.00 ? 21 ALA A HA   4  
ATOM 1748  H HB1  . ALA A 1 21 ? 6.562   -45.725 11.895  1.00 0.00 ? 21 ALA A HB1  4  
ATOM 1749  H HB2  . ALA A 1 21 ? 7.990   -46.198 12.845  1.00 0.00 ? 21 ALA A HB2  4  
ATOM 1750  H HB3  . ALA A 1 21 ? 6.972   -44.839 13.382  1.00 0.00 ? 21 ALA A HB3  4  
ATOM 1751  N N    . ILE A 1 22 ? 7.133   -42.300 12.168  1.00 0.00 ? 22 ILE A N    4  
ATOM 1752  C CA   . ILE A 1 22 ? 6.314   -41.125 11.885  1.00 0.00 ? 22 ILE A CA   4  
ATOM 1753  C C    . ILE A 1 22 ? 6.974   -40.260 10.823  1.00 0.00 ? 22 ILE A C    4  
ATOM 1754  O O    . ILE A 1 22 ? 6.342   -39.859 9.847   1.00 0.00 ? 22 ILE A O    4  
ATOM 1755  C CB   . ILE A 1 22 ? 6.114   -40.260 13.143  1.00 0.00 ? 22 ILE A CB   4  
ATOM 1756  C CG1  . ILE A 1 22 ? 5.260   -41.004 14.172  1.00 0.00 ? 22 ILE A CG1  4  
ATOM 1757  C CG2  . ILE A 1 22 ? 5.414   -38.957 12.788  1.00 0.00 ? 22 ILE A CG2  4  
ATOM 1758  C CD1  . ILE A 1 22 ? 5.218   -40.336 15.529  1.00 0.00 ? 22 ILE A CD1  4  
ATOM 1759  H H    . ILE A 1 22 ? 7.527   -42.395 13.093  1.00 0.00 ? 22 ILE A H    4  
ATOM 1760  H HA   . ILE A 1 22 ? 5.341   -41.461 11.525  1.00 0.00 ? 22 ILE A HA   4  
ATOM 1761  H HB   . ILE A 1 22 ? 7.088   -40.038 13.577  1.00 0.00 ? 22 ILE A HB   4  
ATOM 1762  H HG12 . ILE A 1 22 ? 4.241   -41.070 13.790  1.00 0.00 ? 22 ILE A HG12 4  
ATOM 1763  H HG13 . ILE A 1 22 ? 5.667   -42.007 14.296  1.00 0.00 ? 22 ILE A HG13 4  
ATOM 1764  H HG21 . ILE A 1 22 ? 5.287   -38.349 13.684  1.00 0.00 ? 22 ILE A HG21 4  
ATOM 1765  H HG22 . ILE A 1 22 ? 6.015   -38.409 12.062  1.00 0.00 ? 22 ILE A HG22 4  
ATOM 1766  H HG23 . ILE A 1 22 ? 4.436   -39.176 12.359  1.00 0.00 ? 22 ILE A HG23 4  
ATOM 1767  H HD11 . ILE A 1 22 ? 4.596   -40.907 16.218  1.00 0.00 ? 22 ILE A HD11 4  
ATOM 1768  H HD12 . ILE A 1 22 ? 6.229   -40.272 15.930  1.00 0.00 ? 22 ILE A HD12 4  
ATOM 1769  H HD13 . ILE A 1 22 ? 4.804   -39.333 15.424  1.00 0.00 ? 22 ILE A HD13 4  
ATOM 1770  N N    . GLY A 1 23 ? 8.257   -39.977 11.027  1.00 0.00 ? 23 GLY A N    4  
ATOM 1771  C CA   . GLY A 1 23 ? 9.033   -39.159 10.099  1.00 0.00 ? 23 GLY A CA   4  
ATOM 1772  C C    . GLY A 1 23 ? 9.198   -39.875 8.768   1.00 0.00 ? 23 GLY A C    4  
ATOM 1773  O O    . GLY A 1 23 ? 9.046   -39.280 7.702   1.00 0.00 ? 23 GLY A O    4  
ATOM 1774  H H    . GLY A 1 23 ? 8.720   -40.335 11.850  1.00 0.00 ? 23 GLY A H    4  
ATOM 1775  H HA2  . GLY A 1 23 ? 8.517   -38.212 9.937   1.00 0.00 ? 23 GLY A HA2  4  
ATOM 1776  H HA3  . GLY A 1 23 ? 10.016  -38.964 10.527  1.00 0.00 ? 23 GLY A HA3  4  
ATOM 1777  N N    . GLY A 1 24 ? 9.513   -41.165 8.845   1.00 0.00 ? 24 GLY A N    4  
ATOM 1778  C CA   . GLY A 1 24 ? 9.707   -41.992 7.658   1.00 0.00 ? 24 GLY A CA   4  
ATOM 1779  C C    . GLY A 1 24 ? 8.392   -42.180 6.919   1.00 0.00 ? 24 GLY A C    4  
ATOM 1780  O O    . GLY A 1 24 ? 8.287   -41.901 5.726   1.00 0.00 ? 24 GLY A O    4  
ATOM 1781  H H    . GLY A 1 24 ? 9.624   -41.597 9.751   1.00 0.00 ? 24 GLY A H    4  
ATOM 1782  H HA2  . GLY A 1 24 ? 10.425  -41.507 6.996   1.00 0.00 ? 24 GLY A HA2  4  
ATOM 1783  H HA3  . GLY A 1 24 ? 10.093  -42.966 7.958   1.00 0.00 ? 24 GLY A HA3  4  
ATOM 1784  N N    . TYR A 1 25 ? 7.387   -42.659 7.647   1.00 0.00 ? 25 TYR A N    4  
ATOM 1785  C CA   . TYR A 1 25 ? 6.061   -42.896 7.085   1.00 0.00 ? 25 TYR A CA   4  
ATOM 1786  C C    . TYR A 1 25 ? 5.514   -41.625 6.456   1.00 0.00 ? 25 TYR A C    4  
ATOM 1787  O O    . TYR A 1 25 ? 4.889   -41.657 5.397   1.00 0.00 ? 25 TYR A O    4  
ATOM 1788  C CB   . TYR A 1 25 ? 5.090   -43.352 8.176   1.00 0.00 ? 25 TYR A CB   4  
ATOM 1789  C CG   . TYR A 1 25 ? 3.685   -43.606 7.679   1.00 0.00 ? 25 TYR A CG   4  
ATOM 1790  C CD1  . TYR A 1 25 ? 3.373   -44.774 6.995   1.00 0.00 ? 25 TYR A CD1  4  
ATOM 1791  C CD2  . TYR A 1 25 ? 2.675   -42.678 7.895   1.00 0.00 ? 25 TYR A CD2  4  
ATOM 1792  C CE1  . TYR A 1 25 ? 2.092   -45.015 6.536   1.00 0.00 ? 25 TYR A CE1  4  
ATOM 1793  C CE2  . TYR A 1 25 ? 1.388   -42.902 7.444   1.00 0.00 ? 25 TYR A CE2  4  
ATOM 1794  C CZ   . TYR A 1 25 ? 1.103   -44.082 6.760   1.00 0.00 ? 25 TYR A CZ   4  
ATOM 1795  O OH   . TYR A 1 25 ? -0.174  -44.320 6.305   1.00 0.00 ? 25 TYR A OH   4  
ATOM 1796  H H    . TYR A 1 25 ? 7.536   -42.870 8.623   1.00 0.00 ? 25 TYR A H    4  
ATOM 1797  H HA   . TYR A 1 25 ? 6.137   -43.672 6.324   1.00 0.00 ? 25 TYR A HA   4  
ATOM 1798  H HB2  . TYR A 1 25 ? 5.472   -44.272 8.618   1.00 0.00 ? 25 TYR A HB2  4  
ATOM 1799  H HB3  . TYR A 1 25 ? 5.050   -42.583 8.948   1.00 0.00 ? 25 TYR A HB3  4  
ATOM 1800  H HD1  . TYR A 1 25 ? 4.145   -45.507 6.819   1.00 0.00 ? 25 TYR A HD1  4  
ATOM 1801  H HD2  . TYR A 1 25 ? 2.899   -41.764 8.425   1.00 0.00 ? 25 TYR A HD2  4  
ATOM 1802  H HE1  . TYR A 1 25 ? 1.867   -45.928 6.005   1.00 0.00 ? 25 TYR A HE1  4  
ATOM 1803  H HE2  . TYR A 1 25 ? 0.612   -42.171 7.620   1.00 0.00 ? 25 TYR A HE2  4  
ATOM 1804  H HH   . TYR A 1 25 ? -0.786  -43.609 6.513   1.00 0.00 ? 25 TYR A HH   4  
ATOM 1805  N N    . ILE A 1 26 ? 5.759   -40.501 7.124   1.00 0.00 ? 26 ILE A N    4  
ATOM 1806  C CA   . ILE A 1 26 ? 5.301   -39.197 6.652   1.00 0.00 ? 26 ILE A CA   4  
ATOM 1807  C C    . ILE A 1 26 ? 6.151   -38.728 5.482   1.00 0.00 ? 26 ILE A C    4  
ATOM 1808  O O    . ILE A 1 26 ? 5.635   -38.244 4.476   1.00 0.00 ? 26 ILE A O    4  
ATOM 1809  C CB   . ILE A 1 26 ? 5.391   -38.132 7.761   1.00 0.00 ? 26 ILE A CB   4  
ATOM 1810  C CG1  . ILE A 1 26 ? 4.400   -38.446 8.883   1.00 0.00 ? 26 ILE A CG1  4  
ATOM 1811  C CG2  . ILE A 1 26 ? 5.067   -36.754 7.203   1.00 0.00 ? 26 ILE A CG2  4  
ATOM 1812  C CD1  . ILE A 1 26 ? 4.590   -37.597 10.121  1.00 0.00 ? 26 ILE A CD1  4  
ATOM 1813  H H    . ILE A 1 26 ? 6.280   -40.539 7.989   1.00 0.00 ? 26 ILE A H    4  
ATOM 1814  H HA   . ILE A 1 26 ? 4.263   -39.291 6.331   1.00 0.00 ? 26 ILE A HA   4  
ATOM 1815  H HB   . ILE A 1 26 ? 6.403   -38.127 8.165   1.00 0.00 ? 26 ILE A HB   4  
ATOM 1816  H HG12 . ILE A 1 26 ? 3.390   -38.282 8.506   1.00 0.00 ? 26 ILE A HG12 4  
ATOM 1817  H HG13 . ILE A 1 26 ? 4.518   -39.492 9.163   1.00 0.00 ? 26 ILE A HG13 4  
ATOM 1818  H HG21 . ILE A 1 26 ? 5.143   -36.007 7.994   1.00 0.00 ? 26 ILE A HG21 4  
ATOM 1819  H HG22 . ILE A 1 26 ? 5.771   -36.510 6.408   1.00 0.00 ? 26 ILE A HG22 4  
ATOM 1820  H HG23 . ILE A 1 26 ? 4.053   -36.754 6.803   1.00 0.00 ? 26 ILE A HG23 4  
ATOM 1821  H HD11 . ILE A 1 26 ? 3.858   -37.863 10.884  1.00 0.00 ? 26 ILE A HD11 4  
ATOM 1822  H HD12 . ILE A 1 26 ? 5.592   -37.757 10.517  1.00 0.00 ? 26 ILE A HD12 4  
ATOM 1823  H HD13 . ILE A 1 26 ? 4.466   -36.546 9.859   1.00 0.00 ? 26 ILE A HD13 4  
ATOM 1824  N N    . VAL A 1 27 ? 7.463   -38.878 5.628   1.00 0.00 ? 27 VAL A N    4  
ATOM 1825  C CA   . VAL A 1 27 ? 8.415   -38.476 4.595   1.00 0.00 ? 27 VAL A CA   4  
ATOM 1826  C C    . VAL A 1 27 ? 8.401   -39.469 3.444   1.00 0.00 ? 27 VAL A C    4  
ATOM 1827  O O    . VAL A 1 27 ? 8.641   -39.111 2.292   1.00 0.00 ? 27 VAL A O    4  
ATOM 1828  C CB   . VAL A 1 27 ? 9.851   -38.410 5.146   1.00 0.00 ? 27 VAL A CB   4  
ATOM 1829  C CG1  . VAL A 1 27 ? 10.844  -38.169 4.019   1.00 0.00 ? 27 VAL A CG1  4  
ATOM 1830  C CG2  . VAL A 1 27 ? 9.984   -37.277 6.153   1.00 0.00 ? 27 VAL A CG2  4  
ATOM 1831  H H    . VAL A 1 27 ? 7.825   -39.283 6.479   1.00 0.00 ? 27 VAL A H    4  
ATOM 1832  H HA   . VAL A 1 27 ? 8.128   -37.491 4.227   1.00 0.00 ? 27 VAL A HA   4  
ATOM 1833  H HB   . VAL A 1 27 ? 10.084  -39.355 5.635   1.00 0.00 ? 27 VAL A HB   4  
ATOM 1834  H HG11 . VAL A 1 27 ? 11.856  -38.132 4.420   1.00 0.00 ? 27 VAL A HG11 4  
ATOM 1835  H HG12 . VAL A 1 27 ? 10.771  -38.978 3.293   1.00 0.00 ? 27 VAL A HG12 4  
ATOM 1836  H HG13 . VAL A 1 27 ? 10.614  -37.221 3.531   1.00 0.00 ? 27 VAL A HG13 4  
ATOM 1837  H HG21 . VAL A 1 27 ? 11.001  -37.245 6.542   1.00 0.00 ? 27 VAL A HG21 4  
ATOM 1838  H HG22 . VAL A 1 27 ? 9.754   -36.329 5.665   1.00 0.00 ? 27 VAL A HG22 4  
ATOM 1839  H HG23 . VAL A 1 27 ? 9.287   -37.439 6.976   1.00 0.00 ? 27 VAL A HG23 4  
ATOM 1840  N N    . GLY A 1 28 ? 8.116   -40.726 3.772   1.00 0.00 ? 28 GLY A N    4  
ATOM 1841  C CA   . GLY A 1 28 ? 8.065   -41.798 2.783   1.00 0.00 ? 28 GLY A CA   4  
ATOM 1842  C C    . GLY A 1 28 ? 6.794   -41.697 1.955   1.00 0.00 ? 28 GLY A C    4  
ATOM 1843  O O    . GLY A 1 28 ? 6.727   -42.187 0.829   1.00 0.00 ? 28 GLY A O    4  
ATOM 1844  H H    . GLY A 1 28 ? 7.926   -40.957 4.737   1.00 0.00 ? 28 GLY A H    4  
ATOM 1845  H HA2  . GLY A 1 28 ? 8.930   -41.721 2.125   1.00 0.00 ? 28 GLY A HA2  4  
ATOM 1846  H HA3  . GLY A 1 28 ? 8.085   -42.760 3.294   1.00 0.00 ? 28 GLY A HA3  4  
ATOM 1847  N N    . ALA A 1 29 ? 5.782   -41.053 2.531   1.00 0.00 ? 29 ALA A N    4  
ATOM 1848  C CA   . ALA A 1 29 ? 4.495   -40.871 1.869   1.00 0.00 ? 29 ALA A CA   4  
ATOM 1849  C C    . ALA A 1 29 ? 4.529   -39.649 0.964   1.00 0.00 ? 29 ALA A C    4  
ATOM 1850  O O    . ALA A 1 29 ? 3.885   -39.614 -0.083  1.00 0.00 ? 29 ALA A O    4  
ATOM 1851  C CB   . ALA A 1 29 ? 3.392   -40.678 2.898   1.00 0.00 ? 29 ALA A CB   4  
ATOM 1852  H H    . ALA A 1 29 ? 5.898   -40.673 3.460   1.00 0.00 ? 29 ALA A H    4  
ATOM 1853  H HA   . ALA A 1 29 ? 4.280   -41.757 1.272   1.00 0.00 ? 29 ALA A HA   4  
ATOM 1854  H HB1  . ALA A 1 29 ? 2.432   -40.558 2.394   1.00 0.00 ? 29 ALA A HB1  4  
ATOM 1855  H HB2  . ALA A 1 29 ? 3.349   -41.549 3.552   1.00 0.00 ? 29 ALA A HB2  4  
ATOM 1856  H HB3  . ALA A 1 29 ? 3.602   -39.788 3.492   1.00 0.00 ? 29 ALA A HB3  4  
ATOM 1857  N N    . LEU A 1 30 ? 5.293   -38.645 1.385   1.00 0.00 ? 30 LEU A N    4  
ATOM 1858  C CA   . LEU A 1 30 ? 5.432   -37.402 0.630   1.00 0.00 ? 30 LEU A CA   4  
ATOM 1859  C C    . LEU A 1 30 ? 5.897   -37.691 -0.788  1.00 0.00 ? 30 LEU A C    4  
ATOM 1860  O O    . LEU A 1 30 ? 5.567   -36.966 -1.725  1.00 0.00 ? 30 LEU A O    4  
ATOM 1861  C CB   . LEU A 1 30 ? 6.456   -36.482 1.297   1.00 0.00 ? 30 LEU A CB   4  
ATOM 1862  C CG   . LEU A 1 30 ? 6.039   -35.857 2.631   1.00 0.00 ? 30 LEU A CG   4  
ATOM 1863  C CD1  . LEU A 1 30 ? 7.191   -35.074 3.241   1.00 0.00 ? 30 LEU A CD1  4  
ATOM 1864  C CD2  . LEU A 1 30 ? 4.868   -34.907 2.436   1.00 0.00 ? 30 LEU A CD2  4  
ATOM 1865  H H    . LEU A 1 30 ? 5.798   -38.734 2.255   1.00 0.00 ? 30 LEU A H    4  
ATOM 1866  H HA   . LEU A 1 30 ? 4.464   -36.901 0.599   1.00 0.00 ? 30 LEU A HA   4  
ATOM 1867  H HB2  . LEU A 1 30 ? 7.361   -37.063 1.471   1.00 0.00 ? 30 LEU A HB2  4  
ATOM 1868  H HB3  . LEU A 1 30 ? 6.673   -35.669 0.603   1.00 0.00 ? 30 LEU A HB3  4  
ATOM 1869  H HG   . LEU A 1 30 ? 5.744   -36.653 3.315   1.00 0.00 ? 30 LEU A HG   4  
ATOM 1870  H HD11 . LEU A 1 30 ? 6.884   -34.643 4.194   1.00 0.00 ? 30 LEU A HD11 4  
ATOM 1871  H HD12 . LEU A 1 30 ? 8.037   -35.742 3.403   1.00 0.00 ? 30 LEU A HD12 4  
ATOM 1872  H HD13 . LEU A 1 30 ? 7.484   -34.273 2.562   1.00 0.00 ? 30 LEU A HD13 4  
ATOM 1873  H HD21 . LEU A 1 30 ? 4.573   -34.478 3.394   1.00 0.00 ? 30 LEU A HD21 4  
ATOM 1874  H HD22 . LEU A 1 30 ? 5.160   -34.106 1.757   1.00 0.00 ? 30 LEU A HD22 4  
ATOM 1875  H HD23 . LEU A 1 30 ? 4.025   -35.453 2.012   1.00 0.00 ? 30 LEU A HD23 4  
ATOM 1876  N N    . VAL A 1 31 ? 6.671   -38.762 -0.933  1.00 0.00 ? 31 VAL A N    4  
ATOM 1877  C CA   . VAL A 1 31 ? 7.199   -39.174 -2.231  1.00 0.00 ? 31 VAL A CA   4  
ATOM 1878  C C    . VAL A 1 31 ? 6.070   -39.350 -3.233  1.00 0.00 ? 31 VAL A C    4  
ATOM 1879  O O    . VAL A 1 31 ? 6.222   -39.062 -4.419  1.00 0.00 ? 31 VAL A O    4  
ATOM 1880  C CB   . VAL A 1 31 ? 7.958   -40.510 -2.133  1.00 0.00 ? 31 VAL A CB   4  
ATOM 1881  C CG1  . VAL A 1 31 ? 8.299   -41.032 -3.521  1.00 0.00 ? 31 VAL A CG1  4  
ATOM 1882  C CG2  . VAL A 1 31 ? 9.253   -40.332 -1.356  1.00 0.00 ? 31 VAL A CG2  4  
ATOM 1883  H H    . VAL A 1 31 ? 6.908   -39.317 -0.124  1.00 0.00 ? 31 VAL A H    4  
ATOM 1884  H HA   . VAL A 1 31 ? 7.880   -38.401 -2.586  1.00 0.00 ? 31 VAL A HA   4  
ATOM 1885  H HB   . VAL A 1 31 ? 7.327   -41.236 -1.620  1.00 0.00 ? 31 VAL A HB   4  
ATOM 1886  H HG11 . VAL A 1 31 ? 8.827   -41.981 -3.439  1.00 0.00 ? 31 VAL A HG11 4  
ATOM 1887  H HG12 . VAL A 1 31 ? 7.380   -41.177 -4.089  1.00 0.00 ? 31 VAL A HG12 4  
ATOM 1888  H HG13 . VAL A 1 31 ? 8.932   -40.308 -4.034  1.00 0.00 ? 31 VAL A HG13 4  
ATOM 1889  H HG21 . VAL A 1 31 ? 9.776   -41.285 -1.286  1.00 0.00 ? 31 VAL A HG21 4  
ATOM 1890  H HG22 . VAL A 1 31 ? 9.886   -39.608 -1.869  1.00 0.00 ? 31 VAL A HG22 4  
ATOM 1891  H HG23 . VAL A 1 31 ? 9.026   -39.969 -0.353  1.00 0.00 ? 31 VAL A HG23 4  
ATOM 1892  N N    . ILE A 1 32 ? 4.932   -39.827 -2.739  1.00 0.00 ? 32 ILE A N    4  
ATOM 1893  C CA   . ILE A 1 32 ? 3.753   -40.053 -3.572  1.00 0.00 ? 32 ILE A CA   4  
ATOM 1894  C C    . ILE A 1 32 ? 3.221   -38.735 -4.110  1.00 0.00 ? 32 ILE A C    4  
ATOM 1895  O O    . ILE A 1 32 ? 2.847   -38.628 -5.277  1.00 0.00 ? 32 ILE A O    4  
ATOM 1896  C CB   . ILE A 1 32 ? 2.622   -40.731 -2.777  1.00 0.00 ? 32 ILE A CB   4  
ATOM 1897  C CG1  . ILE A 1 32 ? 3.025   -42.153 -2.383  1.00 0.00 ? 32 ILE A CG1  4  
ATOM 1898  C CG2  . ILE A 1 32 ? 1.353   -40.804 -3.613  1.00 0.00 ? 32 ILE A CG2  4  
ATOM 1899  C CD1  . ILE A 1 32 ? 2.082   -42.804 -1.395  1.00 0.00 ? 32 ILE A CD1  4  
ATOM 1900  H H    . ILE A 1 32 ? 4.868   -40.043 -1.754  1.00 0.00 ? 32 ILE A H    4  
ATOM 1901  H HA   . ILE A 1 32 ? 4.038   -40.695 -4.405  1.00 0.00 ? 32 ILE A HA   4  
ATOM 1902  H HB   . ILE A 1 32 ? 2.426   -40.149 -1.876  1.00 0.00 ? 32 ILE A HB   4  
ATOM 1903  H HG12 . ILE A 1 32 ? 3.053   -42.764 -3.285  1.00 0.00 ? 32 ILE A HG12 4  
ATOM 1904  H HG13 . ILE A 1 32 ? 4.018   -42.117 -1.936  1.00 0.00 ? 32 ILE A HG13 4  
ATOM 1905  H HG21 . ILE A 1 32 ? 0.557   -41.276 -3.037  1.00 0.00 ? 32 ILE A HG21 4  
ATOM 1906  H HG22 . ILE A 1 32 ? 1.046   -39.796 -3.894  1.00 0.00 ? 32 ILE A HG22 4  
ATOM 1907  H HG23 . ILE A 1 32 ? 1.544   -41.389 -4.512  1.00 0.00 ? 32 ILE A HG23 4  
ATOM 1908  H HD11 . ILE A 1 32 ? 2.417   -43.812 -1.153  1.00 0.00 ? 32 ILE A HD11 4  
ATOM 1909  H HD12 . ILE A 1 32 ? 2.050   -42.209 -0.482  1.00 0.00 ? 32 ILE A HD12 4  
ATOM 1910  H HD13 . ILE A 1 32 ? 1.083   -42.854 -1.830  1.00 0.00 ? 32 ILE A HD13 4  
ATOM 1911  N N    . LEU A 1 33 ? 3.193   -37.729 -3.240  1.00 0.00 ? 33 LEU A N    4  
ATOM 1912  C CA   . LEU A 1 33 ? 2.709   -36.399 -3.601  1.00 0.00 ? 33 LEU A CA   4  
ATOM 1913  C C    . LEU A 1 33 ? 3.578   -35.796 -4.692  1.00 0.00 ? 33 LEU A C    4  
ATOM 1914  O O    . LEU A 1 33 ? 3.079   -35.282 -5.692  1.00 0.00 ? 33 LEU A O    4  
ATOM 1915  C CB   . LEU A 1 33 ? 2.742   -35.469 -2.387  1.00 0.00 ? 33 LEU A CB   4  
ATOM 1916  C CG   . LEU A 1 33 ? 1.700   -35.738 -1.299  1.00 0.00 ? 33 LEU A CG   4  
ATOM 1917  C CD1  . LEU A 1 33 ? 1.926   -34.828 -0.101  1.00 0.00 ? 33 LEU A CD1  4  
ATOM 1918  C CD2  . LEU A 1 33 ? 0.295   -35.488 -1.826  1.00 0.00 ? 33 LEU A CD2  4  
ATOM 1919  H H    . LEU A 1 33 ? 3.515   -37.878 -2.294  1.00 0.00 ? 33 LEU A H    4  
ATOM 1920  H HA   . LEU A 1 33 ? 1.683   -36.485 -3.961  1.00 0.00 ? 33 LEU A HA   4  
ATOM 1921  H HB2  . LEU A 1 33 ? 3.728   -35.553 -1.931  1.00 0.00 ? 33 LEU A HB2  4  
ATOM 1922  H HB3  . LEU A 1 33 ? 2.593   -34.450 -2.745  1.00 0.00 ? 33 LEU A HB3  4  
ATOM 1923  H HG   . LEU A 1 33 ? 1.784   -36.777 -0.982  1.00 0.00 ? 33 LEU A HG   4  
ATOM 1924  H HD11 . LEU A 1 33 ? 1.184   -35.036 0.670   1.00 0.00 ? 33 LEU A HD11 4  
ATOM 1925  H HD12 . LEU A 1 33 ? 2.923   -35.001 0.302   1.00 0.00 ? 33 LEU A HD12 4  
ATOM 1926  H HD13 . LEU A 1 33 ? 1.837   -33.787 -0.414  1.00 0.00 ? 33 LEU A HD13 4  
ATOM 1927  H HD21 . LEU A 1 33 ? -0.438  -35.693 -1.045  1.00 0.00 ? 33 LEU A HD21 4  
ATOM 1928  H HD22 . LEU A 1 33 ? 0.205   -34.447 -2.139  1.00 0.00 ? 33 LEU A HD22 4  
ATOM 1929  H HD23 . LEU A 1 33 ? 0.106   -36.141 -2.678  1.00 0.00 ? 33 LEU A HD23 4  
ATOM 1930  N N    . ALA A 1 34 ? 4.890   -35.865 -4.486  1.00 0.00 ? 34 ALA A N    4  
ATOM 1931  C CA   . ALA A 1 34 ? 5.858   -35.330 -5.440  1.00 0.00 ? 34 ALA A CA   4  
ATOM 1932  C C    . ALA A 1 34 ? 5.696   -36.000 -6.795  1.00 0.00 ? 34 ALA A C    4  
ATOM 1933  O O    . ALA A 1 34 ? 5.767   -35.351 -7.838  1.00 0.00 ? 34 ALA A O    4  
ATOM 1934  C CB   . ALA A 1 34 ? 7.277   -35.573 -4.949  1.00 0.00 ? 34 ALA A CB   4  
ATOM 1935  H H    . ALA A 1 34 ? 5.239   -36.299 -3.644  1.00 0.00 ? 34 ALA A H    4  
ATOM 1936  H HA   . ALA A 1 34 ? 5.690   -34.258 -5.544  1.00 0.00 ? 34 ALA A HA   4  
ATOM 1937  H HB1  . ALA A 1 34 ? 7.990   -35.157 -5.660  1.00 0.00 ? 34 ALA A HB1  4  
ATOM 1938  H HB2  . ALA A 1 34 ? 7.412   -35.093 -3.980  1.00 0.00 ? 34 ALA A HB2  4  
ATOM 1939  H HB3  . ALA A 1 34 ? 7.447   -36.645 -4.850  1.00 0.00 ? 34 ALA A HB3  4  
ATOM 1940  N N    . VAL A 1 35 ? 5.476   -37.311 -6.766  1.00 0.00 ? 35 VAL A N    4  
ATOM 1941  C CA   . VAL A 1 35 ? 5.298   -38.099 -7.982  1.00 0.00 ? 35 VAL A CA   4  
ATOM 1942  C C    . VAL A 1 35 ? 4.167   -37.533 -8.823  1.00 0.00 ? 35 VAL A C    4  
ATOM 1943  O O    . VAL A 1 35 ? 4.278   -37.413 -10.042 1.00 0.00 ? 35 VAL A O    4  
ATOM 1944  C CB   . VAL A 1 35 ? 4.959   -39.566 -7.659  1.00 0.00 ? 35 VAL A CB   4  
ATOM 1945  C CG1  . VAL A 1 35 ? 4.574   -40.315 -8.926  1.00 0.00 ? 35 VAL A CG1  4  
ATOM 1946  C CG2  . VAL A 1 35 ? 6.156   -40.264 -7.033  1.00 0.00 ? 35 VAL A CG2  4  
ATOM 1947  H H    . VAL A 1 35 ? 5.428   -37.788 -5.877  1.00 0.00 ? 35 VAL A H    4  
ATOM 1948  H HA   . VAL A 1 35 ? 6.225   -38.064 -8.553  1.00 0.00 ? 35 VAL A HA   4  
ATOM 1949  H HB   . VAL A 1 35 ? 4.123   -39.588 -6.960  1.00 0.00 ? 35 VAL A HB   4  
ATOM 1950  H HG11 . VAL A 1 35 ? 4.328   -41.348 -8.684  1.00 0.00 ? 35 VAL A HG11 4  
ATOM 1951  H HG12 . VAL A 1 35 ? 3.708   -39.834 -9.382  1.00 0.00 ? 35 VAL A HG12 4  
ATOM 1952  H HG13 . VAL A 1 35 ? 5.409   -40.296 -9.626  1.00 0.00 ? 35 VAL A HG13 4  
ATOM 1953  H HG21 . VAL A 1 35 ? 5.901   -41.298 -6.801  1.00 0.00 ? 35 VAL A HG21 4  
ATOM 1954  H HG22 . VAL A 1 35 ? 6.992   -40.245 -7.732  1.00 0.00 ? 35 VAL A HG22 4  
ATOM 1955  H HG23 . VAL A 1 35 ? 6.438   -39.746 -6.116  1.00 0.00 ? 35 VAL A HG23 4  
ATOM 1956  N N    . ALA A 1 36 ? 3.072   -37.185 -8.153  1.00 0.00 ? 36 ALA A N    4  
ATOM 1957  C CA   . ALA A 1 36 ? 1.897   -36.625 -8.815  1.00 0.00 ? 36 ALA A CA   4  
ATOM 1958  C C    . ALA A 1 36 ? 2.225   -35.274 -9.429  1.00 0.00 ? 36 ALA A C    4  
ATOM 1959  O O    . ALA A 1 36 ? 1.880   -34.997 -10.577 1.00 0.00 ? 36 ALA A O    4  
ATOM 1960  C CB   . ALA A 1 36 ? 0.765   -36.438 -7.817  1.00 0.00 ? 36 ALA A CB   4  
ATOM 1961  H H    . ALA A 1 36 ? 3.041   -37.308 -7.151  1.00 0.00 ? 36 ALA A H    4  
ATOM 1962  H HA   . ALA A 1 36 ? 1.577   -37.310 -9.599  1.00 0.00 ? 36 ALA A HA   4  
ATOM 1963  H HB1  . ALA A 1 36 ? -0.112  -36.033 -8.324  1.00 0.00 ? 36 ALA A HB1  4  
ATOM 1964  H HB2  . ALA A 1 36 ? 0.512   -37.400 -7.371  1.00 0.00 ? 36 ALA A HB2  4  
ATOM 1965  H HB3  . ALA A 1 36 ? 1.081   -35.747 -7.035  1.00 0.00 ? 36 ALA A HB3  4  
ATOM 1966  N N    . GLY A 1 37 ? 2.898   -34.435 -8.647  1.00 0.00 ? 37 GLY A N    4  
ATOM 1967  C CA   . GLY A 1 37 ? 3.288   -33.100 -9.088  1.00 0.00 ? 37 GLY A CA   4  
ATOM 1968  C C    . GLY A 1 37 ? 3.967   -33.166 -10.447 1.00 0.00 ? 37 GLY A C    4  
ATOM 1969  O O    . GLY A 1 37 ? 3.505   -32.570 -11.419 1.00 0.00 ? 37 GLY A O    4  
ATOM 1970  H H    . GLY A 1 37 ? 3.153   -34.721 -7.713  1.00 0.00 ? 37 GLY A H    4  
ATOM 1971  H HA2  . GLY A 1 37 ? 2.400   -32.471 -9.160  1.00 0.00 ? 37 GLY A HA2  4  
ATOM 1972  H HA3  . GLY A 1 37 ? 3.977   -32.668 -8.362  1.00 0.00 ? 37 GLY A HA3  4  
ATOM 1973  N N    . LEU A 1 38 ? 5.073   -33.901 -10.501 1.00 0.00 ? 38 LEU A N    4  
ATOM 1974  C CA   . LEU A 1 38 ? 5.842   -34.066 -11.732 1.00 0.00 ? 38 LEU A CA   4  
ATOM 1975  C C    . LEU A 1 38 ? 4.987   -34.708 -12.811 1.00 0.00 ? 38 LEU A C    4  
ATOM 1976  O O    . LEU A 1 38 ? 5.059   -34.341 -13.982 1.00 0.00 ? 38 LEU A O    4  
ATOM 1977  C CB   . LEU A 1 38 ? 7.061   -34.957 -11.487 1.00 0.00 ? 38 LEU A CB   4  
ATOM 1978  C CG   . LEU A 1 38 ? 8.186   -34.351 -10.646 1.00 0.00 ? 38 LEU A CG   4  
ATOM 1979  C CD1  . LEU A 1 38 ? 9.271   -35.382 -10.375 1.00 0.00 ? 38 LEU A CD1  4  
ATOM 1980  C CD2  . LEU A 1 38 ? 8.821   -33.172 -11.367 1.00 0.00 ? 38 LEU A CD2  4  
ATOM 1981  H H    . LEU A 1 38 ? 5.402   -34.366 -9.667  1.00 0.00 ? 38 LEU A H    4  
ATOM 1982  H HA   . LEU A 1 38 ? 6.175   -33.084 -12.070 1.00 0.00 ? 38 LEU A HA   4  
ATOM 1983  H HB2  . LEU A 1 38 ? 6.716   -35.858 -10.981 1.00 0.00 ? 38 LEU A HB2  4  
ATOM 1984  H HB3  . LEU A 1 38 ? 7.478   -35.222 -12.458 1.00 0.00 ? 38 LEU A HB3  4  
ATOM 1985  H HG   . LEU A 1 38 ? 7.769   -34.010 -9.698  1.00 0.00 ? 38 LEU A HG   4  
ATOM 1986  H HD11 . LEU A 1 38 ? 10.060  -34.940 -9.767  1.00 0.00 ? 38 LEU A HD11 4  
ATOM 1987  H HD12 . LEU A 1 38 ? 8.839   -36.230 -9.844  1.00 0.00 ? 38 LEU A HD12 4  
ATOM 1988  H HD13 . LEU A 1 38 ? 9.692   -35.721 -11.321 1.00 0.00 ? 38 LEU A HD13 4  
ATOM 1989  H HD21 . LEU A 1 38 ? 9.612   -32.742 -10.753 1.00 0.00 ? 38 LEU A HD21 4  
ATOM 1990  H HD22 . LEU A 1 38 ? 9.243   -33.510 -12.313 1.00 0.00 ? 38 LEU A HD22 4  
ATOM 1991  H HD23 . LEU A 1 38 ? 8.061   -32.413 -11.558 1.00 0.00 ? 38 LEU A HD23 4  
ATOM 1992  N N    . ILE A 1 39 ? 4.174   -35.677 -12.400 1.00 0.00 ? 39 ILE A N    4  
ATOM 1993  C CA   . ILE A 1 39 ? 3.288   -36.392 -13.313 1.00 0.00 ? 39 ILE A CA   4  
ATOM 1994  C C    . ILE A 1 39 ? 2.345   -35.425 -14.008 1.00 0.00 ? 39 ILE A C    4  
ATOM 1995  O O    . ILE A 1 39 ? 2.126   -35.507 -15.216 1.00 0.00 ? 39 ILE A O    4  
ATOM 1996  C CB   . ILE A 1 39 ? 2.432   -37.434 -12.569 1.00 0.00 ? 39 ILE A CB   4  
ATOM 1997  C CG1  . ILE A 1 39 ? 3.314   -38.563 -12.033 1.00 0.00 ? 39 ILE A CG1  4  
ATOM 1998  C CG2  . ILE A 1 39 ? 1.394   -38.035 -13.503 1.00 0.00 ? 39 ILE A CG2  4  
ATOM 1999  C CD1  . ILE A 1 39 ? 4.059   -39.321 -13.110 1.00 0.00 ? 39 ILE A CD1  4  
ATOM 2000  H H    . ILE A 1 39 ? 4.160   -35.934 -11.423 1.00 0.00 ? 39 ILE A H    4  
ATOM 2001  H HA   . ILE A 1 39 ? 3.899   -36.899 -14.059 1.00 0.00 ? 39 ILE A HA   4  
ATOM 2002  H HB   . ILE A 1 39 ? 1.926   -36.945 -11.736 1.00 0.00 ? 39 ILE A HB   4  
ATOM 2003  H HG12 . ILE A 1 39 ? 4.044   -38.132 -11.348 1.00 0.00 ? 39 ILE A HG12 4  
ATOM 2004  H HG13 . ILE A 1 39 ? 2.680   -39.267 -11.493 1.00 0.00 ? 39 ILE A HG13 4  
ATOM 2005  H HG21 . ILE A 1 39 ? 0.788   -38.763 -12.963 1.00 0.00 ? 39 ILE A HG21 4  
ATOM 2006  H HG22 . ILE A 1 39 ? 0.750   -37.243 -13.886 1.00 0.00 ? 39 ILE A HG22 4  
ATOM 2007  H HG23 . ILE A 1 39 ? 1.897   -38.528 -14.334 1.00 0.00 ? 39 ILE A HG23 4  
ATOM 2008  H HD11 . ILE A 1 39 ? 4.669   -40.109 -12.670 1.00 0.00 ? 39 ILE A HD11 4  
ATOM 2009  H HD12 . ILE A 1 39 ? 3.341   -39.767 -13.798 1.00 0.00 ? 39 ILE A HD12 4  
ATOM 2010  H HD13 . ILE A 1 39 ? 4.704   -38.631 -13.654 1.00 0.00 ? 39 ILE A HD13 4  
ATOM 2011  N N    . TYR A 1 40 ? 1.787   -34.505 -13.226 1.00 0.00 ? 40 TYR A N    4  
ATOM 2012  C CA   . TYR A 1 40 ? 0.858   -33.502 -13.741 1.00 0.00 ? 40 TYR A CA   4  
ATOM 2013  C C    . TYR A 1 40 ? 1.584   -32.517 -14.642 1.00 0.00 ? 40 TYR A C    4  
ATOM 2014  O O    . TYR A 1 40 ? 1.080   -32.127 -15.694 1.00 0.00 ? 40 TYR A O    4  
ATOM 2015  C CB   . TYR A 1 40 ? 0.218   -32.723 -12.590 1.00 0.00 ? 40 TYR A CB   4  
ATOM 2016  C CG   . TYR A 1 40 ? -0.780  -31.679 -13.037 1.00 0.00 ? 40 TYR A CG   4  
ATOM 2017  C CD1  . TYR A 1 40 ? -2.063  -32.043 -13.428 1.00 0.00 ? 40 TYR A CD1  4  
ATOM 2018  C CD2  . TYR A 1 40 ? -0.437  -30.334 -13.067 1.00 0.00 ? 40 TYR A CD2  4  
ATOM 2019  C CE1  . TYR A 1 40 ? -2.981  -31.095 -13.838 1.00 0.00 ? 40 TYR A CE1  4  
ATOM 2020  C CE2  . TYR A 1 40 ? -1.342  -29.372 -13.474 1.00 0.00 ? 40 TYR A CE2  4  
ATOM 2021  C CZ   . TYR A 1 40 ? -2.623  -29.765 -13.861 1.00 0.00 ? 40 TYR A CZ   4  
ATOM 2022  O OH   . TYR A 1 40 ? -3.536  -28.819 -14.269 1.00 0.00 ? 40 TYR A OH   4  
ATOM 2023  H H    . TYR A 1 40 ? 2.005   -34.491 -12.240 1.00 0.00 ? 40 TYR A H    4  
ATOM 2024  H HA   . TYR A 1 40 ? 0.078   -34.007 -14.311 1.00 0.00 ? 40 TYR A HA   4  
ATOM 2025  H HB2  . TYR A 1 40 ? -0.291  -33.429 -11.934 1.00 0.00 ? 40 TYR A HB2  4  
ATOM 2026  H HB3  . TYR A 1 40 ? 1.007   -32.227 -12.025 1.00 0.00 ? 40 TYR A HB3  4  
ATOM 2027  H HD1  . TYR A 1 40 ? -2.348  -33.084 -13.411 1.00 0.00 ? 40 TYR A HD1  4  
ATOM 2028  H HD2  . TYR A 1 40 ? 0.555   -30.033 -12.766 1.00 0.00 ? 40 TYR A HD2  4  
ATOM 2029  H HE1  . TYR A 1 40 ? -3.974  -31.395 -14.139 1.00 0.00 ? 40 TYR A HE1  4  
ATOM 2030  H HE2  . TYR A 1 40 ? -1.061  -28.329 -13.492 1.00 0.00 ? 40 TYR A HE2  4  
ATOM 2031  H HH   . TYR A 1 40 ? -3.187  -27.925 -14.248 1.00 0.00 ? 40 TYR A HH   4  
ATOM 2032  N N    . SER A 1 41 ? 2.779   -32.118 -14.214 1.00 0.00 ? 41 SER A N    4  
ATOM 2033  C CA   . SER A 1 41 ? 3.601   -31.175 -14.965 1.00 0.00 ? 41 SER A CA   4  
ATOM 2034  C C    . SER A 1 41 ? 3.924   -31.729 -16.343 1.00 0.00 ? 41 SER A C    4  
ATOM 2035  O O    . SER A 1 41 ? 3.747   -31.056 -17.357 1.00 0.00 ? 41 SER A O    4  
ATOM 2036  C CB   . SER A 1 41 ? 4.917   -30.908 -14.231 1.00 0.00 ? 41 SER A CB   4  
ATOM 2037  O OG   . SER A 1 41 ? 4.689   -30.240 -13.002 1.00 0.00 ? 41 SER A OG   4  
ATOM 2038  H H    . SER A 1 41 ? 3.139   -32.474 -13.340 1.00 0.00 ? 41 SER A H    4  
ATOM 2039  H HA   . SER A 1 41 ? 3.051   -30.239 -15.071 1.00 0.00 ? 41 SER A HA   4  
ATOM 2040  H HB2  . SER A 1 41 ? 5.413   -31.857 -14.033 1.00 0.00 ? 41 SER A HB2  4  
ATOM 2041  H HB3  . SER A 1 41 ? 5.556   -30.287 -14.859 1.00 0.00 ? 41 SER A HB3  4  
ATOM 2042  H HG   . SER A 1 41 ? 5.532   -30.088 -12.569 1.00 0.00 ? 41 SER A HG   4  
ATOM 2043  N N    . MET A 1 42 ? 4.403   -32.970 -16.365 1.00 0.00 ? 42 MET A N    4  
ATOM 2044  C CA   . MET A 1 42 ? 4.761   -33.645 -17.609 1.00 0.00 ? 42 MET A CA   4  
ATOM 2045  C C    . MET A 1 42 ? 3.533   -33.842 -18.482 1.00 0.00 ? 42 MET A C    4  
ATOM 2046  O O    . MET A 1 42 ? 3.581   -33.661 -19.698 1.00 0.00 ? 42 MET A O    4  
ATOM 2047  C CB   . MET A 1 42 ? 5.371   -35.017 -17.318 1.00 0.00 ? 42 MET A CB   4  
ATOM 2048  C CG   . MET A 1 42 ? 5.852   -35.758 -18.555 1.00 0.00 ? 42 MET A CG   4  
ATOM 2049  S SD   . MET A 1 42 ? 6.592   -37.356 -18.165 1.00 0.00 ? 42 MET A SD   4  
ATOM 2050  C CE   . MET A 1 42 ? 5.145   -38.287 -17.668 1.00 0.00 ? 42 MET A CE   4  
ATOM 2051  H H    . MET A 1 42 ? 4.528   -33.470 -15.497 1.00 0.00 ? 42 MET A H    4  
ATOM 2052  H HA   . MET A 1 42 ? 5.488   -33.033 -18.142 1.00 0.00 ? 42 MET A HA   4  
ATOM 2053  H HB2  . MET A 1 42 ? 6.220   -34.879 -16.649 1.00 0.00 ? 42 MET A HB2  4  
ATOM 2054  H HB3  . MET A 1 42 ? 4.616   -35.629 -16.825 1.00 0.00 ? 42 MET A HB3  4  
ATOM 2055  H HG2  . MET A 1 42 ? 5.005   -35.916 -19.222 1.00 0.00 ? 42 MET A HG2  4  
ATOM 2056  H HG3  . MET A 1 42 ? 6.591   -35.144 -19.069 1.00 0.00 ? 42 MET A HG3  4  
ATOM 2057  H HE1  . MET A 1 42 ? 5.431   -39.302 -17.394 1.00 0.00 ? 42 MET A HE1  4  
ATOM 2058  H HE2  . MET A 1 42 ? 4.678   -37.800 -16.811 1.00 0.00 ? 42 MET A HE2  4  
ATOM 2059  H HE3  . MET A 1 42 ? 4.436   -38.323 -18.495 1.00 0.00 ? 42 MET A HE3  4  
ATOM 2060  N N    . LEU A 1 43 ? 2.428   -34.216 -17.843 1.00 0.00 ? 43 LEU A N    4  
ATOM 2061  C CA   . LEU A 1 43 ? 1.165   -34.446 -18.537 1.00 0.00 ? 43 LEU A CA   4  
ATOM 2062  C C    . LEU A 1 43 ? 0.524   -33.124 -18.928 1.00 0.00 ? 43 LEU A C    4  
ATOM 2063  O O    . LEU A 1 43 ? -0.030  -32.983 -20.017 1.00 0.00 ? 43 LEU A O    4  
ATOM 2064  C CB   . LEU A 1 43 ? 0.190   -35.209 -17.637 1.00 0.00 ? 43 LEU A CB   4  
ATOM 2065  C CG   . LEU A 1 43 ? 0.529   -36.675 -17.360 1.00 0.00 ? 43 LEU A CG   4  
ATOM 2066  C CD1  . LEU A 1 43 ? -0.446  -37.271 -16.357 1.00 0.00 ? 43 LEU A CD1  4  
ATOM 2067  C CD2  . LEU A 1 43 ? 0.455   -37.494 -18.640 1.00 0.00 ? 43 LEU A CD2  4  
ATOM 2068  H H    . LEU A 1 43 ? 2.452   -34.348 -16.842 1.00 0.00 ? 43 LEU A H    4  
ATOM 2069  H HA   . LEU A 1 43 ? 1.360   -35.032 -19.435 1.00 0.00 ? 43 LEU A HA   4  
ATOM 2070  H HB2  . LEU A 1 43 ? 0.147   -34.691 -16.679 1.00 0.00 ? 43 LEU A HB2  4  
ATOM 2071  H HB3  . LEU A 1 43 ? -0.792  -35.178 -18.110 1.00 0.00 ? 43 LEU A HB3  4  
ATOM 2072  H HG   . LEU A 1 43 ? 1.539   -36.731 -16.955 1.00 0.00 ? 43 LEU A HG   4  
ATOM 2073  H HD11 . LEU A 1 43 ? -0.188  -38.311 -16.161 1.00 0.00 ? 43 LEU A HD11 4  
ATOM 2074  H HD12 . LEU A 1 43 ? -0.398  -36.706 -15.426 1.00 0.00 ? 43 LEU A HD12 4  
ATOM 2075  H HD13 . LEU A 1 43 ? -1.458  -37.220 -16.761 1.00 0.00 ? 43 LEU A HD13 4  
ATOM 2076  H HD21 . LEU A 1 43 ? 0.709   -38.533 -18.431 1.00 0.00 ? 43 LEU A HD21 4  
ATOM 2077  H HD22 . LEU A 1 43 ? -0.557  -37.444 -19.044 1.00 0.00 ? 43 LEU A HD22 4  
ATOM 2078  H HD23 . LEU A 1 43 ? 1.157   -37.090 -19.369 1.00 0.00 ? 43 LEU A HD23 4  
ATOM 2079  N N    . ARG A 1 44 ? 0.607   -32.154 -18.022 1.00 0.00 ? 44 ARG A N    4  
ATOM 2080  C CA   . ARG A 1 44 ? 0.042   -30.827 -18.245 1.00 0.00 ? 44 ARG A CA   4  
ATOM 2081  C C    . ARG A 1 44 ? 0.995   -29.974 -19.066 1.00 0.00 ? 44 ARG A C    4  
ATOM 2082  O O    . ARG A 1 44 ? 0.574   -29.136 -19.862 1.00 0.00 ? 44 ARG A O    4  
ATOM 2083  C CB   . ARG A 1 44 ? -0.212  -30.122 -16.911 1.00 0.00 ? 44 ARG A CB   4  
ATOM 2084  C CG   . ARG A 1 44 ? -0.886  -28.766 -17.045 1.00 0.00 ? 44 ARG A CG   4  
ATOM 2085  C CD   . ARG A 1 44 ? -2.305  -28.904 -17.569 1.00 0.00 ? 44 ARG A CD   4  
ATOM 2086  N NE   . ARG A 1 44 ? -2.974  -27.610 -17.688 1.00 0.00 ? 44 ARG A NE   4  
ATOM 2087  C CZ   . ARG A 1 44 ? -4.153  -27.430 -18.273 1.00 0.00 ? 44 ARG A CZ   4  
ATOM 2088  N NH1  . ARG A 1 44 ? -4.799  -28.463 -18.796 1.00 0.00 ? 44 ARG A NH1  4  
ATOM 2089  N NH2  . ARG A 1 44 ? -4.684  -26.216 -18.334 1.00 0.00 ? 44 ARG A NH2  4  
ATOM 2090  H H    . ARG A 1 44 ? 1.074   -32.331 -17.145 1.00 0.00 ? 44 ARG A H    4  
ATOM 2091  H HA   . ARG A 1 44 ? -0.901  -30.933 -18.781 1.00 0.00 ? 44 ARG A HA   4  
ATOM 2092  H HB2  . ARG A 1 44 ? -0.849  -30.762 -16.301 1.00 0.00 ? 44 ARG A HB2  4  
ATOM 2093  H HB3  . ARG A 1 44 ? 0.746   -29.980 -16.411 1.00 0.00 ? 44 ARG A HB3  4  
ATOM 2094  H HG2  . ARG A 1 44 ? -0.914  -28.285 -16.067 1.00 0.00 ? 44 ARG A HG2  4  
ATOM 2095  H HG3  . ARG A 1 44 ? -0.311  -28.150 -17.736 1.00 0.00 ? 44 ARG A HG3  4  
ATOM 2096  H HD2  . ARG A 1 44 ? -2.275  -29.376 -18.551 1.00 0.00 ? 44 ARG A HD2  4  
ATOM 2097  H HD3  . ARG A 1 44 ? -2.875  -29.534 -16.885 1.00 0.00 ? 44 ARG A HD3  4  
ATOM 2098  H HE   . ARG A 1 44 ? -2.501  -26.808 -17.297 1.00 0.00 ? 44 ARG A HE   4  
ATOM 2099  H HH11 . ARG A 1 44 ? -4.395  -29.387 -18.749 1.00 0.00 ? 44 ARG A HH11 4  
ATOM 2100  H HH12 . ARG A 1 44 ? -5.696  -28.325 -19.241 1.00 0.00 ? 44 ARG A HH12 4  
ATOM 2101  H HH21 . ARG A 1 44 ? -4.193  -25.428 -17.936 1.00 0.00 ? 44 ARG A HH21 4  
ATOM 2102  H HH22 . ARG A 1 44 ? -5.581  -26.078 -18.779 1.00 0.00 ? 44 ARG A HH22 4  
ATOM 2103  N N    . LYS A 1 45 ? 2.290   -30.199 -18.860 1.00 0.00 ? 45 LYS A N    4  
ATOM 2104  C CA   . LYS A 1 45 ? 3.332   -29.463 -19.570 1.00 0.00 ? 45 LYS A CA   4  
ATOM 2105  C C    . LYS A 1 45 ? 3.422   -29.927 -21.014 1.00 0.00 ? 45 LYS A C    4  
ATOM 2106  O O    . LYS A 1 45 ? 3.485   -29.119 -21.939 1.00 0.00 ? 45 LYS A O    4  
ATOM 2107  C CB   . LYS A 1 45 ? 4.692   -29.685 -18.905 1.00 0.00 ? 45 LYS A CB   4  
ATOM 2108  C CG   . LYS A 1 45 ? 5.831   -28.911 -19.550 1.00 0.00 ? 45 LYS A CG   4  
ATOM 2109  C CD   . LYS A 1 45 ? 7.139   -29.133 -18.807 1.00 0.00 ? 45 LYS A CD   4  
ATOM 2110  C CE   . LYS A 1 45 ? 8.281   -28.371 -19.460 1.00 0.00 ? 45 LYS A CE   4  
ATOM 2111  N NZ   . LYS A 1 45 ? 9.566   -28.570 -18.736 1.00 0.00 ? 45 LYS A NZ   4  
ATOM 2112  H H    . LYS A 1 45 ? 2.573   -30.901 -18.191 1.00 0.00 ? 45 LYS A H    4  
ATOM 2113  H HA   . LYS A 1 45 ? 3.088   -28.400 -19.546 1.00 0.00 ? 45 LYS A HA   4  
ATOM 2114  H HB2  . LYS A 1 45 ? 4.617   -29.378 -17.862 1.00 0.00 ? 45 LYS A HB2  4  
ATOM 2115  H HB3  . LYS A 1 45 ? 4.928   -30.747 -18.955 1.00 0.00 ? 45 LYS A HB3  4  
ATOM 2116  H HG2  . LYS A 1 45 ? 5.947   -29.243 -20.581 1.00 0.00 ? 45 LYS A HG2  4  
ATOM 2117  H HG3  . LYS A 1 45 ? 5.590   -27.847 -19.536 1.00 0.00 ? 45 LYS A HG3  4  
ATOM 2118  H HD2  . LYS A 1 45 ? 7.025   -28.790 -17.778 1.00 0.00 ? 45 LYS A HD2  4  
ATOM 2119  H HD3  . LYS A 1 45 ? 7.373   -30.197 -18.812 1.00 0.00 ? 45 LYS A HD3  4  
ATOM 2120  H HE2  . LYS A 1 45 ? 8.396   -28.717 -20.487 1.00 0.00 ? 45 LYS A HE2  4  
ATOM 2121  H HE3  . LYS A 1 45 ? 8.039   -27.308 -19.466 1.00 0.00 ? 45 LYS A HE3  4  
ATOM 2122  H HZ1  . LYS A 1 45 ? 10.300  -28.051 -19.196 1.00 0.00 ? 45 LYS A HZ1  4  
ATOM 2123  H HZ2  . LYS A 1 45 ? 9.469   -28.243 -17.785 1.00 0.00 ? 45 LYS A HZ2  4  
ATOM 2124  H HZ3  . LYS A 1 45 ? 9.801   -29.552 -18.733 1.00 0.00 ? 45 LYS A HZ3  4  
ATOM 2125  N N    . ALA A 1 46 ? 3.427   -31.245 -21.195 1.00 0.00 ? 46 ALA A N    4  
ATOM 2126  C CA   . ALA A 1 46 ? 3.508   -31.850 -22.521 1.00 0.00 ? 46 ALA A CA   4  
ATOM 2127  C C    . ALA A 1 46 ? 3.490   -33.366 -22.398 1.00 0.00 ? 46 ALA A C    4  
ATOM 2128  O O    . ALA A 1 46 ? 3.416   -33.902 -21.294 1.00 0.00 ? 46 ALA A O    4  
ATOM 2129  C CB   . ALA A 1 46 ? 4.781   -31.378 -23.217 1.00 0.00 ? 46 ALA A CB   4  
ATOM 2130  H H    . ALA A 1 46 ? 3.374   -31.857 -20.394 1.00 0.00 ? 46 ALA A H    4  
ATOM 2131  H HA   . ALA A 1 46 ? 2.645   -31.532 -23.107 1.00 0.00 ? 46 ALA A HA   4  
ATOM 2132  H HB1  . ALA A 1 46 ? 4.832   -31.819 -24.213 1.00 0.00 ? 46 ALA A HB1  4  
ATOM 2133  H HB2  . ALA A 1 46 ? 4.769   -30.291 -23.301 1.00 0.00 ? 46 ALA A HB2  4  
ATOM 2134  H HB3  . ALA A 1 46 ? 5.649   -31.689 -22.637 1.00 0.00 ? 46 ALA A HB3  4  
ATOM 2135  N N    . GLY A 1 1  ? 29.213  -10.459 39.372  1.00 0.00 ? 1  GLY A N    5  
ATOM 2136  C CA   . GLY A 1 1  ? 30.627  -10.776 39.415  1.00 0.00 ? 1  GLY A CA   5  
ATOM 2137  C C    . GLY A 1 1  ? 30.981  -11.729 38.285  1.00 0.00 ? 1  GLY A C    5  
ATOM 2138  O O    . GLY A 1 1  ? 30.122  -12.120 37.498  1.00 0.00 ? 1  GLY A O    5  
ATOM 2139  H H1   . GLY A 1 1  ? 28.647  -10.876 38.646  1.00 0.00 ? 1  GLY A H1   5  
ATOM 2140  H HA2  . GLY A 1 1  ? 31.206  -9.858  39.309  1.00 0.00 ? 1  GLY A HA2  5  
ATOM 2141  H HA3  . GLY A 1 1  ? 30.864  -11.244 40.370  1.00 0.00 ? 1  GLY A HA3  5  
ATOM 2142  N N    . VAL A 1 2  ? 32.259  -12.094 38.220  1.00 0.00 ? 2  VAL A N    5  
ATOM 2143  C CA   . VAL A 1 2  ? 32.760  -13.003 37.194  1.00 0.00 ? 2  VAL A CA   5  
ATOM 2144  C C    . VAL A 1 2  ? 32.232  -14.410 37.425  1.00 0.00 ? 2  VAL A C    5  
ATOM 2145  O O    . VAL A 1 2  ? 31.806  -15.090 36.493  1.00 0.00 ? 2  VAL A O    5  
ATOM 2146  C CB   . VAL A 1 2  ? 34.299  -13.068 37.200  1.00 0.00 ? 2  VAL A CB   5  
ATOM 2147  C CG1  . VAL A 1 2  ? 34.790  -14.155 36.256  1.00 0.00 ? 2  VAL A CG1  5  
ATOM 2148  C CG2  . VAL A 1 2  ? 34.890  -11.740 36.753  1.00 0.00 ? 2  VAL A CG2  5  
ATOM 2149  H H    . VAL A 1 2  ? 32.914  -11.735 38.900  1.00 0.00 ? 2  VAL A H    5  
ATOM 2150  H HA   . VAL A 1 2  ? 32.421  -12.644 36.222  1.00 0.00 ? 2  VAL A HA   5  
ATOM 2151  H HB   . VAL A 1 2  ? 34.638  -13.290 38.212  1.00 0.00 ? 2  VAL A HB   5  
ATOM 2152  H HG11 . VAL A 1 2  ? 35.878  -14.197 36.275  1.00 0.00 ? 2  VAL A HG11 5  
ATOM 2153  H HG12 . VAL A 1 2  ? 34.385  -15.117 36.570  1.00 0.00 ? 2  VAL A HG12 5  
ATOM 2154  H HG13 . VAL A 1 2  ? 34.455  -13.933 35.243  1.00 0.00 ? 2  VAL A HG13 5  
ATOM 2155  H HG21 . VAL A 1 2  ? 35.978  -11.795 36.770  1.00 0.00 ? 2  VAL A HG21 5  
ATOM 2156  H HG22 . VAL A 1 2  ? 34.555  -11.517 35.740  1.00 0.00 ? 2  VAL A HG22 5  
ATOM 2157  H HG23 . VAL A 1 2  ? 34.557  -10.950 37.427  1.00 0.00 ? 2  VAL A HG23 5  
ATOM 2158  N N    . ILE A 1 3  ? 32.267  -14.837 38.684  1.00 0.00 ? 3  ILE A N    5  
ATOM 2159  C CA   . ILE A 1 3  ? 31.796  -16.163 39.071  1.00 0.00 ? 3  ILE A CA   5  
ATOM 2160  C C    . ILE A 1 3  ? 30.294  -16.277 38.863  1.00 0.00 ? 3  ILE A C    5  
ATOM 2161  O O    . ILE A 1 3  ? 29.790  -17.307 38.419  1.00 0.00 ? 3  ILE A O    5  
ATOM 2162  C CB   . ILE A 1 3  ? 32.092  -16.457 40.554  1.00 0.00 ? 3  ILE A CB   5  
ATOM 2163  C CG1  . ILE A 1 3  ? 33.601  -16.561 40.786  1.00 0.00 ? 3  ILE A CG1  5  
ATOM 2164  C CG2  . ILE A 1 3  ? 31.447  -17.768 40.976  1.00 0.00 ? 3  ILE A CG2  5  
ATOM 2165  C CD1  . ILE A 1 3  ? 33.992  -16.603 42.247  1.00 0.00 ? 3  ILE A CD1  5  
ATOM 2166  H H    . ILE A 1 3  ? 32.629  -14.230 39.406  1.00 0.00 ? 3  ILE A H    5  
ATOM 2167  H HA   . ILE A 1 3  ? 32.303  -16.902 38.452  1.00 0.00 ? 3  ILE A HA   5  
ATOM 2168  H HB   . ILE A 1 3  ? 31.689  -15.646 41.162  1.00 0.00 ? 3  ILE A HB   5  
ATOM 2169  H HG12 . ILE A 1 3  ? 33.960  -17.472 40.308  1.00 0.00 ? 3  ILE A HG12 5  
ATOM 2170  H HG13 . ILE A 1 3  ? 34.080  -15.696 40.327  1.00 0.00 ? 3  ILE A HG13 5  
ATOM 2171  H HG21 . ILE A 1 3  ? 31.654  -17.960 42.029  1.00 0.00 ? 3  ILE A HG21 5  
ATOM 2172  H HG22 . ILE A 1 3  ? 30.369  -17.706 40.826  1.00 0.00 ? 3  ILE A HG22 5  
ATOM 2173  H HG23 . ILE A 1 3  ? 31.851  -18.581 40.374  1.00 0.00 ? 3  ILE A HG23 5  
ATOM 2174  H HD11 . ILE A 1 3  ? 35.074  -16.678 42.351  1.00 0.00 ? 3  ILE A HD11 5  
ATOM 2175  H HD12 . ILE A 1 3  ? 33.648  -15.692 42.738  1.00 0.00 ? 3  ILE A HD12 5  
ATOM 2176  H HD13 . ILE A 1 3  ? 33.526  -17.468 42.720  1.00 0.00 ? 3  ILE A HD13 5  
ATOM 2177  N N    . ASP A 1 4  ? 29.586  -15.200 39.191  1.00 0.00 ? 4  ASP A N    5  
ATOM 2178  C CA   . ASP A 1 4  ? 28.134  -15.150 39.051  1.00 0.00 ? 4  ASP A CA   5  
ATOM 2179  C C    . ASP A 1 4  ? 27.720  -15.558 37.646  1.00 0.00 ? 4  ASP A C    5  
ATOM 2180  O O    . ASP A 1 4  ? 26.738  -16.274 37.455  1.00 0.00 ? 4  ASP A O    5  
ATOM 2181  C CB   . ASP A 1 4  ? 27.619  -13.734 39.315  1.00 0.00 ? 4  ASP A CB   5  
ATOM 2182  C CG   . ASP A 1 4  ? 27.706  -13.345 40.777  1.00 0.00 ? 4  ASP A CG   5  
ATOM 2183  O OD1  . ASP A 1 4  ? 27.180  -12.271 41.139  1.00 0.00 ? 4  ASP A OD1  5  
ATOM 2184  O OD2  . ASP A 1 4  ? 28.301  -14.114 41.562  1.00 0.00 ? 4  ASP A OD2  5  
ATOM 2185  H H    . ASP A 1 4  ? 30.058  -14.383 39.551  1.00 0.00 ? 4  ASP A H    5  
ATOM 2186  H HA   . ASP A 1 4  ? 27.689  -15.835 39.772  1.00 0.00 ? 4  ASP A HA   5  
ATOM 2187  H HB2  . ASP A 1 4  ? 28.211  -13.030 38.730  1.00 0.00 ? 4  ASP A HB2  5  
ATOM 2188  H HB3  . ASP A 1 4  ? 26.577  -13.675 38.999  1.00 0.00 ? 4  ASP A HB3  5  
ATOM 2189  H HD2  . ASP A 1 4  ? 28.318  -13.806 42.471  1.00 0.00 ? 4  ASP A HD2  5  
ATOM 2190  N N    . THR A 1 5  ? 28.486  -15.092 36.663  1.00 0.00 ? 5  THR A N    5  
ATOM 2191  C CA   . THR A 1 5  ? 28.222  -15.392 35.259  1.00 0.00 ? 5  THR A CA   5  
ATOM 2192  C C    . THR A 1 5  ? 29.044  -16.589 34.808  1.00 0.00 ? 5  THR A C    5  
ATOM 2193  O O    . THR A 1 5  ? 28.955  -17.026 33.662  1.00 0.00 ? 5  THR A O    5  
ATOM 2194  C CB   . THR A 1 5  ? 28.580  -14.201 34.350  1.00 0.00 ? 5  THR A CB   5  
ATOM 2195  O OG1  . THR A 1 5  ? 29.979  -13.913 34.466  1.00 0.00 ? 5  THR A OG1  5  
ATOM 2196  C CG2  . THR A 1 5  ? 27.788  -12.967 34.753  1.00 0.00 ? 5  THR A CG2  5  
ATOM 2197  H H    . THR A 1 5  ? 29.281  -14.509 36.885  1.00 0.00 ? 5  THR A H    5  
ATOM 2198  H HA   . THR A 1 5  ? 27.161  -15.618 35.149  1.00 0.00 ? 5  THR A HA   5  
ATOM 2199  H HB   . THR A 1 5  ? 28.346  -14.457 33.317  1.00 0.00 ? 5  THR A HB   5  
ATOM 2200  H HG1  . THR A 1 5  ? 30.188  -13.174 33.889  1.00 0.00 ? 5  THR A HG1  5  
ATOM 2201  H HG21 . THR A 1 5  ? 28.049  -12.132 34.102  1.00 0.00 ? 5  THR A HG21 5  
ATOM 2202  H HG22 . THR A 1 5  ? 26.721  -13.175 34.664  1.00 0.00 ? 5  THR A HG22 5  
ATOM 2203  H HG23 . THR A 1 5  ? 28.022  -12.707 35.786  1.00 0.00 ? 5  THR A HG23 5  
ATOM 2204  N N    . SER A 1 6  ? 29.847  -17.115 35.729  1.00 0.00 ? 6  SER A N    5  
ATOM 2205  C CA   . SER A 1 6  ? 30.700  -18.266 35.453  1.00 0.00 ? 6  SER A CA   5  
ATOM 2206  C C    . SER A 1 6  ? 29.903  -19.373 34.781  1.00 0.00 ? 6  SER A C    5  
ATOM 2207  O O    . SER A 1 6  ? 30.207  -19.788 33.664  1.00 0.00 ? 6  SER A O    5  
ATOM 2208  C CB   . SER A 1 6  ? 31.292  -18.818 36.751  1.00 0.00 ? 6  SER A CB   5  
ATOM 2209  O OG   . SER A 1 6  ? 32.116  -19.942 36.499  1.00 0.00 ? 6  SER A OG   5  
ATOM 2210  H H    . SER A 1 6  ? 29.874  -16.712 36.655  1.00 0.00 ? 6  SER A H    5  
ATOM 2211  H HA   . SER A 1 6  ? 31.508  -17.951 34.793  1.00 0.00 ? 6  SER A HA   5  
ATOM 2212  H HB2  . SER A 1 6  ? 31.887  -18.040 37.230  1.00 0.00 ? 6  SER A HB2  5  
ATOM 2213  H HB3  . SER A 1 6  ? 30.480  -19.114 37.415  1.00 0.00 ? 6  SER A HB3  5  
ATOM 2214  H HG   . SER A 1 6  ? 32.470  -20.262 37.332  1.00 0.00 ? 6  SER A HG   5  
ATOM 2215  N N    . ALA A 1 7  ? 28.874  -19.845 35.480  1.00 0.00 ? 7  ALA A N    5  
ATOM 2216  C CA   . ALA A 1 7  ? 28.010  -20.907 34.974  1.00 0.00 ? 7  ALA A CA   5  
ATOM 2217  C C    . ALA A 1 7  ? 27.342  -20.479 33.677  1.00 0.00 ? 7  ALA A C    5  
ATOM 2218  O O    . ALA A 1 7  ? 27.230  -21.257 32.731  1.00 0.00 ? 7  ALA A O    5  
ATOM 2219  C CB   . ALA A 1 7  ? 26.925  -21.236 35.988  1.00 0.00 ? 7  ALA A CB   5  
ATOM 2220  H H    . ALA A 1 7  ? 28.675  -19.463 36.394  1.00 0.00 ? 7  ALA A H    5  
ATOM 2221  H HA   . ALA A 1 7  ? 28.616  -21.794 34.793  1.00 0.00 ? 7  ALA A HA   5  
ATOM 2222  H HB1  . ALA A 1 7  ? 26.294  -22.039 35.607  1.00 0.00 ? 7  ALA A HB1  5  
ATOM 2223  H HB2  . ALA A 1 7  ? 27.387  -21.551 36.924  1.00 0.00 ? 7  ALA A HB2  5  
ATOM 2224  H HB3  . ALA A 1 7  ? 26.314  -20.350 36.165  1.00 0.00 ? 7  ALA A HB3  5  
ATOM 2225  N N    . VAL A 1 8  ? 26.899  -19.225 33.646  1.00 0.00 ? 8  VAL A N    5  
ATOM 2226  C CA   . VAL A 1 8  ? 26.236  -18.661 32.474  1.00 0.00 ? 8  VAL A CA   5  
ATOM 2227  C C    . VAL A 1 8  ? 27.185  -18.632 31.288  1.00 0.00 ? 8  VAL A C    5  
ATOM 2228  O O    . VAL A 1 8  ? 26.804  -18.941 30.160  1.00 0.00 ? 8  VAL A O    5  
ATOM 2229  C CB   . VAL A 1 8  ? 25.759  -17.220 32.734  1.00 0.00 ? 8  VAL A CB   5  
ATOM 2230  C CG1  . VAL A 1 8  ? 25.263  -16.582 31.445  1.00 0.00 ? 8  VAL A CG1  5  
ATOM 2231  C CG2  . VAL A 1 8  ? 24.623  -17.209 33.744  1.00 0.00 ? 8  VAL A CG2  5  
ATOM 2232  H H    . VAL A 1 8  ? 27.020  -18.634 34.456  1.00 0.00 ? 8  VAL A H    5  
ATOM 2233  H HA   . VAL A 1 8  ? 25.374  -19.284 32.233  1.00 0.00 ? 8  VAL A HA   5  
ATOM 2234  H HB   . VAL A 1 8  ? 26.593  -16.637 33.125  1.00 0.00 ? 8  VAL A HB   5  
ATOM 2235  H HG11 . VAL A 1 8  ? 24.936  -15.560 31.640  1.00 0.00 ? 8  VAL A HG11 5  
ATOM 2236  H HG12 . VAL A 1 8  ? 26.070  -16.569 30.713  1.00 0.00 ? 8  VAL A HG12 5  
ATOM 2237  H HG13 . VAL A 1 8  ? 24.425  -17.160 31.053  1.00 0.00 ? 8  VAL A HG13 5  
ATOM 2238  H HG21 . VAL A 1 8  ? 24.300  -16.184 33.927  1.00 0.00 ? 8  VAL A HG21 5  
ATOM 2239  H HG22 . VAL A 1 8  ? 23.785  -17.787 33.354  1.00 0.00 ? 8  VAL A HG22 5  
ATOM 2240  H HG23 . VAL A 1 8  ? 24.965  -17.651 34.679  1.00 0.00 ? 8  VAL A HG23 5  
ATOM 2241  N N    . GLU A 1 9  ? 28.432  -18.254 31.558  1.00 0.00 ? 9  GLU A N    5  
ATOM 2242  C CA   . GLU A 1 9  ? 29.464  -18.175 30.528  1.00 0.00 ? 9  GLU A CA   5  
ATOM 2243  C C    . GLU A 1 9  ? 29.625  -19.516 29.831  1.00 0.00 ? 9  GLU A C    5  
ATOM 2244  O O    . GLU A 1 9  ? 29.816  -19.584 28.618  1.00 0.00 ? 9  GLU A O    5  
ATOM 2245  C CB   . GLU A 1 9  ? 30.809  -17.787 31.146  1.00 0.00 ? 9  GLU A CB   5  
ATOM 2246  C CG   . GLU A 1 9  ? 31.930  -17.613 30.134  1.00 0.00 ? 9  GLU A CG   5  
ATOM 2247  C CD   . GLU A 1 9  ? 33.233  -17.180 30.776  1.00 0.00 ? 9  GLU A CD   5  
ATOM 2248  O OE1  . GLU A 1 9  ? 33.259  -17.017 32.014  1.00 0.00 ? 9  GLU A OE1  5  
ATOM 2249  O OE2  . GLU A 1 9  ? 34.227  -17.003 30.041  1.00 0.00 ? 9  GLU A OE2  5  
ATOM 2250  H H    . GLU A 1 9  ? 28.684  -18.011 32.506  1.00 0.00 ? 9  GLU A H    5  
ATOM 2251  H HA   . GLU A 1 9  ? 29.172  -17.420 29.798  1.00 0.00 ? 9  GLU A HA   5  
ATOM 2252  H HB2  . GLU A 1 9  ? 30.681  -16.845 31.681  1.00 0.00 ? 9  GLU A HB2  5  
ATOM 2253  H HB3  . GLU A 1 9  ? 31.100  -18.567 31.849  1.00 0.00 ? 9  GLU A HB3  5  
ATOM 2254  H HG2  . GLU A 1 9  ? 32.090  -18.561 29.622  1.00 0.00 ? 9  GLU A HG2  5  
ATOM 2255  H HG3  . GLU A 1 9  ? 31.630  -16.859 29.406  1.00 0.00 ? 9  GLU A HG3  5  
ATOM 2256  H HE2  . GLU A 1 9  ? 35.017  -16.729 30.513  1.00 0.00 ? 9  GLU A HE2  5  
ATOM 2257  N N    . SER A 1 10 ? 29.545  -20.586 30.617  1.00 0.00 ? 10 SER A N    5  
ATOM 2258  C CA   . SER A 1 10 ? 29.677  -21.945 30.101  1.00 0.00 ? 10 SER A CA   5  
ATOM 2259  C C    . SER A 1 10 ? 28.364  -22.418 29.500  1.00 0.00 ? 10 SER A C    5  
ATOM 2260  O O    . SER A 1 10 ? 28.327  -22.948 28.391  1.00 0.00 ? 10 SER A O    5  
ATOM 2261  C CB   . SER A 1 10 ? 30.069  -22.908 31.223  1.00 0.00 ? 10 SER A CB   5  
ATOM 2262  O OG   . SER A 1 10 ? 31.345  -22.587 31.749  1.00 0.00 ? 10 SER A OG   5  
ATOM 2263  H H    . SER A 1 10 ? 29.386  -20.465 31.607  1.00 0.00 ? 10 SER A H    5  
ATOM 2264  H HA   . SER A 1 10 ? 30.449  -21.953 29.333  1.00 0.00 ? 10 SER A HA   5  
ATOM 2265  H HB2  . SER A 1 10 ? 29.329  -22.844 32.021  1.00 0.00 ? 10 SER A HB2  5  
ATOM 2266  H HB3  . SER A 1 10 ? 30.092  -23.923 30.829  1.00 0.00 ? 10 SER A HB3  5  
ATOM 2267  H HG   . SER A 1 10 ? 31.559  -23.208 32.449  1.00 0.00 ? 10 SER A HG   5  
ATOM 2268  N N    . ALA A 1 11 ? 27.284  -22.218 30.251  1.00 0.00 ? 11 ALA A N    5  
ATOM 2269  C CA   . ALA A 1 11 ? 25.948  -22.616 29.816  1.00 0.00 ? 11 ALA A CA   5  
ATOM 2270  C C    . ALA A 1 11 ? 25.509  -21.787 28.620  1.00 0.00 ? 11 ALA A C    5  
ATOM 2271  O O    . ALA A 1 11 ? 24.882  -22.294 27.691  1.00 0.00 ? 11 ALA A O    5  
ATOM 2272  C CB   . ALA A 1 11 ? 24.942  -22.413 30.939  1.00 0.00 ? 11 ALA A CB   5  
ATOM 2273  H H    . ALA A 1 11 ? 27.380  -21.777 31.155  1.00 0.00 ? 11 ALA A H    5  
ATOM 2274  H HA   . ALA A 1 11 ? 25.969  -23.669 29.537  1.00 0.00 ? 11 ALA A HA   5  
ATOM 2275  H HB1  . ALA A 1 11 ? 23.951  -22.726 30.609  1.00 0.00 ? 11 ALA A HB1  5  
ATOM 2276  H HB2  . ALA A 1 11 ? 25.239  -23.006 31.804  1.00 0.00 ? 11 ALA A HB2  5  
ATOM 2277  H HB3  . ALA A 1 11 ? 24.914  -21.358 31.215  1.00 0.00 ? 11 ALA A HB3  5  
ATOM 2278  N N    . ILE A 1 12 ? 25.846  -20.501 28.656  1.00 0.00 ? 12 ILE A N    5  
ATOM 2279  C CA   . ILE A 1 12 ? 25.500  -19.573 27.585  1.00 0.00 ? 12 ILE A CA   5  
ATOM 2280  C C    . ILE A 1 12 ? 26.252  -19.924 26.312  1.00 0.00 ? 12 ILE A C    5  
ATOM 2281  O O    . ILE A 1 12 ? 25.679  -19.963 25.224  1.00 0.00 ? 12 ILE A O    5  
ATOM 2282  C CB   . ILE A 1 12 ? 25.855  -18.122 27.959  1.00 0.00 ? 12 ILE A CB   5  
ATOM 2283  C CG1  . ILE A 1 12 ? 24.976  -17.639 29.114  1.00 0.00 ? 12 ILE A CG1  5  
ATOM 2284  C CG2  . ILE A 1 12 ? 25.640  -17.198 26.770  1.00 0.00 ? 12 ILE A CG2  5  
ATOM 2285  C CD1  . ILE A 1 12 ? 23.496  -17.644 28.799  1.00 0.00 ? 12 ILE A CD1  5  
ATOM 2286  H H    . ILE A 1 12 ? 26.360  -20.143 29.448  1.00 0.00 ? 12 ILE A H    5  
ATOM 2287  H HA   . ILE A 1 12 ? 24.427  -19.642 27.403  1.00 0.00 ? 12 ILE A HA   5  
ATOM 2288  H HB   . ILE A 1 12 ? 26.901  -18.081 28.262  1.00 0.00 ? 12 ILE A HB   5  
ATOM 2289  H HG12 . ILE A 1 12 ? 25.146  -18.289 29.972  1.00 0.00 ? 12 ILE A HG12 5  
ATOM 2290  H HG13 . ILE A 1 12 ? 25.269  -16.620 29.367  1.00 0.00 ? 12 ILE A HG13 5  
ATOM 2291  H HG21 . ILE A 1 12 ? 25.903  -16.176 27.044  1.00 0.00 ? 12 ILE A HG21 5  
ATOM 2292  H HG22 . ILE A 1 12 ? 26.267  -17.523 25.941  1.00 0.00 ? 12 ILE A HG22 5  
ATOM 2293  H HG23 . ILE A 1 12 ? 24.593  -17.232 26.469  1.00 0.00 ? 12 ILE A HG23 5  
ATOM 2294  H HD11 . ILE A 1 12 ? 22.921  -17.292 29.656  1.00 0.00 ? 12 ILE A HD11 5  
ATOM 2295  H HD12 . ILE A 1 12 ? 23.306  -16.988 27.949  1.00 0.00 ? 12 ILE A HD12 5  
ATOM 2296  H HD13 . ILE A 1 12 ? 23.184  -18.658 28.552  1.00 0.00 ? 12 ILE A HD13 5  
ATOM 2297  N N    . THR A 1 13 ? 27.549  -20.180 26.463  1.00 0.00 ? 13 THR A N    5  
ATOM 2298  C CA   . THR A 1 13 ? 28.411  -20.532 25.338  1.00 0.00 ? 13 THR A CA   5  
ATOM 2299  C C    . THR A 1 13 ? 27.980  -21.858 24.732  1.00 0.00 ? 13 THR A C    5  
ATOM 2300  O O    . THR A 1 13 ? 27.937  -22.016 23.513  1.00 0.00 ? 13 THR A O    5  
ATOM 2301  C CB   . THR A 1 13 ? 29.882  -20.666 25.774  1.00 0.00 ? 13 THR A CB   5  
ATOM 2302  O OG1  . THR A 1 13 ? 30.349  -19.411 26.282  1.00 0.00 ? 13 THR A OG1  5  
ATOM 2303  C CG2  . THR A 1 13 ? 30.752  -21.076 24.596  1.00 0.00 ? 13 THR A CG2  5  
ATOM 2304  H H    . THR A 1 13 ? 27.961  -20.132 27.384  1.00 0.00 ? 13 THR A H    5  
ATOM 2305  H HA   . THR A 1 13 ? 28.332  -19.747 24.585  1.00 0.00 ? 13 THR A HA   5  
ATOM 2306  H HB   . THR A 1 13 ? 29.954  -21.422 26.555  1.00 0.00 ? 13 THR A HB   5  
ATOM 2307  H HG1  . THR A 1 13 ? 31.263  -19.512 26.557  1.00 0.00 ? 13 THR A HG1  5  
ATOM 2308  H HG21 . THR A 1 13 ? 31.789  -21.169 24.918  1.00 0.00 ? 13 THR A HG21 5  
ATOM 2309  H HG22 . THR A 1 13 ? 30.406  -22.033 24.207  1.00 0.00 ? 13 THR A HG22 5  
ATOM 2310  H HG23 . THR A 1 13 ? 30.683  -20.319 23.814  1.00 0.00 ? 13 THR A HG23 5  
ATOM 2311  N N    . ASP A 1 14 ? 27.660  -22.812 25.603  1.00 0.00 ? 14 ASP A N    5  
ATOM 2312  C CA   . ASP A 1 14 ? 27.227  -24.140 25.181  1.00 0.00 ? 14 ASP A CA   5  
ATOM 2313  C C    . ASP A 1 14 ? 25.861  -24.070 24.520  1.00 0.00 ? 14 ASP A C    5  
ATOM 2314  O O    . ASP A 1 14 ? 25.654  -24.597 23.428  1.00 0.00 ? 14 ASP A O    5  
ATOM 2315  C CB   . ASP A 1 14 ? 27.134  -25.081 26.384  1.00 0.00 ? 14 ASP A CB   5  
ATOM 2316  C CG   . ASP A 1 14 ? 28.495  -25.459 26.934  1.00 0.00 ? 14 ASP A CG   5  
ATOM 2317  O OD1  . ASP A 1 14 ? 28.553  -26.329 27.829  1.00 0.00 ? 14 ASP A OD1  5  
ATOM 2318  O OD2  . ASP A 1 14 ? 29.503  -24.886 26.471  1.00 0.00 ? 14 ASP A OD2  5  
ATOM 2319  H H    . ASP A 1 14 ? 27.715  -22.621 26.593  1.00 0.00 ? 14 ASP A H    5  
ATOM 2320  H HA   . ASP A 1 14 ? 27.952  -24.534 24.470  1.00 0.00 ? 14 ASP A HA   5  
ATOM 2321  H HB2  . ASP A 1 14 ? 26.562  -24.588 27.171  1.00 0.00 ? 14 ASP A HB2  5  
ATOM 2322  H HB3  . ASP A 1 14 ? 26.615  -25.989 26.079  1.00 0.00 ? 14 ASP A HB3  5  
ATOM 2323  H HD2  . ASP A 1 14 ? 30.330  -25.173 26.864  1.00 0.00 ? 14 ASP A HD2  5  
ATOM 2324  N N    . GLY A 1 15 ? 24.927  -23.409 25.198  1.00 0.00 ? 15 GLY A N    5  
ATOM 2325  C CA   . GLY A 1 15 ? 23.564  -23.251 24.698  1.00 0.00 ? 15 GLY A CA   5  
ATOM 2326  C C    . GLY A 1 15 ? 23.485  -22.087 23.723  1.00 0.00 ? 15 GLY A C    5  
ATOM 2327  O O    . GLY A 1 15 ? 23.266  -22.273 22.527  1.00 0.00 ? 15 GLY A O    5  
ATOM 2328  H H    . GLY A 1 15 ? 25.157  -22.998 26.091  1.00 0.00 ? 15 GLY A H    5  
ATOM 2329  H HA2  . GLY A 1 15 ? 23.259  -24.166 24.190  1.00 0.00 ? 15 GLY A HA2  5  
ATOM 2330  H HA3  . GLY A 1 15 ? 22.893  -23.063 25.537  1.00 0.00 ? 15 GLY A HA3  5  
ATOM 2331  N N    . GLN A 1 16 ? 23.668  -20.881 24.252  1.00 0.00 ? 16 GLN A N    5  
ATOM 2332  C CA   . GLN A 1 16 ? 23.623  -19.662 23.450  1.00 0.00 ? 16 GLN A CA   5  
ATOM 2333  C C    . GLN A 1 16 ? 24.491  -19.809 22.210  1.00 0.00 ? 16 GLN A C    5  
ATOM 2334  O O    . GLN A 1 16 ? 24.032  -19.613 21.086  1.00 0.00 ? 16 GLN A O    5  
ATOM 2335  C CB   . GLN A 1 16 ? 24.134  -18.469 24.260  1.00 0.00 ? 16 GLN A CB   5  
ATOM 2336  C CG   . GLN A 1 16 ? 24.082  -17.145 23.515  1.00 0.00 ? 16 GLN A CG   5  
ATOM 2337  C CD   . GLN A 1 16 ? 22.665  -16.716 23.187  1.00 0.00 ? 16 GLN A CD   5  
ATOM 2338  O OE1  . GLN A 1 16 ? 21.816  -16.616 24.073  1.00 0.00 ? 16 GLN A OE1  5  
ATOM 2339  N NE2  . GLN A 1 16 ? 22.406  -16.462 21.910  1.00 0.00 ? 16 GLN A NE2  5  
ATOM 2340  H H    . GLN A 1 16 ? 23.844  -20.793 25.243  1.00 0.00 ? 16 GLN A H    5  
ATOM 2341  H HA   . GLN A 1 16 ? 22.591  -19.478 23.150  1.00 0.00 ? 16 GLN A HA   5  
ATOM 2342  H HB2  . GLN A 1 16 ? 23.524  -18.379 25.159  1.00 0.00 ? 16 GLN A HB2  5  
ATOM 2343  H HB3  . GLN A 1 16 ? 25.169  -18.663 24.540  1.00 0.00 ? 16 GLN A HB3  5  
ATOM 2344  H HG2  . GLN A 1 16 ? 24.546  -16.376 24.133  1.00 0.00 ? 16 GLN A HG2  5  
ATOM 2345  H HG3  . GLN A 1 16 ? 24.642  -17.244 22.585  1.00 0.00 ? 16 GLN A HG3  5  
ATOM 2346  H HE21 . GLN A 1 16 ? 23.136  -16.558 21.219  1.00 0.00 ? 16 GLN A HE21 5  
ATOM 2347  H HE22 . GLN A 1 16 ? 21.479  -16.172 21.632  1.00 0.00 ? 16 GLN A HE22 5  
ATOM 2348  N N    . GLY A 1 17 ? 25.755  -20.158 22.432  1.00 0.00 ? 17 GLY A N    5  
ATOM 2349  C CA   . GLY A 1 17 ? 26.715  -20.339 21.347  1.00 0.00 ? 17 GLY A CA   5  
ATOM 2350  C C    . GLY A 1 17 ? 26.150  -21.268 20.285  1.00 0.00 ? 17 GLY A C    5  
ATOM 2351  O O    . GLY A 1 17 ? 26.211  -20.981 19.091  1.00 0.00 ? 17 GLY A O    5  
ATOM 2352  H H    . GLY A 1 17 ? 26.072  -20.305 23.380  1.00 0.00 ? 17 GLY A H    5  
ATOM 2353  H HA2  . GLY A 1 17 ? 26.935  -19.370 20.897  1.00 0.00 ? 17 GLY A HA2  5  
ATOM 2354  H HA3  . GLY A 1 17 ? 27.633  -20.767 21.748  1.00 0.00 ? 17 GLY A HA3  5  
ATOM 2355  N N    . ASP A 1 18 ? 25.595  -22.389 20.738  1.00 0.00 ? 18 ASP A N    5  
ATOM 2356  C CA   . ASP A 1 18 ? 25.008  -23.385 19.846  1.00 0.00 ? 18 ASP A CA   5  
ATOM 2357  C C    . ASP A 1 18 ? 23.943  -22.748 18.967  1.00 0.00 ? 18 ASP A C    5  
ATOM 2358  O O    . ASP A 1 18 ? 23.508  -23.329 17.974  1.00 0.00 ? 18 ASP A O    5  
ATOM 2359  C CB   . ASP A 1 18 ? 24.360  -24.512 20.653  1.00 0.00 ? 18 ASP A CB   5  
ATOM 2360  C CG   . ASP A 1 18 ? 25.380  -25.392 21.348  1.00 0.00 ? 18 ASP A CG   5  
ATOM 2361  O OD1  . ASP A 1 18 ? 25.164  -26.621 21.403  1.00 0.00 ? 18 ASP A OD1  5  
ATOM 2362  O OD2  . ASP A 1 18 ? 26.395  -24.853 21.837  1.00 0.00 ? 18 ASP A OD2  5  
ATOM 2363  H H    . ASP A 1 18 ? 25.574  -22.568 21.732  1.00 0.00 ? 18 ASP A H    5  
ATOM 2364  H HA   . ASP A 1 18 ? 25.795  -23.799 19.217  1.00 0.00 ? 18 ASP A HA   5  
ATOM 2365  H HB2  . ASP A 1 18 ? 23.705  -24.072 21.406  1.00 0.00 ? 18 ASP A HB2  5  
ATOM 2366  H HB3  . ASP A 1 18 ? 23.766  -25.129 19.979  1.00 0.00 ? 18 ASP A HB3  5  
ATOM 2367  H HD2  . ASP A 1 18 ? 26.997  -25.468 22.261  1.00 0.00 ? 18 ASP A HD2  5  
ATOM 2368  N N    . MET A 1 19 ? 23.529  -21.543 19.346  1.00 0.00 ? 19 MET A N    5  
ATOM 2369  C CA   . MET A 1 19 ? 22.513  -20.799 18.609  1.00 0.00 ? 19 MET A CA   5  
ATOM 2370  C C    . MET A 1 19 ? 23.015  -20.445 17.219  1.00 0.00 ? 19 MET A C    5  
ATOM 2371  O O    . MET A 1 19 ? 22.288  -20.554 16.233  1.00 0.00 ? 19 MET A O    5  
ATOM 2372  C CB   . MET A 1 19 ? 22.162  -19.502 19.341  1.00 0.00 ? 19 MET A CB   5  
ATOM 2373  C CG   . MET A 1 19 ? 21.049  -18.701 18.686  1.00 0.00 ? 19 MET A CG   5  
ATOM 2374  S SD   . MET A 1 19 ? 20.657  -17.189 19.586  1.00 0.00 ? 19 MET A SD   5  
ATOM 2375  C CE   . MET A 1 19 ? 19.901  -17.861 21.065  1.00 0.00 ? 19 MET A CE   5  
ATOM 2376  H H    . MET A 1 19 ? 23.924  -21.118 20.173  1.00 0.00 ? 19 MET A H    5  
ATOM 2377  H HA   . MET A 1 19 ? 21.619  -21.417 18.524  1.00 0.00 ? 19 MET A HA   5  
ATOM 2378  H HB2  . MET A 1 19 ? 21.851  -19.754 20.355  1.00 0.00 ? 19 MET A HB2  5  
ATOM 2379  H HB3  . MET A 1 19 ? 23.055  -18.878 19.379  1.00 0.00 ? 19 MET A HB3  5  
ATOM 2380  H HG2  . MET A 1 19 ? 21.353  -18.437 17.673  1.00 0.00 ? 19 MET A HG2  5  
ATOM 2381  H HG3  . MET A 1 19 ? 20.153  -19.319 18.632  1.00 0.00 ? 19 MET A HG3  5  
ATOM 2382  H HE1  . MET A 1 19 ? 19.600  -17.051 21.730  1.00 0.00 ? 19 MET A HE1  5  
ATOM 2383  H HE2  . MET A 1 19 ? 19.023  -18.445 20.790  1.00 0.00 ? 19 MET A HE2  5  
ATOM 2384  H HE3  . MET A 1 19 ? 20.617  -18.502 21.579  1.00 0.00 ? 19 MET A HE3  5  
ATOM 2385  N N    . LYS A 1 20 ? 24.273  -20.018 17.154  1.00 0.00 ? 20 LYS A N    5  
ATOM 2386  C CA   . LYS A 1 20 ? 24.904  -19.638 15.893  1.00 0.00 ? 20 LYS A CA   5  
ATOM 2387  C C    . LYS A 1 20 ? 24.867  -20.798 14.910  1.00 0.00 ? 20 LYS A C    5  
ATOM 2388  O O    . LYS A 1 20 ? 24.602  -20.617 13.723  1.00 0.00 ? 20 LYS A O    5  
ATOM 2389  C CB   . LYS A 1 20 ? 26.364  -19.244 16.122  1.00 0.00 ? 20 LYS A CB   5  
ATOM 2390  C CG   . LYS A 1 20 ? 27.084  -18.772 14.869  1.00 0.00 ? 20 LYS A CG   5  
ATOM 2391  C CD   . LYS A 1 20 ? 28.509  -18.344 15.178  1.00 0.00 ? 20 LYS A CD   5  
ATOM 2392  C CE   . LYS A 1 20 ? 29.234  -17.887 13.923  1.00 0.00 ? 20 LYS A CE   5  
ATOM 2393  N NZ   . LYS A 1 20 ? 30.628  -17.453 14.213  1.00 0.00 ? 20 LYS A NZ   5  
ATOM 2394  H H    . LYS A 1 20 ? 24.820  -19.950 18.000  1.00 0.00 ? 20 LYS A H    5  
ATOM 2395  H HA   . LYS A 1 20 ? 24.363  -18.789 15.472  1.00 0.00 ? 20 LYS A HA   5  
ATOM 2396  H HB2  . LYS A 1 20 ? 26.389  -18.438 16.856  1.00 0.00 ? 20 LYS A HB2  5  
ATOM 2397  H HB3  . LYS A 1 20 ? 26.894  -20.110 16.516  1.00 0.00 ? 20 LYS A HB3  5  
ATOM 2398  H HG2  . LYS A 1 20 ? 27.107  -19.586 14.145  1.00 0.00 ? 20 LYS A HG2  5  
ATOM 2399  H HG3  . LYS A 1 20 ? 26.543  -17.925 14.446  1.00 0.00 ? 20 LYS A HG3  5  
ATOM 2400  H HD2  . LYS A 1 20 ? 28.485  -17.521 15.894  1.00 0.00 ? 20 LYS A HD2  5  
ATOM 2401  H HD3  . LYS A 1 20 ? 29.046  -19.187 15.611  1.00 0.00 ? 20 LYS A HD3  5  
ATOM 2402  H HE2  . LYS A 1 20 ? 29.261  -18.711 13.211  1.00 0.00 ? 20 LYS A HE2  5  
ATOM 2403  H HE3  . LYS A 1 20 ? 28.688  -17.051 13.484  1.00 0.00 ? 20 LYS A HE3  5  
ATOM 2404  H HZ1  . LYS A 1 20 ? 31.078  -17.157 13.359  1.00 0.00 ? 20 LYS A HZ1  5  
ATOM 2405  H HZ2  . LYS A 1 20 ? 30.611  -16.683 14.867  1.00 0.00 ? 20 LYS A HZ2  5  
ATOM 2406  H HZ3  . LYS A 1 20 ? 31.143  -18.223 14.614  1.00 0.00 ? 20 LYS A HZ3  5  
ATOM 2407  N N    . ALA A 1 21 ? 25.138  -21.995 15.423  1.00 0.00 ? 21 ALA A N    5  
ATOM 2408  C CA   . ALA A 1 21 ? 25.144  -23.208 14.611  1.00 0.00 ? 21 ALA A CA   5  
ATOM 2409  C C    . ALA A 1 21 ? 23.736  -23.549 14.153  1.00 0.00 ? 21 ALA A C    5  
ATOM 2410  O O    . ALA A 1 21 ? 23.516  -23.938 13.007  1.00 0.00 ? 21 ALA A O    5  
ATOM 2411  C CB   . ALA A 1 21 ? 25.687  -24.380 15.413  1.00 0.00 ? 21 ALA A CB   5  
ATOM 2412  H H    . ALA A 1 21 ? 25.349  -22.078 16.407  1.00 0.00 ? 21 ALA A H    5  
ATOM 2413  H HA   . ALA A 1 21 ? 25.777  -23.042 13.740  1.00 0.00 ? 21 ALA A HA   5  
ATOM 2414  H HB1  . ALA A 1 21 ? 25.701  -25.276 14.794  1.00 0.00 ? 21 ALA A HB1  5  
ATOM 2415  H HB2  . ALA A 1 21 ? 26.700  -24.153 15.744  1.00 0.00 ? 21 ALA A HB2  5  
ATOM 2416  H HB3  . ALA A 1 21 ? 25.050  -24.550 16.281  1.00 0.00 ? 21 ALA A HB3  5  
ATOM 2417  N N    . ILE A 1 22 ? 22.782  -23.398 15.068  1.00 0.00 ? 22 ILE A N    5  
ATOM 2418  C CA   . ILE A 1 22 ? 21.378  -23.685 14.785  1.00 0.00 ? 22 ILE A CA   5  
ATOM 2419  C C    . ILE A 1 22 ? 20.845  -22.737 13.723  1.00 0.00 ? 22 ILE A C    5  
ATOM 2420  O O    . ILE A 1 22 ? 20.227  -23.158 12.747  1.00 0.00 ? 22 ILE A O    5  
ATOM 2421  C CB   . ILE A 1 22 ? 20.505  -23.526 16.043  1.00 0.00 ? 22 ILE A CB   5  
ATOM 2422  C CG1  . ILE A 1 22 ? 20.850  -24.604 17.072  1.00 0.00 ? 22 ILE A CG1  5  
ATOM 2423  C CG2  . ILE A 1 22 ? 19.031  -23.653 15.689  1.00 0.00 ? 22 ILE A CG2  5  
ATOM 2424  C CD1  . ILE A 1 22 ? 20.220  -24.378 18.429  1.00 0.00 ? 22 ILE A CD1  5  
ATOM 2425  H H    . ILE A 1 22 ? 23.025  -23.073 15.993  1.00 0.00 ? 22 ILE A H    5  
ATOM 2426  H HA   . ILE A 1 22 ? 21.302  -24.711 14.425  1.00 0.00 ? 22 ILE A HA   5  
ATOM 2427  H HB   . ILE A 1 22 ? 20.687  -22.542 16.477  1.00 0.00 ? 22 ILE A HB   5  
ATOM 2428  H HG12 . ILE A 1 22 ? 20.507  -25.565 16.691  1.00 0.00 ? 22 ILE A HG12 5  
ATOM 2429  H HG13 . ILE A 1 22 ? 21.932  -24.627 17.196  1.00 0.00 ? 22 ILE A HG13 5  
ATOM 2430  H HG21 . ILE A 1 22 ? 18.423  -23.528 16.585  1.00 0.00 ? 22 ILE A HG21 5  
ATOM 2431  H HG22 . ILE A 1 22 ? 18.765  -22.884 14.963  1.00 0.00 ? 22 ILE A HG22 5  
ATOM 2432  H HG23 . ILE A 1 22 ? 18.844  -24.637 15.260  1.00 0.00 ? 22 ILE A HG23 5  
ATOM 2433  H HD11 . ILE A 1 22 ? 20.499  -25.175 19.118  1.00 0.00 ? 22 ILE A HD11 5  
ATOM 2434  H HD12 . ILE A 1 22 ? 20.561  -23.423 18.830  1.00 0.00 ? 22 ILE A HD12 5  
ATOM 2435  H HD13 . ILE A 1 22 ? 19.135  -24.360 18.324  1.00 0.00 ? 22 ILE A HD13 5  
ATOM 2436  N N    . GLY A 1 23 ? 21.094  -21.447 13.927  1.00 0.00 ? 23 GLY A N    5  
ATOM 2437  C CA   . GLY A 1 23 ? 20.650  -20.410 12.999  1.00 0.00 ? 23 GLY A CA   5  
ATOM 2438  C C    . GLY A 1 23 ? 21.373  -20.542 11.668  1.00 0.00 ? 23 GLY A C    5  
ATOM 2439  O O    . GLY A 1 23 ? 20.767  -20.446 10.602  1.00 0.00 ? 23 GLY A O    5  
ATOM 2440  H H    . GLY A 1 23 ? 21.607  -21.163 14.749  1.00 0.00 ? 23 GLY A H    5  
ATOM 2441  H HA2  . GLY A 1 23 ? 19.576  -20.508 12.837  1.00 0.00 ? 23 GLY A HA2  5  
ATOM 2442  H HA3  . GLY A 1 23 ? 20.861  -19.430 13.427  1.00 0.00 ? 23 GLY A HA3  5  
ATOM 2443  N N    . GLY A 1 24 ? 22.682  -20.764 11.745  1.00 0.00 ? 24 GLY A N    5  
ATOM 2444  C CA   . GLY A 1 24 ? 23.518  -20.913 10.558  1.00 0.00 ? 24 GLY A CA   5  
ATOM 2445  C C    . GLY A 1 24 ? 23.170  -22.195 9.819   1.00 0.00 ? 24 GLY A C    5  
ATOM 2446  O O    . GLY A 1 24 ? 22.873  -22.181 8.626   1.00 0.00 ? 24 GLY A O    5  
ATOM 2447  H H    . GLY A 1 24 ? 23.122  -20.833 12.651  1.00 0.00 ? 24 GLY A H    5  
ATOM 2448  H HA2  . GLY A 1 24 ? 23.357  -20.061 9.896   1.00 0.00 ? 24 GLY A HA2  5  
ATOM 2449  H HA3  . GLY A 1 24 ? 24.565  -20.944 10.858  1.00 0.00 ? 24 GLY A HA3  5  
ATOM 2450  N N    . TYR A 1 25 ? 23.211  -23.308 10.547  1.00 0.00 ? 25 TYR A N    5  
ATOM 2451  C CA   . TYR A 1 25 ? 22.904  -24.619 9.985   1.00 0.00 ? 25 TYR A CA   5  
ATOM 2452  C C    . TYR A 1 25 ? 21.520  -24.618 9.356   1.00 0.00 ? 25 TYR A C    5  
ATOM 2453  O O    . TYR A 1 25 ? 21.302  -25.205 8.297   1.00 0.00 ? 25 TYR A O    5  
ATOM 2454  C CB   . TYR A 1 25 ? 22.938  -25.691 11.076  1.00 0.00 ? 25 TYR A CB   5  
ATOM 2455  C CG   . TYR A 1 25 ? 22.616  -27.082 10.579  1.00 0.00 ? 25 TYR A CG   5  
ATOM 2456  C CD1  . TYR A 1 25 ? 23.565  -27.830 9.894   1.00 0.00 ? 25 TYR A CD1  5  
ATOM 2457  C CD2  . TYR A 1 25 ? 21.363  -27.642 10.795  1.00 0.00 ? 25 TYR A CD2  5  
ATOM 2458  C CE1  . TYR A 1 25 ? 23.279  -29.102 9.436   1.00 0.00 ? 25 TYR A CE1  5  
ATOM 2459  C CE2  . TYR A 1 25 ? 21.060  -28.913 10.344  1.00 0.00 ? 25 TYR A CE2  5  
ATOM 2460  C CZ   . TYR A 1 25 ? 22.031  -29.642 9.659   1.00 0.00 ? 25 TYR A CZ   5  
ATOM 2461  O OH   . TYR A 1 25 ? 21.744  -30.908 9.204   1.00 0.00 ? 25 TYR A OH   5  
ATOM 2462  H H    . TYR A 1 25 ? 23.463  -23.255 11.524  1.00 0.00 ? 25 TYR A H    5  
ATOM 2463  H HA   . TYR A 1 25 ? 23.647  -24.856 9.224   1.00 0.00 ? 25 TYR A HA   5  
ATOM 2464  H HB2  . TYR A 1 25 ? 23.934  -25.703 11.519  1.00 0.00 ? 25 TYR A HB2  5  
ATOM 2465  H HB3  . TYR A 1 25 ? 22.215  -25.423 11.848  1.00 0.00 ? 25 TYR A HB3  5  
ATOM 2466  H HD1  . TYR A 1 25 ? 24.544  -27.410 9.716   1.00 0.00 ? 25 TYR A HD1  5  
ATOM 2467  H HD2  . TYR A 1 25 ? 20.612  -27.074 11.325  1.00 0.00 ? 25 TYR A HD2  5  
ATOM 2468  H HE1  . TYR A 1 25 ? 24.029  -29.670 8.906   1.00 0.00 ? 25 TYR A HE1  5  
ATOM 2469  H HE2  . TYR A 1 25 ? 20.082  -29.336 10.521  1.00 0.00 ? 25 TYR A HE2  5  
ATOM 2470  H HH   . TYR A 1 25 ? 20.849  -31.188 9.412   1.00 0.00 ? 25 TYR A HH   5  
ATOM 2471  N N    . ILE A 1 26 ? 20.586  -23.948 10.024  1.00 0.00 ? 26 ILE A N    5  
ATOM 2472  C CA   . ILE A 1 26 ? 19.207  -23.851 9.552   1.00 0.00 ? 26 ILE A CA   5  
ATOM 2473  C C    . ILE A 1 26 ? 19.112  -22.886 8.382   1.00 0.00 ? 26 ILE A C    5  
ATOM 2474  O O    . ILE A 1 26 ? 18.464  -23.167 7.376   1.00 0.00 ? 26 ILE A O    5  
ATOM 2475  C CB   . ILE A 1 26 ? 18.265  -23.345 10.661  1.00 0.00 ? 26 ILE A CB   5  
ATOM 2476  C CG1  . ILE A 1 26 ? 18.160  -24.379 11.784  1.00 0.00 ? 26 ILE A CG1  5  
ATOM 2477  C CG2  . ILE A 1 26 ? 16.872  -23.096 10.103  1.00 0.00 ? 26 ILE A CG2  5  
ATOM 2478  C CD1  . ILE A 1 26 ? 17.456  -23.867 13.021  1.00 0.00 ? 26 ILE A CD1  5  
ATOM 2479  H H    . ILE A 1 26 ? 20.827  -23.485 10.889  1.00 0.00 ? 26 ILE A H    5  
ATOM 2480  H HA   . ILE A 1 26 ? 18.882  -24.841 9.232   1.00 0.00 ? 26 ILE A HA   5  
ATOM 2481  H HB   . ILE A 1 26 ? 18.662  -22.413 11.065  1.00 0.00 ? 26 ILE A HB   5  
ATOM 2482  H HG12 . ILE A 1 26 ? 17.609  -25.241 11.408  1.00 0.00 ? 26 ILE A HG12 5  
ATOM 2483  H HG13 . ILE A 1 26 ? 19.167  -24.685 12.065  1.00 0.00 ? 26 ILE A HG13 5  
ATOM 2484  H HG21 . ILE A 1 26 ? 16.217  -22.729 10.894  1.00 0.00 ? 26 ILE A HG21 5  
ATOM 2485  H HG22 . ILE A 1 26 ? 16.928  -22.353 9.307   1.00 0.00 ? 26 ILE A HG22 5  
ATOM 2486  H HG23 . ILE A 1 26 ? 16.469  -24.026 9.704   1.00 0.00 ? 26 ILE A HG23 5  
ATOM 2487  H HD11 . ILE A 1 26 ? 17.409  -24.644 13.784  1.00 0.00 ? 26 ILE A HD11 5  
ATOM 2488  H HD12 . ILE A 1 26 ? 18.001  -23.010 13.417  1.00 0.00 ? 26 ILE A HD12 5  
ATOM 2489  H HD13 . ILE A 1 26 ? 16.442  -23.563 12.759  1.00 0.00 ? 26 ILE A HD13 5  
ATOM 2490  N N    . VAL A 1 27 ? 19.771  -21.740 8.528   1.00 0.00 ? 27 VAL A N    5  
ATOM 2491  C CA   . VAL A 1 27 ? 19.778  -20.707 7.495   1.00 0.00 ? 27 VAL A CA   5  
ATOM 2492  C C    . VAL A 1 27 ? 20.685  -21.112 6.344   1.00 0.00 ? 27 VAL A C    5  
ATOM 2493  O O    . VAL A 1 27 ? 20.451  -20.750 5.192   1.00 0.00 ? 27 VAL A O    5  
ATOM 2494  C CB   . VAL A 1 27 ? 20.284  -19.361 8.046   1.00 0.00 ? 27 VAL A CB   5  
ATOM 2495  C CG1  . VAL A 1 27 ? 21.785  -19.415 8.287   1.00 0.00 ? 27 VAL A CG1  5  
ATOM 2496  C CG2  . VAL A 1 27 ? 19.996  -18.239 7.060   1.00 0.00 ? 27 VAL A CG2  5  
ATOM 2497  H H    . VAL A 1 27 ? 20.287  -21.567 9.379   1.00 0.00 ? 27 VAL A H    5  
ATOM 2498  H HA   . VAL A 1 27 ? 18.759  -20.581 7.126   1.00 0.00 ? 27 VAL A HA   5  
ATOM 2499  H HB   . VAL A 1 27 ? 19.775  -19.151 8.987   1.00 0.00 ? 27 VAL A HB   5  
ATOM 2500  H HG11 . VAL A 1 27 ? 22.130  -18.460 8.685   1.00 0.00 ? 27 VAL A HG11 5  
ATOM 2501  H HG12 . VAL A 1 27 ? 22.008  -20.206 9.002   1.00 0.00 ? 27 VAL A HG12 5  
ATOM 2502  H HG13 . VAL A 1 27 ? 22.295  -19.620 7.346   1.00 0.00 ? 27 VAL A HG13 5  
ATOM 2503  H HG21 . VAL A 1 27 ? 20.350  -17.291 7.465   1.00 0.00 ? 27 VAL A HG21 5  
ATOM 2504  H HG22 . VAL A 1 27 ? 20.506  -18.443 6.119   1.00 0.00 ? 27 VAL A HG22 5  
ATOM 2505  H HG23 . VAL A 1 27 ? 18.921  -18.177 6.885   1.00 0.00 ? 27 VAL A HG23 5  
ATOM 2506  N N    . GLY A 1 28 ? 21.726  -21.872 6.672   1.00 0.00 ? 28 GLY A N    5  
ATOM 2507  C CA   . GLY A 1 28 ? 22.690  -22.344 5.683   1.00 0.00 ? 28 GLY A CA   5  
ATOM 2508  C C    . GLY A 1 28 ? 22.093  -23.471 4.855   1.00 0.00 ? 28 GLY A C    5  
ATOM 2509  O O    . GLY A 1 28 ? 22.517  -23.726 3.729   1.00 0.00 ? 28 GLY A O    5  
ATOM 2510  H H    . GLY A 1 28 ? 21.863  -22.137 7.637   1.00 0.00 ? 28 GLY A H    5  
ATOM 2511  H HA2  . GLY A 1 28 ? 22.962  -21.519 5.025   1.00 0.00 ? 28 GLY A HA2  5  
ATOM 2512  H HA3  . GLY A 1 28 ? 23.581  -22.706 6.194   1.00 0.00 ? 28 GLY A HA3  5  
ATOM 2513  N N    . ALA A 1 29 ? 21.101  -24.144 5.431   1.00 0.00 ? 29 ALA A N    5  
ATOM 2514  C CA   . ALA A 1 29 ? 20.424  -25.255 4.769   1.00 0.00 ? 29 ALA A CA   5  
ATOM 2515  C C    . ALA A 1 29 ? 19.316  -24.739 3.864   1.00 0.00 ? 29 ALA A C    5  
ATOM 2516  O O    . ALA A 1 29 ? 19.028  -25.317 2.817   1.00 0.00 ? 29 ALA A O    5  
ATOM 2517  C CB   . ALA A 1 29 ? 19.810  -26.191 5.799   1.00 0.00 ? 29 ALA A CB   5  
ATOM 2518  H H    . ALA A 1 29 ? 20.798  -23.886 6.359   1.00 0.00 ? 29 ALA A H    5  
ATOM 2519  H HA   . ALA A 1 29 ? 21.152  -25.803 4.172   1.00 0.00 ? 29 ALA A HA   5  
ATOM 2520  H HB1  . ALA A 1 29 ? 19.319  -27.024 5.295   1.00 0.00 ? 29 ALA A HB1  5  
ATOM 2521  H HB2  . ALA A 1 29 ? 20.593  -26.574 6.453   1.00 0.00 ? 29 ALA A HB2  5  
ATOM 2522  H HB3  . ALA A 1 29 ? 19.076  -25.645 6.393   1.00 0.00 ? 29 ALA A HB3  5  
ATOM 2523  N N    . LEU A 1 30 ? 18.696  -23.641 4.285   1.00 0.00 ? 30 LEU A N    5  
ATOM 2524  C CA   . LEU A 1 30 ? 17.611  -23.020 3.530   1.00 0.00 ? 30 LEU A CA   5  
ATOM 2525  C C    . LEU A 1 30 ? 18.060  -22.708 2.112   1.00 0.00 ? 30 LEU A C    5  
ATOM 2526  O O    . LEU A 1 30 ? 17.263  -22.724 1.175   1.00 0.00 ? 30 LEU A O    5  
ATOM 2527  C CB   . LEU A 1 30 ? 17.173  -21.714 4.197   1.00 0.00 ? 30 LEU A CB   5  
ATOM 2528  C CG   . LEU A 1 30 ? 16.435  -21.849 5.530   1.00 0.00 ? 30 LEU A CG   5  
ATOM 2529  C CD1  . LEU A 1 30 ? 16.173  -20.480 6.140   1.00 0.00 ? 30 LEU A CD1  5  
ATOM 2530  C CD2  . LEU A 1 30 ? 15.097  -22.546 5.336   1.00 0.00 ? 30 LEU A CD2  5  
ATOM 2531  H H    . LEU A 1 30 ? 18.977  -23.213 5.156   1.00 0.00 ? 30 LEU A H    5  
ATOM 2532  H HA   . LEU A 1 30 ? 16.767  -23.709 3.499   1.00 0.00 ? 30 LEU A HA   5  
ATOM 2533  H HB2  . LEU A 1 30 ? 18.066  -21.114 4.371   1.00 0.00 ? 30 LEU A HB2  5  
ATOM 2534  H HB3  . LEU A 1 30 ? 16.513  -21.191 3.504   1.00 0.00 ? 30 LEU A HB3  5  
ATOM 2535  H HG   . LEU A 1 30 ? 17.049  -22.435 6.213   1.00 0.00 ? 30 LEU A HG   5  
ATOM 2536  H HD11 . LEU A 1 30 ? 15.656  -20.590 7.094   1.00 0.00 ? 30 LEU A HD11 5  
ATOM 2537  H HD12 . LEU A 1 30 ? 17.121  -19.968 6.302   1.00 0.00 ? 30 LEU A HD12 5  
ATOM 2538  H HD13 . LEU A 1 30 ? 15.554  -19.893 5.461   1.00 0.00 ? 30 LEU A HD13 5  
ATOM 2539  H HD21 . LEU A 1 30 ? 14.586  -22.645 6.294   1.00 0.00 ? 30 LEU A HD21 5  
ATOM 2540  H HD22 . LEU A 1 30 ? 14.478  -21.958 4.658   1.00 0.00 ? 30 LEU A HD22 5  
ATOM 2541  H HD23 . LEU A 1 30 ? 15.263  -23.536 4.912   1.00 0.00 ? 30 LEU A HD23 5  
ATOM 2542  N N    . VAL A 1 31 ? 19.350  -22.422 1.967   1.00 0.00 ? 31 VAL A N    5  
ATOM 2543  C CA   . VAL A 1 31 ? 19.938  -22.100 0.669   1.00 0.00 ? 31 VAL A CA   5  
ATOM 2544  C C    . VAL A 1 31 ? 19.652  -23.206 -0.333  1.00 0.00 ? 31 VAL A C    5  
ATOM 2545  O O    . VAL A 1 31 ? 19.448  -22.952 -1.519  1.00 0.00 ? 31 VAL A O    5  
ATOM 2546  C CB   . VAL A 1 31 ? 21.466  -21.933 0.767   1.00 0.00 ? 31 VAL A CB   5  
ATOM 2547  C CG1  . VAL A 1 31 ? 22.080  -21.827 -0.620  1.00 0.00 ? 31 VAL A CG1  5  
ATOM 2548  C CG2  . VAL A 1 31 ? 21.815  -20.674 1.546   1.00 0.00 ? 31 VAL A CG2  5  
ATOM 2549  H H    . VAL A 1 31 ? 19.954  -22.424 2.776   1.00 0.00 ? 31 VAL A H    5  
ATOM 2550  H HA   . VAL A 1 31 ? 19.498  -21.167 0.314   1.00 0.00 ? 31 VAL A HA   5  
ATOM 2551  H HB   . VAL A 1 31 ? 21.883  -22.800 1.280   1.00 0.00 ? 31 VAL A HB   5  
ATOM 2552  H HG11 . VAL A 1 31 ? 23.161  -21.718 -0.538  1.00 0.00 ? 31 VAL A HG11 5  
ATOM 2553  H HG12 . VAL A 1 31 ? 21.849  -22.728 -1.188  1.00 0.00 ? 31 VAL A HG12 5  
ATOM 2554  H HG13 . VAL A 1 31 ? 21.667  -20.958 -1.133  1.00 0.00 ? 31 VAL A HG13 5  
ATOM 2555  H HG21 . VAL A 1 31 ? 22.897  -20.571 1.617   1.00 0.00 ? 31 VAL A HG21 5  
ATOM 2556  H HG22 . VAL A 1 31 ? 21.402  -19.804 1.034   1.00 0.00 ? 31 VAL A HG22 5  
ATOM 2557  H HG23 . VAL A 1 31 ? 21.392  -20.739 2.549   1.00 0.00 ? 31 VAL A HG23 5  
ATOM 2558  N N    . ILE A 1 32 ? 19.639  -24.440 0.161   1.00 0.00 ? 32 ILE A N    5  
ATOM 2559  C CA   . ILE A 1 32 ? 19.380  -25.612 -0.672  1.00 0.00 ? 32 ILE A CA   5  
ATOM 2560  C C    . ILE A 1 32 ? 17.958  -25.578 -1.210  1.00 0.00 ? 32 ILE A C    5  
ATOM 2561  O O    . ILE A 1 32 ? 17.712  -25.879 -2.377  1.00 0.00 ? 32 ILE A O    5  
ATOM 2562  C CB   . ILE A 1 32 ? 19.555  -26.919 0.123   1.00 0.00 ? 32 ILE A CB   5  
ATOM 2563  C CG1  . ILE A 1 32 ? 21.021  -27.112 0.517   1.00 0.00 ? 32 ILE A CG1  5  
ATOM 2564  C CG2  . ILE A 1 32 ? 19.120  -28.113 -0.713  1.00 0.00 ? 32 ILE A CG2  5  
ATOM 2565  C CD1  . ILE A 1 32 ? 21.245  -28.236 1.505   1.00 0.00 ? 32 ILE A CD1  5  
ATOM 2566  H H    . ILE A 1 32 ? 19.812  -24.583 1.146   1.00 0.00 ? 32 ILE A H    5  
ATOM 2567  H HA   . ILE A 1 32 ? 20.082  -25.604 -1.505  1.00 0.00 ? 32 ILE A HA   5  
ATOM 2568  H HB   . ILE A 1 32 ? 18.943  -26.868 1.024   1.00 0.00 ? 32 ILE A HB   5  
ATOM 2569  H HG12 . ILE A 1 32 ? 21.593  -27.328 -0.385  1.00 0.00 ? 32 ILE A HG12 5  
ATOM 2570  H HG13 . ILE A 1 32 ? 21.381  -26.185 0.964   1.00 0.00 ? 32 ILE A HG13 5  
ATOM 2571  H HG21 . ILE A 1 32 ? 19.238  -29.030 -0.137  1.00 0.00 ? 32 ILE A HG21 5  
ATOM 2572  H HG22 . ILE A 1 32 ? 18.073  -27.996 -0.994  1.00 0.00 ? 32 ILE A HG22 5  
ATOM 2573  H HG23 . ILE A 1 32 ? 19.733  -28.168 -1.612  1.00 0.00 ? 32 ILE A HG23 5  
ATOM 2574  H HD11 . ILE A 1 32 ? 22.303  -28.327 1.747   1.00 0.00 ? 32 ILE A HD11 5  
ATOM 2575  H HD12 . ILE A 1 32 ? 20.686  -28.029 2.418   1.00 0.00 ? 32 ILE A HD12 5  
ATOM 2576  H HD13 . ILE A 1 32 ? 20.896  -29.172 1.070   1.00 0.00 ? 32 ILE A HD13 5  
ATOM 2577  N N    . LEU A 1 33 ? 17.024  -25.206 -0.340  1.00 0.00 ? 33 LEU A N    5  
ATOM 2578  C CA   . LEU A 1 33 ? 15.611  -25.124 -0.701  1.00 0.00 ? 33 LEU A CA   5  
ATOM 2579  C C    . LEU A 1 33 ? 15.401  -24.086 -1.792  1.00 0.00 ? 33 LEU A C    5  
ATOM 2580  O O    . LEU A 1 33 ? 14.731  -24.341 -2.792  1.00 0.00 ? 33 LEU A O    5  
ATOM 2581  C CB   . LEU A 1 33 ? 14.770  -24.727 0.514   1.00 0.00 ? 33 LEU A CB   5  
ATOM 2582  C CG   . LEU A 1 33 ? 14.604  -25.791 1.601   1.00 0.00 ? 33 LEU A CG   5  
ATOM 2583  C CD1  . LEU A 1 33 ? 13.859  -25.224 2.799   1.00 0.00 ? 33 LEU A CD1  5  
ATOM 2584  C CD2  . LEU A 1 33 ? 13.819  -26.981 1.072   1.00 0.00 ? 33 LEU A CD2  5  
ATOM 2585  H H    . LEU A 1 33 ? 17.289  -24.969 0.606   1.00 0.00 ? 33 LEU A H    5  
ATOM 2586  H HA   . LEU A 1 33 ? 15.284  -26.099 -1.062  1.00 0.00 ? 33 LEU A HA   5  
ATOM 2587  H HB2  . LEU A 1 33 ? 15.238  -23.855 0.971   1.00 0.00 ? 33 LEU A HB2  5  
ATOM 2588  H HB3  . LEU A 1 33 ? 13.775  -24.459 0.156   1.00 0.00 ? 33 LEU A HB3  5  
ATOM 2589  H HG   . LEU A 1 33 ? 15.591  -26.125 1.918   1.00 0.00 ? 33 LEU A HG   5  
ATOM 2590  H HD11 . LEU A 1 33 ? 13.756  -25.988 3.569   1.00 0.00 ? 33 LEU A HD11 5  
ATOM 2591  H HD12 . LEU A 1 33 ? 14.414  -24.377 3.203   1.00 0.00 ? 33 LEU A HD12 5  
ATOM 2592  H HD13 . LEU A 1 33 ? 12.868  -24.892 2.486   1.00 0.00 ? 33 LEU A HD13 5  
ATOM 2593  H HD21 . LEU A 1 33 ? 13.717  -27.736 1.852   1.00 0.00 ? 33 LEU A HD21 5  
ATOM 2594  H HD22 . LEU A 1 33 ? 12.828  -26.651 0.759   1.00 0.00 ? 33 LEU A HD22 5  
ATOM 2595  H HD23 . LEU A 1 33 ? 14.344  -27.411 0.220   1.00 0.00 ? 33 LEU A HD23 5  
ATOM 2596  N N    . ALA A 1 34 ? 15.984  -22.910 -1.586  1.00 0.00 ? 34 ALA A N    5  
ATOM 2597  C CA   . ALA A 1 34 ? 15.877  -21.808 -2.540  1.00 0.00 ? 34 ALA A CA   5  
ATOM 2598  C C    . ALA A 1 34 ? 16.427  -22.223 -3.895  1.00 0.00 ? 34 ALA A C    5  
ATOM 2599  O O    . ALA A 1 34 ? 15.860  -21.900 -4.938  1.00 0.00 ? 34 ALA A O    5  
ATOM 2600  C CB   . ALA A 1 34 ? 16.664  -20.603 -2.048  1.00 0.00 ? 34 ALA A CB   5  
ATOM 2601  H H    . ALA A 1 34 ? 16.521  -22.761 -0.744  1.00 0.00 ? 34 ALA A H    5  
ATOM 2602  H HA   . ALA A 1 34 ? 14.826  -21.535 -2.644  1.00 0.00 ? 34 ALA A HA   5  
ATOM 2603  H HB1  . ALA A 1 34 ? 16.565  -19.782 -2.759  1.00 0.00 ? 34 ALA A HB1  5  
ATOM 2604  H HB2  . ALA A 1 34 ? 16.277  -20.289 -1.078  1.00 0.00 ? 34 ALA A HB2  5  
ATOM 2605  H HB3  . ALA A 1 34 ? 17.715  -20.872 -1.950  1.00 0.00 ? 34 ALA A HB3  5  
ATOM 2606  N N    . VAL A 1 35 ? 17.544  -22.944 -3.866  1.00 0.00 ? 35 VAL A N    5  
ATOM 2607  C CA   . VAL A 1 35 ? 18.198  -23.419 -5.082  1.00 0.00 ? 35 VAL A CA   5  
ATOM 2608  C C    . VAL A 1 35 ? 17.229  -24.234 -5.923  1.00 0.00 ? 35 VAL A C    5  
ATOM 2609  O O    . VAL A 1 35 ? 17.163  -24.084 -7.142  1.00 0.00 ? 35 VAL A O    5  
ATOM 2610  C CB   . VAL A 1 35 ? 19.411  -24.311 -4.759  1.00 0.00 ? 35 VAL A CB   5  
ATOM 2611  C CG1  . VAL A 1 35 ? 19.947  -24.960 -6.025  1.00 0.00 ? 35 VAL A CG1  5  
ATOM 2612  C CG2  . VAL A 1 35 ? 20.526  -23.488 -4.132  1.00 0.00 ? 35 VAL A CG2  5  
ATOM 2613  H H    . VAL A 1 35 ? 17.963  -23.176 -2.977  1.00 0.00 ? 35 VAL A H    5  
ATOM 2614  H HA   . VAL A 1 35 ? 18.533  -22.553 -5.653  1.00 0.00 ? 35 VAL A HA   5  
ATOM 2615  H HB   . VAL A 1 35 ? 19.100  -25.087 -4.060  1.00 0.00 ? 35 VAL A HB   5  
ATOM 2616  H HG11 . VAL A 1 35 ? 20.798  -25.595 -5.783  1.00 0.00 ? 35 VAL A HG11 5  
ATOM 2617  H HG12 . VAL A 1 35 ? 19.163  -25.565 -6.482  1.00 0.00 ? 35 VAL A HG12 5  
ATOM 2618  H HG13 . VAL A 1 35 ? 20.261  -24.185 -6.724  1.00 0.00 ? 35 VAL A HG13 5  
ATOM 2619  H HG21 . VAL A 1 35 ? 21.374  -24.131 -3.900  1.00 0.00 ? 35 VAL A HG21 5  
ATOM 2620  H HG22 . VAL A 1 35 ? 20.840  -22.712 -4.830  1.00 0.00 ? 35 VAL A HG22 5  
ATOM 2621  H HG23 . VAL A 1 35 ? 20.162  -23.024 -3.215  1.00 0.00 ? 35 VAL A HG23 5  
ATOM 2622  N N    . ALA A 1 36 ? 16.476  -25.101 -5.253  1.00 0.00 ? 36 ALA A N    5  
ATOM 2623  C CA   . ALA A 1 36 ? 15.497  -25.959 -5.915  1.00 0.00 ? 36 ALA A CA   5  
ATOM 2624  C C    . ALA A 1 36 ? 14.386  -25.123 -6.529  1.00 0.00 ? 36 ALA A C    5  
ATOM 2625  O O    . ALA A 1 36 ? 13.995  -25.330 -7.677  1.00 0.00 ? 36 ALA A O    5  
ATOM 2626  C CB   . ALA A 1 36 ? 14.878  -26.925 -4.917  1.00 0.00 ? 36 ALA A CB   5  
ATOM 2627  H H    . ALA A 1 36 ? 16.577  -25.177 -4.251  1.00 0.00 ? 36 ALA A H    5  
ATOM 2628  H HA   . ALA A 1 36 ? 16.000  -26.523 -6.700  1.00 0.00 ? 36 ALA A HA   5  
ATOM 2629  H HB1  . ALA A 1 36 ? 14.160  -27.570 -5.424  1.00 0.00 ? 36 ALA A HB1  5  
ATOM 2630  H HB2  . ALA A 1 36 ? 15.662  -27.537 -4.471  1.00 0.00 ? 36 ALA A HB2  5  
ATOM 2631  H HB3  . ALA A 1 36 ? 14.368  -26.361 -4.135  1.00 0.00 ? 36 ALA A HB3  5  
ATOM 2632  N N    . GLY A 1 37 ? 13.883  -24.172 -5.747  1.00 0.00 ? 37 GLY A N    5  
ATOM 2633  C CA   . GLY A 1 37 ? 12.811  -23.285 -6.188  1.00 0.00 ? 37 GLY A CA   5  
ATOM 2634  C C    . GLY A 1 37 ? 13.140  -22.688 -7.547  1.00 0.00 ? 37 GLY A C    5  
ATOM 2635  O O    . GLY A 1 37 ? 12.410  -22.876 -8.519  1.00 0.00 ? 37 GLY A O    5  
ATOM 2636  H H    . GLY A 1 37 ? 14.248  -24.050 -4.813  1.00 0.00 ? 37 GLY A H    5  
ATOM 2637  H HA2  . GLY A 1 37 ? 11.882  -23.851 -6.259  1.00 0.00 ? 37 GLY A HA2  5  
ATOM 2638  H HA3  . GLY A 1 37 ? 12.688  -22.481 -5.462  1.00 0.00 ? 37 GLY A HA3  5  
ATOM 2639  N N    . LEU A 1 38 ? 14.254  -21.963 -7.601  1.00 0.00 ? 38 LEU A N    5  
ATOM 2640  C CA   . LEU A 1 38 ? 14.709  -21.322 -8.832  1.00 0.00 ? 38 LEU A CA   5  
ATOM 2641  C C    . LEU A 1 38 ? 14.961  -22.362 -9.911  1.00 0.00 ? 38 LEU A C    5  
ATOM 2642  O O    . LEU A 1 38 ? 14.651  -22.151 -11.082 1.00 0.00 ? 38 LEU A O    5  
ATOM 2643  C CB   . LEU A 1 38 ? 16.009  -20.554 -8.587  1.00 0.00 ? 38 LEU A CB   5  
ATOM 2644  C CG   . LEU A 1 38 ? 15.897  -19.281 -7.746  1.00 0.00 ? 38 LEU A CG   5  
ATOM 2645  C CD1  . LEU A 1 38 ? 17.272  -18.691 -7.476  1.00 0.00 ? 38 LEU A CD1  5  
ATOM 2646  C CD2  . LEU A 1 38 ? 15.064  -18.232 -8.467  1.00 0.00 ? 38 LEU A CD2  5  
ATOM 2647  H H    . LEU A 1 38 ? 14.812  -21.845 -6.768  1.00 0.00 ? 38 LEU A H    5  
ATOM 2648  H HA   . LEU A 1 38 ? 13.939  -20.628 -9.171  1.00 0.00 ? 38 LEU A HA   5  
ATOM 2649  H HB2  . LEU A 1 38 ? 16.701  -21.226 -8.081  1.00 0.00 ? 38 LEU A HB2  5  
ATOM 2650  H HB3  . LEU A 1 38 ? 16.417  -20.275 -9.558  1.00 0.00 ? 38 LEU A HB3  5  
ATOM 2651  H HG   . LEU A 1 38 ? 15.420  -19.528 -6.798  1.00 0.00 ? 38 LEU A HG   5  
ATOM 2652  H HD11 . LEU A 1 38 ? 17.178  -17.791 -6.868  1.00 0.00 ? 38 LEU A HD11 5  
ATOM 2653  H HD12 . LEU A 1 38 ? 17.881  -19.422 -6.945  1.00 0.00 ? 38 LEU A HD12 5  
ATOM 2654  H HD13 . LEU A 1 38 ? 17.749  -18.438 -8.422  1.00 0.00 ? 38 LEU A HD13 5  
ATOM 2655  H HD21 . LEU A 1 38 ? 14.982  -17.335 -7.853  1.00 0.00 ? 38 LEU A HD21 5  
ATOM 2656  H HD22 . LEU A 1 38 ? 15.541  -17.978 -9.413  1.00 0.00 ? 38 LEU A HD22 5  
ATOM 2657  H HD23 . LEU A 1 38 ? 14.067  -18.630 -8.658  1.00 0.00 ? 38 LEU A HD23 5  
ATOM 2658  N N    . ILE A 1 39 ? 15.528  -23.492 -9.500  1.00 0.00 ? 39 ILE A N    5  
ATOM 2659  C CA   . ILE A 1 39 ? 15.834  -24.589 -10.413 1.00 0.00 ? 39 ILE A CA   5  
ATOM 2660  C C    . ILE A 1 39 ? 14.572  -25.072 -11.108 1.00 0.00 ? 39 ILE A C    5  
ATOM 2661  O O    . ILE A 1 39 ? 14.561  -25.306 -12.316 1.00 0.00 ? 39 ILE A O    5  
ATOM 2662  C CB   . ILE A 1 39 ? 16.452  -25.787 -9.669  1.00 0.00 ? 39 ILE A CB   5  
ATOM 2663  C CG1  . ILE A 1 39 ? 17.838  -25.425 -9.132  1.00 0.00 ? 39 ILE A CG1  5  
ATOM 2664  C CG2  . ILE A 1 39 ? 16.593  -26.979 -10.603 1.00 0.00 ? 39 ILE A CG2  5  
ATOM 2665  C CD1  . ILE A 1 39 ? 18.829  -25.041 -10.210 1.00 0.00 ? 39 ILE A CD1  5  
ATOM 2666  H H    . ILE A 1 39 ? 15.758  -23.606 -8.523  1.00 0.00 ? 39 ILE A H    5  
ATOM 2667  H HA   . ILE A 1 39 ? 16.542  -24.228 -11.159 1.00 0.00 ? 39 ILE A HA   5  
ATOM 2668  H HB   . ILE A 1 39 ? 15.802  -26.057 -8.836  1.00 0.00 ? 39 ILE A HB   5  
ATOM 2669  H HG12 . ILE A 1 39 ? 17.732  -24.583 -8.447  1.00 0.00 ? 39 ILE A HG12 5  
ATOM 2670  H HG13 . ILE A 1 39 ? 18.233  -26.285 -8.593  1.00 0.00 ? 39 ILE A HG13 5  
ATOM 2671  H HG21 . ILE A 1 39 ? 17.021  -27.823 -10.063 1.00 0.00 ? 39 ILE A HG21 5  
ATOM 2672  H HG22 . ILE A 1 39 ? 15.611  -27.256 -10.987 1.00 0.00 ? 39 ILE A HG22 5  
ATOM 2673  H HG23 . ILE A 1 39 ? 17.245  -26.712 -11.434 1.00 0.00 ? 39 ILE A HG23 5  
ATOM 2674  H HD11 . ILE A 1 39 ? 19.795  -24.792 -9.770  1.00 0.00 ? 39 ILE A HD11 5  
ATOM 2675  H HD12 . ILE A 1 39 ? 18.954  -25.876 -10.898 1.00 0.00 ? 39 ILE A HD12 5  
ATOM 2676  H HD13 . ILE A 1 39 ? 18.451  -24.175 -10.754 1.00 0.00 ? 39 ILE A HD13 5  
ATOM 2677  N N    . TYR A 1 40 ? 13.506  -25.219 -10.326 1.00 0.00 ? 40 TYR A N    5  
ATOM 2678  C CA   . TYR A 1 40 ? 12.218  -25.675 -10.841 1.00 0.00 ? 40 TYR A CA   5  
ATOM 2679  C C    . TYR A 1 40 ? 11.601  -24.619 -11.742 1.00 0.00 ? 40 TYR A C    5  
ATOM 2680  O O    . TYR A 1 40 ? 11.043  -24.928 -12.794 1.00 0.00 ? 40 TYR A O    5  
ATOM 2681  C CB   . TYR A 1 40 ? 11.249  -25.954 -9.690  1.00 0.00 ? 40 TYR A CB   5  
ATOM 2682  C CG   . TYR A 1 40 ? 9.896   -26.458 -10.137 1.00 0.00 ? 40 TYR A CG   5  
ATOM 2683  C CD1  . TYR A 1 40 ? 9.722   -27.779 -10.528 1.00 0.00 ? 40 TYR A CD1  5  
ATOM 2684  C CD2  . TYR A 1 40 ? 8.796   -25.610 -10.168 1.00 0.00 ? 40 TYR A CD2  5  
ATOM 2685  C CE1  . TYR A 1 40 ? 8.488   -28.248 -10.938 1.00 0.00 ? 40 TYR A CE1  5  
ATOM 2686  C CE2  . TYR A 1 40 ? 7.555   -26.061 -10.575 1.00 0.00 ? 40 TYR A CE2  5  
ATOM 2687  C CZ   . TYR A 1 40 ? 7.408   -27.393 -10.962 1.00 0.00 ? 40 TYR A CZ   5  
ATOM 2688  O OH   . TYR A 1 40 ? 6.179   -27.857 -11.370 1.00 0.00 ? 40 TYR A OH   5  
ATOM 2689  H H    . TYR A 1 40 ? 13.579  -25.012 -9.340  1.00 0.00 ? 40 TYR A H    5  
ATOM 2690  H HA   . TYR A 1 40 ? 12.373  -26.590 -11.411 1.00 0.00 ? 40 TYR A HA   5  
ATOM 2691  H HB2  . TYR A 1 40 ? 11.696  -26.700 -9.033  1.00 0.00 ? 40 TYR A HB2  5  
ATOM 2692  H HB3  . TYR A 1 40 ? 11.105  -25.032 -9.126  1.00 0.00 ? 40 TYR A HB3  5  
ATOM 2693  H HD1  . TYR A 1 40 ? 10.566  -28.452 -10.511 1.00 0.00 ? 40 TYR A HD1  5  
ATOM 2694  H HD2  . TYR A 1 40 ? 8.913   -24.579 -9.868  1.00 0.00 ? 40 TYR A HD2  5  
ATOM 2695  H HE1  . TYR A 1 40 ? 8.370   -29.278 -11.238 1.00 0.00 ? 40 TYR A HE1  5  
ATOM 2696  H HE2  . TYR A 1 40 ? 6.708   -25.390 -10.593 1.00 0.00 ? 40 TYR A HE2  5  
ATOM 2697  H HH   . TYR A 1 40 ? 5.496   -27.182 -11.350 1.00 0.00 ? 40 TYR A HH   5  
ATOM 2698  N N    . SER A 1 41 ? 11.707  -23.364 -11.314 1.00 0.00 ? 41 SER A N    5  
ATOM 2699  C CA   . SER A 1 41 ? 11.167  -22.235 -12.065 1.00 0.00 ? 41 SER A CA   5  
ATOM 2700  C C    . SER A 1 41 ? 11.804  -22.158 -13.443 1.00 0.00 ? 41 SER A C    5  
ATOM 2701  O O    . SER A 1 41 ? 11.116  -22.054 -14.457 1.00 0.00 ? 41 SER A O    5  
ATOM 2702  C CB   . SER A 1 41 ? 11.444  -20.922 -11.331 1.00 0.00 ? 41 SER A CB   5  
ATOM 2703  O OG   . SER A 1 41 ? 10.740  -20.866 -10.102 1.00 0.00 ? 41 SER A OG   5  
ATOM 2704  H H    . SER A 1 41 ? 12.176  -23.174 -10.440 1.00 0.00 ? 41 SER A H    5  
ATOM 2705  H HA   . SER A 1 41 ? 10.090  -22.368 -12.171 1.00 0.00 ? 41 SER A HA   5  
ATOM 2706  H HB2  . SER A 1 41 ? 12.512  -20.843 -11.132 1.00 0.00 ? 41 SER A HB2  5  
ATOM 2707  H HB3  . SER A 1 41 ? 11.128  -20.089 -11.959 1.00 0.00 ? 41 SER A HB3  5  
ATOM 2708  H HG   . SER A 1 41 ? 10.935  -20.032 -9.668  1.00 0.00 ? 41 SER A HG   5  
ATOM 2709  N N    . MET A 1 42 ? 13.133  -22.210 -13.465 1.00 0.00 ? 42 MET A N    5  
ATOM 2710  C CA   . MET A 1 42 ? 13.895  -22.148 -14.709 1.00 0.00 ? 42 MET A CA   5  
ATOM 2711  C C    . MET A 1 42 ? 13.589  -23.354 -15.582 1.00 0.00 ? 42 MET A C    5  
ATOM 2712  O O    . MET A 1 42 ? 13.442  -23.239 -16.798 1.00 0.00 ? 42 MET A O    5  
ATOM 2713  C CB   . MET A 1 42 ? 15.397  -22.131 -14.417 1.00 0.00 ? 42 MET A CB   5  
ATOM 2714  C CG   . MET A 1 42 ? 16.268  -21.983 -15.654 1.00 0.00 ? 42 MET A CG   5  
ATOM 2715  S SD   . MET A 1 42 ? 18.028  -21.936 -15.264 1.00 0.00 ? 42 MET A SD   5  
ATOM 2716  C CE   . MET A 1 42 ? 18.310  -23.633 -14.768 1.00 0.00 ? 42 MET A CE   5  
ATOM 2717  H H    . MET A 1 42 ? 13.642  -22.293 -12.597 1.00 0.00 ? 42 MET A H    5  
ATOM 2718  H HA   . MET A 1 42 ? 13.621  -21.237 -15.242 1.00 0.00 ? 42 MET A HA   5  
ATOM 2719  H HB2  . MET A 1 42 ? 15.606  -21.296 -13.748 1.00 0.00 ? 42 MET A HB2  5  
ATOM 2720  H HB3  . MET A 1 42 ? 15.660  -23.066 -13.923 1.00 0.00 ? 42 MET A HB3  5  
ATOM 2721  H HG2  . MET A 1 42 ? 16.078  -22.823 -16.321 1.00 0.00 ? 42 MET A HG2  5  
ATOM 2722  H HG3  . MET A 1 42 ? 15.997  -21.060 -16.168 1.00 0.00 ? 42 MET A HG3  5  
ATOM 2723  H HE1  . MET A 1 42 ? 19.355  -23.771 -14.494 1.00 0.00 ? 42 MET A HE1  5  
ATOM 2724  H HE2  . MET A 1 42 ? 17.678  -23.869 -13.911 1.00 0.00 ? 42 MET A HE2  5  
ATOM 2725  H HE3  . MET A 1 42 ? 18.063  -24.298 -15.596 1.00 0.00 ? 42 MET A HE3  5  
ATOM 2726  N N    . LEU A 1 43 ? 13.495  -24.517 -14.943 1.00 0.00 ? 43 LEU A N    5  
ATOM 2727  C CA   . LEU A 1 43 ? 13.205  -25.768 -15.637 1.00 0.00 ? 43 LEU A CA   5  
ATOM 2728  C C    . LEU A 1 43 ? 11.738  -25.832 -16.028 1.00 0.00 ? 43 LEU A C    5  
ATOM 2729  O O    . LEU A 1 43 ? 11.390  -26.285 -17.117 1.00 0.00 ? 43 LEU A O    5  
ATOM 2730  C CB   . LEU A 1 43 ? 13.518  -26.965 -14.737 1.00 0.00 ? 43 LEU A CB   5  
ATOM 2731  C CG   . LEU A 1 43 ? 14.998  -27.236 -14.460 1.00 0.00 ? 43 LEU A CG   5  
ATOM 2732  C CD1  . LEU A 1 43 ? 15.159  -28.367 -13.456 1.00 0.00 ? 43 LEU A CD1  5  
ATOM 2733  C CD2  . LEU A 1 43 ? 15.722  -27.629 -15.739 1.00 0.00 ? 43 LEU A CD2  5  
ATOM 2734  H H    . LEU A 1 43 ? 13.627  -24.546 -13.942 1.00 0.00 ? 43 LEU A H    5  
ATOM 2735  H HA   . LEU A 1 43 ? 13.821  -25.821 -16.534 1.00 0.00 ? 43 LEU A HA   5  
ATOM 2736  H HB2  . LEU A 1 43 ? 13.025  -26.797 -13.779 1.00 0.00 ? 43 LEU A HB2  5  
ATOM 2737  H HB3  . LEU A 1 43 ? 13.100  -27.853 -15.210 1.00 0.00 ? 43 LEU A HB3  5  
ATOM 2738  H HG   . LEU A 1 43 ? 15.450  -26.330 -14.056 1.00 0.00 ? 43 LEU A HG   5  
ATOM 2739  H HD11 . LEU A 1 43 ? 16.216  -28.542 -13.259 1.00 0.00 ? 43 LEU A HD11 5  
ATOM 2740  H HD12 . LEU A 1 43 ? 14.659  -28.098 -12.525 1.00 0.00 ? 43 LEU A HD12 5  
ATOM 2741  H HD13 . LEU A 1 43 ? 14.711  -29.275 -13.859 1.00 0.00 ? 43 LEU A HD13 5  
ATOM 2742  H HD21 . LEU A 1 43 ? 16.776  -27.807 -15.530 1.00 0.00 ? 43 LEU A HD21 5  
ATOM 2743  H HD22 . LEU A 1 43 ? 15.275  -28.537 -16.143 1.00 0.00 ? 43 LEU A HD22 5  
ATOM 2744  H HD23 . LEU A 1 43 ? 15.630  -26.824 -16.468 1.00 0.00 ? 43 LEU A HD23 5  
ATOM 2745  N N    . ARG A 1 44 ? 10.881  -25.372 -15.122 1.00 0.00 ? 44 ARG A N    5  
ATOM 2746  C CA   . ARG A 1 44 ? 9.438   -25.365 -15.345 1.00 0.00 ? 44 ARG A CA   5  
ATOM 2747  C C    . ARG A 1 44 ? 9.032   -24.152 -16.166 1.00 0.00 ? 44 ARG A C    5  
ATOM 2748  O O    . ARG A 1 44 ? 8.096   -24.207 -16.962 1.00 0.00 ? 44 ARG A O    5  
ATOM 2749  C CB   . ARG A 1 44 ? 8.690   -25.318 -14.011 1.00 0.00 ? 44 ARG A CB   5  
ATOM 2750  C CG   . ARG A 1 44 ? 7.178   -25.400 -14.144 1.00 0.00 ? 44 ARG A CG   5  
ATOM 2751  C CD   . ARG A 1 44 ? 6.742   -26.759 -14.669 1.00 0.00 ? 44 ARG A CD   5  
ATOM 2752  N NE   . ARG A 1 44 ? 5.290   -26.860 -14.788 1.00 0.00 ? 44 ARG A NE   5  
ATOM 2753  C CZ   . ARG A 1 44 ? 4.657   -27.871 -15.373 1.00 0.00 ? 44 ARG A CZ   5  
ATOM 2754  N NH1  . ARG A 1 44 ? 5.349   -28.873 -15.896 1.00 0.00 ? 44 ARG A NH1  5  
ATOM 2755  N NH2  . ARG A 1 44 ? 3.332   -27.877 -15.434 1.00 0.00 ? 44 ARG A NH2  5  
ATOM 2756  H H    . ARG A 1 44 ? 11.229  -25.013 -14.245 1.00 0.00 ? 44 ARG A H    5  
ATOM 2757  H HA   . ARG A 1 44 ? 9.162   -26.273 -15.881 1.00 0.00 ? 44 ARG A HA   5  
ATOM 2758  H HB2  . ARG A 1 44 ? 9.026   -26.156 -13.400 1.00 0.00 ? 44 ARG A HB2  5  
ATOM 2759  H HB3  . ARG A 1 44 ? 8.939   -24.381 -13.512 1.00 0.00 ? 44 ARG A HB3  5  
ATOM 2760  H HG2  . ARG A 1 44 ? 6.726   -25.236 -13.165 1.00 0.00 ? 44 ARG A HG2  5  
ATOM 2761  H HG3  . ARG A 1 44 ? 6.839   -24.627 -14.834 1.00 0.00 ? 44 ARG A HG3  5  
ATOM 2762  H HD2  . ARG A 1 44 ? 7.188   -26.918 -15.651 1.00 0.00 ? 44 ARG A HD2  5  
ATOM 2763  H HD3  . ARG A 1 44 ? 7.094   -27.531 -13.986 1.00 0.00 ? 44 ARG A HD3  5  
ATOM 2764  H HE   . ARG A 1 44 ? 4.741   -26.107 -14.397 1.00 0.00 ? 44 ARG A HE   5  
ATOM 2765  H HH11 . ARG A 1 44 ? 6.357   -28.868 -15.849 1.00 0.00 ? 44 ARG A HH11 5  
ATOM 2766  H HH12 . ARG A 1 44 ? 4.867   -29.641 -16.341 1.00 0.00 ? 44 ARG A HH12 5  
ATOM 2767  H HH21 . ARG A 1 44 ? 2.804   -27.113 -15.036 1.00 0.00 ? 44 ARG A HH21 5  
ATOM 2768  H HH22 . ARG A 1 44 ? 2.850   -28.645 -15.879 1.00 0.00 ? 44 ARG A HH22 5  
ATOM 2769  N N    . LYS A 1 45 ? 9.752   -23.053 -15.960 1.00 0.00 ? 45 LYS A N    5  
ATOM 2770  C CA   . LYS A 1 45 ? 9.489   -21.804 -16.670 1.00 0.00 ? 45 LYS A CA   5  
ATOM 2771  C C    . LYS A 1 45 ? 9.950   -21.905 -18.114 1.00 0.00 ? 45 LYS A C    5  
ATOM 2772  O O    . LYS A 1 45 ? 9.234   -21.527 -19.039 1.00 0.00 ? 45 LYS A O    5  
ATOM 2773  C CB   . LYS A 1 45 ? 10.232  -20.643 -16.006 1.00 0.00 ? 45 LYS A CB   5  
ATOM 2774  C CG   . LYS A 1 45 ? 9.973   -19.291 -16.649 1.00 0.00 ? 45 LYS A CG   5  
ATOM 2775  C CD   . LYS A 1 45 ? 10.696  -18.179 -15.907 1.00 0.00 ? 45 LYS A CD   5  
ATOM 2776  C CE   . LYS A 1 45 ? 10.449  -16.828 -16.559 1.00 0.00 ? 45 LYS A CE   5  
ATOM 2777  N NZ   . LYS A 1 45 ? 11.141  -15.727 -15.835 1.00 0.00 ? 45 LYS A NZ   5  
ATOM 2778  H H    . LYS A 1 45 ? 10.509  -23.071 -15.292 1.00 0.00 ? 45 LYS A H    5  
ATOM 2779  H HA   . LYS A 1 45 ? 8.417   -21.606 -16.645 1.00 0.00 ? 45 LYS A HA   5  
ATOM 2780  H HB2  . LYS A 1 45 ? 9.921   -20.590 -14.962 1.00 0.00 ? 45 LYS A HB2  5  
ATOM 2781  H HB3  . LYS A 1 45 ? 11.301  -20.847 -16.057 1.00 0.00 ? 45 LYS A HB3  5  
ATOM 2782  H HG2  . LYS A 1 45 ? 10.323  -19.315 -17.681 1.00 0.00 ? 45 LYS A HG2  5  
ATOM 2783  H HG3  . LYS A 1 45 ? 8.901   -19.089 -16.634 1.00 0.00 ? 45 LYS A HG3  5  
ATOM 2784  H HD2  . LYS A 1 45 ? 10.337  -18.147 -14.878 1.00 0.00 ? 45 LYS A HD2  5  
ATOM 2785  H HD3  . LYS A 1 45 ? 11.766  -18.385 -15.913 1.00 0.00 ? 45 LYS A HD3  5  
ATOM 2786  H HE2  . LYS A 1 45 ? 10.812  -16.859 -17.586 1.00 0.00 ? 45 LYS A HE2  5  
ATOM 2787  H HE3  . LYS A 1 45 ? 9.377   -16.628 -16.564 1.00 0.00 ? 45 LYS A HE3  5  
ATOM 2788  H HZ1  . LYS A 1 45 ? 10.955  -14.846 -16.294 1.00 0.00 ? 45 LYS A HZ1  5  
ATOM 2789  H HZ2  . LYS A 1 45 ? 10.803  -15.686 -14.884 1.00 0.00 ? 45 LYS A HZ2  5  
ATOM 2790  H HZ3  . LYS A 1 45 ? 12.135  -15.900 -15.832 1.00 0.00 ? 45 LYS A HZ3  5  
ATOM 2791  N N    . ALA A 1 46 ? 11.162  -22.423 -18.295 1.00 0.00 ? 46 ALA A N    5  
ATOM 2792  C CA   . ALA A 1 46 ? 11.750  -22.588 -19.621 1.00 0.00 ? 46 ALA A CA   5  
ATOM 2793  C C    . ALA A 1 46 ? 13.135  -23.205 -19.497 1.00 0.00 ? 46 ALA A C    5  
ATOM 2794  O O    . ALA A 1 46 ? 13.597  -23.486 -18.394 1.00 0.00 ? 46 ALA A O    5  
ATOM 2795  C CB   . ALA A 1 46 ? 11.822  -21.232 -20.317 1.00 0.00 ? 46 ALA A CB   5  
ATOM 2796  H H    . ALA A 1 46 ? 11.703  -22.714 -17.494 1.00 0.00 ? 46 ALA A H    5  
ATOM 2797  H HA   . ALA A 1 46 ? 11.116  -23.253 -20.207 1.00 0.00 ? 46 ALA A HA   5  
ATOM 2798  H HB1  . ALA A 1 46 ? 12.247  -21.358 -21.313 1.00 0.00 ? 46 ALA A HB1  5  
ATOM 2799  H HB2  . ALA A 1 46 ? 10.820  -20.811 -20.400 1.00 0.00 ? 46 ALA A HB2  5  
ATOM 2800  H HB3  . ALA A 1 46 ? 12.451  -20.558 -19.735 1.00 0.00 ? 46 ALA A HB3  5  
ATOM 2801  N N    . GLY A 1 1  ? 2.291   9.487   42.272  1.00 0.00 ? 1  GLY A N    6  
ATOM 2802  C CA   . GLY A 1 1  ? 3.141   10.660  42.315  1.00 0.00 ? 1  GLY A CA   6  
ATOM 2803  C C    . GLY A 1 1  ? 4.157   10.608  41.185  1.00 0.00 ? 1  GLY A C    6  
ATOM 2804  O O    . GLY A 1 1  ? 4.176   9.665   40.398  1.00 0.00 ? 1  GLY A O    6  
ATOM 2805  H H1   . GLY A 1 1  ? 2.449   8.803   41.546  1.00 0.00 ? 1  GLY A H1   6  
ATOM 2806  H HA2  . GLY A 1 1  ? 2.527   11.555  42.209  1.00 0.00 ? 1  GLY A HA2  6  
ATOM 2807  H HA3  . GLY A 1 1  ? 3.664   10.693  43.271  1.00 0.00 ? 1  GLY A HA3  6  
ATOM 2808  N N    . VAL A 1 2  ? 4.998   11.637  41.120  1.00 0.00 ? 2  VAL A N    6  
ATOM 2809  C CA   . VAL A 1 2  ? 6.031   11.737  40.094  1.00 0.00 ? 2  VAL A CA   6  
ATOM 2810  C C    . VAL A 1 2  ? 7.113   10.695  40.325  1.00 0.00 ? 2  VAL A C    6  
ATOM 2811  O O    . VAL A 1 2  ? 7.569   10.034  39.393  1.00 0.00 ? 2  VAL A O    6  
ATOM 2812  C CB   . VAL A 1 2  ? 6.700   13.124  40.100  1.00 0.00 ? 2  VAL A CB   6  
ATOM 2813  C CG1  . VAL A 1 2  ? 7.893   13.144  39.156  1.00 0.00 ? 2  VAL A CG1  6  
ATOM 2814  C CG2  . VAL A 1 2  ? 5.715   14.193  39.653  1.00 0.00 ? 2  VAL A CG2  6  
ATOM 2815  H H    . VAL A 1 2  ? 4.927   12.381  41.800  1.00 0.00 ? 2  VAL A H    6  
ATOM 2816  H HA   . VAL A 1 2  ? 5.568   11.568  39.122  1.00 0.00 ? 2  VAL A HA   6  
ATOM 2817  H HB   . VAL A 1 2  ? 7.038   13.348  41.112  1.00 0.00 ? 2  VAL A HB   6  
ATOM 2818  H HG11 . VAL A 1 2  ? 8.363   14.127  39.175  1.00 0.00 ? 2  VAL A HG11 6  
ATOM 2819  H HG12 . VAL A 1 2  ? 8.616   12.392  39.470  1.00 0.00 ? 2  VAL A HG12 6  
ATOM 2820  H HG13 . VAL A 1 2  ? 7.556   12.925  38.143  1.00 0.00 ? 2  VAL A HG13 6  
ATOM 2821  H HG21 . VAL A 1 2  ? 6.197   15.171  39.670  1.00 0.00 ? 2  VAL A HG21 6  
ATOM 2822  H HG22 . VAL A 1 2  ? 5.377   13.974  38.640  1.00 0.00 ? 2  VAL A HG22 6  
ATOM 2823  H HG23 . VAL A 1 2  ? 4.858   14.201  40.327  1.00 0.00 ? 2  VAL A HG23 6  
ATOM 2824  N N    . ILE A 1 3  ? 7.519   10.557  41.584  1.00 0.00 ? 3  ILE A N    6  
ATOM 2825  C CA   . ILE A 1 3  ? 8.550   9.600   41.971  1.00 0.00 ? 3  ILE A CA   6  
ATOM 2826  C C    . ILE A 1 3  ? 8.060   8.176   41.763  1.00 0.00 ? 3  ILE A C    6  
ATOM 2827  O O    . ILE A 1 3  ? 8.806   7.305   41.319  1.00 0.00 ? 3  ILE A O    6  
ATOM 2828  C CB   . ILE A 1 3  ? 8.937   9.756   43.454  1.00 0.00 ? 3  ILE A CB   6  
ATOM 2829  C CG1  . ILE A 1 3  ? 9.630   11.100  43.686  1.00 0.00 ? 3  ILE A CG1  6  
ATOM 2830  C CG2  . ILE A 1 3  ? 9.886   8.645   43.876  1.00 0.00 ? 3  ILE A CG2  6  
ATOM 2831  C CD1  . ILE A 1 3  ? 9.823   11.443  45.146  1.00 0.00 ? 3  ILE A CD1  6  
ATOM 2832  H H    . ILE A 1 3  ? 7.104   11.130  42.306  1.00 0.00 ? 3  ILE A H    6  
ATOM 2833  H HA   . ILE A 1 3  ? 9.430   9.774   41.352  1.00 0.00 ? 3  ILE A HA   6  
ATOM 2834  H HB   . ILE A 1 3  ? 8.033   9.708   44.062  1.00 0.00 ? 3  ILE A HB   6  
ATOM 2835  H HG12 . ILE A 1 3  ? 10.609  11.070  43.208  1.00 0.00 ? 3  ILE A HG12 6  
ATOM 2836  H HG13 . ILE A 1 3  ? 9.025   11.883  43.227  1.00 0.00 ? 3  ILE A HG13 6  
ATOM 2837  H HG21 . ILE A 1 3  ? 10.144  8.760   44.929  1.00 0.00 ? 3  ILE A HG21 6  
ATOM 2838  H HG22 . ILE A 1 3  ? 9.402   7.680   43.726  1.00 0.00 ? 3  ILE A HG22 6  
ATOM 2839  H HG23 . ILE A 1 3  ? 10.792  8.695   43.274  1.00 0.00 ? 3  ILE A HG23 6  
ATOM 2840  H HD11 . ILE A 1 3  ? 10.320  12.408  45.250  1.00 0.00 ? 3  ILE A HD11 6  
ATOM 2841  H HD12 . ILE A 1 3  ? 8.850   11.489  45.637  1.00 0.00 ? 3  ILE A HD12 6  
ATOM 2842  H HD13 . ILE A 1 3  ? 10.433  10.674  45.619  1.00 0.00 ? 3  ILE A HD13 6  
ATOM 2843  N N    . ASP A 1 4  ? 6.791   7.952   42.091  1.00 0.00 ? 4  ASP A N    6  
ATOM 2844  C CA   . ASP A 1 4  ? 6.170   6.639   41.951  1.00 0.00 ? 4  ASP A CA   6  
ATOM 2845  C C    . ASP A 1 4  ? 6.381   6.097   40.546  1.00 0.00 ? 4  ASP A C    6  
ATOM 2846  O O    . ASP A 1 4  ? 6.649   4.912   40.355  1.00 0.00 ? 4  ASP A O    6  
ATOM 2847  C CB   . ASP A 1 4  ? 4.665   6.727   42.214  1.00 0.00 ? 4  ASP A CB   6  
ATOM 2848  C CG   . ASP A 1 4  ? 4.343   6.962   43.677  1.00 0.00 ? 4  ASP A CG   6  
ATOM 2849  O OD1  . ASP A 1 4  ? 3.148   6.904   44.038  1.00 0.00 ? 4  ASP A OD1  6  
ATOM 2850  O OD2  . ASP A 1 4  ? 5.284   7.203   44.462  1.00 0.00 ? 4  ASP A OD2  6  
ATOM 2851  H H    . ASP A 1 4  ? 6.228   8.710   42.451  1.00 0.00 ? 4  ASP A H    6  
ATOM 2852  H HA   . ASP A 1 4  ? 6.622   5.959   42.673  1.00 0.00 ? 4  ASP A HA   6  
ATOM 2853  H HB2  . ASP A 1 4  ? 4.253   7.550   41.628  1.00 0.00 ? 4  ASP A HB2  6  
ATOM 2854  H HB3  . ASP A 1 4  ? 4.198   5.794   41.898  1.00 0.00 ? 4  ASP A HB3  6  
ATOM 2855  H HD2  . ASP A 1 4  ? 5.008   7.341   45.371  1.00 0.00 ? 4  ASP A HD2  6  
ATOM 2856  N N    . THR A 1 5  ? 6.256   6.985   39.563  1.00 0.00 ? 5  THR A N    6  
ATOM 2857  C CA   . THR A 1 5  ? 6.427   6.623   38.159  1.00 0.00 ? 5  THR A CA   6  
ATOM 2858  C C    . THR A 1 5  ? 7.852   6.904   37.708  1.00 0.00 ? 5  THR A C    6  
ATOM 2859  O O    . THR A 1 5  ? 8.218   6.650   36.562  1.00 0.00 ? 5  THR A O    6  
ATOM 2860  C CB   . THR A 1 5  ? 5.475   7.423   37.250  1.00 0.00 ? 5  THR A CB   6  
ATOM 2861  O OG1  . THR A 1 5  ? 5.764   8.822   37.364  1.00 0.00 ? 5  THR A OG1  6  
ATOM 2862  C CG2  . THR A 1 5  ? 4.028   7.184   37.652  1.00 0.00 ? 5  THR A CG2  6  
ATOM 2863  H H    . THR A 1 5  ? 6.035   7.946   39.785  1.00 0.00 ? 5  THR A H    6  
ATOM 2864  H HA   . THR A 1 5  ? 6.215   5.560   38.049  1.00 0.00 ? 5  THR A HA   6  
ATOM 2865  H HB   . THR A 1 5  ? 5.618   7.107   36.217  1.00 0.00 ? 5  THR A HB   6  
ATOM 2866  H HG1  . THR A 1 5  ? 5.169   9.306   36.787  1.00 0.00 ? 5  THR A HG1  6  
ATOM 2867  H HG21 . THR A 1 5  ? 3.365   7.754   37.000  1.00 0.00 ? 5  THR A HG21 6  
ATOM 2868  H HG22 . THR A 1 5  ? 3.797   6.123   37.563  1.00 0.00 ? 5  THR A HG22 6  
ATOM 2869  H HG23 . THR A 1 5  ? 3.881   7.503   38.684  1.00 0.00 ? 5  THR A HG23 6  
ATOM 2870  N N    . SER A 1 6  ? 8.652   7.433   38.629  1.00 0.00 ? 6  SER A N    6  
ATOM 2871  C CA   . SER A 1 6  ? 10.048  7.761   38.353  1.00 0.00 ? 6  SER A CA   6  
ATOM 2872  C C    . SER A 1 6  ? 10.748  6.590   37.681  1.00 0.00 ? 6  SER A C    6  
ATOM 2873  O O    . SER A 1 6  ? 11.250  6.705   36.564  1.00 0.00 ? 6  SER A O    6  
ATOM 2874  C CB   . SER A 1 6  ? 10.789  8.086   39.652  1.00 0.00 ? 6  SER A CB   6  
ATOM 2875  O OG   . SER A 1 6  ? 12.148  8.398   39.399  1.00 0.00 ? 6  SER A OG   6  
ATOM 2876  H H    . SER A 1 6  ? 8.292   7.618   39.555  1.00 0.00 ? 6  SER A H    6  
ATOM 2877  H HA   . SER A 1 6  ? 10.079  8.629   37.693  1.00 0.00 ? 6  SER A HA   6  
ATOM 2878  H HB2  . SER A 1 6  ? 10.311  8.941   40.131  1.00 0.00 ? 6  SER A HB2  6  
ATOM 2879  H HB3  . SER A 1 6  ? 10.740  7.223   40.316  1.00 0.00 ? 6  SER A HB3  6  
ATOM 2880  H HG   . SER A 1 6  ? 12.582  8.597   40.232  1.00 0.00 ? 6  SER A HG   6  
ATOM 2881  N N    . ALA A 1 7  ? 10.774  5.459   38.380  1.00 0.00 ? 7  ALA A N    6  
ATOM 2882  C CA   . ALA A 1 7  ? 11.407  4.244   37.874  1.00 0.00 ? 7  ALA A CA   6  
ATOM 2883  C C    . ALA A 1 7  ? 10.749  3.801   36.577  1.00 0.00 ? 7  ALA A C    6  
ATOM 2884  O O    . ALA A 1 7  ? 11.420  3.390   35.631  1.00 0.00 ? 7  ALA A O    6  
ATOM 2885  C CB   . ALA A 1 7  ? 11.279  3.118   38.888  1.00 0.00 ? 7  ALA A CB   6  
ATOM 2886  H H    . ALA A 1 7  ? 10.344  5.429   39.294  1.00 0.00 ? 7  ALA A H    6  
ATOM 2887  H HA   . ALA A 1 7  ? 12.462  4.449   37.693  1.00 0.00 ? 7  ALA A HA   6  
ATOM 2888  H HB1  . ALA A 1 7  ? 11.767  2.221   38.507  1.00 0.00 ? 7  ALA A HB1  6  
ATOM 2889  H HB2  . ALA A 1 7  ? 11.752  3.418   39.824  1.00 0.00 ? 7  ALA A HB2  6  
ATOM 2890  H HB3  . ALA A 1 7  ? 10.224  2.909   39.065  1.00 0.00 ? 7  ALA A HB3  6  
ATOM 2891  N N    . VAL A 1 8  ? 9.422   3.891   36.546  1.00 0.00 ? 8  VAL A N    6  
ATOM 2892  C CA   . VAL A 1 8  ? 8.642   3.505   35.374  1.00 0.00 ? 8  VAL A CA   6  
ATOM 2893  C C    . VAL A 1 8  ? 8.991   4.388   34.188  1.00 0.00 ? 8  VAL A C    6  
ATOM 2894  O O    . VAL A 1 8  ? 9.124   3.916   33.060  1.00 0.00 ? 8  VAL A O    6  
ATOM 2895  C CB   . VAL A 1 8  ? 7.130   3.637   35.634  1.00 0.00 ? 8  VAL A CB   6  
ATOM 2896  C CG1  . VAL A 1 8  ? 6.348   3.434   34.345  1.00 0.00 ? 8  VAL A CG1  6  
ATOM 2897  C CG2  . VAL A 1 8  ? 6.670   2.598   36.644  1.00 0.00 ? 8  VAL A CG2  6  
ATOM 2898  H H    . VAL A 1 8  ? 8.927   4.237   37.356  1.00 0.00 ? 8  VAL A H    6  
ATOM 2899  H HA   . VAL A 1 8  ? 8.873   2.468   35.133  1.00 0.00 ? 8  VAL A HA   6  
ATOM 2900  H HB   . VAL A 1 8  ? 6.925   4.634   36.025  1.00 0.00 ? 8  VAL A HB   6  
ATOM 2901  H HG11 . VAL A 1 8  ? 5.280   3.539   34.540  1.00 0.00 ? 8  VAL A HG11 6  
ATOM 2902  H HG12 . VAL A 1 8  ? 6.656   4.181   33.613  1.00 0.00 ? 8  VAL A HG12 6  
ATOM 2903  H HG13 . VAL A 1 8  ? 6.547   2.437   33.953  1.00 0.00 ? 8  VAL A HG13 6  
ATOM 2904  H HG21 . VAL A 1 8  ? 5.600   2.708   36.826  1.00 0.00 ? 8  VAL A HG21 6  
ATOM 2905  H HG22 . VAL A 1 8  ? 6.869   1.600   36.254  1.00 0.00 ? 8  VAL A HG22 6  
ATOM 2906  H HG23 . VAL A 1 8  ? 7.212   2.738   37.579  1.00 0.00 ? 8  VAL A HG23 6  
ATOM 2907  N N    . GLU A 1 9  ? 9.139   5.683   34.458  1.00 0.00 ? 9  GLU A N    6  
ATOM 2908  C CA   . GLU A 1 9  ? 9.475   6.662   33.428  1.00 0.00 ? 9  GLU A CA   6  
ATOM 2909  C C    . GLU A 1 9  ? 10.770  6.278   32.731  1.00 0.00 ? 9  GLU A C    6  
ATOM 2910  O O    . GLU A 1 9  ? 10.908  6.427   31.518  1.00 0.00 ? 9  GLU A O    6  
ATOM 2911  C CB   . GLU A 1 9  ? 9.652   8.051   34.046  1.00 0.00 ? 9  GLU A CB   6  
ATOM 2912  C CG   . GLU A 1 9  ? 9.936   9.149   33.034  1.00 0.00 ? 9  GLU A CG   6  
ATOM 2913  C CD   . GLU A 1 9  ? 10.054  10.517  33.676  1.00 0.00 ? 9  GLU A CD   6  
ATOM 2914  O OE1  . GLU A 1 9  ? 9.916   10.605  34.914  1.00 0.00 ? 9  GLU A OE1  6  
ATOM 2915  O OE2  . GLU A 1 9  ? 10.285  11.500  32.942  1.00 0.00 ? 9  GLU A OE2  6  
ATOM 2916  H H    . GLU A 1 9  ? 9.017   6.011   35.406  1.00 0.00 ? 9  GLU A H    6  
ATOM 2917  H HA   . GLU A 1 9  ? 8.666   6.694   32.698  1.00 0.00 ? 9  GLU A HA   6  
ATOM 2918  H HB2  . GLU A 1 9  ? 8.737   8.307   34.581  1.00 0.00 ? 9  GLU A HB2  6  
ATOM 2919  H HB3  . GLU A 1 9  ? 10.484  8.010   34.749  1.00 0.00 ? 9  GLU A HB3  6  
ATOM 2920  H HG2  . GLU A 1 9  ? 10.870  8.921   32.522  1.00 0.00 ? 9  GLU A HG2  6  
ATOM 2921  H HG3  . GLU A 1 9  ? 9.125   9.173   32.306  1.00 0.00 ? 9  GLU A HG3  6  
ATOM 2922  H HE2  . GLU A 1 9  ? 10.347  12.334  33.415  1.00 0.00 ? 9  GLU A HE2  6  
ATOM 2923  N N    . SER A 1 10 ? 11.720  5.781   33.517  1.00 0.00 ? 10 SER A N    6  
ATOM 2924  C CA   . SER A 1 10 ? 13.020  5.365   33.001  1.00 0.00 ? 10 SER A CA   6  
ATOM 2925  C C    . SER A 1 10 ? 12.935  3.972   32.400  1.00 0.00 ? 10 SER A C    6  
ATOM 2926  O O    . SER A 1 10 ? 13.407  3.727   31.291  1.00 0.00 ? 10 SER A O    6  
ATOM 2927  C CB   . SER A 1 10 ? 14.060  5.344   34.123  1.00 0.00 ? 10 SER A CB   6  
ATOM 2928  O OG   . SER A 1 10 ? 14.269  6.643   34.649  1.00 0.00 ? 10 SER A OG   6  
ATOM 2929  H H    . SER A 1 10 ? 11.546  5.683   34.507  1.00 0.00 ? 10 SER A H    6  
ATOM 2930  H HA   . SER A 1 10 ? 13.333  6.072   32.233  1.00 0.00 ? 10 SER A HA   6  
ATOM 2931  H HB2  . SER A 1 10 ? 13.710  4.690   34.921  1.00 0.00 ? 10 SER A HB2  6  
ATOM 2932  H HB3  . SER A 1 10 ? 15.002  4.965   33.729  1.00 0.00 ? 10 SER A HB3  6  
ATOM 2933  H HG   . SER A 1 10 ? 14.924  6.595   35.349  1.00 0.00 ? 10 SER A HG   6  
ATOM 2934  N N    . ALA A 1 11 ? 12.323  3.059   33.151  1.00 0.00 ? 11 ALA A N    6  
ATOM 2935  C CA   . ALA A 1 11 ? 12.159  1.675   32.716  1.00 0.00 ? 11 ALA A CA   6  
ATOM 2936  C C    . ALA A 1 11 ? 11.225  1.599   31.520  1.00 0.00 ? 11 ALA A C    6  
ATOM 2937  O O    . ALA A 1 11 ? 11.442  0.823   30.591  1.00 0.00 ? 11 ALA A O    6  
ATOM 2938  C CB   . ALA A 1 11 ? 11.573  0.832   33.839  1.00 0.00 ? 11 ALA A CB   6  
ATOM 2939  H H    . ALA A 1 11 ? 11.956  3.322   34.055  1.00 0.00 ? 11 ALA A H    6  
ATOM 2940  H HA   . ALA A 1 11 ? 13.135  1.278   32.438  1.00 0.00 ? 11 ALA A HA   6  
ATOM 2941  H HB1  . ALA A 1 11 ? 11.468  -0.201  33.509  1.00 0.00 ? 11 ALA A HB1  6  
ATOM 2942  H HB2  . ALA A 1 11 ? 12.235  0.871   34.704  1.00 0.00 ? 11 ALA A HB2  6  
ATOM 2943  H HB3  . ALA A 1 11 ? 10.593  1.225   34.114  1.00 0.00 ? 11 ALA A HB3  6  
ATOM 2944  N N    . ILE A 1 12 ? 10.178  2.419   31.556  1.00 0.00 ? 12 ILE A N    6  
ATOM 2945  C CA   . ILE A 1 12 ? 9.188   2.468   30.485  1.00 0.00 ? 12 ILE A CA   6  
ATOM 2946  C C    . ILE A 1 12 ? 9.808   3.019   29.212  1.00 0.00 ? 12 ILE A C    6  
ATOM 2947  O O    . ILE A 1 12 ? 9.617   2.478   28.124  1.00 0.00 ? 12 ILE A O    6  
ATOM 2948  C CB   . ILE A 1 12 ? 7.996   3.368   30.859  1.00 0.00 ? 12 ILE A CB   6  
ATOM 2949  C CG1  . ILE A 1 12 ? 7.205   2.753   32.015  1.00 0.00 ? 12 ILE A CG1  6  
ATOM 2950  C CG2  . ILE A 1 12 ? 7.061   3.536   29.671  1.00 0.00 ? 12 ILE A CG2  6  
ATOM 2951  C CD1  . ILE A 1 12 ? 6.624   1.392   31.701  1.00 0.00 ? 12 ILE A CD1  6  
ATOM 2952  H H    . ILE A 1 12 ? 10.054  3.035   32.347  1.00 0.00 ? 12 ILE A H    6  
ATOM 2953  H HA   . ILE A 1 12 ? 8.827   1.456   30.303  1.00 0.00 ? 12 ILE A HA   6  
ATOM 2954  H HB   . ILE A 1 12 ? 8.373   4.346   31.161  1.00 0.00 ? 12 ILE A HB   6  
ATOM 2955  H HG12 . ILE A 1 12 ? 7.870   2.653   32.872  1.00 0.00 ? 12 ILE A HG12 6  
ATOM 2956  H HG13 . ILE A 1 12 ? 6.385   3.426   32.268  1.00 0.00 ? 12 ILE A HG13 6  
ATOM 2957  H HG21 . ILE A 1 12 ? 6.227   4.183   29.945  1.00 0.00 ? 12 ILE A HG21 6  
ATOM 2958  H HG22 . ILE A 1 12 ? 7.607   3.984   28.841  1.00 0.00 ? 12 ILE A HG22 6  
ATOM 2959  H HG23 . ILE A 1 12 ? 6.678   2.561   29.371  1.00 0.00 ? 12 ILE A HG23 6  
ATOM 2960  H HD11 . ILE A 1 12 ? 6.074   1.004   32.558  1.00 0.00 ? 12 ILE A HD11 6  
ATOM 2961  H HD12 . ILE A 1 12 ? 5.946   1.478   30.851  1.00 0.00 ? 12 ILE A HD12 6  
ATOM 2962  H HD13 . ILE A 1 12 ? 7.432   0.704   31.454  1.00 0.00 ? 12 ILE A HD13 6  
ATOM 2963  N N    . THR A 1 13 ? 10.557  4.109   29.363  1.00 0.00 ? 13 THR A N    6  
ATOM 2964  C CA   . THR A 1 13 ? 11.222  4.761   28.238  1.00 0.00 ? 13 THR A CA   6  
ATOM 2965  C C    . THR A 1 13 ? 12.268  3.840   27.632  1.00 0.00 ? 13 THR A C    6  
ATOM 2966  O O    . THR A 1 13 ? 12.397  3.739   26.413  1.00 0.00 ? 13 THR A O    6  
ATOM 2967  C CB   . THR A 1 13 ? 11.929  6.058   28.675  1.00 0.00 ? 13 THR A CB   6  
ATOM 2968  O OG1  . THR A 1 13 ? 10.961  6.985   29.182  1.00 0.00 ? 13 THR A OG1  6  
ATOM 2969  C CG2  . THR A 1 13 ? 12.650  6.694   27.496  1.00 0.00 ? 13 THR A CG2  6  
ATOM 2970  H H    . THR A 1 13 ? 10.676  4.508   30.284  1.00 0.00 ? 13 THR A H    6  
ATOM 2971  H HA   . THR A 1 13 ? 10.470  5.001   27.485  1.00 0.00 ? 13 THR A HA   6  
ATOM 2972  H HB   . THR A 1 13 ? 12.652  5.825   29.456  1.00 0.00 ? 13 THR A HB   6  
ATOM 2973  H HG1  . THR A 1 13 ? 11.416  7.784   29.457  1.00 0.00 ? 13 THR A HG1  6  
ATOM 2974  H HG21 . THR A 1 13 ? 13.147  7.609   27.818  1.00 0.00 ? 13 THR A HG21 6  
ATOM 2975  H HG22 . THR A 1 13 ? 13.392  5.998   27.107  1.00 0.00 ? 13 THR A HG22 6  
ATOM 2976  H HG23 . THR A 1 13 ? 11.928  6.931   26.714  1.00 0.00 ? 13 THR A HG23 6  
ATOM 2977  N N    . ASP A 1 14 ? 13.017  3.168   28.503  1.00 0.00 ? 14 ASP A N    6  
ATOM 2978  C CA   . ASP A 1 14 ? 14.066  2.245   28.081  1.00 0.00 ? 14 ASP A CA   6  
ATOM 2979  C C    . ASP A 1 14 ? 13.460  1.018   27.420  1.00 0.00 ? 14 ASP A C    6  
ATOM 2980  O O    . ASP A 1 14 ? 13.862  0.620   26.328  1.00 0.00 ? 14 ASP A O    6  
ATOM 2981  C CB   . ASP A 1 14 ? 14.893  1.788   29.284  1.00 0.00 ? 14 ASP A CB   6  
ATOM 2982  C CG   . ASP A 1 14 ? 15.779  2.888   29.834  1.00 0.00 ? 14 ASP A CG   6  
ATOM 2983  O OD1  . ASP A 1 14 ? 16.600  2.598   30.729  1.00 0.00 ? 14 ASP A OD1  6  
ATOM 2984  O OD2  . ASP A 1 14 ? 15.651  4.041   29.371  1.00 0.00 ? 14 ASP A OD2  6  
ATOM 2985  H H    . ASP A 1 14 ? 12.863  3.295   29.493  1.00 0.00 ? 14 ASP A H    6  
ATOM 2986  H HA   . ASP A 1 14 ? 14.715  2.756   27.370  1.00 0.00 ? 14 ASP A HA   6  
ATOM 2987  H HB2  . ASP A 1 14 ? 14.214  1.459   30.071  1.00 0.00 ? 14 ASP A HB2  6  
ATOM 2988  H HB3  . ASP A 1 14 ? 15.522  0.952   28.979  1.00 0.00 ? 14 ASP A HB3  6  
ATOM 2989  H HD2  . ASP A 1 14 ? 16.242  4.687   29.764  1.00 0.00 ? 14 ASP A HD2  6  
ATOM 2990  N N    . GLY A 1 15 ? 12.483  0.423   28.098  1.00 0.00 ? 15 GLY A N    6  
ATOM 2991  C CA   . GLY A 1 15 ? 11.799  -0.766  27.598  1.00 0.00 ? 15 GLY A CA   6  
ATOM 2992  C C    . GLY A 1 15 ? 10.699  -0.378  26.623  1.00 0.00 ? 15 GLY A C    6  
ATOM 2993  O O    . GLY A 1 15 ? 10.782  -0.653  25.427  1.00 0.00 ? 15 GLY A O    6  
ATOM 2994  H H    . GLY A 1 15 ? 12.196  0.799   28.991  1.00 0.00 ? 15 GLY A H    6  
ATOM 2995  H HA2  . GLY A 1 15 ? 12.519  -1.407  27.090  1.00 0.00 ? 15 GLY A HA2  6  
ATOM 2996  H HA3  . GLY A 1 15 ? 11.361  -1.307  28.436  1.00 0.00 ? 15 GLY A HA3  6  
ATOM 2997  N N    . GLN A 1 16 ? 9.663   0.268   27.152  1.00 0.00 ? 16 GLN A N    6  
ATOM 2998  C CA   . GLN A 1 16 ? 8.527   0.710   26.350  1.00 0.00 ? 16 GLN A CA   6  
ATOM 2999  C C    . GLN A 1 16 ? 9.005   1.448   25.110  1.00 0.00 ? 16 GLN A C    6  
ATOM 3000  O O    . GLN A 1 16 ? 8.644   1.104   23.986  1.00 0.00 ? 16 GLN A O    6  
ATOM 3001  C CB   . GLN A 1 16 ? 7.634   1.653   27.159  1.00 0.00 ? 16 GLN A CB   6  
ATOM 3002  C CG   . GLN A 1 16 ? 6.399   2.130   26.414  1.00 0.00 ? 16 GLN A CG   6  
ATOM 3003  C CD   . GLN A 1 16 ? 5.443   1.000   26.086  1.00 0.00 ? 16 GLN A CD   6  
ATOM 3004  O OE1  . GLN A 1 16 ? 5.014   0.261   26.972  1.00 0.00 ? 16 GLN A OE1  6  
ATOM 3005  N NE2  . GLN A 1 16 ? 5.107   0.862   24.809  1.00 0.00 ? 16 GLN A NE2  6  
ATOM 3006  H H    . GLN A 1 16 ? 9.652   0.464   28.143  1.00 0.00 ? 16 GLN A H    6  
ATOM 3007  H HA   . GLN A 1 16 ? 7.949   -0.164  26.050  1.00 0.00 ? 16 GLN A HA   6  
ATOM 3008  H HB2  . GLN A 1 16 ? 7.309   1.130   28.059  1.00 0.00 ? 16 GLN A HB2  6  
ATOM 3009  H HB3  . GLN A 1 16 ? 8.223   2.527   27.439  1.00 0.00 ? 16 GLN A HB3  6  
ATOM 3010  H HG2  . GLN A 1 16 ? 5.877   2.862   27.032  1.00 0.00 ? 16 GLN A HG2  6  
ATOM 3011  H HG3  . GLN A 1 16 ? 6.712   2.605   25.484  1.00 0.00 ? 16 GLN A HG3  6  
ATOM 3012  H HE21 . GLN A 1 16 ? 5.485   1.494   24.117  1.00 0.00 ? 16 GLN A HE21 6  
ATOM 3013  H HE22 . GLN A 1 16 ? 4.473   0.126   24.531  1.00 0.00 ? 16 GLN A HE22 6  
ATOM 3014  N N    . GLY A 1 17 ? 9.826   2.471   25.332  1.00 0.00 ? 17 GLY A N    6  
ATOM 3015  C CA   . GLY A 1 17 ? 10.373  3.281   24.247  1.00 0.00 ? 17 GLY A CA   6  
ATOM 3016  C C    . GLY A 1 17 ? 11.002  2.393   23.185  1.00 0.00 ? 17 GLY A C    6  
ATOM 3017  O O    . GLY A 1 17 ? 10.763  2.564   21.991  1.00 0.00 ? 17 GLY A O    6  
ATOM 3018  H H    . GLY A 1 17 ? 10.086  2.705   26.280  1.00 0.00 ? 17 GLY A H    6  
ATOM 3019  H HA2  . GLY A 1 17 ? 9.571   3.868   23.797  1.00 0.00 ? 17 GLY A HA2  6  
ATOM 3020  H HA3  . GLY A 1 17 ? 11.130  3.955   24.648  1.00 0.00 ? 17 GLY A HA3  6  
ATOM 3021  N N    . ASP A 1 18 ? 11.812  1.440   23.638  1.00 0.00 ? 18 ASP A N    6  
ATOM 3022  C CA   . ASP A 1 18 ? 12.493  0.507   22.746  1.00 0.00 ? 18 ASP A CA   6  
ATOM 3023  C C    . ASP A 1 18 ? 11.487  -0.219  21.867  1.00 0.00 ? 18 ASP A C    6  
ATOM 3024  O O    . ASP A 1 18 ? 11.847  -0.849  20.874  1.00 0.00 ? 18 ASP A O    6  
ATOM 3025  C CB   . ASP A 1 18 ? 13.271  -0.535  23.553  1.00 0.00 ? 18 ASP A CB   6  
ATOM 3026  C CG   . ASP A 1 18 ? 14.484  0.053   24.246  1.00 0.00 ? 18 ASP A CG   6  
ATOM 3027  O OD1  . ASP A 1 18 ? 15.527  -0.632  24.301  1.00 0.00 ? 18 ASP A OD1  6  
ATOM 3028  O OD2  . ASP A 1 18 ? 14.392  1.199   24.736  1.00 0.00 ? 18 ASP A OD2  6  
ATOM 3029  H H    . ASP A 1 18 ? 11.968  1.351   24.632  1.00 0.00 ? 18 ASP A H    6  
ATOM 3030  H HA   . ASP A 1 18 ? 13.185  1.067   22.117  1.00 0.00 ? 18 ASP A HA   6  
ATOM 3031  H HB2  . ASP A 1 18 ? 12.608  -0.960  24.307  1.00 0.00 ? 18 ASP A HB2  6  
ATOM 3032  H HB3  . ASP A 1 18 ? 13.601  -1.325  22.879  1.00 0.00 ? 18 ASP A HB3  6  
ATOM 3033  H HD2  . ASP A 1 18 ? 15.196  1.509   25.159  1.00 0.00 ? 18 ASP A HD2  6  
ATOM 3034  N N    . MET A 1 19 ? 10.216  -0.122  22.246  1.00 0.00 ? 19 MET A N    6  
ATOM 3035  C CA   . MET A 1 19 ? 9.130   -0.760  21.509  1.00 0.00 ? 19 MET A CA   6  
ATOM 3036  C C    . MET A 1 19 ? 9.004   -0.159  20.119  1.00 0.00 ? 19 MET A C    6  
ATOM 3037  O O    . MET A 1 19 ? 8.817   -0.870  19.133  1.00 0.00 ? 19 MET A O    6  
ATOM 3038  C CB   . MET A 1 19 ? 7.800   -0.568  22.241  1.00 0.00 ? 19 MET A CB   6  
ATOM 3039  C CG   . MET A 1 19 ? 6.624   -1.273  21.586  1.00 0.00 ? 19 MET A CG   6  
ATOM 3040  S SD   . MET A 1 19 ? 5.080   -1.033  22.487  1.00 0.00 ? 19 MET A SD   6  
ATOM 3041  C CE   . MET A 1 19 ? 5.398   -1.993  23.965  1.00 0.00 ? 19 MET A CE   6  
ATOM 3042  H H    . MET A 1 19 ? 9.983   0.409   23.073  1.00 0.00 ? 19 MET A H    6  
ATOM 3043  H HA   . MET A 1 19 ? 9.343   -1.825  21.424  1.00 0.00 ? 19 MET A HA   6  
ATOM 3044  H HB2  . MET A 1 19 ? 7.908   -0.952  23.255  1.00 0.00 ? 19 MET A HB2  6  
ATOM 3045  H HB3  . MET A 1 19 ? 7.581   0.500   22.279  1.00 0.00 ? 19 MET A HB3  6  
ATOM 3046  H HG2  . MET A 1 19 ? 6.502   -0.889  20.573  1.00 0.00 ? 19 MET A HG2  6  
ATOM 3047  H HG3  . MET A 1 19 ? 6.837   -2.340  21.533  1.00 0.00 ? 19 MET A HG3  6  
ATOM 3048  H HE1  . MET A 1 19 ? 4.535   -1.947  24.631  1.00 0.00 ? 19 MET A HE1  6  
ATOM 3049  H HE2  . MET A 1 19 ? 5.586   -3.030  23.689  1.00 0.00 ? 19 MET A HE2  6  
ATOM 3050  H HE3  . MET A 1 19 ? 6.270   -1.589  24.478  1.00 0.00 ? 19 MET A HE3  6  
ATOM 3051  N N    . LYS A 1 20 ? 9.110   1.165   20.054  1.00 0.00 ? 20 LYS A N    6  
ATOM 3052  C CA   . LYS A 1 20 ? 9.012   1.895   18.793  1.00 0.00 ? 20 LYS A CA   6  
ATOM 3053  C C    . LYS A 1 20 ? 10.062  1.402   17.810  1.00 0.00 ? 20 LYS A C    6  
ATOM 3054  O O    . LYS A 1 20 ? 9.791   1.230   16.623  1.00 0.00 ? 20 LYS A O    6  
ATOM 3055  C CB   . LYS A 1 20 ? 9.229   3.392   19.022  1.00 0.00 ? 20 LYS A CB   6  
ATOM 3056  C CG   . LYS A 1 20 ? 9.082   4.240   17.769  1.00 0.00 ? 20 LYS A CG   6  
ATOM 3057  C CD   . LYS A 1 20 ? 9.255   5.718   18.079  1.00 0.00 ? 20 LYS A CD   6  
ATOM 3058  C CE   . LYS A 1 20 ? 9.123   6.564   16.823  1.00 0.00 ? 20 LYS A CE   6  
ATOM 3059  N NZ   . LYS A 1 20 ? 9.277   8.016   17.113  1.00 0.00 ? 20 LYS A NZ   6  
ATOM 3060  H H    . LYS A 1 20 ? 9.263   1.695   20.901  1.00 0.00 ? 20 LYS A H    6  
ATOM 3061  H HA   . LYS A 1 20 ? 8.019   1.736   18.372  1.00 0.00 ? 20 LYS A HA   6  
ATOM 3062  H HB2  . LYS A 1 20 ? 8.499   3.736   19.755  1.00 0.00 ? 20 LYS A HB2  6  
ATOM 3063  H HB3  . LYS A 1 20 ? 10.235  3.536   19.416  1.00 0.00 ? 20 LYS A HB3  6  
ATOM 3064  H HG2  . LYS A 1 20 ? 9.838   3.939   17.045  1.00 0.00 ? 20 LYS A HG2  6  
ATOM 3065  H HG3  . LYS A 1 20 ? 8.090   4.080   17.346  1.00 0.00 ? 20 LYS A HG3  6  
ATOM 3066  H HD2  . LYS A 1 20 ? 8.491   6.023   18.795  1.00 0.00 ? 20 LYS A HD2  6  
ATOM 3067  H HD3  . LYS A 1 20 ? 10.242  5.877   18.512  1.00 0.00 ? 20 LYS A HD3  6  
ATOM 3068  H HE2  . LYS A 1 20 ? 9.891   6.263   16.111  1.00 0.00 ? 20 LYS A HE2  6  
ATOM 3069  H HE3  . LYS A 1 20 ? 8.140   6.394   16.384  1.00 0.00 ? 20 LYS A HE3  6  
ATOM 3070  H HZ1  . LYS A 1 20 ? 9.184   8.547   16.259  1.00 0.00 ? 20 LYS A HZ1  6  
ATOM 3071  H HZ2  . LYS A 1 20 ? 8.563   8.306   17.767  1.00 0.00 ? 20 LYS A HZ2  6  
ATOM 3072  H HZ3  . LYS A 1 20 ? 10.188  8.184   17.514  1.00 0.00 ? 20 LYS A HZ3  6  
ATOM 3073  N N    . ALA A 1 21 ? 11.269  1.177   18.323  1.00 0.00 ? 21 ALA A N    6  
ATOM 3074  C CA   . ALA A 1 21 ? 12.385  0.702   17.511  1.00 0.00 ? 21 ALA A CA   6  
ATOM 3075  C C    . ALA A 1 21 ? 12.140  -0.726  17.053  1.00 0.00 ? 21 ALA A C    6  
ATOM 3076  O O    . ALA A 1 21 ? 12.410  -1.082  15.907  1.00 0.00 ? 21 ALA A O    6  
ATOM 3077  C CB   . ALA A 1 21 ? 13.677  0.736   18.313  1.00 0.00 ? 21 ALA A CB   6  
ATOM 3078  H H    . ALA A 1 21 ? 11.429  1.338   19.307  1.00 0.00 ? 21 ALA A H    6  
ATOM 3079  H HA   . ALA A 1 21 ? 12.484  1.350   16.640  1.00 0.00 ? 21 ALA A HA   6  
ATOM 3080  H HB1  . ALA A 1 21 ? 14.505  0.394   17.693  1.00 0.00 ? 21 ALA A HB1  6  
ATOM 3081  H HB2  . ALA A 1 21 ? 13.871  1.757   18.644  1.00 0.00 ? 21 ALA A HB2  6  
ATOM 3082  H HB3  . ALA A 1 21 ? 13.581  0.085   19.181  1.00 0.00 ? 21 ALA A HB3  6  
ATOM 3083  N N    . ILE A 1 22 ? 11.624  -1.543  17.968  1.00 0.00 ? 22 ILE A N    6  
ATOM 3084  C CA   . ILE A 1 22 ? 11.331  -2.945  17.685  1.00 0.00 ? 22 ILE A CA   6  
ATOM 3085  C C    . ILE A 1 22 ? 10.249  -3.059  16.623  1.00 0.00 ? 22 ILE A C    6  
ATOM 3086  O O    . ILE A 1 22 ? 10.391  -3.793  15.647  1.00 0.00 ? 22 ILE A O    6  
ATOM 3087  C CB   . ILE A 1 22 ? 10.839  -3.684  18.943  1.00 0.00 ? 22 ILE A CB   6  
ATOM 3088  C CG1  . ILE A 1 22 ? 11.966  -3.794  19.972  1.00 0.00 ? 22 ILE A CG1  6  
ATOM 3089  C CG2  . ILE A 1 22 ? 10.371  -5.087  18.588  1.00 0.00 ? 22 ILE A CG2  6  
ATOM 3090  C CD1  . ILE A 1 22 ? 11.509  -4.284  21.329  1.00 0.00 ? 22 ILE A CD1  6  
ATOM 3091  H H    . ILE A 1 22 ? 11.423  -1.191  18.893  1.00 0.00 ? 22 ILE A H    6  
ATOM 3092  H HA   . ILE A 1 22 ? 12.242  -3.421  17.325  1.00 0.00 ? 22 ILE A HA   6  
ATOM 3093  H HB   . ILE A 1 22 ? 10.008  -3.127  19.377  1.00 0.00 ? 22 ILE A HB   6  
ATOM 3094  H HG12 . ILE A 1 22 ? 12.713  -4.488  19.590  1.00 0.00 ? 22 ILE A HG12 6  
ATOM 3095  H HG13 . ILE A 1 22 ? 12.415  -2.808  20.097  1.00 0.00 ? 22 ILE A HG13 6  
ATOM 3096  H HG21 . ILE A 1 22 ? 10.015  -5.596  19.484  1.00 0.00 ? 22 ILE A HG21 6  
ATOM 3097  H HG22 . ILE A 1 22 ? 9.560   -5.025  17.862  1.00 0.00 ? 22 ILE A HG22 6  
ATOM 3098  H HG23 . ILE A 1 22 ? 11.200  -5.648  18.159  1.00 0.00 ? 22 ILE A HG23 6  
ATOM 3099  H HD11 . ILE A 1 22 ? 12.351  -4.343  22.018  1.00 0.00 ? 22 ILE A HD11 6  
ATOM 3100  H HD12 . ILE A 1 22 ? 10.767  -3.592  21.730  1.00 0.00 ? 22 ILE A HD12 6  
ATOM 3101  H HD13 . ILE A 1 22 ? 11.063  -5.273  21.223  1.00 0.00 ? 22 ILE A HD13 6  
ATOM 3102  N N    . GLY A 1 23 ? 9.163   -2.320  16.827  1.00 0.00 ? 23 GLY A N    6  
ATOM 3103  C CA   . GLY A 1 23 ? 8.035   -2.316  15.899  1.00 0.00 ? 23 GLY A CA   6  
ATOM 3104  C C    . GLY A 1 23 ? 8.443   -1.705  14.568  1.00 0.00 ? 23 GLY A C    6  
ATOM 3105  O O    . GLY A 1 23 ? 8.114   -2.224  13.502  1.00 0.00 ? 23 GLY A O    6  
ATOM 3106  H H    . GLY A 1 23 ? 9.105   -1.737  17.650  1.00 0.00 ? 23 GLY A H    6  
ATOM 3107  H HA2  . GLY A 1 23 ? 7.699   -3.340  15.737  1.00 0.00 ? 23 GLY A HA2  6  
ATOM 3108  H HA3  . GLY A 1 23 ? 7.219   -1.733  16.327  1.00 0.00 ? 23 GLY A HA3  6  
ATOM 3109  N N    . GLY A 1 24 ? 9.165   -0.591  14.645  1.00 0.00 ? 24 GLY A N    6  
ATOM 3110  C CA   . GLY A 1 24 ? 9.633   0.118   13.458  1.00 0.00 ? 24 GLY A CA   6  
ATOM 3111  C C    . GLY A 1 24 ? 10.673  -0.710  12.719  1.00 0.00 ? 24 GLY A C    6  
ATOM 3112  O O    . GLY A 1 24 ? 10.542  -0.977  11.526  1.00 0.00 ? 24 GLY A O    6  
ATOM 3113  H H    . GLY A 1 24 ? 9.403   -0.213  15.551  1.00 0.00 ? 24 GLY A H    6  
ATOM 3114  H HA2  . GLY A 1 24 ? 8.787   0.308   12.796  1.00 0.00 ? 24 GLY A HA2  6  
ATOM 3115  H HA3  . GLY A 1 24 ? 10.076  1.068   13.758  1.00 0.00 ? 24 GLY A HA3  6  
ATOM 3116  N N    . TYR A 1 25 ? 11.711  -1.113  13.447  1.00 0.00 ? 25 TYR A N    6  
ATOM 3117  C CA   . TYR A 1 25 ? 12.793  -1.914  12.885  1.00 0.00 ? 25 TYR A CA   6  
ATOM 3118  C C    . TYR A 1 25 ? 12.244  -3.184  12.256  1.00 0.00 ? 25 TYR A C    6  
ATOM 3119  O O    . TYR A 1 25 ? 12.697  -3.617  11.197  1.00 0.00 ? 25 TYR A O    6  
ATOM 3120  C CB   . TYR A 1 25 ? 13.791  -2.307  13.976  1.00 0.00 ? 25 TYR A CB   6  
ATOM 3121  C CG   . TYR A 1 25 ? 14.940  -3.154  13.478  1.00 0.00 ? 25 TYR A CG   6  
ATOM 3122  C CD1  . TYR A 1 25 ? 16.004  -2.579  12.794  1.00 0.00 ? 25 TYR A CD1  6  
ATOM 3123  C CD2  . TYR A 1 25 ? 14.959  -4.526  13.695  1.00 0.00 ? 25 TYR A CD2  6  
ATOM 3124  C CE1  . TYR A 1 25 ? 17.058  -3.345  12.336  1.00 0.00 ? 25 TYR A CE1  6  
ATOM 3125  C CE2  . TYR A 1 25 ? 16.005  -5.308  13.243  1.00 0.00 ? 25 TYR A CE2  6  
ATOM 3126  C CZ   . TYR A 1 25 ? 17.060  -4.705  12.559  1.00 0.00 ? 25 TYR A CZ   6  
ATOM 3127  O OH   . TYR A 1 25 ? 18.109  -5.470  12.104  1.00 0.00 ? 25 TYR A OH   6  
ATOM 3128  H H    . TYR A 1 25 ? 11.762  -0.860  14.424  1.00 0.00 ? 25 TYR A H    6  
ATOM 3129  H HA   . TYR A 1 25 ? 13.304  -1.325  12.124  1.00 0.00 ? 25 TYR A HA   6  
ATOM 3130  H HB2  . TYR A 1 25 ? 14.197  -1.397  14.418  1.00 0.00 ? 25 TYR A HB2  6  
ATOM 3131  H HB3  . TYR A 1 25 ? 13.259  -2.863  14.748  1.00 0.00 ? 25 TYR A HB3  6  
ATOM 3132  H HD1  . TYR A 1 25 ? 16.007  -1.513  12.617  1.00 0.00 ? 25 TYR A HD1  6  
ATOM 3133  H HD2  . TYR A 1 25 ? 14.141  -4.990  14.227  1.00 0.00 ? 25 TYR A HD2  6  
ATOM 3134  H HE1  . TYR A 1 25 ? 17.876  -2.880  11.806  1.00 0.00 ? 25 TYR A HE1  6  
ATOM 3135  H HE2  . TYR A 1 25 ? 16.005  -6.373  13.418  1.00 0.00 ? 25 TYR A HE2  6  
ATOM 3136  H HH   . TYR A 1 25 ? 18.012  -6.402  12.311  1.00 0.00 ? 25 TYR A HH   6  
ATOM 3137  N N    . ILE A 1 26 ? 11.259  -3.777  12.924  1.00 0.00 ? 26 ILE A N    6  
ATOM 3138  C CA   . ILE A 1 26 ? 10.624  -5.005  12.452  1.00 0.00 ? 26 ILE A CA   6  
ATOM 3139  C C    . ILE A 1 26 ? 9.700   -4.709  11.282  1.00 0.00 ? 26 ILE A C    6  
ATOM 3140  O O    . ILE A 1 26 ? 9.701   -5.416  10.276  1.00 0.00 ? 26 ILE A O    6  
ATOM 3141  C CB   . ILE A 1 26 ? 9.787   -5.670  13.561  1.00 0.00 ? 26 ILE A CB   6  
ATOM 3142  C CG1  . ILE A 1 26 ? 10.695  -6.176  14.684  1.00 0.00 ? 26 ILE A CG1  6  
ATOM 3143  C CG2  . ILE A 1 26 ? 9.006   -6.850  13.003  1.00 0.00 ? 26 ILE A CG2  6  
ATOM 3144  C CD1  . ILE A 1 26 ? 9.946   -6.619  15.921  1.00 0.00 ? 26 ILE A CD1  6  
ATOM 3145  H H    . ILE A 1 26 ? 10.929  -3.372  13.789  1.00 0.00 ? 26 ILE A H    6  
ATOM 3146  H HA   . ILE A 1 26 ? 11.404  -5.695  12.131  1.00 0.00 ? 26 ILE A HA   6  
ATOM 3147  H HB   . ILE A 1 26 ? 9.089   -4.936  13.965  1.00 0.00 ? 26 ILE A HB   6  
ATOM 3148  H HG12 . ILE A 1 26 ? 11.268  -7.023  14.308  1.00 0.00 ? 26 ILE A HG12 6  
ATOM 3149  H HG13 . ILE A 1 26 ? 11.375  -5.372  14.964  1.00 0.00 ? 26 ILE A HG13 6  
ATOM 3150  H HG21 . ILE A 1 26 ? 8.410   -7.305  13.794  1.00 0.00 ? 26 ILE A HG21 6  
ATOM 3151  H HG22 . ILE A 1 26 ? 8.346   -6.503  12.208  1.00 0.00 ? 26 ILE A HG22 6  
ATOM 3152  H HG23 . ILE A 1 26 ? 9.701   -7.588  12.603  1.00 0.00 ? 26 ILE A HG23 6  
ATOM 3153  H HD11 . ILE A 1 26 ? 10.641  -6.969  16.684  1.00 0.00 ? 26 ILE A HD11 6  
ATOM 3154  H HD12 . ILE A 1 26 ? 9.375   -5.778  16.317  1.00 0.00 ? 26 ILE A HD12 6  
ATOM 3155  H HD13 . ILE A 1 26 ? 9.265   -7.429  15.659  1.00 0.00 ? 26 ILE A HD13 6  
ATOM 3156  N N    . VAL A 1 27 ? 8.908   -3.651  11.428  1.00 0.00 ? 27 VAL A N    6  
ATOM 3157  C CA   . VAL A 1 27 ? 7.963   -3.235  10.395  1.00 0.00 ? 27 VAL A CA   6  
ATOM 3158  C C    . VAL A 1 27 ? 8.694   -2.563  9.244   1.00 0.00 ? 27 VAL A C    6  
ATOM 3159  O O    . VAL A 1 27 ? 8.269   -2.634  8.092   1.00 0.00 ? 27 VAL A O    6  
ATOM 3160  C CB   . VAL A 1 27 ? 6.928   -2.236  10.946  1.00 0.00 ? 27 VAL A CB   6  
ATOM 3161  C CG1  . VAL A 1 27 ? 6.072   -1.680  9.818   1.00 0.00 ? 27 VAL A CG1  6  
ATOM 3162  C CG2  . VAL A 1 27 ? 6.014   -2.918  11.952  1.00 0.00 ? 27 VAL A CG2  6  
ATOM 3163  H H    . VAL A 1 27 ? 8.953   -3.109  12.279  1.00 0.00 ? 27 VAL A H    6  
ATOM 3164  H HA   . VAL A 1 27 ? 7.444   -4.120  10.026  1.00 0.00 ? 27 VAL A HA   6  
ATOM 3165  H HB   . VAL A 1 27 ? 7.454   -1.416  11.436  1.00 0.00 ? 27 VAL A HB   6  
ATOM 3166  H HG11 . VAL A 1 27 ? 5.349   -0.968  10.218  1.00 0.00 ? 27 VAL A HG11 6  
ATOM 3167  H HG12 . VAL A 1 27 ? 6.710   -1.176  9.093   1.00 0.00 ? 27 VAL A HG12 6  
ATOM 3168  H HG13 . VAL A 1 27 ? 5.541   -2.497  9.329   1.00 0.00 ? 27 VAL A HG13 6  
ATOM 3169  H HG21 . VAL A 1 27 ? 5.291   -2.200  12.341  1.00 0.00 ? 27 VAL A HG21 6  
ATOM 3170  H HG22 . VAL A 1 27 ? 5.483   -3.735  11.464  1.00 0.00 ? 27 VAL A HG22 6  
ATOM 3171  H HG23 . VAL A 1 27 ? 6.610   -3.312  12.775  1.00 0.00 ? 27 VAL A HG23 6  
ATOM 3172  N N    . GLY A 1 28 ? 9.804   -1.908  9.572   1.00 0.00 ? 28 GLY A N    6  
ATOM 3173  C CA   . GLY A 1 28 ? 10.619  -1.210  8.583   1.00 0.00 ? 28 GLY A CA   6  
ATOM 3174  C C    . GLY A 1 28 ? 11.418  -2.204  7.755   1.00 0.00 ? 28 GLY A C    6  
ATOM 3175  O O    . GLY A 1 28 ? 11.820  -1.916  6.629   1.00 0.00 ? 28 GLY A O    6  
ATOM 3176  H H    . GLY A 1 28 ? 10.102  -1.886  10.537  1.00 0.00 ? 28 GLY A H    6  
ATOM 3177  H HA2  . GLY A 1 28 ? 9.969   -0.633  7.924   1.00 0.00 ? 28 GLY A HA2  6  
ATOM 3178  H HA3  . GLY A 1 28 ? 11.304  -0.534  9.094   1.00 0.00 ? 28 GLY A HA3  6  
ATOM 3179  N N    . ALA A 1 29 ? 11.643  -3.382  8.331   1.00 0.00 ? 29 ALA A N    6  
ATOM 3180  C CA   . ALA A 1 29 ? 12.395  -4.443  7.669   1.00 0.00 ? 29 ALA A CA   6  
ATOM 3181  C C    . ALA A 1 29 ? 11.482  -5.257  6.764   1.00 0.00 ? 29 ALA A C    6  
ATOM 3182  O O    . ALA A 1 29 ? 11.899  -5.749  5.717   1.00 0.00 ? 29 ALA A O    6  
ATOM 3183  C CB   . ALA A 1 29 ? 13.012  -5.377  8.699   1.00 0.00 ? 29 ALA A CB   6  
ATOM 3184  H H    . ALA A 1 29 ? 11.286  -3.558  9.259   1.00 0.00 ? 29 ALA A H    6  
ATOM 3185  H HA   . ALA A 1 29 ? 13.186  -3.991  7.072   1.00 0.00 ? 29 ALA A HA   6  
ATOM 3186  H HB1  . ALA A 1 29 ? 13.583  -6.157  8.195   1.00 0.00 ? 29 ALA A HB1  6  
ATOM 3187  H HB2  . ALA A 1 29 ? 13.674  -4.809  9.352   1.00 0.00 ? 29 ALA A HB2  6  
ATOM 3188  H HB3  . ALA A 1 29 ? 12.220  -5.834  9.293   1.00 0.00 ? 29 ALA A HB3  6  
ATOM 3189  N N    . LEU A 1 30 ? 10.228  -5.390  7.185   1.00 0.00 ? 30 LEU A N    6  
ATOM 3190  C CA   . LEU A 1 30 ? 9.228   -6.141  6.430   1.00 0.00 ? 30 LEU A CA   6  
ATOM 3191  C C    . LEU A 1 30 ? 9.119   -5.605  5.012   1.00 0.00 ? 30 LEU A C    6  
ATOM 3192  O O    . LEU A 1 30 ? 8.819   -6.343  4.075   1.00 0.00 ? 30 LEU A O    6  
ATOM 3193  C CB   . LEU A 1 30 ? 7.856   -6.027  7.097   1.00 0.00 ? 30 LEU A CB   6  
ATOM 3194  C CG   . LEU A 1 30 ? 7.687   -6.758  8.430   1.00 0.00 ? 30 LEU A CG   6  
ATOM 3195  C CD1  . LEU A 1 30 ? 6.327   -6.457  9.041   1.00 0.00 ? 30 LEU A CD1  6  
ATOM 3196  C CD2  . LEU A 1 30 ? 7.799   -8.262  8.236   1.00 0.00 ? 30 LEU A CD2  6  
ATOM 3197  H H    . LEU A 1 30 ? 9.946   -4.961  8.055   1.00 0.00 ? 30 LEU A H    6  
ATOM 3198  H HA   . LEU A 1 30 ? 9.527   -7.188  6.399   1.00 0.00 ? 30 LEU A HA   6  
ATOM 3199  H HB2  . LEU A 1 30 ? 7.658   -4.969  7.271   1.00 0.00 ? 30 LEU A HB2  6  
ATOM 3200  H HB3  . LEU A 1 30 ? 7.115   -6.425  6.404   1.00 0.00 ? 30 LEU A HB3  6  
ATOM 3201  H HG   . LEU A 1 30 ? 8.468   -6.425  9.113   1.00 0.00 ? 30 LEU A HG   6  
ATOM 3202  H HD11 . LEU A 1 30 ? 6.224   -6.975  9.995   1.00 0.00 ? 30 LEU A HD11 6  
ATOM 3203  H HD12 . LEU A 1 30 ? 6.232   -5.383  9.203   1.00 0.00 ? 30 LEU A HD12 6  
ATOM 3204  H HD13 . LEU A 1 30 ? 5.542   -6.792  8.362   1.00 0.00 ? 30 LEU A HD13 6  
ATOM 3205  H HD21 . LEU A 1 30 ? 7.688   -8.769  9.194   1.00 0.00 ? 30 LEU A HD21 6  
ATOM 3206  H HD22 . LEU A 1 30 ? 7.015   -8.598  7.557   1.00 0.00 ? 30 LEU A HD22 6  
ATOM 3207  H HD23 . LEU A 1 30 ? 8.774   -8.500  7.812   1.00 0.00 ? 30 LEU A HD23 6  
ATOM 3208  N N    . VAL A 1 31 ? 9.368   -4.307  4.867   1.00 0.00 ? 31 VAL A N    6  
ATOM 3209  C CA   . VAL A 1 31 ? 9.305   -3.640  3.569   1.00 0.00 ? 31 VAL A CA   6  
ATOM 3210  C C    . VAL A 1 31 ? 10.207  -4.341  2.567   1.00 0.00 ? 31 VAL A C    6  
ATOM 3211  O O    . VAL A 1 31 ? 9.894   -4.427  1.381   1.00 0.00 ? 31 VAL A O    6  
ATOM 3212  C CB   . VAL A 1 31 ? 9.757   -2.171  3.667   1.00 0.00 ? 31 VAL A CB   6  
ATOM 3213  C CG1  . VAL A 1 31 ? 9.903   -1.565  2.279   1.00 0.00 ? 31 VAL A CG1  6  
ATOM 3214  C CG2  . VAL A 1 31 ? 8.739   -1.351  4.445   1.00 0.00 ? 31 VAL A CG2  6  
ATOM 3215  H H    . VAL A 1 31 ? 9.610   -3.753  5.676   1.00 0.00 ? 31 VAL A H    6  
ATOM 3216  H HA   . VAL A 1 31 ? 8.275   -3.673  3.214   1.00 0.00 ? 31 VAL A HA   6  
ATOM 3217  H HB   . VAL A 1 31 ? 10.718  -2.131  4.180   1.00 0.00 ? 31 VAL A HB   6  
ATOM 3218  H HG11 . VAL A 1 31 ? 10.231  -0.528  2.361   1.00 0.00 ? 31 VAL A HG11 6  
ATOM 3219  H HG12 . VAL A 1 31 ? 10.639  -2.133  1.711   1.00 0.00 ? 31 VAL A HG12 6  
ATOM 3220  H HG13 . VAL A 1 31 ? 8.942   -1.599  1.766   1.00 0.00 ? 31 VAL A HG13 6  
ATOM 3221  H HG21 . VAL A 1 31 ? 9.073   -0.316  4.515   1.00 0.00 ? 31 VAL A HG21 6  
ATOM 3222  H HG22 . VAL A 1 31 ? 7.777   -1.385  3.932   1.00 0.00 ? 31 VAL A HG22 6  
ATOM 3223  H HG23 . VAL A 1 31 ? 8.631   -1.764  5.448   1.00 0.00 ? 31 VAL A HG23 6  
ATOM 3224  N N    . ILE A 1 32 ? 11.336  -4.841  3.061   1.00 0.00 ? 32 ILE A N    6  
ATOM 3225  C CA   . ILE A 1 32 ? 12.309  -5.543  2.228   1.00 0.00 ? 32 ILE A CA   6  
ATOM 3226  C C    . ILE A 1 32 ? 11.715  -6.835  1.690   1.00 0.00 ? 32 ILE A C    6  
ATOM 3227  O O    . ILE A 1 32 ? 11.894  -7.180  0.523   1.00 0.00 ? 32 ILE A O    6  
ATOM 3228  C CB   . ILE A 1 32 ? 13.579  -5.900  3.023   1.00 0.00 ? 32 ILE A CB   6  
ATOM 3229  C CG1  . ILE A 1 32 ? 14.336  -4.631  3.417   1.00 0.00 ? 32 ILE A CG1  6  
ATOM 3230  C CG2  . ILE A 1 32 ? 14.502  -6.773  2.187   1.00 0.00 ? 32 ILE A CG2  6  
ATOM 3231  C CD1  . ILE A 1 32 ? 15.457  -4.870  4.404   1.00 0.00 ? 32 ILE A CD1  6  
ATOM 3232  H H    . ILE A 1 32 ? 11.537  -4.738  4.046   1.00 0.00 ? 32 ILE A H    6  
ATOM 3233  H HA   . ILE A 1 32 ? 12.579  -4.894  1.395   1.00 0.00 ? 32 ILE A HA   6  
ATOM 3234  H HB   . ILE A 1 32 ? 13.290  -6.441  3.924   1.00 0.00 ? 32 ILE A HB   6  
ATOM 3235  H HG12 . ILE A 1 32 ? 14.760  -4.189  2.515   1.00 0.00 ? 32 ILE A HG12 6  
ATOM 3236  H HG13 . ILE A 1 32 ? 13.628  -3.933  3.864   1.00 0.00 ? 32 ILE A HG13 6  
ATOM 3237  H HG21 . ILE A 1 32 ? 15.391  -7.027  2.763   1.00 0.00 ? 32 ILE A HG21 6  
ATOM 3238  H HG22 . ILE A 1 32 ? 13.979  -7.687  1.907   1.00 0.00 ? 32 ILE A HG22 6  
ATOM 3239  H HG23 . ILE A 1 32 ? 14.796  -6.232  1.288   1.00 0.00 ? 32 ILE A HG23 6  
ATOM 3240  H HD11 . ILE A 1 32 ? 15.959  -3.933  4.646   1.00 0.00 ? 32 ILE A HD11 6  
ATOM 3241  H HD12 . ILE A 1 32 ? 15.046  -5.301  5.317   1.00 0.00 ? 32 ILE A HD12 6  
ATOM 3242  H HD13 . ILE A 1 32 ? 16.179  -5.560  3.968   1.00 0.00 ? 32 ILE A HD13 6  
ATOM 3243  N N    . LEU A 1 33 ? 11.003  -7.546  2.560   1.00 0.00 ? 33 LEU A N    6  
ATOM 3244  C CA   . LEU A 1 33 ? 10.368  -8.810  2.199   1.00 0.00 ? 33 LEU A CA   6  
ATOM 3245  C C    . LEU A 1 33 ? 9.332   -8.592  1.108   1.00 0.00 ? 33 LEU A C    6  
ATOM 3246  O O    . LEU A 1 33 ? 9.301   -9.308  0.108   1.00 0.00 ? 33 LEU A O    6  
ATOM 3247  C CB   . LEU A 1 33 ? 9.670   -9.425  3.414   1.00 0.00 ? 33 LEU A CB   6  
ATOM 3248  C CG   . LEU A 1 33 ? 10.581  -9.999  4.501   1.00 0.00 ? 33 LEU A CG   6  
ATOM 3249  C CD1  . LEU A 1 33 ? 9.764   -10.458 5.699   1.00 0.00 ? 33 LEU A CD1  6  
ATOM 3250  C CD2  . LEU A 1 33 ? 11.363  -11.192 3.972   1.00 0.00 ? 33 LEU A CD2  6  
ATOM 3251  H H    . LEU A 1 33 ? 10.891  -7.209  3.506   1.00 0.00 ? 33 LEU A H    6  
ATOM 3252  H HA   . LEU A 1 33 ? 11.134  -9.496  1.838   1.00 0.00 ? 33 LEU A HA   6  
ATOM 3253  H HB2  . LEU A 1 33 ? 9.055   -8.649  3.871   1.00 0.00 ? 33 LEU A HB2  6  
ATOM 3254  H HB3  . LEU A 1 33 ? 9.030   -10.232 3.056   1.00 0.00 ? 33 LEU A HB3  6  
ATOM 3255  H HG   . LEU A 1 33 ? 11.279  -9.224  4.818   1.00 0.00 ? 33 LEU A HG   6  
ATOM 3256  H HD11 . LEU A 1 33 ? 10.424  -10.854 6.470   1.00 0.00 ? 33 LEU A HD11 6  
ATOM 3257  H HD12 . LEU A 1 33 ? 9.206   -9.612  6.103   1.00 0.00 ? 33 LEU A HD12 6  
ATOM 3258  H HD13 . LEU A 1 33 ? 9.067   -11.235 5.386   1.00 0.00 ? 33 LEU A HD13 6  
ATOM 3259  H HD21 . LEU A 1 33 ? 12.015  -11.584 4.752   1.00 0.00 ? 33 LEU A HD21 6  
ATOM 3260  H HD22 . LEU A 1 33 ? 10.667  -11.970 3.659   1.00 0.00 ? 33 LEU A HD22 6  
ATOM 3261  H HD23 . LEU A 1 33 ? 11.966  -10.879 3.120   1.00 0.00 ? 33 LEU A HD23 6  
ATOM 3262  N N    . ALA A 1 34 ? 8.483   -7.591  1.314   1.00 0.00 ? 34 ALA A N    6  
ATOM 3263  C CA   . ALA A 1 34 ? 7.429   -7.253  0.360   1.00 0.00 ? 34 ALA A CA   6  
ATOM 3264  C C    . ALA A 1 34 ? 8.027   -6.912  -0.995  1.00 0.00 ? 34 ALA A C    6  
ATOM 3265  O O    . ALA A 1 34 ? 7.507   -7.305  -2.038  1.00 0.00 ? 34 ALA A O    6  
ATOM 3266  C CB   . ALA A 1 34 ? 6.634   -6.053  0.852   1.00 0.00 ? 34 ALA A CB   6  
ATOM 3267  H H    . ALA A 1 34 ? 8.559   -7.038  2.156   1.00 0.00 ? 34 ALA A H    6  
ATOM 3268  H HA   . ALA A 1 34 ? 6.762   -8.109  0.256   1.00 0.00 ? 34 ALA A HA   6  
ATOM 3269  H HB1  . ALA A 1 34 ? 5.841   -5.818  0.141   1.00 0.00 ? 34 ALA A HB1  6  
ATOM 3270  H HB2  . ALA A 1 34 ? 6.192   -6.283  1.822   1.00 0.00 ? 34 ALA A HB2  6  
ATOM 3271  H HB3  . ALA A 1 34 ? 7.297   -5.194  0.950   1.00 0.00 ? 34 ALA A HB3  6  
ATOM 3272  N N    . VAL A 1 35 ? 9.132   -6.172  -0.966  1.00 0.00 ? 35 VAL A N    6  
ATOM 3273  C CA   . VAL A 1 35 ? 9.827   -5.760  -2.182  1.00 0.00 ? 35 VAL A CA   6  
ATOM 3274  C C    . VAL A 1 35 ? 10.192  -6.972  -3.023  1.00 0.00 ? 35 VAL A C    6  
ATOM 3275  O O    . VAL A 1 35 ? 10.028  -6.973  -4.242  1.00 0.00 ? 35 VAL A O    6  
ATOM 3276  C CB   . VAL A 1 35 ? 11.126  -4.999  -1.859  1.00 0.00 ? 35 VAL A CB   6  
ATOM 3277  C CG1  . VAL A 1 35 ? 11.935  -4.764  -3.126  1.00 0.00 ? 35 VAL A CG1  6  
ATOM 3278  C CG2  . VAL A 1 35 ? 10.812  -3.649  -1.233  1.00 0.00 ? 35 VAL A CG2  6  
ATOM 3279  H H    . VAL A 1 35 ? 9.511   -5.879  -0.077  1.00 0.00 ? 35 VAL A H    6  
ATOM 3280  H HA   . VAL A 1 35 ? 9.164   -5.109  -2.753  1.00 0.00 ? 35 VAL A HA   6  
ATOM 3281  H HB   . VAL A 1 35 ? 11.716  -5.591  -1.160  1.00 0.00 ? 35 VAL A HB   6  
ATOM 3282  H HG11 . VAL A 1 35 ? 12.855  -4.232  -2.884  1.00 0.00 ? 35 VAL A HG11 6  
ATOM 3283  H HG12 . VAL A 1 35 ? 12.180  -5.723  -3.582  1.00 0.00 ? 35 VAL A HG12 6  
ATOM 3284  H HG13 . VAL A 1 35 ? 11.348  -4.168  -3.825  1.00 0.00 ? 35 VAL A HG13 6  
ATOM 3285  H HG21 . VAL A 1 35 ? 11.738  -3.124  -1.001  1.00 0.00 ? 35 VAL A HG21 6  
ATOM 3286  H HG22 . VAL A 1 35 ? 10.224  -3.053  -1.932  1.00 0.00 ? 35 VAL A HG22 6  
ATOM 3287  H HG23 . VAL A 1 35 ? 10.242  -3.798  -0.316  1.00 0.00 ? 35 VAL A HG23 6  
ATOM 3288  N N    . ALA A 1 36 ? 10.690  -8.007  -2.353  1.00 0.00 ? 36 ALA A N    6  
ATOM 3289  C CA   . ALA A 1 36 ? 11.090  -9.246  -3.015  1.00 0.00 ? 36 ALA A CA   6  
ATOM 3290  C C    . ALA A 1 36 ? 9.882   -9.935  -3.629  1.00 0.00 ? 36 ALA A C    6  
ATOM 3291  O O    . ALA A 1 36 ? 9.917   -10.376 -4.777  1.00 0.00 ? 36 ALA A O    6  
ATOM 3292  C CB   . ALA A 1 36 ? 11.732  -10.197 -2.017  1.00 0.00 ? 36 ALA A CB   6  
ATOM 3293  H H    . ALA A 1 36 ? 10.800  -7.944  -1.351  1.00 0.00 ? 36 ALA A H    6  
ATOM 3294  H HA   . ALA A 1 36 ? 11.807  -9.007  -3.800  1.00 0.00 ? 36 ALA A HA   6  
ATOM 3295  H HB1  . ALA A 1 36 ? 12.039  -11.111 -2.524  1.00 0.00 ? 36 ALA A HB1  6  
ATOM 3296  H HB2  . ALA A 1 36 ? 12.604  -9.719  -1.571  1.00 0.00 ? 36 ALA A HB2  6  
ATOM 3297  H HB3  . ALA A 1 36 ? 11.012  -10.441 -1.235  1.00 0.00 ? 36 ALA A HB3  6  
ATOM 3298  N N    . GLY A 1 37 ? 8.810   -10.021 -2.847  1.00 0.00 ? 37 GLY A N    6  
ATOM 3299  C CA   . GLY A 1 37 ? 7.570   -10.653 -3.288  1.00 0.00 ? 37 GLY A CA   6  
ATOM 3300  C C    . GLY A 1 37 ? 7.153   -10.114 -4.647  1.00 0.00 ? 37 GLY A C    6  
ATOM 3301  O O    . GLY A 1 37 ? 7.037   -10.859 -5.619  1.00 0.00 ? 37 GLY A O    6  
ATOM 3302  H H    . GLY A 1 37 ? 8.844   -9.638  -1.913  1.00 0.00 ? 37 GLY A H    6  
ATOM 3303  H HA2  . GLY A 1 37 ? 7.721   -11.730 -3.359  1.00 0.00 ? 37 GLY A HA2  6  
ATOM 3304  H HA3  . GLY A 1 37 ? 6.783   -10.446 -2.562  1.00 0.00 ? 37 GLY A HA3  6  
ATOM 3305  N N    . LEU A 1 38 ? 6.928   -8.805  -4.701  1.00 0.00 ? 38 LEU A N    6  
ATOM 3306  C CA   . LEU A 1 38 ? 6.520   -8.133  -5.932  1.00 0.00 ? 38 LEU A CA   6  
ATOM 3307  C C    . LEU A 1 38 ? 7.575   -8.314  -7.011  1.00 0.00 ? 38 LEU A C    6  
ATOM 3308  O O    . LEU A 1 38 ? 7.258   -8.514  -8.182  1.00 0.00 ? 38 LEU A O    6  
ATOM 3309  C CB   . LEU A 1 38 ? 6.330   -6.635  -5.687  1.00 0.00 ? 38 LEU A CB   6  
ATOM 3310  C CG   . LEU A 1 38 ? 5.117   -6.234  -4.846  1.00 0.00 ? 38 LEU A CG   6  
ATOM 3311  C CD1  . LEU A 1 38 ? 5.121   -4.737  -4.575  1.00 0.00 ? 38 LEU A CD1  6  
ATOM 3312  C CD2  . LEU A 1 38 ? 3.824   -6.582  -5.567  1.00 0.00 ? 38 LEU A CD2  6  
ATOM 3313  H H    . LEU A 1 38 ? 7.040   -8.245  -3.867  1.00 0.00 ? 38 LEU A H    6  
ATOM 3314  H HA   . LEU A 1 38 ? 5.578   -8.564  -6.271  1.00 0.00 ? 38 LEU A HA   6  
ATOM 3315  H HB2  . LEU A 1 38 ? 7.221   -6.265  -5.181  1.00 0.00 ? 38 LEU A HB2  6  
ATOM 3316  H HB3  . LEU A 1 38 ? 6.236   -6.149  -6.658  1.00 0.00 ? 38 LEU A HB3  6  
ATOM 3317  H HG   . LEU A 1 38 ? 5.155   -6.770  -3.898  1.00 0.00 ? 38 LEU A HG   6  
ATOM 3318  H HD11 . LEU A 1 38 ? 4.257   -4.466  -3.967  1.00 0.00 ? 38 LEU A HD11 6  
ATOM 3319  H HD12 . LEU A 1 38 ? 6.034   -4.467  -4.044  1.00 0.00 ? 38 LEU A HD12 6  
ATOM 3320  H HD13 . LEU A 1 38 ? 5.078   -4.197  -5.521  1.00 0.00 ? 38 LEU A HD13 6  
ATOM 3321  H HD21 . LEU A 1 38 ? 2.968   -6.301  -4.952  1.00 0.00 ? 38 LEU A HD21 6  
ATOM 3322  H HD22 . LEU A 1 38 ? 3.780   -6.042  -6.513  1.00 0.00 ? 38 LEU A HD22 6  
ATOM 3323  H HD23 . LEU A 1 38 ? 3.794   -7.654  -5.759  1.00 0.00 ? 38 LEU A HD23 6  
ATOM 3324  N N    . ILE A 1 39 ? 8.837   -8.241  -6.600  1.00 0.00 ? 39 ILE A N    6  
ATOM 3325  C CA   . ILE A 1 39 ? 9.966   -8.394  -7.513  1.00 0.00 ? 39 ILE A CA   6  
ATOM 3326  C C    . ILE A 1 39 ? 9.909   -9.744  -8.208  1.00 0.00 ? 39 ILE A C    6  
ATOM 3327  O O    . ILE A 1 39 ? 10.119  -9.847  -9.416  1.00 0.00 ? 39 ILE A O    6  
ATOM 3328  C CB   . ILE A 1 39 ? 11.311  -8.301  -6.768  1.00 0.00 ? 39 ILE A CB   6  
ATOM 3329  C CG1  . ILE A 1 39 ? 11.527  -6.885  -6.231  1.00 0.00 ? 39 ILE A CG1  6  
ATOM 3330  C CG2  . ILE A 1 39 ? 12.462  -8.643  -7.702  1.00 0.00 ? 39 ILE A CG2  6  
ATOM 3331  C CD1  . ILE A 1 39 ? 11.566  -5.823  -7.309  1.00 0.00 ? 39 ILE A CD1  6  
ATOM 3332  H H    . ILE A 1 39 ? 9.033   -8.075  -5.623  1.00 0.00 ? 39 ILE A H    6  
ATOM 3333  H HA   . ILE A 1 39 ? 9.915   -7.600  -8.259  1.00 0.00 ? 39 ILE A HA   6  
ATOM 3334  H HB   . ILE A 1 39 ? 11.302  -9.004  -5.935  1.00 0.00 ? 39 ILE A HB   6  
ATOM 3335  H HG12 . ILE A 1 39 ? 10.713  -6.649  -5.545  1.00 0.00 ? 39 ILE A HG12 6  
ATOM 3336  H HG13 . ILE A 1 39 ? 12.474  -6.862  -5.692  1.00 0.00 ? 39 ILE A HG13 6  
ATOM 3337  H HG21 . ILE A 1 39 ? 13.406  -8.583  -7.161  1.00 0.00 ? 39 ILE A HG21 6  
ATOM 3338  H HG22 . ILE A 1 39 ? 12.328  -9.654  -8.086  1.00 0.00 ? 39 ILE A HG22 6  
ATOM 3339  H HG23 . ILE A 1 39 ? 12.476  -7.937  -8.533  1.00 0.00 ? 39 ILE A HG23 6  
ATOM 3340  H HD11 . ILE A 1 39 ? 11.720  -4.837  -6.870  1.00 0.00 ? 39 ILE A HD11 6  
ATOM 3341  H HD12 . ILE A 1 39 ? 12.382  -6.038  -7.998  1.00 0.00 ? 39 ILE A HD12 6  
ATOM 3342  H HD13 . ILE A 1 39 ? 10.621  -5.827  -7.853  1.00 0.00 ? 39 ILE A HD13 6  
ATOM 3343  N N    . TYR A 1 40 ? 9.622   -10.781 -7.426  1.00 0.00 ? 40 TYR A N    6  
ATOM 3344  C CA   . TYR A 1 40 ? 9.530   -12.144 -7.941  1.00 0.00 ? 40 TYR A CA   6  
ATOM 3345  C C    . TYR A 1 40 ? 8.316   -12.293 -8.842  1.00 0.00 ? 40 TYR A C    6  
ATOM 3346  O O    . TYR A 1 40 ? 8.379   -12.927 -9.894  1.00 0.00 ? 40 TYR A O    6  
ATOM 3347  C CB   . TYR A 1 40 ? 9.403   -13.144 -6.790  1.00 0.00 ? 40 TYR A CB   6  
ATOM 3348  C CG   . TYR A 1 40 ? 9.328   -14.587 -7.238  1.00 0.00 ? 40 TYR A CG   6  
ATOM 3349  C CD1  . TYR A 1 40 ? 10.473  -15.270 -7.628  1.00 0.00 ? 40 TYR A CD1  6  
ATOM 3350  C CD2  . TYR A 1 40 ? 8.114   -15.260 -7.268  1.00 0.00 ? 40 TYR A CD2  6  
ATOM 3351  C CE1  . TYR A 1 40 ? 10.414  -16.588 -8.039  1.00 0.00 ? 40 TYR A CE1  6  
ATOM 3352  C CE2  . TYR A 1 40 ? 8.036   -16.578 -7.675  1.00 0.00 ? 40 TYR A CE2  6  
ATOM 3353  C CZ   . TYR A 1 40 ? 9.200   -17.241 -8.062  1.00 0.00 ? 40 TYR A CZ   6  
ATOM 3354  O OH   . TYR A 1 40 ? 9.139   -18.553 -8.470  1.00 0.00 ? 40 TYR A OH   6  
ATOM 3355  H H    . TYR A 1 40 ? 9.461   -10.631 -6.440  1.00 0.00 ? 40 TYR A H    6  
ATOM 3356  H HA   . TYR A 1 40 ? 10.432  -12.363 -8.511  1.00 0.00 ? 40 TYR A HA   6  
ATOM 3357  H HB2  . TYR A 1 40 ? 10.266  -13.029 -6.134  1.00 0.00 ? 40 TYR A HB2  6  
ATOM 3358  H HB3  . TYR A 1 40 ? 8.500   -12.909 -6.225  1.00 0.00 ? 40 TYR A HB3  6  
ATOM 3359  H HD1  . TYR A 1 40 ? 11.426  -14.762 -7.609  1.00 0.00 ? 40 TYR A HD1  6  
ATOM 3360  H HD2  . TYR A 1 40 ? 7.214   -14.743 -6.967  1.00 0.00 ? 40 TYR A HD2  6  
ATOM 3361  H HE1  . TYR A 1 40 ? 11.313  -17.103 -8.341  1.00 0.00 ? 40 TYR A HE1  6  
ATOM 3362  H HE2  . TYR A 1 40 ? 7.084   -17.088 -7.693  1.00 0.00 ? 40 TYR A HE2  6  
ATOM 3363  H HH   . TYR A 1 40 ? 8.248   -18.912 -8.449  1.00 0.00 ? 40 TYR A HH   6  
ATOM 3364  N N    . SER A 1 41 ? 7.206   -11.698 -8.414  1.00 0.00 ? 41 SER A N    6  
ATOM 3365  C CA   . SER A 1 41 ? 5.956   -11.747 -9.165  1.00 0.00 ? 41 SER A CA   6  
ATOM 3366  C C    . SER A 1 41 ? 6.137   -11.131 -10.543 1.00 0.00 ? 41 SER A C    6  
ATOM 3367  O O    . SER A 1 41 ? 5.769   -11.722 -11.557 1.00 0.00 ? 41 SER A O    6  
ATOM 3368  C CB   . SER A 1 41 ? 4.859   -10.974 -8.431  1.00 0.00 ? 41 SER A CB   6  
ATOM 3369  O OG   . SER A 1 41 ? 4.529   -11.598 -7.202  1.00 0.00 ? 41 SER A OG   6  
ATOM 3370  H H    . SER A 1 41 ? 7.217   -11.191 -7.540  1.00 0.00 ? 41 SER A H    6  
ATOM 3371  H HA   . SER A 1 41 ? 5.652   -12.788 -9.272  1.00 0.00 ? 41 SER A HA   6  
ATOM 3372  H HB2  . SER A 1 41 ? 5.209   -9.960  -8.232  1.00 0.00 ? 41 SER A HB2  6  
ATOM 3373  H HB3  . SER A 1 41 ? 3.969   -10.934 -9.059  1.00 0.00 ? 41 SER A HB3  6  
ATOM 3374  H HG   . SER A 1 41 ? 3.840   -11.088 -6.769  1.00 0.00 ? 41 SER A HG   6  
ATOM 3375  N N    . MET A 1 42 ? 6.711   -9.932  -10.565 1.00 0.00 ? 42 MET A N    6  
ATOM 3376  C CA   . MET A 1 42 ? 6.956   -9.207  -11.809 1.00 0.00 ? 42 MET A CA   6  
ATOM 3377  C C    . MET A 1 42 ? 7.942   -9.966  -12.682 1.00 0.00 ? 42 MET A C    6  
ATOM 3378  O O    . MET A 1 42 ? 7.778   -10.055 -13.898 1.00 0.00 ? 42 MET A O    6  
ATOM 3379  C CB   . MET A 1 42 ? 7.536   -7.822  -11.517 1.00 0.00 ? 42 MET A CB   6  
ATOM 3380  C CG   . MET A 1 42 ? 7.745   -6.963  -12.753 1.00 0.00 ? 42 MET A CG   6  
ATOM 3381  S SD   . MET A 1 42 ? 8.399   -5.328  -12.362 1.00 0.00 ? 42 MET A SD   6  
ATOM 3382  C CE   . MET A 1 42 ? 10.069  -5.742  -11.866 1.00 0.00 ? 42 MET A CE   6  
ATOM 3383  H H    . MET A 1 42 ? 6.990   -9.497  -9.697  1.00 0.00 ? 42 MET A H    6  
ATOM 3384  H HA   . MET A 1 42 ? 6.011   -9.097  -12.342 1.00 0.00 ? 42 MET A HA   6  
ATOM 3385  H HB2  . MET A 1 42 ? 6.853   -7.298  -10.848 1.00 0.00 ? 42 MET A HB2  6  
ATOM 3386  H HB3  . MET A 1 42 ? 8.499   -7.951  -11.024 1.00 0.00 ? 42 MET A HB3  6  
ATOM 3387  H HG2  . MET A 1 42 ? 8.442   -7.469  -13.421 1.00 0.00 ? 42 MET A HG2  6  
ATOM 3388  H HG3  . MET A 1 42 ? 6.791   -6.846  -13.267 1.00 0.00 ? 42 MET A HG3  6  
ATOM 3389  H HE1  . MET A 1 42 ? 10.610  -4.836  -11.591 1.00 0.00 ? 42 MET A HE1  6  
ATOM 3390  H HE2  . MET A 1 42 ? 10.036  -6.415  -11.010 1.00 0.00 ? 42 MET A HE2  6  
ATOM 3391  H HE3  . MET A 1 42 ? 10.581  -6.231  -12.694 1.00 0.00 ? 42 MET A HE3  6  
ATOM 3392  N N    . LEU A 1 43 ? 8.972   -10.513 -12.043 1.00 0.00 ? 43 LEU A N    6  
ATOM 3393  C CA   . LEU A 1 43 ? 10.006  -11.274 -12.737 1.00 0.00 ? 43 LEU A CA   6  
ATOM 3394  C C    . LEU A 1 43 ? 9.485   -12.647 -13.128 1.00 0.00 ? 43 LEU A C    6  
ATOM 3395  O O    . LEU A 1 43 ? 9.762   -13.147 -14.217 1.00 0.00 ? 43 LEU A O    6  
ATOM 3396  C CB   . LEU A 1 43 ? 11.230  -11.460 -11.837 1.00 0.00 ? 43 LEU A CB   6  
ATOM 3397  C CG   . LEU A 1 43 ? 12.064  -10.207 -11.561 1.00 0.00 ? 43 LEU A CG   6  
ATOM 3398  C CD1  . LEU A 1 43 ? 13.167  -10.507 -10.557 1.00 0.00 ? 43 LEU A CD1  6  
ATOM 3399  C CD2  . LEU A 1 43 ? 12.710  -9.699  -12.840 1.00 0.00 ? 43 LEU A CD2  6  
ATOM 3400  H H    . LEU A 1 43 ? 9.051   -10.404 -11.042 1.00 0.00 ? 43 LEU A H    6  
ATOM 3401  H HA   . LEU A 1 43 ? 10.298  -10.729 -13.635 1.00 0.00 ? 43 LEU A HA   6  
ATOM 3402  H HB2  . LEU A 1 43 ? 10.882  -11.845 -10.879 1.00 0.00 ? 43 LEU A HB2  6  
ATOM 3403  H HB3  . LEU A 1 43 ? 11.881  -12.195 -12.310 1.00 0.00 ? 43 LEU A HB3  6  
ATOM 3404  H HG   . LEU A 1 43 ? 11.411  -9.433  -11.157 1.00 0.00 ? 43 LEU A HG   6  
ATOM 3405  H HD11 . LEU A 1 43 ? 13.746  -9.605  -10.361 1.00 0.00 ? 43 LEU A HD11 6  
ATOM 3406  H HD12 . LEU A 1 43 ? 12.722  -10.859 -9.626  1.00 0.00 ? 43 LEU A HD12 6  
ATOM 3407  H HD13 . LEU A 1 43 ? 13.824  -11.277 -10.960 1.00 0.00 ? 43 LEU A HD13 6  
ATOM 3408  H HD21 . LEU A 1 43 ? 13.291  -8.800  -12.631 1.00 0.00 ? 43 LEU A HD21 6  
ATOM 3409  H HD22 . LEU A 1 43 ? 13.367  -10.468 -13.244 1.00 0.00 ? 43 LEU A HD22 6  
ATOM 3410  H HD23 . LEU A 1 43 ? 11.934  -9.464  -13.569 1.00 0.00 ? 43 LEU A HD23 6  
ATOM 3411  N N    . ARG A 1 44 ? 8.723   -13.252 -12.222 1.00 0.00 ? 44 ARG A N    6  
ATOM 3412  C CA   . ARG A 1 44 ? 8.145   -14.574 -12.445 1.00 0.00 ? 44 ARG A CA   6  
ATOM 3413  C C    . ARG A 1 44 ? 6.870   -14.466 -13.266 1.00 0.00 ? 44 ARG A C    6  
ATOM 3414  O O    . ARG A 1 44 ? 6.549   -15.347 -14.062 1.00 0.00 ? 44 ARG A O    6  
ATOM 3415  C CB   . ARG A 1 44 ? 7.806   -15.243 -11.111 1.00 0.00 ? 44 ARG A CB   6  
ATOM 3416  C CG   . ARG A 1 44 ? 7.282   -16.663 -11.244 1.00 0.00 ? 44 ARG A CG   6  
ATOM 3417  C CD   . ARG A 1 44 ? 8.357   -17.601 -11.769 1.00 0.00 ? 44 ARG A CD   6  
ATOM 3418  N NE   . ARG A 1 44 ? 7.874   -18.975 -11.888 1.00 0.00 ? 44 ARG A NE   6  
ATOM 3419  C CZ   . ARG A 1 44 ? 8.552   -19.957 -12.473 1.00 0.00 ? 44 ARG A CZ   6  
ATOM 3420  N NH1  . ARG A 1 44 ? 9.746   -19.718 -12.997 1.00 0.00 ? 44 ARG A NH1  6  
ATOM 3421  N NH2  . ARG A 1 44 ? 8.033   -21.176 -12.534 1.00 0.00 ? 44 ARG A NH2  6  
ATOM 3422  H H    . ARG A 1 44 ? 8.531   -12.790 -11.345 1.00 0.00 ? 44 ARG A H    6  
ATOM 3423  H HA   . ARG A 1 44 ? 8.869   -15.186 -12.981 1.00 0.00 ? 44 ARG A HA   6  
ATOM 3424  H HB2  . ARG A 1 44 ? 8.708   -15.266 -10.501 1.00 0.00 ? 44 ARG A HB2  6  
ATOM 3425  H HB3  . ARG A 1 44 ? 7.045   -14.643 -10.611 1.00 0.00 ? 44 ARG A HB3  6  
ATOM 3426  H HG2  . ARG A 1 44 ? 6.952   -17.012 -10.266 1.00 0.00 ? 44 ARG A HG2  6  
ATOM 3427  H HG3  . ARG A 1 44 ? 6.438   -16.667 -11.934 1.00 0.00 ? 44 ARG A HG3  6  
ATOM 3428  H HD2  . ARG A 1 44 ? 8.680   -17.254 -12.751 1.00 0.00 ? 44 ARG A HD2  6  
ATOM 3429  H HD3  . ARG A 1 44 ? 9.206   -17.583 -11.086 1.00 0.00 ? 44 ARG A HD3  6  
ATOM 3430  H HE   . ARG A 1 44 ? 6.965   -19.179 -11.497 1.00 0.00 ? 44 ARG A HE   6  
ATOM 3431  H HH11 . ARG A 1 44 ? 10.141  -18.789 -12.951 1.00 0.00 ? 44 ARG A HH11 6  
ATOM 3432  H HH12 . ARG A 1 44 ? 10.260  -20.464 -13.442 1.00 0.00 ? 44 ARG A HH12 6  
ATOM 3433  H HH21 . ARG A 1 44 ? 7.123   -21.358 -12.136 1.00 0.00 ? 44 ARG A HH21 6  
ATOM 3434  H HH22 . ARG A 1 44 ? 8.548   -21.922 -12.979 1.00 0.00 ? 44 ARG A HH22 6  
ATOM 3435  N N    . LYS A 1 45 ? 6.145   -13.370 -13.060 1.00 0.00 ? 45 LYS A N    6  
ATOM 3436  C CA   . LYS A 1 45 ? 4.895   -13.117 -13.770 1.00 0.00 ? 45 LYS A CA   6  
ATOM 3437  C C    . LYS A 1 45 ? 5.171   -12.733 -15.214 1.00 0.00 ? 45 LYS A C    6  
ATOM 3438  O O    . LYS A 1 45 ? 4.539   -13.242 -16.139 1.00 0.00 ? 45 LYS A O    6  
ATOM 3439  C CB   . LYS A 1 45 ? 4.123   -11.975 -13.105 1.00 0.00 ? 45 LYS A CB   6  
ATOM 3440  C CG   . LYS A 1 45 ? 2.779   -11.678 -13.750 1.00 0.00 ? 45 LYS A CG   6  
ATOM 3441  C CD   . LYS A 1 45 ? 2.043   -10.574 -13.007 1.00 0.00 ? 45 LYS A CD   6  
ATOM 3442  C CE   . LYS A 1 45 ? 0.705   -10.266 -13.660 1.00 0.00 ? 45 LYS A CE   6  
ATOM 3443  N NZ   . LYS A 1 45 ? -0.032  -9.195  -12.936 1.00 0.00 ? 45 LYS A NZ   6  
ATOM 3444  H H    . LYS A 1 45 ? 6.461   -12.682 -12.391 1.00 0.00 ? 45 LYS A H    6  
ATOM 3445  H HA   . LYS A 1 45 ? 4.289   -14.023 -13.746 1.00 0.00 ? 45 LYS A HA   6  
ATOM 3446  H HB2  . LYS A 1 45 ? 3.951   -12.239 -12.062 1.00 0.00 ? 45 LYS A HB2  6  
ATOM 3447  H HB3  . LYS A 1 45 ? 4.733   -11.073 -13.155 1.00 0.00 ? 45 LYS A HB3  6  
ATOM 3448  H HG2  . LYS A 1 45 ? 2.941   -11.365 -14.781 1.00 0.00 ? 45 LYS A HG2  6  
ATOM 3449  H HG3  . LYS A 1 45 ? 2.170   -12.582 -13.736 1.00 0.00 ? 45 LYS A HG3  6  
ATOM 3450  H HD2  . LYS A 1 45 ? 1.871   -10.891 -11.978 1.00 0.00 ? 45 LYS A HD2  6  
ATOM 3451  H HD3  . LYS A 1 45 ? 2.656   -9.672  -13.012 1.00 0.00 ? 45 LYS A HD3  6  
ATOM 3452  H HE2  . LYS A 1 45 ? 0.878   -9.944  -14.687 1.00 0.00 ? 45 LYS A HE2  6  
ATOM 3453  H HE3  . LYS A 1 45 ? 0.097   -11.171 -13.666 1.00 0.00 ? 45 LYS A HE3  6  
ATOM 3454  H HZ1  . LYS A 1 45 ? -0.914  -9.016  -13.396 1.00 0.00 ? 45 LYS A HZ1  6  
ATOM 3455  H HZ2  . LYS A 1 45 ? -0.204  -9.489  -11.985 1.00 0.00 ? 45 LYS A HZ2  6  
ATOM 3456  H HZ3  . LYS A 1 45 ? 0.521   -8.350  -12.932 1.00 0.00 ? 45 LYS A HZ3  6  
ATOM 3457  N N    . ALA A 1 46 ? 6.126   -11.826 -15.395 1.00 0.00 ? 46 ALA A N    6  
ATOM 3458  C CA   . ALA A 1 46 ? 6.510   -11.351 -16.721 1.00 0.00 ? 46 ALA A CA   6  
ATOM 3459  C C    . ALA A 1 46 ? 7.626   -10.323 -16.598 1.00 0.00 ? 46 ALA A C    6  
ATOM 3460  O O    . ALA A 1 46 ? 8.067   -10.011 -15.494 1.00 0.00 ? 46 ALA A O    6  
ATOM 3461  C CB   . ALA A 1 46 ? 5.293   -10.746 -17.416 1.00 0.00 ? 46 ALA A CB   6  
ATOM 3462  H H    . ALA A 1 46 ? 6.608   -11.444 -14.594 1.00 0.00 ? 46 ALA A H    6  
ATOM 3463  H HA   . ALA A 1 46 ? 6.869   -12.196 -17.307 1.00 0.00 ? 46 ALA A HA   6  
ATOM 3464  H HB1  . ALA A 1 46 ? 5.578   -10.406 -18.412 1.00 0.00 ? 46 ALA A HB1  6  
ATOM 3465  H HB2  . ALA A 1 46 ? 4.510   -11.500 -17.499 1.00 0.00 ? 46 ALA A HB2  6  
ATOM 3466  H HB3  . ALA A 1 46 ? 4.924   -9.902  -16.834 1.00 0.00 ? 46 ALA A HB3  6  
ATOM 3467  N N    . GLY A 1 1  ? -26.688 -7.331  45.172  1.00 0.00 ? 1  GLY A N    7  
ATOM 3468  C CA   . GLY A 1 1  ? -27.428 -6.087  45.215  1.00 0.00 ? 1  GLY A CA   7  
ATOM 3469  C C    . GLY A 1 1  ? -26.978 -5.175  44.085  1.00 0.00 ? 1  GLY A C    7  
ATOM 3470  O O    . GLY A 1 1  ? -26.104 -5.530  43.298  1.00 0.00 ? 1  GLY A O    7  
ATOM 3471  H H1   . GLY A 1 1  ? -25.996 -7.457  44.447  1.00 0.00 ? 1  GLY A H1   7  
ATOM 3472  H HA2  . GLY A 1 1  ? -28.493 -6.295  45.109  1.00 0.00 ? 1  GLY A HA2  7  
ATOM 3473  H HA3  . GLY A 1 1  ? -27.251 -5.593  46.171  1.00 0.00 ? 1  GLY A HA3  7  
ATOM 3474  N N    . VAL A 1 2  ? -27.590 -3.996  44.020  1.00 0.00 ? 2  VAL A N    7  
ATOM 3475  C CA   . VAL A 1 2  ? -27.272 -3.008  42.994  1.00 0.00 ? 2  VAL A CA   7  
ATOM 3476  C C    . VAL A 1 2  ? -25.887 -2.426  43.225  1.00 0.00 ? 2  VAL A C    7  
ATOM 3477  O O    . VAL A 1 2  ? -25.099 -2.269  42.293  1.00 0.00 ? 2  VAL A O    7  
ATOM 3478  C CB   . VAL A 1 2  ? -28.281 -1.844  42.999  1.00 0.00 ? 2  VAL A CB   7  
ATOM 3479  C CG1  . VAL A 1 2  ? -27.827 -0.742  42.055  1.00 0.00 ? 2  VAL A CG1  7  
ATOM 3480  C CG2  . VAL A 1 2  ? -29.652 -2.326  42.551  1.00 0.00 ? 2  VAL A CG2  7  
ATOM 3481  H H    . VAL A 1 2  ? -28.302 -3.766  44.699  1.00 0.00 ? 2  VAL A H    7  
ATOM 3482  H HA   . VAL A 1 2  ? -27.300 -3.500  42.022  1.00 0.00 ? 2  VAL A HA   7  
ATOM 3483  H HB   . VAL A 1 2  ? -28.354 -1.444  44.011  1.00 0.00 ? 2  VAL A HB   7  
ATOM 3484  H HG11 . VAL A 1 2  ? -28.544 0.079   42.074  1.00 0.00 ? 2  VAL A HG11 7  
ATOM 3485  H HG12 . VAL A 1 2  ? -26.850 -0.375  42.369  1.00 0.00 ? 2  VAL A HG12 7  
ATOM 3486  H HG13 . VAL A 1 2  ? -27.758 -1.138  41.042  1.00 0.00 ? 2  VAL A HG13 7  
ATOM 3487  H HG21 . VAL A 1 2  ? -30.359 -1.496  42.567  1.00 0.00 ? 2  VAL A HG21 7  
ATOM 3488  H HG22 . VAL A 1 2  ? -29.584 -2.723  41.538  1.00 0.00 ? 2  VAL A HG22 7  
ATOM 3489  H HG23 . VAL A 1 2  ? -29.999 -3.109  43.225  1.00 0.00 ? 2  VAL A HG23 7  
ATOM 3490  N N    . ILE A 1 3  ? -25.600 -2.108  44.484  1.00 0.00 ? 3  ILE A N    7  
ATOM 3491  C CA   . ILE A 1 3  ? -24.312 -1.541  44.871  1.00 0.00 ? 3  ILE A CA   7  
ATOM 3492  C C    . ILE A 1 3  ? -23.199 -2.555  44.663  1.00 0.00 ? 3  ILE A C    7  
ATOM 3493  O O    . ILE A 1 3  ? -22.104 -2.215  44.219  1.00 0.00 ? 3  ILE A O    7  
ATOM 3494  C CB   . ILE A 1 3  ? -24.301 -1.124  46.354  1.00 0.00 ? 3  ILE A CB   7  
ATOM 3495  C CG1  . ILE A 1 3  ? -25.260 0.045   46.586  1.00 0.00 ? 3  ILE A CG1  7  
ATOM 3496  C CG2  . ILE A 1 3  ? -22.905 -0.694  46.776  1.00 0.00 ? 3  ILE A CG2  7  
ATOM 3497  C CD1  . ILE A 1 3  ? -25.499 0.358   48.047  1.00 0.00 ? 3  ILE A CD1  7  
ATOM 3498  H H    . ILE A 1 3  ? -26.290 -2.261  45.206  1.00 0.00 ? 3  ILE A H    7  
ATOM 3499  H HA   . ILE A 1 3  ? -24.123 -0.664  44.252  1.00 0.00 ? 3  ILE A HA   7  
ATOM 3500  H HB   . ILE A 1 3  ? -24.615 -1.972  46.961  1.00 0.00 ? 3  ILE A HB   7  
ATOM 3501  H HG12 . ILE A 1 3  ? -24.844 0.932   46.109  1.00 0.00 ? 3  ILE A HG12 7  
ATOM 3502  H HG13 . ILE A 1 3  ? -26.218 -0.199  46.126  1.00 0.00 ? 3  ILE A HG13 7  
ATOM 3503  H HG21 . ILE A 1 3  ? -22.908 -0.411  47.829  1.00 0.00 ? 3  ILE A HG21 7  
ATOM 3504  H HG22 . ILE A 1 3  ? -22.211 -1.520  46.626  1.00 0.00 ? 3  ILE A HG22 7  
ATOM 3505  H HG23 . ILE A 1 3  ? -22.591 0.159   46.174  1.00 0.00 ? 3  ILE A HG23 7  
ATOM 3506  H HD11 . ILE A 1 3  ? -26.187 1.198   48.151  1.00 0.00 ? 3  ILE A HD11 7  
ATOM 3507  H HD12 . ILE A 1 3  ? -25.927 -0.516  48.537  1.00 0.00 ? 3  ILE A HD12 7  
ATOM 3508  H HD13 . ILE A 1 3  ? -24.551 0.613   48.520  1.00 0.00 ? 3  ILE A HD13 7  
ATOM 3509  N N    . ASP A 1 4  ? -23.496 -3.809  44.991  1.00 0.00 ? 4  ASP A N    7  
ATOM 3510  C CA   . ASP A 1 4  ? -22.536 -4.899  44.851  1.00 0.00 ? 4  ASP A CA   7  
ATOM 3511  C C    . ASP A 1 4  ? -21.955 -4.920  43.446  1.00 0.00 ? 4  ASP A C    7  
ATOM 3512  O O    . ASP A 1 4  ? -20.761 -5.143  43.255  1.00 0.00 ? 4  ASP A O    7  
ATOM 3513  C CB   . ASP A 1 4  ? -23.212 -6.246  45.115  1.00 0.00 ? 4  ASP A CB   7  
ATOM 3514  C CG   . ASP A 1 4  ? -23.555 -6.449  46.577  1.00 0.00 ? 4  ASP A CG   7  
ATOM 3515  O OD1  . ASP A 1 4  ? -23.975 -7.569  46.939  1.00 0.00 ? 4  ASP A OD1  7  
ATOM 3516  O OD2  . ASP A 1 4  ? -23.404 -5.489  47.362  1.00 0.00 ? 4  ASP A OD2  7  
ATOM 3517  H H    . ASP A 1 4  ? -24.415 -4.025  45.351  1.00 0.00 ? 4  ASP A H    7  
ATOM 3518  H HA   . ASP A 1 4  ? -21.733 -4.751  45.572  1.00 0.00 ? 4  ASP A HA   7  
ATOM 3519  H HB2  . ASP A 1 4  ? -24.130 -6.298  44.529  1.00 0.00 ? 4  ASP A HB2  7  
ATOM 3520  H HB3  . ASP A 1 4  ? -22.540 -7.043  44.800  1.00 0.00 ? 4  ASP A HB3  7  
ATOM 3521  H HD2  . ASP A 1 4  ? -23.640 -5.687  48.271  1.00 0.00 ? 4  ASP A HD2  7  
ATOM 3522  N N    . THR A 1 5  ? -22.820 -4.683  42.463  1.00 0.00 ? 5  THR A N    7  
ATOM 3523  C CA   . THR A 1 5  ? -22.420 -4.669  41.059  1.00 0.00 ? 5  THR A CA   7  
ATOM 3524  C C    . THR A 1 5  ? -22.114 -3.250  40.608  1.00 0.00 ? 5  THR A C    7  
ATOM 3525  O O    . THR A 1 5  ? -21.735 -3.014  39.462  1.00 0.00 ? 5  THR A O    7  
ATOM 3526  C CB   . THR A 1 5  ? -23.531 -5.226  40.150  1.00 0.00 ? 5  THR A CB   7  
ATOM 3527  O OG1  . THR A 1 5  ? -24.702 -4.407  40.265  1.00 0.00 ? 5  THR A OG1  7  
ATOM 3528  C CG2  . THR A 1 5  ? -23.885 -6.650  40.552  1.00 0.00 ? 5  THR A CG2  7  
ATOM 3529  H H    . THR A 1 5  ? -23.790 -4.504  42.685  1.00 0.00 ? 5  THR A H    7  
ATOM 3530  H HA   . THR A 1 5  ? -21.527 -5.284  40.949  1.00 0.00 ? 5  THR A HA   7  
ATOM 3531  H HB   . THR A 1 5  ? -23.184 -5.219  39.117  1.00 0.00 ? 5  THR A HB   7  
ATOM 3532  H HG1  . THR A 1 5  ? -25.382 -4.761  39.688  1.00 0.00 ? 5  THR A HG1  7  
ATOM 3533  H HG21 . THR A 1 5  ? -24.671 -7.032  39.900  1.00 0.00 ? 5  THR A HG21 7  
ATOM 3534  H HG22 . THR A 1 5  ? -23.002 -7.281  40.463  1.00 0.00 ? 5  THR A HG22 7  
ATOM 3535  H HG23 . THR A 1 5  ? -24.236 -6.658  41.584  1.00 0.00 ? 5  THR A HG23 7  
ATOM 3536  N N    . SER A 1 6  ? -22.282 -2.305  41.529  1.00 0.00 ? 6  SER A N    7  
ATOM 3537  C CA   . SER A 1 6  ? -22.031 -0.894  41.253  1.00 0.00 ? 6  SER A CA   7  
ATOM 3538  C C    . SER A 1 6  ? -20.678 -0.715  40.581  1.00 0.00 ? 6  SER A C    7  
ATOM 3539  O O    . SER A 1 6  ? -20.585 -0.208  39.464  1.00 0.00 ? 6  SER A O    7  
ATOM 3540  C CB   . SER A 1 6  ? -22.037 -0.085  42.551  1.00 0.00 ? 6  SER A CB   7  
ATOM 3541  O OG   . SER A 1 6  ? -21.785 1.287   42.299  1.00 0.00 ? 6  SER A OG   7  
ATOM 3542  H H    . SER A 1 6  ? -22.594 -2.561  42.455  1.00 0.00 ? 6  SER A H    7  
ATOM 3543  H HA   . SER A 1 6  ? -22.815 -0.521  40.593  1.00 0.00 ? 6  SER A HA   7  
ATOM 3544  H HB2  . SER A 1 6  ? -23.012 -0.185  43.029  1.00 0.00 ? 6  SER A HB2  7  
ATOM 3545  H HB3  . SER A 1 6  ? -21.265 -0.471  43.216  1.00 0.00 ? 6  SER A HB3  7  
ATOM 3546  H HG   . SER A 1 6  ? -21.796 1.765   43.132  1.00 0.00 ? 6  SER A HG   7  
ATOM 3547  N N    . ALA A 1 7  ? -19.629 -1.139  41.280  1.00 0.00 ? 7  ALA A N    7  
ATOM 3548  C CA   . ALA A 1 7  ? -18.263 -1.039  40.774  1.00 0.00 ? 7  ALA A CA   7  
ATOM 3549  C C    . ALA A 1 7  ? -18.117 -1.818  39.477  1.00 0.00 ? 7  ALA A C    7  
ATOM 3550  O O    . ALA A 1 7  ? -17.474 -1.365  38.531  1.00 0.00 ? 7  ALA A O    7  
ATOM 3551  C CB   . ALA A 1 7  ? -17.279 -1.603  41.788  1.00 0.00 ? 7  ALA A CB   7  
ATOM 3552  H H    . ALA A 1 7  ? -19.771 -1.545  42.194  1.00 0.00 ? 7  ALA A H    7  
ATOM 3553  H HA   . ALA A 1 7  ? -18.033 0.011   40.593  1.00 0.00 ? 7  ALA A HA   7  
ATOM 3554  H HB1  . ALA A 1 7  ? -16.262 -1.510  41.407  1.00 0.00 ? 7  ALA A HB1  7  
ATOM 3555  H HB2  . ALA A 1 7  ? -17.367 -1.050  42.724  1.00 0.00 ? 7  ALA A HB2  7  
ATOM 3556  H HB3  . ALA A 1 7  ? -17.504 -2.654  41.965  1.00 0.00 ? 7  ALA A HB3  7  
ATOM 3557  N N    . VAL A 1 8  ? -18.725 -3.001  39.446  1.00 0.00 ? 8  VAL A N    7  
ATOM 3558  C CA   . VAL A 1 8  ? -18.680 -3.870  38.274  1.00 0.00 ? 8  VAL A CA   7  
ATOM 3559  C C    . VAL A 1 8  ? -19.353 -3.200  37.088  1.00 0.00 ? 8  VAL A C    7  
ATOM 3560  O O    . VAL A 1 8  ? -18.866 -3.265  35.960  1.00 0.00 ? 8  VAL A O    7  
ATOM 3561  C CB   . VAL A 1 8  ? -19.400 -5.206  38.534  1.00 0.00 ? 8  VAL A CB   7  
ATOM 3562  C CG1  . VAL A 1 8  ? -19.524 -6.004  37.245  1.00 0.00 ? 8  VAL A CG1  7  
ATOM 3563  C CG2  . VAL A 1 8  ? -18.627 -6.040  39.544  1.00 0.00 ? 8  VAL A CG2  7  
ATOM 3564  H H    . VAL A 1 8  ? -19.239 -3.318  40.256  1.00 0.00 ? 8  VAL A H    7  
ATOM 3565  H HA   . VAL A 1 8  ? -17.636 -4.068  38.033  1.00 0.00 ? 8  VAL A HA   7  
ATOM 3566  H HB   . VAL A 1 8  ? -20.396 -4.999  38.926  1.00 0.00 ? 8  VAL A HB   7  
ATOM 3567  H HG11 . VAL A 1 8  ? -20.043 -6.942  37.440  1.00 0.00 ? 8  VAL A HG11 7  
ATOM 3568  H HG12 . VAL A 1 8  ? -20.088 -5.425  36.513  1.00 0.00 ? 8  VAL A HG12 7  
ATOM 3569  H HG13 . VAL A 1 8  ? -18.530 -6.215  36.853  1.00 0.00 ? 8  VAL A HG13 7  
ATOM 3570  H HG21 . VAL A 1 8  ? -19.151 -6.978  39.727  1.00 0.00 ? 8  VAL A HG21 7  
ATOM 3571  H HG22 . VAL A 1 8  ? -17.632 -6.251  39.153  1.00 0.00 ? 8  VAL A HG22 7  
ATOM 3572  H HG23 . VAL A 1 8  ? -18.540 -5.487  40.479  1.00 0.00 ? 8  VAL A HG23 7  
ATOM 3573  N N    . GLU A 1 9  ? -20.482 -2.552  37.358  1.00 0.00 ? 9  GLU A N    7  
ATOM 3574  C CA   . GLU A 1 9  ? -21.248 -1.856  36.328  1.00 0.00 ? 9  GLU A CA   7  
ATOM 3575  C C    . GLU A 1 9  ? -20.383 -0.818  35.631  1.00 0.00 ? 9  GLU A C    7  
ATOM 3576  O O    . GLU A 1 9  ? -20.466 -0.633  34.418  1.00 0.00 ? 9  GLU A O    7  
ATOM 3577  C CB   . GLU A 1 9  ? -22.454 -1.145  36.946  1.00 0.00 ? 9  GLU A CB   7  
ATOM 3578  C CG   . GLU A 1 9  ? -23.349 -0.449  35.934  1.00 0.00 ? 9  GLU A CG   7  
ATOM 3579  C CD   . GLU A 1 9  ? -24.559 0.200   36.576  1.00 0.00 ? 9  GLU A CD   7  
ATOM 3580  O OE1  . GLU A 1 9  ? -24.696 0.108   37.814  1.00 0.00 ? 9  GLU A OE1  7  
ATOM 3581  O OE2  . GLU A 1 9  ? -25.371 0.802   35.841  1.00 0.00 ? 9  GLU A OE2  7  
ATOM 3582  H H    . GLU A 1 9  ? -20.831 -2.533  38.306  1.00 0.00 ? 9  GLU A H    7  
ATOM 3583  H HA   . GLU A 1 9  ? -21.597 -2.586  35.597  1.00 0.00 ? 9  GLU A HA   7  
ATOM 3584  H HB2  . GLU A 1 9  ? -23.051 -1.884  37.480  1.00 0.00 ? 9  GLU A HB2  7  
ATOM 3585  H HB3  . GLU A 1 9  ? -22.088 -0.397  37.650  1.00 0.00 ? 9  GLU A HB3  7  
ATOM 3586  H HG2  . GLU A 1 9  ? -22.769 0.320   35.423  1.00 0.00 ? 9  GLU A HG2  7  
ATOM 3587  H HG3  . GLU A 1 9  ? -23.692 -1.183  35.205  1.00 0.00 ? 9  GLU A HG3  7  
ATOM 3588  H HE2  . GLU A 1 9  ? -26.113 1.189   36.313  1.00 0.00 ? 9  GLU A HE2  7  
ATOM 3589  N N    . SER A 1 10 ? -19.550 -0.143  36.417  1.00 0.00 ? 10 SER A N    7  
ATOM 3590  C CA   . SER A 1 10 ? -18.653 0.886   35.901  1.00 0.00 ? 10 SER A CA   7  
ATOM 3591  C C    . SER A 1 10 ? -17.408 0.256   35.300  1.00 0.00 ? 10 SER A C    7  
ATOM 3592  O O    . SER A 1 10 ? -16.996 0.592   34.191  1.00 0.00 ? 10 SER A O    7  
ATOM 3593  C CB   . SER A 1 10 ? -18.222 1.832   37.023  1.00 0.00 ? 10 SER A CB   7  
ATOM 3594  O OG   . SER A 1 10 ? -19.331 2.539   37.549  1.00 0.00 ? 10 SER A OG   7  
ATOM 3595  H H    . SER A 1 10 ? -19.529 -0.341  37.407  1.00 0.00 ? 10 SER A H    7  
ATOM 3596  H HA   . SER A 1 10 ? -19.178 1.454   35.133  1.00 0.00 ? 10 SER A HA   7  
ATOM 3597  H HB2  . SER A 1 10 ? -17.760 1.251   37.821  1.00 0.00 ? 10 SER A HB2  7  
ATOM 3598  H HB3  . SER A 1 10 ? -17.500 2.547   36.629  1.00 0.00 ? 10 SER A HB3  7  
ATOM 3599  H HG   . SER A 1 10 ? -19.027 3.122   38.249  1.00 0.00 ? 10 SER A HG   7  
ATOM 3600  N N    . ALA A 1 11 ? -16.812 -0.667  36.051  1.00 0.00 ? 11 ALA A N    7  
ATOM 3601  C CA   . ALA A 1 11 ? -15.606 -1.366  35.616  1.00 0.00 ? 11 ALA A CA   7  
ATOM 3602  C C    . ALA A 1 11 ? -15.907 -2.254  34.420  1.00 0.00 ? 11 ALA A C    7  
ATOM 3603  O O    . ALA A 1 11 ? -15.108 -2.362  33.491  1.00 0.00 ? 11 ALA A O    7  
ATOM 3604  C CB   . ALA A 1 11 ? -15.064 -2.237  36.739  1.00 0.00 ? 11 ALA A CB   7  
ATOM 3605  H H    . ALA A 1 11 ? -17.199 -0.899  36.955  1.00 0.00 ? 11 ALA A H    7  
ATOM 3606  H HA   . ALA A 1 11 ? -14.855 -0.627  35.338  1.00 0.00 ? 11 ALA A HA   7  
ATOM 3607  H HB1  . ALA A 1 11 ? -14.157 -2.742  36.409  1.00 0.00 ? 11 ALA A HB1  7  
ATOM 3608  H HB2  . ALA A 1 11 ? -14.837 -1.613  37.604  1.00 0.00 ? 11 ALA A HB2  7  
ATOM 3609  H HB3  . ALA A 1 11 ? -15.812 -2.980  37.014  1.00 0.00 ? 11 ALA A HB3  7  
ATOM 3610  N N    . ILE A 1 12 ? -17.074 -2.891  34.456  1.00 0.00 ? 12 ILE A N    7  
ATOM 3611  C CA   . ILE A 1 12 ? -17.511 -3.780  33.385  1.00 0.00 ? 12 ILE A CA   7  
ATOM 3612  C C    . ILE A 1 12 ? -17.772 -2.992  32.112  1.00 0.00 ? 12 ILE A C    7  
ATOM 3613  O O    . ILE A 1 12 ? -17.351 -3.382  31.024  1.00 0.00 ? 12 ILE A O    7  
ATOM 3614  C CB   . ILE A 1 12 ? -18.810 -4.519  33.759  1.00 0.00 ? 12 ILE A CB   7  
ATOM 3615  C CG1  . ILE A 1 12 ? -18.557 -5.489  34.914  1.00 0.00 ? 12 ILE A CG1  7  
ATOM 3616  C CG2  . ILE A 1 12 ? -19.334 -5.310  32.570  1.00 0.00 ? 12 ILE A CG2  7  
ATOM 3617  C CD1  . ILE A 1 12 ? -17.537 -6.562  34.599  1.00 0.00 ? 12 ILE A CD1  7  
ATOM 3618  H H    . ILE A 1 12 ? -17.688 -2.761  35.248  1.00 0.00 ? 12 ILE A H    7  
ATOM 3619  H HA   . ILE A 1 12 ? -16.724 -4.511  33.203  1.00 0.00 ? 12 ILE A HA   7  
ATOM 3620  H HB   . ILE A 1 12 ? -19.559 -3.786  34.061  1.00 0.00 ? 12 ILE A HB   7  
ATOM 3621  H HG12 . ILE A 1 12 ? -18.201 -4.917  35.771  1.00 0.00 ? 12 ILE A HG12 7  
ATOM 3622  H HG13 . ILE A 1 12 ? -19.500 -5.975  35.168  1.00 0.00 ? 12 ILE A HG13 7  
ATOM 3623  H HG21 . ILE A 1 12 ? -20.258 -5.820  32.844  1.00 0.00 ? 12 ILE A HG21 7  
ATOM 3624  H HG22 . ILE A 1 12 ? -19.529 -4.630  31.741  1.00 0.00 ? 12 ILE A HG22 7  
ATOM 3625  H HG23 . ILE A 1 12 ? -18.590 -6.047  32.269  1.00 0.00 ? 12 ILE A HG23 7  
ATOM 3626  H HD11 . ILE A 1 12 ? -17.398 -7.220  35.456  1.00 0.00 ? 12 ILE A HD11 7  
ATOM 3627  H HD12 . ILE A 1 12 ? -17.885 -7.150  33.750  1.00 0.00 ? 12 ILE A HD12 7  
ATOM 3628  H HD13 . ILE A 1 12 ? -16.586 -6.092  34.351  1.00 0.00 ? 12 ILE A HD13 7  
ATOM 3629  N N    . THR A 1 13 ? -18.476 -1.873  32.263  1.00 0.00 ? 13 THR A N    7  
ATOM 3630  C CA   . THR A 1 13 ? -18.811 -1.004  31.138  1.00 0.00 ? 13 THR A CA   7  
ATOM 3631  C C    . THR A 1 13 ? -17.551 -0.408  30.532  1.00 0.00 ? 13 THR A C    7  
ATOM 3632  O O    . THR A 1 13 ? -17.407 -0.330  29.313  1.00 0.00 ? 13 THR A O    7  
ATOM 3633  C CB   . THR A 1 13 ? -19.722 0.158   31.574  1.00 0.00 ? 13 THR A CB   7  
ATOM 3634  O OG1  . THR A 1 13 ? -20.957 -0.363  32.081  1.00 0.00 ? 13 THR A OG1  7  
ATOM 3635  C CG2  . THR A 1 13 ? -20.020 1.073   30.396  1.00 0.00 ? 13 THR A CG2  7  
ATOM 3636  H H    . THR A 1 13 ? -18.795 -1.605  33.184  1.00 0.00 ? 13 THR A H    7  
ATOM 3637  H HA   . THR A 1 13 ? -19.328 -1.599  30.385  1.00 0.00 ? 13 THR A HA   7  
ATOM 3638  H HB   . THR A 1 13 ? -19.222 0.730   32.356  1.00 0.00 ? 13 THR A HB   7  
ATOM 3639  H HG1  . THR A 1 13 ? -21.510 0.372   32.356  1.00 0.00 ? 13 THR A HG1  7  
ATOM 3640  H HG21 . THR A 1 13 ? -20.664 1.892   30.718  1.00 0.00 ? 13 THR A HG21 7  
ATOM 3641  H HG22 . THR A 1 13 ? -19.086 1.479   30.007  1.00 0.00 ? 13 THR A HG22 7  
ATOM 3642  H HG23 . THR A 1 13 ? -20.523 0.505   29.614  1.00 0.00 ? 13 THR A HG23 7  
ATOM 3643  N N    . ASP A 1 14 ? -16.638 0.014   31.403  1.00 0.00 ? 14 ASP A N    7  
ATOM 3644  C CA   . ASP A 1 14 ? -15.374 0.610   30.981  1.00 0.00 ? 14 ASP A CA   7  
ATOM 3645  C C    . ASP A 1 14 ? -14.488 -0.432  30.320  1.00 0.00 ? 14 ASP A C    7  
ATOM 3646  O O    . ASP A 1 14 ? -13.963 -0.220  29.228  1.00 0.00 ? 14 ASP A O    7  
ATOM 3647  C CB   . ASP A 1 14 ? -14.626 1.187   32.184  1.00 0.00 ? 14 ASP A CB   7  
ATOM 3648  C CG   . ASP A 1 14 ? -15.284 2.437   32.734  1.00 0.00 ? 14 ASP A CG   7  
ATOM 3649  O OD1  . ASP A 1 14 ? -14.691 3.076   33.629  1.00 0.00 ? 14 ASP A OD1  7  
ATOM 3650  O OD2  . ASP A 1 14 ? -16.392 2.778   32.271  1.00 0.00 ? 14 ASP A OD2  7  
ATOM 3651  H H    . ASP A 1 14 ? -16.816 -0.075  32.393  1.00 0.00 ? 14 ASP A H    7  
ATOM 3652  H HA   . ASP A 1 14 ? -15.585 1.410   30.270  1.00 0.00 ? 14 ASP A HA   7  
ATOM 3653  H HB2  . ASP A 1 14 ? -14.593 0.434   32.971  1.00 0.00 ? 14 ASP A HB2  7  
ATOM 3654  H HB3  . ASP A 1 14 ? -13.609 1.433   31.880  1.00 0.00 ? 14 ASP A HB3  7  
ATOM 3655  H HD2  . ASP A 1 14 ? -16.750 3.578   32.664  1.00 0.00 ? 14 ASP A HD2  7  
ATOM 3656  N N    . GLY A 1 15 ? -14.328 -1.564  30.998  1.00 0.00 ? 15 GLY A N    7  
ATOM 3657  C CA   . GLY A 1 15 ? -13.508 -2.664  30.498  1.00 0.00 ? 15 GLY A CA   7  
ATOM 3658  C C    . GLY A 1 15 ? -14.300 -3.520  29.523  1.00 0.00 ? 15 GLY A C    7  
ATOM 3659  O O    . GLY A 1 15 ? -14.014 -3.552  28.327  1.00 0.00 ? 15 GLY A O    7  
ATOM 3660  H H    . GLY A 1 15 ? -14.785 -1.677  31.892  1.00 0.00 ? 15 GLY A H    7  
ATOM 3661  H HA2  . GLY A 1 15 ? -12.634 -2.257  29.991  1.00 0.00 ? 15 GLY A HA2  7  
ATOM 3662  H HA3  . GLY A 1 15 ? -13.185 -3.280  31.337  1.00 0.00 ? 15 GLY A HA3  7  
ATOM 3663  N N    . GLN A 1 16 ? -15.303 -4.215  30.052  1.00 0.00 ? 16 GLN A N    7  
ATOM 3664  C CA   . GLN A 1 16 ? -16.158 -5.083  29.250  1.00 0.00 ? 16 GLN A CA   7  
ATOM 3665  C C    . GLN A 1 16 ? -16.647 -4.352  28.010  1.00 0.00 ? 16 GLN A C    7  
ATOM 3666  O O    . GLN A 1 16 ? -16.475 -4.820  26.886  1.00 0.00 ? 16 GLN A O    7  
ATOM 3667  C CB   . GLN A 1 16 ? -17.377 -5.530  30.059  1.00 0.00 ? 16 GLN A CB   7  
ATOM 3668  C CG   . GLN A 1 16 ? -18.304 -6.476  29.313  1.00 0.00 ? 16 GLN A CG   7  
ATOM 3669  C CD   . GLN A 1 16 ? -17.644 -7.801  28.985  1.00 0.00 ? 16 GLN A CD   7  
ATOM 3670  O OE1  . GLN A 1 16 ? -17.135 -8.488  29.871  1.00 0.00 ? 16 GLN A OE1  7  
ATOM 3671  N NE2  . GLN A 1 16 ? -17.651 -8.164  27.708  1.00 0.00 ? 16 GLN A NE2  7  
ATOM 3672  H H    . GLN A 1 16 ? -15.488 -4.147  31.043  1.00 0.00 ? 16 GLN A H    7  
ATOM 3673  H HA   . GLN A 1 16 ? -15.584 -5.959  28.950  1.00 0.00 ? 16 GLN A HA   7  
ATOM 3674  H HB2  . GLN A 1 16 ? -17.025 -6.034  30.959  1.00 0.00 ? 16 GLN A HB2  7  
ATOM 3675  H HB3  . GLN A 1 16 ? -17.946 -4.643  30.339  1.00 0.00 ? 16 GLN A HB3  7  
ATOM 3676  H HG2  . GLN A 1 16 ? -19.183 -6.665  29.930  1.00 0.00 ? 16 GLN A HG2  7  
ATOM 3677  H HG3  . GLN A 1 16 ? -18.616 -6.000  28.383  1.00 0.00 ? 16 GLN A HG3  7  
ATOM 3678  H HE21 . GLN A 1 16 ? -18.082 -7.566  27.017  1.00 0.00 ? 16 GLN A HE21 7  
ATOM 3679  H HE22 . GLN A 1 16 ? -17.226 -9.037  27.430  1.00 0.00 ? 16 GLN A HE22 7  
ATOM 3680  N N    . GLY A 1 17 ? -17.261 -3.193  28.232  1.00 0.00 ? 17 GLY A N    7  
ATOM 3681  C CA   . GLY A 1 17 ? -17.788 -2.370  27.147  1.00 0.00 ? 17 GLY A CA   7  
ATOM 3682  C C    . GLY A 1 17 ? -16.724 -2.144  26.085  1.00 0.00 ? 17 GLY A C    7  
ATOM 3683  O O    . GLY A 1 17 ? -16.975 -2.296  24.891  1.00 0.00 ? 17 GLY A O    7  
ATOM 3684  H H    . GLY A 1 17 ? -17.372 -2.861  29.180  1.00 0.00 ? 17 GLY A H    7  
ATOM 3685  H HA2  . GLY A 1 17 ? -18.644 -2.873  26.697  1.00 0.00 ? 17 GLY A HA2  7  
ATOM 3686  H HA3  . GLY A 1 17 ? -18.106 -1.407  27.548  1.00 0.00 ? 17 GLY A HA3  7  
ATOM 3687  N N    . ASP A 1 18 ? -15.528 -1.778  26.538  1.00 0.00 ? 18 ASP A N    7  
ATOM 3688  C CA   . ASP A 1 18 ? -14.401 -1.522  25.646  1.00 0.00 ? 18 ASP A CA   7  
ATOM 3689  C C    . ASP A 1 18 ? -14.134 -2.733  24.767  1.00 0.00 ? 18 ASP A C    7  
ATOM 3690  O O    . ASP A 1 18 ? -13.412 -2.651  23.774  1.00 0.00 ? 18 ASP A O    7  
ATOM 3691  C CB   . ASP A 1 18 ? -13.136 -1.221  26.453  1.00 0.00 ? 18 ASP A CB   7  
ATOM 3692  C CG   . ASP A 1 18 ? -13.195 0.125   27.148  1.00 0.00 ? 18 ASP A CG   7  
ATOM 3693  O OD1  . ASP A 1 18 ? -12.153 0.811   27.203  1.00 0.00 ? 18 ASP A OD1  7  
ATOM 3694  O OD2  . ASP A 1 18 ? -14.283 0.494   27.637  1.00 0.00 ? 18 ASP A OD2  7  
ATOM 3695  H H    . ASP A 1 18 ? -15.384 -1.669  27.532  1.00 0.00 ? 18 ASP A H    7  
ATOM 3696  H HA   . ASP A 1 18 ? -14.640 -0.664  25.017  1.00 0.00 ? 18 ASP A HA   7  
ATOM 3697  H HB2  . ASP A 1 18 ? -13.007 -1.998  27.206  1.00 0.00 ? 18 ASP A HB2  7  
ATOM 3698  H HB3  . ASP A 1 18 ? -12.280 -1.229  25.779  1.00 0.00 ? 18 ASP A HB3  7  
ATOM 3699  H HD2  . ASP A 1 18 ? -14.249 1.355   28.061  1.00 0.00 ? 18 ASP A HD2  7  
ATOM 3700  N N    . MET A 1 19 ? -14.726 -3.861  25.146  1.00 0.00 ? 19 MET A N    7  
ATOM 3701  C CA   . MET A 1 19 ? -14.570 -5.111  24.409  1.00 0.00 ? 19 MET A CA   7  
ATOM 3702  C C    . MET A 1 19 ? -15.172 -4.989  23.019  1.00 0.00 ? 19 MET A C    7  
ATOM 3703  O O    . MET A 1 19 ? -14.594 -5.443  22.033  1.00 0.00 ? 19 MET A O    7  
ATOM 3704  C CB   . MET A 1 19 ? -15.273 -6.256  25.141  1.00 0.00 ? 19 MET A CB   7  
ATOM 3705  C CG   . MET A 1 19 ? -15.091 -7.616  24.486  1.00 0.00 ? 19 MET A CG   7  
ATOM 3706  S SD   . MET A 1 19 ? -15.922 -8.938  25.387  1.00 0.00 ? 19 MET A SD   7  
ATOM 3707  C CE   . MET A 1 19 ? -14.915 -9.026  26.865  1.00 0.00 ? 19 MET A CE   7  
ATOM 3708  H H    . MET A 1 19 ? -15.306 -3.864  25.973  1.00 0.00 ? 19 MET A H    7  
ATOM 3709  H HA   . MET A 1 19 ? -13.507 -5.336  24.324  1.00 0.00 ? 19 MET A HA   7  
ATOM 3710  H HB2  . MET A 1 19 ? -14.878 -6.308  26.155  1.00 0.00 ? 19 MET A HB2  7  
ATOM 3711  H HB3  . MET A 1 19 ? -16.340 -6.034  25.178  1.00 0.00 ? 19 MET A HB3  7  
ATOM 3712  H HG2  . MET A 1 19 ? -15.492 -7.576  23.473  1.00 0.00 ? 19 MET A HG2  7  
ATOM 3713  H HG3  . MET A 1 19 ? -14.027 -7.842  24.433  1.00 0.00 ? 19 MET A HG3  7  
ATOM 3714  H HE1  . MET A 1 19 ? -15.298 -9.799  27.531  1.00 0.00 ? 19 MET A HE1  7  
ATOM 3715  H HE2  . MET A 1 19 ? -13.888 -9.264  26.590  1.00 0.00 ? 19 MET A HE2  7  
ATOM 3716  H HE3  . MET A 1 19 ? -14.941 -8.064  27.378  1.00 0.00 ? 19 MET A HE3  7  
ATOM 3717  N N    . LYS A 1 20 ? -16.346 -4.367  22.954  1.00 0.00 ? 20 LYS A N    7  
ATOM 3718  C CA   . LYS A 1 20 ? -17.055 -4.169  21.693  1.00 0.00 ? 20 LYS A CA   7  
ATOM 3719  C C    . LYS A 1 20 ? -16.186 -3.399  20.710  1.00 0.00 ? 20 LYS A C    7  
ATOM 3720  O O    . LYS A 1 20 ? -16.136 -3.716  19.523  1.00 0.00 ? 20 LYS A O    7  
ATOM 3721  C CB   . LYS A 1 20 ? -18.345 -3.378  21.922  1.00 0.00 ? 20 LYS A CB   7  
ATOM 3722  C CG   . LYS A 1 20 ? -19.181 -3.178  20.668  1.00 0.00 ? 20 LYS A CG   7  
ATOM 3723  C CD   . LYS A 1 20 ? -20.471 -2.436  20.978  1.00 0.00 ? 20 LYS A CD   7  
ATOM 3724  C CE   . LYS A 1 20 ? -21.300 -2.223  19.722  1.00 0.00 ? 20 LYS A CE   7  
ATOM 3725  N NZ   . LYS A 1 20 ? -22.573 -1.508  20.012  1.00 0.00 ? 20 LYS A NZ   7  
ATOM 3726  H H    . LYS A 1 20 ? -16.771 -4.015  23.800  1.00 0.00 ? 20 LYS A H    7  
ATOM 3727  H HA   . LYS A 1 20 ? -17.301 -5.144  21.272  1.00 0.00 ? 20 LYS A HA   7  
ATOM 3728  H HB2  . LYS A 1 20 ? -18.950 -3.913  22.655  1.00 0.00 ? 20 LYS A HB2  7  
ATOM 3729  H HB3  . LYS A 1 20 ? -18.080 -2.397  22.317  1.00 0.00 ? 20 LYS A HB3  7  
ATOM 3730  H HG2  . LYS A 1 20 ? -18.605 -2.601  19.945  1.00 0.00 ? 20 LYS A HG2  7  
ATOM 3731  H HG3  . LYS A 1 20 ? -19.425 -4.152  20.244  1.00 0.00 ? 20 LYS A HG3  7  
ATOM 3732  H HD2  . LYS A 1 20 ? -21.053 -3.017  21.693  1.00 0.00 ? 20 LYS A HD2  7  
ATOM 3733  H HD3  . LYS A 1 20 ? -20.228 -1.466  21.412  1.00 0.00 ? 20 LYS A HD3  7  
ATOM 3734  H HE2  . LYS A 1 20 ? -20.720 -1.636  19.010  1.00 0.00 ? 20 LYS A HE2  7  
ATOM 3735  H HE3  . LYS A 1 20 ? -21.532 -3.193  19.282  1.00 0.00 ? 20 LYS A HE3  7  
ATOM 3736  H HZ1  . LYS A 1 20 ? -23.097 -1.383  19.158  1.00 0.00 ? 20 LYS A HZ1  7  
ATOM 3737  H HZ2  . LYS A 1 20 ? -23.121 -2.049  20.665  1.00 0.00 ? 20 LYS A HZ2  7  
ATOM 3738  H HZ3  . LYS A 1 20 ? -22.367 -0.604  20.413  1.00 0.00 ? 20 LYS A HZ3  7  
ATOM 3739  N N    . ALA A 1 21 ? -15.502 -2.381  21.223  1.00 0.00 ? 21 ALA A N    7  
ATOM 3740  C CA   . ALA A 1 21 ? -14.623 -1.543  20.411  1.00 0.00 ? 21 ALA A CA   7  
ATOM 3741  C C    . ALA A 1 21 ? -13.409 -2.334  19.953  1.00 0.00 ? 21 ALA A C    7  
ATOM 3742  O O    . ALA A 1 21 ? -12.975 -2.227  18.807  1.00 0.00 ? 21 ALA A O    7  
ATOM 3743  C CB   . ALA A 1 21 ? -14.143 -0.344  21.214  1.00 0.00 ? 21 ALA A CB   7  
ATOM 3744  H H    . ALA A 1 21 ? -15.587 -2.170  22.207  1.00 0.00 ? 21 ALA A H    7  
ATOM 3745  H HA   . ALA A 1 21 ? -15.178 -1.195  19.540  1.00 0.00 ? 21 ALA A HA   7  
ATOM 3746  H HB1  . ALA A 1 21 ? -13.501 0.282   20.595  1.00 0.00 ? 21 ALA A HB1  7  
ATOM 3747  H HB2  . ALA A 1 21 ? -15.004 0.238   21.545  1.00 0.00 ? 21 ALA A HB2  7  
ATOM 3748  H HB3  . ALA A 1 21 ? -13.583 -0.690  22.082  1.00 0.00 ? 21 ALA A HB3  7  
ATOM 3749  N N    . ILE A 1 22 ? -12.864 -3.132  20.868  1.00 0.00 ? 22 ILE A N    7  
ATOM 3750  C CA   . ILE A 1 22 ? -11.692 -3.956  20.585  1.00 0.00 ? 22 ILE A CA   7  
ATOM 3751  C C    . ILE A 1 22 ? -12.016 -4.994  19.523  1.00 0.00 ? 22 ILE A C    7  
ATOM 3752  O O    . ILE A 1 22 ? -11.285 -5.155  18.547  1.00 0.00 ? 22 ILE A O    7  
ATOM 3753  C CB   . ILE A 1 22 ? -11.208 -4.701  21.843  1.00 0.00 ? 22 ILE A CB   7  
ATOM 3754  C CG1  . ILE A 1 22 ? -10.661 -3.709  22.872  1.00 0.00 ? 22 ILE A CG1  7  
ATOM 3755  C CG2  . ILE A 1 22 ? -10.105 -5.685  21.488  1.00 0.00 ? 22 ILE A CG2  7  
ATOM 3756  C CD1  . ILE A 1 22 ? -10.393 -4.323  24.229  1.00 0.00 ? 22 ILE A CD1  7  
ATOM 3757  H H    . ILE A 1 22 ? -13.268 -3.177  21.793  1.00 0.00 ? 22 ILE A H    7  
ATOM 3758  H HA   . ILE A 1 22 ? -10.894 -3.307  20.225  1.00 0.00 ? 22 ILE A HA   7  
ATOM 3759  H HB   . ILE A 1 22 ? -12.048 -5.243  22.277  1.00 0.00 ? 22 ILE A HB   7  
ATOM 3760  H HG12 . ILE A 1 22 ? -9.727  -3.297  22.491  1.00 0.00 ? 22 ILE A HG12 7  
ATOM 3761  H HG13 . ILE A 1 22 ? -11.388 -2.906  22.996  1.00 0.00 ? 22 ILE A HG13 7  
ATOM 3762  H HG21 . ILE A 1 22 ? -9.778  -6.212  22.384  1.00 0.00 ? 22 ILE A HG21 7  
ATOM 3763  H HG22 . ILE A 1 22 ? -10.483 -6.405  20.762  1.00 0.00 ? 22 ILE A HG22 7  
ATOM 3764  H HG23 . ILE A 1 22 ? -9.262  -5.144  21.059  1.00 0.00 ? 22 ILE A HG23 7  
ATOM 3765  H HD11 . ILE A 1 22 ? -10.006 -3.573  24.918  1.00 0.00 ? 22 ILE A HD11 7  
ATOM 3766  H HD12 . ILE A 1 22 ? -11.322 -4.729  24.630  1.00 0.00 ? 22 ILE A HD12 7  
ATOM 3767  H HD13 . ILE A 1 22 ? -9.661  -5.123  24.124  1.00 0.00 ? 22 ILE A HD13 7  
ATOM 3768  N N    . GLY A 1 23 ? -13.125 -5.699  19.727  1.00 0.00 ? 23 GLY A N    7  
ATOM 3769  C CA   . GLY A 1 23 ? -13.575 -6.733  18.799  1.00 0.00 ? 23 GLY A CA   7  
ATOM 3770  C C    . GLY A 1 23 ? -13.975 -6.117  17.468  1.00 0.00 ? 23 GLY A C    7  
ATOM 3771  O O    . GLY A 1 23 ? -13.628 -6.624  16.402  1.00 0.00 ? 23 GLY A O    7  
ATOM 3772  H H    . GLY A 1 23 ? -13.684 -5.521  20.550  1.00 0.00 ? 23 GLY A H    7  
ATOM 3773  H HA2  . GLY A 1 23 ? -12.767 -7.446  18.637  1.00 0.00 ? 23 GLY A HA2  7  
ATOM 3774  H HA3  . GLY A 1 23 ? -14.433 -7.251  19.227  1.00 0.00 ? 23 GLY A HA3  7  
ATOM 3775  N N    . GLY A 1 24 ? -14.711 -5.012  17.545  1.00 0.00 ? 24 GLY A N    7  
ATOM 3776  C CA   . GLY A 1 24 ? -15.177 -4.302  16.358  1.00 0.00 ? 24 GLY A CA   7  
ATOM 3777  C C    . GLY A 1 24 ? -14.005 -3.675  15.619  1.00 0.00 ? 24 GLY A C    7  
ATOM 3778  O O    . GLY A 1 24 ? -13.811 -3.901  14.426  1.00 0.00 ? 24 GLY A O    7  
ATOM 3779  H H    . GLY A 1 24 ? -14.962 -4.642  18.451  1.00 0.00 ? 24 GLY A H    7  
ATOM 3780  H HA2  . GLY A 1 24 ? -15.686 -5.003  15.696  1.00 0.00 ? 24 GLY A HA2  7  
ATOM 3781  H HA3  . GLY A 1 24 ? -15.874 -3.518  16.658  1.00 0.00 ? 24 GLY A HA3  7  
ATOM 3782  N N    . TYR A 1 25 ? -13.224 -2.882  16.347  1.00 0.00 ? 25 TYR A N    7  
ATOM 3783  C CA   . TYR A 1 25 ? -12.059 -2.205  15.785  1.00 0.00 ? 25 TYR A CA   7  
ATOM 3784  C C    . TYR A 1 25 ? -11.111 -3.212  15.156  1.00 0.00 ? 25 TYR A C    7  
ATOM 3785  O O    . TYR A 1 25 ? -10.534 -2.968  14.097  1.00 0.00 ? 25 TYR A O    7  
ATOM 3786  C CB   . TYR A 1 25 ? -11.303 -1.445  16.876  1.00 0.00 ? 25 TYR A CB   7  
ATOM 3787  C CG   . TYR A 1 25 ? -10.070 -0.725  16.379  1.00 0.00 ? 25 TYR A CG   7  
ATOM 3788  C CD1  . TYR A 1 25 ? -10.177 0.480   15.695  1.00 0.00 ? 25 TYR A CD1  7  
ATOM 3789  C CD2  . TYR A 1 25 ? -8.803  -1.252  16.595  1.00 0.00 ? 25 TYR A CD2  7  
ATOM 3790  C CE1  . TYR A 1 25 ? -9.055  1.145   15.237  1.00 0.00 ? 25 TYR A CE1  7  
ATOM 3791  C CE2  . TYR A 1 25 ? -7.670  -0.600  16.144  1.00 0.00 ? 25 TYR A CE2  7  
ATOM 3792  C CZ   . TYR A 1 25 ? -7.806  0.607   15.461  1.00 0.00 ? 25 TYR A CZ   7  
ATOM 3793  O OH   . TYR A 1 25 ? -6.688  1.268   15.006  1.00 0.00 ? 25 TYR A OH   7  
ATOM 3794  H H    . TYR A 1 25 ? -13.436 -2.735  17.324  1.00 0.00 ? 25 TYR A H    7  
ATOM 3795  H HA   . TYR A 1 25 ? -12.397 -1.501  15.024  1.00 0.00 ? 25 TYR A HA   7  
ATOM 3796  H HB2  . TYR A 1 25 ? -11.978 -0.711  17.318  1.00 0.00 ? 25 TYR A HB2  7  
ATOM 3797  H HB3  . TYR A 1 25 ? -11.003 -2.153  17.648  1.00 0.00 ? 25 TYR A HB3  7  
ATOM 3798  H HD1  . TYR A 1 25 ? -11.155 0.905   15.518  1.00 0.00 ? 25 TYR A HD1  7  
ATOM 3799  H HD2  . TYR A 1 25 ? -8.701  -2.187  17.125  1.00 0.00 ? 25 TYR A HD2  7  
ATOM 3800  H HE1  . TYR A 1 25 ? -9.157  2.081   14.707  1.00 0.00 ? 25 TYR A HE1  7  
ATOM 3801  H HE2  . TYR A 1 25 ? -6.692  -1.021  16.319  1.00 0.00 ? 25 TYR A HE2  7  
ATOM 3802  H HH   . TYR A 1 25 ? -5.871  0.810   15.213  1.00 0.00 ? 25 TYR A HH   7  
ATOM 3803  N N    . ILE A 1 26 ? -10.957 -4.352  15.824  1.00 0.00 ? 26 ILE A N    7  
ATOM 3804  C CA   . ILE A 1 26 ? -10.081 -5.421  15.352  1.00 0.00 ? 26 ILE A CA   7  
ATOM 3805  C C    . ILE A 1 26 ? -10.718 -6.153  14.182  1.00 0.00 ? 26 ILE A C    7  
ATOM 3806  O O    . ILE A 1 26 ? -10.068 -6.431  13.176  1.00 0.00 ? 26 ILE A O    7  
ATOM 3807  C CB   . ILE A 1 26 ? -9.802  -6.453  16.461  1.00 0.00 ? 26 ILE A CB   7  
ATOM 3808  C CG1  . ILE A 1 26 ? -8.975  -5.820  17.582  1.00 0.00 ? 26 ILE A CG1  7  
ATOM 3809  C CG2  . ILE A 1 26 ? -9.029  -7.638  15.903  1.00 0.00 ? 26 ILE A CG2  7  
ATOM 3810  C CD1  . ILE A 1 26 ? -8.864  -6.683  18.820  1.00 0.00 ? 26 ILE A CD1  7  
ATOM 3811  H H    . ILE A 1 26 ? -11.460 -4.494  16.689  1.00 0.00 ? 26 ILE A H    7  
ATOM 3812  H HA   . ILE A 1 26 ? -9.139  -4.977  15.031  1.00 0.00 ? 26 ILE A HA   7  
ATOM 3813  H HB   . ILE A 1 26 ? -10.752 -6.801  16.866  1.00 0.00 ? 26 ILE A HB   7  
ATOM 3814  H HG12 . ILE A 1 26 ? -7.971  -5.630  17.204  1.00 0.00 ? 26 ILE A HG12 7  
ATOM 3815  H HG13 . ILE A 1 26 ? -9.442  -4.875  17.863  1.00 0.00 ? 26 ILE A HG13 7  
ATOM 3816  H HG21 . ILE A 1 26 ? -8.846  -8.365  16.694  1.00 0.00 ? 26 ILE A HG21 7  
ATOM 3817  H HG22 . ILE A 1 26 ? -9.610  -8.106  15.108  1.00 0.00 ? 26 ILE A HG22 7  
ATOM 3818  H HG23 . ILE A 1 26 ? -8.077  -7.292  15.502  1.00 0.00 ? 26 ILE A HG23 7  
ATOM 3819  H HD11 . ILE A 1 26 ? -8.266  -6.183  19.582  1.00 0.00 ? 26 ILE A HD11 7  
ATOM 3820  H HD12 . ILE A 1 26 ? -9.862  -6.872  19.218  1.00 0.00 ? 26 ILE A HD12 7  
ATOM 3821  H HD13 . ILE A 1 26 ? -8.392  -7.629  18.558  1.00 0.00 ? 26 ILE A HD13 7  
ATOM 3822  N N    . VAL A 1 27 ? -12.004 -6.460  14.328  1.00 0.00 ? 27 VAL A N    7  
ATOM 3823  C CA   . VAL A 1 27 ? -12.760 -7.164  13.295  1.00 0.00 ? 27 VAL A CA   7  
ATOM 3824  C C    . VAL A 1 27 ? -13.087 -6.226  12.144  1.00 0.00 ? 27 VAL A C    7  
ATOM 3825  O O    . VAL A 1 27 ? -13.190 -6.644  10.992  1.00 0.00 ? 27 VAL A O    7  
ATOM 3826  C CB   . VAL A 1 27 ? -14.087 -7.719  13.846  1.00 0.00 ? 27 VAL A CB   7  
ATOM 3827  C CG1  . VAL A 1 27 ? -15.077 -6.590  14.086  1.00 0.00 ? 27 VAL A CG1  7  
ATOM 3828  C CG2  . VAL A 1 27 ? -14.704 -8.699  12.860  1.00 0.00 ? 27 VAL A CG2  7  
ATOM 3829  H H    . VAL A 1 27 ? -12.485 -6.202  15.178  1.00 0.00 ? 27 VAL A H    7  
ATOM 3830  H HA   . VAL A 1 27 ? -12.153 -7.990  12.927  1.00 0.00 ? 27 VAL A HA   7  
ATOM 3831  H HB   . VAL A 1 27 ? -13.891 -8.231  14.788  1.00 0.00 ? 27 VAL A HB   7  
ATOM 3832  H HG11 . VAL A 1 27 ? -16.009 -6.993  14.483  1.00 0.00 ? 27 VAL A HG11 7  
ATOM 3833  H HG12 . VAL A 1 27 ? -14.655 -5.883  14.801  1.00 0.00 ? 27 VAL A HG12 7  
ATOM 3834  H HG13 . VAL A 1 27 ? -15.278 -6.077  13.145  1.00 0.00 ? 27 VAL A HG13 7  
ATOM 3835  H HG21 . VAL A 1 27 ? -15.638 -9.091  13.264  1.00 0.00 ? 27 VAL A HG21 7  
ATOM 3836  H HG22 . VAL A 1 27 ? -14.905 -8.187  11.918  1.00 0.00 ? 27 VAL A HG22 7  
ATOM 3837  H HG23 . VAL A 1 27 ? -14.012 -9.522  12.686  1.00 0.00 ? 27 VAL A HG23 7  
ATOM 3838  N N    . GLY A 1 28 ? -13.249 -4.947  12.472  1.00 0.00 ? 28 GLY A N    7  
ATOM 3839  C CA   . GLY A 1 28 ? -13.567 -3.922  11.483  1.00 0.00 ? 28 GLY A CA   7  
ATOM 3840  C C    . GLY A 1 28 ? -12.338 -3.582  10.655  1.00 0.00 ? 28 GLY A C    7  
ATOM 3841  O O    . GLY A 1 28 ? -12.443 -3.099  9.529   1.00 0.00 ? 28 GLY A O    7  
ATOM 3842  H H    . GLY A 1 28 ? -13.151 -4.664  13.437  1.00 0.00 ? 28 GLY A H    7  
ATOM 3843  H HA2  . GLY A 1 28 ? -14.354 -4.289  10.824  1.00 0.00 ? 28 GLY A HA2  7  
ATOM 3844  H HA3  . GLY A 1 28 ? -13.916 -3.024  11.995  1.00 0.00 ? 28 GLY A HA3  7  
ATOM 3845  N N    . ALA A 1 29 ? -11.168 -3.842  11.231  1.00 0.00 ? 29 ALA A N    7  
ATOM 3846  C CA   . ALA A 1 29 ? -9.895  -3.573  10.569  1.00 0.00 ? 29 ALA A CA   7  
ATOM 3847  C C    . ALA A 1 29 ? -9.510  -4.733  9.664   1.00 0.00 ? 29 ALA A C    7  
ATOM 3848  O O    . ALA A 1 29 ? -8.892  -4.545  8.617   1.00 0.00 ? 29 ALA A O    7  
ATOM 3849  C CB   . ALA A 1 29 ? -8.793  -3.378  11.599  1.00 0.00 ? 29 ALA A CB   7  
ATOM 3850  H H    . ALA A 1 29 ? -11.148 -4.238  12.160  1.00 0.00 ? 29 ALA A H    7  
ATOM 3851  H HA   . ALA A 1 29 ? -9.996  -2.666  9.972   1.00 0.00 ? 29 ALA A HA   7  
ATOM 3852  H HB1  . ALA A 1 29 ? -7.851  -3.163  11.095  1.00 0.00 ? 29 ALA A HB1  7  
ATOM 3853  H HB2  . ALA A 1 29 ? -9.052  -2.544  12.253  1.00 0.00 ? 29 ALA A HB2  7  
ATOM 3854  H HB3  . ALA A 1 29 ? -8.687  -4.286  12.193  1.00 0.00 ? 29 ALA A HB3  7  
ATOM 3855  N N    . LEU A 1 30 ? -9.884  -5.937  10.085  1.00 0.00 ? 30 LEU A N    7  
ATOM 3856  C CA   . LEU A 1 30 ? -9.590  -7.153  9.330   1.00 0.00 ? 30 LEU A CA   7  
ATOM 3857  C C    . LEU A 1 30 ? -10.125 -7.041  7.912   1.00 0.00 ? 30 LEU A C    7  
ATOM 3858  O O    . LEU A 1 30 ? -9.567  -7.609  6.975   1.00 0.00 ? 30 LEU A O    7  
ATOM 3859  C CB   . LEU A 1 30 ? -10.238 -8.368  9.997   1.00 0.00 ? 30 LEU A CB   7  
ATOM 3860  C CG   . LEU A 1 30 ? -9.634  -8.812  11.331  1.00 0.00 ? 30 LEU A CG   7  
ATOM 3861  C CD1  . LEU A 1 30 ? -10.449 -9.942  11.941  1.00 0.00 ? 30 LEU A CD1  7  
ATOM 3862  C CD2  . LEU A 1 30 ? -8.208  -9.305  11.137  1.00 0.00 ? 30 LEU A CD2  7  
ATOM 3863  H H    . LEU A 1 30 ? -10.390 -6.026  10.955  1.00 0.00 ? 30 LEU A H    7  
ATOM 3864  H HA   . LEU A 1 30 ? -8.510  -7.292  9.299   1.00 0.00 ? 30 LEU A HA   7  
ATOM 3865  H HB2  . LEU A 1 30 ? -11.288 -8.131  10.170  1.00 0.00 ? 30 LEU A HB2  7  
ATOM 3866  H HB3  . LEU A 1 30 ? -10.165 -9.205  9.304   1.00 0.00 ? 30 LEU A HB3  7  
ATOM 3867  H HG   . LEU A 1 30 ? -9.631  -7.962  12.014  1.00 0.00 ? 30 LEU A HG   7  
ATOM 3868  H HD11 . LEU A 1 30 ? -10.015 -10.241 12.895  1.00 0.00 ? 30 LEU A HD11 7  
ATOM 3869  H HD12 . LEU A 1 30 ? -11.473 -9.603  12.102  1.00 0.00 ? 30 LEU A HD12 7  
ATOM 3870  H HD13 . LEU A 1 30 ? -10.451 -10.794 11.262  1.00 0.00 ? 30 LEU A HD13 7  
ATOM 3871  H HD21 . LEU A 1 30 ? -7.786  -9.607  12.095  1.00 0.00 ? 30 LEU A HD21 7  
ATOM 3872  H HD22 . LEU A 1 30 ? -8.209  -10.158 10.458  1.00 0.00 ? 30 LEU A HD22 7  
ATOM 3873  H HD23 . LEU A 1 30 ? -7.603  -8.503  10.713  1.00 0.00 ? 30 LEU A HD23 7  
ATOM 3874  N N    . VAL A 1 31 ? -11.219 -6.298  7.767   1.00 0.00 ? 31 VAL A N    7  
ATOM 3875  C CA   . VAL A 1 31 ? -11.856 -6.092  6.469   1.00 0.00 ? 31 VAL A CA   7  
ATOM 3876  C C    . VAL A 1 31 ? -10.856 -5.541  5.467   1.00 0.00 ? 31 VAL A C    7  
ATOM 3877  O O    . VAL A 1 31 ? -10.900 -5.863  4.281   1.00 0.00 ? 31 VAL A O    7  
ATOM 3878  C CB   . VAL A 1 31 ? -13.026 -5.096  6.566   1.00 0.00 ? 31 VAL A CB   7  
ATOM 3879  C CG1  . VAL A 1 31 ? -13.538 -4.738  5.179   1.00 0.00 ? 31 VAL A CG1  7  
ATOM 3880  C CG2  . VAL A 1 31 ? -14.174 -5.699  7.361   1.00 0.00 ? 31 VAL A CG2  7  
ATOM 3881  H H    . VAL A 1 31 ? -11.632 -5.856  8.576   1.00 0.00 ? 31 VAL A H    7  
ATOM 3882  H HA   . VAL A 1 31 ? -12.233 -7.051  6.114   1.00 0.00 ? 31 VAL A HA   7  
ATOM 3883  H HB   . VAL A 1 31 ? -12.679 -4.191  7.066   1.00 0.00 ? 31 VAL A HB   7  
ATOM 3884  H HG11 . VAL A 1 31 ? -14.360 -4.026  5.260   1.00 0.00 ? 31 VAL A HG11 7  
ATOM 3885  H HG12 . VAL A 1 31 ? -12.731 -4.292  4.599   1.00 0.00 ? 31 VAL A HG12 7  
ATOM 3886  H HG13 . VAL A 1 31 ? -13.890 -5.640  4.679   1.00 0.00 ? 31 VAL A HG13 7  
ATOM 3887  H HG21 . VAL A 1 31 ? -14.993 -4.982  7.431   1.00 0.00 ? 31 VAL A HG21 7  
ATOM 3888  H HG22 . VAL A 1 31 ? -14.526 -6.601  6.862   1.00 0.00 ? 31 VAL A HG22 7  
ATOM 3889  H HG23 . VAL A 1 31 ? -13.828 -5.950  8.364   1.00 0.00 ? 31 VAL A HG23 7  
ATOM 3890  N N    . ILE A 1 32 ? -9.949  -4.703  5.961   1.00 0.00 ? 32 ILE A N    7  
ATOM 3891  C CA   . ILE A 1 32 ? -8.919  -4.087  5.128   1.00 0.00 ? 32 ILE A CA   7  
ATOM 3892  C C    . ILE A 1 32 ? -7.968  -5.144  4.590   1.00 0.00 ? 32 ILE A C    7  
ATOM 3893  O O    . ILE A 1 32 ? -7.580  -5.117  3.423   1.00 0.00 ? 32 ILE A O    7  
ATOM 3894  C CB   . ILE A 1 32 ? -8.088  -3.063  5.923   1.00 0.00 ? 32 ILE A CB   7  
ATOM 3895  C CG1  . ILE A 1 32 ? -8.954  -1.864  6.317   1.00 0.00 ? 32 ILE A CG1  7  
ATOM 3896  C CG2  . ILE A 1 32 ? -6.921  -2.560  5.087   1.00 0.00 ? 32 ILE A CG2  7  
ATOM 3897  C CD1  . ILE A 1 32 ? -8.291  -0.930  7.305   1.00 0.00 ? 32 ILE A CD1  7  
ATOM 3898  H H    . ILE A 1 32 ? -9.963  -4.478  6.946   1.00 0.00 ? 32 ILE A H    7  
ATOM 3899  H HA   . ILE A 1 32 ? -9.407  -3.581  4.295   1.00 0.00 ? 32 ILE A HA   7  
ATOM 3900  H HB   . ILE A 1 32 ? -7.706  -3.542  6.824   1.00 0.00 ? 32 ILE A HB   7  
ATOM 3901  H HG12 . ILE A 1 32 ? -9.190  -1.298  5.415   1.00 0.00 ? 32 ILE A HG12 7  
ATOM 3902  H HG13 . ILE A 1 32 ? -9.876  -2.237  6.763   1.00 0.00 ? 32 ILE A HG13 7  
ATOM 3903  H HG21 . ILE A 1 32 ? -6.335  -1.844  5.663   1.00 0.00 ? 32 ILE A HG21 7  
ATOM 3904  H HG22 . ILE A 1 32 ? -6.288  -3.401  4.806   1.00 0.00 ? 32 ILE A HG22 7  
ATOM 3905  H HG23 . ILE A 1 32 ? -7.302  -2.075  4.188   1.00 0.00 ? 32 ILE A HG23 7  
ATOM 3906  H HD11 . ILE A 1 32 ? -8.952  -0.097  7.547   1.00 0.00 ? 32 ILE A HD11 7  
ATOM 3907  H HD12 . ILE A 1 32 ? -8.059  -1.478  8.218   1.00 0.00 ? 32 ILE A HD12 7  
ATOM 3908  H HD13 . ILE A 1 32 ? -7.371  -0.540  6.870   1.00 0.00 ? 32 ILE A HD13 7  
ATOM 3909  N N    . LEU A 1 33 ? -7.597  -6.079  5.460   1.00 0.00 ? 33 LEU A N    7  
ATOM 3910  C CA   . LEU A 1 33 ? -6.688  -7.163  5.099   1.00 0.00 ? 33 LEU A CA   7  
ATOM 3911  C C    . LEU A 1 33 ? -7.298  -8.028  4.008   1.00 0.00 ? 33 LEU A C    7  
ATOM 3912  O O    . LEU A 1 33 ? -6.653  -8.340  3.008   1.00 0.00 ? 33 LEU A O    7  
ATOM 3913  C CB   . LEU A 1 33 ? -6.400  -8.048  6.314   1.00 0.00 ? 33 LEU A CB   7  
ATOM 3914  C CG   . LEU A 1 33 ? -5.513  -7.439  7.401   1.00 0.00 ? 33 LEU A CG   7  
ATOM 3915  C CD1  . LEU A 1 33 ? -5.414  -8.371  8.599   1.00 0.00 ? 33 LEU A CD1  7  
ATOM 3916  C CD2  . LEU A 1 33 ? -4.107  -7.194  6.873   1.00 0.00 ? 33 LEU A CD2  7  
ATOM 3917  H H    . LEU A 1 33 ? -7.951  -6.047  6.406   1.00 0.00 ? 33 LEU A H    7  
ATOM 3918  H HA   . LEU A 1 33 ? -5.755  -6.731  4.739   1.00 0.00 ? 33 LEU A HA   7  
ATOM 3919  H HB2  . LEU A 1 33 ? -7.356  -8.306  6.771   1.00 0.00 ? 33 LEU A HB2  7  
ATOM 3920  H HB3  . LEU A 1 33 ? -5.912  -8.954  5.956   1.00 0.00 ? 33 LEU A HB3  7  
ATOM 3921  H HG   . LEU A 1 33 ? -5.948  -6.491  7.718   1.00 0.00 ? 33 LEU A HG   7  
ATOM 3922  H HD11 . LEU A 1 33 ? -4.789  -7.921  9.370   1.00 0.00 ? 33 LEU A HD11 7  
ATOM 3923  H HD12 . LEU A 1 33 ? -6.411  -8.548  9.003   1.00 0.00 ? 33 LEU A HD12 7  
ATOM 3924  H HD13 . LEU A 1 33 ? -4.976  -9.318  8.286   1.00 0.00 ? 33 LEU A HD13 7  
ATOM 3925  H HD21 . LEU A 1 33 ? -3.489  -6.749  7.653   1.00 0.00 ? 33 LEU A HD21 7  
ATOM 3926  H HD22 . LEU A 1 33 ? -3.668  -8.141  6.560   1.00 0.00 ? 33 LEU A HD22 7  
ATOM 3927  H HD23 . LEU A 1 33 ? -4.154  -6.516  6.021   1.00 0.00 ? 33 LEU A HD23 7  
ATOM 3928  N N    . ALA A 1 34 ? -8.554  -8.412  4.214   1.00 0.00 ? 34 ALA A N    7  
ATOM 3929  C CA   . ALA A 1 34 ? -9.282  -9.245  3.260   1.00 0.00 ? 34 ALA A CA   7  
ATOM 3930  C C    . ALA A 1 34 ? -9.358  -8.561  1.905   1.00 0.00 ? 34 ALA A C    7  
ATOM 3931  O O    . ALA A 1 34 ? -9.203  -9.195  0.862   1.00 0.00 ? 34 ALA A O    7  
ATOM 3932  C CB   . ALA A 1 34 ? -10.699 -9.499  3.751   1.00 0.00 ? 34 ALA A CB   7  
ATOM 3933  H H    . ALA A 1 34 ? -9.031  -8.124  5.057   1.00 0.00 ? 34 ALA A H    7  
ATOM 3934  H HA   . ALA A 1 34 ? -8.760  -10.196 3.156   1.00 0.00 ? 34 ALA A HA   7  
ATOM 3935  H HB1  . ALA A 1 34 ? -11.229 -10.133 3.040   1.00 0.00 ? 34 ALA A HB1  7  
ATOM 3936  H HB2  . ALA A 1 34 ? -10.663 -9.995  4.721   1.00 0.00 ? 34 ALA A HB2  7  
ATOM 3937  H HB3  . ALA A 1 34 ? -11.225 -8.549  3.849   1.00 0.00 ? 34 ALA A HB3  7  
ATOM 3938  N N    . VAL A 1 35 ? -9.600  -7.253  1.934   1.00 0.00 ? 35 VAL A N    7  
ATOM 3939  C CA   . VAL A 1 35 ? -9.703  -6.452  0.718   1.00 0.00 ? 35 VAL A CA   7  
ATOM 3940  C C    . VAL A 1 35 ? -8.446  -6.597  -0.123  1.00 0.00 ? 35 VAL A C    7  
ATOM 3941  O O    . VAL A 1 35 ? -8.509  -6.748  -1.342  1.00 0.00 ? 35 VAL A O    7  
ATOM 3942  C CB   . VAL A 1 35 ? -9.887  -4.957  1.041   1.00 0.00 ? 35 VAL A CB   7  
ATOM 3943  C CG1  . VAL A 1 35 ? -9.782  -4.122  -0.226  1.00 0.00 ? 35 VAL A CG1  7  
ATOM 3944  C CG2  . VAL A 1 35 ? -11.251 -4.712  1.667   1.00 0.00 ? 35 VAL A CG2  7  
ATOM 3945  H H    . VAL A 1 35 ? -9.719  -6.788  2.823   1.00 0.00 ? 35 VAL A H    7  
ATOM 3946  H HA   . VAL A 1 35 ? -10.563 -6.802  0.147   1.00 0.00 ? 35 VAL A HA   7  
ATOM 3947  H HB   . VAL A 1 35 ? -9.110  -4.649  1.740   1.00 0.00 ? 35 VAL A HB   7  
ATOM 3948  H HG11 . VAL A 1 35 ? -9.906  -3.066  0.016   1.00 0.00 ? 35 VAL A HG11 7  
ATOM 3949  H HG12 . VAL A 1 35 ? -8.804  -4.276  -0.682  1.00 0.00 ? 35 VAL A HG12 7  
ATOM 3950  H HG13 . VAL A 1 35 ? -10.561 -4.425  -0.926  1.00 0.00 ? 35 VAL A HG13 7  
ATOM 3951  H HG21 . VAL A 1 35 ? -11.367 -3.653  1.899   1.00 0.00 ? 35 VAL A HG21 7  
ATOM 3952  H HG22 . VAL A 1 35 ? -12.031 -5.015  0.968   1.00 0.00 ? 35 VAL A HG22 7  
ATOM 3953  H HG23 . VAL A 1 35 ? -11.339 -5.294  2.584   1.00 0.00 ? 35 VAL A HG23 7  
ATOM 3954  N N    . ALA A 1 36 ? -7.298  -6.550  0.547   1.00 0.00 ? 36 ALA A N    7  
ATOM 3955  C CA   . ALA A 1 36 ? -6.002  -6.673  -0.115  1.00 0.00 ? 36 ALA A CA   7  
ATOM 3956  C C    . ALA A 1 36 ? -5.848  -8.055  -0.729  1.00 0.00 ? 36 ALA A C    7  
ATOM 3957  O O    . ALA A 1 36 ? -5.429  -8.198  -1.877  1.00 0.00 ? 36 ALA A O    7  
ATOM 3958  C CB   . ALA A 1 36 ? -4.874  -6.460  0.883   1.00 0.00 ? 36 ALA A CB   7  
ATOM 3959  H H    . ALA A 1 36 ? -7.312  -6.424  1.549   1.00 0.00 ? 36 ALA A H    7  
ATOM 3960  H HA   . ALA A 1 36 ? -5.937  -5.919  -0.900  1.00 0.00 ? 36 ALA A HA   7  
ATOM 3961  H HB1  . ALA A 1 36 ? -3.913  -6.539  0.376   1.00 0.00 ? 36 ALA A HB1  7  
ATOM 3962  H HB2  . ALA A 1 36 ? -4.967  -5.469  1.329   1.00 0.00 ? 36 ALA A HB2  7  
ATOM 3963  H HB3  . ALA A 1 36 ? -4.935  -7.217  1.665   1.00 0.00 ? 36 ALA A HB3  7  
ATOM 3964  N N    . GLY A 1 37 ? -6.194  -9.074  0.053   1.00 0.00 ? 37 GLY A N    7  
ATOM 3965  C CA   . GLY A 1 37 ? -6.104  -10.462 -0.388  1.00 0.00 ? 37 GLY A CA   7  
ATOM 3966  C C    . GLY A 1 37 ? -6.764  -10.632 -1.747  1.00 0.00 ? 37 GLY A C    7  
ATOM 3967  O O    . GLY A 1 37 ? -6.126  -11.034 -2.719  1.00 0.00 ? 37 GLY A O    7  
ATOM 3968  H H    . GLY A 1 37 ? -6.533  -8.891  0.987   1.00 0.00 ? 37 GLY A H    7  
ATOM 3969  H HA2  . GLY A 1 37 ? -5.055  -10.749 -0.459  1.00 0.00 ? 37 GLY A HA2  7  
ATOM 3970  H HA3  . GLY A 1 37 ? -6.605  -11.103 0.338   1.00 0.00 ? 37 GLY A HA3  7  
ATOM 3971  N N    . LEU A 1 38 ? -8.056  -10.320 -1.801  1.00 0.00 ? 38 LEU A N    7  
ATOM 3972  C CA   . LEU A 1 38 ? -8.834  -10.428 -3.032  1.00 0.00 ? 38 LEU A CA   7  
ATOM 3973  C C    . LEU A 1 38 ? -8.250  -9.532  -4.111  1.00 0.00 ? 38 LEU A C    7  
ATOM 3974  O O    . LEU A 1 38 ? -8.192  -9.902  -5.282  1.00 0.00 ? 38 LEU A O    7  
ATOM 3975  C CB   . LEU A 1 38 ? -10.285 -10.008 -2.788  1.00 0.00 ? 38 LEU A CB   7  
ATOM 3976  C CG   . LEU A 1 38 ? -11.135 -10.963 -1.947  1.00 0.00 ? 38 LEU A CG   7  
ATOM 3977  C CD1  . LEU A 1 38 ? -12.507 -10.365 -1.677  1.00 0.00 ? 38 LEU A CD1  7  
ATOM 3978  C CD2  . LEU A 1 38 ? -11.327 -12.288 -2.669  1.00 0.00 ? 38 LEU A CD2  7  
ATOM 3979  H H    . LEU A 1 38 ? -8.526  -9.995  -0.967  1.00 0.00 ? 38 LEU A H    7  
ATOM 3980  H HA   . LEU A 1 38 ? -8.811  -11.463 -3.370  1.00 0.00 ? 38 LEU A HA   7  
ATOM 3981  H HB2  . LEU A 1 38 ? -10.271 -9.042  -2.282  1.00 0.00 ? 38 LEU A HB2  7  
ATOM 3982  H HB3  . LEU A 1 38 ? -10.768 -9.901  -3.759  1.00 0.00 ? 38 LEU A HB3  7  
ATOM 3983  H HG   . LEU A 1 38 ? -10.628 -11.141 -0.999  1.00 0.00 ? 38 LEU A HG   7  
ATOM 3984  H HD11 . LEU A 1 38 ? -13.099 -11.050 -1.069  1.00 0.00 ? 38 LEU A HD11 7  
ATOM 3985  H HD12 . LEU A 1 38 ? -12.392 -9.420  -1.146  1.00 0.00 ? 38 LEU A HD12 7  
ATOM 3986  H HD13 . LEU A 1 38 ? -13.019 -10.189 -2.623  1.00 0.00 ? 38 LEU A HD13 7  
ATOM 3987  H HD21 . LEU A 1 38 ? -11.924 -12.962 -2.055  1.00 0.00 ? 38 LEU A HD21 7  
ATOM 3988  H HD22 . LEU A 1 38 ? -11.839 -12.113 -3.615  1.00 0.00 ? 38 LEU A HD22 7  
ATOM 3989  H HD23 . LEU A 1 38 ? -10.354 -12.740 -2.860  1.00 0.00 ? 38 LEU A HD23 7  
ATOM 3990  N N    . ILE A 1 39 ? -7.817  -8.344  -3.700  1.00 0.00 ? 39 ILE A N    7  
ATOM 3991  C CA   . ILE A 1 39 ? -7.229  -7.368  -4.613  1.00 0.00 ? 39 ILE A CA   7  
ATOM 3992  C C    . ILE A 1 39 ? -6.012  -7.954  -5.308  1.00 0.00 ? 39 ILE A C    7  
ATOM 3993  O O    . ILE A 1 39 ? -5.835  -7.803  -6.516  1.00 0.00 ? 39 ILE A O    7  
ATOM 3994  C CB   . ILE A 1 39 ? -6.782  -6.096  -3.868  1.00 0.00 ? 39 ILE A CB   7  
ATOM 3995  C CG1  . ILE A 1 39 ? -7.997  -5.337  -3.332  1.00 0.00 ? 39 ILE A CG1  7  
ATOM 3996  C CG2  . ILE A 1 39 ? -6.011  -5.175  -4.802  1.00 0.00 ? 39 ILE A CG2  7  
ATOM 3997  C CD1  . ILE A 1 39 ? -8.956  -4.880  -4.409  1.00 0.00 ? 39 ILE A CD1  7  
ATOM 3998  H H    . ILE A 1 39 ? -7.892  -8.097  -2.723  1.00 0.00 ? 39 ILE A H    7  
ATOM 3999  H HA   . ILE A 1 39 ? -7.978  -7.100  -5.359  1.00 0.00 ? 39 ILE A HA   7  
ATOM 4000  H HB   . ILE A 1 39 ? -6.141  -6.382  -3.035  1.00 0.00 ? 39 ILE A HB   7  
ATOM 4001  H HG12 . ILE A 1 39 ? -8.537  -5.991  -2.647  1.00 0.00 ? 39 ILE A HG12 7  
ATOM 4002  H HG13 . ILE A 1 39 ? -7.644  -4.458  -2.792  1.00 0.00 ? 39 ILE A HG13 7  
ATOM 4003  H HG21 . ILE A 1 39 ? -5.692  -4.283  -4.262  1.00 0.00 ? 39 ILE A HG21 7  
ATOM 4004  H HG22 . ILE A 1 39 ? -5.136  -5.698  -5.185  1.00 0.00 ? 39 ILE A HG22 7  
ATOM 4005  H HG23 . ILE A 1 39 ? -6.653  -4.882  -5.633  1.00 0.00 ? 39 ILE A HG23 7  
ATOM 4006  H HD11 . ILE A 1 39 ? -9.800  -4.348  -3.969  1.00 0.00 ? 39 ILE A HD11 7  
ATOM 4007  H HD12 . ILE A 1 39 ? -8.435  -4.215  -5.097  1.00 0.00 ? 39 ILE A HD12 7  
ATOM 4008  H HD13 . ILE A 1 39 ? -9.327  -5.748  -4.953  1.00 0.00 ? 39 ILE A HD13 7  
ATOM 4009  N N    . TYR A 1 40 ? -5.174  -8.629  -4.526  1.00 0.00 ? 40 TYR A N    7  
ATOM 4010  C CA   . TYR A 1 40 ? -3.958  -9.253  -5.041  1.00 0.00 ? 40 TYR A CA   7  
ATOM 4011  C C    . TYR A 1 40 ? -4.303  -10.427 -5.942  1.00 0.00 ? 40 TYR A C    7  
ATOM 4012  O O    . TYR A 1 40 ? -3.696  -10.621 -6.994  1.00 0.00 ? 40 TYR A O    7  
ATOM 4013  C CB   . TYR A 1 40 ? -3.090  -9.765  -3.890  1.00 0.00 ? 40 TYR A CB   7  
ATOM 4014  C CG   . TYR A 1 40 ? -1.795  -10.405 -4.337  1.00 0.00 ? 40 TYR A CG   7  
ATOM 4015  C CD1  . TYR A 1 40 ? -0.714  -9.624  -4.728  1.00 0.00 ? 40 TYR A CD1  7  
ATOM 4016  C CD2  . TYR A 1 40 ? -1.657  -11.786 -4.367  1.00 0.00 ? 40 TYR A CD2  7  
ATOM 4017  C CE1  . TYR A 1 40 ? 0.474   -10.199 -5.138  1.00 0.00 ? 40 TYR A CE1  7  
ATOM 4018  C CE2  . TYR A 1 40 ? -0.476  -12.379 -4.774  1.00 0.00 ? 40 TYR A CE2  7  
ATOM 4019  C CZ   . TYR A 1 40 ? 0.592   -11.572 -5.161  1.00 0.00 ? 40 TYR A CZ   7  
ATOM 4020  O OH   . TYR A 1 40 ? 1.774   -12.147 -5.569  1.00 0.00 ? 40 TYR A OH   7  
ATOM 4021  H H    . TYR A 1 40 ? -5.376  -8.718  -3.540  1.00 0.00 ? 40 TYR A H    7  
ATOM 4022  H HA   . TYR A 1 40 ? -3.399  -8.511  -5.611  1.00 0.00 ? 40 TYR A HA   7  
ATOM 4023  H HB2  . TYR A 1 40 ? -2.854  -8.926  -3.235  1.00 0.00 ? 40 TYR A HB2  7  
ATOM 4024  H HB3  . TYR A 1 40 ? -3.663  -10.500 -3.324  1.00 0.00 ? 40 TYR A HB3  7  
ATOM 4025  H HD1  . TYR A 1 40 ? -0.804  -8.547  -4.711  1.00 0.00 ? 40 TYR A HD1  7  
ATOM 4026  H HD2  . TYR A 1 40 ? -2.487  -12.408 -4.067  1.00 0.00 ? 40 TYR A HD2  7  
ATOM 4027  H HE1  . TYR A 1 40 ? 1.304   -9.577  -5.438  1.00 0.00 ? 40 TYR A HE1  7  
ATOM 4028  H HE2  . TYR A 1 40 ? -0.383  -13.454 -4.791  1.00 0.00 ? 40 TYR A HE2  7  
ATOM 4029  H HH   . TYR A 1 40 ? 1.751   -13.106 -5.548  1.00 0.00 ? 40 TYR A HH   7  
ATOM 4030  N N    . SER A 1 41 ? -5.289  -11.211 -5.514  1.00 0.00 ? 41 SER A N    7  
ATOM 4031  C CA   . SER A 1 41 ? -5.739  -12.378 -6.265  1.00 0.00 ? 41 SER A CA   7  
ATOM 4032  C C    . SER A 1 41 ? -6.233  -11.968 -7.643  1.00 0.00 ? 41 SER A C    7  
ATOM 4033  O O    . SER A 1 41 ? -5.836  -12.539 -8.657  1.00 0.00 ? 41 SER A O    7  
ATOM 4034  C CB   . SER A 1 41 ? -6.884  -13.079 -5.531  1.00 0.00 ? 41 SER A CB   7  
ATOM 4035  O OG   . SER A 1 41 ? -6.440  -13.629 -4.302  1.00 0.00 ? 41 SER A OG   7  
ATOM 4036  H H    . SER A 1 41 ? -5.750  -10.999 -4.640  1.00 0.00 ? 41 SER A H    7  
ATOM 4037  H HA   . SER A 1 41 ? -4.903  -13.068 -6.372  1.00 0.00 ? 41 SER A HA   7  
ATOM 4038  H HB2  . SER A 1 41 ? -7.676  -12.356 -5.332  1.00 0.00 ? 41 SER A HB2  7  
ATOM 4039  H HB3  . SER A 1 41 ? -7.273  -13.880 -6.159  1.00 0.00 ? 41 SER A HB3  7  
ATOM 4040  H HG   . SER A 1 41 ? -7.181  -14.060 -3.868  1.00 0.00 ? 41 SER A HG   7  
ATOM 4041  N N    . MET A 1 42 ? -7.107  -10.966 -7.665  1.00 0.00 ? 42 MET A N    7  
ATOM 4042  C CA   . MET A 1 42 ? -7.675  -10.453 -8.909  1.00 0.00 ? 42 MET A CA   7  
ATOM 4043  C C    . MET A 1 42 ? -6.587  -9.849  -9.782  1.00 0.00 ? 42 MET A C    7  
ATOM 4044  O O    . MET A 1 42 ? -6.571  -10.035 -10.998 1.00 0.00 ? 42 MET A O    7  
ATOM 4045  C CB   . MET A 1 42 ? -8.716  -9.371  -8.616  1.00 0.00 ? 42 MET A CB   7  
ATOM 4046  C CG   . MET A 1 42 ? -9.422  -8.838  -9.853  1.00 0.00 ? 42 MET A CG   7  
ATOM 4047  S SD   . MET A 1 42 ? -10.662 -7.589  -9.462  1.00 0.00 ? 42 MET A SD   7  
ATOM 4048  C CE   . MET A 1 42 ? -9.619  -6.220  -8.965  1.00 0.00 ? 42 MET A CE   7  
ATOM 4049  H H    . MET A 1 42 ? -7.396  -10.538 -6.797  1.00 0.00 ? 42 MET A H    7  
ATOM 4050  H HA   . MET A 1 42 ? -8.151  -11.276 -9.442  1.00 0.00 ? 42 MET A HA   7  
ATOM 4051  H HB2  . MET A 1 42 ? -9.468  -9.790  -7.947  1.00 0.00 ? 42 MET A HB2  7  
ATOM 4052  H HB3  . MET A 1 42 ? -8.215  -8.538  -8.123  1.00 0.00 ? 42 MET A HB3  7  
ATOM 4053  H HG2  . MET A 1 42 ? -8.681  -8.399  -10.521 1.00 0.00 ? 42 MET A HG2  7  
ATOM 4054  H HG3  . MET A 1 42 ? -9.909  -9.667  -10.367 1.00 0.00 ? 42 MET A HG3  7  
ATOM 4055  H HE1  . MET A 1 42 ? -10.235 -5.363  -8.690  1.00 0.00 ? 42 MET A HE1  7  
ATOM 4056  H HE2  . MET A 1 42 ? -9.014  -6.518  -8.108  1.00 0.00 ? 42 MET A HE2  7  
ATOM 4057  H HE3  . MET A 1 42 ? -8.966  -5.943  -9.793  1.00 0.00 ? 42 MET A HE3  7  
ATOM 4058  N N    . LEU A 1 43 ? -5.677  -9.119  -9.143  1.00 0.00 ? 43 LEU A N    7  
ATOM 4059  C CA   . LEU A 1 43 ? -4.569  -8.471  -9.837  1.00 0.00 ? 43 LEU A CA   7  
ATOM 4060  C C    . LEU A 1 43 ? -3.515  -9.494  -10.228 1.00 0.00 ? 43 LEU A C    7  
ATOM 4061  O O    . LEU A 1 43 ? -2.946  -9.437  -11.317 1.00 0.00 ? 43 LEU A O    7  
ATOM 4062  C CB   . LEU A 1 43 ? -3.914  -7.421  -8.937  1.00 0.00 ? 43 LEU A CB   7  
ATOM 4063  C CG   . LEU A 1 43 ? -4.733  -6.159  -8.660  1.00 0.00 ? 43 LEU A CG   7  
ATOM 4064  C CD1  . LEU A 1 43 ? -4.021  -5.265  -7.657  1.00 0.00 ? 43 LEU A CD1  7  
ATOM 4065  C CD2  . LEU A 1 43 ? -4.944  -5.364  -9.939  1.00 0.00 ? 43 LEU A CD2  7  
ATOM 4066  H H    . LEU A 1 43 ? -5.746  -9.002  -8.142  1.00 0.00 ? 43 LEU A H    7  
ATOM 4067  H HA   . LEU A 1 43 ? -4.954  -7.986  -10.735 1.00 0.00 ? 43 LEU A HA   7  
ATOM 4068  H HB2  . LEU A 1 43 ? -3.698  -7.893  -7.979  1.00 0.00 ? 43 LEU A HB2  7  
ATOM 4069  H HB3  . LEU A 1 43 ? -2.981  -7.114  -9.410  1.00 0.00 ? 43 LEU A HB3  7  
ATOM 4070  H HG   . LEU A 1 43 ? -5.702  -6.451  -8.255  1.00 0.00 ? 43 LEU A HG   7  
ATOM 4071  H HD11 . LEU A 1 43 ? -4.620  -4.375  -7.461  1.00 0.00 ? 43 LEU A HD11 7  
ATOM 4072  H HD12 . LEU A 1 43 ? -3.874  -5.812  -6.726  1.00 0.00 ? 43 LEU A HD12 7  
ATOM 4073  H HD13 . LEU A 1 43 ? -3.054  -4.966  -8.061  1.00 0.00 ? 43 LEU A HD13 7  
ATOM 4074  H HD21 . LEU A 1 43 ? -5.539  -4.474  -9.730  1.00 0.00 ? 43 LEU A HD21 7  
ATOM 4075  H HD22 . LEU A 1 43 ? -3.977  -5.064  -10.343 1.00 0.00 ? 43 LEU A HD22 7  
ATOM 4076  H HD23 . LEU A 1 43 ? -5.467  -5.983  -10.668 1.00 0.00 ? 43 LEU A HD23 7  
ATOM 4077  N N    . ARG A 1 44 ? -3.261  -10.434 -9.322  1.00 0.00 ? 44 ARG A N    7  
ATOM 4078  C CA   . ARG A 1 44 ? -2.276  -11.488 -9.545  1.00 0.00 ? 44 ARG A CA   7  
ATOM 4079  C C    . ARG A 1 44 ? -2.880  -12.616 -10.366 1.00 0.00 ? 44 ARG A C    7  
ATOM 4080  O O    . ARG A 1 44 ? -2.198  -13.259 -11.162 1.00 0.00 ? 44 ARG A O    7  
ATOM 4081  C CB   . ARG A 1 44 ? -1.796  -12.064 -8.211  1.00 0.00 ? 44 ARG A CB   7  
ATOM 4082  C CG   . ARG A 1 44 ? -0.699  -13.107 -8.344  1.00 0.00 ? 44 ARG A CG   7  
ATOM 4083  C CD   . ARG A 1 44 ? 0.588   -12.492 -8.869  1.00 0.00 ? 44 ARG A CD   7  
ATOM 4084  N NE   . ARG A 1 44 ? 1.658   -13.479 -8.988  1.00 0.00 ? 44 ARG A NE   7  
ATOM 4085  C CZ   . ARG A 1 44 ? 2.828   -13.246 -9.574  1.00 0.00 ? 44 ARG A CZ   7  
ATOM 4086  N NH1  . ARG A 1 44 ? 3.082   -12.054 -10.097 1.00 0.00 ? 44 ARG A NH1  7  
ATOM 4087  N NH2  . ARG A 1 44 ? 3.742   -14.204 -9.634  1.00 0.00 ? 44 ARG A NH2  7  
ATOM 4088  H H    . ARG A 1 44 ? -3.762  -10.427 -8.445  1.00 0.00 ? 44 ARG A H    7  
ATOM 4089  H HA   . ARG A 1 44 ? -1.427  -11.065 -10.081 1.00 0.00 ? 44 ARG A HA   7  
ATOM 4090  H HB2  . ARG A 1 44 ? -1.417  -11.244 -7.601  1.00 0.00 ? 44 ARG A HB2  7  
ATOM 4091  H HB3  . ARG A 1 44 ? -2.648  -12.525 -7.711  1.00 0.00 ? 44 ARG A HB3  7  
ATOM 4092  H HG2  . ARG A 1 44 ? -0.509  -13.547 -7.365  1.00 0.00 ? 44 ARG A HG2  7  
ATOM 4093  H HG3  . ARG A 1 44 ? -1.029  -13.883 -9.034  1.00 0.00 ? 44 ARG A HG3  7  
ATOM 4094  H HD2  . ARG A 1 44 ? 0.397   -12.058 -9.851  1.00 0.00 ? 44 ARG A HD2  7  
ATOM 4095  H HD3  . ARG A 1 44 ? 0.908   -11.705 -8.186  1.00 0.00 ? 44 ARG A HD3  7  
ATOM 4096  H HE   . ARG A 1 44 ? 1.486   -14.394 -8.596  1.00 0.00 ? 44 ARG A HE   7  
ATOM 4097  H HH11 . ARG A 1 44 ? 2.386   -11.323 -10.050 1.00 0.00 ? 44 ARG A HH11 7  
ATOM 4098  H HH12 . ARG A 1 44 ? 3.971   -11.877 -10.542 1.00 0.00 ? 44 ARG A HH12 7  
ATOM 4099  H HH21 . ARG A 1 44 ? 3.549   -15.111 -9.235  1.00 0.00 ? 44 ARG A HH21 7  
ATOM 4100  H HH22 . ARG A 1 44 ? 4.631   -14.026 -10.079 1.00 0.00 ? 44 ARG A HH22 7  
ATOM 4101  N N    . LYS A 1 45 ? -4.173  -12.847 -10.160 1.00 0.00 ? 45 LYS A N    7  
ATOM 4102  C CA   . LYS A 1 45 ? -4.901  -13.894 -10.870 1.00 0.00 ? 45 LYS A CA   7  
ATOM 4103  C C    . LYS A 1 45 ? -5.144  -13.489 -12.314 1.00 0.00 ? 45 LYS A C    7  
ATOM 4104  O O    . LYS A 1 45 ? -4.927  -14.271 -13.239 1.00 0.00 ? 45 LYS A O    7  
ATOM 4105  C CB   . LYS A 1 45 ? -6.255  -14.150 -10.206 1.00 0.00 ? 45 LYS A CB   7  
ATOM 4106  C CG   . LYS A 1 45 ? -7.062  -15.265 -10.850 1.00 0.00 ? 45 LYS A CG   7  
ATOM 4107  C CD   . LYS A 1 45 ? -8.367  -15.503 -10.108 1.00 0.00 ? 45 LYS A CD   7  
ATOM 4108  C CE   . LYS A 1 45 ? -9.180  -16.609 -10.761 1.00 0.00 ? 45 LYS A CE   7  
ATOM 4109  N NZ   . LYS A 1 45 ? -10.457 -16.861 -10.037 1.00 0.00 ? 45 LYS A NZ   7  
ATOM 4110  H H    . LYS A 1 45 ? -4.679  -12.284 -9.491  1.00 0.00 ? 45 LYS A H    7  
ATOM 4111  H HA   . LYS A 1 45 ? -4.310  -14.809 -10.846 1.00 0.00 ? 45 LYS A HA   7  
ATOM 4112  H HB2  . LYS A 1 45 ? -6.080  -14.412 -9.163  1.00 0.00 ? 45 LYS A HB2  7  
ATOM 4113  H HB3  . LYS A 1 45 ? -6.840  -13.231 -10.256 1.00 0.00 ? 45 LYS A HB3  7  
ATOM 4114  H HG2  . LYS A 1 45 ? -7.285  -14.991 -11.881 1.00 0.00 ? 45 LYS A HG2  7  
ATOM 4115  H HG3  . LYS A 1 45 ? -6.474  -16.182 -10.836 1.00 0.00 ? 45 LYS A HG3  7  
ATOM 4116  H HD2  . LYS A 1 45 ? -8.145  -15.786 -9.079  1.00 0.00 ? 45 LYS A HD2  7  
ATOM 4117  H HD3  . LYS A 1 45 ? -8.952  -14.582 -10.113 1.00 0.00 ? 45 LYS A HD3  7  
ATOM 4118  H HE2  . LYS A 1 45 ? -9.407  -16.322 -11.788 1.00 0.00 ? 45 LYS A HE2  7  
ATOM 4119  H HE3  . LYS A 1 45 ? -8.590  -17.525 -10.766 1.00 0.00 ? 45 LYS A HE3  7  
ATOM 4120  H HZ1  . LYS A 1 45 ? -10.971 -17.599 -10.497 1.00 0.00 ? 45 LYS A HZ1  7  
ATOM 4121  H HZ2  . LYS A 1 45 ? -10.256 -17.135 -9.086  1.00 0.00 ? 45 LYS A HZ2  7  
ATOM 4122  H HZ3  . LYS A 1 45 ? -11.014 -16.018 -10.034 1.00 0.00 ? 45 LYS A HZ3  7  
ATOM 4123  N N    . ALA A 1 46 ? -5.599  -12.253 -12.495 1.00 0.00 ? 46 ALA A N    7  
ATOM 4124  C CA   . ALA A 1 46 ? -5.883  -11.712 -13.821 1.00 0.00 ? 46 ALA A CA   7  
ATOM 4125  C C    . ALA A 1 46 ? -6.385  -10.280 -13.697 1.00 0.00 ? 46 ALA A C    7  
ATOM 4126  O O    . ALA A 1 46 ? -6.498  -9.752  -12.593 1.00 0.00 ? 46 ALA A O    7  
ATOM 4127  C CB   . ALA A 1 46 ? -6.920  -12.590 -14.517 1.00 0.00 ? 46 ALA A CB   7  
ATOM 4128  H H    . ALA A 1 46 ? -5.759  -11.659 -11.694 1.00 0.00 ? 46 ALA A H    7  
ATOM 4129  H HA   . ALA A 1 46 ? -4.965  -11.715 -14.407 1.00 0.00 ? 46 ALA A HA   7  
ATOM 4130  H HB1  . ALA A 1 46 ? -7.119  -12.193 -15.512 1.00 0.00 ? 46 ALA A HB1  7  
ATOM 4131  H HB2  . ALA A 1 46 ? -6.537  -13.607 -14.600 1.00 0.00 ? 46 ALA A HB2  7  
ATOM 4132  H HB3  . ALA A 1 46 ? -7.841  -12.595 -13.935 1.00 0.00 ? 46 ALA A HB3  7  
ATOM 4133  N N    . GLY A 1 1  ? -22.723 -40.603 48.072  1.00 0.00 ? 1  GLY A N    8  
ATOM 4134  C CA   . GLY A 1 1  ? -24.159 -40.790 48.115  1.00 0.00 ? 1  GLY A CA   8  
ATOM 4135  C C    . GLY A 1 1  ? -24.818 -40.016 46.985  1.00 0.00 ? 1  GLY A C    8  
ATOM 4136  O O    . GLY A 1 1  ? -24.146 -39.354 46.197  1.00 0.00 ? 1  GLY A O    8  
ATOM 4137  H H1   . GLY A 1 1  ? -22.334 -40.019 47.346  1.00 0.00 ? 1  GLY A H1   8  
ATOM 4138  H HA2  . GLY A 1 1  ? -24.390 -41.850 48.010  1.00 0.00 ? 1  GLY A HA2  8  
ATOM 4139  H HA3  . GLY A 1 1  ? -24.542 -40.431 49.070  1.00 0.00 ? 1  GLY A HA3  8  
ATOM 4140  N N    . VAL A 1 2  ? -26.143 -40.110 46.920  1.00 0.00 ? 2  VAL A N    8  
ATOM 4141  C CA   . VAL A 1 2  ? -26.925 -39.427 45.894  1.00 0.00 ? 2  VAL A CA   8  
ATOM 4142  C C    . VAL A 1 2  ? -26.910 -37.925 46.125  1.00 0.00 ? 2  VAL A C    8  
ATOM 4143  O O    . VAL A 1 2  ? -26.742 -37.139 45.193  1.00 0.00 ? 2  VAL A O    8  
ATOM 4144  C CB   . VAL A 1 2  ? -28.393 -39.892 45.900  1.00 0.00 ? 2  VAL A CB   8  
ATOM 4145  C CG1  . VAL A 1 2  ? -29.226 -39.039 44.956  1.00 0.00 ? 2  VAL A CG1  8  
ATOM 4146  C CG2  . VAL A 1 2  ? -28.494 -41.342 45.453  1.00 0.00 ? 2  VAL A CG2  8  
ATOM 4147  H H    . VAL A 1 2  ? -26.636 -40.671 47.600  1.00 0.00 ? 2  VAL A H    8  
ATOM 4148  H HA   . VAL A 1 2  ? -26.485 -39.647 44.922  1.00 0.00 ? 2  VAL A HA   8  
ATOM 4149  H HB   . VAL A 1 2  ? -28.788 -39.799 46.912  1.00 0.00 ? 2  VAL A HB   8  
ATOM 4150  H HG11 . VAL A 1 2  ? -30.264 -39.371 44.975  1.00 0.00 ? 2  VAL A HG11 8  
ATOM 4151  H HG12 . VAL A 1 2  ? -29.176 -37.996 45.270  1.00 0.00 ? 2  VAL A HG12 8  
ATOM 4152  H HG13 . VAL A 1 2  ? -28.836 -39.133 43.943  1.00 0.00 ? 2  VAL A HG13 8  
ATOM 4153  H HG21 . VAL A 1 2  ? -29.536 -41.662 45.470  1.00 0.00 ? 2  VAL A HG21 8  
ATOM 4154  H HG22 . VAL A 1 2  ? -28.103 -41.436 44.440  1.00 0.00 ? 2  VAL A HG22 8  
ATOM 4155  H HG23 . VAL A 1 2  ? -27.912 -41.970 46.127  1.00 0.00 ? 2  VAL A HG23 8  
ATOM 4156  N N    . ILE A 1 3  ? -27.088 -37.535 47.384  1.00 0.00 ? 3  ILE A N    8  
ATOM 4157  C CA   . ILE A 1 3  ? -27.099 -36.128 47.771  1.00 0.00 ? 3  ILE A CA   8  
ATOM 4158  C C    . ILE A 1 3  ? -25.727 -35.508 47.563  1.00 0.00 ? 3  ILE A C    8  
ATOM 4159  O O    . ILE A 1 3  ? -25.606 -34.367 47.119  1.00 0.00 ? 3  ILE A O    8  
ATOM 4160  C CB   . ILE A 1 3  ? -27.478 -35.953 49.253  1.00 0.00 ? 3  ILE A CB   8  
ATOM 4161  C CG1  . ILE A 1 3  ? -28.931 -36.371 49.485  1.00 0.00 ? 3  ILE A CG1  8  
ATOM 4162  C CG2  . ILE A 1 3  ? -27.320 -34.501 49.676  1.00 0.00 ? 3  ILE A CG2  8  
ATOM 4163  C CD1  . ILE A 1 3  ? -29.313 -36.466 50.946  1.00 0.00 ? 3  ILE A CD1  8  
ATOM 4164  H H    . ILE A 1 3  ? -27.221 -38.228 48.106  1.00 0.00 ? 3  ILE A H    8  
ATOM 4165  H HA   . ILE A 1 3  ? -27.829 -35.606 47.152  1.00 0.00 ? 3  ILE A HA   8  
ATOM 4166  H HB   . ILE A 1 3  ? -26.823 -36.577 49.860  1.00 0.00 ? 3  ILE A HB   8  
ATOM 4167  H HG12 . ILE A 1 3  ? -29.581 -35.637 49.007  1.00 0.00 ? 3  ILE A HG12 8  
ATOM 4168  H HG13 . ILE A 1 3  ? -29.086 -37.347 49.026  1.00 0.00 ? 3  ILE A HG13 8  
ATOM 4169  H HG21 . ILE A 1 3  ? -27.581 -34.391 50.729  1.00 0.00 ? 3  ILE A HG21 8  
ATOM 4170  H HG22 . ILE A 1 3  ? -26.286 -34.190 49.526  1.00 0.00 ? 3  ILE A HG22 8  
ATOM 4171  H HG23 . ILE A 1 3  ? -27.978 -33.874 49.074  1.00 0.00 ? 3  ILE A HG23 8  
ATOM 4172  H HD11 . ILE A 1 3  ? -30.356 -36.765 51.050  1.00 0.00 ? 3  ILE A HD11 8  
ATOM 4173  H HD12 . ILE A 1 3  ? -28.679 -37.204 51.437  1.00 0.00 ? 3  ILE A HD12 8  
ATOM 4174  H HD13 . ILE A 1 3  ? -29.172 -35.494 51.419  1.00 0.00 ? 3  ILE A HD13 8  
ATOM 4175  N N    . ASP A 1 4  ? -24.693 -36.277 47.891  1.00 0.00 ? 4  ASP A N    8  
ATOM 4176  C CA   . ASP A 1 4  ? -23.312 -35.827 47.751  1.00 0.00 ? 4  ASP A CA   8  
ATOM 4177  C C    . ASP A 1 4  ? -23.063 -35.302 46.346  1.00 0.00 ? 4  ASP A C    8  
ATOM 4178  O O    . ASP A 1 4  ? -22.385 -34.294 46.155  1.00 0.00 ? 4  ASP A O    8  
ATOM 4179  C CB   . ASP A 1 4  ? -22.343 -36.981 48.015  1.00 0.00 ? 4  ASP A CB   8  
ATOM 4180  C CG   . ASP A 1 4  ? -22.292 -37.377 49.477  1.00 0.00 ? 4  ASP A CG   8  
ATOM 4181  O OD1  . ASP A 1 4  ? -21.430 -38.205 49.839  1.00 0.00 ? 4  ASP A OD1  8  
ATOM 4182  O OD2  . ASP A 1 4  ? -23.114 -36.858 50.262  1.00 0.00 ? 4  ASP A OD2  8  
ATOM 4183  H H    . ASP A 1 4  ? -24.858 -37.206 48.251  1.00 0.00 ? 4  ASP A H    8  
ATOM 4184  H HA   . ASP A 1 4  ? -23.129 -35.030 48.472  1.00 0.00 ? 4  ASP A HA   8  
ATOM 4185  H HB2  . ASP A 1 4  ? -22.659 -37.844 47.429  1.00 0.00 ? 4  ASP A HB2  8  
ATOM 4186  H HB3  . ASP A 1 4  ? -21.345 -36.679 47.700  1.00 0.00 ? 4  ASP A HB3  8  
ATOM 4187  H HD2  . ASP A 1 4  ? -23.025 -37.153 51.171  1.00 0.00 ? 4  ASP A HD2  8  
ATOM 4188  N N    . THR A 1 5  ? -23.623 -36.003 45.363  1.00 0.00 ? 5  THR A N    8  
ATOM 4189  C CA   . THR A 1 5  ? -23.477 -35.630 43.959  1.00 0.00 ? 5  THR A CA   8  
ATOM 4190  C C    . THR A 1 5  ? -24.659 -34.786 43.508  1.00 0.00 ? 5  THR A C    8  
ATOM 4191  O O    . THR A 1 5  ? -24.725 -34.346 42.362  1.00 0.00 ? 5  THR A O    8  
ATOM 4192  C CB   . THR A 1 5  ? -23.406 -36.871 43.050  1.00 0.00 ? 5  THR A CB   8  
ATOM 4193  O OG1  . THR A 1 5  ? -24.622 -37.621 43.164  1.00 0.00 ? 5  THR A OG1  8  
ATOM 4194  C CG2  . THR A 1 5  ? -22.239 -37.760 43.452  1.00 0.00 ? 5  THR A CG2  8  
ATOM 4195  H H    . THR A 1 5  ? -24.171 -36.822 45.585  1.00 0.00 ? 5  THR A H    8  
ATOM 4196  H HA   . THR A 1 5  ? -22.558 -35.054 43.849  1.00 0.00 ? 5  THR A HA   8  
ATOM 4197  H HB   . THR A 1 5  ? -23.274 -36.549 42.017  1.00 0.00 ? 5  THR A HB   8  
ATOM 4198  H HG1  . THR A 1 5  ? -24.566 -38.385 42.587  1.00 0.00 ? 5  THR A HG1  8  
ATOM 4199  H HG21 . THR A 1 5  ? -22.199 -38.632 42.800  1.00 0.00 ? 5  THR A HG21 8  
ATOM 4200  H HG22 . THR A 1 5  ? -21.309 -37.198 43.363  1.00 0.00 ? 5  THR A HG22 8  
ATOM 4201  H HG23 . THR A 1 5  ? -22.370 -38.085 44.484  1.00 0.00 ? 5  THR A HG23 8  
ATOM 4202  N N    . SER A 1 6  ? -25.593 -34.567 44.429  1.00 0.00 ? 6  SER A N    8  
ATOM 4203  C CA   . SER A 1 6  ? -26.789 -33.777 44.153  1.00 0.00 ? 6  SER A CA   8  
ATOM 4204  C C    . SER A 1 6  ? -26.418 -32.464 43.481  1.00 0.00 ? 6  SER A C    8  
ATOM 4205  O O    . SER A 1 6  ? -26.846 -32.178 42.364  1.00 0.00 ? 6  SER A O    8  
ATOM 4206  C CB   . SER A 1 6  ? -27.534 -33.461 45.451  1.00 0.00 ? 6  SER A CB   8  
ATOM 4207  O OG   . SER A 1 6  ? -28.693 -32.686 45.199  1.00 0.00 ? 6  SER A OG   8  
ATOM 4208  H H    . SER A 1 6  ? -25.481 -34.955 45.355  1.00 0.00 ? 6  SER A H    8  
ATOM 4209  H HA   . SER A 1 6  ? -27.442 -34.349 43.493  1.00 0.00 ? 6  SER A HA   8  
ATOM 4210  H HB2  . SER A 1 6  ? -27.829 -34.395 45.929  1.00 0.00 ? 6  SER A HB2  8  
ATOM 4211  H HB3  . SER A 1 6  ? -26.873 -32.905 46.115  1.00 0.00 ? 6  SER A HB3  8  
ATOM 4212  H HG   . SER A 1 6  ? -29.136 -32.506 46.032  1.00 0.00 ? 6  SER A HG   8  
ATOM 4213  N N    . ALA A 1 7  ? -25.613 -31.669 44.180  1.00 0.00 ? 7  ALA A N    8  
ATOM 4214  C CA   . ALA A 1 7  ? -25.164 -30.375 43.674  1.00 0.00 ? 7  ALA A CA   8  
ATOM 4215  C C    . ALA A 1 7  ? -24.390 -30.549 42.377  1.00 0.00 ? 7  ALA A C    8  
ATOM 4216  O O    . ALA A 1 7  ? -24.552 -29.779 41.431  1.00 0.00 ? 7  ALA A O    8  
ATOM 4217  C CB   . ALA A 1 7  ? -24.257 -29.695 44.688  1.00 0.00 ? 7  ALA A CB   8  
ATOM 4218  H H    . ALA A 1 7  ? -25.296 -31.960 45.094  1.00 0.00 ? 7  ALA A H    8  
ATOM 4219  H HA   . ALA A 1 7  ? -26.037 -29.748 43.493  1.00 0.00 ? 7  ALA A HA   8  
ATOM 4220  H HB1  . ALA A 1 7  ? -23.940 -28.724 44.307  1.00 0.00 ? 7  ALA A HB1  8  
ATOM 4221  H HB2  . ALA A 1 7  ? -24.800 -29.556 45.624  1.00 0.00 ? 7  ALA A HB2  8  
ATOM 4222  H HB3  . ALA A 1 7  ? -23.381 -30.317 44.865  1.00 0.00 ? 7  ALA A HB3  8  
ATOM 4223  N N    . VAL A 1 8  ? -23.545 -31.576 42.346  1.00 0.00 ? 8  VAL A N    8  
ATOM 4224  C CA   . VAL A 1 8  ? -22.729 -31.879 41.174  1.00 0.00 ? 8  VAL A CA   8  
ATOM 4225  C C    . VAL A 1 8  ? -23.611 -32.231 39.988  1.00 0.00 ? 8  VAL A C    8  
ATOM 4226  O O    . VAL A 1 8  ? -23.358 -31.810 38.860  1.00 0.00 ? 8  VAL A O    8  
ATOM 4227  C CB   . VAL A 1 8  ? -21.788 -33.070 41.434  1.00 0.00 ? 8  VAL A CB   8  
ATOM 4228  C CG1  . VAL A 1 8  ? -21.104 -33.499 40.145  1.00 0.00 ? 8  VAL A CG1  8  
ATOM 4229  C CG2  . VAL A 1 8  ? -20.716 -32.691 42.444  1.00 0.00 ? 8  VAL A CG2  8  
ATOM 4230  H H    . VAL A 1 8  ? -23.458 -32.173 43.156  1.00 0.00 ? 8  VAL A H    8  
ATOM 4231  H HA   . VAL A 1 8  ? -22.133 -30.998 40.933  1.00 0.00 ? 8  VAL A HA   8  
ATOM 4232  H HB   . VAL A 1 8  ? -22.373 -33.902 41.826  1.00 0.00 ? 8  VAL A HB   8  
ATOM 4233  H HG11 . VAL A 1 8  ? -20.448 -34.347 40.340  1.00 0.00 ? 8  VAL A HG11 8  
ATOM 4234  H HG12 . VAL A 1 8  ? -21.859 -33.786 39.413  1.00 0.00 ? 8  VAL A HG12 8  
ATOM 4235  H HG13 . VAL A 1 8  ? -20.516 -32.669 39.754  1.00 0.00 ? 8  VAL A HG13 8  
ATOM 4236  H HG21 . VAL A 1 8  ? -20.062 -33.543 42.626  1.00 0.00 ? 8  VAL A HG21 8  
ATOM 4237  H HG22 . VAL A 1 8  ? -20.128 -31.860 42.053  1.00 0.00 ? 8  VAL A HG22 8  
ATOM 4238  H HG23 . VAL A 1 8  ? -21.190 -32.392 43.380  1.00 0.00 ? 8  VAL A HG23 8  
ATOM 4239  N N    . GLU A 1 9  ? -24.654 -33.012 40.258  1.00 0.00 ? 9  GLU A N    8  
ATOM 4240  C CA   . GLU A 1 9  ? -25.597 -33.439 39.228  1.00 0.00 ? 9  GLU A CA   8  
ATOM 4241  C C    . GLU A 1 9  ? -26.206 -32.234 38.531  1.00 0.00 ? 9  GLU A C    8  
ATOM 4242  O O    . GLU A 1 9  ? -26.409 -32.236 37.318  1.00 0.00 ? 9  GLU A O    8  
ATOM 4243  C CB   . GLU A 1 9  ? -26.729 -34.263 39.846  1.00 0.00 ? 9  GLU A CB   8  
ATOM 4244  C CG   . GLU A 1 9  ? -27.722 -34.809 38.834  1.00 0.00 ? 9  GLU A CG   8  
ATOM 4245  C CD   . GLU A 1 9  ? -28.799 -35.661 39.476  1.00 0.00 ? 9  GLU A CD   8  
ATOM 4246  O OE1  . GLU A 1 9  ? -28.769 -35.823 40.715  1.00 0.00 ? 9  GLU A OE1  8  
ATOM 4247  O OE2  . GLU A 1 9  ? -29.673 -36.168 38.742  1.00 0.00 ? 9  GLU A OE2  8  
ATOM 4248  H H    . GLU A 1 9  ? -24.809 -33.325 41.206  1.00 0.00 ? 9  GLU A H    8  
ATOM 4249  H HA   . GLU A 1 9  ? -25.066 -34.048 38.498  1.00 0.00 ? 9  GLU A HA   8  
ATOM 4250  H HB2  . GLU A 1 9  ? -26.288 -35.103 40.381  1.00 0.00 ? 9  GLU A HB2  8  
ATOM 4251  H HB3  . GLU A 1 9  ? -27.270 -33.629 40.549  1.00 0.00 ? 9  GLU A HB3  8  
ATOM 4252  H HG2  . GLU A 1 9  ? -28.197 -33.972 38.322  1.00 0.00 ? 9  GLU A HG2  8  
ATOM 4253  H HG3  . GLU A 1 9  ? -27.184 -35.415 38.106  1.00 0.00 ? 9  GLU A HG3  8  
ATOM 4254  H HE2  . GLU A 1 9  ? -30.323 -36.694 39.215  1.00 0.00 ? 9  GLU A HE2  8  
ATOM 4255  N N    . SER A 1 10 ? -26.497 -31.202 39.317  1.00 0.00 ? 10 SER A N    8  
ATOM 4256  C CA   . SER A 1 10 ? -27.086 -29.970 38.801  1.00 0.00 ? 10 SER A CA   8  
ATOM 4257  C C    . SER A 1 10 ? -26.014 -29.077 38.200  1.00 0.00 ? 10 SER A C    8  
ATOM 4258  O O    . SER A 1 10 ? -26.160 -28.565 37.091  1.00 0.00 ? 10 SER A O    8  
ATOM 4259  C CB   . SER A 1 10 ? -27.784 -29.199 39.923  1.00 0.00 ? 10 SER A CB   8  
ATOM 4260  O OG   . SER A 1 10 ? -28.872 -29.937 40.450  1.00 0.00 ? 10 SER A OG   8  
ATOM 4261  H H    . SER A 1 10 ? -26.308 -31.261 40.307  1.00 0.00 ? 10 SER A H    8  
ATOM 4262  H HA   . SER A 1 10 ? -27.816 -30.226 38.033  1.00 0.00 ? 10 SER A HA   8  
ATOM 4263  H HB2  . SER A 1 10 ? -27.068 -29.004 40.721  1.00 0.00 ? 10 SER A HB2  8  
ATOM 4264  H HB3  . SER A 1 10 ? -28.155 -28.253 39.528  1.00 0.00 ? 10 SER A HB3  8  
ATOM 4265  H HG   . SER A 1 10 ? -29.286 -29.426 41.149  1.00 0.00 ? 10 SER A HG   8  
ATOM 4266  N N    . ALA A 1 11 ? -24.931 -28.895 38.951  1.00 0.00 ? 11 ALA A N    8  
ATOM 4267  C CA   . ALA A 1 11 ? -23.812 -28.065 38.516  1.00 0.00 ? 11 ALA A CA   8  
ATOM 4268  C C    . ALA A 1 11 ? -23.115 -28.693 37.320  1.00 0.00 ? 11 ALA A C    8  
ATOM 4269  O O    . ALA A 1 11 ? -22.700 -28.002 36.391  1.00 0.00 ? 11 ALA A O    8  
ATOM 4270  C CB   . ALA A 1 11 ? -22.797 -27.912 39.639  1.00 0.00 ? 11 ALA A CB   8  
ATOM 4271  H H    . ALA A 1 11 ? -24.872 -29.341 39.855  1.00 0.00 ? 11 ALA A H    8  
ATOM 4272  H HA   . ALA A 1 11 ? -24.193 -27.082 38.237  1.00 0.00 ? 11 ALA A HA   8  
ATOM 4273  H HB1  . ALA A 1 11 ? -21.974 -27.278 39.309  1.00 0.00 ? 11 ALA A HB1  8  
ATOM 4274  H HB2  . ALA A 1 11 ? -23.280 -27.456 40.504  1.00 0.00 ? 11 ALA A HB2  8  
ATOM 4275  H HB3  . ALA A 1 11 ? -22.411 -28.893 39.914  1.00 0.00 ? 11 ALA A HB3  8  
ATOM 4276  N N    . ILE A 1 12 ? -22.993 -30.016 37.356  1.00 0.00 ? 12 ILE A N    8  
ATOM 4277  C CA   . ILE A 1 12 ? -22.349 -30.770 36.285  1.00 0.00 ? 12 ILE A CA   8  
ATOM 4278  C C    . ILE A 1 12 ? -23.176 -30.698 35.012  1.00 0.00 ? 12 ILE A C    8  
ATOM 4279  O O    . ILE A 1 12 ? -22.651 -30.465 33.924  1.00 0.00 ? 12 ILE A O    8  
ATOM 4280  C CB   . ILE A 1 12 ? -22.185 -32.255 36.660  1.00 0.00 ? 12 ILE A CB   8  
ATOM 4281  C CG1  . ILE A 1 12 ? -21.194 -32.407 37.815  1.00 0.00 ? 12 ILE A CG1  8  
ATOM 4282  C CG2  . ILE A 1 12 ? -21.665 -33.050 35.472  1.00 0.00 ? 12 ILE A CG2  8  
ATOM 4283  C CD1  . ILE A 1 12 ? -19.805 -31.895 37.500  1.00 0.00 ? 12 ILE A CD1  8  
ATOM 4284  H H    . ILE A 1 12 ? -23.357 -30.527 38.147  1.00 0.00 ? 12 ILE A H    8  
ATOM 4285  H HA   . ILE A 1 12 ? -21.366 -30.337 36.102  1.00 0.00 ? 12 ILE A HA   8  
ATOM 4286  H HB   . ILE A 1 12 ? -23.155 -32.651 36.962  1.00 0.00 ? 12 ILE A HB   8  
ATOM 4287  H HG12 . ILE A 1 12 ? -21.578 -31.853 38.672  1.00 0.00 ? 12 ILE A HG12 8  
ATOM 4288  H HG13 . ILE A 1 12 ? -21.121 -33.464 38.068  1.00 0.00 ? 12 ILE A HG13 8  
ATOM 4289  H HG21 . ILE A 1 12 ? -21.563 -34.100 35.746  1.00 0.00 ? 12 ILE A HG21 8  
ATOM 4290  H HG22 . ILE A 1 12 ? -22.366 -32.960 34.642  1.00 0.00 ? 12 ILE A HG22 8  
ATOM 4291  H HG23 . ILE A 1 12 ? -20.694 -32.658 35.171  1.00 0.00 ? 12 ILE A HG23 8  
ATOM 4292  H HD11 . ILE A 1 12 ? -19.145 -32.027 38.357  1.00 0.00 ? 12 ILE A HD11 8  
ATOM 4293  H HD12 . ILE A 1 12 ? -19.403 -32.446 36.650  1.00 0.00 ? 12 ILE A HD12 8  
ATOM 4294  H HD13 . ILE A 1 12 ? -19.860 -30.835 37.252  1.00 0.00 ? 12 ILE A HD13 8  
ATOM 4295  N N    . THR A 1 13 ? -24.482 -30.900 35.163  1.00 0.00 ? 13 THR A N    8  
ATOM 4296  C CA   . THR A 1 13 ? -25.413 -30.864 34.038  1.00 0.00 ? 13 THR A CA   8  
ATOM 4297  C C    . THR A 1 13 ? -25.461 -29.471 33.432  1.00 0.00 ? 13 THR A C    8  
ATOM 4298  O O    . THR A 1 13 ? -25.476 -29.308 32.213  1.00 0.00 ? 13 THR A O    8  
ATOM 4299  C CB   . THR A 1 13 ? -26.841 -31.240 34.475  1.00 0.00 ? 13 THR A CB   8  
ATOM 4300  O OG1  . THR A 1 13 ? -26.851 -32.580 34.982  1.00 0.00 ? 13 THR A OG1  8  
ATOM 4301  C CG2  . THR A 1 13 ? -27.799 -31.152 33.297  1.00 0.00 ? 13 THR A CG2  8  
ATOM 4302  H H    . THR A 1 13 ? -24.854 -31.085 36.084  1.00 0.00 ? 13 THR A H    8  
ATOM 4303  H HA   . THR A 1 13 ? -25.072 -31.574 33.285  1.00 0.00 ? 13 THR A HA   8  
ATOM 4304  H HB   . THR A 1 13 ? -27.168 -30.553 35.257  1.00 0.00 ? 13 THR A HB   8  
ATOM 4305  H HG1  . THR A 1 13 ? -27.745 -32.796 35.257  1.00 0.00 ? 13 THR A HG1  8  
ATOM 4306  H HG21 . THR A 1 13 ? -28.806 -31.418 33.620  1.00 0.00 ? 13 THR A HG21 8  
ATOM 4307  H HG22 . THR A 1 13 ? -27.802 -30.133 32.908  1.00 0.00 ? 13 THR A HG22 8  
ATOM 4308  H HG23 . THR A 1 13 ? -27.476 -31.839 32.515  1.00 0.00 ? 13 THR A HG23 8  
ATOM 4309  N N    . ASP A 1 14 ? -25.487 -28.465 34.303  1.00 0.00 ? 14 ASP A N    8  
ATOM 4310  C CA   . ASP A 1 14 ? -25.534 -27.069 33.881  1.00 0.00 ? 14 ASP A CA   8  
ATOM 4311  C C    . ASP A 1 14 ? -24.227 -26.668 33.220  1.00 0.00 ? 14 ASP A C    8  
ATOM 4312  O O    . ASP A 1 14 ? -24.213 -26.102 32.128  1.00 0.00 ? 14 ASP A O    8  
ATOM 4313  C CB   . ASP A 1 14 ? -25.768 -26.153 35.084  1.00 0.00 ? 14 ASP A CB   8  
ATOM 4314  C CG   . ASP A 1 14 ? -27.176 -26.262 35.635  1.00 0.00 ? 14 ASP A CG   8  
ATOM 4315  O OD1  . ASP A 1 14 ? -27.528 -25.465 36.529  1.00 0.00 ? 14 ASP A OD1  8  
ATOM 4316  O OD2  . ASP A 1 14 ? -27.928 -27.145 35.171  1.00 0.00 ? 14 ASP A OD2  8  
ATOM 4317  H H    . ASP A 1 14 ? -25.475 -28.663 35.293  1.00 0.00 ? 14 ASP A H    8  
ATOM 4318  H HA   . ASP A 1 14 ? -26.352 -26.946 33.170  1.00 0.00 ? 14 ASP A HA   8  
ATOM 4319  H HB2  . ASP A 1 14 ? -25.063 -26.420 35.871  1.00 0.00 ? 14 ASP A HB2  8  
ATOM 4320  H HB3  . ASP A 1 14 ? -25.591 -25.121 34.779  1.00 0.00 ? 14 ASP A HB3  8  
ATOM 4321  H HD2  . ASP A 1 14 ? -28.804 -27.157 35.564  1.00 0.00 ? 14 ASP A HD2  8  
ATOM 4322  N N    . GLY A 1 15 ? -23.123 -26.970 33.898  1.00 0.00 ? 15 GLY A N    8  
ATOM 4323  C CA   . GLY A 1 15 ? -21.789 -26.652 33.398  1.00 0.00 ? 15 GLY A CA   8  
ATOM 4324  C C    . GLY A 1 15 ? -21.316 -27.718 32.423  1.00 0.00 ? 15 GLY A C    8  
ATOM 4325  O O    . GLY A 1 15 ? -21.174 -27.469 31.227  1.00 0.00 ? 15 GLY A O    8  
ATOM 4326  H H    . GLY A 1 15 ? -23.200 -27.435 34.791  1.00 0.00 ? 15 GLY A H    8  
ATOM 4327  H HA2  . GLY A 1 15 ? -21.817 -25.687 32.891  1.00 0.00 ? 15 GLY A HA2  8  
ATOM 4328  H HA3  . GLY A 1 15 ? -21.095 -26.598 34.237  1.00 0.00 ? 15 GLY A HA3  8  
ATOM 4329  N N    . GLN A 1 16 ? -21.075 -28.914 32.952  1.00 0.00 ? 16 GLN A N    8  
ATOM 4330  C CA   . GLN A 1 16 ? -20.617 -30.044 32.150  1.00 0.00 ? 16 GLN A CA   8  
ATOM 4331  C C    . GLN A 1 16 ? -21.482 -30.203 30.910  1.00 0.00 ? 16 GLN A C    8  
ATOM 4332  O O    . GLN A 1 16 ? -20.984 -30.230 29.786  1.00 0.00 ? 16 GLN A O    8  
ATOM 4333  C CB   . GLN A 1 16 ? -20.690 -31.340 32.960  1.00 0.00 ? 16 GLN A CB   8  
ATOM 4334  C CG   . GLN A 1 16 ? -20.190 -32.567 32.214  1.00 0.00 ? 16 GLN A CG   8  
ATOM 4335  C CD   . GLN A 1 16 ? -18.712 -32.486 31.886  1.00 0.00 ? 16 GLN A CD   8  
ATOM 4336  O OE1  . GLN A 1 16 ? -17.879 -32.291 32.772  1.00 0.00 ? 16 GLN A OE1  8  
ATOM 4337  N NE2  . GLN A 1 16 ? -18.381 -32.637 30.609  1.00 0.00 ? 16 GLN A NE2  8  
ATOM 4338  H H    . GLN A 1 16 ? -21.210 -29.056 33.943  1.00 0.00 ? 16 GLN A H    8  
ATOM 4339  H HA   . GLN A 1 16 ? -19.585 -29.864 31.850  1.00 0.00 ? 16 GLN A HA   8  
ATOM 4340  H HB2  . GLN A 1 16 ? -20.087 -31.216 33.859  1.00 0.00 ? 16 GLN A HB2  8  
ATOM 4341  H HB3  . GLN A 1 16 ? -21.730 -31.510 33.241  1.00 0.00 ? 16 GLN A HB3  8  
ATOM 4342  H HG2  . GLN A 1 16 ? -20.365 -33.448 32.832  1.00 0.00 ? 16 GLN A HG2  8  
ATOM 4343  H HG3  . GLN A 1 16 ? -20.751 -32.664 31.284  1.00 0.00 ? 16 GLN A HG3  8  
ATOM 4344  H HE21 . GLN A 1 16 ? -19.101 -32.795 29.918  1.00 0.00 ? 16 GLN A HE21 8  
ATOM 4345  H HE22 . GLN A 1 16 ? -17.411 -32.593 30.331  1.00 0.00 ? 16 GLN A HE22 8  
ATOM 4346  N N    . GLY A 1 17 ? -22.789 -30.308 31.132  1.00 0.00 ? 17 GLY A N    8  
ATOM 4347  C CA   . GLY A 1 17 ? -23.754 -30.466 30.047  1.00 0.00 ? 17 GLY A CA   8  
ATOM 4348  C C    . GLY A 1 17 ? -23.540 -29.399 28.985  1.00 0.00 ? 17 GLY A C    8  
ATOM 4349  O O    . GLY A 1 17 ? -23.500 -29.690 27.791  1.00 0.00 ? 17 GLY A O    8  
ATOM 4350  H H    . GLY A 1 17 ? -23.138 -30.278 32.080  1.00 0.00 ? 17 GLY A H    8  
ATOM 4351  H HA2  . GLY A 1 17 ? -23.631 -31.451 29.597  1.00 0.00 ? 17 GLY A HA2  8  
ATOM 4352  H HA3  . GLY A 1 17 ? -24.764 -30.376 30.448  1.00 0.00 ? 17 GLY A HA3  8  
ATOM 4353  N N    . ASP A 1 18 ? -23.402 -28.156 29.438  1.00 0.00 ? 18 ASP A N    8  
ATOM 4354  C CA   . ASP A 1 18 ? -23.191 -27.020 28.546  1.00 0.00 ? 18 ASP A CA   8  
ATOM 4355  C C    . ASP A 1 18 ? -21.973 -27.254 27.667  1.00 0.00 ? 18 ASP A C    8  
ATOM 4356  O O    . ASP A 1 18 ? -21.762 -26.559 26.674  1.00 0.00 ? 18 ASP A O    8  
ATOM 4357  C CB   . ASP A 1 18 ? -22.967 -25.740 29.353  1.00 0.00 ? 18 ASP A CB   8  
ATOM 4358  C CG   . ASP A 1 18 ? -24.227 -25.261 30.047  1.00 0.00 ? 18 ASP A CG   8  
ATOM 4359  O OD1  . ASP A 1 18 ? -24.444 -24.032 30.102  1.00 0.00 ? 18 ASP A OD1  8  
ATOM 4360  O OD2  . ASP A 1 18 ? -24.996 -26.114 30.536  1.00 0.00 ? 18 ASP A OD2  8  
ATOM 4361  H H    . ASP A 1 18 ? -23.444 -27.980 30.432  1.00 0.00 ? 18 ASP A H    8  
ATOM 4362  H HA   . ASP A 1 18 ? -24.074 -26.899 27.917  1.00 0.00 ? 18 ASP A HA   8  
ATOM 4363  H HB2  . ASP A 1 18 ? -22.203 -25.929 30.107  1.00 0.00 ? 18 ASP A HB2  8  
ATOM 4364  H HB3  . ASP A 1 18 ? -22.620 -24.957 28.679  1.00 0.00 ? 18 ASP A HB3  8  
ATOM 4365  H HD2  . ASP A 1 18 ? -25.773 -25.741 30.960  1.00 0.00 ? 18 ASP A HD2  8  
ATOM 4366  N N    . MET A 1 19 ? -21.171 -28.245 28.046  1.00 0.00 ? 19 MET A N    8  
ATOM 4367  C CA   . MET A 1 19 ? -19.962 -28.597 27.309  1.00 0.00 ? 19 MET A CA   8  
ATOM 4368  C C    . MET A 1 19 ? -20.313 -29.101 25.919  1.00 0.00 ? 19 MET A C    8  
ATOM 4369  O O    . MET A 1 19 ? -19.667 -28.750 24.933  1.00 0.00 ? 19 MET A O    8  
ATOM 4370  C CB   . MET A 1 19 ? -19.189 -29.696 28.041  1.00 0.00 ? 19 MET A CB   8  
ATOM 4371  C CG   . MET A 1 19 ? -17.869 -30.068 27.386  1.00 0.00 ? 19 MET A CG   8  
ATOM 4372  S SD   . MET A 1 19 ? -16.984 -31.355 28.286  1.00 0.00 ? 19 MET A SD   8  
ATOM 4373  C CE   . MET A 1 19 ? -16.504 -30.466 29.765  1.00 0.00 ? 19 MET A CE   8  
ATOM 4374  H H    . MET A 1 19 ? -21.398 -28.778 28.873  1.00 0.00 ? 19 MET A H    8  
ATOM 4375  H HA   . MET A 1 19 ? -19.334 -27.710 27.224  1.00 0.00 ? 19 MET A HA   8  
ATOM 4376  H HB2  . MET A 1 19 ? -18.984 -29.353 29.055  1.00 0.00 ? 19 MET A HB2  8  
ATOM 4377  H HB3  . MET A 1 19 ? -19.815 -30.587 28.079  1.00 0.00 ? 19 MET A HB3  8  
ATOM 4378  H HG2  . MET A 1 19 ? -18.065 -30.419 26.373  1.00 0.00 ? 19 MET A HG2  8  
ATOM 4379  H HG3  . MET A 1 19 ? -17.239 -29.180 27.332  1.00 0.00 ? 19 MET A HG3  8  
ATOM 4380  H HE1  . MET A 1 19 ? -15.945 -31.124 30.430  1.00 0.00 ? 19 MET A HE1  8  
ATOM 4381  H HE2  . MET A 1 19 ? -15.879 -29.616 29.490  1.00 0.00 ? 19 MET A HE2  8  
ATOM 4382  H HE3  . MET A 1 19 ? -17.397 -30.108 30.279  1.00 0.00 ? 19 MET A HE3  8  
ATOM 4383  N N    . LYS A 1 20 ? -21.349 -29.933 25.854  1.00 0.00 ? 20 LYS A N    8  
ATOM 4384  C CA   . LYS A 1 20 ? -21.812 -30.505 24.593  1.00 0.00 ? 20 LYS A CA   8  
ATOM 4385  C C    . LYS A 1 20 ? -22.174 -29.403 23.610  1.00 0.00 ? 20 LYS A C    8  
ATOM 4386  O O    . LYS A 1 20 ? -21.863 -29.482 22.423  1.00 0.00 ? 20 LYS A O    8  
ATOM 4387  C CB   . LYS A 1 20 ? -23.050 -31.375 24.822  1.00 0.00 ? 20 LYS A CB   8  
ATOM 4388  C CG   . LYS A 1 20 ? -23.565 -32.063 23.568  1.00 0.00 ? 20 LYS A CG   8  
ATOM 4389  C CD   . LYS A 1 20 ? -24.758 -32.953 23.877  1.00 0.00 ? 20 LYS A CD   8  
ATOM 4390  C CE   . LYS A 1 20 ? -25.282 -33.629 22.621  1.00 0.00 ? 20 LYS A CE   8  
ATOM 4391  N NZ   . LYS A 1 20 ? -26.444 -34.514 22.911  1.00 0.00 ? 20 LYS A NZ   8  
ATOM 4392  H H    . LYS A 1 20 ? -21.840 -30.184 26.700  1.00 0.00 ? 20 LYS A H    8  
ATOM 4393  H HA   . LYS A 1 20 ? -21.015 -31.117 24.172  1.00 0.00 ? 20 LYS A HA   8  
ATOM 4394  H HB2  . LYS A 1 20 ? -22.799 -32.141 25.555  1.00 0.00 ? 20 LYS A HB2  8  
ATOM 4395  H HB3  . LYS A 1 20 ? -23.846 -30.742 25.217  1.00 0.00 ? 20 LYS A HB3  8  
ATOM 4396  H HG2  . LYS A 1 20 ? -23.866 -31.304 22.845  1.00 0.00 ? 20 LYS A HG2  8  
ATOM 4397  H HG3  . LYS A 1 20 ? -22.768 -32.673 23.144  1.00 0.00 ? 20 LYS A HG3  8  
ATOM 4398  H HD2  . LYS A 1 20 ? -24.455 -33.718 24.592  1.00 0.00 ? 20 LYS A HD2  8  
ATOM 4399  H HD3  . LYS A 1 20 ? -25.552 -32.344 24.311  1.00 0.00 ? 20 LYS A HD3  8  
ATOM 4400  H HE2  . LYS A 1 20 ? -25.590 -32.863 21.909  1.00 0.00 ? 20 LYS A HE2  8  
ATOM 4401  H HE3  . LYS A 1 20 ? -24.484 -34.226 22.182  1.00 0.00 ? 20 LYS A HE3  8  
ATOM 4402  H HZ1  . LYS A 1 20 ? -26.766 -34.945 22.057  1.00 0.00 ? 20 LYS A HZ1  8  
ATOM 4403  H HZ2  . LYS A 1 20 ? -26.165 -35.231 23.564  1.00 0.00 ? 20 LYS A HZ2  8  
ATOM 4404  H HZ3  . LYS A 1 20 ? -27.192 -33.966 23.312  1.00 0.00 ? 20 LYS A HZ3  8  
ATOM 4405  N N    . ALA A 1 21 ? -22.838 -28.371 24.123  1.00 0.00 ? 21 ALA A N    8  
ATOM 4406  C CA   . ALA A 1 21 ? -23.259 -27.232 23.311  1.00 0.00 ? 21 ALA A CA   8  
ATOM 4407  C C    . ALA A 1 21 ? -22.052 -26.430 22.853  1.00 0.00 ? 21 ALA A C    8  
ATOM 4408  O O    . ALA A 1 21 ? -21.978 -25.990 21.707  1.00 0.00 ? 21 ALA A O    8  
ATOM 4409  C CB   . ALA A 1 21 ? -24.170 -26.316 24.114  1.00 0.00 ? 21 ALA A CB   8  
ATOM 4410  H H    . ALA A 1 21 ? -23.065 -28.364 25.107  1.00 0.00 ? 21 ALA A H    8  
ATOM 4411  H HA   . ALA A 1 21 ? -23.799 -27.603 22.440  1.00 0.00 ? 21 ALA A HA   8  
ATOM 4412  H HB1  . ALA A 1 21 ? -24.490 -25.477 23.495  1.00 0.00 ? 21 ALA A HB1  8  
ATOM 4413  H HB2  . ALA A 1 21 ? -25.046 -26.875 24.445  1.00 0.00 ? 21 ALA A HB2  8  
ATOM 4414  H HB3  . ALA A 1 21 ? -23.631 -25.938 24.982  1.00 0.00 ? 21 ALA A HB3  8  
ATOM 4415  N N    . ILE A 1 22 ? -21.103 -26.246 23.768  1.00 0.00 ? 22 ILE A N    8  
ATOM 4416  C CA   . ILE A 1 22 ? -19.883 -25.496 23.485  1.00 0.00 ? 22 ILE A CA   8  
ATOM 4417  C C    . ILE A 1 22 ? -19.058 -26.205 22.423  1.00 0.00 ? 22 ILE A C    8  
ATOM 4418  O O    . ILE A 1 22 ? -18.621 -25.598 21.447  1.00 0.00 ? 22 ILE A O    8  
ATOM 4419  C CB   . ILE A 1 22 ? -19.008 -25.346 24.743  1.00 0.00 ? 22 ILE A CB   8  
ATOM 4420  C CG1  . ILE A 1 22 ? -19.702 -24.451 25.772  1.00 0.00 ? 22 ILE A CG1  8  
ATOM 4421  C CG2  . ILE A 1 22 ? -17.667 -24.722 24.388  1.00 0.00 ? 22 ILE A CG2  8  
ATOM 4422  C CD1  . ILE A 1 22 ? -19.032 -24.447 27.129  1.00 0.00 ? 22 ILE A CD1  8  
ATOM 4423  H H    . ILE A 1 22 ? -21.221 -26.635 24.693  1.00 0.00 ? 22 ILE A H    8  
ATOM 4424  H HA   . ILE A 1 22 ? -20.163 -24.506 23.125  1.00 0.00 ? 22 ILE A HA   8  
ATOM 4425  H HB   . ILE A 1 22 ? -18.843 -26.332 25.177  1.00 0.00 ? 22 ILE A HB   8  
ATOM 4426  H HG12 . ILE A 1 22 ? -19.711 -23.430 25.390  1.00 0.00 ? 22 ILE A HG12 8  
ATOM 4427  H HG13 . ILE A 1 22 ? -20.727 -24.800 25.896  1.00 0.00 ? 22 ILE A HG13 8  
ATOM 4428  H HG21 . ILE A 1 22 ? -17.053 -24.630 25.284  1.00 0.00 ? 22 ILE A HG21 8  
ATOM 4429  H HG22 . ILE A 1 22 ? -17.155 -25.353 23.662  1.00 0.00 ? 22 ILE A HG22 8  
ATOM 4430  H HG23 . ILE A 1 22 ? -17.830 -23.733 23.959  1.00 0.00 ? 22 ILE A HG23 8  
ATOM 4431  H HD11 . ILE A 1 22 ? -19.568 -23.793 27.818  1.00 0.00 ? 22 ILE A HD11 8  
ATOM 4432  H HD12 . ILE A 1 22 ? -19.026 -25.460 27.530  1.00 0.00 ? 22 ILE A HD12 8  
ATOM 4433  H HD13 . ILE A 1 22 ? -18.008 -24.091 27.024  1.00 0.00 ? 22 ILE A HD13 8  
ATOM 4434  N N    . GLY A 1 23 ? -18.850 -27.502 22.627  1.00 0.00 ? 23 GLY A N    8  
ATOM 4435  C CA   . GLY A 1 23 ? -18.078 -28.325 21.699  1.00 0.00 ? 23 GLY A CA   8  
ATOM 4436  C C    . GLY A 1 23 ? -18.803 -28.448 20.368  1.00 0.00 ? 23 GLY A C    8  
ATOM 4437  O O    . GLY A 1 23 ? -18.200 -28.331 19.302  1.00 0.00 ? 23 GLY A O    8  
ATOM 4438  H H    . GLY A 1 23 ? -19.235 -27.944 23.450  1.00 0.00 ? 23 GLY A H    8  
ATOM 4439  H HA2  . GLY A 1 23 ? -17.104 -27.865 21.536  1.00 0.00 ? 23 GLY A HA2  8  
ATOM 4440  H HA3  . GLY A 1 23 ? -17.942 -29.318 22.127  1.00 0.00 ? 23 GLY A HA3  8  
ATOM 4441  N N    . GLY A 1 24 ? -20.109 -28.687 20.445  1.00 0.00 ? 24 GLY A N    8  
ATOM 4442  C CA   . GLY A 1 24 ? -20.946 -28.833 19.258  1.00 0.00 ? 24 GLY A CA   8  
ATOM 4443  C C    . GLY A 1 24 ? -21.057 -27.509 18.519  1.00 0.00 ? 24 GLY A C    8  
ATOM 4444  O O    . GLY A 1 24 ? -20.773 -27.421 17.326  1.00 0.00 ? 24 GLY A O    8  
ATOM 4445  H H    . GLY A 1 24 ? -20.547 -28.772 21.351  1.00 0.00 ? 24 GLY A H    8  
ATOM 4446  H HA2  . GLY A 1 24 ? -20.505 -29.578 18.596  1.00 0.00 ? 24 GLY A HA2  8  
ATOM 4447  H HA3  . GLY A 1 24 ? -21.941 -29.161 19.558  1.00 0.00 ? 24 GLY A HA3  8  
ATOM 4448  N N    . TYR A 1 25 ? -21.476 -26.478 19.247  1.00 0.00 ? 25 TYR A N    8  
ATOM 4449  C CA   . TYR A 1 25 ? -21.636 -25.140 18.685  1.00 0.00 ? 25 TYR A CA   8  
ATOM 4450  C C    . TYR A 1 25 ? -20.335 -24.669 18.056  1.00 0.00 ? 25 TYR A C    8  
ATOM 4451  O O    . TYR A 1 25 ? -20.331 -24.042 16.997  1.00 0.00 ? 25 TYR A O    8  
ATOM 4452  C CB   . TYR A 1 25 ? -22.034 -24.145 19.776  1.00 0.00 ? 25 TYR A CB   8  
ATOM 4453  C CG   . TYR A 1 25 ? -22.207 -22.727 19.279  1.00 0.00 ? 25 TYR A CG   8  
ATOM 4454  C CD1  . TYR A 1 25 ? -23.355 -22.348 18.595  1.00 0.00 ? 25 TYR A CD1  8  
ATOM 4455  C CD2  . TYR A 1 25 ? -21.221 -21.773 19.495  1.00 0.00 ? 25 TYR A CD2  8  
ATOM 4456  C CE1  . TYR A 1 25 ? -23.521 -21.055 18.137  1.00 0.00 ? 25 TYR A CE1  8  
ATOM 4457  C CE2  . TYR A 1 25 ? -21.371 -20.475 19.045  1.00 0.00 ? 25 TYR A CE2  8  
ATOM 4458  C CZ   . TYR A 1 25 ? -22.533 -20.121 18.361  1.00 0.00 ? 25 TYR A CZ   8  
ATOM 4459  O OH   . TYR A 1 25 ? -22.696 -18.833 17.906  1.00 0.00 ? 25 TYR A OH   8  
ATOM 4460  H H    . TYR A 1 25 ? -21.696 -26.614 20.224  1.00 0.00 ? 25 TYR A H    8  
ATOM 4461  H HA   . TYR A 1 25 ? -22.416 -25.170 17.924  1.00 0.00 ? 25 TYR A HA   8  
ATOM 4462  H HB2  . TYR A 1 25 ? -22.975 -24.473 20.219  1.00 0.00 ? 25 TYR A HB2  8  
ATOM 4463  H HB3  . TYR A 1 25 ? -21.264 -24.149 20.547  1.00 0.00 ? 25 TYR A HB3  8  
ATOM 4464  H HD1  . TYR A 1 25 ? -24.132 -23.077 18.418  1.00 0.00 ? 25 TYR A HD1  8  
ATOM 4465  H HD2  . TYR A 1 25 ? -20.322 -22.050 20.024  1.00 0.00 ? 25 TYR A HD2  8  
ATOM 4466  H HE1  . TYR A 1 25 ? -24.420 -20.777 17.606  1.00 0.00 ? 25 TYR A HE1  8  
ATOM 4467  H HE2  . TYR A 1 25 ? -20.597 -19.743 19.221  1.00 0.00 ? 25 TYR A HE2  8  
ATOM 4468  H HH   . TYR A 1 25 ? -21.952 -18.263 18.114  1.00 0.00 ? 25 TYR A HH   8  
ATOM 4469  N N    . ILE A 1 26 ? -19.228 -24.978 18.724  1.00 0.00 ? 26 ILE A N    8  
ATOM 4470  C CA   . ILE A 1 26 ? -17.900 -24.598 18.252  1.00 0.00 ? 26 ILE A CA   8  
ATOM 4471  C C    . ILE A 1 26 ? -17.480 -25.473 17.082  1.00 0.00 ? 26 ILE A C    8  
ATOM 4472  O O    . ILE A 1 26 ? -16.967 -24.986 16.076  1.00 0.00 ? 26 ILE A O    8  
ATOM 4473  C CB   . ILE A 1 26 ? -16.842 -24.750 19.361  1.00 0.00 ? 26 ILE A CB   8  
ATOM 4474  C CG1  . ILE A 1 26 ? -17.097 -23.742 20.483  1.00 0.00 ? 26 ILE A CG1  8  
ATOM 4475  C CG2  . ILE A 1 26 ? -15.448 -24.509 18.803  1.00 0.00 ? 26 ILE A CG2  8  
ATOM 4476  C CD1  . ILE A 1 26 ? -16.260 -23.982 21.721  1.00 0.00 ? 26 ILE A CD1  8  
ATOM 4477  H H    . ILE A 1 26 ? -19.297 -25.494 19.589  1.00 0.00 ? 26 ILE A H    8  
ATOM 4478  H HA   . ILE A 1 26 ? -17.934 -23.556 17.931  1.00 0.00 ? 26 ILE A HA   8  
ATOM 4479  H HB   . ILE A 1 26 ? -16.898 -25.760 19.766  1.00 0.00 ? 26 ILE A HB   8  
ATOM 4480  H HG12 . ILE A 1 26 ? -16.875 -22.743 20.106  1.00 0.00 ? 26 ILE A HG12 8  
ATOM 4481  H HG13 . ILE A 1 26 ? -18.149 -23.798 20.764  1.00 0.00 ? 26 ILE A HG13 8  
ATOM 4482  H HG21 . ILE A 1 26 ? -14.708 -24.629 19.594  1.00 0.00 ? 26 ILE A HG21 8  
ATOM 4483  H HG22 . ILE A 1 26 ? -15.248 -25.227 18.008  1.00 0.00 ? 26 ILE A HG22 8  
ATOM 4484  H HG23 . ILE A 1 26 ? -15.388 -23.497 18.402  1.00 0.00 ? 26 ILE A HG23 8  
ATOM 4485  H HD11 . ILE A 1 26 ? -16.483 -23.235 22.484  1.00 0.00 ? 26 ILE A HD11 8  
ATOM 4486  H HD12 . ILE A 1 26 ? -16.480 -24.973 22.117  1.00 0.00 ? 26 ILE A HD12 8  
ATOM 4487  H HD13 . ILE A 1 26 ? -15.204 -23.920 21.459  1.00 0.00 ? 26 ILE A HD13 8  
ATOM 4488  N N    . VAL A 1 27 ? -17.707 -26.775 17.228  1.00 0.00 ? 27 VAL A N    8  
ATOM 4489  C CA   . VAL A 1 27 ? -17.360 -27.748 16.195  1.00 0.00 ? 27 VAL A CA   8  
ATOM 4490  C C    . VAL A 1 27 ? -18.351 -27.677 15.044  1.00 0.00 ? 27 VAL A C    8  
ATOM 4491  O O    . VAL A 1 27 ? -18.008 -27.937 13.892  1.00 0.00 ? 27 VAL A O    8  
ATOM 4492  C CB   . VAL A 1 27 ? -17.376 -29.186 16.746  1.00 0.00 ? 27 VAL A CB   8  
ATOM 4493  C CG1  . VAL A 1 27 ? -18.804 -29.649 16.987  1.00 0.00 ? 27 VAL A CG1  8  
ATOM 4494  C CG2  . VAL A 1 27 ? -16.720 -30.141 15.760  1.00 0.00 ? 27 VAL A CG2  8  
ATOM 4495  H H    . VAL A 1 27 ? -18.134 -27.113 18.079  1.00 0.00 ? 27 VAL A H    8  
ATOM 4496  H HA   . VAL A 1 27 ? -16.361 -27.517 15.827  1.00 0.00 ? 27 VAL A HA   8  
ATOM 4497  H HB   . VAL A 1 27 ? -16.828 -29.208 17.688  1.00 0.00 ? 27 VAL A HB   8  
ATOM 4498  H HG11 . VAL A 1 27 ? -18.802 -30.663 17.385  1.00 0.00 ? 27 VAL A HG11 8  
ATOM 4499  H HG12 . VAL A 1 27 ? -19.286 -28.981 17.702  1.00 0.00 ? 27 VAL A HG12 8  
ATOM 4500  H HG13 . VAL A 1 27 ? -19.355 -29.631 16.046  1.00 0.00 ? 27 VAL A HG13 8  
ATOM 4501  H HG21 . VAL A 1 27 ? -16.729 -31.153 16.164  1.00 0.00 ? 27 VAL A HG21 8  
ATOM 4502  H HG22 . VAL A 1 27 ? -17.269 -30.123 14.818  1.00 0.00 ? 27 VAL A HG22 8  
ATOM 4503  H HG23 . VAL A 1 27 ? -15.690 -29.830 15.586  1.00 0.00 ? 27 VAL A HG23 8  
ATOM 4504  N N    . GLY A 1 28 ? -19.589 -27.319 15.372  1.00 0.00 ? 28 GLY A N    8  
ATOM 4505  C CA   . GLY A 1 28 ? -20.656 -27.205 14.383  1.00 0.00 ? 28 GLY A CA   8  
ATOM 4506  C C    . GLY A 1 28 ? -20.482 -25.942 13.555  1.00 0.00 ? 28 GLY A C    8  
ATOM 4507  O O    . GLY A 1 28 ? -20.967 -25.847 12.429  1.00 0.00 ? 28 GLY A O    8  
ATOM 4508  H H    . GLY A 1 28 ? -19.810 -27.116 16.337  1.00 0.00 ? 28 GLY A H    8  
ATOM 4509  H HA2  . GLY A 1 28 ? -20.630 -28.073 13.724  1.00 0.00 ? 28 GLY A HA2  8  
ATOM 4510  H HA3  . GLY A 1 28 ? -21.618 -27.169 14.895  1.00 0.00 ? 28 GLY A HA3  8  
ATOM 4511  N N    . ALA A 1 29 ? -19.780 -24.970 14.131  1.00 0.00 ? 29 ALA A N    8  
ATOM 4512  C CA   . ALA A 1 29 ? -19.523 -23.695 13.469  1.00 0.00 ? 29 ALA A CA   8  
ATOM 4513  C C    . ALA A 1 29 ? -18.305 -23.800 12.564  1.00 0.00 ? 29 ALA A C    8  
ATOM 4514  O O    . ALA A 1 29 ? -18.233 -23.159 11.517  1.00 0.00 ? 29 ALA A O    8  
ATOM 4515  C CB   . ALA A 1 29 ? -19.266 -22.605 14.499  1.00 0.00 ? 29 ALA A CB   8  
ATOM 4516  H H    . ALA A 1 29 ? -19.408 -25.108 15.060  1.00 0.00 ? 29 ALA A H    8  
ATOM 4517  H HA   . ALA A 1 29 ? -20.395 -23.428 12.872  1.00 0.00 ? 29 ALA A HA   8  
ATOM 4518  H HB1  . ALA A 1 29 ? -19.091 -21.654 13.995  1.00 0.00 ? 29 ALA A HB1  8  
ATOM 4519  H HB2  . ALA A 1 29 ? -20.134 -22.512 15.153  1.00 0.00 ? 29 ALA A HB2  8  
ATOM 4520  H HB3  . ALA A 1 29 ? -18.391 -22.866 15.093  1.00 0.00 ? 29 ALA A HB3  8  
ATOM 4521  N N    . LEU A 1 30 ? -17.347 -24.621 12.985  1.00 0.00 ? 30 LEU A N    8  
ATOM 4522  C CA   . LEU A 1 30 ? -16.115 -24.833 12.230  1.00 0.00 ? 30 LEU A CA   8  
ATOM 4523  C C    . LEU A 1 30 ? -16.430 -25.280 10.812  1.00 0.00 ? 30 LEU A C    8  
ATOM 4524  O O    . LEU A 1 30 ? -15.687 -24.992 9.875   1.00 0.00 ? 30 LEU A O    8  
ATOM 4525  C CB   . LEU A 1 30 ? -15.256 -25.910 12.897  1.00 0.00 ? 30 LEU A CB   8  
ATOM 4526  C CG   . LEU A 1 30 ? -14.609 -25.530 14.230  1.00 0.00 ? 30 LEU A CG   8  
ATOM 4527  C CD1  . LEU A 1 30 ? -13.894 -26.727 14.840  1.00 0.00 ? 30 LEU A CD1  8  
ATOM 4528  C CD2  . LEU A 1 30 ? -13.591 -24.417 14.036  1.00 0.00 ? 30 LEU A CD2  8  
ATOM 4529  H H    . LEU A 1 30 ? -17.466 -25.120 13.855  1.00 0.00 ? 30 LEU A H    8  
ATOM 4530  H HA   . LEU A 1 30 ? -15.559 -23.896 12.199  1.00 0.00 ? 30 LEU A HA   8  
ATOM 4531  H HB2  . LEU A 1 30 ? -15.890 -26.779 13.071  1.00 0.00 ? 30 LEU A HB2  8  
ATOM 4532  H HB3  . LEU A 1 30 ? -14.458 -26.174 12.204  1.00 0.00 ? 30 LEU A HB3  8  
ATOM 4533  H HG   . LEU A 1 30 ? -15.388 -25.189 14.913  1.00 0.00 ? 30 LEU A HG   8  
ATOM 4534  H HD11 . LEU A 1 30 ? -13.447 -26.446 15.794  1.00 0.00 ? 30 LEU A HD11 8  
ATOM 4535  H HD12 . LEU A 1 30 ? -14.611 -27.532 15.001  1.00 0.00 ? 30 LEU A HD12 8  
ATOM 4536  H HD13 . LEU A 1 30 ? -13.113 -27.066 14.161  1.00 0.00 ? 30 LEU A HD13 8  
ATOM 4537  H HD21 . LEU A 1 30 ? -13.146 -24.148 14.994  1.00 0.00 ? 30 LEU A HD21 8  
ATOM 4538  H HD22 . LEU A 1 30 ? -12.809 -24.756 13.358  1.00 0.00 ? 30 LEU A HD22 8  
ATOM 4539  H HD23 . LEU A 1 30 ? -14.087 -23.543 13.612  1.00 0.00 ? 30 LEU A HD23 8  
ATOM 4540  N N    . VAL A 1 31 ? -17.545 -25.990 10.667  1.00 0.00 ? 31 VAL A N    8  
ATOM 4541  C CA   . VAL A 1 31 ? -17.987 -26.493 9.369   1.00 0.00 ? 31 VAL A CA   8  
ATOM 4542  C C    . VAL A 1 31 ? -18.096 -25.356 8.367   1.00 0.00 ? 31 VAL A C    8  
ATOM 4543  O O    . VAL A 1 31 ? -17.818 -25.525 7.181   1.00 0.00 ? 31 VAL A O    8  
ATOM 4544  C CB   . VAL A 1 31 ? -19.366 -27.172 9.467   1.00 0.00 ? 31 VAL A CB   8  
ATOM 4545  C CG1  . VAL A 1 31 ? -19.907 -27.481 8.079   1.00 0.00 ? 31 VAL A CG1  8  
ATOM 4546  C CG2  . VAL A 1 31 ? -19.264 -28.475 10.244  1.00 0.00 ? 31 VAL A CG2  8  
ATOM 4547  H H    . VAL A 1 31 ? -18.114 -26.194 11.476  1.00 0.00 ? 31 VAL A H    8  
ATOM 4548  H HA   . VAL A 1 31 ? -17.256 -27.219 9.014   1.00 0.00 ? 31 VAL A HA   8  
ATOM 4549  H HB   . VAL A 1 31 ? -20.055 -26.500 9.980   1.00 0.00 ? 31 VAL A HB   8  
ATOM 4550  H HG11 . VAL A 1 31 ? -20.886 -27.953 8.161   1.00 0.00 ? 31 VAL A HG11 8  
ATOM 4551  H HG12 . VAL A 1 31 ? -19.999 -26.555 7.511   1.00 0.00 ? 31 VAL A HG12 8  
ATOM 4552  H HG13 . VAL A 1 31 ? -19.223 -28.155 7.565   1.00 0.00 ? 31 VAL A HG13 8  
ATOM 4553  H HG21 . VAL A 1 31 ? -20.247 -28.941 10.314  1.00 0.00 ? 31 VAL A HG21 8  
ATOM 4554  H HG22 . VAL A 1 31 ? -18.580 -29.150 9.731   1.00 0.00 ? 31 VAL A HG22 8  
ATOM 4555  H HG23 . VAL A 1 31 ? -18.889 -28.270 11.247  1.00 0.00 ? 31 VAL A HG23 8  
ATOM 4556  N N    . ILE A 1 32 ? -18.507 -24.192 8.861   1.00 0.00 ? 32 ILE A N    8  
ATOM 4557  C CA   . ILE A 1 32 ? -18.664 -23.002 8.028   1.00 0.00 ? 32 ILE A CA   8  
ATOM 4558  C C    . ILE A 1 32 ? -17.317 -22.548 7.490   1.00 0.00 ? 32 ILE A C    8  
ATOM 4559  O O    . ILE A 1 32 ? -17.189 -22.181 6.323   1.00 0.00 ? 32 ILE A O    8  
ATOM 4560  C CB   . ILE A 1 32 ? -19.275 -21.833 8.823   1.00 0.00 ? 32 ILE A CB   8  
ATOM 4561  C CG1  . ILE A 1 32 ? -20.718 -22.153 9.217   1.00 0.00 ? 32 ILE A CG1  8  
ATOM 4562  C CG2  . ILE A 1 32 ? -19.274 -20.562 7.987   1.00 0.00 ? 32 ILE A CG2  8  
ATOM 4563  C CD1  . ILE A 1 32 ? -21.313 -21.173 10.205  1.00 0.00 ? 32 ILE A CD1  8  
ATOM 4564  H H    . ILE A 1 32 ? -18.720 -24.116 9.846   1.00 0.00 ? 32 ILE A H    8  
ATOM 4565  H HA   . ILE A 1 32 ? -19.322 -23.249 7.195   1.00 0.00 ? 32 ILE A HA   8  
ATOM 4566  H HB   . ILE A 1 32 ? -18.684 -21.671 9.724   1.00 0.00 ? 32 ILE A HB   8  
ATOM 4567  H HG12 . ILE A 1 32 ? -21.331 -22.146 8.315   1.00 0.00 ? 32 ILE A HG12 8  
ATOM 4568  H HG13 . ILE A 1 32 ? -20.741 -23.146 9.664   1.00 0.00 ? 32 ILE A HG13 8  
ATOM 4569  H HG21 . ILE A 1 32 ? -19.700 -19.740 8.563   1.00 0.00 ? 32 ILE A HG21 8  
ATOM 4570  H HG22 . ILE A 1 32 ? -18.251 -20.314 7.706   1.00 0.00 ? 32 ILE A HG22 8  
ATOM 4571  H HG23 . ILE A 1 32 ? -19.870 -20.719 7.088   1.00 0.00 ? 32 ILE A HG23 8  
ATOM 4572  H HD11 . ILE A 1 32 ? -22.340 -21.449 10.447  1.00 0.00 ? 32 ILE A HD11 8  
ATOM 4573  H HD12 . ILE A 1 32 ? -20.718 -21.176 11.118  1.00 0.00 ? 32 ILE A HD12 8  
ATOM 4574  H HD13 . ILE A 1 32 ? -21.306 -20.173 9.770   1.00 0.00 ? 32 ILE A HD13 8  
ATOM 4575  N N    . LEU A 1 33 ? -16.311 -22.578 8.360   1.00 0.00 ? 33 LEU A N    8  
ATOM 4576  C CA   . LEU A 1 33 ? -14.956 -22.172 7.999   1.00 0.00 ? 33 LEU A CA   8  
ATOM 4577  C C    . LEU A 1 33 ? -14.403 -23.075 6.908   1.00 0.00 ? 33 LEU A C    8  
ATOM 4578  O O    . LEU A 1 33 ? -13.861 -22.606 5.908   1.00 0.00 ? 33 LEU A O    8  
ATOM 4579  C CB   . LEU A 1 33 ? -14.030 -22.258 9.214   1.00 0.00 ? 33 LEU A CB   8  
ATOM 4580  C CG   . LEU A 1 33 ? -14.238 -21.201 10.301  1.00 0.00 ? 33 LEU A CG   8  
ATOM 4581  C CD1  . LEU A 1 33 ? -13.343 -21.479 11.499  1.00 0.00 ? 33 LEU A CD1  8  
ATOM 4582  C CD2  . LEU A 1 33 ? -13.907 -19.814 9.772   1.00 0.00 ? 33 LEU A CD2  8  
ATOM 4583  H H    . LEU A 1 33 ? -16.480 -22.890 9.306   1.00 0.00 ? 33 LEU A H    8  
ATOM 4584  H HA   . LEU A 1 33 ? -14.983 -21.143 7.638   1.00 0.00 ? 33 LEU A HA   8  
ATOM 4585  H HB2  . LEU A 1 33 ? -14.173 -23.237 9.671   1.00 0.00 ? 33 LEU A HB2  8  
ATOM 4586  H HB3  . LEU A 1 33 ? -13.005 -22.169 8.857   1.00 0.00 ? 33 LEU A HB3  8  
ATOM 4587  H HG   . LEU A 1 33 ? -15.281 -21.224 10.618  1.00 0.00 ? 33 LEU A HG   8  
ATOM 4588  H HD11 . LEU A 1 33 ? -13.509 -20.725 12.270  1.00 0.00 ? 33 LEU A HD11 8  
ATOM 4589  H HD12 . LEU A 1 33 ? -13.575 -22.464 11.903  1.00 0.00 ? 33 LEU A HD12 8  
ATOM 4590  H HD13 . LEU A 1 33 ? -12.300 -21.451 11.186  1.00 0.00 ? 33 LEU A HD13 8  
ATOM 4591  H HD21 . LEU A 1 33 ? -14.070 -19.070 10.552  1.00 0.00 ? 33 LEU A HD21 8  
ATOM 4592  H HD22 . LEU A 1 33 ? -12.864 -19.785 9.459   1.00 0.00 ? 33 LEU A HD22 8  
ATOM 4593  H HD23 . LEU A 1 33 ? -14.549 -19.589 8.920   1.00 0.00 ? 33 LEU A HD23 8  
ATOM 4594  N N    . ALA A 1 34 ? -14.549 -24.380 7.114   1.00 0.00 ? 34 ALA A N    8  
ATOM 4595  C CA   . ALA A 1 34 ? -14.072 -25.378 6.160   1.00 0.00 ? 34 ALA A CA   8  
ATOM 4596  C C    . ALA A 1 34 ? -14.730 -25.177 4.805   1.00 0.00 ? 34 ALA A C    8  
ATOM 4597  O O    . ALA A 1 34 ? -14.087 -25.286 3.762   1.00 0.00 ? 34 ALA A O    8  
ATOM 4598  C CB   . ALA A 1 34 ? -14.399 -26.780 6.651   1.00 0.00 ? 34 ALA A CB   8  
ATOM 4599  H H    . ALA A 1 34 ? -15.004 -24.703 7.956   1.00 0.00 ? 34 ALA A H    8  
ATOM 4600  H HA   . ALA A 1 34 ? -12.992 -25.274 6.056   1.00 0.00 ? 34 ALA A HA   8  
ATOM 4601  H HB1  . ALA A 1 34 ? -14.026 -27.517 5.940   1.00 0.00 ? 34 ALA A HB1  8  
ATOM 4602  H HB2  . ALA A 1 34 ? -13.929 -26.943 7.621   1.00 0.00 ? 34 ALA A HB2  8  
ATOM 4603  H HB3  . ALA A 1 34 ? -15.480 -26.886 6.749   1.00 0.00 ? 34 ALA A HB3  8  
ATOM 4604  N N    . VAL A 1 35 ? -16.026 -24.882 4.834   1.00 0.00 ? 35 VAL A N    8  
ATOM 4605  C CA   . VAL A 1 35 ? -16.803 -24.659 3.618   1.00 0.00 ? 35 VAL A CA   8  
ATOM 4606  C C    . VAL A 1 35 ? -16.172 -23.562 2.777   1.00 0.00 ? 35 VAL A C    8  
ATOM 4607  O O    . VAL A 1 35 ? -16.059 -23.680 1.558   1.00 0.00 ? 35 VAL A O    8  
ATOM 4608  C CB   . VAL A 1 35 ? -18.248 -24.236 3.941   1.00 0.00 ? 35 VAL A CB   8  
ATOM 4609  C CG1  . VAL A 1 35 ? -18.974 -23.809 2.675   1.00 0.00 ? 35 VAL A CG1  8  
ATOM 4610  C CG2  . VAL A 1 35 ? -19.014 -25.391 4.568   1.00 0.00 ? 35 VAL A CG2  8  
ATOM 4611  H H    . VAL A 1 35 ? -16.500 -24.807 5.723   1.00 0.00 ? 35 VAL A H    8  
ATOM 4612  H HA   . VAL A 1 35 ? -16.822 -25.587 3.047   1.00 0.00 ? 35 VAL A HA   8  
ATOM 4613  H HB   . VAL A 1 35 ? -18.223 -23.400 4.640   1.00 0.00 ? 35 VAL A HB   8  
ATOM 4614  H HG11 . VAL A 1 35 ? -19.992 -23.503 2.917   1.00 0.00 ? 35 VAL A HG11 8  
ATOM 4615  H HG12 . VAL A 1 35 ? -18.445 -22.972 2.219   1.00 0.00 ? 35 VAL A HG12 8  
ATOM 4616  H HG13 . VAL A 1 35 ? -19.005 -24.644 1.976   1.00 0.00 ? 35 VAL A HG13 8  
ATOM 4617  H HG21 . VAL A 1 35 ? -20.032 -25.077 4.800   1.00 0.00 ? 35 VAL A HG21 8  
ATOM 4618  H HG22 . VAL A 1 35 ? -19.045 -26.227 3.870   1.00 0.00 ? 35 VAL A HG22 8  
ATOM 4619  H HG23 . VAL A 1 35 ? -18.514 -25.701 5.485   1.00 0.00 ? 35 VAL A HG23 8  
ATOM 4620  N N    . ALA A 1 36 ? -15.761 -22.489 3.447   1.00 0.00 ? 36 ALA A N    8  
ATOM 4621  C CA   . ALA A 1 36 ? -15.134 -21.348 2.785   1.00 0.00 ? 36 ALA A CA   8  
ATOM 4622  C C    . ALA A 1 36 ? -13.804 -21.754 2.171   1.00 0.00 ? 36 ALA A C    8  
ATOM 4623  O O    . ALA A 1 36 ? -13.507 -21.426 1.023   1.00 0.00 ? 36 ALA A O    8  
ATOM 4624  C CB   . ALA A 1 36 ? -14.882 -20.228 3.783   1.00 0.00 ? 36 ALA A CB   8  
ATOM 4625  H H    . ALA A 1 36 ? -15.883 -22.451 4.449   1.00 0.00 ? 36 ALA A H    8  
ATOM 4626  H HA   . ALA A 1 36 ? -15.800 -20.989 2.000   1.00 0.00 ? 36 ALA A HA   8  
ATOM 4627  H HB1  . ALA A 1 36 ? -14.428 -19.376 3.276   1.00 0.00 ? 36 ALA A HB1  8  
ATOM 4628  H HB2  . ALA A 1 36 ? -15.828 -19.920 4.229   1.00 0.00 ? 36 ALA A HB2  8  
ATOM 4629  H HB3  . ALA A 1 36 ? -14.211 -20.583 4.565   1.00 0.00 ? 36 ALA A HB3  8  
ATOM 4630  N N    . GLY A 1 37 ? -13.006 -22.475 2.953   1.00 0.00 ? 37 GLY A N    8  
ATOM 4631  C CA   . GLY A 1 37 ? -11.695 -22.942 2.512   1.00 0.00 ? 37 GLY A CA   8  
ATOM 4632  C C    . GLY A 1 37 ? -11.801 -23.616 1.153   1.00 0.00 ? 37 GLY A C    8  
ATOM 4633  O O    . GLY A 1 37 ? -11.179 -23.189 0.181   1.00 0.00 ? 37 GLY A O    8  
ATOM 4634  H H    . GLY A 1 37 ? -13.308 -22.713 3.887   1.00 0.00 ? 37 GLY A H    8  
ATOM 4635  H HA2  . GLY A 1 37 ? -11.016 -22.092 2.440   1.00 0.00 ? 37 GLY A HA2  8  
ATOM 4636  H HA3  . GLY A 1 37 ? -11.305 -23.655 3.238   1.00 0.00 ? 37 GLY A HA3  8  
ATOM 4637  N N    . LEU A 1 38 ? -12.599 -24.678 1.099   1.00 0.00 ? 38 LEU A N    8  
ATOM 4638  C CA   . LEU A 1 38 ? -12.808 -25.436 -0.132  1.00 0.00 ? 38 LEU A CA   8  
ATOM 4639  C C    . LEU A 1 38 ? -13.400 -24.545 -1.211  1.00 0.00 ? 38 LEU A C    8  
ATOM 4640  O O    . LEU A 1 38 ? -13.037 -24.638 -2.382  1.00 0.00 ? 38 LEU A O    8  
ATOM 4641  C CB   . LEU A 1 38 ? -13.768 -26.602 0.113   1.00 0.00 ? 38 LEU A CB   8  
ATOM 4642  C CG   . LEU A 1 38 ? -13.227 -27.760 0.954   1.00 0.00 ? 38 LEU A CG   8  
ATOM 4643  C CD1  . LEU A 1 38 ? -14.319 -28.784 1.225   1.00 0.00 ? 38 LEU A CD1  8  
ATOM 4644  C CD2  . LEU A 1 38 ? -12.086 -28.461 0.233   1.00 0.00 ? 38 LEU A CD2  8  
ATOM 4645  H H    . LEU A 1 38 ? -13.083 -24.980 1.933   1.00 0.00 ? 38 LEU A H    8  
ATOM 4646  H HA   . LEU A 1 38 ? -11.848 -25.825 -0.471  1.00 0.00 ? 38 LEU A HA   8  
ATOM 4647  H HB2  . LEU A 1 38 ? -14.649 -26.206 0.620   1.00 0.00 ? 38 LEU A HB2  8  
ATOM 4648  H HB3  . LEU A 1 38 ? -14.058 -27.003 -0.858  1.00 0.00 ? 38 LEU A HB3  8  
ATOM 4649  H HG   . LEU A 1 38 ? -12.863 -27.364 1.902   1.00 0.00 ? 38 LEU A HG   8  
ATOM 4650  H HD11 . LEU A 1 38 ? -13.924 -29.597 1.833   1.00 0.00 ? 38 LEU A HD11 8  
ATOM 4651  H HD12 . LEU A 1 38 ? -15.142 -28.304 1.756   1.00 0.00 ? 38 LEU A HD12 8  
ATOM 4652  H HD13 . LEU A 1 38 ? -14.683 -29.185 0.279   1.00 0.00 ? 38 LEU A HD13 8  
ATOM 4653  H HD21 . LEU A 1 38 ? -11.703 -29.275 0.847   1.00 0.00 ? 38 LEU A HD21 8  
ATOM 4654  H HD22 . LEU A 1 38 ? -12.449 -28.862 -0.713  1.00 0.00 ? 38 LEU A HD22 8  
ATOM 4655  H HD23 . LEU A 1 38 ? -11.286 -27.746 0.042   1.00 0.00 ? 38 LEU A HD23 8  
ATOM 4656  N N    . ILE A 1 39 ? -14.319 -23.677 -0.800  1.00 0.00 ? 39 ILE A N    8  
ATOM 4657  C CA   . ILE A 1 39 ? -14.982 -22.750 -1.713  1.00 0.00 ? 39 ILE A CA   8  
ATOM 4658  C C    . ILE A 1 39 ? -13.962 -21.865 -2.408  1.00 0.00 ? 39 ILE A C    8  
ATOM 4659  O O    . ILE A 1 39 ? -14.031 -21.642 -3.616  1.00 0.00 ? 39 ILE A O    8  
ATOM 4660  C CB   . ILE A 1 39 ? -15.972 -21.835 -0.968  1.00 0.00 ? 39 ILE A CB   8  
ATOM 4661  C CG1  . ILE A 1 39 ? -17.151 -22.650 -0.432  1.00 0.00 ? 39 ILE A CG1  8  
ATOM 4662  C CG2  . ILE A 1 39 ? -16.512 -20.763 -1.902  1.00 0.00 ? 39 ILE A CG2  8  
ATOM 4663  C CD1  . ILE A 1 39 ? -17.951 -23.349 -1.509  1.00 0.00 ? 39 ILE A CD1  8  
ATOM 4664  H H    . ILE A 1 39 ? -14.575 -23.648 0.177   1.00 0.00 ? 39 ILE A H    8  
ATOM 4665  H HA   . ILE A 1 39 ? -15.525 -23.330 -2.459  1.00 0.00 ? 39 ILE A HA   8  
ATOM 4666  H HB   . ILE A 1 39 ? -15.455 -21.359 -0.135  1.00 0.00 ? 39 ILE A HB   8  
ATOM 4667  H HG12 . ILE A 1 39 ? -16.765 -23.404 0.253   1.00 0.00 ? 39 ILE A HG12 8  
ATOM 4668  H HG13 . ILE A 1 39 ? -17.818 -21.976 0.108   1.00 0.00 ? 39 ILE A HG13 8  
ATOM 4669  H HG21 . ILE A 1 39 ? -17.204 -20.116 -1.362  1.00 0.00 ? 39 ILE A HG21 8  
ATOM 4670  H HG22 . ILE A 1 39 ? -15.685 -20.166 -2.285  1.00 0.00 ? 39 ILE A HG22 8  
ATOM 4671  H HG23 . ILE A 1 39 ? -17.035 -21.236 -2.733  1.00 0.00 ? 39 ILE A HG23 8  
ATOM 4672  H HD11 . ILE A 1 39 ? -18.774 -23.912 -1.069  1.00 0.00 ? 39 ILE A HD11 8  
ATOM 4673  H HD12 . ILE A 1 39 ? -18.355 -22.606 -2.197  1.00 0.00 ? 39 ILE A HD12 8  
ATOM 4674  H HD13 . ILE A 1 39 ? -17.301 -24.033 -2.054  1.00 0.00 ? 39 ILE A HD13 8  
ATOM 4675  N N    . TYR A 1 40 ? -13.011 -21.362 -1.626  1.00 0.00 ? 40 TYR A N    8  
ATOM 4676  C CA   . TYR A 1 40 ? -11.956 -20.493 -2.141  1.00 0.00 ? 40 TYR A CA   8  
ATOM 4677  C C    . TYR A 1 40 ? -11.014 -21.275 -3.042  1.00 0.00 ? 40 TYR A C    8  
ATOM 4678  O O    . TYR A 1 40 ? -10.596 -20.794 -4.094  1.00 0.00 ? 40 TYR A O    8  
ATOM 4679  C CB   . TYR A 1 40 ? -11.142 -19.899 -0.990  1.00 0.00 ? 40 TYR A CB   8  
ATOM 4680  C CG   . TYR A 1 40 ? -10.041 -18.963 -1.437  1.00 0.00 ? 40 TYR A CG   8  
ATOM 4681  C CD1  . TYR A 1 40 ? -10.330 -17.662 -1.828  1.00 0.00 ? 40 TYR A CD1  8  
ATOM 4682  C CD2  . TYR A 1 40 ? -8.718  -19.384 -1.467  1.00 0.00 ? 40 TYR A CD2  8  
ATOM 4683  C CE1  . TYR A 1 40 ? -9.331  -16.800 -2.238  1.00 0.00 ? 40 TYR A CE1  8  
ATOM 4684  C CE2  . TYR A 1 40 ? -7.706  -18.536 -1.874  1.00 0.00 ? 40 TYR A CE2  8  
ATOM 4685  C CZ   . TYR A 1 40 ? -8.023  -17.234 -2.261  1.00 0.00 ? 40 TYR A CZ   8  
ATOM 4686  O OH   . TYR A 1 40 ? -7.027  -16.378 -2.669  1.00 0.00 ? 40 TYR A OH   8  
ATOM 4687  H H    . TYR A 1 40 ? -13.010 -21.581 -0.640  1.00 0.00 ? 40 TYR A H    8  
ATOM 4688  H HA   . TYR A 1 40 ? -12.416 -19.685 -2.712  1.00 0.00 ? 40 TYR A HA   8  
ATOM 4689  H HB2  . TYR A 1 40 ? -11.819 -19.349 -0.334  1.00 0.00 ? 40 TYR A HB2  8  
ATOM 4690  H HB3  . TYR A 1 40 ? -10.694 -20.715 -0.425  1.00 0.00 ? 40 TYR A HB3  8  
ATOM 4691  H HD1  . TYR A 1 40 ? -11.354 -17.317 -1.811  1.00 0.00 ? 40 TYR A HD1  8  
ATOM 4692  H HD2  . TYR A 1 40 ? -8.476  -20.392 -1.167  1.00 0.00 ? 40 TYR A HD2  8  
ATOM 4693  H HE1  . TYR A 1 40 ? -9.574  -15.791 -2.539  1.00 0.00 ? 40 TYR A HE1  8  
ATOM 4694  H HE2  . TYR A 1 40 ? -6.682  -18.877 -1.892  1.00 0.00 ? 40 TYR A HE2  8  
ATOM 4695  H HH   . TYR A 1 40 ? -6.155  -16.778 -2.648  1.00 0.00 ? 40 TYR A HH   8  
ATOM 4696  N N    . SER A 1 41 ? -10.685 -22.491 -2.614  1.00 0.00 ? 41 SER A N    8  
ATOM 4697  C CA   . SER A 1 41 ? -9.792  -23.366 -3.365  1.00 0.00 ? 41 SER A CA   8  
ATOM 4698  C C    . SER A 1 41 ? -10.364 -23.657 -4.743  1.00 0.00 ? 41 SER A C    8  
ATOM 4699  O O    . SER A 1 41 ? -9.682  -23.519 -5.757  1.00 0.00 ? 41 SER A O    8  
ATOM 4700  C CB   . SER A 1 41 ? -9.602  -24.695 -2.631  1.00 0.00 ? 41 SER A CB   8  
ATOM 4701  O OG   . SER A 1 41 ? -8.921  -24.506 -1.403  1.00 0.00 ? 41 SER A OG   8  
ATOM 4702  H H    . SER A 1 41 ? -11.062 -22.830 -1.740  1.00 0.00 ? 41 SER A H    8  
ATOM 4703  H HA   . SER A 1 41 ? -8.827  -22.871 -3.471  1.00 0.00 ? 41 SER A HA   8  
ATOM 4704  H HB2  . SER A 1 41 ? -10.580 -25.135 -2.432  1.00 0.00 ? 41 SER A HB2  8  
ATOM 4705  H HB3  . SER A 1 41 ? -9.021  -25.369 -3.259  1.00 0.00 ? 41 SER A HB3  8  
ATOM 4706  H HG   . SER A 1 41 ? -8.819  -25.356 -0.969  1.00 0.00 ? 41 SER A HG   8  
ATOM 4707  N N    . MET A 1 42 ? -11.630 -24.063 -4.765  1.00 0.00 ? 42 MET A N    8  
ATOM 4708  C CA   . MET A 1 42 ? -12.326 -24.381 -6.009  1.00 0.00 ? 42 MET A CA   8  
ATOM 4709  C C    . MET A 1 42 ? -12.450 -23.143 -6.882  1.00 0.00 ? 42 MET A C    8  
ATOM 4710  O O    . MET A 1 42 ? -12.273 -23.202 -8.098  1.00 0.00 ? 42 MET A O    8  
ATOM 4711  C CB   . MET A 1 42 ? -13.732 -24.909 -5.717  1.00 0.00 ? 42 MET A CB   8  
ATOM 4712  C CG   . MET A 1 42 ? -14.501 -25.345 -6.953  1.00 0.00 ? 42 MET A CG   8  
ATOM 4713  S SD   . MET A 1 42 ? -16.139 -25.989 -6.562  1.00 0.00 ? 42 MET A SD   8  
ATOM 4714  C CE   . MET A 1 42 ? -16.983 -24.490 -6.065  1.00 0.00 ? 42 MET A CE   8  
ATOM 4715  H H    . MET A 1 42 ? -12.137 -24.159 -3.897  1.00 0.00 ? 42 MET A H    8  
ATOM 4716  H HA   . MET A 1 42 ? -11.759 -25.143 -6.542  1.00 0.00 ? 42 MET A HA   8  
ATOM 4717  H HB2  . MET A 1 42 ? -13.645 -25.765 -5.048  1.00 0.00 ? 42 MET A HB2  8  
ATOM 4718  H HB3  . MET A 1 42 ? -14.299 -24.119 -5.223  1.00 0.00 ? 42 MET A HB3  8  
ATOM 4719  H HG2  . MET A 1 42 ? -14.610 -24.490 -7.620  1.00 0.00 ? 42 MET A HG2  8  
ATOM 4720  H HG3  . MET A 1 42 ? -13.933 -26.119 -7.467  1.00 0.00 ? 42 MET A HG3  8  
ATOM 4721  H HE1  . MET A 1 42 ? -18.014 -24.716 -5.790  1.00 0.00 ? 42 MET A HE1  8  
ATOM 4722  H HE2  . MET A 1 42 ? -16.470 -24.052 -5.208  1.00 0.00 ? 42 MET A HE2  8  
ATOM 4723  H HE3  . MET A 1 42 ? -16.979 -23.780 -6.892  1.00 0.00 ? 42 MET A HE3  8  
ATOM 4724  N N    . LEU A 1 43 ? -12.759 -22.019 -6.243  1.00 0.00 ? 43 LEU A N    8  
ATOM 4725  C CA   . LEU A 1 43 ? -12.915 -20.744 -6.937  1.00 0.00 ? 43 LEU A CA   8  
ATOM 4726  C C    . LEU A 1 43 ? -11.559 -20.181 -7.328  1.00 0.00 ? 43 LEU A C    8  
ATOM 4727  O O    . LEU A 1 43 ? -11.386 -19.637 -8.417  1.00 0.00 ? 43 LEU A O    8  
ATOM 4728  C CB   . LEU A 1 43 ? -13.619 -19.727 -6.037  1.00 0.00 ? 43 LEU A CB   8  
ATOM 4729  C CG   . LEU A 1 43 ? -15.103 -19.979 -5.760  1.00 0.00 ? 43 LEU A CG   8  
ATOM 4730  C CD1  . LEU A 1 43 ? -15.641 -18.972 -4.756  1.00 0.00 ? 43 LEU A CD1  8  
ATOM 4731  C CD2  . LEU A 1 43 ? -15.917 -19.858 -7.039  1.00 0.00 ? 43 LEU A CD2  8  
ATOM 4732  H H    . LEU A 1 43 ? -12.893 -22.036 -5.242  1.00 0.00 ? 43 LEU A H    8  
ATOM 4733  H HA   . LEU A 1 43 ? -13.513 -20.905 -7.835  1.00 0.00 ? 43 LEU A HA   8  
ATOM 4734  H HB2  . LEU A 1 43 ? -13.100 -19.716 -5.079  1.00 0.00 ? 43 LEU A HB2  8  
ATOM 4735  H HB3  . LEU A 1 43 ? -13.531 -18.748 -6.509  1.00 0.00 ? 43 LEU A HB3  8  
ATOM 4736  H HG   . LEU A 1 43 ? -15.218 -20.984 -5.356  1.00 0.00 ? 43 LEU A HG   8  
ATOM 4737  H HD11 . LEU A 1 43 ? -16.695 -19.169 -4.559  1.00 0.00 ? 43 LEU A HD11 8  
ATOM 4738  H HD12 . LEU A 1 43 ? -15.080 -19.053 -3.825  1.00 0.00 ? 43 LEU A HD12 8  
ATOM 4739  H HD13 . LEU A 1 43 ? -15.532 -17.965 -5.159  1.00 0.00 ? 43 LEU A HD13 8  
ATOM 4740  H HD21 . LEU A 1 43 ? -16.970 -20.051 -6.830  1.00 0.00 ? 43 LEU A HD21 8  
ATOM 4741  H HD22 . LEU A 1 43 ? -15.809 -18.851 -7.443  1.00 0.00 ? 43 LEU A HD22 8  
ATOM 4742  H HD23 . LEU A 1 43 ? -15.556 -20.583 -7.768  1.00 0.00 ? 43 LEU A HD23 8  
ATOM 4743  N N    . ARG A 1 44 ? -10.596 -20.321 -6.422  1.00 0.00 ? 44 ARG A N    8  
ATOM 4744  C CA   . ARG A 1 44 ? -9.238  -19.834 -6.645  1.00 0.00 ? 44 ARG A CA   8  
ATOM 4745  C C    . ARG A 1 44 ? -8.441  -20.835 -7.466  1.00 0.00 ? 44 ARG A C    8  
ATOM 4746  O O    . ARG A 1 44 ? -7.580  -20.464 -8.262  1.00 0.00 ? 44 ARG A O    8  
ATOM 4747  C CB   . ARG A 1 44 ? -8.519  -19.622 -5.311  1.00 0.00 ? 44 ARG A CB   8  
ATOM 4748  C CG   . ARG A 1 44 ? -7.126  -19.028 -5.444  1.00 0.00 ? 44 ARG A CG   8  
ATOM 4749  C CD   . ARG A 1 44 ? -7.182  -17.602 -5.969  1.00 0.00 ? 44 ARG A CD   8  
ATOM 4750  N NE   . ARG A 1 44 ? -5.852  -17.010 -6.088  1.00 0.00 ? 44 ARG A NE   8  
ATOM 4751  C CZ   . ARG A 1 44 ? -5.602  -15.844 -6.673  1.00 0.00 ? 44 ARG A CZ   8  
ATOM 4752  N NH1  . ARG A 1 44 ? -6.596  -15.139 -7.197  1.00 0.00 ? 44 ARG A NH1  8  
ATOM 4753  N NH2  . ARG A 1 44 ? -4.360  -15.384 -6.734  1.00 0.00 ? 44 ARG A NH2  8  
ATOM 4754  H H    . ARG A 1 44 ? -10.801 -20.778 -5.545  1.00 0.00 ? 44 ARG A H    8  
ATOM 4755  H HA   . ARG A 1 44 ? -9.290  -18.886 -7.181  1.00 0.00 ? 44 ARG A HA   8  
ATOM 4756  H HB2  . ARG A 1 44 ? -9.122  -18.949 -4.700  1.00 0.00 ? 44 ARG A HB2  8  
ATOM 4757  H HB3  . ARG A 1 44 ? -8.434  -20.587 -4.811  1.00 0.00 ? 44 ARG A HB3  8  
ATOM 4758  H HG2  . ARG A 1 44 ? -6.646  -19.027 -4.466  1.00 0.00 ? 44 ARG A HG2  8  
ATOM 4759  H HG3  . ARG A 1 44 ? -6.544  -19.638 -6.134  1.00 0.00 ? 44 ARG A HG3  8  
ATOM 4760  H HD2  . ARG A 1 44 ? -7.656  -17.605 -6.951  1.00 0.00 ? 44 ARG A HD2  8  
ATOM 4761  H HD3  . ARG A 1 44 ? -7.778  -16.996 -5.286  1.00 0.00 ? 44 ARG A HD3  8  
ATOM 4762  H HE   . ARG A 1 44 ? -5.080  -17.530 -5.697  1.00 0.00 ? 44 ARG A HE   8  
ATOM 4763  H HH11 . ARG A 1 44 ? -7.543  -15.488 -7.151  1.00 0.00 ? 44 ARG A HH11 8  
ATOM 4764  H HH12 . ARG A 1 44 ? -6.407  -14.252 -7.642  1.00 0.00 ? 44 ARG A HH12 8  
ATOM 4765  H HH21 . ARG A 1 44 ? -3.603  -15.920 -6.335  1.00 0.00 ? 44 ARG A HH21 8  
ATOM 4766  H HH22 . ARG A 1 44 ? -4.171  -14.497 -7.179  1.00 0.00 ? 44 ARG A HH22 8  
ATOM 4767  N N    . LYS A 1 45 ? -8.741  -22.114 -7.260  1.00 0.00 ? 45 LYS A N    8  
ATOM 4768  C CA   . LYS A 1 45 ? -8.067  -23.197 -7.970  1.00 0.00 ? 45 LYS A CA   8  
ATOM 4769  C C    . LYS A 1 45 ? -8.536  -23.260 -9.414  1.00 0.00 ? 45 LYS A C    8  
ATOM 4770  O O    . LYS A 1 45 ? -7.732  -23.371 -10.339 1.00 0.00 ? 45 LYS A O    8  
ATOM 4771  C CB   . LYS A 1 45 ? -8.367  -24.542 -7.305  1.00 0.00 ? 45 LYS A CB   8  
ATOM 4772  C CG   . LYS A 1 45 ? -7.661  -25.724 -7.949  1.00 0.00 ? 45 LYS A CG   8  
ATOM 4773  C CD   . LYS A 1 45 ? -7.959  -27.016 -7.207  1.00 0.00 ? 45 LYS A CD   8  
ATOM 4774  C CE   . LYS A 1 45 ? -7.264  -28.201 -7.859  1.00 0.00 ? 45 LYS A CE   8  
ATOM 4775  N NZ   . LYS A 1 45 ? -7.537  -29.473 -7.135  1.00 0.00 ? 45 LYS A NZ   8  
ATOM 4776  H H    . LYS A 1 45 ? -9.459  -22.355 -6.591  1.00 0.00 ? 45 LYS A H    8  
ATOM 4777  H HA   . LYS A 1 45 ? -6.993  -23.015 -7.946  1.00 0.00 ? 45 LYS A HA   8  
ATOM 4778  H HB2  . LYS A 1 45 ? -8.057  -24.484 -6.262  1.00 0.00 ? 45 LYS A HB2  8  
ATOM 4779  H HB3  . LYS A 1 45 ? -9.442  -24.716 -7.355  1.00 0.00 ? 45 LYS A HB3  8  
ATOM 4780  H HG2  . LYS A 1 45 ? -8.000  -25.820 -8.980  1.00 0.00 ? 45 LYS A HG2  8  
ATOM 4781  H HG3  . LYS A 1 45 ? -6.586  -25.546 -7.935  1.00 0.00 ? 45 LYS A HG3  8  
ATOM 4782  H HD2  . LYS A 1 45 ? -7.612  -26.922 -6.178  1.00 0.00 ? 45 LYS A HD2  8  
ATOM 4783  H HD3  . LYS A 1 45 ? -9.036  -27.188 -7.213  1.00 0.00 ? 45 LYS A HD3  8  
ATOM 4784  H HE2  . LYS A 1 45 ? -7.617  -28.296 -8.886  1.00 0.00 ? 45 LYS A HE2  8  
ATOM 4785  H HE3  . LYS A 1 45 ? -6.189  -28.021 -7.864  1.00 0.00 ? 45 LYS A HE3  8  
ATOM 4786  H HZ1  . LYS A 1 45 ? -7.062  -30.236 -7.594  1.00 0.00 ? 45 LYS A HZ1  8  
ATOM 4787  H HZ2  . LYS A 1 45 ? -7.206  -29.395 -6.184  1.00 0.00 ? 45 LYS A HZ2  8  
ATOM 4788  H HZ3  . LYS A 1 45 ? -8.532  -29.651 -7.132  1.00 0.00 ? 45 LYS A HZ3  8  
ATOM 4789  N N    . ALA A 1 46 ? -9.851  -23.188 -9.595  1.00 0.00 ? 46 ALA A N    8  
ATOM 4790  C CA   . ALA A 1 46 ? -10.460 -23.235 -10.921 1.00 0.00 ? 46 ALA A CA   8  
ATOM 4791  C C    . ALA A 1 46 ? -11.974 -23.128 -10.798 1.00 0.00 ? 46 ALA A C    8  
ATOM 4792  O O    . ALA A 1 46 ? -12.503 -23.021 -9.694  1.00 0.00 ? 46 ALA A O    8  
ATOM 4793  C CB   . ALA A 1 46 ? -10.065 -24.534 -11.616 1.00 0.00 ? 46 ALA A CB   8  
ATOM 4794  H H    . ALA A 1 46 ? -10.460 -23.098 -8.794  1.00 0.00 ? 46 ALA A H    8  
ATOM 4795  H HA   . ALA A 1 46 ? -10.093 -22.393 -11.508 1.00 0.00 ? 46 ALA A HA   8  
ATOM 4796  H HB1  . ALA A 1 46 ? -10.508 -24.561 -12.612 1.00 0.00 ? 46 ALA A HB1  8  
ATOM 4797  H HB2  . ALA A 1 46 ? -8.979  -24.586 -11.699 1.00 0.00 ? 46 ALA A HB2  8  
ATOM 4798  H HB3  . ALA A 1 46 ? -10.426 -25.382 -11.034 1.00 0.00 ? 46 ALA A HB3  8  
ATOM 4799  N N    . GLY A 1 1  ? 9.398   -50.140 50.972  1.00 0.00 ? 1  GLY A N    9  
ATOM 4800  C CA   . GLY A 1 1  ? 9.001   -51.533 51.015  1.00 0.00 ? 1  GLY A CA   9  
ATOM 4801  C C    . GLY A 1 1  ? 8.029   -51.831 49.885  1.00 0.00 ? 1  GLY A C    9  
ATOM 4802  O O    . GLY A 1 1  ? 7.687   -50.951 49.098  1.00 0.00 ? 1  GLY A O    9  
ATOM 4803  H H1   . GLY A 1 1  ? 9.015   -49.550 50.247  1.00 0.00 ? 1  GLY A H1   9  
ATOM 4804  H HA2  . GLY A 1 1  ? 9.883   -52.164 50.909  1.00 0.00 ? 1  GLY A HA2  9  
ATOM 4805  H HA3  . GLY A 1 1  ? 8.520   -51.742 51.970  1.00 0.00 ? 1  GLY A HA3  9  
ATOM 4806  N N    . VAL A 1 2  ? 7.591   -53.086 49.820  1.00 0.00 ? 2  VAL A N    9  
ATOM 4807  C CA   . VAL A 1 2  ? 6.654   -53.533 48.794  1.00 0.00 ? 2  VAL A CA   9  
ATOM 4808  C C    . VAL A 1 2  ? 5.280   -52.924 49.025  1.00 0.00 ? 2  VAL A C    9  
ATOM 4809  O O    . VAL A 1 2  ? 4.626   -52.459 48.093  1.00 0.00 ? 2  VAL A O    9  
ATOM 4810  C CB   . VAL A 1 2  ? 6.499   -55.065 48.800  1.00 0.00 ? 2  VAL A CB   9  
ATOM 4811  C CG1  . VAL A 1 2  ? 5.386   -55.492 47.856  1.00 0.00 ? 2  VAL A CG1  9  
ATOM 4812  C CG2  . VAL A 1 2  ? 7.791   -55.733 48.352  1.00 0.00 ? 2  VAL A CG2  9  
ATOM 4813  H H    . VAL A 1 2  ? 7.911   -53.760 50.499  1.00 0.00 ? 2  VAL A H    9  
ATOM 4814  H HA   . VAL A 1 2  ? 7.031   -53.215 47.822  1.00 0.00 ? 2  VAL A HA   9  
ATOM 4815  H HB   . VAL A 1 2  ? 6.257   -55.390 49.812  1.00 0.00 ? 2  VAL A HB   9  
ATOM 4816  H HG11 . VAL A 1 2  ? 5.280   -56.576 47.875  1.00 0.00 ? 2  VAL A HG11 9  
ATOM 4817  H HG12 . VAL A 1 2  ? 4.448   -55.032 48.170  1.00 0.00 ? 2  VAL A HG12 9  
ATOM 4818  H HG13 . VAL A 1 2  ? 5.627   -55.170 46.843  1.00 0.00 ? 2  VAL A HG13 9  
ATOM 4819  H HG21 . VAL A 1 2  ? 7.672   -56.816 48.369  1.00 0.00 ? 2  VAL A HG21 9  
ATOM 4820  H HG22 . VAL A 1 2  ? 8.032   -55.411 47.339  1.00 0.00 ? 2  VAL A HG22 9  
ATOM 4821  H HG23 . VAL A 1 2  ? 8.598   -55.447 49.026  1.00 0.00 ? 2  VAL A HG23 9  
ATOM 4822  N N    . ILE A 1 3  ? 4.852   -52.934 50.284  1.00 0.00 ? 3  ILE A N    9  
ATOM 4823  C CA   . ILE A 1 3  ? 3.555   -52.386 50.671  1.00 0.00 ? 3  ILE A CA   9  
ATOM 4824  C C    . ILE A 1 3  ? 3.529   -50.881 50.463  1.00 0.00 ? 3  ILE A C    9  
ATOM 4825  O O    . ILE A 1 3  ? 2.530   -50.317 50.019  1.00 0.00 ? 3  ILE A O    9  
ATOM 4826  C CB   . ILE A 1 3  ? 3.244   -52.664 52.154  1.00 0.00 ? 3  ILE A CB   9  
ATOM 4827  C CG1  . ILE A 1 3  ? 3.052   -54.164 52.386  1.00 0.00 ? 3  ILE A CG1  9  
ATOM 4828  C CG2  . ILE A 1 3  ? 1.973   -51.944 52.576  1.00 0.00 ? 3  ILE A CG2  9  
ATOM 4829  C CD1  . ILE A 1 3  ? 2.988   -54.552 53.847  1.00 0.00 ? 3  ILE A CD1  9  
ATOM 4830  H H    . ILE A 1 3  ? 5.436   -53.331 51.006  1.00 0.00 ? 3  ILE A H    9  
ATOM 4831  H HA   . ILE A 1 3  ? 2.787   -52.849 50.052  1.00 0.00 ? 3  ILE A HA   9  
ATOM 4832  H HB   . ILE A 1 3  ? 4.076   -52.309 52.762  1.00 0.00 ? 3  ILE A HB   9  
ATOM 4833  H HG12 . ILE A 1 3  ? 2.121   -54.469 51.908  1.00 0.00 ? 3  ILE A HG12 9  
ATOM 4834  H HG13 . ILE A 1 3  ? 3.887   -54.692 51.927  1.00 0.00 ? 3  ILE A HG13 9  
ATOM 4835  H HG21 . ILE A 1 3  ? 1.769   -52.140 53.629  1.00 0.00 ? 3  ILE A HG21 9  
ATOM 4836  H HG22 . ILE A 1 3  ? 2.097   -50.871 52.426  1.00 0.00 ? 3  ILE A HG22 9  
ATOM 4837  H HG23 . ILE A 1 3  ? 1.137   -52.300 51.974  1.00 0.00 ? 3  ILE A HG23 9  
ATOM 4838  H HD11 . ILE A 1 3  ? 2.849   -55.628 53.951  1.00 0.00 ? 3  ILE A HD11 9  
ATOM 4839  H HD12 . ILE A 1 3  ? 3.917   -54.262 54.338  1.00 0.00 ? 3  ILE A HD12 9  
ATOM 4840  H HD13 . ILE A 1 3  ? 2.151   -54.037 54.320  1.00 0.00 ? 3  ILE A HD13 9  
ATOM 4841  N N    . ASP A 1 4  ? 4.645   -50.236 50.791  1.00 0.00 ? 4  ASP A N    9  
ATOM 4842  C CA   . ASP A 1 4  ? 4.780   -48.790 50.651  1.00 0.00 ? 4  ASP A CA   9  
ATOM 4843  C C    . ASP A 1 4  ? 4.396   -48.353 49.246  1.00 0.00 ? 4  ASP A C    9  
ATOM 4844  O O    . ASP A 1 4  ? 3.739   -47.331 49.055  1.00 0.00 ? 4  ASP A O    9  
ATOM 4845  C CB   . ASP A 1 4  ? 6.224   -48.359 50.914  1.00 0.00 ? 4  ASP A CB   9  
ATOM 4846  C CG   . ASP A 1 4  ? 6.608   -48.469 52.376  1.00 0.00 ? 4  ASP A CG   9  
ATOM 4847  O OD1  . ASP A 1 4  ? 7.711   -48.007 52.737  1.00 0.00 ? 4  ASP A OD1  9  
ATOM 4848  O OD2  . ASP A 1 4  ? 5.806   -49.018 53.161  1.00 0.00 ? 4  ASP A OD2  9  
ATOM 4849  H H    . ASP A 1 4  ? 5.432   -50.755 51.151  1.00 0.00 ? 4  ASP A H    9  
ATOM 4850  H HA   . ASP A 1 4  ? 4.122   -48.305 51.373  1.00 0.00 ? 4  ASP A HA   9  
ATOM 4851  H HB2  . ASP A 1 4  ? 6.890   -48.991 50.328  1.00 0.00 ? 4  ASP A HB2  9  
ATOM 4852  H HB3  . ASP A 1 4  ? 6.343   -47.322 50.598  1.00 0.00 ? 4  ASP A HB3  9  
ATOM 4853  H HD2  . ASP A 1 4  ? 6.112   -49.053 54.070  1.00 0.00 ? 4  ASP A HD2  9  
ATOM 4854  N N    . THR A 1 5  ? 4.817   -49.144 48.263  1.00 0.00 ? 5  THR A N    9  
ATOM 4855  C CA   . THR A 1 5  ? 4.533   -48.863 46.859  1.00 0.00 ? 5  THR A CA   9  
ATOM 4856  C C    . THR A 1 5  ? 3.290   -49.614 46.408  1.00 0.00 ? 5  THR A C    9  
ATOM 4857  O O    . THR A 1 5  ? 2.859   -49.501 45.262  1.00 0.00 ? 5  THR A O    9  
ATOM 4858  C CB   . THR A 1 5  ? 5.701   -49.290 45.950  1.00 0.00 ? 5  THR A CB   9  
ATOM 4859  O OG1  . THR A 1 5  ? 5.908   -50.703 46.066  1.00 0.00 ? 5  THR A OG1  9  
ATOM 4860  C CG2  . THR A 1 5  ? 6.979   -48.571 46.353  1.00 0.00 ? 5  THR A CG2  9  
ATOM 4861  H H    . THR A 1 5  ? 5.352   -49.971 48.485  1.00 0.00 ? 5  THR A H    9  
ATOM 4862  H HA   . THR A 1 5  ? 4.368   -47.791 46.749  1.00 0.00 ? 5  THR A HA   9  
ATOM 4863  H HB   . THR A 1 5  ? 5.458   -49.042 44.917  1.00 0.00 ? 5  THR A HB   9  
ATOM 4864  H HG1  . THR A 1 5  ? 6.632   -50.954 45.489  1.00 0.00 ? 5  THR A HG1  9  
ATOM 4865  H HG21 . THR A 1 5  ? 7.796   -48.880 45.702  1.00 0.00 ? 5  THR A HG21 9  
ATOM 4866  H HG22 . THR A 1 5  ? 6.832   -47.494 46.264  1.00 0.00 ? 5  THR A HG22 9  
ATOM 4867  H HG23 . THR A 1 5  ? 7.224   -48.819 47.386  1.00 0.00 ? 5  THR A HG23 9  
ATOM 4868  N N    . SER A 1 6  ? 2.719   -50.385 47.329  1.00 0.00 ? 6  SER A N    9  
ATOM 4869  C CA   . SER A 1 6  ? 1.519   -51.171 47.053  1.00 0.00 ? 6  SER A CA   9  
ATOM 4870  C C    . SER A 1 6  ? 0.461   -50.310 46.381  1.00 0.00 ? 6  SER A C    9  
ATOM 4871  O O    . SER A 1 6  ? 0.029   -50.589 45.264  1.00 0.00 ? 6  SER A O    9  
ATOM 4872  C CB   . SER A 1 6  ? 0.934   -51.730 48.352  1.00 0.00 ? 6  SER A CB   9  
ATOM 4873  O OG   . SER A 1 6  ? -0.237  -52.487 48.099  1.00 0.00 ? 6  SER A OG   9  
ATOM 4874  H H    . SER A 1 6  ? 3.120   -50.435 48.255  1.00 0.00 ? 6  SER A H    9  
ATOM 4875  H HA   . SER A 1 6  ? 1.785   -51.996 46.393  1.00 0.00 ? 6  SER A HA   9  
ATOM 4876  H HB2  . SER A 1 6  ? 1.675   -52.370 48.830  1.00 0.00 ? 6  SER A HB2  9  
ATOM 4877  H HB3  . SER A 1 6  ? 0.685   -50.902 49.016  1.00 0.00 ? 6  SER A HB3  9  
ATOM 4878  H HG   . SER A 1 6  ? -0.578  -52.822 48.932  1.00 0.00 ? 6  SER A HG   9  
ATOM 4879  N N    . ALA A 1 7  ? 0.050   -49.256 47.080  1.00 0.00 ? 7  ALA A N    9  
ATOM 4880  C CA   . ALA A 1 7  ? -0.961  -48.331 46.574  1.00 0.00 ? 7  ALA A CA   9  
ATOM 4881  C C    . ALA A 1 7  ? -0.494  -47.689 45.277  1.00 0.00 ? 7  ALA A C    9  
ATOM 4882  O O    . ALA A 1 7  ? -1.265  -47.533 44.331  1.00 0.00 ? 7  ALA A O    9  
ATOM 4883  C CB   . ALA A 1 7  ? -1.227  -47.229 47.589  1.00 0.00 ? 7  ALA A CB   9  
ATOM 4884  H H    . ALA A 1 7  ? 0.443   -49.080 47.994  1.00 0.00 ? 7  ALA A H    9  
ATOM 4885  H HA   . ALA A 1 7  ? -1.883  -48.884 46.392  1.00 0.00 ? 7  ALA A HA   9  
ATOM 4886  H HB1  . ALA A 1 7  ? -1.993  -46.553 47.208  1.00 0.00 ? 7  ALA A HB1  9  
ATOM 4887  H HB2  . ALA A 1 7  ? -1.570  -47.672 48.524  1.00 0.00 ? 7  ALA A HB2  9  
ATOM 4888  H HB3  . ALA A 1 7  ? -0.308  -46.670 47.767  1.00 0.00 ? 7  ALA A HB3  9  
ATOM 4889  N N    . VAL A 1 8  ? 0.783   -47.320 45.246  1.00 0.00 ? 8  VAL A N    9  
ATOM 4890  C CA   . VAL A 1 8  ? 1.385   -46.691 44.074  1.00 0.00 ? 8  VAL A CA   9  
ATOM 4891  C C    . VAL A 1 8  ? 1.359   -47.640 42.888  1.00 0.00 ? 8  VAL A C    9  
ATOM 4892  O O    . VAL A 1 8  ? 1.073   -47.241 41.760  1.00 0.00 ? 8  VAL A O    9  
ATOM 4893  C CB   . VAL A 1 8  ? 2.851   -46.299 44.334  1.00 0.00 ? 8  VAL A CB   9  
ATOM 4894  C CG1  . VAL A 1 8  ? 3.517   -45.841 43.046  1.00 0.00 ? 8  VAL A CG1  9  
ATOM 4895  C CG2  . VAL A 1 8  ? 2.928   -45.165 45.345  1.00 0.00 ? 8  VAL A CG2  9  
ATOM 4896  H H    . VAL A 1 8  ? 1.365   -47.475 46.056  1.00 0.00 ? 8  VAL A H    9  
ATOM 4897  H HA   . VAL A 1 8  ? 0.813   -45.795 43.833  1.00 0.00 ? 8  VAL A HA   9  
ATOM 4898  H HB   . VAL A 1 8  ? 3.383   -47.166 44.725  1.00 0.00 ? 8  VAL A HB   9  
ATOM 4899  H HG11 . VAL A 1 8  ? 4.555   -45.574 43.241  1.00 0.00 ? 8  VAL A HG11 9  
ATOM 4900  H HG12 . VAL A 1 8  ? 3.482   -46.647 42.314  1.00 0.00 ? 8  VAL A HG12 9  
ATOM 4901  H HG13 . VAL A 1 8  ? 2.988   -44.971 42.654  1.00 0.00 ? 8  VAL A HG13 9  
ATOM 4902  H HG21 . VAL A 1 8  ? 3.970   -44.902 45.528  1.00 0.00 ? 8  VAL A HG21 9  
ATOM 4903  H HG22 . VAL A 1 8  ? 2.399   -44.295 44.955  1.00 0.00 ? 8  VAL A HG22 9  
ATOM 4904  H HG23 . VAL A 1 8  ? 2.465   -45.481 46.280  1.00 0.00 ? 8  VAL A HG23 9  
ATOM 4905  N N    . GLU A 1 9  ? 1.663   -48.907 43.158  1.00 0.00 ? 9  GLU A N    9  
ATOM 4906  C CA   . GLU A 1 9  ? 1.682   -49.942 42.128  1.00 0.00 ? 9  GLU A CA   9  
ATOM 4907  C C    . GLU A 1 9  ? 0.334   -50.024 41.431  1.00 0.00 ? 9  GLU A C    9  
ATOM 4908  O O    . GLU A 1 9  ? 0.255   -50.211 40.218  1.00 0.00 ? 9  GLU A O    9  
ATOM 4909  C CB   . GLU A 1 9  ? 1.991   -51.307 42.746  1.00 0.00 ? 9  GLU A CB   9  
ATOM 4910  C CG   . GLU A 1 9  ? 2.099   -52.436 41.734  1.00 0.00 ? 9  GLU A CG   9  
ATOM 4911  C CD   . GLU A 1 9  ? 2.456   -53.762 42.377  1.00 0.00 ? 9  GLU A CD   9  
ATOM 4912  O OE1  . GLU A 1 9  ? 2.616   -53.798 43.615  1.00 0.00 ? 9  GLU A OE1  9  
ATOM 4913  O OE2  . GLU A 1 9  ? 2.575   -54.765 41.642  1.00 0.00 ? 9  GLU A OE2  9  
ATOM 4914  H H    . GLU A 1 9  ? 1.889   -49.173 44.106  1.00 0.00 ? 9  GLU A H    9  
ATOM 4915  H HA   . GLU A 1 9  ? 2.452   -49.695 41.398  1.00 0.00 ? 9  GLU A HA   9  
ATOM 4916  H HB2  . GLU A 1 9  ? 2.938   -51.234 43.280  1.00 0.00 ? 9  GLU A HB2  9  
ATOM 4917  H HB3  . GLU A 1 9  ? 1.195   -51.552 43.449  1.00 0.00 ? 9  GLU A HB3  9  
ATOM 4918  H HG2  . GLU A 1 9  ? 1.142   -52.541 41.223  1.00 0.00 ? 9  GLU A HG2  9  
ATOM 4919  H HG3  . GLU A 1 9  ? 2.868   -52.181 41.006  1.00 0.00 ? 9  GLU A HG3  9  
ATOM 4920  H HE2  . GLU A 1 9  ? 2.801   -55.569 42.114  1.00 0.00 ? 9  GLU A HE2  9  
ATOM 4921  N N    . SER A 1 10 ? -0.729  -49.882 42.217  1.00 0.00 ? 10 SER A N    9  
ATOM 4922  C CA   . SER A 1 10 ? -2.093  -49.936 41.701  1.00 0.00 ? 10 SER A CA   9  
ATOM 4923  C C    . SER A 1 10 ? -2.490  -48.597 41.100  1.00 0.00 ? 10 SER A C    9  
ATOM 4924  O O    . SER A 1 10 ? -3.017  -48.529 39.991  1.00 0.00 ? 10 SER A O    9  
ATOM 4925  C CB   . SER A 1 10 ? -3.077  -50.272 42.823  1.00 0.00 ? 10 SER A CB   9  
ATOM 4926  O OG   . SER A 1 10 ? -2.829  -51.565 43.349  1.00 0.00 ? 10 SER A OG   9  
ATOM 4927  H H    . SER A 1 10 ? -0.600  -49.730 43.207  1.00 0.00 ? 10 SER A H    9  
ATOM 4928  H HA   . SER A 1 10 ? -2.146  -50.707 40.932  1.00 0.00 ? 10 SER A HA   9  
ATOM 4929  H HB2  . SER A 1 10 ? -2.972  -49.537 43.621  1.00 0.00 ? 10 SER A HB2  9  
ATOM 4930  H HB3  . SER A 1 10 ? -4.093  -50.237 42.429  1.00 0.00 ? 10 SER A HB3  9  
ATOM 4931  H HG   . SER A 1 10 ? -3.462  -51.743 44.049  1.00 0.00 ? 10 SER A HG   9  
ATOM 4932  N N    . ALA A 1 11 ? -2.227  -47.530 41.851  1.00 0.00 ? 11 ALA A N    9  
ATOM 4933  C CA   . ALA A 1 11 ? -2.546  -46.174 41.416  1.00 0.00 ? 11 ALA A CA   9  
ATOM 4934  C C    . ALA A 1 11 ? -1.694  -45.783 40.220  1.00 0.00 ? 11 ALA A C    9  
ATOM 4935  O O    . ALA A 1 11 ? -2.163  -45.128 39.291  1.00 0.00 ? 11 ALA A O    9  
ATOM 4936  C CB   . ALA A 1 11 ? -2.284  -45.182 42.539  1.00 0.00 ? 11 ALA A CB   9  
ATOM 4937  H H    . ALA A 1 11 ? -1.793  -47.651 42.755  1.00 0.00 ? 11 ALA A H    9  
ATOM 4938  H HA   . ALA A 1 11 ? -3.600  -46.134 41.138  1.00 0.00 ? 11 ALA A HA   9  
ATOM 4939  H HB1  . ALA A 1 11 ? -2.540  -44.174 42.210  1.00 0.00 ? 11 ALA A HB1  9  
ATOM 4940  H HB2  . ALA A 1 11 ? -2.894  -45.444 43.404  1.00 0.00 ? 11 ALA A HB2  9  
ATOM 4941  H HB3  . ALA A 1 11 ? -1.230  -45.215 42.814  1.00 0.00 ? 11 ALA A HB3  9  
ATOM 4942  N N    . ILE A 1 12 ? -0.430  -46.195 40.256  1.00 0.00 ? 12 ILE A N    9  
ATOM 4943  C CA   . ILE A 1 12 ? 0.517   -45.903 39.185  1.00 0.00 ? 12 ILE A CA   9  
ATOM 4944  C C    . ILE A 1 12 ? 0.123   -46.633 37.912  1.00 0.00 ? 12 ILE A C    9  
ATOM 4945  O O    . ILE A 1 12 ? 0.118   -46.059 36.824  1.00 0.00 ? 12 ILE A O    9  
ATOM 4946  C CB   . ILE A 1 12 ? 1.945   -46.341 39.559  1.00 0.00 ? 12 ILE A CB   9  
ATOM 4947  C CG1  . ILE A 1 12 ? 2.478   -45.492 40.715  1.00 0.00 ? 12 ILE A CG1  9  
ATOM 4948  C CG2  . ILE A 1 12 ? 2.880   -46.180 38.371  1.00 0.00 ? 12 ILE A CG2  9  
ATOM 4949  C CD1  . ILE A 1 12 ? 2.559   -44.015 40.400  1.00 0.00 ? 12 ILE A CD1  9  
ATOM 4950  H H    . ILE A 1 12 ? -0.104  -46.730 41.048  1.00 0.00 ? 12 ILE A H    9  
ATOM 4951  H HA   . ILE A 1 12 ? 0.509   -44.828 39.003  1.00 0.00 ? 12 ILE A HA   9  
ATOM 4952  H HB   . ILE A 1 12 ? 1.924   -47.388 39.861  1.00 0.00 ? 12 ILE A HB   9  
ATOM 4953  H HG12 . ILE A 1 12 ? 1.818   -45.624 41.572  1.00 0.00 ? 12 ILE A HG12 9  
ATOM 4954  H HG13 . ILE A 1 12 ? 3.477   -45.844 40.968  1.00 0.00 ? 12 ILE A HG13 9  
ATOM 4955  H HG21 . ILE A 1 12 ? 3.884   -46.502 38.645  1.00 0.00 ? 12 ILE A HG21 9  
ATOM 4956  H HG22 . ILE A 1 12 ? 2.519   -46.787 37.541  1.00 0.00 ? 12 ILE A HG22 9  
ATOM 4957  H HG23 . ILE A 1 12 ? 2.906   -45.132 38.070  1.00 0.00 ? 12 ILE A HG23 9  
ATOM 4958  H HD11 . ILE A 1 12 ? 2.942   -43.461 41.257  1.00 0.00 ? 12 ILE A HD11 9  
ATOM 4959  H HD12 . ILE A 1 12 ? 3.225   -43.864 39.550  1.00 0.00 ? 12 ILE A HD12 9  
ATOM 4960  H HD13 . ILE A 1 12 ? 1.564   -43.644 40.152  1.00 0.00 ? 12 ILE A HD13 9  
ATOM 4961  N N    . THR A 1 13 ? -0.208  -47.913 38.063  1.00 0.00 ? 13 THR A N    9  
ATOM 4962  C CA   . THR A 1 13 ? -0.610  -48.753 36.938  1.00 0.00 ? 13 THR A CA   9  
ATOM 4963  C C    . THR A 1 13 ? -1.908  -48.246 36.332  1.00 0.00 ? 13 THR A C    9  
ATOM 4964  O O    . THR A 1 13 ? -2.064  -48.194 35.113  1.00 0.00 ? 13 THR A O    9  
ATOM 4965  C CB   . THR A 1 13 ? -0.830  -50.213 37.374  1.00 0.00 ? 13 THR A CB   9  
ATOM 4966  O OG1  . THR A 1 13 ? 0.396   -50.754 37.881  1.00 0.00 ? 13 THR A OG1  9  
ATOM 4967  C CG2  . THR A 1 13 ? -1.290  -51.058 36.196  1.00 0.00 ? 13 THR A CG2  9  
ATOM 4968  H H    . THR A 1 13 ? -0.185  -48.328 38.984  1.00 0.00 ? 13 THR A H    9  
ATOM 4969  H HA   . THR A 1 13 ? 0.177   -48.720 36.185  1.00 0.00 ? 13 THR A HA   9  
ATOM 4970  H HB   . THR A 1 13 ? -1.590  -50.241 38.155  1.00 0.00 ? 13 THR A HB   9  
ATOM 4971  H HG1  . THR A 1 13 ? 0.240   -51.660 38.156  1.00 0.00 ? 13 THR A HG1  9  
ATOM 4972  H HG21 . THR A 1 13 ? -1.445  -52.087 36.518  1.00 0.00 ? 13 THR A HG21 9  
ATOM 4973  H HG22 . THR A 1 13 ? -2.226  -50.657 35.807  1.00 0.00 ? 13 THR A HG22 9  
ATOM 4974  H HG23 . THR A 1 13 ? -0.531  -51.033 35.414  1.00 0.00 ? 13 THR A HG23 9  
ATOM 4975  N N    . ASP A 1 14 ? -2.842  -47.871 37.203  1.00 0.00 ? 14 ASP A N    9  
ATOM 4976  C CA   . ASP A 1 14 ? -4.143  -47.361 36.781  1.00 0.00 ? 14 ASP A CA   9  
ATOM 4977  C C    . ASP A 1 14 ? -3.993  -46.002 36.120  1.00 0.00 ? 14 ASP A C    9  
ATOM 4978  O O    . ASP A 1 14 ? -4.508  -45.765 35.028  1.00 0.00 ? 14 ASP A O    9  
ATOM 4979  C CB   . ASP A 1 14 ? -5.076  -47.213 37.984  1.00 0.00 ? 14 ASP A CB   9  
ATOM 4980  C CG   . ASP A 1 14 ? -5.534  -48.549 38.535  1.00 0.00 ? 14 ASP A CG   9  
ATOM 4981  O OD1  . ASP A 1 14 ? -6.405  -48.556 39.430  1.00 0.00 ? 14 ASP A OD1  9  
ATOM 4982  O OD2  . ASP A 1 14 ? -5.021  -49.590 38.071  1.00 0.00 ? 14 ASP A OD2  9  
ATOM 4983  H H    . ASP A 1 14 ? -2.655  -47.938 38.193  1.00 0.00 ? 14 ASP A H    9  
ATOM 4984  H HA   . ASP A 1 14 ? -4.580  -48.062 36.070  1.00 0.00 ? 14 ASP A HA   9  
ATOM 4985  H HB2  . ASP A 1 14 ? -4.551  -46.671 38.771  1.00 0.00 ? 14 ASP A HB2  9  
ATOM 4986  H HB3  . ASP A 1 14 ? -5.953  -46.641 37.679  1.00 0.00 ? 14 ASP A HB3  9  
ATOM 4987  H HD2  . ASP A 1 14 ? -5.357  -50.398 38.465  1.00 0.00 ? 14 ASP A HD2  9  
ATOM 4988  N N    . GLY A 1 15 ? -3.279  -45.108 36.798  1.00 0.00 ? 15 GLY A N    9  
ATOM 4989  C CA   . GLY A 1 15 ? -3.042  -43.757 36.298  1.00 0.00 ? 15 GLY A CA   9  
ATOM 4990  C C    . GLY A 1 15 ? -1.876  -43.746 35.323  1.00 0.00 ? 15 GLY A C    9  
ATOM 4991  O O    . GLY A 1 15 ? -2.048  -43.516 34.127  1.00 0.00 ? 15 GLY A O    9  
ATOM 4992  H H    . GLY A 1 15 ? -2.883  -45.362 37.691  1.00 0.00 ? 15 GLY A H    9  
ATOM 4993  H HA2  . GLY A 1 15 ? -3.938  -43.399 35.791  1.00 0.00 ? 15 GLY A HA2  9  
ATOM 4994  H HA3  . GLY A 1 15 ? -2.816  -43.098 37.136  1.00 0.00 ? 15 GLY A HA3  9  
ATOM 4995  N N    . GLN A 1 16 ? -0.682  -43.998 35.852  1.00 0.00 ? 16 GLN A N    9  
ATOM 4996  C CA   . GLN A 1 16 ? 0.537   -44.024 35.050  1.00 0.00 ? 16 GLN A CA   9  
ATOM 4997  C C    . GLN A 1 16 ? 0.340   -44.882 33.810  1.00 0.00 ? 16 GLN A C    9  
ATOM 4998  O O    . GLN A 1 16 ? 0.562   -44.435 32.686  1.00 0.00 ? 16 GLN A O    9  
ATOM 4999  C CB   . GLN A 1 16 ? 1.699   -44.603 35.860  1.00 0.00 ? 16 GLN A CB   9  
ATOM 5000  C CG   . GLN A 1 16 ? 3.023   -44.628 35.114  1.00 0.00 ? 16 GLN A CG   9  
ATOM 5001  C CD   . GLN A 1 16 ? 3.534   -43.239 34.786  1.00 0.00 ? 16 GLN A CD   9  
ATOM 5002  O OE1  . GLN A 1 16 ? 3.683   -42.397 35.672  1.00 0.00 ? 16 GLN A OE1  9  
ATOM 5003  N NE2  . GLN A 1 16 ? 3.802   -42.995 33.509  1.00 0.00 ? 16 GLN A NE2  9  
ATOM 5004  H H    . GLN A 1 16 ? -0.605  -44.178 36.843  1.00 0.00 ? 16 GLN A H    9  
ATOM 5005  H HA   . GLN A 1 16 ? 0.779   -43.004 34.750  1.00 0.00 ? 16 GLN A HA   9  
ATOM 5006  H HB2  . GLN A 1 16 ? 1.824   -43.999 36.759  1.00 0.00 ? 16 GLN A HB2  9  
ATOM 5007  H HB3  . GLN A 1 16 ? 1.444   -45.625 36.141  1.00 0.00 ? 16 GLN A HB3  9  
ATOM 5008  H HG2  . GLN A 1 16 ? 3.763   -45.136 35.731  1.00 0.00 ? 16 GLN A HG2  9  
ATOM 5009  H HG3  . GLN A 1 16 ? 2.890   -45.181 34.184  1.00 0.00 ? 16 GLN A HG3  9  
ATOM 5010  H HE21 . GLN A 1 16 ? 3.662   -43.718 32.818  1.00 0.00 ? 16 GLN A HE21 9  
ATOM 5011  H HE22 . GLN A 1 16 ? 4.144   -42.086 33.231  1.00 0.00 ? 16 GLN A HE22 9  
ATOM 5012  N N    . GLY A 1 17 ? -0.081  -46.124 34.032  1.00 0.00 ? 17 GLY A N    9  
ATOM 5013  C CA   . GLY A 1 17 ? -0.318  -47.072 32.947  1.00 0.00 ? 17 GLY A CA   9  
ATOM 5014  C C    . GLY A 1 17 ? -1.213  -46.453 31.885  1.00 0.00 ? 17 GLY A C    9  
ATOM 5015  O O    . GLY A 1 17 ? -0.930  -46.531 30.691  1.00 0.00 ? 17 GLY A O    9  
ATOM 5016  H H    . GLY A 1 17 ? -0.246  -46.432 34.980  1.00 0.00 ? 17 GLY A H    9  
ATOM 5017  H HA2  . GLY A 1 17 ? 0.635   -47.348 32.497  1.00 0.00 ? 17 GLY A HA2  9  
ATOM 5018  H HA3  . GLY A 1 17 ? -0.800  -47.963 33.348  1.00 0.00 ? 17 GLY A HA3  9  
ATOM 5019  N N    . ASP A 1 18 ? -2.300  -45.835 32.338  1.00 0.00 ? 18 ASP A N    9  
ATOM 5020  C CA   . ASP A 1 18 ? -3.259  -45.190 31.446  1.00 0.00 ? 18 ASP A CA   9  
ATOM 5021  C C    . ASP A 1 18 ? -2.562  -44.164 30.567  1.00 0.00 ? 18 ASP A C    9  
ATOM 5022  O O    . ASP A 1 18 ? -3.116  -43.696 29.574  1.00 0.00 ? 18 ASP A O    9  
ATOM 5023  C CB   . ASP A 1 18 ? -4.346  -44.477 32.253  1.00 0.00 ? 18 ASP A CB   9  
ATOM 5024  C CG   . ASP A 1 18 ? -5.285  -45.443 32.947  1.00 0.00 ? 18 ASP A CG   9  
ATOM 5025  O OD1  . ASP A 1 18 ? -6.499  -45.155 33.001  1.00 0.00 ? 18 ASP A OD1  9  
ATOM 5026  O OD2  . ASP A 1 18 ? -4.808  -46.489 33.435  1.00 0.00 ? 18 ASP A OD2  9  
ATOM 5027  H H    . ASP A 1 18 ? -2.479  -45.805 33.332  1.00 0.00 ? 18 ASP A H    9  
ATOM 5028  H HA   . ASP A 1 18 ? -3.719  -45.952 30.817  1.00 0.00 ? 18 ASP A HA   9  
ATOM 5029  H HB2  . ASP A 1 18 ? -3.869  -43.850 33.006  1.00 0.00 ? 18 ASP A HB2  9  
ATOM 5030  H HB3  . ASP A 1 18 ? -4.928  -43.847 31.579  1.00 0.00 ? 18 ASP A HB3  9  
ATOM 5031  H HD2  . ASP A 1 18 ? -5.459  -47.054 33.858  1.00 0.00 ? 18 ASP A HD2  9  
ATOM 5032  N N    . MET A 1 19 ? -1.335  -43.821 30.946  1.00 0.00 ? 19 MET A N    9  
ATOM 5033  C CA   . MET A 1 19 ? -0.533  -42.849 30.209  1.00 0.00 ? 19 MET A CA   9  
ATOM 5034  C C    . MET A 1 19 ? -0.209  -43.372 28.819  1.00 0.00 ? 19 MET A C    9  
ATOM 5035  O O    . MET A 1 19 ? -0.275  -42.640 27.833  1.00 0.00 ? 19 MET A O    9  
ATOM 5036  C CB   . MET A 1 19 ? 0.782   -42.574 30.941  1.00 0.00 ? 19 MET A CB   9  
ATOM 5037  C CG   . MET A 1 19 ? 1.646   -41.508 30.287  1.00 0.00 ? 19 MET A CG   9  
ATOM 5038  S SD   . MET A 1 19 ? 3.178   -41.204 31.188  1.00 0.00 ? 19 MET A SD   9  
ATOM 5039  C CE   . MET A 1 19 ? 2.550   -40.412 32.666  1.00 0.00 ? 19 MET A CE   9  
ATOM 5040  H H    . MET A 1 19 ? -0.935  -44.240 31.773  1.00 0.00 ? 19 MET A H    9  
ATOM 5041  H HA   . MET A 1 19 ? -1.099  -41.921 30.124  1.00 0.00 ? 19 MET A HA   9  
ATOM 5042  H HB2  . MET A 1 19 ? 0.548   -42.250 31.955  1.00 0.00 ? 19 MET A HB2  9  
ATOM 5043  H HB3  . MET A 1 19 ? 1.353   -43.501 30.978  1.00 0.00 ? 19 MET A HB3  9  
ATOM 5044  H HG2  . MET A 1 19 ? 1.891   -41.826 29.274  1.00 0.00 ? 19 MET A HG2  9  
ATOM 5045  H HG3  . MET A 1 19 ? 1.079   -40.578 30.234  1.00 0.00 ? 19 MET A HG3  9  
ATOM 5046  H HE1  . MET A 1 19 ? 3.375   -40.158 33.332  1.00 0.00 ? 19 MET A HE1  9  
ATOM 5047  H HE2  . MET A 1 19 ? 2.017   -39.501 32.391  1.00 0.00 ? 19 MET A HE2  9  
ATOM 5048  H HE3  . MET A 1 19 ? 1.868   -41.090 33.179  1.00 0.00 ? 19 MET A HE3  9  
ATOM 5049  N N    . LYS A 1 20 ? 0.145   -44.652 28.754  1.00 0.00 ? 20 LYS A N    9  
ATOM 5050  C CA   . LYS A 1 20 ? 0.487   -45.304 27.493  1.00 0.00 ? 20 LYS A CA   9  
ATOM 5051  C C    . LYS A 1 20 ? -0.669  -45.200 26.510  1.00 0.00 ? 20 LYS A C    9  
ATOM 5052  O O    . LYS A 1 20 ? -0.473  -44.946 25.323  1.00 0.00 ? 20 LYS A O    9  
ATOM 5053  C CB   . LYS A 1 20 ? 0.796   -46.785 27.722  1.00 0.00 ? 20 LYS A CB   9  
ATOM 5054  C CG   . LYS A 1 20 ? 1.224   -47.531 26.469  1.00 0.00 ? 20 LYS A CG   9  
ATOM 5055  C CD   . LYS A 1 20 ? 1.568   -48.978 26.778  1.00 0.00 ? 20 LYS A CD   9  
ATOM 5056  C CE   . LYS A 1 20 ? 1.982   -49.728 25.522  1.00 0.00 ? 20 LYS A CE   9  
ATOM 5057  N NZ   . LYS A 1 20 ? 2.334   -51.146 25.812  1.00 0.00 ? 20 LYS A NZ   9  
ATOM 5058  H H    . LYS A 1 20 ? 0.182   -45.201 29.600  1.00 0.00 ? 20 LYS A H    9  
ATOM 5059  H HA   . LYS A 1 20 ? 1.364   -44.813 27.072  1.00 0.00 ? 20 LYS A HA   9  
ATOM 5060  H HB2  . LYS A 1 20 ? 1.599   -46.857 28.455  1.00 0.00 ? 20 LYS A HB2  9  
ATOM 5061  H HB3  . LYS A 1 20 ? -0.100  -47.264 28.117  1.00 0.00 ? 20 LYS A HB3  9  
ATOM 5062  H HG2  . LYS A 1 20 ? 0.409   -47.506 25.746  1.00 0.00 ? 20 LYS A HG2  9  
ATOM 5063  H HG3  . LYS A 1 20 ? 2.100   -47.040 26.046  1.00 0.00 ? 20 LYS A HG3  9  
ATOM 5064  H HD2  . LYS A 1 20 ? 2.390   -49.002 27.494  1.00 0.00 ? 20 LYS A HD2  9  
ATOM 5065  H HD3  . LYS A 1 20 ? 0.694   -49.465 27.211  1.00 0.00 ? 20 LYS A HD3  9  
ATOM 5066  H HE2  . LYS A 1 20 ? 1.157   -49.707 24.810  1.00 0.00 ? 20 LYS A HE2  9  
ATOM 5067  H HE3  . LYS A 1 20 ? 2.847   -49.231 25.083  1.00 0.00 ? 20 LYS A HE3  9  
ATOM 5068  H HZ1  . LYS A 1 20 ? 2.603   -51.612 24.958  1.00 0.00 ? 20 LYS A HZ1  9  
ATOM 5069  H HZ2  . LYS A 1 20 ? 3.103   -51.174 26.466  1.00 0.00 ? 20 LYS A HZ2  9  
ATOM 5070  H HZ3  . LYS A 1 20 ? 1.534   -51.615 26.212  1.00 0.00 ? 20 LYS A HZ3  9  
ATOM 5071  N N    . ALA A 1 21 ? -1.880  -45.401 27.023  1.00 0.00 ? 21 ALA A N    9  
ATOM 5072  C CA   . ALA A 1 21 ? -3.091  -45.337 26.211  1.00 0.00 ? 21 ALA A CA   9  
ATOM 5073  C C    . ALA A 1 21 ? -3.350  -43.911 25.753  1.00 0.00 ? 21 ALA A C    9  
ATOM 5074  O O    . ALA A 1 21 ? -3.725  -43.669 24.607  1.00 0.00 ? 21 ALA A O    9  
ATOM 5075  C CB   . ALA A 1 21 ? -4.293  -45.811 27.013  1.00 0.00 ? 21 ALA A CB   9  
ATOM 5076  H H    . ALA A 1 21 ? -1.976  -45.606 28.007  1.00 0.00 ? 21 ALA A H    9  
ATOM 5077  H HA   . ALA A 1 21 ? -2.963  -45.979 25.340  1.00 0.00 ? 21 ALA A HA   9  
ATOM 5078  H HB1  . ALA A 1 21 ? -5.190  -45.773 26.393  1.00 0.00 ? 21 ALA A HB1  9  
ATOM 5079  H HB2  . ALA A 1 21 ? -4.126  -46.836 27.345  1.00 0.00 ? 21 ALA A HB2  9  
ATOM 5080  H HB3  . ALA A 1 21 ? -4.427  -45.165 27.881  1.00 0.00 ? 21 ALA A HB3  9  
ATOM 5081  N N    . ILE A 1 22 ? -3.143  -42.967 26.668  1.00 0.00 ? 22 ILE A N    9  
ATOM 5082  C CA   . ILE A 1 22 ? -3.348  -41.549 26.385  1.00 0.00 ? 22 ILE A CA   9  
ATOM 5083  C C    . ILE A 1 22 ? -2.370  -41.072 25.323  1.00 0.00 ? 22 ILE A C    9  
ATOM 5084  O O    . ILE A 1 22 ? -2.755  -40.431 24.347  1.00 0.00 ? 22 ILE A O    9  
ATOM 5085  C CB   . ILE A 1 22 ? -3.139  -40.686 27.643  1.00 0.00 ? 22 ILE A CB   9  
ATOM 5086  C CG1  . ILE A 1 22 ? -4.236  -40.969 28.672  1.00 0.00 ? 22 ILE A CG1  9  
ATOM 5087  C CG2  . ILE A 1 22 ? -3.180  -39.208 27.289  1.00 0.00 ? 22 ILE A CG2  9  
ATOM 5088  C CD1  . ILE A 1 22 ? -3.974  -40.353 30.029  1.00 0.00 ? 22 ILE A CD1  9  
ATOM 5089  H H    . ILE A 1 22 ? -2.833  -43.228 27.593  1.00 0.00 ? 22 ILE A H    9  
ATOM 5090  H HA   . ILE A 1 22 ? -4.368  -41.413 26.025  1.00 0.00 ? 22 ILE A HA   9  
ATOM 5091  H HB   . ILE A 1 22 ? -2.169  -40.924 28.077  1.00 0.00 ? 22 ILE A HB   9  
ATOM 5092  H HG12 . ILE A 1 22 ? -5.177  -40.571 28.290  1.00 0.00 ? 22 ILE A HG12 9  
ATOM 5093  H HG13 . ILE A 1 22 ? -4.322  -42.048 28.796  1.00 0.00 ? 22 ILE A HG13 9  
ATOM 5094  H HG21 . ILE A 1 22 ? -3.021  -38.608 28.185  1.00 0.00 ? 22 ILE A HG21 9  
ATOM 5095  H HG22 . ILE A 1 22 ? -2.397  -38.987 26.564  1.00 0.00 ? 22 ILE A HG22 9  
ATOM 5096  H HG23 . ILE A 1 22 ? -4.152  -38.965 26.860  1.00 0.00 ? 22 ILE A HG23 9  
ATOM 5097  H HD11 . ILE A 1 22 ? -4.786  -40.585 30.718  1.00 0.00 ? 22 ILE A HD11 9  
ATOM 5098  H HD12 . ILE A 1 22 ? -3.041  -40.749 30.430  1.00 0.00 ? 22 ILE A HD12 9  
ATOM 5099  H HD13 . ILE A 1 22 ? -3.895  -39.271 29.924  1.00 0.00 ? 22 ILE A HD13 9  
ATOM 5100  N N    . GLY A 1 23 ? -1.097  -41.395 25.527  1.00 0.00 ? 23 GLY A N    9  
ATOM 5101  C CA   . GLY A 1 23 ? -0.036  -41.013 24.599  1.00 0.00 ? 23 GLY A CA   9  
ATOM 5102  C C    . GLY A 1 23 ? -0.210  -41.727 23.268  1.00 0.00 ? 23 GLY A C    9  
ATOM 5103  O O    . GLY A 1 23 ? -0.079  -41.127 22.202  1.00 0.00 ? 23 GLY A O    9  
ATOM 5104  H H    . GLY A 1 23 ? -0.844  -41.923 26.350  1.00 0.00 ? 23 GLY A H    9  
ATOM 5105  H HA2  . GLY A 1 23 ? -0.072  -39.935 24.436  1.00 0.00 ? 23 GLY A HA2  9  
ATOM 5106  H HA3  . GLY A 1 23 ? 0.929   -41.281 25.027  1.00 0.00 ? 23 GLY A HA3  9  
ATOM 5107  N N    . GLY A 1 24 ? -0.508  -43.021 23.345  1.00 0.00 ? 24 GLY A N    9  
ATOM 5108  C CA   . GLY A 1 24 ? -0.705  -43.847 22.158  1.00 0.00 ? 24 GLY A CA   9  
ATOM 5109  C C    . GLY A 1 24 ? -1.965  -43.424 21.419  1.00 0.00 ? 24 GLY A C    9  
ATOM 5110  O O    . GLY A 1 24 ? -1.934  -43.128 20.226  1.00 0.00 ? 24 GLY A O    9  
ATOM 5111  H H    . GLY A 1 24 ? -0.604  -43.457 24.251  1.00 0.00 ? 24 GLY A H    9  
ATOM 5112  H HA2  . GLY A 1 24 ? 0.154   -43.736 21.496  1.00 0.00 ? 24 GLY A HA2  9  
ATOM 5113  H HA3  . GLY A 1 24 ? -0.798  -44.890 22.458  1.00 0.00 ? 24 GLY A HA3  9  
ATOM 5114  N N    . TYR A 1 25 ? -3.078  -43.401 22.147  1.00 0.00 ? 25 TYR A N    9  
ATOM 5115  C CA   . TYR A 1 25 ? -4.370  -43.018 21.585  1.00 0.00 ? 25 TYR A CA   9  
ATOM 5116  C C    . TYR A 1 25 ? -4.288  -41.637 20.956  1.00 0.00 ? 25 TYR A C    9  
ATOM 5117  O O    . TYR A 1 25 ? -4.861  -41.385 19.897  1.00 0.00 ? 25 TYR A O    9  
ATOM 5118  C CB   . TYR A 1 25 ? -5.442  -42.990 22.676  1.00 0.00 ? 25 TYR A CB   9  
ATOM 5119  C CG   . TYR A 1 25 ? -6.812  -42.587 22.179  1.00 0.00 ? 25 TYR A CG   9  
ATOM 5120  C CD1  . TYR A 1 25 ? -7.614  -43.491 21.495  1.00 0.00 ? 25 TYR A CD1  9  
ATOM 5121  C CD2  . TYR A 1 25 ? -7.298  -41.304 22.396  1.00 0.00 ? 25 TYR A CD2  9  
ATOM 5122  C CE1  . TYR A 1 25 ? -8.868  -43.132 21.037  1.00 0.00 ? 25 TYR A CE1  9  
ATOM 5123  C CE2  . TYR A 1 25 ? -8.549  -40.927 21.945  1.00 0.00 ? 25 TYR A CE2  9  
ATOM 5124  C CZ   . TYR A 1 25 ? -9.334  -41.854 21.261  1.00 0.00 ? 25 TYR A CZ   9  
ATOM 5125  O OH   . TYR A 1 25 ? -10.581 -41.494 20.806  1.00 0.00 ? 25 TYR A OH   9  
ATOM 5126  H H    . TYR A 1 25 ? -3.040  -43.656 23.123  1.00 0.00 ? 25 TYR A H    9  
ATOM 5127  H HA   . TYR A 1 25 ? -4.650  -43.746 20.824  1.00 0.00 ? 25 TYR A HA   9  
ATOM 5128  H HB2  . TYR A 1 25 ? -5.513  -43.983 23.118  1.00 0.00 ? 25 TYR A HB2  9  
ATOM 5129  H HB3  . TYR A 1 25 ? -5.133  -42.285 23.448  1.00 0.00 ? 25 TYR A HB3  9  
ATOM 5130  H HD1  . TYR A 1 25 ? -7.252  -44.492 21.318  1.00 0.00 ? 25 TYR A HD1  9  
ATOM 5131  H HD2  . TYR A 1 25 ? -6.688  -40.588 22.927  1.00 0.00 ? 25 TYR A HD2  9  
ATOM 5132  H HE1  . TYR A 1 25 ? -9.479  -43.847 20.507  1.00 0.00 ? 25 TYR A HE1  9  
ATOM 5133  H HE2  . TYR A 1 25 ? -8.914  -39.925 22.121  1.00 0.00 ? 25 TYR A HE2  9  
ATOM 5134  H HH   . TYR A 1 25 ? -10.809 -40.584 21.013  1.00 0.00 ? 25 TYR A HH   9  
ATOM 5135  N N    . ILE A 1 26 ? -3.565  -40.743 21.624  1.00 0.00 ? 26 ILE A N    9  
ATOM 5136  C CA   . ILE A 1 26 ? -3.388  -39.372 21.152  1.00 0.00 ? 26 ILE A CA   9  
ATOM 5137  C C    . ILE A 1 26 ? -2.419  -39.334 19.982  1.00 0.00 ? 26 ILE A C    9  
ATOM 5138  O O    . ILE A 1 26 ? -2.662  -38.670 18.976  1.00 0.00 ? 26 ILE A O    9  
ATOM 5139  C CB   . ILE A 1 26 ? -2.828  -38.461 22.261  1.00 0.00 ? 26 ILE A CB   9  
ATOM 5140  C CG1  . ILE A 1 26 ? -3.854  -38.296 23.384  1.00 0.00 ? 26 ILE A CG1  9  
ATOM 5141  C CG2  . ILE A 1 26 ? -2.498  -37.085 21.703  1.00 0.00 ? 26 ILE A CG2  9  
ATOM 5142  C CD1  . ILE A 1 26 ? -3.302  -37.623 24.621  1.00 0.00 ? 26 ILE A CD1  9  
ATOM 5143  H H    . ILE A 1 26 ? -3.118  -41.010 22.489  1.00 0.00 ? 26 ILE A H    9  
ATOM 5144  H HA   . ILE A 1 26 ? -4.358  -38.990 20.832  1.00 0.00 ? 26 ILE A HA   9  
ATOM 5145  H HB   . ILE A 1 26 ? -1.922  -38.912 22.665  1.00 0.00 ? 26 ILE A HB   9  
ATOM 5146  H HG12 . ILE A 1 26 ? -4.683  -37.696 23.008  1.00 0.00 ? 26 ILE A HG12 9  
ATOM 5147  H HG13 . ILE A 1 26 ? -4.219  -39.284 23.665  1.00 0.00 ? 26 ILE A HG13 9  
ATOM 5148  H HG21 . ILE A 1 26 ? -2.094  -36.452 22.494  1.00 0.00 ? 26 ILE A HG21 9  
ATOM 5149  H HG22 . ILE A 1 26 ? -1.760  -37.184 20.907  1.00 0.00 ? 26 ILE A HG22 9  
ATOM 5150  H HG23 . ILE A 1 26 ? -3.404  -36.629 21.304  1.00 0.00 ? 26 ILE A HG23 9  
ATOM 5151  H HD11 . ILE A 1 26 ? -4.075  -37.531 25.384  1.00 0.00 ? 26 ILE A HD11 9  
ATOM 5152  H HD12 . ILE A 1 26 ? -2.479  -38.217 25.017  1.00 0.00 ? 26 ILE A HD12 9  
ATOM 5153  H HD13 . ILE A 1 26 ? -2.941  -36.628 24.359  1.00 0.00 ? 26 ILE A HD13 9  
ATOM 5154  N N    . VAL A 1 27 ? -1.313  -40.057 20.128  1.00 0.00 ? 27 VAL A N    9  
ATOM 5155  C CA   . VAL A 1 27 ? -0.282  -40.125 19.095  1.00 0.00 ? 27 VAL A CA   9  
ATOM 5156  C C    . VAL A 1 27 ? -0.740  -41.006 17.944  1.00 0.00 ? 27 VAL A C    9  
ATOM 5157  O O    . VAL A 1 27 ? -0.364  -40.794 16.792  1.00 0.00 ? 27 VAL A O    9  
ATOM 5158  C CB   . VAL A 1 27 ? 1.031   -40.710 19.646  1.00 0.00 ? 27 VAL A CB   9  
ATOM 5159  C CG1  . VAL A 1 27 ? 2.026   -40.941 18.519  1.00 0.00 ? 27 VAL A CG1  9  
ATOM 5160  C CG2  . VAL A 1 27 ? 1.658   -39.758 20.653  1.00 0.00 ? 27 VAL A CG2  9  
ATOM 5161  H H    . VAL A 1 27 ? -1.171  -40.581 20.979  1.00 0.00 ? 27 VAL A H    9  
ATOM 5162  H HA   . VAL A 1 27 ? -0.097  -39.116 18.727  1.00 0.00 ? 27 VAL A HA   9  
ATOM 5163  H HB   . VAL A 1 27 ? 0.815   -41.659 20.136  1.00 0.00 ? 27 VAL A HB   9  
ATOM 5164  H HG11 . VAL A 1 27 ? 2.947   -41.363 18.920  1.00 0.00 ? 27 VAL A HG11 9  
ATOM 5165  H HG12 . VAL A 1 27 ? 1.597   -41.632 17.793  1.00 0.00 ? 27 VAL A HG12 9  
ATOM 5166  H HG13 . VAL A 1 27 ? 2.246   -39.991 18.030  1.00 0.00 ? 27 VAL A HG13 9  
ATOM 5167  H HG21 . VAL A 1 27 ? 2.581   -40.186 21.042  1.00 0.00 ? 27 VAL A HG21 9  
ATOM 5168  H HG22 . VAL A 1 27 ? 1.878   -38.808 20.165  1.00 0.00 ? 27 VAL A HG22 9  
ATOM 5169  H HG23 . VAL A 1 27 ? 0.962   -39.591 21.476  1.00 0.00 ? 27 VAL A HG23 9  
ATOM 5170  N N    . GLY A 1 28 ? -1.558  -42.002 18.272  1.00 0.00 ? 28 GLY A N    9  
ATOM 5171  C CA   . GLY A 1 28 ? -2.086  -42.936 17.283  1.00 0.00 ? 28 GLY A CA   9  
ATOM 5172  C C    . GLY A 1 28 ? -3.176  -42.276 16.455  1.00 0.00 ? 28 GLY A C    9  
ATOM 5173  O O    . GLY A 1 28 ? -3.456  -42.684 15.329  1.00 0.00 ? 28 GLY A O    9  
ATOM 5174  H H    . GLY A 1 28 ? -1.830  -42.125 19.237  1.00 0.00 ? 28 GLY A H    9  
ATOM 5175  H HA2  . GLY A 1 28 ? -1.279  -43.256 16.624  1.00 0.00 ? 28 GLY A HA2  9  
ATOM 5176  H HA3  . GLY A 1 28 ? -2.500  -43.804 17.795  1.00 0.00 ? 28 GLY A HA3  9  
ATOM 5177  N N    . ALA A 1 29 ? -3.791  -41.246 17.031  1.00 0.00 ? 29 ALA A N    9  
ATOM 5178  C CA   . ALA A 1 29 ? -4.860  -40.506 16.369  1.00 0.00 ? 29 ALA A CA   9  
ATOM 5179  C C    . ALA A 1 29 ? -4.281  -39.429 15.464  1.00 0.00 ? 29 ALA A C    9  
ATOM 5180  O O    . ALA A 1 29 ? -4.841  -39.108 14.417  1.00 0.00 ? 29 ALA A O    9  
ATOM 5181  C CB   . ALA A 1 29 ? -5.759  -39.839 17.398  1.00 0.00 ? 29 ALA A CB   9  
ATOM 5182  H H    . ALA A 1 29 ? -3.517  -40.958 17.960  1.00 0.00 ? 29 ALA A H    9  
ATOM 5183  H HA   . ALA A 1 29 ? -5.450  -41.201 15.772  1.00 0.00 ? 29 ALA A HA   9  
ATOM 5184  H HB1  . ALA A 1 29 ? -6.563  -39.301 16.894  1.00 0.00 ? 29 ALA A HB1  9  
ATOM 5185  H HB2  . ALA A 1 29 ? -6.188  -40.599 18.052  1.00 0.00 ? 29 ALA A HB2  9  
ATOM 5186  H HB3  . ALA A 1 29 ? -5.173  -39.138 17.992  1.00 0.00 ? 29 ALA A HB3  9  
ATOM 5187  N N    . LEU A 1 30 ? -3.148  -38.874 15.885  1.00 0.00 ? 30 LEU A N    9  
ATOM 5188  C CA   . LEU A 1 30 ? -2.465  -37.827 15.130  1.00 0.00 ? 30 LEU A CA   9  
ATOM 5189  C C    . LEU A 1 30 ? -2.179  -38.293 13.712  1.00 0.00 ? 30 LEU A C    9  
ATOM 5190  O O    . LEU A 1 30 ? -2.149  -37.497 12.775  1.00 0.00 ? 30 LEU A O    9  
ATOM 5191  C CB   . LEU A 1 30 ? -1.136  -37.465 15.797  1.00 0.00 ? 30 LEU A CB   9  
ATOM 5192  C CG   . LEU A 1 30 ? -1.228  -36.720 17.130  1.00 0.00 ? 30 LEU A CG   9  
ATOM 5193  C CD1  . LEU A 1 30 ? 0.153   -36.538 17.740  1.00 0.00 ? 30 LEU A CD1  9  
ATOM 5194  C CD2  . LEU A 1 30 ? -1.847  -35.344 16.936  1.00 0.00 ? 30 LEU A CD2  9  
ATOM 5195  H H    . LEU A 1 30 ? -2.737  -39.179 16.756  1.00 0.00 ? 30 LEU A H    9  
ATOM 5196  H HA   . LEU A 1 30 ? -3.105  -36.944 15.099  1.00 0.00 ? 30 LEU A HA   9  
ATOM 5197  H HB2  . LEU A 1 30 ? -0.589  -38.391 15.971  1.00 0.00 ? 30 LEU A HB2  9  
ATOM 5198  H HB3  . LEU A 1 30 ? -0.577  -36.837 15.104  1.00 0.00 ? 30 LEU A HB3  9  
ATOM 5199  H HG   . LEU A 1 30 ? -1.849  -37.299 17.813  1.00 0.00 ? 30 LEU A HG   9  
ATOM 5200  H HD11 . LEU A 1 30 ? 0.072   -36.015 18.694  1.00 0.00 ? 30 LEU A HD11 9  
ATOM 5201  H HD12 . LEU A 1 30 ? 0.608   -37.514 17.902  1.00 0.00 ? 30 LEU A HD12 9  
ATOM 5202  H HD13 . LEU A 1 30 ? 0.774   -35.954 17.061  1.00 0.00 ? 30 LEU A HD13 9  
ATOM 5203  H HD21 . LEU A 1 30 ? -1.917  -34.829 17.894  1.00 0.00 ? 30 LEU A HD21 9  
ATOM 5204  H HD22 . LEU A 1 30 ? -1.226  -34.759 16.258  1.00 0.00 ? 30 LEU A HD22 9  
ATOM 5205  H HD23 . LEU A 1 30 ? -2.846  -35.452 16.512  1.00 0.00 ? 30 LEU A HD23 9  
ATOM 5206  N N    . VAL A 1 31 ? -1.969  -39.598 13.567  1.00 0.00 ? 31 VAL A N    9  
ATOM 5207  C CA   . VAL A 1 31 ? -1.682  -40.203 12.269  1.00 0.00 ? 31 VAL A CA   9  
ATOM 5208  C C    . VAL A 1 31 ? -2.769  -39.853 11.267  1.00 0.00 ? 31 VAL A C    9  
ATOM 5209  O O    . VAL A 1 31 ? -2.504  -39.665 10.081  1.00 0.00 ? 31 VAL A O    9  
ATOM 5210  C CB   . VAL A 1 31 ? -1.604  -41.738 12.367  1.00 0.00 ? 31 VAL A CB   9  
ATOM 5211  C CG1  . VAL A 1 31 ? -1.534  -42.357 10.979  1.00 0.00 ? 31 VAL A CG1  9  
ATOM 5212  C CG2  . VAL A 1 31 ? -0.368  -42.160 13.144  1.00 0.00 ? 31 VAL A CG2  9  
ATOM 5213  H H    . VAL A 1 31 ? -2.007  -40.201 14.376  1.00 0.00 ? 31 VAL A H    9  
ATOM 5214  H HA   . VAL A 1 31 ? -0.726  -39.818 11.914  1.00 0.00 ? 31 VAL A HA   9  
ATOM 5215  H HB   . VAL A 1 31 ? -2.494  -42.104 12.880  1.00 0.00 ? 31 VAL A HB   9  
ATOM 5216  H HG11 . VAL A 1 31 ? -1.488  -43.442 11.061  1.00 0.00 ? 31 VAL A HG11 9  
ATOM 5217  H HG12 . VAL A 1 31 ? -2.421  -42.074 10.411  1.00 0.00 ? 31 VAL A HG12 9  
ATOM 5218  H HG13 . VAL A 1 31 ? -0.644  -41.995 10.465  1.00 0.00 ? 31 VAL A HG13 9  
ATOM 5219  H HG21 . VAL A 1 31 ? -0.329  -43.247 13.214  1.00 0.00 ? 31 VAL A HG21 9  
ATOM 5220  H HG22 . VAL A 1 31 ? 0.523   -41.798 12.631  1.00 0.00 ? 31 VAL A HG22 9  
ATOM 5221  H HG23 . VAL A 1 31 ? -0.408  -41.734 14.147  1.00 0.00 ? 31 VAL A HG23 9  
ATOM 5222  N N    . ILE A 1 32 ? -4.001  -39.769 11.761  1.00 0.00 ? 32 ILE A N    9  
ATOM 5223  C CA   . ILE A 1 32 ? -5.156  -39.442 10.928  1.00 0.00 ? 32 ILE A CA   9  
ATOM 5224  C C    . ILE A 1 32 ? -5.039  -38.025 10.390  1.00 0.00 ? 32 ILE A C    9  
ATOM 5225  O O    . ILE A 1 32 ? -5.325  -37.762 9.223   1.00 0.00 ? 32 ILE A O    9  
ATOM 5226  C CB   . ILE A 1 32 ? -6.471  -39.540 11.723  1.00 0.00 ? 32 ILE A CB   9  
ATOM 5227  C CG1  . ILE A 1 32 ? -6.749  -40.992 12.118  1.00 0.00 ? 32 ILE A CG1  9  
ATOM 5228  C CG2  . ILE A 1 32 ? -7.638  -39.036 10.887  1.00 0.00 ? 32 ILE A CG2  9  
ATOM 5229  C CD1  . ILE A 1 32 ? -7.884  -41.150 13.106  1.00 0.00 ? 32 ILE A CD1  9  
ATOM 5230  H H    . ILE A 1 32 ? -4.155  -39.934 12.746  1.00 0.00 ? 32 ILE A H    9  
ATOM 5231  H HA   . ILE A 1 32 ? -5.190  -40.143 10.095  1.00 0.00 ? 32 ILE A HA   9  
ATOM 5232  H HB   . ILE A 1 32 ? -6.385  -38.932 12.624  1.00 0.00 ? 32 ILE A HB   9  
ATOM 5233  H HG12 . ILE A 1 32 ? -6.999  -41.552 11.217  1.00 0.00 ? 32 ILE A HG12 9  
ATOM 5234  H HG13 . ILE A 1 32 ? -5.846  -41.405 12.565  1.00 0.00 ? 32 ILE A HG13 9  
ATOM 5235  H HG21 . ILE A 1 32 ? -8.561  -39.100 11.463  1.00 0.00 ? 32 ILE A HG21 9  
ATOM 5236  H HG22 . ILE A 1 32 ? -7.460  -37.998 10.606  1.00 0.00 ? 32 ILE A HG22 9  
ATOM 5237  H HG23 . ILE A 1 32 ? -7.730  -39.645 9.988   1.00 0.00 ? 32 ILE A HG23 9  
ATOM 5238  H HD11 . ILE A 1 32 ? -8.037  -42.201 13.349  1.00 0.00 ? 32 ILE A HD11 9  
ATOM 5239  H HD12 . ILE A 1 32 ? -7.646  -40.604 14.019  1.00 0.00 ? 32 ILE A HD12 9  
ATOM 5240  H HD13 . ILE A 1 32 ? -8.799  -40.747 12.671  1.00 0.00 ? 32 ILE A HD13 9  
ATOM 5241  N N    . LEU A 1 33 ? -4.614  -37.114 11.260  1.00 0.00 ? 33 LEU A N    9  
ATOM 5242  C CA   . LEU A 1 33 ? -4.449  -35.708 10.899  1.00 0.00 ? 33 LEU A CA   9  
ATOM 5243  C C    . LEU A 1 33 ? -3.401  -35.559 9.808   1.00 0.00 ? 33 LEU A C    9  
ATOM 5244  O O    . LEU A 1 33 ? -3.617  -34.876 8.808   1.00 0.00 ? 33 LEU A O    9  
ATOM 5245  C CB   . LEU A 1 33 ? -4.003  -34.892 12.114  1.00 0.00 ? 33 LEU A CB   9  
ATOM 5246  C CG   . LEU A 1 33 ? -5.055  -34.664 13.201  1.00 0.00 ? 33 LEU A CG   9  
ATOM 5247  C CD1  . LEU A 1 33 ? -4.444  -33.953 14.399  1.00 0.00 ? 33 LEU A CD1  9  
ATOM 5248  C CD2  . LEU A 1 33 ? -6.197  -33.810 12.673  1.00 0.00 ? 33 LEU A CD2  9  
ATOM 5249  H H    . LEU A 1 33 ? -4.395  -37.392 12.206  1.00 0.00 ? 33 LEU A H    9  
ATOM 5250  H HA   . LEU A 1 33 ? -5.404  -35.324 10.538  1.00 0.00 ? 33 LEU A HA   9  
ATOM 5251  H HB2  . LEU A 1 33 ? -3.161  -35.410 12.571  1.00 0.00 ? 33 LEU A HB2  9  
ATOM 5252  H HB3  . LEU A 1 33 ? -3.678  -33.915 11.757  1.00 0.00 ? 33 LEU A HB3  9  
ATOM 5253  H HG   . LEU A 1 33 ? -5.447  -35.630 13.518  1.00 0.00 ? 33 LEU A HG   9  
ATOM 5254  H HD11 . LEU A 1 33 ? -5.201  -33.805 15.170  1.00 0.00 ? 33 LEU A HD11 9  
ATOM 5255  H HD12 . LEU A 1 33 ? -3.632  -34.557 14.803  1.00 0.00 ? 33 LEU A HD12 9  
ATOM 5256  H HD13 . LEU A 1 33 ? -4.056  -32.984 14.086  1.00 0.00 ? 33 LEU A HD13 9  
ATOM 5257  H HD21 . LEU A 1 33 ? -6.945  -33.664 13.453  1.00 0.00 ? 33 LEU A HD21 9  
ATOM 5258  H HD22 . LEU A 1 33 ? -5.810  -32.840 12.360  1.00 0.00 ? 33 LEU A HD22 9  
ATOM 5259  H HD23 . LEU A 1 33 ? -6.659  -34.309 11.821  1.00 0.00 ? 33 LEU A HD23 9  
ATOM 5260  N N    . ALA A 1 34 ? -2.260  -36.209 10.014  1.00 0.00 ? 34 ALA A N    9  
ATOM 5261  C CA   . ALA A 1 34 ? -1.155  -36.166 9.060   1.00 0.00 ? 34 ALA A CA   9  
ATOM 5262  C C    . ALA A 1 34 ? -1.600  -36.692 7.705   1.00 0.00 ? 34 ALA A C    9  
ATOM 5263  O O    . ALA A 1 34 ? -1.246  -36.144 6.662   1.00 0.00 ? 34 ALA A O    9  
ATOM 5264  C CB   . ALA A 1 34 ? 0.003   -37.020 9.552   1.00 0.00 ? 34 ALA A CB   9  
ATOM 5265  H H    . ALA A 1 34 ? -2.143  -36.753 10.856  1.00 0.00 ? 34 ALA A H    9  
ATOM 5266  H HA   . ALA A 1 34 ? -0.823  -35.133 8.955   1.00 0.00 ? 34 ALA A HA   9  
ATOM 5267  H HB1  . ALA A 1 34 ? 0.827   -36.969 8.841   1.00 0.00 ? 34 ALA A HB1  9  
ATOM 5268  H HB2  . ALA A 1 34 ? 0.338   -36.651 10.521  1.00 0.00 ? 34 ALA A HB2  9  
ATOM 5269  H HB3  . ALA A 1 34 ? -0.326  -38.054 9.651   1.00 0.00 ? 34 ALA A HB3  9  
ATOM 5270  N N    . VAL A 1 35 ? -2.385  -37.765 7.734   1.00 0.00 ? 35 VAL A N    9  
ATOM 5271  C CA   . VAL A 1 35 ? -2.898  -38.389 6.518   1.00 0.00 ? 35 VAL A CA   9  
ATOM 5272  C C    . VAL A 1 35 ? -3.655  -37.375 5.677   1.00 0.00 ? 35 VAL A C    9  
ATOM 5273  O O    . VAL A 1 35 ? -3.501  -37.318 4.458   1.00 0.00 ? 35 VAL A O    9  
ATOM 5274  C CB   . VAL A 1 35 ? -3.860  -39.548 6.841   1.00 0.00 ? 35 VAL A CB   9  
ATOM 5275  C CG1  . VAL A 1 35 ? -4.540  -40.044 5.574   1.00 0.00 ? 35 VAL A CG1  9  
ATOM 5276  C CG2  . VAL A 1 35 ? -3.103  -40.709 7.466   1.00 0.00 ? 35 VAL A CG2  9  
ATOM 5277  H H    . VAL A 1 35 ? -2.642  -38.170 8.623   1.00 0.00 ? 35 VAL A H    9  
ATOM 5278  H HA   . VAL A 1 35 ? -2.054  -38.774 5.947   1.00 0.00 ? 35 VAL A HA   9  
ATOM 5279  H HB   . VAL A 1 35 ? -4.617  -39.193 7.541   1.00 0.00 ? 35 VAL A HB   9  
ATOM 5280  H HG11 . VAL A 1 35 ? -5.224  -40.857 5.816   1.00 0.00 ? 35 VAL A HG11 9  
ATOM 5281  H HG12 . VAL A 1 35 ? -5.099  -39.226 5.119   1.00 0.00 ? 35 VAL A HG12 9  
ATOM 5282  H HG13 . VAL A 1 35 ? -3.786  -40.402 4.874   1.00 0.00 ? 35 VAL A HG13 9  
ATOM 5283  H HG21 . VAL A 1 35 ? -3.795  -41.519 7.698   1.00 0.00 ? 35 VAL A HG21 9  
ATOM 5284  H HG22 . VAL A 1 35 ? -2.348  -41.067 6.767   1.00 0.00 ? 35 VAL A HG22 9  
ATOM 5285  H HG23 . VAL A 1 35 ? -2.619  -40.373 8.383   1.00 0.00 ? 35 VAL A HG23 9  
ATOM 5286  N N    . ALA A 1 36 ? -4.477  -36.573 6.347   1.00 0.00 ? 36 ALA A N    9  
ATOM 5287  C CA   . ALA A 1 36 ? -5.276  -35.546 5.685   1.00 0.00 ? 36 ALA A CA   9  
ATOM 5288  C C    . ALA A 1 36 ? -4.377  -34.486 5.071   1.00 0.00 ? 36 ALA A C    9  
ATOM 5289  O O    . ALA A 1 36 ? -4.561  -34.083 3.923   1.00 0.00 ? 36 ALA A O    9  
ATOM 5290  C CB   . ALA A 1 36 ? -6.205  -34.871 6.683   1.00 0.00 ? 36 ALA A CB   9  
ATOM 5291  H H    . ALA A 1 36 ? -4.560  -36.669 7.349   1.00 0.00 ? 36 ALA A H    9  
ATOM 5292  H HA   . ALA A 1 36 ? -5.870  -36.015 4.900   1.00 0.00 ? 36 ALA A HA   9  
ATOM 5293  H HB1  . ALA A 1 36 ? -6.807  -34.116 6.176   1.00 0.00 ? 36 ALA A HB1  9  
ATOM 5294  H HB2  . ALA A 1 36 ? -6.863  -35.617 7.129   1.00 0.00 ? 36 ALA A HB2  9  
ATOM 5295  H HB3  . ALA A 1 36 ? -5.613  -34.395 7.465   1.00 0.00 ? 36 ALA A HB3  9  
ATOM 5296  N N    . GLY A 1 37 ? -3.399  -34.038 5.853   1.00 0.00 ? 37 GLY A N    9  
ATOM 5297  C CA   . GLY A 1 37 ? -2.451  -33.020 5.412   1.00 0.00 ? 37 GLY A CA   9  
ATOM 5298  C C    . GLY A 1 37 ? -1.874  -33.383 4.053   1.00 0.00 ? 37 GLY A C    9  
ATOM 5299  O O    . GLY A 1 37 ? -2.020  -32.644 3.081   1.00 0.00 ? 37 GLY A O    9  
ATOM 5300  H H    . GLY A 1 37 ? -3.300  -34.408 6.787   1.00 0.00 ? 37 GLY A H    9  
ATOM 5301  H HA2  . GLY A 1 37 ? -2.963  -32.059 5.341   1.00 0.00 ? 37 GLY A HA2  9  
ATOM 5302  H HA3  . GLY A 1 37 ? -1.642  -32.944 6.138   1.00 0.00 ? 37 GLY A HA3  9  
ATOM 5303  N N    . LEU A 1 38 ? -1.215  -34.537 3.999   1.00 0.00 ? 38 LEU A N    9  
ATOM 5304  C CA   . LEU A 1 38 ? -0.601  -35.029 2.768   1.00 0.00 ? 38 LEU A CA   9  
ATOM 5305  C C    . LEU A 1 38 ? -1.655  -35.219 1.689   1.00 0.00 ? 38 LEU A C    9  
ATOM 5306  O O    . LEU A 1 38 ? -1.425  -34.923 0.518   1.00 0.00 ? 38 LEU A O    9  
ATOM 5307  C CB   . LEU A 1 38 ? 0.089   -36.372 3.013   1.00 0.00 ? 38 LEU A CB   9  
ATOM 5308  C CG   . LEU A 1 38 ? 1.366   -36.334 3.855   1.00 0.00 ? 38 LEU A CG   9  
ATOM 5309  C CD1  . LEU A 1 38 ? 1.874   -37.743 4.126   1.00 0.00 ? 38 LEU A CD1  9  
ATOM 5310  C CD2  . LEU A 1 38 ? 2.463   -35.565 3.134   1.00 0.00 ? 38 LEU A CD2  9  
ATOM 5311  H H    . LEU A 1 38 ? -1.130  -35.101 4.833   1.00 0.00 ? 38 LEU A H    9  
ATOM 5312  H HA   . LEU A 1 38 ? 0.136   -34.301 2.429   1.00 0.00 ? 38 LEU A HA   9  
ATOM 5313  H HB2  . LEU A 1 38 ? -0.624  -37.023 3.519   1.00 0.00 ? 38 LEU A HB2  9  
ATOM 5314  H HB3  . LEU A 1 38 ? 0.343   -36.796 2.042   1.00 0.00 ? 38 LEU A HB3  9  
ATOM 5315  H HG   . LEU A 1 38 ? 1.146   -35.842 4.803   1.00 0.00 ? 38 LEU A HG   9  
ATOM 5316  H HD11 . LEU A 1 38 ? 2.777   -37.702 4.735   1.00 0.00 ? 38 LEU A HD11 9  
ATOM 5317  H HD12 . LEU A 1 38 ? 1.107   -38.308 4.656   1.00 0.00 ? 38 LEU A HD12 9  
ATOM 5318  H HD13 . LEU A 1 38 ? 2.098   -38.235 3.180   1.00 0.00 ? 38 LEU A HD13 9  
ATOM 5319  H HD21 . LEU A 1 38 ? 3.362   -35.535 3.749   1.00 0.00 ? 38 LEU A HD21 9  
ATOM 5320  H HD22 . LEU A 1 38 ? 2.688   -36.057 2.188   1.00 0.00 ? 38 LEU A HD22 9  
ATOM 5321  H HD23 . LEU A 1 38 ? 2.124   -34.546 2.942   1.00 0.00 ? 38 LEU A HD23 9  
ATOM 5322  N N    . ILE A 1 39 ? -2.816  -35.720 2.100   1.00 0.00 ? 39 ILE A N    9  
ATOM 5323  C CA   . ILE A 1 39 ? -3.929  -35.962 1.187   1.00 0.00 ? 39 ILE A CA   9  
ATOM 5324  C C    . ILE A 1 39 ? -4.337  -34.674 0.492   1.00 0.00 ? 39 ILE A C    9  
ATOM 5325  O O    . ILE A 1 39 ? -4.570  -34.649 -0.716  1.00 0.00 ? 39 ILE A O    9  
ATOM 5326  C CB   . ILE A 1 39 ? -5.161  -36.509 1.932   1.00 0.00 ? 39 ILE A CB   9  
ATOM 5327  C CG1  . ILE A 1 39 ? -4.880  -37.914 2.468   1.00 0.00 ? 39 ILE A CG1  9  
ATOM 5328  C CG2  . ILE A 1 39 ? -6.359  -36.581 0.998   1.00 0.00 ? 39 ILE A CG2  9  
ATOM 5329  C CD1  . ILE A 1 39 ? -4.554  -38.925 1.391   1.00 0.00 ? 39 ILE A CD1  9  
ATOM 5330  H H    . ILE A 1 39 ? -2.944  -35.943 3.077   1.00 0.00 ? 39 ILE A H    9  
ATOM 5331  H HA   . ILE A 1 39 ? -3.611  -36.690 0.441   1.00 0.00 ? 39 ILE A HA   9  
ATOM 5332  H HB   . ILE A 1 39 ? -5.394  -35.845 2.765   1.00 0.00 ? 39 ILE A HB   9  
ATOM 5333  H HG12 . ILE A 1 39 ? -4.035  -37.857 3.154   1.00 0.00 ? 39 ILE A HG12 9  
ATOM 5334  H HG13 . ILE A 1 39 ? -5.763  -38.259 3.007   1.00 0.00 ? 39 ILE A HG13 9  
ATOM 5335  H HG21 . ILE A 1 39 ? -7.227  -36.959 1.538   1.00 0.00 ? 39 ILE A HG21 9  
ATOM 5336  H HG22 . ILE A 1 39 ? -6.580  -35.584 0.614   1.00 0.00 ? 39 ILE A HG22 9  
ATOM 5337  H HG23 . ILE A 1 39 ? -6.132  -37.248 0.167   1.00 0.00 ? 39 ILE A HG23 9  
ATOM 5338  H HD11 . ILE A 1 39 ? -4.363  -39.903 1.830   1.00 0.00 ? 39 ILE A HD11 9  
ATOM 5339  H HD12 . ILE A 1 39 ? -5.396  -39.001 0.702   1.00 0.00 ? 39 ILE A HD12 9  
ATOM 5340  H HD13 . ILE A 1 39 ? -3.668  -38.598 0.847   1.00 0.00 ? 39 ILE A HD13 9  
ATOM 5341  N N    . TYR A 1 40 ? -4.422  -33.602 1.274   1.00 0.00 ? 40 TYR A N    9  
ATOM 5342  C CA   . TYR A 1 40 ? -4.802  -32.289 0.759   1.00 0.00 ? 40 TYR A CA   9  
ATOM 5343  C C    . TYR A 1 40 ? -3.712  -31.734 -0.142  1.00 0.00 ? 40 TYR A C    9  
ATOM 5344  O O    . TYR A 1 40 ? -3.988  -31.159 -1.194  1.00 0.00 ? 40 TYR A O    9  
ATOM 5345  C CB   . TYR A 1 40 ? -5.024  -31.306 1.910   1.00 0.00 ? 40 TYR A CB   9  
ATOM 5346  C CG   . TYR A 1 40 ? -5.448  -29.925 1.463   1.00 0.00 ? 40 TYR A CG   9  
ATOM 5347  C CD1  . TYR A 1 40 ? -6.757  -29.674 1.072   1.00 0.00 ? 40 TYR A CD1  9  
ATOM 5348  C CD2  . TYR A 1 40 ? -4.537  -28.877 1.433   1.00 0.00 ? 40 TYR A CD2  9  
ATOM 5349  C CE1  . TYR A 1 40 ? -7.153  -28.415 0.662   1.00 0.00 ? 40 TYR A CE1  9  
ATOM 5350  C CE2  . TYR A 1 40 ? -4.915  -27.611 1.026   1.00 0.00 ? 40 TYR A CE2  9  
ATOM 5351  C CZ   . TYR A 1 40 ? -6.236  -27.387 0.639   1.00 0.00 ? 40 TYR A CZ   9  
ATOM 5352  O OH   . TYR A 1 40 ? -6.627  -26.133 0.231   1.00 0.00 ? 40 TYR A OH   9  
ATOM 5353  H H    . TYR A 1 40 ? -4.221  -33.687 2.260   1.00 0.00 ? 40 TYR A H    9  
ATOM 5354  H HA   . TYR A 1 40 ? -5.726  -32.390 0.189   1.00 0.00 ? 40 TYR A HA   9  
ATOM 5355  H HB2  . TYR A 1 40 ? -5.796  -31.709 2.566   1.00 0.00 ? 40 TYR A HB2  9  
ATOM 5356  H HB3  . TYR A 1 40 ? -4.096  -31.217 2.474   1.00 0.00 ? 40 TYR A HB3  9  
ATOM 5357  H HD1  . TYR A 1 40 ? -7.479  -30.477 1.089   1.00 0.00 ? 40 TYR A HD1  9  
ATOM 5358  H HD2  . TYR A 1 40 ? -3.515  -29.054 1.733   1.00 0.00 ? 40 TYR A HD2  9  
ATOM 5359  H HE1  . TYR A 1 40 ? -8.176  -28.237 0.361   1.00 0.00 ? 40 TYR A HE1  9  
ATOM 5360  H HE2  . TYR A 1 40 ? -4.196  -26.805 1.008   1.00 0.00 ? 40 TYR A HE2  9  
ATOM 5361  H HH   . TYR A 1 40 ? -5.914  -25.491 0.252   1.00 0.00 ? 40 TYR A HH   9  
ATOM 5362  N N    . SER A 1 41 ? -2.465  -31.913 0.286   1.00 0.00 ? 41 SER A N    9  
ATOM 5363  C CA   . SER A 1 41 ? -1.307  -31.440 -0.465  1.00 0.00 ? 41 SER A CA   9  
ATOM 5364  C C    . SER A 1 41 ? -1.267  -32.080 -1.843  1.00 0.00 ? 41 SER A C    9  
ATOM 5365  O O    . SER A 1 41 ? -1.124  -31.399 -2.857  1.00 0.00 ? 41 SER A O    9  
ATOM 5366  C CB   . SER A 1 41 ? -0.012  -31.793 0.269   1.00 0.00 ? 41 SER A CB   9  
ATOM 5367  O OG   . SER A 1 41 ? 0.085   -31.094 1.498   1.00 0.00 ? 41 SER A OG   9  
ATOM 5368  H H    . SER A 1 41 ? -2.303  -32.392 1.160   1.00 0.00 ? 41 SER A H    9  
ATOM 5369  H HA   . SER A 1 41 ? -1.378  -30.357 -0.571  1.00 0.00 ? 41 SER A HA   9  
ATOM 5370  H HB2  . SER A 1 41 ? 0.004   -32.864 0.467   1.00 0.00 ? 41 SER A HB2  9  
ATOM 5371  H HB3  . SER A 1 41 ? 0.837   -31.526 -0.359  1.00 0.00 ? 41 SER A HB3  9  
ATOM 5372  H HG   . SER A 1 41 ? 0.906   -31.337 1.931   1.00 0.00 ? 41 SER A HG   9  
ATOM 5373  N N    . MET A 1 42 ? -1.396  -33.404 -1.865  1.00 0.00 ? 42 MET A N    9  
ATOM 5374  C CA   . MET A 1 42 ? -1.379  -34.168 -3.109  1.00 0.00 ? 42 MET A CA   9  
ATOM 5375  C C    . MET A 1 42 ? -2.565  -33.793 -3.982  1.00 0.00 ? 42 MET A C    9  
ATOM 5376  O O    . MET A 1 42 ? -2.441  -33.652 -5.198  1.00 0.00 ? 42 MET A O    9  
ATOM 5377  C CB   . MET A 1 42 ? -1.450  -35.668 -2.817  1.00 0.00 ? 42 MET A CB   9  
ATOM 5378  C CG   . MET A 1 42 ? -1.353  -36.546 -4.054  1.00 0.00 ? 42 MET A CG   9  
ATOM 5379  S SD   . MET A 1 42 ? -1.408  -38.306 -3.665  1.00 0.00 ? 42 MET A SD   9  
ATOM 5380  C CE   . MET A 1 42 ? -3.119  -38.489 -3.168  1.00 0.00 ? 42 MET A CE   9  
ATOM 5381  H H    . MET A 1 42 ? -1.509  -33.907 -0.997  1.00 0.00 ? 42 MET A H    9  
ATOM 5382  H HA   . MET A 1 42 ? -0.455  -33.948 -3.642  1.00 0.00 ? 42 MET A HA   9  
ATOM 5383  H HB2  . MET A 1 42 ? -0.629  -35.926 -2.148  1.00 0.00 ? 42 MET A HB2  9  
ATOM 5384  H HB3  . MET A 1 42 ? -2.400  -35.876 -2.324  1.00 0.00 ? 42 MET A HB3  9  
ATOM 5385  H HG2  . MET A 1 42 ? -2.182  -36.308 -4.721  1.00 0.00 ? 42 MET A HG2  9  
ATOM 5386  H HG3  . MET A 1 42 ? -0.417  -36.329 -4.568  1.00 0.00 ? 42 MET A HG3  9  
ATOM 5387  H HE1  . MET A 1 42 ? -3.319  -39.525 -2.894  1.00 0.00 ? 42 MET A HE1  9  
ATOM 5388  H HE2  . MET A 1 42 ? -3.318  -37.845 -2.311  1.00 0.00 ? 42 MET A HE2  9  
ATOM 5389  H HE3  . MET A 1 42 ? -3.769  -38.203 -3.995  1.00 0.00 ? 42 MET A HE3  9  
ATOM 5390  N N    . LEU A 1 43 ? -3.720  -33.631 -3.343  1.00 0.00 ? 43 LEU A N    9  
ATOM 5391  C CA   . LEU A 1 43 ? -4.952  -33.269 -4.037  1.00 0.00 ? 43 LEU A CA   9  
ATOM 5392  C C    . LEU A 1 43 ? -4.932  -31.801 -4.428  1.00 0.00 ? 43 LEU A C    9  
ATOM 5393  O O    . LEU A 1 43 ? -5.363  -31.426 -5.517  1.00 0.00 ? 43 LEU A O    9  
ATOM 5394  C CB   . LEU A 1 43 ? -6.165  -33.513 -3.137  1.00 0.00 ? 43 LEU A CB   9  
ATOM 5395  C CG   . LEU A 1 43 ? -6.521  -34.975 -2.861  1.00 0.00 ? 43 LEU A CG   9  
ATOM 5396  C CD1  . LEU A 1 43 ? -7.660  -35.070 -1.857  1.00 0.00 ? 43 LEU A CD1  9  
ATOM 5397  C CD2  . LEU A 1 43 ? -6.955  -35.674 -4.140  1.00 0.00 ? 43 LEU A CD2  9  
ATOM 5398  H H    . LEU A 1 43 ? -3.758  -33.760 -2.342  1.00 0.00 ? 43 LEU A H    9  
ATOM 5399  H HA   . LEU A 1 43 ? -5.041  -33.881 -4.935  1.00 0.00 ? 43 LEU A HA   9  
ATOM 5400  H HB2  . LEU A 1 43 ? -5.970  -33.032 -2.178  1.00 0.00 ? 43 LEU A HB2  9  
ATOM 5401  H HB3  . LEU A 1 43 ? -7.029  -33.044 -3.609  1.00 0.00 ? 43 LEU A HB3  9  
ATOM 5402  H HG   . LEU A 1 43 ? -5.644  -35.479 -2.457  1.00 0.00 ? 43 LEU A HG   9  
ATOM 5403  H HD11 . LEU A 1 43 ? -7.897  -36.115 -1.661  1.00 0.00 ? 43 LEU A HD11 9  
ATOM 5404  H HD12 . LEU A 1 43 ? -7.363  -34.587 -0.926  1.00 0.00 ? 43 LEU A HD12 9  
ATOM 5405  H HD13 . LEU A 1 43 ? -8.541  -34.570 -2.260  1.00 0.00 ? 43 LEU A HD13 9  
ATOM 5406  H HD21 . LEU A 1 43 ? -7.195  -36.716 -3.931  1.00 0.00 ? 43 LEU A HD21 9  
ATOM 5407  H HD22 . LEU A 1 43 ? -7.837  -35.175 -4.544  1.00 0.00 ? 43 LEU A HD22 9  
ATOM 5408  H HD23 . LEU A 1 43 ? -6.147  -35.629 -4.869  1.00 0.00 ? 43 LEU A HD23 9  
ATOM 5409  N N    . ARG A 1 44 ? -4.422  -30.972 -3.522  1.00 0.00 ? 44 ARG A N    9  
ATOM 5410  C CA   . ARG A 1 44 ? -4.331  -29.532 -3.745  1.00 0.00 ? 44 ARG A CA   9  
ATOM 5411  C C    . ARG A 1 44 ? -3.097  -29.197 -4.566  1.00 0.00 ? 44 ARG A C    9  
ATOM 5412  O O    . ARG A 1 44 ? -3.097  -28.260 -5.362  1.00 0.00 ? 44 ARG A O    9  
ATOM 5413  C CB   . ARG A 1 44 ? -4.241  -28.788 -2.411  1.00 0.00 ? 44 ARG A CB   9  
ATOM 5414  C CG   . ARG A 1 44 ? -4.234  -27.274 -2.544  1.00 0.00 ? 44 ARG A CG   9  
ATOM 5415  C CD   . ARG A 1 44 ? -5.565  -26.760 -3.069  1.00 0.00 ? 44 ARG A CD   9  
ATOM 5416  N NE   . ARG A 1 44 ? -5.581  -25.304 -3.187  1.00 0.00 ? 44 ARG A NE   9  
ATOM 5417  C CZ   . ARG A 1 44 ? -6.554  -24.613 -3.772  1.00 0.00 ? 44 ARG A CZ   9  
ATOM 5418  N NH1  . ARG A 1 44 ? -7.595  -25.246 -4.295  1.00 0.00 ? 44 ARG A NH1  9  
ATOM 5419  N NH2  . ARG A 1 44 ? -6.483  -23.290 -3.833  1.00 0.00 ? 44 ARG A NH2  9  
ATOM 5420  H H    . ARG A 1 44 ? -4.084  -31.340 -2.645  1.00 0.00 ? 44 ARG A H    9  
ATOM 5421  H HA   . ARG A 1 44 ? -5.222  -29.203 -4.281  1.00 0.00 ? 44 ARG A HA   9  
ATOM 5422  H HB2  . ARG A 1 44 ? -5.098  -29.074 -1.801  1.00 0.00 ? 44 ARG A HB2  9  
ATOM 5423  H HB3  . ARG A 1 44 ? -3.322  -29.091 -1.911  1.00 0.00 ? 44 ARG A HB3  9  
ATOM 5424  H HG2  . ARG A 1 44 ? -4.044  -26.832 -1.566  1.00 0.00 ? 44 ARG A HG2  9  
ATOM 5425  H HG3  . ARG A 1 44 ? -3.443  -26.981 -3.234  1.00 0.00 ? 44 ARG A HG3  9  
ATOM 5426  H HD2  . ARG A 1 44 ? -5.750  -27.195 -4.051  1.00 0.00 ? 44 ARG A HD2  9  
ATOM 5427  H HD3  . ARG A 1 44 ? -6.357  -27.067 -2.386  1.00 0.00 ? 44 ARG A HD3  9  
ATOM 5428  H HE   . ARG A 1 44 ? -4.798  -24.800 -2.796  1.00 0.00 ? 44 ARG A HE   9  
ATOM 5429  H HH11 . ARG A 1 44 ? -7.650  -26.253 -4.248  1.00 0.00 ? 44 ARG A HH11 9  
ATOM 5430  H HH12 . ARG A 1 44 ? -8.335  -24.720 -4.740  1.00 0.00 ? 44 ARG A HH12 9  
ATOM 5431  H HH21 . ARG A 1 44 ? -5.690  -22.807 -3.435  1.00 0.00 ? 44 ARG A HH21 9  
ATOM 5432  H HH22 . ARG A 1 44 ? -7.223  -22.765 -4.278  1.00 0.00 ? 44 ARG A HH22 9  
ATOM 5433  N N    . LYS A 1 45 ? -2.041  -29.979 -4.360  1.00 0.00 ? 45 LYS A N    9  
ATOM 5434  C CA   . LYS A 1 45 ? -0.779  -29.789 -5.070  1.00 0.00 ? 45 LYS A CA   9  
ATOM 5435  C C    . LYS A 1 45 ? -0.907  -30.244 -6.514  1.00 0.00 ? 45 LYS A C    9  
ATOM 5436  O O    . LYS A 1 45 ? -0.488  -29.551 -7.439  1.00 0.00 ? 45 LYS A O    9  
ATOM 5437  C CB   . LYS A 1 45 ? 0.337   -30.598 -4.405  1.00 0.00 ? 45 LYS A CB   9  
ATOM 5438  C CG   . LYS A 1 45 ? 1.702   -30.418 -5.049  1.00 0.00 ? 45 LYS A CG   9  
ATOM 5439  C CD   . LYS A 1 45 ? 2.770   -31.203 -4.307  1.00 0.00 ? 45 LYS A CD   9  
ATOM 5440  C CE   . LYS A 1 45 ? 4.133   -31.035 -4.959  1.00 0.00 ? 45 LYS A CE   9  
ATOM 5441  N NZ   . LYS A 1 45 ? 5.193   -31.790 -4.235  1.00 0.00 ? 45 LYS A NZ   9  
ATOM 5442  H H    . LYS A 1 45 ? -2.104  -30.733 -3.691  1.00 0.00 ? 45 LYS A H    9  
ATOM 5443  H HA   . LYS A 1 45 ? -0.520  -28.730 -5.046  1.00 0.00 ? 45 LYS A HA   9  
ATOM 5444  H HB2  . LYS A 1 45 ? 0.407   -30.290 -3.362  1.00 0.00 ? 45 LYS A HB2  9  
ATOM 5445  H HB3  . LYS A 1 45 ? 0.071   -31.653 -4.455  1.00 0.00 ? 45 LYS A HB3  9  
ATOM 5446  H HG2  . LYS A 1 45 ? 1.656   -30.767 -6.080  1.00 0.00 ? 45 LYS A HG2  9  
ATOM 5447  H HG3  . LYS A 1 45 ? 1.964   -29.360 -5.035  1.00 0.00 ? 45 LYS A HG3  9  
ATOM 5448  H HD2  . LYS A 1 45 ? 2.822   -30.846 -3.278  1.00 0.00 ? 45 LYS A HD2  9  
ATOM 5449  H HD3  . LYS A 1 45 ? 2.501   -32.259 -4.312  1.00 0.00 ? 45 LYS A HD3  9  
ATOM 5450  H HE2  . LYS A 1 45 ? 4.080   -31.396 -5.986  1.00 0.00 ? 45 LYS A HE2  9  
ATOM 5451  H HE3  . LYS A 1 45 ? 4.394   -29.976 -4.964  1.00 0.00 ? 45 LYS A HE3  9  
ATOM 5452  H HZ1  . LYS A 1 45 ? 6.082   -31.656 -4.695  1.00 0.00 ? 45 LYS A HZ1  9  
ATOM 5453  H HZ2  . LYS A 1 45 ? 5.253   -31.455 -3.284  1.00 0.00 ? 45 LYS A HZ2  9  
ATOM 5454  H HZ3  . LYS A 1 45 ? 4.962   -32.773 -4.232  1.00 0.00 ? 45 LYS A HZ3  9  
ATOM 5455  N N    . ALA A 1 46 ? -1.494  -31.424 -6.695  1.00 0.00 ? 46 ALA A N    9  
ATOM 5456  C CA   . ALA A 1 46 ? -1.693  -32.002 -8.021  1.00 0.00 ? 46 ALA A CA   9  
ATOM 5457  C C    . ALA A 1 46 ? -2.390  -33.349 -7.897  1.00 0.00 ? 46 ALA A C    9  
ATOM 5458  O O    . ALA A 1 46 ? -2.696  -33.794 -6.793  1.00 0.00 ? 46 ALA A O    9  
ATOM 5459  C CB   . ALA A 1 46 ? -0.344  -32.152 -8.717  1.00 0.00 ? 46 ALA A CB   9  
ATOM 5460  H H    . ALA A 1 46 ? -1.817  -31.947 -5.894  1.00 0.00 ? 46 ALA A H    9  
ATOM 5461  H HA   . ALA A 1 46 ? -2.322  -31.331 -8.607  1.00 0.00 ? 46 ALA A HA   9  
ATOM 5462  H HB1  . ALA A 1 46 ? -0.495  -32.570 -9.713  1.00 0.00 ? 46 ALA A HB1  9  
ATOM 5463  H HB2  . ALA A 1 46 ? 0.133   -31.176 -8.801  1.00 0.00 ? 46 ALA A HB2  9  
ATOM 5464  H HB3  . ALA A 1 46 ? 0.293   -32.819 -8.136  1.00 0.00 ? 46 ALA A HB3  9  
ATOM 5465  N N    . GLY A 1 1  ? 30.877  -24.423 53.872  1.00 0.00 ? 1  GLY A N    10 
ATOM 5466  C CA   . GLY A 1 1  ? 31.999  -25.340 53.915  1.00 0.00 ? 1  GLY A CA   10 
ATOM 5467  C C    . GLY A 1 1  ? 31.888  -26.351 52.785  1.00 0.00 ? 1  GLY A C    10 
ATOM 5468  O O    . GLY A 1 1  ? 30.944  -26.316 51.998  1.00 0.00 ? 1  GLY A O    10 
ATOM 5469  H H1   . GLY A 1 1  ? 30.184  -24.542 53.147  1.00 0.00 ? 1  GLY A H1   10 
ATOM 5470  H HA2  . GLY A 1 1  ? 32.927  -24.779 53.809  1.00 0.00 ? 1  GLY A HA2  10 
ATOM 5471  H HA3  . GLY A 1 1  ? 32.001  -25.864 54.871  1.00 0.00 ? 1  GLY A HA3  10 
ATOM 5472  N N    . VAL A 1 2  ? 32.867  -27.250 52.720  1.00 0.00 ? 2  VAL A N    10 
ATOM 5473  C CA   . VAL A 1 2  ? 32.906  -28.287 51.694  1.00 0.00 ? 2  VAL A CA   10 
ATOM 5474  C C    . VAL A 1 2  ? 31.803  -29.307 51.925  1.00 0.00 ? 2  VAL A C    10 
ATOM 5475  O O    . VAL A 1 2  ? 31.116  -29.724 50.993  1.00 0.00 ? 2  VAL A O    10 
ATOM 5476  C CB   . VAL A 1 2  ? 34.252  -29.036 51.699  1.00 0.00 ? 2  VAL A CB   10 
ATOM 5477  C CG1  . VAL A 1 2  ? 34.202  -30.227 50.755  1.00 0.00 ? 2  VAL A CG1  10 
ATOM 5478  C CG2  . VAL A 1 2  ? 35.376  -28.115 51.252  1.00 0.00 ? 2  VAL A CG2  10 
ATOM 5479  H H    . VAL A 1 2  ? 33.613  -27.222 53.399  1.00 0.00 ? 2  VAL A H    10 
ATOM 5480  H HA   . VAL A 1 2  ? 32.763  -27.814 50.722  1.00 0.00 ? 2  VAL A HA   10 
ATOM 5481  H HB   . VAL A 1 2  ? 34.455  -29.387 52.711  1.00 0.00 ? 2  VAL A HB   10 
ATOM 5482  H HG11 . VAL A 1 2  ? 35.155  -30.753 50.774  1.00 0.00 ? 2  VAL A HG11 10 
ATOM 5483  H HG12 . VAL A 1 2  ? 33.408  -30.905 51.069  1.00 0.00 ? 2  VAL A HG12 10 
ATOM 5484  H HG13 . VAL A 1 2  ? 34.001  -29.878 49.742  1.00 0.00 ? 2  VAL A HG13 10 
ATOM 5485  H HG21 . VAL A 1 2  ? 36.323  -28.653 51.268  1.00 0.00 ? 2  VAL A HG21 10 
ATOM 5486  H HG22 . VAL A 1 2  ? 35.176  -27.765 50.239  1.00 0.00 ? 2  VAL A HG22 10 
ATOM 5487  H HG23 . VAL A 1 2  ? 35.434  -27.260 51.927  1.00 0.00 ? 2  VAL A HG23 10 
ATOM 5488  N N    . ILE A 1 3  ? 31.642  -29.705 53.184  1.00 0.00 ? 3  ILE A N    10 
ATOM 5489  C CA   . ILE A 1 3  ? 30.626  -30.678 53.571  1.00 0.00 ? 3  ILE A CA   10 
ATOM 5490  C C    . ILE A 1 3  ? 29.233  -30.106 53.363  1.00 0.00 ? 3  ILE A C    10 
ATOM 5491  O O    . ILE A 1 3  ? 28.320  -30.800 52.919  1.00 0.00 ? 3  ILE A O    10 
ATOM 5492  C CB   . ILE A 1 3  ? 30.758  -31.073 55.054  1.00 0.00 ? 3  ILE A CB   10 
ATOM 5493  C CG1  . ILE A 1 3  ? 32.059  -31.844 55.286  1.00 0.00 ? 3  ILE A CG1  10 
ATOM 5494  C CG2  . ILE A 1 3  ? 29.593  -31.955 55.476  1.00 0.00 ? 3  ILE A CG2  10 
ATOM 5495  C CD1  . ILE A 1 3  ? 32.391  -32.056 56.747  1.00 0.00 ? 3  ILE A CD1  10 
ATOM 5496  H H    . ILE A 1 3  ? 32.238  -29.325 53.906  1.00 0.00 ? 3  ILE A H    10 
ATOM 5497  H HA   . ILE A 1 3  ? 30.747  -31.567 52.952  1.00 0.00 ? 3  ILE A HA   10 
ATOM 5498  H HB   . ILE A 1 3  ? 30.762  -30.167 55.661  1.00 0.00 ? 3  ILE A HB   10 
ATOM 5499  H HG12 . ILE A 1 3  ? 31.970  -32.820 54.809  1.00 0.00 ? 3  ILE A HG12 10 
ATOM 5500  H HG13 . ILE A 1 3  ? 32.875  -31.287 54.826  1.00 0.00 ? 3  ILE A HG13 10 
ATOM 5501  H HG21 . ILE A 1 3  ? 29.692  -32.219 56.529  1.00 0.00 ? 3  ILE A HG21 10 
ATOM 5502  H HG22 . ILE A 1 3  ? 28.657  -31.415 55.326  1.00 0.00 ? 3  ILE A HG22 10 
ATOM 5503  H HG23 . ILE A 1 3  ? 29.589  -32.863 54.874  1.00 0.00 ? 3  ILE A HG23 10 
ATOM 5504  H HD11 . ILE A 1 3  ? 33.324  -32.609 56.851  1.00 0.00 ? 3  ILE A HD11 10 
ATOM 5505  H HD12 . ILE A 1 3  ? 32.494  -31.087 57.237  1.00 0.00 ? 3  ILE A HD12 10 
ATOM 5506  H HD13 . ILE A 1 3  ? 31.587  -32.619 57.221  1.00 0.00 ? 3  ILE A HD13 10 
ATOM 5507  N N    . ASP A 1 4  ? 29.083  -28.826 53.691  1.00 0.00 ? 4  ASP A N    10 
ATOM 5508  C CA   . ASP A 1 4  ? 27.808  -28.130 53.551  1.00 0.00 ? 4  ASP A CA   10 
ATOM 5509  C C    . ASP A 1 4  ? 27.255  -28.309 52.146  1.00 0.00 ? 4  ASP A C    10 
ATOM 5510  O O    . ASP A 1 4  ? 26.057  -28.507 51.955  1.00 0.00 ? 4  ASP A O    10 
ATOM 5511  C CB   . ASP A 1 4  ? 27.983  -26.633 53.815  1.00 0.00 ? 4  ASP A CB   10 
ATOM 5512  C CG   . ASP A 1 4  ? 28.236  -26.325 55.277  1.00 0.00 ? 4  ASP A CG   10 
ATOM 5513  O OD1  . ASP A 1 4  ? 28.247  -25.129 55.639  1.00 0.00 ? 4  ASP A OD1  10 
ATOM 5514  O OD2  . ASP A 1 4  ? 28.422  -27.279 56.062  1.00 0.00 ? 4  ASP A OD2  10 
ATOM 5515  H H    . ASP A 1 4  ? 29.871  -28.308 54.051  1.00 0.00 ? 4  ASP A H    10 
ATOM 5516  H HA   . ASP A 1 4  ? 27.102  -28.543 54.272  1.00 0.00 ? 4  ASP A HA   10 
ATOM 5517  H HB2  . ASP A 1 4  ? 28.827  -26.270 53.229  1.00 0.00 ? 4  ASP A HB2  10 
ATOM 5518  H HB3  . ASP A 1 4  ? 27.078  -26.113 53.500  1.00 0.00 ? 4  ASP A HB3  10 
ATOM 5519  H HD2  . ASP A 1 4  ? 28.575  -27.011 56.971  1.00 0.00 ? 4  ASP A HD2  10 
ATOM 5520  N N    . THR A 1 5  ? 28.149  -28.235 51.163  1.00 0.00 ? 5  THR A N    10 
ATOM 5521  C CA   . THR A 1 5  ? 27.778  -28.386 49.759  1.00 0.00 ? 5  THR A CA   10 
ATOM 5522  C C    . THR A 1 5  ? 27.975  -29.824 49.308  1.00 0.00 ? 5  THR A C    10 
ATOM 5523  O O    . THR A 1 5  ? 27.701  -30.175 48.162  1.00 0.00 ? 5  THR A O    10 
ATOM 5524  C CB   . THR A 1 5  ? 28.632  -27.483 48.849  1.00 0.00 ? 5  THR A CB   10 
ATOM 5525  O OG1  . THR A 1 5  ? 30.012  -27.853 48.964  1.00 0.00 ? 5  THR A OG1  10 
ATOM 5526  C CG2  . THR A 1 5  ? 28.478  -26.024 49.250  1.00 0.00 ? 5  THR A CG2  10 
ATOM 5527  H H    . THR A 1 5  ? 29.120  -28.069 51.385  1.00 0.00 ? 5  THR A H    10 
ATOM 5528  H HA   . THR A 1 5  ? 26.728  -28.112 49.649  1.00 0.00 ? 5  THR A HA   10 
ATOM 5529  H HB   . THR A 1 5  ? 28.307  -27.608 47.816  1.00 0.00 ? 5  THR A HB   10 
ATOM 5530  H HG1  . THR A 1 5  ? 30.529  -27.287 48.386  1.00 0.00 ? 5  THR A HG1  10 
ATOM 5531  H HG21 . THR A 1 5  ? 29.085  -25.396 48.598  1.00 0.00 ? 5  THR A HG21 10 
ATOM 5532  H HG22 . THR A 1 5  ? 27.431  -25.732 49.161  1.00 0.00 ? 5  THR A HG22 10 
ATOM 5533  H HG23 . THR A 1 5  ? 28.804  -25.895 50.282  1.00 0.00 ? 5  THR A HG23 10 
ATOM 5534  N N    . SER A 1 6  ? 28.457  -30.654 50.229  1.00 0.00 ? 6  SER A N    10 
ATOM 5535  C CA   . SER A 1 6  ? 28.703  -32.066 49.953  1.00 0.00 ? 6  SER A CA   10 
ATOM 5536  C C    . SER A 1 6  ? 27.494  -32.697 49.281  1.00 0.00 ? 6  SER A C    10 
ATOM 5537  O O    . SER A 1 6  ? 27.579  -33.205 48.164  1.00 0.00 ? 6  SER A O    10 
ATOM 5538  C CB   . SER A 1 6  ? 28.984  -32.825 51.252  1.00 0.00 ? 6  SER A CB   10 
ATOM 5539  O OG   . SER A 1 6  ? 29.216  -34.200 50.999  1.00 0.00 ? 6  SER A OG   10 
ATOM 5540  H H    . SER A 1 6  ? 28.662  -30.305 51.155  1.00 0.00 ? 6  SER A H    10 
ATOM 5541  H HA   . SER A 1 6  ? 29.566  -32.148 49.294  1.00 0.00 ? 6  SER A HA   10 
ATOM 5542  H HB2  . SER A 1 6  ? 29.865  -32.397 51.731  1.00 0.00 ? 6  SER A HB2  10 
ATOM 5543  H HB3  . SER A 1 6  ? 28.125  -32.725 51.916  1.00 0.00 ? 6  SER A HB3  10 
ATOM 5544  H HG   . SER A 1 6  ? 29.388  -34.645 51.832  1.00 0.00 ? 6  SER A HG   10 
ATOM 5545  N N    . ALA A 1 7  ? 26.363  -32.657 49.980  1.00 0.00 ? 7  ALA A N    10 
ATOM 5546  C CA   . ALA A 1 7  ? 25.114  -33.219 49.474  1.00 0.00 ? 7  ALA A CA   10 
ATOM 5547  C C    . ALA A 1 7  ? 24.709  -32.536 48.177  1.00 0.00 ? 7  ALA A C    10 
ATOM 5548  O O    . ALA A 1 7  ? 24.260  -33.182 47.231  1.00 0.00 ? 7  ALA A O    10 
ATOM 5549  C CB   . ALA A 1 7  ? 23.997  -33.027 50.488  1.00 0.00 ? 7  ALA A CB   10 
ATOM 5550  H H    . ALA A 1 7  ? 26.356  -32.226 50.894  1.00 0.00 ? 7  ALA A H    10 
ATOM 5551  H HA   . ALA A 1 7  ? 25.257  -34.284 49.292  1.00 0.00 ? 7  ALA A HA   10 
ATOM 5552  H HB1  . ALA A 1 7  ? 23.073  -33.462 50.107  1.00 0.00 ? 7  ALA A HB1  10 
ATOM 5553  H HB2  . ALA A 1 7  ? 24.268  -33.516 51.423  1.00 0.00 ? 7  ALA A HB2  10 
ATOM 5554  H HB3  . ALA A 1 7  ? 23.847  -31.961 50.666  1.00 0.00 ? 7  ALA A HB3  10 
ATOM 5555  N N    . VAL A 1 8  ? 24.876  -31.217 48.146  1.00 0.00 ? 8  VAL A N    10 
ATOM 5556  C CA   . VAL A 1 8  ? 24.536  -30.415 46.974  1.00 0.00 ? 8  VAL A CA   10 
ATOM 5557  C C    . VAL A 1 8  ? 25.398  -30.815 45.788  1.00 0.00 ? 8  VAL A C    10 
ATOM 5558  O O    . VAL A 1 8  ? 24.918  -30.920 44.660  1.00 0.00 ? 8  VAL A O    10 
ATOM 5559  C CB   . VAL A 1 8  ? 24.756  -28.913 47.235  1.00 0.00 ? 8  VAL A CB   10 
ATOM 5560  C CG1  . VAL A 1 8  ? 24.598  -28.120 45.946  1.00 0.00 ? 8  VAL A CG1  10 
ATOM 5561  C CG2  . VAL A 1 8  ? 23.745  -28.394 48.245  1.00 0.00 ? 8  VAL A CG2  10 
ATOM 5562  H H    . VAL A 1 8  ? 25.250  -30.743 48.956  1.00 0.00 ? 8  VAL A H    10 
ATOM 5563  H HA   . VAL A 1 8  ? 23.486  -30.585 46.732  1.00 0.00 ? 8  VAL A HA   10 
ATOM 5564  H HB   . VAL A 1 8  ? 25.762  -28.766 47.626  1.00 0.00 ? 8  VAL A HB   10 
ATOM 5565  H HG11 . VAL A 1 8  ? 24.764  -27.060 46.141  1.00 0.00 ? 8  VAL A HG11 10 
ATOM 5566  H HG12 . VAL A 1 8  ? 25.324  -28.470 45.213  1.00 0.00 ? 8  VAL A HG12 10 
ATOM 5567  H HG13 . VAL A 1 8  ? 23.590  -28.261 45.555  1.00 0.00 ? 8  VAL A HG13 10 
ATOM 5568  H HG21 . VAL A 1 8  ? 23.916  -27.333 48.428  1.00 0.00 ? 8  VAL A HG21 10 
ATOM 5569  H HG22 . VAL A 1 8  ? 22.737  -28.535 47.854  1.00 0.00 ? 8  VAL A HG22 10 
ATOM 5570  H HG23 . VAL A 1 8  ? 23.852  -28.943 49.180  1.00 0.00 ? 8  VAL A HG23 10 
ATOM 5571  N N    . GLU A 1 9  ? 26.681  -31.038 46.058  1.00 0.00 ? 9  GLU A N    10 
ATOM 5572  C CA   . GLU A 1 9  ? 27.639  -31.430 45.028  1.00 0.00 ? 9  GLU A CA   10 
ATOM 5573  C C    . GLU A 1 9  ? 27.181  -32.701 44.331  1.00 0.00 ? 9  GLU A C    10 
ATOM 5574  O O    . GLU A 1 9  ? 27.322  -32.847 43.118  1.00 0.00 ? 9  GLU A O    10 
ATOM 5575  C CB   . GLU A 1 9  ? 29.015  -31.686 45.646  1.00 0.00 ? 9  GLU A CB   10 
ATOM 5576  C CG   . GLU A 1 9  ? 30.095  -32.033 44.634  1.00 0.00 ? 9  GLU A CG   10 
ATOM 5577  C CD   . GLU A 1 9  ? 31.454  -32.230 45.276  1.00 0.00 ? 9  GLU A CD   10 
ATOM 5578  O OE1  . GLU A 1 9  ? 31.550  -32.097 46.514  1.00 0.00 ? 9  GLU A OE1  10 
ATOM 5579  O OE2  . GLU A 1 9  ? 32.422  -32.518 44.542  1.00 0.00 ? 9  GLU A OE2  10 
ATOM 5580  H H    . GLU A 1 9  ? 27.014  -30.936 47.006  1.00 0.00 ? 9  GLU A H    10 
ATOM 5581  H HA   . GLU A 1 9  ? 27.716  -30.624 44.298  1.00 0.00 ? 9  GLU A HA   10 
ATOM 5582  H HB2  . GLU A 1 9  ? 29.322  -30.787 46.181  1.00 0.00 ? 9  GLU A HB2  10 
ATOM 5583  H HB3  . GLU A 1 9  ? 28.926  -32.514 46.349  1.00 0.00 ? 9  GLU A HB3  10 
ATOM 5584  H HG2  . GLU A 1 9  ? 29.812  -32.953 44.122  1.00 0.00 ? 9  GLU A HG2  10 
ATOM 5585  H HG3  . GLU A 1 9  ? 30.165  -31.224 43.906  1.00 0.00 ? 9  GLU A HG3  10 
ATOM 5586  H HE2  . GLU A 1 9  ? 33.250  -32.628 45.015  1.00 0.00 ? 9  GLU A HE2  10 
ATOM 5587  N N    . SER A 1 10 ? 26.629  -33.620 45.117  1.00 0.00 ? 10 SER A N    10 
ATOM 5588  C CA   . SER A 1 10 ? 26.138  -34.895 44.601  1.00 0.00 ? 10 SER A CA   10 
ATOM 5589  C C    . SER A 1 10 ? 24.752  -34.728 44.000  1.00 0.00 ? 10 SER A C    10 
ATOM 5590  O O    . SER A 1 10 ? 24.481  -35.185 42.891  1.00 0.00 ? 10 SER A O    10 
ATOM 5591  C CB   . SER A 1 10 ? 26.057  -35.932 45.723  1.00 0.00 ? 10 SER A CB   10 
ATOM 5592  O OG   . SER A 1 10 ? 27.341  -36.216 46.250  1.00 0.00 ? 10 SER A OG   10 
ATOM 5593  H H    . SER A 1 10 ? 26.540  -33.440 46.107  1.00 0.00 ? 10 SER A H    10 
ATOM 5594  H HA   . SER A 1 10 ? 26.824  -35.249 43.832  1.00 0.00 ? 10 SER A HA   10 
ATOM 5595  H HB2  . SER A 1 10 ? 25.423  -35.544 46.521  1.00 0.00 ? 10 SER A HB2  10 
ATOM 5596  H HB3  . SER A 1 10 ? 25.624  -36.850 45.328  1.00 0.00 ? 10 SER A HB3  10 
ATOM 5597  H HG   . SER A 1 10 ? 27.253  -36.867 46.949  1.00 0.00 ? 10 SER A HG   10 
ATOM 5598  N N    . ALA A 1 11 ? 23.877  -34.065 44.751  1.00 0.00 ? 11 ALA A N    10 
ATOM 5599  C CA   . ALA A 1 11 ? 22.505  -33.820 44.316  1.00 0.00 ? 11 ALA A CA   10 
ATOM 5600  C C    . ALA A 1 11 ? 22.484  -32.883 43.120  1.00 0.00 ? 11 ALA A C    10 
ATOM 5601  O O    . ALA A 1 11 ? 21.696  -33.055 42.191  1.00 0.00 ? 11 ALA A O    10 
ATOM 5602  C CB   . ALA A 1 11 ? 21.698  -33.186 45.439  1.00 0.00 ? 11 ALA A CB   10 
ATOM 5603  H H    . ALA A 1 11 ? 24.160  -33.715 45.655  1.00 0.00 ? 11 ALA A H    10 
ATOM 5604  H HA   . ALA A 1 11 ? 22.051  -34.771 44.038  1.00 0.00 ? 11 ALA A HA   10 
ATOM 5605  H HB1  . ALA A 1 11 ? 20.672  -33.021 45.109  1.00 0.00 ? 11 ALA A HB1  10 
ATOM 5606  H HB2  . ALA A 1 11 ? 21.697  -33.849 46.304  1.00 0.00 ? 11 ALA A HB2  10 
ATOM 5607  H HB3  . ALA A 1 11 ? 22.147  -32.231 45.714  1.00 0.00 ? 11 ALA A HB3  10 
ATOM 5608  N N    . ILE A 1 12 ? 23.362  -31.885 43.156  1.00 0.00 ? 12 ILE A N    10 
ATOM 5609  C CA   . ILE A 1 12 ? 23.469  -30.900 42.085  1.00 0.00 ? 12 ILE A CA   10 
ATOM 5610  C C    . ILE A 1 12 ? 23.984  -31.551 40.812  1.00 0.00 ? 12 ILE A C    10 
ATOM 5611  O O    . ILE A 1 12 ? 23.454  -31.329 39.724  1.00 0.00 ? 12 ILE A O    10 
ATOM 5612  C CB   . ILE A 1 12 ? 24.437  -29.762 42.459  1.00 0.00 ? 12 ILE A CB   10 
ATOM 5613  C CG1  . ILE A 1 12 ? 23.867  -28.936 43.615  1.00 0.00 ? 12 ILE A CG1  10 
ATOM 5614  C CG2  . ILE A 1 12 ? 24.659  -28.839 41.271  1.00 0.00 ? 12 ILE A CG2  10 
ATOM 5615  C CD1  . ILE A 1 12 ? 22.543  -28.277 43.299  1.00 0.00 ? 12 ILE A CD1  10 
ATOM 5616  H H    . ILE A 1 12 ? 23.982  -31.796 43.948  1.00 0.00 ? 12 ILE A H    10 
ATOM 5617  H HA   . ILE A 1 12 ? 22.479  -30.481 41.902  1.00 0.00 ? 12 ILE A HA   10 
ATOM 5618  H HB   . ILE A 1 12 ? 25.390  -30.194 42.761  1.00 0.00 ? 12 ILE A HB   10 
ATOM 5619  H HG12 . ILE A 1 12 ? 23.726  -29.594 44.472  1.00 0.00 ? 12 ILE A HG12 10 
ATOM 5620  H HG13 . ILE A 1 12 ? 24.586  -28.157 43.869  1.00 0.00 ? 12 ILE A HG13 10 
ATOM 5621  H HG21 . ILE A 1 12 ? 25.352  -28.044 41.545  1.00 0.00 ? 12 ILE A HG21 10 
ATOM 5622  H HG22 . ILE A 1 12 ? 25.074  -29.410 40.441  1.00 0.00 ? 12 ILE A HG22 10 
ATOM 5623  H HG23 . ILE A 1 12 ? 23.707  -28.400 40.970  1.00 0.00 ? 12 ILE A HG23 10 
ATOM 5624  H HD11 . ILE A 1 12 ? 22.186  -27.705 44.156  1.00 0.00 ? 12 ILE A HD11 10 
ATOM 5625  H HD12 . ILE A 1 12 ? 22.668  -27.605 42.450  1.00 0.00 ? 12 ILE A HD12 10 
ATOM 5626  H HD13 . ILE A 1 12 ? 21.809  -29.043 43.051  1.00 0.00 ? 12 ILE A HD13 10 
ATOM 5627  N N    . THR A 1 13 ? 25.028  -32.362 40.963  1.00 0.00 ? 13 THR A N    10 
ATOM 5628  C CA   . THR A 1 13 ? 25.640  -33.064 39.838  1.00 0.00 ? 13 THR A CA   10 
ATOM 5629  C C    . THR A 1 13 ? 24.660  -34.055 39.232  1.00 0.00 ? 13 THR A C    10 
ATOM 5630  O O    . THR A 1 13 ? 24.551  -34.178 38.013  1.00 0.00 ? 13 THR A O    10 
ATOM 5631  C CB   . THR A 1 13 ? 26.894  -33.845 40.274  1.00 0.00 ? 13 THR A CB   10 
ATOM 5632  O OG1  . THR A 1 13 ? 27.876  -32.933 40.781  1.00 0.00 ? 13 THR A OG1  10 
ATOM 5633  C CG2  . THR A 1 13 ? 27.487  -34.602 39.096  1.00 0.00 ? 13 THR A CG2  10 
ATOM 5634  H H    . THR A 1 13 ? 25.418  -32.504 41.884  1.00 0.00 ? 13 THR A H    10 
ATOM 5635  H HA   . THR A 1 13 ? 25.922  -32.327 39.085  1.00 0.00 ? 13 THR A HA   10 
ATOM 5636  H HB   . THR A 1 13 ? 26.619  -34.553 41.055  1.00 0.00 ? 13 THR A HB   10 
ATOM 5637  H HG1  . THR A 1 13 ? 28.647  -33.434 41.056  1.00 0.00 ? 13 THR A HG1  10 
ATOM 5638  H HG21 . THR A 1 13 ? 28.371  -35.151 39.418  1.00 0.00 ? 13 THR A HG21 10 
ATOM 5639  H HG22 . THR A 1 13 ? 26.748  -35.302 38.707  1.00 0.00 ? 13 THR A HG22 10 
ATOM 5640  H HG23 . THR A 1 13 ? 27.765  -33.895 38.314  1.00 0.00 ? 13 THR A HG23 10 
ATOM 5641  N N    . ASP A 1 14 ? 23.946  -34.764 40.103  1.00 0.00 ? 14 ASP A N    10 
ATOM 5642  C CA   . ASP A 1 14 ? 22.963  -35.757 39.681  1.00 0.00 ? 14 ASP A CA   10 
ATOM 5643  C C    . ASP A 1 14 ? 21.774  -35.081 39.020  1.00 0.00 ? 14 ASP A C    10 
ATOM 5644  O O    . ASP A 1 14 ? 21.353  -35.459 37.928  1.00 0.00 ? 14 ASP A O    10 
ATOM 5645  C CB   . ASP A 1 14 ? 22.458  -36.556 40.884  1.00 0.00 ? 14 ASP A CB   10 
ATOM 5646  C CG   . ASP A 1 14 ? 23.504  -37.505 41.435  1.00 0.00 ? 14 ASP A CG   10 
ATOM 5647  O OD1  . ASP A 1 14 ? 23.166  -38.308 42.329  1.00 0.00 ? 14 ASP A OD1  10 
ATOM 5648  O OD2  . ASP A 1 14 ? 24.663  -37.445 40.971  1.00 0.00 ? 14 ASP A OD2  10 
ATOM 5649  H H    . ASP A 1 14 ? 24.081  -34.618 41.093  1.00 0.00 ? 14 ASP A H    10 
ATOM 5650  H HA   . ASP A 1 14 ? 23.434  -36.435 38.970  1.00 0.00 ? 14 ASP A HA   10 
ATOM 5651  H HB2  . ASP A 1 14 ? 22.168  -35.859 41.671  1.00 0.00 ? 14 ASP A HB2  10 
ATOM 5652  H HB3  . ASP A 1 14 ? 21.586  -37.135 40.579  1.00 0.00 ? 14 ASP A HB3  10 
ATOM 5653  H HD2  . ASP A 1 14 ? 25.273  -38.073 41.364  1.00 0.00 ? 14 ASP A HD2  10 
ATOM 5654  N N    . GLY A 1 15 ? 21.236  -34.071 39.698  1.00 0.00 ? 15 GLY A N    10 
ATOM 5655  C CA   . GLY A 1 15 ? 20.089  -33.318 39.198  1.00 0.00 ? 15 GLY A CA   10 
ATOM 5656  C C    . GLY A 1 15 ? 20.541  -32.243 38.223  1.00 0.00 ? 15 GLY A C    10 
ATOM 5657  O O    . GLY A 1 15 ? 20.261  -32.311 37.027  1.00 0.00 ? 15 GLY A O    10 
ATOM 5658  H H    . GLY A 1 15 ? 21.626  -33.807 40.591  1.00 0.00 ? 15 GLY A H    10 
ATOM 5659  H HA2  . GLY A 1 15 ? 19.405  -33.999 38.691  1.00 0.00 ? 15 GLY A HA2  10 
ATOM 5660  H HA3  . GLY A 1 15 ? 19.574  -32.849 40.036  1.00 0.00 ? 15 GLY A HA3  10 
ATOM 5661  N N    . GLN A 1 16 ? 21.245  -31.247 38.752  1.00 0.00 ? 16 GLN A N    10 
ATOM 5662  C CA   . GLN A 1 16 ? 21.752  -30.138 37.950  1.00 0.00 ? 16 GLN A CA   10 
ATOM 5663  C C    . GLN A 1 16 ? 22.462  -30.658 36.710  1.00 0.00 ? 16 GLN A C    10 
ATOM 5664  O O    . GLN A 1 16 ? 22.140  -30.278 35.586  1.00 0.00 ? 16 GLN A O    10 
ATOM 5665  C CB   . GLN A 1 16 ? 22.744  -29.301 38.760  1.00 0.00 ? 16 GLN A CB   10 
ATOM 5666  C CG   . GLN A 1 16 ? 23.292  -28.095 38.014  1.00 0.00 ? 16 GLN A CG   10 
ATOM 5667  C CD   . GLN A 1 16 ? 22.219  -27.076 37.686  1.00 0.00 ? 16 GLN A CD   10 
ATOM 5668  O OE1  . GLN A 1 16 ? 21.505  -26.605 38.572  1.00 0.00 ? 16 GLN A OE1  10 
ATOM 5669  N NE2  . GLN A 1 16 ? 22.101  -26.732 36.409  1.00 0.00 ? 16 GLN A NE2  10 
ATOM 5670  H H    . GLN A 1 16 ? 21.441  -31.247 39.743  1.00 0.00 ? 16 GLN A H    10 
ATOM 5671  H HA   . GLN A 1 16 ? 20.912  -29.511 37.650  1.00 0.00 ? 16 GLN A HA   10 
ATOM 5672  H HB2  . GLN A 1 16 ? 22.239  -28.947 39.659  1.00 0.00 ? 16 GLN A HB2  10 
ATOM 5673  H HB3  . GLN A 1 16 ? 23.581  -29.939 39.041  1.00 0.00 ? 16 GLN A HB3  10 
ATOM 5674  H HG2  . GLN A 1 16 ? 24.052  -27.616 38.631  1.00 0.00 ? 16 GLN A HG2  10 
ATOM 5675  H HG3  . GLN A 1 16 ? 23.747  -28.435 37.084  1.00 0.00 ? 16 GLN A HG3  10 
ATOM 5676  H HE21 . GLN A 1 16 ? 22.709  -27.146 35.718  1.00 0.00 ? 16 GLN A HE21 10 
ATOM 5677  H HE22 . GLN A 1 16 ? 21.402  -26.057 36.131  1.00 0.00 ? 16 GLN A HE22 10 
ATOM 5678  N N    . GLY A 1 17 ? 23.435  -31.537 36.932  1.00 0.00 ? 17 GLY A N    10 
ATOM 5679  C CA   . GLY A 1 17 ? 24.212  -32.130 35.847  1.00 0.00 ? 17 GLY A CA   10 
ATOM 5680  C C    . GLY A 1 17 ? 23.289  -32.707 34.785  1.00 0.00 ? 17 GLY A C    10 
ATOM 5681  O O    . GLY A 1 17 ? 23.473  -32.478 33.591  1.00 0.00 ? 17 GLY A O    10 
ATOM 5682  H H    . GLY A 1 17 ? 23.652  -31.810 37.880  1.00 0.00 ? 17 GLY A H    10 
ATOM 5683  H HA2  . GLY A 1 17 ? 24.843  -31.364 35.397  1.00 0.00 ? 17 GLY A HA2  10 
ATOM 5684  H HA3  . GLY A 1 17 ? 24.840  -32.925 36.248  1.00 0.00 ? 17 GLY A HA3  10 
ATOM 5685  N N    . ASP A 1 18 ? 22.291  -33.460 35.238  1.00 0.00 ? 18 ASP A N    10 
ATOM 5686  C CA   . ASP A 1 18 ? 21.319  -34.086 34.346  1.00 0.00 ? 18 ASP A CA   10 
ATOM 5687  C C    . ASP A 1 18 ? 20.653  -33.039 33.467  1.00 0.00 ? 18 ASP A C    10 
ATOM 5688  O O    . ASP A 1 18 ? 20.003  -33.362 32.474  1.00 0.00 ? 18 ASP A O    10 
ATOM 5689  C CB   . ASP A 1 18 ? 20.234  -34.802 35.153  1.00 0.00 ? 18 ASP A CB   10 
ATOM 5690  C CG   . ASP A 1 18 ? 20.750  -36.047 35.847  1.00 0.00 ? 18 ASP A CG   10 
ATOM 5691  O OD1  . ASP A 1 18 ? 20.005  -37.048 35.902  1.00 0.00 ? 18 ASP A OD1  10 
ATOM 5692  O OD2  . ASP A 1 18 ? 21.899  -36.021 36.336  1.00 0.00 ? 18 ASP A OD2  10 
ATOM 5693  H H    . ASP A 1 18 ? 22.192  -33.611 36.232  1.00 0.00 ? 18 ASP A H    10 
ATOM 5694  H HA   . ASP A 1 18 ? 21.836  -34.810 33.717  1.00 0.00 ? 18 ASP A HA   10 
ATOM 5695  H HB2  . ASP A 1 18 ? 19.847  -34.115 35.907  1.00 0.00 ? 18 ASP A HB2  10 
ATOM 5696  H HB3  . ASP A 1 18 ? 19.426  -35.086 34.479  1.00 0.00 ? 18 ASP A HB3  10 
ATOM 5697  H HD2  . ASP A 1 18 ? 22.160  -36.841 36.760  1.00 0.00 ? 18 ASP A HD2  10 
ATOM 5698  N N    . MET A 1 19 ? 20.824  -31.776 33.846  1.00 0.00 ? 19 MET A N    10 
ATOM 5699  C CA   . MET A 1 19 ? 20.250  -30.655 33.109  1.00 0.00 ? 19 MET A CA   10 
ATOM 5700  C C    . MET A 1 19 ? 20.858  -30.564 31.719  1.00 0.00 ? 19 MET A C    10 
ATOM 5701  O O    . MET A 1 19 ? 20.159  -30.335 30.733  1.00 0.00 ? 19 MET A O    10 
ATOM 5702  C CB   . MET A 1 19 ? 20.519  -29.339 33.841  1.00 0.00 ? 19 MET A CB   10 
ATOM 5703  C CG   . MET A 1 19 ? 19.883  -28.123 33.186  1.00 0.00 ? 19 MET A CG   10 
ATOM 5704  S SD   . MET A 1 19 ? 20.211  -26.596 34.087  1.00 0.00 ? 19 MET A SD   10 
ATOM 5705  C CE   . MET A 1 19 ? 19.234  -26.858 35.565  1.00 0.00 ? 19 MET A CE   10 
ATOM 5706  H H    . MET A 1 19 ? 21.367  -31.574 34.673  1.00 0.00 ? 19 MET A H    10 
ATOM 5707  H HA   . MET A 1 19 ? 19.173  -30.806 33.024  1.00 0.00 ? 19 MET A HA   10 
ATOM 5708  H HB2  . MET A 1 19 ? 20.129  -29.425 34.855  1.00 0.00 ? 19 MET A HB2  10 
ATOM 5709  H HB3  . MET A 1 19 ? 21.597  -29.182 33.879  1.00 0.00 ? 19 MET A HB3  10 
ATOM 5710  H HG2  . MET A 1 19 ? 20.273  -28.023 32.173  1.00 0.00 ? 19 MET A HG2  10 
ATOM 5711  H HG3  . MET A 1 19 ? 18.804  -28.274 33.132  1.00 0.00 ? 19 MET A HG3  10 
ATOM 5712  H HE1  . MET A 1 19 ? 19.328  -25.999 36.231  1.00 0.00 ? 19 MET A HE1  10 
ATOM 5713  H HE2  . MET A 1 19 ? 18.187  -26.986 35.289  1.00 0.00 ? 19 MET A HE2  10 
ATOM 5714  H HE3  . MET A 1 19 ? 19.586  -27.752 36.078  1.00 0.00 ? 19 MET A HE3  10 
ATOM 5715  N N    . LYS A 1 20 ? 22.173  -30.747 31.654  1.00 0.00 ? 20 LYS A N    10 
ATOM 5716  C CA   . LYS A 1 20 ? 22.907  -30.691 30.393  1.00 0.00 ? 20 LYS A CA   10 
ATOM 5717  C C    . LYS A 1 20 ? 22.354  -31.711 29.410  1.00 0.00 ? 20 LYS A C    10 
ATOM 5718  O O    . LYS A 1 20 ? 22.198  -31.430 28.223  1.00 0.00 ? 20 LYS A O    10 
ATOM 5719  C CB   . LYS A 1 20 ? 24.389  -30.994 30.622  1.00 0.00 ? 20 LYS A CB   10 
ATOM 5720  C CG   . LYS A 1 20 ? 25.243  -30.896 29.368  1.00 0.00 ? 20 LYS A CG   10 
ATOM 5721  C CD   . LYS A 1 20 ? 26.709  -31.153 29.678  1.00 0.00 ? 20 LYS A CD   10 
ATOM 5722  C CE   . LYS A 1 20 ? 27.561  -31.070 28.422  1.00 0.00 ? 20 LYS A CE   10 
ATOM 5723  N NZ   . LYS A 1 20 ? 29.002  -31.307 28.712  1.00 0.00 ? 20 LYS A NZ   10 
ATOM 5724  H H    . LYS A 1 20 ? 22.692  -30.931 32.500  1.00 0.00 ? 20 LYS A H    10 
ATOM 5725  H HA   . LYS A 1 20 ? 22.804  -29.690 29.972  1.00 0.00 ? 20 LYS A HA   10 
ATOM 5726  H HB2  . LYS A 1 20 ? 24.774  -30.284 31.355  1.00 0.00 ? 20 LYS A HB2  10 
ATOM 5727  H HB3  . LYS A 1 20 ? 24.474  -32.006 31.016  1.00 0.00 ? 20 LYS A HB3  10 
ATOM 5728  H HG2  . LYS A 1 20 ? 24.898  -31.634 28.645  1.00 0.00 ? 20 LYS A HG2  10 
ATOM 5729  H HG3  . LYS A 1 20 ? 25.139  -29.897 28.945  1.00 0.00 ? 20 LYS A HG3  10 
ATOM 5730  H HD2  . LYS A 1 20 ? 27.057  -30.407 30.393  1.00 0.00 ? 20 LYS A HD2  10 
ATOM 5731  H HD3  . LYS A 1 20 ? 26.811  -32.147 30.112  1.00 0.00 ? 20 LYS A HD3  10 
ATOM 5732  H HE2  . LYS A 1 20 ? 27.215  -31.819 27.710  1.00 0.00 ? 20 LYS A HE2  10 
ATOM 5733  H HE3  . LYS A 1 20 ? 27.447  -30.079 27.982  1.00 0.00 ? 20 LYS A HE3  10 
ATOM 5734  H HZ1  . LYS A 1 20 ? 29.536  -31.244 27.858  1.00 0.00 ? 20 LYS A HZ1  10 
ATOM 5735  H HZ2  . LYS A 1 20 ? 29.331  -30.611 29.365  1.00 0.00 ? 20 LYS A HZ2  10 
ATOM 5736  H HZ3  . LYS A 1 20 ? 29.117  -32.226 29.113  1.00 0.00 ? 20 LYS A HZ3  10 
ATOM 5737  N N    . ALA A 1 21 ? 22.059  -32.902 29.923  1.00 0.00 ? 21 ALA A N    10 
ATOM 5738  C CA   . ALA A 1 21 ? 21.520  -33.989 29.111  1.00 0.00 ? 21 ALA A CA   10 
ATOM 5739  C C    . ALA A 1 21 ? 20.109  -33.662 28.653  1.00 0.00 ? 21 ALA A C    10 
ATOM 5740  O O    . ALA A 1 21 ? 19.738  -33.910 27.507  1.00 0.00 ? 21 ALA A O    10 
ATOM 5741  C CB   . ALA A 1 21 ? 21.479  -35.280 29.914  1.00 0.00 ? 21 ALA A CB   10 
ATOM 5742  H H    . ALA A 1 21 ? 22.210  -33.071 30.907  1.00 0.00 ? 21 ALA A H    10 
ATOM 5743  H HA   . ALA A 1 21 ? 22.160  -34.125 28.240  1.00 0.00 ? 21 ALA A HA   10 
ATOM 5744  H HB1  . ALA A 1 21 ? 21.089  -36.088 29.295  1.00 0.00 ? 21 ALA A HB1  10 
ATOM 5745  H HB2  . ALA A 1 21 ? 22.486  -35.532 30.246  1.00 0.00 ? 21 ALA A HB2  10 
ATOM 5746  H HB3  . ALA A 1 21 ? 20.833  -35.146 30.782  1.00 0.00 ? 21 ALA A HB3  10 
ATOM 5747  N N    . ILE A 1 22 ? 19.323  -33.099 29.568  1.00 0.00 ? 22 ILE A N    10 
ATOM 5748  C CA   . ILE A 1 22 ? 17.941  -32.725 29.285  1.00 0.00 ? 22 ILE A CA   10 
ATOM 5749  C C    . ILE A 1 22 ? 17.890  -31.638 28.223  1.00 0.00 ? 22 ILE A C    10 
ATOM 5750  O O    . ILE A 1 22 ? 17.149  -31.737 27.247  1.00 0.00 ? 22 ILE A O    10 
ATOM 5751  C CB   . ILE A 1 22 ? 17.232  -32.191 30.543  1.00 0.00 ? 22 ILE A CB   10 
ATOM 5752  C CG1  . ILE A 1 22 ? 17.056  -33.310 31.572  1.00 0.00 ? 22 ILE A CG1  10 
ATOM 5753  C CG2  . ILE A 1 22 ? 15.858  -31.642 30.188  1.00 0.00 ? 22 ILE A CG2  10 
ATOM 5754  C CD1  . ILE A 1 22 ? 16.594  -32.825 32.929  1.00 0.00 ? 22 ILE A CD1  10 
ATOM 5755  H H    . ILE A 1 22 ? 19.685  -32.918 30.493  1.00 0.00 ? 22 ILE A H    10 
ATOM 5756  H HA   . ILE A 1 22 ? 17.412  -33.607 28.925  1.00 0.00 ? 22 ILE A HA   10 
ATOM 5757  H HB   . ILE A 1 22 ? 17.836  -31.394 30.977  1.00 0.00 ? 22 ILE A HB   10 
ATOM 5758  H HG12 . ILE A 1 22 ? 16.318  -34.015 31.190  1.00 0.00 ? 22 ILE A HG12 10 
ATOM 5759  H HG13 . ILE A 1 22 ? 18.013  -33.816 31.696  1.00 0.00 ? 22 ILE A HG13 10 
ATOM 5760  H HG21 . ILE A 1 22 ? 15.370  -31.257 31.084  1.00 0.00 ? 22 ILE A HG21 10 
ATOM 5761  H HG22 . ILE A 1 22 ? 15.966  -30.835 29.462  1.00 0.00 ? 22 ILE A HG22 10 
ATOM 5762  H HG23 . ILE A 1 22 ? 15.249  -32.437 29.759  1.00 0.00 ? 22 ILE A HG23 10 
ATOM 5763  H HD11 . ILE A 1 22 ? 16.485  -33.662 33.618  1.00 0.00 ? 22 ILE A HD11 10 
ATOM 5764  H HD12 . ILE A 1 22 ? 17.327  -32.125 33.330  1.00 0.00 ? 22 ILE A HD12 10 
ATOM 5765  H HD13 . ILE A 1 22 ? 15.632  -32.322 32.824  1.00 0.00 ? 22 ILE A HD13 10 
ATOM 5766  N N    . GLY A 1 23 ? 18.691  -30.597 28.427  1.00 0.00 ? 23 GLY A N    10 
ATOM 5767  C CA   . GLY A 1 23 ? 18.760  -29.471 27.499  1.00 0.00 ? 23 GLY A CA   10 
ATOM 5768  C C    . GLY A 1 23 ? 19.347  -29.914 26.168  1.00 0.00 ? 23 GLY A C    10 
ATOM 5769  O O    . GLY A 1 23 ? 18.848  -29.556 25.102  1.00 0.00 ? 23 GLY A O    10 
ATOM 5770  H H    . GLY A 1 23 ? 19.276  -30.573 29.250  1.00 0.00 ? 23 GLY A H    10 
ATOM 5771  H HA2  . GLY A 1 23 ? 17.756  -29.077 27.336  1.00 0.00 ? 23 GLY A HA2  10 
ATOM 5772  H HA3  . GLY A 1 23 ? 19.388  -28.690 27.927  1.00 0.00 ? 23 GLY A HA3  10 
ATOM 5773  N N    . GLY A 1 24 ? 20.417  -30.700 26.245  1.00 0.00 ? 24 GLY A N    10 
ATOM 5774  C CA   . GLY A 1 24 ? 21.097  -31.208 25.058  1.00 0.00 ? 24 GLY A CA   10 
ATOM 5775  C C    . GLY A 1 24 ? 20.210  -32.198 24.319  1.00 0.00 ? 24 GLY A C    10 
ATOM 5776  O O    . GLY A 1 24 ? 19.951  -32.052 23.126  1.00 0.00 ? 24 GLY A O    10 
ATOM 5777  H H    . GLY A 1 24 ? 20.779  -30.960 27.151  1.00 0.00 ? 24 GLY A H    10 
ATOM 5778  H HA2  . GLY A 1 24 ? 21.335  -30.375 24.396  1.00 0.00 ? 24 GLY A HA2  10 
ATOM 5779  H HA3  . GLY A 1 24 ? 22.019  -31.705 25.358  1.00 0.00 ? 24 GLY A HA3  10 
ATOM 5780  N N    . TYR A 1 25 ? 19.748  -33.210 25.047  1.00 0.00 ? 25 TYR A N    10 
ATOM 5781  C CA   . TYR A 1 25 ? 18.885  -34.245 24.485  1.00 0.00 ? 25 TYR A CA   10 
ATOM 5782  C C    . TYR A 1 25 ? 17.649  -33.622 23.856  1.00 0.00 ? 25 TYR A C    10 
ATOM 5783  O O    . TYR A 1 25 ? 17.191  -34.049 22.797  1.00 0.00 ? 25 TYR A O    10 
ATOM 5784  C CB   . TYR A 1 25 ? 18.435  -35.218 25.576  1.00 0.00 ? 25 TYR A CB   10 
ATOM 5785  C CG   . TYR A 1 25 ? 17.523  -36.317 25.079  1.00 0.00 ? 25 TYR A CG   10 
ATOM 5786  C CD1  . TYR A 1 25 ? 18.035  -37.412 24.395  1.00 0.00 ? 25 TYR A CD1  10 
ATOM 5787  C CD2  . TYR A 1 25 ? 16.152  -36.256 25.296  1.00 0.00 ? 25 TYR A CD2  10 
ATOM 5788  C CE1  . TYR A 1 25 ? 17.209  -38.421 23.937  1.00 0.00 ? 25 TYR A CE1  10 
ATOM 5789  C CE2  . TYR A 1 25 ? 15.311  -37.255 24.845  1.00 0.00 ? 25 TYR A CE2  10 
ATOM 5790  C CZ   . TYR A 1 25 ? 15.852  -38.343 24.161  1.00 0.00 ? 25 TYR A CZ   10 
ATOM 5791  O OH   . TYR A 1 25 ? 15.027  -39.346 23.706  1.00 0.00 ? 25 TYR A OH   10 
ATOM 5792  H H    . TYR A 1 25 ? 19.997  -33.275 26.024  1.00 0.00 ? 25 TYR A H    10 
ATOM 5793  H HA   . TYR A 1 25 ? 19.442  -34.790 23.724  1.00 0.00 ? 25 TYR A HA   10 
ATOM 5794  H HB2  . TYR A 1 25 ? 19.319  -35.676 26.018  1.00 0.00 ? 25 TYR A HB2  10 
ATOM 5795  H HB3  . TYR A 1 25 ? 17.909  -34.655 26.348  1.00 0.00 ? 25 TYR A HB3  10 
ATOM 5796  H HD1  . TYR A 1 25 ? 19.098  -37.476 24.218  1.00 0.00 ? 25 TYR A HD1  10 
ATOM 5797  H HD2  . TYR A 1 25 ? 15.736  -35.412 25.827  1.00 0.00 ? 25 TYR A HD2  10 
ATOM 5798  H HE1  . TYR A 1 25 ? 17.624  -39.265 23.407  1.00 0.00 ? 25 TYR A HE1  10 
ATOM 5799  H HE2  . TYR A 1 25 ? 14.247  -37.193 25.020  1.00 0.00 ? 25 TYR A HE2  10 
ATOM 5800  H HH   . TYR A 1 25 ? 14.101  -39.195 23.914  1.00 0.00 ? 25 TYR A HH   10 
ATOM 5801  N N    . ILE A 1 26 ? 17.114  -32.604 24.524  1.00 0.00 ? 26 ILE A N    10 
ATOM 5802  C CA   . ILE A 1 26 ? 15.926  -31.899 24.052  1.00 0.00 ? 26 ILE A CA   10 
ATOM 5803  C C    . ILE A 1 26 ? 16.275  -30.994 22.882  1.00 0.00 ? 26 ILE A C    10 
ATOM 5804  O O    . ILE A 1 26 ? 15.568  -30.954 21.876  1.00 0.00 ? 26 ILE A O    10 
ATOM 5805  C CB   . ILE A 1 26 ? 15.311  -31.025 25.160  1.00 0.00 ? 26 ILE A CB   10 
ATOM 5806  C CG1  . ILE A 1 26 ? 14.753  -31.901 26.283  1.00 0.00 ? 26 ILE A CG1  10 
ATOM 5807  C CG2  . ILE A 1 26 ? 14.178  -30.176 24.603  1.00 0.00 ? 26 ILE A CG2  10 
ATOM 5808  C CD1  . ILE A 1 26 ? 14.354  -31.128 27.521  1.00 0.00 ? 26 ILE A CD1  10 
ATOM 5809  H H    . ILE A 1 26 ? 17.537  -32.298 25.389  1.00 0.00 ? 26 ILE A H    10 
ATOM 5810  H HA   . ILE A 1 26 ? 15.191  -32.638 23.731  1.00 0.00 ? 26 ILE A HA   10 
ATOM 5811  H HB   . ILE A 1 26 ? 16.084  -30.371 25.564  1.00 0.00 ? 26 ILE A HB   10 
ATOM 5812  H HG12 . ILE A 1 26 ? 13.873  -32.423 25.907  1.00 0.00 ? 26 ILE A HG12 10 
ATOM 5813  H HG13 . ILE A 1 26 ? 15.515  -32.627 26.563  1.00 0.00 ? 26 ILE A HG13 10 
ATOM 5814  H HG21 . ILE A 1 26 ? 13.757  -29.554 25.394  1.00 0.00 ? 26 ILE A HG21 10 
ATOM 5815  H HG22 . ILE A 1 26 ? 14.561  -29.537 23.808  1.00 0.00 ? 26 ILE A HG22 10 
ATOM 5816  H HG23 . ILE A 1 26 ? 13.400  -30.826 24.203  1.00 0.00 ? 26 ILE A HG23 10 
ATOM 5817  H HD11 . ILE A 1 26 ? 13.963  -31.801 28.284  1.00 0.00 ? 26 ILE A HD11 10 
ATOM 5818  H HD12 . ILE A 1 26 ? 15.226  -30.607 27.917  1.00 0.00 ? 26 ILE A HD12 10 
ATOM 5819  H HD13 . ILE A 1 26 ? 13.584  -30.401 27.259  1.00 0.00 ? 26 ILE A HD13 10 
ATOM 5820  N N    . VAL A 1 27 ? 17.377  -30.265 23.028  1.00 0.00 ? 27 VAL A N    10 
ATOM 5821  C CA   . VAL A 1 27 ? 17.847  -29.345 21.995  1.00 0.00 ? 27 VAL A CA   10 
ATOM 5822  C C    . VAL A 1 27 ? 18.475  -30.115 20.844  1.00 0.00 ? 27 VAL A C    10 
ATOM 5823  O O    . VAL A 1 27 ? 18.429  -29.686 19.692  1.00 0.00 ? 27 VAL A O    10 
ATOM 5824  C CB   . VAL A 1 27 ? 18.904  -28.370 22.546  1.00 0.00 ? 27 VAL A CB   10 
ATOM 5825  C CG1  . VAL A 1 27 ? 19.509  -27.547 21.419  1.00 0.00 ? 27 VAL A CG1  10 
ATOM 5826  C CG2  . VAL A 1 27 ? 18.277  -27.418 23.553  1.00 0.00 ? 27 VAL A CG2  10 
ATOM 5827  H H    . VAL A 1 27 ? 17.915  -30.342 23.879  1.00 0.00 ? 27 VAL A H    10 
ATOM 5828  H HA   . VAL A 1 27 ? 16.993  -28.775 21.627  1.00 0.00 ? 27 VAL A HA   10 
ATOM 5829  H HB   . VAL A 1 27 ? 19.691  -28.943 23.035  1.00 0.00 ? 27 VAL A HB   10 
ATOM 5830  H HG11 . VAL A 1 27 ? 20.261  -26.867 21.820  1.00 0.00 ? 27 VAL A HG11 10 
ATOM 5831  H HG12 . VAL A 1 27 ? 19.974  -28.213 20.693  1.00 0.00 ? 27 VAL A HG12 10 
ATOM 5832  H HG13 . VAL A 1 27 ? 18.724  -26.969 20.931  1.00 0.00 ? 27 VAL A HG13 10 
ATOM 5833  H HG21 . VAL A 1 27 ? 19.035  -26.739 23.942  1.00 0.00 ? 27 VAL A HG21 10 
ATOM 5834  H HG22 . VAL A 1 27 ? 17.491  -26.840 23.065  1.00 0.00 ? 27 VAL A HG22 10 
ATOM 5835  H HG23 . VAL A 1 27 ? 17.848  -27.991 24.375  1.00 0.00 ? 27 VAL A HG23 10 
ATOM 5836  N N    . GLY A 1 28 ? 19.065  -31.261 21.172  1.00 0.00 ? 28 GLY A N    10 
ATOM 5837  C CA   . GLY A 1 28 ? 19.714  -32.115 20.183  1.00 0.00 ? 28 GLY A CA   10 
ATOM 5838  C C    . GLY A 1 28 ? 18.676  -32.855 19.355  1.00 0.00 ? 28 GLY A C    10 
ATOM 5839  O O    . GLY A 1 28 ? 18.940  -33.273 18.229  1.00 0.00 ? 28 GLY A O    10 
ATOM 5840  H H    . GLY A 1 28 ? 19.069  -31.559 22.137  1.00 0.00 ? 28 GLY A H    10 
ATOM 5841  H HA2  . GLY A 1 28 ? 20.327  -31.499 19.524  1.00 0.00 ? 28 GLY A HA2  10 
ATOM 5842  H HA3  . GLY A 1 28 ? 20.348  -32.839 20.694  1.00 0.00 ? 28 GLY A HA3  10 
ATOM 5843  N N    . ALA A 1 29 ? 17.487  -33.011 19.931  1.00 0.00 ? 29 ALA A N    10 
ATOM 5844  C CA   . ALA A 1 29 ? 16.384  -33.700 19.269  1.00 0.00 ? 29 ALA A CA   10 
ATOM 5845  C C    . ALA A 1 29 ? 15.624  -32.742 18.364  1.00 0.00 ? 29 ALA A C    10 
ATOM 5846  O O    . ALA A 1 29 ? 15.108  -33.129 17.317  1.00 0.00 ? 29 ALA A O    10 
ATOM 5847  C CB   . ALA A 1 29 ? 15.415  -34.261 20.299  1.00 0.00 ? 29 ALA A CB   10 
ATOM 5848  H H    . ALA A 1 29 ? 17.331  -32.644 20.859  1.00 0.00 ? 29 ALA A H    10 
ATOM 5849  H HA   . ALA A 1 29 ? 16.789  -34.516 18.672  1.00 0.00 ? 29 ALA A HA   10 
ATOM 5850  H HB1  . ALA A 1 29 ? 14.603  -34.785 19.795  1.00 0.00 ? 29 ALA A HB1  10 
ATOM 5851  H HB2  . ALA A 1 29 ? 15.943  -34.955 20.953  1.00 0.00 ? 29 ALA A HB2  10 
ATOM 5852  H HB3  . ALA A 1 29 ? 15.004  -33.444 20.893  1.00 0.00 ? 29 ALA A HB3  10 
ATOM 5853  N N    . LEU A 1 30 ? 15.564  -31.482 18.785  1.00 0.00 ? 30 LEU A N    10 
ATOM 5854  C CA   . LEU A 1 30 ? 14.872  -30.440 18.030  1.00 0.00 ? 30 LEU A CA   10 
ATOM 5855  C C    . LEU A 1 30 ? 15.414  -30.362 16.612  1.00 0.00 ? 30 LEU A C    10 
ATOM 5856  O O    . LEU A 1 30 ? 14.695  -30.019 15.675  1.00 0.00 ? 30 LEU A O    10 
ATOM 5857  C CB   . LEU A 1 30 ? 15.065  -29.077 18.697  1.00 0.00 ? 30 LEU A CB   10 
ATOM 5858  C CG   . LEU A 1 30 ? 14.344  -28.867 20.031  1.00 0.00 ? 30 LEU A CG   10 
ATOM 5859  C CD1  . LEU A 1 30 ? 14.724  -27.526 20.641  1.00 0.00 ? 30 LEU A CD1  10 
ATOM 5860  C CD2  . LEU A 1 30 ? 12.836  -28.891 19.836  1.00 0.00 ? 30 LEU A CD2  10 
ATOM 5861  H H    . LEU A 1 30 ? 16.008  -31.225 19.655  1.00 0.00 ? 30 LEU A H    10 
ATOM 5862  H HA   . LEU A 1 30 ? 13.808  -30.678 17.998  1.00 0.00 ? 30 LEU A HA   10 
ATOM 5863  H HB2  . LEU A 1 30 ? 16.132  -28.940 18.871  1.00 0.00 ? 30 LEU A HB2  10 
ATOM 5864  H HB3  . LEU A 1 30 ? 14.709  -28.314 18.004  1.00 0.00 ? 30 LEU A HB3  10 
ATOM 5865  H HG   . LEU A 1 30 ? 14.630  -29.666 20.714  1.00 0.00 ? 30 LEU A HG   10 
ATOM 5866  H HD11 . LEU A 1 30 ? 14.212  -27.393 21.595  1.00 0.00 ? 30 LEU A HD11 10 
ATOM 5867  H HD12 . LEU A 1 30 ? 15.801  -27.494 20.803  1.00 0.00 ? 30 LEU A HD12 10 
ATOM 5868  H HD13 . LEU A 1 30 ? 14.434  -26.724 19.962  1.00 0.00 ? 30 LEU A HD13 10 
ATOM 5869  H HD21 . LEU A 1 30 ? 12.335  -28.751 20.794  1.00 0.00 ? 30 LEU A HD21 10 
ATOM 5870  H HD22 . LEU A 1 30 ? 12.545  -28.088 19.157  1.00 0.00 ? 30 LEU A HD22 10 
ATOM 5871  H HD23 . LEU A 1 30 ? 12.541  -29.850 19.412  1.00 0.00 ? 30 LEU A HD23 10 
ATOM 5872  N N    . VAL A 1 31 ? 16.695  -30.686 16.467  1.00 0.00 ? 31 VAL A N    10 
ATOM 5873  C CA   . VAL A 1 31 ? 17.365  -30.662 15.169  1.00 0.00 ? 31 VAL A CA   10 
ATOM 5874  C C    . VAL A 1 31 ? 16.613  -31.522 14.167  1.00 0.00 ? 31 VAL A C    10 
ATOM 5875  O O    . VAL A 1 31 ? 16.544  -31.204 12.981  1.00 0.00 ? 31 VAL A O    10 
ATOM 5876  C CB   . VAL A 1 31 ? 18.805  -31.198 15.267  1.00 0.00 ? 31 VAL A CB   10 
ATOM 5877  C CG1  . VAL A 1 31 ? 19.409  -31.360 13.881  1.00 0.00 ? 31 VAL A CG1  10 
ATOM 5878  C CG2  . VAL A 1 31 ? 19.678  -30.239 16.062  1.00 0.00 ? 31 VAL A CG2  10 
ATOM 5879  H H    . VAL A 1 31 ? 17.233  -30.959 17.276  1.00 0.00 ? 31 VAL A H    10 
ATOM 5880  H HA   . VAL A 1 31 ? 17.390  -29.631 14.814  1.00 0.00 ? 31 VAL A HA   10 
ATOM 5881  H HB   . VAL A 1 31 ? 18.787  -32.166 15.767  1.00 0.00 ? 31 VAL A HB   10 
ATOM 5882  H HG11 . VAL A 1 31 ? 20.424  -31.747 13.963  1.00 0.00 ? 31 VAL A HG11 10 
ATOM 5883  H HG12 . VAL A 1 31 ? 18.802  -32.055 13.301  1.00 0.00 ? 31 VAL A HG12 10 
ATOM 5884  H HG13 . VAL A 1 31 ? 19.431  -30.392 13.380  1.00 0.00 ? 31 VAL A HG13 10 
ATOM 5885  H HG21 . VAL A 1 31 ? 20.691  -30.633 16.132  1.00 0.00 ? 31 VAL A HG21 10 
ATOM 5886  H HG22 . VAL A 1 31 ? 19.700  -29.270 15.562  1.00 0.00 ? 31 VAL A HG22 10 
ATOM 5887  H HG23 . VAL A 1 31 ? 19.266  -30.120 17.064  1.00 0.00 ? 31 VAL A HG23 10 
ATOM 5888  N N    . ILE A 1 32 ? 16.047  -32.619 14.661  1.00 0.00 ? 32 ILE A N    10 
ATOM 5889  C CA   . ILE A 1 32 ? 15.290  -33.550 13.828  1.00 0.00 ? 32 ILE A CA   10 
ATOM 5890  C C    . ILE A 1 32 ? 14.035  -32.882 13.290  1.00 0.00 ? 32 ILE A C    10 
ATOM 5891  O O    . ILE A 1 32 ? 13.680  -33.041 12.123  1.00 0.00 ? 32 ILE A O    10 
ATOM 5892  C CB   . ILE A 1 32 ? 14.860  -34.797 14.623  1.00 0.00 ? 32 ILE A CB   10 
ATOM 5893  C CG1  . ILE A 1 32 ? 16.083  -35.626 15.017  1.00 0.00 ? 32 ILE A CG1  10 
ATOM 5894  C CG2  . ILE A 1 32 ? 13.935  -35.669 13.787  1.00 0.00 ? 32 ILE A CG2  10 
ATOM 5895  C CD1  . ILE A 1 32 ? 15.779  -36.731 16.005  1.00 0.00 ? 32 ILE A CD1  10 
ATOM 5896  H H    . ILE A 1 32 ? 16.136  -32.825 15.646  1.00 0.00 ? 32 ILE A H    10 
ATOM 5897  H HA   . ILE A 1 32 ? 15.921  -33.858 12.995  1.00 0.00 ? 32 ILE A HA   10 
ATOM 5898  H HB   . ILE A 1 32 ? 14.336  -34.477 15.524  1.00 0.00 ? 32 ILE A HB   10 
ATOM 5899  H HG12 . ILE A 1 32 ? 16.498  -36.076 14.116  1.00 0.00 ? 32 ILE A HG12 10 
ATOM 5900  H HG13 . ILE A 1 32 ? 16.820  -34.959 15.464  1.00 0.00 ? 32 ILE A HG13 10 
ATOM 5901  H HG21 . ILE A 1 32 ? 13.629  -36.542 14.363  1.00 0.00 ? 32 ILE A HG21 10 
ATOM 5902  H HG22 . ILE A 1 32 ? 13.052  -35.094 13.506  1.00 0.00 ? 32 ILE A HG22 10 
ATOM 5903  H HG23 . ILE A 1 32 ? 14.458  -35.994 12.888  1.00 0.00 ? 32 ILE A HG23 10 
ATOM 5904  H HD11 . ILE A 1 32 ? 16.684  -37.287 16.248  1.00 0.00 ? 32 ILE A HD11 10 
ATOM 5905  H HD12 . ILE A 1 32 ? 15.372  -36.295 16.918  1.00 0.00 ? 32 ILE A HD12 10 
ATOM 5906  H HD13 . ILE A 1 32 ? 15.047  -37.411 15.570  1.00 0.00 ? 32 ILE A HD13 10 
ATOM 5907  N N    . LEU A 1 33 ? 13.367  -32.130 14.160  1.00 0.00 ? 33 LEU A N    10 
ATOM 5908  C CA   . LEU A 1 33 ? 12.141  -31.422 13.799  1.00 0.00 ? 33 LEU A CA   10 
ATOM 5909  C C    . LEU A 1 33 ? 12.419  -30.401 12.708  1.00 0.00 ? 33 LEU A C    10 
ATOM 5910  O O    . LEU A 1 33 ? 11.706  -30.329 11.708  1.00 0.00 ? 33 LEU A O    10 
ATOM 5911  C CB   . LEU A 1 33 ? 11.568  -30.689 15.014  1.00 0.00 ? 33 LEU A CB   10 
ATOM 5912  C CG   . LEU A 1 33 ? 10.943  -31.565 16.101  1.00 0.00 ? 33 LEU A CG   10 
ATOM 5913  C CD1  . LEU A 1 33 ? 10.532  -30.723 17.299  1.00 0.00 ? 33 LEU A CD1  10 
ATOM 5914  C CD2  . LEU A 1 33 ? 9.706   -32.276 15.573  1.00 0.00 ? 33 LEU A CD2  10 
ATOM 5915  H H    . LEU A 1 33 ? 13.710  -32.038 15.106  1.00 0.00 ? 33 LEU A H    10 
ATOM 5916  H HA   . LEU A 1 33 ? 11.411  -32.147 13.439  1.00 0.00 ? 33 LEU A HA   10 
ATOM 5917  H HB2  . LEU A 1 33 ? 12.377  -30.119 15.471  1.00 0.00 ? 33 LEU A HB2  10 
ATOM 5918  H HB3  . LEU A 1 33 ? 10.799  -30.004 14.656  1.00 0.00 ? 33 LEU A HB3  10 
ATOM 5919  H HG   . LEU A 1 33 ? 11.675  -32.307 16.418  1.00 0.00 ? 33 LEU A HG   10 
ATOM 5920  H HD11 . LEU A 1 33 ? 10.097  -31.359 18.070  1.00 0.00 ? 33 LEU A HD11 10 
ATOM 5921  H HD12 . LEU A 1 33 ? 11.408  -30.215 17.702  1.00 0.00 ? 33 LEU A HD12 10 
ATOM 5922  H HD13 . LEU A 1 33 ? 9.795   -29.982 16.986  1.00 0.00 ? 33 LEU A HD13 10 
ATOM 5923  H HD21 . LEU A 1 33 ? 9.277   -32.904 16.353  1.00 0.00 ? 33 LEU A HD21 10 
ATOM 5924  H HD22 . LEU A 1 33 ? 8.968   -31.536 15.261  1.00 0.00 ? 33 LEU A HD22 10 
ATOM 5925  H HD23 . LEU A 1 33 ? 9.981   -32.896 14.721  1.00 0.00 ? 33 LEU A HD23 10 
ATOM 5926  N N    . ALA A 1 34 ? 13.468  -29.611 12.914  1.00 0.00 ? 34 ALA A N    10 
ATOM 5927  C CA   . ALA A 1 34 ? 13.867  -28.579 11.960  1.00 0.00 ? 34 ALA A CA   10 
ATOM 5928  C C    . ALA A 1 34 ? 14.173  -29.196 10.605  1.00 0.00 ? 34 ALA A C    10 
ATOM 5929  O O    . ALA A 1 34 ? 13.810  -28.653 9.562   1.00 0.00 ? 34 ALA A O    10 
ATOM 5930  C CB   . ALA A 1 34 ? 15.111  -27.855 12.452  1.00 0.00 ? 34 ALA A CB   10 
ATOM 5931  H H    . ALA A 1 34 ? 14.014  -29.718 13.757  1.00 0.00 ? 34 ALA A H    10 
ATOM 5932  H HA   . ALA A 1 34 ? 13.050  -27.864 11.856  1.00 0.00 ? 34 ALA A HA   10 
ATOM 5933  H HB1  . ALA A 1 34 ? 15.391  -27.077 11.741  1.00 0.00 ? 34 ALA A HB1  10 
ATOM 5934  H HB2  . ALA A 1 34 ? 14.906  -27.400 13.422  1.00 0.00 ? 34 ALA A HB2  10 
ATOM 5935  H HB3  . ALA A 1 34 ? 15.929  -28.567 12.551  1.00 0.00 ? 34 ALA A HB3  10 
ATOM 5936  N N    . VAL A 1 35 ? 14.847  -30.342 10.634  1.00 0.00 ? 35 VAL A N    10 
ATOM 5937  C CA   . VAL A 1 35 ? 15.218  -31.060 9.418   1.00 0.00 ? 35 VAL A CA   10 
ATOM 5938  C C    . VAL A 1 35 ? 13.987  -31.353 8.577   1.00 0.00 ? 35 VAL A C    10 
ATOM 5939  O O    . VAL A 1 35 ? 13.995  -31.190 7.358   1.00 0.00 ? 35 VAL A O    10 
ATOM 5940  C CB   . VAL A 1 35 ? 15.901  -32.402 9.741   1.00 0.00 ? 35 VAL A CB   10 
ATOM 5941  C CG1  . VAL A 1 35 ? 16.089  -33.223 8.474   1.00 0.00 ? 35 VAL A CG1  10 
ATOM 5942  C CG2  . VAL A 1 35 ? 17.267  -32.167 10.368  1.00 0.00 ? 35 VAL A CG2  10 
ATOM 5943  H H    . VAL A 1 35 ? 15.116  -30.738 11.523  1.00 0.00 ? 35 VAL A H    10 
ATOM 5944  H HA   . VAL A 1 35 ? 15.906  -30.437 8.847   1.00 0.00 ? 35 VAL A HA   10 
ATOM 5945  H HB   . VAL A 1 35 ? 15.274  -32.957 10.440  1.00 0.00 ? 35 VAL A HB   10 
ATOM 5946  H HG11 . VAL A 1 35 ? 16.565  -34.173 8.716   1.00 0.00 ? 35 VAL A HG11 10 
ATOM 5947  H HG12 . VAL A 1 35 ? 15.117  -33.411 8.017   1.00 0.00 ? 35 VAL A HG12 10 
ATOM 5948  H HG13 . VAL A 1 35 ? 16.718  -32.671 7.775   1.00 0.00 ? 35 VAL A HG13 10 
ATOM 5949  H HG21 . VAL A 1 35 ? 17.736  -33.122 10.600  1.00 0.00 ? 35 VAL A HG21 10 
ATOM 5950  H HG22 . VAL A 1 35 ? 17.896  -31.615 9.670   1.00 0.00 ? 35 VAL A HG22 10 
ATOM 5951  H HG23 . VAL A 1 35 ? 17.150  -31.589 11.285  1.00 0.00 ? 35 VAL A HG23 10 
ATOM 5952  N N    . ALA A 1 36 ? 12.925  -31.791 9.247   1.00 0.00 ? 36 ALA A N    10 
ATOM 5953  C CA   . ALA A 1 36 ? 11.665  -32.117 8.585   1.00 0.00 ? 36 ALA A CA   10 
ATOM 5954  C C    . ALA A 1 36 ? 11.047  -30.872 7.971   1.00 0.00 ? 36 ALA A C    10 
ATOM 5955  O O    . ALA A 1 36 ? 10.605  -30.881 6.823   1.00 0.00 ? 36 ALA A O    10 
ATOM 5956  C CB   . ALA A 1 36 ? 10.678  -32.702 9.583   1.00 0.00 ? 36 ALA A CB   10 
ATOM 5957  H H    . ALA A 1 36 ? 12.981  -31.906 10.249  1.00 0.00 ? 36 ALA A H    10 
ATOM 5958  H HA   . ALA A 1 36 ? 11.860  -32.847 7.800   1.00 0.00 ? 36 ALA A HA   10 
ATOM 5959  H HB1  . ALA A 1 36 ? 9.746   -32.955 9.076   1.00 0.00 ? 36 ALA A HB1  10 
ATOM 5960  H HB2  . ALA A 1 36 ? 11.103  -33.601 10.029  1.00 0.00 ? 36 ALA A HB2  10 
ATOM 5961  H HB3  . ALA A 1 36 ? 10.476  -31.969 10.365  1.00 0.00 ? 36 ALA A HB3  10 
ATOM 5962  N N    . GLY A 1 37 ? 11.024  -29.796 8.753   1.00 0.00 ? 37 GLY A N    10 
ATOM 5963  C CA   . GLY A 1 37 ? 10.464  -28.522 8.312   1.00 0.00 ? 37 GLY A CA   10 
ATOM 5964  C C    . GLY A 1 37 ? 11.027  -28.137 6.953   1.00 0.00 ? 37 GLY A C    10 
ATOM 5965  O O    . GLY A 1 37 ? 10.290  -27.978 5.981   1.00 0.00 ? 37 GLY A O    10 
ATOM 5966  H H    . GLY A 1 37 ? 11.404  -29.851 9.687   1.00 0.00 ? 37 GLY A H    10 
ATOM 5967  H HA2  . GLY A 1 37 ? 9.380   -28.611 8.240   1.00 0.00 ? 37 GLY A HA2  10 
ATOM 5968  H HA3  . GLY A 1 37 ? 10.714  -27.748 9.038   1.00 0.00 ? 37 GLY A HA3  10 
ATOM 5969  N N    . LEU A 1 38 ? 12.347  -27.989 6.899   1.00 0.00 ? 38 LEU A N    10 
ATOM 5970  C CA   . LEU A 1 38 ? 13.042  -27.620 5.668   1.00 0.00 ? 38 LEU A CA   10 
ATOM 5971  C C    . LEU A 1 38 ? 12.799  -28.663 4.589   1.00 0.00 ? 38 LEU A C    10 
ATOM 5972  O O    . LEU A 1 38 ? 12.618  -28.335 3.418   1.00 0.00 ? 38 LEU A O    10 
ATOM 5973  C CB   . LEU A 1 38 ? 14.549  -27.518 5.913   1.00 0.00 ? 38 LEU A CB   10 
ATOM 5974  C CG   . LEU A 1 38 ? 15.020  -26.331 6.755   1.00 0.00 ? 38 LEU A CG   10 
ATOM 5975  C CD1  . LEU A 1 38 ? 16.514  -26.423 7.026   1.00 0.00 ? 38 LEU A CD1  10 
ATOM 5976  C CD2  . LEU A 1 38 ? 14.747  -25.019 6.034   1.00 0.00 ? 38 LEU A CD2  10 
ATOM 5977  H H    . LEU A 1 38 ? 12.898  -28.134 7.733   1.00 0.00 ? 38 LEU A H    10 
ATOM 5978  H HA   . LEU A 1 38 ? 12.665  -26.654 5.329   1.00 0.00 ? 38 LEU A HA   10 
ATOM 5979  H HB2  . LEU A 1 38 ? 14.865  -28.430 6.419   1.00 0.00 ? 38 LEU A HB2  10 
ATOM 5980  H HB3  . LEU A 1 38 ? 15.039  -27.451 4.942   1.00 0.00 ? 38 LEU A HB3  10 
ATOM 5981  H HG   . LEU A 1 38 ? 14.482  -26.338 7.703   1.00 0.00 ? 38 LEU A HG   10 
ATOM 5982  H HD11 . LEU A 1 38 ? 16.834  -25.577 7.635   1.00 0.00 ? 38 LEU A HD11 10 
ATOM 5983  H HD12 . LEU A 1 38 ? 16.729  -27.350 7.556   1.00 0.00 ? 38 LEU A HD12 10 
ATOM 5984  H HD13 . LEU A 1 38 ? 17.055  -26.411 6.080   1.00 0.00 ? 38 LEU A HD13 10 
ATOM 5985  H HD21 . LEU A 1 38 ? 15.076  -24.181 6.649   1.00 0.00 ? 38 LEU A HD21 10 
ATOM 5986  H HD22 . LEU A 1 38 ? 15.288  -25.006 5.088   1.00 0.00 ? 38 LEU A HD22 10 
ATOM 5987  H HD23 . LEU A 1 38 ? 13.677  -24.927 5.843   1.00 0.00 ? 38 LEU A HD23 10 
ATOM 5988  N N    . ILE A 1 39 ? 12.799  -29.927 5.000   1.00 0.00 ? 39 ILE A N    10 
ATOM 5989  C CA   . ILE A 1 39 ? 12.580  -31.045 4.087   1.00 0.00 ? 39 ILE A CA   10 
ATOM 5990  C C    . ILE A 1 39 ? 11.236  -30.910 3.392   1.00 0.00 ? 39 ILE A C    10 
ATOM 5991  O O    . ILE A 1 39 ? 11.121  -31.114 2.184   1.00 0.00 ? 39 ILE A O    10 
ATOM 5992  C CB   . ILE A 1 39 ? 12.594  -32.393 4.832   1.00 0.00 ? 39 ILE A CB   10 
ATOM 5993  C CG1  . ILE A 1 39 ? 13.996  -32.691 5.368   1.00 0.00 ? 39 ILE A CG1  10 
ATOM 5994  C CG2  . ILE A 1 39 ? 12.185  -33.522 3.898   1.00 0.00 ? 39 ILE A CG2  10 
ATOM 5995  C CD1  . ILE A 1 39 ? 15.053  -32.793 4.291   1.00 0.00 ? 39 ILE A CD1  10 
ATOM 5996  H H    . ILE A 1 39 ? 12.954  -30.132 5.977   1.00 0.00 ? 39 ILE A H    10 
ATOM 5997  H HA   . ILE A 1 39 ? 13.374  -31.040 3.341   1.00 0.00 ? 39 ILE A HA   10 
ATOM 5998  H HB   . ILE A 1 39 ? 11.892  -32.343 5.665   1.00 0.00 ? 39 ILE A HB   10 
ATOM 5999  H HG12 . ILE A 1 39 ? 14.279  -31.891 6.053   1.00 0.00 ? 39 ILE A HG12 10 
ATOM 6000  H HG13 . ILE A 1 39 ? 13.963  -33.637 5.908   1.00 0.00 ? 39 ILE A HG13 10 
ATOM 6001  H HG21 . ILE A 1 39 ? 12.189  -34.468 4.439   1.00 0.00 ? 39 ILE A HG21 10 
ATOM 6002  H HG22 . ILE A 1 39 ? 11.183  -33.329 3.514   1.00 0.00 ? 39 ILE A HG22 10 
ATOM 6003  H HG23 . ILE A 1 39 ? 12.887  -33.577 3.067   1.00 0.00 ? 39 ILE A HG23 10 
ATOM 6004  H HD11 . ILE A 1 39 ? 16.027  -33.004 4.730   1.00 0.00 ? 39 ILE A HD11 10 
ATOM 6005  H HD12 . ILE A 1 39 ? 14.789  -33.596 3.603   1.00 0.00 ? 39 ILE A HD12 10 
ATOM 6006  H HD13 . ILE A 1 39 ? 15.104  -31.850 3.746   1.00 0.00 ? 39 ILE A HD13 10 
ATOM 6007  N N    . TYR A 1 40 ? 10.218  -30.563 4.174   1.00 0.00 ? 40 TYR A N    10 
ATOM 6008  C CA   . TYR A 1 40 ? 8.862   -30.393 3.659   1.00 0.00 ? 40 TYR A CA   10 
ATOM 6009  C C    . TYR A 1 40 ? 8.784   -29.172 2.758   1.00 0.00 ? 40 TYR A C    10 
ATOM 6010  O O    . TYR A 1 40 ? 8.147   -29.197 1.706   1.00 0.00 ? 40 TYR A O    10 
ATOM 6011  C CB   . TYR A 1 40 ? 7.871   -30.209 4.810   1.00 0.00 ? 40 TYR A CB   10 
ATOM 6012  C CG   . TYR A 1 40 ? 6.435   -30.052 4.363   1.00 0.00 ? 40 TYR A CG   10 
ATOM 6013  C CD1  . TYR A 1 40 ? 5.687   -31.155 3.972   1.00 0.00 ? 40 TYR A CD1  10 
ATOM 6014  C CD2  . TYR A 1 40 ? 5.832   -28.801 4.333   1.00 0.00 ? 40 TYR A CD2  10 
ATOM 6015  C CE1  . TYR A 1 40 ? 4.374   -31.021 3.562   1.00 0.00 ? 40 TYR A CE1  10 
ATOM 6016  C CE2  . TYR A 1 40 ? 4.521   -28.648 3.925   1.00 0.00 ? 40 TYR A CE2  10 
ATOM 6017  C CZ   . TYR A 1 40 ? 3.793   -29.772 3.538   1.00 0.00 ? 40 TYR A CZ   10 
ATOM 6018  O OH   . TYR A 1 40 ? 2.486   -29.636 3.130   1.00 0.00 ? 40 TYR A OH   10 
ATOM 6019  H H    . TYR A 1 40 ? 10.376  -30.410 5.160   1.00 0.00 ? 40 TYR A H    10 
ATOM 6020  H HA   . TYR A 1 40 ? 8.590   -31.281 3.089   1.00 0.00 ? 40 TYR A HA   10 
ATOM 6021  H HB2  . TYR A 1 40 ? 7.936   -31.077 5.466   1.00 0.00 ? 40 TYR A HB2  10 
ATOM 6022  H HB3  . TYR A 1 40 ? 8.156   -29.321 5.375   1.00 0.00 ? 40 TYR A HB3  10 
ATOM 6023  H HD1  . TYR A 1 40 ? 6.139   -32.135 3.989   1.00 0.00 ? 40 TYR A HD1  10 
ATOM 6024  H HD2  . TYR A 1 40 ? 6.398   -27.932 4.634   1.00 0.00 ? 40 TYR A HD2  10 
ATOM 6025  H HE1  . TYR A 1 40 ? 3.806   -31.889 3.262   1.00 0.00 ? 40 TYR A HE1  10 
ATOM 6026  H HE2  . TYR A 1 40 ? 4.065   -27.668 3.906   1.00 0.00 ? 40 TYR A HE2  10 
ATOM 6027  H HH   . TYR A 1 40 ? 2.178   -28.726 3.150   1.00 0.00 ? 40 TYR A HH   10 
ATOM 6028  N N    . SER A 1 41 ? 9.443   -28.098 3.186   1.00 0.00 ? 41 SER A N    10 
ATOM 6029  C CA   . SER A 1 41 ? 9.467   -26.847 2.435   1.00 0.00 ? 41 SER A CA   10 
ATOM 6030  C C    . SER A 1 41 ? 10.070  -27.063 1.057   1.00 0.00 ? 41 SER A C    10 
ATOM 6031  O O    . SER A 1 41 ? 9.502   -26.662 0.043   1.00 0.00 ? 41 SER A O    10 
ATOM 6032  C CB   . SER A 1 41 ? 10.304  -25.797 3.169   1.00 0.00 ? 41 SER A CB   10 
ATOM 6033  O OG   . SER A 1 41 ? 9.701   -25.432 4.398   1.00 0.00 ? 41 SER A OG   10 
ATOM 6034  H H    . SER A 1 41 ? 9.948   -28.139 4.060   1.00 0.00 ? 41 SER A H    10 
ATOM 6035  H HA   . SER A 1 41 ? 8.444   -26.483 2.329   1.00 0.00 ? 41 SER A HA   10 
ATOM 6036  H HB2  . SER A 1 41 ? 11.294  -26.205 3.367   1.00 0.00 ? 41 SER A HB2  10 
ATOM 6037  H HB3  . SER A 1 41 ? 10.394  -24.911 2.541   1.00 0.00 ? 41 SER A HB3  10 
ATOM 6038  H HG   . SER A 1 41 ? 10.249  -24.774 4.831   1.00 0.00 ? 41 SER A HG   10 
ATOM 6039  N N    . MET A 1 42 ? 11.235  -27.706 1.035   1.00 0.00 ? 42 MET A N    10 
ATOM 6040  C CA   . MET A 1 42 ? 11.943  -27.994 -0.209  1.00 0.00 ? 42 MET A CA   10 
ATOM 6041  C C    . MET A 1 42 ? 11.129  -28.934 -1.082  1.00 0.00 ? 42 MET A C    10 
ATOM 6042  O O    . MET A 1 42 ? 11.049  -28.764 -2.298  1.00 0.00 ? 42 MET A O    10 
ATOM 6043  C CB   . MET A 1 42 ? 13.292  -28.654 0.083   1.00 0.00 ? 42 MET A CB   10 
ATOM 6044  C CG   . MET A 1 42 ? 14.137  -28.914 -1.154  1.00 0.00 ? 42 MET A CG   10 
ATOM 6045  S SD   . MET A 1 42 ? 15.730  -29.662 -0.764  1.00 0.00 ? 42 MET A SD   10 
ATOM 6046  C CE   . MET A 1 42 ? 15.219  -31.305 -0.266  1.00 0.00 ? 42 MET A CE   10 
ATOM 6047  H H    . MET A 1 42 ? 11.653  -28.008 1.903   1.00 0.00 ? 42 MET A H    10 
ATOM 6048  H HA   . MET A 1 42 ? 12.107  -27.057 -0.742  1.00 0.00 ? 42 MET A HA   10 
ATOM 6049  H HB2  . MET A 1 42 ? 13.854  -28.002 0.752   1.00 0.00 ? 42 MET A HB2  10 
ATOM 6050  H HB3  . MET A 1 42 ? 13.106  -29.607 0.577   1.00 0.00 ? 42 MET A HB3  10 
ATOM 6051  H HG2  . MET A 1 42 ? 13.590  -29.580 -1.821  1.00 0.00 ? 42 MET A HG2  10 
ATOM 6052  H HG3  . MET A 1 42 ? 14.309  -27.968 -1.669  1.00 0.00 ? 42 MET A HG3  10 
ATOM 6053  H HE1  . MET A 1 42 ? 16.090  -31.898 0.009   1.00 0.00 ? 42 MET A HE1  10 
ATOM 6054  H HE2  . MET A 1 42 ? 14.549  -31.231 0.591   1.00 0.00 ? 42 MET A HE2  10 
ATOM 6055  H HE3  . MET A 1 42 ? 14.699  -31.788 -1.093  1.00 0.00 ? 42 MET A HE3  10 
ATOM 6056  N N    . LEU A 1 43 ? 10.523  -29.930 -0.443  1.00 0.00 ? 43 LEU A N    10 
ATOM 6057  C CA   . LEU A 1 43 ? 9.703   -30.918 -1.137  1.00 0.00 ? 43 LEU A CA   10 
ATOM 6058  C C    . LEU A 1 43 ? 8.362   -30.318 -1.528  1.00 0.00 ? 43 LEU A C    10 
ATOM 6059  O O    . LEU A 1 43 ? 7.848   -30.566 -2.617  1.00 0.00 ? 43 LEU A O    10 
ATOM 6060  C CB   . LEU A 1 43 ? 9.447   -32.129 -0.237  1.00 0.00 ? 43 LEU A CB   10 
ATOM 6061  C CG   . LEU A 1 43 ? 10.659  -33.007 0.080   1.00 0.00 ? 43 LEU A CG   10 
ATOM 6062  C CD1  . LEU A 1 43 ? 10.290  -34.092 1.079   1.00 0.00 ? 43 LEU A CD1  10 
ATOM 6063  C CD2  . LEU A 1 43 ? 11.180  -33.679 -1.181  1.00 0.00 ? 43 LEU A CD2  10 
ATOM 6064  H H    . LEU A 1 43 ? 10.626  -30.015 0.558   1.00 0.00 ? 43 LEU A H    10 
ATOM 6065  H HA   . LEU A 1 43 ? 10.229  -31.241 -2.035  1.00 0.00 ? 43 LEU A HA   10 
ATOM 6066  H HB2  . LEU A 1 43 ? 9.046   -31.761 0.708   1.00 0.00 ? 43 LEU A HB2  10 
ATOM 6067  H HB3  . LEU A 1 43 ? 8.702   -32.755 -0.728  1.00 0.00 ? 43 LEU A HB3  10 
ATOM 6068  H HG   . LEU A 1 43 ? 11.444  -32.380 0.504   1.00 0.00 ? 43 LEU A HG   10 
ATOM 6069  H HD11 . LEU A 1 43 ? 11.163  -34.703 1.304   1.00 0.00 ? 43 LEU A HD11 10 
ATOM 6070  H HD12 . LEU A 1 43 ? 9.927   -33.630 1.997   1.00 0.00 ? 43 LEU A HD12 10 
ATOM 6071  H HD13 . LEU A 1 43 ? 9.507   -34.722 0.656   1.00 0.00 ? 43 LEU A HD13 10 
ATOM 6072  H HD21 . LEU A 1 43 ? 12.049  -34.292 -0.943  1.00 0.00 ? 43 LEU A HD21 10 
ATOM 6073  H HD22 . LEU A 1 43 ? 10.398  -34.310 -1.604  1.00 0.00 ? 43 LEU A HD22 10 
ATOM 6074  H HD23 . LEU A 1 43 ? 11.463  -32.916 -1.906  1.00 0.00 ? 43 LEU A HD23 10 
ATOM 6075  N N    . ARG A 1 44 ? 7.803   -29.522 -0.622  1.00 0.00 ? 44 ARG A N    10 
ATOM 6076  C CA   . ARG A 1 44 ? 6.517   -28.868 -0.845  1.00 0.00 ? 44 ARG A CA   10 
ATOM 6077  C C    . ARG A 1 44 ? 6.698   -27.601 -1.666  1.00 0.00 ? 44 ARG A C    10 
ATOM 6078  O O    . ARG A 1 44 ? 5.838   -27.230 -2.462  1.00 0.00 ? 44 ARG A O    10 
ATOM 6079  C CB   . ARG A 1 44 ? 5.869   -28.491 0.489   1.00 0.00 ? 44 ARG A CB   10 
ATOM 6080  C CG   . ARG A 1 44 ? 4.482   -27.885 0.356   1.00 0.00 ? 44 ARG A CG   10 
ATOM 6081  C CD   . ARG A 1 44 ? 3.483   -28.903 -0.169  1.00 0.00 ? 44 ARG A CD   10 
ATOM 6082  N NE   . ARG A 1 44 ? 2.139   -28.341 -0.288  1.00 0.00 ? 44 ARG A NE   10 
ATOM 6083  C CZ   . ARG A 1 44 ? 1.120   -28.960 -0.874  1.00 0.00 ? 44 ARG A CZ   10 
ATOM 6084  N NH1  . ARG A 1 44 ? 1.289   -30.167 -1.397  1.00 0.00 ? 44 ARG A NH1  10 
ATOM 6085  N NH2  . ARG A 1 44 ? -0.067  -28.372 -0.935  1.00 0.00 ? 44 ARG A NH2  10 
ATOM 6086  H H    . ARG A 1 44 ? 8.275   -29.357 0.255   1.00 0.00 ? 44 ARG A H    10 
ATOM 6087  H HA   . ARG A 1 44 ? 5.863   -29.555 -1.381  1.00 0.00 ? 44 ARG A HA   10 
ATOM 6088  H HB2  . ARG A 1 44 ? 5.792   -29.391 1.099   1.00 0.00 ? 44 ARG A HB2  10 
ATOM 6089  H HB3  . ARG A 1 44 ? 6.512   -27.766 0.989   1.00 0.00 ? 44 ARG A HB3  10 
ATOM 6090  H HG2  . ARG A 1 44 ? 4.152   -27.535 1.334   1.00 0.00 ? 44 ARG A HG2  10 
ATOM 6091  H HG3  . ARG A 1 44 ? 4.526   -27.042 -0.334  1.00 0.00 ? 44 ARG A HG3  10 
ATOM 6092  H HD2  . ARG A 1 44 ? 3.810   -29.245 -1.151  1.00 0.00 ? 44 ARG A HD2  10 
ATOM 6093  H HD3  . ARG A 1 44 ? 3.451   -29.751 0.514   1.00 0.00 ? 44 ARG A HD3  10 
ATOM 6094  H HE   . ARG A 1 44 ? 1.986   -27.422 0.104   1.00 0.00 ? 44 ARG A HE   10 
ATOM 6095  H HH11 . ARG A 1 44 ? 2.192   -30.615 -1.350  1.00 0.00 ? 44 ARG A HH11 10 
ATOM 6096  H HH12 . ARG A 1 44 ? 0.513   -30.637 -1.842  1.00 0.00 ? 44 ARG A HH12 10 
ATOM 6097  H HH21 . ARG A 1 44 ? -0.197  -27.453 -0.536  1.00 0.00 ? 44 ARG A HH21 10 
ATOM 6098  H HH22 . ARG A 1 44 ? -0.842  -28.842 -1.380  1.00 0.00 ? 44 ARG A HH22 10 
ATOM 6099  N N    . LYS A 1 45 ? 7.835   -26.942 -1.460  1.00 0.00 ? 45 LYS A N    10 
ATOM 6100  C CA   . LYS A 1 45 ? 8.160   -25.709 -2.170  1.00 0.00 ? 45 LYS A CA   10 
ATOM 6101  C C    . LYS A 1 45 ? 8.527   -26.006 -3.614  1.00 0.00 ? 45 LYS A C    10 
ATOM 6102  O O    . LYS A 1 45 ? 8.056   -25.346 -4.539  1.00 0.00 ? 45 LYS A O    10 
ATOM 6103  C CB   . LYS A 1 45 ? 9.345   -25.005 -1.506  1.00 0.00 ? 45 LYS A CB   10 
ATOM 6104  C CG   . LYS A 1 45 ? 9.720   -23.680 -2.150  1.00 0.00 ? 45 LYS A CG   10 
ATOM 6105  C CD   . LYS A 1 45 ? 10.865  -23.010 -1.408  1.00 0.00 ? 45 LYS A CD   10 
ATOM 6106  C CE   . LYS A 1 45 ? 11.249  -21.692 -2.061  1.00 0.00 ? 45 LYS A CE   10 
ATOM 6107  N NZ   . LYS A 1 45 ? 12.362  -21.018 -1.337  1.00 0.00 ? 45 LYS A NZ   10 
ATOM 6108  H H    . LYS A 1 45 ? 8.503   -27.298 -0.792  1.00 0.00 ? 45 LYS A H    10 
ATOM 6109  H HA   . LYS A 1 45 ? 7.290   -25.051 -2.146  1.00 0.00 ? 45 LYS A HA   10 
ATOM 6110  H HB2  . LYS A 1 45 ? 9.091   -24.818 -0.462  1.00 0.00 ? 45 LYS A HB2  10 
ATOM 6111  H HB3  . LYS A 1 45 ? 10.209  -25.667 -1.557  1.00 0.00 ? 45 LYS A HB3  10 
ATOM 6112  H HG2  . LYS A 1 45 ? 10.022  -23.859 -3.182  1.00 0.00 ? 45 LYS A HG2  10 
ATOM 6113  H HG3  . LYS A 1 45 ? 8.852   -23.019 -2.135  1.00 0.00 ? 45 LYS A HG3  10 
ATOM 6114  H HD2  . LYS A 1 45 ? 10.559  -22.820 -0.379  1.00 0.00 ? 45 LYS A HD2  10 
ATOM 6115  H HD3  . LYS A 1 45 ? 11.729  -23.674 -1.414  1.00 0.00 ? 45 LYS A HD3  10 
ATOM 6116  H HE2  . LYS A 1 45 ? 11.559  -21.883 -3.088  1.00 0.00 ? 45 LYS A HE2  10 
ATOM 6117  H HE3  . LYS A 1 45 ? 10.380  -21.033 -2.066  1.00 0.00 ? 45 LYS A HE3  10 
ATOM 6118  H HZ1  . LYS A 1 45 ? 12.590  -20.148 -1.797  1.00 0.00 ? 45 LYS A HZ1  10 
ATOM 6119  H HZ2  . LYS A 1 45 ? 12.078  -20.830 -0.386  1.00 0.00 ? 45 LYS A HZ2  10 
ATOM 6120  H HZ3  . LYS A 1 45 ? 13.173  -21.619 -1.334  1.00 0.00 ? 45 LYS A HZ3  10 
ATOM 6121  N N    . ALA A 1 46 ? 9.378   -27.012 -3.795  1.00 0.00 ? 46 ALA A N    10 
ATOM 6122  C CA   . ALA A 1 46 ? 9.830   -27.423 -5.121  1.00 0.00 ? 46 ALA A CA   10 
ATOM 6123  C C    . ALA A 1 46 ? 10.791  -28.596 -4.997  1.00 0.00 ? 46 ALA A C    10 
ATOM 6124  O O    . ALA A 1 46 ? 11.078  -29.054 -3.893  1.00 0.00 ? 46 ALA A O    10 
ATOM 6125  C CB   . ALA A 1 46 ? 10.502  -26.243 -5.817  1.00 0.00 ? 46 ALA A CB   10 
ATOM 6126  H H    . ALA A 1 46 ? 9.730   -27.515 -2.994  1.00 0.00 ? 46 ALA A H    10 
ATOM 6127  H HA   . ALA A 1 46 ? 8.965   -27.733 -5.707  1.00 0.00 ? 46 ALA A HA   10 
ATOM 6128  H HB1  . ALA A 1 46 ? 10.826  -26.547 -6.812  1.00 0.00 ? 46 ALA A HB1  10 
ATOM 6129  H HB2  . ALA A 1 46 ? 9.795   -25.418 -5.900  1.00 0.00 ? 46 ALA A HB2  10 
ATOM 6130  H HB3  . ALA A 1 46 ? 11.367  -25.922 -5.235  1.00 0.00 ? 46 ALA A HB3  10 
ATOM 6131  N N    . GLY A 1 1  ? 15.772  5.485   56.773  1.00 0.00 ? 1  GLY A N    11 
ATOM 6132  C CA   . GLY A 1 1  ? 17.058  6.152   56.815  1.00 0.00 ? 1  GLY A CA   11 
ATOM 6133  C C    . GLY A 1 1  ? 17.942  5.649   55.685  1.00 0.00 ? 1  GLY A C    11 
ATOM 6134  O O    . GLY A 1 1  ? 17.536  4.797   54.898  1.00 0.00 ? 1  GLY A O    11 
ATOM 6135  H H1   . GLY A 1 1  ? 15.606  4.802   56.048  1.00 0.00 ? 1  GLY A H1   11 
ATOM 6136  H HA2  . GLY A 1 1  ? 16.911  7.227   56.709  1.00 0.00 ? 1  GLY A HA2  11 
ATOM 6137  H HA3  . GLY A 1 1  ? 17.540  5.947   57.771  1.00 0.00 ? 1  GLY A HA3  11 
ATOM 6138  N N    . VAL A 1 2  ? 19.155  6.192   55.620  1.00 0.00 ? 2  VAL A N    11 
ATOM 6139  C CA   . VAL A 1 2  ? 20.123  5.817   54.594  1.00 0.00 ? 2  VAL A CA   11 
ATOM 6140  C C    . VAL A 1 2  ? 20.623  4.400   54.825  1.00 0.00 ? 2  VAL A C    11 
ATOM 6141  O O    . VAL A 1 2  ? 20.734  3.605   53.893  1.00 0.00 ? 2  VAL A O    11 
ATOM 6142  C CB   . VAL A 1 2  ? 21.344  6.756   54.599  1.00 0.00 ? 2  VAL A CB   11 
ATOM 6143  C CG1  . VAL A 1 2  ? 22.418  6.238   53.656  1.00 0.00 ? 2  VAL A CG1  11 
ATOM 6144  C CG2  . VAL A 1 2  ? 20.943  8.153   54.152  1.00 0.00 ? 2  VAL A CG2  11 
ATOM 6145  H H    . VAL A 1 2  ? 19.425  6.889   56.299  1.00 0.00 ? 2  VAL A H    11 
ATOM 6146  H HA   . VAL A 1 2  ? 19.633  5.874   53.622  1.00 0.00 ? 2  VAL A HA   11 
ATOM 6147  H HB   . VAL A 1 2  ? 21.747  6.805   55.611  1.00 0.00 ? 2  VAL A HB   11 
ATOM 6148  H HG11 . VAL A 1 2  ? 23.279  6.906   53.675  1.00 0.00 ? 2  VAL A HG11 11 
ATOM 6149  H HG12 . VAL A 1 2  ? 22.726  5.241   53.971  1.00 0.00 ? 2  VAL A HG12 11 
ATOM 6150  H HG13 . VAL A 1 2  ? 22.018  6.192   52.643  1.00 0.00 ? 2  VAL A HG13 11 
ATOM 6151  H HG21 . VAL A 1 2  ? 21.812  8.811   54.168  1.00 0.00 ? 2  VAL A HG21 11 
ATOM 6152  H HG22 . VAL A 1 2  ? 20.542  8.109   53.139  1.00 0.00 ? 2  VAL A HG22 11 
ATOM 6153  H HG23 . VAL A 1 2  ? 20.181  8.545   54.827  1.00 0.00 ? 2  VAL A HG23 11 
ATOM 6154  N N    . ILE A 1 3  ? 20.924  4.095   56.084  1.00 0.00 ? 3  ILE A N    11 
ATOM 6155  C CA   . ILE A 1 3  ? 21.415  2.776   56.471  1.00 0.00 ? 3  ILE A CA   11 
ATOM 6156  C C    . ILE A 1 3  ? 20.338  1.724   56.263  1.00 0.00 ? 3  ILE A C    11 
ATOM 6157  O O    . ILE A 1 3  ? 20.614  0.611   55.819  1.00 0.00 ? 3  ILE A O    11 
ATOM 6158  C CB   . ILE A 1 3  ? 21.830  2.741   57.954  1.00 0.00 ? 3  ILE A CB   11 
ATOM 6159  C CG1  . ILE A 1 3  ? 23.054  3.630   58.186  1.00 0.00 ? 3  ILE A CG1  11 
ATOM 6160  C CG2  . ILE A 1 3  ? 22.178  1.322   58.376  1.00 0.00 ? 3  ILE A CG2  11 
ATOM 6161  C CD1  . ILE A 1 3  ? 23.380  3.850   59.647  1.00 0.00 ? 3  ILE A CD1  11 
ATOM 6162  H H    . ILE A 1 3  ? 20.811  4.793   56.806  1.00 0.00 ? 3  ILE A H    11 
ATOM 6163  H HA   . ILE A 1 3  ? 22.279  2.536   55.852  1.00 0.00 ? 3  ILE A HA   11 
ATOM 6164  H HB   . ILE A 1 3  ? 21.000  3.104   58.561  1.00 0.00 ? 3  ILE A HB   11 
ATOM 6165  H HG12 . ILE A 1 3  ? 23.914  3.162   57.709  1.00 0.00 ? 3  ILE A HG12 11 
ATOM 6166  H HG13 . ILE A 1 3  ? 22.866  4.601   57.726  1.00 0.00 ? 3  ILE A HG13 11 
ATOM 6167  H HG21 . ILE A 1 3  ? 22.460  1.309   59.429  1.00 0.00 ? 3  ILE A HG21 11 
ATOM 6168  H HG22 . ILE A 1 3  ? 21.312  0.677   58.226  1.00 0.00 ? 3  ILE A HG22 11 
ATOM 6169  H HG23 . ILE A 1 3  ? 23.010  0.959   57.774  1.00 0.00 ? 3  ILE A HG23 11 
ATOM 6170  H HD11 . ILE A 1 3  ? 24.258  4.488   59.751  1.00 0.00 ? 3  ILE A HD11 11 
ATOM 6171  H HD12 . ILE A 1 3  ? 22.531  4.329   60.137  1.00 0.00 ? 3  ILE A HD12 11 
ATOM 6172  H HD13 . ILE A 1 3  ? 23.578  2.889   60.120  1.00 0.00 ? 3  ILE A HD13 11 
ATOM 6173  N N    . ASP A 1 4  ? 19.104  2.093   56.591  1.00 0.00 ? 4  ASP A N    11 
ATOM 6174  C CA   . ASP A 1 4  ? 17.959  1.199   56.451  1.00 0.00 ? 4  ASP A CA   11 
ATOM 6175  C C    . ASP A 1 4  ? 17.905  0.620   55.046  1.00 0.00 ? 4  ASP A C    11 
ATOM 6176  O O    . ASP A 1 4  ? 17.612  -0.559  54.855  1.00 0.00 ? 4  ASP A O    11 
ATOM 6177  C CB   . ASP A 1 4  ? 16.654  1.954   56.714  1.00 0.00 ? 4  ASP A CB   11 
ATOM 6178  C CG   . ASP A 1 4  ? 16.471  2.309   58.176  1.00 0.00 ? 4  ASP A CG   11 
ATOM 6179  O OD1  . ASP A 1 4  ? 15.378  2.795   58.537  1.00 0.00 ? 4  ASP A OD1  11 
ATOM 6180  O OD2  . ASP A 1 4  ? 17.420  2.102   58.961  1.00 0.00 ? 4  ASP A OD2  11 
ATOM 6181  H H    . ASP A 1 4  ? 18.941  3.023   56.952  1.00 0.00 ? 4  ASP A H    11 
ATOM 6182  H HA   . ASP A 1 4  ? 18.057  0.389   57.173  1.00 0.00 ? 4  ASP A HA   11 
ATOM 6183  H HB2  . ASP A 1 4  ? 16.656  2.874   56.128  1.00 0.00 ? 4  ASP A HB2  11 
ATOM 6184  H HB3  . ASP A 1 4  ? 15.818  1.330   56.398  1.00 0.00 ? 4  ASP A HB3  11 
ATOM 6185  H HD2  . ASP A 1 4  ? 17.235  2.350   59.870  1.00 0.00 ? 4  ASP A HD2  11 
ATOM 6186  N N    . THR A 1 5  ? 18.191  1.469   54.063  1.00 0.00 ? 5  THR A N    11 
ATOM 6187  C CA   . THR A 1 5  ? 18.182  1.069   52.659  1.00 0.00 ? 5  THR A CA   11 
ATOM 6188  C C    . THR A 1 5  ? 19.581  0.681   52.208  1.00 0.00 ? 5  THR A C    11 
ATOM 6189  O O    . THR A 1 5  ? 19.794  0.290   51.062  1.00 0.00 ? 5  THR A O    11 
ATOM 6190  C CB   . THR A 1 5  ? 17.691  2.211   51.750  1.00 0.00 ? 5  THR A CB   11 
ATOM 6191  O OG1  . THR A 1 5  ? 18.576  3.332   51.865  1.00 0.00 ? 5  THR A OG1  11 
ATOM 6192  C CG2  . THR A 1 5  ? 16.290  2.647   52.152  1.00 0.00 ? 5  THR A CG2  11 
ATOM 6193  H H    . THR A 1 5  ? 18.424  2.427   54.285  1.00 0.00 ? 5  THR A H    11 
ATOM 6194  H HA   . THR A 1 5  ? 17.515  0.214   52.549  1.00 0.00 ? 5  THR A HA   11 
ATOM 6195  H HB   . THR A 1 5  ? 17.677  1.865   50.717  1.00 0.00 ? 5  THR A HB   11 
ATOM 6196  H HG1  . THR A 1 5  ? 18.261  4.032   51.288  1.00 0.00 ? 5  THR A HG1  11 
ATOM 6197  H HG21 . THR A 1 5  ? 15.953  3.454   51.501  1.00 0.00 ? 5  THR A HG21 11 
ATOM 6198  H HG22 . THR A 1 5  ? 15.607  1.802   52.063  1.00 0.00 ? 5  THR A HG22 11 
ATOM 6199  H HG23 . THR A 1 5  ? 16.301  2.997   53.184  1.00 0.00 ? 5  THR A HG23 11 
ATOM 6200  N N    . SER A 1 6  ? 20.534  0.794   53.129  1.00 0.00 ? 6  SER A N    11 
ATOM 6201  C CA   . SER A 1 6  ? 21.928  0.461   52.853  1.00 0.00 ? 6  SER A CA   11 
ATOM 6202  C C    . SER A 1 6  ? 22.028  -0.899  52.181  1.00 0.00 ? 6  SER A C    11 
ATOM 6203  O O    . SER A 1 6  ? 22.529  -1.022  51.064  1.00 0.00 ? 6  SER A O    11 
ATOM 6204  C CB   . SER A 1 6  ? 22.736  0.419   54.152  1.00 0.00 ? 6  SER A CB   11 
ATOM 6205  O OG   . SER A 1 6  ? 24.090  0.088   53.899  1.00 0.00 ? 6  SER A OG   11 
ATOM 6206  H H    . SER A 1 6  ? 20.295  1.120   54.055  1.00 0.00 ? 6  SER A H    11 
ATOM 6207  H HA   . SER A 1 6  ? 22.345  1.222   52.193  1.00 0.00 ? 6  SER A HA   11 
ATOM 6208  H HB2  . SER A 1 6  ? 22.692  1.398   54.631  1.00 0.00 ? 6  SER A HB2  11 
ATOM 6209  H HB3  . SER A 1 6  ? 22.305  -0.330  54.816  1.00 0.00 ? 6  SER A HB3  11 
ATOM 6210  H HG   . SER A 1 6  ? 24.567  0.071   54.732  1.00 0.00 ? 6  SER A HG   11 
ATOM 6211  N N    . ALA A 1 7  ? 21.544  -1.922  52.880  1.00 0.00 ? 7  ALA A N    11 
ATOM 6212  C CA   . ALA A 1 7  ? 21.565  -3.291  52.374  1.00 0.00 ? 7  ALA A CA   11 
ATOM 6213  C C    . ALA A 1 7  ? 20.778  -3.392  51.077  1.00 0.00 ? 7  ALA A C    11 
ATOM 6214  O O    . ALA A 1 7  ? 21.193  -4.061  50.131  1.00 0.00 ? 7  ALA A O    11 
ATOM 6215  C CB   . ALA A 1 7  ? 20.946  -4.241  53.388  1.00 0.00 ? 7  ALA A CB   11 
ATOM 6216  H H    . ALA A 1 7  ? 21.146  -1.757  53.794  1.00 0.00 ? 7  ALA A H    11 
ATOM 6217  H HA   . ALA A 1 7  ? 22.599  -3.581  52.193  1.00 0.00 ? 7  ALA A HA   11 
ATOM 6218  H HB1  . ALA A 1 7  ? 20.980  -5.261  53.007  1.00 0.00 ? 7  ALA A HB1  11 
ATOM 6219  H HB2  . ALA A 1 7  ? 21.503  -4.185  54.323  1.00 0.00 ? 7  ALA A HB2  11 
ATOM 6220  H HB3  . ALA A 1 7  ? 19.909  -3.956  53.566  1.00 0.00 ? 7  ALA A HB3  11 
ATOM 6221  N N    . VAL A 1 8  ? 19.633  -2.717  51.046  1.00 0.00 ? 8  VAL A N    11 
ATOM 6222  C CA   . VAL A 1 8  ? 18.762  -2.711  49.874  1.00 0.00 ? 8  VAL A CA   11 
ATOM 6223  C C    . VAL A 1 8  ? 19.470  -2.078  48.688  1.00 0.00 ? 8  VAL A C    11 
ATOM 6224  O O    . VAL A 1 8  ? 19.377  -2.560  47.560  1.00 0.00 ? 8  VAL A O    11 
ATOM 6225  C CB   . VAL A 1 8  ? 17.470  -1.914  50.135  1.00 0.00 ? 8  VAL A CB   11 
ATOM 6226  C CG1  . VAL A 1 8  ? 16.680  -1.744  48.846  1.00 0.00 ? 8  VAL A CG1  11 
ATOM 6227  C CG2  . VAL A 1 8  ? 16.593  -2.637  51.145  1.00 0.00 ? 8  VAL A CG2  11 
ATOM 6228  H H    . VAL A 1 8  ? 19.345  -2.186  51.856  1.00 0.00 ? 8  VAL A H    11 
ATOM 6229  H HA   . VAL A 1 8  ? 18.503  -3.741  49.632  1.00 0.00 ? 8  VAL A HA   11 
ATOM 6230  H HB   . VAL A 1 8  ? 17.734  -0.931  50.527  1.00 0.00 ? 8  VAL A HB   11 
ATOM 6231  H HG11 . VAL A 1 8  ? 15.773  -1.171  49.041  1.00 0.00 ? 8  VAL A HG11 11 
ATOM 6232  H HG12 . VAL A 1 8  ? 17.290  -1.215  48.114  1.00 0.00 ? 8  VAL A HG12 11 
ATOM 6233  H HG13 . VAL A 1 8  ? 16.410  -2.724  48.454  1.00 0.00 ? 8  VAL A HG13 11 
ATOM 6234  H HG21 . VAL A 1 8  ? 15.686  -2.059  51.328  1.00 0.00 ? 8  VAL A HG21 11 
ATOM 6235  H HG22 . VAL A 1 8  ? 16.323  -3.618  50.754  1.00 0.00 ? 8  VAL A HG22 11 
ATOM 6236  H HG23 . VAL A 1 8  ? 17.140  -2.756  52.080  1.00 0.00 ? 8  VAL A HG23 11 
ATOM 6237  N N    . GLU A 1 9  ? 20.183  -0.988  48.958  1.00 0.00 ? 9  GLU A N    11 
ATOM 6238  C CA   . GLU A 1 9  ? 20.923  -0.264  47.928  1.00 0.00 ? 9  GLU A CA   11 
ATOM 6239  C C    . GLU A 1 9  ? 21.908  -1.188  47.231  1.00 0.00 ? 9  GLU A C    11 
ATOM 6240  O O    . GLU A 1 9  ? 22.098  -1.117  46.018  1.00 0.00 ? 9  GLU A O    11 
ATOM 6241  C CB   . GLU A 1 9  ? 21.704  0.898   48.546  1.00 0.00 ? 9  GLU A CB   11 
ATOM 6242  C CG   . GLU A 1 9  ? 22.451  1.751   47.534  1.00 0.00 ? 9  GLU A CG   11 
ATOM 6243  C CD   . GLU A 1 9  ? 23.171  2.920   48.177  1.00 0.00 ? 9  GLU A CD   11 
ATOM 6244  O OE1  . GLU A 1 9  ? 23.087  3.062   49.415  1.00 0.00 ? 9  GLU A OE1  11 
ATOM 6245  O OE2  . GLU A 1 9  ? 23.819  3.695   47.442  1.00 0.00 ? 9  GLU A OE2  11 
ATOM 6246  H H    . GLU A 1 9  ? 20.221  -0.640  49.906  1.00 0.00 ? 9  GLU A H    11 
ATOM 6247  H HA   . GLU A 1 9  ? 20.214  0.127   47.198  1.00 0.00 ? 9  GLU A HA   11 
ATOM 6248  H HB2  . GLU A 1 9  ? 21.001  1.538   49.080  1.00 0.00 ? 9  GLU A HB2  11 
ATOM 6249  H HB3  . GLU A 1 9  ? 22.428  0.488   49.250  1.00 0.00 ? 9  GLU A HB3  11 
ATOM 6250  H HG2  . GLU A 1 9  ? 23.183  1.127   47.022  1.00 0.00 ? 9  GLU A HG2  11 
ATOM 6251  H HG3  . GLU A 1 9  ? 21.737  2.137   46.806  1.00 0.00 ? 9  GLU A HG3  11 
ATOM 6252  H HE2  . GLU A 1 9  ? 24.248  4.412   47.914  1.00 0.00 ? 9  GLU A HE2  11 
ATOM 6253  N N    . SER A 1 10 ? 22.534  -2.059  48.017  1.00 0.00 ? 10 SER A N    11 
ATOM 6254  C CA   . SER A 1 10 ? 23.509  -3.014  47.501  1.00 0.00 ? 10 SER A CA   11 
ATOM 6255  C C    . SER A 1 10 ? 22.808  -4.221  46.900  1.00 0.00 ? 10 SER A C    11 
ATOM 6256  O O    . SER A 1 10 ? 23.119  -4.651  45.791  1.00 0.00 ? 10 SER A O    11 
ATOM 6257  C CB   . SER A 1 10 ? 24.429  -3.499  48.623  1.00 0.00 ? 10 SER A CB   11 
ATOM 6258  O OG   . SER A 1 10 ? 25.199  -2.432  49.149  1.00 0.00 ? 10 SER A OG   11 
ATOM 6259  H H    . SER A 1 10 ? 22.334  -2.069  49.007  1.00 0.00 ? 10 SER A H    11 
ATOM 6260  H HA   . SER A 1 10 ? 24.106  -2.523  46.732  1.00 0.00 ? 10 SER A HA   11 
ATOM 6261  H HB2  . SER A 1 10 ? 23.822  -3.926  49.421  1.00 0.00 ? 10 SER A HB2  11 
ATOM 6262  H HB3  . SER A 1 10 ? 25.100  -4.261  48.229  1.00 0.00 ? 10 SER A HB3  11 
ATOM 6263  H HG   . SER A 1 10 ? 25.763  -2.769  49.849  1.00 0.00 ? 10 SER A HG   11 
ATOM 6264  N N    . ALA A 1 11 ? 21.851  -4.762  47.651  1.00 0.00 ? 11 ALA A N    11 
ATOM 6265  C CA   . ALA A 1 11 ? 21.084  -5.925  47.216  1.00 0.00 ? 11 ALA A CA   11 
ATOM 6266  C C    . ALA A 1 11 ? 20.215  -5.573  46.020  1.00 0.00 ? 11 ALA A C    11 
ATOM 6267  O O    . ALA A 1 11 ? 20.061  -6.364  45.091  1.00 0.00 ? 11 ALA A O    11 
ATOM 6268  C CB   . ALA A 1 11 ? 20.183  -6.416  48.339  1.00 0.00 ? 11 ALA A CB   11 
ATOM 6269  H H    . ALA A 1 11 ? 21.641  -4.362  48.555  1.00 0.00 ? 11 ALA A H    11 
ATOM 6270  H HA   . ALA A 1 11 ? 21.778  -6.717  46.938  1.00 0.00 ? 11 ALA A HA   11 
ATOM 6271  H HB1  . ALA A 1 11 ? 19.626  -7.293  48.009  1.00 0.00 ? 11 ALA A HB1  11 
ATOM 6272  H HB2  . ALA A 1 11 ? 20.792  -6.679  49.204  1.00 0.00 ? 11 ALA A HB2  11 
ATOM 6273  H HB3  . ALA A 1 11 ? 19.483  -5.626  48.614  1.00 0.00 ? 11 ALA A HB3  11 
ATOM 6274  N N    . ILE A 1 12 ? 19.647  -4.371  46.056  1.00 0.00 ? 12 ILE A N    11 
ATOM 6275  C CA   . ILE A 1 12 ? 18.784  -3.883  44.985  1.00 0.00 ? 12 ILE A CA   11 
ATOM 6276  C C    . ILE A 1 12 ? 19.586  -3.668  43.712  1.00 0.00 ? 12 ILE A C    11 
ATOM 6277  O O    . ILE A 1 12 ? 19.172  -4.066  42.624  1.00 0.00 ? 12 ILE A O    11 
ATOM 6278  C CB   . ILE A 1 12 ? 18.122  -2.544  45.360  1.00 0.00 ? 12 ILE A CB   11 
ATOM 6279  C CG1  . ILE A 1 12 ? 17.139  -2.740  46.515  1.00 0.00 ? 12 ILE A CG1  11 
ATOM 6280  C CG2  . ILE A 1 12 ? 17.362  -1.975  44.171  1.00 0.00 ? 12 ILE A CG2  11 
ATOM 6281  C CD1  . ILE A 1 12 ? 16.009  -3.696  46.200  1.00 0.00 ? 12 ILE A CD1  11 
ATOM 6282  H H    . ILE A 1 12 ? 19.812  -3.765  46.848  1.00 0.00 ? 12 ILE A H    11 
ATOM 6283  H HA   . ILE A 1 12 ? 18.007  -4.626  44.802  1.00 0.00 ? 12 ILE A HA   11 
ATOM 6284  H HB   . ILE A 1 12 ? 18.896  -1.839  45.662  1.00 0.00 ? 12 ILE A HB   11 
ATOM 6285  H HG12 . ILE A 1 12 ? 17.688  -3.128  47.372  1.00 0.00 ? 12 ILE A HG12 11 
ATOM 6286  H HG13 . ILE A 1 12 ? 16.708  -1.771  46.768  1.00 0.00 ? 12 ILE A HG13 11 
ATOM 6287  H HG21 . ILE A 1 12 ? 16.906  -1.023  44.445  1.00 0.00 ? 12 ILE A HG21 11 
ATOM 6288  H HG22 . ILE A 1 12 ? 18.051  -1.820  43.341  1.00 0.00 ? 12 ILE A HG22 11 
ATOM 6289  H HG23 . ILE A 1 12 ? 16.582  -2.675  43.870  1.00 0.00 ? 12 ILE A HG23 11 
ATOM 6290  H HD11 . ILE A 1 12 ? 15.343  -3.797  47.057  1.00 0.00 ? 12 ILE A HD11 11 
ATOM 6291  H HD12 . ILE A 1 12 ? 15.441  -3.315  45.350  1.00 0.00 ? 12 ILE A HD12 11 
ATOM 6292  H HD13 . ILE A 1 12 ? 16.422  -4.673  45.952  1.00 0.00 ? 12 ILE A HD13 11 
ATOM 6293  N N    . THR A 1 13 ? 20.744  -3.031  43.863  1.00 0.00 ? 13 THR A N    11 
ATOM 6294  C CA   . THR A 1 13 ? 21.631  -2.747  42.738  1.00 0.00 ? 13 THR A CA   11 
ATOM 6295  C C    . THR A 1 13 ? 22.153  -4.039  42.132  1.00 0.00 ? 13 THR A C    11 
ATOM 6296  O O    . THR A 1 13 ? 22.222  -4.188  40.913  1.00 0.00 ? 13 THR A O    11 
ATOM 6297  C CB   . THR A 1 13 ? 22.844  -1.905  43.174  1.00 0.00 ? 13 THR A CB   11 
ATOM 6298  O OG1  . THR A 1 13 ? 22.396  -0.642  43.681  1.00 0.00 ? 13 THR A OG1  11 
ATOM 6299  C CG2  . THR A 1 13 ? 23.774  -1.660  41.996  1.00 0.00 ? 13 THR A CG2  11 
ATOM 6300  H H    . THR A 1 13 ? 21.029  -2.729  44.784  1.00 0.00 ? 13 THR A H    11 
ATOM 6301  H HA   . THR A 1 13 ? 21.066  -2.196  41.985  1.00 0.00 ? 13 THR A HA   11 
ATOM 6302  H HB   . THR A 1 13 ? 23.385  -2.437  43.955  1.00 0.00 ? 13 THR A HB   11 
ATOM 6303  H HG1  . THR A 1 13 ? 23.161  -0.132  43.956  1.00 0.00 ? 13 THR A HG1  11 
ATOM 6304  H HG21 . THR A 1 13 ? 24.628  -1.065  42.318  1.00 0.00 ? 13 THR A HG21 11 
ATOM 6305  H HG22 . THR A 1 13 ? 24.124  -2.615  41.607  1.00 0.00 ? 13 THR A HG22 11 
ATOM 6306  H HG23 . THR A 1 13 ? 23.235  -1.124  41.214  1.00 0.00 ? 13 THR A HG23 11 
ATOM 6307  N N    . ASP A 1 14 ? 22.521  -4.976  43.003  1.00 0.00 ? 14 ASP A N    11 
ATOM 6308  C CA   . ASP A 1 14 ? 23.043  -6.271  42.581  1.00 0.00 ? 14 ASP A CA   11 
ATOM 6309  C C    . ASP A 1 14 ? 21.951  -7.096  41.920  1.00 0.00 ? 14 ASP A C    11 
ATOM 6310  O O    . ASP A 1 14 ? 22.132  -7.632  40.828  1.00 0.00 ? 14 ASP A O    11 
ATOM 6311  C CB   . ASP A 1 14 ? 23.577  -7.051  43.784  1.00 0.00 ? 14 ASP A CB   11 
ATOM 6312  C CG   . ASP A 1 14 ? 24.863  -6.466  44.334  1.00 0.00 ? 14 ASP A CG   11 
ATOM 6313  O OD1  . ASP A 1 14 ? 25.467  -7.095  45.228  1.00 0.00 ? 14 ASP A OD1  11 
ATOM 6314  O OD2  . ASP A 1 14 ? 25.267  -5.379  43.870  1.00 0.00 ? 14 ASP A OD2  11 
ATOM 6315  H H    . ASP A 1 14 ? 22.440  -4.794  43.993  1.00 0.00 ? 14 ASP A H    11 
ATOM 6316  H HA   . ASP A 1 14 ? 23.852  -6.106  41.870  1.00 0.00 ? 14 ASP A HA   11 
ATOM 6317  H HB2  . ASP A 1 14 ? 22.823  -7.041  44.571  1.00 0.00 ? 14 ASP A HB2  11 
ATOM 6318  H HB3  . ASP A 1 14 ? 23.763  -8.080  43.479  1.00 0.00 ? 14 ASP A HB3  11 
ATOM 6319  H HD2  . ASP A 1 14 ? 26.085  -5.067  44.263  1.00 0.00 ? 14 ASP A HD2  11 
ATOM 6320  N N    . GLY A 1 15 ? 20.811  -7.189  42.598  1.00 0.00 ? 15 GLY A N    11 
ATOM 6321  C CA   . GLY A 1 15 ? 19.666  -7.944  42.098  1.00 0.00 ? 15 GLY A CA   11 
ATOM 6322  C C    . GLY A 1 15 ? 18.857  -7.104  41.123  1.00 0.00 ? 15 GLY A C    11 
ATOM 6323  O O    . GLY A 1 15 ? 18.809  -7.387  39.927  1.00 0.00 ? 15 GLY A O    11 
ATOM 6324  H H    . GLY A 1 15 ? 20.723  -6.725  43.491  1.00 0.00 ? 15 GLY A H    11 
ATOM 6325  H HA2  . GLY A 1 15 ? 20.021  -8.840  41.591  1.00 0.00 ? 15 GLY A HA2  11 
ATOM 6326  H HA3  . GLY A 1 15 ? 19.031  -8.231  42.937  1.00 0.00 ? 15 GLY A HA3  11 
ATOM 6327  N N    . GLN A 1 16 ? 18.222  -6.063  41.652  1.00 0.00 ? 16 GLN A N    11 
ATOM 6328  C CA   . GLN A 1 16 ? 17.404  -5.158  40.850  1.00 0.00 ? 16 GLN A CA   11 
ATOM 6329  C C    . GLN A 1 16 ? 18.163  -4.712  39.610  1.00 0.00 ? 16 GLN A C    11 
ATOM 6330  O O    . GLN A 1 16 ? 17.686  -4.857  38.486  1.00 0.00 ? 16 GLN A O    11 
ATOM 6331  C CB   . GLN A 1 16 ? 17.028  -3.916  41.660  1.00 0.00 ? 16 GLN A CB   11 
ATOM 6332  C CG   . GLN A 1 16 ? 16.137  -2.935  40.915  1.00 0.00 ? 16 GLN A CG   11 
ATOM 6333  C CD   . GLN A 1 16 ? 14.777  -3.517  40.587  1.00 0.00 ? 16 GLN A CD   11 
ATOM 6334  O OE1  . GLN A 1 16 ? 14.062  -3.986  41.472  1.00 0.00 ? 16 GLN A OE1  11 
ATOM 6335  N NE2  . GLN A 1 16 ? 14.415  -3.489  39.309  1.00 0.00 ? 16 GLN A NE2  11 
ATOM 6336  H H    . GLN A 1 16 ? 18.300  -5.883  42.643  1.00 0.00 ? 16 GLN A H    11 
ATOM 6337  H HA   . GLN A 1 16 ? 16.495  -5.680  40.550  1.00 0.00 ? 16 GLN A HA   11 
ATOM 6338  H HB2  . GLN A 1 16 ? 16.503  -4.239  42.559  1.00 0.00 ? 16 GLN A HB2  11 
ATOM 6339  H HB3  . GLN A 1 16 ? 17.945  -3.399  41.941  1.00 0.00 ? 16 GLN A HB3  11 
ATOM 6340  H HG2  . GLN A 1 16 ? 15.998  -2.047  41.533  1.00 0.00 ? 16 GLN A HG2  11 
ATOM 6341  H HG3  . GLN A 1 16 ? 16.630  -2.650  39.985  1.00 0.00 ? 16 GLN A HG3  11 
ATOM 6342  H HE21 . GLN A 1 16 ? 15.036  -3.093  38.618  1.00 0.00 ? 16 GLN A HE21 11 
ATOM 6343  H HE22 . GLN A 1 16 ? 13.519  -3.863  39.031  1.00 0.00 ? 16 GLN A HE22 11 
ATOM 6344  N N    . GLY A 1 17 ? 19.356  -4.167  39.832  1.00 0.00 ? 17 GLY A N    11 
ATOM 6345  C CA   . GLY A 1 17 ? 20.208  -3.688  38.747  1.00 0.00 ? 17 GLY A CA   11 
ATOM 6346  C C    . GLY A 1 17 ? 20.372  -4.764  37.685  1.00 0.00 ? 17 GLY A C    11 
ATOM 6347  O O    . GLY A 1 17 ? 20.235  -4.504  36.491  1.00 0.00 ? 17 GLY A O    11 
ATOM 6348  H H    . GLY A 1 17 ? 19.693  -4.076  40.780  1.00 0.00 ? 17 GLY A H    11 
ATOM 6349  H HA2  . GLY A 1 17 ? 19.754  -2.804  38.297  1.00 0.00 ? 17 GLY A HA2  11 
ATOM 6350  H HA3  . GLY A 1 17 ? 21.187  -3.426  39.148  1.00 0.00 ? 17 GLY A HA3  11 
ATOM 6351  N N    . ASP A 1 18 ? 20.668  -5.979  38.138  1.00 0.00 ? 18 ASP A N    11 
ATOM 6352  C CA   . ASP A 1 18 ? 20.858  -7.119  37.246  1.00 0.00 ? 18 ASP A CA   11 
ATOM 6353  C C    . ASP A 1 18 ? 19.633  -7.316  36.367  1.00 0.00 ? 18 ASP A C    11 
ATOM 6354  O O    . ASP A 1 18 ? 19.673  -8.041  35.374  1.00 0.00 ? 18 ASP A O    11 
ATOM 6355  C CB   . ASP A 1 18 ? 21.086  -8.399  38.053  1.00 0.00 ? 18 ASP A CB   11 
ATOM 6356  C CG   . ASP A 1 18 ? 22.433  -8.418  38.747  1.00 0.00 ? 18 ASP A CG   11 
ATOM 6357  O OD1  . ASP A 1 18 ? 23.058  -9.498  38.802  1.00 0.00 ? 18 ASP A OD1  11 
ATOM 6358  O OD2  . ASP A 1 18 ? 22.865  -7.353  39.236  1.00 0.00 ? 18 ASP A OD2  11 
ATOM 6359  H H    . ASP A 1 18 ? 20.767  -6.129  39.132  1.00 0.00 ? 18 ASP A H    11 
ATOM 6360  H HA   . ASP A 1 18 ? 21.727  -6.930  36.617  1.00 0.00 ? 18 ASP A HA   11 
ATOM 6361  H HB2  . ASP A 1 18 ? 20.302  -8.482  38.806  1.00 0.00 ? 18 ASP A HB2  11 
ATOM 6362  H HB3  . ASP A 1 18 ? 21.027  -9.253  37.379  1.00 0.00 ? 18 ASP A HB3  11 
ATOM 6363  H HD2  . ASP A 1 18 ? 23.722  -7.437  39.660  1.00 0.00 ? 18 ASP A HD2  11 
ATOM 6364  N N    . MET A 1 19 ? 18.541  -6.658  36.746  1.00 0.00 ? 19 MET A N    11 
ATOM 6365  C CA   . MET A 1 19 ? 17.284  -6.742  36.009  1.00 0.00 ? 19 MET A CA   11 
ATOM 6366  C C    . MET A 1 19 ? 17.441  -6.148  34.619  1.00 0.00 ? 19 MET A C    11 
ATOM 6367  O O    . MET A 1 19 ? 16.955  -6.699  33.633  1.00 0.00 ? 19 MET A O    11 
ATOM 6368  C CB   . MET A 1 19 ? 16.181  -5.974  36.741  1.00 0.00 ? 19 MET A CB   11 
ATOM 6369  C CG   . MET A 1 19 ? 14.813  -6.078  36.086  1.00 0.00 ? 19 MET A CG   11 
ATOM 6370  S SD   . MET A 1 19 ? 13.541  -5.172  36.987  1.00 0.00 ? 19 MET A SD   11 
ATOM 6371  C CE   . MET A 1 19 ? 13.395  -6.173  38.465  1.00 0.00 ? 19 MET A CE   11 
ATOM 6372  H H    . MET A 1 19 ? 18.571  -6.078  37.572  1.00 0.00 ? 19 MET A H    11 
ATOM 6373  H HA   . MET A 1 19 ? 16.997  -7.790  35.924  1.00 0.00 ? 19 MET A HA   11 
ATOM 6374  H HB2  . MET A 1 19 ? 16.105  -6.365  37.756  1.00 0.00 ? 19 MET A HB2  11 
ATOM 6375  H HB3  . MET A 1 19 ? 16.463  -4.921  36.778  1.00 0.00 ? 19 MET A HB3  11 
ATOM 6376  H HG2  . MET A 1 19 ? 14.875  -5.681  35.073  1.00 0.00 ? 19 MET A HG2  11 
ATOM 6377  H HG3  . MET A 1 19 ? 14.525  -7.128  36.033  1.00 0.00 ? 19 MET A HG3  11 
ATOM 6378  H HE1  . MET A 1 19 ? 12.644  -5.746  39.131  1.00 0.00 ? 19 MET A HE1  11 
ATOM 6379  H HE2  . MET A 1 19 ? 13.098  -7.184  38.189  1.00 0.00 ? 19 MET A HE2  11 
ATOM 6380  H HE3  . MET A 1 19 ? 14.356  -6.203  38.978  1.00 0.00 ? 19 MET A HE3  11 
ATOM 6381  N N    . LYS A 1 20 ? 18.130  -5.012  34.554  1.00 0.00 ? 20 LYS A N    11 
ATOM 6382  C CA   . LYS A 1 20 ? 18.370  -4.316  33.293  1.00 0.00 ? 20 LYS A CA   11 
ATOM 6383  C C    . LYS A 1 20 ? 19.087  -5.228  32.310  1.00 0.00 ? 20 LYS A C    11 
ATOM 6384  O O    . LYS A 1 20 ? 18.768  -5.260  31.123  1.00 0.00 ? 20 LYS A O    11 
ATOM 6385  C CB   . LYS A 1 20 ? 19.236  -3.076  33.522  1.00 0.00 ? 20 LYS A CB   11 
ATOM 6386  C CG   . LYS A 1 20 ? 19.485  -2.253  32.269  1.00 0.00 ? 20 LYS A CG   11 
ATOM 6387  C CD   . LYS A 1 20 ? 20.303  -1.009  32.578  1.00 0.00 ? 20 LYS A CD   11 
ATOM 6388  C CE   . LYS A 1 20 ? 20.564  -0.194  31.322  1.00 0.00 ? 20 LYS A CE   11 
ATOM 6389  N NZ   . LYS A 1 20 ? 21.354  1.035   31.612  1.00 0.00 ? 20 LYS A NZ   11 
ATOM 6390  H H    . LYS A 1 20 ? 18.504  -4.608  35.400  1.00 0.00 ? 20 LYS A H    11 
ATOM 6391  H HA   . LYS A 1 20 ? 17.411  -4.013  32.872  1.00 0.00 ? 20 LYS A HA   11 
ATOM 6392  H HB2  . LYS A 1 20 ? 18.737  -2.441  34.255  1.00 0.00 ? 20 LYS A HB2  11 
ATOM 6393  H HB3  . LYS A 1 20 ? 20.199  -3.399  33.916  1.00 0.00 ? 20 LYS A HB3  11 
ATOM 6394  H HG2  . LYS A 1 20 ? 20.026  -2.862  31.546  1.00 0.00 ? 20 LYS A HG2  11 
ATOM 6395  H HG3  . LYS A 1 20 ? 18.526  -1.951  31.846  1.00 0.00 ? 20 LYS A HG3  11 
ATOM 6396  H HD2  . LYS A 1 20 ? 19.757  -0.393  33.294  1.00 0.00 ? 20 LYS A HD2  11 
ATOM 6397  H HD3  . LYS A 1 20 ? 21.257  -1.309  33.011  1.00 0.00 ? 20 LYS A HD3  11 
ATOM 6398  H HE2  . LYS A 1 20 ? 21.114  -0.808  30.610  1.00 0.00 ? 20 LYS A HE2  11 
ATOM 6399  H HE3  . LYS A 1 20 ? 19.609  0.095   30.883  1.00 0.00 ? 20 LYS A HE3  11 
ATOM 6400  H HZ1  . LYS A 1 20 ? 21.508  1.551   30.758  1.00 0.00 ? 20 LYS A HZ1  11 
ATOM 6401  H HZ2  . LYS A 1 20 ? 20.846  1.614   32.266  1.00 0.00 ? 20 LYS A HZ2  11 
ATOM 6402  H HZ3  . LYS A 1 20 ? 22.244  0.776   32.012  1.00 0.00 ? 20 LYS A HZ3  11 
ATOM 6403  N N    . ALA A 1 21 ? 20.065  -5.971  32.823  1.00 0.00 ? 21 ALA A N    11 
ATOM 6404  C CA   . ALA A 1 21 ? 20.849  -6.896  32.011  1.00 0.00 ? 21 ALA A CA   11 
ATOM 6405  C C    . ALA A 1 21 ? 19.989  -8.063  31.553  1.00 0.00 ? 21 ALA A C    11 
ATOM 6406  O O    . ALA A 1 21 ? 20.070  -8.501  30.407  1.00 0.00 ? 21 ALA A O    11 
ATOM 6407  C CB   . ALA A 1 21 ? 22.019  -7.445  32.813  1.00 0.00 ? 21 ALA A CB   11 
ATOM 6408  H H    . ALA A 1 21 ? 20.280  -5.899  33.807  1.00 0.00 ? 21 ALA A H    11 
ATOM 6409  H HA   . ALA A 1 21 ? 21.227  -6.362  31.140  1.00 0.00 ? 21 ALA A HA   11 
ATOM 6410  H HB1  . ALA A 1 21 ? 22.606  -8.122  32.193  1.00 0.00 ? 21 ALA A HB1  11 
ATOM 6411  H HB2  . ALA A 1 21 ? 22.650  -6.620  33.144  1.00 0.00 ? 21 ALA A HB2  11 
ATOM 6412  H HB3  . ALA A 1 21 ? 21.641  -7.984  33.682  1.00 0.00 ? 21 ALA A HB3  11 
ATOM 6413  N N    . ILE A 1 22 ? 19.161  -8.560  32.468  1.00 0.00 ? 22 ILE A N    11 
ATOM 6414  C CA   . ILE A 1 22 ? 18.270  -9.682  32.185  1.00 0.00 ? 22 ILE A CA   11 
ATOM 6415  C C    . ILE A 1 22 ? 17.252  -9.298  31.123  1.00 0.00 ? 22 ILE A C    11 
ATOM 6416  O O    . ILE A 1 22 ? 17.050  -10.018 30.147  1.00 0.00 ? 22 ILE A O    11 
ATOM 6417  C CB   . ILE A 1 22 ? 17.499  -10.122 33.443  1.00 0.00 ? 22 ILE A CB   11 
ATOM 6418  C CG1  . ILE A 1 22 ? 18.457  -10.726 34.472  1.00 0.00 ? 22 ILE A CG1  11 
ATOM 6419  C CG2  . ILE A 1 22 ? 16.451  -11.166 33.089  1.00 0.00 ? 22 ILE A CG2  11 
ATOM 6420  C CD1  . ILE A 1 22 ? 17.829  -10.958 35.829  1.00 0.00 ? 22 ILE A CD1  11 
ATOM 6421  H H    . ILE A 1 22 ? 19.138  -8.154  33.393  1.00 0.00 ? 22 ILE A H    11 
ATOM 6422  H HA   . ILE A 1 22 ? 18.871  -10.516 31.825  1.00 0.00 ? 22 ILE A HA   11 
ATOM 6423  H HB   . ILE A 1 22 ? 17.006  -9.251  33.877  1.00 0.00 ? 22 ILE A HB   11 
ATOM 6424  H HG12 . ILE A 1 22 ? 18.813  -11.682 34.090  1.00 0.00 ? 22 ILE A HG12 11 
ATOM 6425  H HG13 . ILE A 1 22 ? 19.300  -10.047 34.596  1.00 0.00 ? 22 ILE A HG13 11 
ATOM 6426  H HG21 . ILE A 1 22 ? 15.905  -11.461 33.985  1.00 0.00 ? 22 ILE A HG21 11 
ATOM 6427  H HG22 . ILE A 1 22 ? 15.753  -10.747 32.364  1.00 0.00 ? 22 ILE A HG22 11 
ATOM 6428  H HG23 . ILE A 1 22 ? 16.940  -12.039 32.660  1.00 0.00 ? 22 ILE A HG23 11 
ATOM 6429  H HD11 . ILE A 1 22 ? 18.555  -11.389 36.518  1.00 0.00 ? 22 ILE A HD11 11 
ATOM 6430  H HD12 . ILE A 1 22 ? 17.477  -10.007 36.230  1.00 0.00 ? 22 ILE A HD12 11 
ATOM 6431  H HD13 . ILE A 1 22 ? 16.987  -11.642 35.724  1.00 0.00 ? 22 ILE A HD13 11 
ATOM 6432  N N    . GLY A 1 23 ? 16.614  -8.150  31.327  1.00 0.00 ? 23 GLY A N    11 
ATOM 6433  C CA   . GLY A 1 23 ? 15.607  -7.641  30.399  1.00 0.00 ? 23 GLY A CA   11 
ATOM 6434  C C    . GLY A 1 23 ? 16.246  -7.278  29.068  1.00 0.00 ? 23 GLY A C    11 
ATOM 6435  O O    . GLY A 1 23 ? 15.720  -7.594  28.002  1.00 0.00 ? 23 GLY A O    11 
ATOM 6436  H H    . GLY A 1 23 ? 16.824  -7.602  32.149  1.00 0.00 ? 23 GLY A H    11 
ATOM 6437  H HA2  . GLY A 1 23 ? 14.848  -8.406  30.237  1.00 0.00 ? 23 GLY A HA2  11 
ATOM 6438  H HA3  . GLY A 1 23 ? 15.139  -6.754  30.827  1.00 0.00 ? 23 GLY A HA3  11 
ATOM 6439  N N    . GLY A 1 24 ? 17.391  -6.606  29.145  1.00 0.00 ? 24 GLY A N    11 
ATOM 6440  C CA   . GLY A 1 24 ? 18.128  -6.183  27.958  1.00 0.00 ? 24 GLY A CA   11 
ATOM 6441  C C    . GLY A 1 24 ? 18.685  -7.389  27.219  1.00 0.00 ? 24 GLY A C    11 
ATOM 6442  O O    . GLY A 1 24 ? 18.448  -7.570  26.026  1.00 0.00 ? 24 GLY A O    11 
ATOM 6443  H H    . GLY A 1 24 ? 17.772  -6.375  30.051  1.00 0.00 ? 24 GLY A H    11 
ATOM 6444  H HA2  . GLY A 1 24 ? 17.458  -5.633  27.296  1.00 0.00 ? 24 GLY A HA2  11 
ATOM 6445  H HA3  . GLY A 1 24 ? 18.950  -5.534  28.258  1.00 0.00 ? 24 GLY A HA3  11 
ATOM 6446  N N    . TYR A 1 25 ? 19.432  -8.215  27.947  1.00 0.00 ? 25 TYR A N    11 
ATOM 6447  C CA   . TYR A 1 25 ? 20.040  -9.417  27.385  1.00 0.00 ? 25 TYR A CA   11 
ATOM 6448  C C    . TYR A 1 25 ? 18.979  -10.305 26.756  1.00 0.00 ? 25 TYR A C    11 
ATOM 6449  O O    . TYR A 1 25 ? 19.189  -10.895 25.697  1.00 0.00 ? 25 TYR A O    11 
ATOM 6450  C CB   . TYR A 1 25 ? 20.755  -10.216 28.476  1.00 0.00 ? 25 TYR A CB   11 
ATOM 6451  C CG   . TYR A 1 25 ? 21.402  -11.489 27.979  1.00 0.00 ? 25 TYR A CG   11 
ATOM 6452  C CD1  . TYR A 1 25 ? 22.611  -11.452 27.295  1.00 0.00 ? 25 TYR A CD1  11 
ATOM 6453  C CD2  . TYR A 1 25 ? 20.803  -12.723 28.195  1.00 0.00 ? 25 TYR A CD2  11 
ATOM 6454  C CE1  . TYR A 1 25 ? 23.210  -12.610 26.837  1.00 0.00 ? 25 TYR A CE1  11 
ATOM 6455  C CE2  . TYR A 1 25 ? 21.387  -13.892 27.744  1.00 0.00 ? 25 TYR A CE2  11 
ATOM 6456  C CZ   . TYR A 1 25 ? 22.601  -13.826 27.060  1.00 0.00 ? 25 TYR A CZ   11 
ATOM 6457  O OH   . TYR A 1 25 ? 23.195  -14.980 26.605  1.00 0.00 ? 25 TYR A OH   11 
ATOM 6458  H H    . TYR A 1 25 ? 19.591  -8.012  28.924  1.00 0.00 ? 25 TYR A H    11 
ATOM 6459  H HA   . TYR A 1 25 ? 20.761  -9.120  26.624  1.00 0.00 ? 25 TYR A HA   11 
ATOM 6460  H HB2  . TYR A 1 25 ? 21.526  -9.585  28.918  1.00 0.00 ? 25 TYR A HB2  11 
ATOM 6461  H HB3  . TYR A 1 25 ? 20.030  -10.474 29.248  1.00 0.00 ? 25 TYR A HB3  11 
ATOM 6462  H HD1  . TYR A 1 25 ? 23.091  -10.501 27.118  1.00 0.00 ? 25 TYR A HD1  11 
ATOM 6463  H HD2  . TYR A 1 25 ? 19.863  -12.770 28.725  1.00 0.00 ? 25 TYR A HD2  11 
ATOM 6464  H HE1  . TYR A 1 25 ? 24.150  -12.562 26.307  1.00 0.00 ? 25 TYR A HE1  11 
ATOM 6465  H HE2  . TYR A 1 25 ? 20.909  -14.844 27.919  1.00 0.00 ? 25 TYR A HE2  11 
ATOM 6466  H HH   . TYR A 1 25 ? 22.689  -15.769 26.812  1.00 0.00 ? 25 TYR A HH   11 
ATOM 6467  N N    . ILE A 1 26 ? 17.832  -10.393 27.424  1.00 0.00 ? 26 ILE A N    11 
ATOM 6468  C CA   . ILE A 1 26 ? 16.714  -11.205 26.952  1.00 0.00 ? 26 ILE A CA   11 
ATOM 6469  C C    . ILE A 1 26 ? 16.021  -10.526 25.782  1.00 0.00 ? 26 ILE A C    11 
ATOM 6470  O O    . ILE A 1 26 ? 15.705  -11.159 24.776  1.00 0.00 ? 26 ILE A O    11 
ATOM 6471  C CB   . ILE A 1 26 ? 15.668  -11.424 28.061  1.00 0.00 ? 26 ILE A CB   11 
ATOM 6472  C CG1  . ILE A 1 26 ? 16.252  -12.283 29.183  1.00 0.00 ? 26 ILE A CG1  11 
ATOM 6473  C CG2  . ILE A 1 26 ? 14.440  -12.128 27.503  1.00 0.00 ? 26 ILE A CG2  11 
ATOM 6474  C CD1  . ILE A 1 26 ? 15.384  -12.344 30.421  1.00 0.00 ? 26 ILE A CD1  11 
ATOM 6475  H H    . ILE A 1 26 ? 17.719  -9.883  28.289  1.00 0.00 ? 26 ILE A H    11 
ATOM 6476  H HA   . ILE A 1 26 ? 17.101  -12.171 26.631  1.00 0.00 ? 26 ILE A HA   11 
ATOM 6477  H HB   . ILE A 1 26 ? 15.374  -10.455 28.465  1.00 0.00 ? 26 ILE A HB   11 
ATOM 6478  H HG12 . ILE A 1 26 ? 16.384  -13.297 28.806  1.00 0.00 ? 26 ILE A HG12 11 
ATOM 6479  H HG13 . ILE A 1 26 ? 17.221  -11.870 29.463  1.00 0.00 ? 26 ILE A HG13 11 
ATOM 6480  H HG21 . ILE A 1 26 ? 13.703  -12.268 28.294  1.00 0.00 ? 26 ILE A HG21 11 
ATOM 6481  H HG22 . ILE A 1 26 ? 14.005  -11.522 26.708  1.00 0.00 ? 26 ILE A HG22 11 
ATOM 6482  H HG23 . ILE A 1 26 ? 14.729  -13.099 27.103  1.00 0.00 ? 26 ILE A HG23 11 
ATOM 6483  H HD11 . ILE A 1 26 ? 15.848  -12.969 31.184  1.00 0.00 ? 26 ILE A HD11 11 
ATOM 6484  H HD12 . ILE A 1 26 ? 15.250  -11.337 30.817  1.00 0.00 ? 26 ILE A HD12 11 
ATOM 6485  H HD13 . ILE A 1 26 ? 14.412  -12.763 30.159  1.00 0.00 ? 26 ILE A HD13 11 
ATOM 6486  N N    . VAL A 1 27 ? 15.788  -9.225  25.928  1.00 0.00 ? 27 VAL A N    11 
ATOM 6487  C CA   . VAL A 1 27 ? 15.130  -8.429  24.895  1.00 0.00 ? 27 VAL A CA   11 
ATOM 6488  C C    . VAL A 1 27 ? 16.085  -8.157  23.744  1.00 0.00 ? 27 VAL A C    11 
ATOM 6489  O O    . VAL A 1 27 ? 15.673  -8.030  22.592  1.00 0.00 ? 27 VAL A O    11 
ATOM 6490  C CB   . VAL A 1 27 ? 14.654  -7.072  25.446  1.00 0.00 ? 27 VAL A CB   11 
ATOM 6491  C CG1  . VAL A 1 27 ? 14.138  -6.191  24.318  1.00 0.00 ? 27 VAL A CG1  11 
ATOM 6492  C CG2  . VAL A 1 27 ? 13.531  -7.270  26.453  1.00 0.00 ? 27 VAL A CG2  11 
ATOM 6493  H H    . VAL A 1 27 ? 16.071  -8.761  26.779  1.00 0.00 ? 27 VAL A H    11 
ATOM 6494  H HA   . VAL A 1 27 ? 14.269  -8.986  24.527  1.00 0.00 ? 27 VAL A HA   11 
ATOM 6495  H HB   . VAL A 1 27 ? 15.492  -6.576  25.935  1.00 0.00 ? 27 VAL A HB   11 
ATOM 6496  H HG11 . VAL A 1 27 ? 13.812  -5.231  24.718  1.00 0.00 ? 27 VAL A HG11 11 
ATOM 6497  H HG12 . VAL A 1 27 ? 14.934  -6.028  23.592  1.00 0.00 ? 27 VAL A HG12 11 
ATOM 6498  H HG13 . VAL A 1 27 ? 13.296  -6.683  23.830  1.00 0.00 ? 27 VAL A HG13 11 
ATOM 6499  H HG21 . VAL A 1 27 ? 13.208  -6.304  26.842  1.00 0.00 ? 27 VAL A HG21 11 
ATOM 6500  H HG22 . VAL A 1 27 ? 12.689  -7.762  25.965  1.00 0.00 ? 27 VAL A HG22 11 
ATOM 6501  H HG23 . VAL A 1 27 ? 13.887  -7.890  27.276  1.00 0.00 ? 27 VAL A HG23 11 
ATOM 6502  N N    . GLY A 1 28 ? 17.371  -8.070  24.072  1.00 0.00 ? 28 GLY A N    11 
ATOM 6503  C CA   . GLY A 1 28 ? 18.413  -7.812  23.083  1.00 0.00 ? 28 GLY A CA   11 
ATOM 6504  C C    . GLY A 1 28 ? 18.681  -9.059  22.255  1.00 0.00 ? 28 GLY A C    11 
ATOM 6505  O O    . GLY A 1 28 ? 19.169  -8.982  21.129  1.00 0.00 ? 28 GLY A O    11 
ATOM 6506  H H    . GLY A 1 28 ? 17.647  -8.184  25.037  1.00 0.00 ? 28 GLY A H    11 
ATOM 6507  H HA2  . GLY A 1 28 ? 18.091  -7.005  22.424  1.00 0.00 ? 28 GLY A HA2  11 
ATOM 6508  H HA3  . GLY A 1 28 ? 19.329  -7.516  23.595  1.00 0.00 ? 28 GLY A HA3  11 
ATOM 6509  N N    . ALA A 1 29 ? 18.353  -10.212 22.831  1.00 0.00 ? 29 ALA A N    11 
ATOM 6510  C CA   . ALA A 1 29 ? 18.549  -11.498 22.169  1.00 0.00 ? 29 ALA A CA   11 
ATOM 6511  C C    . ALA A 1 29 ? 17.368  -11.816 21.264  1.00 0.00 ? 29 ALA A C    11 
ATOM 6512  O O    . ALA A 1 29 ? 17.519  -12.443 20.217  1.00 0.00 ? 29 ALA A O    11 
ATOM 6513  C CB   . ALA A 1 29 ? 18.681  -12.610 23.199  1.00 0.00 ? 29 ALA A CB   11 
ATOM 6514  H H    . ALA A 1 29 ? 17.954  -10.209 23.759  1.00 0.00 ? 29 ALA A H    11 
ATOM 6515  H HA   . ALA A 1 29 ? 19.459  -11.449 21.572  1.00 0.00 ? 29 ALA A HA   11 
ATOM 6516  H HB1  . ALA A 1 29 ? 18.841  -13.563 22.695  1.00 0.00 ? 29 ALA A HB1  11 
ATOM 6517  H HB2  . ALA A 1 29 ? 19.527  -12.399 23.853  1.00 0.00 ? 29 ALA A HB2  11 
ATOM 6518  H HB3  . ALA A 1 29 ? 17.768  -12.664 23.793  1.00 0.00 ? 29 ALA A HB3  11 
ATOM 6519  N N    . LEU A 1 30 ? 16.187  -11.372 21.685  1.00 0.00 ? 30 LEU A N    11 
ATOM 6520  C CA   . LEU A 1 30 ? 14.957  -11.595 20.930  1.00 0.00 ? 30 LEU A CA   11 
ATOM 6521  C C    . LEU A 1 30 ? 15.100  -11.067 19.512  1.00 0.00 ? 30 LEU A C    11 
ATOM 6522  O O    . LEU A 1 30 ? 14.500  -11.591 18.575  1.00 0.00 ? 30 LEU A O    11 
ATOM 6523  C CB   . LEU A 1 30 ? 13.781  -10.878 21.597  1.00 0.00 ? 30 LEU A CB   11 
ATOM 6524  C CG   . LEU A 1 30 ? 13.303  -11.456 22.930  1.00 0.00 ? 30 LEU A CG   11 
ATOM 6525  C CD1  . LEU A 1 30 ? 12.222  -10.577 23.540  1.00 0.00 ? 30 LEU A CD1  11 
ATOM 6526  C CD2  . LEU A 1 30 ? 12.728  -12.851 22.736  1.00 0.00 ? 30 LEU A CD2  11 
ATOM 6527  H H    . LEU A 1 30 ? 16.127  -10.862 22.555  1.00 0.00 ? 30 LEU A H    11 
ATOM 6528  H HA   . LEU A 1 30 ? 14.755  -12.665 20.899  1.00 0.00 ? 30 LEU A HA   11 
ATOM 6529  H HB2  . LEU A 1 30 ? 14.078  -9.843  21.771  1.00 0.00 ? 30 LEU A HB2  11 
ATOM 6530  H HB3  . LEU A 1 30 ? 12.940  -10.903 20.904  1.00 0.00 ? 30 LEU A HB3  11 
ATOM 6531  H HG   . LEU A 1 30 ? 14.150  -11.509 23.613  1.00 0.00 ? 30 LEU A HG   11 
ATOM 6532  H HD11 . LEU A 1 30 ? 11.897  -10.993 24.494  1.00 0.00 ? 30 LEU A HD11 11 
ATOM 6533  H HD12 . LEU A 1 30 ? 12.618  -9.574  23.701  1.00 0.00 ? 30 LEU A HD12 11 
ATOM 6534  H HD13 . LEU A 1 30 ? 11.370  -10.525 22.861  1.00 0.00 ? 30 LEU A HD13 11 
ATOM 6535  H HD21 . LEU A 1 30 ? 12.401  -13.255 23.694  1.00 0.00 ? 30 LEU A HD21 11 
ATOM 6536  H HD22 . LEU A 1 30 ? 11.876  -12.800 22.058  1.00 0.00 ? 30 LEU A HD22 11 
ATOM 6537  H HD23 . LEU A 1 30 ? 13.492  -13.501 22.312  1.00 0.00 ? 30 LEU A HD23 11 
ATOM 6538  N N    . VAL A 1 31 ? 15.905  -10.018 19.367  1.00 0.00 ? 31 VAL A N    11 
ATOM 6539  C CA   . VAL A 1 31 ? 16.148  -9.394  18.069  1.00 0.00 ? 31 VAL A CA   11 
ATOM 6540  C C    . VAL A 1 31 ? 16.640  -10.425 17.067  1.00 0.00 ? 31 VAL A C    11 
ATOM 6541  O O    . VAL A 1 31 ? 16.320  -10.362 15.881  1.00 0.00 ? 31 VAL A O    11 
ATOM 6542  C CB   . VAL A 1 31 ? 17.211  -8.284  18.167  1.00 0.00 ? 31 VAL A CB   11 
ATOM 6543  C CG1  . VAL A 1 31 ? 17.613  -7.808  16.779  1.00 0.00 ? 31 VAL A CG1  11 
ATOM 6544  C CG2  . VAL A 1 31 ? 16.669  -7.094  18.944  1.00 0.00 ? 31 VAL A CG2  11 
ATOM 6545  H H    . VAL A 1 31 ? 16.369  -9.631  20.176  1.00 0.00 ? 31 VAL A H    11 
ATOM 6546  H HA   . VAL A 1 31 ? 15.212  -8.962  17.714  1.00 0.00 ? 31 VAL A HA   11 
ATOM 6547  H HB   . VAL A 1 31 ? 18.087  -8.679  18.680  1.00 0.00 ? 31 VAL A HB   11 
ATOM 6548  H HG11 . VAL A 1 31 ? 18.371  -7.029  16.861  1.00 0.00 ? 31 VAL A HG11 11 
ATOM 6549  H HG12 . VAL A 1 31 ? 18.015  -8.646  16.211  1.00 0.00 ? 31 VAL A HG12 11 
ATOM 6550  H HG13 . VAL A 1 31 ? 16.738  -7.408  16.266  1.00 0.00 ? 31 VAL A HG13 11 
ATOM 6551  H HG21 . VAL A 1 31 ? 17.432  -6.319  19.014  1.00 0.00 ? 31 VAL A HG21 11 
ATOM 6552  H HG22 . VAL A 1 31 ? 15.794  -6.694  18.431  1.00 0.00 ? 31 VAL A HG22 11 
ATOM 6553  H HG23 . VAL A 1 31 ? 16.386  -7.414  19.947  1.00 0.00 ? 31 VAL A HG23 11 
ATOM 6554  N N    . ILE A 1 32 ? 17.424  -11.379 17.561  1.00 0.00 ? 32 ILE A N    11 
ATOM 6555  C CA   . ILE A 1 32 ? 17.978  -12.443 16.728  1.00 0.00 ? 32 ILE A CA   11 
ATOM 6556  C C    . ILE A 1 32 ? 16.868  -13.331 16.190  1.00 0.00 ? 32 ILE A C    11 
ATOM 6557  O O    . ILE A 1 32 ? 16.873  -13.719 15.023  1.00 0.00 ? 32 ILE A O    11 
ATOM 6558  C CB   . ILE A 1 32 ? 18.952  -13.332 17.523  1.00 0.00 ? 32 ILE A CB   11 
ATOM 6559  C CG1  . ILE A 1 32 ? 20.199  -12.538 17.916  1.00 0.00 ? 32 ILE A CG1  11 
ATOM 6560  C CG2  . ILE A 1 32 ? 19.386  -14.527 16.686  1.00 0.00 ? 32 ILE A CG2  11 
ATOM 6561  C CD1  . ILE A 1 32 ? 21.094  -13.255 18.904  1.00 0.00 ? 32 ILE A CD1  11 
ATOM 6562  H H    . ILE A 1 32 ? 17.649  -11.377 18.546  1.00 0.00 ? 32 ILE A H    11 
ATOM 6563  H HA   . ILE A 1 32 ? 18.511  -11.985 15.895  1.00 0.00 ? 32 ILE A HA   11 
ATOM 6564  H HB   . ILE A 1 32 ? 18.451  -13.686 18.424  1.00 0.00 ? 32 ILE A HB   11 
ATOM 6565  H HG12 . ILE A 1 32 ? 20.776  -12.335 17.014  1.00 0.00 ? 32 ILE A HG12 11 
ATOM 6566  H HG13 . ILE A 1 32 ? 19.880  -11.596 18.363  1.00 0.00 ? 32 ILE A HG13 11 
ATOM 6567  H HG21 . ILE A 1 32 ? 20.066  -15.153 17.262  1.00 0.00 ? 32 ILE A HG21 11 
ATOM 6568  H HG22 . ILE A 1 32 ? 18.508  -15.109 16.405  1.00 0.00 ? 32 ILE A HG22 11 
ATOM 6569  H HG23 . ILE A 1 32 ? 19.891  -14.175 15.787  1.00 0.00 ? 32 ILE A HG23 11 
ATOM 6570  H HD11 . ILE A 1 32 ? 21.963  -12.644 19.145  1.00 0.00 ? 32 ILE A HD11 11 
ATOM 6571  H HD12 . ILE A 1 32 ? 20.533  -13.455 19.818  1.00 0.00 ? 32 ILE A HD12 11 
ATOM 6572  H HD13 . ILE A 1 32 ? 21.428  -14.196 18.469  1.00 0.00 ? 32 ILE A HD13 11 
ATOM 6573  N N    . LEU A 1 33 ? 15.913  -13.646 17.060  1.00 0.00 ? 33 LEU A N    11 
ATOM 6574  C CA   . LEU A 1 33 ? 14.777  -14.491 16.699  1.00 0.00 ? 33 LEU A CA   11 
ATOM 6575  C C    . LEU A 1 33 ? 13.950  -13.832 15.608  1.00 0.00 ? 33 LEU A C    11 
ATOM 6576  O O    . LEU A 1 33 ? 13.601  -14.457 14.608  1.00 0.00 ? 33 LEU A O    11 
ATOM 6577  C CB   . LEU A 1 33 ? 13.877  -14.726 17.914  1.00 0.00 ? 33 LEU A CB   11 
ATOM 6578  C CG   . LEU A 1 33 ? 14.432  -15.647 19.001  1.00 0.00 ? 33 LEU A CG   11 
ATOM 6579  C CD1  . LEU A 1 33 ? 13.496  -15.690 20.199  1.00 0.00 ? 33 LEU A CD1  11 
ATOM 6580  C CD2  . LEU A 1 33 ? 14.595  -17.064 18.474  1.00 0.00 ? 33 LEU A CD2  11 
ATOM 6581  H H    . LEU A 1 33 ? 15.964  -13.294 18.006  1.00 0.00 ? 33 LEU A H    11 
ATOM 6582  H HA   . LEU A 1 33 ? 15.153  -15.448 16.339  1.00 0.00 ? 33 LEU A HA   11 
ATOM 6583  H HB2  . LEU A 1 33 ? 13.676  -13.756 18.371  1.00 0.00 ? 33 LEU A HB2  11 
ATOM 6584  H HB3  . LEU A 1 33 ? 12.943  -15.159 17.556  1.00 0.00 ? 33 LEU A HB3  11 
ATOM 6585  H HG   . LEU A 1 33 ? 15.403  -15.268 19.318  1.00 0.00 ? 33 LEU A HG   11 
ATOM 6586  H HD11 . LEU A 1 33 ? 13.908  -16.340 20.970  1.00 0.00 ? 33 LEU A HD11 11 
ATOM 6587  H HD12 . LEU A 1 33 ? 13.377  -14.684 20.602  1.00 0.00 ? 33 LEU A HD12 11 
ATOM 6588  H HD13 . LEU A 1 33 ? 12.524  -16.072 19.886  1.00 0.00 ? 33 LEU A HD13 11 
ATOM 6589  H HD21 . LEU A 1 33 ? 15.001  -17.706 19.255  1.00 0.00 ? 33 LEU A HD21 11 
ATOM 6590  H HD22 . LEU A 1 33 ? 13.623  -17.447 18.161  1.00 0.00 ? 33 LEU A HD22 11 
ATOM 6591  H HD23 . LEU A 1 33 ? 15.274  -17.057 17.622  1.00 0.00 ? 33 LEU A HD23 11 
ATOM 6592  N N    . ALA A 1 34 ? 13.640  -12.555 15.814  1.00 0.00 ? 34 ALA A N    11 
ATOM 6593  C CA   . ALA A 1 34 ? 12.850  -11.781 14.860  1.00 0.00 ? 34 ALA A CA   11 
ATOM 6594  C C    . ALA A 1 34 ? 13.538  -11.744 13.505  1.00 0.00 ? 34 ALA A C    11 
ATOM 6595  O O    . ALA A 1 34 ? 12.896  -11.862 12.462  1.00 0.00 ? 34 ALA A O    11 
ATOM 6596  C CB   . ALA A 1 34 ? 12.676  -10.352 15.351  1.00 0.00 ? 34 ALA A CB   11 
ATOM 6597  H H    . ALA A 1 34 ? 13.955  -12.095 16.656  1.00 0.00 ? 34 ALA A H    11 
ATOM 6598  H HA   . ALA A 1 34 ? 11.870  -12.248 14.756  1.00 0.00 ? 34 ALA A HA   11 
ATOM 6599  H HB1  . ALA A 1 34 ? 12.073  -9.787  14.640  1.00 0.00 ? 34 ALA A HB1  11 
ATOM 6600  H HB2  . ALA A 1 34 ? 12.177  -10.360 16.321  1.00 0.00 ? 34 ALA A HB2  11 
ATOM 6601  H HB3  . ALA A 1 34 ? 13.654  -9.881  15.450  1.00 0.00 ? 34 ALA A HB3  11 
ATOM 6602  N N    . VAL A 1 35 ? 14.857  -11.579 13.534  1.00 0.00 ? 35 VAL A N    11 
ATOM 6603  C CA   . VAL A 1 35 ? 15.663  -11.523 12.318  1.00 0.00 ? 35 VAL A CA   11 
ATOM 6604  C C    . VAL A 1 35 ? 15.445  -12.769 11.477  1.00 0.00 ? 35 VAL A C    11 
ATOM 6605  O O    . VAL A 1 35 ? 15.298  -12.697 10.258  1.00 0.00 ? 35 VAL A O    11 
ATOM 6606  C CB   . VAL A 1 35 ? 17.166  -11.427 12.641  1.00 0.00 ? 35 VAL A CB   11 
ATOM 6607  C CG1  . VAL A 1 35 ? 17.994  -11.580 11.374  1.00 0.00 ? 35 VAL A CG1  11 
ATOM 6608  C CG2  . VAL A 1 35 ? 17.491  -10.080 13.267  1.00 0.00 ? 35 VAL A CG2  11 
ATOM 6609  H H    . VAL A 1 35 ? 15.327  -11.488 14.423  1.00 0.00 ? 35 VAL A H    11 
ATOM 6610  H HA   . VAL A 1 35 ? 15.363  -10.644 11.747  1.00 0.00 ? 35 VAL A HA   11 
ATOM 6611  H HB   . VAL A 1 35 ? 17.427  -12.221 13.340  1.00 0.00 ? 35 VAL A HB   11 
ATOM 6612  H HG11 . VAL A 1 35 ? 19.054  -11.518 11.616  1.00 0.00 ? 35 VAL A HG11 11 
ATOM 6613  H HG12 . VAL A 1 35 ? 17.782  -12.547 10.918  1.00 0.00 ? 35 VAL A HG12 11 
ATOM 6614  H HG13 . VAL A 1 35 ? 17.736  -10.784 10.675  1.00 0.00 ? 35 VAL A HG13 11 
ATOM 6615  H HG21 . VAL A 1 35 ? 18.554  -10.027 13.499  1.00 0.00 ? 35 VAL A HG21 11 
ATOM 6616  H HG22 . VAL A 1 35 ? 17.233  -9.284  12.568  1.00 0.00 ? 35 VAL A HG22 11 
ATOM 6617  H HG23 . VAL A 1 35 ? 16.914  -9.958  14.184  1.00 0.00 ? 35 VAL A HG23 11 
ATOM 6618  N N    . ALA A 1 36 ? 15.426  -13.918 12.147  1.00 0.00 ? 36 ALA A N    11 
ATOM 6619  C CA   . ALA A 1 36 ? 15.227  -15.204 11.485  1.00 0.00 ? 36 ALA A CA   11 
ATOM 6620  C C    . ALA A 1 36 ? 13.838  -15.278 10.871  1.00 0.00 ? 36 ALA A C    11 
ATOM 6621  O O    . ALA A 1 36 ? 13.671  -15.688 9.723   1.00 0.00 ? 36 ALA A O    11 
ATOM 6622  C CB   . ALA A 1 36 ? 15.374  -16.342 12.483  1.00 0.00 ? 36 ALA A CB   11 
ATOM 6623  H H    . ALA A 1 36 ? 15.553  -13.912 13.149  1.00 0.00 ? 36 ALA A H    11 
ATOM 6624  H HA   . ALA A 1 36 ? 15.975  -15.313 10.700  1.00 0.00 ? 36 ALA A HA   11 
ATOM 6625  H HB1  . ALA A 1 36 ? 15.238  -17.297 11.976  1.00 0.00 ? 36 ALA A HB1  11 
ATOM 6626  H HB2  . ALA A 1 36 ? 16.368  -16.307 12.929  1.00 0.00 ? 36 ALA A HB2  11 
ATOM 6627  H HB3  . ALA A 1 36 ? 14.621  -16.237 13.265  1.00 0.00 ? 36 ALA A HB3  11 
ATOM 6628  N N    . GLY A 1 37 ? 12.842  -14.873 11.653  1.00 0.00 ? 37 GLY A N    11 
ATOM 6629  C CA   . GLY A 1 37 ? 11.450  -14.883 11.212  1.00 0.00 ? 37 GLY A CA   11 
ATOM 6630  C C    . GLY A 1 37 ? 11.319  -14.213 9.853   1.00 0.00 ? 37 GLY A C    11 
ATOM 6631  O O    . GLY A 1 37 ? 10.881  -14.827 8.881   1.00 0.00 ? 37 GLY A O    11 
ATOM 6632  H H    . GLY A 1 37 ? 13.044  -14.545 12.587  1.00 0.00 ? 37 GLY A H    11 
ATOM 6633  H HA2  . GLY A 1 37 ? 11.102  -15.913 11.140  1.00 0.00 ? 37 GLY A HA2  11 
ATOM 6634  H HA3  . GLY A 1 37 ? 10.838  -14.346 11.938  1.00 0.00 ? 37 GLY A HA3  11 
ATOM 6635  N N    . LEU A 1 38 ? 11.706  -12.942 9.799   1.00 0.00 ? 38 LEU A N    11 
ATOM 6636  C CA   . LEU A 1 38 ? 11.643  -12.159 8.568   1.00 0.00 ? 38 LEU A CA   11 
ATOM 6637  C C    . LEU A 1 38 ? 12.504  -12.794 7.489   1.00 0.00 ? 38 LEU A C    11 
ATOM 6638  O O    . LEU A 1 38 ? 12.131  -12.831 6.318   1.00 0.00 ? 38 LEU A O    11 
ATOM 6639  C CB   . LEU A 1 38 ? 12.146  -10.735 8.812   1.00 0.00 ? 38 LEU A CB   11 
ATOM 6640  C CG   . LEU A 1 38 ? 11.242  -9.831  9.653   1.00 0.00 ? 38 LEU A CG   11 
ATOM 6641  C CD1  . LEU A 1 38 ? 11.918  -8.496  9.923   1.00 0.00 ? 38 LEU A CD1  11 
ATOM 6642  C CD2  . LEU A 1 38 ? 9.930   -9.563  8.932   1.00 0.00 ? 38 LEU A CD2  11 
ATOM 6643  H H    . LEU A 1 38 ? 12.057  -12.492 10.633  1.00 0.00 ? 38 LEU A H    11 
ATOM 6644  H HA   . LEU A 1 38 ? 10.607  -12.122 8.230   1.00 0.00 ? 38 LEU A HA   11 
ATOM 6645  H HB2  . LEU A 1 38 ? 13.108  -10.805 9.318   1.00 0.00 ? 38 LEU A HB2  11 
ATOM 6646  H HB3  . LEU A 1 38 ? 12.280  -10.259 7.841   1.00 0.00 ? 38 LEU A HB3  11 
ATOM 6647  H HG   . LEU A 1 38 ? 11.035  -10.326 10.602  1.00 0.00 ? 38 LEU A HG   11 
ATOM 6648  H HD11 . LEU A 1 38 ? 11.268  -7.866  10.531  1.00 0.00 ? 38 LEU A HD11 11 
ATOM 6649  H HD12 . LEU A 1 38 ? 12.854  -8.665  10.454  1.00 0.00 ? 38 LEU A HD12 11 
ATOM 6650  H HD13 . LEU A 1 38 ? 12.122  -7.995  8.977   1.00 0.00 ? 38 LEU A HD13 11 
ATOM 6651  H HD21 . LEU A 1 38 ? 9.291   -8.928  9.546   1.00 0.00 ? 38 LEU A HD21 11 
ATOM 6652  H HD22 . LEU A 1 38 ? 10.132  -9.062  7.985   1.00 0.00 ? 38 LEU A HD22 11 
ATOM 6653  H HD23 . LEU A 1 38 ? 9.422   -10.508 8.742   1.00 0.00 ? 38 LEU A HD23 11 
ATOM 6654  N N    . ILE A 1 39 ? 13.665  -13.295 7.900   1.00 0.00 ? 39 ILE A N    11 
ATOM 6655  C CA   . ILE A 1 39 ? 14.604  -13.939 6.987   1.00 0.00 ? 39 ILE A CA   11 
ATOM 6656  C C    . ILE A 1 39 ? 13.948  -15.119 6.292   1.00 0.00 ? 39 ILE A C    11 
ATOM 6657  O O    . ILE A 1 39 ? 14.090  -15.306 5.084   1.00 0.00 ? 39 ILE A O    11 
ATOM 6658  C CB   . ILE A 1 39 ? 15.847  -14.460 7.731   1.00 0.00 ? 39 ILE A CB   11 
ATOM 6659  C CG1  . ILE A 1 39 ? 16.677  -13.292 8.268   1.00 0.00 ? 39 ILE A CG1  11 
ATOM 6660  C CG2  . ILE A 1 39 ? 16.721  -15.283 6.797   1.00 0.00 ? 39 ILE A CG2  11 
ATOM 6661  C CD1  . ILE A 1 39 ? 17.189  -12.362 7.190   1.00 0.00 ? 39 ILE A CD1  11 
ATOM 6662  H H    . ILE A 1 39 ? 13.915  -13.234 8.877   1.00 0.00 ? 39 ILE A H    11 
ATOM 6663  H HA   . ILE A 1 39 ? 14.914  -13.207 6.241   1.00 0.00 ? 39 ILE A HA   11 
ATOM 6664  H HB   . ILE A 1 39 ? 15.523  -15.084 8.564   1.00 0.00 ? 39 ILE A HB   11 
ATOM 6665  H HG12 . ILE A 1 39 ? 16.056  -12.714 8.953   1.00 0.00 ? 39 ILE A HG12 11 
ATOM 6666  H HG13 . ILE A 1 39 ? 17.533  -13.697 8.807   1.00 0.00 ? 39 ILE A HG13 11 
ATOM 6667  H HG21 . ILE A 1 39 ? 17.591  -15.654 7.337   1.00 0.00 ? 39 ILE A HG21 11 
ATOM 6668  H HG22 . ILE A 1 39 ? 16.146  -16.126 6.413   1.00 0.00 ? 39 ILE A HG22 11 
ATOM 6669  H HG23 . ILE A 1 39 ? 17.050  -14.659 5.966   1.00 0.00 ? 39 ILE A HG23 11 
ATOM 6670  H HD11 . ILE A 1 39 ? 17.770  -11.551 7.629   1.00 0.00 ? 39 ILE A HD11 11 
ATOM 6671  H HD12 . ILE A 1 39 ? 17.821  -12.922 6.502   1.00 0.00 ? 39 ILE A HD12 11 
ATOM 6672  H HD13 . ILE A 1 39 ? 16.343  -11.941 6.646   1.00 0.00 ? 39 ILE A HD13 11 
ATOM 6673  N N    . TYR A 1 40 ? 13.226  -15.917 7.074   1.00 0.00 ? 40 TYR A N    11 
ATOM 6674  C CA   . TYR A 1 40 ? 12.533  -17.095 6.559   1.00 0.00 ? 40 TYR A CA   11 
ATOM 6675  C C    . TYR A 1 40 ? 11.381  -16.683 5.658   1.00 0.00 ? 40 TYR A C    11 
ATOM 6676  O O    . TYR A 1 40 ? 11.152  -17.277 4.606   1.00 0.00 ? 40 TYR A O    11 
ATOM 6677  C CB   . TYR A 1 40 ? 11.971  -17.932 7.710   1.00 0.00 ? 40 TYR A CB   11 
ATOM 6678  C CG   . TYR A 1 40 ? 11.259  -19.188 7.263   1.00 0.00 ? 40 TYR A CG   11 
ATOM 6679  C CD1  . TYR A 1 40 ? 11.976  -20.312 6.872   1.00 0.00 ? 40 TYR A CD1  11 
ATOM 6680  C CD2  . TYR A 1 40 ? 9.871   -19.247 7.233   1.00 0.00 ? 40 TYR A CD2  11 
ATOM 6681  C CE1  . TYR A 1 40 ? 11.333  -21.465 6.462   1.00 0.00 ? 40 TYR A CE1  11 
ATOM 6682  C CE2  . TYR A 1 40 ? 9.211   -20.391 6.826   1.00 0.00 ? 40 TYR A CE2  11 
ATOM 6683  C CZ   . TYR A 1 40 ? 9.956   -21.504 6.439   1.00 0.00 ? 40 TYR A CZ   11 
ATOM 6684  O OH   . TYR A 1 40 ? 9.313   -22.651 6.031   1.00 0.00 ? 40 TYR A OH   11 
ATOM 6685  H H    . TYR A 1 40 ? 13.148  -15.711 8.060   1.00 0.00 ? 40 TYR A H    11 
ATOM 6686  H HA   . TYR A 1 40 ? 13.241  -17.696 5.989   1.00 0.00 ? 40 TYR A HA   11 
ATOM 6687  H HB2  . TYR A 1 40 ? 12.793  -18.215 8.366   1.00 0.00 ? 40 TYR A HB2  11 
ATOM 6688  H HB3  . TYR A 1 40 ? 11.268  -17.318 8.274   1.00 0.00 ? 40 TYR A HB3  11 
ATOM 6689  H HD1  . TYR A 1 40 ? 13.055  -20.284 6.889   1.00 0.00 ? 40 TYR A HD1  11 
ATOM 6690  H HD2  . TYR A 1 40 ? 9.297   -18.382 7.534   1.00 0.00 ? 40 TYR A HD2  11 
ATOM 6691  H HE1  . TYR A 1 40 ? 11.906  -22.329 6.162   1.00 0.00 ? 40 TYR A HE1  11 
ATOM 6692  H HE2  . TYR A 1 40 ? 8.131   -20.422 6.808   1.00 0.00 ? 40 TYR A HE2  11 
ATOM 6693  H HH   . TYR A 1 40 ? 8.356   -22.573 6.052   1.00 0.00 ? 40 TYR A HH   11 
ATOM 6694  N N    . SER A 1 41 ? 10.655  -15.652 6.086   1.00 0.00 ? 41 SER A N    11 
ATOM 6695  C CA   . SER A 1 41 ? 9.516   -15.135 5.335   1.00 0.00 ? 41 SER A CA   11 
ATOM 6696  C C    . SER A 1 41 ? 9.954   -14.666 3.957   1.00 0.00 ? 41 SER A C    11 
ATOM 6697  O O    . SER A 1 41 ? 9.361   -15.029 2.943   1.00 0.00 ? 41 SER A O    11 
ATOM 6698  C CB   . SER A 1 41 ? 8.883   -13.951 6.069   1.00 0.00 ? 41 SER A CB   11 
ATOM 6699  O OG   . SER A 1 41 ? 8.308   -14.362 7.298   1.00 0.00 ? 41 SER A OG   11 
ATOM 6700  H H    . SER A 1 41 ? 10.892  -15.204 6.960   1.00 0.00 ? 41 SER A H    11 
ATOM 6701  H HA   . SER A 1 41 ? 8.777   -15.929 5.229   1.00 0.00 ? 41 SER A HA   11 
ATOM 6702  H HB2  . SER A 1 41 ? 9.650   -13.203 6.268   1.00 0.00 ? 41 SER A HB2  11 
ATOM 6703  H HB3  . SER A 1 41 ? 8.105   -13.516 5.441   1.00 0.00 ? 41 SER A HB3  11 
ATOM 6704  H HG   . SER A 1 41 ? 7.921   -13.598 7.732   1.00 0.00 ? 41 SER A HG   11 
ATOM 6705  N N    . MET A 1 42 ? 11.006  -13.852 3.935   1.00 0.00 ? 42 MET A N    11 
ATOM 6706  C CA   . MET A 1 42 ? 11.550  -13.315 2.691   1.00 0.00 ? 42 MET A CA   11 
ATOM 6707  C C    . MET A 1 42 ? 12.091  -14.435 1.818   1.00 0.00 ? 42 MET A C    11 
ATOM 6708  O O    . MET A 1 42 ? 11.904  -14.441 0.602   1.00 0.00 ? 42 MET A O    11 
ATOM 6709  C CB   . MET A 1 42 ? 12.690  -12.337 2.983   1.00 0.00 ? 42 MET A CB   11 
ATOM 6710  C CG   . MET A 1 42 ? 13.262  -11.663 1.746   1.00 0.00 ? 42 MET A CG   11 
ATOM 6711  S SD   . MET A 1 42 ? 14.579  -10.496 2.136   1.00 0.00 ? 42 MET A SD   11 
ATOM 6712  C CE   . MET A 1 42 ? 15.887  -11.615 2.633   1.00 0.00 ? 42 MET A CE   11 
ATOM 6713  H H    . MET A 1 42 ? 11.450  -13.589 4.803   1.00 0.00 ? 42 MET A H    11 
ATOM 6714  H HA   . MET A 1 42 ? 10.755  -12.793 2.158   1.00 0.00 ? 42 MET A HA   11 
ATOM 6715  H HB2  . MET A 1 42 ? 12.314  -11.562 3.652   1.00 0.00 ? 42 MET A HB2  11 
ATOM 6716  H HB3  . MET A 1 42 ? 13.493  -12.884 3.476   1.00 0.00 ? 42 MET A HB3  11 
ATOM 6717  H HG2  . MET A 1 42 ? 13.657  -12.428 1.078   1.00 0.00 ? 42 MET A HG2  11 
ATOM 6718  H HG3  . MET A 1 42 ? 12.461  -11.130 1.232   1.00 0.00 ? 42 MET A HG3  11 
ATOM 6719  H HE1  . MET A 1 42 ? 16.777  -11.048 2.907   1.00 0.00 ? 42 MET A HE1  11 
ATOM 6720  H HE2  . MET A 1 42 ? 15.555  -12.201 3.490   1.00 0.00 ? 42 MET A HE2  11 
ATOM 6721  H HE3  . MET A 1 42 ? 16.125  -12.283 1.806   1.00 0.00 ? 42 MET A HE3  11 
ATOM 6722  N N    . LEU A 1 43 ? 12.766  -15.386 2.457   1.00 0.00 ? 43 LEU A N    11 
ATOM 6723  C CA   . LEU A 1 43 ? 13.348  -16.531 1.763   1.00 0.00 ? 43 LEU A CA   11 
ATOM 6724  C C    . LEU A 1 43 ? 12.266  -17.524 1.372   1.00 0.00 ? 43 LEU A C    11 
ATOM 6725  O O    . LEU A 1 43 ? 12.290  -18.095 0.283   1.00 0.00 ? 43 LEU A O    11 
ATOM 6726  C CB   . LEU A 1 43 ? 14.358  -17.246 2.663   1.00 0.00 ? 43 LEU A CB   11 
ATOM 6727  C CG   . LEU A 1 43 ? 15.666  -16.502 2.939   1.00 0.00 ? 43 LEU A CG   11 
ATOM 6728  C CD1  . LEU A 1 43 ? 16.516  -17.265 3.943   1.00 0.00 ? 43 LEU A CD1  11 
ATOM 6729  C CD2  . LEU A 1 43 ? 16.472  -16.339 1.660   1.00 0.00 ? 43 LEU A CD2  11 
ATOM 6730  H H    . LEU A 1 43 ? 12.886  -15.324 3.458   1.00 0.00 ? 43 LEU A H    11 
ATOM 6731  H HA   . LEU A 1 43 ? 13.853  -16.175 0.865   1.00 0.00 ? 43 LEU A HA   11 
ATOM 6732  H HB2  . LEU A 1 43 ? 13.874  -17.433 3.622   1.00 0.00 ? 43 LEU A HB2  11 
ATOM 6733  H HB3  . LEU A 1 43 ? 14.609  -18.195 2.191   1.00 0.00 ? 43 LEU A HB3  11 
ATOM 6734  H HG   . LEU A 1 43 ? 15.430  -15.517 3.343   1.00 0.00 ? 43 LEU A HG   11 
ATOM 6735  H HD11 . LEU A 1 43 ? 17.439  -16.719 4.139   1.00 0.00 ? 43 LEU A HD11 11 
ATOM 6736  H HD12 . LEU A 1 43 ? 15.960  -17.379 4.874   1.00 0.00 ? 43 LEU A HD12 11 
ATOM 6737  H HD13 . LEU A 1 43 ? 16.756  -18.248 3.540   1.00 0.00 ? 43 LEU A HD13 11 
ATOM 6738  H HD21 . LEU A 1 43 ? 17.395  -15.798 1.869   1.00 0.00 ? 43 LEU A HD21 11 
ATOM 6739  H HD22 . LEU A 1 43 ? 16.713  -17.322 1.257   1.00 0.00 ? 43 LEU A HD22 11 
ATOM 6740  H HD23 . LEU A 1 43 ? 15.884  -15.781 0.931   1.00 0.00 ? 43 LEU A HD23 11 
ATOM 6741  N N    . ARG A 1 44 ? 11.313  -17.722 2.278   1.00 0.00 ? 44 ARG A N    11 
ATOM 6742  C CA   . ARG A 1 44 ? 10.204  -18.644 2.055   1.00 0.00 ? 44 ARG A CA   11 
ATOM 6743  C C    . ARG A 1 44 ? 9.113   -17.976 1.234   1.00 0.00 ? 44 ARG A C    11 
ATOM 6744  O O    . ARG A 1 44 ? 8.431   -18.619 0.438   1.00 0.00 ? 44 ARG A O    11 
ATOM 6745  C CB   . ARG A 1 44 ? 9.601   -19.090 3.389   1.00 0.00 ? 44 ARG A CB   11 
ATOM 6746  C CG   . ARG A 1 44 ? 8.496   -20.124 3.255   1.00 0.00 ? 44 ARG A CG   11 
ATOM 6747  C CD   . ARG A 1 44 ? 9.036   -21.445 2.731   1.00 0.00 ? 44 ARG A CD   11 
ATOM 6748  N NE   . ARG A 1 44 ? 7.988   -22.456 2.612   1.00 0.00 ? 44 ARG A NE   11 
ATOM 6749  C CZ   . ARG A 1 44 ? 8.153   -23.638 2.027   1.00 0.00 ? 44 ARG A CZ   11 
ATOM 6750  N NH1  . ARG A 1 44 ? 9.329   -23.960 1.503   1.00 0.00 ? 44 ARG A NH1  11 
ATOM 6751  N NH2  . ARG A 1 44 ? 7.143   -24.494 1.966   1.00 0.00 ? 44 ARG A NH2  11 
ATOM 6752  H H    . ARG A 1 44 ? 11.348  -17.222 3.155   1.00 0.00 ? 44 ARG A H    11 
ATOM 6753  H HA   . ARG A 1 44 ? 10.576  -19.516 1.519   1.00 0.00 ? 44 ARG A HA   11 
ATOM 6754  H HB2  . ARG A 1 44 ? 10.397  -19.516 3.999   1.00 0.00 ? 44 ARG A HB2  11 
ATOM 6755  H HB3  . ARG A 1 44 ? 9.190   -18.212 3.889   1.00 0.00 ? 44 ARG A HB3  11 
ATOM 6756  H HG2  . ARG A 1 44 ? 8.043   -20.288 4.233   1.00 0.00 ? 44 ARG A HG2  11 
ATOM 6757  H HG3  . ARG A 1 44 ? 7.741   -19.749 2.564   1.00 0.00 ? 44 ARG A HG3  11 
ATOM 6758  H HD2  . ARG A 1 44 ? 9.480   -21.280 1.750   1.00 0.00 ? 44 ARG A HD2  11 
ATOM 6759  H HD3  . ARG A 1 44 ? 9.802   -21.809 3.415   1.00 0.00 ? 44 ARG A HD3  11 
ATOM 6760  H HE   . ARG A 1 44 ? 7.084   -22.231 3.003   1.00 0.00 ? 44 ARG A HE   11 
ATOM 6761  H HH11 . ARG A 1 44 ? 10.098  -23.307 1.550   1.00 0.00 ? 44 ARG A HH11 11 
ATOM 6762  H HH12 . ARG A 1 44 ? 9.454   -24.858 1.058   1.00 0.00 ? 44 ARG A HH12 11 
ATOM 6763  H HH21 . ARG A 1 44 ? 6.248   -24.248 2.364   1.00 0.00 ? 44 ARG A HH21 11 
ATOM 6764  H HH22 . ARG A 1 44 ? 7.268   -25.391 1.521   1.00 0.00 ? 44 ARG A HH22 11 
ATOM 6765  N N    . LYS A 1 45 ? 8.957   -16.671 1.440   1.00 0.00 ? 45 LYS A N    11 
ATOM 6766  C CA   . LYS A 1 45 ? 7.954   -15.884 0.730   1.00 0.00 ? 45 LYS A CA   11 
ATOM 6767  C C    . LYS A 1 45 ? 8.372   -15.664 -0.714  1.00 0.00 ? 45 LYS A C    11 
ATOM 6768  O O    . LYS A 1 45 ? 7.580   -15.835 -1.639  1.00 0.00 ? 45 LYS A O    11 
ATOM 6769  C CB   . LYS A 1 45 ? 7.776   -14.517 1.395   1.00 0.00 ? 45 LYS A CB   11 
ATOM 6770  C CG   . LYS A 1 45 ? 6.709   -13.648 0.750   1.00 0.00 ? 45 LYS A CG   11 
ATOM 6771  C CD   . LYS A 1 45 ? 6.547   -12.331 1.493   1.00 0.00 ? 45 LYS A CD   11 
ATOM 6772  C CE   . LYS A 1 45 ? 5.490   -11.456 0.839   1.00 0.00 ? 45 LYS A CE   11 
ATOM 6773  N NZ   . LYS A 1 45 ? 5.312   -10.167 1.564   1.00 0.00 ? 45 LYS A NZ   11 
ATOM 6774  H H    . LYS A 1 45 ? 9.548   -16.198 2.109   1.00 0.00 ? 45 LYS A H    11 
ATOM 6775  H HA   . LYS A 1 45 ? 7.006   -16.422 0.754   1.00 0.00 ? 45 LYS A HA   11 
ATOM 6776  H HB2  . LYS A 1 45 ? 7.503   -14.676 2.438   1.00 0.00 ? 45 LYS A HB2  11 
ATOM 6777  H HB3  . LYS A 1 45 ? 8.726   -13.985 1.345   1.00 0.00 ? 45 LYS A HB3  11 
ATOM 6778  H HG2  . LYS A 1 45 ? 6.994   -13.441 -0.281  1.00 0.00 ? 45 LYS A HG2  11 
ATOM 6779  H HG3  . LYS A 1 45 ? 5.759   -14.182 0.764   1.00 0.00 ? 45 LYS A HG3  11 
ATOM 6780  H HD2  . LYS A 1 45 ? 6.250   -12.537 2.522   1.00 0.00 ? 45 LYS A HD2  11 
ATOM 6781  H HD3  . LYS A 1 45 ? 7.499   -11.801 1.489   1.00 0.00 ? 45 LYS A HD3  11 
ATOM 6782  H HE2  . LYS A 1 45 ? 5.789   -11.246 -0.188  1.00 0.00 ? 45 LYS A HE2  11 
ATOM 6783  H HE3  . LYS A 1 45 ? 4.541   -11.992 0.833   1.00 0.00 ? 45 LYS A HE3  11 
ATOM 6784  H HZ1  . LYS A 1 45 ? 4.604   -9.611  1.104   1.00 0.00 ? 45 LYS A HZ1  11 
ATOM 6785  H HZ2  . LYS A 1 45 ? 5.026   -10.353 2.515   1.00 0.00 ? 45 LYS A HZ2  11 
ATOM 6786  H HZ3  . LYS A 1 45 ? 6.185   -9.660  1.568   1.00 0.00 ? 45 LYS A HZ3  11 
ATOM 6787  N N    . ALA A 1 46 ? 9.633   -15.282 -0.895  1.00 0.00 ? 46 ALA A N    11 
ATOM 6788  C CA   . ALA A 1 46 ? 10.190  -15.030 -2.221  1.00 0.00 ? 46 ALA A CA   11 
ATOM 6789  C C    . ALA A 1 46 ? 11.648  -14.613 -2.097  1.00 0.00 ? 46 ALA A C    11 
ATOM 6790  O O    . ALA A 1 46 ? 12.182  -14.531 -0.993  1.00 0.00 ? 46 ALA A O    11 
ATOM 6791  C CB   . ALA A 1 46 ? 9.374   -13.944 -2.917  1.00 0.00 ? 46 ALA A CB   11 
ATOM 6792  H H    . ALA A 1 46 ? 10.235  -15.158 -0.094  1.00 0.00 ? 46 ALA A H    11 
ATOM 6793  H HA   . ALA A 1 46 ? 10.132  -15.947 -2.807  1.00 0.00 ? 46 ALA A HA   11 
ATOM 6794  H HB1  . ALA A 1 46 ? 9.781   -13.767 -3.912  1.00 0.00 ? 46 ALA A HB1  11 
ATOM 6795  H HB2  . ALA A 1 46 ? 8.336   -14.266 -3.000  1.00 0.00 ? 46 ALA A HB2  11 
ATOM 6796  H HB3  . ALA A 1 46 ? 9.423   -13.023 -2.335  1.00 0.00 ? 46 ALA A HB3  11 
ATOM 6797  N N    . GLY A 1 1  ? -17.674 3.461   59.672  1.00 0.00 ? 1  GLY A N    12 
ATOM 6798  C CA   . GLY A 1 1  ? -17.777 4.905   59.715  1.00 0.00 ? 1  GLY A CA   12 
ATOM 6799  C C    . GLY A 1 1  ? -16.965 5.518   58.585  1.00 0.00 ? 1  GLY A C    12 
ATOM 6800  O O    . GLY A 1 1  ? -16.343 4.809   57.798  1.00 0.00 ? 1  GLY A O    12 
ATOM 6801  H H1   . GLY A 1 1  ? -17.112 3.038   58.947  1.00 0.00 ? 1  GLY A H1   12 
ATOM 6802  H HA2  . GLY A 1 1  ? -18.822 5.197   59.609  1.00 0.00 ? 1  GLY A HA2  12 
ATOM 6803  H HA3  . GLY A 1 1  ? -17.398 5.267   60.671  1.00 0.00 ? 1  GLY A HA3  12 
ATOM 6804  N N    . VAL A 1 2  ? -16.983 6.847   58.520  1.00 0.00 ? 2  VAL A N    12 
ATOM 6805  C CA   . VAL A 1 2  ? -16.255 7.587   57.494  1.00 0.00 ? 2  VAL A CA   12 
ATOM 6806  C C    . VAL A 1 2  ? -14.756 7.485   57.725  1.00 0.00 ? 2  VAL A C    12 
ATOM 6807  O O    . VAL A 1 2  ? -13.982 7.272   56.793  1.00 0.00 ? 2  VAL A O    12 
ATOM 6808  C CB   . VAL A 1 2  ? -16.634 9.080   57.499  1.00 0.00 ? 2  VAL A CB   12 
ATOM 6809  C CG1  . VAL A 1 2  ? -15.732 9.861   56.555  1.00 0.00 ? 2  VAL A CG1  12 
ATOM 6810  C CG2  . VAL A 1 2  ? -18.075 9.265   57.051  1.00 0.00 ? 2  VAL A CG2  12 
ATOM 6811  H H    . VAL A 1 2  ? -17.516 7.372   59.199  1.00 0.00 ? 2  VAL A H    12 
ATOM 6812  H HA   . VAL A 1 2  ? -16.501 7.160   56.522  1.00 0.00 ? 2  VAL A HA   12 
ATOM 6813  H HB   . VAL A 1 2  ? -16.520 9.470   58.511  1.00 0.00 ? 2  VAL A HB   12 
ATOM 6814  H HG11 . VAL A 1 2  ? -16.004 10.917  56.573  1.00 0.00 ? 2  VAL A HG11 12 
ATOM 6815  H HG12 . VAL A 1 2  ? -14.695 9.750   56.870  1.00 0.00 ? 2  VAL A HG12 12 
ATOM 6816  H HG13 . VAL A 1 2  ? -15.848 9.476   55.542  1.00 0.00 ? 2  VAL A HG13 12 
ATOM 6817  H HG21 . VAL A 1 2  ? -18.335 10.324  57.067  1.00 0.00 ? 2  VAL A HG21 12 
ATOM 6818  H HG22 . VAL A 1 2  ? -18.192 8.880   56.038  1.00 0.00 ? 2  VAL A HG22 12 
ATOM 6819  H HG23 . VAL A 1 2  ? -18.737 8.721   57.725  1.00 0.00 ? 2  VAL A HG23 12 
ATOM 6820  N N    . ILE A 1 3  ? -14.357 7.641   58.984  1.00 0.00 ? 3  ILE A N    12 
ATOM 6821  C CA   . ILE A 1 3  ? -12.951 7.570   59.371  1.00 0.00 ? 3  ILE A CA   12 
ATOM 6822  C C    . ILE A 1 3  ? -12.412 6.164   59.163  1.00 0.00 ? 3  ILE A C    12 
ATOM 6823  O O    . ILE A 1 3  ? -11.280 5.976   58.719  1.00 0.00 ? 3  ILE A O    12 
ATOM 6824  C CB   . ILE A 1 3  ? -12.754 7.938   60.853  1.00 0.00 ? 3  ILE A CB   12 
ATOM 6825  C CG1  . ILE A 1 3  ? -13.087 9.413   61.085  1.00 0.00 ? 3  ILE A CG1  12 
ATOM 6826  C CG2  . ILE A 1 3  ? -11.313 7.696   61.276  1.00 0.00 ? 3  ILE A CG2  12 
ATOM 6827  C CD1  . ILE A 1 3  ? -13.159 9.800   62.546  1.00 0.00 ? 3  ILE A CD1  12 
ATOM 6828  H H    . ILE A 1 3  ? -15.043 7.815   59.706  1.00 0.00 ? 3  ILE A H    12 
ATOM 6829  H HA   . ILE A 1 3  ? -12.388 8.269   58.752  1.00 0.00 ? 3  ILE A HA   12 
ATOM 6830  H HB   . ILE A 1 3  ? -13.416 7.321   61.460  1.00 0.00 ? 3  ILE A HB   12 
ATOM 6831  H HG12 . ILE A 1 3  ? -12.318 10.019  60.607  1.00 0.00 ? 3  ILE A HG12 12 
ATOM 6832  H HG13 . ILE A 1 3  ? -14.053 9.624   60.626  1.00 0.00 ? 3  ILE A HG13 12 
ATOM 6833  H HG21 . ILE A 1 3  ? -11.189 7.951   62.329  1.00 0.00 ? 3  ILE A HG21 12 
ATOM 6834  H HG22 . ILE A 1 3  ? -11.064 6.646   61.126  1.00 0.00 ? 3  ILE A HG22 12 
ATOM 6835  H HG23 . ILE A 1 3  ? -10.650 8.317   60.674  1.00 0.00 ? 3  ILE A HG23 12 
ATOM 6836  H HD11 . ILE A 1 3  ? -13.398 10.859  62.650  1.00 0.00 ? 3  ILE A HD11 12 
ATOM 6837  H HD12 . ILE A 1 3  ? -13.933 9.210   63.037  1.00 0.00 ? 3  ILE A HD12 12 
ATOM 6838  H HD13 . ILE A 1 3  ? -12.197 9.603   63.019  1.00 0.00 ? 3  ILE A HD13 12 
ATOM 6839  N N    . ASP A 1 4  ? -13.240 5.177   59.491  1.00 0.00 ? 4  ASP A N    12 
ATOM 6840  C CA   . ASP A 1 4  ? -12.872 3.771   59.351  1.00 0.00 ? 4  ASP A CA   12 
ATOM 6841  C C    . ASP A 1 4  ? -12.362 3.492   57.946  1.00 0.00 ? 4  ASP A C    12 
ATOM 6842  O O    . ASP A 1 4  ? -11.395 2.756   57.755  1.00 0.00 ? 4  ASP A O    12 
ATOM 6843  C CB   . ASP A 1 4  ? -14.082 2.872   59.614  1.00 0.00 ? 4  ASP A CB   12 
ATOM 6844  C CG   . ASP A 1 4  ? -14.480 2.844   61.077  1.00 0.00 ? 4  ASP A CG   12 
ATOM 6845  O OD1  . ASP A 1 4  ? -15.358 2.033   61.438  1.00 0.00 ? 4  ASP A OD1  12 
ATOM 6846  O OD2  . ASP A 1 4  ? -13.914 3.634   61.861  1.00 0.00 ? 4  ASP A OD2  12 
ATOM 6847  H H    . ASP A 1 4  ? -14.158 5.396   59.851  1.00 0.00 ? 4  ASP A H    12 
ATOM 6848  H HA   . ASP A 1 4  ? -12.089 3.541   60.073  1.00 0.00 ? 4  ASP A HA   12 
ATOM 6849  H HB2  . ASP A 1 4  ? -14.926 3.239   59.029  1.00 0.00 ? 4  ASP A HB2  12 
ATOM 6850  H HB3  . ASP A 1 4  ? -13.841 1.858   59.298  1.00 0.00 ? 4  ASP A HB3  12 
ATOM 6851  H HD2  . ASP A 1 4  ? -14.215 3.563   62.770  1.00 0.00 ? 4  ASP A HD2  12 
ATOM 6852  N N    . THR A 1 5  ? -13.028 4.092   56.963  1.00 0.00 ? 5  THR A N    12 
ATOM 6853  C CA   . THR A 1 5  ? -12.665 3.925   55.559  1.00 0.00 ? 5  THR A CA   12 
ATOM 6854  C C    . THR A 1 5  ? -11.754 5.056   55.108  1.00 0.00 ? 5  THR A C    12 
ATOM 6855  O O    . THR A 1 5  ? -11.310 5.096   53.962  1.00 0.00 ? 5  THR A O    12 
ATOM 6856  C CB   . THR A 1 5  ? -13.908 3.927   54.650  1.00 0.00 ? 5  THR A CB   12 
ATOM 6857  O OG1  . THR A 1 5  ? -14.586 5.184   54.766  1.00 0.00 ? 5  THR A OG1  12 
ATOM 6858  C CG2  . THR A 1 5  ? -14.864 2.814   55.053  1.00 0.00 ? 5  THR A CG2  12 
ATOM 6859  H H    . THR A 1 5  ? -13.814 4.687   57.185  1.00 0.00 ? 5  THR A H    12 
ATOM 6860  H HA   . THR A 1 5  ? -12.144 2.975   55.449  1.00 0.00 ? 5  THR A HA   12 
ATOM 6861  H HB   . THR A 1 5  ? -13.596 3.777   53.617  1.00 0.00 ? 5  THR A HB   12 
ATOM 6862  H HG1  . THR A 1 5  ? -15.354 5.173   54.189  1.00 0.00 ? 5  THR A HG1  12 
ATOM 6863  H HG21 . THR A 1 5  ? -15.738 2.825   54.402  1.00 0.00 ? 5  THR A HG21 12 
ATOM 6864  H HG22 . THR A 1 5  ? -14.359 1.853   54.964  1.00 0.00 ? 5  THR A HG22 12 
ATOM 6865  H HG23 . THR A 1 5  ? -15.181 2.964   56.085  1.00 0.00 ? 5  THR A HG23 12 
ATOM 6866  N N    . SER A 1 6  ? -11.480 5.976   56.029  1.00 0.00 ? 6  SER A N    12 
ATOM 6867  C CA   . SER A 1 6  ? -10.622 7.124   55.753  1.00 0.00 ? 6  SER A CA   12 
ATOM 6868  C C    . SER A 1 6  ? -9.333  6.677   55.081  1.00 0.00 ? 6  SER A C    12 
ATOM 6869  O O    . SER A 1 6  ? -9.023  7.087   53.964  1.00 0.00 ? 6  SER A O    12 
ATOM 6870  C CB   . SER A 1 6  ? -10.264 7.850   57.051  1.00 0.00 ? 6  SER A CB   12 
ATOM 6871  O OG   . SER A 1 6  ? -9.423  8.962   56.799  1.00 0.00 ? 6  SER A OG   12 
ATOM 6872  H H    . SER A 1 6  ? -11.874 5.887   56.955  1.00 0.00 ? 6  SER A H    12 
ATOM 6873  H HA   . SER A 1 6  ? -11.156 7.809   55.093  1.00 0.00 ? 6  SER A HA   12 
ATOM 6874  H HB2  . SER A 1 6  ? -11.180 8.199   57.529  1.00 0.00 ? 6  SER A HB2  12 
ATOM 6875  H HB3  . SER A 1 6  ? -9.748  7.158   57.716  1.00 0.00 ? 6  SER A HB3  12 
ATOM 6876  H HG   . SER A 1 6  ? -9.219  9.394   57.632  1.00 0.00 ? 6  SER A HG   12 
ATOM 6877  N N    . ALA A 1 7  ? -8.586  5.827   55.780  1.00 0.00 ? 7  ALA A N    12 
ATOM 6878  C CA   . ALA A 1 7  ? -7.321  5.304   55.274  1.00 0.00 ? 7  ALA A CA   12 
ATOM 6879  C C    . ALA A 1 7  ? -7.540  4.541   53.977  1.00 0.00 ? 7  ALA A C    12 
ATOM 6880  O O    . ALA A 1 7  ? -6.762  4.657   53.031  1.00 0.00 ? 7  ALA A O    12 
ATOM 6881  C CB   . ALA A 1 7  ? -6.694  4.360   56.288  1.00 0.00 ? 7  ALA A CB   12 
ATOM 6882  H H    . ALA A 1 7  ? -8.895  5.528   56.694  1.00 0.00 ? 7  ALA A H    12 
ATOM 6883  H HA   . ALA A 1 7  ? -6.645  6.140   55.092  1.00 0.00 ? 7  ALA A HA   12 
ATOM 6884  H HB1  . ALA A 1 7  ? -5.744  3.987   55.907  1.00 0.00 ? 7  ALA A HB1  12 
ATOM 6885  H HB2  . ALA A 1 7  ? -6.525  4.894   57.223  1.00 0.00 ? 7  ALA A HB2  12 
ATOM 6886  H HB3  . ALA A 1 7  ? -7.367  3.521   56.466  1.00 0.00 ? 7  ALA A HB3  12 
ATOM 6887  N N    . VAL A 1 8  ? -8.614  3.757   53.946  1.00 0.00 ? 8  VAL A N    12 
ATOM 6888  C CA   . VAL A 1 8  ? -8.964  2.960   52.774  1.00 0.00 ? 8  VAL A CA   12 
ATOM 6889  C C    . VAL A 1 8  ? -9.264  3.861   51.588  1.00 0.00 ? 8  VAL A C    12 
ATOM 6890  O O    . VAL A 1 8  ? -8.859  3.584   50.460  1.00 0.00 ? 8  VAL A O    12 
ATOM 6891  C CB   . VAL A 1 8  ? -10.208 2.090   53.034  1.00 0.00 ? 8  VAL A CB   12 
ATOM 6892  C CG1  . VAL A 1 8  ? -10.676 1.432   51.745  1.00 0.00 ? 8  VAL A CG1  12 
ATOM 6893  C CG2  . VAL A 1 8  ? -9.892  0.998   54.044  1.00 0.00 ? 8  VAL A CG2  12 
ATOM 6894  H H    . VAL A 1 8  ? -9.215  3.704   54.756  1.00 0.00 ? 8  VAL A H    12 
ATOM 6895  H HA   . VAL A 1 8  ? -8.121  2.314   52.533  1.00 0.00 ? 8  VAL A HA   12 
ATOM 6896  H HB   . VAL A 1 8  ? -11.006 2.723   53.425  1.00 0.00 ? 8  VAL A HB   12 
ATOM 6897  H HG11 . VAL A 1 8  ? -11.561 0.827   51.940  1.00 0.00 ? 8  VAL A HG11 12 
ATOM 6898  H HG12 . VAL A 1 8  ? -10.919 2.202   51.013  1.00 0.00 ? 8  VAL A HG12 12 
ATOM 6899  H HG13 . VAL A 1 8  ? -9.882  0.796   51.354  1.00 0.00 ? 8  VAL A HG13 12 
ATOM 6900  H HG21 . VAL A 1 8  ? -10.782 0.395   54.226  1.00 0.00 ? 8  VAL A HG21 12 
ATOM 6901  H HG22 . VAL A 1 8  ? -9.098  0.362   53.653  1.00 0.00 ? 8  VAL A HG22 12 
ATOM 6902  H HG23 . VAL A 1 8  ? -9.567  1.454   54.979  1.00 0.00 ? 8  VAL A HG23 12 
ATOM 6903  N N    . GLU A 1 9  ? -9.983  4.947   51.858  1.00 0.00 ? 9  GLU A N    12 
ATOM 6904  C CA   . GLU A 1 9  ? -10.355 5.913   50.828  1.00 0.00 ? 9  GLU A CA   12 
ATOM 6905  C C    . GLU A 1 9  ? -9.116  6.452   50.131  1.00 0.00 ? 9  GLU A C    12 
ATOM 6906  O O    . GLU A 1 9  ? -9.106  6.655   48.918  1.00 0.00 ? 9  GLU A O    12 
ATOM 6907  C CB   . GLU A 1 9  ? -11.113 7.090   51.446  1.00 0.00 ? 9  GLU A CB   12 
ATOM 6908  C CG   . GLU A 1 9  ? -11.601 8.114   50.434  1.00 0.00 ? 9  GLU A CG   12 
ATOM 6909  C CD   . GLU A 1 9  ? -12.390 9.237   51.076  1.00 0.00 ? 9  GLU A CD   12 
ATOM 6910  O OE1  . GLU A 1 9  ? -12.553 9.216   52.314  1.00 0.00 ? 9  GLU A OE1  12 
ATOM 6911  O OE2  . GLU A 1 9  ? -12.845 10.139  50.342  1.00 0.00 ? 9  GLU A OE2  12 
ATOM 6912  H H    . GLU A 1 9  ? -10.287 5.120   52.806  1.00 0.00 ? 9  GLU A H    12 
ATOM 6913  H HA   . GLU A 1 9  ? -10.995 5.418   50.098  1.00 0.00 ? 9  GLU A HA   12 
ATOM 6914  H HB2  . GLU A 1 9  ? -11.979 6.698   51.980  1.00 0.00 ? 9  GLU A HB2  12 
ATOM 6915  H HB3  . GLU A 1 9  ? -10.450 7.594   52.150  1.00 0.00 ? 9  GLU A HB3  12 
ATOM 6916  H HG2  . GLU A 1 9  ? -10.738 8.541   49.923  1.00 0.00 ? 9  GLU A HG2  12 
ATOM 6917  H HG3  . GLU A 1 9  ? -12.237 7.612   49.706  1.00 0.00 ? 9  GLU A HG3  12 
ATOM 6918  H HE2  . GLU A 1 9  ? -13.334 10.818  50.815  1.00 0.00 ? 9  GLU A HE2  12 
ATOM 6919  N N    . SER A 1 10 ? -8.069  6.682   50.917  1.00 0.00 ? 10 SER A N    12 
ATOM 6920  C CA   . SER A 1 10 ? -6.805  7.199   50.401  1.00 0.00 ? 10 SER A CA   12 
ATOM 6921  C C    . SER A 1 10 ? -5.975  6.077   49.800  1.00 0.00 ? 10 SER A C    12 
ATOM 6922  O O    . SER A 1 10 ? -5.456  6.193   48.691  1.00 0.00 ? 10 SER A O    12 
ATOM 6923  C CB   . SER A 1 10 ? -5.995  7.851   51.523  1.00 0.00 ? 10 SER A CB   12 
ATOM 6924  O OG   . SER A 1 10 ? -6.669  8.981   52.049  1.00 0.00 ? 10 SER A OG   12 
ATOM 6925  H H    . SER A 1 10 ? -8.140  6.496   51.907  1.00 0.00 ? 10 SER A H    12 
ATOM 6926  H HA   . SER A 1 10 ? -7.019  7.942   49.633  1.00 0.00 ? 10 SER A HA   12 
ATOM 6927  H HB2  . SER A 1 10 ? -5.843  7.125   52.321  1.00 0.00 ? 10 SER A HB2  12 
ATOM 6928  H HB3  . SER A 1 10 ? -5.029  8.166   51.129  1.00 0.00 ? 10 SER A HB3  12 
ATOM 6929  H HG   . SER A 1 10 ? -6.136  9.365   52.749  1.00 0.00 ? 10 SER A HG   12 
ATOM 6930  N N    . ALA A 1 11 ? -5.857  4.984   50.551  1.00 0.00 ? 11 ALA A N    12 
ATOM 6931  C CA   . ALA A 1 11 ? -5.093  3.819   50.116  1.00 0.00 ? 11 ALA A CA   12 
ATOM 6932  C C    . ALA A 1 11 ? -5.760  3.160   48.920  1.00 0.00 ? 11 ALA A C    12 
ATOM 6933  O O    . ALA A 1 11 ? -5.095  2.705   47.991  1.00 0.00 ? 11 ALA A O    12 
ATOM 6934  C CB   . ALA A 1 11 ? -4.999  2.797   51.239  1.00 0.00 ? 11 ALA A CB   12 
ATOM 6935  H H    . ALA A 1 11 ? -6.307  4.950   51.455  1.00 0.00 ? 11 ALA A H    12 
ATOM 6936  H HA   . ALA A 1 11 ? -4.091  4.143   49.838  1.00 0.00 ? 11 ALA A HA   12 
ATOM 6937  H HB1  . ALA A 1 11 ? -4.415  1.939   50.909  1.00 0.00 ? 11 ALA A HB1  12 
ATOM 6938  H HB2  . ALA A 1 11 ? -4.517  3.253   52.104  1.00 0.00 ? 11 ALA A HB2  12 
ATOM 6939  H HB3  . ALA A 1 11 ? -6.001  2.468   51.514  1.00 0.00 ? 11 ALA A HB3  12 
ATOM 6940  N N    . ILE A 1 12 ? -7.089  3.115   48.956  1.00 0.00 ? 12 ILE A N    12 
ATOM 6941  C CA   . ILE A 1 12 ? -7.879  2.516   47.885  1.00 0.00 ? 12 ILE A CA   12 
ATOM 6942  C C    . ILE A 1 12 ? -7.758  3.337   46.612  1.00 0.00 ? 12 ILE A C    12 
ATOM 6943  O O    . ILE A 1 12 ? -7.557  2.799   45.524  1.00 0.00 ? 12 ILE A O    12 
ATOM 6944  C CB   . ILE A 1 12 ? -9.371  2.439   48.259  1.00 0.00 ? 12 ILE A CB   12 
ATOM 6945  C CG1  . ILE A 1 12 ? -9.581  1.459   49.415  1.00 0.00 ? 12 ILE A CG1  12 
ATOM 6946  C CG2  . ILE A 1 12 ? -10.194 1.967   47.071  1.00 0.00 ? 12 ILE A CG2  12 
ATOM 6947  C CD1  . ILE A 1 12 ? -9.151  0.043   49.101  1.00 0.00 ? 12 ILE A CD1  12 
ATOM 6948  H H    . ILE A 1 12 ? -7.579  3.508   49.747  1.00 0.00 ? 12 ILE A H    12 
ATOM 6949  H HA   . ILE A 1 12 ? -7.505  1.509   47.703  1.00 0.00 ? 12 ILE A HA   12 
ATOM 6950  H HB   . ILE A 1 12 ? -9.711  3.430   48.561  1.00 0.00 ? 12 ILE A HB   12 
ATOM 6951  H HG12 . ILE A 1 12 ? -9.007  1.811   50.272  1.00 0.00 ? 12 ILE A HG12 12 
ATOM 6952  H HG13 . ILE A 1 12 ? -10.642 1.448   49.668  1.00 0.00 ? 12 ILE A HG13 12 
ATOM 6953  H HG21 . ILE A 1 12 ? -11.249 1.927   47.345  1.00 0.00 ? 12 ILE A HG21 12 
ATOM 6954  H HG22 . ILE A 1 12 ? -10.063 2.662   46.241  1.00 0.00 ? 12 ILE A HG22 12 
ATOM 6955  H HG23 . ILE A 1 12 ? -9.860  0.974   46.770  1.00 0.00 ? 12 ILE A HG23 12 
ATOM 6956  H HD11 . ILE A 1 12 ? -9.323  -0.607  49.958  1.00 0.00 ? 12 ILE A HD11 12 
ATOM 6957  H HD12 . ILE A 1 12 ? -9.725  -0.327  48.252  1.00 0.00 ? 12 ILE A HD12 12 
ATOM 6958  H HD13 . ILE A 1 12 ? -8.090  0.036   48.854  1.00 0.00 ? 12 ILE A HD13 12 
ATOM 6959  N N    . THR A 1 13 ? -7.885  4.653   46.763  1.00 0.00 ? 13 THR A N    12 
ATOM 6960  C CA   . THR A 1 13 ? -7.795  5.580   45.638  1.00 0.00 ? 13 THR A CA   12 
ATOM 6961  C C    . THR A 1 13 ? -6.401  5.548   45.032  1.00 0.00 ? 13 THR A C    12 
ATOM 6962  O O    . THR A 1 13 ? -6.237  5.553   43.813  1.00 0.00 ? 13 THR A O    12 
ATOM 6963  C CB   . THR A 1 13 ? -8.088  7.027   46.074  1.00 0.00 ? 13 THR A CB   12 
ATOM 6964  O OG1  . THR A 1 13 ? -9.426  7.115   46.581  1.00 0.00 ? 13 THR A OG1  12 
ATOM 6965  C CG2  . THR A 1 13 ? -7.945  7.978   44.896  1.00 0.00 ? 13 THR A CG2  12 
ATOM 6966  H H    . THR A 1 13 ? -8.050  5.035   47.684  1.00 0.00 ? 13 THR A H    12 
ATOM 6967  H HA   . THR A 1 13 ? -8.524  5.280   44.885  1.00 0.00 ? 13 THR A HA   12 
ATOM 6968  H HB   . THR A 1 13 ? -7.385  7.314   46.855  1.00 0.00 ? 13 THR A HB   12 
ATOM 6969  H HG1  . THR A 1 13 ? -9.591  8.020   46.856  1.00 0.00 ? 13 THR A HG1  12 
ATOM 6970  H HG21 . THR A 1 13 ? -8.153  8.999   45.218  1.00 0.00 ? 13 THR A HG21 12 
ATOM 6971  H HG22 . THR A 1 13 ? -6.929  7.922   44.507  1.00 0.00 ? 13 THR A HG22 12 
ATOM 6972  H HG23 . THR A 1 13 ? -8.650  7.695   44.114  1.00 0.00 ? 13 THR A HG23 12 
ATOM 6973  N N    . ASP A 1 14 ? -5.395  5.514   45.903  1.00 0.00 ? 14 ASP A N    12 
ATOM 6974  C CA   . ASP A 1 14 ? -3.999  5.481   45.481  1.00 0.00 ? 14 ASP A CA   12 
ATOM 6975  C C    . ASP A 1 14 ? -3.675  4.152   44.820  1.00 0.00 ? 14 ASP A C    12 
ATOM 6976  O O    . ASP A 1 14 ? -3.110  4.106   43.728  1.00 0.00 ? 14 ASP A O    12 
ATOM 6977  C CB   . ASP A 1 14 ? -3.071  5.662   46.684  1.00 0.00 ? 14 ASP A CB   12 
ATOM 6978  C CG   . ASP A 1 14 ? -3.100  7.074   47.234  1.00 0.00 ? 14 ASP A CG   12 
ATOM 6979  O OD1  . ASP A 1 14 ? -2.283  7.380   48.129  1.00 0.00 ? 14 ASP A OD1  12 
ATOM 6980  O OD2  . ASP A 1 14 ? -3.938  7.876   46.771  1.00 0.00 ? 14 ASP A OD2  12 
ATOM 6981  H H    . ASP A 1 14 ? -5.594  5.512   46.893  1.00 0.00 ? 14 ASP A H    12 
ATOM 6982  H HA   . ASP A 1 14 ? -3.830  6.290   44.770  1.00 0.00 ? 14 ASP A HA   12 
ATOM 6983  H HB2  . ASP A 1 14 ? -3.379  4.974   47.471  1.00 0.00 ? 14 ASP A HB2  12 
ATOM 6984  H HB3  . ASP A 1 14 ? -2.052  5.427   46.379  1.00 0.00 ? 14 ASP A HB3  12 
ATOM 6985  H HD2  . ASP A 1 14 ? -3.900  8.751   47.164  1.00 0.00 ? 14 ASP A HD2  12 
ATOM 6986  N N    . GLY A 1 15 ? -4.040  3.068   45.498  1.00 0.00 ? 15 GLY A N    12 
ATOM 6987  C CA   . GLY A 1 15 ? -3.800  1.717   44.998  1.00 0.00 ? 15 GLY A CA   12 
ATOM 6988  C C    . GLY A 1 15 ? -4.892  1.308   44.023  1.00 0.00 ? 15 GLY A C    12 
ATOM 6989  O O    . GLY A 1 15 ? -4.651  1.151   42.827  1.00 0.00 ? 15 GLY A O    12 
ATOM 6990  H H    . GLY A 1 15 ? -4.500  3.172   46.391  1.00 0.00 ? 15 GLY A H    12 
ATOM 6991  H HA2  . GLY A 1 15 ? -2.836  1.688   44.491  1.00 0.00 ? 15 GLY A HA2  12 
ATOM 6992  H HA3  . GLY A 1 15 ? -3.788  1.021   45.836  1.00 0.00 ? 15 GLY A HA3  12 
ATOM 6993  N N    . GLN A 1 16 ? -6.100  1.136   44.552  1.00 0.00 ? 16 GLN A N    12 
ATOM 6994  C CA   . GLN A 1 16 ? -7.255  0.744   43.750  1.00 0.00 ? 16 GLN A CA   12 
ATOM 6995  C C    . GLN A 1 16 ? -7.363  1.617   42.510  1.00 0.00 ? 16 GLN A C    12 
ATOM 6996  O O    . GLN A 1 16 ? -7.419  1.122   41.386  1.00 0.00 ? 16 GLN A O    12 
ATOM 6997  C CB   . GLN A 1 16 ? -8.545  0.892   44.560  1.00 0.00 ? 16 GLN A CB   12 
ATOM 6998  C CG   . GLN A 1 16 ? -9.798  0.464   43.814  1.00 0.00 ? 16 GLN A CG   12 
ATOM 6999  C CD   . GLN A 1 16 ? -9.804  -1.017  43.487  1.00 0.00 ? 16 GLN A CD   12 
ATOM 7000  O OE1  . GLN A 1 16 ? -9.657  -1.859  44.373  1.00 0.00 ? 16 GLN A OE1  12 
ATOM 7001  N NE2  . GLN A 1 16 ? -9.973  -1.338  42.210  1.00 0.00 ? 16 GLN A NE2  12 
ATOM 7002  H H    . GLN A 1 16 ? -6.234  1.279   45.543  1.00 0.00 ? 16 GLN A H    12 
ATOM 7003  H HA   . GLN A 1 16 ? -7.136  -0.297  43.450  1.00 0.00 ? 16 GLN A HA   12 
ATOM 7004  H HB2  . GLN A 1 16 ? -8.457  0.282   45.459  1.00 0.00 ? 16 GLN A HB2  12 
ATOM 7005  H HB3  . GLN A 1 16 ? -8.655  1.940   44.841  1.00 0.00 ? 16 GLN A HB3  12 
ATOM 7006  H HG2  . GLN A 1 16 ? -10.668 0.691   44.431  1.00 0.00 ? 16 GLN A HG2  12 
ATOM 7007  H HG3  . GLN A 1 16 ? -9.862  1.029   42.884  1.00 0.00 ? 16 GLN A HG3  12 
ATOM 7008  H HE21 . GLN A 1 16 ? -10.089 -0.611  41.519  1.00 0.00 ? 16 GLN A HE21 12 
ATOM 7009  H HE22 . GLN A 1 16 ? -9.986  -2.308  41.932  1.00 0.00 ? 16 GLN A HE22 12 
ATOM 7010  N N    . GLY A 1 17 ? -7.392  2.929   42.732  1.00 0.00 ? 17 GLY A N    12 
ATOM 7011  C CA   . GLY A 1 17 ? -7.493  3.901   41.647  1.00 0.00 ? 17 GLY A CA   12 
ATOM 7012  C C    . GLY A 1 17 ? -6.441  3.625   40.585  1.00 0.00 ? 17 GLY A C    12 
ATOM 7013  O O    . GLY A 1 17 ? -6.734  3.602   39.391  1.00 0.00 ? 17 GLY A O    12 
ATOM 7014  H H    . GLY A 1 17 ? -7.344  3.275   43.680  1.00 0.00 ? 17 GLY A H    12 
ATOM 7015  H HA2  . GLY A 1 17 ? -8.484  3.836   41.197  1.00 0.00 ? 17 GLY A HA2  12 
ATOM 7016  H HA3  . GLY A 1 17 ? -7.345  4.904   42.048  1.00 0.00 ? 17 GLY A HA3  12 
ATOM 7017  N N    . ASP A 1 18 ? -5.208  3.416   41.038  1.00 0.00 ? 18 ASP A N    12 
ATOM 7018  C CA   . ASP A 1 18 ? -4.086  3.138   40.146  1.00 0.00 ? 18 ASP A CA   12 
ATOM 7019  C C    . ASP A 1 18 ? -4.391  1.936   39.267  1.00 0.00 ? 18 ASP A C    12 
ATOM 7020  O O    . ASP A 1 18 ? -3.709  1.685   38.274  1.00 0.00 ? 18 ASP A O    12 
ATOM 7021  C CB   . ASP A 1 18 ? -2.821  2.839   40.953  1.00 0.00 ? 18 ASP A CB   12 
ATOM 7022  C CG   . ASP A 1 18 ? -2.269  4.068   41.647  1.00 0.00 ? 18 ASP A CG   12 
ATOM 7023  O OD1  . ASP A 1 18 ? -1.029  4.213   41.702  1.00 0.00 ? 18 ASP A OD1  12 
ATOM 7024  O OD2  . ASP A 1 18 ? -3.075  4.887   42.136  1.00 0.00 ? 18 ASP A OD2  12 
ATOM 7025  H H    . ASP A 1 18 ? -5.031  3.450   42.032  1.00 0.00 ? 18 ASP A H    12 
ATOM 7026  H HA   . ASP A 1 18 ? -3.915  4.012   39.517  1.00 0.00 ? 18 ASP A HA   12 
ATOM 7027  H HB2  . ASP A 1 18 ? -3.056  2.087   41.706  1.00 0.00 ? 18 ASP A HB2  12 
ATOM 7028  H HB3  . ASP A 1 18 ? -2.060  2.447   40.279  1.00 0.00 ? 18 ASP A HB3  12 
ATOM 7029  H HD2  . ASP A 1 18 ? -2.658  5.641   42.560  1.00 0.00 ? 18 ASP A HD2  12 
ATOM 7030  N N    . MET A 1 19 ? -5.427  1.194   39.646  1.00 0.00 ? 19 MET A N    12 
ATOM 7031  C CA   . MET A 1 19 ? -5.848  0.006   38.909  1.00 0.00 ? 19 MET A CA   12 
ATOM 7032  C C    . MET A 1 19 ? -6.331  0.386   37.519  1.00 0.00 ? 19 MET A C    12 
ATOM 7033  O O    . MET A 1 19 ? -6.018  -0.279  36.533  1.00 0.00 ? 19 MET A O    12 
ATOM 7034  C CB   . MET A 1 19 ? -6.990  -0.702  39.641  1.00 0.00 ? 19 MET A CB   12 
ATOM 7035  C CG   . MET A 1 19 ? -7.436  -1.999  38.987  1.00 0.00 ? 19 MET A CG   12 
ATOM 7036  S SD   . MET A 1 19 ? -8.772  -2.809  39.887  1.00 0.00 ? 19 MET A SD   12 
ATOM 7037  C CE   . MET A 1 19 ? -7.912  -3.338  41.366  1.00 0.00 ? 19 MET A CE   12 
ATOM 7038  H H    . MET A 1 19 ? -5.948  1.452   40.472  1.00 0.00 ? 19 MET A H    12 
ATOM 7039  H HA   . MET A 1 19 ? -5.000  -0.672  38.824  1.00 0.00 ? 19 MET A HA   12 
ATOM 7040  H HB2  . MET A 1 19 ? -6.661  -0.925  40.656  1.00 0.00 ? 19 MET A HB2  12 
ATOM 7041  H HB3  . MET A 1 19 ? -7.845  -0.026  39.677  1.00 0.00 ? 19 MET A HB3  12 
ATOM 7042  H HG2  . MET A 1 19 ? -7.776  -1.784  37.974  1.00 0.00 ? 19 MET A HG2  12 
ATOM 7043  H HG3  . MET A 1 19 ? -6.586  -2.678  38.935  1.00 0.00 ? 19 MET A HG3  12 
ATOM 7044  H HE1  . MET A 1 19 ? -8.602  -3.858  42.031  1.00 0.00 ? 19 MET A HE1  12 
ATOM 7045  H HE2  . MET A 1 19 ? -7.100  -4.010  41.091  1.00 0.00 ? 19 MET A HE2  12 
ATOM 7046  H HE3  . MET A 1 19 ? -7.505  -2.466  41.879  1.00 0.00 ? 19 MET A HE3  12 
ATOM 7047  N N    . LYS A 1 20 ? -7.101  1.469   37.454  1.00 0.00 ? 20 LYS A N    12 
ATOM 7048  C CA   . LYS A 1 20 ? -7.645  1.964   36.193  1.00 0.00 ? 20 LYS A CA   12 
ATOM 7049  C C    . LYS A 1 20 ? -6.524  2.262   35.210  1.00 0.00 ? 20 LYS A C    12 
ATOM 7050  O O    . LYS A 1 20 ? -6.621  1.956   34.023  1.00 0.00 ? 20 LYS A O    12 
ATOM 7051  C CB   . LYS A 1 20 ? -8.442  3.250   36.421  1.00 0.00 ? 20 LYS A CB   12 
ATOM 7052  C CG   . LYS A 1 20 ? -9.099  3.804   35.168  1.00 0.00 ? 20 LYS A CG   12 
ATOM 7053  C CD   . LYS A 1 20 ? -9.919  5.046   35.476  1.00 0.00 ? 20 LYS A CD   12 
ATOM 7054  C CE   . LYS A 1 20 ? -10.564 5.608   34.220  1.00 0.00 ? 20 LYS A CE   12 
ATOM 7055  N NZ   . LYS A 1 20 ? -11.380 6.819   34.510  1.00 0.00 ? 20 LYS A NZ   12 
ATOM 7056  H H    . LYS A 1 20 ? -7.324  1.974   38.300  1.00 0.00 ? 20 LYS A H    12 
ATOM 7057  H HA   . LYS A 1 20 ? -8.303  1.203   35.772  1.00 0.00 ? 20 LYS A HA   12 
ATOM 7058  H HB2  . LYS A 1 20 ? -9.223  3.044   37.154  1.00 0.00 ? 20 LYS A HB2  12 
ATOM 7059  H HB3  . LYS A 1 20 ? -7.765  4.008   36.815  1.00 0.00 ? 20 LYS A HB3  12 
ATOM 7060  H HG2  . LYS A 1 20 ? -8.325  4.061   34.445  1.00 0.00 ? 20 LYS A HG2  12 
ATOM 7061  H HG3  . LYS A 1 20 ? -9.754  3.043   34.744  1.00 0.00 ? 20 LYS A HG3  12 
ATOM 7062  H HD2  . LYS A 1 20 ? -10.701 4.788   36.191  1.00 0.00 ? 20 LYS A HD2  12 
ATOM 7063  H HD3  . LYS A 1 20 ? -9.267  5.804   35.909  1.00 0.00 ? 20 LYS A HD3  12 
ATOM 7064  H HE2  . LYS A 1 20 ? -9.782  5.871   33.508  1.00 0.00 ? 20 LYS A HE2  12 
ATOM 7065  H HE3  . LYS A 1 20 ? -11.207 4.846   33.781  1.00 0.00 ? 20 LYS A HE3  12 
ATOM 7066  H HZ1  . LYS A 1 20 ? -11.793 7.166   33.656  1.00 0.00 ? 20 LYS A HZ1  12 
ATOM 7067  H HZ2  . LYS A 1 20 ? -12.113 6.582   35.164  1.00 0.00 ? 20 LYS A HZ2  12 
ATOM 7068  H HZ3  . LYS A 1 20 ? -10.790 7.534   34.911  1.00 0.00 ? 20 LYS A HZ3  12 
ATOM 7069  N N    . ALA A 1 21 ? -5.455  2.865   35.723  1.00 0.00 ? 21 ALA A N    12 
ATOM 7070  C CA   . ALA A 1 21 ? -4.294  3.219   34.911  1.00 0.00 ? 21 ALA A CA   12 
ATOM 7071  C C    . ALA A 1 21 ? -3.564  1.967   34.453  1.00 0.00 ? 21 ALA A C    12 
ATOM 7072  O O    . ALA A 1 21 ? -3.129  1.868   33.307  1.00 0.00 ? 21 ALA A O    12 
ATOM 7073  C CB   . ALA A 1 21 ? -3.327  4.075   35.714  1.00 0.00 ? 21 ALA A CB   12 
ATOM 7074  H H    . ALA A 1 21 ? -5.436  3.092   36.707  1.00 0.00 ? 21 ALA A H    12 
ATOM 7075  H HA   . ALA A 1 21 ? -4.634  3.779   34.040  1.00 0.00 ? 21 ALA A HA   12 
ATOM 7076  H HB1  . ALA A 1 21 ? -2.472  4.346   35.095  1.00 0.00 ? 21 ALA A HB1  12 
ATOM 7077  H HB2  . ALA A 1 21 ? -3.835  4.982   36.045  1.00 0.00 ? 21 ALA A HB2  12 
ATOM 7078  H HB3  . ALA A 1 21 ? -2.982  3.514   36.582  1.00 0.00 ? 21 ALA A HB3  12 
ATOM 7079  N N    . ILE A 1 22 ? -3.435  1.009   35.368  1.00 0.00 ? 22 ILE A N    12 
ATOM 7080  C CA   . ILE A 1 22 ? -2.758  -0.253  35.085  1.00 0.00 ? 22 ILE A CA   12 
ATOM 7081  C C    . ILE A 1 22 ? -3.513  -1.035  34.023  1.00 0.00 ? 22 ILE A C    12 
ATOM 7082  O O    . ILE A 1 22 ? -2.932  -1.507  33.047  1.00 0.00 ? 22 ILE A O    12 
ATOM 7083  C CB   . ILE A 1 22 ? -2.660  -1.136  36.343  1.00 0.00 ? 22 ILE A CB   12 
ATOM 7084  C CG1  . ILE A 1 22 ? -1.726  -0.496  37.372  1.00 0.00 ? 22 ILE A CG1  12 
ATOM 7085  C CG2  . ILE A 1 22 ? -2.117  -2.511  35.988  1.00 0.00 ? 22 ILE A CG2  12 
ATOM 7086  C CD1  . ILE A 1 22 ? -1.763  -1.165  38.729  1.00 0.00 ? 22 ILE A CD1  12 
ATOM 7087  H H    . ILE A 1 22 ? -3.816  1.149   36.293  1.00 0.00 ? 22 ILE A H    12 
ATOM 7088  H HA   . ILE A 1 22 ? -1.754  -0.031  34.725  1.00 0.00 ? 22 ILE A HA   12 
ATOM 7089  H HB   . ILE A 1 22 ? -3.655  -1.243  36.777  1.00 0.00 ? 22 ILE A HB   12 
ATOM 7090  H HG12 . ILE A 1 22 ? -0.707  -0.548  36.991  1.00 0.00 ? 22 ILE A HG12 12 
ATOM 7091  H HG13 . ILE A 1 22 ? -2.015  0.548   37.496  1.00 0.00 ? 22 ILE A HG13 12 
ATOM 7092  H HG21 . ILE A 1 22 ? -2.062  -3.129  36.884  1.00 0.00 ? 22 ILE A HG21 12 
ATOM 7093  H HG22 . ILE A 1 22 ? -2.778  -2.984  35.262  1.00 0.00 ? 22 ILE A HG22 12 
ATOM 7094  H HG23 . ILE A 1 22 ? -1.121  -2.407  35.559  1.00 0.00 ? 22 ILE A HG23 12 
ATOM 7095  H HD11 . ILE A 1 22 ? -1.080  -0.669  39.419  1.00 0.00 ? 22 ILE A HD11 12 
ATOM 7096  H HD12 . ILE A 1 22 ? -2.776  -1.111  39.130  1.00 0.00 ? 22 ILE A HD12 12 
ATOM 7097  H HD13 . ILE A 1 22 ? -1.469  -2.209  38.624  1.00 0.00 ? 22 ILE A HD13 12 
ATOM 7098  N N    . GLY A 1 23 ? -4.820  -1.167  34.227  1.00 0.00 ? 23 GLY A N    12 
ATOM 7099  C CA   . GLY A 1 23 ? -5.686  -1.890  33.299  1.00 0.00 ? 23 GLY A CA   12 
ATOM 7100  C C    . GLY A 1 23 ? -5.767  -1.159  31.968  1.00 0.00 ? 23 GLY A C    12 
ATOM 7101  O O    . GLY A 1 23 ? -5.685  -1.768  30.902  1.00 0.00 ? 23 GLY A O    12 
ATOM 7102  H H    . GLY A 1 23 ? -5.240  -0.757  35.049  1.00 0.00 ? 23 GLY A H    12 
ATOM 7103  H HA2  . GLY A 1 23 ? -5.284  -2.889  33.136  1.00 0.00 ? 23 GLY A HA2  12 
ATOM 7104  H HA3  . GLY A 1 23 ? -6.686  -1.969  33.727  1.00 0.00 ? 23 GLY A HA3  12 
ATOM 7105  N N    . GLY A 1 24 ? -5.930  0.158   32.045  1.00 0.00 ? 24 GLY A N    12 
ATOM 7106  C CA   . GLY A 1 24 ? -6.027  1.002   30.858  1.00 0.00 ? 24 GLY A CA   12 
ATOM 7107  C C    . GLY A 1 24 ? -4.698  1.037   30.119  1.00 0.00 ? 24 GLY A C    12 
ATOM 7108  O O    . GLY A 1 24 ? -4.627  0.748   28.926  1.00 0.00 ? 24 GLY A O    12 
ATOM 7109  H H    . GLY A 1 24 ? -5.991  0.601   32.951  1.00 0.00 ? 24 GLY A H    12 
ATOM 7110  H HA2  . GLY A 1 24 ? -6.796  0.604   30.196  1.00 0.00 ? 24 GLY A HA2  12 
ATOM 7111  H HA3  . GLY A 1 24 ? -6.299  2.015   31.158  1.00 0.00 ? 24 GLY A HA3  12 
ATOM 7112  N N    . TYR A 1 25 ? -3.645  1.395   30.847  1.00 0.00 ? 25 TYR A N    12 
ATOM 7113  C CA   . TYR A 1 25 ? -2.300  1.477   30.285  1.00 0.00 ? 25 TYR A CA   12 
ATOM 7114  C C    . TYR A 1 25 ? -1.905  0.151   29.656  1.00 0.00 ? 25 TYR A C    12 
ATOM 7115  O O    . TYR A 1 25 ? -1.280  0.111   28.597  1.00 0.00 ? 25 TYR A O    12 
ATOM 7116  C CB   . TYR A 1 25 ? -1.283  1.817   31.376  1.00 0.00 ? 25 TYR A CB   12 
ATOM 7117  C CG   . TYR A 1 25 ? 0.142   1.907   30.879  1.00 0.00 ? 25 TYR A CG   12 
ATOM 7118  C CD1  . TYR A 1 25 ? 0.587   3.031   30.195  1.00 0.00 ? 25 TYR A CD1  12 
ATOM 7119  C CD2  . TYR A 1 25 ? 1.038   0.868   31.095  1.00 0.00 ? 25 TYR A CD2  12 
ATOM 7120  C CE1  . TYR A 1 25 ? 1.888   3.122   29.737  1.00 0.00 ? 25 TYR A CE1  12 
ATOM 7121  C CE2  . TYR A 1 25 ? 2.342   0.941   30.645  1.00 0.00 ? 25 TYR A CE2  12 
ATOM 7122  C CZ   . TYR A 1 25 ? 2.763   2.081   29.961  1.00 0.00 ? 25 TYR A CZ   12 
ATOM 7123  O OH   . TYR A 1 25 ? 4.058   2.169   29.506  1.00 0.00 ? 25 TYR A OH   12 
ATOM 7124  H H    . TYR A 1 25 ? -3.769  1.622   31.824  1.00 0.00 ? 25 TYR A H    12 
ATOM 7125  H HA   . TYR A 1 25 ? -2.286  2.257   29.524  1.00 0.00 ? 25 TYR A HA   12 
ATOM 7126  H HB2  . TYR A 1 25 ? -1.557  2.776   31.818  1.00 0.00 ? 25 TYR A HB2  12 
ATOM 7127  H HB3  . TYR A 1 25 ? -1.333  1.049   32.148  1.00 0.00 ? 25 TYR A HB3  12 
ATOM 7128  H HD1  . TYR A 1 25 ? -0.096  3.849   30.018  1.00 0.00 ? 25 TYR A HD1  12 
ATOM 7129  H HD2  . TYR A 1 25 ? 0.709   -0.013  31.625  1.00 0.00 ? 25 TYR A HD2  12 
ATOM 7130  H HE1  . TYR A 1 25 ? 2.217   4.004   29.207  1.00 0.00 ? 25 TYR A HE1  12 
ATOM 7131  H HE2  . TYR A 1 25 ? 3.027   0.125   30.821  1.00 0.00 ? 25 TYR A HE2  12 
ATOM 7132  H HH   . TYR A 1 25 ? 4.582   1.393   29.713  1.00 0.00 ? 25 TYR A HH   12 
ATOM 7133  N N    . ILE A 1 26 ? -2.278  -0.936  30.324  1.00 0.00 ? 26 ILE A N    12 
ATOM 7134  C CA   . ILE A 1 26 ? -1.975  -2.285  29.852  1.00 0.00 ? 26 ILE A CA   12 
ATOM 7135  C C    . ILE A 1 26 ? -2.873  -2.652  28.682  1.00 0.00 ? 26 ILE A C    12 
ATOM 7136  O O    . ILE A 1 26 ? -2.418  -3.193  27.676  1.00 0.00 ? 26 ILE A O    12 
ATOM 7137  C CB   . ILE A 1 26 ? -2.189  -3.332  30.961  1.00 0.00 ? 26 ILE A CB   12 
ATOM 7138  C CG1  . ILE A 1 26 ? -1.168  -3.136  32.084  1.00 0.00 ? 26 ILE A CG1  12 
ATOM 7139  C CG2  . ILE A 1 26 ? -2.028  -4.738  30.404  1.00 0.00 ? 26 ILE A CG2  12 
ATOM 7140  C CD1  . ILE A 1 26 ? -1.457  -3.957  33.321  1.00 0.00 ? 26 ILE A CD1  12 
ATOM 7141  H H    . ILE A 1 26 ? -2.791  -0.837  31.189  1.00 0.00 ? 26 ILE A H    12 
ATOM 7142  H HA   . ILE A 1 26 ? -0.934  -2.312  29.531  1.00 0.00 ? 26 ILE A HA   12 
ATOM 7143  H HB   . ILE A 1 26 ? -3.195  -3.217  31.365  1.00 0.00 ? 26 ILE A HB   12 
ATOM 7144  H HG12 . ILE A 1 26 ? -0.185  -3.416  31.708  1.00 0.00 ? 26 ILE A HG12 12 
ATOM 7145  H HG13 . ILE A 1 26 ? -1.163  -2.082  32.365  1.00 0.00 ? 26 ILE A HG13 12 
ATOM 7146  H HG21 . ILE A 1 26 ? -2.192  -5.470  31.195  1.00 0.00 ? 26 ILE A HG21 12 
ATOM 7147  H HG22 . ILE A 1 26 ? -2.756  -4.897  29.608  1.00 0.00 ? 26 ILE A HG22 12 
ATOM 7148  H HG23 . ILE A 1 26 ? -1.021  -4.856  30.005  1.00 0.00 ? 26 ILE A HG23 12 
ATOM 7149  H HD11 . ILE A 1 26 ? -0.700  -3.778  34.084  1.00 0.00 ? 26 ILE A HD11 12 
ATOM 7150  H HD12 . ILE A 1 26 ? -2.435  -3.680  33.717  1.00 0.00 ? 26 ILE A HD12 12 
ATOM 7151  H HD13 . ILE A 1 26 ? -1.458  -5.015  33.059  1.00 0.00 ? 26 ILE A HD13 12 
ATOM 7152  N N    . VAL A 1 27 ? -4.160  -2.351  28.828  1.00 0.00 ? 27 VAL A N    12 
ATOM 7153  C CA   . VAL A 1 27 ? -5.152  -2.640  27.795  1.00 0.00 ? 27 VAL A CA   12 
ATOM 7154  C C    . VAL A 1 27 ? -5.023  -1.655  26.644  1.00 0.00 ? 27 VAL A C    12 
ATOM 7155  O O    . VAL A 1 27 ? -5.303  -1.983  25.492  1.00 0.00 ? 27 VAL A O    12 
ATOM 7156  C CB   . VAL A 1 27 ? -6.586  -2.540  28.346  1.00 0.00 ? 27 VAL A CB   12 
ATOM 7157  C CG1  . VAL A 1 27 ? -7.600  -2.664  27.219  1.00 0.00 ? 27 VAL A CG1  12 
ATOM 7158  C CG2  . VAL A 1 27 ? -6.849  -3.649  29.353  1.00 0.00 ? 27 VAL A CG2  12 
ATOM 7159  H H    . VAL A 1 27 ? -4.474  -1.906  29.679  1.00 0.00 ? 27 VAL A H    12 
ATOM 7160  H HA   . VAL A 1 27 ? -4.981  -3.651  27.426  1.00 0.00 ? 27 VAL A HA   12 
ATOM 7161  H HB   . VAL A 1 27 ? -6.709  -1.573  28.835  1.00 0.00 ? 27 VAL A HB   12 
ATOM 7162  H HG11 . VAL A 1 27 ? -8.611  -2.582  27.620  1.00 0.00 ? 27 VAL A HG11 12 
ATOM 7163  H HG12 . VAL A 1 27 ? -7.435  -1.867  26.493  1.00 0.00 ? 27 VAL A HG12 12 
ATOM 7164  H HG13 . VAL A 1 27 ? -7.483  -3.631  26.730  1.00 0.00 ? 27 VAL A HG13 12 
ATOM 7165  H HG21 . VAL A 1 27 ? -7.864  -3.562  29.742  1.00 0.00 ? 27 VAL A HG21 12 
ATOM 7166  H HG22 . VAL A 1 27 ? -6.731  -4.616  28.865  1.00 0.00 ? 27 VAL A HG22 12 
ATOM 7167  H HG23 . VAL A 1 27 ? -6.139  -3.567  30.176  1.00 0.00 ? 27 VAL A HG23 12 
ATOM 7168  N N    . GLY A 1 28 ? -4.594  -0.440  26.972  1.00 0.00 ? 28 GLY A N    12 
ATOM 7169  C CA   . GLY A 1 28 ? -4.418  0.619   25.983  1.00 0.00 ? 28 GLY A CA   12 
ATOM 7170  C C    . GLY A 1 28 ? -3.167  0.371   25.155  1.00 0.00 ? 28 GLY A C    12 
ATOM 7171  O O    . GLY A 1 28 ? -3.045  0.850   24.029  1.00 0.00 ? 28 GLY A O    12 
ATOM 7172  H H    . GLY A 1 28 ? -4.380  -0.231  27.937  1.00 0.00 ? 28 GLY A H    12 
ATOM 7173  H HA2  . GLY A 1 28 ? -5.287  0.644   25.324  1.00 0.00 ? 28 GLY A HA2  12 
ATOM 7174  H HA3  . GLY A 1 28 ? -4.327  1.578   26.495  1.00 0.00 ? 28 GLY A HA3  12 
ATOM 7175  N N    . ALA A 1 29 ? -2.238  -0.386  25.731  1.00 0.00 ? 29 ALA A N    12 
ATOM 7176  C CA   . ALA A 1 29 ? -0.980  -0.716  25.069  1.00 0.00 ? 29 ALA A CA   12 
ATOM 7177  C C    . ALA A 1 29 ? -1.156  -1.926  24.164  1.00 0.00 ? 29 ALA A C    12 
ATOM 7178  O O    . ALA A 1 29 ? -0.520  -2.036  23.117  1.00 0.00 ? 29 ALA A O    12 
ATOM 7179  C CB   . ALA A 1 29 ? 0.093   -1.036  26.099  1.00 0.00 ? 29 ALA A CB   12 
ATOM 7180  H H    . ALA A 1 29 ? -2.398  -0.749  26.660  1.00 0.00 ? 29 ALA A H    12 
ATOM 7181  H HA   . ALA A 1 29 ? -0.664  0.140   24.472  1.00 0.00 ? 29 ALA A HA   12 
ATOM 7182  H HB1  . ALA A 1 29 ? 1.031   -1.266  25.595  1.00 0.00 ? 29 ALA A HB1  12 
ATOM 7183  H HB2  . ALA A 1 29 ? 0.235   -0.175  26.753  1.00 0.00 ? 29 ALA A HB2  12 
ATOM 7184  H HB3  . ALA A 1 29 ? -0.220  -1.895  26.693  1.00 0.00 ? 29 ALA A HB3  12 
ATOM 7185  N N    . LEU A 1 30 ? -2.031  -2.835  24.585  1.00 0.00 ? 30 LEU A N    12 
ATOM 7186  C CA   . LEU A 1 30 ? -2.314  -4.053  23.830  1.00 0.00 ? 30 LEU A CA   12 
ATOM 7187  C C    . LEU A 1 30 ? -2.742  -3.712  22.412  1.00 0.00 ? 30 LEU A C    12 
ATOM 7188  O O    . LEU A 1 30 ? -2.498  -4.470  21.475  1.00 0.00 ? 30 LEU A O    12 
ATOM 7189  C CB   . LEU A 1 30 ? -3.438  -4.848  24.497  1.00 0.00 ? 30 LEU A CB   12 
ATOM 7190  C CG   . LEU A 1 30 ? -3.097  -5.516  25.830  1.00 0.00 ? 30 LEU A CG   12 
ATOM 7191  C CD1  . LEU A 1 30 ? -4.333  -6.160  26.440  1.00 0.00 ? 30 LEU A CD1  12 
ATOM 7192  C CD2  . LEU A 1 30 ? -2.045  -6.597  25.636  1.00 0.00 ? 30 LEU A CD2  12 
ATOM 7193  H H    . LEU A 1 30 ? -2.523  -2.688  25.455  1.00 0.00 ? 30 LEU A H    12 
ATOM 7194  H HA   . LEU A 1 30 ? -1.412  -4.662  23.799  1.00 0.00 ? 30 LEU A HA   12 
ATOM 7195  H HB2  . LEU A 1 30 ? -4.270  -4.165  24.671  1.00 0.00 ? 30 LEU A HB2  12 
ATOM 7196  H HB3  . LEU A 1 30 ? -3.749  -5.629  23.804  1.00 0.00 ? 30 LEU A HB3  12 
ATOM 7197  H HG   . LEU A 1 30 ? -2.713  -4.758  26.513  1.00 0.00 ? 30 LEU A HG   12 
ATOM 7198  H HD11 . LEU A 1 30 ? -4.080  -6.623  27.394  1.00 0.00 ? 30 LEU A HD11 12 
ATOM 7199  H HD12 . LEU A 1 30 ? -5.096  -5.398  26.601  1.00 0.00 ? 30 LEU A HD12 12 
ATOM 7200  H HD13 . LEU A 1 30 ? -4.718  -6.920  25.761  1.00 0.00 ? 30 LEU A HD13 12 
ATOM 7201  H HD21 . LEU A 1 30 ? -1.804  -7.057  26.594  1.00 0.00 ? 30 LEU A HD21 12 
ATOM 7202  H HD22 . LEU A 1 30 ? -2.430  -7.358  24.958  1.00 0.00 ? 30 LEU A HD22 12 
ATOM 7203  H HD23 . LEU A 1 30 ? -1.145  -6.153  25.212  1.00 0.00 ? 30 LEU A HD23 12 
ATOM 7204  N N    . VAL A 1 31 ? -3.386  -2.558  22.267  1.00 0.00 ? 31 VAL A N    12 
ATOM 7205  C CA   . VAL A 1 31 ? -3.863  -2.087  20.969  1.00 0.00 ? 31 VAL A CA   12 
ATOM 7206  C C    . VAL A 1 31 ? -2.721  -2.044  19.967  1.00 0.00 ? 31 VAL A C    12 
ATOM 7207  O O    . VAL A 1 31 ? -2.906  -2.312  18.781  1.00 0.00 ? 31 VAL A O    12 
ATOM 7208  C CB   . VAL A 1 31 ? -4.461  -0.671  21.067  1.00 0.00 ? 31 VAL A CB   12 
ATOM 7209  C CG1  . VAL A 1 31 ? -4.739  -0.113  19.680  1.00 0.00 ? 31 VAL A CG1  12 
ATOM 7210  C CG2  . VAL A 1 31 ? -5.767  -0.698  21.845  1.00 0.00 ? 31 VAL A CG2  12 
ATOM 7211  H H    . VAL A 1 31 ? -3.557  -1.978  23.076  1.00 0.00 ? 31 VAL A H    12 
ATOM 7212  H HA   . VAL A 1 31 ? -4.631  -2.775  20.614  1.00 0.00 ? 31 VAL A HA   12 
ATOM 7213  H HB   . VAL A 1 31 ? -3.751  -0.022  21.580  1.00 0.00 ? 31 VAL A HB   12 
ATOM 7214  H HG11 . VAL A 1 31 ? -5.154  0.892   19.762  1.00 0.00 ? 31 VAL A HG11 12 
ATOM 7215  H HG12 . VAL A 1 31 ? -3.810  -0.075  19.112  1.00 0.00 ? 31 VAL A HG12 12 
ATOM 7216  H HG13 . VAL A 1 31 ? -5.453  -0.757  19.167  1.00 0.00 ? 31 VAL A HG13 12 
ATOM 7217  H HG21 . VAL A 1 31 ? -6.177  0.310   21.916  1.00 0.00 ? 31 VAL A HG21 12 
ATOM 7218  H HG22 . VAL A 1 31 ? -6.481  -1.342  21.332  1.00 0.00 ? 31 VAL A HG22 12 
ATOM 7219  H HG23 . VAL A 1 31 ? -5.584  -1.084  22.848  1.00 0.00 ? 31 VAL A HG23 12 
ATOM 7220  N N    . ILE A 1 32 ? -1.535  -1.702  20.461  1.00 0.00 ? 32 ILE A N    12 
ATOM 7221  C CA   . ILE A 1 32 ? -0.338  -1.614  19.628  1.00 0.00 ? 32 ILE A CA   12 
ATOM 7222  C C    . ILE A 1 32 ? 0.037   -2.986  19.090  1.00 0.00 ? 32 ILE A C    12 
ATOM 7223  O O    . ILE A 1 32 ? 0.396   -3.135  17.923  1.00 0.00 ? 32 ILE A O    12 
ATOM 7224  C CB   . ILE A 1 32 ? 0.864   -1.072  20.423  1.00 0.00 ? 32 ILE A CB   12 
ATOM 7225  C CG1  . ILE A 1 32 ? 0.628   0.388   20.817  1.00 0.00 ? 32 ILE A CG1  12 
ATOM 7226  C CG2  . ILE A 1 32 ? 2.133   -1.146  19.587  1.00 0.00 ? 32 ILE A CG2  12 
ATOM 7227  C CD1  . ILE A 1 32 ? 1.641   0.924   21.805  1.00 0.00 ? 32 ILE A CD1  12 
ATOM 7228  H H    . ILE A 1 32 ? -1.447  -1.494  21.446  1.00 0.00 ? 32 ILE A H    12 
ATOM 7229  H HA   . ILE A 1 32 ? -0.547  -0.943  18.795  1.00 0.00 ? 32 ILE A HA   12 
ATOM 7230  H HB   . ILE A 1 32 ? 0.990   -1.672  21.324  1.00 0.00 ? 32 ILE A HB   12 
ATOM 7231  H HG12 . ILE A 1 32 ? 0.670   1.000   19.916  1.00 0.00 ? 32 ILE A HG12 12 
ATOM 7232  H HG13 . ILE A 1 32 ? -0.363  0.469   21.264  1.00 0.00 ? 32 ILE A HG13 12 
ATOM 7233  H HG21 . ILE A 1 32 ? 2.978   -0.769  20.163  1.00 0.00 ? 32 ILE A HG21 12 
ATOM 7234  H HG22 . ILE A 1 32 ? 2.321   -2.182  19.306  1.00 0.00 ? 32 ILE A HG22 12 
ATOM 7235  H HG23 . ILE A 1 32 ? 2.010   -0.541  18.688  1.00 0.00 ? 32 ILE A HG23 12 
ATOM 7236  H HD11 . ILE A 1 32 ? 1.425   1.965   22.048  1.00 0.00 ? 32 ILE A HD11 12 
ATOM 7237  H HD12 . ILE A 1 32 ? 1.603   0.330   22.718  1.00 0.00 ? 32 ILE A HD12 12 
ATOM 7238  H HD13 . ILE A 1 32 ? 2.638   0.859   21.370  1.00 0.00 ? 32 ILE A HD13 12 
ATOM 7239  N N    . LEU A 1 33 ? -0.051  -3.988  19.960  1.00 0.00 ? 33 LEU A N    12 
ATOM 7240  C CA   . LEU A 1 33 ? 0.275   -5.365  19.599  1.00 0.00 ? 33 LEU A CA   12 
ATOM 7241  C C    . LEU A 1 33 ? -0.659  -5.864  18.508  1.00 0.00 ? 33 LEU A C    12 
ATOM 7242  O O    . LEU A 1 33 ? -0.222  -6.432  17.508  1.00 0.00 ? 33 LEU A O    12 
ATOM 7243  C CB   . LEU A 1 33 ? 0.135   -6.285  20.814  1.00 0.00 ? 33 LEU A CB   12 
ATOM 7244  C CG   . LEU A 1 33 ? 1.202   -6.139  21.901  1.00 0.00 ? 33 LEU A CG   12 
ATOM 7245  C CD1  . LEU A 1 33 ? 0.872   -7.016  23.099  1.00 0.00 ? 33 LEU A CD1  12 
ATOM 7246  C CD2  . LEU A 1 33 ? 2.568   -6.550  21.372  1.00 0.00 ? 33 LEU A CD2  12 
ATOM 7247  H H    . LEU A 1 33 ? -0.353  -3.801  20.906  1.00 0.00 ? 33 LEU A H    12 
ATOM 7248  H HA   . LEU A 1 33 ? 1.303   -5.398  19.238  1.00 0.00 ? 33 LEU A HA   12 
ATOM 7249  H HB2  . LEU A 1 33 ? -0.835  -6.086  21.271  1.00 0.00 ? 33 LEU A HB2  12 
ATOM 7250  H HB3  . LEU A 1 33 ? 0.163   -7.314  20.456  1.00 0.00 ? 33 LEU A HB3  12 
ATOM 7251  H HG   . LEU A 1 33 ? 1.238   -5.096  22.218  1.00 0.00 ? 33 LEU A HG   12 
ATOM 7252  H HD11 . LEU A 1 33 ? 1.633   -6.895  23.870  1.00 0.00 ? 33 LEU A HD11 12 
ATOM 7253  H HD12 . LEU A 1 33 ? -0.099  -6.726  23.503  1.00 0.00 ? 33 LEU A HD12 12 
ATOM 7254  H HD13 . LEU A 1 33 ? 0.838   -8.059  22.786  1.00 0.00 ? 33 LEU A HD13 12 
ATOM 7255  H HD21 . LEU A 1 33 ? 3.320   -6.430  22.152  1.00 0.00 ? 33 LEU A HD21 12 
ATOM 7256  H HD22 . LEU A 1 33 ? 2.535   -7.593  21.059  1.00 0.00 ? 33 LEU A HD22 12 
ATOM 7257  H HD23 . LEU A 1 33 ? 2.829   -5.922  20.520  1.00 0.00 ? 33 LEU A HD23 12 
ATOM 7258  N N    . ALA A 1 34 ? -1.953  -5.643  18.714  1.00 0.00 ? 34 ALA A N    12 
ATOM 7259  C CA   . ALA A 1 34 ? -2.978  -6.061  17.760  1.00 0.00 ? 34 ALA A CA   12 
ATOM 7260  C C    . ALA A 1 34 ? -2.739  -5.415  16.405  1.00 0.00 ? 34 ALA A C    12 
ATOM 7261  O O    . ALA A 1 34 ? -2.885  -6.051  15.362  1.00 0.00 ? 34 ALA A O    12 
ATOM 7262  C CB   . ALA A 1 34 ? -4.358  -5.653  18.252  1.00 0.00 ? 34 ALA A CB   12 
ATOM 7263  H H    . ALA A 1 34 ? -2.250  -5.171  19.556  1.00 0.00 ? 34 ALA A H    12 
ATOM 7264  H HA   . ALA A 1 34 ? -2.938  -7.145  17.656  1.00 0.00 ? 34 ALA A HA   12 
ATOM 7265  H HB1  . ALA A 1 34 ? -5.116  -5.982  17.541  1.00 0.00 ? 34 ALA A HB1  12 
ATOM 7266  H HB2  . ALA A 1 34 ? -4.548  -6.113  19.222  1.00 0.00 ? 34 ALA A HB2  12 
ATOM 7267  H HB3  . ALA A 1 34 ? -4.402  -4.568  18.351  1.00 0.00 ? 34 ALA A HB3  12 
ATOM 7268  N N    . VAL A 1 35 ? -2.368  -4.138  16.434  1.00 0.00 ? 35 VAL A N    12 
ATOM 7269  C CA   . VAL A 1 35 ? -2.100  -3.376  15.218  1.00 0.00 ? 35 VAL A CA   12 
ATOM 7270  C C    . VAL A 1 35 ? -1.042  -4.070  14.377  1.00 0.00 ? 35 VAL A C    12 
ATOM 7271  O O    . VAL A 1 35 ? -1.166  -4.176  13.158  1.00 0.00 ? 35 VAL A O    12 
ATOM 7272  C CB   . VAL A 1 35 ? -1.593  -1.958  15.541  1.00 0.00 ? 35 VAL A CB   12 
ATOM 7273  C CG1  . VAL A 1 35 ? -1.124  -1.259  14.274  1.00 0.00 ? 35 VAL A CG1  12 
ATOM 7274  C CG2  . VAL A 1 35 ? -2.701  -1.126  16.167  1.00 0.00 ? 35 VAL A CG2  12 
ATOM 7275  H H    . VAL A 1 35 ? -2.266  -3.669  17.323  1.00 0.00 ? 35 VAL A H    12 
ATOM 7276  H HA   . VAL A 1 35 ? -3.026  -3.303  14.647  1.00 0.00 ? 35 VAL A HA   12 
ATOM 7277  H HB   . VAL A 1 35 ? -0.761  -2.032  16.240  1.00 0.00 ? 35 VAL A HB   12 
ATOM 7278  H HG11 . VAL A 1 35 ? -0.760  -0.260  14.516  1.00 0.00 ? 35 VAL A HG11 12 
ATOM 7279  H HG12 . VAL A 1 35 ? -0.320  -1.836  13.818  1.00 0.00 ? 35 VAL A HG12 12 
ATOM 7280  H HG13 . VAL A 1 35 ? -1.957  -1.180  13.574  1.00 0.00 ? 35 VAL A HG13 12 
ATOM 7281  H HG21 . VAL A 1 35 ? -2.329  -0.128  16.399  1.00 0.00 ? 35 VAL A HG21 12 
ATOM 7282  H HG22 . VAL A 1 35 ? -3.534  -1.047  15.468  1.00 0.00 ? 35 VAL A HG22 12 
ATOM 7283  H HG23 . VAL A 1 35 ? -3.041  -1.607  17.084  1.00 0.00 ? 35 VAL A HG23 12 
ATOM 7284  N N    . ALA A 1 36 ? 0.005   -4.542  15.047  1.00 0.00 ? 36 ALA A N    12 
ATOM 7285  C CA   . ALA A 1 36 ? 1.107   -5.235  14.385  1.00 0.00 ? 36 ALA A CA   12 
ATOM 7286  C C    . ALA A 1 36 ? 0.625   -6.538  13.771  1.00 0.00 ? 36 ALA A C    12 
ATOM 7287  O O    . ALA A 1 36 ? 0.936   -6.854  12.623  1.00 0.00 ? 36 ALA A O    12 
ATOM 7288  C CB   . ALA A 1 36 ? 2.210   -5.552  15.383  1.00 0.00 ? 36 ALA A CB   12 
ATOM 7289  H H    . ALA A 1 36 ? 0.050   -4.421  16.049  1.00 0.00 ? 36 ALA A H    12 
ATOM 7290  H HA   . ALA A 1 36 ? 1.504   -4.591  13.601  1.00 0.00 ? 36 ALA A HA   12 
ATOM 7291  H HB1  . ALA A 1 36 ? 3.033   -6.055  14.876  1.00 0.00 ? 36 ALA A HB1  12 
ATOM 7292  H HB2  . ALA A 1 36 ? 2.572   -4.625  15.829  1.00 0.00 ? 36 ALA A HB2  12 
ATOM 7293  H HB3  . ALA A 1 36 ? 1.815   -6.201  16.165  1.00 0.00 ? 36 ALA A HB3  12 
ATOM 7294  N N    . GLY A 1 37 ? -0.141  -7.294  14.553  1.00 0.00 ? 37 GLY A N    12 
ATOM 7295  C CA   . GLY A 1 37 ? -0.684  -8.575  14.112  1.00 0.00 ? 37 GLY A CA   12 
ATOM 7296  C C    . GLY A 1 37 ? -1.350  -8.430  12.753  1.00 0.00 ? 37 GLY A C    12 
ATOM 7297  O O    . GLY A 1 37 ? -0.960  -9.076  11.781  1.00 0.00 ? 37 GLY A O    12 
ATOM 7298  H H    . GLY A 1 37 ? -0.361  -6.979  15.487  1.00 0.00 ? 37 GLY A H    12 
ATOM 7299  H HA2  . GLY A 1 37 ? 0.124   -9.302  14.041  1.00 0.00 ? 37 GLY A HA2  12 
ATOM 7300  H HA3  . GLY A 1 37 ? -1.420  -8.922  14.838  1.00 0.00 ? 37 GLY A HA3  12 
ATOM 7301  N N    . LEU A 1 38 ? -2.364  -7.571  12.699  1.00 0.00 ? 38 LEU A N    12 
ATOM 7302  C CA   . LEU A 1 38 ? -3.109  -7.319  11.468  1.00 0.00 ? 38 LEU A CA   12 
ATOM 7303  C C    . LEU A 1 38 ? -2.184  -6.780  10.389  1.00 0.00 ? 38 LEU A C    12 
ATOM 7304  O O    . LEU A 1 38 ? -2.298  -7.137  9.218   1.00 0.00 ? 38 LEU A O    12 
ATOM 7305  C CB   . LEU A 1 38 ? -4.217  -6.293  11.713  1.00 0.00 ? 38 LEU A CB   12 
ATOM 7306  C CG   . LEU A 1 38 ? -5.405  -6.765  12.554  1.00 0.00 ? 38 LEU A CG   12 
ATOM 7307  C CD1  . LEU A 1 38 ? -6.363  -5.616  12.825  1.00 0.00 ? 38 LEU A CD1  12 
ATOM 7308  C CD2  . LEU A 1 38 ? -6.171  -7.864  11.834  1.00 0.00 ? 38 LEU A CD2  12 
ATOM 7309  H H    . LEU A 1 38 ? -2.637  -7.069  13.533  1.00 0.00 ? 38 LEU A H    12 
ATOM 7310  H HA   . LEU A 1 38 ? -3.554  -8.255  11.130  1.00 0.00 ? 38 LEU A HA   12 
ATOM 7311  H HB2  . LEU A 1 38 ? -3.771  -5.437  12.220  1.00 0.00 ? 38 LEU A HB2  12 
ATOM 7312  H HB3  . LEU A 1 38 ? -4.601  -5.980  10.742  1.00 0.00 ? 38 LEU A HB3  12 
ATOM 7313  H HG   . LEU A 1 38 ? -5.031  -7.151  13.502  1.00 0.00 ? 38 LEU A HG   12 
ATOM 7314  H HD11 . LEU A 1 38 ? -7.199  -5.963  13.434  1.00 0.00 ? 38 LEU A HD11 12 
ATOM 7315  H HD12 . LEU A 1 38 ? -5.836  -4.823  13.356  1.00 0.00 ? 38 LEU A HD12 12 
ATOM 7316  H HD13 . LEU A 1 38 ? -6.743  -5.230  11.879  1.00 0.00 ? 38 LEU A HD13 12 
ATOM 7317  H HD21 . LEU A 1 38 ? -7.007  -8.199  12.449  1.00 0.00 ? 38 LEU A HD21 12 
ATOM 7318  H HD22 . LEU A 1 38 ? -6.552  -7.479  10.888  1.00 0.00 ? 38 LEU A HD22 12 
ATOM 7319  H HD23 . LEU A 1 38 ? -5.504  -8.704  11.644  1.00 0.00 ? 38 LEU A HD23 12 
ATOM 7320  N N    . ILE A 1 39 ? -1.264  -5.913  10.800  1.00 0.00 ? 39 ILE A N    12 
ATOM 7321  C CA   . ILE A 1 39 ? -0.301  -5.305  9.887   1.00 0.00 ? 39 ILE A CA   12 
ATOM 7322  C C    . ILE A 1 39 ? 0.523   -6.375  9.192   1.00 0.00 ? 39 ILE A C    12 
ATOM 7323  O O    . ILE A 1 39 ? 0.750   -6.319  7.984   1.00 0.00 ? 39 ILE A O    12 
ATOM 7324  C CB   . ILE A 1 39 ? 0.670   -4.370  10.631  1.00 0.00 ? 39 ILE A CB   12 
ATOM 7325  C CG1  . ILE A 1 39 ? -0.075  -3.146  11.168  1.00 0.00 ? 39 ILE A CG1  12 
ATOM 7326  C CG2  . ILE A 1 39 ? 1.771   -3.892  9.697   1.00 0.00 ? 39 ILE A CG2  12 
ATOM 7327  C CD1  . ILE A 1 39 ? -0.727  -2.307  10.091  1.00 0.00 ? 39 ILE A CD1  12 
ATOM 7328  H H    . ILE A 1 39 ? -1.221  -5.659  11.777  1.00 0.00 ? 39 ILE A H    12 
ATOM 7329  H HA   . ILE A 1 39 ? -0.850  -4.729  9.141   1.00 0.00 ? 39 ILE A HA   12 
ATOM 7330  H HB   . ILE A 1 39 ? 1.115   -4.914  11.464  1.00 0.00 ? 39 ILE A HB   12 
ATOM 7331  H HG12 . ILE A 1 39 ? -0.851  -3.488  11.853  1.00 0.00 ? 39 ILE A HG12 12 
ATOM 7332  H HG13 . ILE A 1 39 ? 0.635   -2.520  11.708  1.00 0.00 ? 39 ILE A HG13 12 
ATOM 7333  H HG21 . ILE A 1 39 ? 2.456   -3.239  10.237  1.00 0.00 ? 39 ILE A HG21 12 
ATOM 7334  H HG22 . ILE A 1 39 ? 2.318   -4.752  9.313   1.00 0.00 ? 39 ILE A HG22 12 
ATOM 7335  H HG23 . ILE A 1 39 ? 1.328   -3.342  8.866   1.00 0.00 ? 39 ILE A HG23 12 
ATOM 7336  H HD11 . ILE A 1 39 ? -1.242  -1.452  10.531  1.00 0.00 ? 39 ILE A HD11 12 
ATOM 7337  H HD12 . ILE A 1 39 ? 0.037   -1.947  9.403   1.00 0.00 ? 39 ILE A HD12 12 
ATOM 7338  H HD13 . ILE A 1 39 ? -1.448  -2.916  9.547   1.00 0.00 ? 39 ILE A HD13 12 
ATOM 7339  N N    . TYR A 1 40 ? 0.970   -7.354  9.974   1.00 0.00 ? 40 TYR A N    12 
ATOM 7340  C CA   . TYR A 1 40 ? 1.776   -8.457  9.459   1.00 0.00 ? 40 TYR A CA   12 
ATOM 7341  C C    . TYR A 1 40 ? 0.942   -9.352  8.558   1.00 0.00 ? 40 TYR A C    12 
ATOM 7342  O O    . TYR A 1 40 ? 1.397   -9.797  7.506   1.00 0.00 ? 40 TYR A O    12 
ATOM 7343  C CB   . TYR A 1 40 ? 2.322   -9.305  10.610  1.00 0.00 ? 40 TYR A CB   12 
ATOM 7344  C CG   . TYR A 1 40 ? 3.192   -10.457 10.162  1.00 0.00 ? 40 TYR A CG   12 
ATOM 7345  C CD1  . TYR A 1 40 ? 4.508   -10.245 9.771   1.00 0.00 ? 40 TYR A CD1  12 
ATOM 7346  C CD2  . TYR A 1 40 ? 2.695   -11.754 10.133  1.00 0.00 ? 40 TYR A CD2  12 
ATOM 7347  C CE1  . TYR A 1 40 ? 5.311   -11.292 9.361   1.00 0.00 ? 40 TYR A CE1  12 
ATOM 7348  C CE2  . TYR A 1 40 ? 3.484   -12.813 9.725   1.00 0.00 ? 40 TYR A CE2  12 
ATOM 7349  C CZ   . TYR A 1 40 ? 4.801   -12.572 9.338   1.00 0.00 ? 40 TYR A CZ   12 
ATOM 7350  O OH   . TYR A 1 40 ? 5.598   -13.617 8.930   1.00 0.00 ? 40 TYR A OH   12 
ATOM 7351  H H    . TYR A 1 40 ? 0.751   -7.343  10.960  1.00 0.00 ? 40 TYR A H    12 
ATOM 7352  H HA   . TYR A 1 40 ? 2.608   -8.044  8.889   1.00 0.00 ? 40 TYR A HA   12 
ATOM 7353  H HB2  . TYR A 1 40 ? 2.909   -8.662  11.266  1.00 0.00 ? 40 TYR A HB2  12 
ATOM 7354  H HB3  . TYR A 1 40 ? 1.480   -9.706  11.175  1.00 0.00 ? 40 TYR A HB3  12 
ATOM 7355  H HD1  . TYR A 1 40 ? 4.911   -9.243  9.788   1.00 0.00 ? 40 TYR A HD1  12 
ATOM 7356  H HD2  . TYR A 1 40 ? 1.674   -11.938 10.435  1.00 0.00 ? 40 TYR A HD2  12 
ATOM 7357  H HE1  . TYR A 1 40 ? 6.332   -11.108 9.060   1.00 0.00 ? 40 TYR A HE1  12 
ATOM 7358  H HE2  . TYR A 1 40 ? 3.084   -13.816 9.707   1.00 0.00 ? 40 TYR A HE2  12 
ATOM 7359  H HH   . TYR A 1 40 ? 5.147   -14.464 8.951   1.00 0.00 ? 40 TYR A HH   12 
ATOM 7360  N N    . SER A 1 41 ? -0.292  -9.609  8.986   1.00 0.00 ? 41 SER A N    12 
ATOM 7361  C CA   . SER A 1 41 ? -1.218  -10.450 8.235   1.00 0.00 ? 41 SER A CA   12 
ATOM 7362  C C    . SER A 1 41 ? -1.475  -9.863  6.857   1.00 0.00 ? 41 SER A C    12 
ATOM 7363  O O    . SER A 1 41 ? -1.376  -10.551 5.843   1.00 0.00 ? 41 SER A O    12 
ATOM 7364  C CB   . SER A 1 41 ? -2.556  -10.562 8.969   1.00 0.00 ? 41 SER A CB   12 
ATOM 7365  O OG   . SER A 1 41 ? -2.407  -11.252 10.198  1.00 0.00 ? 41 SER A OG   12 
ATOM 7366  H H    . SER A 1 41 ? -0.609  -9.212  9.859   1.00 0.00 ? 41 SER A H    12 
ATOM 7367  H HA   . SER A 1 41 ? -0.781  -11.442 8.129   1.00 0.00 ? 41 SER A HA   12 
ATOM 7368  H HB2  . SER A 1 41 ? -2.939  -9.560  9.167   1.00 0.00 ? 41 SER A HB2  12 
ATOM 7369  H HB3  . SER A 1 41 ? -3.263  -11.103 8.341   1.00 0.00 ? 41 SER A HB3  12 
ATOM 7370  H HG   . SER A 1 41 ? -3.262  -11.304 10.632  1.00 0.00 ? 41 SER A HG   12 
ATOM 7371  N N    . MET A 1 42 ? -1.806  -8.574  6.835   1.00 0.00 ? 42 MET A N    12 
ATOM 7372  C CA   . MET A 1 42 ? -2.083  -7.862  5.591   1.00 0.00 ? 42 MET A CA   12 
ATOM 7373  C C    . MET A 1 42 ? -0.841  -7.809  4.718   1.00 0.00 ? 42 MET A C    12 
ATOM 7374  O O    . MET A 1 42 ? -0.909  -7.983  3.502   1.00 0.00 ? 42 MET A O    12 
ATOM 7375  C CB   . MET A 1 42 ? -2.529  -6.428  5.882   1.00 0.00 ? 42 MET A CB   12 
ATOM 7376  C CG   . MET A 1 42 ? -2.921  -5.636  4.645   1.00 0.00 ? 42 MET A CG   12 
ATOM 7377  S SD   . MET A 1 42 ? -3.470  -3.964  5.035   1.00 0.00 ? 42 MET A SD   12 
ATOM 7378  C CE   . MET A 1 42 ? -1.925  -3.207  5.532   1.00 0.00 ? 42 MET A CE   12 
ATOM 7379  H H    . MET A 1 42 ? -1.872  -8.061  7.703   1.00 0.00 ? 42 MET A H    12 
ATOM 7380  H HA   . MET A 1 42 ? -2.877  -8.385  5.058   1.00 0.00 ? 42 MET A HA   12 
ATOM 7381  H HB2  . MET A 1 42 ? -3.389  -6.465  6.551   1.00 0.00 ? 42 MET A HB2  12 
ATOM 7382  H HB3  . MET A 1 42 ? -1.708  -5.907  6.375   1.00 0.00 ? 42 MET A HB3  12 
ATOM 7383  H HG2  . MET A 1 42 ? -2.062  -5.576  3.977   1.00 0.00 ? 42 MET A HG2  12 
ATOM 7384  H HG3  . MET A 1 42 ? -3.728  -6.159  4.131   1.00 0.00 ? 42 MET A HG3  12 
ATOM 7385  H HE1  . MET A 1 42 ? -2.092  -2.165  5.806   1.00 0.00 ? 42 MET A HE1  12 
ATOM 7386  H HE2  . MET A 1 42 ? -1.518  -3.744  6.389   1.00 0.00 ? 42 MET A HE2  12 
ATOM 7387  H HE3  . MET A 1 42 ? -1.217  -3.252  4.705   1.00 0.00 ? 42 MET A HE3  12 
ATOM 7388  N N    . LEU A 1 43 ? 0.300   -7.566  5.357   1.00 0.00 ? 43 LEU A N    12 
ATOM 7389  C CA   . LEU A 1 43 ? 1.582   -7.485  4.663   1.00 0.00 ? 43 LEU A CA   12 
ATOM 7390  C C    . LEU A 1 43 ? 2.065   -8.872  4.272   1.00 0.00 ? 43 LEU A C    12 
ATOM 7391  O O    . LEU A 1 43 ? 2.598   -9.076  3.183   1.00 0.00 ? 43 LEU A O    12 
ATOM 7392  C CB   . LEU A 1 43 ? 2.639   -6.841  5.563   1.00 0.00 ? 43 LEU A CB   12 
ATOM 7393  C CG   . LEU A 1 43 ? 2.474   -5.346  5.840   1.00 0.00 ? 43 LEU A CG   12 
ATOM 7394  C CD1  . LEU A 1 43 ? 3.511   -4.867  6.843   1.00 0.00 ? 43 LEU A CD1  12 
ATOM 7395  C CD2  . LEU A 1 43 ? 2.643   -4.540  4.560   1.00 0.00 ? 43 LEU A CD2  12 
ATOM 7396  H H    . LEU A 1 43 ? 0.290   -7.431  6.358   1.00 0.00 ? 43 LEU A H    12 
ATOM 7397  H HA   . LEU A 1 43 ? 1.456   -6.879  3.765   1.00 0.00 ? 43 LEU A HA   12 
ATOM 7398  H HB2  . LEU A 1 43 ? 2.620   -7.360  6.521   1.00 0.00 ? 43 LEU A HB2  12 
ATOM 7399  H HB3  . LEU A 1 43 ? 3.610   -6.985  5.090   1.00 0.00 ? 43 LEU A HB3  12 
ATOM 7400  H HG   . LEU A 1 43 ? 1.476   -5.172  6.244   1.00 0.00 ? 43 LEU A HG   12 
ATOM 7401  H HD11 . LEU A 1 43 ? 3.375   -3.803  7.039   1.00 0.00 ? 43 LEU A HD11 12 
ATOM 7402  H HD12 . LEU A 1 43 ? 3.397   -5.422  7.774   1.00 0.00 ? 43 LEU A HD12 12 
ATOM 7403  H HD13 . LEU A 1 43 ? 4.509   -5.035  6.440   1.00 0.00 ? 43 LEU A HD13 12 
ATOM 7404  H HD21 . LEU A 1 43 ? 2.511   -3.478  4.769   1.00 0.00 ? 43 LEU A HD21 12 
ATOM 7405  H HD22 . LEU A 1 43 ? 3.641   -4.707  4.156   1.00 0.00 ? 43 LEU A HD22 12 
ATOM 7406  H HD23 . LEU A 1 43 ? 1.898   -4.858  3.831   1.00 0.00 ? 43 LEU A HD23 12 
ATOM 7407  N N    . ARG A 1 44 ? 1.870   -9.825  5.178   1.00 0.00 ? 44 ARG A N    12 
ATOM 7408  C CA   . ARG A 1 44 ? 2.276   -11.209 4.955   1.00 0.00 ? 44 ARG A CA   12 
ATOM 7409  C C    . ARG A 1 44 ? 1.231   -11.946 4.134   1.00 0.00 ? 44 ARG A C    12 
ATOM 7410  O O    . ARG A 1 44 ? 1.552   -12.827 3.338   1.00 0.00 ? 44 ARG A O    12 
ATOM 7411  C CB   . ARG A 1 44 ? 2.445   -11.939 6.289   1.00 0.00 ? 44 ARG A CB   12 
ATOM 7412  C CG   . ARG A 1 44 ? 2.956   -13.365 6.155   1.00 0.00 ? 44 ARG A CG   12 
ATOM 7413  C CD   . ARG A 1 44 ? 4.382   -13.393 5.631   1.00 0.00 ? 44 ARG A CD   12 
ATOM 7414  N NE   . ARG A 1 44 ? 4.895   -14.756 5.512   1.00 0.00 ? 44 ARG A NE   12 
ATOM 7415  C CZ   . ARG A 1 44 ? 6.045   -15.074 4.927   1.00 0.00 ? 44 ARG A CZ   12 
ATOM 7416  N NH1  . ARG A 1 44 ? 6.807   -14.123 4.404   1.00 0.00 ? 44 ARG A NH1  12 
ATOM 7417  N NH2  . ARG A 1 44 ? 6.430   -16.341 4.866   1.00 0.00 ? 44 ARG A NH2  12 
ATOM 7418  H H    . ARG A 1 44 ? 1.426   -9.593  6.056   1.00 0.00 ? 44 ARG A H    12 
ATOM 7419  H HA   . ARG A 1 44 ? 3.225   -11.213 4.419   1.00 0.00 ? 44 ARG A HA   12 
ATOM 7420  H HB2  . ARG A 1 44 ? 3.152   -11.377 6.900   1.00 0.00 ? 44 ARG A HB2  12 
ATOM 7421  H HB3  . ARG A 1 44 ? 1.476   -11.967 6.789   1.00 0.00 ? 44 ARG A HB3  12 
ATOM 7422  H HG2  . ARG A 1 44 ? 2.927   -13.845 7.133   1.00 0.00 ? 44 ARG A HG2  12 
ATOM 7423  H HG3  . ARG A 1 44 ? 2.312   -13.909 5.464   1.00 0.00 ? 44 ARG A HG3  12 
ATOM 7424  H HD2  . ARG A 1 44 ? 4.407   -12.919 4.650   1.00 0.00 ? 44 ARG A HD2  12 
ATOM 7425  H HD3  . ARG A 1 44 ? 5.020   -12.833 6.315   1.00 0.00 ? 44 ARG A HD3  12 
ATOM 7426  H HE   . ARG A 1 44 ? 4.330   -15.496 5.903   1.00 0.00 ? 44 ARG A HE   12 
ATOM 7427  H HH11 . ARG A 1 44 ? 6.513   -13.157 4.451   1.00 0.00 ? 44 ARG A HH11 12 
ATOM 7428  H HH12 . ARG A 1 44 ? 7.681   -14.364 3.959   1.00 0.00 ? 44 ARG A HH12 12 
ATOM 7429  H HH21 . ARG A 1 44 ? 5.849   -17.065 5.264   1.00 0.00 ? 44 ARG A HH21 12 
ATOM 7430  H HH22 . ARG A 1 44 ? 7.303   -16.582 4.421   1.00 0.00 ? 44 ARG A HH22 12 
ATOM 7431  N N    . LYS A 1 45 ? -0.029  -11.572 4.340   1.00 0.00 ? 45 LYS A N    12 
ATOM 7432  C CA   . LYS A 1 45 ? -1.149  -12.182 3.630   1.00 0.00 ? 45 LYS A CA   12 
ATOM 7433  C C    . LYS A 1 45 ? -1.185  -11.711 2.186   1.00 0.00 ? 45 LYS A C    12 
ATOM 7434  O O    . LYS A 1 45 ? -1.342  -12.506 1.261   1.00 0.00 ? 45 LYS A O    12 
ATOM 7435  C CB   . LYS A 1 45 ? -2.474  -11.804 4.294   1.00 0.00 ? 45 LYS A CB   12 
ATOM 7436  C CG   . LYS A 1 45 ? -3.695  -12.440 3.650   1.00 0.00 ? 45 LYS A CG   12 
ATOM 7437  C CD   . LYS A 1 45 ? -4.968  -12.068 4.393   1.00 0.00 ? 45 LYS A CD   12 
ATOM 7438  C CE   . LYS A 1 45 ? -6.191  -12.692 3.740   1.00 0.00 ? 45 LYS A CE   12 
ATOM 7439  N NZ   . LYS A 1 45 ? -7.445  -12.346 4.464   1.00 0.00 ? 45 LYS A NZ   12 
ATOM 7440  H H    . LYS A 1 45 ? -0.229  -10.841 5.009   1.00 0.00 ? 45 LYS A H    12 
ATOM 7441  H HA   . LYS A 1 45 ? -1.031  -13.265 3.654   1.00 0.00 ? 45 LYS A HA   12 
ATOM 7442  H HB2  . LYS A 1 45 ? -2.436  -12.117 5.337   1.00 0.00 ? 45 LYS A HB2  12 
ATOM 7443  H HB3  . LYS A 1 45 ? -2.586  -10.720 4.244   1.00 0.00 ? 45 LYS A HB3  12 
ATOM 7444  H HG2  . LYS A 1 45 ? -3.773  -12.095 2.619   1.00 0.00 ? 45 LYS A HG2  12 
ATOM 7445  H HG3  . LYS A 1 45 ? -3.580  -13.523 3.664   1.00 0.00 ? 45 LYS A HG3  12 
ATOM 7446  H HD2  . LYS A 1 45 ? -4.896  -12.421 5.422   1.00 0.00 ? 45 LYS A HD2  12 
ATOM 7447  H HD3  . LYS A 1 45 ? -5.078  -10.983 4.389   1.00 0.00 ? 45 LYS A HD3  12 
ATOM 7448  H HE2  . LYS A 1 45 ? -6.266  -12.333 2.713   1.00 0.00 ? 45 LYS A HE2  12 
ATOM 7449  H HE3  . LYS A 1 45 ? -6.075  -13.775 3.734   1.00 0.00 ? 45 LYS A HE3  12 
ATOM 7450  H HZ1  . LYS A 1 45 ? -8.235  -12.775 4.004   1.00 0.00 ? 45 LYS A HZ1  12 
ATOM 7451  H HZ2  . LYS A 1 45 ? -7.388  -12.681 5.415   1.00 0.00 ? 45 LYS A HZ2  12 
ATOM 7452  H HZ3  . LYS A 1 45 ? -7.565  -11.343 4.468   1.00 0.00 ? 45 LYS A HZ3  12 
ATOM 7453  N N    . ALA A 1 46 ? -1.037  -10.401 2.005   1.00 0.00 ? 46 ALA A N    12 
ATOM 7454  C CA   . ALA A 1 46 ? -1.048  -9.791  0.679   1.00 0.00 ? 46 ALA A CA   12 
ATOM 7455  C C    . ALA A 1 46 ? -0.855  -8.286  0.802   1.00 0.00 ? 46 ALA A C    12 
ATOM 7456  O O    . ALA A 1 46 ? -0.719  -7.763  1.906   1.00 0.00 ? 46 ALA A O    12 
ATOM 7457  C CB   . ALA A 1 46 ? -2.368  -10.111 -0.017  1.00 0.00 ? 46 ALA A CB   12 
ATOM 7458  H H    . ALA A 1 46 ? -0.913  -9.798  2.806   1.00 0.00 ? 46 ALA A H    12 
ATOM 7459  H HA   . ALA A 1 46 ? -0.229  -10.206 0.093   1.00 0.00 ? 46 ALA A HA   12 
ATOM 7460  H HB1  . ALA A 1 46 ? -2.369  -9.668  -1.012  1.00 0.00 ? 46 ALA A HB1  12 
ATOM 7461  H HB2  . ALA A 1 46 ? -2.483  -11.192 -0.099  1.00 0.00 ? 46 ALA A HB2  12 
ATOM 7462  H HB3  . ALA A 1 46 ? -3.195  -9.702  0.565   1.00 0.00 ? 46 ALA A HB3  12 
ATOM 7463  N N    . GLY A 1 1  ? -29.062 -28.051 62.572  1.00 0.00 ? 1  GLY A N    13 
ATOM 7464  C CA   . GLY A 1 1  ? -30.429 -27.574 62.615  1.00 0.00 ? 1  GLY A CA   13 
ATOM 7465  C C    . GLY A 1 1  ? -30.671 -26.586 61.485  1.00 0.00 ? 1  GLY A C    13 
ATOM 7466  O O    . GLY A 1 1  ? -29.774 -26.296 60.698  1.00 0.00 ? 1  GLY A O    13 
ATOM 7467  H H1   . GLY A 1 1  ? -28.452 -27.702 61.846  1.00 0.00 ? 1  GLY A H1   13 
ATOM 7468  H HA2  . GLY A 1 1  ? -31.111 -28.418 62.509  1.00 0.00 ? 1  GLY A HA2  13 
ATOM 7469  H HA3  . GLY A 1 1  ? -30.611 -27.081 63.571  1.00 0.00 ? 1  GLY A HA3  13 
ATOM 7470  N N    . VAL A 1 2  ? -31.898 -26.076 61.420  1.00 0.00 ? 2  VAL A N    13 
ATOM 7471  C CA   . VAL A 1 2  ? -32.289 -25.114 60.394  1.00 0.00 ? 2  VAL A CA   13 
ATOM 7472  C C    . VAL A 1 2  ? -31.602 -23.779 60.625  1.00 0.00 ? 2  VAL A C    13 
ATOM 7473  O O    . VAL A 1 2  ? -31.099 -23.152 59.693  1.00 0.00 ? 2  VAL A O    13 
ATOM 7474  C CB   . VAL A 1 2  ? -33.810 -24.870 60.399  1.00 0.00 ? 2  VAL A CB   13 
ATOM 7475  C CG1  . VAL A 1 2  ? -34.170 -23.733 59.455  1.00 0.00 ? 2  VAL A CG1  13 
ATOM 7476  C CG2  . VAL A 1 2  ? -34.551 -26.120 59.950  1.00 0.00 ? 2  VAL A CG2  13 
ATOM 7477  H H    . VAL A 1 2  ? -32.591 -26.357 62.099  1.00 0.00 ? 2  VAL A H    13 
ATOM 7478  H HA   . VAL A 1 2  ? -31.994 -25.508 59.422  1.00 0.00 ? 2  VAL A HA   13 
ATOM 7479  H HB   . VAL A 1 2  ? -34.123 -24.610 61.411  1.00 0.00 ? 2  VAL A HB   13 
ATOM 7480  H HG11 . VAL A 1 2  ? -35.247 -23.564 59.473  1.00 0.00 ? 2  VAL A HG11 13 
ATOM 7481  H HG12 . VAL A 1 2  ? -33.657 -22.824 59.770  1.00 0.00 ? 2  VAL A HG12 13 
ATOM 7482  H HG13 . VAL A 1 2  ? -33.863 -23.992 58.442  1.00 0.00 ? 2  VAL A HG13 13 
ATOM 7483  H HG21 . VAL A 1 2  ? -35.626 -25.938 59.966  1.00 0.00 ? 2  VAL A HG21 13 
ATOM 7484  H HG22 . VAL A 1 2  ? -34.244 -26.379 58.937  1.00 0.00 ? 2  VAL A HG22 13 
ATOM 7485  H HG23 . VAL A 1 2  ? -34.314 -26.943 60.624  1.00 0.00 ? 2  VAL A HG23 13 
ATOM 7486  N N    . ILE A 1 3  ? -31.586 -23.350 61.884  1.00 0.00 ? 3  ILE A N    13 
ATOM 7487  C CA   . ILE A 1 3  ? -30.965 -22.088 62.271  1.00 0.00 ? 3  ILE A CA   13 
ATOM 7488  C C    . ILE A 1 3  ? -29.460 -22.149 62.063  1.00 0.00 ? 3  ILE A C    13 
ATOM 7489  O O    . ILE A 1 3  ? -28.840 -21.185 61.619  1.00 0.00 ? 3  ILE A O    13 
ATOM 7490  C CB   . ILE A 1 3  ? -31.225 -21.762 63.754  1.00 0.00 ? 3  ILE A CB   13 
ATOM 7491  C CG1  . ILE A 1 3  ? -32.711 -21.484 63.986  1.00 0.00 ? 3  ILE A CG1  13 
ATOM 7492  C CG2  . ILE A 1 3  ? -30.433 -20.534 64.176  1.00 0.00 ? 3  ILE A CG2  13 
ATOM 7493  C CD1  . ILE A 1 3  ? -33.096 -21.397 65.446  1.00 0.00 ? 3  ILE A CD1  13 
ATOM 7494  H H    . ILE A 1 3  ? -32.016 -23.910 62.606  1.00 0.00 ? 3  ILE A H    13 
ATOM 7495  H HA   . ILE A 1 3  ? -31.384 -21.294 61.652  1.00 0.00 ? 3  ILE A HA   13 
ATOM 7496  H HB   . ILE A 1 3  ? -30.919 -22.613 64.361  1.00 0.00 ? 3  ILE A HB   13 
ATOM 7497  H HG12 . ILE A 1 3  ? -32.963 -20.537 63.508  1.00 0.00 ? 3  ILE A HG12 13 
ATOM 7498  H HG13 . ILE A 1 3  ? -33.287 -22.287 63.527  1.00 0.00 ? 3  ILE A HG13 13 
ATOM 7499  H HG21 . ILE A 1 3  ? -30.618 -20.319 65.229  1.00 0.00 ? 3  ILE A HG21 13 
ATOM 7500  H HG22 . ILE A 1 3  ? -29.370 -20.719 64.026  1.00 0.00 ? 3  ILE A HG22 13 
ATOM 7501  H HG23 . ILE A 1 3  ? -30.742 -19.679 63.574  1.00 0.00 ? 3  ILE A HG23 13 
ATOM 7502  H HD11 . ILE A 1 3  ? -34.163 -21.196 65.549  1.00 0.00 ? 3  ILE A HD11 13 
ATOM 7503  H HD12 . ILE A 1 3  ? -32.861 -22.341 65.937  1.00 0.00 ? 3  ILE A HD12 13 
ATOM 7504  H HD13 . ILE A 1 3  ? -32.535 -20.591 65.919  1.00 0.00 ? 3  ILE A HD13 13 
ATOM 7505  N N    . ASP A 1 4  ? -28.882 -23.301 62.391  1.00 0.00 ? 4  ASP A N    13 
ATOM 7506  C CA   . ASP A 1 4  ? -27.445 -23.519 62.251  1.00 0.00 ? 4  ASP A CA   13 
ATOM 7507  C C    . ASP A 1 4  ? -26.987 -23.162 60.846  1.00 0.00 ? 4  ASP A C    13 
ATOM 7508  O O    . ASP A 1 4  ? -25.928 -22.565 60.655  1.00 0.00 ? 4  ASP A O    13 
ATOM 7509  C CB   . ASP A 1 4  ? -27.097 -24.985 62.515  1.00 0.00 ? 4  ASP A CB   13 
ATOM 7510  C CG   . ASP A 1 4  ? -27.229 -25.361 63.978  1.00 0.00 ? 4  ASP A CG   13 
ATOM 7511  O OD1  . ASP A 1 4  ? -26.831 -26.488 64.340  1.00 0.00 ? 4  ASP A OD1  13 
ATOM 7512  O OD2  . ASP A 1 4  ? -27.731 -24.528 64.762  1.00 0.00 ? 4  ASP A OD2  13 
ATOM 7513  H H    . ASP A 1 4  ? -29.447 -24.057 62.751  1.00 0.00 ? 4  ASP A H    13 
ATOM 7514  H HA   . ASP A 1 4  ? -26.924 -22.889 62.972  1.00 0.00 ? 4  ASP A HA   13 
ATOM 7515  H HB2  . ASP A 1 4  ? -27.767 -25.615 61.930  1.00 0.00 ? 4  ASP A HB2  13 
ATOM 7516  H HB3  . ASP A 1 4  ? -26.070 -25.163 62.199  1.00 0.00 ? 4  ASP A HB3  13 
ATOM 7517  H HD2  . ASP A 1 4  ? -27.785 -24.831 65.671  1.00 0.00 ? 4  ASP A HD2  13 
ATOM 7518  N N    . THR A 1 5  ? -27.802 -23.536 59.863  1.00 0.00 ? 5  THR A N    13 
ATOM 7519  C CA   . THR A 1 5  ? -27.504 -23.268 58.459  1.00 0.00 ? 5  THR A CA   13 
ATOM 7520  C C    . THR A 1 5  ? -28.182 -21.984 58.008  1.00 0.00 ? 5  THR A C    13 
ATOM 7521  O O    . THR A 1 5  ? -28.043 -21.560 56.862  1.00 0.00 ? 5  THR A O    13 
ATOM 7522  C CB   . THR A 1 5  ? -27.997 -24.409 57.550  1.00 0.00 ? 5  THR A CB   13 
ATOM 7523  O OG1  . THR A 1 5  ? -29.420 -24.534 57.664  1.00 0.00 ? 5  THR A OG1  13 
ATOM 7524  C CG2  . THR A 1 5  ? -27.352 -25.727 57.952  1.00 0.00 ? 5  THR A CG2  13 
ATOM 7525  H H    . THR A 1 5  ? -28.660 -24.022 60.085  1.00 0.00 ? 5  THR A H    13 
ATOM 7526  H HA   . THR A 1 5  ? -26.425 -23.165 58.349  1.00 0.00 ? 5  THR A HA   13 
ATOM 7527  H HB   . THR A 1 5  ? -27.735 -24.180 56.517  1.00 0.00 ? 5  THR A HB   13 
ATOM 7528  H HG1  . THR A 1 5  ? -29.713 -25.242 57.087  1.00 0.00 ? 5  THR A HG1  13 
ATOM 7529  H HG21 . THR A 1 5  ? -27.708 -26.525 57.300  1.00 0.00 ? 5  THR A HG21 13 
ATOM 7530  H HG22 . THR A 1 5  ? -26.269 -25.642 57.863  1.00 0.00 ? 5  THR A HG22 13 
ATOM 7531  H HG23 . THR A 1 5  ? -27.615 -25.959 58.984  1.00 0.00 ? 5  THR A HG23 13 
ATOM 7532  N N    . SER A 1 6  ? -28.918 -21.369 58.929  1.00 0.00 ? 6  SER A N    13 
ATOM 7533  C CA   . SER A 1 6  ? -29.633 -20.126 58.653  1.00 0.00 ? 6  SER A CA   13 
ATOM 7534  C C    . SER A 1 6  ? -28.712 -19.119 57.981  1.00 0.00 ? 6  SER A C    13 
ATOM 7535  O O    . SER A 1 6  ? -28.966 -18.671 56.864  1.00 0.00 ? 6  SER A O    13 
ATOM 7536  C CB   . SER A 1 6  ? -30.157 -19.510 59.952  1.00 0.00 ? 6  SER A CB   13 
ATOM 7537  O OG   . SER A 1 6  ? -30.846 -18.297 59.699  1.00 0.00 ? 6  SER A OG   13 
ATOM 7538  H H    . SER A 1 6  ? -28.992 -21.766 59.855  1.00 0.00 ? 6  SER A H    13 
ATOM 7539  H HA   . SER A 1 6  ? -30.473 -20.344 57.993  1.00 0.00 ? 6  SER A HA   13 
ATOM 7540  H HB2  . SER A 1 6  ? -30.839 -20.213 60.431  1.00 0.00 ? 6  SER A HB2  13 
ATOM 7541  H HB3  . SER A 1 6  ? -29.317 -19.309 60.616  1.00 0.00 ? 6  SER A HB3  13 
ATOM 7542  H HG   . SER A 1 6  ? -31.161 -17.937 60.532  1.00 0.00 ? 6  SER A HG   13 
ATOM 7543  N N    . ALA A 1 7  ? -27.636 -18.770 58.680  1.00 0.00 ? 7  ALA A N    13 
ATOM 7544  C CA   . ALA A 1 7  ? -26.654 -17.815 58.174  1.00 0.00 ? 7  ALA A CA   13 
ATOM 7545  C C    . ALA A 1 7  ? -26.040 -18.318 56.877  1.00 0.00 ? 7  ALA A C    13 
ATOM 7546  O O    . ALA A 1 7  ? -25.839 -17.558 55.931  1.00 0.00 ? 7  ALA A O    13 
ATOM 7547  C CB   . ALA A 1 7  ? -25.539 -17.614 59.188  1.00 0.00 ? 7  ALA A CB   13 
ATOM 7548  H H    . ALA A 1 7  ? -27.484 -19.172 59.594  1.00 0.00 ? 7  ALA A H    13 
ATOM 7549  H HA   . ALA A 1 7  ? -27.153 -16.863 57.993  1.00 0.00 ? 7  ALA A HA   13 
ATOM 7550  H HB1  . ALA A 1 7  ? -24.820 -16.888 58.808  1.00 0.00 ? 7  ALA A HB1  13 
ATOM 7551  H HB2  . ALA A 1 7  ? -25.962 -17.246 60.123  1.00 0.00 ? 7  ALA A HB2  13 
ATOM 7552  H HB3  . ALA A 1 7  ? -25.035 -18.564 59.366  1.00 0.00 ? 7  ALA A HB3  13 
ATOM 7553  N N    . VAL A 1 8  ? -25.746 -19.615 56.846  1.00 0.00 ? 8  VAL A N    13 
ATOM 7554  C CA   . VAL A 1 8  ? -25.152 -20.252 55.674  1.00 0.00 ? 8  VAL A CA   13 
ATOM 7555  C C    . VAL A 1 8  ? -26.099 -20.171 54.488  1.00 0.00 ? 8  VAL A C    13 
ATOM 7556  O O    . VAL A 1 8  ? -25.684 -19.908 53.360  1.00 0.00 ? 8  VAL A O    13 
ATOM 7557  C CB   . VAL A 1 8  ? -24.845 -21.738 55.934  1.00 0.00 ? 8  VAL A CB   13 
ATOM 7558  C CG1  . VAL A 1 8  ? -24.425 -22.429 54.646  1.00 0.00 ? 8  VAL A CG1  13 
ATOM 7559  C CG2  . VAL A 1 8  ? -23.717 -21.880 56.945  1.00 0.00 ? 8  VAL A CG2  13 
ATOM 7560  H H    . VAL A 1 8  ? -25.936 -20.188 57.656  1.00 0.00 ? 8  VAL A H    13 
ATOM 7561  H HA   . VAL A 1 8  ? -24.225 -19.732 55.433  1.00 0.00 ? 8  VAL A HA   13 
ATOM 7562  H HB   . VAL A 1 8  ? -25.742 -22.219 56.325  1.00 0.00 ? 8  VAL A HB   13 
ATOM 7563  H HG11 . VAL A 1 8  ? -24.219 -23.481 54.841  1.00 0.00 ? 8  VAL A HG11 13 
ATOM 7564  H HG12 . VAL A 1 8  ? -25.228 -22.348 53.913  1.00 0.00 ? 8  VAL A HG12 13 
ATOM 7565  H HG13 . VAL A 1 8  ? -23.527 -21.951 54.255  1.00 0.00 ? 8  VAL A HG13 13 
ATOM 7566  H HG21 . VAL A 1 8  ? -23.515 -22.935 57.128  1.00 0.00 ? 8  VAL A HG21 13 
ATOM 7567  H HG22 . VAL A 1 8  ? -22.819 -21.402 56.555  1.00 0.00 ? 8  VAL A HG22 13 
ATOM 7568  H HG23 . VAL A 1 8  ? -24.007 -21.400 57.880  1.00 0.00 ? 8  VAL A HG23 13 
ATOM 7569  N N    . GLU A 1 9  ? -27.381 -20.401 54.758  1.00 0.00 ? 9  GLU A N    13 
ATOM 7570  C CA   . GLU A 1 9  ? -28.415 -20.360 53.728  1.00 0.00 ? 9  GLU A CA   13 
ATOM 7571  C C    . GLU A 1 9  ? -28.419 -19.009 53.031  1.00 0.00 ? 9  GLU A C    13 
ATOM 7572  O O    . GLU A 1 9  ? -28.602 -18.920 51.818  1.00 0.00 ? 9  GLU A O    13 
ATOM 7573  C CB   . GLU A 1 9  ? -29.796 -20.590 54.346  1.00 0.00 ? 9  GLU A CB   13 
ATOM 7574  C CG   . GLU A 1 9  ? -30.929 -20.632 53.333  1.00 0.00 ? 9  GLU A CG   13 
ATOM 7575  C CD   . GLU A 1 9  ? -32.274 -20.912 53.976  1.00 0.00 ? 9  GLU A CD   13 
ATOM 7576  O OE1  . GLU A 1 9  ? -32.319 -21.070 55.214  1.00 0.00 ? 9  GLU A OE1  13 
ATOM 7577  O OE2  . GLU A 1 9  ? -33.282 -20.972 53.241  1.00 0.00 ? 9  GLU A OE2  13 
ATOM 7578  H H    . GLU A 1 9  ? -27.660 -20.611 55.706  1.00 0.00 ? 9  GLU A H    13 
ATOM 7579  H HA   . GLU A 1 9  ? -28.213 -21.143 52.998  1.00 0.00 ? 9  GLU A HA   13 
ATOM 7580  H HB2  . GLU A 1 9  ? -29.779 -21.540 54.880  1.00 0.00 ? 9  GLU A HB2  13 
ATOM 7581  H HB3  . GLU A 1 9  ? -29.996 -19.781 55.050  1.00 0.00 ? 9  GLU A HB3  13 
ATOM 7582  H HG2  . GLU A 1 9  ? -30.979 -19.670 52.822  1.00 0.00 ? 9  GLU A HG2  13 
ATOM 7583  H HG3  . GLU A 1 9  ? -30.720 -21.415 52.604  1.00 0.00 ? 9  GLU A HG3  13 
ATOM 7584  H HE2  . GLU A 1 9  ? -34.099 -21.151 53.713  1.00 0.00 ? 9  GLU A HE2  13 
ATOM 7585  N N    . SER A 1 10 ? -28.215 -17.956 53.817  1.00 0.00 ? 10 SER A N    13 
ATOM 7586  C CA   . SER A 1 10 ? -28.190 -16.591 53.301  1.00 0.00 ? 10 SER A CA   13 
ATOM 7587  C C    . SER A 1 10 ? -26.831 -16.273 52.700  1.00 0.00 ? 10 SER A C    13 
ATOM 7588  O O    . SER A 1 10 ? -26.731 -15.751 51.591  1.00 0.00 ? 10 SER A O    13 
ATOM 7589  C CB   . SER A 1 10 ? -28.468 -15.589 54.423  1.00 0.00 ? 10 SER A CB   13 
ATOM 7590  O OG   . SER A 1 10 ? -29.773 -15.762 54.949  1.00 0.00 ? 10 SER A OG   13 
ATOM 7591  H H    . SER A 1 10 ? -28.071 -18.094 54.807  1.00 0.00 ? 10 SER A H    13 
ATOM 7592  H HA   . SER A 1 10 ? -28.957 -16.493 52.533  1.00 0.00 ? 10 SER A HA   13 
ATOM 7593  H HB2  . SER A 1 10 ? -27.741 -15.736 55.221  1.00 0.00 ? 10 SER A HB2  13 
ATOM 7594  H HB3  . SER A 1 10 ? -28.375 -14.577 54.029  1.00 0.00 ? 10 SER A HB3  13 
ATOM 7595  H HG   . SER A 1 10 ? -29.915 -15.120 55.649  1.00 0.00 ? 10 SER A HG   13 
ATOM 7596  N N    . ALA A 1 11 ? -25.781 -16.597 53.451  1.00 0.00 ? 11 ALA A N    13 
ATOM 7597  C CA   . ALA A 1 11 ? -24.408 -16.358 53.016  1.00 0.00 ? 11 ALA A CA   13 
ATOM 7598  C C    . ALA A 1 11 ? -24.067 -17.231 51.820  1.00 0.00 ? 11 ALA A C    13 
ATOM 7599  O O    . ALA A 1 11 ? -23.386 -16.801 50.891  1.00 0.00 ? 11 ALA A O    13 
ATOM 7600  C CB   . ALA A 1 11 ? -23.433 -16.678 54.139  1.00 0.00 ? 11 ALA A CB   13 
ATOM 7601  H H    . ALA A 1 11 ? -25.928 -17.022 54.355  1.00 0.00 ? 11 ALA A H    13 
ATOM 7602  H HA   . ALA A 1 11 ? -24.307 -15.309 52.738  1.00 0.00 ? 11 ALA A HA   13 
ATOM 7603  H HB1  . ALA A 1 11 ? -22.413 -16.481 53.810  1.00 0.00 ? 11 ALA A HB1  13 
ATOM 7604  H HB2  . ALA A 1 11 ? -23.660 -16.054 55.004  1.00 0.00 ? 11 ALA A HB2  13 
ATOM 7605  H HB3  . ALA A 1 11 ? -23.529 -17.728 54.414  1.00 0.00 ? 11 ALA A HB3  13 
ATOM 7606  N N    . ILE A 1 12 ? -24.552 -18.469 51.856  1.00 0.00 ? 12 ILE A N    13 
ATOM 7607  C CA   . ILE A 1 12 ? -24.315 -19.432 50.785  1.00 0.00 ? 12 ILE A CA   13 
ATOM 7608  C C    . ILE A 1 12 ? -25.022 -18.996 49.512  1.00 0.00 ? 12 ILE A C    13 
ATOM 7609  O O    . ILE A 1 12 ? -24.448 -19.024 48.424  1.00 0.00 ? 12 ILE A O    13 
ATOM 7610  C CB   . ILE A 1 12 ? -24.835 -20.832 51.160  1.00 0.00 ? 12 ILE A CB   13 
ATOM 7611  C CG1  . ILE A 1 12 ? -24.018 -21.413 52.316  1.00 0.00 ? 12 ILE A CG1  13 
ATOM 7612  C CG2  . ILE A 1 12 ? -24.727 -21.776 49.972  1.00 0.00 ? 12 ILE A CG2  13 
ATOM 7613  C CD1  . ILE A 1 12 ? -22.547 -21.579 52.001  1.00 0.00 ? 12 ILE A CD1  13 
ATOM 7614  H H    . ILE A 1 12 ? -25.107 -18.763 52.648  1.00 0.00 ? 12 ILE A H    13 
ATOM 7615  H HA   . ILE A 1 12 ? -23.242 -19.486 50.602  1.00 0.00 ? 12 ILE A HA   13 
ATOM 7616  H HB   . ILE A 1 12 ? -25.880 -20.751 51.462  1.00 0.00 ? 12 ILE A HB   13 
ATOM 7617  H HG12 . ILE A 1 12 ? -24.113 -20.746 53.173  1.00 0.00 ? 12 ILE A HG12 13 
ATOM 7618  H HG13 . ILE A 1 12 ? -24.428 -22.391 52.569  1.00 0.00 ? 12 ILE A HG13 13 
ATOM 7619  H HG21 . ILE A 1 12 ? -25.107 -22.760 50.246  1.00 0.00 ? 12 ILE A HG21 13 
ATOM 7620  H HG22 . ILE A 1 12 ? -25.313 -21.381 49.142  1.00 0.00 ? 12 ILE A HG22 13 
ATOM 7621  H HG23 . ILE A 1 12 ? -23.683 -21.862 49.672  1.00 0.00 ? 12 ILE A HG23 13 
ATOM 7622  H HD11 . ILE A 1 12 ? -22.017 -21.994 52.858  1.00 0.00 ? 12 ILE A HD11 13 
ATOM 7623  H HD12 . ILE A 1 12 ? -22.435 -22.252 51.151  1.00 0.00 ? 12 ILE A HD12 13 
ATOM 7624  H HD13 . ILE A 1 12 ? -22.120 -20.607 51.753  1.00 0.00 ? 12 ILE A HD13 13 
ATOM 7625  N N    . THR A 1 13 ? -26.280 -18.591 49.663  1.00 0.00 ? 13 THR A N    13 
ATOM 7626  C CA   . THR A 1 13 ? -27.095 -18.141 48.538  1.00 0.00 ? 13 THR A CA   13 
ATOM 7627  C C    . THR A 1 13 ? -26.514 -16.874 47.932  1.00 0.00 ? 13 THR A C    13 
ATOM 7628  O O    . THR A 1 13 ? -26.453 -16.722 46.713  1.00 0.00 ? 13 THR A O    13 
ATOM 7629  C CB   . THR A 1 13 ? -28.540 -17.837 48.974  1.00 0.00 ? 13 THR A CB   13 
ATOM 7630  O OG1  . THR A 1 13 ? -29.151 -19.031 49.481  1.00 0.00 ? 13 THR A OG1  13 
ATOM 7631  C CG2  . THR A 1 13 ? -29.357 -17.329 47.796  1.00 0.00 ? 13 THR A CG2  13 
ATOM 7632  H H    . THR A 1 13 ? -26.696 -18.590 50.584  1.00 0.00 ? 13 THR A H    13 
ATOM 7633  H HA   . THR A 1 13 ? -27.108 -18.929 47.785  1.00 0.00 ? 13 THR A HA   13 
ATOM 7634  H HB   . THR A 1 13 ? -28.525 -17.077 49.756  1.00 0.00 ? 13 THR A HB   13 
ATOM 7635  H HG1  . THR A 1 13 ? -30.048 -18.824 49.756  1.00 0.00 ? 13 THR A HG1  13 
ATOM 7636  H HG21 . THR A 1 13 ? -30.377 -17.115 48.118  1.00 0.00 ? 13 THR A HG21 13 
ATOM 7637  H HG22 . THR A 1 13 ? -28.904 -16.417 47.407  1.00 0.00 ? 13 THR A HG22 13 
ATOM 7638  H HG23 . THR A 1 13 ? -29.377 -18.088 47.014  1.00 0.00 ? 13 THR A HG23 13 
ATOM 7639  N N    . ASP A 1 14 ? -26.085 -15.964 48.803  1.00 0.00 ? 14 ASP A N    13 
ATOM 7640  C CA   . ASP A 1 14 ? -25.501 -14.695 48.381  1.00 0.00 ? 14 ASP A CA   13 
ATOM 7641  C C    . ASP A 1 14 ? -24.152 -14.923 47.720  1.00 0.00 ? 14 ASP A C    13 
ATOM 7642  O O    . ASP A 1 14 ? -23.886 -14.423 46.628  1.00 0.00 ? 14 ASP A O    13 
ATOM 7643  C CB   . ASP A 1 14 ? -25.300 -13.771 49.584  1.00 0.00 ? 14 ASP A CB   13 
ATOM 7644  C CG   . ASP A 1 14 ? -26.608 -13.238 50.134  1.00 0.00 ? 14 ASP A CG   13 
ATOM 7645  O OD1  . ASP A 1 14 ? -26.565 -12.367 51.029  1.00 0.00 ? 14 ASP A OD1  13 
ATOM 7646  O OD2  . ASP A 1 14 ? -27.676 -13.690 49.671  1.00 0.00 ? 14 ASP A OD2  13 
ATOM 7647  H H    . ASP A 1 14 ? -26.163 -16.147 49.793  1.00 0.00 ? 14 ASP A H    13 
ATOM 7648  H HA   . ASP A 1 14 ? -26.176 -14.218 47.670  1.00 0.00 ? 14 ASP A HA   13 
ATOM 7649  H HB2  . ASP A 1 14 ? -24.790 -14.325 50.371  1.00 0.00 ? 14 ASP A HB2  13 
ATOM 7650  H HB3  . ASP A 1 14 ? -24.680 -12.928 49.279  1.00 0.00 ? 14 ASP A HB3  13 
ATOM 7651  H HD2  . ASP A 1 14 ? -28.465 -13.308 50.064  1.00 0.00 ? 14 ASP A HD2  13 
ATOM 7652  N N    . GLY A 1 15 ? -23.302 -15.688 48.398  1.00 0.00 ? 15 GLY A N    13 
ATOM 7653  C CA   . GLY A 1 15 ? -21.966 -16.003 47.898  1.00 0.00 ? 15 GLY A CA   13 
ATOM 7654  C C    . GLY A 1 15 ? -22.023 -17.168 46.923  1.00 0.00 ? 15 GLY A C    13 
ATOM 7655  O O    . GLY A 1 15 ? -21.783 -17.009 45.727  1.00 0.00 ? 15 GLY A O    13 
ATOM 7656  H H    . GLY A 1 15 ? -23.580 -16.069 49.291  1.00 0.00 ? 15 GLY A H    13 
ATOM 7657  H HA2  . GLY A 1 15 ? -21.558 -15.129 47.391  1.00 0.00 ? 15 GLY A HA2  13 
ATOM 7658  H HA3  . GLY A 1 15 ? -21.322 -16.267 48.737  1.00 0.00 ? 15 GLY A HA3  13 
ATOM 7659  N N    . GLN A 1 16 ? -22.344 -18.345 47.452  1.00 0.00 ? 16 GLN A N    13 
ATOM 7660  C CA   . GLN A 1 16 ? -22.441 -19.561 46.650  1.00 0.00 ? 16 GLN A CA   13 
ATOM 7661  C C    . GLN A 1 16 ? -23.286 -19.314 45.410  1.00 0.00 ? 16 GLN A C    13 
ATOM 7662  O O    . GLN A 1 16 ? -22.853 -19.562 44.286  1.00 0.00 ? 16 GLN A O    13 
ATOM 7663  C CB   . GLN A 1 16 ? -23.087 -20.687 47.460  1.00 0.00 ? 16 GLN A CB   13 
ATOM 7664  C CG   . GLN A 1 16 ? -23.189 -22.008 46.715  1.00 0.00 ? 16 GLN A CG   13 
ATOM 7665  C CD   . GLN A 1 16 ? -21.832 -22.598 46.387  1.00 0.00 ? 16 GLN A CD   13 
ATOM 7666  O OE1  . GLN A 1 16 ? -21.001 -22.797 47.273  1.00 0.00 ? 16 GLN A OE1  13 
ATOM 7667  N NE2  . GLN A 1 16 ? -21.604 -22.881 45.110  1.00 0.00 ? 16 GLN A NE2  13 
ATOM 7668  H H    . GLN A 1 16 ? -22.529 -18.411 48.443  1.00 0.00 ? 16 GLN A H    13 
ATOM 7669  H HA   . GLN A 1 16 ? -21.438 -19.863 46.350  1.00 0.00 ? 16 GLN A HA   13 
ATOM 7670  H HB2  . GLN A 1 16 ? -22.493 -20.846 48.359  1.00 0.00 ? 16 GLN A HB2  13 
ATOM 7671  H HB3  . GLN A 1 16 ? -24.093 -20.373 47.740  1.00 0.00 ? 16 GLN A HB3  13 
ATOM 7672  H HG2  . GLN A 1 16 ? -23.740 -22.717 47.333  1.00 0.00 ? 16 GLN A HG2  13 
ATOM 7673  H HG3  . GLN A 1 16 ? -23.734 -21.844 45.785  1.00 0.00 ? 16 GLN A HG3  13 
ATOM 7674  H HE21 . GLN A 1 16 ? -22.318 -22.699 44.419  1.00 0.00 ? 16 GLN A HE21 13 
ATOM 7675  H HE22 . GLN A 1 16 ? -20.718 -23.276 44.832  1.00 0.00 ? 16 GLN A HE22 13 
ATOM 7676  N N    . GLY A 1 17 ? -24.501 -18.821 45.632  1.00 0.00 ? 17 GLY A N    13 
ATOM 7677  C CA   . GLY A 1 17 ? -25.434 -18.529 44.547  1.00 0.00 ? 17 GLY A CA   13 
ATOM 7678  C C    . GLY A 1 17 ? -24.764 -17.673 43.485  1.00 0.00 ? 17 GLY A C    13 
ATOM 7679  O O    . GLY A 1 17 ? -24.859 -17.950 42.291  1.00 0.00 ? 17 GLY A O    13 
ATOM 7680  H H    . GLY A 1 17 ? -24.799 -18.638 46.580  1.00 0.00 ? 17 GLY A H    13 
ATOM 7681  H HA2  . GLY A 1 17 ? -25.767 -19.464 44.097  1.00 0.00 ? 17 GLY A HA2  13 
ATOM 7682  H HA3  . GLY A 1 17 ? -26.296 -17.995 44.948  1.00 0.00 ? 17 GLY A HA3  13 
ATOM 7683  N N    . ASP A 1 18 ? -24.084 -16.623 43.938  1.00 0.00 ? 18 ASP A N    13 
ATOM 7684  C CA   . ASP A 1 18 ? -23.384 -15.703 43.046  1.00 0.00 ? 18 ASP A CA   13 
ATOM 7685  C C    . ASP A 1 18 ? -22.401 -16.459 42.167  1.00 0.00 ? 18 ASP A C    13 
ATOM 7686  O O    . ASP A 1 18 ? -21.901 -15.932 41.174  1.00 0.00 ? 18 ASP A O    13 
ATOM 7687  C CB   . ASP A 1 18 ? -22.608 -14.660 43.853  1.00 0.00 ? 18 ASP A CB   13 
ATOM 7688  C CG   . ASP A 1 18 ? -23.518 -13.666 44.547  1.00 0.00 ? 18 ASP A CG   13 
ATOM 7689  O OD1  . ASP A 1 18 ? -23.160 -12.471 44.602  1.00 0.00 ? 18 ASP A OD1  13 
ATOM 7690  O OD2  . ASP A 1 18 ? -24.590 -14.082 45.036  1.00 0.00 ? 18 ASP A OD2  13 
ATOM 7691  H H    . ASP A 1 18 ? -24.045 -16.446 44.932  1.00 0.00 ? 18 ASP A H    13 
ATOM 7692  H HA   . ASP A 1 18 ? -24.118 -15.199 42.417  1.00 0.00 ? 18 ASP A HA   13 
ATOM 7693  H HB2  . ASP A 1 18 ? -22.011 -15.173 44.606  1.00 0.00 ? 18 ASP A HB2  13 
ATOM 7694  H HB3  . ASP A 1 18 ? -21.946 -14.116 43.179  1.00 0.00 ? 18 ASP A HB3  13 
ATOM 7695  H HD2  . ASP A 1 18 ? -25.117 -13.399 45.459  1.00 0.00 ? 18 ASP A HD2  13 
ATOM 7696  N N    . MET A 1 19 ? -22.130 -17.704 42.546  1.00 0.00 ? 19 MET A N    13 
ATOM 7697  C CA   . MET A 1 19 ? -21.206 -18.561 41.809  1.00 0.00 ? 19 MET A CA   13 
ATOM 7698  C C    . MET A 1 19 ? -21.746 -18.854 40.419  1.00 0.00 ? 19 MET A C    13 
ATOM 7699  O O    . MET A 1 19 ? -21.012 -18.830 39.433  1.00 0.00 ? 19 MET A O    13 
ATOM 7700  C CB   . MET A 1 19 ? -21.008 -19.890 42.541  1.00 0.00 ? 19 MET A CB   13 
ATOM 7701  C CG   . MET A 1 19 ? -19.994 -20.814 41.887  1.00 0.00 ? 19 MET A CG   13 
ATOM 7702  S SD   . MET A 1 19 ? -19.780 -22.361 42.787  1.00 0.00 ? 19 MET A SD   13 
ATOM 7703  C CE   . MET A 1 19 ? -18.953 -21.781 44.266  1.00 0.00 ? 19 MET A CE   13 
ATOM 7704  H H    . MET A 1 19 ? -22.573 -18.079 43.372  1.00 0.00 ? 19 MET A H    13 
ATOM 7705  H HA   . MET A 1 19 ? -20.247 -18.050 41.724  1.00 0.00 ? 19 MET A HA   13 
ATOM 7706  H HB2  . MET A 1 19 ? -20.672 -19.675 43.556  1.00 0.00 ? 19 MET A HB2  13 
ATOM 7707  H HB3  . MET A 1 19 ? -21.968 -20.406 42.578  1.00 0.00 ? 19 MET A HB3  13 
ATOM 7708  H HG2  . MET A 1 19 ? -20.326 -21.040 40.874  1.00 0.00 ? 19 MET A HG2  13 
ATOM 7709  H HG3  . MET A 1 19 ? -19.033 -20.302 41.834  1.00 0.00 ? 19 MET A HG3  13 
ATOM 7710  H HE1  . MET A 1 19 ? -18.749 -22.619 44.931  1.00 0.00 ? 19 MET A HE1  13 
ATOM 7711  H HE2  . MET A 1 19 ? -18.014 -21.301 43.991  1.00 0.00 ? 19 MET A HE2  13 
ATOM 7712  H HE3  . MET A 1 19 ? -19.592 -21.061 44.779  1.00 0.00 ? 19 MET A HE3  13 
ATOM 7713  N N    . LYS A 1 20 ? -23.045 -19.132 40.354  1.00 0.00 ? 20 LYS A N    13 
ATOM 7714  C CA   . LYS A 1 20 ? -23.716 -19.436 39.093  1.00 0.00 ? 20 LYS A CA   13 
ATOM 7715  C C    . LYS A 1 20 ? -23.545 -18.288 38.110  1.00 0.00 ? 20 LYS A C    13 
ATOM 7716  O O    . LYS A 1 20 ? -23.303 -18.499 36.923  1.00 0.00 ? 20 LYS A O    13 
ATOM 7717  C CB   . LYS A 1 20 ? -25.212 -19.658 39.322  1.00 0.00 ? 20 LYS A CB   13 
ATOM 7718  C CG   . LYS A 1 20 ? -25.982 -20.043 38.069  1.00 0.00 ? 20 LYS A CG   13 
ATOM 7719  C CD   . LYS A 1 20 ? -27.447 -20.303 38.379  1.00 0.00 ? 20 LYS A CD   13 
ATOM 7720  C CE   . LYS A 1 20 ? -28.220 -20.673 37.123  1.00 0.00 ? 20 LYS A CE   13 
ATOM 7721  N NZ   . LYS A 1 20 ? -29.655 -20.942 37.413  1.00 0.00 ? 20 LYS A NZ   13 
ATOM 7722  H H    . LYS A 1 20 ? -23.597 -19.135 41.200  1.00 0.00 ? 20 LYS A H    13 
ATOM 7723  H HA   . LYS A 1 20 ? -23.278 -20.341 38.672  1.00 0.00 ? 20 LYS A HA   13 
ATOM 7724  H HB2  . LYS A 1 20 ? -25.332 -20.455 40.055  1.00 0.00 ? 20 LYS A HB2  13 
ATOM 7725  H HB3  . LYS A 1 20 ? -25.639 -18.735 39.716  1.00 0.00 ? 20 LYS A HB3  13 
ATOM 7726  H HG2  . LYS A 1 20 ? -25.911 -19.231 37.345  1.00 0.00 ? 20 LYS A HG2  13 
ATOM 7727  H HG3  . LYS A 1 20 ? -25.543 -20.946 37.646  1.00 0.00 ? 20 LYS A HG3  13 
ATOM 7728  H HD2  . LYS A 1 20 ? -27.519 -21.122 39.095  1.00 0.00 ? 20 LYS A HD2  13 
ATOM 7729  H HD3  . LYS A 1 20 ? -27.884 -19.403 38.812  1.00 0.00 ? 20 LYS A HD3  13 
ATOM 7730  H HE2  . LYS A 1 20 ? -28.152 -19.851 36.411  1.00 0.00 ? 20 LYS A HE2  13 
ATOM 7731  H HE3  . LYS A 1 20 ? -27.775 -21.565 36.684  1.00 0.00 ? 20 LYS A HE3  13 
ATOM 7732  H HZ1  . LYS A 1 20 ? -30.137 -21.183 36.559  1.00 0.00 ? 20 LYS A HZ1  13 
ATOM 7733  H HZ2  . LYS A 1 20 ? -29.728 -21.708 38.067  1.00 0.00 ? 20 LYS A HZ2  13 
ATOM 7734  H HZ3  . LYS A 1 20 ? -30.078 -20.116 37.813  1.00 0.00 ? 20 LYS A HZ3  13 
ATOM 7735  N N    . ALA A 1 21 ? -23.676 -17.068 38.623  1.00 0.00 ? 21 ALA A N    13 
ATOM 7736  C CA   . ALA A 1 21 ? -23.541 -15.862 37.811  1.00 0.00 ? 21 ALA A CA   13 
ATOM 7737  C C    . ALA A 1 21 ? -22.102 -15.687 37.353  1.00 0.00 ? 21 ALA A C    13 
ATOM 7738  O O    . ALA A 1 21 ? -21.839 -15.327 36.207  1.00 0.00 ? 21 ALA A O    13 
ATOM 7739  C CB   . ALA A 1 21 ? -23.944 -14.635 38.614  1.00 0.00 ? 21 ALA A CB   13 
ATOM 7740  H H    . ALA A 1 21 ? -23.877 -16.960 39.607  1.00 0.00 ? 21 ALA A H    13 
ATOM 7741  H HA   . ALA A 1 21 ? -24.190 -15.952 36.940  1.00 0.00 ? 21 ALA A HA   13 
ATOM 7742  H HB1  . ALA A 1 21 ? -23.854 -13.742 37.995  1.00 0.00 ? 21 ALA A HB1  13 
ATOM 7743  H HB2  . ALA A 1 21 ? -24.977 -14.742 38.945  1.00 0.00 ? 21 ALA A HB2  13 
ATOM 7744  H HB3  . ALA A 1 21 ? -23.293 -14.540 39.482  1.00 0.00 ? 21 ALA A HB3  13 
ATOM 7745  N N    . ILE A 1 22 ? -21.172 -15.948 38.268  1.00 0.00 ? 22 ILE A N    13 
ATOM 7746  C CA   . ILE A 1 22 ? -19.744 -15.826 37.985  1.00 0.00 ? 22 ILE A CA   13 
ATOM 7747  C C    . ILE A 1 22 ? -19.325 -16.830 36.923  1.00 0.00 ? 22 ILE A C    13 
ATOM 7748  O O    . ILE A 1 22 ? -18.662 -16.483 35.947  1.00 0.00 ? 22 ILE A O    13 
ATOM 7749  C CB   . ILE A 1 22 ? -18.895 -16.085 39.243  1.00 0.00 ? 22 ILE A CB   13 
ATOM 7750  C CG1  . ILE A 1 22 ? -19.113 -14.974 40.272  1.00 0.00 ? 22 ILE A CG1  13 
ATOM 7751  C CG2  . ILE A 1 22 ? -17.417 -16.131 38.889  1.00 0.00 ? 22 ILE A CG2  13 
ATOM 7752  C CD1  . ILE A 1 22 ? -18.513 -15.271 41.629  1.00 0.00 ? 22 ILE A CD1  13 
ATOM 7753  H H    . ILE A 1 22 ? -21.452 -16.242 39.193  1.00 0.00 ? 22 ILE A H    13 
ATOM 7754  H HA   . ILE A 1 22 ? -19.550 -14.815 37.625  1.00 0.00 ? 22 ILE A HA   13 
ATOM 7755  H HB   . ILE A 1 22 ? -19.191 -17.040 39.677  1.00 0.00 ? 22 ILE A HB   13 
ATOM 7756  H HG12 . ILE A 1 22 ? -18.662 -14.058 39.890  1.00 0.00 ? 22 ILE A HG12 13 
ATOM 7757  H HG13 . ILE A 1 22 ? -20.186 -14.826 40.396  1.00 0.00 ? 22 ILE A HG13 13 
ATOM 7758  H HG21 . ILE A 1 22 ? -16.828 -16.325 39.785  1.00 0.00 ? 22 ILE A HG21 13 
ATOM 7759  H HG22 . ILE A 1 22 ? -17.244 -16.925 38.164  1.00 0.00 ? 22 ILE A HG22 13 
ATOM 7760  H HG23 . ILE A 1 22 ? -17.118 -15.175 38.460  1.00 0.00 ? 22 ILE A HG23 13 
ATOM 7761  H HD11 . ILE A 1 22 ? -18.698 -14.446 42.318  1.00 0.00 ? 22 ILE A HD11 13 
ATOM 7762  H HD12 . ILE A 1 22 ? -18.963 -16.179 42.030  1.00 0.00 ? 22 ILE A HD12 13 
ATOM 7763  H HD13 . ILE A 1 22 ? -17.438 -15.413 41.524  1.00 0.00 ? 22 ILE A HD13 13 
ATOM 7764  N N    . GLY A 1 23 ? -19.722 -18.082 37.127  1.00 0.00 ? 23 GLY A N    13 
ATOM 7765  C CA   . GLY A 1 23 ? -19.401 -19.164 36.199  1.00 0.00 ? 23 GLY A CA   13 
ATOM 7766  C C    . GLY A 1 23 ? -20.104 -18.949 34.868  1.00 0.00 ? 23 GLY A C    13 
ATOM 7767  O O    . GLY A 1 23 ? -19.513 -19.114 33.802  1.00 0.00 ? 23 GLY A O    13 
ATOM 7768  H H    . GLY A 1 23 ? -20.265 -18.304 37.949  1.00 0.00 ? 23 GLY A H    13 
ATOM 7769  H HA2  . GLY A 1 23 ? -18.324 -19.190 36.036  1.00 0.00 ? 23 GLY A HA2  13 
ATOM 7770  H HA3  . GLY A 1 23 ? -19.725 -20.112 36.627  1.00 0.00 ? 23 GLY A HA3  13 
ATOM 7771  N N    . GLY A 1 24 ? -21.378 -18.576 34.945  1.00 0.00 ? 24 GLY A N    13 
ATOM 7772  C CA   . GLY A 1 24 ? -22.192 -18.331 33.758  1.00 0.00 ? 24 GLY A CA   13 
ATOM 7773  C C    . GLY A 1 24 ? -21.697 -17.097 33.019  1.00 0.00 ? 24 GLY A C    13 
ATOM 7774  O O    . GLY A 1 24 ? -21.403 -17.146 31.826  1.00 0.00 ? 24 GLY A O    13 
ATOM 7775  H H    . GLY A 1 24 ? -21.808 -18.455 35.851  1.00 0.00 ? 24 GLY A H    13 
ATOM 7776  H HA2  . GLY A 1 24 ? -22.132 -19.194 33.096  1.00 0.00 ? 24 GLY A HA2  13 
ATOM 7777  H HA3  . GLY A 1 24 ? -23.229 -18.178 34.058  1.00 0.00 ? 24 GLY A HA3  13 
ATOM 7778  N N    . TYR A 1 25 ? -21.609 -15.988 33.747  1.00 0.00 ? 25 TYR A N    13 
ATOM 7779  C CA   . TYR A 1 25 ? -21.151 -14.721 33.185  1.00 0.00 ? 25 TYR A CA   13 
ATOM 7780  C C    . TYR A 1 25 ? -19.777 -14.883 32.556  1.00 0.00 ? 25 TYR A C    13 
ATOM 7781  O O    . TYR A 1 25 ? -19.493 -14.325 31.497  1.00 0.00 ? 25 TYR A O    13 
ATOM 7782  C CB   . TYR A 1 25 ? -21.060 -13.652 34.276  1.00 0.00 ? 25 TYR A CB   13 
ATOM 7783  C CG   . TYR A 1 25 ? -20.578 -12.309 33.779  1.00 0.00 ? 25 TYR A CG   13 
ATOM 7784  C CD1  . TYR A 1 25 ? -21.433 -11.454 33.095  1.00 0.00 ? 25 TYR A CD1  13 
ATOM 7785  C CD2  . TYR A 1 25 ? -19.268 -11.898 33.995  1.00 0.00 ? 25 TYR A CD2  13 
ATOM 7786  C CE1  . TYR A 1 25 ? -21.001 -10.224 32.637  1.00 0.00 ? 25 TYR A CE1  13 
ATOM 7787  C CE2  . TYR A 1 25 ? -18.819 -10.672 33.545  1.00 0.00 ? 25 TYR A CE2  13 
ATOM 7788  C CZ   . TYR A 1 25 ? -19.698 -9.834  32.861  1.00 0.00 ? 25 TYR A CZ   13 
ATOM 7789  O OH   . TYR A 1 25 ? -19.266 -8.610  32.405  1.00 0.00 ? 25 TYR A OH   13 
ATOM 7790  H H    . TYR A 1 25 ? -21.867 -16.011 34.723  1.00 0.00 ? 25 TYR A H    13 
ATOM 7791  H HA   . TYR A 1 25 ? -21.862 -14.399 32.424  1.00 0.00 ? 25 TYR A HA   13 
ATOM 7792  H HB2  . TYR A 1 25 ? -22.048 -13.523 34.718  1.00 0.00 ? 25 TYR A HB2  13 
ATOM 7793  H HB3  . TYR A 1 25 ? -20.375 -14.001 35.048  1.00 0.00 ? 25 TYR A HB3  13 
ATOM 7794  H HD1  . TYR A 1 25 ? -22.455 -11.756 32.918  1.00 0.00 ? 25 TYR A HD1  13 
ATOM 7795  H HD2  . TYR A 1 25 ? -18.589 -12.549 34.525  1.00 0.00 ? 25 TYR A HD2  13 
ATOM 7796  H HE1  . TYR A 1 25 ? -21.680 -9.572  32.107  1.00 0.00 ? 25 TYR A HE1  13 
ATOM 7797  H HE2  . TYR A 1 25 ? -17.799 -10.366 33.721  1.00 0.00 ? 25 TYR A HE2  13 
ATOM 7798  H HH   . TYR A 1 25 ? -18.345 -8.435  32.612  1.00 0.00 ? 25 TYR A HH   13 
ATOM 7799  N N    . ILE A 1 26 ? -18.927 -15.657 33.224  1.00 0.00 ? 26 ILE A N    13 
ATOM 7800  C CA   . ILE A 1 26 ? -17.569 -15.913 32.752  1.00 0.00 ? 26 ILE A CA   13 
ATOM 7801  C C    . ILE A 1 26 ? -17.587 -16.883 31.582  1.00 0.00 ? 26 ILE A C    13 
ATOM 7802  O O    . ILE A 1 26 ? -16.910 -16.679 30.576  1.00 0.00 ? 26 ILE A O    13 
ATOM 7803  C CB   . ILE A 1 26 ? -16.692 -16.524 33.861  1.00 0.00 ? 26 ILE A CB   13 
ATOM 7804  C CG1  . ILE A 1 26 ? -16.468 -15.509 34.983  1.00 0.00 ? 26 ILE A CG1  13 
ATOM 7805  C CG2  . ILE A 1 26 ? -15.337 -16.933 33.303  1.00 0.00 ? 26 ILE A CG2  13 
ATOM 7806  C CD1  . ILE A 1 26 ? -15.828 -16.099 36.221  1.00 0.00 ? 26 ILE A CD1  13 
ATOM 7807  H H    . ILE A 1 26 ? -19.221 -16.088 34.089  1.00 0.00 ? 26 ILE A H    13 
ATOM 7808  H HA   . ILE A 1 26 ? -17.132 -14.967 32.431  1.00 0.00 ? 26 ILE A HA   13 
ATOM 7809  H HB   . ILE A 1 26 ? -17.195 -17.402 34.265  1.00 0.00 ? 26 ILE A HB   13 
ATOM 7810  H HG12 . ILE A 1 26 ? -15.822 -14.716 34.606  1.00 0.00 ? 26 ILE A HG12 13 
ATOM 7811  H HG13 . ILE A 1 26 ? -17.434 -15.087 35.263  1.00 0.00 ? 26 ILE A HG13 13 
ATOM 7812  H HG21 . ILE A 1 26 ? -14.730 -17.372 34.094  1.00 0.00 ? 26 ILE A HG21 13 
ATOM 7813  H HG22 . ILE A 1 26 ? -15.479 -17.664 32.508  1.00 0.00 ? 26 ILE A HG22 13 
ATOM 7814  H HG23 . ILE A 1 26 ? -14.830 -16.055 32.903  1.00 0.00 ? 26 ILE A HG23 13 
ATOM 7815  H HD11 . ILE A 1 26 ? -15.692 -15.332 36.984  1.00 0.00 ? 26 ILE A HD11 13 
ATOM 7816  H HD12 . ILE A 1 26 ? -16.469 -16.886 36.617  1.00 0.00 ? 26 ILE A HD12 13 
ATOM 7817  H HD13 . ILE A 1 26 ? -14.857 -16.518 35.959  1.00 0.00 ? 26 ILE A HD13 13 
ATOM 7818  N N    . VAL A 1 27 ? -18.373 -17.945 31.728  1.00 0.00 ? 27 VAL A N    13 
ATOM 7819  C CA   . VAL A 1 27 ? -18.501 -18.970 30.695  1.00 0.00 ? 27 VAL A CA   13 
ATOM 7820  C C    . VAL A 1 27 ? -19.354 -18.462 29.544  1.00 0.00 ? 27 VAL A C    13 
ATOM 7821  O O    . VAL A 1 27 ? -19.164 -18.848 28.392  1.00 0.00 ? 27 VAL A O    13 
ATOM 7822  C CB   . VAL A 1 27 ? -19.162 -20.247 31.246  1.00 0.00 ? 27 VAL A CB   13 
ATOM 7823  C CG1  . VAL A 1 27 ? -19.450 -21.227 30.119  1.00 0.00 ? 27 VAL A CG1  13 
ATOM 7824  C CG2  . VAL A 1 27 ? -18.247 -20.928 32.253  1.00 0.00 ? 27 VAL A CG2  13 
ATOM 7825  H H    . VAL A 1 27 ? -18.905 -18.057 32.579  1.00 0.00 ? 27 VAL A H    13 
ATOM 7826  H HA   . VAL A 1 27 ? -17.505 -19.213 30.327  1.00 0.00 ? 27 VAL A HA   13 
ATOM 7827  H HB   . VAL A 1 27 ? -20.098 -19.976 31.736  1.00 0.00 ? 27 VAL A HB   13 
ATOM 7828  H HG11 . VAL A 1 27 ? -19.925 -22.122 30.520  1.00 0.00 ? 27 VAL A HG11 13 
ATOM 7829  H HG12 . VAL A 1 27 ? -20.116 -20.759 29.393  1.00 0.00 ? 27 VAL A HG12 13 
ATOM 7830  H HG13 . VAL A 1 27 ? -18.516 -21.502 29.630  1.00 0.00 ? 27 VAL A HG13 13 
ATOM 7831  H HG21 . VAL A 1 27 ? -18.729 -21.825 32.643  1.00 0.00 ? 27 VAL A HG21 13 
ATOM 7832  H HG22 . VAL A 1 27 ? -17.312 -21.202 31.765  1.00 0.00 ? 27 VAL A HG22 13 
ATOM 7833  H HG23 . VAL A 1 27 ? -18.040 -20.243 33.075  1.00 0.00 ? 27 VAL A HG23 13 
ATOM 7834  N N    . GLY A 1 28 ? -20.300 -17.586 29.872  1.00 0.00 ? 28 GLY A N    13 
ATOM 7835  C CA   . GLY A 1 28 ? -21.203 -17.006 28.883  1.00 0.00 ? 28 GLY A CA   13 
ATOM 7836  C C    . GLY A 1 28 ? -20.480 -15.955 28.055  1.00 0.00 ? 28 GLY A C    13 
ATOM 7837  O O    . GLY A 1 28 ? -20.871 -15.653 26.929  1.00 0.00 ? 28 GLY A O    13 
ATOM 7838  H H    . GLY A 1 28 ? -20.406 -17.305 30.837  1.00 0.00 ? 28 GLY A H    13 
ATOM 7839  H HA2  . GLY A 1 28 ? -21.569 -17.793 28.224  1.00 0.00 ? 28 GLY A HA2  13 
ATOM 7840  H HA3  . GLY A 1 28 ? -22.047 -16.542 29.394  1.00 0.00 ? 28 GLY A HA3  13 
ATOM 7841  N N    . ALA A 1 29 ? -19.416 -15.402 28.631  1.00 0.00 ? 29 ALA A N    13 
ATOM 7842  C CA   . ALA A 1 29 ? -18.615 -14.377 27.969  1.00 0.00 ? 29 ALA A CA   13 
ATOM 7843  C C    . ALA A 1 29 ? -17.573 -15.018 27.064  1.00 0.00 ? 29 ALA A C    13 
ATOM 7844  O O    . ALA A 1 29 ? -17.221 -14.478 26.017  1.00 0.00 ? 29 ALA A O    13 
ATOM 7845  C CB   . ALA A 1 29 ? -17.897 -13.518 28.999  1.00 0.00 ? 29 ALA A CB   13 
ATOM 7846  H H    . ALA A 1 29 ? -19.145 -15.693 29.559  1.00 0.00 ? 29 ALA A H    13 
ATOM 7847  H HA   . ALA A 1 29 ? -19.276 -13.748 27.372  1.00 0.00 ? 29 ALA A HA   13 
ATOM 7848  H HB1  . ALA A 1 29 ? -17.314 -12.747 28.495  1.00 0.00 ? 29 ALA A HB1  13 
ATOM 7849  H HB2  . ALA A 1 29 ? -18.632 -13.046 29.653  1.00 0.00 ? 29 ALA A HB2  13 
ATOM 7850  H HB3  . ALA A 1 29 ? -17.232 -14.144 29.593  1.00 0.00 ? 29 ALA A HB3  13 
ATOM 7851  N N    . LEU A 1 30 ? -17.086 -16.181 27.485  1.00 0.00 ? 30 LEU A N    13 
ATOM 7852  C CA   . LEU A 1 30 ? -16.080 -16.924 26.730  1.00 0.00 ? 30 LEU A CA   13 
ATOM 7853  C C    . LEU A 1 30 ? -16.562 -17.182 25.312  1.00 0.00 ? 30 LEU A C    13 
ATOM 7854  O O    . LEU A 1 30 ? -15.769 -17.258 24.375  1.00 0.00 ? 30 LEU A O    13 
ATOM 7855  C CB   . LEU A 1 30 ? -15.796 -18.271 27.397  1.00 0.00 ? 30 LEU A CB   13 
ATOM 7856  C CG   . LEU A 1 30 ? -15.048 -18.224 28.730  1.00 0.00 ? 30 LEU A CG   13 
ATOM 7857  C CD1  . LEU A 1 30 ? -14.947 -19.613 29.341  1.00 0.00 ? 30 LEU A CD1  13 
ATOM 7858  C CD2  . LEU A 1 30 ? -13.638 -17.686 28.536  1.00 0.00 ? 30 LEU A CD2  13 
ATOM 7859  H H    . LEU A 1 30 ? -17.416 -16.573 28.355  1.00 0.00 ? 30 LEU A H    13 
ATOM 7860  H HA   . LEU A 1 30 ? -15.163 -16.337 26.699  1.00 0.00 ? 30 LEU A HA   13 
ATOM 7861  H HB2  . LEU A 1 30 ? -16.753 -18.763 27.571  1.00 0.00 ? 30 LEU A HB2  13 
ATOM 7862  H HB3  . LEU A 1 30 ? -15.202 -18.865 26.704  1.00 0.00 ? 30 LEU A HB3  13 
ATOM 7863  H HG   . LEU A 1 30 ? -15.591 -17.570 29.413  1.00 0.00 ? 30 LEU A HG   13 
ATOM 7864  H HD11 . LEU A 1 30 ? -14.422 -19.563 30.295  1.00 0.00 ? 30 LEU A HD11 13 
ATOM 7865  H HD12 . LEU A 1 30 ? -15.949 -20.010 29.503  1.00 0.00 ? 30 LEU A HD12 13 
ATOM 7866  H HD13 . LEU A 1 30 ? -14.401 -20.268 28.662  1.00 0.00 ? 30 LEU A HD13 13 
ATOM 7867  H HD21 . LEU A 1 30 ? -13.120 -17.646 29.494  1.00 0.00 ? 30 LEU A HD21 13 
ATOM 7868  H HD22 . LEU A 1 30 ? -13.091 -18.340 27.858  1.00 0.00 ? 30 LEU A HD22 13 
ATOM 7869  H HD23 . LEU A 1 30 ? -13.689 -16.683 28.112  1.00 0.00 ? 30 LEU A HD23 13 
ATOM 7870  N N    . VAL A 1 31 ? -17.877 -17.316 25.167  1.00 0.00 ? 31 VAL A N    13 
ATOM 7871  C CA   . VAL A 1 31 ? -18.498 -17.568 23.869  1.00 0.00 ? 31 VAL A CA   13 
ATOM 7872  C C    . VAL A 1 31 ? -18.085 -16.502 22.867  1.00 0.00 ? 31 VAL A C    13 
ATOM 7873  O O    . VAL A 1 31 ? -17.912 -16.778 21.681  1.00 0.00 ? 31 VAL A O    13 
ATOM 7874  C CB   . VAL A 1 31 ? -20.035 -17.557 23.967  1.00 0.00 ? 31 VAL A CB   13 
ATOM 7875  C CG1  . VAL A 1 31 ? -20.657 -17.611 22.580  1.00 0.00 ? 31 VAL A CG1  13 
ATOM 7876  C CG2  . VAL A 1 31 ? -20.527 -18.756 24.762  1.00 0.00 ? 31 VAL A CG2  13 
ATOM 7877  H H    . VAL A 1 31 ? -18.477 -17.242 25.976  1.00 0.00 ? 31 VAL A H    13 
ATOM 7878  H HA   . VAL A 1 31 ? -18.170 -18.544 23.514  1.00 0.00 ? 31 VAL A HA   13 
ATOM 7879  H HB   . VAL A 1 31 ? -20.350 -16.640 24.467  1.00 0.00 ? 31 VAL A HB   13 
ATOM 7880  H HG11 . VAL A 1 31 ? -21.744 -17.593 22.661  1.00 0.00 ? 31 VAL A HG11 13 
ATOM 7881  H HG12 . VAL A 1 31 ? -20.325 -16.750 22.000  1.00 0.00 ? 31 VAL A HG12 13 
ATOM 7882  H HG13 . VAL A 1 31 ? -20.347 -18.528 22.079  1.00 0.00 ? 31 VAL A HG13 13 
ATOM 7883  H HG21 . VAL A 1 31 ? -21.615 -18.732 24.832  1.00 0.00 ? 31 VAL A HG21 13 
ATOM 7884  H HG22 . VAL A 1 31 ? -20.217 -19.673 24.263  1.00 0.00 ? 31 VAL A HG22 13 
ATOM 7885  H HG23 . VAL A 1 31 ? -20.100 -18.725 25.765  1.00 0.00 ? 31 VAL A HG23 13 
ATOM 7886  N N    . ILE A 1 32 ? -17.929 -15.278 23.361  1.00 0.00 ? 32 ILE A N    13 
ATOM 7887  C CA   . ILE A 1 32 ? -17.536 -14.144 22.528  1.00 0.00 ? 32 ILE A CA   13 
ATOM 7888  C C    . ILE A 1 32 ? -16.128 -14.343 21.990  1.00 0.00 ? 32 ILE A C    13 
ATOM 7889  O O    . ILE A 1 32 ? -15.849 -14.072 20.823  1.00 0.00 ? 32 ILE A O    13 
ATOM 7890  C CB   . ILE A 1 32 ? -17.558 -12.825 23.323  1.00 0.00 ? 32 ILE A CB   13 
ATOM 7891  C CG1  . ILE A 1 32 ? -18.991 -12.464 23.718  1.00 0.00 ? 32 ILE A CG1  13 
ATOM 7892  C CG2  . ILE A 1 32 ? -16.987 -11.690 22.487  1.00 0.00 ? 32 ILE A CG2  13 
ATOM 7893  C CD1  . ILE A 1 32 ? -19.083 -11.322 24.706  1.00 0.00 ? 32 ILE A CD1  13 
ATOM 7894  H H    . ILE A 1 32 ? -18.084 -15.115 24.346  1.00 0.00 ? 32 ILE A H    13 
ATOM 7895  H HA   . ILE A 1 32 ? -18.235 -14.070 21.695  1.00 0.00 ? 32 ILE A HA   13 
ATOM 7896  H HB   . ILE A 1 32 ? -16.957 -12.946 24.224  1.00 0.00 ? 32 ILE A HB   13 
ATOM 7897  H HG12 . ILE A 1 32 ? -19.536 -12.183 22.817  1.00 0.00 ? 32 ILE A HG12 13 
ATOM 7898  H HG13 . ILE A 1 32 ? -19.457 -13.342 24.165  1.00 0.00 ? 32 ILE A HG13 13 
ATOM 7899  H HG21 . ILE A 1 32 ? -16.999 -10.764 23.063  1.00 0.00 ? 32 ILE A HG21 13 
ATOM 7900  H HG22 . ILE A 1 32 ? -15.962 -11.928 22.206  1.00 0.00 ? 32 ILE A HG22 13 
ATOM 7901  H HG23 . ILE A 1 32 ? -17.590 -11.563 21.588  1.00 0.00 ? 32 ILE A HG23 13 
ATOM 7902  H HD11 . ILE A 1 32 ? -20.124 -11.109 24.949  1.00 0.00 ? 32 ILE A HD11 13 
ATOM 7903  H HD12 . ILE A 1 32 ? -18.552 -11.591 25.619  1.00 0.00 ? 32 ILE A HD12 13 
ATOM 7904  H HD13 . ILE A 1 32 ? -18.629 -10.431 24.271  1.00 0.00 ? 32 ILE A HD13 13 
ATOM 7905  N N    . LEU A 1 33 ? -15.243 -14.820 22.860  1.00 0.00 ? 33 LEU A N    13 
ATOM 7906  C CA   . LEU A 1 33 ? -13.849 -15.066 22.499  1.00 0.00 ? 33 LEU A CA   13 
ATOM 7907  C C    . LEU A 1 33 ? -13.761 -16.121 21.408  1.00 0.00 ? 33 LEU A C    13 
ATOM 7908  O O    . LEU A 1 33 ? -13.066 -15.945 20.408  1.00 0.00 ? 33 LEU A O    13 
ATOM 7909  C CB   . LEU A 1 33 ? -13.060 -15.559 23.714  1.00 0.00 ? 33 LEU A CB   13 
ATOM 7910  C CG   . LEU A 1 33 ? -12.771 -14.522 24.801  1.00 0.00 ? 33 LEU A CG   13 
ATOM 7911  C CD1  . LEU A 1 33 ? -12.097 -15.172 25.999  1.00 0.00 ? 33 LEU A CD1  13 
ATOM 7912  C CD2  . LEU A 1 33 ? -11.853 -13.430 24.273  1.00 0.00 ? 33 LEU A CD2  13 
ATOM 7913  H H    . LEU A 1 33 ? -15.534 -15.022 23.806  1.00 0.00 ? 33 LEU A H    13 
ATOM 7914  H HA   . LEU A 1 33 ? -13.412 -14.135 22.139  1.00 0.00 ? 33 LEU A HA   13 
ATOM 7915  H HB2  . LEU A 1 33 ? -13.627 -16.370 24.171  1.00 0.00 ? 33 LEU A HB2  13 
ATOM 7916  H HB3  . LEU A 1 33 ? -12.104 -15.940 23.356  1.00 0.00 ? 33 LEU A HB3  13 
ATOM 7917  H HG   . LEU A 1 33 ? -13.714 -14.075 25.118  1.00 0.00 ? 33 LEU A HG   13 
ATOM 7918  H HD11 . LEU A 1 33 ? -11.907 -14.425 26.770  1.00 0.00 ? 33 LEU A HD11 13 
ATOM 7919  H HD12 . LEU A 1 33 ? -12.747 -15.948 26.403  1.00 0.00 ? 33 LEU A HD12 13 
ATOM 7920  H HD13 . LEU A 1 33 ? -11.152 -15.615 25.686  1.00 0.00 ? 33 LEU A HD13 13 
ATOM 7921  H HD21 . LEU A 1 33 ? -11.665 -12.692 25.053  1.00 0.00 ? 33 LEU A HD21 13 
ATOM 7922  H HD22 . LEU A 1 33 ? -10.908 -13.872 23.960  1.00 0.00 ? 33 LEU A HD22 13 
ATOM 7923  H HD23 . LEU A 1 33 ? -12.326 -12.940 23.421  1.00 0.00 ? 33 LEU A HD23 13 
ATOM 7924  N N    . ALA A 1 34 ? -14.477 -17.222 21.614  1.00 0.00 ? 34 ALA A N    13 
ATOM 7925  C CA   . ALA A 1 34 ? -14.498 -18.329 20.660  1.00 0.00 ? 34 ALA A CA   13 
ATOM 7926  C C    . ALA A 1 34 ? -14.997 -17.853 19.305  1.00 0.00 ? 34 ALA A C    13 
ATOM 7927  O O    . ALA A 1 34 ? -14.471 -18.239 18.262  1.00 0.00 ? 34 ALA A O    13 
ATOM 7928  C CB   . ALA A 1 34 ? -15.418 -19.435 21.152  1.00 0.00 ? 34 ALA A CB   13 
ATOM 7929  H H    . ALA A 1 34 ? -15.029 -17.307 22.456  1.00 0.00 ? 34 ALA A H    13 
ATOM 7930  H HA   . ALA A 1 34 ? -13.487 -18.720 20.556  1.00 0.00 ? 34 ALA A HA   13 
ATOM 7931  H HB1  . ALA A 1 34 ? -15.416 -20.261 20.441  1.00 0.00 ? 34 ALA A HB1  13 
ATOM 7932  H HB2  . ALA A 1 34 ? -15.070 -19.791 22.122  1.00 0.00 ? 34 ALA A HB2  13 
ATOM 7933  H HB3  . ALA A 1 34 ? -16.432 -19.046 21.251  1.00 0.00 ? 34 ALA A HB3  13 
ATOM 7934  N N    . VAL A 1 35 ? -16.022 -17.007 19.334  1.00 0.00 ? 35 VAL A N    13 
ATOM 7935  C CA   . VAL A 1 35 ? -16.616 -16.459 18.118  1.00 0.00 ? 35 VAL A CA   13 
ATOM 7936  C C    . VAL A 1 35 ? -15.560 -15.762 17.277  1.00 0.00 ? 35 VAL A C    13 
ATOM 7937  O O    . VAL A 1 35 ? -15.512 -15.919 16.058  1.00 0.00 ? 35 VAL A O    13 
ATOM 7938  C CB   . VAL A 1 35 ? -17.717 -15.432 18.441  1.00 0.00 ? 35 VAL A CB   13 
ATOM 7939  C CG1  . VAL A 1 35 ? -18.174 -14.725 17.174  1.00 0.00 ? 35 VAL A CG1  13 
ATOM 7940  C CG2  . VAL A 1 35 ? -18.920 -16.121 19.067  1.00 0.00 ? 35 VAL A CG2  13 
ATOM 7941  H H    . VAL A 1 35 ? -16.412 -16.727 20.223  1.00 0.00 ? 35 VAL A H    13 
ATOM 7942  H HA   . VAL A 1 35 ? -17.050 -17.279 17.547  1.00 0.00 ? 35 VAL A HA   13 
ATOM 7943  H HB   . VAL A 1 35 ? -17.320 -14.696 19.140  1.00 0.00 ? 35 VAL A HB   13 
ATOM 7944  H HG11 . VAL A 1 35 ? -18.947 -13.995 17.416  1.00 0.00 ? 35 VAL A HG11 13 
ATOM 7945  H HG12 . VAL A 1 35 ? -17.326 -14.214 16.718  1.00 0.00 ? 35 VAL A HG12 13 
ATOM 7946  H HG13 . VAL A 1 35 ? -18.576 -15.458 16.475  1.00 0.00 ? 35 VAL A HG13 13 
ATOM 7947  H HG21 . VAL A 1 35 ? -19.689 -15.384 19.299  1.00 0.00 ? 35 VAL A HG21 13 
ATOM 7948  H HG22 . VAL A 1 35 ? -19.322 -16.854 18.368  1.00 0.00 ? 35 VAL A HG22 13 
ATOM 7949  H HG23 . VAL A 1 35 ? -18.613 -16.623 19.984  1.00 0.00 ? 35 VAL A HG23 13 
ATOM 7950  N N    . ALA A 1 36 ? -14.711 -14.988 17.947  1.00 0.00 ? 36 ALA A N    13 
ATOM 7951  C CA   . ALA A 1 36 ? -13.639 -14.250 17.285  1.00 0.00 ? 36 ALA A CA   13 
ATOM 7952  C C    . ALA A 1 36 ? -12.633 -15.210 16.671  1.00 0.00 ? 36 ALA A C    13 
ATOM 7953  O O    . ALA A 1 36 ? -12.220 -15.050 15.523  1.00 0.00 ? 36 ALA A O    13 
ATOM 7954  C CB   . ALA A 1 36 ? -12.912 -13.362 18.283  1.00 0.00 ? 36 ALA A CB   13 
ATOM 7955  H H    . ALA A 1 36 ? -14.803 -14.899 18.949  1.00 0.00 ? 36 ALA A H    13 
ATOM 7956  H HA   . ALA A 1 36 ? -14.074 -13.630 16.500  1.00 0.00 ? 36 ALA A HA   13 
ATOM 7957  H HB1  . ALA A 1 36 ? -12.124 -12.804 17.776  1.00 0.00 ? 36 ALA A HB1  13 
ATOM 7958  H HB2  . ALA A 1 36 ? -13.620 -12.662 18.728  1.00 0.00 ? 36 ALA A HB2  13 
ATOM 7959  H HB3  . ALA A 1 36 ? -12.472 -13.980 19.065  1.00 0.00 ? 36 ALA A HB3  13 
ATOM 7960  N N    . GLY A 1 37 ? -12.243 -16.212 17.453  1.00 0.00 ? 37 GLY A N    13 
ATOM 7961  C CA   . GLY A 1 37 ? -11.282 -17.218 17.012  1.00 0.00 ? 37 GLY A CA   13 
ATOM 7962  C C    . GLY A 1 37 ? -11.678 -17.773 15.653  1.00 0.00 ? 37 GLY A C    13 
ATOM 7963  O O    . GLY A 1 37 ? -10.931 -17.670 14.681  1.00 0.00 ? 37 GLY A O    13 
ATOM 7964  H H    . GLY A 1 37 ? -12.619 -16.289 18.387  1.00 0.00 ? 37 GLY A H    13 
ATOM 7965  H HA2  . GLY A 1 37 ? -10.294 -16.763 16.941  1.00 0.00 ? 37 GLY A HA2  13 
ATOM 7966  H HA3  . GLY A 1 37 ? -11.254 -18.030 17.738  1.00 0.00 ? 37 GLY A HA3  13 
ATOM 7967  N N    . LEU A 1 38 ? -12.868 -18.363 15.599  1.00 0.00 ? 38 LEU A N    13 
ATOM 7968  C CA   . LEU A 1 38 ? -13.395 -18.947 14.368  1.00 0.00 ? 38 LEU A CA   13 
ATOM 7969  C C    . LEU A 1 38 ? -13.524 -17.885 13.289  1.00 0.00 ? 38 LEU A C    13 
ATOM 7970  O O    . LEU A 1 38 ? -13.241 -18.131 12.118  1.00 0.00 ? 38 LEU A O    13 
ATOM 7971  C CB   . LEU A 1 38 ? -14.776 -19.558 14.613  1.00 0.00 ? 38 LEU A CB   13 
ATOM 7972  C CG   . LEU A 1 38 ? -14.812 -20.835 15.455  1.00 0.00 ? 38 LEU A CG   13 
ATOM 7973  C CD1  . LEU A 1 38 ? -16.248 -21.260 15.726  1.00 0.00 ? 38 LEU A CD1  13 
ATOM 7974  C CD2  . LEU A 1 38 ? -14.108 -21.974 14.734  1.00 0.00 ? 38 LEU A CD2  13 
ATOM 7975  H H    . LEU A 1 38 ? -13.437 -18.414 16.433  1.00 0.00 ? 38 LEU A H    13 
ATOM 7976  H HA   . LEU A 1 38 ? -12.712 -19.725 14.029  1.00 0.00 ? 38 LEU A HA   13 
ATOM 7977  H HB2  . LEU A 1 38 ? -15.386 -18.809 15.119  1.00 0.00 ? 38 LEU A HB2  13 
ATOM 7978  H HB3  . LEU A 1 38 ? -15.215 -19.787 13.642  1.00 0.00 ? 38 LEU A HB3  13 
ATOM 7979  H HG   . LEU A 1 38 ? -14.309 -20.644 16.403  1.00 0.00 ? 38 LEU A HG   13 
ATOM 7980  H HD11 . LEU A 1 38 ? -16.260 -22.164 16.335  1.00 0.00 ? 38 LEU A HD11 13 
ATOM 7981  H HD12 . LEU A 1 38 ? -16.768 -20.461 16.256  1.00 0.00 ? 38 LEU A HD12 13 
ATOM 7982  H HD13 . LEU A 1 38 ? -16.753 -21.455 14.780  1.00 0.00 ? 38 LEU A HD13 13 
ATOM 7983  H HD21 . LEU A 1 38 ? -14.131 -22.873 15.349  1.00 0.00 ? 38 LEU A HD21 13 
ATOM 7984  H HD22 . LEU A 1 38 ? -14.613 -22.170 13.788  1.00 0.00 ? 38 LEU A HD22 13 
ATOM 7985  H HD23 . LEU A 1 38 ? -13.072 -21.695 14.542  1.00 0.00 ? 38 LEU A HD23 13 
ATOM 7986  N N    . ILE A 1 39 ? -13.956 -16.697 13.700  1.00 0.00 ? 39 ILE A N    13 
ATOM 7987  C CA   . ILE A 1 39 ? -14.133 -15.571 12.787  1.00 0.00 ? 39 ILE A CA   13 
ATOM 7988  C C    . ILE A 1 39 ? -12.824 -15.238 12.092  1.00 0.00 ? 39 ILE A C    13 
ATOM 7989  O O    . ILE A 1 39 ? -12.785 -15.008 10.884  1.00 0.00 ? 39 ILE A O    13 
ATOM 7990  C CB   . ILE A 1 39 ? -14.607 -14.309 13.532  1.00 0.00 ? 39 ILE A CB   13 
ATOM 7991  C CG1  . ILE A 1 39 ? -16.026 -14.509 14.069  1.00 0.00 ? 39 ILE A CG1  13 
ATOM 7992  C CG2  . ILE A 1 39 ? -14.609 -13.109 12.598  1.00 0.00 ? 39 ILE A CG2  13 
ATOM 7993  C CD1  . ILE A 1 39 ? -17.055 -14.775 12.991  1.00 0.00 ? 39 ILE A CD1  13 
ATOM 7994  H H    . ILE A 1 39 ? -14.172 -16.556 14.677  1.00 0.00 ? 39 ILE A H    13 
ATOM 7995  H HA   . ILE A 1 39 ? -14.879 -15.846 12.041  1.00 0.00 ? 39 ILE A HA   13 
ATOM 7996  H HB   . ILE A 1 39 ? -13.931 -14.115 14.365  1.00 0.00 ? 39 ILE A HB   13 
ATOM 7997  H HG12 . ILE A 1 39 ? -16.019 -15.357 14.754  1.00 0.00 ? 39 ILE A HG12 13 
ATOM 7998  H HG13 . ILE A 1 39 ? -16.320 -13.608 14.609  1.00 0.00 ? 39 ILE A HG13 13 
ATOM 7999  H HG21 . ILE A 1 39 ? -14.937 -12.220 13.138  1.00 0.00 ? 39 ILE A HG21 13 
ATOM 8000  H HG22 . ILE A 1 39 ? -13.602 -12.947 12.214  1.00 0.00 ? 39 ILE A HG22 13 
ATOM 8001  H HG23 . ILE A 1 39 ? -15.289 -13.297 11.767  1.00 0.00 ? 39 ILE A HG23 13 
ATOM 8002  H HD11 . ILE A 1 39 ? -18.044 -14.910 13.431  1.00 0.00 ? 39 ILE A HD11 13 
ATOM 8003  H HD12 . ILE A 1 39 ? -17.083 -13.929 12.303  1.00 0.00 ? 39 ILE A HD12 13 
ATOM 8004  H HD13 . ILE A 1 39 ? -16.781 -15.678 12.446  1.00 0.00 ? 39 ILE A HD13 13 
ATOM 8005  N N    . TYR A 1 40 ? -11.748 -15.216 12.874  1.00 0.00 ? 40 TYR A N    13 
ATOM 8006  C CA   . TYR A 1 40 ? -10.415 -14.913 12.359  1.00 0.00 ? 40 TYR A CA   13 
ATOM 8007  C C    . TYR A 1 40 ? -9.925  -16.033 11.458  1.00 0.00 ? 40 TYR A C    13 
ATOM 8008  O O    . TYR A 1 40 ? -9.335  -15.792 10.406  1.00 0.00 ? 40 TYR A O    13 
ATOM 8009  C CB   . TYR A 1 40 ? -9.420  -14.749 13.510  1.00 0.00 ? 40 TYR A CB   13 
ATOM 8010  C CG   . TYR A 1 40 ? -8.017  -14.406 13.063  1.00 0.00 ? 40 TYR A CG   13 
ATOM 8011  C CD1  . TYR A 1 40 ? -7.690  -13.114 12.673  1.00 0.00 ? 40 TYR A CD1  13 
ATOM 8012  C CD2  . TYR A 1 40 ? -7.024  -15.377 13.033  1.00 0.00 ? 40 TYR A CD2  13 
ATOM 8013  C CE1  . TYR A 1 40 ? -6.411  -12.792 12.263  1.00 0.00 ? 40 TYR A CE1  13 
ATOM 8014  C CE2  . TYR A 1 40 ? -5.739  -15.073 12.625  1.00 0.00 ? 40 TYR A CE2  13 
ATOM 8015  C CZ   . TYR A 1 40 ? -5.438  -13.768 12.239  1.00 0.00 ? 40 TYR A CZ   13 
ATOM 8016  O OH   . TYR A 1 40 ? -4.163  -13.450 11.831  1.00 0.00 ? 40 TYR A OH   13 
ATOM 8017  H H    . TYR A 1 40 ? -11.845 -15.413 13.860  1.00 0.00 ? 40 TYR A H    13 
ATOM 8018  H HA   . TYR A 1 40 ? -10.463 -13.985 11.789  1.00 0.00 ? 40 TYR A HA   13 
ATOM 8019  H HB2  . TYR A 1 40 ? -9.778  -13.955 14.167  1.00 0.00 ? 40 TYR A HB2  13 
ATOM 8020  H HB3  . TYR A 1 40 ? -9.386  -15.681 14.074  1.00 0.00 ? 40 TYR A HB3  13 
ATOM 8021  H HD1  . TYR A 1 40 ? -8.450  -12.346 12.691  1.00 0.00 ? 40 TYR A HD1  13 
ATOM 8022  H HD2  . TYR A 1 40 ? -7.261  -16.387 13.334  1.00 0.00 ? 40 TYR A HD2  13 
ATOM 8023  H HE1  . TYR A 1 40 ? -6.175  -11.781 11.963  1.00 0.00 ? 40 TYR A HE1  13 
ATOM 8024  H HE2  . TYR A 1 40 ? -4.977  -15.838 12.606  1.00 0.00 ? 40 TYR A HE2  13 
ATOM 8025  H HH   . TYR A 1 40 ? -3.564  -14.199 11.851  1.00 0.00 ? 40 TYR A HH   13 
ATOM 8026  N N    . SER A 1 41 ? -10.176 -17.268 11.886  1.00 0.00 ? 41 SER A N    13 
ATOM 8027  C CA   . SER A 1 41 ? -9.771  -18.451 11.135  1.00 0.00 ? 41 SER A CA   13 
ATOM 8028  C C    . SER A 1 41 ? -10.412 -18.454 9.757   1.00 0.00 ? 41 SER A C    13 
ATOM 8029  O O    . SER A 1 41 ? -9.741  -18.637 8.743   1.00 0.00 ? 41 SER A O    13 
ATOM 8030  C CB   . SER A 1 41 ? -10.198 -19.724 11.869  1.00 0.00 ? 41 SER A CB   13 
ATOM 8031  O OG   . SER A 1 41 ? -9.506  -19.861 13.097  1.00 0.00 ? 41 SER A OG   13 
ATOM 8032  H H    . SER A 1 41 ? -10.665 -17.402 12.760  1.00 0.00 ? 41 SER A H    13 
ATOM 8033  H HA   . SER A 1 41 ? -8.687  -18.443 11.029  1.00 0.00 ? 41 SER A HA   13 
ATOM 8034  H HB2  . SER A 1 41 ? -11.269 -19.678 12.068  1.00 0.00 ? 41 SER A HB2  13 
ATOM 8035  H HB3  . SER A 1 41 ? -9.981  -20.587 11.241  1.00 0.00 ? 41 SER A HB3  13 
ATOM 8036  H HG   . SER A 1 41 ? -9.797  -20.666 13.530  1.00 0.00 ? 41 SER A HG   13 
ATOM 8037  N N    . MET A 1 42 ? -11.726 -18.248 9.735   1.00 0.00 ? 42 MET A N    13 
ATOM 8038  C CA   . MET A 1 42 ? -12.491 -18.221 8.491   1.00 0.00 ? 42 MET A CA   13 
ATOM 8039  C C    . MET A 1 42 ? -12.046 -17.059 7.618   1.00 0.00 ? 42 MET A C    13 
ATOM 8040  O O    . MET A 1 42 ? -11.914 -17.191 6.402   1.00 0.00 ? 42 MET A O    13 
ATOM 8041  C CB   . MET A 1 42 ? -13.984 -18.062 8.784   1.00 0.00 ? 42 MET A CB   13 
ATOM 8042  C CG   . MET A 1 42 ? -14.867 -18.108 7.547   1.00 0.00 ? 42 MET A CG   13 
ATOM 8043  S SD   . MET A 1 42 ? -16.620 -17.949 7.938   1.00 0.00 ? 42 MET A SD   13 
ATOM 8044  C CE   . MET A 1 42 ? -16.702 -16.230 8.434   1.00 0.00 ? 42 MET A CE   13 
ATOM 8045  H H    . MET A 1 42 ? -12.222 -18.105 10.603  1.00 0.00 ? 42 MET A H    13 
ATOM 8046  H HA   . MET A 1 42 ? -12.327 -19.157 7.958   1.00 0.00 ? 42 MET A HA   13 
ATOM 8047  H HB2  . MET A 1 42 ? -14.290 -18.866 9.453   1.00 0.00 ? 42 MET A HB2  13 
ATOM 8048  H HB3  . MET A 1 42 ? -14.136 -17.101 9.277   1.00 0.00 ? 42 MET A HB3  13 
ATOM 8049  H HG2  . MET A 1 42 ? -14.582 -17.295 6.879   1.00 0.00 ? 42 MET A HG2  13 
ATOM 8050  H HG3  . MET A 1 42 ? -14.707 -19.055 7.033   1.00 0.00 ? 42 MET A HG3  13 
ATOM 8051  H HE1  . MET A 1 42 ? -17.725 -15.970 8.709   1.00 0.00 ? 42 MET A HE1  13 
ATOM 8052  H HE2  . MET A 1 42 ? -16.048 -16.068 9.290   1.00 0.00 ? 42 MET A HE2  13 
ATOM 8053  H HE3  . MET A 1 42 ? -16.380 -15.598 7.606   1.00 0.00 ? 42 MET A HE3  13 
ATOM 8054  N N    . LEU A 1 43 ? -11.818 -15.915 8.257   1.00 0.00 ? 43 LEU A N    13 
ATOM 8055  C CA   . LEU A 1 43 ? -11.385 -14.706 7.563   1.00 0.00 ? 43 LEU A CA   13 
ATOM 8056  C C    . LEU A 1 43 ? -9.920  -14.812 7.172   1.00 0.00 ? 43 LEU A C    13 
ATOM 8057  O O    . LEU A 1 43 ? -9.521  -14.403 6.083   1.00 0.00 ? 43 LEU A O    13 
ATOM 8058  C CB   . LEU A 1 43 ? -11.558 -13.481 8.463   1.00 0.00 ? 43 LEU A CB   13 
ATOM 8059  C CG   . LEU A 1 43 ? -12.997 -13.040 8.740   1.00 0.00 ? 43 LEU A CG   13 
ATOM 8060  C CD1  . LEU A 1 43 ? -13.025 -11.898 9.743   1.00 0.00 ? 43 LEU A CD1  13 
ATOM 8061  C CD2  . LEU A 1 43 ? -13.669 -12.566 7.460   1.00 0.00 ? 43 LEU A CD2  13 
ATOM 8062  H H    . LEU A 1 43 ? -11.946 -15.870 9.258   1.00 0.00 ? 43 LEU A H    13 
ATOM 8063  H HA   . LEU A 1 43 ? -11.991 -14.582 6.665   1.00 0.00 ? 43 LEU A HA   13 
ATOM 8064  H HB2  . LEU A 1 43 ? -11.089 -13.704 9.421   1.00 0.00 ? 43 LEU A HB2  13 
ATOM 8065  H HB3  . LEU A 1 43 ? -11.040 -12.646 7.991   1.00 0.00 ? 43 LEU A HB3  13 
ATOM 8066  H HG   . LEU A 1 43 ? -13.552 -13.886 9.144   1.00 0.00 ? 43 LEU A HG   13 
ATOM 8067  H HD11 . LEU A 1 43 ? -14.056 -11.600 9.939   1.00 0.00 ? 43 LEU A HD11 13 
ATOM 8068  H HD12 . LEU A 1 43 ? -12.561 -12.222 10.674  1.00 0.00 ? 43 LEU A HD12 13 
ATOM 8069  H HD13 . LEU A 1 43 ? -12.475 -11.048 9.340   1.00 0.00 ? 43 LEU A HD13 13 
ATOM 8070  H HD21 . LEU A 1 43 ? -14.696 -12.265 7.669   1.00 0.00 ? 43 LEU A HD21 13 
ATOM 8071  H HD22 . LEU A 1 43 ? -13.120 -11.715 7.056   1.00 0.00 ? 43 LEU A HD22 13 
ATOM 8072  H HD23 . LEU A 1 43 ? -13.672 -13.376 6.731   1.00 0.00 ? 43 LEU A HD23 13 
ATOM 8073  N N    . ARG A 1 44 ? -9.122  -15.369 8.078   1.00 0.00 ? 44 ARG A N    13 
ATOM 8074  C CA   . ARG A 1 44 ? -7.690  -15.543 7.855   1.00 0.00 ? 44 ARG A CA   13 
ATOM 8075  C C    . ARG A 1 44 ? -7.428  -16.795 7.034   1.00 0.00 ? 44 ARG A C    13 
ATOM 8076  O O    . ARG A 1 44 ? -6.492  -16.850 6.238   1.00 0.00 ? 44 ARG A O    13 
ATOM 8077  C CB   . ARG A 1 44 ? -6.952  -15.676 9.189   1.00 0.00 ? 44 ARG A CB   13 
ATOM 8078  C CG   . ARG A 1 44 ? -5.441  -15.770 9.056   1.00 0.00 ? 44 ARG A CG   13 
ATOM 8079  C CD   . ARG A 1 44 ? -4.851  -14.471 8.531   1.00 0.00 ? 44 ARG A CD   13 
ATOM 8080  N NE   . ARG A 1 44 ? -3.397  -14.539 8.412   1.00 0.00 ? 44 ARG A NE   13 
ATOM 8081  C CZ   . ARG A 1 44 ? -2.651  -13.608 7.827   1.00 0.00 ? 44 ARG A CZ   13 
ATOM 8082  N NH1  . ARG A 1 44 ? -3.223  -12.532 7.304   1.00 0.00 ? 44 ARG A NH1  13 
ATOM 8083  N NH2  . ARG A 1 44 ? -1.334  -13.755 7.766   1.00 0.00 ? 44 ARG A NH2  13 
ATOM 8084  H H    . ARG A 1 44 ? -9.510  -15.685 8.955   1.00 0.00 ? 44 ARG A H    13 
ATOM 8085  H HA   . ARG A 1 44 ? -7.311  -14.673 7.319   1.00 0.00 ? 44 ARG A HA   13 
ATOM 8086  H HB2  . ARG A 1 44 ? -7.189  -14.804 9.800   1.00 0.00 ? 44 ARG A HB2  13 
ATOM 8087  H HB3  . ARG A 1 44 ? -7.309  -16.577 9.689   1.00 0.00 ? 44 ARG A HB3  13 
ATOM 8088  H HG2  . ARG A 1 44 ? -5.012  -15.985 10.035  1.00 0.00 ? 44 ARG A HG2  13 
ATOM 8089  H HG3  . ARG A 1 44 ? -5.195  -16.576 8.366   1.00 0.00 ? 44 ARG A HG3  13 
ATOM 8090  H HD2  . ARG A 1 44 ? -5.276  -14.261 7.549   1.00 0.00 ? 44 ARG A HD2  13 
ATOM 8091  H HD3  . ARG A 1 44 ? -5.112  -13.662 9.214   1.00 0.00 ? 44 ARG A HD3  13 
ATOM 8092  H HE   . ARG A 1 44 ? -2.940  -15.350 8.803   1.00 0.00 ? 44 ARG A HE   13 
ATOM 8093  H HH11 . ARG A 1 44 ? -4.226  -12.419 7.351   1.00 0.00 ? 44 ARG A HH11 13 
ATOM 8094  H HH12 . ARG A 1 44 ? -2.656  -11.824 6.859   1.00 0.00 ? 44 ARG A HH12 13 
ATOM 8095  H HH21 . ARG A 1 44 ? -0.899  -14.574 8.164   1.00 0.00 ? 44 ARG A HH21 13 
ATOM 8096  H HH22 . ARG A 1 44 ? -0.768  -13.047 7.321   1.00 0.00 ? 44 ARG A HH22 13 
ATOM 8097  N N    . LYS A 1 45 ? -8.270  -17.804 7.240   1.00 0.00 ? 45 LYS A N    13 
ATOM 8098  C CA   . LYS A 1 45 ? -8.154  -19.074 6.530   1.00 0.00 ? 45 LYS A CA   13 
ATOM 8099  C C    . LYS A 1 45 ? -8.601  -18.920 5.086   1.00 0.00 ? 45 LYS A C    13 
ATOM 8100  O O    . LYS A 1 45 ? -7.932  -19.379 4.161   1.00 0.00 ? 45 LYS A O    13 
ATOM 8101  C CB   . LYS A 1 45 ? -9.026  -20.141 7.195   1.00 0.00 ? 45 LYS A CB   13 
ATOM 8102  C CG   . LYS A 1 45 ? -8.926  -21.514 6.550   1.00 0.00 ? 45 LYS A CG   13 
ATOM 8103  C CD   . LYS A 1 45 ? -9.772  -22.535 7.293   1.00 0.00 ? 45 LYS A CD   13 
ATOM 8104  C CE   . LYS A 1 45 ? -9.684  -23.905 6.640   1.00 0.00 ? 45 LYS A CE   13 
ATOM 8105  N NZ   . LYS A 1 45 ? -10.499 -24.919 7.364   1.00 0.00 ? 45 LYS A NZ   13 
ATOM 8106  H H    . LYS A 1 45 ? -9.020  -17.698 7.909   1.00 0.00 ? 45 LYS A H    13 
ATOM 8107  H HA   . LYS A 1 45 ? -7.113  -19.394 6.554   1.00 0.00 ? 45 LYS A HA   13 
ATOM 8108  H HB2  . LYS A 1 45 ? -8.723  -20.229 8.238   1.00 0.00 ? 45 LYS A HB2  13 
ATOM 8109  H HB3  . LYS A 1 45 ? -10.065 -19.814 7.145   1.00 0.00 ? 45 LYS A HB3  13 
ATOM 8110  H HG2  . LYS A 1 45 ? -9.273  -21.448 5.519   1.00 0.00 ? 45 LYS A HG2  13 
ATOM 8111  H HG3  . LYS A 1 45 ? -7.886  -21.838 6.563   1.00 0.00 ? 45 LYS A HG3  13 
ATOM 8112  H HD2  . LYS A 1 45 ? -9.419  -22.608 8.322   1.00 0.00 ? 45 LYS A HD2  13 
ATOM 8113  H HD3  . LYS A 1 45 ? -10.812 -22.205 7.289   1.00 0.00 ? 45 LYS A HD3  13 
ATOM 8114  H HE2  . LYS A 1 45 ? -10.043 -23.831 5.613   1.00 0.00 ? 45 LYS A HE2  13 
ATOM 8115  H HE3  . LYS A 1 45 ? -8.643  -24.227 6.634   1.00 0.00 ? 45 LYS A HE3  13 
ATOM 8116  H HZ1  . LYS A 1 45 ? -10.418 -25.814 6.904   1.00 0.00 ? 45 LYS A HZ1  13 
ATOM 8117  H HZ2  . LYS A 1 45 ? -10.168 -24.999 8.315   1.00 0.00 ? 45 LYS A HZ2  13 
ATOM 8118  H HZ3  . LYS A 1 45 ? -11.468 -24.631 7.368   1.00 0.00 ? 45 LYS A HZ3  13 
ATOM 8119  N N    . ALA A 1 46 ? -9.744  -18.265 4.905   1.00 0.00 ? 46 ALA A N    13 
ATOM 8120  C CA   . ALA A 1 46 ? -10.309 -18.034 3.579   1.00 0.00 ? 46 ALA A CA   13 
ATOM 8121  C C    . ALA A 1 46 ? -11.614 -17.259 3.702   1.00 0.00 ? 46 ALA A C    13 
ATOM 8122  O O    . ALA A 1 46 ? -12.039 -16.925 4.806   1.00 0.00 ? 46 ALA A O    13 
ATOM 8123  C CB   . ALA A 1 46 ? -10.539 -19.373 2.884   1.00 0.00 ? 46 ALA A CB   13 
ATOM 8124  H H    . ALA A 1 46 ? -10.248 -17.911 5.706   1.00 0.00 ? 46 ALA A H    13 
ATOM 8125  H HA   . ALA A 1 46 ? -9.603  -17.447 2.992   1.00 0.00 ? 46 ALA A HA   13 
ATOM 8126  H HB1  . ALA A 1 46 ? -10.947 -19.198 1.889   1.00 0.00 ? 46 ALA A HB1  13 
ATOM 8127  H HB2  . ALA A 1 46 ? -9.593  -19.906 2.802   1.00 0.00 ? 46 ALA A HB2  13 
ATOM 8128  H HB3  . ALA A 1 46 ? -11.243 -19.968 3.467   1.00 0.00 ? 46 ALA A HB3  13 
ATOM 8129  N N    . GLY A 1 1  ? -4.639  -50.989 65.472  1.00 0.00 ? 1  GLY A N    14 
ATOM 8130  C CA   . GLY A 1 1  ? -5.618  -52.056 65.515  1.00 0.00 ? 1  GLY A CA   14 
ATOM 8131  C C    . GLY A 1 1  ? -6.621  -51.886 64.385  1.00 0.00 ? 1  GLY A C    14 
ATOM 8132  O O    . GLY A 1 1  ? -6.532  -50.946 63.598  1.00 0.00 ? 1  GLY A O    14 
ATOM 8133  H H1   . GLY A 1 1  ? -4.717  -50.290 64.747  1.00 0.00 ? 1  GLY A H1   14 
ATOM 8134  H HA2  . GLY A 1 1  ? -5.113  -53.015 65.409  1.00 0.00 ? 1  GLY A HA2  14 
ATOM 8135  H HA3  . GLY A 1 1  ? -6.142  -52.028 66.471  1.00 0.00 ? 1  GLY A HA3  14 
ATOM 8136  N N    . VAL A 1 2  ? -7.575  -52.811 64.320  1.00 0.00 ? 2  VAL A N    14 
ATOM 8137  C CA   . VAL A 1 2  ? -8.613  -52.790 63.294  1.00 0.00 ? 2  VAL A CA   14 
ATOM 8138  C C    . VAL A 1 2  ? -9.567  -51.629 63.525  1.00 0.00 ? 2  VAL A C    14 
ATOM 8139  O O    . VAL A 1 2  ? -9.943  -50.920 62.593  1.00 0.00 ? 2  VAL A O    14 
ATOM 8140  C CB   . VAL A 1 2  ? -9.439  -54.090 63.300  1.00 0.00 ? 2  VAL A CB   14 
ATOM 8141  C CG1  . VAL A 1 2  ? -10.626 -53.971 62.356  1.00 0.00 ? 2  VAL A CG1  14 
ATOM 8142  C CG2  . VAL A 1 2  ? -8.585  -55.266 62.853  1.00 0.00 ? 2  VAL A CG2  14 
ATOM 8143  H H    . VAL A 1 2  ? -7.591  -53.558 64.999  1.00 0.00 ? 2  VAL A H    14 
ATOM 8144  H HA   . VAL A 1 2  ? -8.134  -52.675 62.322  1.00 0.00 ? 2  VAL A HA   14 
ATOM 8145  H HB   . VAL A 1 2  ? -9.802  -54.272 64.312  1.00 0.00 ? 2  VAL A HB   14 
ATOM 8146  H HG11 . VAL A 1 2  ? -11.208 -54.892 62.375  1.00 0.00 ? 2  VAL A HG11 14 
ATOM 8147  H HG12 . VAL A 1 2  ? -11.257 -53.139 62.670  1.00 0.00 ? 2  VAL A HG12 14 
ATOM 8148  H HG13 . VAL A 1 2  ? -10.267 -53.791 61.343  1.00 0.00 ? 2  VAL A HG13 14 
ATOM 8149  H HG21 . VAL A 1 2  ? -9.178  -56.180 62.870  1.00 0.00 ? 2  VAL A HG21 14 
ATOM 8150  H HG22 . VAL A 1 2  ? -8.225  -55.087 61.840  1.00 0.00 ? 2  VAL A HG22 14 
ATOM 8151  H HG23 . VAL A 1 2  ? -7.736  -55.373 63.527  1.00 0.00 ? 2  VAL A HG23 14 
ATOM 8152  N N    . ILE A 1 3  ? -9.954  -51.446 64.784  1.00 0.00 ? 3  ILE A N    14 
ATOM 8153  C CA   . ILE A 1 3  ? -10.867 -50.375 65.171  1.00 0.00 ? 3  ILE A CA   14 
ATOM 8154  C C    . ILE A 1 3  ? -10.215 -49.018 64.963  1.00 0.00 ? 3  ILE A C    14 
ATOM 8155  O O    . ILE A 1 3  ? -10.855 -48.066 64.519  1.00 0.00 ? 3  ILE A O    14 
ATOM 8156  C CB   . ILE A 1 3  ? -11.269 -50.484 66.654  1.00 0.00 ? 3  ILE A CB   14 
ATOM 8157  C CG1  . ILE A 1 3  ? -12.114 -51.739 66.886  1.00 0.00 ? 3  ILE A CG1  14 
ATOM 8158  C CG2  . ILE A 1 3  ? -12.082 -49.270 67.076  1.00 0.00 ? 3  ILE A CG2  14 
ATOM 8159  C CD1  . ILE A 1 3  ? -12.346 -52.057 68.347  1.00 0.00 ? 3  ILE A CD1  14 
ATOM 8160  H H    . ILE A 1 3  ? -9.610  -52.063 65.506  1.00 0.00 ? 3  ILE A H    14 
ATOM 8161  H HA   . ILE A 1 3  ? -11.762 -50.445 64.552  1.00 0.00 ? 3  ILE A HA   14 
ATOM 8162  H HB   . ILE A 1 3  ? -10.366 -50.540 67.261  1.00 0.00 ? 3  ILE A HB   14 
ATOM 8163  H HG12 . ILE A 1 3  ? -13.083 -51.594 66.408  1.00 0.00 ? 3  ILE A HG12 14 
ATOM 8164  H HG13 . ILE A 1 3  ? -11.605 -52.586 66.427  1.00 0.00 ? 3  ILE A HG13 14 
ATOM 8165  H HG21 . ILE A 1 3  ? -12.352 -49.353 68.129  1.00 0.00 ? 3  ILE A HG21 14 
ATOM 8166  H HG22 . ILE A 1 3  ? -11.490 -48.367 66.926  1.00 0.00 ? 3  ILE A HG22 14 
ATOM 8167  H HG23 . ILE A 1 3  ? -12.989 -49.213 66.474  1.00 0.00 ? 3  ILE A HG23 14 
ATOM 8168  H HD11 . ILE A 1 3  ? -12.953 -52.956 68.451  1.00 0.00 ? 3  ILE A HD11 14 
ATOM 8169  H HD12 . ILE A 1 3  ? -11.386 -52.215 68.838  1.00 0.00 ? 3  ILE A HD12 14 
ATOM 8170  H HD13 . ILE A 1 3  ? -12.863 -51.221 68.820  1.00 0.00 ? 3  ILE A HD13 14 
ATOM 8171  N N    . ASP A 1 4  ? -8.929  -48.942 65.291  1.00 0.00 ? 4  ASP A N    14 
ATOM 8172  C CA   . ASP A 1 4  ? -8.159  -47.710 65.151  1.00 0.00 ? 4  ASP A CA   14 
ATOM 8173  C C    . ASP A 1 4  ? -8.306  -47.147 63.746  1.00 0.00 ? 4  ASP A C    14 
ATOM 8174  O O    . ASP A 1 4  ? -8.435  -45.939 63.555  1.00 0.00 ? 4  ASP A O    14 
ATOM 8175  C CB   . ASP A 1 4  ? -6.675  -47.973 65.414  1.00 0.00 ? 4  ASP A CB   14 
ATOM 8176  C CG   . ASP A 1 4  ? -6.381  -48.244 66.876  1.00 0.00 ? 4  ASP A CG   14 
ATOM 8177  O OD1  . ASP A 1 4  ? -5.188  -48.326 67.237  1.00 0.00 ? 4  ASP A OD1  14 
ATOM 8178  O OD2  . ASP A 1 4  ? -7.344  -48.374 67.661  1.00 0.00 ? 4  ASP A OD2  14 
ATOM 8179  H H    . ASP A 1 4  ? -8.459  -49.759 65.652  1.00 0.00 ? 4  ASP A H    14 
ATOM 8180  H HA   . ASP A 1 4  ? -8.530  -46.981 65.873  1.00 0.00 ? 4  ASP A HA   14 
ATOM 8181  H HB2  . ASP A 1 4  ? -6.363  -48.837 64.828  1.00 0.00 ? 4  ASP A HB2  14 
ATOM 8182  H HB3  . ASP A 1 4  ? -6.104  -47.100 65.098  1.00 0.00 ? 4  ASP A HB3  14 
ATOM 8183  H HD2  . ASP A 1 4  ? -7.086  -48.543 68.570  1.00 0.00 ? 4  ASP A HD2  14 
ATOM 8184  N N    . THR A 1 5  ? -8.285  -48.044 62.763  1.00 0.00 ? 5  THR A N    14 
ATOM 8185  C CA   . THR A 1 5  ? -8.413  -47.665 61.359  1.00 0.00 ? 5  THR A CA   14 
ATOM 8186  C C    . THR A 1 5  ? -9.861  -47.778 60.908  1.00 0.00 ? 5  THR A C    14 
ATOM 8187  O O    . THR A 1 5  ? -10.195 -47.483 59.762  1.00 0.00 ? 5  THR A O    14 
ATOM 8188  C CB   . THR A 1 5  ? -7.561  -48.571 60.450  1.00 0.00 ? 5  THR A CB   14 
ATOM 8189  O OG1  . THR A 1 5  ? -8.011  -49.926 60.565  1.00 0.00 ? 5  THR A OG1  14 
ATOM 8190  C CG2  . THR A 1 5  ? -6.096  -48.502 60.852  1.00 0.00 ? 5  THR A CG2  14 
ATOM 8191  H H    . THR A 1 5  ? -8.178  -49.023 62.985  1.00 0.00 ? 5  THR A H    14 
ATOM 8192  H HA   . THR A 1 5  ? -8.079  -46.633 61.249  1.00 0.00 ? 5  THR A HA   14 
ATOM 8193  H HB   . THR A 1 5  ? -7.667  -48.240 59.417  1.00 0.00 ? 5  THR A HB   14 
ATOM 8194  H HG1  . THR A 1 5  ? -7.477  -50.476 59.988  1.00 0.00 ? 5  THR A HG1  14 
ATOM 8195  H HG21 . THR A 1 5  ? -5.505  -49.145 60.201  1.00 0.00 ? 5  THR A HG21 14 
ATOM 8196  H HG22 . THR A 1 5  ? -5.744  -47.474 60.762  1.00 0.00 ? 5  THR A HG22 14 
ATOM 8197  H HG23 . THR A 1 5  ? -5.988  -48.834 61.884  1.00 0.00 ? 5  THR A HG23 14 
ATOM 8198  N N    . SER A 1 6  ? -10.717 -48.211 61.829  1.00 0.00 ? 6  SER A N    14 
ATOM 8199  C CA   . SER A 1 6  ? -12.141 -48.374 61.553  1.00 0.00 ? 6  SER A CA   14 
ATOM 8200  C C    . SER A 1 6  ? -12.701 -47.130 60.881  1.00 0.00 ? 6  SER A C    14 
ATOM 8201  O O    . SER A 1 6  ? -13.213 -47.186 59.764  1.00 0.00 ? 6  SER A O    14 
ATOM 8202  C CB   . SER A 1 6  ? -12.915 -48.611 62.851  1.00 0.00 ? 6  SER A CB   14 
ATOM 8203  O OG   . SER A 1 6  ? -14.301 -48.762 62.599  1.00 0.00 ? 6  SER A OG   14 
ATOM 8204  H H    . SER A 1 6  ? -10.382 -48.436 62.755  1.00 0.00 ? 6  SER A H    14 
ATOM 8205  H HA   . SER A 1 6  ? -12.274 -49.231 60.893  1.00 0.00 ? 6  SER A HA   14 
ATOM 8206  H HB2  . SER A 1 6  ? -12.541 -49.516 63.329  1.00 0.00 ? 6  SER A HB2  14 
ATOM 8207  H HB3  . SER A 1 6  ? -12.766 -47.760 63.515  1.00 0.00 ? 6  SER A HB3  14 
ATOM 8208  H HG   . SER A 1 6  ? -14.756 -48.908 63.432  1.00 0.00 ? 6  SER A HG   14 
ATOM 8209  N N    . ALA A 1 7  ? -12.595 -46.004 61.580  1.00 0.00 ? 7  ALA A N    14 
ATOM 8210  C CA   . ALA A 1 7  ? -13.083 -44.724 61.074  1.00 0.00 ? 7  ALA A CA   14 
ATOM 8211  C C    . ALA A 1 7  ? -12.378 -44.360 59.777  1.00 0.00 ? 7  ALA A C    14 
ATOM 8212  O O    . ALA A 1 7  ? -12.997 -43.874 58.831  1.00 0.00 ? 7  ALA A O    14 
ATOM 8213  C CB   . ALA A 1 7  ? -12.826 -43.620 62.088  1.00 0.00 ? 7  ALA A CB   14 
ATOM 8214  H H    . ALA A 1 7  ? -12.165 -46.023 62.494  1.00 0.00 ? 7  ALA A H    14 
ATOM 8215  H HA   . ALA A 1 7  ? -14.155 -44.805 60.893  1.00 0.00 ? 7  ALA A HA   14 
ATOM 8216  H HB1  . ALA A 1 7  ? -13.208 -42.672 61.707  1.00 0.00 ? 7  ALA A HB1  14 
ATOM 8217  H HB2  . ALA A 1 7  ? -13.331 -43.862 63.023  1.00 0.00 ? 7  ALA A HB2  14 
ATOM 8218  H HB3  . ALA A 1 7  ? -11.755 -43.533 62.266  1.00 0.00 ? 7  ALA A HB3  14 
ATOM 8219  N N    . VAL A 1 8  ? -11.071 -44.603 59.746  1.00 0.00 ? 8  VAL A N    14 
ATOM 8220  C CA   . VAL A 1 8  ? -10.251 -44.311 58.574  1.00 0.00 ? 8  VAL A CA   14 
ATOM 8221  C C    . VAL A 1 8  ? -10.700 -45.148 57.388  1.00 0.00 ? 8  VAL A C    14 
ATOM 8222  O O    . VAL A 1 8  ? -10.777 -44.663 56.260  1.00 0.00 ? 8  VAL A O    14 
ATOM 8223  C CB   . VAL A 1 8  ? -8.765  -44.618 58.834  1.00 0.00 ? 8  VAL A CB   14 
ATOM 8224  C CG1  . VAL A 1 8  ? -7.964  -44.508 57.546  1.00 0.00 ? 8  VAL A CG1  14 
ATOM 8225  C CG2  . VAL A 1 8  ? -8.187  -43.639 59.844  1.00 0.00 ? 8  VAL A CG2  14 
ATOM 8226  H H    . VAL A 1 8  ? -10.620 -45.003 60.556  1.00 0.00 ? 8  VAL A H    14 
ATOM 8227  H HA   . VAL A 1 8  ? -10.361 -43.253 58.332  1.00 0.00 ? 8  VAL A HA   14 
ATOM 8228  H HB   . VAL A 1 8  ? -8.679  -45.631 59.226  1.00 0.00 ? 8  VAL A HB   14 
ATOM 8229  H HG11 . VAL A 1 8  ? -6.917  -44.736 57.741  1.00 0.00 ? 8  VAL A HG11 14 
ATOM 8230  H HG12 . VAL A 1 8  ? -8.357  -45.213 56.814  1.00 0.00 ? 8  VAL A HG12 14 
ATOM 8231  H HG13 . VAL A 1 8  ? -8.046  -43.494 57.154  1.00 0.00 ? 8  VAL A HG13 14 
ATOM 8232  H HG21 . VAL A 1 8  ? -7.138  -43.872 60.027  1.00 0.00 ? 8  VAL A HG21 14 
ATOM 8233  H HG22 . VAL A 1 8  ? -8.270  -42.624 59.453  1.00 0.00 ? 8  VAL A HG22 14 
ATOM 8234  H HG23 . VAL A 1 8  ? -8.742  -43.713 60.779  1.00 0.00 ? 8  VAL A HG23 14 
ATOM 8235  N N    . GLU A 1 9  ? -10.997 -46.416 57.658  1.00 0.00 ? 9  GLU A N    14 
ATOM 8236  C CA   . GLU A 1 9  ? -11.444 -47.349 56.628  1.00 0.00 ? 9  GLU A CA   14 
ATOM 8237  C C    . GLU A 1 9  ? -12.686 -46.818 55.931  1.00 0.00 ? 9  GLU A C    14 
ATOM 8238  O O    . GLU A 1 9  ? -12.840 -46.950 54.718  1.00 0.00 ? 9  GLU A O    14 
ATOM 8239  C CB   . GLU A 1 9  ? -11.780 -48.708 57.245  1.00 0.00 ? 9  GLU A CB   14 
ATOM 8240  C CG   . GLU A 1 9  ? -12.189 -49.765 56.233  1.00 0.00 ? 9  GLU A CG   14 
ATOM 8241  C CD   . GLU A 1 9  ? -12.465 -51.111 56.875  1.00 0.00 ? 9  GLU A CD   14 
ATOM 8242  O OE1  . GLU A 1 9  ? -12.338 -51.215 58.113  1.00 0.00 ? 9  GLU A OE1  14 
ATOM 8243  O OE2  . GLU A 1 9  ? -12.808 -52.061 56.140  1.00 0.00 ? 9  GLU A OE2  14 
ATOM 8244  H H    . GLU A 1 9  ? -10.915 -46.755 58.606  1.00 0.00 ? 9  GLU A H    14 
ATOM 8245  H HA   . GLU A 1 9  ? -10.645 -47.473 55.898  1.00 0.00 ? 9  GLU A HA   14 
ATOM 8246  H HB2  . GLU A 1 9  ? -10.901 -49.067 57.780  1.00 0.00 ? 9  GLU A HB2  14 
ATOM 8247  H HB3  . GLU A 1 9  ? -12.602 -48.571 57.948  1.00 0.00 ? 9  GLU A HB3  14 
ATOM 8248  H HG2  . GLU A 1 9  ? -13.091 -49.429 55.721  1.00 0.00 ? 9  GLU A HG2  14 
ATOM 8249  H HG3  . GLU A 1 9  ? -11.387 -49.882 55.505  1.00 0.00 ? 9  GLU A HG3  14 
ATOM 8250  H HE2  . GLU A 1 9  ? -12.967 -52.881 56.612  1.00 0.00 ? 9  GLU A HE2  14 
ATOM 8251  N N    . SER A 1 10 ? -13.572 -46.214 56.717  1.00 0.00 ? 10 SER A N    14 
ATOM 8252  C CA   . SER A 1 10 ? -14.816 -45.649 56.201  1.00 0.00 ? 10 SER A CA   14 
ATOM 8253  C C    . SER A 1 10 ? -14.569 -44.276 55.600  1.00 0.00 ? 10 SER A C    14 
ATOM 8254  O O    . SER A 1 10 ? -15.009 -43.978 54.491  1.00 0.00 ? 10 SER A O    14 
ATOM 8255  C CB   . SER A 1 10 ? -15.846 -45.507 57.323  1.00 0.00 ? 10 SER A CB   14 
ATOM 8256  O OG   . SER A 1 10 ? -16.205 -46.772 57.850  1.00 0.00 ? 10 SER A OG   14 
ATOM 8257  H H    . SER A 1 10 ? -13.389 -46.136 57.707  1.00 0.00 ? 10 SER A H    14 
ATOM 8258  H HA   . SER A 1 10 ? -15.210 -46.314 55.433  1.00 0.00 ? 10 SER A HA   14 
ATOM 8259  H HB2  . SER A 1 10 ? -15.422 -44.897 58.121  1.00 0.00 ? 10 SER A HB2  14 
ATOM 8260  H HB3  . SER A 1 10 ? -16.738 -45.020 56.928  1.00 0.00 ? 10 SER A HB3  14 
ATOM 8261  H HG   . SER A 1 10 ? -16.851 -46.646 58.550  1.00 0.00 ? 10 SER A HG   14 
ATOM 8262  N N    . ALA A 1 11 ? -13.856 -43.440 56.351  1.00 0.00 ? 11 ALA A N    14 
ATOM 8263  C CA   . ALA A 1 11 ? -13.532 -42.084 55.916  1.00 0.00 ? 11 ALA A CA   14 
ATOM 8264  C C    . ALA A 1 11 ? -12.595 -42.118 54.720  1.00 0.00 ? 11 ALA A C    14 
ATOM 8265  O O    . ALA A 1 11 ? -12.721 -41.322 53.791  1.00 0.00 ? 11 ALA A O    14 
ATOM 8266  C CB   . ALA A 1 11 ? -12.852 -41.315 57.039  1.00 0.00 ? 11 ALA A CB   14 
ATOM 8267  H H    . ALA A 1 11 ? -13.524 -43.743 57.255  1.00 0.00 ? 11 ALA A H    14 
ATOM 8268  H HA   . ALA A 1 11 ? -14.456 -41.575 55.638  1.00 0.00 ? 11 ALA A HA   14 
ATOM 8269  H HB1  . ALA A 1 11 ? -12.628 -40.300 56.709  1.00 0.00 ? 11 ALA A HB1  14 
ATOM 8270  H HB2  . ALA A 1 11 ? -13.515 -41.275 57.904  1.00 0.00 ? 11 ALA A HB2  14 
ATOM 8271  H HB3  . ALA A 1 11 ? -11.926 -41.818 57.314  1.00 0.00 ? 11 ALA A HB3  14 
ATOM 8272  N N    . ILE A 1 12 ? -11.650 -43.053 54.756  1.00 0.00 ? 12 ILE A N    14 
ATOM 8273  C CA   . ILE A 1 12 ? -10.673 -43.217 53.685  1.00 0.00 ? 12 ILE A CA   14 
ATOM 8274  C C    . ILE A 1 12 ? -11.353 -43.693 52.412  1.00 0.00 ? 12 ILE A C    14 
ATOM 8275  O O    . ILE A 1 12 ? -11.100 -43.177 51.324  1.00 0.00 ? 12 ILE A O    14 
ATOM 8276  C CB   . ILE A 1 12 ? -9.593  -44.249 54.059  1.00 0.00 ? 12 ILE A CB   14 
ATOM 8277  C CG1  . ILE A 1 12 ? -8.736  -43.729 55.215  1.00 0.00 ? 12 ILE A CG1  14 
ATOM 8278  C CG2  . ILE A 1 12 ? -8.685  -44.525 52.871  1.00 0.00 ? 12 ILE A CG2  14 
ATOM 8279  C CD1  . ILE A 1 12 ? -8.001  -42.445 54.899  1.00 0.00 ? 12 ILE A CD1  14 
ATOM 8280  H H    . ILE A 1 12 ? -11.599 -43.677 55.548  1.00 0.00 ? 12 ILE A H    14 
ATOM 8281  H HA   . ILE A 1 12 ? -10.198 -42.253 53.502  1.00 0.00 ? 12 ILE A HA   14 
ATOM 8282  H HB   . ILE A 1 12 ? -10.081 -45.175 54.361  1.00 0.00 ? 12 ILE A HB   14 
ATOM 8283  H HG12 . ILE A 1 12 ? -9.386  -43.551 56.072  1.00 0.00 ? 12 ILE A HG12 14 
ATOM 8284  H HG13 . ILE A 1 12 ? -8.001  -44.492 55.469  1.00 0.00 ? 12 ILE A HG13 14 
ATOM 8285  H HG21 . ILE A 1 12 ? -7.932  -45.263 53.145  1.00 0.00 ? 12 ILE A HG21 14 
ATOM 8286  H HG22 . ILE A 1 12 ? -9.281  -44.906 52.042  1.00 0.00 ? 12 ILE A HG22 14 
ATOM 8287  H HG23 . ILE A 1 12 ? -8.192  -43.601 52.570  1.00 0.00 ? 12 ILE A HG23 14 
ATOM 8288  H HD11 . ILE A 1 12 ? -7.410  -42.122 55.756  1.00 0.00 ? 12 ILE A HD11 14 
ATOM 8289  H HD12 . ILE A 1 12 ? -7.339  -42.609 54.050  1.00 0.00 ? 12 ILE A HD12 14 
ATOM 8290  H HD13 . ILE A 1 12 ? -8.724  -41.668 54.651  1.00 0.00 ? 12 ILE A HD13 14 
ATOM 8291  N N    . THR A 1 13 ? -12.223 -44.688 52.563  1.00 0.00 ? 13 THR A N    14 
ATOM 8292  C CA   . THR A 1 13 ? -12.959 -45.258 51.438  1.00 0.00 ? 13 THR A CA   14 
ATOM 8293  C C    . THR A 1 13 ? -13.892 -44.222 50.832  1.00 0.00 ? 13 THR A C    14 
ATOM 8294  O O    . THR A 1 13 ? -14.008 -44.107 49.613  1.00 0.00 ? 13 THR A O    14 
ATOM 8295  C CB   . THR A 1 13 ? -13.811 -46.465 51.874  1.00 0.00 ? 13 THR A CB   14 
ATOM 8296  O OG1  . THR A 1 13 ? -12.957 -47.498 52.381  1.00 0.00 ? 13 THR A OG1  14 
ATOM 8297  C CG2  . THR A 1 13 ? -14.601 -47.012 50.696  1.00 0.00 ? 13 THR A CG2  14 
ATOM 8298  H H    . THR A 1 13 ? -12.389 -45.069 53.484  1.00 0.00 ? 13 THR A H    14 
ATOM 8299  H HA   . THR A 1 13 ? -12.241 -45.581 50.685  1.00 0.00 ? 13 THR A HA   14 
ATOM 8300  H HB   . THR A 1 13 ? -14.503 -46.150 52.656  1.00 0.00 ? 13 THR A HB   14 
ATOM 8301  H HG1  . THR A 1 13 ? -13.503 -48.238 52.656  1.00 0.00 ? 13 THR A HG1  14 
ATOM 8302  H HG21 . THR A 1 13 ? -15.201 -47.863 51.018  1.00 0.00 ? 13 THR A HG21 14 
ATOM 8303  H HG22 . THR A 1 13 ? -15.258 -46.233 50.307  1.00 0.00 ? 13 THR A HG22 14 
ATOM 8304  H HG23 . THR A 1 13 ? -13.912 -47.330 49.914  1.00 0.00 ? 13 THR A HG23 14 
ATOM 8305  N N    . ASP A 1 14 ? -14.558 -43.468 51.703  1.00 0.00 ? 14 ASP A N    14 
ATOM 8306  C CA   . ASP A 1 14 ? -15.492 -42.429 51.281  1.00 0.00 ? 14 ASP A CA   14 
ATOM 8307  C C    . ASP A 1 14 ? -14.747 -41.281 50.620  1.00 0.00 ? 14 ASP A C    14 
ATOM 8308  O O    . ASP A 1 14 ? -15.101 -40.839 49.528  1.00 0.00 ? 14 ASP A O    14 
ATOM 8309  C CB   . ASP A 1 14 ? -16.260 -41.878 52.484  1.00 0.00 ? 14 ASP A CB   14 
ATOM 8310  C CG   . ASP A 1 14 ? -17.268 -42.868 53.034  1.00 0.00 ? 14 ASP A CG   14 
ATOM 8311  O OD1  . ASP A 1 14 ? -18.051 -42.484 53.929  1.00 0.00 ? 14 ASP A OD1  14 
ATOM 8312  O OD2  . ASP A 1 14 ? -17.276 -44.028 52.571  1.00 0.00 ? 14 ASP A OD2  14 
ATOM 8313  H H    . ASP A 1 14 ? -14.421 -43.611 52.693  1.00 0.00 ? 14 ASP A H    14 
ATOM 8314  H HA   . ASP A 1 14 ? -16.197 -42.859 50.570  1.00 0.00 ? 14 ASP A HA   14 
ATOM 8315  H HB2  . ASP A 1 14 ? -15.548 -41.629 53.271  1.00 0.00 ? 14 ASP A HB2  14 
ATOM 8316  H HB3  . ASP A 1 14 ? -16.788 -40.974 52.179  1.00 0.00 ? 14 ASP A HB3  14 
ATOM 8317  H HD2  . ASP A 1 14 ? -17.939 -44.600 52.964  1.00 0.00 ? 14 ASP A HD2  14 
ATOM 8318  N N    . GLY A 1 15 ? -13.708 -40.804 51.298  1.00 0.00 ? 15 GLY A N    14 
ATOM 8319  C CA   . GLY A 1 15 ? -12.890 -39.702 50.798  1.00 0.00 ? 15 GLY A CA   14 
ATOM 8320  C C    . GLY A 1 15 ? -11.843 -40.216 49.823  1.00 0.00 ? 15 GLY A C    14 
ATOM 8321  O O    . GLY A 1 15 ? -11.894 -39.933 48.627  1.00 0.00 ? 15 GLY A O    14 
ATOM 8322  H H    . GLY A 1 15 ? -13.468 -41.210 52.191  1.00 0.00 ? 15 GLY A H    14 
ATOM 8323  H HA2  . GLY A 1 15 ? -13.531 -38.980 50.290  1.00 0.00 ? 15 GLY A HA2  14 
ATOM 8324  H HA3  . GLY A 1 15 ? -12.392 -39.214 51.636  1.00 0.00 ? 15 GLY A HA3  14 
ATOM 8325  N N    . GLN A 1 16 ? -10.889 -40.976 50.352  1.00 0.00 ? 16 GLN A N    14 
ATOM 8326  C CA   . GLN A 1 16 ? -9.812  -41.547 49.550  1.00 0.00 ? 16 GLN A CA   14 
ATOM 8327  C C    . GLN A 1 16 ? -10.373 -42.225 48.310  1.00 0.00 ? 16 GLN A C    14 
ATOM 8328  O O    . GLN A 1 16 ? -9.974  -41.926 47.186  1.00 0.00 ? 16 GLN A O    14 
ATOM 8329  C CB   . GLN A 1 16 ? -9.035  -42.587 50.359  1.00 0.00 ? 16 GLN A CB   14 
ATOM 8330  C CG   . GLN A 1 16 ? -7.863  -43.204 49.614  1.00 0.00 ? 16 GLN A CG   14 
ATOM 8331  C CD   . GLN A 1 16 ? -6.782  -42.193 49.286  1.00 0.00 ? 16 GLN A CD   14 
ATOM 8332  O OE1  . GLN A 1 16 ? -6.270  -41.508 50.171  1.00 0.00 ? 16 GLN A OE1  14 
ATOM 8333  N NE2  . GLN A 1 16 ? -6.433  -42.096 48.008  1.00 0.00 ? 16 GLN A NE2  14 
ATOM 8334  H H    . GLN A 1 16 ? -10.901 -41.170 51.343  1.00 0.00 ? 16 GLN A H    14 
ATOM 8335  H HA   . GLN A 1 16 ? -9.137  -40.745 49.250  1.00 0.00 ? 16 GLN A HA   14 
ATOM 8336  H HB2  . GLN A 1 16 ? -8.653  -42.104 51.259  1.00 0.00 ? 16 GLN A HB2  14 
ATOM 8337  H HB3  . GLN A 1 16 ? -9.722  -43.386 50.639  1.00 0.00 ? 16 GLN A HB3  14 
ATOM 8338  H HG2  . GLN A 1 16 ? -7.431  -43.991 50.232  1.00 0.00 ? 16 GLN A HG2  14 
ATOM 8339  H HG3  . GLN A 1 16 ? -8.230  -43.638 48.684  1.00 0.00 ? 16 GLN A HG3  14 
ATOM 8340  H HE21 . GLN A 1 16 ? -6.883  -42.679 47.317  1.00 0.00 ? 16 GLN A HE21 14 
ATOM 8341  H HE22 . GLN A 1 16 ? -5.719  -41.438 47.729  1.00 0.00 ? 16 GLN A HE22 14 
ATOM 8342  N N    . GLY A 1 17 ? -11.307 -43.146 48.532  1.00 0.00 ? 17 GLY A N    14 
ATOM 8343  C CA   . GLY A 1 17 ? -11.944 -43.887 47.447  1.00 0.00 ? 17 GLY A CA   14 
ATOM 8344  C C    . GLY A 1 17 ? -12.466 -42.932 46.385  1.00 0.00 ? 17 GLY A C    14 
ATOM 8345  O O    . GLY A 1 17 ? -12.248 -43.129 45.191  1.00 0.00 ? 17 GLY A O    14 
ATOM 8346  H H    . GLY A 1 17 ? -11.593 -43.347 49.480  1.00 0.00 ? 17 GLY A H    14 
ATOM 8347  H HA2  . GLY A 1 17 ? -11.216 -44.562 46.997  1.00 0.00 ? 17 GLY A HA2  14 
ATOM 8348  H HA3  . GLY A 1 17 ? -12.775 -44.467 47.848  1.00 0.00 ? 17 GLY A HA3  14 
ATOM 8349  N N    . ASP A 1 18 ? -13.159 -41.892 46.838  1.00 0.00 ? 18 ASP A N    14 
ATOM 8350  C CA   . ASP A 1 18 ? -13.728 -40.885 45.946  1.00 0.00 ? 18 ASP A CA   14 
ATOM 8351  C C    . ASP A 1 18 ? -12.644 -40.282 45.067  1.00 0.00 ? 18 ASP A C    14 
ATOM 8352  O O    . ASP A 1 18 ? -12.929 -39.614 44.074  1.00 0.00 ? 18 ASP A O    14 
ATOM 8353  C CB   . ASP A 1 18 ? -14.379 -39.760 46.754  1.00 0.00 ? 18 ASP A CB   14 
ATOM 8354  C CG   . ASP A 1 18 ? -15.651 -40.203 47.448  1.00 0.00 ? 18 ASP A CG   14 
ATOM 8355  O OD1  . ASP A 1 18 ? -16.607 -39.401 47.504  1.00 0.00 ? 18 ASP A OD1  14 
ATOM 8356  O OD2  . ASP A 1 18 ? -15.693 -41.351 47.937  1.00 0.00 ? 18 ASP A OD2  14 
ATOM 8357  H H    . ASP A 1 18 ? -13.304 -41.784 47.832  1.00 0.00 ? 18 ASP A H    14 
ATOM 8358  H HA   . ASP A 1 18 ? -14.482 -41.359 45.317  1.00 0.00 ? 18 ASP A HA   14 
ATOM 8359  H HB2  . ASP A 1 18 ? -13.672 -39.414 47.507  1.00 0.00 ? 18 ASP A HB2  14 
ATOM 8360  H HB3  . ASP A 1 18 ? -14.617 -38.936 46.080  1.00 0.00 ? 18 ASP A HB3  14 
ATOM 8361  H HD2  . ASP A 1 18 ? -16.528 -41.564 48.361  1.00 0.00 ? 18 ASP A HD2  14 
ATOM 8362  N N    . MET A 1 19 ? -11.393 -40.526 45.446  1.00 0.00 ? 19 MET A N    14 
ATOM 8363  C CA   . MET A 1 19 ? -10.241 -40.017 44.709  1.00 0.00 ? 19 MET A CA   14 
ATOM 8364  C C    . MET A 1 19 ? -10.185 -40.629 43.319  1.00 0.00 ? 19 MET A C    14 
ATOM 8365  O O    . MET A 1 19 ? -9.916  -39.945 42.333  1.00 0.00 ? 19 MET A O    14 
ATOM 8366  C CB   . MET A 1 19 ? -8.942  -40.361 45.441  1.00 0.00 ? 19 MET A CB   14 
ATOM 8367  C CG   . MET A 1 19 ? -7.692  -39.795 44.786  1.00 0.00 ? 19 MET A CG   14 
ATOM 8368  S SD   . MET A 1 19 ? -6.187  -40.210 45.687  1.00 0.00 ? 19 MET A SD   14 
ATOM 8369  C CE   . MET A 1 19 ? -6.392  -39.220 47.165  1.00 0.00 ? 19 MET A CE   14 
ATOM 8370  H H    . MET A 1 19 ? -11.223 -41.081 46.272  1.00 0.00 ? 19 MET A H    14 
ATOM 8371  H HA   . MET A 1 19 ? -10.331 -38.934 44.624  1.00 0.00 ? 19 MET A HA   14 
ATOM 8372  H HB2  . MET A 1 19 ? -9.006  -39.967 46.455  1.00 0.00 ? 19 MET A HB2  14 
ATOM 8373  H HB3  . MET A 1 19 ? -8.848  -41.446 45.478  1.00 0.00 ? 19 MET A HB3  14 
ATOM 8374  H HG2  . MET A 1 19 ? -7.615  -40.189 43.773  1.00 0.00 ? 19 MET A HG2  14 
ATOM 8375  H HG3  . MET A 1 19 ? -7.782  -38.710 44.733  1.00 0.00 ? 19 MET A HG3  14 
ATOM 8376  H HE1  . MET A 1 19 ? -5.541  -39.363 47.831  1.00 0.00 ? 19 MET A HE1  14 
ATOM 8377  H HE2  . MET A 1 19 ? -6.460  -38.167 46.889  1.00 0.00 ? 19 MET A HE2  14 
ATOM 8378  H HE3  . MET A 1 19 ? -7.306  -39.520 47.678  1.00 0.00 ? 19 MET A HE3  14 
ATOM 8379  N N    . LYS A 1 20 ? -10.444 -41.932 43.254  1.00 0.00 ? 20 LYS A N    14 
ATOM 8380  C CA   . LYS A 1 20 ? -10.431 -42.668 41.993  1.00 0.00 ? 20 LYS A CA   14 
ATOM 8381  C C    . LYS A 1 20 ? -11.417 -42.057 41.010  1.00 0.00 ? 20 LYS A C    14 
ATOM 8382  O O    . LYS A 1 20 ? -11.128 -41.918 39.823  1.00 0.00 ? 20 LYS A O    14 
ATOM 8383  C CB   . LYS A 1 20 ? -10.819 -44.130 42.222  1.00 0.00 ? 20 LYS A CB   14 
ATOM 8384  C CG   . LYS A 1 20 ? -10.772 -44.989 40.968  1.00 0.00 ? 20 LYS A CG   14 
ATOM 8385  C CD   . LYS A 1 20 ? -11.113 -46.437 41.278  1.00 0.00 ? 20 LYS A CD   14 
ATOM 8386  C CE   . LYS A 1 20 ? -11.080 -47.292 40.022  1.00 0.00 ? 20 LYS A CE   14 
ATOM 8387  N NZ   . LYS A 1 20 ? -11.401 -48.717 40.312  1.00 0.00 ? 20 LYS A NZ   14 
ATOM 8388  H H    . LYS A 1 20 ? -10.659 -42.439 44.100  1.00 0.00 ? 20 LYS A H    14 
ATOM 8389  H HA   . LYS A 1 20 ? -9.427  -42.623 41.572  1.00 0.00 ? 20 LYS A HA   14 
ATOM 8390  H HB2  . LYS A 1 20 ? -10.133 -44.555 42.954  1.00 0.00 ? 20 LYS A HB2  14 
ATOM 8391  H HB3  . LYS A 1 20 ? -11.835 -44.156 42.617  1.00 0.00 ? 20 LYS A HB3  14 
ATOM 8392  H HG2  . LYS A 1 20 ? -11.491 -44.602 40.245  1.00 0.00 ? 20 LYS A HG2  14 
ATOM 8393  H HG3  . LYS A 1 20 ? -9.770  -44.943 40.544  1.00 0.00 ? 20 LYS A HG3  14 
ATOM 8394  H HD2  . LYS A 1 20 ? -10.389 -46.827 41.993  1.00 0.00 ? 20 LYS A HD2  14 
ATOM 8395  H HD3  . LYS A 1 20 ? -12.112 -46.481 41.712  1.00 0.00 ? 20 LYS A HD3  14 
ATOM 8396  H HE2  . LYS A 1 20 ? -11.809 -46.903 39.310  1.00 0.00 ? 20 LYS A HE2  14 
ATOM 8397  H HE3  . LYS A 1 20 ? -10.085 -47.236 39.582  1.00 0.00 ? 20 LYS A HE3  14 
ATOM 8398  H HZ1  . LYS A 1 20 ? -11.371 -49.254 39.458  1.00 0.00 ? 20 LYS A HZ1  14 
ATOM 8399  H HZ2  . LYS A 1 20 ? -10.726 -49.087 40.965  1.00 0.00 ? 20 LYS A HZ2  14 
ATOM 8400  H HZ3  . LYS A 1 20 ? -12.326 -48.778 40.713  1.00 0.00 ? 20 LYS A HZ3  14 
ATOM 8401  N N    . ALA A 1 21 ? -12.590 -41.693 41.523  1.00 0.00 ? 21 ALA A N    14 
ATOM 8402  C CA   . ALA A 1 21 ? -13.644 -41.092 40.711  1.00 0.00 ? 21 ALA A CA   14 
ATOM 8403  C C    . ALA A 1 21 ? -13.234 -39.702 40.253  1.00 0.00 ? 21 ALA A C    14 
ATOM 8404  O O    . ALA A 1 21 ? -13.461 -39.317 39.107  1.00 0.00 ? 21 ALA A O    14 
ATOM 8405  C CB   . ALA A 1 21 ? -14.931 -40.976 41.514  1.00 0.00 ? 21 ALA A CB   14 
ATOM 8406  H H    . ALA A 1 21 ? -12.768 -41.833 42.507  1.00 0.00 ? 21 ALA A H    14 
ATOM 8407  H HA   . ALA A 1 21 ? -13.818 -41.723 39.840  1.00 0.00 ? 21 ALA A HA   14 
ATOM 8408  H HB1  . ALA A 1 21 ? -15.715 -40.539 40.895  1.00 0.00 ? 21 ALA A HB1  14 
ATOM 8409  H HB2  . ALA A 1 21 ? -15.242 -41.966 41.845  1.00 0.00 ? 21 ALA A HB2  14 
ATOM 8410  H HB3  . ALA A 1 21 ? -14.761 -40.339 42.382  1.00 0.00 ? 21 ALA A HB3  14 
ATOM 8411  N N    . ILE A 1 22 ? -12.626 -38.951 41.168  1.00 0.00 ? 22 ILE A N    14 
ATOM 8412  C CA   . ILE A 1 22 ? -12.173 -37.592 40.885  1.00 0.00 ? 22 ILE A CA   14 
ATOM 8413  C C    . ILE A 1 22 ? -11.085 -37.605 39.823  1.00 0.00 ? 22 ILE A C    14 
ATOM 8414  O O    . ILE A 1 22 ? -11.141 -36.859 38.847  1.00 0.00 ? 22 ILE A O    14 
ATOM 8415  C CB   . ILE A 1 22 ? -11.599 -36.915 42.143  1.00 0.00 ? 22 ILE A CB   14 
ATOM 8416  C CG1  . ILE A 1 22 ? -12.706 -36.675 43.172  1.00 0.00 ? 22 ILE A CG1  14 
ATOM 8417  C CG2  . ILE A 1 22 ? -10.972 -35.575 41.789  1.00 0.00 ? 22 ILE A CG2  14 
ATOM 8418  C CD1  . ILE A 1 22 ? -12.196 -36.242 44.529  1.00 0.00 ? 22 ILE A CD1  14 
ATOM 8419  H H    . ILE A 1 22 ? -12.467 -39.324 42.093  1.00 0.00 ? 22 ILE A H    14 
ATOM 8420  H HA   . ILE A 1 22 ? -13.024 -37.013 40.525  1.00 0.00 ? 22 ILE A HA   14 
ATOM 8421  H HB   . ILE A 1 22 ? -10.839 -37.564 42.577  1.00 0.00 ? 22 ILE A HB   14 
ATOM 8422  H HG12 . ILE A 1 22 ? -13.368 -35.897 42.790  1.00 0.00 ? 22 ILE A HG12 14 
ATOM 8423  H HG13 . ILE A 1 22 ? -13.267 -37.601 43.296  1.00 0.00 ? 22 ILE A HG13 14 
ATOM 8424  H HG21 . ILE A 1 22 ? -10.561 -35.110 42.685  1.00 0.00 ? 22 ILE A HG21 14 
ATOM 8425  H HG22 . ILE A 1 22 ? -10.174 -35.729 41.063  1.00 0.00 ? 22 ILE A HG22 14 
ATOM 8426  H HG23 . ILE A 1 22 ? -11.732 -34.921 41.360  1.00 0.00 ? 22 ILE A HG23 14 
ATOM 8427  H HD11 . ILE A 1 22 ? -13.027 -36.085 45.218  1.00 0.00 ? 22 ILE A HD11 14 
ATOM 8428  H HD12 . ILE A 1 22 ? -11.541 -37.014 44.931  1.00 0.00 ? 22 ILE A HD12 14 
ATOM 8429  H HD13 . ILE A 1 22 ? -11.639 -35.311 44.424  1.00 0.00 ? 22 ILE A HD13 14 
ATOM 8430  N N    . GLY A 1 23 ? -10.093 -38.465 40.027  1.00 0.00 ? 23 GLY A N    14 
ATOM 8431  C CA   . GLY A 1 23 ? -8.972  -38.599 39.099  1.00 0.00 ? 23 GLY A CA   14 
ATOM 8432  C C    . GLY A 1 23 ? -9.448  -39.159 37.768  1.00 0.00 ? 23 GLY A C    14 
ATOM 8433  O O    . GLY A 1 23 ? -9.062  -38.682 36.702  1.00 0.00 ? 23 GLY A O    14 
ATOM 8434  H H    . GLY A 1 23 ? -10.104 -39.051 40.849  1.00 0.00 ? 23 GLY A H    14 
ATOM 8435  H HA2  . GLY A 1 23 ? -8.521  -37.620 38.937  1.00 0.00 ? 23 GLY A HA2  14 
ATOM 8436  H HA3  . GLY A 1 23 ? -8.230  -39.271 39.527  1.00 0.00 ? 23 GLY A HA3  14 
ATOM 8437  N N    . GLY A 1 24 ? -10.295 -40.181 37.845  1.00 0.00 ? 24 GLY A N    14 
ATOM 8438  C CA   . GLY A 1 24 ? -10.842 -40.831 36.658  1.00 0.00 ? 24 GLY A CA   14 
ATOM 8439  C C    . GLY A 1 24 ? -11.779 -39.888 35.919  1.00 0.00 ? 24 GLY A C    14 
ATOM 8440  O O    . GLY A 1 24 ? -11.618 -39.638 34.726  1.00 0.00 ? 24 GLY A O    14 
ATOM 8441  H H    . GLY A 1 24 ? -10.577 -40.527 38.751  1.00 0.00 ? 24 GLY A H    14 
ATOM 8442  H HA2  . GLY A 1 24 ? -10.025 -41.117 35.996  1.00 0.00 ? 24 GLY A HA2  14 
ATOM 8443  H HA3  . GLY A 1 24 ? -11.393 -41.722 36.958  1.00 0.00 ? 24 GLY A HA3  14 
ATOM 8444  N N    . TYR A 1 25 ? -12.763 -39.368 36.647  1.00 0.00 ? 25 TYR A N    14 
ATOM 8445  C CA   . TYR A 1 25 ? -13.745 -38.446 36.085  1.00 0.00 ? 25 TYR A CA   14 
ATOM 8446  C C    . TYR A 1 25 ? -13.052 -37.249 35.456  1.00 0.00 ? 25 TYR A C    14 
ATOM 8447  O O    . TYR A 1 25 ? -13.451 -36.766 34.397  1.00 0.00 ? 25 TYR A O    14 
ATOM 8448  C CB   . TYR A 1 25 ? -14.690 -37.939 37.176  1.00 0.00 ? 25 TYR A CB   14 
ATOM 8449  C CG   . TYR A 1 25 ? -15.733 -36.964 36.679  1.00 0.00 ? 25 TYR A CG   14 
ATOM 8450  C CD1  . TYR A 1 25 ? -16.856 -37.412 35.995  1.00 0.00 ? 25 TYR A CD1  14 
ATOM 8451  C CD2  . TYR A 1 25 ? -15.591 -35.599 36.895  1.00 0.00 ? 25 TYR A CD2  14 
ATOM 8452  C CE1  . TYR A 1 25 ? -17.815 -36.528 35.537  1.00 0.00 ? 25 TYR A CE1  14 
ATOM 8453  C CE2  . TYR A 1 25 ? -16.540 -34.701 36.444  1.00 0.00 ? 25 TYR A CE2  14 
ATOM 8454  C CZ   . TYR A 1 25 ? -17.658 -35.177 35.760  1.00 0.00 ? 25 TYR A CZ   14 
ATOM 8455  O OH   . TYR A 1 25 ? -18.610 -34.295 35.305  1.00 0.00 ? 25 TYR A OH   14 
ATOM 8456  H H    . TYR A 1 25 ? -12.844 -39.613 37.623  1.00 0.00 ? 25 TYR A H    14 
ATOM 8457  H HA   . TYR A 1 25 ? -14.323 -38.971 35.324  1.00 0.00 ? 25 TYR A HA   14 
ATOM 8458  H HB2  . TYR A 1 25 ? -15.200 -38.795 37.618  1.00 0.00 ? 25 TYR A HB2  14 
ATOM 8459  H HB3  . TYR A 1 25 ? -14.098 -37.447 37.948  1.00 0.00 ? 25 TYR A HB3  14 
ATOM 8460  H HD1  . TYR A 1 25 ? -16.983 -38.469 35.818  1.00 0.00 ? 25 TYR A HD1  14 
ATOM 8461  H HD2  . TYR A 1 25 ? -14.724 -35.233 37.425  1.00 0.00 ? 25 TYR A HD2  14 
ATOM 8462  H HE1  . TYR A 1 25 ? -18.683 -36.893 35.007  1.00 0.00 ? 25 TYR A HE1  14 
ATOM 8463  H HE2  . TYR A 1 25 ? -16.417 -33.642 36.620  1.00 0.00 ? 25 TYR A HE2  14 
ATOM 8464  H HH   . TYR A 1 25 ? -18.405 -33.380 35.512  1.00 0.00 ? 25 TYR A HH   14 
ATOM 8465  N N    . ILE A 1 26 ? -12.005 -36.774 36.124  1.00 0.00 ? 26 ILE A N    14 
ATOM 8466  C CA   . ILE A 1 26 ? -11.232 -35.628 35.652  1.00 0.00 ? 26 ILE A CA   14 
ATOM 8467  C C    . ILE A 1 26 ? -10.348 -36.029 34.482  1.00 0.00 ? 26 ILE A C    14 
ATOM 8468  O O    . ILE A 1 26 ? -10.267 -35.327 33.476  1.00 0.00 ? 26 ILE A O    14 
ATOM 8469  C CB   . ILE A 1 26 ? -10.324 -35.064 36.761  1.00 0.00 ? 26 ILE A CB   14 
ATOM 8470  C CG1  . ILE A 1 26 ? -11.167 -34.457 37.883  1.00 0.00 ? 26 ILE A CG1  14 
ATOM 8471  C CG2  . ILE A 1 26 ? -9.412  -33.982 36.204  1.00 0.00 ? 26 ILE A CG2  14 
ATOM 8472  C CD1  . ILE A 1 26 ? -10.373 -34.103 39.121  1.00 0.00 ? 26 ILE A CD1  14 
ATOM 8473  H H    . ILE A 1 26 ? -11.725 -37.214 36.989  1.00 0.00 ? 26 ILE A H    14 
ATOM 8474  H HA   . ILE A 1 26 ? -11.928 -34.852 35.331  1.00 0.00 ? 26 ILE A HA   14 
ATOM 8475  H HB   . ILE A 1 26 ? -9.717  -35.873 37.165  1.00 0.00 ? 26 ILE A HB   14 
ATOM 8476  H HG12 . ILE A 1 26 ? -11.639 -33.549 37.506  1.00 0.00 ? 26 ILE A HG12 14 
ATOM 8477  H HG13 . ILE A 1 26 ? -11.937 -35.176 38.163  1.00 0.00 ? 26 ILE A HG13 14 
ATOM 8478  H HG21 . ILE A 1 26 ? -8.768  -33.598 36.995  1.00 0.00 ? 26 ILE A HG21 14 
ATOM 8479  H HG22 . ILE A 1 26 ? -8.797  -34.401 35.409  1.00 0.00 ? 26 ILE A HG22 14 
ATOM 8480  H HG23 . ILE A 1 26 ? -10.018 -33.168 35.804  1.00 0.00 ? 26 ILE A HG23 14 
ATOM 8481  H HD11 . ILE A 1 26 ? -11.024 -33.674 39.884  1.00 0.00 ? 26 ILE A HD11 14 
ATOM 8482  H HD12 . ILE A 1 26 ? -9.904  -35.003 39.517  1.00 0.00 ? 26 ILE A HD12 14 
ATOM 8483  H HD13 . ILE A 1 26 ? -9.604  -33.376 38.860  1.00 0.00 ? 26 ILE A HD13 14 
ATOM 8484  N N    . VAL A 1 27 ? -9.685  -37.172 34.628  1.00 0.00 ? 27 VAL A N    14 
ATOM 8485  C CA   . VAL A 1 27 ? -8.794  -37.695 33.595  1.00 0.00 ? 27 VAL A CA   14 
ATOM 8486  C C    . VAL A 1 27 ? -9.598  -38.277 32.444  1.00 0.00 ? 27 VAL A C    14 
ATOM 8487  O O    . VAL A 1 27 ? -9.168  -38.256 31.292  1.00 0.00 ? 27 VAL A O    14 
ATOM 8488  C CB   . VAL A 1 27 ? -7.882  -38.807 34.146  1.00 0.00 ? 27 VAL A CB   14 
ATOM 8489  C CG1  . VAL A 1 27 ? -8.680  -40.080 34.387  1.00 0.00 ? 27 VAL A CG1  14 
ATOM 8490  C CG2  . VAL A 1 27 ? -6.767  -39.119 33.160  1.00 0.00 ? 27 VAL A CG2  14 
ATOM 8491  H H    . VAL A 1 27 ? -9.794  -37.705 35.479  1.00 0.00 ? 27 VAL A H    14 
ATOM 8492  H HA   . VAL A 1 27 ? -8.176  -36.876 33.227  1.00 0.00 ? 27 VAL A HA   14 
ATOM 8493  H HB   . VAL A 1 27 ? -7.447  -38.471 35.087  1.00 0.00 ? 27 VAL A HB   14 
ATOM 8494  H HG11 . VAL A 1 27 ? -8.027  -40.856 34.785  1.00 0.00 ? 27 VAL A HG11 14 
ATOM 8495  H HG12 . VAL A 1 27 ? -9.478  -39.877 35.102  1.00 0.00 ? 27 VAL A HG12 14 
ATOM 8496  H HG13 . VAL A 1 27 ? -9.114  -40.419 33.446  1.00 0.00 ? 27 VAL A HG13 14 
ATOM 8497  H HG21 . VAL A 1 27 ? -6.124  -39.900 33.564  1.00 0.00 ? 27 VAL A HG21 14 
ATOM 8498  H HG22 . VAL A 1 27 ? -7.200  -39.458 32.219  1.00 0.00 ? 27 VAL A HG22 14 
ATOM 8499  H HG23 . VAL A 1 27 ? -6.177  -38.219 32.985  1.00 0.00 ? 27 VAL A HG23 14 
ATOM 8500  N N    . GLY A 1 28 ? -10.777 -38.799 32.772  1.00 0.00 ? 28 GLY A N    14 
ATOM 8501  C CA   . GLY A 1 28 ? -11.667 -39.398 31.783  1.00 0.00 ? 28 GLY A CA   14 
ATOM 8502  C C    . GLY A 1 28 ? -12.346 -38.318 30.955  1.00 0.00 ? 28 GLY A C    14 
ATOM 8503  O O    . GLY A 1 28 ? -12.778 -38.557 29.829  1.00 0.00 ? 28 GLY A O    14 
ATOM 8504  H H    . GLY A 1 28 ? -11.077 -38.785 33.737  1.00 0.00 ? 28 GLY A H    14 
ATOM 8505  H HA2  . GLY A 1 28 ? -11.089 -40.045 31.124  1.00 0.00 ? 28 GLY A HA2  14 
ATOM 8506  H HA3  . GLY A 1 28 ? -12.427 -39.989 32.294  1.00 0.00 ? 28 GLY A HA3  14 
ATOM 8507  N N    . ALA A 1 29 ? -12.432 -37.122 31.531  1.00 0.00 ? 29 ALA A N    14 
ATOM 8508  C CA   . ALA A 1 29 ? -13.056 -35.981 30.869  1.00 0.00 ? 29 ALA A CA   14 
ATOM 8509  C C    . ALA A 1 29 ? -12.055 -35.278 29.964  1.00 0.00 ? 29 ALA A C    14 
ATOM 8510  O O    . ALA A 1 29 ? -12.412 -34.741 28.917  1.00 0.00 ? 29 ALA A O    14 
ATOM 8511  C CB   . ALA A 1 29 ? -13.560 -34.981 31.899  1.00 0.00 ? 29 ALA A CB   14 
ATOM 8512  H H    . ALA A 1 29 ? -12.057 -36.988 32.459  1.00 0.00 ? 29 ALA A H    14 
ATOM 8513  H HA   . ALA A 1 29 ? -13.895 -36.338 30.272  1.00 0.00 ? 29 ALA A HA   14 
ATOM 8514  H HB1  . ALA A 1 29 ? -14.037 -34.140 31.395  1.00 0.00 ? 29 ALA A HB1  14 
ATOM 8515  H HB2  . ALA A 1 29 ? -14.284 -35.467 32.553  1.00 0.00 ? 29 ALA A HB2  14 
ATOM 8516  H HB3  . ALA A 1 29 ? -12.721 -34.618 32.493  1.00 0.00 ? 29 ALA A HB3  14 
ATOM 8517  N N    . LEU A 1 30 ? -10.794 -35.291 30.385  1.00 0.00 ? 30 LEU A N    14 
ATOM 8518  C CA   . LEU A 1 30 ? -9.714  -34.661 29.630  1.00 0.00 ? 30 LEU A CA   14 
ATOM 8519  C C    . LEU A 1 30 ? -9.667  -35.207 28.212  1.00 0.00 ? 30 LEU A C    14 
ATOM 8520  O O    . LEU A 1 30 ? -9.283  -34.509 27.275  1.00 0.00 ? 30 LEU A O    14 
ATOM 8521  C CB   . LEU A 1 30 ? -8.364  -34.932 30.298  1.00 0.00 ? 30 LEU A CB   14 
ATOM 8522  C CG   . LEU A 1 30 ? -8.113  -34.224 31.631  1.00 0.00 ? 30 LEU A CG   14 
ATOM 8523  C CD1  . LEU A 1 30 ? -6.797  -34.680 32.241  1.00 0.00 ? 30 LEU A CD1  14 
ATOM 8524  C CD2  . LEU A 1 30 ? -8.050  -32.717 31.435  1.00 0.00 ? 30 LEU A CD2  14 
ATOM 8525  H H    . LEU A 1 30 ? -10.564 -35.749 31.255  1.00 0.00 ? 30 LEU A H    14 
ATOM 8526  H HA   . LEU A 1 30 ? -9.891  -33.585 29.598  1.00 0.00 ? 30 LEU A HA   14 
ATOM 8527  H HB2  . LEU A 1 30 ? -8.290  -36.005 30.473  1.00 0.00 ? 30 LEU A HB2  14 
ATOM 8528  H HB3  . LEU A 1 30 ? -7.583  -34.621 29.605  1.00 0.00 ? 30 LEU A HB3  14 
ATOM 8529  H HG   . LEU A 1 30 ? -8.928  -34.463 32.314  1.00 0.00 ? 30 LEU A HG   14 
ATOM 8530  H HD11 . LEU A 1 30 ? -6.635  -34.176 33.194  1.00 0.00 ? 30 LEU A HD11 14 
ATOM 8531  H HD12 . LEU A 1 30 ? -6.828  -35.757 32.403  1.00 0.00 ? 30 LEU A HD12 14 
ATOM 8532  H HD13 . LEU A 1 30 ? -5.980  -34.437 31.562  1.00 0.00 ? 30 LEU A HD13 14 
ATOM 8533  H HD21 . LEU A 1 30 ? -7.882  -32.224 32.393  1.00 0.00 ? 30 LEU A HD21 14 
ATOM 8534  H HD22 . LEU A 1 30 ? -7.233  -32.474 30.756  1.00 0.00 ? 30 LEU A HD22 14 
ATOM 8535  H HD23 . LEU A 1 30 ? -8.992  -32.367 31.010  1.00 0.00 ? 30 LEU A HD23 14 
ATOM 8536  N N    . VAL A 1 31 ? -10.065 -36.467 28.067  1.00 0.00 ? 31 VAL A N    14 
ATOM 8537  C CA   . VAL A 1 31 ? -10.080 -37.137 26.769  1.00 0.00 ? 31 VAL A CA   14 
ATOM 8538  C C    . VAL A 1 31 ? -10.895 -36.336 25.767  1.00 0.00 ? 31 VAL A C    14 
ATOM 8539  O O    . VAL A 1 31 ? -10.573 -36.286 24.581  1.00 0.00 ? 31 VAL A O    14 
ATOM 8540  C CB   . VAL A 1 31 ? -10.699 -38.544 26.867  1.00 0.00 ? 31 VAL A CB   14 
ATOM 8541  C CG1  . VAL A 1 31 ? -10.896 -39.137 25.480  1.00 0.00 ? 31 VAL A CG1  14 
ATOM 8542  C CG2  . VAL A 1 31 ? -9.792  -39.471 27.662  1.00 0.00 ? 31 VAL A CG2  14 
ATOM 8543  H H    . VAL A 1 31 ? -10.370 -36.988 28.876  1.00 0.00 ? 31 VAL A H    14 
ATOM 8544  H HA   . VAL A 1 31 ? -9.054  -37.222 26.414  1.00 0.00 ? 31 VAL A HA   14 
ATOM 8545  H HB   . VAL A 1 31 ? -11.665 -38.470 27.367  1.00 0.00 ? 31 VAL A HB   14 
ATOM 8546  H HG11 . VAL A 1 31 ? -11.343 -40.128 25.562  1.00 0.00 ? 31 VAL A HG11 14 
ATOM 8547  H HG12 . VAL A 1 31 ? -11.555 -38.490 24.900  1.00 0.00 ? 31 VAL A HG12 14 
ATOM 8548  H HG13 . VAL A 1 31 ? -9.931  -39.215 24.979  1.00 0.00 ? 31 VAL A HG13 14 
ATOM 8549  H HG21 . VAL A 1 31 ? -10.245 -40.460 27.732  1.00 0.00 ? 31 VAL A HG21 14 
ATOM 8550  H HG22 . VAL A 1 31 ? -8.827  -39.549 27.162  1.00 0.00 ? 31 VAL A HG22 14 
ATOM 8551  H HG23 . VAL A 1 31 ? -9.651  -39.066 28.664  1.00 0.00 ? 31 VAL A HG23 14 
ATOM 8552  N N    . ILE A 1 32 ? -11.958 -35.708 26.261  1.00 0.00 ? 32 ILE A N    14 
ATOM 8553  C CA   . ILE A 1 32 ? -12.843 -34.898 25.428  1.00 0.00 ? 32 ILE A CA   14 
ATOM 8554  C C    . ILE A 1 32 ? -12.103 -33.684 24.890  1.00 0.00 ? 32 ILE A C    14 
ATOM 8555  O O    . ILE A 1 32 ? -12.240 -33.320 23.723  1.00 0.00 ? 32 ILE A O    14 
ATOM 8556  C CB   . ILE A 1 32 ? -14.063 -34.396 26.223  1.00 0.00 ? 32 ILE A CB   14 
ATOM 8557  C CG1  . ILE A 1 32 ? -14.962 -35.569 26.617  1.00 0.00 ? 32 ILE A CG1  14 
ATOM 8558  C CG2  . ILE A 1 32 ? -14.879 -33.422 25.387  1.00 0.00 ? 32 ILE A CG2  14 
ATOM 8559  C CD1  . ILE A 1 32 ? -16.048 -35.201 27.605  1.00 0.00 ? 32 ILE A CD1  14 
ATOM 8560  H H    . ILE A 1 32 ? -12.170 -35.786 27.246  1.00 0.00 ? 32 ILE A H    14 
ATOM 8561  H HA   . ILE A 1 32 ? -13.188 -35.510 24.595  1.00 0.00 ? 32 ILE A HA   14 
ATOM 8562  H HB   . ILE A 1 32 ? -13.714 -33.891 27.124  1.00 0.00 ? 32 ILE A HB   14 
ATOM 8563  H HG12 . ILE A 1 32 ? -15.436 -35.957 25.715  1.00 0.00 ? 32 ILE A HG12 14 
ATOM 8564  H HG13 . ILE A 1 32 ? -14.340 -36.344 27.064  1.00 0.00 ? 32 ILE A HG13 14 
ATOM 8565  H HG21 . ILE A 1 32 ? -15.734 -33.066 25.963  1.00 0.00 ? 32 ILE A HG21 14 
ATOM 8566  H HG22 . ILE A 1 32 ? -14.255 -32.574 25.106  1.00 0.00 ? 32 ILE A HG22 14 
ATOM 8567  H HG23 . ILE A 1 32 ? -15.234 -33.925 24.488  1.00 0.00 ? 32 ILE A HG23 14 
ATOM 8568  H HD11 . ILE A 1 32 ? -16.656 -36.072 27.847  1.00 0.00 ? 32 ILE A HD11 14 
ATOM 8569  H HD12 . ILE A 1 32 ? -15.591 -34.820 28.518  1.00 0.00 ? 32 ILE A HD12 14 
ATOM 8570  H HD13 . ILE A 1 32 ? -16.686 -34.431 27.170  1.00 0.00 ? 32 ILE A HD13 14 
ATOM 8571  N N    . LEU A 1 33 ? -11.313 -33.060 25.760  1.00 0.00 ? 33 LEU A N    14 
ATOM 8572  C CA   . LEU A 1 33 ? -10.535 -31.878 25.399  1.00 0.00 ? 33 LEU A CA   14 
ATOM 8573  C C    . LEU A 1 33 ? -9.532  -32.215 24.308  1.00 0.00 ? 33 LEU A C    14 
ATOM 8574  O O    . LEU A 1 33 ? -9.418  -31.507 23.308  1.00 0.00 ? 33 LEU A O    14 
ATOM 8575  C CB   . LEU A 1 33 ? -9.770  -31.349 26.614  1.00 0.00 ? 33 LEU A CB   14 
ATOM 8576  C CG   . LEU A 1 33 ? -10.607 -30.673 27.701  1.00 0.00 ? 33 LEU A CG   14 
ATOM 8577  C CD1  . LEU A 1 33 ? -9.743  -30.312 28.899  1.00 0.00 ? 33 LEU A CD1  14 
ATOM 8578  C CD2  . LEU A 1 33 ? -11.245 -29.397 27.173  1.00 0.00 ? 33 LEU A CD2  14 
ATOM 8579  H H    . LEU A 1 33 ? -11.242 -33.407 26.706  1.00 0.00 ? 33 LEU A H    14 
ATOM 8580  H HA   . LEU A 1 33 ? -11.217 -31.107 25.039  1.00 0.00 ? 33 LEU A HA   14 
ATOM 8581  H HB2  . LEU A 1 33 ? -9.250  -32.190 27.071  1.00 0.00 ? 33 LEU A HB2  14 
ATOM 8582  H HB3  . LEU A 1 33 ? -9.041  -30.622 26.256  1.00 0.00 ? 33 LEU A HB3  14 
ATOM 8583  H HG   . LEU A 1 33 ? -11.391 -31.361 28.018  1.00 0.00 ? 33 LEU A HG   14 
ATOM 8584  H HD11 . LEU A 1 33 ? -10.354 -29.841 29.670  1.00 0.00 ? 33 LEU A HD11 14 
ATOM 8585  H HD12 . LEU A 1 33 ? -9.288  -31.216 29.303  1.00 0.00 ? 33 LEU A HD12 14 
ATOM 8586  H HD13 . LEU A 1 33 ? -8.961  -29.620 28.586  1.00 0.00 ? 33 LEU A HD13 14 
ATOM 8587  H HD21 . LEU A 1 33 ? -11.848 -28.931 27.953  1.00 0.00 ? 33 LEU A HD21 14 
ATOM 8588  H HD22 . LEU A 1 33 ? -10.464 -28.704 26.860  1.00 0.00 ? 33 LEU A HD22 14 
ATOM 8589  H HD23 . LEU A 1 33 ? -11.882 -29.636 26.321  1.00 0.00 ? 33 LEU A HD23 14 
ATOM 8590  N N    . ALA A 1 34 ? -8.804  -33.308 24.514  1.00 0.00 ? 34 ALA A N    14 
ATOM 8591  C CA   . ALA A 1 34 ? -7.797  -33.766 23.560  1.00 0.00 ? 34 ALA A CA   14 
ATOM 8592  C C    . ALA A 1 34 ? -8.431  -34.036 22.205  1.00 0.00 ? 34 ALA A C    14 
ATOM 8593  O O    . ALA A 1 34 ? -7.868  -33.705 21.162  1.00 0.00 ? 34 ALA A O    14 
ATOM 8594  C CB   . ALA A 1 34 ? -7.146  -35.050 24.052  1.00 0.00 ? 34 ALA A CB   14 
ATOM 8595  H H    . ALA A 1 34 ? -8.944  -33.847 25.357  1.00 0.00 ? 34 ALA A H    14 
ATOM 8596  H HA   . ALA A 1 34 ? -7.037  -32.992 23.456  1.00 0.00 ? 34 ALA A HA   14 
ATOM 8597  H HB1  . ALA A 1 34 ? -6.387  -35.375 23.341  1.00 0.00 ? 34 ALA A HB1  14 
ATOM 8598  H HB2  . ALA A 1 34 ? -6.681  -34.871 25.022  1.00 0.00 ? 34 ALA A HB2  14 
ATOM 8599  H HB3  . ALA A 1 34 ? -7.905  -35.826 24.151  1.00 0.00 ? 34 ALA A HB3  14 
ATOM 8600  N N    . VAL A 1 35 ? -9.614  -34.642 22.234  1.00 0.00 ? 35 VAL A N    14 
ATOM 8601  C CA   . VAL A 1 35 ? -10.352 -34.970 21.018  1.00 0.00 ? 35 VAL A CA   14 
ATOM 8602  C C    . VAL A 1 35 ? -10.574 -33.724 20.177  1.00 0.00 ? 35 VAL A C    14 
ATOM 8603  O O    . VAL A 1 35 ? -10.411 -33.742 18.958  1.00 0.00 ? 35 VAL A O    14 
ATOM 8604  C CB   . VAL A 1 35 ? -11.731 -35.575 21.341  1.00 0.00 ? 35 VAL A CB   14 
ATOM 8605  C CG1  . VAL A 1 35 ? -12.561 -35.714 20.074  1.00 0.00 ? 35 VAL A CG1  14 
ATOM 8606  C CG2  . VAL A 1 35 ? -11.575 -36.952 21.966  1.00 0.00 ? 35 VAL A CG2  14 
ATOM 8607  H H    . VAL A 1 35 ? -10.026 -34.888 23.123  1.00 0.00 ? 35 VAL A H    14 
ATOM 8608  H HA   . VAL A 1 35 ? -9.770  -35.692 20.447  1.00 0.00 ? 35 VAL A HA   14 
ATOM 8609  H HB   . VAL A 1 35 ? -12.249 -34.918 22.041  1.00 0.00 ? 35 VAL A HB   14 
ATOM 8610  H HG11 . VAL A 1 35 ? -13.537 -36.134 20.316  1.00 0.00 ? 35 VAL A HG11 14 
ATOM 8611  H HG12 . VAL A 1 35 ? -12.694 -34.732 19.618  1.00 0.00 ? 35 VAL A HG12 14 
ATOM 8612  H HG13 . VAL A 1 35 ? -12.047 -36.373 19.374  1.00 0.00 ? 35 VAL A HG13 14 
ATOM 8613  H HG21 . VAL A 1 35 ? -12.557 -37.366 22.198  1.00 0.00 ? 35 VAL A HG21 14 
ATOM 8614  H HG22 . VAL A 1 35 ? -11.061 -37.611 21.267  1.00 0.00 ? 35 VAL A HG22 14 
ATOM 8615  H HG23 . VAL A 1 35 ? -10.992 -36.869 22.883  1.00 0.00 ? 35 VAL A HG23 14 
ATOM 8616  N N    . ALA A 1 36 ? -10.949 -32.639 20.847  1.00 0.00 ? 36 ALA A N    14 
ATOM 8617  C CA   . ALA A 1 36 ? -11.202 -31.362 20.185  1.00 0.00 ? 36 ALA A CA   14 
ATOM 8618  C C    . ALA A 1 36 ? -9.922  -30.818 19.571  1.00 0.00 ? 36 ALA A C    14 
ATOM 8619  O O    . ALA A 1 36 ? -9.906  -30.375 18.423  1.00 0.00 ? 36 ALA A O    14 
ATOM 8620  C CB   . ALA A 1 36 ? -11.729 -30.343 21.183  1.00 0.00 ? 36 ALA A CB   14 
ATOM 8621  H H    . ALA A 1 36 ? -11.067 -32.688 21.849  1.00 0.00 ? 36 ALA A H    14 
ATOM 8622  H HA   . ALA A 1 36 ? -11.943 -31.515 19.400  1.00 0.00 ? 36 ALA A HA   14 
ATOM 8623  H HB1  . ALA A 1 36 ? -11.929 -29.398 20.676  1.00 0.00 ? 36 ALA A HB1  14 
ATOM 8624  H HB2  . ALA A 1 36 ? -12.652 -30.715 21.629  1.00 0.00 ? 36 ALA A HB2  14 
ATOM 8625  H HB3  . ALA A 1 36 ? -10.987 -30.183 21.965  1.00 0.00 ? 36 ALA A HB3  14 
ATOM 8626  N N    . GLY A 1 37 ? -8.847  -30.857 20.353  1.00 0.00 ? 37 GLY A N    14 
ATOM 8627  C CA   . GLY A 1 37 ? -7.543  -30.372 19.912  1.00 0.00 ? 37 GLY A CA   14 
ATOM 8628  C C    . GLY A 1 37 ? -7.191  -30.956 18.553  1.00 0.00 ? 37 GLY A C    14 
ATOM 8629  O O    . GLY A 1 37 ? -6.989  -30.230 17.581  1.00 0.00 ? 37 GLY A O    14 
ATOM 8630  H H    . GLY A 1 37 ? -8.925  -31.233 21.287  1.00 0.00 ? 37 GLY A H    14 
ATOM 8631  H HA2  . GLY A 1 37 ? -7.570  -29.284 19.840  1.00 0.00 ? 37 GLY A HA2  14 
ATOM 8632  H HA3  . GLY A 1 37 ? -6.786  -30.667 20.638  1.00 0.00 ? 37 GLY A HA3  14 
ATOM 8633  N N    . LEU A 1 38 ? -7.120  -32.283 18.499  1.00 0.00 ? 38 LEU A N    14 
ATOM 8634  C CA   . LEU A 1 38 ? -6.792  -32.998 17.268  1.00 0.00 ? 38 LEU A CA   14 
ATOM 8635  C C    . LEU A 1 38 ? -7.819  -32.696 16.189  1.00 0.00 ? 38 LEU A C    14 
ATOM 8636  O O    . LEU A 1 38 ? -7.481  -32.533 15.018  1.00 0.00 ? 38 LEU A O    14 
ATOM 8637  C CB   . LEU A 1 38 ? -6.777  -34.508 17.513  1.00 0.00 ? 38 LEU A CB   14 
ATOM 8638  C CG   . LEU A 1 38 ? -5.618  -35.047 18.355  1.00 0.00 ? 38 LEU A CG   14 
ATOM 8639  C CD1  . LEU A 1 38 ? -5.796  -36.533 18.626  1.00 0.00 ? 38 LEU A CD1  14 
ATOM 8640  C CD2  . LEU A 1 38 ? -4.293  -34.850 17.634  1.00 0.00 ? 38 LEU A CD2  14 
ATOM 8641  H H    . LEU A 1 38 ? -7.298  -32.825 19.333  1.00 0.00 ? 38 LEU A H    14 
ATOM 8642  H HA   . LEU A 1 38 ? -5.807  -32.678 16.929  1.00 0.00 ? 38 LEU A HA   14 
ATOM 8643  H HB2  . LEU A 1 38 ? -7.706  -34.771 18.019  1.00 0.00 ? 38 LEU A HB2  14 
ATOM 8644  H HB3  . LEU A 1 38 ? -6.740  -35.001 16.542  1.00 0.00 ? 38 LEU A HB3  14 
ATOM 8645  H HG   . LEU A 1 38 ? -5.595  -34.509 19.303  1.00 0.00 ? 38 LEU A HG   14 
ATOM 8646  H HD11 . LEU A 1 38 ? -4.971  -36.901 19.235  1.00 0.00 ? 38 LEU A HD11 14 
ATOM 8647  H HD12 . LEU A 1 38 ? -6.735  -36.694 19.157  1.00 0.00 ? 38 LEU A HD12 14 
ATOM 8648  H HD13 . LEU A 1 38 ? -5.817  -37.073 17.680  1.00 0.00 ? 38 LEU A HD13 14 
ATOM 8649  H HD21 . LEU A 1 38 ? -3.476  -35.227 18.249  1.00 0.00 ? 38 LEU A HD21 14 
ATOM 8650  H HD22 . LEU A 1 38 ? -4.312  -35.390 16.688  1.00 0.00 ? 38 LEU A HD22 14 
ATOM 8651  H HD23 . LEU A 1 38 ? -4.140  -33.788 17.443  1.00 0.00 ? 38 LEU A HD23 14 
ATOM 8652  N N    . ILE A 1 39 ? -9.081  -32.621 16.600  1.00 0.00 ? 39 ILE A N    14 
ATOM 8653  C CA   . ILE A 1 39 ? -10.184 -32.338 15.687  1.00 0.00 ? 39 ILE A CA   14 
ATOM 8654  C C    . ILE A 1 39 ? -9.972  -31.004 14.992  1.00 0.00 ? 39 ILE A C    14 
ATOM 8655  O O    . ILE A 1 39 ? -10.168 -30.877 13.784  1.00 0.00 ? 39 ILE A O    14 
ATOM 8656  C CB   . ILE A 1 39 ? -11.531 -32.275 16.431  1.00 0.00 ? 39 ILE A CB   14 
ATOM 8657  C CG1  . ILE A 1 39 ? -11.909 -33.657 16.968  1.00 0.00 ? 39 ILE A CG1  14 
ATOM 8658  C CG2  . ILE A 1 39 ? -12.634 -31.801 15.497  1.00 0.00 ? 39 ILE A CG2  14 
ATOM 8659  C CD1  . ILE A 1 39 ? -12.072 -34.706 15.890  1.00 0.00 ? 39 ILE A CD1  14 
ATOM 8660  H H    . ILE A 1 39 ? -9.296  -32.762 17.577  1.00 0.00 ? 39 ILE A H    14 
ATOM 8661  H HA   . ILE A 1 39 ? -10.225 -33.131 14.941  1.00 0.00 ? 39 ILE A HA   14 
ATOM 8662  H HB   . ILE A 1 39 ? -11.442 -31.577 17.264  1.00 0.00 ? 39 ILE A HB   14 
ATOM 8663  H HG12 . ILE A 1 39 ? -11.127 -33.986 17.652  1.00 0.00 ? 39 ILE A HG12 14 
ATOM 8664  H HG13 . ILE A 1 39 ? -12.852 -33.570 17.508  1.00 0.00 ? 39 ILE A HG13 14 
ATOM 8665  H HG21 . ILE A 1 39 ? -13.580 -31.750 16.037  1.00 0.00 ? 39 ILE A HG21 14 
ATOM 8666  H HG22 . ILE A 1 39 ? -12.384 -30.811 15.114  1.00 0.00 ? 39 ILE A HG22 14 
ATOM 8667  H HG23 . ILE A 1 39 ? -12.730 -32.499 14.666  1.00 0.00 ? 39 ILE A HG23 14 
ATOM 8668  H HD11 . ILE A 1 39 ? -12.340 -35.667 16.329  1.00 0.00 ? 39 ILE A HD11 14 
ATOM 8669  H HD12 . ILE A 1 39 ? -12.860 -34.396 15.203  1.00 0.00 ? 39 ILE A HD12 14 
ATOM 8670  H HD13 . ILE A 1 39 ? -11.134 -34.810 15.345  1.00 0.00 ? 39 ILE A HD13 14 
ATOM 8671  N N    . TYR A 1 40 ? -9.566  -30.008 15.774  1.00 0.00 ? 40 TYR A N    14 
ATOM 8672  C CA   . TYR A 1 40 ? -9.317  -28.664 15.259  1.00 0.00 ? 40 TYR A CA   14 
ATOM 8673  C C    . TYR A 1 40 ? -8.093  -28.657 14.358  1.00 0.00 ? 40 TYR A C    14 
ATOM 8674  O O    . TYR A 1 40 ? -8.082  -28.020 13.306  1.00 0.00 ? 40 TYR A O    14 
ATOM 8675  C CB   . TYR A 1 40 ? -9.075  -27.685 16.410  1.00 0.00 ? 40 TYR A CB   14 
ATOM 8676  C CG   . TYR A 1 40 ? -8.835  -26.261 15.963  1.00 0.00 ? 40 TYR A CG   14 
ATOM 8677  C CD1  . TYR A 1 40 ? -9.892  -25.450 15.572  1.00 0.00 ? 40 TYR A CD1  14 
ATOM 8678  C CD2  . TYR A 1 40 ? -7.551  -25.732 15.933  1.00 0.00 ? 40 TYR A CD2  14 
ATOM 8679  C CE1  . TYR A 1 40 ? -9.682  -24.147 15.162  1.00 0.00 ? 40 TYR A CE1  14 
ATOM 8680  C CE2  . TYR A 1 40 ? -7.321  -24.432 15.526  1.00 0.00 ? 40 TYR A CE2  14 
ATOM 8681  C CZ   . TYR A 1 40 ? -8.401  -23.639 15.139  1.00 0.00 ? 40 TYR A CZ   14 
ATOM 8682  O OH   . TYR A 1 40 ? -8.189  -22.343 14.731  1.00 0.00 ? 40 TYR A OH   14 
ATOM 8683  H H    . TYR A 1 40 ? -9.423  -30.175 16.760  1.00 0.00 ? 40 TYR A H    14 
ATOM 8684  H HA   . TYR A 1 40 ? -10.188 -28.341 14.689  1.00 0.00 ? 40 TYR A HA   14 
ATOM 8685  H HB2  . TYR A 1 40 ? -9.946  -27.699 17.066  1.00 0.00 ? 40 TYR A HB2  14 
ATOM 8686  H HB3  . TYR A 1 40 ? -8.206  -28.021 16.975  1.00 0.00 ? 40 TYR A HB3  14 
ATOM 8687  H HD1  . TYR A 1 40 ? -10.898 -25.844 15.589  1.00 0.00 ? 40 TYR A HD1  14 
ATOM 8688  H HD2  . TYR A 1 40 ? -6.717  -26.348 16.234  1.00 0.00 ? 40 TYR A HD2  14 
ATOM 8689  H HE1  . TYR A 1 40 ? -10.517 -23.530 14.861  1.00 0.00 ? 40 TYR A HE1  14 
ATOM 8690  H HE2  . TYR A 1 40 ? -6.317  -24.034 15.508  1.00 0.00 ? 40 TYR A HE2  14 
ATOM 8691  H HH   . TYR A 1 40 ? -7.264  -22.089 14.752  1.00 0.00 ? 40 TYR A HH   14 
ATOM 8692  N N    . SER A 1 41 ? -7.059  -29.377 14.786  1.00 0.00 ? 41 SER A N    14 
ATOM 8693  C CA   . SER A 1 41 ? -5.812  -29.474 14.035  1.00 0.00 ? 41 SER A CA   14 
ATOM 8694  C C    . SER A 1 41 ? -6.063  -30.064 12.657  1.00 0.00 ? 41 SER A C    14 
ATOM 8695  O O    . SER A 1 41 ? -5.630  -29.520 11.643  1.00 0.00 ? 41 SER A O    14 
ATOM 8696  C CB   . SER A 1 41 ? -4.813  -30.370 14.769  1.00 0.00 ? 41 SER A CB   14 
ATOM 8697  O OG   . SER A 1 41 ? -4.412  -29.789 15.998  1.00 0.00 ? 41 SER A OG   14 
ATOM 8698  H H    . SER A 1 41 ? -7.130  -29.878 15.660  1.00 0.00 ? 41 SER A H    14 
ATOM 8699  H HA   . SER A 1 41 ? -5.390  -28.474 13.929  1.00 0.00 ? 41 SER A HA   14 
ATOM 8700  H HB2  . SER A 1 41 ? -5.280  -31.335 14.968  1.00 0.00 ? 41 SER A HB2  14 
ATOM 8701  H HB3  . SER A 1 41 ? -3.935  -30.513 14.141  1.00 0.00 ? 41 SER A HB3  14 
ATOM 8702  H HG   . SER A 1 41 ? -3.788  -30.375 16.431  1.00 0.00 ? 41 SER A HG   14 
ATOM 8703  N N    . MET A 1 42 ? -6.773  -31.189 12.635  1.00 0.00 ? 42 MET A N    14 
ATOM 8704  C CA   . MET A 1 42 ? -7.101  -31.880 11.391  1.00 0.00 ? 42 MET A CA   14 
ATOM 8705  C C    . MET A 1 42 ? -7.992  -31.012 10.518  1.00 0.00 ? 42 MET A C    14 
ATOM 8706  O O    . MET A 1 42 ? -7.818  -30.942 9.302   1.00 0.00 ? 42 MET A O    14 
ATOM 8707  C CB   . MET A 1 42 ? -7.838  -33.189 11.683  1.00 0.00 ? 42 MET A CB   14 
ATOM 8708  C CG   . MET A 1 42 ? -8.146  -34.017 10.447  1.00 0.00 ? 42 MET A CG   14 
ATOM 8709  S SD   . MET A 1 42 ? -8.986  -35.564 10.837  1.00 0.00 ? 42 MET A SD   14 
ATOM 8710  C CE   . MET A 1 42 ? -10.596 -34.959 11.334  1.00 0.00 ? 42 MET A CE   14 
ATOM 8711  H H    . MET A 1 42 ? -7.101  -31.588 13.503  1.00 0.00 ? 42 MET A H    14 
ATOM 8712  H HA   . MET A 1 42 ? -6.176  -32.098 10.858  1.00 0.00 ? 42 MET A HA   14 
ATOM 8713  H HB2  . MET A 1 42 ? -7.220  -33.788 12.352  1.00 0.00 ? 42 MET A HB2  14 
ATOM 8714  H HB3  . MET A 1 42 ? -8.780  -32.948 12.177  1.00 0.00 ? 42 MET A HB3  14 
ATOM 8715  H HG2  . MET A 1 42 ? -8.780  -33.432 9.780   1.00 0.00 ? 42 MET A HG2  14 
ATOM 8716  H HG3  . MET A 1 42 ? -7.213  -34.244 9.933   1.00 0.00 ? 42 MET A HG3  14 
ATOM 8717  H HE1  . MET A 1 42 ? -11.240 -35.795 11.608  1.00 0.00 ? 42 MET A HE1  14 
ATOM 8718  H HE2  . MET A 1 42 ? -10.485 -34.294 12.191  1.00 0.00 ? 42 MET A HE2  14 
ATOM 8719  H HE3  . MET A 1 42 ? -11.049 -34.412 10.507  1.00 0.00 ? 42 MET A HE3  14 
ATOM 8720  N N    . LEU A 1 43 ? -8.952  -30.349 11.157  1.00 0.00 ? 43 LEU A N    14 
ATOM 8721  C CA   . LEU A 1 43 ? -9.890  -29.473 10.463  1.00 0.00 ? 43 LEU A CA   14 
ATOM 8722  C C    . LEU A 1 43 ? -9.213  -28.170 10.072  1.00 0.00 ? 43 LEU A C    14 
ATOM 8723  O O    . LEU A 1 43 ? -9.431  -27.641 8.983   1.00 0.00 ? 43 LEU A O    14 
ATOM 8724  C CB   . LEU A 1 43 ? -11.084 -29.146 11.362  1.00 0.00 ? 43 LEU A CB   14 
ATOM 8725  C CG   . LEU A 1 43 ? -12.058 -30.293 11.639  1.00 0.00 ? 43 LEU A CG   14 
ATOM 8726  C CD1  . LEU A 1 43 ? -13.119 -29.867 12.642  1.00 0.00 ? 43 LEU A CD1  14 
ATOM 8727  C CD2  . LEU A 1 43 ? -12.759 -30.723 10.360  1.00 0.00 ? 43 LEU A CD2  14 
ATOM 8728  H H    . LEU A 1 43 ? -9.044  -30.448 12.158  1.00 0.00 ? 43 LEU A H    14 
ATOM 8729  H HA   . LEU A 1 43 ? -10.244 -29.980 9.565   1.00 0.00 ? 43 LEU A HA   14 
ATOM 8730  H HB2  . LEU A 1 43 ? -10.694 -28.802 12.320  1.00 0.00 ? 43 LEU A HB2  14 
ATOM 8731  H HB3  . LEU A 1 43 ? -11.646 -28.340 10.889  1.00 0.00 ? 43 LEU A HB3  14 
ATOM 8732  H HG   . LEU A 1 43 ? -11.500 -31.137 12.044  1.00 0.00 ? 43 LEU A HG   14 
ATOM 8733  H HD11 . LEU A 1 43 ? -13.800 -30.695 12.838  1.00 0.00 ? 43 LEU A HD11 14 
ATOM 8734  H HD12 . LEU A 1 43 ? -12.638 -29.568 13.573  1.00 0.00 ? 43 LEU A HD12 14 
ATOM 8735  H HD13 . LEU A 1 43 ? -13.683 -29.025 12.238  1.00 0.00 ? 43 LEU A HD13 14 
ATOM 8736  H HD21 . LEU A 1 43 ? -13.441 -31.547 10.569  1.00 0.00 ? 43 LEU A HD21 14 
ATOM 8737  H HD22 . LEU A 1 43 ? -13.323 -29.882 9.956   1.00 0.00 ? 43 LEU A HD22 14 
ATOM 8738  H HD23 . LEU A 1 43 ? -12.016 -31.046 9.631   1.00 0.00 ? 43 LEU A HD23 14 
ATOM 8739  N N    . ARG A 1 44 ? -8.386  -27.657 10.978  1.00 0.00 ? 44 ARG A N    14 
ATOM 8740  C CA   . ARG A 1 44 ? -7.658  -26.411 10.755  1.00 0.00 ? 44 ARG A CA   14 
ATOM 8741  C C    . ARG A 1 44 ? -6.405  -26.666 9.934   1.00 0.00 ? 44 ARG A C    14 
ATOM 8742  O O    . ARG A 1 44 ? -5.984  -25.829 9.138   1.00 0.00 ? 44 ARG A O    14 
ATOM 8743  C CB   . ARG A 1 44 ? -7.243  -25.787 12.089  1.00 0.00 ? 44 ARG A CB   14 
ATOM 8744  C CG   . ARG A 1 44 ? -6.557  -24.437 11.956  1.00 0.00 ? 44 ARG A CG   14 
ATOM 8745  C CD   . ARG A 1 44 ? -7.516  -23.380 11.431  1.00 0.00 ? 44 ARG A CD   14 
ATOM 8746  N NE   . ARG A 1 44 ? -6.877  -22.072 11.313  1.00 0.00 ? 44 ARG A NE   14 
ATOM 8747  C CZ   . ARG A 1 44 ? -7.435  -21.017 10.728  1.00 0.00 ? 44 ARG A CZ   14 
ATOM 8748  N NH1  . ARG A 1 44 ? -8.650  -21.116 10.205  1.00 0.00 ? 44 ARG A NH1  14 
ATOM 8749  N NH2  . ARG A 1 44 ? -6.778  -19.867 10.667  1.00 0.00 ? 44 ARG A NH2  14 
ATOM 8750  H H    . ARG A 1 44 ? -8.250  -28.137 11.856  1.00 0.00 ? 44 ARG A H    14 
ATOM 8751  H HA   . ARG A 1 44 ? -8.307  -25.717 10.219  1.00 0.00 ? 44 ARG A HA   14 
ATOM 8752  H HB2  . ARG A 1 44 ? -8.137  -25.658 12.700  1.00 0.00 ? 44 ARG A HB2  14 
ATOM 8753  H HB3  . ARG A 1 44 ? -6.558  -26.471 12.588  1.00 0.00 ? 44 ARG A HB3  14 
ATOM 8754  H HG2  . ARG A 1 44 ? -6.189  -24.127 12.934  1.00 0.00 ? 44 ARG A HG2  14 
ATOM 8755  H HG3  . ARG A 1 44 ? -5.719  -24.530 11.266  1.00 0.00 ? 44 ARG A HG3  14 
ATOM 8756  H HD2  . ARG A 1 44 ? -7.877  -23.686 10.449  1.00 0.00 ? 44 ARG A HD2  14 
ATOM 8757  H HD3  . ARG A 1 44 ? -8.362  -23.299 12.114  1.00 0.00 ? 44 ARG A HD3  14 
ATOM 8758  H HE   . ARG A 1 44 ? -5.952  -21.974 11.705  1.00 0.00 ? 44 ARG A HE   14 
ATOM 8759  H HH11 . ARG A 1 44 ? -9.151  -21.992 10.252  1.00 0.00 ? 44 ARG A HH11 14 
ATOM 8760  H HH12 . ARG A 1 44 ? -9.075  -20.314 9.760   1.00 0.00 ? 44 ARG A HH12 14 
ATOM 8761  H HH21 . ARG A 1 44 ? -5.853  -19.792 11.065  1.00 0.00 ? 44 ARG A HH21 14 
ATOM 8762  H HH22 . ARG A 1 44 ? -7.203  -19.066 10.222  1.00 0.00 ? 44 ARG A HH22 14 
ATOM 8763  N N    . LYS A 1 45 ? -5.812  -27.839 10.140  1.00 0.00 ? 45 LYS A N    14 
ATOM 8764  C CA   . LYS A 1 45 ? -4.600  -28.236 9.430   1.00 0.00 ? 45 LYS A CA   14 
ATOM 8765  C C    . LYS A 1 45 ? -4.918  -28.585 7.986   1.00 0.00 ? 45 LYS A C    14 
ATOM 8766  O O    . LYS A 1 45 ? -4.232  -28.153 7.061   1.00 0.00 ? 45 LYS A O    14 
ATOM 8767  C CB   . LYS A 1 45 ? -3.966  -29.460 10.094  1.00 0.00 ? 45 LYS A CB   14 
ATOM 8768  C CG   . LYS A 1 45 ? -2.666  -29.912 9.450   1.00 0.00 ? 45 LYS A CG   14 
ATOM 8769  C CD   . LYS A 1 45 ? -2.064  -31.094 10.192  1.00 0.00 ? 45 LYS A CD   14 
ATOM 8770  C CE   . LYS A 1 45 ? -0.772  -31.556 9.540   1.00 0.00 ? 45 LYS A CE   14 
ATOM 8771  N NZ   . LYS A 1 45 ? -0.164  -32.707 10.263  1.00 0.00 ? 45 LYS A NZ   14 
ATOM 8772  H H    . LYS A 1 45 ? -6.206  -28.485 10.809  1.00 0.00 ? 45 LYS A H    14 
ATOM 8773  H HA   . LYS A 1 45 ? -3.894  -27.406 9.454   1.00 0.00 ? 45 LYS A HA   14 
ATOM 8774  H HB2  . LYS A 1 45 ? -3.765  -29.217 11.138  1.00 0.00 ? 45 LYS A HB2  14 
ATOM 8775  H HB3  . LYS A 1 45 ? -4.678  -30.284 10.043  1.00 0.00 ? 45 LYS A HB3  14 
ATOM 8776  H HG2  . LYS A 1 45 ? -2.864  -30.203 8.419   1.00 0.00 ? 45 LYS A HG2  14 
ATOM 8777  H HG3  . LYS A 1 45 ? -1.957  -29.085 9.464   1.00 0.00 ? 45 LYS A HG3  14 
ATOM 8778  H HD2  . LYS A 1 45 ? -1.857  -30.799 11.221  1.00 0.00 ? 45 LYS A HD2  14 
ATOM 8779  H HD3  . LYS A 1 45 ? -2.779  -31.917 10.187  1.00 0.00 ? 45 LYS A HD3  14 
ATOM 8780  H HE2  . LYS A 1 45 ? -0.982  -31.854 8.513   1.00 0.00 ? 45 LYS A HE2  14 
ATOM 8781  H HE3  . LYS A 1 45 ? -0.064  -30.728 9.535   1.00 0.00 ? 45 LYS A HE3  14 
ATOM 8782  H HZ1  . LYS A 1 45 ? 0.690   -32.986 9.803   1.00 0.00 ? 45 LYS A HZ1  14 
ATOM 8783  H HZ2  . LYS A 1 45 ? 0.040   -32.435 11.214  1.00 0.00 ? 45 LYS A HZ2  14 
ATOM 8784  H HZ3  . LYS A 1 45 ? -0.812  -33.481 10.266  1.00 0.00 ? 45 LYS A HZ3  14 
ATOM 8785  N N    . ALA A 1 46 ? -5.972  -29.376 7.805   1.00 0.00 ? 46 ALA A N    14 
ATOM 8786  C CA   . ALA A 1 46 ? -6.409  -29.803 6.479   1.00 0.00 ? 46 ALA A CA   14 
ATOM 8787  C C    . ALA A 1 46 ? -7.637  -30.694 6.603   1.00 0.00 ? 46 ALA A C    14 
ATOM 8788  O O    . ALA A 1 46 ? -8.110  -30.954 7.707   1.00 0.00 ? 46 ALA A O    14 
ATOM 8789  C CB   . ALA A 1 46 ? -5.271  -30.543 5.783   1.00 0.00 ? 46 ALA A CB   14 
ATOM 8790  H H    . ALA A 1 46 ? -6.496  -29.699 8.606   1.00 0.00 ? 46 ALA A H    14 
ATOM 8791  H HA   . ALA A 1 46 ? -6.670  -28.921 5.893   1.00 0.00 ? 46 ALA A HA   14 
ATOM 8792  H HB1  . ALA A 1 46 ? -5.594  -30.848 4.787   1.00 0.00 ? 46 ALA A HB1  14 
ATOM 8793  H HB2  . ALA A 1 46 ? -4.406  -29.884 5.699   1.00 0.00 ? 46 ALA A HB2  14 
ATOM 8794  H HB3  . ALA A 1 46 ? -5.001  -31.425 6.364   1.00 0.00 ? 46 ALA A HB3  14 
ATOM 8795  N N    . GLY A 1 1  ? 26.098  -37.648 68.372  1.00 0.00 ? 1  GLY A N    15 
ATOM 8796  C CA   . GLY A 1 1  ? 26.689  -38.971 68.415  1.00 0.00 ? 1  GLY A CA   15 
ATOM 8797  C C    . GLY A 1 1  ? 26.136  -39.824 67.285  1.00 0.00 ? 1  GLY A C    15 
ATOM 8798  O O    . GLY A 1 1  ? 25.309  -39.369 66.498  1.00 0.00 ? 1  GLY A O    15 
ATOM 8799  H H1   . GLY A 1 1  ? 25.426  -37.443 67.647  1.00 0.00 ? 1  GLY A H1   15 
ATOM 8800  H HA2  . GLY A 1 1  ? 27.770  -38.887 68.309  1.00 0.00 ? 1  GLY A HA2  15 
ATOM 8801  H HA3  . GLY A 1 1  ? 26.455  -39.440 69.370  1.00 0.00 ? 1  GLY A HA3  15 
ATOM 8802  N N    . VAL A 1 2  ? 26.607  -41.067 67.220  1.00 0.00 ? 2  VAL A N    15 
ATOM 8803  C CA   . VAL A 1 2  ? 26.177  -42.011 66.194  1.00 0.00 ? 2  VAL A CA   15 
ATOM 8804  C C    . VAL A 1 2  ? 24.733  -42.428 66.425  1.00 0.00 ? 2  VAL A C    15 
ATOM 8805  O O    . VAL A 1 2  ? 23.933  -42.492 65.493  1.00 0.00 ? 2  VAL A O    15 
ATOM 8806  C CB   . VAL A 1 2  ? 27.044  -43.284 66.199  1.00 0.00 ? 2  VAL A CB   15 
ATOM 8807  C CG1  . VAL A 1 2  ? 26.465  -44.326 65.255  1.00 0.00 ? 2  VAL A CG1  15 
ATOM 8808  C CG2  . VAL A 1 2  ? 28.462  -42.965 65.752  1.00 0.00 ? 2  VAL A CG2  15 
ATOM 8809  H H    . VAL A 1 2  ? 27.286  -41.378 67.900  1.00 0.00 ? 2  VAL A H    15 
ATOM 8810  H HA   . VAL A 1 2  ? 26.261  -41.525 65.222  1.00 0.00 ? 2  VAL A HA   15 
ATOM 8811  H HB   . VAL A 1 2  ? 27.068  -43.689 67.211  1.00 0.00 ? 2  VAL A HB   15 
ATOM 8812  H HG11 . VAL A 1 2  ? 27.081  -45.224 65.274  1.00 0.00 ? 2  VAL A HG11 15 
ATOM 8813  H HG12 . VAL A 1 2  ? 25.451  -44.576 65.569  1.00 0.00 ? 2  VAL A HG12 15 
ATOM 8814  H HG13 . VAL A 1 2  ? 26.442  -43.924 64.242  1.00 0.00 ? 2  VAL A HG13 15 
ATOM 8815  H HG21 . VAL A 1 2  ? 29.067  -43.871 65.768  1.00 0.00 ? 2  VAL A HG21 15 
ATOM 8816  H HG22 . VAL A 1 2  ? 28.440  -42.562 64.739  1.00 0.00 ? 2  VAL A HG22 15 
ATOM 8817  H HG23 . VAL A 1 2  ? 28.897  -42.227 66.427  1.00 0.00 ? 2  VAL A HG23 15 
ATOM 8818  N N    . ILE A 1 3  ? 24.411  -42.711 67.684  1.00 0.00 ? 3  ILE A N    15 
ATOM 8819  C CA   . ILE A 1 3  ? 23.066  -43.125 68.071  1.00 0.00 ? 3  ILE A CA   15 
ATOM 8820  C C    . ILE A 1 3  ? 22.079  -41.989 67.863  1.00 0.00 ? 3  ILE A C    15 
ATOM 8821  O O    . ILE A 1 3  ? 20.951  -42.199 67.419  1.00 0.00 ? 3  ILE A O    15 
ATOM 8822  C CB   . ILE A 1 3  ? 23.007  -43.538 69.554  1.00 0.00 ? 3  ILE A CB   15 
ATOM 8823  C CG1  . ILE A 1 3  ? 23.824  -44.810 69.786  1.00 0.00 ? 3  ILE A CG1  15 
ATOM 8824  C CG2  . ILE A 1 3  ? 21.570  -43.803 69.976  1.00 0.00 ? 3  ILE A CG2  15 
ATOM 8825  C CD1  . ILE A 1 3  ? 24.025  -45.149 71.247  1.00 0.00 ? 3  ILE A CD1  15 
ATOM 8826  H H    . ILE A 1 3  ? 25.113  -42.639 68.406  1.00 0.00 ? 3  ILE A H    15 
ATOM 8827  H HA   . ILE A 1 3  ? 22.775  -43.974 67.452  1.00 0.00 ? 3  ILE A HA   15 
ATOM 8828  H HB   . ILE A 1 3  ? 23.417  -42.731 70.161  1.00 0.00 ? 3  ILE A HB   15 
ATOM 8829  H HG12 . ILE A 1 3  ? 23.307  -45.642 69.308  1.00 0.00 ? 3  ILE A HG12 15 
ATOM 8830  H HG13 . ILE A 1 3  ? 24.803  -44.678 69.326  1.00 0.00 ? 3  ILE A HG13 15 
ATOM 8831  H HG21 . ILE A 1 3  ? 21.539  -44.084 71.029  1.00 0.00 ? 3  ILE A HG21 15 
ATOM 8832  H HG22 . ILE A 1 3  ? 20.976  -42.901 69.826  1.00 0.00 ? 3  ILE A HG22 15 
ATOM 8833  H HG23 . ILE A 1 3  ? 21.158  -44.613 69.374  1.00 0.00 ? 3  ILE A HG23 15 
ATOM 8834  H HD11 . ILE A 1 3  ? 24.610  -46.062 71.351  1.00 0.00 ? 3  ILE A HD11 15 
ATOM 8835  H HD12 . ILE A 1 3  ? 24.550  -44.329 71.738  1.00 0.00 ? 3  ILE A HD12 15 
ATOM 8836  H HD13 . ILE A 1 3  ? 23.053  -45.292 71.720  1.00 0.00 ? 3  ILE A HD13 15 
ATOM 8837  N N    . ASP A 1 4  ? 22.519  -40.777 68.191  1.00 0.00 ? 4  ASP A N    15 
ATOM 8838  C CA   . ASP A 1 4  ? 21.692  -39.583 68.051  1.00 0.00 ? 4  ASP A CA   15 
ATOM 8839  C C    . ASP A 1 4  ? 21.118  -39.495 66.646  1.00 0.00 ? 4  ASP A C    15 
ATOM 8840  O O    . ASP A 1 4  ? 19.957  -39.134 66.455  1.00 0.00 ? 4  ASP A O    15 
ATOM 8841  C CB   . ASP A 1 4  ? 22.520  -38.324 68.315  1.00 0.00 ? 4  ASP A CB   15 
ATOM 8842  C CG   . ASP A 1 4  ? 22.884  -38.162 69.778  1.00 0.00 ? 4  ASP A CG   15 
ATOM 8843  O OD1  . ASP A 1 4  ? 23.431  -37.099 70.140  1.00 0.00 ? 4  ASP A OD1  15 
ATOM 8844  O OD2  . ASP A 1 4  ? 22.623  -39.098 70.562  1.00 0.00 ? 4  ASP A OD2  15 
ATOM 8845  H H    . ASP A 1 4  ? 23.456  -40.668 68.551  1.00 0.00 ? 4  ASP A H    15 
ATOM 8846  H HA   . ASP A 1 4  ? 20.876  -39.635 68.772  1.00 0.00 ? 4  ASP A HA   15 
ATOM 8847  H HB2  . ASP A 1 4  ? 23.437  -38.378 67.730  1.00 0.00 ? 4  ASP A HB2  15 
ATOM 8848  H HB3  . ASP A 1 4  ? 21.944  -37.453 67.999  1.00 0.00 ? 4  ASP A HB3  15 
ATOM 8849  H HD2  . ASP A 1 4  ? 22.880  -38.928 71.471  1.00 0.00 ? 4  ASP A HD2  15 
ATOM 8850  N N    . THR A 1 5  ? 21.949  -39.830 65.663  1.00 0.00 ? 5  THR A N    15 
ATOM 8851  C CA   . THR A 1 5  ? 21.550  -39.798 64.259  1.00 0.00 ? 5  THR A CA   15 
ATOM 8852  C C    . THR A 1 5  ? 21.081  -41.172 63.808  1.00 0.00 ? 5  THR A C    15 
ATOM 8853  O O    . THR A 1 5  ? 20.678  -41.362 62.662  1.00 0.00 ? 5  THR A O    15 
ATOM 8854  C CB   . THR A 1 5  ? 22.718  -39.374 63.350  1.00 0.00 ? 5  THR A CB   15 
ATOM 8855  O OG1  . THR A 1 5  ? 23.786  -40.323 63.465  1.00 0.00 ? 5  THR A OG1  15 
ATOM 8856  C CG2  . THR A 1 5  ? 23.235  -38.001 63.751  1.00 0.00 ? 5  THR A CG2  15 
ATOM 8857  H H    . THR A 1 5  ? 22.891  -40.118 65.885  1.00 0.00 ? 5  THR A H    15 
ATOM 8858  H HA   . THR A 1 5  ? 20.734  -39.083 64.149  1.00 0.00 ? 5  THR A HA   15 
ATOM 8859  H HB   . THR A 1 5  ? 22.372  -39.340 62.317  1.00 0.00 ? 5  THR A HB   15 
ATOM 8860  H HG1  . THR A 1 5  ? 24.502  -40.049 62.887  1.00 0.00 ? 5  THR A HG1  15 
ATOM 8861  H HG21 . THR A 1 5  ? 24.059  -37.712 63.099  1.00 0.00 ? 5  THR A HG21 15 
ATOM 8862  H HG22 . THR A 1 5  ? 22.430  -37.270 63.662  1.00 0.00 ? 5  THR A HG22 15 
ATOM 8863  H HG23 . THR A 1 5  ? 23.584  -38.032 64.783  1.00 0.00 ? 5  THR A HG23 15 
ATOM 8864  N N    . SER A 1 6  ? 21.139  -42.130 64.729  1.00 0.00 ? 6  SER A N    15 
ATOM 8865  C CA   . SER A 1 6  ? 20.725  -43.502 64.453  1.00 0.00 ? 6  SER A CA   15 
ATOM 8866  C C    . SER A 1 6  ? 19.361  -43.523 63.781  1.00 0.00 ? 6  SER A C    15 
ATOM 8867  O O    . SER A 1 6  ? 19.209  -44.015 62.664  1.00 0.00 ? 6  SER A O    15 
ATOM 8868  C CB   . SER A 1 6  ? 20.636  -44.306 65.751  1.00 0.00 ? 6  SER A CB   15 
ATOM 8869  O OG   . SER A 1 6  ? 20.226  -45.639 65.499  1.00 0.00 ? 6  SER A OG   15 
ATOM 8870  H H    . SER A 1 6  ? 21.478  -41.911 65.655  1.00 0.00 ? 6  SER A H    15 
ATOM 8871  H HA   . SER A 1 6  ? 21.460  -43.963 63.793  1.00 0.00 ? 6  SER A HA   15 
ATOM 8872  H HB2  . SER A 1 6  ? 21.615  -44.319 66.229  1.00 0.00 ? 6  SER A HB2  15 
ATOM 8873  H HB3  . SER A 1 6  ? 19.913  -43.831 66.415  1.00 0.00 ? 6  SER A HB3  15 
ATOM 8874  H HG   . SER A 1 6  ? 20.180  -46.114 66.332  1.00 0.00 ? 6  SER A HG   15 
ATOM 8875  N N    . ALA A 1 7  ? 18.368  -42.980 64.480  1.00 0.00 ? 7  ALA A N    15 
ATOM 8876  C CA   . ALA A 1 7  ? 17.000  -42.921 63.974  1.00 0.00 ? 7  ALA A CA   15 
ATOM 8877  C C    . ALA A 1 7  ? 16.945  -42.130 62.677  1.00 0.00 ? 7  ALA A C    15 
ATOM 8878  O O    . ALA A 1 7  ? 16.254  -42.505 61.731  1.00 0.00 ? 7  ALA A O    15 
ATOM 8879  C CB   . ALA A 1 7  ? 16.088  -42.247 64.988  1.00 0.00 ? 7  ALA A CB   15 
ATOM 8880  H H    . ALA A 1 7  ? 18.555  -42.593 65.394  1.00 0.00 ? 7  ALA A H    15 
ATOM 8881  H HA   . ALA A 1 7  ? 16.649  -43.937 63.793  1.00 0.00 ? 7  ALA A HA   15 
ATOM 8882  H HB1  . ALA A 1 7  ? 15.066  -42.221 64.607  1.00 0.00 ? 7  ALA A HB1  15 
ATOM 8883  H HB2  . ALA A 1 7  ? 16.110  -42.806 65.924  1.00 0.00 ? 7  ALA A HB2  15 
ATOM 8884  H HB3  . ALA A 1 7  ? 16.433  -41.228 65.165  1.00 0.00 ? 7  ALA A HB3  15 
ATOM 8885  N N    . VAL A 1 8  ? 17.686  -41.026 62.646  1.00 0.00 ? 8  VAL A N    15 
ATOM 8886  C CA   . VAL A 1 8  ? 17.742  -40.157 61.474  1.00 0.00 ? 8  VAL A CA   15 
ATOM 8887  C C    . VAL A 1 8  ? 18.333  -40.901 60.288  1.00 0.00 ? 8  VAL A C    15 
ATOM 8888  O O    . VAL A 1 8  ? 17.857  -40.779 59.160  1.00 0.00 ? 8  VAL A O    15 
ATOM 8889  C CB   . VAL A 1 8  ? 18.612  -38.913 61.734  1.00 0.00 ? 8  VAL A CB   15 
ATOM 8890  C CG1  . VAL A 1 8  ? 18.827  -38.134 60.446  1.00 0.00 ? 8  VAL A CG1  15 
ATOM 8891  C CG2  . VAL A 1 8  ? 17.941  -37.996 62.745  1.00 0.00 ? 8  VAL A CG2  15 
ATOM 8892  H H    . VAL A 1 8  ? 18.232  -40.770 63.456  1.00 0.00 ? 8  VAL A H    15 
ATOM 8893  H HA   . VAL A 1 8  ? 16.727  -39.839 61.233  1.00 0.00 ? 8  VAL A HA   15 
ATOM 8894  H HB   . VAL A 1 8  ? 19.577  -39.233 62.125  1.00 0.00 ? 8  VAL A HB   15 
ATOM 8895  H HG11 . VAL A 1 8  ? 19.450  -37.261 60.641  1.00 0.00 ? 8  VAL A HG11 15 
ATOM 8896  H HG12 . VAL A 1 8  ? 19.319  -38.773 59.714  1.00 0.00 ? 8  VAL A HG12 15 
ATOM 8897  H HG13 . VAL A 1 8  ? 17.863  -37.808 60.054  1.00 0.00 ? 8  VAL A HG13 15 
ATOM 8898  H HG21 . VAL A 1 8  ? 18.569  -37.124 62.928  1.00 0.00 ? 8  VAL A HG21 15 
ATOM 8899  H HG22 . VAL A 1 8  ? 16.976  -37.670 62.355  1.00 0.00 ? 8  VAL A HG22 15 
ATOM 8900  H HG23 . VAL A 1 8  ? 17.791  -38.535 63.680  1.00 0.00 ? 8  VAL A HG23 15 
ATOM 8901  N N    . GLU A 1 9  ? 19.380  -41.676 60.558  1.00 0.00 ? 9  GLU A N    15 
ATOM 8902  C CA   . GLU A 1 9  ? 20.060  -42.456 59.528  1.00 0.00 ? 9  GLU A CA   15 
ATOM 8903  C C    . GLU A 1 9  ? 19.080  -43.386 58.831  1.00 0.00 ? 9  GLU A C    15 
ATOM 8904  O O    . GLU A 1 9  ? 19.140  -43.580 57.618  1.00 0.00 ? 9  GLU A O    15 
ATOM 8905  C CB   . GLU A 1 9  ? 21.175  -43.303 60.146  1.00 0.00 ? 9  GLU A CB   15 
ATOM 8906  C CG   . GLU A 1 9  ? 21.984  -44.097 59.134  1.00 0.00 ? 9  GLU A CG   15 
ATOM 8907  C CD   . GLU A 1 9  ? 23.110  -44.883 59.776  1.00 0.00 ? 9  GLU A CD   15 
ATOM 8908  O OE1  . GLU A 1 9  ? 23.256  -44.808 61.014  1.00 0.00 ? 9  GLU A OE1  15 
ATOM 8909  O OE2  . GLU A 1 9  ? 23.846  -45.575 59.041  1.00 0.00 ? 9  GLU A OE2  15 
ATOM 8910  H H    . GLU A 1 9  ? 19.724  -41.734 61.506  1.00 0.00 ? 9  GLU A H    15 
ATOM 8911  H HA   . GLU A 1 9  ? 20.491  -41.771 58.798  1.00 0.00 ? 9  GLU A HA   15 
ATOM 8912  H HB2  . GLU A 1 9  ? 21.853  -42.638 60.681  1.00 0.00 ? 9  GLU A HB2  15 
ATOM 8913  H HB3  . GLU A 1 9  ? 20.723  -44.003 60.849  1.00 0.00 ? 9  GLU A HB3  15 
ATOM 8914  H HG2  . GLU A 1 9  ? 21.319  -44.792 58.622  1.00 0.00 ? 9  GLU A HG2  15 
ATOM 8915  H HG3  . GLU A 1 9  ? 22.409  -43.406 58.406  1.00 0.00 ? 9  GLU A HG3  15 
ATOM 8916  H HE2  . GLU A 1 9  ? 24.536  -46.045 59.513  1.00 0.00 ? 9  GLU A HE2  15 
ATOM 8917  N N    . SER A 1 10 ? 18.174  -43.960 59.617  1.00 0.00 ? 10 SER A N    15 
ATOM 8918  C CA   . SER A 1 10 ? 17.164  -44.879 59.101  1.00 0.00 ? 10 SER A CA   15 
ATOM 8919  C C    . SER A 1 10 ? 16.000  -44.108 58.500  1.00 0.00 ? 10 SER A C    15 
ATOM 8920  O O    . SER A 1 10 ? 15.552  -44.394 57.391  1.00 0.00 ? 10 SER A O    15 
ATOM 8921  C CB   . SER A 1 10 ? 16.626  -45.769 60.223  1.00 0.00 ? 10 SER A CB   15 
ATOM 8922  O OG   . SER A 1 10 ? 17.647  -46.599 60.750  1.00 0.00 ? 10 SER A OG   15 
ATOM 8923  H H    . SER A 1 10 ? 18.175  -43.759 60.607  1.00 0.00 ? 10 SER A H    15 
ATOM 8924  H HA   . SER A 1 10 ? 17.619  -45.503 58.333  1.00 0.00 ? 10 SER A HA   15 
ATOM 8925  H HB2  . SER A 1 10 ? 16.233  -45.138 61.021  1.00 0.00 ? 10 SER A HB2  15 
ATOM 8926  H HB3  . SER A 1 10 ? 15.826  -46.396 59.828  1.00 0.00 ? 10 SER A HB3  15 
ATOM 8927  H HG   . SER A 1 10 ? 17.276  -47.142 61.450  1.00 0.00 ? 10 SER A HG   15 
ATOM 8928  N N    . ALA A 1 11 ? 15.515  -43.122 59.251  1.00 0.00 ? 11 ALA A N    15 
ATOM 8929  C CA   . ALA A 1 11 ? 14.399  -42.288 58.816  1.00 0.00 ? 11 ALA A CA   15 
ATOM 8930  C C    . ALA A 1 11 ? 14.801  -41.441 57.620  1.00 0.00 ? 11 ALA A C    15 
ATOM 8931  O O    . ALA A 1 11 ? 14.020  -41.241 56.691  1.00 0.00 ? 11 ALA A O    15 
ATOM 8932  C CB   . ALA A 1 11 ? 13.962  -41.359 59.939  1.00 0.00 ? 11 ALA A CB   15 
ATOM 8933  H H    . ALA A 1 11 ? 15.925  -42.936 60.155  1.00 0.00 ? 11 ALA A H    15 
ATOM 8934  H HA   . ALA A 1 11 ? 13.566  -42.934 58.538  1.00 0.00 ? 11 ALA A HA   15 
ATOM 8935  H HB1  . ALA A 1 11 ? 13.119  -40.751 59.609  1.00 0.00 ? 11 ALA A HB1  15 
ATOM 8936  H HB2  . ALA A 1 11 ? 13.663  -41.951 60.804  1.00 0.00 ? 11 ALA A HB2  15 
ATOM 8937  H HB3  . ALA A 1 11 ? 14.791  -40.707 60.214  1.00 0.00 ? 11 ALA A HB3  15 
ATOM 8938  N N    . ILE A 1 12 ? 16.034  -40.944 57.656  1.00 0.00 ? 12 ILE A N    15 
ATOM 8939  C CA   . ILE A 1 12 ? 16.571  -40.111 56.585  1.00 0.00 ? 12 ILE A CA   15 
ATOM 8940  C C    . ILE A 1 12 ? 16.739  -40.924 55.312  1.00 0.00 ? 12 ILE A C    15 
ATOM 8941  O O    . ILE A 1 12 ? 16.365  -40.487 54.224  1.00 0.00 ? 12 ILE A O    15 
ATOM 8942  C CB   . ILE A 1 12 ? 17.946  -39.528 56.959  1.00 0.00 ? 12 ILE A CB   15 
ATOM 8943  C CG1  . ILE A 1 12 ? 17.808  -38.535 58.115  1.00 0.00 ? 12 ILE A CG1  15 
ATOM 8944  C CG2  . ILE A 1 12 ? 18.558  -38.802 55.771  1.00 0.00 ? 12 ILE A CG2  15 
ATOM 8945  C CD1  . ILE A 1 12 ? 16.919  -37.351 57.800  1.00 0.00 ? 12 ILE A CD1  15 
ATOM 8946  H H    . ILE A 1 12 ? 16.628  -41.144 58.447  1.00 0.00 ? 12 ILE A H    15 
ATOM 8947  H HA   . ILE A 1 12 ? 15.873  -39.293 56.403  1.00 0.00 ? 12 ILE A HA   15 
ATOM 8948  H HB   . ILE A 1 12 ? 18.604  -40.342 57.261  1.00 0.00 ? 12 ILE A HB   15 
ATOM 8949  H HG12 . ILE A 1 12 ? 17.388  -39.061 58.972  1.00 0.00 ? 12 ILE A HG12 15 
ATOM 8950  H HG13 . ILE A 1 12 ? 18.800  -38.161 58.368  1.00 0.00 ? 12 ILE A HG13 15 
ATOM 8951  H HG21 . ILE A 1 12 ? 19.534  -38.402 56.045  1.00 0.00 ? 12 ILE A HG21 15 
ATOM 8952  H HG22 . ILE A 1 12 ? 18.672  -39.498 54.941  1.00 0.00 ? 12 ILE A HG22 15 
ATOM 8953  H HG23 . ILE A 1 12 ? 17.904  -37.983 55.471  1.00 0.00 ? 12 ILE A HG23 15 
ATOM 8954  H HD11 . ILE A 1 12 ? 16.857  -36.680 58.657  1.00 0.00 ? 12 ILE A HD11 15 
ATOM 8955  H HD12 . ILE A 1 12 ? 17.331  -36.806 56.950  1.00 0.00 ? 12 ILE A HD12 15 
ATOM 8956  H HD13 . ILE A 1 12 ? 15.919  -37.707 57.553  1.00 0.00 ? 12 ILE A HD13 15 
ATOM 8957  N N    . THR A 1 13 ? 17.308  -42.117 55.463  1.00 0.00 ? 13 THR A N    15 
ATOM 8958  C CA   . THR A 1 13 ? 17.540  -43.019 54.338  1.00 0.00 ? 13 THR A CA   15 
ATOM 8959  C C    . THR A 1 13 ? 16.219  -43.465 53.732  1.00 0.00 ? 13 THR A C    15 
ATOM 8960  O O    . THR A 1 13 ? 16.067  -43.526 52.513  1.00 0.00 ? 13 THR A O    15 
ATOM 8961  C CB   . THR A 1 13 ? 18.310  -44.279 54.774  1.00 0.00 ? 13 THR A CB   15 
ATOM 8962  O OG1  . THR A 1 13 ? 19.597  -43.905 55.281  1.00 0.00 ? 13 THR A OG1  15 
ATOM 8963  C CG2  . THR A 1 13 ? 18.500  -45.222 53.596  1.00 0.00 ? 13 THR A CG2  15 
ATOM 8964  H H    . THR A 1 13 ? 17.592  -42.419 56.384  1.00 0.00 ? 13 THR A H    15 
ATOM 8965  H HA   . THR A 1 13 ? 18.122  -42.487 53.585  1.00 0.00 ? 13 THR A HA   15 
ATOM 8966  H HB   . THR A 1 13 ? 17.746  -44.788 55.556  1.00 0.00 ? 13 THR A HB   15 
ATOM 8967  H HG1  . THR A 1 13 ? 20.060  -44.699 55.556  1.00 0.00 ? 13 THR A HG1  15 
ATOM 8968  H HG21 . THR A 1 13 ? 19.043  -46.109 53.918  1.00 0.00 ? 13 THR A HG21 15 
ATOM 8969  H HG22 . THR A 1 13 ? 17.525  -45.516 53.207  1.00 0.00 ? 13 THR A HG22 15 
ATOM 8970  H HG23 . THR A 1 13 ? 19.065  -44.715 52.814  1.00 0.00 ? 13 THR A HG23 15 
ATOM 8971  N N    . ASP A 1 14 ? 15.263  -43.778 54.603  1.00 0.00 ? 14 ASP A N    15 
ATOM 8972  C CA   . ASP A 1 14 ? 13.939  -44.224 54.181  1.00 0.00 ? 14 ASP A CA   15 
ATOM 8973  C C    . ASP A 1 14 ? 13.180  -43.086 53.520  1.00 0.00 ? 14 ASP A C    15 
ATOM 8974  O O    . ASP A 1 14 ? 12.634  -43.236 52.428  1.00 0.00 ? 14 ASP A O    15 
ATOM 8975  C CB   . ASP A 1 14 ? 13.129  -44.711 55.384  1.00 0.00 ? 14 ASP A CB   15 
ATOM 8976  C CG   . ASP A 1 14 ? 13.638  -46.029 55.934  1.00 0.00 ? 14 ASP A CG   15 
ATOM 8977  O OD1  . ASP A 1 14 ? 12.976  -46.594 56.829  1.00 0.00 ? 14 ASP A OD1  15 
ATOM 8978  O OD2  . ASP A 1 14 ? 14.700  -46.495 55.471  1.00 0.00 ? 14 ASP A OD2  15 
ATOM 8979  H H    . ASP A 1 14 ? 15.449  -43.708 55.593  1.00 0.00 ? 14 ASP A H    15 
ATOM 8980  H HA   . ASP A 1 14 ? 14.055  -45.042 53.470  1.00 0.00 ? 14 ASP A HA   15 
ATOM 8981  H HB2  . ASP A 1 14 ? 13.183  -43.958 56.171  1.00 0.00 ? 14 ASP A HB2  15 
ATOM 8982  H HB3  . ASP A 1 14 ? 12.090  -44.836 55.079  1.00 0.00 ? 14 ASP A HB3  15 
ATOM 8983  H HD2  . ASP A 1 14 ? 14.963  -47.330 55.865  1.00 0.00 ? 14 ASP A HD2  15 
ATOM 8984  N N    . GLY A 1 15 ? 13.153  -41.942 54.198  1.00 0.00 ? 15 GLY A N    15 
ATOM 8985  C CA   . GLY A 1 15 ? 12.465  -40.755 53.698  1.00 0.00 ? 15 GLY A CA   15 
ATOM 8986  C C    . GLY A 1 15 ? 13.352  -39.997 52.723  1.00 0.00 ? 15 GLY A C    15 
ATOM 8987  O O    . GLY A 1 15 ? 13.071  -39.932 51.527  1.00 0.00 ? 15 GLY A O    15 
ATOM 8988  H H    . GLY A 1 15 ? 13.621  -41.881 55.091  1.00 0.00 ? 15 GLY A H    15 
ATOM 8989  H HA2  . GLY A 1 15 ? 11.549  -41.057 53.190  1.00 0.00 ? 15 GLY A HA2  15 
ATOM 8990  H HA3  . GLY A 1 15 ? 12.214  -40.104 54.536  1.00 0.00 ? 15 GLY A HA3  15 
ATOM 8991  N N    . GLN A 1 16 ? 14.428  -39.423 53.252  1.00 0.00 ? 16 GLN A N    15 
ATOM 8992  C CA   . GLN A 1 16 ? 15.379  -38.659 52.450  1.00 0.00 ? 16 GLN A CA   15 
ATOM 8993  C C    . GLN A 1 16 ? 15.779  -39.443 51.210  1.00 0.00 ? 16 GLN A C    15 
ATOM 8994  O O    . GLN A 1 16 ? 15.662  -38.958 50.086  1.00 0.00 ? 16 GLN A O    15 
ATOM 8995  C CB   . GLN A 1 16 ? 16.641  -38.357 53.260  1.00 0.00 ? 16 GLN A CB   15 
ATOM 8996  C CG   . GLN A 1 16 ? 17.672  -37.524 52.514  1.00 0.00 ? 16 GLN A CG   15 
ATOM 8997  C CD   . GLN A 1 16 ? 17.171  -36.132 52.187  1.00 0.00 ? 16 GLN A CD   15 
ATOM 8998  O OE1  . GLN A 1 16 ? 16.744  -35.391 53.073  1.00 0.00 ? 16 GLN A OE1  15 
ATOM 8999  N NE2  . GLN A 1 16 ? 17.220  -35.772 50.910  1.00 0.00 ? 16 GLN A NE2  15 
ATOM 9000  H H    . GLN A 1 16 ? 14.602  -39.511 54.243  1.00 0.00 ? 16 GLN A H    15 
ATOM 9001  H HA   . GLN A 1 16 ? 14.910  -37.721 52.150  1.00 0.00 ? 16 GLN A HA   15 
ATOM 9002  H HB2  . GLN A 1 16 ? 16.349  -37.815 54.160  1.00 0.00 ? 16 GLN A HB2  15 
ATOM 9003  H HB3  . GLN A 1 16 ? 17.103  -39.303 53.540  1.00 0.00 ? 16 GLN A HB3  15 
ATOM 9004  H HG2  . GLN A 1 16 ? 18.566  -37.438 53.131  1.00 0.00 ? 16 GLN A HG2  15 
ATOM 9005  H HG3  . GLN A 1 16 ? 17.925  -38.032 51.584  1.00 0.00 ? 16 GLN A HG3  15 
ATOM 9006  H HE21 . GLN A 1 16 ? 17.578  -36.415 50.219  1.00 0.00 ? 16 GLN A HE21 15 
ATOM 9007  H HE22 . GLN A 1 16 ? 16.898  -34.855 50.632  1.00 0.00 ? 16 GLN A HE22 15 
ATOM 9008  N N    . GLY A 1 17 ? 16.255  -40.665 51.432  1.00 0.00 ? 17 GLY A N    15 
ATOM 9009  C CA   . GLY A 1 17 ? 16.683  -41.544 50.347  1.00 0.00 ? 17 GLY A CA   15 
ATOM 9010  C C    . GLY A 1 17 ? 15.600  -41.645 49.285  1.00 0.00 ? 17 GLY A C    15 
ATOM 9011  O O    . GLY A 1 17 ? 15.867  -41.523 48.091  1.00 0.00 ? 17 GLY A O    15 
ATOM 9012  H H    . GLY A 1 17 ? 16.327  -41.006 52.380  1.00 0.00 ? 17 GLY A H    15 
ATOM 9013  H HA2  . GLY A 1 17 ? 17.591  -41.143 49.897  1.00 0.00 ? 17 GLY A HA2  15 
ATOM 9014  H HA3  . GLY A 1 17 ? 16.886  -42.536 50.748  1.00 0.00 ? 17 GLY A HA3  15 
ATOM 9015  N N    . ASP A 1 18 ? 14.369  -41.870 49.738  1.00 0.00 ? 18 ASP A N    15 
ATOM 9016  C CA   . ASP A 1 18 ? 13.220  -41.993 48.846  1.00 0.00 ? 18 ASP A CA   15 
ATOM 9017  C C    . ASP A 1 18 ? 13.095  -40.759 47.967  1.00 0.00 ? 18 ASP A C    15 
ATOM 9018  O O    . ASP A 1 18 ? 12.369  -40.756 46.974  1.00 0.00 ? 18 ASP A O    15 
ATOM 9019  C CB   . ASP A 1 18 ? 11.929  -42.145 49.653  1.00 0.00 ? 18 ASP A CB   15 
ATOM 9020  C CG   . ASP A 1 18 ? 11.831  -43.489 50.347  1.00 0.00 ? 18 ASP A CG   15 
ATOM 9021  O OD1  . ASP A 1 18 ? 10.716  -44.050 50.402  1.00 0.00 ? 18 ASP A OD1  15 
ATOM 9022  O OD2  . ASP A 1 18 ? 12.869  -43.983 50.836  1.00 0.00 ? 18 ASP A OD2  15 
ATOM 9023  H H    . ASP A 1 18 ? 14.212  -41.961 50.732  1.00 0.00 ? 18 ASP A H    15 
ATOM 9024  H HA   . ASP A 1 18 ? 13.357  -42.872 48.217  1.00 0.00 ? 18 ASP A HA   15 
ATOM 9025  H HB2  . ASP A 1 18 ? 11.891  -41.358 50.406  1.00 0.00 ? 18 ASP A HB2  15 
ATOM 9026  H HB3  . ASP A 1 18 ? 11.079  -42.036 48.979  1.00 0.00 ? 18 ASP A HB3  15 
ATOM 9027  H HD2  . ASP A 1 18 ? 12.734  -44.834 51.259  1.00 0.00 ? 18 ASP A HD2  15 
ATOM 9028  N N    . MET A 1 19 ? 13.814  -39.707 48.346  1.00 0.00 ? 19 MET A N    15 
ATOM 9029  C CA   . MET A 1 19 ? 13.804  -38.447 47.609  1.00 0.00 ? 19 MET A CA   15 
ATOM 9030  C C    . MET A 1 19 ? 14.388  -38.639 46.219  1.00 0.00 ? 19 MET A C    15 
ATOM 9031  O O    . MET A 1 19 ? 13.866  -38.121 45.233  1.00 0.00 ? 19 MET A O    15 
ATOM 9032  C CB   . MET A 1 19 ? 14.635  -37.391 48.341  1.00 0.00 ? 19 MET A CB   15 
ATOM 9033  C CG   . MET A 1 19 ? 14.612  -36.020 47.687  1.00 0.00 ? 19 MET A CG   15 
ATOM 9034  S SD   . MET A 1 19 ? 15.591  -34.802 48.587  1.00 0.00 ? 19 MET A SD   15 
ATOM 9035  C CE   . MET A 1 19 ? 14.601  -34.599 50.066  1.00 0.00 ? 19 MET A CE   15 
ATOM 9036  H H    . MET A 1 19 ? 14.390  -39.770 49.173  1.00 0.00 ? 19 MET A H    15 
ATOM 9037  H HA   . MET A 1 19 ? 12.774  -38.099 47.524  1.00 0.00 ? 19 MET A HA   15 
ATOM 9038  H HB2  . MET A 1 19 ? 14.248  -37.293 49.355  1.00 0.00 ? 19 MET A HB2  15 
ATOM 9039  H HB3  . MET A 1 19 ? 15.668  -37.734 48.378  1.00 0.00 ? 19 MET A HB3  15 
ATOM 9040  H HG2  . MET A 1 19 ? 15.004  -36.106 46.674  1.00 0.00 ? 19 MET A HG2  15 
ATOM 9041  H HG3  . MET A 1 19 ? 13.580  -35.671 47.634  1.00 0.00 ? 19 MET A HG3  15 
ATOM 9042  H HE1  . MET A 1 19 ? 15.070  -33.874 50.731  1.00 0.00 ? 19 MET A HE1  15 
ATOM 9043  H HE2  . MET A 1 19 ? 13.607  -34.244 49.791  1.00 0.00 ? 19 MET A HE2  15 
ATOM 9044  H HE3  . MET A 1 19 ? 14.515  -35.556 50.579  1.00 0.00 ? 19 MET A HE3  15 
ATOM 9045  N N    . LYS A 1 20 ? 15.482  -39.393 46.154  1.00 0.00 ? 20 LYS A N    15 
ATOM 9046  C CA   . LYS A 1 20 ? 16.163  -39.672 44.893  1.00 0.00 ? 20 LYS A CA   15 
ATOM 9047  C C    . LYS A 1 20 ? 15.211  -40.335 43.910  1.00 0.00 ? 20 LYS A C    15 
ATOM 9048  O O    . LYS A 1 20 ? 15.198  -40.015 42.723  1.00 0.00 ? 20 LYS A O    15 
ATOM 9049  C CB   . LYS A 1 20 ? 17.352  -40.608 45.122  1.00 0.00 ? 20 LYS A CB   15 
ATOM 9050  C CG   . LYS A 1 20 ? 18.159  -40.903 43.868  1.00 0.00 ? 20 LYS A CG   15 
ATOM 9051  C CD   . LYS A 1 20 ? 19.354  -41.791 44.177  1.00 0.00 ? 20 LYS A CD   15 
ATOM 9052  C CE   . LYS A 1 20 ? 20.152  -42.099 42.921  1.00 0.00 ? 20 LYS A CE   15 
ATOM 9053  N NZ   . LYS A 1 20 ? 21.333  -42.958 43.211  1.00 0.00 ? 20 LYS A NZ   15 
ATOM 9054  H H    . LYS A 1 20 ? 15.863  -39.791 47.000  1.00 0.00 ? 20 LYS A H    15 
ATOM 9055  H HA   . LYS A 1 20 ? 16.520  -38.732 44.472  1.00 0.00 ? 20 LYS A HA   15 
ATOM 9056  H HB2  . LYS A 1 20 ? 18.014  -40.147 45.855  1.00 0.00 ? 20 LYS A HB2  15 
ATOM 9057  H HB3  . LYS A 1 20 ? 16.974  -41.551 45.516  1.00 0.00 ? 20 LYS A HB3  15 
ATOM 9058  H HG2  . LYS A 1 20 ? 17.519  -41.407 43.145  1.00 0.00 ? 20 LYS A HG2  15 
ATOM 9059  H HG3  . LYS A 1 20 ? 18.514  -39.963 43.445  1.00 0.00 ? 20 LYS A HG3  15 
ATOM 9060  H HD2  . LYS A 1 20 ? 19.999  -41.281 44.892  1.00 0.00 ? 20 LYS A HD2  15 
ATOM 9061  H HD3  . LYS A 1 20 ? 18.999  -42.726 44.610  1.00 0.00 ? 20 LYS A HD3  15 
ATOM 9062  H HE2  . LYS A 1 20 ? 19.506  -42.613 42.209  1.00 0.00 ? 20 LYS A HE2  15 
ATOM 9063  H HE3  . LYS A 1 20 ? 20.495  -41.162 42.482  1.00 0.00 ? 20 LYS A HE3  15 
ATOM 9064  H HZ1  . LYS A 1 20 ? 21.838  -43.142 42.357  1.00 0.00 ? 20 LYS A HZ1  15 
ATOM 9065  H HZ2  . LYS A 1 20 ? 21.940  -42.484 43.864  1.00 0.00 ? 20 LYS A HZ2  15 
ATOM 9066  H HZ3  . LYS A 1 20 ? 21.022  -43.831 43.612  1.00 0.00 ? 20 LYS A HZ3  15 
ATOM 9067  N N    . ALA A 1 21 ? 14.413  -41.268 44.423  1.00 0.00 ? 21 ALA A N    15 
ATOM 9068  C CA   . ALA A 1 21 ? 13.443  -41.997 43.611  1.00 0.00 ? 21 ALA A CA   15 
ATOM 9069  C C    . ALA A 1 21 ? 12.328  -41.071 43.153  1.00 0.00 ? 21 ALA A C    15 
ATOM 9070  O O    . ALA A 1 21 ? 11.886  -41.126 42.007  1.00 0.00 ? 21 ALA A O    15 
ATOM 9071  C CB   . ALA A 1 21 ? 12.827  -43.133 44.413  1.00 0.00 ? 21 ALA A CB   15 
ATOM 9072  H H    . ALA A 1 21 ? 14.472  -41.488 45.407  1.00 0.00 ? 21 ALA A H    15 
ATOM 9073  H HA   . ALA A 1 21 ? 13.953  -42.406 42.739  1.00 0.00 ? 21 ALA A HA   15 
ATOM 9074  H HB1  . ALA A 1 21 ? 12.116  -43.679 43.794  1.00 0.00 ? 21 ALA A HB1  15 
ATOM 9075  H HB2  . ALA A 1 21 ? 13.613  -43.811 44.744  1.00 0.00 ? 21 ALA A HB2  15 
ATOM 9076  H HB3  . ALA A 1 21 ? 12.310  -42.724 45.282  1.00 0.00 ? 21 ALA A HB3  15 
ATOM 9077  N N    . ILE A 1 22 ? 11.880  -40.215 44.068  1.00 0.00 ? 22 ILE A N    15 
ATOM 9078  C CA   . ILE A 1 22 ? 10.812  -39.261 43.785  1.00 0.00 ? 22 ILE A CA   15 
ATOM 9079  C C    . ILE A 1 22 ? 11.254  -38.267 42.723  1.00 0.00 ? 22 ILE A C    15 
ATOM 9080  O O    . ILE A 1 22 ? 10.547  -38.023 41.747  1.00 0.00 ? 22 ILE A O    15 
ATOM 9081  C CB   . ILE A 1 22 ? 10.418  -38.466 45.043  1.00 0.00 ? 22 ILE A CB   15 
ATOM 9082  C CG1  . ILE A 1 22 ? 9.759   -39.387 46.072  1.00 0.00 ? 22 ILE A CG1  15 
ATOM 9083  C CG2  . ILE A 1 22 ? 9.436   -37.359 44.688  1.00 0.00 ? 22 ILE A CG2  15 
ATOM 9084  C CD1  . ILE A 1 22 ? 9.564   -38.746 47.429  1.00 0.00 ? 22 ILE A CD1  15 
ATOM 9085  H H    . ILE A 1 22 ? 12.286  -40.216 44.993  1.00 0.00 ? 22 ILE A H    15 
ATOM 9086  H HA   . ILE A 1 22 ? 9.943   -39.812 43.425  1.00 0.00 ? 22 ILE A HA   15 
ATOM 9087  H HB   . ILE A 1 22 ? 11.315  -38.025 45.477  1.00 0.00 ? 22 ILE A HB   15 
ATOM 9088  H HG12 . ILE A 1 22 ? 8.783   -39.686 45.690  1.00 0.00 ? 22 ILE A HG12 15 
ATOM 9089  H HG13 . ILE A 1 22 ? 10.387  -40.269 46.196  1.00 0.00 ? 22 ILE A HG13 15 
ATOM 9090  H HG21 . ILE A 1 22 ? 9.172   -36.797 45.584  1.00 0.00 ? 22 ILE A HG21 15 
ATOM 9091  H HG22 . ILE A 1 22 ? 9.894   -36.687 43.962  1.00 0.00 ? 22 ILE A HG22 15 
ATOM 9092  H HG23 . ILE A 1 22 ? 8.535   -37.797 44.259  1.00 0.00 ? 22 ILE A HG23 15 
ATOM 9093  H HD11 . ILE A 1 22 ? 9.091   -39.445 48.118  1.00 0.00 ? 22 ILE A HD11 15 
ATOM 9094  H HD12 . ILE A 1 22 ? 10.533  -38.450 47.830  1.00 0.00 ? 22 ILE A HD12 15 
ATOM 9095  H HD13 . ILE A 1 22 ? 8.930   -37.865 47.324  1.00 0.00 ? 22 ILE A HD13 15 
ATOM 9096  N N    . GLY A 1 23 ? 12.437  -37.696 42.927  1.00 0.00 ? 23 GLY A N    15 
ATOM 9097  C CA   . GLY A 1 23 ? 13.004  -36.721 41.999  1.00 0.00 ? 23 GLY A CA   15 
ATOM 9098  C C    . GLY A 1 23 ? 13.330  -37.379 40.668  1.00 0.00 ? 23 GLY A C    15 
ATOM 9099  O O    . GLY A 1 23 ? 13.045  -36.836 39.602  1.00 0.00 ? 23 GLY A O    15 
ATOM 9100  H H    . GLY A 1 23 ? 12.970  -37.937 43.750  1.00 0.00 ? 23 GLY A H    15 
ATOM 9101  H HA2  . GLY A 1 23 ? 12.284  -35.918 41.837  1.00 0.00 ? 23 GLY A HA2  15 
ATOM 9102  H HA3  . GLY A 1 23 ? 13.916  -36.305 42.427  1.00 0.00 ? 23 GLY A HA3  15 
ATOM 9103  N N    . GLY A 1 24 ? 13.933  -38.562 40.745  1.00 0.00 ? 24 GLY A N    15 
ATOM 9104  C CA   . GLY A 1 24 ? 14.313  -39.322 39.558  1.00 0.00 ? 24 GLY A CA   15 
ATOM 9105  C C    . GLY A 1 24 ? 13.077  -39.808 38.819  1.00 0.00 ? 24 GLY A C    15 
ATOM 9106  O O    . GLY A 1 24 ? 12.910  -39.561 37.626  1.00 0.00 ? 24 GLY A O    15 
ATOM 9107  H H    . GLY A 1 24 ? 14.139  -38.957 41.651  1.00 0.00 ? 24 GLY A H    15 
ATOM 9108  H HA2  . GLY A 1 24 ? 14.900  -38.685 38.896  1.00 0.00 ? 24 GLY A HA2  15 
ATOM 9109  H HA3  . GLY A 1 24 ? 14.913  -40.180 39.858  1.00 0.00 ? 24 GLY A HA3  15 
ATOM 9110  N N    . TYR A 1 25 ? 12.209  -40.506 39.547  1.00 0.00 ? 25 TYR A N    15 
ATOM 9111  C CA   . TYR A 1 25 ? 10.973  -41.042 38.985  1.00 0.00 ? 25 TYR A CA   15 
ATOM 9112  C C    . TYR A 1 25 ? 10.148  -39.932 38.356  1.00 0.00 ? 25 TYR A C    15 
ATOM 9113  O O    . TYR A 1 25 ? 9.547   -40.108 37.297  1.00 0.00 ? 25 TYR A O    15 
ATOM 9114  C CB   . TYR A 1 25 ? 10.133  -41.709 40.076  1.00 0.00 ? 25 TYR A CB   15 
ATOM 9115  C CG   . TYR A 1 25 ? 8.824   -42.280 39.579  1.00 0.00 ? 25 TYR A CG   15 
ATOM 9116  C CD1  . TYR A 1 25 ? 8.790   -43.488 38.895  1.00 0.00 ? 25 TYR A CD1  15 
ATOM 9117  C CD2  . TYR A 1 25 ? 7.628   -41.609 39.795  1.00 0.00 ? 25 TYR A CD2  15 
ATOM 9118  C CE1  . TYR A 1 25 ? 7.598   -44.018 38.437  1.00 0.00 ? 25 TYR A CE1  15 
ATOM 9119  C CE2  . TYR A 1 25 ? 6.427   -42.123 39.345  1.00 0.00 ? 25 TYR A CE2  15 
ATOM 9120  C CZ   . TYR A 1 25 ? 6.421   -43.338 38.660  1.00 0.00 ? 25 TYR A CZ   15 
ATOM 9121  O OH   . TYR A 1 25 ? 5.233   -43.863 38.205  1.00 0.00 ? 25 TYR A OH   15 
ATOM 9122  H H    . TYR A 1 25 ? 12.402  -40.677 40.523  1.00 0.00 ? 25 TYR A H    15 
ATOM 9123  H HA   . TYR A 1 25 ? 11.226  -41.779 38.224  1.00 0.00 ? 25 TYR A HA   15 
ATOM 9124  H HB2  . TYR A 1 25 ? 10.717  -42.516 40.518  1.00 0.00 ? 25 TYR A HB2  15 
ATOM 9125  H HB3  . TYR A 1 25 ? 9.917   -40.970 40.848  1.00 0.00 ? 25 TYR A HB3  15 
ATOM 9126  H HD1  . TYR A 1 25 ? 9.711   -44.023 38.718  1.00 0.00 ? 25 TYR A HD1  15 
ATOM 9127  H HD2  . TYR A 1 25 ? 7.636   -40.667 40.325  1.00 0.00 ? 25 TYR A HD2  15 
ATOM 9128  H HE1  . TYR A 1 25 ? 7.589   -44.959 37.908  1.00 0.00 ? 25 TYR A HE1  15 
ATOM 9129  H HE2  . TYR A 1 25 ? 5.504   -41.590 39.522  1.00 0.00 ? 25 TYR A HE2  15 
ATOM 9130  H HH   . TYR A 1 25 ? 4.474   -43.312 38.412  1.00 0.00 ? 25 TYR A HH   15 
ATOM 9131  N N    . ILE A 1 26 ? 10.127  -38.782 39.024  1.00 0.00 ? 26 ILE A N    15 
ATOM 9132  C CA   . ILE A 1 26 ? 9.382   -37.619 38.552  1.00 0.00 ? 26 ILE A CA   15 
ATOM 9133  C C    . ILE A 1 26 ? 10.100  -36.966 37.382  1.00 0.00 ? 26 ILE A C    15 
ATOM 9134  O O    . ILE A 1 26 ? 9.486   -36.614 36.376  1.00 0.00 ? 26 ILE A O    15 
ATOM 9135  C CB   . ILE A 1 26 ? 9.224   -36.562 39.661  1.00 0.00 ? 26 ILE A CB   15 
ATOM 9136  C CG1  . ILE A 1 26 ? 8.332   -37.095 40.783  1.00 0.00 ? 26 ILE A CG1  15 
ATOM 9137  C CG2  . ILE A 1 26 ? 8.593   -35.295 39.103  1.00 0.00 ? 26 ILE A CG2  15 
ATOM 9138  C CD1  . ILE A 1 26 ? 8.322   -36.225 42.021  1.00 0.00 ? 26 ILE A CD1  15 
ATOM 9139  H H    . ILE A 1 26 ? 10.642  -38.699 39.889  1.00 0.00 ? 26 ILE A H    15 
ATOM 9140  H HA   . ILE A 1 26 ? 8.394   -37.950 38.231  1.00 0.00 ? 26 ILE A HA   15 
ATOM 9141  H HB   . ILE A 1 26 ? 10.208  -36.325 40.065  1.00 0.00 ? 26 ILE A HB   15 
ATOM 9142  H HG12 . ILE A 1 26 ? 7.311   -37.167 40.406  1.00 0.00 ? 26 ILE A HG12 15 
ATOM 9143  H HG13 . ILE A 1 26 ? 8.687   -38.086 41.063  1.00 0.00 ? 26 ILE A HG13 15 
ATOM 9144  H HG21 . ILE A 1 26 ? 8.495   -34.551 39.894  1.00 0.00 ? 26 ILE A HG21 15 
ATOM 9145  H HG22 . ILE A 1 26 ? 9.223   -34.896 38.308  1.00 0.00 ? 26 ILE A HG22 15 
ATOM 9146  H HG23 . ILE A 1 26 ? 7.606   -35.527 38.703  1.00 0.00 ? 26 ILE A HG23 15 
ATOM 9147  H HD11 . ILE A 1 26 ? 7.670   -36.652 42.784  1.00 0.00 ? 26 ILE A HD11 15 
ATOM 9148  H HD12 . ILE A 1 26 ? 9.334   -36.151 42.417  1.00 0.00 ? 26 ILE A HD12 15 
ATOM 9149  H HD13 . ILE A 1 26 ? 7.960   -35.230 41.759  1.00 0.00 ? 26 ILE A HD13 15 
ATOM 9150  N N    . VAL A 1 27 ? 11.412  -36.810 37.528  1.00 0.00 ? 27 VAL A N    15 
ATOM 9151  C CA   . VAL A 1 27 ? 12.245  -36.199 36.495  1.00 0.00 ? 27 VAL A CA   15 
ATOM 9152  C C    . VAL A 1 27 ? 12.461  -37.168 35.344  1.00 0.00 ? 27 VAL A C    15 
ATOM 9153  O O    . VAL A 1 27 ? 12.612  -36.764 34.192  1.00 0.00 ? 27 VAL A O    15 
ATOM 9154  C CB   . VAL A 1 27 ? 13.627  -35.802 37.046  1.00 0.00 ? 27 VAL A CB   15 
ATOM 9155  C CG1  . VAL A 1 27 ? 14.480  -37.039 37.287  1.00 0.00 ? 27 VAL A CG1  15 
ATOM 9156  C CG2  . VAL A 1 27 ? 14.355  -34.901 36.060  1.00 0.00 ? 27 VAL A CG2  15 
ATOM 9157  H H    . VAL A 1 27 ? 11.858  -37.121 38.379  1.00 0.00 ? 27 VAL A H    15 
ATOM 9158  H HA   . VAL A 1 27 ? 11.737  -35.307 36.127  1.00 0.00 ? 27 VAL A HA   15 
ATOM 9159  H HB   . VAL A 1 27 ? 13.491  -35.269 37.988  1.00 0.00 ? 27 VAL A HB   15 
ATOM 9160  H HG11 . VAL A 1 27 ? 15.451  -36.746 37.685  1.00 0.00 ? 27 VAL A HG11 15 
ATOM 9161  H HG12 . VAL A 1 27 ? 13.978  -37.691 38.002  1.00 0.00 ? 27 VAL A HG12 15 
ATOM 9162  H HG13 . VAL A 1 27 ? 14.620  -37.571 36.346  1.00 0.00 ? 27 VAL A HG13 15 
ATOM 9163  H HG21 . VAL A 1 27 ? 15.327  -34.619 36.464  1.00 0.00 ? 27 VAL A HG21 15 
ATOM 9164  H HG22 . VAL A 1 27 ? 14.495  -35.432 35.119  1.00 0.00 ? 27 VAL A HG22 15 
ATOM 9165  H HG23 . VAL A 1 27 ? 13.762  -34.002 35.885  1.00 0.00 ? 27 VAL A HG23 15 
ATOM 9166  N N    . GLY A 1 28 ? 12.473  -38.457 35.672  1.00 0.00 ? 28 GLY A N    15 
ATOM 9167  C CA   . GLY A 1 28 ? 12.670  -39.512 34.683  1.00 0.00 ? 28 GLY A CA   15 
ATOM 9168  C C    . GLY A 1 28 ? 11.410  -39.707 33.855  1.00 0.00 ? 28 GLY A C    15 
ATOM 9169  O O    . GLY A 1 28 ? 11.459  -40.199 32.729  1.00 0.00 ? 28 GLY A O    15 
ATOM 9170  H H    . GLY A 1 28 ? 12.342  -38.726 36.637  1.00 0.00 ? 28 GLY A H    15 
ATOM 9171  H HA2  . GLY A 1 28 ? 13.494  -39.237 34.024  1.00 0.00 ? 28 GLY A HA2  15 
ATOM 9172  H HA3  . GLY A 1 28 ? 12.911  -40.443 35.195  1.00 0.00 ? 28 GLY A HA3  15 
ATOM 9173  N N    . ALA A 1 29 ? 10.278  -39.313 34.431  1.00 0.00 ? 29 ALA A N    15 
ATOM 9174  C CA   . ALA A 1 29 ? 8.983   -39.433 33.769  1.00 0.00 ? 29 ALA A CA   15 
ATOM 9175  C C    . ALA A 1 29 ? 8.734   -38.236 32.864  1.00 0.00 ? 29 ALA A C    15 
ATOM 9176  O O    . ALA A 1 29 ? 8.099   -38.350 31.817  1.00 0.00 ? 29 ALA A O    15 
ATOM 9177  C CB   . ALA A 1 29 ? 7.865   -39.499 34.799  1.00 0.00 ? 29 ALA A CB   15 
ATOM 9178  H H    . ALA A 1 29 ? 10.303  -38.916 35.360  1.00 0.00 ? 29 ALA A H    15 
ATOM 9179  H HA   . ALA A 1 29 ? 8.978   -40.344 33.172  1.00 0.00 ? 29 ALA A HA   15 
ATOM 9180  H HB1  . ALA A 1 29 ? 6.903   -39.603 34.295  1.00 0.00 ? 29 ALA A HB1  15 
ATOM 9181  H HB2  . ALA A 1 29 ? 8.025   -40.356 35.453  1.00 0.00 ? 29 ALA A HB2  15 
ATOM 9182  H HB3  . ALA A 1 29 ? 7.864   -38.584 35.392  1.00 0.00 ? 29 ALA A HB3  15 
ATOM 9183  N N    . LEU A 1 30 ? 9.246   -37.083 33.285  1.00 0.00 ? 30 LEU A N    15 
ATOM 9184  C CA   . LEU A 1 30 ? 9.095   -35.842 32.530  1.00 0.00 ? 30 LEU A CA   15 
ATOM 9185  C C    . LEU A 1 30 ? 9.614   -36.015 31.112  1.00 0.00 ? 30 LEU A C    15 
ATOM 9186  O O    . LEU A 1 30 ? 9.125   -35.386 30.175  1.00 0.00 ? 30 LEU A O    15 
ATOM 9187  C CB   . LEU A 1 30 ? 9.879   -34.710 33.197  1.00 0.00 ? 30 LEU A CB   15 
ATOM 9188  C CG   . LEU A 1 30 ? 9.329   -34.199 34.530  1.00 0.00 ? 30 LEU A CG   15 
ATOM 9189  C CD1  . LEU A 1 30 ? 10.270  -33.171 35.141  1.00 0.00 ? 30 LEU A CD1  15 
ATOM 9190  C CD2  . LEU A 1 30 ? 7.971   -33.544 34.336  1.00 0.00 ? 30 LEU A CD2  15 
ATOM 9191  H H    . LEU A 1 30 ? 9.758   -37.053 34.155  1.00 0.00 ? 30 LEU A H    15 
ATOM 9192  H HA   . LEU A 1 30 ? 8.037   -35.578 32.499  1.00 0.00 ? 30 LEU A HA   15 
ATOM 9193  H HB2  . LEU A 1 30 ? 10.894  -35.066 33.371  1.00 0.00 ? 30 LEU A HB2  15 
ATOM 9194  H HB3  . LEU A 1 30 ? 9.903   -33.869 32.504  1.00 0.00 ? 30 LEU A HB3  15 
ATOM 9195  H HG   . LEU A 1 30 ? 9.226   -35.042 35.213  1.00 0.00 ? 30 LEU A HG   15 
ATOM 9196  H HD11 . LEU A 1 30 ? 9.872   -32.823 36.095  1.00 0.00 ? 30 LEU A HD11 15 
ATOM 9197  H HD12 . LEU A 1 30 ? 11.247  -33.626 35.303  1.00 0.00 ? 30 LEU A HD12 15 
ATOM 9198  H HD13 . LEU A 1 30 ? 10.371  -32.324 34.462  1.00 0.00 ? 30 LEU A HD13 15 
ATOM 9199  H HD21 . LEU A 1 30 ? 7.585   -33.194 35.294  1.00 0.00 ? 30 LEU A HD21 15 
ATOM 9200  H HD22 . LEU A 1 30 ? 8.071   -32.696 33.658  1.00 0.00 ? 30 LEU A HD22 15 
ATOM 9201  H HD23 . LEU A 1 30 ? 7.276   -34.269 33.911  1.00 0.00 ? 30 LEU A HD23 15 
ATOM 9202  N N    . VAL A 1 31 ? 10.614  -36.879 30.967  1.00 0.00 ? 31 VAL A N    15 
ATOM 9203  C CA   . VAL A 1 31 ? 11.223  -37.159 29.669  1.00 0.00 ? 31 VAL A CA   15 
ATOM 9204  C C    . VAL A 1 31 ? 10.165  -37.590 28.667  1.00 0.00 ? 31 VAL A C    15 
ATOM 9205  O O    . VAL A 1 31 ? 10.247  -37.275 27.481  1.00 0.00 ? 31 VAL A O    15 
ATOM 9206  C CB   . VAL A 1 31 ? 12.269  -38.285 29.767  1.00 0.00 ? 31 VAL A CB   15 
ATOM 9207  C CG1  . VAL A 1 31 ? 12.721  -38.715 28.380  1.00 0.00 ? 31 VAL A CG1  15 
ATOM 9208  C CG2  . VAL A 1 31 ? 13.488  -37.814 30.545  1.00 0.00 ? 31 VAL A CG2  15 
ATOM 9209  H H    . VAL A 1 31 ? 10.973  -37.364 31.777  1.00 0.00 ? 31 VAL A H    15 
ATOM 9210  H HA   . VAL A 1 31 ? 11.708  -36.250 29.314  1.00 0.00 ? 31 VAL A HA   15 
ATOM 9211  H HB   . VAL A 1 31 ? 11.822  -39.136 30.280  1.00 0.00 ? 31 VAL A HB   15 
ATOM 9212  H HG11 . VAL A 1 31 ? 13.453  -39.517 28.462  1.00 0.00 ? 31 VAL A HG11 15 
ATOM 9213  H HG12 . VAL A 1 31 ? 11.860  -39.068 27.812  1.00 0.00 ? 31 VAL A HG12 15 
ATOM 9214  H HG13 . VAL A 1 31 ? 13.171  -37.865 27.866  1.00 0.00 ? 31 VAL A HG13 15 
ATOM 9215  H HG21 . VAL A 1 31 ? 14.216  -38.621 30.615  1.00 0.00 ? 31 VAL A HG21 15 
ATOM 9216  H HG22 . VAL A 1 31 ? 13.938  -36.964 30.032  1.00 0.00 ? 31 VAL A HG22 15 
ATOM 9217  H HG23 . VAL A 1 31 ? 13.183  -37.513 31.548  1.00 0.00 ? 31 VAL A HG23 15 
ATOM 9218  N N    . ILE A 1 32 ? 9.167   -38.317 29.161  1.00 0.00 ? 32 ILE A N    15 
ATOM 9219  C CA   . ILE A 1 32 ? 8.073   -38.808 28.328  1.00 0.00 ? 32 ILE A CA   15 
ATOM 9220  C C    . ILE A 1 32 ? 7.251   -37.648 27.790  1.00 0.00 ? 32 ILE A C    15 
ATOM 9221  O O    . ILE A 1 32 ? 6.863   -37.631 26.623  1.00 0.00 ? 32 ILE A O    15 
ATOM 9222  C CB   . ILE A 1 32 ? 7.128   -39.729 29.122  1.00 0.00 ? 32 ILE A CB   15 
ATOM 9223  C CG1  . ILE A 1 32 ? 7.849   -41.020 29.516  1.00 0.00 ? 32 ILE A CG1  15 
ATOM 9224  C CG2  . ILE A 1 32 ? 5.911   -40.092 28.286  1.00 0.00 ? 32 ILE A CG2  15 
ATOM 9225  C CD1  . ILE A 1 32 ? 7.081   -41.871 30.503  1.00 0.00 ? 32 ILE A CD1  15 
ATOM 9226  H H    . ILE A 1 32 ? 9.154   -38.542 30.146  1.00 0.00 ? 32 ILE A H    15 
ATOM 9227  H HA   . ILE A 1 32 ? 8.499   -39.366 27.495  1.00 0.00 ? 32 ILE A HA   15 
ATOM 9228  H HB   . ILE A 1 32 ? 6.803   -39.208 30.023  1.00 0.00 ? 32 ILE A HB   15 
ATOM 9229  H HG12 . ILE A 1 32 ? 8.018   -41.608 28.614  1.00 0.00 ? 32 ILE A HG12 15 
ATOM 9230  H HG13 . ILE A 1 32 ? 8.807   -40.756 29.963  1.00 0.00 ? 32 ILE A HG13 15 
ATOM 9231  H HG21 . ILE A 1 32 ? 5.245   -40.735 28.862  1.00 0.00 ? 32 ILE A HG21 15 
ATOM 9232  H HG22 . ILE A 1 32 ? 5.380   -39.182 28.005  1.00 0.00 ? 32 ILE A HG22 15 
ATOM 9233  H HG23 . ILE A 1 32 ? 6.232   -40.617 27.387  1.00 0.00 ? 32 ILE A HG23 15 
ATOM 9234  H HD11 . ILE A 1 32 ? 7.640   -42.774 30.745  1.00 0.00 ? 32 ILE A HD11 15 
ATOM 9235  H HD12 . ILE A 1 32 ? 6.912   -41.299 31.416  1.00 0.00 ? 32 ILE A HD12 15 
ATOM 9236  H HD13 . ILE A 1 32 ? 6.121   -42.150 30.067  1.00 0.00 ? 32 ILE A HD13 15 
ATOM 9237  N N    . LEU A 1 33 ? 6.991   -36.676 28.660  1.00 0.00 ? 33 LEU A N    15 
ATOM 9238  C CA   . LEU A 1 33 ? 6.214   -35.494 28.299  1.00 0.00 ? 33 LEU A CA   15 
ATOM 9239  C C    . LEU A 1 33 ? 6.920   -34.706 27.208  1.00 0.00 ? 33 LEU A C    15 
ATOM 9240  O O    . LEU A 1 33 ? 6.316   -34.321 26.208  1.00 0.00 ? 33 LEU A O    15 
ATOM 9241  C CB   . LEU A 1 33 ? 6.031   -34.582 29.513  1.00 0.00 ? 33 LEU A CB   15 
ATOM 9242  C CG   . LEU A 1 33 ? 5.079   -35.083 30.601  1.00 0.00 ? 33 LEU A CG   15 
ATOM 9243  C CD1  . LEU A 1 33 ? 5.090   -34.146 31.799  1.00 0.00 ? 33 LEU A CD1  15 
ATOM 9244  C CD2  . LEU A 1 33 ? 3.655   -35.164 30.073  1.00 0.00 ? 33 LEU A CD2  15 
ATOM 9245  H H    . LEU A 1 33 ? 7.338   -36.747 29.606  1.00 0.00 ? 33 LEU A H    15 
ATOM 9246  H HA   . LEU A 1 33 ? 5.236   -35.814 27.939  1.00 0.00 ? 33 LEU A HA   15 
ATOM 9247  H HB2  . LEU A 1 33 ? 7.010   -34.436 29.970  1.00 0.00 ? 33 LEU A HB2  15 
ATOM 9248  H HB3  . LEU A 1 33 ? 5.651   -33.625 29.155  1.00 0.00 ? 33 LEU A HB3  15 
ATOM 9249  H HG   . LEU A 1 33 ? 5.400   -36.074 30.919  1.00 0.00 ? 33 LEU A HG   15 
ATOM 9250  H HD11 . LEU A 1 33 ? 4.416   -34.519 32.570  1.00 0.00 ? 33 LEU A HD11 15 
ATOM 9251  H HD12 . LEU A 1 33 ? 6.100   -34.086 32.202  1.00 0.00 ? 33 LEU A HD12 15 
ATOM 9252  H HD13 . LEU A 1 33 ? 4.764   -33.153 31.486  1.00 0.00 ? 33 LEU A HD13 15 
ATOM 9253  H HD21 . LEU A 1 33 ? 2.989   -35.533 30.854  1.00 0.00 ? 33 LEU A HD21 15 
ATOM 9254  H HD22 . LEU A 1 33 ? 3.328   -34.172 29.760  1.00 0.00 ? 33 LEU A HD22 15 
ATOM 9255  H HD23 . LEU A 1 33 ? 3.623   -35.843 29.221  1.00 0.00 ? 33 LEU A HD23 15 
ATOM 9256  N N    . ALA A 1 34 ? 8.213   -34.471 27.414  1.00 0.00 ? 34 ALA A N    15 
ATOM 9257  C CA   . ALA A 1 34 ? 9.032   -33.727 26.460  1.00 0.00 ? 34 ALA A CA   15 
ATOM 9258  C C    . ALA A 1 34 ? 9.028   -34.416 25.105  1.00 0.00 ? 34 ALA A C    15 
ATOM 9259  O O    . ALA A 1 34 ? 8.948   -33.768 24.062  1.00 0.00 ? 34 ALA A O    15 
ATOM 9260  C CB   . ALA A 1 34 ? 10.469  -33.637 26.951  1.00 0.00 ? 34 ALA A CB   15 
ATOM 9261  H H    . ALA A 1 34 ? 8.653   -34.813 28.256  1.00 0.00 ? 34 ALA A H    15 
ATOM 9262  H HA   . ALA A 1 34 ? 8.622   -32.722 26.356  1.00 0.00 ? 34 ALA A HA   15 
ATOM 9263  H HB1  . ALA A 1 34 ? 11.067  -33.067 26.240  1.00 0.00 ? 34 ALA A HB1  15 
ATOM 9264  H HB2  . ALA A 1 34 ? 10.490  -33.139 27.921  1.00 0.00 ? 34 ALA A HB2  15 
ATOM 9265  H HB3  . ALA A 1 34 ? 10.882  -34.640 27.049  1.00 0.00 ? 34 ALA A HB3  15 
ATOM 9266  N N    . VAL A 1 35 ? 9.117   -35.743 25.134  1.00 0.00 ? 35 VAL A N    15 
ATOM 9267  C CA   . VAL A 1 35 ? 9.126   -36.551 23.918  1.00 0.00 ? 35 VAL A CA   15 
ATOM 9268  C C    . VAL A 1 35 ? 7.894   -36.260 23.077  1.00 0.00 ? 35 VAL A C    15 
ATOM 9269  O O    . VAL A 1 35 ? 7.975   -36.118 21.858  1.00 0.00 ? 35 VAL A O    15 
ATOM 9270  C CB   . VAL A 1 35 ? 9.134   -38.057 24.241  1.00 0.00 ? 35 VAL A CB   15 
ATOM 9271  C CG1  . VAL A 1 35 ? 8.933   -38.874 22.974  1.00 0.00 ? 35 VAL A CG1  15 
ATOM 9272  C CG2  . VAL A 1 35 ? 10.460  -38.460 24.868  1.00 0.00 ? 35 VAL A CG2  15 
ATOM 9273  H H    . VAL A 1 35 ? 9.181   -36.218 26.023  1.00 0.00 ? 35 VAL A H    15 
ATOM 9274  H HA   . VAL A 1 35 ? 10.020  -36.303 23.347  1.00 0.00 ? 35 VAL A HA   15 
ATOM 9275  H HB   . VAL A 1 35 ? 8.325   -38.272 24.940  1.00 0.00 ? 35 VAL A HB   15 
ATOM 9276  H HG11 . VAL A 1 35 ? 8.931   -39.936 23.216  1.00 0.00 ? 35 VAL A HG11 15 
ATOM 9277  H HG12 . VAL A 1 35 ? 7.980   -38.606 22.518  1.00 0.00 ? 35 VAL A HG12 15 
ATOM 9278  H HG13 . VAL A 1 35 ? 9.742   -38.663 22.275  1.00 0.00 ? 35 VAL A HG13 15 
ATOM 9279  H HG21 . VAL A 1 35 ? 10.450  -39.525 25.100  1.00 0.00 ? 35 VAL A HG21 15 
ATOM 9280  H HG22 . VAL A 1 35 ? 11.269  -38.249 24.170  1.00 0.00 ? 35 VAL A HG22 15 
ATOM 9281  H HG23 . VAL A 1 35 ? 10.614  -37.891 25.785  1.00 0.00 ? 35 VAL A HG23 15 
ATOM 9282  N N    . ALA A 1 36 ? 6.748   -36.175 23.747  1.00 0.00 ? 36 ALA A N    15 
ATOM 9283  C CA   . ALA A 1 36 ? 5.476   -35.901 23.085  1.00 0.00 ? 36 ALA A CA   15 
ATOM 9284  C C    . ALA A 1 36 ? 5.483   -34.511 22.471  1.00 0.00 ? 36 ALA A C    15 
ATOM 9285  O O    . ALA A 1 36 ? 5.083   -34.320 21.323  1.00 0.00 ? 36 ALA A O    15 
ATOM 9286  C CB   . ALA A 1 36 ? 4.331   -35.981 24.083  1.00 0.00 ? 36 ALA A CB   15 
ATOM 9287  H H    . ALA A 1 36 ? 6.746   -36.303 24.749  1.00 0.00 ? 36 ALA A H    15 
ATOM 9288  H HA   . ALA A 1 36 ? 5.323   -36.641 22.300  1.00 0.00 ? 36 ALA A HA   15 
ATOM 9289  H HB1  . ALA A 1 36 ? 3.384   -35.789 23.576  1.00 0.00 ? 36 ALA A HB1  15 
ATOM 9290  H HB2  . ALA A 1 36 ? 4.307   -36.975 24.529  1.00 0.00 ? 36 ALA A HB2  15 
ATOM 9291  H HB3  . ALA A 1 36 ? 4.479   -35.236 24.865  1.00 0.00 ? 36 ALA A HB3  15 
ATOM 9292  N N    . GLY A 1 37 ? 5.945   -33.539 23.253  1.00 0.00 ? 37 GLY A N    15 
ATOM 9293  C CA   . GLY A 1 37 ? 6.017   -32.150 22.812  1.00 0.00 ? 37 GLY A CA   15 
ATOM 9294  C C    . GLY A 1 37 ? 6.692   -32.058 21.453  1.00 0.00 ? 37 GLY A C    15 
ATOM 9295  O O    . GLY A 1 37 ? 6.105   -31.585 20.481  1.00 0.00 ? 37 GLY A O    15 
ATOM 9296  H H    . GLY A 1 37 ? 6.259   -33.759 24.187  1.00 0.00 ? 37 GLY A H    15 
ATOM 9297  H HA2  . GLY A 1 37 ? 5.008   -31.742 22.741  1.00 0.00 ? 37 GLY A HA2  15 
ATOM 9298  H HA3  . GLY A 1 37 ? 6.589   -31.571 23.538  1.00 0.00 ? 37 GLY A HA3  15 
ATOM 9299  N N    . LEU A 1 38 ? 7.939   -32.518 21.399  1.00 0.00 ? 38 LEU A N    15 
ATOM 9300  C CA   . LEU A 1 38 ? 8.725   -32.501 20.168  1.00 0.00 ? 38 LEU A CA   15 
ATOM 9301  C C    . LEU A 1 38 ? 8.040   -33.323 19.089  1.00 0.00 ? 38 LEU A C    15 
ATOM 9302  O O    . LEU A 1 38 ? 8.025   -32.949 17.918  1.00 0.00 ? 38 LEU A O    15 
ATOM 9303  C CB   . LEU A 1 38 ? 10.117  -33.087 20.413  1.00 0.00 ? 38 LEU A CB   15 
ATOM 9304  C CG   . LEU A 1 38 ? 11.072  -32.238 21.254  1.00 0.00 ? 38 LEU A CG   15 
ATOM 9305  C CD1  . LEU A 1 38 ? 12.365  -32.992 21.525  1.00 0.00 ? 38 LEU A CD1  15 
ATOM 9306  C CD2  . LEU A 1 38 ? 11.417  -30.944 20.533  1.00 0.00 ? 38 LEU A CD2  15 
ATOM 9307  H H    . LEU A 1 38 ? 8.367   -32.894 22.233  1.00 0.00 ? 38 LEU A H    15 
ATOM 9308  H HA   . LEU A 1 38 ? 8.822   -31.469 19.830  1.00 0.00 ? 38 LEU A HA   15 
ATOM 9309  H HB2  . LEU A 1 38 ? 9.989   -34.043 20.919  1.00 0.00 ? 38 LEU A HB2  15 
ATOM 9310  H HB3  . LEU A 1 38 ? 10.584  -33.249 19.442  1.00 0.00 ? 38 LEU A HB3  15 
ATOM 9311  H HG   . LEU A 1 38 ? 10.588  -32.002 22.202  1.00 0.00 ? 38 LEU A HG   15 
ATOM 9312  H HD11 . LEU A 1 38 ? 13.031  -32.380 22.133  1.00 0.00 ? 38 LEU A HD11 15 
ATOM 9313  H HD12 . LEU A 1 38 ? 12.139  -33.917 22.056  1.00 0.00 ? 38 LEU A HD12 15 
ATOM 9314  H HD13 . LEU A 1 38 ? 12.853  -33.225 20.579  1.00 0.00 ? 38 LEU A HD13 15 
ATOM 9315  H HD21 . LEU A 1 38 ? 12.088  -30.343 21.147  1.00 0.00 ? 38 LEU A HD21 15 
ATOM 9316  H HD22 . LEU A 1 38 ? 11.905  -31.176 19.587  1.00 0.00 ? 38 LEU A HD22 15 
ATOM 9317  H HD23 . LEU A 1 38 ? 10.503  -30.381 20.342  1.00 0.00 ? 38 LEU A HD23 15 
ATOM 9318  N N    . ILE A 1 39 ? 7.473   -34.453 19.500  1.00 0.00 ? 39 ILE A N    15 
ATOM 9319  C CA   . ILE A 1 39 ? 6.775   -35.354 18.587  1.00 0.00 ? 39 ILE A CA   15 
ATOM 9320  C C    . ILE A 1 39 ? 5.635   -34.630 17.892  1.00 0.00 ? 39 ILE A C    15 
ATOM 9321  O O    . ILE A 1 39 ? 5.441   -34.760 16.684  1.00 0.00 ? 39 ILE A O    15 
ATOM 9322  C CB   . ILE A 1 39 ? 6.182   -36.564 19.332  1.00 0.00 ? 39 ILE A CB   15 
ATOM 9323  C CG1  . ILE A 1 39 ? 7.300   -37.460 19.869  1.00 0.00 ? 39 ILE A CG1  15 
ATOM 9324  C CG2  . ILE A 1 39 ? 5.310   -37.390 18.398  1.00 0.00 ? 39 ILE A CG2  15 
ATOM 9325  C CD1  . ILE A 1 39 ? 8.199   -38.026 18.791  1.00 0.00 ? 39 ILE A CD1  15 
ATOM 9326  H H    . ILE A 1 39 ? 7.519   -34.706 20.477  1.00 0.00 ? 39 ILE A H    15 
ATOM 9327  H HA   . ILE A 1 39 ? 7.487   -35.707 17.841  1.00 0.00 ? 39 ILE A HA   15 
ATOM 9328  H HB   . ILE A 1 39 ? 5.577   -36.204 20.165  1.00 0.00 ? 39 ILE A HB   15 
ATOM 9329  H HG12 . ILE A 1 39 ? 7.912   -36.873 20.554  1.00 0.00 ? 39 ILE A HG12 15 
ATOM 9330  H HG13 . ILE A 1 39 ? 6.845   -38.291 20.409  1.00 0.00 ? 39 ILE A HG13 15 
ATOM 9331  H HG21 . ILE A 1 39 ? 4.888   -38.237 18.939  1.00 0.00 ? 39 ILE A HG21 15 
ATOM 9332  H HG22 . ILE A 1 39 ? 4.501   -36.768 18.014  1.00 0.00 ? 39 ILE A HG22 15 
ATOM 9333  H HG23 . ILE A 1 39 ? 5.913   -37.755 17.568  1.00 0.00 ? 39 ILE A HG23 15 
ATOM 9334  H HD11 . ILE A 1 39 ? 8.974   -38.653 19.230  1.00 0.00 ? 39 ILE A HD11 15 
ATOM 9335  H HD12 . ILE A 1 39 ? 7.602   -38.625 18.103  1.00 0.00 ? 39 ILE A HD12 15 
ATOM 9336  H HD13 . ILE A 1 39 ? 8.668   -37.206 18.247  1.00 0.00 ? 39 ILE A HD13 15 
ATOM 9337  N N    . TYR A 1 40 ? 4.880   -33.863 18.674  1.00 0.00 ? 40 TYR A N    15 
ATOM 9338  C CA   . TYR A 1 40 ? 3.745   -33.102 18.159  1.00 0.00 ? 40 TYR A CA   15 
ATOM 9339  C C    . TYR A 1 40 ? 4.224   -31.976 17.258  1.00 0.00 ? 40 TYR A C    15 
ATOM 9340  O O    . TYR A 1 40 ? 3.643   -31.713 16.206  1.00 0.00 ? 40 TYR A O    15 
ATOM 9341  C CB   . TYR A 1 40 ? 2.942   -32.492 19.310  1.00 0.00 ? 40 TYR A CB   15 
ATOM 9342  C CG   . TYR A 1 40 ? 1.730   -31.707 18.863  1.00 0.00 ? 40 TYR A CG   15 
ATOM 9343  C CD1  . TYR A 1 40 ? 0.566   -32.356 18.472  1.00 0.00 ? 40 TYR A CD1  15 
ATOM 9344  C CD2  . TYR A 1 40 ? 1.754   -30.318 18.833  1.00 0.00 ? 40 TYR A CD2  15 
ATOM 9345  C CE1  . TYR A 1 40 ? -0.546  -31.647 18.062  1.00 0.00 ? 40 TYR A CE1  15 
ATOM 9346  C CE2  . TYR A 1 40 ? 0.650   -29.592 18.425  1.00 0.00 ? 40 TYR A CE2  15 
ATOM 9347  C CZ   . TYR A 1 40 ? -0.505  -30.270 18.038  1.00 0.00 ? 40 TYR A CZ   15 
ATOM 9348  O OH   . TYR A 1 40 ? -1.612  -29.561 17.630  1.00 0.00 ? 40 TYR A OH   15 
ATOM 9349  H H    . TYR A 1 40 ? 5.089   -33.798 19.660  1.00 0.00 ? 40 TYR A H    15 
ATOM 9350  H HA   . TYR A 1 40 ? 3.103   -33.773 17.589  1.00 0.00 ? 40 TYR A HA   15 
ATOM 9351  H HB2  . TYR A 1 40 ? 2.610   -33.296 19.966  1.00 0.00 ? 40 TYR A HB2  15 
ATOM 9352  H HB3  . TYR A 1 40 ? 3.595   -31.827 19.875  1.00 0.00 ? 40 TYR A HB3  15 
ATOM 9353  H HD1  . TYR A 1 40 ? 0.529   -33.435 18.489  1.00 0.00 ? 40 TYR A HD1  15 
ATOM 9354  H HD2  . TYR A 1 40 ? 2.650   -29.796 19.134  1.00 0.00 ? 40 TYR A HD2  15 
ATOM 9355  H HE1  . TYR A 1 40 ? -1.443  -32.168 17.762  1.00 0.00 ? 40 TYR A HE1  15 
ATOM 9356  H HE2  . TYR A 1 40 ? 0.682   -28.512 18.407  1.00 0.00 ? 40 TYR A HE2  15 
ATOM 9357  H HH   . TYR A 1 40 ? -1.479  -28.610 17.650  1.00 0.00 ? 40 TYR A HH   15 
ATOM 9358  N N    . SER A 1 41 ? 5.294   -31.312 17.686  1.00 0.00 ? 41 SER A N    15 
ATOM 9359  C CA   . SER A 1 41 ? 5.877   -30.205 16.935  1.00 0.00 ? 41 SER A CA   15 
ATOM 9360  C C    . SER A 1 41 ? 6.319   -30.669 15.557  1.00 0.00 ? 41 SER A C    15 
ATOM 9361  O O    . SER A 1 41 ? 5.992   -30.055 14.543  1.00 0.00 ? 41 SER A O    15 
ATOM 9362  C CB   . SER A 1 41 ? 7.096   -29.643 17.669  1.00 0.00 ? 41 SER A CB   15 
ATOM 9363  O OG   . SER A 1 41 ? 6.721   -29.045 18.898  1.00 0.00 ? 41 SER A OG   15 
ATOM 9364  H H    . SER A 1 41 ? 5.726   -31.575 18.560  1.00 0.00 ? 41 SER A H    15 
ATOM 9365  H HA   . SER A 1 41 ? 5.127   -29.421 16.829  1.00 0.00 ? 41 SER A HA   15 
ATOM 9366  H HB2  . SER A 1 41 ? 7.797   -30.453 17.868  1.00 0.00 ? 41 SER A HB2  15 
ATOM 9367  H HB3  . SER A 1 41 ? 7.575   -28.892 17.041  1.00 0.00 ? 41 SER A HB3  15 
ATOM 9368  H HG   . SER A 1 41 ? 7.506   -28.703 19.331  1.00 0.00 ? 41 SER A HG   15 
ATOM 9369  N N    . MET A 1 42 ? 7.071   -31.766 15.535  1.00 0.00 ? 42 MET A N    15 
ATOM 9370  C CA   . MET A 1 42 ? 7.576   -32.341 14.291  1.00 0.00 ? 42 MET A CA   15 
ATOM 9371  C C    . MET A 1 42 ? 6.426   -32.815 13.418  1.00 0.00 ? 42 MET A C    15 
ATOM 9372  O O    . MET A 1 42 ? 6.431   -32.628 12.202  1.00 0.00 ? 42 MET A O    15 
ATOM 9373  C CB   . MET A 1 42 ? 8.485   -33.536 14.583  1.00 0.00 ? 42 MET A CB   15 
ATOM 9374  C CG   . MET A 1 42 ? 9.125   -34.147 13.347  1.00 0.00 ? 42 MET A CG   15 
ATOM 9375  S SD   . MET A 1 42 ? 10.212  -35.531 13.738  1.00 0.00 ? 42 MET A SD   15 
ATOM 9376  C CE   . MET A 1 42 ? 9.018   -36.770 14.234  1.00 0.00 ? 42 MET A CE   15 
ATOM 9377  H H    . MET A 1 42 ? 7.308   -32.224 16.403  1.00 0.00 ? 42 MET A H    15 
ATOM 9378  H HA   . MET A 1 42 ? 8.143   -31.578 13.758  1.00 0.00 ? 42 MET A HA   15 
ATOM 9379  H HB2  . MET A 1 42 ? 9.279   -33.206 15.253  1.00 0.00 ? 42 MET A HB2  15 
ATOM 9380  H HB3  . MET A 1 42 ? 7.890   -34.305 15.076  1.00 0.00 ? 42 MET A HB3  15 
ATOM 9381  H HG2  . MET A 1 42 ? 8.338   -34.496 12.679  1.00 0.00 ? 42 MET A HG2  15 
ATOM 9382  H HG3  . MET A 1 42 ? 9.704   -33.379 12.834  1.00 0.00 ? 42 MET A HG3  15 
ATOM 9383  H HE1  . MET A 1 42 ? 9.530   -37.691 14.509  1.00 0.00 ? 42 MET A HE1  15 
ATOM 9384  H HE2  . MET A 1 42 ? 8.451   -36.404 15.090  1.00 0.00 ? 42 MET A HE2  15 
ATOM 9385  H HE3  . MET A 1 42 ? 8.337   -36.969 13.406  1.00 0.00 ? 42 MET A HE3  15 
ATOM 9386  N N    . LEU A 1 43 ? 5.437   -33.434 14.057  1.00 0.00 ? 43 LEU A N    15 
ATOM 9387  C CA   . LEU A 1 43 ? 4.261   -33.949 13.363  1.00 0.00 ? 43 LEU A CA   15 
ATOM 9388  C C    . LEU A 1 43 ? 3.332   -32.811 12.972  1.00 0.00 ? 43 LEU A C    15 
ATOM 9389  O O    . LEU A 1 43 ? 2.761   -32.801 11.883  1.00 0.00 ? 43 LEU A O    15 
ATOM 9390  C CB   . LEU A 1 43 ? 3.489   -34.916 14.263  1.00 0.00 ? 43 LEU A CB   15 
ATOM 9391  C CG   . LEU A 1 43 ? 4.156   -36.265 14.539  1.00 0.00 ? 43 LEU A CG   15 
ATOM 9392  C CD1  . LEU A 1 43 ? 3.345   -37.070 15.543  1.00 0.00 ? 43 LEU A CD1  15 
ATOM 9393  C CD2  . LEU A 1 43 ? 4.273   -37.079 13.260  1.00 0.00 ? 43 LEU A CD2  15 
ATOM 9394  H H    . LEU A 1 43 ? 5.491   -33.557 15.058  1.00 0.00 ? 43 LEU A H    15 
ATOM 9395  H HA   . LEU A 1 43 ? 4.586   -34.474 12.465  1.00 0.00 ? 43 LEU A HA   15 
ATOM 9396  H HB2  . LEU A 1 43 ? 3.329   -34.422 15.222  1.00 0.00 ? 43 LEU A HB2  15 
ATOM 9397  H HB3  . LEU A 1 43 ? 2.526   -35.111 13.791  1.00 0.00 ? 43 LEU A HB3  15 
ATOM 9398  H HG   . LEU A 1 43 ? 5.152   -36.086 14.943  1.00 0.00 ? 43 LEU A HG   15 
ATOM 9399  H HD11 . LEU A 1 43 ? 3.836   -38.023 15.739  1.00 0.00 ? 43 LEU A HD11 15 
ATOM 9400  H HD12 . LEU A 1 43 ? 3.262   -36.509 16.474  1.00 0.00 ? 43 LEU A HD12 15 
ATOM 9401  H HD13 . LEU A 1 43 ? 2.348   -37.253 15.140  1.00 0.00 ? 43 LEU A HD13 15 
ATOM 9402  H HD21 . LEU A 1 43 ? 4.759   -38.031 13.469  1.00 0.00 ? 43 LEU A HD21 15 
ATOM 9403  H HD22 . LEU A 1 43 ? 3.277   -37.263 12.856  1.00 0.00 ? 43 LEU A HD22 15 
ATOM 9404  H HD23 . LEU A 1 43 ? 4.863   -36.524 12.531  1.00 0.00 ? 43 LEU A HD23 15 
ATOM 9405  N N    . ARG A 1 44 ? 3.190   -31.848 13.878  1.00 0.00 ? 44 ARG A N    15 
ATOM 9406  C CA   . ARG A 1 44 ? 2.334   -30.687 13.655  1.00 0.00 ? 44 ARG A CA   15 
ATOM 9407  C C    . ARG A 1 44 ? 3.065   -29.637 12.834  1.00 0.00 ? 44 ARG A C    15 
ATOM 9408  O O    . ARG A 1 44 ? 2.462   -28.919 12.038  1.00 0.00 ? 44 ARG A O    15 
ATOM 9409  C CB   . ARG A 1 44 ? 1.924   -30.059 14.989  1.00 0.00 ? 44 ARG A CB   15 
ATOM 9410  C CG   . ARG A 1 44 ? 0.956   -28.895 14.855  1.00 0.00 ? 44 ARG A CG   15 
ATOM 9411  C CD   . ARG A 1 44 ? -0.394  -29.358 14.331  1.00 0.00 ? 44 ARG A CD   15 
ATOM 9412  N NE   . ARG A 1 44 ? -1.343  -28.253 14.212  1.00 0.00 ? 44 ARG A NE   15 
ATOM 9413  C CZ   . ARG A 1 44 ? -2.532  -28.349 13.626  1.00 0.00 ? 44 ARG A CZ   15 
ATOM 9414  N NH1  . ARG A 1 44 ? -2.922  -29.503 13.103  1.00 0.00 ? 44 ARG A NH1  15 
ATOM 9415  N NH2  . ARG A 1 44 ? -3.328  -27.291 13.565  1.00 0.00 ? 44 ARG A NH2  15 
ATOM 9416  H H    . ARG A 1 44 ? 3.686   -31.912 14.755  1.00 0.00 ? 44 ARG A H    15 
ATOM 9417  H HA   . ARG A 1 44 ? 1.441   -31.008 13.118  1.00 0.00 ? 44 ARG A HA   15 
ATOM 9418  H HB2  . ARG A 1 44 ? 1.451   -30.828 15.599  1.00 0.00 ? 44 ARG A HB2  15 
ATOM 9419  H HB3  . ARG A 1 44 ? 2.823   -29.700 15.489  1.00 0.00 ? 44 ARG A HB3  15 
ATOM 9420  H HG2  . ARG A 1 44 ? 0.818   -28.433 15.833  1.00 0.00 ? 44 ARG A HG2  15 
ATOM 9421  H HG3  . ARG A 1 44 ? 1.373   -28.163 14.164  1.00 0.00 ? 44 ARG A HG3  15 
ATOM 9422  H HD2  . ARG A 1 44 ? -0.256  -29.811 13.350  1.00 0.00 ? 44 ARG A HD2  15 
ATOM 9423  H HD3  . ARG A 1 44 ? -0.803  -30.102 15.015  1.00 0.00 ? 44 ARG A HD3  15 
ATOM 9424  H HE   . ARG A 1 44 ? -1.067  -27.363 14.604  1.00 0.00 ? 44 ARG A HE   15 
ATOM 9425  H HH11 . ARG A 1 44 ? -2.316  -30.309 13.150  1.00 0.00 ? 44 ARG A HH11 15 
ATOM 9426  H HH12 . ARG A 1 44 ? -3.826  -29.575 12.658  1.00 0.00 ? 44 ARG A HH12 15 
ATOM 9427  H HH21 . ARG A 1 44 ? -3.032  -26.411 13.964  1.00 0.00 ? 44 ARG A HH21 15 
ATOM 9428  H HH22 . ARG A 1 44 ? -4.232  -27.364 13.120  1.00 0.00 ? 44 ARG A HH22 15 
ATOM 9429  N N    . LYS A 1 45 ? 4.376   -29.557 13.040  1.00 0.00 ? 45 LYS A N    15 
ATOM 9430  C CA   . LYS A 1 45 ? 5.220   -28.601 12.330  1.00 0.00 ? 45 LYS A CA   15 
ATOM 9431  C C    . LYS A 1 45 ? 5.415   -29.032 10.886  1.00 0.00 ? 45 LYS A C    15 
ATOM 9432  O O    . LYS A 1 45 ? 5.290   -28.231 9.961   1.00 0.00 ? 45 LYS A O    15 
ATOM 9433  C CB   . LYS A 1 45 ? 6.595   -28.503 12.995  1.00 0.00 ? 45 LYS A CB   15 
ATOM 9434  C CG   . LYS A 1 45 ? 7.524   -27.488 12.350  1.00 0.00 ? 45 LYS A CG   15 
ATOM 9435  C CD   . LYS A 1 45 ? 8.848   -27.402 13.093  1.00 0.00 ? 45 LYS A CD   15 
ATOM 9436  C CE   . LYS A 1 45 ? 9.783   -26.397 12.440  1.00 0.00 ? 45 LYS A CE   15 
ATOM 9437  N NZ   . LYS A 1 45 ? 11.080  -26.294 13.164  1.00 0.00 ? 45 LYS A NZ   15 
ATOM 9438  H H    . LYS A 1 45 ? 4.813   -30.174 13.709  1.00 0.00 ? 45 LYS A H    15 
ATOM 9439  H HA   . LYS A 1 45 ? 4.737   -27.623 12.354  1.00 0.00 ? 45 LYS A HA   15 
ATOM 9440  H HB2  . LYS A 1 45 ? 6.451   -28.221 14.038  1.00 0.00 ? 45 LYS A HB2  15 
ATOM 9441  H HB3  . LYS A 1 45 ? 7.070   -29.482 12.945  1.00 0.00 ? 45 LYS A HB3  15 
ATOM 9442  H HG2  . LYS A 1 45 ? 7.714   -27.785 11.319  1.00 0.00 ? 45 LYS A HG2  15 
ATOM 9443  H HG3  . LYS A 1 45 ? 7.045   -26.509 12.363  1.00 0.00 ? 45 LYS A HG3  15 
ATOM 9444  H HD2  . LYS A 1 45 ? 8.658   -27.094 14.122  1.00 0.00 ? 45 LYS A HD2  15 
ATOM 9445  H HD3  . LYS A 1 45 ? 9.322   -28.383 13.088  1.00 0.00 ? 45 LYS A HD3  15 
ATOM 9446  H HE2  . LYS A 1 45 ? 9.974   -26.707 11.413  1.00 0.00 ? 45 LYS A HE2  15 
ATOM 9447  H HE3  . LYS A 1 45 ? 9.302   -25.418 12.435  1.00 0.00 ? 45 LYS A HE3  15 
ATOM 9448  H HZ1  . LYS A 1 45 ? 11.675  -25.619 12.704  1.00 0.00 ? 45 LYS A HZ1  15 
ATOM 9449  H HZ2  . LYS A 1 45 ? 10.911  -25.998 14.115  1.00 0.00 ? 45 LYS A HZ2  15 
ATOM 9450  H HZ3  . LYS A 1 45 ? 11.535  -27.195 13.167  1.00 0.00 ? 45 LYS A HZ3  15 
ATOM 9451  N N    . ALA A 1 46 ? 5.723   -30.313 10.705  1.00 0.00 ? 46 ALA A N    15 
ATOM 9452  C CA   . ALA A 1 46 ? 5.943   -30.883 9.379   1.00 0.00 ? 46 ALA A CA   15 
ATOM 9453  C C    . ALA A 1 46 ? 6.274   -32.363 9.503   1.00 0.00 ? 46 ALA A C    15 
ATOM 9454  O O    . ALA A 1 46 ? 6.323   -32.901 10.606  1.00 0.00 ? 46 ALA A O    15 
ATOM 9455  C CB   . ALA A 1 46 ? 7.074   -30.131 8.684   1.00 0.00 ? 46 ALA A CB   15 
ATOM 9456  H H    . ALA A 1 46 ? 5.811   -30.921 11.506  1.00 0.00 ? 46 ALA A H    15 
ATOM 9457  H HA   . ALA A 1 46 ? 5.031   -30.771 8.792   1.00 0.00 ? 46 ALA A HA   15 
ATOM 9458  H HB1  . ALA A 1 46 ? 7.228   -30.548 7.689   1.00 0.00 ? 46 ALA A HB1  15 
ATOM 9459  H HB2  . ALA A 1 46 ? 6.813   -29.076 8.601   1.00 0.00 ? 46 ALA A HB2  15 
ATOM 9460  H HB3  . ALA A 1 46 ? 7.990   -30.234 9.267   1.00 0.00 ? 46 ALA A HB3  15 
ATOM 9461  N N    . GLY A 1 1  ? 26.021  -4.141  71.272  1.00 0.00 ? 1  GLY A N    16 
ATOM 9462  C CA   . GLY A 1 1  ? 27.470  -4.123  71.315  1.00 0.00 ? 1  GLY A CA   16 
ATOM 9463  C C    . GLY A 1 1  ? 28.035  -4.969  70.185  1.00 0.00 ? 1  GLY A C    16 
ATOM 9464  O O    . GLY A 1 1  ? 27.290  -5.548  69.398  1.00 0.00 ? 1  GLY A O    16 
ATOM 9465  H H1   . GLY A 1 1  ? 25.567  -4.677  70.546  1.00 0.00 ? 1  GLY A H1   16 
ATOM 9466  H HA2  . GLY A 1 1  ? 27.821  -3.096  71.209  1.00 0.00 ? 1  GLY A HA2  16 
ATOM 9467  H HA3  . GLY A 1 1  ? 27.808  -4.523  72.271  1.00 0.00 ? 1  GLY A HA3  16 
ATOM 9468  N N    . VAL A 1 2  ? 29.363  -5.029  70.120  1.00 0.00 ? 2  VAL A N    16 
ATOM 9469  C CA   . VAL A 1 2  ? 30.059  -5.798  69.094  1.00 0.00 ? 2  VAL A CA   16 
ATOM 9470  C C    . VAL A 1 2  ? 29.870  -7.288  69.325  1.00 0.00 ? 2  VAL A C    16 
ATOM 9471  O O    . VAL A 1 2  ? 29.612  -8.049  68.393  1.00 0.00 ? 2  VAL A O    16 
ATOM 9472  C CB   . VAL A 1 2  ? 31.571  -5.507  69.099  1.00 0.00 ? 2  VAL A CB   16 
ATOM 9473  C CG1  . VAL A 1 2  ? 32.299  -6.451  68.154  1.00 0.00 ? 2  VAL A CG1  16 
ATOM 9474  C CG2  . VAL A 1 2  ? 31.840  -4.078  68.651  1.00 0.00 ? 2  VAL A CG2  16 
ATOM 9475  H H    . VAL A 1 2  ? 29.917  -4.528  70.800  1.00 0.00 ? 2  VAL A H    16 
ATOM 9476  H HA   . VAL A 1 2  ? 29.646  -5.527  68.122  1.00 0.00 ? 2  VAL A HA   16 
ATOM 9477  H HB   . VAL A 1 2  ? 31.953  -5.645  70.111  1.00 0.00 ? 2  VAL A HB   16 
ATOM 9478  H HG11 . VAL A 1 2  ? 33.368  -6.241  68.173  1.00 0.00 ? 2  VAL A HG11 16 
ATOM 9479  H HG12 . VAL A 1 2  ? 32.127  -7.480  68.467  1.00 0.00 ? 2  VAL A HG12 16 
ATOM 9480  H HG13 . VAL A 1 2  ? 31.921  -6.312  67.141  1.00 0.00 ? 2  VAL A HG13 16 
ATOM 9481  H HG21 . VAL A 1 2  ? 32.911  -3.880  68.667  1.00 0.00 ? 2  VAL A HG21 16 
ATOM 9482  H HG22 . VAL A 1 2  ? 31.462  -3.938  67.638  1.00 0.00 ? 2  VAL A HG22 16 
ATOM 9483  H HG23 . VAL A 1 2  ? 31.335  -3.386  69.325  1.00 0.00 ? 2  VAL A HG23 16 
ATOM 9484  N N    . ILE A 1 3  ? 30.002  -7.696  70.584  1.00 0.00 ? 3  ILE A N    16 
ATOM 9485  C CA   . ILE A 1 3  ? 29.850  -9.095  70.971  1.00 0.00 ? 3  ILE A CA   16 
ATOM 9486  C C    . ILE A 1 3  ? 28.415  -9.552  70.763  1.00 0.00 ? 3  ILE A C    16 
ATOM 9487  O O    . ILE A 1 3  ? 28.162  -10.671 70.319  1.00 0.00 ? 3  ILE A O    16 
ATOM 9488  C CB   . ILE A 1 3  ? 30.206  -9.312  72.453  1.00 0.00 ? 3  ILE A CB   16 
ATOM 9489  C CG1  . ILE A 1 3  ? 31.698  -9.066  72.685  1.00 0.00 ? 3  ILE A CG1  16 
ATOM 9490  C CG2  . ILE A 1 3  ? 29.881  -10.737 72.876  1.00 0.00 ? 3  ILE A CG2  16 
ATOM 9491  C CD1  . ILE A 1 3  ? 32.089  -9.016  74.146  1.00 0.00 ? 3  ILE A CD1  16 
ATOM 9492  H H    . ILE A 1 3  ? 30.213  -7.022  71.306  1.00 0.00 ? 3  ILE A H    16 
ATOM 9493  H HA   . ILE A 1 3  ? 30.514  -9.697  70.352  1.00 0.00 ? 3  ILE A HA   16 
ATOM 9494  H HB   . ILE A 1 3  ? 29.627  -8.615  73.060  1.00 0.00 ? 3  ILE A HB   16 
ATOM 9495  H HG12 . ILE A 1 3  ? 32.257  -9.870  72.207  1.00 0.00 ? 3  ILE A HG12 16 
ATOM 9496  H HG13 . ILE A 1 3  ? 31.965  -8.114  72.226  1.00 0.00 ? 3  ILE A HG13 16 
ATOM 9497  H HG21 . ILE A 1 3  ? 30.127  -10.875 73.929  1.00 0.00 ? 3  ILE A HG21 16 
ATOM 9498  H HG22 . ILE A 1 3  ? 28.817  -10.925 72.726  1.00 0.00 ? 3  ILE A HG22 16 
ATOM 9499  H HG23 . ILE A 1 3  ? 30.462  -11.435 72.274  1.00 0.00 ? 3  ILE A HG23 16 
ATOM 9500  H HD11 . ILE A 1 3  ? 33.159  -8.840  74.250  1.00 0.00 ? 3  ILE A HD11 16 
ATOM 9501  H HD12 . ILE A 1 3  ? 31.545  -8.208  74.637  1.00 0.00 ? 3  ILE A HD12 16 
ATOM 9502  H HD13 . ILE A 1 3  ? 31.835  -9.964  74.619  1.00 0.00 ? 3  ILE A HD13 16 
ATOM 9503  N N    . ASP A 1 4  ? 27.477  -8.668  71.091  1.00 0.00 ? 4  ASP A N    16 
ATOM 9504  C CA   . ASP A 1 4  ? 26.053  -8.954  70.951  1.00 0.00 ? 4  ASP A CA   16 
ATOM 9505  C C    . ASP A 1 4  ? 25.745  -9.446  69.546  1.00 0.00 ? 4  ASP A C    16 
ATOM 9506  O O    . ASP A 1 4  ? 24.954  -10.369 69.355  1.00 0.00 ? 4  ASP A O    16 
ATOM 9507  C CB   . ASP A 1 4  ? 25.225  -7.695  71.215  1.00 0.00 ? 4  ASP A CB   16 
ATOM 9508  C CG   . ASP A 1 4  ? 25.221  -7.296  72.678  1.00 0.00 ? 4  ASP A CG   16 
ATOM 9509  O OD1  . ASP A 1 4  ? 24.461  -6.373  73.040  1.00 0.00 ? 4  ASP A OD1  16 
ATOM 9510  O OD2  . ASP A 1 4  ? 25.977  -7.908  73.462  1.00 0.00 ? 4  ASP A OD2  16 
ATOM 9511  H H    . ASP A 1 4  ? 27.748  -7.764  71.451  1.00 0.00 ? 4  ASP A H    16 
ATOM 9512  H HA   . ASP A 1 4  ? 25.778  -9.723  71.672  1.00 0.00 ? 4  ASP A HA   16 
ATOM 9513  H HB2  . ASP A 1 4  ? 25.638  -6.874  70.629  1.00 0.00 ? 4  ASP A HB2  16 
ATOM 9514  H HB3  . ASP A 1 4  ? 24.197  -7.878  70.900  1.00 0.00 ? 4  ASP A HB3  16 
ATOM 9515  H HD2  . ASP A 1 4  ? 25.923  -7.604  74.371  1.00 0.00 ? 4  ASP A HD2  16 
ATOM 9516  N N    . THR A 1 5  ? 26.382  -8.816  68.563  1.00 0.00 ? 5  THR A N    16 
ATOM 9517  C CA   . THR A 1 5  ? 26.195  -9.169  67.159  1.00 0.00 ? 5  THR A CA   16 
ATOM 9518  C C    . THR A 1 5  ? 27.270  -10.144 66.708  1.00 0.00 ? 5  THR A C    16 
ATOM 9519  O O    . THR A 1 5  ? 27.285  -10.590 65.562  1.00 0.00 ? 5  THR A O    16 
ATOM 9520  C CB   . THR A 1 5  ? 26.270  -7.928  66.250  1.00 0.00 ? 5  THR A CB   16 
ATOM 9521  O OG1  . THR A 1 5  ? 27.564  -7.325  66.366  1.00 0.00 ? 5  THR A OG1  16 
ATOM 9522  C CG2  . THR A 1 5  ? 25.214  -6.909  66.652  1.00 0.00 ? 5  THR A CG2  16 
ATOM 9523  H H    . THR A 1 5  ? 27.020  -8.065  68.785  1.00 0.00 ? 5  THR A H    16 
ATOM 9524  H HA   . THR A 1 5  ? 25.215  -9.633  67.048  1.00 0.00 ? 5  THR A HA   16 
ATOM 9525  H HB   . THR A 1 5  ? 26.102  -8.231  65.217  1.00 0.00 ? 5  THR A HB   16 
ATOM 9526  H HG1  . THR A 1 5  ? 27.597  -6.558  65.789  1.00 0.00 ? 5  THR A HG1  16 
ATOM 9527  H HG21 . THR A 1 5  ? 25.276  -6.037  66.001  1.00 0.00 ? 5  THR A HG21 16 
ATOM 9528  H HG22 . THR A 1 5  ? 24.224  -7.357  66.562  1.00 0.00 ? 5  THR A HG22 16 
ATOM 9529  H HG23 . THR A 1 5  ? 25.381  -6.601  67.685  1.00 0.00 ? 5  THR A HG23 16 
ATOM 9530  N N    . SER A 1 6  ? 28.173  -10.471 67.629  1.00 0.00 ? 6  SER A N    16 
ATOM 9531  C CA   . SER A 1 6  ? 29.269  -11.394 67.353  1.00 0.00 ? 6  SER A CA   16 
ATOM 9532  C C    . SER A 1 6  ? 28.748  -12.655 66.681  1.00 0.00 ? 6  SER A C    16 
ATOM 9533  O O    . SER A 1 6  ? 29.140  -12.989 65.564  1.00 0.00 ? 6  SER A O    16 
ATOM 9534  C CB   . SER A 1 6  ? 29.973  -11.794 68.651  1.00 0.00 ? 6  SER A CB   16 
ATOM 9535  O OG   . SER A 1 6  ? 31.034  -12.698 68.399  1.00 0.00 ? 6  SER A OG   16 
ATOM 9536  H H    . SER A 1 6  ? 28.106  -10.072 68.555  1.00 0.00 ? 6  SER A H    16 
ATOM 9537  H HA   . SER A 1 6  ? 29.983  -10.901 66.693  1.00 0.00 ? 6  SER A HA   16 
ATOM 9538  H HB2  . SER A 1 6  ? 30.373  -10.900 69.129  1.00 0.00 ? 6  SER A HB2  16 
ATOM 9539  H HB3  . SER A 1 6  ? 29.251  -12.269 69.316  1.00 0.00 ? 6  SER A HB3  16 
ATOM 9540  H HG   . SER A 1 6  ? 31.452  -12.927 69.232  1.00 0.00 ? 6  SER A HG   16 
ATOM 9541  N N    . ALA A 1 7  ? 27.856  -13.351 67.380  1.00 0.00 ? 7  ALA A N    16 
ATOM 9542  C CA   . ALA A 1 7  ? 27.260  -14.584 66.874  1.00 0.00 ? 7  ALA A CA   16 
ATOM 9543  C C    . ALA A 1 7  ? 26.512  -14.321 65.577  1.00 0.00 ? 7  ALA A C    16 
ATOM 9544  O O    . ALA A 1 7  ? 26.582  -15.105 64.631  1.00 0.00 ? 7  ALA A O    16 
ATOM 9545  C CB   . ALA A 1 7  ? 26.280  -15.154 67.888  1.00 0.00 ? 7  ALA A CB   16 
ATOM 9546  H H    . ALA A 1 7  ? 27.574  -13.024 68.294  1.00 0.00 ? 7  ALA A H    16 
ATOM 9547  H HA   . ALA A 1 7  ? 28.054  -15.308 66.693  1.00 0.00 ? 7  ALA A HA   16 
ATOM 9548  H HB1  . ALA A 1 7  ? 25.852  -16.081 67.507  1.00 0.00 ? 7  ALA A HB1  16 
ATOM 9549  H HB2  . ALA A 1 7  ? 26.802  -15.354 68.824  1.00 0.00 ? 7  ALA A HB2  16 
ATOM 9550  H HB3  . ALA A 1 7  ? 25.481  -14.433 68.065  1.00 0.00 ? 7  ALA A HB3  16 
ATOM 9551  N N    . VAL A 1 8  ? 25.791  -13.204 65.546  1.00 0.00 ? 8  VAL A N    16 
ATOM 9552  C CA   . VAL A 1 8  ? 25.016  -12.808 64.374  1.00 0.00 ? 8  VAL A CA   16 
ATOM 9553  C C    . VAL A 1 8  ? 25.933  -12.560 63.188  1.00 0.00 ? 8  VAL A C    16 
ATOM 9554  O O    . VAL A 1 8  ? 25.633  -12.949 62.060  1.00 0.00 ? 8  VAL A O    16 
ATOM 9555  C CB   . VAL A 1 8  ? 24.219  -11.516 64.634  1.00 0.00 ? 8  VAL A CB   16 
ATOM 9556  C CG1  . VAL A 1 8  ? 23.590  -11.010 63.346  1.00 0.00 ? 8  VAL A CG1  16 
ATOM 9557  C CG2  . VAL A 1 8  ? 23.110  -11.768 65.644  1.00 0.00 ? 8  VAL A CG2  16 
ATOM 9558  H H    . VAL A 1 8  ? 25.771  -12.601 66.356  1.00 0.00 ? 8  VAL A H    16 
ATOM 9559  H HA   . VAL A 1 8  ? 24.322  -13.613 64.132  1.00 0.00 ? 8  VAL A HA   16 
ATOM 9560  H HB   . VAL A 1 8  ? 24.896  -10.757 65.026  1.00 0.00 ? 8  VAL A HB   16 
ATOM 9561  H HG11 . VAL A 1 8  ? 23.036  -10.091 63.541  1.00 0.00 ? 8  VAL A HG11 16 
ATOM 9562  H HG12 . VAL A 1 8  ? 24.372  -10.811 62.614  1.00 0.00 ? 8  VAL A HG12 16 
ATOM 9563  H HG13 . VAL A 1 8  ? 22.909  -11.765 62.954  1.00 0.00 ? 8  VAL A HG13 16 
ATOM 9564  H HG21 . VAL A 1 8  ? 22.559  -10.845 65.826  1.00 0.00 ? 8  VAL A HG21 16 
ATOM 9565  H HG22 . VAL A 1 8  ? 22.428  -12.524 65.253  1.00 0.00 ? 8  VAL A HG22 16 
ATOM 9566  H HG23 . VAL A 1 8  ? 23.545  -12.119 66.580  1.00 0.00 ? 8  VAL A HG23 16 
ATOM 9567  N N    . GLU A 1 9  ? 27.059  -11.906 63.458  1.00 0.00 ? 9  GLU A N    16 
ATOM 9568  C CA   . GLU A 1 9  ? 28.045  -11.591 62.428  1.00 0.00 ? 9  GLU A CA   16 
ATOM 9569  C C    . GLU A 1 9  ? 28.511  -12.859 61.731  1.00 0.00 ? 9  GLU A C    16 
ATOM 9570  O O    . GLU A 1 9  ? 28.713  -12.880 60.518  1.00 0.00 ? 9  GLU A O    16 
ATOM 9571  C CB   . GLU A 1 9  ? 29.264  -10.903 63.046  1.00 0.00 ? 9  GLU A CB   16 
ATOM 9572  C CG   . GLU A 1 9  ? 30.314  -10.475 62.034  1.00 0.00 ? 9  GLU A CG   16 
ATOM 9573  C CD   . GLU A 1 9  ? 31.482  -9.753  62.676  1.00 0.00 ? 9  GLU A CD   16 
ATOM 9574  O OE1  . GLU A 1 9  ? 31.471  -9.589  63.914  1.00 0.00 ? 9  GLU A OE1  16 
ATOM 9575  O OE2  . GLU A 1 9  ? 32.409  -9.351  61.942  1.00 0.00 ? 9  GLU A OE2  16 
ATOM 9576  H H    . GLU A 1 9  ? 27.249  -11.612 64.406  1.00 0.00 ? 9  GLU A H    16 
ATOM 9577  H HA   . GLU A 1 9  ? 27.587  -10.924 61.698  1.00 0.00 ? 9  GLU A HA   16 
ATOM 9578  H HB2  . GLU A 1 9  ? 28.922  -10.016 63.581  1.00 0.00 ? 9  GLU A HB2  16 
ATOM 9579  H HB3  . GLU A 1 9  ? 29.728  -11.594 63.749  1.00 0.00 ? 9  GLU A HB3  16 
ATOM 9580  H HG2  . GLU A 1 9  ? 30.688  -11.361 61.522  1.00 0.00 ? 9  GLU A HG2  16 
ATOM 9581  H HG3  . GLU A 1 9  ? 29.848  -9.810  61.306  1.00 0.00 ? 9  GLU A HG3  16 
ATOM 9582  H HE2  . GLU A 1 9  ? 33.114  -8.903  62.415  1.00 0.00 ? 9  GLU A HE2  16 
ATOM 9583  N N    . SER A 1 10 ? 28.679  -13.918 62.517  1.00 0.00 ? 10 SER A N    16 
ATOM 9584  C CA   . SER A 1 10 ? 29.122  -15.209 62.001  1.00 0.00 ? 10 SER A CA   16 
ATOM 9585  C C    . SER A 1 10 ? 27.954  -15.973 61.400  1.00 0.00 ? 10 SER A C    16 
ATOM 9586  O O    . SER A 1 10 ? 28.039  -16.497 60.291  1.00 0.00 ? 10 SER A O    16 
ATOM 9587  C CB   . SER A 1 10 ? 29.726  -16.056 63.123  1.00 0.00 ? 10 SER A CB   16 
ATOM 9588  O OG   . SER A 1 10 ? 30.893  -15.447 63.649  1.00 0.00 ? 10 SER A OG   16 
ATOM 9589  H H    . SER A 1 10 ? 28.495  -13.837 63.507  1.00 0.00 ? 10 SER A H    16 
ATOM 9590  H HA   . SER A 1 10 ? 29.875  -15.038 61.233  1.00 0.00 ? 10 SER A HA   16 
ATOM 9591  H HB2  . SER A 1 10 ? 28.991  -16.166 63.921  1.00 0.00 ? 10 SER A HB2  16 
ATOM 9592  H HB3  . SER A 1 10 ? 29.984  -17.038 62.729  1.00 0.00 ? 10 SER A HB3  16 
ATOM 9593  H HG   . SER A 1 10 ? 31.245  -16.001 64.349  1.00 0.00 ? 10 SER A HG   16 
ATOM 9594  N N    . ALA A 1 11 ? 26.856  -16.027 62.151  1.00 0.00 ? 11 ALA A N    16 
ATOM 9595  C CA   . ALA A 1 11 ? 25.648  -16.722 61.716  1.00 0.00 ? 11 ALA A CA   16 
ATOM 9596  C C    . ALA A 1 11 ? 25.029  -16.018 60.520  1.00 0.00 ? 11 ALA A C    16 
ATOM 9597  O O    . ALA A 1 11 ? 24.537  -16.655 59.591  1.00 0.00 ? 11 ALA A O    16 
ATOM 9598  C CB   . ALA A 1 11 ? 24.622  -16.756 62.839  1.00 0.00 ? 11 ALA A CB   16 
ATOM 9599  H H    . ALA A 1 11 ? 26.847  -15.575 63.055  1.00 0.00 ? 11 ALA A H    16 
ATOM 9600  H HA   . ALA A 1 11 ? 25.912  -17.742 61.438  1.00 0.00 ? 11 ALA A HA   16 
ATOM 9601  H HB1  . ALA A 1 11 ? 23.730  -17.289 62.509  1.00 0.00 ? 11 ALA A HB1  16 
ATOM 9602  H HB2  . ALA A 1 11 ? 25.048  -17.264 63.704  1.00 0.00 ? 11 ALA A HB2  16 
ATOM 9603  H HB3  . ALA A 1 11 ? 24.351  -15.736 63.114  1.00 0.00 ? 11 ALA A HB3  16 
ATOM 9604  N N    . ILE A 1 12 ? 25.061  -14.689 60.556  1.00 0.00 ? 12 ILE A N    16 
ATOM 9605  C CA   . ILE A 1 12 ? 24.510  -13.865 59.485  1.00 0.00 ? 12 ILE A CA   16 
ATOM 9606  C C    . ILE A 1 12 ? 25.323  -14.033 58.212  1.00 0.00 ? 12 ILE A C    16 
ATOM 9607  O O    . ILE A 1 12 ? 24.774  -14.203 57.124  1.00 0.00 ? 12 ILE A O    16 
ATOM 9608  C CB   . ILE A 1 12 ? 24.521  -12.371 59.860  1.00 0.00 ? 12 ILE A CB   16 
ATOM 9609  C CG1  . ILE A 1 12 ? 23.554  -12.104 61.015  1.00 0.00 ? 12 ILE A CG1  16 
ATOM 9610  C CG2  . ILE A 1 12 ? 24.098  -11.521 58.671  1.00 0.00 ? 12 ILE A CG2  16 
ATOM 9611  C CD1  . ILE A 1 12 ? 22.115  -12.450 60.700  1.00 0.00 ? 12 ILE A CD1  16 
ATOM 9612  H H    . ILE A 1 12 ? 25.480  -14.222 61.348  1.00 0.00 ? 12 ILE A H    16 
ATOM 9613  H HA   . ILE A 1 12 ? 23.482  -14.179 59.302  1.00 0.00 ? 12 ILE A HA   16 
ATOM 9614  H HB   . ILE A 1 12 ? 25.529  -12.090 60.163  1.00 0.00 ? 12 ILE A HB   16 
ATOM 9615  H HG12 . ILE A 1 12 ? 23.870  -12.698 61.873  1.00 0.00 ? 12 ILE A HG12 16 
ATOM 9616  H HG13 . ILE A 1 12 ? 23.604  -11.045 61.268  1.00 0.00 ? 12 ILE A HG13 16 
ATOM 9617  H HG21 . ILE A 1 12 ? 24.119  -10.466 58.945  1.00 0.00 ? 12 ILE A HG21 16 
ATOM 9618  H HG22 . ILE A 1 12 ? 24.783  -11.692 57.841  1.00 0.00 ? 12 ILE A HG22 16 
ATOM 9619  H HG23 . ILE A 1 12 ? 23.087  -11.796 58.370  1.00 0.00 ? 12 ILE A HG23 16 
ATOM 9620  H HD11 . ILE A 1 12 ? 21.474  -12.240 61.557  1.00 0.00 ? 12 ILE A HD11 16 
ATOM 9621  H HD12 . ILE A 1 12 ? 21.779  -11.855 59.850  1.00 0.00 ? 12 ILE A HD12 16 
ATOM 9622  H HD13 . ILE A 1 12 ? 22.045  -13.509 60.453  1.00 0.00 ? 12 ILE A HD13 16 
ATOM 9623  N N    . THR A 1 13 ? 26.644  -13.983 58.363  1.00 0.00 ? 13 THR A N    16 
ATOM 9624  C CA   . THR A 1 13 ? 27.564  -14.127 57.238  1.00 0.00 ? 13 THR A CA   16 
ATOM 9625  C C    . THR A 1 13 ? 27.450  -15.517 56.632  1.00 0.00 ? 13 THR A C    16 
ATOM 9626  O O    . THR A 1 13 ? 27.446  -15.681 55.413  1.00 0.00 ? 13 THR A O    16 
ATOM 9627  C CB   . THR A 1 13 ? 29.026  -13.919 57.674  1.00 0.00 ? 13 THR A CB   16 
ATOM 9628  O OG1  . THR A 1 13 ? 29.192  -12.589 58.182  1.00 0.00 ? 13 THR A OG1  16 
ATOM 9629  C CG2  . THR A 1 13 ? 29.967  -14.117 56.496  1.00 0.00 ? 13 THR A CG2  16 
ATOM 9630  H H    . THR A 1 13 ? 27.034  -13.841 59.284  1.00 0.00 ? 13 THR A H    16 
ATOM 9631  H HA   . THR A 1 13 ? 27.306  -13.381 56.485  1.00 0.00 ? 13 THR A HA   16 
ATOM 9632  H HB   . THR A 1 13 ? 29.271  -14.638 58.455  1.00 0.00 ? 13 THR A HB   16 
ATOM 9633  H HG1  . THR A 1 13 ? 30.105  -12.477 58.457  1.00 0.00 ? 13 THR A HG1  16 
ATOM 9634  H HG21 . THR A 1 13 ? 30.997  -13.969 56.818  1.00 0.00 ? 13 THR A HG21 16 
ATOM 9635  H HG22 . THR A 1 13 ? 29.851  -15.128 56.106  1.00 0.00 ? 13 THR A HG22 16 
ATOM 9636  H HG23 . THR A 1 13 ? 29.725  -13.396 55.714  1.00 0.00 ? 13 THR A HG23 16 
ATOM 9637  N N    . ASP A 1 14 ? 27.358  -16.519 57.503  1.00 0.00 ? 14 ASP A N    16 
ATOM 9638  C CA   . ASP A 1 14 ? 27.244  -17.911 57.081  1.00 0.00 ? 14 ASP A CA   16 
ATOM 9639  C C    . ASP A 1 14 ? 25.898  -18.157 56.420  1.00 0.00 ? 14 ASP A C    16 
ATOM 9640  O O    . ASP A 1 14 ? 25.819  -18.718 55.328  1.00 0.00 ? 14 ASP A O    16 
ATOM 9641  C CB   . ASP A 1 14 ? 27.371  -18.848 58.284  1.00 0.00 ? 14 ASP A CB   16 
ATOM 9642  C CG   . ASP A 1 14 ? 28.783  -18.901 58.834  1.00 0.00 ? 14 ASP A CG   16 
ATOM 9643  O OD1  . ASP A 1 14 ? 29.040  -19.734 59.729  1.00 0.00 ? 14 ASP A OD1  16 
ATOM 9644  O OD2  . ASP A 1 14 ? 29.631  -18.111 58.371  1.00 0.00 ? 14 ASP A OD2  16 
ATOM 9645  H H    . ASP A 1 14 ? 27.367  -16.320 58.493  1.00 0.00 ? 14 ASP A H    16 
ATOM 9646  H HA   . ASP A 1 14 ? 28.041  -18.127 56.370  1.00 0.00 ? 14 ASP A HA   16 
ATOM 9647  H HB2  . ASP A 1 14 ? 26.701  -18.501 59.071  1.00 0.00 ? 14 ASP A HB2  16 
ATOM 9648  H HB3  . ASP A 1 14 ? 27.076  -19.852 57.979  1.00 0.00 ? 14 ASP A HB3  16 
ATOM 9649  H HD2  . ASP A 1 14 ? 30.502  -18.199 58.764  1.00 0.00 ? 14 ASP A HD2  16 
ATOM 9650  N N    . GLY A 1 15 ? 24.837  -17.729 57.098  1.00 0.00 ? 15 GLY A N    16 
ATOM 9651  C CA   . GLY A 1 15 ? 23.475  -17.890 56.598  1.00 0.00 ? 15 GLY A CA   16 
ATOM 9652  C C    . GLY A 1 15 ? 23.130  -16.776 55.623  1.00 0.00 ? 15 GLY A C    16 
ATOM 9653  O O    . GLY A 1 15 ? 22.959  -17.008 54.427  1.00 0.00 ? 15 GLY A O    16 
ATOM 9654  H H    . GLY A 1 15 ? 24.966  -17.275 57.991  1.00 0.00 ? 15 GLY A H    16 
ATOM 9655  H HA2  . GLY A 1 15 ? 23.389  -18.850 56.090  1.00 0.00 ? 15 GLY A HA2  16 
ATOM 9656  H HA3  . GLY A 1 15 ? 22.778  -17.862 57.436  1.00 0.00 ? 15 GLY A HA3  16 
ATOM 9657  N N    . GLN A 1 16 ? 23.029  -15.560 56.152  1.00 0.00 ? 16 GLN A N    16 
ATOM 9658  C CA   . GLN A 1 16 ? 22.705  -14.385 55.350  1.00 0.00 ? 16 GLN A CA   16 
ATOM 9659  C C    . GLN A 1 16 ? 23.583  -14.328 54.110  1.00 0.00 ? 16 GLN A C    16 
ATOM 9660  O O    . GLN A 1 16 ? 23.091  -14.243 52.986  1.00 0.00 ? 16 GLN A O    16 
ATOM 9661  C CB   . GLN A 1 16 ? 22.928  -13.106 56.159  1.00 0.00 ? 16 GLN A CB   16 
ATOM 9662  C CG   . GLN A 1 16 ? 22.573  -11.830 55.414  1.00 0.00 ? 16 GLN A CG   16 
ATOM 9663  C CD   . GLN A 1 16 ? 21.095  -11.739 55.086  1.00 0.00 ? 16 GLN A CD   16 
ATOM 9664  O OE1  . GLN A 1 16 ? 20.246  -11.836 55.972  1.00 0.00 ? 16 GLN A OE1  16 
ATOM 9665  N NE2  . GLN A 1 16 ? 20.784  -11.551 53.808  1.00 0.00 ? 16 GLN A NE2  16 
ATOM 9666  H H    . GLN A 1 16 ? 23.179  -15.434 57.143  1.00 0.00 ? 16 GLN A H    16 
ATOM 9667  H HA   . GLN A 1 16 ? 21.658  -14.443 55.050  1.00 0.00 ? 16 GLN A HA   16 
ATOM 9668  H HB2  . GLN A 1 16 ? 22.314  -13.158 57.059  1.00 0.00 ? 16 GLN A HB2  16 
ATOM 9669  H HB3  . GLN A 1 16 ? 23.980  -13.057 56.439  1.00 0.00 ? 16 GLN A HB3  16 
ATOM 9670  H HG2  . GLN A 1 16 ? 22.848  -10.975 56.032  1.00 0.00 ? 16 GLN A HG2  16 
ATOM 9671  H HG3  . GLN A 1 16 ? 23.140  -11.798 54.484  1.00 0.00 ? 16 GLN A HG3  16 
ATOM 9672  H HE21 . GLN A 1 16 ? 21.516  -11.477 53.117  1.00 0.00 ? 16 GLN A HE21 16 
ATOM 9673  H HE22 . GLN A 1 16 ? 19.815  -11.482 53.530  1.00 0.00 ? 16 GLN A HE22 16 
ATOM 9674  N N    . GLY A 1 17 ? 24.893  -14.375 54.332  1.00 0.00 ? 17 GLY A N    16 
ATOM 9675  C CA   . GLY A 1 17 ? 25.870  -14.330 53.247  1.00 0.00 ? 17 GLY A CA   16 
ATOM 9676  C C    . GLY A 1 17 ? 25.533  -15.365 52.185  1.00 0.00 ? 17 GLY A C    16 
ATOM 9677  O O    . GLY A 1 17 ? 25.527  -15.071 50.991  1.00 0.00 ? 17 GLY A O    16 
ATOM 9678  H H    . GLY A 1 17 ? 25.235  -14.444 55.280  1.00 0.00 ? 17 GLY A H    16 
ATOM 9679  H HA2  . GLY A 1 17 ? 25.862  -13.337 52.797  1.00 0.00 ? 17 GLY A HA2  16 
ATOM 9680  H HA3  . GLY A 1 17 ? 26.862  -14.536 53.648  1.00 0.00 ? 17 GLY A HA3  16 
ATOM 9681  N N    . ASP A 1 18 ? 25.253  -16.583 52.638  1.00 0.00 ? 18 ASP A N    16 
ATOM 9682  C CA   . ASP A 1 18 ? 24.910  -17.687 51.746  1.00 0.00 ? 18 ASP A CA   16 
ATOM 9683  C C    . ASP A 1 18 ? 23.728  -17.313 50.867  1.00 0.00 ? 18 ASP A C    16 
ATOM 9684  O O    . ASP A 1 18 ? 23.438  -17.979 49.874  1.00 0.00 ? 18 ASP A O    16 
ATOM 9685  C CB   . ASP A 1 18 ? 24.538  -18.932 52.553  1.00 0.00 ? 18 ASP A CB   16 
ATOM 9686  C CG   . ASP A 1 18 ? 25.733  -19.555 53.247  1.00 0.00 ? 18 ASP A CG   16 
ATOM 9687  O OD1  . ASP A 1 18 ? 25.805  -20.801 53.302  1.00 0.00 ? 18 ASP A OD1  16 
ATOM 9688  O OD2  . ASP A 1 18 ? 26.597  -18.798 53.736  1.00 0.00 ? 18 ASP A OD2  16 
ATOM 9689  H H    . ASP A 1 18 ? 25.276  -16.762 53.632  1.00 0.00 ? 18 ASP A H    16 
ATOM 9690  H HA   . ASP A 1 18 ? 25.772  -17.909 51.117  1.00 0.00 ? 18 ASP A HA   16 
ATOM 9691  H HB2  . ASP A 1 18 ? 23.800  -18.654 53.307  1.00 0.00 ? 18 ASP A HB2  16 
ATOM 9692  H HB3  . ASP A 1 18 ? 24.101  -19.669 51.879  1.00 0.00 ? 18 ASP A HB3  16 
ATOM 9693  H HD2  . ASP A 1 18 ? 27.324  -19.259 54.160  1.00 0.00 ? 18 ASP A HD2  16 
ATOM 9694  N N    . MET A 1 19 ? 23.047  -16.236 51.246  1.00 0.00 ? 19 MET A N    16 
ATOM 9695  C CA   . MET A 1 19 ? 21.886  -15.747 50.509  1.00 0.00 ? 19 MET A CA   16 
ATOM 9696  C C    . MET A 1 19 ? 22.293  -15.286 49.119  1.00 0.00 ? 19 MET A C    16 
ATOM 9697  O O    . MET A 1 19 ? 21.611  -15.560 48.133  1.00 0.00 ? 19 MET A O    16 
ATOM 9698  C CB   . MET A 1 19 ? 21.245  -14.567 51.241  1.00 0.00 ? 19 MET A CB   16 
ATOM 9699  C CG   . MET A 1 19 ? 19.976  -14.045 50.587  1.00 0.00 ? 19 MET A CG   16 
ATOM 9700  S SD   . MET A 1 19 ? 19.244  -12.665 51.488  1.00 0.00 ? 19 MET A SD   16 
ATOM 9701  C CE   . MET A 1 19 ? 18.665  -13.495 52.966  1.00 0.00 ? 19 MET A CE   16 
ATOM 9702  H H    . MET A 1 19 ? 23.333  -15.731 52.073  1.00 0.00 ? 19 MET A H    16 
ATOM 9703  H HA   . MET A 1 19 ? 21.159  -16.555 50.424  1.00 0.00 ? 19 MET A HA   16 
ATOM 9704  H HB2  . MET A 1 19 ? 21.002  -14.884 52.255  1.00 0.00 ? 19 MET A HB2  16 
ATOM 9705  H HB3  . MET A 1 19 ? 21.969  -13.753 51.279  1.00 0.00 ? 19 MET A HB3  16 
ATOM 9706  H HG2  . MET A 1 19 ? 20.210  -13.717 49.574  1.00 0.00 ? 19 MET A HG2  16 
ATOM 9707  H HG3  . MET A 1 19 ? 19.248  -14.854 50.533  1.00 0.00 ? 19 MET A HG3  16 
ATOM 9708  H HE1  . MET A 1 19 ? 18.184  -12.777 53.632  1.00 0.00 ? 19 MET A HE1  16 
ATOM 9709  H HE2  . MET A 1 19 ? 17.946  -14.266 52.690  1.00 0.00 ? 19 MET A HE2  16 
ATOM 9710  H HE3  . MET A 1 19 ? 19.510  -13.952 53.479  1.00 0.00 ? 19 MET A HE3  16 
ATOM 9711  N N    . LYS A 1 20 ? 23.419  -14.581 49.054  1.00 0.00 ? 20 LYS A N    16 
ATOM 9712  C CA   . LYS A 1 20 ? 23.945  -14.066 47.793  1.00 0.00 ? 20 LYS A CA   16 
ATOM 9713  C C    . LYS A 1 20 ? 24.177  -15.203 46.810  1.00 0.00 ? 20 LYS A C    16 
ATOM 9714  O O    . LYS A 1 20 ? 23.877  -15.088 45.623  1.00 0.00 ? 20 LYS A O    16 
ATOM 9715  C CB   . LYS A 1 20 ? 25.275  -13.345 48.022  1.00 0.00 ? 20 LYS A CB   16 
ATOM 9716  C CG   . LYS A 1 20 ? 25.866  -12.721 46.768  1.00 0.00 ? 20 LYS A CG   16 
ATOM 9717  C CD   . LYS A 1 20 ? 27.154  -11.975 47.078  1.00 0.00 ? 20 LYS A CD   16 
ATOM 9718  C CE   . LYS A 1 20 ? 27.753  -11.363 45.822  1.00 0.00 ? 20 LYS A CE   16 
ATOM 9719  N NZ   . LYS A 1 20 ? 29.010  -10.619 46.111  1.00 0.00 ? 20 LYS A NZ   16 
ATOM 9720  H H    . LYS A 1 20 ? 23.936  -14.389 49.900  1.00 0.00 ? 20 LYS A H    16 
ATOM 9721  H HA   . LYS A 1 20 ? 23.223  -13.365 47.372  1.00 0.00 ? 20 LYS A HA   16 
ATOM 9722  H HB2  . LYS A 1 20 ? 25.113  -12.554 48.755  1.00 0.00 ? 20 LYS A HB2  16 
ATOM 9723  H HB3  . LYS A 1 20 ? 25.991  -14.065 48.417  1.00 0.00 ? 20 LYS A HB3  16 
ATOM 9724  H HG2  . LYS A 1 20 ? 26.077  -13.508 46.045  1.00 0.00 ? 20 LYS A HG2  16 
ATOM 9725  H HG3  . LYS A 1 20 ? 25.144  -12.022 46.344  1.00 0.00 ? 20 LYS A HG3  16 
ATOM 9726  H HD2  . LYS A 1 20 ? 26.941  -11.180 47.794  1.00 0.00 ? 20 LYS A HD2  16 
ATOM 9727  H HD3  . LYS A 1 20 ? 27.872  -12.671 47.511  1.00 0.00 ? 20 LYS A HD3  16 
ATOM 9728  H HE2  . LYS A 1 20 ? 27.969  -12.159 45.109  1.00 0.00 ? 20 LYS A HE2  16 
ATOM 9729  H HE3  . LYS A 1 20 ? 27.028  -10.676 45.384  1.00 0.00 ? 20 LYS A HE3  16 
ATOM 9730  H HZ1  . LYS A 1 20 ? 29.379  -10.227 45.256  1.00 0.00 ? 20 LYS A HZ1  16 
ATOM 9731  H HZ2  . LYS A 1 20 ? 28.816  -9.874  46.765  1.00 0.00 ? 20 LYS A HZ2  16 
ATOM 9732  H HZ3  . LYS A 1 20 ? 29.689  -11.250 46.511  1.00 0.00 ? 20 LYS A HZ3  16 
ATOM 9733  N N    . ALA A 1 21 ? 24.717  -16.305 47.323  1.00 0.00 ? 21 ALA A N    16 
ATOM 9734  C CA   . ALA A 1 21 ? 25.003  -17.485 46.511  1.00 0.00 ? 21 ALA A CA   16 
ATOM 9735  C C    . ALA A 1 21 ? 23.711  -18.141 46.053  1.00 0.00 ? 21 ALA A C    16 
ATOM 9736  O O    . ALA A 1 21 ? 23.586  -18.570 44.907  1.00 0.00 ? 21 ALA A O    16 
ATOM 9737  C CB   . ALA A 1 21 ? 25.801  -18.501 47.314  1.00 0.00 ? 21 ALA A CB   16 
ATOM 9738  H H    . ALA A 1 21 ? 24.941  -16.337 48.307  1.00 0.00 ? 21 ALA A H    16 
ATOM 9739  H HA   . ALA A 1 21 ? 25.581  -17.178 45.640  1.00 0.00 ? 21 ALA A HA   16 
ATOM 9740  H HB1  . ALA A 1 21 ? 26.021  -19.370 46.695  1.00 0.00 ? 21 ALA A HB1  16 
ATOM 9741  H HB2  . ALA A 1 21 ? 26.735  -18.047 47.646  1.00 0.00 ? 21 ALA A HB2  16 
ATOM 9742  H HB3  . ALA A 1 21 ? 25.220  -18.813 48.182  1.00 0.00 ? 21 ALA A HB3  16 
ATOM 9743  N N    . ILE A 1 22 ? 22.747  -18.214 46.968  1.00 0.00 ? 22 ILE A N    16 
ATOM 9744  C CA   . ILE A 1 22 ? 21.448  -18.817 46.685  1.00 0.00 ? 22 ILE A CA   16 
ATOM 9745  C C    . ILE A 1 22 ? 20.711  -18.017 45.623  1.00 0.00 ? 22 ILE A C    16 
ATOM 9746  O O    . ILE A 1 22 ? 20.206  -18.569 44.647  1.00 0.00 ? 22 ILE A O    16 
ATOM 9747  C CB   . ILE A 1 22 ? 20.561  -18.864 47.943  1.00 0.00 ? 22 ILE A CB   16 
ATOM 9748  C CG1  . ILE A 1 22 ? 21.147  -19.834 48.972  1.00 0.00 ? 22 ILE A CG1  16 
ATOM 9749  C CG2  . ILE A 1 22 ? 19.157  -19.328 47.588  1.00 0.00 ? 22 ILE A CG2  16 
ATOM 9750  C CD1  . ILE A 1 22 ? 20.481  -19.760 50.329  1.00 0.00 ? 22 ILE A CD1  16 
ATOM 9751  H H    . ILE A 1 22 ? 22.908  -17.841 47.893  1.00 0.00 ? 22 ILE A H    16 
ATOM 9752  H HA   . ILE A 1 22 ? 21.611  -19.832 46.325  1.00 0.00 ? 22 ILE A HA   16 
ATOM 9753  H HB   . ILE A 1 22 ? 20.510  -17.865 48.377  1.00 0.00 ? 22 ILE A HB   16 
ATOM 9754  H HG12 . ILE A 1 22 ? 21.036  -20.848 48.590  1.00 0.00 ? 22 ILE A HG12 16 
ATOM 9755  H HG13 . ILE A 1 22 ? 22.205  -19.605 49.096  1.00 0.00 ? 22 ILE A HG13 16 
ATOM 9756  H HG21 . ILE A 1 22 ? 18.536  -19.347 48.484  1.00 0.00 ? 22 ILE A HG21 16 
ATOM 9757  H HG22 . ILE A 1 22 ? 18.721  -18.641 46.862  1.00 0.00 ? 22 ILE A HG22 16 
ATOM 9758  H HG23 . ILE A 1 22 ? 19.203  -20.328 47.159  1.00 0.00 ? 22 ILE A HG23 16 
ATOM 9759  H HD11 . ILE A 1 22 ? 20.936  -20.471 51.018  1.00 0.00 ? 22 ILE A HD11 16 
ATOM 9760  H HD12 . ILE A 1 22 ? 20.592  -18.752 50.730  1.00 0.00 ? 22 ILE A HD12 16 
ATOM 9761  H HD13 . ILE A 1 22 ? 19.421  -19.994 50.224  1.00 0.00 ? 22 ILE A HD13 16 
ATOM 9762  N N    . GLY A 1 23 ? 20.655  -16.704 45.827  1.00 0.00 ? 23 GLY A N    16 
ATOM 9763  C CA   . GLY A 1 23 ? 19.984  -15.798 44.899  1.00 0.00 ? 23 GLY A CA   16 
ATOM 9764  C C    . GLY A 1 23 ? 20.718  -15.759 43.568  1.00 0.00 ? 23 GLY A C    16 
ATOM 9765  O O    . GLY A 1 23 ? 20.106  -15.806 42.502  1.00 0.00 ? 23 GLY A O    16 
ATOM 9766  H H    . GLY A 1 23 ? 21.088  -16.309 46.650  1.00 0.00 ? 23 GLY A H    16 
ATOM 9767  H HA2  . GLY A 1 23 ? 18.962  -16.142 44.736  1.00 0.00 ? 23 GLY A HA2  16 
ATOM 9768  H HA3  . GLY A 1 23 ? 19.962  -14.795 45.327  1.00 0.00 ? 23 GLY A HA3  16 
ATOM 9769  N N    . GLY A 1 24 ? 22.043  -15.674 43.645  1.00 0.00 ? 24 GLY A N    16 
ATOM 9770  C CA   . GLY A 1 24 ? 22.891  -15.626 42.458  1.00 0.00 ? 24 GLY A CA   16 
ATOM 9771  C C    . GLY A 1 24 ? 22.848  -16.954 41.719  1.00 0.00 ? 24 GLY A C    16 
ATOM 9772  O O    . GLY A 1 24 ? 22.555  -17.009 40.526  1.00 0.00 ? 24 GLY A O    16 
ATOM 9773  H H    . GLY A 1 24 ? 22.488  -15.640 44.551  1.00 0.00 ? 24 GLY A H    16 
ATOM 9774  H HA2  . GLY A 1 24 ? 22.538  -14.834 41.796  1.00 0.00 ? 24 GLY A HA2  16 
ATOM 9775  H HA3  . GLY A 1 24 ? 23.917  -15.414 42.758  1.00 0.00 ? 24 GLY A HA3  16 
ATOM 9776  N N    . TYR A 1 25 ? 23.144  -18.027 42.447  1.00 0.00 ? 25 TYR A N    16 
ATOM 9777  C CA   . TYR A 1 25 ? 23.148  -19.374 41.885  1.00 0.00 ? 25 TYR A CA   16 
ATOM 9778  C C    . TYR A 1 25 ? 21.801  -19.692 41.256  1.00 0.00 ? 25 TYR A C    16 
ATOM 9779  O O    . TYR A 1 25 ? 21.725  -20.313 40.197  1.00 0.00 ? 25 TYR A O    16 
ATOM 9780  C CB   . TYR A 1 25 ? 23.429  -20.409 42.976  1.00 0.00 ? 25 TYR A CB   16 
ATOM 9781  C CG   . TYR A 1 25 ? 23.436  -21.837 42.479  1.00 0.00 ? 25 TYR A CG   16 
ATOM 9782  C CD1  . TYR A 1 25 ? 24.533  -22.346 41.795  1.00 0.00 ? 25 TYR A CD1  16 
ATOM 9783  C CD2  . TYR A 1 25 ? 22.347  -22.671 42.695  1.00 0.00 ? 25 TYR A CD2  16 
ATOM 9784  C CE1  . TYR A 1 25 ? 24.548  -23.650 41.336  1.00 0.00 ? 25 TYR A CE1  16 
ATOM 9785  C CE2  . TYR A 1 25 ? 22.345  -23.977 42.244  1.00 0.00 ? 25 TYR A CE2  16 
ATOM 9786  C CZ   . TYR A 1 25 ? 23.458  -24.463 41.560  1.00 0.00 ? 25 TYR A CZ   16 
ATOM 9787  O OH   . TYR A 1 25 ? 23.471  -25.761 41.105  1.00 0.00 ? 25 TYR A OH   16 
ATOM 9788  H H    . TYR A 1 25 ? 23.376  -17.917 43.424  1.00 0.00 ? 25 TYR A H    16 
ATOM 9789  H HA   . TYR A 1 25 ? 23.925  -19.433 41.124  1.00 0.00 ? 25 TYR A HA   16 
ATOM 9790  H HB2  . TYR A 1 25 ? 24.401  -20.191 43.418  1.00 0.00 ? 25 TYR A HB2  16 
ATOM 9791  H HB3  . TYR A 1 25 ? 22.665  -20.315 43.748  1.00 0.00 ? 25 TYR A HB3  16 
ATOM 9792  H HD1  . TYR A 1 25 ? 25.389  -21.711 41.619  1.00 0.00 ? 25 TYR A HD1  16 
ATOM 9793  H HD2  . TYR A 1 25 ? 21.485  -22.292 43.225  1.00 0.00 ? 25 TYR A HD2  16 
ATOM 9794  H HE1  . TYR A 1 25 ? 25.408  -24.029 40.805  1.00 0.00 ? 25 TYR A HE1  16 
ATOM 9795  H HE2  . TYR A 1 25 ? 21.490  -24.613 42.420  1.00 0.00 ? 25 TYR A HE2  16 
ATOM 9796  H HH   . TYR A 1 25 ? 22.665  -26.240 41.313  1.00 0.00 ? 25 TYR A HH   16 
ATOM 9797  N N    . ILE A 1 26 ? 20.737  -19.255 41.924  1.00 0.00 ? 26 ILE A N    16 
ATOM 9798  C CA   . ILE A 1 26 ? 19.374  -19.479 41.452  1.00 0.00 ? 26 ILE A CA   16 
ATOM 9799  C C    . ILE A 1 26 ? 19.059  -18.562 40.282  1.00 0.00 ? 26 ILE A C    16 
ATOM 9800  O O    . ILE A 1 26 ? 18.492  -18.985 39.276  1.00 0.00 ? 26 ILE A O    16 
ATOM 9801  C CB   . ILE A 1 26 ? 18.341  -19.205 42.560  1.00 0.00 ? 26 ILE A CB   16 
ATOM 9802  C CG1  . ILE A 1 26 ? 18.477  -20.235 43.683  1.00 0.00 ? 26 ILE A CG1  16 
ATOM 9803  C CG2  . ILE A 1 26 ? 16.928  -19.284 42.003  1.00 0.00 ? 26 ILE A CG2  16 
ATOM 9804  C CD1  . ILE A 1 26 ? 17.674  -19.899 44.921  1.00 0.00 ? 26 ILE A CD1  16 
ATOM 9805  H H    . ILE A 1 26 ? 20.865  -18.748 42.789  1.00 0.00 ? 26 ILE A H    16 
ATOM 9806  H HA   . ILE A 1 26 ? 19.286  -20.517 41.132  1.00 0.00 ? 26 ILE A HA   16 
ATOM 9807  H HB   . ILE A 1 26 ? 18.513  -18.207 42.964  1.00 0.00 ? 26 ILE A HB   16 
ATOM 9808  H HG12 . ILE A 1 26 ? 18.139  -21.200 43.307  1.00 0.00 ? 26 ILE A HG12 16 
ATOM 9809  H HG13 . ILE A 1 26 ? 19.528  -20.301 43.963  1.00 0.00 ? 26 ILE A HG13 16 
ATOM 9810  H HG21 . ILE A 1 26 ? 16.206  -19.078 42.794  1.00 0.00 ? 26 ILE A HG21 16 
ATOM 9811  H HG22 . ILE A 1 26 ? 16.810  -18.548 41.207  1.00 0.00 ? 26 ILE A HG22 16 
ATOM 9812  H HG23 . ILE A 1 26 ? 16.751  -20.282 41.604  1.00 0.00 ? 26 ILE A HG23 16 
ATOM 9813  H HD11 . ILE A 1 26 ? 17.808  -20.665 45.684  1.00 0.00 ? 26 ILE A HD11 16 
ATOM 9814  H HD12 . ILE A 1 26 ? 18.007  -18.939 45.317  1.00 0.00 ? 26 ILE A HD12 16 
ATOM 9815  H HD13 . ILE A 1 26 ? 16.617  -19.837 44.659  1.00 0.00 ? 26 ILE A HD13 16 
ATOM 9816  N N    . VAL A 1 27 ? 19.435  -17.295 40.428  1.00 0.00 ? 27 VAL A N    16 
ATOM 9817  C CA   . VAL A 1 27 ? 19.204  -16.288 39.395  1.00 0.00 ? 27 VAL A CA   16 
ATOM 9818  C C    . VAL A 1 27 ? 20.180  -16.474 38.244  1.00 0.00 ? 27 VAL A C    16 
ATOM 9819  O O    . VAL A 1 27 ? 19.869  -16.175 37.092  1.00 0.00 ? 27 VAL A O    16 
ATOM 9820  C CB   . VAL A 1 27 ? 19.387  -14.862 39.946  1.00 0.00 ? 27 VAL A CB   16 
ATOM 9821  C CG1  . VAL A 1 27 ? 20.860  -14.569 40.187  1.00 0.00 ? 27 VAL A CG1  16 
ATOM 9822  C CG2  . VAL A 1 27 ? 18.848  -13.836 38.960  1.00 0.00 ? 27 VAL A CG2  16 
ATOM 9823  H H    . VAL A 1 27 ? 19.897  -17.007 41.279  1.00 0.00 ? 27 VAL A H    16 
ATOM 9824  H HA   . VAL A 1 27 ? 18.184  -16.400 39.026  1.00 0.00 ? 27 VAL A HA   16 
ATOM 9825  H HB   . VAL A 1 27 ? 18.844  -14.775 40.888  1.00 0.00 ? 27 VAL A HB   16 
ATOM 9826  H HG11 . VAL A 1 27 ? 20.976  -13.561 40.585  1.00 0.00 ? 27 VAL A HG11 16 
ATOM 9827  H HG12 . VAL A 1 27 ? 21.260  -15.287 40.902  1.00 0.00 ? 27 VAL A HG12 16 
ATOM 9828  H HG13 . VAL A 1 27 ? 21.404  -14.650 39.246  1.00 0.00 ? 27 VAL A HG13 16 
ATOM 9829  H HG21 . VAL A 1 27 ? 18.975  -12.831 39.365  1.00 0.00 ? 27 VAL A HG21 16 
ATOM 9830  H HG22 . VAL A 1 27 ? 19.391  -13.917 38.019  1.00 0.00 ? 27 VAL A HG22 16 
ATOM 9831  H HG23 . VAL A 1 27 ? 17.788  -14.023 38.785  1.00 0.00 ? 27 VAL A HG23 16 
ATOM 9832  N N    . GLY A 1 28 ? 21.368  -16.972 38.572  1.00 0.00 ? 28 GLY A N    16 
ATOM 9833  C CA   . GLY A 1 28 ? 22.415  -17.210 37.583  1.00 0.00 ? 28 GLY A CA   16 
ATOM 9834  C C    . GLY A 1 28 ? 22.095  -18.444 36.755  1.00 0.00 ? 28 GLY A C    16 
ATOM 9835  O O    . GLY A 1 28 ? 22.565  -18.594 35.629  1.00 0.00 ? 28 GLY A O    16 
ATOM 9836  H H    . GLY A 1 28 ? 21.563  -17.197 39.537  1.00 0.00 ? 28 GLY A H    16 
ATOM 9837  H HA2  . GLY A 1 28 ? 22.490  -16.344 36.924  1.00 0.00 ? 28 GLY A HA2  16 
ATOM 9838  H HA3  . GLY A 1 28 ? 23.366  -17.357 38.095  1.00 0.00 ? 28 GLY A HA3  16 
ATOM 9839  N N    . ALA A 1 29 ? 21.284  -19.328 37.331  1.00 0.00 ? 29 ALA A N    16 
ATOM 9840  C CA   . ALA A 1 29 ? 20.882  -20.564 36.669  1.00 0.00 ? 29 ALA A CA   16 
ATOM 9841  C C    . ALA A 1 29 ? 19.684  -20.318 35.764  1.00 0.00 ? 29 ALA A C    16 
ATOM 9842  O O    . ALA A 1 29 ? 19.538  -20.947 34.717  1.00 0.00 ? 29 ALA A O    16 
ATOM 9843  C CB   . ALA A 1 29 ? 20.501  -21.617 37.698  1.00 0.00 ? 29 ALA A CB   16 
ATOM 9844  H H    . ALA A 1 29 ? 20.929  -19.147 38.259  1.00 0.00 ? 29 ALA A H    16 
ATOM 9845  H HA   . ALA A 1 29 ? 21.717  -20.928 36.072  1.00 0.00 ? 29 ALA A HA   16 
ATOM 9846  H HB1  . ALA A 1 29 ? 20.216  -22.540 37.194  1.00 0.00 ? 29 ALA A HB1  16 
ATOM 9847  H HB2  . ALA A 1 29 ? 21.352  -21.809 38.352  1.00 0.00 ? 29 ALA A HB2  16 
ATOM 9848  H HB3  . ALA A 1 29 ? 19.661  -21.256 38.292  1.00 0.00 ? 29 ALA A HB3  16 
ATOM 9849  N N    . LEU A 1 30 ? 18.828  -19.392 36.185  1.00 0.00 ? 30 LEU A N    16 
ATOM 9850  C CA   . LEU A 1 30 ? 17.629  -19.039 35.430  1.00 0.00 ? 30 LEU A CA   16 
ATOM 9851  C C    . LEU A 1 30 ? 17.993  -18.631 34.012  1.00 0.00 ? 30 LEU A C    16 
ATOM 9852  O O    . LEU A 1 30 ? 17.222  -18.831 33.075  1.00 0.00 ? 30 LEU A O    16 
ATOM 9853  C CB   . LEU A 1 30 ? 16.900  -17.871 36.097  1.00 0.00 ? 30 LEU A CB   16 
ATOM 9854  C CG   . LEU A 1 30 ? 16.213  -18.173 37.430  1.00 0.00 ? 30 LEU A CG   16 
ATOM 9855  C CD1  . LEU A 1 30 ? 15.642  -16.902 38.040  1.00 0.00 ? 30 LEU A CD1  16 
ATOM 9856  C CD2  . LEU A 1 30 ? 15.073  -19.161 37.236  1.00 0.00 ? 30 LEU A CD2  16 
ATOM 9857  H H    . LEU A 1 30 ? 19.003  -18.910 37.055  1.00 0.00 ? 30 LEU A H    16 
ATOM 9858  H HA   . LEU A 1 30 ? 16.968  -19.905 35.399  1.00 0.00 ? 30 LEU A HA   16 
ATOM 9859  H HB2  . LEU A 1 30 ? 17.629  -17.080 36.271  1.00 0.00 ? 30 LEU A HB2  16 
ATOM 9860  H HB3  . LEU A 1 30 ? 16.137  -17.515 35.404  1.00 0.00 ? 30 LEU A HB3  16 
ATOM 9861  H HG   . LEU A 1 30 ? 16.946  -18.601 38.113  1.00 0.00 ? 30 LEU A HG   16 
ATOM 9862  H HD11 . LEU A 1 30 ? 15.164  -17.128 38.994  1.00 0.00 ? 30 LEU A HD11 16 
ATOM 9863  H HD12 . LEU A 1 30 ? 16.446  -16.184 38.202  1.00 0.00 ? 30 LEU A HD12 16 
ATOM 9864  H HD13 . LEU A 1 30 ? 14.904  -16.473 37.361  1.00 0.00 ? 30 LEU A HD13 16 
ATOM 9865  H HD21 . LEU A 1 30 ? 14.599  -19.375 38.194  1.00 0.00 ? 30 LEU A HD21 16 
ATOM 9866  H HD22 . LEU A 1 30 ? 14.334  -18.733 36.558  1.00 0.00 ? 30 LEU A HD22 16 
ATOM 9867  H HD23 . LEU A 1 30 ? 15.463  -20.085 36.812  1.00 0.00 ? 30 LEU A HD23 16 
ATOM 9868  N N    . VAL A 1 31 ? 19.183  -18.055 33.867  1.00 0.00 ? 31 VAL A N    16 
ATOM 9869  C CA   . VAL A 1 31 ? 19.680  -17.607 32.569  1.00 0.00 ? 31 VAL A CA   16 
ATOM 9870  C C    . VAL A 1 31 ? 19.657  -18.749 31.567  1.00 0.00 ? 31 VAL A C    16 
ATOM 9871  O O    . VAL A 1 31 ? 19.400  -18.549 30.381  1.00 0.00 ? 31 VAL A O    16 
ATOM 9872  C CB   . VAL A 1 31 ? 21.128  -17.092 32.666  1.00 0.00 ? 31 VAL A CB   16 
ATOM 9873  C CG1  . VAL A 1 31 ? 21.701  -16.848 31.279  1.00 0.00 ? 31 VAL A CG1  16 
ATOM 9874  C CG2  . VAL A 1 31 ? 21.178  -15.785 33.444  1.00 0.00 ? 31 VAL A CG2  16 
ATOM 9875  H H    . VAL A 1 31 ? 19.771  -17.917 34.676  1.00 0.00 ? 31 VAL A H    16 
ATOM 9876  H HA   . VAL A 1 31 ? 19.037  -16.801 32.214  1.00 0.00 ? 31 VAL A HA   16 
ATOM 9877  H HB   . VAL A 1 31 ? 21.733  -17.839 33.179  1.00 0.00 ? 31 VAL A HB   16 
ATOM 9878  H HG11 . VAL A 1 31 ? 22.728  -16.492 31.360  1.00 0.00 ? 31 VAL A HG11 16 
ATOM 9879  H HG12 . VAL A 1 31 ? 21.684  -17.778 30.711  1.00 0.00 ? 31 VAL A HG12 16 
ATOM 9880  H HG13 . VAL A 1 31 ? 21.099  -16.098 30.765  1.00 0.00 ? 31 VAL A HG13 16 
ATOM 9881  H HG21 . VAL A 1 31 ? 22.208  -15.435 33.514  1.00 0.00 ? 31 VAL A HG21 16 
ATOM 9882  H HG22 . VAL A 1 31 ? 20.575  -15.034 32.931  1.00 0.00 ? 31 VAL A HG22 16 
ATOM 9883  H HG23 . VAL A 1 31 ? 20.782  -15.945 34.447  1.00 0.00 ? 31 VAL A HG23 16 
ATOM 9884  N N    . ILE A 1 32 ? 19.930  -19.953 32.061  1.00 0.00 ? 32 ILE A N    16 
ATOM 9885  C CA   . ILE A 1 32 ? 19.948  -21.153 31.228  1.00 0.00 ? 32 ILE A CA   16 
ATOM 9886  C C    . ILE A 1 32 ? 18.557  -21.448 30.690  1.00 0.00 ? 32 ILE A C    16 
ATOM 9887  O O    . ILE A 1 32 ? 18.387  -21.797 29.523  1.00 0.00 ? 32 ILE A O    16 
ATOM 9888  C CB   . ILE A 1 32 ? 20.419  -22.385 32.023  1.00 0.00 ? 32 ILE A CB   16 
ATOM 9889  C CG1  . ILE A 1 32 ? 21.890  -22.234 32.417  1.00 0.00 ? 32 ILE A CG1  16 
ATOM 9890  C CG2  . ILE A 1 32 ? 20.271  -23.647 31.187  1.00 0.00 ? 32 ILE A CG2  16 
ATOM 9891  C CD1  . ILE A 1 32 ? 22.367  -23.276 33.405  1.00 0.00 ? 32 ILE A CD1  16 
ATOM 9892  H H    . ILE A 1 32 ? 20.132  -20.053 33.046  1.00 0.00 ? 32 ILE A H    16 
ATOM 9893  H HA   . ILE A 1 32 ? 20.629  -20.983 30.395  1.00 0.00 ? 32 ILE A HA   16 
ATOM 9894  H HB   . ILE A 1 32 ? 19.812  -22.476 32.924  1.00 0.00 ? 32 ILE A HB   16 
ATOM 9895  H HG12 . ILE A 1 32 ? 22.497  -22.312 31.515  1.00 0.00 ? 32 ILE A HG12 16 
ATOM 9896  H HG13 . ILE A 1 32 ? 22.027  -21.249 32.864  1.00 0.00 ? 32 ILE A HG13 16 
ATOM 9897  H HG21 . ILE A 1 32 ? 20.598  -24.512 31.763  1.00 0.00 ? 32 ILE A HG21 16 
ATOM 9898  H HG22 . ILE A 1 32 ? 19.225  -23.774 30.906  1.00 0.00 ? 32 ILE A HG22 16 
ATOM 9899  H HG23 . ILE A 1 32 ? 20.881  -23.559 30.288  1.00 0.00 ? 32 ILE A HG23 16 
ATOM 9900  H HD11 . ILE A 1 32 ? 23.418  -23.120 33.647  1.00 0.00 ? 32 ILE A HD11 16 
ATOM 9901  H HD12 . ILE A 1 32 ? 21.775  -23.203 34.318  1.00 0.00 ? 32 ILE A HD12 16 
ATOM 9902  H HD13 . ILE A 1 32 ? 22.244  -24.267 32.970  1.00 0.00 ? 32 ILE A HD13 16 
ATOM 9903  N N    . LEU A 1 33 ? 17.562  -21.301 31.560  1.00 0.00 ? 33 LEU A N    16 
ATOM 9904  C CA   . LEU A 1 33 ? 16.168  -21.547 31.199  1.00 0.00 ? 33 LEU A CA   16 
ATOM 9905  C C    . LEU A 1 33 ? 15.724  -20.586 30.108  1.00 0.00 ? 33 LEU A C    16 
ATOM 9906  O O    . LEU A 1 33 ? 15.132  -20.988 29.108  1.00 0.00 ? 33 LEU A O    16 
ATOM 9907  C CB   . LEU A 1 33 ? 15.258  -21.354 32.414  1.00 0.00 ? 33 LEU A CB   16 
ATOM 9908  C CG   . LEU A 1 33 ? 15.342  -22.427 33.501  1.00 0.00 ? 33 LEU A CG   16 
ATOM 9909  C CD1  . LEU A 1 33 ? 14.486  -22.047 34.699  1.00 0.00 ? 33 LEU A CD1  16 
ATOM 9910  C CD2  . LEU A 1 33 ? 14.852  -23.767 32.973  1.00 0.00 ? 33 LEU A CD2  16 
ATOM 9911  H H    . LEU A 1 33 ? 17.765  -21.009 32.506  1.00 0.00 ? 33 LEU A H    16 
ATOM 9912  H HA   . LEU A 1 33 ? 16.075  -22.571 30.839  1.00 0.00 ? 33 LEU A HA   16 
ATOM 9913  H HB2  . LEU A 1 33 ? 15.512  -20.397 32.871  1.00 0.00 ? 33 LEU A HB2  16 
ATOM 9914  H HB3  . LEU A 1 33 ? 14.228  -21.323 32.056  1.00 0.00 ? 33 LEU A HB3  16 
ATOM 9915  H HG   . LEU A 1 33 ? 16.380  -22.524 33.818  1.00 0.00 ? 33 LEU A HG   16 
ATOM 9916  H HD11 . LEU A 1 33 ? 14.562  -22.814 35.470  1.00 0.00 ? 33 LEU A HD11 16 
ATOM 9917  H HD12 . LEU A 1 33 ? 14.830  -21.095 35.103  1.00 0.00 ? 33 LEU A HD12 16 
ATOM 9918  H HD13 . LEU A 1 33 ? 13.446  -21.953 34.386  1.00 0.00 ? 33 LEU A HD13 16 
ATOM 9919  H HD21 . LEU A 1 33 ? 14.927  -24.524 33.753  1.00 0.00 ? 33 LEU A HD21 16 
ATOM 9920  H HD22 . LEU A 1 33 ? 13.811  -23.674 32.660  1.00 0.00 ? 33 LEU A HD22 16 
ATOM 9921  H HD23 . LEU A 1 33 ? 15.462  -24.065 32.121  1.00 0.00 ? 33 LEU A HD23 16 
ATOM 9922  N N    . ALA A 1 34 ? 16.020  -19.306 30.314  1.00 0.00 ? 34 ALA A N    16 
ATOM 9923  C CA   . ALA A 1 34 ? 15.662  -18.259 29.360  1.00 0.00 ? 34 ALA A CA   16 
ATOM 9924  C C    . ALA A 1 34 ? 16.293  -18.535 28.005  1.00 0.00 ? 34 ALA A C    16 
ATOM 9925  O O    . ALA A 1 34 ? 15.667  -18.353 26.962  1.00 0.00 ? 34 ALA A O    16 
ATOM 9926  C CB   . ALA A 1 34 ? 16.149  -16.905 29.852  1.00 0.00 ? 34 ALA A CB   16 
ATOM 9927  H H    . ALA A 1 34 ? 16.508  -19.037 31.156  1.00 0.00 ? 34 ALA A H    16 
ATOM 9928  H HA   . ALA A 1 34 ? 14.577  -18.236 29.256  1.00 0.00 ? 34 ALA A HA   16 
ATOM 9929  H HB1  . ALA A 1 34 ? 15.864  -16.129 29.141  1.00 0.00 ? 34 ALA A HB1  16 
ATOM 9930  H HB2  . ALA A 1 34 ? 15.700  -16.688 30.822  1.00 0.00 ? 34 ALA A HB2  16 
ATOM 9931  H HB3  . ALA A 1 34 ? 17.234  -16.924 29.951  1.00 0.00 ? 34 ALA A HB3  16 
ATOM 9932  N N    . VAL A 1 35 ? 17.546  -18.980 28.034  1.00 0.00 ? 35 VAL A N    16 
ATOM 9933  C CA   . VAL A 1 35 ? 18.292  -19.292 26.818  1.00 0.00 ? 35 VAL A CA   16 
ATOM 9934  C C    . VAL A 1 35 ? 17.537  -20.308 25.977  1.00 0.00 ? 35 VAL A C    16 
ATOM 9935  O O    . VAL A 1 35 ? 17.439  -20.177 24.758  1.00 0.00 ? 35 VAL A O    16 
ATOM 9936  C CB   . VAL A 1 35 ? 19.678  -19.881 27.141  1.00 0.00 ? 35 VAL A CB   16 
ATOM 9937  C CG1  . VAL A 1 35 ? 20.349  -20.390 25.875  1.00 0.00 ? 35 VAL A CG1  16 
ATOM 9938  C CG2  . VAL A 1 35 ? 20.573  -18.823 27.768  1.00 0.00 ? 35 VAL A CG2  16 
ATOM 9939  H H    . VAL A 1 35 ? 18.007  -19.110 28.923  1.00 0.00 ? 35 VAL A H    16 
ATOM 9940  H HA   . VAL A 1 35 ? 18.419  -18.372 26.247  1.00 0.00 ? 35 VAL A HA   16 
ATOM 9941  H HB   . VAL A 1 35 ? 19.555  -20.708 27.840  1.00 0.00 ? 35 VAL A HB   16 
ATOM 9942  H HG11 . VAL A 1 35 ? 21.324  -20.811 26.118  1.00 0.00 ? 35 VAL A HG11 16 
ATOM 9943  H HG12 . VAL A 1 35 ? 19.725  -21.159 25.419  1.00 0.00 ? 35 VAL A HG12 16 
ATOM 9944  H HG13 . VAL A 1 35 ? 20.476  -19.563 25.175  1.00 0.00 ? 35 VAL A HG13 16 
ATOM 9945  H HG21 . VAL A 1 35 ? 21.547  -19.253 28.000  1.00 0.00 ? 35 VAL A HG21 16 
ATOM 9946  H HG22 . VAL A 1 35 ? 20.700  -17.996 27.070  1.00 0.00 ? 35 VAL A HG22 16 
ATOM 9947  H HG23 . VAL A 1 35 ? 20.112  -18.455 28.685  1.00 0.00 ? 35 VAL A HG23 16 
ATOM 9948  N N    . ALA A 1 36 ? 17.005  -21.325 26.647  1.00 0.00 ? 36 ALA A N    16 
ATOM 9949  C CA   . ALA A 1 36 ? 16.250  -22.385 25.985  1.00 0.00 ? 36 ALA A CA   16 
ATOM 9950  C C    . ALA A 1 36 ? 14.976  -21.828 25.371  1.00 0.00 ? 36 ALA A C    16 
ATOM 9951  O O    . ALA A 1 36 ? 14.643  -22.120 24.223  1.00 0.00 ? 36 ALA A O    16 
ATOM 9952  C CB   . ALA A 1 36 ? 15.870  -23.468 26.983  1.00 0.00 ? 36 ALA A CB   16 
ATOM 9953  H H    . ALA A 1 36 ? 17.121  -21.376 27.649  1.00 0.00 ? 36 ALA A H    16 
ATOM 9954  H HA   . ALA A 1 36 ? 16.869  -22.818 25.200  1.00 0.00 ? 36 ALA A HA   16 
ATOM 9955  H HB1  . ALA A 1 36 ? 15.320  -24.261 26.476  1.00 0.00 ? 36 ALA A HB1  16 
ATOM 9956  H HB2  . ALA A 1 36 ? 16.774  -23.883 27.429  1.00 0.00 ? 36 ALA A HB2  16 
ATOM 9957  H HB3  . ALA A 1 36 ? 15.244  -23.037 27.765  1.00 0.00 ? 36 ALA A HB3  16 
ATOM 9958  N N    . GLY A 1 37 ? 14.267  -21.020 26.153  1.00 0.00 ? 37 GLY A N    16 
ATOM 9959  C CA   . GLY A 1 37 ? 13.019  -20.403 25.712  1.00 0.00 ? 37 GLY A CA   16 
ATOM 9960  C C    . GLY A 1 37 ? 13.202  -19.746 24.353  1.00 0.00 ? 37 GLY A C    16 
ATOM 9961  O O    . GLY A 1 37 ? 12.535  -20.098 23.381  1.00 0.00 ? 37 GLY A O    16 
ATOM 9962  H H    . GLY A 1 37 ? 14.593  -20.819 27.087  1.00 0.00 ? 37 GLY A H    16 
ATOM 9963  H HA2  . GLY A 1 37 ? 12.245  -21.167 25.641  1.00 0.00 ? 37 GLY A HA2  16 
ATOM 9964  H HA3  . GLY A 1 37 ? 12.714  -19.648 26.438  1.00 0.00 ? 37 GLY A HA3  16 
ATOM 9965  N N    . LEU A 1 38 ? 14.119  -18.784 24.299  1.00 0.00 ? 38 LEU A N    16 
ATOM 9966  C CA   . LEU A 1 38 ? 14.414  -18.055 23.068  1.00 0.00 ? 38 LEU A CA   16 
ATOM 9967  C C    . LEU A 1 38 ? 14.898  -19.010 21.989  1.00 0.00 ? 38 LEU A C    16 
ATOM 9968  O O    . LEU A 1 38 ? 14.548  -18.875 20.818  1.00 0.00 ? 38 LEU A O    16 
ATOM 9969  C CB   . LEU A 1 38 ? 15.503  -17.009 23.313  1.00 0.00 ? 38 LEU A CB   16 
ATOM 9970  C CG   . LEU A 1 38 ? 15.101  -15.796 24.154  1.00 0.00 ? 38 LEU A CG   16 
ATOM 9971  C CD1  . LEU A 1 38 ? 16.304  -14.906 24.425  1.00 0.00 ? 38 LEU A CD1  16 
ATOM 9972  C CD2  . LEU A 1 38 ? 14.049  -14.966 23.434  1.00 0.00 ? 38 LEU A CD2  16 
ATOM 9973  H H    . LEU A 1 38 ? 14.635  -18.541 25.132  1.00 0.00 ? 38 LEU A H    16 
ATOM 9974  H HA   . LEU A 1 38 ? 13.505  -17.556 22.730  1.00 0.00 ? 38 LEU A HA   16 
ATOM 9975  H HB2  . LEU A 1 38 ? 16.331  -17.504 23.820  1.00 0.00 ? 38 LEU A HB2  16 
ATOM 9976  H HB3  . LEU A 1 38 ? 15.837  -16.643 22.342  1.00 0.00 ? 38 LEU A HB3  16 
ATOM 9977  H HG   . LEU A 1 38 ? 14.693  -16.147 25.102  1.00 0.00 ? 38 LEU A HG   16 
ATOM 9978  H HD11 . LEU A 1 38 ? 16.006  -14.052 25.034  1.00 0.00 ? 38 LEU A HD11 16 
ATOM 9979  H HD12 . LEU A 1 38 ? 17.065  -15.478 24.955  1.00 0.00 ? 38 LEU A HD12 16 
ATOM 9980  H HD13 . LEU A 1 38 ? 16.711  -14.549 23.479  1.00 0.00 ? 38 LEU A HD13 16 
ATOM 9981  H HD21 . LEU A 1 38 ? 13.763  -14.112 24.049  1.00 0.00 ? 38 LEU A HD21 16 
ATOM 9982  H HD22 . LEU A 1 38 ? 14.455  -14.608 22.488  1.00 0.00 ? 38 LEU A HD22 16 
ATOM 9983  H HD23 . LEU A 1 38 ? 13.170  -15.582 23.243  1.00 0.00 ? 38 LEU A HD23 16 
ATOM 9984  N N    . ILE A 1 39 ? 15.711  -19.979 22.400  1.00 0.00 ? 39 ILE A N    16 
ATOM 9985  C CA   . ILE A 1 39 ? 16.262  -20.975 21.487  1.00 0.00 ? 39 ILE A CA   16 
ATOM 9986  C C    . ILE A 1 39 ? 15.145  -21.736 20.792  1.00 0.00 ? 39 ILE A C    16 
ATOM 9987  O O    . ILE A 1 39 ? 15.188  -21.966 19.584  1.00 0.00 ? 39 ILE A O    16 
ATOM 9988  C CB   . ILE A 1 39 ? 17.140  -21.998 22.231  1.00 0.00 ? 39 ILE A CB   16 
ATOM 9989  C CG1  . ILE A 1 39 ? 18.405  -21.325 22.768  1.00 0.00 ? 39 ILE A CG1  16 
ATOM 9990  C CG2  . ILE A 1 39 ? 17.553  -23.125 21.297  1.00 0.00 ? 39 ILE A CG2  16 
ATOM 9991  C CD1  . ILE A 1 39 ? 19.280  -20.723 21.690  1.00 0.00 ? 39 ILE A CD1  16 
ATOM 9992  H H    . ILE A 1 39 ? 15.961  -20.037 23.377  1.00 0.00 ? 39 ILE A H    16 
ATOM 9993  H HA   . ILE A 1 39 ? 16.867  -20.460 20.741  1.00 0.00 ? 39 ILE A HA   16 
ATOM 9994  H HB   . ILE A 1 39 ? 16.571  -22.411 23.064  1.00 0.00 ? 39 ILE A HB   16 
ATOM 9995  H HG12 . ILE A 1 39 ? 18.108  -20.530 23.453  1.00 0.00 ? 39 ILE A HG12 16 
ATOM 9996  H HG13 . ILE A 1 39 ? 18.988  -22.070 23.308  1.00 0.00 ? 39 ILE A HG13 16 
ATOM 9997  H HG21 . ILE A 1 39 ? 18.165  -23.847 21.837  1.00 0.00 ? 39 ILE A HG21 16 
ATOM 9998  H HG22 . ILE A 1 39 ? 16.662  -23.621 20.913  1.00 0.00 ? 39 ILE A HG22 16 
ATOM 9999  H HG23 . ILE A 1 39 ? 18.126  -22.715 20.466  1.00 0.00 ? 39 ILE A HG23 16 
ATOM 10000 H HD11 . ILE A 1 39 ? 20.162  -20.258 22.129  1.00 0.00 ? 39 ILE A HD11 16 
ATOM 10001 H HD12 . ILE A 1 39 ? 19.594  -21.507 21.002  1.00 0.00 ? 39 ILE A HD12 16 
ATOM 10002 H HD13 . ILE A 1 39 ? 18.712  -19.968 21.146  1.00 0.00 ? 39 ILE A HD13 16 
ATOM 10003 N N    . TYR A 1 40 ? 14.142  -22.125 21.574  1.00 0.00 ? 40 TYR A N    16 
ATOM 10004 C CA   . TYR A 1 40 ? 12.994  -22.866 21.059  1.00 0.00 ? 40 TYR A CA   16 
ATOM 10005 C C    . TYR A 1 40 ? 12.149  -21.981 20.158  1.00 0.00 ? 40 TYR A C    16 
ATOM 10006 O O    . TYR A 1 40 ? 11.678  -22.409 19.106  1.00 0.00 ? 40 TYR A O    16 
ATOM 10007 C CB   . TYR A 1 40 ? 12.116  -23.362 22.210  1.00 0.00 ? 40 TYR A CB   16 
ATOM 10008 C CG   . TYR A 1 40 ? 10.915  -24.164 21.763  1.00 0.00 ? 40 TYR A CG   16 
ATOM 10009 C CD1  . TYR A 1 40 ? 11.051  -25.490 21.372  1.00 0.00 ? 40 TYR A CD1  16 
ATOM 10010 C CD2  . TYR A 1 40 ? 9.649   -23.593 21.733  1.00 0.00 ? 40 TYR A CD2  16 
ATOM 10011 C CE1  . TYR A 1 40 ? 9.959   -26.231 20.961  1.00 0.00 ? 40 TYR A CE1  16 
ATOM 10012 C CE2  . TYR A 1 40 ? 8.546   -24.319 21.325  1.00 0.00 ? 40 TYR A CE2  16 
ATOM 10013 C CZ   . TYR A 1 40 ? 8.711   -25.648 20.938  1.00 0.00 ? 40 TYR A CZ   16 
ATOM 10014 O OH   . TYR A 1 40 ? 7.622   -26.384 20.530  1.00 0.00 ? 40 TYR A OH   16 
ATOM 10015 H H    . TYR A 1 40 ? 14.165  -21.906 22.560  1.00 0.00 ? 40 TYR A H    16 
ATOM 10016 H HA   . TYR A 1 40 ? 13.357  -23.720 20.489  1.00 0.00 ? 40 TYR A HA   16 
ATOM 10017 H HB2  . TYR A 1 40 ? 12.723  -23.985 22.866  1.00 0.00 ? 40 TYR A HB2  16 
ATOM 10018 H HB3  . TYR A 1 40 ? 11.764  -22.498 22.775  1.00 0.00 ? 40 TYR A HB3  16 
ATOM 10019 H HD1  . TYR A 1 40 ? 12.027  -25.950 21.390  1.00 0.00 ? 40 TYR A HD1  16 
ATOM 10020 H HD2  . TYR A 1 40 ? 9.524   -22.563 22.034  1.00 0.00 ? 40 TYR A HD2  16 
ATOM 10021 H HE1  . TYR A 1 40 ? 10.083  -27.260 20.660  1.00 0.00 ? 40 TYR A HE1  16 
ATOM 10022 H HE2  . TYR A 1 40 ? 7.567   -23.861 21.306  1.00 0.00 ? 40 TYR A HE2  16 
ATOM 10023 H HH   . TYR A 1 40 ? 6.802   -25.885 20.551  1.00 0.00 ? 40 TYR A HH   16 
ATOM 10024 N N    . SER A 1 41 ? 11.964  -20.735 20.586  1.00 0.00 ? 41 SER A N    16 
ATOM 10025 C CA   . SER A 1 41 ? 11.178  -19.761 19.835  1.00 0.00 ? 41 SER A CA   16 
ATOM 10026 C C    . SER A 1 41 ? 11.780  -19.539 18.457  1.00 0.00 ? 41 SER A C    16 
ATOM 10027 O O    . SER A 1 41 ? 11.086  -19.597 17.443  1.00 0.00 ? 41 SER A O    16 
ATOM 10028 C CB   . SER A 1 41 ? 11.144  -18.419 20.569  1.00 0.00 ? 41 SER A CB   16 
ATOM 10029 O OG   . SER A 1 41 ? 10.447  -18.528 21.798  1.00 0.00 ? 41 SER A OG   16 
ATOM 10030 H H    . SER A 1 41 ? 12.378  -20.441 21.460  1.00 0.00 ? 41 SER A H    16 
ATOM 10031 H HA   . SER A 1 41 ? 10.161  -20.139 19.729  1.00 0.00 ? 41 SER A HA   16 
ATOM 10032 H HB2  . SER A 1 41 ? 12.165  -18.095 20.767  1.00 0.00 ? 41 SER A HB2  16 
ATOM 10033 H HB3  . SER A 1 41 ? 10.644  -17.681 19.941  1.00 0.00 ? 41 SER A HB3  16 
ATOM 10034 H HG   . SER A 1 41 ? 10.444  -17.671 22.232  1.00 0.00 ? 41 SER A HG   16 
ATOM 10035 N N    . MET A 1 42 ? 13.085  -19.283 18.435  1.00 0.00 ? 42 MET A N    16 
ATOM 10036 C CA   . MET A 1 42 ? 13.812  -19.047 17.191  1.00 0.00 ? 42 MET A CA   16 
ATOM 10037 C C    . MET A 1 42 ? 13.792  -20.291 16.318  1.00 0.00 ? 42 MET A C    16 
ATOM 10038 O O    . MET A 1 42 ? 13.623  -20.213 15.102  1.00 0.00 ? 42 MET A O    16 
ATOM 10039 C CB   . MET A 1 42 ? 15.270  -18.685 17.483  1.00 0.00 ? 42 MET A CB   16 
ATOM 10040 C CG   . MET A 1 42 ? 16.083  -18.339 16.246  1.00 0.00 ? 42 MET A CG   16 
ATOM 10041 S SD   . MET A 1 42 ? 17.784  -17.888 16.635  1.00 0.00 ? 42 MET A SD   16 
ATOM 10042 C CE   . MET A 1 42 ? 18.450  -19.475 17.132  1.00 0.00 ? 42 MET A CE   16 
ATOM 10043 H H    . MET A 1 42 ? 13.600  -19.247 19.303  1.00 0.00 ? 42 MET A H    16 
ATOM 10044 H HA   . MET A 1 42 ? 13.336  -18.223 16.658  1.00 0.00 ? 42 MET A HA   16 
ATOM 10045 H HB2  . MET A 1 42 ? 15.282  -17.825 18.153  1.00 0.00 ? 42 MET A HB2  16 
ATOM 10046 H HB3  . MET A 1 42 ? 15.741  -19.535 17.975  1.00 0.00 ? 42 MET A HB3  16 
ATOM 10047 H HG2  . MET A 1 42 ? 16.092  -19.200 15.578  1.00 0.00 ? 42 MET A HG2  16 
ATOM 10048 H HG3  . MET A 1 42 ? 15.606  -17.503 15.733  1.00 0.00 ? 42 MET A HG3  16 
ATOM 10049 H HE1  . MET A 1 42 ? 19.499  -19.369 17.406  1.00 0.00 ? 42 MET A HE1  16 
ATOM 10050 H HE2  . MET A 1 42 ? 17.890  -19.850 17.989  1.00 0.00 ? 42 MET A HE2  16 
ATOM 10051 H HE3  . MET A 1 42 ? 18.362  -20.179 16.305  1.00 0.00 ? 42 MET A HE3  16 
ATOM 10052 N N    . LEU A 1 43 ? 13.969  -21.444 16.957  1.00 0.00 ? 43 LEU A N    16 
ATOM 10053 C CA   . LEU A 1 43 ? 13.976  -22.728 16.263  1.00 0.00 ? 43 LEU A CA   16 
ATOM 10054 C C    . LEU A 1 43 ? 12.563  -23.130 15.872  1.00 0.00 ? 43 LEU A C    16 
ATOM 10055 O O    . LEU A 1 43 ? 12.328  -23.650 14.783  1.00 0.00 ? 43 LEU A O    16 
ATOM 10056 C CB   . LEU A 1 43 ? 14.558  -23.820 17.163  1.00 0.00 ? 43 LEU A CB   16 
ATOM 10057 C CG   . LEU A 1 43 ? 16.060  -23.742 17.439  1.00 0.00 ? 43 LEU A CG   16 
ATOM 10058 C CD1  . LEU A 1 43 ? 16.479  -24.805 18.443  1.00 0.00 ? 43 LEU A CD1  16 
ATOM 10059 C CD2  . LEU A 1 43 ? 16.855  -23.957 16.160  1.00 0.00 ? 43 LEU A CD2  16 
ATOM 10060 H H    . LEU A 1 43 ? 14.104  -21.442 17.958  1.00 0.00 ? 43 LEU A H    16 
ATOM 10061 H HA   . LEU A 1 43 ? 14.587  -22.637 15.365  1.00 0.00 ? 43 LEU A HA   16 
ATOM 10062 H HB2  . LEU A 1 43 ? 14.041  -23.770 18.122  1.00 0.00 ? 43 LEU A HB2  16 
ATOM 10063 H HB3  . LEU A 1 43 ? 14.356  -24.781 16.691  1.00 0.00 ? 43 LEU A HB3  16 
ATOM 10064 H HG   . LEU A 1 43 ? 16.290  -22.756 17.843  1.00 0.00 ? 43 LEU A HG   16 
ATOM 10065 H HD11 . LEU A 1 43 ? 17.548  -24.731 18.639  1.00 0.00 ? 43 LEU A HD11 16 
ATOM 10066 H HD12 . LEU A 1 43 ? 15.931  -24.659 19.374  1.00 0.00 ? 43 LEU A HD12 16 
ATOM 10067 H HD13 . LEU A 1 43 ? 16.253  -25.792 18.040  1.00 0.00 ? 43 LEU A HD13 16 
ATOM 10068 H HD21 . LEU A 1 43 ? 17.922  -23.887 16.369  1.00 0.00 ? 43 LEU A HD21 16 
ATOM 10069 H HD22 . LEU A 1 43 ? 16.630  -24.944 15.756  1.00 0.00 ? 43 LEU A HD22 16 
ATOM 10070 H HD23 . LEU A 1 43 ? 16.580  -23.195 15.431  1.00 0.00 ? 43 LEU A HD23 16 
ATOM 10071 N N    . ARG A 1 44 ? 11.623  -22.879 16.778  1.00 0.00 ? 44 ARG A N    16 
ATOM 10072 C CA   . ARG A 1 44 ? 10.217  -23.205 16.555  1.00 0.00 ? 44 ARG A CA   16 
ATOM 10073 C C    . ARG A 1 44 ? 9.542   -22.118 15.734  1.00 0.00 ? 44 ARG A C    16 
ATOM 10074 O O    . ARG A 1 44 ? 8.644   -22.387 14.938  1.00 0.00 ? 44 ARG A O    16 
ATOM 10075 C CB   . ARG A 1 44 ? 9.478   -23.332 17.889  1.00 0.00 ? 44 ARG A CB   16 
ATOM 10076 C CG   . ARG A 1 44 ? 8.026   -23.760 17.756  1.00 0.00 ? 44 ARG A CG   16 
ATOM 10077 C CD   . ARG A 1 44 ? 7.916   -25.183 17.231  1.00 0.00 ? 44 ARG A CD   16 
ATOM 10078 N NE   . ARG A 1 44 ? 6.525   -25.616 17.112  1.00 0.00 ? 44 ARG A NE   16 
ATOM 10079 C CZ   . ARG A 1 44 ? 6.142   -26.746 16.527  1.00 0.00 ? 44 ARG A CZ   16 
ATOM 10080 N NH1  . ARG A 1 44 ? 7.047   -27.561 16.004  1.00 0.00 ? 44 ARG A NH1  16 
ATOM 10081 N NH2  . ARG A 1 44 ? 4.855   -27.058 16.466  1.00 0.00 ? 44 ARG A NH2  16 
ATOM 10082 H H    . ARG A 1 44 ? 11.879  -22.448 17.655  1.00 0.00 ? 44 ARG A H    16 
ATOM 10083 H HA   . ARG A 1 44 ? 10.158  -24.152 16.019  1.00 0.00 ? 44 ARG A HA   16 
ATOM 10084 H HB2  . ARG A 1 44 ? 9.998   -24.070 18.500  1.00 0.00 ? 44 ARG A HB2  16 
ATOM 10085 H HB3  . ARG A 1 44 ? 9.504   -22.363 18.388  1.00 0.00 ? 44 ARG A HB3  16 
ATOM 10086 H HG2  . ARG A 1 44 ? 7.548   -23.704 18.734  1.00 0.00 ? 44 ARG A HG2  16 
ATOM 10087 H HG3  . ARG A 1 44 ? 7.518   -23.086 17.065  1.00 0.00 ? 44 ARG A HG3  16 
ATOM 10088 H HD2  . ARG A 1 44 ? 8.387   -25.235 16.250  1.00 0.00 ? 44 ARG A HD2  16 
ATOM 10089 H HD3  . ARG A 1 44 ? 8.437   -25.853 17.914  1.00 0.00 ? 44 ARG A HD3  16 
ATOM 10090 H HE   . ARG A 1 44 ? 5.818   -25.009 17.503  1.00 0.00 ? 44 ARG A HE   16 
ATOM 10091 H HH11 . ARG A 1 44 ? 8.027   -27.323 16.051  1.00 0.00 ? 44 ARG A HH11 16 
ATOM 10092 H HH12 . ARG A 1 44 ? 6.755   -28.419 15.559  1.00 0.00 ? 44 ARG A HH12 16 
ATOM 10093 H HH21 . ARG A 1 44 ? 4.165   -26.436 16.864  1.00 0.00 ? 44 ARG A HH21 16 
ATOM 10094 H HH22 . ARG A 1 44 ? 4.564   -27.916 16.021  1.00 0.00 ? 44 ARG A HH22 16 
ATOM 10095 N N    . LYS A 1 45 ? 9.989   -20.883 15.940  1.00 0.00 ? 45 LYS A N    16 
ATOM 10096 C CA   . LYS A 1 45 ? 9.445   -19.729 15.230  1.00 0.00 ? 45 LYS A CA   16 
ATOM 10097 C C    . LYS A 1 45 ? 9.918   -19.721 13.786  1.00 0.00 ? 45 LYS A C    16 
ATOM 10098 O O    . LYS A 1 45 ? 9.133   -19.518 12.861  1.00 0.00 ? 45 LYS A O    16 
ATOM 10099 C CB   . LYS A 1 45 ? 9.899   -18.428 15.895  1.00 0.00 ? 45 LYS A CB   16 
ATOM 10100 C CG   . LYS A 1 45 ? 9.335   -17.172 15.251  1.00 0.00 ? 45 LYS A CG   16 
ATOM 10101 C CD   . LYS A 1 45 ? 9.780   -15.923 15.993  1.00 0.00 ? 45 LYS A CD   16 
ATOM 10102 C CE   . LYS A 1 45 ? 9.228   -14.666 15.341  1.00 0.00 ? 45 LYS A CE   16 
ATOM 10103 N NZ   . LYS A 1 45 ? 9.647   -13.434 16.065  1.00 0.00 ? 45 LYS A NZ   16 
ATOM 10104 H H    . LYS A 1 45 ? 10.729  -20.726 16.608  1.00 0.00 ? 45 LYS A H    16 
ATOM 10105 H HA   . LYS A 1 45 ? 8.356   -19.784 15.254  1.00 0.00 ? 45 LYS A HA   16 
ATOM 10106 H HB2  . LYS A 1 45 ? 9.583   -18.448 16.938  1.00 0.00 ? 45 LYS A HB2  16 
ATOM 10107 H HB3  . LYS A 1 45 ? 10.986  -18.379 15.845  1.00 0.00 ? 45 LYS A HB3  16 
ATOM 10108 H HG2  . LYS A 1 45 ? 9.683   -17.115 14.220  1.00 0.00 ? 45 LYS A HG2  16 
ATOM 10109 H HG3  . LYS A 1 45 ? 8.246   -17.224 15.265  1.00 0.00 ? 45 LYS A HG3  16 
ATOM 10110 H HD2  . LYS A 1 45 ? 9.423   -15.975 17.022  1.00 0.00 ? 45 LYS A HD2  16 
ATOM 10111 H HD3  . LYS A 1 45 ? 10.868  -15.876 15.988  1.00 0.00 ? 45 LYS A HD3  16 
ATOM 10112 H HE2  . LYS A 1 45 ? 9.589   -14.612 14.314  1.00 0.00 ? 45 LYS A HE2  16 
ATOM 10113 H HE3  . LYS A 1 45 ? 8.139   -14.719 15.336  1.00 0.00 ? 45 LYS A HE3  16 
ATOM 10114 H HZ1  . LYS A 1 45 ? 9.263   -12.620 15.605  1.00 0.00 ? 45 LYS A HZ1  16 
ATOM 10115 H HZ2  . LYS A 1 45 ? 9.309   -13.472 17.016  1.00 0.00 ? 45 LYS A HZ2  16 
ATOM 10116 H HZ3  . LYS A 1 45 ? 10.655  -13.372 16.068  1.00 0.00 ? 45 LYS A HZ3  16 
ATOM 10117 N N    . ALA A 1 46 ? 11.216  -19.945 13.605  1.00 0.00 ? 46 ALA A N    16 
ATOM 10118 C CA   . ALA A 1 46 ? 11.827  -19.969 12.279  1.00 0.00 ? 46 ALA A CA   16 
ATOM 10119 C C    . ALA A 1 46 ? 13.317  -20.250 12.403  1.00 0.00 ? 46 ALA A C    16 
ATOM 10120 O O    . ALA A 1 46 ? 13.831  -20.417 13.507  1.00 0.00 ? 46 ALA A O    16 
ATOM 10121 C CB   . ALA A 1 46 ? 11.585  -18.632 11.584  1.00 0.00 ? 46 ALA A CB   16 
ATOM 10122 H H    . ALA A 1 46 ? 11.809  -20.104 14.406  1.00 0.00 ? 46 ALA A H    16 
ATOM 10123 H HA   . ALA A 1 46 ? 11.364  -20.762 11.692  1.00 0.00 ? 46 ALA A HA   16 
ATOM 10124 H HB1  . ALA A 1 46 ? 12.028  -18.657 10.588  1.00 0.00 ? 46 ALA A HB1  16 
ATOM 10125 H HB2  . ALA A 1 46 ? 10.512  -18.454 11.500  1.00 0.00 ? 46 ALA A HB2  16 
ATOM 10126 H HB3  . ALA A 1 46 ? 12.041  -17.831 12.166  1.00 0.00 ? 46 ALA A HB3  16 
ATOM 10127 N N    . GLY A 1 1  ? -4.775  9.060   74.172  1.00 0.00 ? 1  GLY A N    17 
ATOM 10128 C CA   . GLY A 1 1  ? -4.218  10.397  74.215  1.00 0.00 ? 1  GLY A CA   17 
ATOM 10129 C C    . GLY A 1 1  ? -3.218  10.580  73.085  1.00 0.00 ? 1  GLY A C    17 
ATOM 10130 O O    . GLY A 1 1  ? -2.982  9.667   72.298  1.00 0.00 ? 1  GLY A O    17 
ATOM 10131 H H1   . GLY A 1 1  ? -4.463  8.430   73.447  1.00 0.00 ? 1  GLY A H1   17 
ATOM 10132 H HA2  . GLY A 1 1  ? -5.021  11.127  74.109  1.00 0.00 ? 1  GLY A HA2  17 
ATOM 10133 H HA3  . GLY A 1 1  ? -3.716  10.550  75.170  1.00 0.00 ? 1  GLY A HA3  17 
ATOM 10134 N N    . VAL A 1 2  ? -2.637  11.776  73.020  1.00 0.00 ? 2  VAL A N    17 
ATOM 10135 C CA   . VAL A 1 2  ? -1.655  12.111  71.994  1.00 0.00 ? 2  VAL A CA   17 
ATOM 10136 C C    . VAL A 1 2  ? -0.361  11.347  72.225  1.00 0.00 ? 2  VAL A C    17 
ATOM 10137 O O    . VAL A 1 2  ? 0.235   10.808  71.293  1.00 0.00 ? 2  VAL A O    17 
ATOM 10138 C CB   . VAL A 1 2  ? -1.324  13.615  71.999  1.00 0.00 ? 2  VAL A CB   17 
ATOM 10139 C CG1  . VAL A 1 2  ? -0.168  13.909  71.055  1.00 0.00 ? 2  VAL A CG1  17 
ATOM 10140 C CG2  . VAL A 1 2  ? -2.529  14.427  71.552  1.00 0.00 ? 2  VAL A CG2  17 
ATOM 10141 H H    . VAL A 1 2  ? -2.877  12.484  73.700  1.00 0.00 ? 2  VAL A H    17 
ATOM 10142 H HA   . VAL A 1 2  ? -2.067  11.840  71.022  1.00 0.00 ? 2  VAL A HA   17 
ATOM 10143 H HB   . VAL A 1 2  ? -1.047  13.912  73.011  1.00 0.00 ? 2  VAL A HB   17 
ATOM 10144 H HG11 . VAL A 1 2  ? 0.062   14.974  71.074  1.00 0.00 ? 2  VAL A HG11 17 
ATOM 10145 H HG12 . VAL A 1 2  ? 0.709   13.344  71.369  1.00 0.00 ? 2  VAL A HG12 17 
ATOM 10146 H HG13 . VAL A 1 2  ? -0.445  13.617  70.042  1.00 0.00 ? 2  VAL A HG13 17 
ATOM 10147 H HG21 . VAL A 1 2  ? -2.286  15.490  71.568  1.00 0.00 ? 2  VAL A HG21 17 
ATOM 10148 H HG22 . VAL A 1 2  ? -2.807  14.136  70.539  1.00 0.00 ? 2  VAL A HG22 17 
ATOM 10149 H HG23 . VAL A 1 2  ? -3.364  14.238  72.227  1.00 0.00 ? 2  VAL A HG23 17 
ATOM 10150 N N    . ILE A 1 3  ? 0.066   11.306  73.484  1.00 0.00 ? 3  ILE A N    17 
ATOM 10151 C CA   . ILE A 1 3  ? 1.290   10.612  73.871  1.00 0.00 ? 3  ILE A CA   17 
ATOM 10152 C C    . ILE A 1 3  ? 1.141   9.114   73.663  1.00 0.00 ? 3  ILE A C    17 
ATOM 10153 O O    . ILE A 1 3  ? 2.068   8.438   73.219  1.00 0.00 ? 3  ILE A O    17 
ATOM 10154 C CB   . ILE A 1 3  ? 1.631   10.852  75.354  1.00 0.00 ? 3  ILE A CB   17 
ATOM 10155 C CG1  . ILE A 1 3  ? 1.996   12.320  75.586  1.00 0.00 ? 3  ILE A CG1  17 
ATOM 10156 C CG2  . ILE A 1 3  ? 2.810   9.990   75.776  1.00 0.00 ? 3  ILE A CG2  17 
ATOM 10157 C CD1  . ILE A 1 3  ? 2.104   12.699  77.046  1.00 0.00 ? 3  ILE A CD1  17 
ATOM 10158 H H    . ILE A 1 3  ? -0.469  11.768  74.206  1.00 0.00 ? 3  ILE A H    17 
ATOM 10159 H HA   . ILE A 1 3  ? 2.106   10.984  73.252  1.00 0.00 ? 3  ILE A HA   17 
ATOM 10160 H HB   . ILE A 1 3  ? 0.762   10.597  75.962  1.00 0.00 ? 3  ILE A HB   17 
ATOM 10161 H HG12 . ILE A 1 3  ? 2.956   12.516  75.109  1.00 0.00 ? 3  ILE A HG12 17 
ATOM 10162 H HG13 . ILE A 1 3  ? 1.228   12.943  75.126  1.00 0.00 ? 3  ILE A HG13 17 
ATOM 10163 H HG21 . ILE A 1 3  ? 3.035   10.162  76.829  1.00 0.00 ? 3  ILE A HG21 17 
ATOM 10164 H HG22 . ILE A 1 3  ? 2.562   8.940   75.626  1.00 0.00 ? 3  ILE A HG22 17 
ATOM 10165 H HG23 . ILE A 1 3  ? 3.681   10.248  75.174  1.00 0.00 ? 3  ILE A HG23 17 
ATOM 10166 H HD11 . ILE A 1 3  ? 2.366   13.752  77.150  1.00 0.00 ? 3  ILE A HD11 17 
ATOM 10167 H HD12 . ILE A 1 3  ? 1.147   12.520  77.536  1.00 0.00 ? 3  ILE A HD12 17 
ATOM 10168 H HD13 . ILE A 1 3  ? 2.874   12.091  77.520  1.00 0.00 ? 3  ILE A HD13 17 
ATOM 10169 N N    . ASP A 1 4  ? -0.042  8.603   73.991  1.00 0.00 ? 4  ASP A N    17 
ATOM 10170 C CA   . ASP A 1 4  ? -0.344  7.182   73.851  1.00 0.00 ? 4  ASP A CA   17 
ATOM 10171 C C    . ASP A 1 4  ? -0.013  6.704   72.446  1.00 0.00 ? 4  ASP A C    17 
ATOM 10172 O O    . ASP A 1 4  ? 0.521   5.612   72.255  1.00 0.00 ? 4  ASP A O    17 
ATOM 10173 C CB   . ASP A 1 4  ? -1.829  6.921   74.114  1.00 0.00 ? 4  ASP A CB   17 
ATOM 10174 C CG   . ASP A 1 4  ? -2.197  7.075   75.576  1.00 0.00 ? 4  ASP A CG   17 
ATOM 10175 O OD1  . ASP A 1 4  ? -3.346  6.745   75.937  1.00 0.00 ? 4  ASP A OD1  17 
ATOM 10176 O OD2  . ASP A 1 4  ? -1.337  7.527   76.361  1.00 0.00 ? 4  ASP A OD2  17 
ATOM 10177 H H    . ASP A 1 4  ? -0.765  9.211   74.352  1.00 0.00 ? 4  ASP A H    17 
ATOM 10178 H HA   . ASP A 1 4  ? 0.253   6.625   74.573  1.00 0.00 ? 4  ASP A HA   17 
ATOM 10179 H HB2  . ASP A 1 4  ? -2.419  7.627   73.528  1.00 0.00 ? 4  ASP A HB2  17 
ATOM 10180 H HB3  . ASP A 1 4  ? -2.068  5.906   73.798  1.00 0.00 ? 4  ASP A HB3  17 
ATOM 10181 H HD2  . ASP A 1 4  ? -1.638  7.598   77.270  1.00 0.00 ? 4  ASP A HD2  17 
ATOM 10182 N N    . THR A 1 5  ? -0.340  7.539   71.463  1.00 0.00 ? 5  THR A N    17 
ATOM 10183 C CA   . THR A 1 5  ? -0.090  7.227   70.059  1.00 0.00 ? 5  THR A CA   17 
ATOM 10184 C C    . THR A 1 5  ? 1.232   7.828   69.608  1.00 0.00 ? 5  THR A C    17 
ATOM 10185 O O    . THR A 1 5  ? 1.646   7.665   68.462  1.00 0.00 ? 5  THR A O    17 
ATOM 10186 C CB   . THR A 1 5  ? -1.200  7.787   69.150  1.00 0.00 ? 5  THR A CB   17 
ATOM 10187 O OG1  . THR A 1 5  ? -1.241  9.215   69.265  1.00 0.00 ? 5  THR A OG1  17 
ATOM 10188 C CG2  . THR A 1 5  ? -2.553  7.222   69.552  1.00 0.00 ? 5  THR A CG2  17 
ATOM 10189 H H    . THR A 1 5  ? -0.777  8.423   71.685  1.00 0.00 ? 5  THR A H    17 
ATOM 10190 H HA   . THR A 1 5  ? -0.052  6.144   69.949  1.00 0.00 ? 5  THR A HA   17 
ATOM 10191 H HB   . THR A 1 5  ? -0.988  7.513   68.117  1.00 0.00 ? 5  THR A HB   17 
ATOM 10192 H HG1  . THR A 1 5  ? -1.932  9.550   68.688  1.00 0.00 ? 5  THR A HG1  17 
ATOM 10193 H HG21 . THR A 1 5  ? -3.329  7.625   68.901  1.00 0.00 ? 5  THR A HG21 17 
ATOM 10194 H HG22 . THR A 1 5  ? -2.534  6.136   69.463  1.00 0.00 ? 5  THR A HG22 17 
ATOM 10195 H HG23 . THR A 1 5  ? -2.769  7.498   70.584  1.00 0.00 ? 5  THR A HG23 17 
ATOM 10196 N N    . SER A 1 6  ? 1.889   8.528   70.529  1.00 0.00 ? 6  SER A N    17 
ATOM 10197 C CA   . SER A 1 6  ? 3.171   9.168   70.253  1.00 0.00 ? 6  SER A CA   17 
ATOM 10198 C C    . SER A 1 6  ? 4.122   8.191   69.581  1.00 0.00 ? 6  SER A C    17 
ATOM 10199 O O    . SER A 1 6  ? 4.584   8.418   68.464  1.00 0.00 ? 6  SER A O    17 
ATOM 10200 C CB   . SER A 1 6  ? 3.817   9.655   71.551  1.00 0.00 ? 6  SER A CB   17 
ATOM 10201 O OG   . SER A 1 6  ? 5.068   10.271  71.299  1.00 0.00 ? 6  SER A OG   17 
ATOM 10202 H H    . SER A 1 6  ? 1.496   8.626   71.455  1.00 0.00 ? 6  SER A H    17 
ATOM 10203 H HA   . SER A 1 6  ? 3.001   10.020  69.593  1.00 0.00 ? 6  SER A HA   17 
ATOM 10204 H HB2  . SER A 1 6  ? 3.155   10.378  72.029  1.00 0.00 ? 6  SER A HB2  17 
ATOM 10205 H HB3  . SER A 1 6  ? 3.967   8.805   72.215  1.00 0.00 ? 6  SER A HB3  17 
ATOM 10206 H HG   . SER A 1 6  ? 5.444   10.565  72.132  1.00 0.00 ? 6  SER A HG   17 
ATOM 10207 N N    . ALA A 1 7  ? 4.408   7.096   70.280  1.00 0.00 ? 7  ALA A N    17 
ATOM 10208 C CA   . ALA A 1 7  ? 5.305   6.060   69.774  1.00 0.00 ? 7  ALA A CA   17 
ATOM 10209 C C    . ALA A 1 7  ? 4.767   5.477   68.477  1.00 0.00 ? 7  ALA A C    17 
ATOM 10210 O O    . ALA A 1 7  ? 5.514   5.232   67.531  1.00 0.00 ? 7  ALA A O    17 
ATOM 10211 C CB   . ALA A 1 7  ? 5.441   4.935   70.788  1.00 0.00 ? 7  ALA A CB   17 
ATOM 10212 H H    . ALA A 1 7  ? 3.997   6.967   71.194  1.00 0.00 ? 7  ALA A H    17 
ATOM 10213 H HA   . ALA A 1 7  ? 6.284   6.503   69.593  1.00 0.00 ? 7  ALA A HA   17 
ATOM 10214 H HB1  . ALA A 1 7  ? 6.123   4.175   70.407  1.00 0.00 ? 7  ALA A HB1  17 
ATOM 10215 H HB2  . ALA A 1 7  ? 5.832   5.336   71.723  1.00 0.00 ? 7  ALA A HB2  17 
ATOM 10216 H HB3  . ALA A 1 7  ? 4.463   4.487   70.965  1.00 0.00 ? 7  ALA A HB3  17 
ATOM 10217 N N    . VAL A 1 8  ? 3.455   5.258   68.446  1.00 0.00 ? 8  VAL A N    17 
ATOM 10218 C CA   . VAL A 1 8  ? 2.784   4.703   67.274  1.00 0.00 ? 8  VAL A CA   17 
ATOM 10219 C C    . VAL A 1 8  ? 2.920   5.643   66.088  1.00 0.00 ? 8  VAL A C    17 
ATOM 10220 O O    . VAL A 1 8  ? 3.158   5.214   64.960  1.00 0.00 ? 8  VAL A O    17 
ATOM 10221 C CB   . VAL A 1 8  ? 1.282   4.484   67.535  1.00 0.00 ? 8  VAL A CB   17 
ATOM 10222 C CG1  . VAL A 1 8  ? 0.568   4.106   66.246  1.00 0.00 ? 8  VAL A CG1  17 
ATOM 10223 C CG2  . VAL A 1 8  ? 1.074   3.366   68.545  1.00 0.00 ? 8  VAL A CG2  17 
ATOM 10224 H H    . VAL A 1 8  ? 2.894   5.480   69.256  1.00 0.00 ? 8  VAL A H    17 
ATOM 10225 H HA   . VAL A 1 8  ? 3.247   3.747   67.032  1.00 0.00 ? 8  VAL A HA   17 
ATOM 10226 H HB   . VAL A 1 8  ? 0.853   5.407   67.927  1.00 0.00 ? 8  VAL A HB   17 
ATOM 10227 H HG11 . VAL A 1 8  ? -0.495  3.962   66.441  1.00 0.00 ? 8  VAL A HG11 17 
ATOM 10228 H HG12 . VAL A 1 8  ? 0.696   4.903   65.514  1.00 0.00 ? 8  VAL A HG12 17 
ATOM 10229 H HG13 . VAL A 1 8  ? 0.992   3.182   65.855  1.00 0.00 ? 8  VAL A HG13 17 
ATOM 10230 H HG21 . VAL A 1 8  ? 0.008   3.227   68.728  1.00 0.00 ? 8  VAL A HG21 17 
ATOM 10231 H HG22 . VAL A 1 8  ? 1.498   2.441   68.154  1.00 0.00 ? 8  VAL A HG22 17 
ATOM 10232 H HG23 . VAL A 1 8  ? 1.569   3.626   69.480  1.00 0.00 ? 8  VAL A HG23 17 
ATOM 10233 N N    . GLU A 1 9  ? 2.765   6.936   66.358  1.00 0.00 ? 9  GLU A N    17 
ATOM 10234 C CA   . GLU A 1 9  ? 2.867   7.967   65.328  1.00 0.00 ? 9  GLU A CA   17 
ATOM 10235 C C    . GLU A 1 9  ? 4.215   7.892   64.631  1.00 0.00 ? 9  GLU A C    17 
ATOM 10236 O O    . GLU A 1 9  ? 4.315   8.069   63.418  1.00 0.00 ? 9  GLU A O    17 
ATOM 10237 C CB   . GLU A 1 9  ? 2.719   9.359   65.946  1.00 0.00 ? 9  GLU A CB   17 
ATOM 10238 C CG   . GLU A 1 9  ? 2.743   10.493  64.935  1.00 0.00 ? 9  GLU A CG   17 
ATOM 10239 C CD   . GLU A 1 9  ? 2.544   11.851  65.578  1.00 0.00 ? 9  GLU A CD   17 
ATOM 10240 O OE1  . GLU A 1 9  ? 2.389   11.905  66.816  1.00 0.00 ? 9  GLU A OE1  17 
ATOM 10241 O OE2  . GLU A 1 9  ? 2.543   12.862  64.844  1.00 0.00 ? 9  GLU A OE2  17 
ATOM 10242 H H    . GLU A 1 9  ? 2.570   7.227   67.306  1.00 0.00 ? 9  GLU A H    17 
ATOM 10243 H HA   . GLU A 1 9  ? 2.073   7.812   64.598  1.00 0.00 ? 9  GLU A HA   17 
ATOM 10244 H HB2  . GLU A 1 9  ? 1.769   9.397   66.481  1.00 0.00 ? 9  GLU A HB2  17 
ATOM 10245 H HB3  . GLU A 1 9  ? 3.537   9.511   66.649  1.00 0.00 ? 9  GLU A HB3  17 
ATOM 10246 H HG2  . GLU A 1 9  ? 3.705   10.486  64.423  1.00 0.00 ? 9  GLU A HG2  17 
ATOM 10247 H HG3  . GLU A 1 9  ? 1.948   10.331  64.207  1.00 0.00 ? 9  GLU A HG3  17 
ATOM 10248 H HE2  . GLU A 1 9  ? 2.412   13.688  65.317  1.00 0.00 ? 9  GLU A HE2  17 
ATOM 10249 N N    . SER A 1 10 ? 5.254   7.627   65.417  1.00 0.00 ? 10 SER A N    17 
ATOM 10250 C CA   . SER A 1 10 ? 6.616   7.522   64.901  1.00 0.00 ? 10 SER A CA   17 
ATOM 10251 C C    . SER A 1 10 ? 6.854   6.147   64.300  1.00 0.00 ? 10 SER A C    17 
ATOM 10252 O O    . SER A 1 10 ? 7.370   6.018   63.191  1.00 0.00 ? 10 SER A O    17 
ATOM 10253 C CB   . SER A 1 10 ? 7.633   7.741   66.023  1.00 0.00 ? 10 SER A CB   17 
ATOM 10254 O OG   . SER A 1 10 ? 7.536   9.053   66.550  1.00 0.00 ? 10 SER A OG   17 
ATOM 10255 H H    . SER A 1 10 ? 5.107   7.491   66.407  1.00 0.00 ? 10 SER A H    17 
ATOM 10256 H HA   . SER A 1 10 ? 6.758   8.282   64.133  1.00 0.00 ? 10 SER A HA   17 
ATOM 10257 H HB2  . SER A 1 10 ? 7.444   7.023   66.821  1.00 0.00 ? 10 SER A HB2  17 
ATOM 10258 H HB3  . SER A 1 10 ? 8.637   7.590   65.628  1.00 0.00 ? 10 SER A HB3  17 
ATOM 10259 H HG   . SER A 1 10 ? 8.185   9.157   67.249  1.00 0.00 ? 10 SER A HG   17 
ATOM 10260 N N    . ALA A 1 11 ? 6.470   5.118   65.051  1.00 0.00 ? 11 ALA A N    17 
ATOM 10261 C CA   . ALA A 1 11 ? 6.629   3.733   64.616  1.00 0.00 ? 11 ALA A CA   17 
ATOM 10262 C C    . ALA A 1 11 ? 5.737   3.444   63.420  1.00 0.00 ? 11 ALA A C    17 
ATOM 10263 O O    . ALA A 1 11 ? 6.127   2.739   62.491  1.00 0.00 ? 11 ALA A O    17 
ATOM 10264 C CB   . ALA A 1 11 ? 6.253   2.778   65.739  1.00 0.00 ? 11 ALA A CB   17 
ATOM 10265 H H    . ALA A 1 11 ? 6.053   5.290   65.955  1.00 0.00 ? 11 ALA A H    17 
ATOM 10266 H HA   . ALA A 1 11 ? 7.670   3.571   64.338  1.00 0.00 ? 11 ALA A HA   17 
ATOM 10267 H HB1  . ALA A 1 11 ? 6.389   1.748   65.409  1.00 0.00 ? 11 ALA A HB1  17 
ATOM 10268 H HB2  . ALA A 1 11 ? 6.888   2.968   66.604  1.00 0.00 ? 11 ALA A HB2  17 
ATOM 10269 H HB3  . ALA A 1 11 ? 5.209   2.935   66.014  1.00 0.00 ? 11 ALA A HB3  17 
ATOM 10270 N N    . ILE A 1 12 ? 4.529   4.000   63.456  1.00 0.00 ? 12 ILE A N    17 
ATOM 10271 C CA   . ILE A 1 12 ? 3.555   3.820   62.385  1.00 0.00 ? 12 ILE A CA   17 
ATOM 10272 C C    . ILE A 1 12 ? 4.031   4.500   61.112  1.00 0.00 ? 12 ILE A C    17 
ATOM 10273 O O    . ILE A 1 12 ? 3.970   3.928   60.024  1.00 0.00 ? 12 ILE A O    17 
ATOM 10274 C CB   . ILE A 1 12 ? 2.187   4.421   62.759  1.00 0.00 ? 12 ILE A CB   17 
ATOM 10275 C CG1  . ILE A 1 12 ? 1.559   3.638   63.914  1.00 0.00 ? 12 ILE A CG1  17 
ATOM 10276 C CG2  . ILE A 1 12 ? 1.240   4.369   61.571  1.00 0.00 ? 12 ILE A CG2  17 
ATOM 10277 C CD1  . ILE A 1 12 ? 1.308   2.180   63.599  1.00 0.00 ? 12 ILE A CD1  17 
ATOM 10278 H H    . ILE A 1 12 ? 4.266   4.570   64.248  1.00 0.00 ? 12 ILE A H    17 
ATOM 10279 H HA   . ILE A 1 12 ? 3.437   2.752   62.202  1.00 0.00 ? 12 ILE A HA   17 
ATOM 10280 H HB   . ILE A 1 12 ? 2.328   5.459   63.062  1.00 0.00 ? 12 ILE A HB   17 
ATOM 10281 H HG12 . ILE A 1 12 ? 2.229   3.694   64.772  1.00 0.00 ? 12 ILE A HG12 17 
ATOM 10282 H HG13 . ILE A 1 12 ? 0.606   4.104   64.167  1.00 0.00 ? 12 ILE A HG13 17 
ATOM 10283 H HG21 . ILE A 1 12 ? 0.279   4.806   61.845  1.00 0.00 ? 12 ILE A HG21 17 
ATOM 10284 H HG22 . ILE A 1 12 ? 1.668   4.931   60.741  1.00 0.00 ? 12 ILE A HG22 17 
ATOM 10285 H HG23 . ILE A 1 12 ? 1.093   3.332   61.270  1.00 0.00 ? 12 ILE A HG23 17 
ATOM 10286 H HD11 . ILE A 1 12 ? 0.862   1.675   64.456  1.00 0.00 ? 12 ILE A HD11 17 
ATOM 10287 H HD12 . ILE A 1 12 ? 0.629   2.107   62.749  1.00 0.00 ? 12 ILE A HD12 17 
ATOM 10288 H HD13 . ILE A 1 12 ? 2.253   1.698   63.352  1.00 0.00 ? 12 ILE A HD13 17 
ATOM 10289 N N    . THR A 1 13 ? 4.508   5.732   61.263  1.00 0.00 ? 13 THR A N    17 
ATOM 10290 C CA   . THR A 1 13 ? 5.005   6.520   60.138  1.00 0.00 ? 13 THR A CA   17 
ATOM 10291 C C    . THR A 1 13 ? 6.236   5.865   59.532  1.00 0.00 ? 13 THR A C    17 
ATOM 10292 O O    . THR A 1 13 ? 6.384   5.796   58.313  1.00 0.00 ? 13 THR A O    17 
ATOM 10293 C CB   . THR A 1 13 ? 5.393   7.945   60.575  1.00 0.00 ? 13 THR A CB   17 
ATOM 10294 O OG1  . THR A 1 13 ? 4.238   8.624   61.082  1.00 0.00 ? 13 THR A OG1  17 
ATOM 10295 C CG2  . THR A 1 13 ? 5.949   8.730   59.397  1.00 0.00 ? 13 THR A CG2  17 
ATOM 10296 H H    . THR A 1 13 ? 4.532   6.147   62.184  1.00 0.00 ? 13 THR A H    17 
ATOM 10297 H HA   . THR A 1 13 ? 4.219   6.580   59.385  1.00 0.00 ? 13 THR A HA   17 
ATOM 10298 H HB   . THR A 1 13 ? 6.150   7.885   61.357  1.00 0.00 ? 13 THR A HB   17 
ATOM 10299 H HG1  . THR A 1 13 ? 4.497   9.507   61.357  1.00 0.00 ? 13 THR A HG1  17 
ATOM 10300 H HG21 . THR A 1 13 ? 6.221   9.735   59.720  1.00 0.00 ? 13 THR A HG21 17 
ATOM 10301 H HG22 . THR A 1 13 ? 6.832   8.223   59.008  1.00 0.00 ? 13 THR A HG22 17 
ATOM 10302 H HG23 . THR A 1 13 ? 5.192   8.794   58.615  1.00 0.00 ? 13 THR A HG23 17 
ATOM 10303 N N    . ASP A 1 14 ? 7.119   5.384   60.403  1.00 0.00 ? 14 ASP A N    17 
ATOM 10304 C CA   . ASP A 1 14 ? 8.352   4.728   59.981  1.00 0.00 ? 14 ASP A CA   17 
ATOM 10305 C C    . ASP A 1 14 ? 8.046   3.395   59.320  1.00 0.00 ? 14 ASP A C    17 
ATOM 10306 O O    . ASP A 1 14 ? 8.530   3.100   58.228  1.00 0.00 ? 14 ASP A O    17 
ATOM 10307 C CB   . ASP A 1 14 ? 9.262   4.473   61.184  1.00 0.00 ? 14 ASP A CB   17 
ATOM 10308 C CG   . ASP A 1 14 ? 9.871   5.748   61.734  1.00 0.00 ? 14 ASP A CG   17 
ATOM 10309 O OD1  . ASP A 1 14 ? 10.737  5.655   62.629  1.00 0.00 ? 14 ASP A OD1  17 
ATOM 10310 O OD2  . ASP A 1 14 ? 9.481   6.841   61.271  1.00 0.00 ? 14 ASP A OD2  17 
ATOM 10311 H H    . ASP A 1 14 ? 6.940   5.472   61.393  1.00 0.00 ? 14 ASP A H    17 
ATOM 10312 H HA   . ASP A 1 14 ? 8.866   5.375   59.270  1.00 0.00 ? 14 ASP A HA   17 
ATOM 10313 H HB2  . ASP A 1 14 ? 8.677   3.996   61.971  1.00 0.00 ? 14 ASP A HB2  17 
ATOM 10314 H HB3  . ASP A 1 14 ? 10.066  3.804   60.879  1.00 0.00 ? 14 ASP A HB3  17 
ATOM 10315 H HD2  . ASP A 1 14 ? 9.907   7.606   61.664  1.00 0.00 ? 14 ASP A HD2  17 
ATOM 10316 N N    . GLY A 1 15 ? 7.233   2.590   59.998  1.00 0.00 ? 15 GLY A N    17 
ATOM 10317 C CA   . GLY A 1 15 ? 6.841   1.275   59.498  1.00 0.00 ? 15 GLY A CA   17 
ATOM 10318 C C    . GLY A 1 15 ? 5.681   1.400   58.523  1.00 0.00 ? 15 GLY A C    17 
ATOM 10319 O O    . GLY A 1 15 ? 5.826   1.151   57.327  1.00 0.00 ? 15 GLY A O    17 
ATOM 10320 H H    . GLY A 1 15 ? 6.868   2.889   60.891  1.00 0.00 ? 15 GLY A H    17 
ATOM 10321 H HA2  . GLY A 1 15 ? 7.689   0.817   58.990  1.00 0.00 ? 15 GLY A HA2  17 
ATOM 10322 H HA3  . GLY A 1 15 ? 6.539   0.647   60.336  1.00 0.00 ? 15 GLY A HA3  17 
ATOM 10323 N N    . GLN A 1 16 ? 4.525   1.788   59.052  1.00 0.00 ? 16 GLN A N    17 
ATOM 10324 C CA   . GLN A 1 16 ? 3.317   1.956   58.250  1.00 0.00 ? 16 GLN A CA   17 
ATOM 10325 C C    . GLN A 1 16 ? 3.612   2.785   57.010  1.00 0.00 ? 16 GLN A C    17 
ATOM 10326 O O    . GLN A 1 16 ? 3.340   2.368   55.886  1.00 0.00 ? 16 GLN A O    17 
ATOM 10327 C CB   . GLN A 1 16 ? 2.231   2.667   59.060  1.00 0.00 ? 16 GLN A CB   17 
ATOM 10328 C CG   . GLN A 1 16 ? 0.918   2.846   58.314  1.00 0.00 ? 16 GLN A CG   17 
ATOM 10329 C CD   . GLN A 1 16 ? 0.249   1.526   57.987  1.00 0.00 ? 16 GLN A CD   17 
ATOM 10330 O OE1  . GLN A 1 16 ? 0.002   0.707   58.872  1.00 0.00 ? 16 GLN A OE1  17 
ATOM 10331 N NE2  . GLN A 1 16 ? -0.046  1.315   56.709  1.00 0.00 ? 16 GLN A NE2  17 
ATOM 10332 H H    . GLN A 1 16 ? 4.469   1.976   60.043  1.00 0.00 ? 16 GLN A H    17 
ATOM 10333 H HA   . GLN A 1 16 ? 2.956   0.973   57.950  1.00 0.00 ? 16 GLN A HA   17 
ATOM 10334 H HB2  . GLN A 1 16 ? 2.036   2.083   59.959  1.00 0.00 ? 16 GLN A HB2  17 
ATOM 10335 H HB3  . GLN A 1 16 ? 2.602   3.653   59.340  1.00 0.00 ? 16 GLN A HB3  17 
ATOM 10336 H HG2  . GLN A 1 16 ? 0.242   3.438   58.931  1.00 0.00 ? 16 GLN A HG2  17 
ATOM 10337 H HG3  . GLN A 1 16 ? 1.113   3.380   57.384  1.00 0.00 ? 16 GLN A HG3  17 
ATOM 10338 H HE21 . GLN A 1 16 ? 0.176   2.017   56.018  1.00 0.00 ? 16 GLN A HE21 17 
ATOM 10339 H HE22 . GLN A 1 16 ? -0.493  0.453   56.431  1.00 0.00 ? 16 GLN A HE22 17 
ATOM 10340 N N    . GLY A 1 17 ? 4.175   3.970   57.232  1.00 0.00 ? 17 GLY A N    17 
ATOM 10341 C CA   . GLY A 1 17 ? 4.520   4.884   56.147  1.00 0.00 ? 17 GLY A CA   17 
ATOM 10342 C C    . GLY A 1 17 ? 5.337   4.165   55.085  1.00 0.00 ? 17 GLY A C    17 
ATOM 10343 O O    . GLY A 1 17 ? 5.065   4.276   53.891  1.00 0.00 ? 17 GLY A O    17 
ATOM 10344 H H    . GLY A 1 17 ? 4.374   4.257   58.180  1.00 0.00 ? 17 GLY A H    17 
ATOM 10345 H HA2  . GLY A 1 17 ? 3.605   5.270   55.697  1.00 0.00 ? 17 GLY A HA2  17 
ATOM 10346 H HA3  . GLY A 1 17 ? 5.102   5.714   56.548  1.00 0.00 ? 17 GLY A HA3  17 
ATOM 10347 N N    . ASP A 1 18 ? 6.345   3.425   55.538  1.00 0.00 ? 18 ASP A N    17 
ATOM 10348 C CA   . ASP A 1 18 ? 7.223   2.674   54.646  1.00 0.00 ? 18 ASP A CA   17 
ATOM 10349 C C    . ASP A 1 18 ? 6.411   1.736   53.767  1.00 0.00 ? 18 ASP A C    17 
ATOM 10350 O O    . ASP A 1 18 ? 6.908   1.206   52.774  1.00 0.00 ? 18 ASP A O    17 
ATOM 10351 C CB   . ASP A 1 18 ? 8.220   1.840   55.453  1.00 0.00 ? 18 ASP A CB   17 
ATOM 10352 C CG   . ASP A 1 18 ? 9.265   2.691   56.147  1.00 0.00 ? 18 ASP A CG   17 
ATOM 10353 O OD1  . ASP A 1 18 ? 10.438  2.265   56.202  1.00 0.00 ? 18 ASP A OD1  17 
ATOM 10354 O OD2  . ASP A 1 18 ? 8.911   3.784   56.636  1.00 0.00 ? 18 ASP A OD2  17 
ATOM 10355 H H    . ASP A 1 18 ? 6.518   3.375   56.532  1.00 0.00 ? 18 ASP A H    17 
ATOM 10356 H HA   . ASP A 1 18 ? 7.768   3.378   54.017  1.00 0.00 ? 18 ASP A HA   17 
ATOM 10357 H HB2  . ASP A 1 18 ? 7.673   1.273   56.207  1.00 0.00 ? 18 ASP A HB2  17 
ATOM 10358 H HB3  . ASP A 1 18 ? 8.724   1.148   54.779  1.00 0.00 ? 18 ASP A HB3  17 
ATOM 10359 H HD2  . ASP A 1 18 ? 9.622   4.271   57.060  1.00 0.00 ? 18 ASP A HD2  17 
ATOM 10360 N N    . MET A 1 19 ? 5.153   1.537   54.146  1.00 0.00 ? 19 MET A N    17 
ATOM 10361 C CA   . MET A 1 19 ? 4.243   0.665   53.409  1.00 0.00 ? 19 MET A CA   17 
ATOM 10362 C C    . MET A 1 19 ? 3.982   1.222   52.019  1.00 0.00 ? 19 MET A C    17 
ATOM 10363 O O    . MET A 1 19 ? 3.963   0.487   51.033  1.00 0.00 ? 19 MET A O    17 
ATOM 10364 C CB   . MET A 1 19 ? 2.905   0.545   54.141  1.00 0.00 ? 19 MET A CB   17 
ATOM 10365 C CG   . MET A 1 19 ? 1.923   -0.413  53.487  1.00 0.00 ? 19 MET A CG   17 
ATOM 10366 S SD   . MET A 1 19 ? 0.366   -0.536  54.388  1.00 0.00 ? 19 MET A SD   17 
ATOM 10367 C CE   . MET A 1 19 ? 0.897   -1.396  55.866  1.00 0.00 ? 19 MET A CE   17 
ATOM 10368 H H    . MET A 1 19 ? 4.804   2.000   54.973  1.00 0.00 ? 19 MET A H    17 
ATOM 10369 H HA   . MET A 1 19 ? 4.696   -0.322  53.324  1.00 0.00 ? 19 MET A HA   17 
ATOM 10370 H HB2  . MET A 1 19 ? 3.099   0.197   55.155  1.00 0.00 ? 19 MET A HB2  17 
ATOM 10371 H HB3  . MET A 1 19 ? 2.445   1.533   54.178  1.00 0.00 ? 19 MET A HB3  17 
ATOM 10372 H HG2  . MET A 1 19 ? 1.716   -0.068  52.474  1.00 0.00 ? 19 MET A HG2  17 
ATOM 10373 H HG3  . MET A 1 19 ? 2.377   -1.402  53.434  1.00 0.00 ? 19 MET A HG3  17 
ATOM 10374 H HE1  . MET A 1 19 ? 0.047   -1.551  56.532  1.00 0.00 ? 19 MET A HE1  17 
ATOM 10375 H HE2  . MET A 1 19 ? 1.319   -2.362  55.591  1.00 0.00 ? 19 MET A HE2  17 
ATOM 10376 H HE3  . MET A 1 19 ? 1.653   -0.801  56.379  1.00 0.00 ? 19 MET A HE3  17 
ATOM 10377 N N    . LYS A 1 20 ? 3.780   2.534   51.954  1.00 0.00 ? 20 LYS A N    17 
ATOM 10378 C CA   . LYS A 1 20 ? 3.516   3.221   50.693  1.00 0.00 ? 20 LYS A CA   17 
ATOM 10379 C C    . LYS A 1 20 ? 4.651   2.984   49.710  1.00 0.00 ? 20 LYS A C    17 
ATOM 10380 O O    . LYS A 1 20 ? 4.427   2.755   48.523  1.00 0.00 ? 20 LYS A O    17 
ATOM 10381 C CB   . LYS A 1 20 ? 3.381   4.728   50.922  1.00 0.00 ? 20 LYS A CB   17 
ATOM 10382 C CG   . LYS A 1 20 ? 3.043   5.518   49.668  1.00 0.00 ? 20 LYS A CG   17 
ATOM 10383 C CD   . LYS A 1 20 ? 2.868   6.996   49.977  1.00 0.00 ? 20 LYS A CD   17 
ATOM 10384 C CE   . LYS A 1 20 ? 2.544   7.788   48.721  1.00 0.00 ? 20 LYS A CE   17 
ATOM 10385 N NZ   . LYS A 1 20 ? 2.359   9.237   49.011  1.00 0.00 ? 20 LYS A NZ   17 
ATOM 10386 H H    . LYS A 1 20 ? 3.807   3.085   52.800  1.00 0.00 ? 20 LYS A H    17 
ATOM 10387 H HA   . LYS A 1 20 ? 2.587   2.836   50.272  1.00 0.00 ? 20 LYS A HA   17 
ATOM 10388 H HB2  . LYS A 1 20 ? 2.590   4.894   51.654  1.00 0.00 ? 20 LYS A HB2  17 
ATOM 10389 H HB3  . LYS A 1 20 ? 4.326   5.101   51.317  1.00 0.00 ? 20 LYS A HB3  17 
ATOM 10390 H HG2  . LYS A 1 20 ? 3.850   5.400   48.945  1.00 0.00 ? 20 LYS A HG2  17 
ATOM 10391 H HG3  . LYS A 1 20 ? 2.116   5.132   49.244  1.00 0.00 ? 20 LYS A HG3  17 
ATOM 10392 H HD2  . LYS A 1 20 ? 2.053   7.116   50.692  1.00 0.00 ? 20 LYS A HD2  17 
ATOM 10393 H HD3  . LYS A 1 20 ? 3.791   7.380   50.411  1.00 0.00 ? 20 LYS A HD3  17 
ATOM 10394 H HE2  . LYS A 1 20 ? 3.360   7.672   48.009  1.00 0.00 ? 20 LYS A HE2  17 
ATOM 10395 H HE3  . LYS A 1 20 ? 1.626   7.396   48.282  1.00 0.00 ? 20 LYS A HE3  17 
ATOM 10396 H HZ1  . LYS A 1 20 ? 2.145   9.732   48.157  1.00 0.00 ? 20 LYS A HZ1  17 
ATOM 10397 H HZ2  . LYS A 1 20 ? 1.598   9.355   49.665  1.00 0.00 ? 20 LYS A HZ2  17 
ATOM 10398 H HZ3  . LYS A 1 20 ? 3.207   9.611   49.411  1.00 0.00 ? 20 LYS A HZ3  17 
ATOM 10399 N N    . ALA A 1 21 ? 5.877   3.044   50.223  1.00 0.00 ? 21 ALA A N    17 
ATOM 10400 C CA   . ALA A 1 21 ? 7.073   2.839   49.411  1.00 0.00 ? 21 ALA A CA   17 
ATOM 10401 C C    . ALA A 1 21 ? 7.164   1.392   48.953  1.00 0.00 ? 21 ALA A C    17 
ATOM 10402 O O    . ALA A 1 21 ? 7.509   1.109   47.807  1.00 0.00 ? 21 ALA A O    17 
ATOM 10403 C CB   . ALA A 1 21 ? 8.322   3.170   50.214  1.00 0.00 ? 21 ALA A CB   17 
ATOM 10404 H H    . ALA A 1 21 ? 5.996   3.239   51.207  1.00 0.00 ? 21 ALA A H    17 
ATOM 10405 H HA   . ALA A 1 21 ? 7.020   3.492   48.540  1.00 0.00 ? 21 ALA A HA   17 
ATOM 10406 H HB1  . ALA A 1 21 ? 9.207   3.028   49.595  1.00 0.00 ? 21 ALA A HB1  17 
ATOM 10407 H HB2  . ALA A 1 21 ? 8.275   4.208   50.545  1.00 0.00 ? 21 ALA A HB2  17 
ATOM 10408 H HB3  . ALA A 1 21 ? 8.379   2.514   51.082  1.00 0.00 ? 21 ALA A HB3  17 
ATOM 10409 N N    . ILE A 1 22 ? 6.850   0.479   49.868  1.00 0.00 ? 22 ILE A N    17 
ATOM 10410 C CA   . ILE A 1 22 ? 6.889   -0.953  49.585  1.00 0.00 ? 22 ILE A CA   17 
ATOM 10411 C C    . ILE A 1 22 ? 5.862   -1.313  48.523  1.00 0.00 ? 22 ILE A C    17 
ATOM 10412 O O    . ILE A 1 22 ? 6.170   -1.995  47.547  1.00 0.00 ? 22 ILE A O    17 
ATOM 10413 C CB   . ILE A 1 22 ? 6.581   -1.786  50.843  1.00 0.00 ? 22 ILE A CB   17 
ATOM 10414 C CG1  . ILE A 1 22 ? 7.704   -1.633  51.872  1.00 0.00 ? 22 ILE A CG1  17 
ATOM 10415 C CG2  . ILE A 1 22 ? 6.450   -3.259  50.489  1.00 0.00 ? 22 ILE A CG2  17 
ATOM 10416 C CD1  . ILE A 1 22 ? 7.372   -2.214  53.229  1.00 0.00 ? 22 ILE A CD1  17 
ATOM 10417 H H    . ILE A 1 22 ? 6.572   0.776   50.793  1.00 0.00 ? 22 ILE A H    17 
ATOM 10418 H HA   . ILE A 1 22 ? 7.886   -1.205  49.225  1.00 0.00 ? 22 ILE A HA   17 
ATOM 10419 H HB   . ILE A 1 22 ? 5.644   -1.435  51.277  1.00 0.00 ? 22 ILE A HB   17 
ATOM 10420 H HG12 . ILE A 1 22 ? 8.591   -2.137  51.490  1.00 0.00 ? 22 ILE A HG12 17 
ATOM 10421 H HG13 . ILE A 1 22 ? 7.914   -0.570  51.996  1.00 0.00 ? 22 ILE A HG13 17 
ATOM 10422 H HG21 . ILE A 1 22 ? 6.222   -3.836  51.385  1.00 0.00 ? 22 ILE A HG21 17 
ATOM 10423 H HG22 . ILE A 1 22 ? 5.646   -3.386  49.764  1.00 0.00 ? 22 ILE A HG22 17 
ATOM 10424 H HG23 . ILE A 1 22 ? 7.387   -3.613  50.060  1.00 0.00 ? 22 ILE A HG23 17 
ATOM 10425 H HD11 . ILE A 1 22 ? 8.205   -2.077  53.918  1.00 0.00 ? 22 ILE A HD11 17 
ATOM 10426 H HD12 . ILE A 1 22 ? 6.491   -1.711  53.630  1.00 0.00 ? 22 ILE A HD12 17 
ATOM 10427 H HD13 . ILE A 1 22 ? 7.166   -3.279  53.124  1.00 0.00 ? 22 ILE A HD13 17 
ATOM 10428 N N    . GLY A 1 23 ? 4.635   -0.844  48.727  1.00 0.00 ? 23 GLY A N    17 
ATOM 10429 C CA   . GLY A 1 23 ? 3.537   -1.101  47.799  1.00 0.00 ? 23 GLY A CA   17 
ATOM 10430 C C    . GLY A 1 23 ? 3.792   -0.412  46.468  1.00 0.00 ? 23 GLY A C    17 
ATOM 10431 O O    . GLY A 1 23 ? 3.592   -0.993  45.402  1.00 0.00 ? 23 GLY A O    17 
ATOM 10432 H H    . GLY A 1 23 ? 4.444   -0.289  49.549  1.00 0.00 ? 23 GLY A H    17 
ATOM 10433 H HA2  . GLY A 1 23 ? 3.448   -2.175  47.636  1.00 0.00 ? 23 GLY A HA2  17 
ATOM 10434 H HA3  . GLY A 1 23 ? 2.608   -0.723  48.227  1.00 0.00 ? 23 GLY A HA3  17 
ATOM 10435 N N    . GLY A 1 24 ? 4.238   0.838   46.545  1.00 0.00 ? 24 GLY A N    17 
ATOM 10436 C CA   . GLY A 1 24 ? 4.530   1.636   45.358  1.00 0.00 ? 24 GLY A CA   17 
ATOM 10437 C C    . GLY A 1 24 ? 5.733   1.070   44.619  1.00 0.00 ? 24 GLY A C    17 
ATOM 10438 O O    . GLY A 1 24 ? 5.667   0.780   43.426  1.00 0.00 ? 24 GLY A O    17 
ATOM 10439 H H    . GLY A 1 24 ? 4.383   1.260   47.451  1.00 0.00 ? 24 GLY A H    17 
ATOM 10440 H HA2  . GLY A 1 24 ? 3.664   1.626   44.696  1.00 0.00 ? 24 GLY A HA2  17 
ATOM 10441 H HA3  . GLY A 1 24 ? 4.742   2.663   45.658  1.00 0.00 ? 24 GLY A HA3  17 
ATOM 10442 N N    . TYR A 1 25 ? 6.835   0.918   45.347  1.00 0.00 ? 25 TYR A N    17 
ATOM 10443 C CA   . TYR A 1 25 ? 8.074   0.387   44.785  1.00 0.00 ? 25 TYR A CA   17 
ATOM 10444 C C    . TYR A 1 25 ? 7.832   -0.975  44.156  1.00 0.00 ? 25 TYR A C    17 
ATOM 10445 O O    . TYR A 1 25 ? 8.372   -1.292  43.097  1.00 0.00 ? 25 TYR A O    17 
ATOM 10446 C CB   . TYR A 1 25 ? 9.135   0.234   45.877  1.00 0.00 ? 25 TYR A CB   17 
ATOM 10447 C CG   . TYR A 1 25 ? 10.449  -0.326  45.380  1.00 0.00 ? 25 TYR A CG   17 
ATOM 10448 C CD1  . TYR A 1 25 ? 11.351  0.479   44.696  1.00 0.00 ? 25 TYR A CD1  17 
ATOM 10449 C CD2  . TYR A 1 25 ? 10.782  -1.657  45.596  1.00 0.00 ? 25 TYR A CD2  17 
ATOM 10450 C CE1  . TYR A 1 25 ? 12.555  -0.024  44.238  1.00 0.00 ? 25 TYR A CE1  17 
ATOM 10451 C CE2  . TYR A 1 25 ? 11.981  -2.177  45.145  1.00 0.00 ? 25 TYR A CE2  17 
ATOM 10452 C CZ   . TYR A 1 25 ? 12.869  -1.347  44.462  1.00 0.00 ? 25 TYR A CZ   17 
ATOM 10453 O OH   . TYR A 1 25 ? 14.066  -1.850  44.007  1.00 0.00 ? 25 TYR A OH   17 
ATOM 10454 H H    . TYR A 1 25 ? 6.826   1.177   46.323  1.00 0.00 ? 25 TYR A H    17 
ATOM 10455 H HA   . TYR A 1 25 ? 8.437   1.078   44.024  1.00 0.00 ? 25 TYR A HA   17 
ATOM 10456 H HB2  . TYR A 1 25 ? 9.321   1.213   46.319  1.00 0.00 ? 25 TYR A HB2  17 
ATOM 10457 H HB3  . TYR A 1 25 ? 8.745   -0.430  46.649  1.00 0.00 ? 25 TYR A HB3  17 
ATOM 10458 H HD1  . TYR A 1 25 ? 11.107  1.517   44.519  1.00 0.00 ? 25 TYR A HD1  17 
ATOM 10459 H HD2  . TYR A 1 25 ? 10.092  -2.297  46.126  1.00 0.00 ? 25 TYR A HD2  17 
ATOM 10460 H HE1  . TYR A 1 25 ? 13.245  0.616   43.708  1.00 0.00 ? 25 TYR A HE1  17 
ATOM 10461 H HE2  . TYR A 1 25 ? 12.226  -3.214  45.320  1.00 0.00 ? 25 TYR A HE2  17 
ATOM 10462 H HH   . TYR A 1 25 ? 14.186  -2.779  44.214  1.00 0.00 ? 25 TYR A HH   17 
ATOM 10463 N N    . ILE A 1 26 ? 7.010   -1.779  44.824  1.00 0.00 ? 26 ILE A N    17 
ATOM 10464 C CA   . ILE A 1 26 ? 6.675   -3.120  44.352  1.00 0.00 ? 26 ILE A CA   17 
ATOM 10465 C C    . ILE A 1 26 ? 5.708   -3.046  43.182  1.00 0.00 ? 26 ILE A C    17 
ATOM 10466 O O    . ILE A 1 26 ? 5.873   -3.734  42.176  1.00 0.00 ? 26 ILE A O    17 
ATOM 10467 C CB   . ILE A 1 26 ? 6.014   -3.960  45.461  1.00 0.00 ? 26 ILE A CB   17 
ATOM 10468 C CG1  . ILE A 1 26 ? 7.013   -4.243  46.584  1.00 0.00 ? 26 ILE A CG1  17 
ATOM 10469 C CG2  . ILE A 1 26 ? 5.526   -5.288  44.903  1.00 0.00 ? 26 ILE A CG2  17 
ATOM 10470 C CD1  . ILE A 1 26 ? 6.387   -4.847  47.821  1.00 0.00 ? 26 ILE A CD1  17 
ATOM 10471 H H    . ILE A 1 26 ? 6.596   -1.460  45.689  1.00 0.00 ? 26 ILE A H    17 
ATOM 10472 H HA   . ILE A 1 26 ? 7.593   -3.611  44.031  1.00 0.00 ? 26 ILE A HA   17 
ATOM 10473 H HB   . ILE A 1 26 ? 5.166   -3.406  45.865  1.00 0.00 ? 26 ILE A HB   17 
ATOM 10474 H HG12 . ILE A 1 26 ? 7.766   -4.935  46.208  1.00 0.00 ? 26 ILE A HG12 17 
ATOM 10475 H HG13 . ILE A 1 26 ? 7.490   -3.303  46.865  1.00 0.00 ? 26 ILE A HG13 17 
ATOM 10476 H HG21 . ILE A 1 26 ? 5.051   -5.869  45.694  1.00 0.00 ? 26 ILE A HG21 17 
ATOM 10477 H HG22 . ILE A 1 26 ? 4.804   -5.103  44.108  1.00 0.00 ? 26 ILE A HG22 17 
ATOM 10478 H HG23 . ILE A 1 26 ? 6.372   -5.846  44.503  1.00 0.00 ? 26 ILE A HG23 17 
ATOM 10479 H HD11 . ILE A 1 26 ? 7.144   -5.027  48.584  1.00 0.00 ? 26 ILE A HD11 17 
ATOM 10480 H HD12 . ILE A 1 26 ? 5.637   -4.161  48.217  1.00 0.00 ? 26 ILE A HD12 17 
ATOM 10481 H HD13 . ILE A 1 26 ? 5.912   -5.792  47.559  1.00 0.00 ? 26 ILE A HD13 17 
ATOM 10482 N N    . VAL A 1 27 ? 4.694   -2.199  43.328  1.00 0.00 ? 27 VAL A N    17 
ATOM 10483 C CA   . VAL A 1 27 ? 3.678   -2.012  42.295  1.00 0.00 ? 27 VAL A CA   17 
ATOM 10484 C C    . VAL A 1 27 ? 4.235   -1.189  41.144  1.00 0.00 ? 27 VAL A C    17 
ATOM 10485 O O    . VAL A 1 27 ? 3.837   -1.357  39.992  1.00 0.00 ? 27 VAL A O    17 
ATOM 10486 C CB   . VAL A 1 27 ? 2.441   -1.279  42.846  1.00 0.00 ? 27 VAL A CB   17 
ATOM 10487 C CG1  . VAL A 1 27 ? 2.755   0.189   43.087  1.00 0.00 ? 27 VAL A CG1  17 
ATOM 10488 C CG2  . VAL A 1 27 ? 1.286   -1.368  41.860  1.00 0.00 ? 27 VAL A CG2  17 
ATOM 10489 H H    . VAL A 1 27 ? 4.613   -1.661  44.179  1.00 0.00 ? 27 VAL A H    17 
ATOM 10490 H HA   . VAL A 1 27 ? 3.377   -2.992  41.926  1.00 0.00 ? 27 VAL A HA   17 
ATOM 10491 H HB   . VAL A 1 27 ? 2.146   -1.743  43.788  1.00 0.00 ? 27 VAL A HB   17 
ATOM 10492 H HG11 . VAL A 1 27 ? 1.875   0.695   43.485  1.00 0.00 ? 27 VAL A HG11 17 
ATOM 10493 H HG12 . VAL A 1 27 ? 3.573   0.272   43.802  1.00 0.00 ? 27 VAL A HG12 17 
ATOM 10494 H HG13 . VAL A 1 27 ? 3.045   0.657   42.146  1.00 0.00 ? 27 VAL A HG13 17 
ATOM 10495 H HG21 . VAL A 1 27 ? 0.414   -0.853  42.264  1.00 0.00 ? 27 VAL A HG21 17 
ATOM 10496 H HG22 . VAL A 1 27 ? 1.576   -0.901  40.919  1.00 0.00 ? 27 VAL A HG22 17 
ATOM 10497 H HG23 . VAL A 1 27 ? 1.038   -2.415  41.685  1.00 0.00 ? 27 VAL A HG23 17 
ATOM 10498 N N    . GLY A 1 28 ? 5.164   -0.296  41.472  1.00 0.00 ? 28 GLY A N    17 
ATOM 10499 C CA   . GLY A 1 28 ? 5.796   0.571   40.483  1.00 0.00 ? 28 GLY A CA   17 
ATOM 10500 C C    . GLY A 1 28 ? 6.802   -0.212  39.655  1.00 0.00 ? 28 GLY A C    17 
ATOM 10501 O O    . GLY A 1 28 ? 7.127   0.161   38.529  1.00 0.00 ? 28 GLY A O    17 
ATOM 10502 H H    . GLY A 1 28 ? 5.449   -0.206  42.437  1.00 0.00 ? 28 GLY A H    17 
ATOM 10503 H HA2  . GLY A 1 28 ? 5.031   0.983   39.825  1.00 0.00 ? 28 GLY A HA2  17 
ATOM 10504 H HA3  . GLY A 1 28 ? 6.308   1.387   40.994  1.00 0.00 ? 28 GLY A HA3  17 
ATOM 10505 N N    . ALA A 1 29 ? 7.293   -1.306  40.231  1.00 0.00 ? 29 ALA A N    17 
ATOM 10506 C CA   . ALA A 1 29 ? 8.269   -2.165  39.569  1.00 0.00 ? 29 ALA A CA   17 
ATOM 10507 C C    . ALA A 1 29 ? 7.569   -3.167  38.664  1.00 0.00 ? 29 ALA A C    17 
ATOM 10508 O O    . ALA A 1 29 ? 8.088   -3.551  37.617  1.00 0.00 ? 29 ALA A O    17 
ATOM 10509 C CB   . ALA A 1 29 ? 9.084   -2.932  40.598  1.00 0.00 ? 29 ALA A CB   17 
ATOM 10510 H H    . ALA A 1 29 ? 6.986   -1.559  41.160  1.00 0.00 ? 29 ALA A H    17 
ATOM 10511 H HA   . ALA A 1 29 ? 8.935   -1.542  38.972  1.00 0.00 ? 29 ALA A HA   17 
ATOM 10512 H HB1  . ALA A 1 29 ? 9.819   -3.559  40.094  1.00 0.00 ? 29 ALA A HB1  17 
ATOM 10513 H HB2  . ALA A 1 29 ? 9.597   -2.227  41.252  1.00 0.00 ? 29 ALA A HB2  17 
ATOM 10514 H HB3  . ALA A 1 29 ? 8.419   -3.560  41.192  1.00 0.00 ? 29 ALA A HB3  17 
ATOM 10515 N N    . LEU A 1 30 ? 6.379   -3.586  39.085  1.00 0.00 ? 30 LEU A N    17 
ATOM 10516 C CA   . LEU A 1 30 ? 5.580   -4.548  38.330  1.00 0.00 ? 30 LEU A CA   17 
ATOM 10517 C C    . LEU A 1 30 ? 5.350   -4.052  36.912  1.00 0.00 ? 30 LEU A C    17 
ATOM 10518 O O    . LEU A 1 30 ? 5.228   -4.839  35.975  1.00 0.00 ? 30 LEU A O    17 
ATOM 10519 C CB   . LEU A 1 30 ? 4.219   -4.754  38.997  1.00 0.00 ? 30 LEU A CB   17 
ATOM 10520 C CG   . LEU A 1 30 ? 4.224   -5.505  40.330  1.00 0.00 ? 30 LEU A CG   17 
ATOM 10521 C CD1  . LEU A 1 30 ? 2.831   -5.526  40.940  1.00 0.00 ? 30 LEU A CD1  17 
ATOM 10522 C CD2  . LEU A 1 30 ? 4.680   -6.943  40.136  1.00 0.00 ? 30 LEU A CD2  17 
ATOM 10523 H H    . LEU A 1 30 ? 6.005   -3.233  39.955  1.00 0.00 ? 30 LEU A H    17 
ATOM 10524 H HA   . LEU A 1 30 ? 6.113   -5.498  38.299  1.00 0.00 ? 30 LEU A HA   17 
ATOM 10525 H HB2  . LEU A 1 30 ? 3.782   -3.770  39.172  1.00 0.00 ? 30 LEU A HB2  17 
ATOM 10526 H HB3  . LEU A 1 30 ? 3.590   -5.312  38.303  1.00 0.00 ? 30 LEU A HB3  17 
ATOM 10527 H HG   . LEU A 1 30 ? 4.907   -5.001  41.013  1.00 0.00 ? 30 LEU A HG   17 
ATOM 10528 H HD11 . LEU A 1 30 ? 2.850   -6.054  41.894  1.00 0.00 ? 30 LEU A HD11 17 
ATOM 10529 H HD12 . LEU A 1 30 ? 2.491   -4.502  41.102  1.00 0.00 ? 30 LEU A HD12 17 
ATOM 10530 H HD13 . LEU A 1 30 ? 2.145   -6.033  40.261  1.00 0.00 ? 30 LEU A HD13 17 
ATOM 10531 H HD21 . LEU A 1 30 ? 4.689   -7.462  41.094  1.00 0.00 ? 30 LEU A HD21 17 
ATOM 10532 H HD22 . LEU A 1 30 ? 3.995   -7.451  39.457  1.00 0.00 ? 30 LEU A HD22 17 
ATOM 10533 H HD23 . LEU A 1 30 ? 5.684   -6.950  39.712  1.00 0.00 ? 30 LEU A HD23 17 
ATOM 10534 N N    . VAL A 1 31 ? 5.292   -2.731  36.767  1.00 0.00 ? 31 VAL A N    17 
ATOM 10535 C CA   . VAL A 1 31 ? 5.077   -2.096  35.469  1.00 0.00 ? 31 VAL A CA   17 
ATOM 10536 C C    . VAL A 1 31 ? 6.117   -2.570  34.467  1.00 0.00 ? 31 VAL A C    17 
ATOM 10537 O O    . VAL A 1 31 ? 5.832   -2.727  33.281  1.00 0.00 ? 31 VAL A O    17 
ATOM 10538 C CB   . VAL A 1 31 ? 5.178   -0.562  35.567  1.00 0.00 ? 31 VAL A CB   17 
ATOM 10539 C CG1  . VAL A 1 31 ? 5.180   0.061   34.180  1.00 0.00 ? 31 VAL A CG1  17 
ATOM 10540 C CG2  . VAL A 1 31 ? 3.998   0.000   36.346  1.00 0.00 ? 31 VAL A CG2  17 
ATOM 10541 H H    . VAL A 1 31 ? 5.399   -2.136  37.577  1.00 0.00 ? 31 VAL A H    17 
ATOM 10542 H HA   . VAL A 1 31 ? 4.082   -2.366  35.114  1.00 0.00 ? 31 VAL A HA   17 
ATOM 10543 H HB   . VAL A 1 31 ? 6.104   -0.301  36.080  1.00 0.00 ? 31 VAL A HB   17 
ATOM 10544 H HG11 . VAL A 1 31 ? 5.260   1.145   34.262  1.00 0.00 ? 31 VAL A HG11 17 
ATOM 10545 H HG12 . VAL A 1 31 ? 6.027   -0.322  33.612  1.00 0.00 ? 31 VAL A HG12 17 
ATOM 10546 H HG13 . VAL A 1 31 ? 4.253   -0.194  33.667  1.00 0.00 ? 31 VAL A HG13 17 
ATOM 10547 H HG21 . VAL A 1 31 ? 4.084   1.085   36.417  1.00 0.00 ? 31 VAL A HG21 17 
ATOM 10548 H HG22 . VAL A 1 31 ? 3.070   -0.256  35.834  1.00 0.00 ? 31 VAL A HG22 17 
ATOM 10549 H HG23 . VAL A 1 31 ? 3.989   -0.427  37.349  1.00 0.00 ? 31 VAL A HG23 17 
ATOM 10550 N N    . ILE A 1 32 ? 7.331   -2.797  34.961  1.00 0.00 ? 32 ILE A N    17 
ATOM 10551 C CA   . ILE A 1 32 ? 8.439   -3.256  34.128  1.00 0.00 ? 32 ILE A CA   17 
ATOM 10552 C C    . ILE A 1 32 ? 8.159   -4.650  33.590  1.00 0.00 ? 32 ILE A C    17 
ATOM 10553 O O    . ILE A 1 32 ? 8.413   -4.944  32.423  1.00 0.00 ? 32 ILE A O    17 
ATOM 10554 C CB   . ILE A 1 32 ? 9.757   -3.311  34.922  1.00 0.00 ? 32 ILE A CB   17 
ATOM 10555 C CG1  . ILE A 1 32 ? 10.202  -1.901  35.316  1.00 0.00 ? 32 ILE A CG1  17 
ATOM 10556 C CG2  . ILE A 1 32 ? 10.857  -3.948  34.086  1.00 0.00 ? 32 ILE A CG2  17 
ATOM 10557 C CD1  . ILE A 1 32 ? 11.348  -1.876  36.303  1.00 0.00 ? 32 ILE A CD1  17 
ATOM 10558 H H    . ILE A 1 32 ? 7.503   -2.651  35.946  1.00 0.00 ? 32 ILE A H    17 
ATOM 10559 H HA   . ILE A 1 32 ? 8.552   -2.562  33.295  1.00 0.00 ? 32 ILE A HA   17 
ATOM 10560 H HB   . ILE A 1 32 ? 9.601   -3.904  35.823  1.00 0.00 ? 32 ILE A HB   17 
ATOM 10561 H HG12 . ILE A 1 32 ? 10.513  -1.374  34.414  1.00 0.00 ? 32 ILE A HG12 17 
ATOM 10562 H HG13 . ILE A 1 32 ? 9.352   -1.384  35.763  1.00 0.00 ? 32 ILE A HG13 17 
ATOM 10563 H HG21 . ILE A 1 32 ? 11.781  -3.990  34.662  1.00 0.00 ? 32 ILE A HG21 17 
ATOM 10564 H HG22 . ILE A 1 32 ? 10.559  -4.958  33.806  1.00 0.00 ? 32 ILE A HG22 17 
ATOM 10565 H HG23 . ILE A 1 32 ? 11.018  -3.353  33.187  1.00 0.00 ? 32 ILE A HG23 17 
ATOM 10566 H HD11 . ILE A 1 32 ? 11.622  -0.849  36.545  1.00 0.00 ? 32 ILE A HD11 17 
ATOM 10567 H HD12 . ILE A 1 32 ? 11.047  -2.390  37.216  1.00 0.00 ? 32 ILE A HD12 17 
ATOM 10568 H HD13 . ILE A 1 32 ? 12.209  -2.382  35.867  1.00 0.00 ? 32 ILE A HD13 17 
ATOM 10569 N N    . LEU A 1 33 ? 7.631   -5.505  34.460  1.00 0.00 ? 33 LEU A N    17 
ATOM 10570 C CA   . LEU A 1 33 ? 7.304   -6.882  34.099  1.00 0.00 ? 33 LEU A CA   17 
ATOM 10571 C C    . LEU A 1 33 ? 6.246   -6.909  33.008  1.00 0.00 ? 33 LEU A C    17 
ATOM 10572 O O    . LEU A 1 33 ? 6.381   -7.613  32.008  1.00 0.00 ? 33 LEU A O    17 
ATOM 10573 C CB   . LEU A 1 33 ? 6.766   -7.641  35.314  1.00 0.00 ? 33 LEU A CB   17 
ATOM 10574 C CG   . LEU A 1 33 ? 7.784   -7.990  36.401  1.00 0.00 ? 33 LEU A CG   17 
ATOM 10575 C CD1  . LEU A 1 33 ? 7.095   -8.625  37.599  1.00 0.00 ? 33 LEU A CD1  17 
ATOM 10576 C CD2  . LEU A 1 33 ? 8.820   -8.970  35.873  1.00 0.00 ? 33 LEU A CD2  17 
ATOM 10577 H H    . LEU A 1 33 ? 7.445   -5.202  35.406  1.00 0.00 ? 33 LEU A H    17 
ATOM 10578 H HA   . LEU A 1 33 ? 8.207   -7.373  33.739  1.00 0.00 ? 33 LEU A HA   17 
ATOM 10579 H HB2  . LEU A 1 33 ? 5.989   -7.028  35.771  1.00 0.00 ? 33 LEU A HB2  17 
ATOM 10580 H HB3  . LEU A 1 33 ? 6.329   -8.573  34.956  1.00 0.00 ? 33 LEU A HB3  17 
ATOM 10581 H HG   . LEU A 1 33 ? 8.284   -7.075  36.719  1.00 0.00 ? 33 LEU A HG   17 
ATOM 10582 H HD11 . LEU A 1 33 ? 7.829   -8.858  38.370  1.00 0.00 ? 33 LEU A HD11 17 
ATOM 10583 H HD12 . LEU A 1 33 ? 6.357   -7.930  38.002  1.00 0.00 ? 33 LEU A HD12 17 
ATOM 10584 H HD13 . LEU A 1 33 ? 6.596   -9.542  37.286  1.00 0.00 ? 33 LEU A HD13 17 
ATOM 10585 H HD21 . LEU A 1 33 ? 9.545   -9.201  36.653  1.00 0.00 ? 33 LEU A HD21 17 
ATOM 10586 H HD22 . LEU A 1 33 ? 8.323   -9.888  35.560  1.00 0.00 ? 33 LEU A HD22 17 
ATOM 10587 H HD23 . LEU A 1 33 ? 9.336   -8.527  35.021  1.00 0.00 ? 33 LEU A HD23 17 
ATOM 10588 N N    . ALA A 1 34 ? 5.188   -6.131  33.214  1.00 0.00 ? 34 ALA A N    17 
ATOM 10589 C CA   . ALA A 1 34 ? 4.085   -6.045  32.260  1.00 0.00 ? 34 ALA A CA   17 
ATOM 10590 C C    . ALA A 1 34 ? 4.589   -5.575  30.905  1.00 0.00 ? 34 ALA A C    17 
ATOM 10591 O O    . ALA A 1 34 ? 4.173   -6.078  29.862  1.00 0.00 ? 34 ALA A O    17 
ATOM 10592 C CB   . ALA A 1 34 ? 3.034   -5.061  32.751  1.00 0.00 ? 34 ALA A CB   17 
ATOM 10593 H H    . ALA A 1 34 ? 5.134   -5.576  34.057  1.00 0.00 ? 34 ALA A H    17 
ATOM 10594 H HA   . ALA A 1 34 ? 3.634   -7.032  32.156  1.00 0.00 ? 34 ALA A HA   17 
ATOM 10595 H HB1  . ALA A 1 34 ? 2.209   -5.015  32.040  1.00 0.00 ? 34 ALA A HB1  17 
ATOM 10596 H HB2  . ALA A 1 34 ? 2.657   -5.387  33.721  1.00 0.00 ? 34 ALA A HB2  17 
ATOM 10597 H HB3  . ALA A 1 34 ? 3.481   -4.071  32.849  1.00 0.00 ? 34 ALA A HB3  17 
ATOM 10598 N N    . VAL A 1 35 ? 5.493   -4.600  30.934  1.00 0.00 ? 35 VAL A N    17 
ATOM 10599 C CA   . VAL A 1 35 ? 6.074   -4.039  29.718  1.00 0.00 ? 35 VAL A CA   17 
ATOM 10600 C C    . VAL A 1 35 ? 6.709   -5.134  28.877  1.00 0.00 ? 35 VAL A C    17 
ATOM 10601 O O    . VAL A 1 35 ? 6.550   -5.173  27.658  1.00 0.00 ? 35 VAL A O    17 
ATOM 10602 C CB   . VAL A 1 35 ? 7.163   -2.999  30.041  1.00 0.00 ? 35 VAL A CB   17 
ATOM 10603 C CG1  . VAL A 1 35 ? 7.895   -2.584  28.774  1.00 0.00 ? 35 VAL A CG1  17 
ATOM 10604 C CG2  . VAL A 1 35 ? 6.545   -1.758  30.667  1.00 0.00 ? 35 VAL A CG2  17 
ATOM 10605 H H    . VAL A 1 35 ? 5.795   -4.227  31.823  1.00 0.00 ? 35 VAL A H    17 
ATOM 10606 H HA   . VAL A 1 35 ? 5.279   -3.558  29.147  1.00 0.00 ? 35 VAL A HA   17 
ATOM 10607 H HB   . VAL A 1 35 ? 7.874   -3.438  30.740  1.00 0.00 ? 35 VAL A HB   17 
ATOM 10608 H HG11 . VAL A 1 35 ? 8.668   -1.854  29.016  1.00 0.00 ? 35 VAL A HG11 17 
ATOM 10609 H HG12 . VAL A 1 35 ? 8.355   -3.460  28.318  1.00 0.00 ? 35 VAL A HG12 17 
ATOM 10610 H HG13 . VAL A 1 35 ? 7.186   -2.140  28.075  1.00 0.00 ? 35 VAL A HG13 17 
ATOM 10611 H HG21 . VAL A 1 35 ? 7.325   -1.033  30.899  1.00 0.00 ? 35 VAL A HG21 17 
ATOM 10612 H HG22 . VAL A 1 35 ? 5.835   -1.314  29.968  1.00 0.00 ? 35 VAL A HG22 17 
ATOM 10613 H HG23 . VAL A 1 35 ? 6.025   -2.035  31.584  1.00 0.00 ? 35 VAL A HG23 17 
ATOM 10614 N N    . ALA A 1 36 ? 7.432   -6.026  29.547  1.00 0.00 ? 36 ALA A N    17 
ATOM 10615 C CA   . ALA A 1 36 ? 8.107   -7.140  28.885  1.00 0.00 ? 36 ALA A CA   17 
ATOM 10616 C C    . ALA A 1 36 ? 7.090   -8.088  28.271  1.00 0.00 ? 36 ALA A C    17 
ATOM 10617 O O    . ALA A 1 36 ? 7.226   -8.510  27.123  1.00 0.00 ? 36 ALA A O    17 
ATOM 10618 C CB   . ALA A 1 36 ? 8.950   -7.918  29.884  1.00 0.00 ? 36 ALA A CB   17 
ATOM 10619 H H    . ALA A 1 36 ? 7.525   -5.939  30.549  1.00 0.00 ? 36 ALA A H    17 
ATOM 10620 H HA   . ALA A 1 36 ? 8.751   -6.743  28.101  1.00 0.00 ? 36 ALA A HA   17 
ATOM 10621 H HB1  . ALA A 1 36 ? 9.460   -8.737  29.378  1.00 0.00 ? 36 ALA A HB1  17 
ATOM 10622 H HB2  . ALA A 1 36 ? 9.689   -7.252  30.330  1.00 0.00 ? 36 ALA A HB2  17 
ATOM 10623 H HB3  . ALA A 1 36 ? 8.305   -8.321  30.666  1.00 0.00 ? 36 ALA A HB3  17 
ATOM 10624 N N    . GLY A 1 37 ? 6.067   -8.419  29.053  1.00 0.00 ? 37 GLY A N    17 
ATOM 10625 C CA   . GLY A 1 37 ? 5.007   -9.321  28.612  1.00 0.00 ? 37 GLY A CA   17 
ATOM 10626 C C    . GLY A 1 37 ? 4.476   -8.893  27.253  1.00 0.00 ? 37 GLY A C    17 
ATOM 10627 O O    . GLY A 1 37 ? 4.535   -9.644  26.281  1.00 0.00 ? 37 GLY A O    17 
ATOM 10628 H H    . GLY A 1 37 ? 6.011   -8.038  29.987  1.00 0.00 ? 37 GLY A H    17 
ATOM 10629 H HA2  . GLY A 1 37 ? 5.403   -10.333 28.541  1.00 0.00 ? 37 GLY A HA2  17 
ATOM 10630 H HA3  . GLY A 1 37 ? 4.194   -9.302  29.338  1.00 0.00 ? 37 GLY A HA3  17 
ATOM 10631 N N    . LEU A 1 38 ? 3.956   -7.670  27.199  1.00 0.00 ? 38 LEU A N    17 
ATOM 10632 C CA   . LEU A 1 38 ? 3.404   -7.110  25.968  1.00 0.00 ? 38 LEU A CA   17 
ATOM 10633 C C    . LEU A 1 38 ? 4.472   -7.043  24.889  1.00 0.00 ? 38 LEU A C    17 
ATOM 10634 O O    . LEU A 1 38 ? 4.209   -7.311  23.718  1.00 0.00 ? 38 LEU A O    17 
ATOM 10635 C CB   . LEU A 1 38 ? 2.874   -5.696  26.213  1.00 0.00 ? 38 LEU A CB   17 
ATOM 10636 C CG   . LEU A 1 38 ? 1.601   -5.585  27.054  1.00 0.00 ? 38 LEU A CG   17 
ATOM 10637 C CD1  . LEU A 1 38 ? 1.261   -4.128  27.325  1.00 0.00 ? 38 LEU A CD1  17 
ATOM 10638 C CD2  . LEU A 1 38 ? 0.423   -6.222  26.333  1.00 0.00 ? 38 LEU A CD2  17 
ATOM 10639 H H    . LEU A 1 38 ? 3.937   -7.099  28.033  1.00 0.00 ? 38 LEU A H    17 
ATOM 10640 H HA   . LEU A 1 38 ? 2.587   -7.747  25.629  1.00 0.00 ? 38 LEU A HA   17 
ATOM 10641 H HB2  . LEU A 1 38 ? 3.656   -5.131  26.719  1.00 0.00 ? 38 LEU A HB2  17 
ATOM 10642 H HB3  . LEU A 1 38 ? 2.670   -5.244  25.242  1.00 0.00 ? 38 LEU A HB3  17 
ATOM 10643 H HG   . LEU A 1 38 ? 1.761   -6.098  28.002  1.00 0.00 ? 38 LEU A HG   17 
ATOM 10644 H HD11 . LEU A 1 38 ? 0.358   -4.063  27.933  1.00 0.00 ? 38 LEU A HD11 17 
ATOM 10645 H HD12 . LEU A 1 38 ? 2.087   -3.656  27.856  1.00 0.00 ? 38 LEU A HD12 17 
ATOM 10646 H HD13 . LEU A 1 38 ? 1.095   -3.612  26.379  1.00 0.00 ? 38 LEU A HD13 17 
ATOM 10647 H HD21 . LEU A 1 38 ? -0.475  -6.146  26.948  1.00 0.00 ? 38 LEU A HD21 17 
ATOM 10648 H HD22 . LEU A 1 38 ? 0.256   -5.707  25.387  1.00 0.00 ? 38 LEU A HD22 17 
ATOM 10649 H HD23 . LEU A 1 38 ? 0.641   -7.272  26.142  1.00 0.00 ? 38 LEU A HD23 17 
ATOM 10650 N N    . ILE A 1 39 ? 5.683   -6.681  25.300  1.00 0.00 ? 39 ILE A N    17 
ATOM 10651 C CA   . ILE A 1 39 ? 6.817   -6.570  24.387  1.00 0.00 ? 39 ILE A CA   17 
ATOM 10652 C C    . ILE A 1 39 ? 7.073   -7.896  23.692  1.00 0.00 ? 39 ILE A C    17 
ATOM 10653 O O    . ILE A 1 39 ? 7.301   -7.948  22.484  1.00 0.00 ? 39 ILE A O    17 
ATOM 10654 C CB   . ILE A 1 39 ? 8.104   -6.170  25.132  1.00 0.00 ? 39 ILE A CB   17 
ATOM 10655 C CG1  . ILE A 1 39 ? 7.988   -4.742  25.669  1.00 0.00 ? 39 ILE A CG1  17 
ATOM 10656 C CG2  . ILE A 1 39 ? 9.303   -6.238  24.198  1.00 0.00 ? 39 ILE A CG2  17 
ATOM 10657 C CD1  . ILE A 1 39 ? 7.782   -3.700  24.591  1.00 0.00 ? 39 ILE A CD1  17 
ATOM 10658 H H    . ILE A 1 39 ? 5.835   -6.474  26.277  1.00 0.00 ? 39 ILE A H    17 
ATOM 10659 H HA   . ILE A 1 39 ? 6.585   -5.809  23.641  1.00 0.00 ? 39 ILE A HA   17 
ATOM 10660 H HB   . ILE A 1 39 ? 8.257   -6.856  25.965  1.00 0.00 ? 39 ILE A HB   17 
ATOM 10661 H HG12 . ILE A 1 39 ? 7.141   -4.699  26.354  1.00 0.00 ? 39 ILE A HG12 17 
ATOM 10662 H HG13 . ILE A 1 39 ? 8.904   -4.501  26.208  1.00 0.00 ? 39 ILE A HG13 17 
ATOM 10663 H HG21 . ILE A 1 39 ? 10.208  -5.962  24.739  1.00 0.00 ? 39 ILE A HG21 17 
ATOM 10664 H HG22 . ILE A 1 39 ? 9.405   -7.252  23.814  1.00 0.00 ? 39 ILE A HG22 17 
ATOM 10665 H HG23 . ILE A 1 39 ? 9.154   -5.548  23.367  1.00 0.00 ? 39 ILE A HG23 17 
ATOM 10666 H HD11 . ILE A 1 39 ? 7.705   -2.705  25.030  1.00 0.00 ? 39 ILE A HD11 17 
ATOM 10667 H HD12 . ILE A 1 39 ? 8.627   -3.722  23.903  1.00 0.00 ? 39 ILE A HD12 17 
ATOM 10668 H HD13 . ILE A 1 39 ? 6.864   -3.921  24.047  1.00 0.00 ? 39 ILE A HD13 17 
ATOM 10669 N N    . TYR A 1 40 ? 7.033   -8.972  24.474  1.00 0.00 ? 40 TYR A N    17 
ATOM 10670 C CA   . TYR A 1 40 ? 7.258   -10.320 23.959  1.00 0.00 ? 40 TYR A CA   17 
ATOM 10671 C C    . TYR A 1 40 ? 6.111   -10.744 23.058  1.00 0.00 ? 40 TYR A C    17 
ATOM 10672 O O    . TYR A 1 40 ? 6.318   -11.347 22.006  1.00 0.00 ? 40 TYR A O    17 
ATOM 10673 C CB   . TYR A 1 40 ? 7.365   -11.322 25.110  1.00 0.00 ? 40 TYR A CB   17 
ATOM 10674 C CG   . TYR A 1 40 ? 7.625   -12.743 24.663  1.00 0.00 ? 40 TYR A CG   17 
ATOM 10675 C CD1  . TYR A 1 40 ? 8.896   -13.144 24.272  1.00 0.00 ? 40 TYR A CD1  17 
ATOM 10676 C CD2  . TYR A 1 40 ? 6.598   -13.679 24.633  1.00 0.00 ? 40 TYR A CD2  17 
ATOM 10677 C CE1  . TYR A 1 40 ? 9.143   -14.441 23.862  1.00 0.00 ? 40 TYR A CE1  17 
ATOM 10678 C CE2  . TYR A 1 40 ? 6.827   -14.979 24.225  1.00 0.00 ? 40 TYR A CE2  17 
ATOM 10679 C CZ   . TYR A 1 40 ? 8.113   -15.355 23.838  1.00 0.00 ? 40 TYR A CZ   17 
ATOM 10680 O OH   . TYR A 1 40 ? 8.356   -16.647 23.430  1.00 0.00 ? 40 TYR A OH   17 
ATOM 10681 H H    . TYR A 1 40 ? 6.842   -8.863  25.460  1.00 0.00 ? 40 TYR A H    17 
ATOM 10682 H HA   . TYR A 1 40 ? 8.186   -10.326 23.389  1.00 0.00 ? 40 TYR A HA   17 
ATOM 10683 H HB2  . TYR A 1 40 ? 8.178   -11.011 25.766  1.00 0.00 ? 40 TYR A HB2  17 
ATOM 10684 H HB3  . TYR A 1 40 ? 6.433   -11.302 25.675  1.00 0.00 ? 40 TYR A HB3  17 
ATOM 10685 H HD1  . TYR A 1 40 ? 9.706   -12.429 24.289  1.00 0.00 ? 40 TYR A HD1  17 
ATOM 10686 H HD2  . TYR A 1 40 ? 5.603   -13.385 24.934  1.00 0.00 ? 40 TYR A HD2  17 
ATOM 10687 H HE1  . TYR A 1 40 ? 10.137  -14.736 23.562  1.00 0.00 ? 40 TYR A HE1  17 
ATOM 10688 H HE2  . TYR A 1 40 ? 6.019   -15.695 24.206  1.00 0.00 ? 40 TYR A HE2  17 
ATOM 10689 H HH   . TYR A 1 40 ? 7.572   -17.201 23.450  1.00 0.00 ? 40 TYR A HH   17 
ATOM 10690 N N    . SER A 1 41 ? 4.893   -10.421 23.486  1.00 0.00 ? 41 SER A N    17 
ATOM 10691 C CA   . SER A 1 41 ? 3.688   -10.757 22.735  1.00 0.00 ? 41 SER A CA   17 
ATOM 10692 C C    . SER A 1 41 ? 3.722   -10.117 21.357  1.00 0.00 ? 41 SER A C    17 
ATOM 10693 O O    . SER A 1 41 ? 3.501   -10.776 20.343  1.00 0.00 ? 41 SER A O    17 
ATOM 10694 C CB   . SER A 1 41 ? 2.442   -10.257 23.469  1.00 0.00 ? 41 SER A CB   17 
ATOM 10695 O OG   . SER A 1 41 ? 2.265   -10.940 24.698  1.00 0.00 ? 41 SER A OG   17 
ATOM 10696 H H    . SER A 1 41 ? 4.787   -9.925  24.360  1.00 0.00 ? 41 SER A H    17 
ATOM 10697 H HA   . SER A 1 41 ? 3.633   -11.840 22.629  1.00 0.00 ? 41 SER A HA   17 
ATOM 10698 H HB2  . SER A 1 41 ? 2.549   -9.190  23.667  1.00 0.00 ? 41 SER A HB2  17 
ATOM 10699 H HB3  . SER A 1 41 ? 1.567   -10.423 22.841  1.00 0.00 ? 41 SER A HB3  17 
ATOM 10700 H HG   . SER A 1 41 ? 1.477   -10.603 25.131  1.00 0.00 ? 41 SER A HG   17 
ATOM 10701 N N    . MET A 1 42 ? 4.004   -8.817  21.335  1.00 0.00 ? 42 MET A N    17 
ATOM 10702 C CA   . MET A 1 42 ? 4.076   -8.055  20.091  1.00 0.00 ? 42 MET A CA   17 
ATOM 10703 C C    . MET A 1 42 ? 5.210   -8.566  19.218  1.00 0.00 ? 42 MET A C    17 
ATOM 10704 O O    . MET A 1 42 ? 5.071   -8.691  18.002  1.00 0.00 ? 42 MET A O    17 
ATOM 10705 C CB   . MET A 1 42 ? 4.321   -6.573  20.384  1.00 0.00 ? 42 MET A CB   17 
ATOM 10706 C CG   . MET A 1 42 ? 4.327   -5.689  19.147  1.00 0.00 ? 42 MET A CG   17 
ATOM 10707 S SD   . MET A 1 42 ? 4.588   -3.948  19.538  1.00 0.00 ? 42 MET A SD   17 
ATOM 10708 C CE   . MET A 1 42 ? 6.308   -3.967  20.035  1.00 0.00 ? 42 MET A CE   17 
ATOM 10709 H H    . MET A 1 42 ? 4.174   -8.330  22.203  1.00 0.00 ? 42 MET A H    17 
ATOM 10710 H HA   . MET A 1 42 ? 3.131   -8.165  19.558  1.00 0.00 ? 42 MET A HA   17 
ATOM 10711 H HB2  . MET A 1 42 ? 3.535   -6.221  21.053  1.00 0.00 ? 42 MET A HB2  17 
ATOM 10712 H HB3  . MET A 1 42 ? 5.288   -6.477  20.878  1.00 0.00 ? 42 MET A HB3  17 
ATOM 10713 H HG2  . MET A 1 42 ? 5.121   -6.021  18.479  1.00 0.00 ? 42 MET A HG2  17 
ATOM 10714 H HG3  . MET A 1 42 ? 3.371   -5.794  18.633  1.00 0.00 ? 42 MET A HG3  17 
ATOM 10715 H HE1  . MET A 1 42 ? 6.626   -2.961  20.310  1.00 0.00 ? 42 MET A HE1  17 
ATOM 10716 H HE2  . MET A 1 42 ? 6.430   -4.630  20.892  1.00 0.00 ? 42 MET A HE2  17 
ATOM 10717 H HE3  . MET A 1 42 ? 6.920   -4.325  19.208  1.00 0.00 ? 42 MET A HE3  17 
ATOM 10718 N N    . LEU A 1 43 ? 6.339   -8.861  19.857  1.00 0.00 ? 43 LEU A N    17 
ATOM 10719 C CA   . LEU A 1 43 ? 7.521   -9.363  19.163  1.00 0.00 ? 43 LEU A CA   17 
ATOM 10720 C C    . LEU A 1 43 ? 7.330   -10.820 18.772  1.00 0.00 ? 43 LEU A C    17 
ATOM 10721 O O    . LEU A 1 43 ? 7.715   -11.241 17.683  1.00 0.00 ? 43 LEU A O    17 
ATOM 10722 C CB   . LEU A 1 43 ? 8.754   -9.261  20.063  1.00 0.00 ? 43 LEU A CB   17 
ATOM 10723 C CG   . LEU A 1 43 ? 9.277   -7.850  20.340  1.00 0.00 ? 43 LEU A CG   17 
ATOM 10724 C CD1  . LEU A 1 43 ? 10.419  -7.888  21.344  1.00 0.00 ? 43 LEU A CD1  17 
ATOM 10725 C CD2  . LEU A 1 43 ? 9.789   -7.206  19.061  1.00 0.00 ? 43 LEU A CD2  17 
ATOM 10726 H H    . LEU A 1 43 ? 6.391   -8.737  20.858  1.00 0.00 ? 43 LEU A H    17 
ATOM 10727 H HA   . LEU A 1 43 ? 7.679   -8.765  18.265  1.00 0.00 ? 43 LEU A HA   17 
ATOM 10728 H HB2  . LEU A 1 43 ? 8.504   -9.716  21.021  1.00 0.00 ? 43 LEU A HB2  17 
ATOM 10729 H HB3  . LEU A 1 43 ? 9.557   -9.826  19.591  1.00 0.00 ? 43 LEU A HB3  17 
ATOM 10730 H HG   . LEU A 1 43 ? 8.463   -7.247  20.744  1.00 0.00 ? 43 LEU A HG   17 
ATOM 10731 H HD11 . LEU A 1 43 ? 10.775  -6.876  21.541  1.00 0.00 ? 43 LEU A HD11 17 
ATOM 10732 H HD12 . LEU A 1 43 ? 10.067  -8.333  22.275  1.00 0.00 ? 43 LEU A HD12 17 
ATOM 10733 H HD13 . LEU A 1 43 ? 11.236  -8.486  20.941  1.00 0.00 ? 43 LEU A HD13 17 
ATOM 10734 H HD21 . LEU A 1 43 ? 10.147  -6.198  19.270  1.00 0.00 ? 43 LEU A HD21 17 
ATOM 10735 H HD22 . LEU A 1 43 ? 10.606  -7.803  18.657  1.00 0.00 ? 43 LEU A HD22 17 
ATOM 10736 H HD23 . LEU A 1 43 ? 8.980   -7.156  18.332  1.00 0.00 ? 43 LEU A HD23 17 
ATOM 10737 N N    . ARG A 1 44 ? 6.727   -11.584 19.678  1.00 0.00 ? 44 ARG A N    17 
ATOM 10738 C CA   . ARG A 1 44 ? 6.470   -13.003 19.455  1.00 0.00 ? 44 ARG A CA   17 
ATOM 10739 C C    . ARG A 1 44 ? 5.205   -13.193 18.634  1.00 0.00 ? 44 ARG A C    17 
ATOM 10740 O O    . ARG A 1 44 ? 5.096   -14.124 17.838  1.00 0.00 ? 44 ARG A O    17 
ATOM 10741 C CB   . ARG A 1 44 ? 6.294   -13.732 20.789  1.00 0.00 ? 44 ARG A CB   17 
ATOM 10742 C CG   . ARG A 1 44 ? 6.113   -15.235 20.655  1.00 0.00 ? 44 ARG A CG   17 
ATOM 10743 C CD   . ARG A 1 44 ? 7.375   -15.899 20.131  1.00 0.00 ? 44 ARG A CD   17 
ATOM 10744 N NE   . ARG A 1 44 ? 7.222   -17.348 20.012  1.00 0.00 ? 44 ARG A NE   17 
ATOM 10745 C CZ   . ARG A 1 44 ? 8.109   -18.147 19.427  1.00 0.00 ? 44 ARG A CZ   17 
ATOM 10746 N NH1  . ARG A 1 44 ? 9.216   -17.638 18.904  1.00 0.00 ? 44 ARG A NH1  17 
ATOM 10747 N NH2  . ARG A 1 44 ? 7.885   -19.452 19.366  1.00 0.00 ? 44 ARG A NH2  17 
ATOM 10748 H H    . ARG A 1 44 ? 6.433   -11.178 20.555  1.00 0.00 ? 44 ARG A H    17 
ATOM 10749 H HA   . ARG A 1 44 ? 7.316   -13.431 18.919  1.00 0.00 ? 44 ARG A HA   17 
ATOM 10750 H HB2  . ARG A 1 44 ? 7.177   -13.546 21.400  1.00 0.00 ? 44 ARG A HB2  17 
ATOM 10751 H HB3  . ARG A 1 44 ? 5.414   -13.324 21.288  1.00 0.00 ? 44 ARG A HB3  17 
ATOM 10752 H HG2  . ARG A 1 44 ? 5.872   -15.651 21.633  1.00 0.00 ? 44 ARG A HG2  17 
ATOM 10753 H HG3  . ARG A 1 44 ? 5.294   -15.433 19.964  1.00 0.00 ? 44 ARG A HG3  17 
ATOM 10754 H HD2  . ARG A 1 44 ? 7.609   -15.487 19.150  1.00 0.00 ? 44 ARG A HD2  17 
ATOM 10755 H HD3  . ARG A 1 44 ? 8.196   -15.685 20.815  1.00 0.00 ? 44 ARG A HD3  17 
ATOM 10756 H HE   . ARG A 1 44 ? 6.385   -17.757 20.403  1.00 0.00 ? 44 ARG A HE   17 
ATOM 10757 H HH11 . ARG A 1 44 ? 9.385   -16.643 18.951  1.00 0.00 ? 44 ARG A HH11 17 
ATOM 10758 H HH12 . ARG A 1 44 ? 9.889   -18.245 18.459  1.00 0.00 ? 44 ARG A HH12 17 
ATOM 10759 H HH21 . ARG A 1 44 ? 7.041   -19.839 19.764  1.00 0.00 ? 44 ARG A HH21 17 
ATOM 10760 H HH22 . ARG A 1 44 ? 8.558   -20.059 18.921  1.00 0.00 ? 44 ARG A HH22 17 
ATOM 10761 N N    . LYS A 1 45 ? 4.247   -12.293 18.840  1.00 0.00 ? 45 LYS A N    17 
ATOM 10762 C CA   . LYS A 1 45 ? 2.972   -12.335 18.130  1.00 0.00 ? 45 LYS A CA   17 
ATOM 10763 C C    . LYS A 1 45 ? 3.152   -11.898 16.686  1.00 0.00 ? 45 LYS A C    17 
ATOM 10764 O O    . LYS A 1 45 ? 2.654   -12.538 15.761  1.00 0.00 ? 45 LYS A O    17 
ATOM 10765 C CB   . LYS A 1 45 ? 1.958   -11.402 18.794  1.00 0.00 ? 45 LYS A CB   17 
ATOM 10766 C CG   . LYS A 1 45 ? 0.581   -11.422 18.150  1.00 0.00 ? 45 LYS A CG   17 
ATOM 10767 C CD   . LYS A 1 45 ? -0.389  -10.518 18.893  1.00 0.00 ? 45 LYS A CD   17 
ATOM 10768 C CE   . LYS A 1 45 ? -1.762  -10.526 18.240  1.00 0.00 ? 45 LYS A CE   17 
ATOM 10769 N NZ   . LYS A 1 45 ? -2.727  -9.654  18.964  1.00 0.00 ? 45 LYS A NZ   17 
ATOM 10770 H H    . LYS A 1 45 ? 4.396   -11.550 19.509  1.00 0.00 ? 45 LYS A H    17 
ATOM 10771 H HA   . LYS A 1 45 ? 2.591   -13.356 18.154  1.00 0.00 ? 45 LYS A HA   17 
ATOM 10772 H HB2  . LYS A 1 45 ? 1.852   -11.698 19.838  1.00 0.00 ? 45 LYS A HB2  17 
ATOM 10773 H HB3  . LYS A 1 45 ? 2.344   -10.384 18.743  1.00 0.00 ? 45 LYS A HB3  17 
ATOM 10774 H HG2  . LYS A 1 45 ? 0.666   -11.079 17.119  1.00 0.00 ? 45 LYS A HG2  17 
ATOM 10775 H HG3  . LYS A 1 45 ? 0.197   -12.442 18.164  1.00 0.00 ? 45 LYS A HG3  17 
ATOM 10776 H HD2  . LYS A 1 45 ? -0.483  -10.866 19.922  1.00 0.00 ? 45 LYS A HD2  17 
ATOM 10777 H HD3  . LYS A 1 45 ? -0.000  -9.499  18.889  1.00 0.00 ? 45 LYS A HD3  17 
ATOM 10778 H HE2  . LYS A 1 45 ? -1.668  -10.172 17.213  1.00 0.00 ? 45 LYS A HE2  17 
ATOM 10779 H HE3  . LYS A 1 45 ? -2.145  -11.546 18.234  1.00 0.00 ? 45 LYS A HE3  17 
ATOM 10780 H HZ1  . LYS A 1 45 ? -3.626  -9.683  18.504  1.00 0.00 ? 45 LYS A HZ1  17 
ATOM 10781 H HZ2  . LYS A 1 45 ? -2.827  -9.980  19.915  1.00 0.00 ? 45 LYS A HZ2  17 
ATOM 10782 H HZ3  . LYS A 1 45 ? -2.384  -8.704  18.968  1.00 0.00 ? 45 LYS A HZ3  17 
ATOM 10783 N N    . ALA A 1 46 ? 3.872   -10.794 16.505  1.00 0.00 ? 46 ALA A N    17 
ATOM 10784 C CA   . ALA A 1 46 ? 4.136   -10.244 15.179  1.00 0.00 ? 46 ALA A CA   17 
ATOM 10785 C C    . ALA A 1 46 ? 4.984   -8.986  15.302  1.00 0.00 ? 46 ALA A C    17 
ATOM 10786 O O    . ALA A 1 46 ? 5.340   -8.579  16.406  1.00 0.00 ? 46 ALA A O    17 
ATOM 10787 C CB   . ALA A 1 46 ? 2.812   -9.938  14.483  1.00 0.00 ? 46 ALA A CB   17 
ATOM 10788 H H    . ALA A 1 46 ? 4.253   -10.311 17.306  1.00 0.00 ? 46 ALA A H    17 
ATOM 10789 H HA   . ALA A 1 46 ? 4.681   -10.983 14.593  1.00 0.00 ? 46 ALA A HA   17 
ATOM 10790 H HB1  . ALA A 1 46 ? 3.011   -9.541  13.487  1.00 0.00 ? 46 ALA A HB1  17 
ATOM 10791 H HB2  . ALA A 1 46 ? 2.225   -10.852 14.400  1.00 0.00 ? 46 ALA A HB2  17 
ATOM 10792 H HB3  . ALA A 1 46 ? 2.258   -9.201  15.065  1.00 0.00 ? 46 ALA A HB3  17 
ATOM 10793 N N    . GLY A 1 1  ? -29.094 -13.989 77.072  1.00 0.00 ? 1  GLY A N    18 
ATOM 10794 C CA   . GLY A 1 1  ? -30.101 -12.949 77.115  1.00 0.00 ? 1  GLY A CA   18 
ATOM 10795 C C    . GLY A 1 1  ? -29.874 -11.958 75.985  1.00 0.00 ? 1  GLY A C    18 
ATOM 10796 O O    . GLY A 1 1  ? -28.942 -12.102 75.197  1.00 0.00 ? 1  GLY A O    18 
ATOM 10797 H H1   . GLY A 1 1  ? -28.393 -13.952 76.346  1.00 0.00 ? 1  GLY A H1   18 
ATOM 10798 H HA2  . GLY A 1 1  ? -31.089 -13.397 77.010  1.00 0.00 ? 1  GLY A HA2  18 
ATOM 10799 H HA3  . GLY A 1 1  ? -30.042 -12.427 78.070  1.00 0.00 ? 1  GLY A HA3  18 
ATOM 10800 N N    . VAL A 1 2  ? -30.741 -10.951 75.920  1.00 0.00 ? 2  VAL A N    18 
ATOM 10801 C CA   . VAL A 1 2  ? -30.660 -9.916  74.894  1.00 0.00 ? 2  VAL A CA   18 
ATOM 10802 C C    . VAL A 1 2  ? -29.446 -9.031  75.125  1.00 0.00 ? 2  VAL A C    18 
ATOM 10803 O O    . VAL A 1 2  ? -28.716 -8.697  74.193  1.00 0.00 ? 2  VAL A O    18 
ATOM 10804 C CB   . VAL A 1 2  ? -31.910 -9.016  74.900  1.00 0.00 ? 2  VAL A CB   18 
ATOM 10805 C CG1  . VAL A 1 2  ? -31.723 -7.838  73.956  1.00 0.00 ? 2  VAL A CG1  18 
ATOM 10806 C CG2  . VAL A 1 2  ? -33.133 -9.801  74.453  1.00 0.00 ? 2  VAL A CG2  18 
ATOM 10807 H H    . VAL A 1 2  ? -31.486 -10.891 76.600  1.00 0.00 ? 2  VAL A H    18 
ATOM 10808 H HA   . VAL A 1 2  ? -30.574 -10.401 73.922  1.00 0.00 ? 2  VAL A HA   18 
ATOM 10809 H HB   . VAL A 1 2  ? -32.072 -8.643  75.912  1.00 0.00 ? 2  VAL A HB   18 
ATOM 10810 H HG11 . VAL A 1 2  ? -32.610 -7.204  73.975  1.00 0.00 ? 2  VAL A HG11 18 
ATOM 10811 H HG12 . VAL A 1 2  ? -30.857 -7.256  74.270  1.00 0.00 ? 2  VAL A HG12 18 
ATOM 10812 H HG13 . VAL A 1 2  ? -31.565 -8.207  72.943  1.00 0.00 ? 2  VAL A HG13 18 
ATOM 10813 H HG21 . VAL A 1 2  ? -34.013 -9.156  74.470  1.00 0.00 ? 2  VAL A HG21 18 
ATOM 10814 H HG22 . VAL A 1 2  ? -32.976 -10.171 73.440  1.00 0.00 ? 2  VAL A HG22 18 
ATOM 10815 H HG23 . VAL A 1 2  ? -33.290 -10.643 75.127  1.00 0.00 ? 2  VAL A HG23 18 
ATOM 10816 N N    . ILE A 1 3  ? -29.240 -8.655  76.384  1.00 0.00 ? 3  ILE A N    18 
ATOM 10817 C CA   . ILE A 1 3  ? -28.118 -7.806  76.771  1.00 0.00 ? 3  ILE A CA   18 
ATOM 10818 C C    . ILE A 1 3  ? -26.801 -8.536  76.563  1.00 0.00 ? 3  ILE A C    18 
ATOM 10819 O O    . ILE A 1 3  ? -25.813 -7.953  76.119  1.00 0.00 ? 3  ILE A O    18 
ATOM 10820 C CB   . ILE A 1 3  ? -28.204 -7.398  78.254  1.00 0.00 ? 3  ILE A CB   18 
ATOM 10821 C CG1  . ILE A 1 3  ? -29.407 -6.482  78.486  1.00 0.00 ? 3  ILE A CG1  18 
ATOM 10822 C CG2  . ILE A 1 3  ? -26.945 -6.657  78.676  1.00 0.00 ? 3  ILE A CG2  18 
ATOM 10823 C CD1  . ILE A 1 3  ? -29.711 -6.232  79.947  1.00 0.00 ? 3  ILE A CD1  18 
ATOM 10824 H H    . ILE A 1 3  ? -29.876 -8.963  77.106  1.00 0.00 ? 3  ILE A H    18 
ATOM 10825 H HA   . ILE A 1 3  ? -28.136 -6.908  76.152  1.00 0.00 ? 3  ILE A HA   18 
ATOM 10826 H HB   . ILE A 1 3  ? -28.314 -8.296  78.861  1.00 0.00 ? 3  ILE A HB   18 
ATOM 10827 H HG12 . ILE A 1 3  ? -29.207 -5.523  78.008  1.00 0.00 ? 3  ILE A HG12 18 
ATOM 10828 H HG13 . ILE A 1 3  ? -30.283 -6.941  78.027  1.00 0.00 ? 3  ILE A HG13 18 
ATOM 10829 H HG21 . ILE A 1 3  ? -27.013 -6.382  79.729  1.00 0.00 ? 3  ILE A HG21 18 
ATOM 10830 H HG22 . ILE A 1 3  ? -26.079 -7.300  78.526  1.00 0.00 ? 3  ILE A HG22 18 
ATOM 10831 H HG23 . ILE A 1 3  ? -26.837 -5.755  78.074  1.00 0.00 ? 3  ILE A HG23 18 
ATOM 10832 H HD11 . ILE A 1 3  ? -30.574 -5.574  80.051  1.00 0.00 ? 3  ILE A HD11 18 
ATOM 10833 H HD12 . ILE A 1 3  ? -29.925 -7.181  80.438  1.00 0.00 ? 3  ILE A HD12 18 
ATOM 10834 H HD13 . ILE A 1 3  ? -28.848 -5.764  80.420  1.00 0.00 ? 3  ILE A HD13 18 
ATOM 10835 N N    . ASP A 1 4  ? -26.801 -9.825  76.891  1.00 0.00 ? 4  ASP A N    18 
ATOM 10836 C CA   . ASP A 1 4  ? -25.615 -10.665 76.751  1.00 0.00 ? 4  ASP A CA   18 
ATOM 10837 C C    . ASP A 1 4  ? -25.045 -10.551 75.346  1.00 0.00 ? 4  ASP A C    18 
ATOM 10838 O O    . ASP A 1 4  ? -23.831 -10.493 75.155  1.00 0.00 ? 4  ASP A O    18 
ATOM 10839 C CB   . ASP A 1 4  ? -25.963 -12.131 77.014  1.00 0.00 ? 4  ASP A CB   18 
ATOM 10840 C CG   . ASP A 1 4  ? -26.250 -12.409 78.477  1.00 0.00 ? 4  ASP A CG   18 
ATOM 10841 O OD1  . ASP A 1 4  ? -26.401 -13.595 78.838  1.00 0.00 ? 4  ASP A OD1  18 
ATOM 10842 O OD2  . ASP A 1 4  ? -26.325 -11.440 79.262  1.00 0.00 ? 4  ASP A OD2  18 
ATOM 10843 H H    . ASP A 1 4  ? -27.645 -10.247 77.251  1.00 0.00 ? 4  ASP A H    18 
ATOM 10844 H HA   . ASP A 1 4  ? -24.867 -10.337 77.473  1.00 0.00 ? 4  ASP A HA   18 
ATOM 10845 H HB2  . ASP A 1 4  ? -26.845 -12.392 76.428  1.00 0.00 ? 4  ASP A HB2  18 
ATOM 10846 H HB3  . ASP A 1 4  ? -25.126 -12.752 76.698  1.00 0.00 ? 4  ASP A HB3  18 
ATOM 10847 H HD2  . ASP A 1 4  ? -26.509 -11.688 80.171  1.00 0.00 ? 4  ASP A HD2  18 
ATOM 10848 N N    . THR A 1 5  ? -25.941 -10.520 74.363  1.00 0.00 ? 5  THR A N    18 
ATOM 10849 C CA   . THR A 1 5  ? -25.555 -10.414 72.959  1.00 0.00 ? 5  THR A CA   18 
ATOM 10850 C C    . THR A 1 5  ? -25.584 -8.962  72.508  1.00 0.00 ? 5  THR A C    18 
ATOM 10851 O O    . THR A 1 5  ? -25.271 -8.646  71.362  1.00 0.00 ? 5  THR A O    18 
ATOM 10852 C CB   . THR A 1 5  ? -26.508 -11.212 72.050  1.00 0.00 ? 5  THR A CB   18 
ATOM 10853 O OG1  . THR A 1 5  ? -27.836 -10.685 72.165  1.00 0.00 ? 5  THR A OG1  18 
ATOM 10854 C CG2  . THR A 1 5  ? -26.524 -12.679 72.452  1.00 0.00 ? 5  THR A CG2  18 
ATOM 10855 H H    . THR A 1 5  ? -26.926 -10.570 74.585  1.00 0.00 ? 5  THR A H    18 
ATOM 10856 H HA   . THR A 1 5  ? -24.545 -10.807 72.849  1.00 0.00 ? 5  THR A HA   18 
ATOM 10857 H HB   . THR A 1 5  ? -26.172 -11.125 71.017  1.00 0.00 ? 5  THR A HB   18 
ATOM 10858 H HG1  . THR A 1 5  ? -28.416 -11.186 71.588  1.00 0.00 ? 5  THR A HG1  18 
ATOM 10859 H HG21 . THR A 1 5  ? -27.200 -13.232 71.800  1.00 0.00 ? 5  THR A HG21 18 
ATOM 10860 H HG22 . THR A 1 5  ? -25.519 -13.090 72.363  1.00 0.00 ? 5  THR A HG22 18 
ATOM 10861 H HG23 . THR A 1 5  ? -26.863 -12.768 73.484  1.00 0.00 ? 5  THR A HG23 18 
ATOM 10862 N N    . SER A 1 6  ? -25.966 -8.082  73.429  1.00 0.00 ? 6  SER A N    18 
ATOM 10863 C CA   . SER A 1 6  ? -26.047 -6.651  73.153  1.00 0.00 ? 6  SER A CA   18 
ATOM 10864 C C    . SER A 1 6  ? -24.772 -6.165  72.481  1.00 0.00 ? 6  SER A C    18 
ATOM 10865 O O    . SER A 1 6  ? -24.798 -5.650  71.364  1.00 0.00 ? 6  SER A O    18 
ATOM 10866 C CB   . SER A 1 6  ? -26.239 -5.865  74.451  1.00 0.00 ? 6  SER A CB   18 
ATOM 10867 O OG   . SER A 1 6  ? -26.310 -4.472  74.199  1.00 0.00 ? 6  SER A OG   18 
ATOM 10868 H H    . SER A 1 6  ? -26.210 -8.403  74.355  1.00 0.00 ? 6  SER A H    18 
ATOM 10869 H HA   . SER A 1 6  ? -26.896 -6.469  72.493  1.00 0.00 ? 6  SER A HA   18 
ATOM 10870 H HB2  . SER A 1 6  ? -27.165 -6.187  74.929  1.00 0.00 ? 6  SER A HB2  18 
ATOM 10871 H HB3  . SER A 1 6  ? -25.399 -6.063  75.115  1.00 0.00 ? 6  SER A HB3  18 
ATOM 10872 H HG   . SER A 1 6  ? -26.431 -4.010  75.032  1.00 0.00 ? 6  SER A HG   18 
ATOM 10873 N N    . ALA A 1 7  ? -23.654 -6.336  73.180  1.00 0.00 ? 7  ALA A N    18 
ATOM 10874 C CA   . ALA A 1 7  ? -22.348 -5.923  72.674  1.00 0.00 ? 7  ALA A CA   18 
ATOM 10875 C C    . ALA A 1 7  ? -22.025 -6.648  71.377  1.00 0.00 ? 7  ALA A C    18 
ATOM 10876 O O    . ALA A 1 7  ? -21.504 -6.059  70.431  1.00 0.00 ? 7  ALA A O    18 
ATOM 10877 C CB   . ALA A 1 7  ? -21.261 -6.243  73.688  1.00 0.00 ? 7  ALA A CB   18 
ATOM 10878 H H    . ALA A 1 7  ? -23.699 -6.764  74.094  1.00 0.00 ? 7  ALA A H    18 
ATOM 10879 H HA   . ALA A 1 7  ? -22.367 -4.848  72.492  1.00 0.00 ? 7  ALA A HA   18 
ATOM 10880 H HB1  . ALA A 1 7  ? -20.293 -5.917  73.307  1.00 0.00 ? 7  ALA A HB1  18 
ATOM 10881 H HB2  . ALA A 1 7  ? -21.475 -5.725  74.623  1.00 0.00 ? 7  ALA A HB2  18 
ATOM 10882 H HB3  . ALA A 1 7  ? -21.237 -7.318  73.866  1.00 0.00 ? 7  ALA A HB3  18 
ATOM 10883 N N    . VAL A 1 8  ? -22.344 -7.939  71.346  1.00 0.00 ? 8  VAL A N    18 
ATOM 10884 C CA   . VAL A 1 8  ? -22.100 -8.774  70.174  1.00 0.00 ? 8  VAL A CA   18 
ATOM 10885 C C    . VAL A 1 8  ? -22.909 -8.277  68.988  1.00 0.00 ? 8  VAL A C    18 
ATOM 10886 O O    . VAL A 1 8  ? -22.421 -8.229  67.860  1.00 0.00 ? 8  VAL A O    18 
ATOM 10887 C CB   . VAL A 1 8  ? -22.493 -10.240 70.434  1.00 0.00 ? 8  VAL A CB   18 
ATOM 10888 C CG1  . VAL A 1 8  ? -22.429 -11.045 69.145  1.00 0.00 ? 8  VAL A CG1  18 
ATOM 10889 C CG2  . VAL A 1 8  ? -21.549 -10.874 71.444  1.00 0.00 ? 8  VAL A CG2  18 
ATOM 10890 H H    . VAL A 1 8  ? -22.771 -8.366  72.156  1.00 0.00 ? 8  VAL A H    18 
ATOM 10891 H HA   . VAL A 1 8  ? -21.039 -8.726  69.933  1.00 0.00 ? 8  VAL A HA   18 
ATOM 10892 H HB   . VAL A 1 8  ? -23.510 -10.268 70.826  1.00 0.00 ? 8  VAL A HB   18 
ATOM 10893 H HG11 . VAL A 1 8  ? -22.718 -12.077 69.340  1.00 0.00 ? 8  VAL A HG11 18 
ATOM 10894 H HG12 . VAL A 1 8  ? -23.111 -10.611 68.413  1.00 0.00 ? 8  VAL A HG12 18 
ATOM 10895 H HG13 . VAL A 1 8  ? -21.412 -11.021 68.753  1.00 0.00 ? 8  VAL A HG13 18 
ATOM 10896 H HG21 . VAL A 1 8  ? -21.843 -11.907 71.626  1.00 0.00 ? 8  VAL A HG21 18 
ATOM 10897 H HG22 . VAL A 1 8  ? -20.532 -10.850 71.053  1.00 0.00 ? 8  VAL A HG22 18 
ATOM 10898 H HG23 . VAL A 1 8  ? -21.592 -10.316 72.380  1.00 0.00 ? 8  VAL A HG23 18 
ATOM 10899 N N    . GLU A 1 9  ? -24.158 -7.907  69.258  1.00 0.00 ? 9  GLU A N    18 
ATOM 10900 C CA   . GLU A 1 9  ? -25.064 -7.406  68.228  1.00 0.00 ? 9  GLU A CA   18 
ATOM 10901 C C    . GLU A 1 9  ? -24.461 -6.197  67.531  1.00 0.00 ? 9  GLU A C    18 
ATOM 10902 O O    . GLU A 1 9  ? -24.584 -6.036  66.318  1.00 0.00 ? 9  GLU A O    18 
ATOM 10903 C CB   . GLU A 1 9  ? -26.401 -6.991  68.846  1.00 0.00 ? 9  GLU A CB   18 
ATOM 10904 C CG   . GLU A 1 9  ? -27.433 -6.521  67.834  1.00 0.00 ? 9  GLU A CG   18 
ATOM 10905 C CD   . GLU A 1 9  ? -28.760 -6.167  68.477  1.00 0.00 ? 9  GLU A CD   18 
ATOM 10906 O OE1  . GLU A 1 9  ? -28.871 -6.288  69.715  1.00 0.00 ? 9  GLU A OE1  18 
ATOM 10907 O OE2  . GLU A 1 9  ? -29.688 -5.768  67.742  1.00 0.00 ? 9  GLU A OE2  18 
ATOM 10908 H H    . GLU A 1 9  ? -24.502 -7.970  70.206  1.00 0.00 ? 9  GLU A H    18 
ATOM 10909 H HA   . GLU A 1 9  ? -25.236 -8.196  67.498  1.00 0.00 ? 9  GLU A HA   18 
ATOM 10910 H HB2  . GLU A 1 9  ? -26.812 -7.847  69.381  1.00 0.00 ? 9  GLU A HB2  18 
ATOM 10911 H HB3  . GLU A 1 9  ? -26.217 -6.178  69.549  1.00 0.00 ? 9  GLU A HB3  18 
ATOM 10912 H HG2  . GLU A 1 9  ? -27.046 -5.640  67.322  1.00 0.00 ? 9  GLU A HG2  18 
ATOM 10913 H HG3  . GLU A 1 9  ? -27.598 -7.315  67.106  1.00 0.00 ? 9  GLU A HG3  18 
ATOM 10914 H HE2  . GLU A 1 9  ? -30.498 -5.561  68.215  1.00 0.00 ? 9  GLU A HE2  18 
ATOM 10915 N N    . SER A 1 10 ? -23.807 -5.348  68.317  1.00 0.00 ? 10 SER A N    18 
ATOM 10916 C CA   . SER A 1 10 ? -23.171 -4.140  67.801  1.00 0.00 ? 10 SER A CA   18 
ATOM 10917 C C    . SER A 1 10 ? -21.814 -4.466  67.200  1.00 0.00 ? 10 SER A C    18 
ATOM 10918 O O    . SER A 1 10 ? -21.491 -4.043  66.091  1.00 0.00 ? 10 SER A O    18 
ATOM 10919 C CB   . SER A 1 10 ? -22.969 -3.120  68.923  1.00 0.00 ? 10 SER A CB   18 
ATOM 10920 O OG   . SER A 1 10 ? -24.212 -2.688  69.449  1.00 0.00 ? 10 SER A OG   18 
ATOM 10921 H H    . SER A 1 10 ? -23.742 -5.535  69.307  1.00 0.00 ? 10 SER A H    18 
ATOM 10922 H HA   . SER A 1 10 ? -23.813 -3.708  67.033  1.00 0.00 ? 10 SER A HA   18 
ATOM 10923 H HB2  . SER A 1 10 ? -22.386 -3.578  69.721  1.00 0.00 ? 10 SER A HB2  18 
ATOM 10924 H HB3  . SER A 1 10 ? -22.432 -2.258  68.529  1.00 0.00 ? 10 SER A HB3  18 
ATOM 10925 H HG   . SER A 1 10 ? -24.050 -2.050  70.149  1.00 0.00 ? 10 SER A HG   18 
ATOM 10926 N N    . ALA A 1 11 ? -21.021 -5.226  67.951  1.00 0.00 ? 11 ALA A N    18 
ATOM 10927 C CA   . ALA A 1 11 ? -19.687 -5.628  67.516  1.00 0.00 ? 11 ALA A CA   18 
ATOM 10928 C C    . ALA A 1 11 ? -19.775 -6.562  66.320  1.00 0.00 ? 11 ALA A C    18 
ATOM 10929 O O    . ALA A 1 11 ? -18.973 -6.483  65.391  1.00 0.00 ? 11 ALA A O    18 
ATOM 10930 C CB   . ALA A 1 11 ? -18.959 -6.351  68.639  1.00 0.00 ? 11 ALA A CB   18 
ATOM 10931 H H    . ALA A 1 11 ? -21.343 -5.540  68.855  1.00 0.00 ? 11 ALA A H    18 
ATOM 10932 H HA   . ALA A 1 11 ? -19.126 -4.736  67.238  1.00 0.00 ? 11 ALA A HA   18 
ATOM 10933 H HB1  . ALA A 1 11 ? -17.960 -6.633  68.310  1.00 0.00 ? 11 ALA A HB1  18 
ATOM 10934 H HB2  . ALA A 1 11 ? -18.882 -5.691  69.504  1.00 0.00 ? 11 ALA A HB2  18 
ATOM 10935 H HB3  . ALA A 1 11 ? -19.516 -7.246  68.914  1.00 0.00 ? 11 ALA A HB3  18 
ATOM 10936 N N    . ILE A 1 12 ? -20.763 -7.451  66.356  1.00 0.00 ? 12 ILE A N    18 
ATOM 10937 C CA   . ILE A 1 12 ? -20.984 -8.417  65.285  1.00 0.00 ? 12 ILE A CA   18 
ATOM 10938 C C    . ILE A 1 12 ? -21.419 -7.710  64.012  1.00 0.00 ? 12 ILE A C    18 
ATOM 10939 O O    . ILE A 1 12 ? -20.919 -7.993  62.924  1.00 0.00 ? 12 ILE A O    18 
ATOM 10940 C CB   . ILE A 1 12 ? -22.078 -9.434  65.659  1.00 0.00 ? 12 ILE A CB   18 
ATOM 10941 C CG1  . ILE A 1 12 ? -21.610 -10.321 66.815  1.00 0.00 ? 12 ILE A CG1  18 
ATOM 10942 C CG2  . ILE A 1 12 ? -22.406 -10.325 64.471  1.00 0.00 ? 12 ILE A CG2  18 
ATOM 10943 C CD1  . ILE A 1 12 ? -20.371 -11.130 66.500  1.00 0.00 ? 12 ILE A CD1  18 
ATOM 10944 H H    . ILE A 1 12 ? -21.390 -7.466  67.148  1.00 0.00 ? 12 ILE A H    18 
ATOM 10945 H HA   . ILE A 1 12 ? -20.050 -8.948  65.103  1.00 0.00 ? 12 ILE A HA   18 
ATOM 10946 H HB   . ILE A 1 12 ? -22.975 -8.892  65.961  1.00 0.00 ? 12 ILE A HB   18 
ATOM 10947 H HG12 . ILE A 1 12 ? -21.396 -9.683  67.673  1.00 0.00 ? 12 ILE A HG12 18 
ATOM 10948 H HG13 . ILE A 1 12 ? -22.416 -11.010 67.067  1.00 0.00 ? 12 ILE A HG13 18 
ATOM 10949 H HG21 . ILE A 1 12 ? -23.189 -11.033 64.745  1.00 0.00 ? 12 ILE A HG21 18 
ATOM 10950 H HG22 . ILE A 1 12 ? -22.752 -9.708  63.641  1.00 0.00 ? 12 ILE A HG22 18 
ATOM 10951 H HG23 . ILE A 1 12 ? -21.513 -10.871 64.171  1.00 0.00 ? 12 ILE A HG23 18 
ATOM 10952 H HD11 . ILE A 1 12 ? -20.085 -11.739 67.357  1.00 0.00 ? 12 ILE A HD11 18 
ATOM 10953 H HD12 . ILE A 1 12 ? -20.574 -11.781 65.650  1.00 0.00 ? 12 ILE A HD12 18 
ATOM 10954 H HD13 . ILE A 1 12 ? -19.553 -10.453 66.253  1.00 0.00 ? 12 ILE A HD13 18 
ATOM 10955 N N    . THR A 1 13 ? -22.362 -6.784  64.163  1.00 0.00 ? 13 THR A N    18 
ATOM 10956 C CA   . THR A 1 13 ? -22.889 -6.016  63.038  1.00 0.00 ? 13 THR A CA   18 
ATOM 10957 C C    . THR A 1 13 ? -21.800 -5.145  62.432  1.00 0.00 ? 13 THR A C    18 
ATOM 10958 O O    . THR A 1 13 ? -21.678 -5.036  61.213  1.00 0.00 ? 13 THR A O    18 
ATOM 10959 C CB   . THR A 1 13 ? -24.044 -5.095  63.475  1.00 0.00 ? 13 THR A CB   18 
ATOM 10960 O OG1  . THR A 1 13 ? -25.125 -5.888  63.982  1.00 0.00 ? 13 THR A OG1  18 
ATOM 10961 C CG2  . THR A 1 13 ? -24.545 -4.275  62.296  1.00 0.00 ? 13 THR A CG2  18 
ATOM 10962 H H    . THR A 1 13 ? -22.734 -6.597  65.084  1.00 0.00 ? 13 THR A H    18 
ATOM 10963 H HA   . THR A 1 13 ? -23.255 -6.714  62.285  1.00 0.00 ? 13 THR A HA   18 
ATOM 10964 H HB   . THR A 1 13 ? -23.690 -4.422  64.256  1.00 0.00 ? 13 THR A HB   18 
ATOM 10965 H HG1  . THR A 1 13 ? -25.833 -5.300  64.257  1.00 0.00 ? 13 THR A HG1  18 
ATOM 10966 H HG21 . THR A 1 13 ? -25.360 -3.626  62.618  1.00 0.00 ? 13 THR A HG21 18 
ATOM 10967 H HG22 . THR A 1 13 ? -23.730 -3.664  61.907  1.00 0.00 ? 13 THR A HG22 18 
ATOM 10968 H HG23 . THR A 1 13 ? -24.903 -4.945  61.514  1.00 0.00 ? 13 THR A HG23 18 
ATOM 10969 N N    . ASP A 1 14 ? -21.008 -4.524  63.303  1.00 0.00 ? 14 ASP A N    18 
ATOM 10970 C CA   . ASP A 1 14 ? -19.917 -3.652  62.881  1.00 0.00 ? 14 ASP A CA   18 
ATOM 10971 C C    . ASP A 1 14 ? -18.814 -4.462  62.220  1.00 0.00 ? 14 ASP A C    18 
ATOM 10972 O O    . ASP A 1 14 ? -18.352 -4.134  61.128  1.00 0.00 ? 14 ASP A O    18 
ATOM 10973 C CB   . ASP A 1 14 ? -19.323 -2.917  64.084  1.00 0.00 ? 14 ASP A CB   18 
ATOM 10974 C CG   . ASP A 1 14 ? -20.252 -1.853  64.634  1.00 0.00 ? 14 ASP A CG   18 
ATOM 10975 O OD1  . ASP A 1 14 ? -19.823 -1.094  65.529  1.00 0.00 ? 14 ASP A OD1  18 
ATOM 10976 O OD2  . ASP A 1 14 ? -21.410 -1.778  64.171  1.00 0.00 ? 14 ASP A OD2  18 
ATOM 10977 H H    . ASP A 1 14 ? -21.159 -4.653  64.293  1.00 0.00 ? 14 ASP A H    18 
ATOM 10978 H HA   . ASP A 1 14 ? -20.307 -2.923  62.170  1.00 0.00 ? 14 ASP A HA   18 
ATOM 10979 H HB2  . ASP A 1 14 ? -19.117 -3.642  64.871  1.00 0.00 ? 14 ASP A HB2  18 
ATOM 10980 H HB3  . ASP A 1 14 ? -18.390 -2.443  63.779  1.00 0.00 ? 14 ASP A HB3  18 
ATOM 10981 H HD2  . ASP A 1 14 ? -21.943 -1.083  64.564  1.00 0.00 ? 14 ASP A HD2  18 
ATOM 10982 N N    . GLY A 1 15 ? -18.398 -5.527  62.898  1.00 0.00 ? 15 GLY A N    18 
ATOM 10983 C CA   . GLY A 1 15 ? -17.346 -6.407  62.398  1.00 0.00 ? 15 GLY A CA   18 
ATOM 10984 C C    . GLY A 1 15 ? -17.919 -7.423  61.423  1.00 0.00 ? 15 GLY A C    18 
ATOM 10985 O O    . GLY A 1 15 ? -17.634 -7.388  60.227  1.00 0.00 ? 15 GLY A O    18 
ATOM 10986 H H    . GLY A 1 15 ? -18.818 -5.744  63.791  1.00 0.00 ? 15 GLY A H    18 
ATOM 10987 H HA2  . GLY A 1 15 ? -16.589 -5.809  61.890  1.00 0.00 ? 15 GLY A HA2  18 
ATOM 10988 H HA3  . GLY A 1 15 ? -16.889 -6.932  63.236  1.00 0.00 ? 15 GLY A HA3  18 
ATOM 10989 N N    . GLN A 1 16 ? -18.734 -8.331  61.952  1.00 0.00 ? 16 GLN A N    18 
ATOM 10990 C CA   . GLN A 1 16 ? -19.367 -9.373  61.150  1.00 0.00 ? 16 GLN A CA   18 
ATOM 10991 C C    . GLN A 1 16 ? -20.011 -8.774  59.910  1.00 0.00 ? 16 GLN A C    18 
ATOM 10992 O O    . GLN A 1 16 ? -19.735 -9.189  58.786  1.00 0.00 ? 16 GLN A O    18 
ATOM 10993 C CB   . GLN A 1 16 ? -20.450 -10.088 61.960  1.00 0.00 ? 16 GLN A CB   18 
ATOM 10994 C CG   . GLN A 1 16 ? -21.135 -11.222 61.214  1.00 0.00 ? 16 GLN A CG   18 
ATOM 10995 C CD   . GLN A 1 16 ? -20.189 -12.360 60.886  1.00 0.00 ? 16 GLN A CD   18 
ATOM 10996 O OE1  . GLN A 1 16 ? -19.535 -12.911 61.772  1.00 0.00 ? 16 GLN A OE1  18 
ATOM 10997 N NE2  . GLN A 1 16 ? -20.112 -12.715 59.609  1.00 0.00 ? 16 GLN A NE2  18 
ATOM 10998 H H    . GLN A 1 16 ? -18.928 -8.308  62.943  1.00 0.00 ? 16 GLN A H    18 
ATOM 10999 H HA   . GLN A 1 16 ? -18.607 -10.093 60.850  1.00 0.00 ? 16 GLN A HA   18 
ATOM 11000 H HB2  . GLN A 1 16 ? -19.991 -10.498 62.859  1.00 0.00 ? 16 GLN A HB2  18 
ATOM 11001 H HB3  . GLN A 1 16 ? -21.208 -9.356  62.241  1.00 0.00 ? 16 GLN A HB3  18 
ATOM 11002 H HG2  . GLN A 1 16 ? -21.947 -11.608 61.831  1.00 0.00 ? 16 GLN A HG2  18 
ATOM 11003 H HG3  . GLN A 1 16 ? -21.548 -10.830 60.284  1.00 0.00 ? 16 GLN A HG3  18 
ATOM 11004 H HE21 . GLN A 1 16 ? -20.668 -12.232 58.918  1.00 0.00 ? 16 GLN A HE21 18 
ATOM 11005 H HE22 . GLN A 1 16 ? -19.498 -13.466 59.331  1.00 0.00 ? 16 GLN A HE22 18 
ATOM 11006 N N    . GLY A 1 17 ? -20.876 -7.788  60.132  1.00 0.00 ? 17 GLY A N    18 
ATOM 11007 C CA   . GLY A 1 17 ? -21.578 -7.109  59.047  1.00 0.00 ? 17 GLY A CA   18 
ATOM 11008 C C    . GLY A 1 17 ? -20.595 -6.643  57.985  1.00 0.00 ? 17 GLY A C    18 
ATOM 11009 O O    . GLY A 1 17 ? -20.805 -6.849  56.791  1.00 0.00 ? 17 GLY A O    18 
ATOM 11010 H H    . GLY A 1 17 ? -21.061 -7.491  61.080  1.00 0.00 ? 17 GLY A H    18 
ATOM 11011 H HA2  . GLY A 1 17 ? -22.295 -7.796  58.597  1.00 0.00 ? 17 GLY A HA2  18 
ATOM 11012 H HA3  . GLY A 1 17 ? -22.110 -6.246  59.448  1.00 0.00 ? 17 GLY A HA3  18 
ATOM 11013 N N    . ASP A 1 18 ? -19.516 -6.011  58.438  1.00 0.00 ? 18 ASP A N    18 
ATOM 11014 C CA   . ASP A 1 18 ? -18.478 -5.503  57.546  1.00 0.00 ? 18 ASP A CA   18 
ATOM 11015 C C    . ASP A 1 18 ? -17.939 -6.619  56.667  1.00 0.00 ? 18 ASP A C    18 
ATOM 11016 O O    . ASP A 1 18 ? -17.256 -6.374  55.674  1.00 0.00 ? 18 ASP A O    18 
ATOM 11017 C CB   . ASP A 1 18 ? -17.317 -4.919  58.353  1.00 0.00 ? 18 ASP A CB   18 
ATOM 11018 C CG   . ASP A 1 18 ? -17.683 -3.622  59.047  1.00 0.00 ? 18 ASP A CG   18 
ATOM 11019 O OD1  . ASP A 1 18 ? -16.827 -2.715  59.102  1.00 0.00 ? 18 ASP A OD1  18 
ATOM 11020 O OD2  . ASP A 1 18 ? -18.827 -3.513  59.536  1.00 0.00 ? 18 ASP A OD2  18 
ATOM 11021 H H    . ASP A 1 18 ? -19.401 -5.871  59.432  1.00 0.00 ? 18 ASP A H    18 
ATOM 11022 H HA   . ASP A 1 18 ? -18.908 -4.723  56.917  1.00 0.00 ? 18 ASP A HA   18 
ATOM 11023 H HB2  . ASP A 1 18 ? -17.014 -5.645  59.107  1.00 0.00 ? 18 ASP A HB2  18 
ATOM 11024 H HB3  . ASP A 1 18 ? -16.482 -4.731  57.679  1.00 0.00 ? 18 ASP A HB3  18 
ATOM 11025 H HD2  . ASP A 1 18 ? -18.991 -2.667  59.960  1.00 0.00 ? 18 ASP A HD2  18 
ATOM 11026 N N    . MET A 1 19 ? -18.255 -7.854  57.046  1.00 0.00 ? 19 MET A N    18 
ATOM 11027 C CA   . MET A 1 19 ? -17.814 -9.034  56.309  1.00 0.00 ? 19 MET A CA   18 
ATOM 11028 C C    . MET A 1 19 ? -18.429 -9.054  54.919  1.00 0.00 ? 19 MET A C    18 
ATOM 11029 O O    . MET A 1 19 ? -17.761 -9.362  53.933  1.00 0.00 ? 19 MET A O    18 
ATOM 11030 C CB   . MET A 1 19 ? -18.232 -10.311 57.041  1.00 0.00 ? 19 MET A CB   18 
ATOM 11031 C CG   . MET A 1 19 ? -17.741 -11.591 56.387  1.00 0.00 ? 19 MET A CG   18 
ATOM 11032 S SD   . MET A 1 19 ? -18.243 -13.070 57.288  1.00 0.00 ? 19 MET A SD   18 
ATOM 11033 C CE   . MET A 1 19 ? -17.242 -12.922 58.766  1.00 0.00 ? 19 MET A CE   18 
ATOM 11034 H H    . MET A 1 19 ? -18.819 -7.991  57.873  1.00 0.00 ? 19 MET A H    18 
ATOM 11035 H HA   . MET A 1 19 ? -16.728 -9.007  56.223  1.00 0.00 ? 19 MET A HA   18 
ATOM 11036 H HB2  . MET A 1 19 ? -17.835 -10.270 58.055  1.00 0.00 ? 19 MET A HB2  18 
ATOM 11037 H HB3  . MET A 1 19 ? -19.321 -10.342 57.079  1.00 0.00 ? 19 MET A HB3  18 
ATOM 11038 H HG2  . MET A 1 19 ? -18.140 -11.644 55.374  1.00 0.00 ? 19 MET A HG2  18 
ATOM 11039 H HG3  . MET A 1 19 ? -16.653 -11.565 56.333  1.00 0.00 ? 19 MET A HG3  18 
ATOM 11040 H HE1  . MET A 1 19 ? -17.435 -13.763 59.432  1.00 0.00 ? 19 MET A HE1  18 
ATOM 11041 H HE2  . MET A 1 19 ? -16.188 -12.915 58.490  1.00 0.00 ? 19 MET A HE2  18 
ATOM 11042 H HE3  . MET A 1 19 ? -17.490 -11.992 59.279  1.00 0.00 ? 19 MET A HE3  18 
ATOM 11043 N N    . LYS A 1 20 ? -19.714 -8.719  54.854  1.00 0.00 ? 20 LYS A N    18 
ATOM 11044 C CA   . LYS A 1 20 ? -20.450 -8.690  53.593  1.00 0.00 ? 20 LYS A CA   18 
ATOM 11045 C C    . LYS A 1 20 ? -19.782 -7.741  52.610  1.00 0.00 ? 20 LYS A C    18 
ATOM 11046 O O    . LYS A 1 20 ? -19.660 -8.038  51.423  1.00 0.00 ? 20 LYS A O    18 
ATOM 11047 C CB   . LYS A 1 20 ? -21.887 -8.217  53.822  1.00 0.00 ? 20 LYS A CB   18 
ATOM 11048 C CG   . LYS A 1 20 ? -22.747 -8.216  52.569  1.00 0.00 ? 20 LYS A CG   18 
ATOM 11049 C CD   . LYS A 1 20 ? -24.173 -7.791  52.878  1.00 0.00 ? 20 LYS A CD   18 
ATOM 11050 C CE   . LYS A 1 20 ? -25.030 -7.775  51.623  1.00 0.00 ? 20 LYS A CE   18 
ATOM 11051 N NZ   . LYS A 1 20 ? -26.433 -7.372  51.913  1.00 0.00 ? 20 LYS A NZ   18 
ATOM 11052 H H    . LYS A 1 20 ? -20.208 -8.474  55.700  1.00 0.00 ? 20 LYS A H    18 
ATOM 11053 H HA   . LYS A 1 20 ? -20.465 -9.695  53.173  1.00 0.00 ? 20 LYS A HA   18 
ATOM 11054 H HB2  . LYS A 1 20 ? -22.352 -8.876  54.556  1.00 0.00 ? 20 LYS A HB2  18 
ATOM 11055 H HB3  . LYS A 1 20 ? -21.855 -7.201  54.216  1.00 0.00 ? 20 LYS A HB3  18 
ATOM 11056 H HG2  . LYS A 1 20 ? -22.319 -7.522  51.845  1.00 0.00 ? 20 LYS A HG2  18 
ATOM 11057 H HG3  . LYS A 1 20 ? -22.760 -9.220  52.146  1.00 0.00 ? 20 LYS A HG3  18 
ATOM 11058 H HD2  . LYS A 1 20 ? -24.605 -8.490  53.594  1.00 0.00 ? 20 LYS A HD2  18 
ATOM 11059 H HD3  . LYS A 1 20 ? -24.160 -6.790  53.311  1.00 0.00 ? 20 LYS A HD3  18 
ATOM 11060 H HE2  . LYS A 1 20 ? -24.601 -7.071  50.910  1.00 0.00 ? 20 LYS A HE2  18 
ATOM 11061 H HE3  . LYS A 1 20 ? -25.033 -8.772  51.184  1.00 0.00 ? 20 LYS A HE3  18 
ATOM 11062 H HZ1  . LYS A 1 20 ? -26.972 -7.372  51.059  1.00 0.00 ? 20 LYS A HZ1  18 
ATOM 11063 H HZ2  . LYS A 1 20 ? -26.842 -8.024  52.567  1.00 0.00 ? 20 LYS A HZ2  18 
ATOM 11064 H HZ3  . LYS A 1 20 ? -26.441 -6.444  52.313  1.00 0.00 ? 20 LYS A HZ3  18 
ATOM 11065 N N    . ALA A 1 21 ? -19.351 -6.592  53.123  1.00 0.00 ? 21 ALA A N    18 
ATOM 11066 C CA   . ALA A 1 21 ? -18.689 -5.575  52.311  1.00 0.00 ? 21 ALA A CA   18 
ATOM 11067 C C    . ALA A 1 21 ? -17.325 -6.064  51.853  1.00 0.00 ? 21 ALA A C    18 
ATOM 11068 O O    . ALA A 1 21 ? -16.928 -5.860  50.707  1.00 0.00 ? 21 ALA A O    18 
ATOM 11069 C CB   . ALA A 1 21 ? -18.498 -4.297  53.114  1.00 0.00 ? 21 ALA A CB   18 
ATOM 11070 H H    . ALA A 1 21 ? -19.482 -6.405  54.107  1.00 0.00 ? 21 ALA A H    18 
ATOM 11071 H HA   . ALA A 1 21 ? -19.309 -5.364  51.440  1.00 0.00 ? 21 ALA A HA   18 
ATOM 11072 H HB1  . ALA A 1 21 ? -18.017 -3.539  52.495  1.00 0.00 ? 21 ALA A HB1  18 
ATOM 11073 H HB2  . ALA A 1 21 ? -19.470 -3.928  53.445  1.00 0.00 ? 21 ALA A HB2  18 
ATOM 11074 H HB3  . ALA A 1 21 ? -17.873 -4.504  53.982  1.00 0.00 ? 21 ALA A HB3  18 
ATOM 11075 N N    . ILE A 1 22 ? -16.611 -6.715  52.768  1.00 0.00 ? 22 ILE A N    18 
ATOM 11076 C CA   . ILE A 1 22 ? -15.281 -7.246  52.485  1.00 0.00 ? 22 ILE A CA   18 
ATOM 11077 C C    . ILE A 1 22 ? -15.357 -8.331  51.423  1.00 0.00 ? 22 ILE A C    18 
ATOM 11078 O O    . ILE A 1 22 ? -14.609 -8.319  50.447  1.00 0.00 ? 22 ILE A O    18 
ATOM 11079 C CB   . ILE A 1 22 ? -14.638 -7.859  53.743  1.00 0.00 ? 22 ILE A CB   18 
ATOM 11080 C CG1  . ILE A 1 22 ? -14.334 -6.768  54.772  1.00 0.00 ? 22 ILE A CG1  18 
ATOM 11081 C CG2  . ILE A 1 22 ? -13.337 -8.562  53.388  1.00 0.00 ? 22 ILE A CG2  18 
ATOM 11082 C CD1  . ILE A 1 22 ? -13.932 -7.303  56.129  1.00 0.00 ? 22 ILE A CD1  18 
ATOM 11083 H H    . ILE A 1 22 ? -16.993 -6.853  53.693  1.00 0.00 ? 22 ILE A H    18 
ATOM 11084 H HA   . ILE A 1 22 ? -14.655 -6.430  52.125  1.00 0.00 ? 22 ILE A HA   18 
ATOM 11085 H HB   . ILE A 1 22 ? -15.331 -8.580  54.177  1.00 0.00 ? 22 ILE A HB   18 
ATOM 11086 H HG12 . ILE A 1 22 ? -13.520 -6.152  54.391  1.00 0.00 ? 22 ILE A HG12 18 
ATOM 11087 H HG13 . ILE A 1 22 ? -15.226 -6.153  54.896  1.00 0.00 ? 22 ILE A HG13 18 
ATOM 11088 H HG21 . ILE A 1 22 ? -12.897 -8.999  54.284  1.00 0.00 ? 22 ILE A HG21 18 
ATOM 11089 H HG22 . ILE A 1 22 ? -13.538 -9.349  52.662  1.00 0.00 ? 22 ILE A HG22 18 
ATOM 11090 H HG23 . ILE A 1 22 ? -12.642 -7.841  52.959  1.00 0.00 ? 22 ILE A HG23 18 
ATOM 11091 H HD11 . ILE A 1 22 ? -13.728 -6.483  56.818  1.00 0.00 ? 22 ILE A HD11 18 
ATOM 11092 H HD12 . ILE A 1 22 ? -14.742 -7.912  56.530  1.00 0.00 ? 22 ILE A HD12 18 
ATOM 11093 H HD13 . ILE A 1 22 ? -13.036 -7.913  56.024  1.00 0.00 ? 22 ILE A HD13 18 
ATOM 11094 N N    . GLY A 1 23 ? -16.273 -9.272  51.627  1.00 0.00 ? 23 GLY A N    18 
ATOM 11095 C CA   . GLY A 1 23 ? -16.472 -10.383 50.699  1.00 0.00 ? 23 GLY A CA   18 
ATOM 11096 C C    . GLY A 1 23 ? -17.004 -9.875  49.368  1.00 0.00 ? 23 GLY A C    18 
ATOM 11097 O O    . GLY A 1 23 ? -16.550 -10.289 48.302  1.00 0.00 ? 23 GLY A O    18 
ATOM 11098 H H    . GLY A 1 23 ? -16.858 -9.227  52.450  1.00 0.00 ? 23 GLY A H    18 
ATOM 11099 H HA2  . GLY A 1 23 ? -15.521 -10.890 50.536  1.00 0.00 ? 23 GLY A HA2  18 
ATOM 11100 H HA3  . GLY A 1 23 ? -17.187 -11.085 51.127  1.00 0.00 ? 23 GLY A HA3  18 
ATOM 11101 N N    . GLY A 1 24 ? -17.975 -8.970  49.445  1.00 0.00 ? 24 GLY A N    18 
ATOM 11102 C CA   . GLY A 1 24 ? -18.592 -8.386  48.258  1.00 0.00 ? 24 GLY A CA   18 
ATOM 11103 C C    . GLY A 1 24 ? -17.596 -7.506  47.519  1.00 0.00 ? 24 GLY A C    18 
ATOM 11104 O O    . GLY A 1 24 ? -17.356 -7.681  46.326  1.00 0.00 ? 24 GLY A O    18 
ATOM 11105 H H    . GLY A 1 24 ? -18.305 -8.669  50.351  1.00 0.00 ? 24 GLY A H    18 
ATOM 11106 H HA2  . GLY A 1 24 ? -18.926 -9.185  47.596  1.00 0.00 ? 24 GLY A HA2  18 
ATOM 11107 H HA3  . GLY A 1 24 ? -19.450 -7.784  48.558  1.00 0.00 ? 24 GLY A HA3  18 
ATOM 11108 N N    . TYR A 1 25 ? -17.020 -6.554  48.247  1.00 0.00 ? 25 TYR A N    18 
ATOM 11109 C CA   . TYR A 1 25 ? -16.042 -5.627  47.685  1.00 0.00 ? 25 TYR A CA   18 
ATOM 11110 C C    . TYR A 1 25 ? -14.887 -6.389  47.056  1.00 0.00 ? 25 TYR A C    18 
ATOM 11111 O O    . TYR A 1 25 ? -14.382 -6.018  45.997  1.00 0.00 ? 25 TYR A O    18 
ATOM 11112 C CB   . TYR A 1 25 ? -15.481 -4.713  48.776  1.00 0.00 ? 25 TYR A CB   18 
ATOM 11113 C CG   . TYR A 1 25 ? -14.447 -3.728  48.279  1.00 0.00 ? 25 TYR A CG   18 
ATOM 11114 C CD1  . TYR A 1 25 ? -14.828 -2.581  47.595  1.00 0.00 ? 25 TYR A CD1  18 
ATOM 11115 C CD2  . TYR A 1 25 ? -13.093 -3.949  48.496  1.00 0.00 ? 25 TYR A CD2  18 
ATOM 11116 C CE1  . TYR A 1 25 ? -13.890 -1.676  47.137  1.00 0.00 ? 25 TYR A CE1  18 
ATOM 11117 C CE2  . TYR A 1 25 ? -12.141 -3.055  48.045  1.00 0.00 ? 25 TYR A CE2  18 
ATOM 11118 C CZ   . TYR A 1 25 ? -12.551 -1.911  47.361  1.00 0.00 ? 25 TYR A CZ   18 
ATOM 11119 O OH   . TYR A 1 25 ? -11.615 -1.011  46.906  1.00 0.00 ? 25 TYR A OH   18 
ATOM 11120 H H    . TYR A 1 25 ? -17.261 -6.459  49.223  1.00 0.00 ? 25 TYR A H    18 
ATOM 11121 H HA   . TYR A 1 25 ? -16.533 -5.020  46.924  1.00 0.00 ? 25 TYR A HA   18 
ATOM 11122 H HB2  . TYR A 1 25 ? -16.307 -4.154  49.219  1.00 0.00 ? 25 TYR A HB2  18 
ATOM 11123 H HB3  . TYR A 1 25 ? -15.025 -5.333  49.548  1.00 0.00 ? 25 TYR A HB3  18 
ATOM 11124 H HD1  . TYR A 1 25 ? -15.877 -2.392  47.418  1.00 0.00 ? 25 TYR A HD1  18 
ATOM 11125 H HD2  . TYR A 1 25 ? -12.779 -4.835  49.027  1.00 0.00 ? 25 TYR A HD2  18 
ATOM 11126 H HE1  . TYR A 1 25 ? -14.205 -0.789  46.606  1.00 0.00 ? 25 TYR A HE1  18 
ATOM 11127 H HE2  . TYR A 1 25 ? -11.092 -3.240  48.220  1.00 0.00 ? 25 TYR A HE2  18 
ATOM 11128 H HH   . TYR A 1 25 ? -10.714 -1.268  47.114  1.00 0.00 ? 25 TYR A HH   18 
ATOM 11129 N N    . ILE A 1 26 ? -14.474 -7.462  47.724  1.00 0.00 ? 26 ILE A N    18 
ATOM 11130 C CA   . ILE A 1 26 ? -13.375 -8.300  47.252  1.00 0.00 ? 26 ILE A CA   18 
ATOM 11131 C C    . ILE A 1 26 ? -13.827 -9.159  46.082  1.00 0.00 ? 26 ILE A C    18 
ATOM 11132 O O    . ILE A 1 26 ? -13.130 -9.280  45.076  1.00 0.00 ? 26 ILE A O    18 
ATOM 11133 C CB   . ILE A 1 26 ? -12.865 -9.239  48.361  1.00 0.00 ? 26 ILE A CB   18 
ATOM 11134 C CG1  . ILE A 1 26 ? -12.209 -8.433  49.483  1.00 0.00 ? 26 ILE A CG1  18 
ATOM 11135 C CG2  . ILE A 1 26 ? -11.838 -10.213 47.803  1.00 0.00 ? 26 ILE A CG2  18 
ATOM 11136 C CD1  . ILE A 1 26 ? -11.902 -9.247  50.721  1.00 0.00 ? 26 ILE A CD1  18 
ATOM 11137 H H    . ILE A 1 26 ? -14.930 -7.716  48.589  1.00 0.00 ? 26 ILE A H    18 
ATOM 11138 H HA   . ILE A 1 26 ? -12.561 -7.651  46.931  1.00 0.00 ? 26 ILE A HA   18 
ATOM 11139 H HB   . ILE A 1 26 ? -13.709 -9.798  48.765  1.00 0.00 ? 26 ILE A HB   18 
ATOM 11140 H HG12 . ILE A 1 26 ? -11.276 -8.015  49.106  1.00 0.00 ? 26 ILE A HG12 18 
ATOM 11141 H HG13 . ILE A 1 26 ? -12.883 -7.622  49.763  1.00 0.00 ? 26 ILE A HG13 18 
ATOM 11142 H HG21 . ILE A 1 26 ? -11.493 -10.878 48.594  1.00 0.00 ? 26 ILE A HG21 18 
ATOM 11143 H HG22 . ILE A 1 26 ? -12.294 -10.803 47.008  1.00 0.00 ? 26 ILE A HG22 18 
ATOM 11144 H HG23 . ILE A 1 26 ? -10.991 -9.656  47.403  1.00 0.00 ? 26 ILE A HG23 18 
ATOM 11145 H HD11 . ILE A 1 26 ? -11.437 -8.622  51.484  1.00 0.00 ? 26 ILE A HD11 18 
ATOM 11146 H HD12 . ILE A 1 26 ? -12.829 -9.662  51.117  1.00 0.00 ? 26 ILE A HD12 18 
ATOM 11147 H HD13 . ILE A 1 26 ? -11.223 -10.057 50.459  1.00 0.00 ? 26 ILE A HD13 18 
ATOM 11148 N N    . VAL A 1 27 ? -15.006 -9.755  46.228  1.00 0.00 ? 27 VAL A N    18 
ATOM 11149 C CA   . VAL A 1 27 ? -15.580 -10.614 45.195  1.00 0.00 ? 27 VAL A CA   18 
ATOM 11150 C C    . VAL A 1 27 ? -16.115 -9.776  44.044  1.00 0.00 ? 27 VAL A C    18 
ATOM 11151 O O    . VAL A 1 27 ? -16.119 -10.208 42.892  1.00 0.00 ? 27 VAL A O    18 
ATOM 11152 C CB   . VAL A 1 27 ? -16.743 -11.460 45.746  1.00 0.00 ? 27 VAL A CB   18 
ATOM 11153 C CG1  . VAL A 1 27 ? -17.967 -10.590 45.987  1.00 0.00 ? 27 VAL A CG1  18 
ATOM 11154 C CG2  . VAL A 1 27 ? -17.119 -12.555 44.761  1.00 0.00 ? 27 VAL A CG2  18 
ATOM 11155 H H    . VAL A 1 27 ? -15.532 -9.616  47.079  1.00 0.00 ? 27 VAL A H    18 
ATOM 11156 H HA   . VAL A 1 27 ? -14.799 -11.278 44.826  1.00 0.00 ? 27 VAL A HA   18 
ATOM 11157 H HB   . VAL A 1 27 ? -16.434 -11.914 46.688  1.00 0.00 ? 27 VAL A HB   18 
ATOM 11158 H HG11 . VAL A 1 27 ? -18.780 -11.197 46.385  1.00 0.00 ? 27 VAL A HG11 18 
ATOM 11159 H HG12 . VAL A 1 27 ? -17.719 -9.805  46.702  1.00 0.00 ? 27 VAL A HG12 18 
ATOM 11160 H HG13 . VAL A 1 27 ? -18.282 -10.137 45.046  1.00 0.00 ? 27 VAL A HG13 18 
ATOM 11161 H HG21 . VAL A 1 27 ? -17.937 -13.151 45.166  1.00 0.00 ? 27 VAL A HG21 18 
ATOM 11162 H HG22 . VAL A 1 27 ? -17.433 -12.103 43.820  1.00 0.00 ? 27 VAL A HG22 18 
ATOM 11163 H HG23 . VAL A 1 27 ? -16.256 -13.196 44.586  1.00 0.00 ? 27 VAL A HG23 18 
ATOM 11164 N N    . GLY A 1 28 ? -16.567 -8.570  44.372  1.00 0.00 ? 28 GLY A N    18 
ATOM 11165 C CA   . GLY A 1 28 ? -17.113 -7.646  43.383  1.00 0.00 ? 28 GLY A CA   18 
ATOM 11166 C C    . GLY A 1 28 ? -15.996 -7.032  42.555  1.00 0.00 ? 28 GLY A C    18 
ATOM 11167 O O    . GLY A 1 28 ? -16.209 -6.586  41.429  1.00 0.00 ? 28 GLY A O    18 
ATOM 11168 H H    . GLY A 1 28 ? -16.537 -8.272  45.337  1.00 0.00 ? 28 GLY A H    18 
ATOM 11169 H HA2  . GLY A 1 28 ? -17.794 -8.185  42.725  1.00 0.00 ? 28 GLY A HA2  18 
ATOM 11170 H HA3  . GLY A 1 28 ? -17.659 -6.853  43.895  1.00 0.00 ? 28 GLY A HA3  18 
ATOM 11171 N N    . ALA A 1 29 ? -14.797 -7.014  43.131  1.00 0.00 ? 29 ALA A N    18 
ATOM 11172 C CA   . ALA A 1 29 ? -13.621 -6.459  42.469  1.00 0.00 ? 29 ALA A CA   18 
ATOM 11173 C C    . ALA A 1 29 ? -12.978 -7.498  41.564  1.00 0.00 ? 29 ALA A C    18 
ATOM 11174 O O    . ALA A 1 29 ? -12.420 -7.174  40.517  1.00 0.00 ? 29 ALA A O    18 
ATOM 11175 C CB   . ALA A 1 29 ? -12.593 -6.015  43.498  1.00 0.00 ? 29 ALA A CB   18 
ATOM 11176 H H    . ALA A 1 29 ? -14.686 -7.394  44.060  1.00 0.00 ? 29 ALA A H    18 
ATOM 11177 H HA   . ALA A 1 29 ? -13.929 -5.600  41.872  1.00 0.00 ? 29 ALA A HA   18 
ATOM 11178 H HB1  . ALA A 1 29 ? -11.726 -5.588  42.994  1.00 0.00 ? 29 ALA A HB1  18 
ATOM 11179 H HB2  . ALA A 1 29 ? -13.037 -5.263  44.152  1.00 0.00 ? 29 ALA A HB2  18 
ATOM 11180 H HB3  . ALA A 1 29 ? -12.280 -6.874  44.091  1.00 0.00 ? 29 ALA A HB3  18 
ATOM 11181 N N    . LEU A 1 30 ? -13.064 -8.757  41.985  1.00 0.00 ? 30 LEU A N    18 
ATOM 11182 C CA   . LEU A 1 30 ? -12.498 -9.872  41.230  1.00 0.00 ? 30 LEU A CA   18 
ATOM 11183 C C    . LEU A 1 30 ? -13.045 -9.886  39.812  1.00 0.00 ? 30 LEU A C    18 
ATOM 11184 O O    . LEU A 1 30 ? -12.371 -10.310 38.875  1.00 0.00 ? 30 LEU A O    18 
ATOM 11185 C CB   . LEU A 1 30 ? -12.849 -11.204 41.897  1.00 0.00 ? 30 LEU A CB   18 
ATOM 11186 C CG   . LEU A 1 30 ? -12.158 -11.497 43.230  1.00 0.00 ? 30 LEU A CG   18 
ATOM 11187 C CD1  . LEU A 1 30 ? -12.690 -12.784 43.840  1.00 0.00 ? 30 LEU A CD1  18 
ATOM 11188 C CD2  . LEU A 1 30 ? -10.657 -11.648 43.036  1.00 0.00 ? 30 LEU A CD2  18 
ATOM 11189 H H    . LEU A 1 30 ? -13.535 -8.960  42.855  1.00 0.00 ? 30 LEU A H    18 
ATOM 11190 H HA   . LEU A 1 30 ? -11.415 -9.759  41.199  1.00 0.00 ? 30 LEU A HA   18 
ATOM 11191 H HB2  . LEU A 1 30 ? -13.925 -11.214 42.071  1.00 0.00 ? 30 LEU A HB2  18 
ATOM 11192 H HB3  . LEU A 1 30 ? -12.586 -12.002 41.203  1.00 0.00 ? 30 LEU A HB3  18 
ATOM 11193 H HG   . LEU A 1 30 ? -12.351 -10.669 43.913  1.00 0.00 ? 30 LEU A HG   18 
ATOM 11194 H HD11 . LEU A 1 30 ? -12.198 -12.975 44.794  1.00 0.00 ? 30 LEU A HD11 18 
ATOM 11195 H HD12 . LEU A 1 30 ? -13.764 -12.690 44.002  1.00 0.00 ? 30 LEU A HD12 18 
ATOM 11196 H HD13 . LEU A 1 30 ? -12.496 -13.614 43.161  1.00 0.00 ? 30 LEU A HD13 18 
ATOM 11197 H HD21 . LEU A 1 30 ? -10.176 -11.844 43.994  1.00 0.00 ? 30 LEU A HD21 18 
ATOM 11198 H HD22 . LEU A 1 30 ? -10.462 -12.478 42.357  1.00 0.00 ? 30 LEU A HD22 18 
ATOM 11199 H HD23 . LEU A 1 30 ? -10.253 -10.728 42.612  1.00 0.00 ? 30 LEU A HD23 18 
ATOM 11200 N N    . VAL A 1 31 ? -14.280 -9.416  39.667  1.00 0.00 ? 31 VAL A N    18 
ATOM 11201 C CA   . VAL A 1 31 ? -14.948 -9.362  38.369  1.00 0.00 ? 31 VAL A CA   18 
ATOM 11202 C C    . VAL A 1 31 ? -14.101 -8.595  37.367  1.00 0.00 ? 31 VAL A C    18 
ATOM 11203 O O    . VAL A 1 31 ? -14.071 -8.919  36.181  1.00 0.00 ? 31 VAL A O    18 
ATOM 11204 C CB   . VAL A 1 31 ? -16.316 -8.662  38.467  1.00 0.00 ? 31 VAL A CB   18 
ATOM 11205 C CG1  . VAL A 1 31 ? -16.888 -8.413  37.080  1.00 0.00 ? 31 VAL A CG1  18 
ATOM 11206 C CG2  . VAL A 1 31 ? -17.300 -9.522  39.245  1.00 0.00 ? 31 VAL A CG2  18 
ATOM 11207 H H    . VAL A 1 31 ? -14.784 -9.082  40.476  1.00 0.00 ? 31 VAL A H    18 
ATOM 11208 H HA   . VAL A 1 31 ? -15.094 -10.382 38.014  1.00 0.00 ? 31 VAL A HA   18 
ATOM 11209 H HB   . VAL A 1 31 ? -16.188 -7.708  38.980  1.00 0.00 ? 31 VAL A HB   18 
ATOM 11210 H HG11 . VAL A 1 31 ? -17.852 -7.909  37.162  1.00 0.00 ? 31 VAL A HG11 18 
ATOM 11211 H HG12 . VAL A 1 31 ? -16.201 -7.786  36.512  1.00 0.00 ? 31 VAL A HG12 18 
ATOM 11212 H HG13 . VAL A 1 31 ? -17.021 -9.365  36.567  1.00 0.00 ? 31 VAL A HG13 18 
ATOM 11213 H HG21 . VAL A 1 31 ? -18.262 -9.012  39.316  1.00 0.00 ? 31 VAL A HG21 18 
ATOM 11214 H HG22 . VAL A 1 31 ? -17.433 -10.474 38.732  1.00 0.00 ? 31 VAL A HG22 18 
ATOM 11215 H HG23 . VAL A 1 31 ? -16.912 -9.700  40.248  1.00 0.00 ? 31 VAL A HG23 18 
ATOM 11216 N N    . ILE A 1 32 ? -13.413 -7.571  37.861  1.00 0.00 ? 32 ILE A N    18 
ATOM 11217 C CA   . ILE A 1 32 ? -12.552 -6.734  37.028  1.00 0.00 ? 32 ILE A CA   18 
ATOM 11218 C C    . ILE A 1 32 ? -11.383 -7.544  36.490  1.00 0.00 ? 32 ILE A C    18 
ATOM 11219 O O    . ILE A 1 32 ? -11.012 -7.427  35.323  1.00 0.00 ? 32 ILE A O    18 
ATOM 11220 C CB   . ILE A 1 32 ? -11.979 -5.546  37.823  1.00 0.00 ? 32 ILE A CB   18 
ATOM 11221 C CG1  . ILE A 1 32 ? -13.098 -4.579  38.218  1.00 0.00 ? 32 ILE A CG1  18 
ATOM 11222 C CG2  . ILE A 1 32 ? -10.959 -4.788  36.988  1.00 0.00 ? 32 ILE A CG2  18 
ATOM 11223 C CD1  . ILE A 1 32 ? -12.667 -3.518  39.206  1.00 0.00 ? 32 ILE A CD1  18 
ATOM 11224 H H    . ILE A 1 32 ? -13.480 -7.355  38.846  1.00 0.00 ? 32 ILE A H    18 
ATOM 11225 H HA   . ILE A 1 32 ? -13.144 -6.354  36.195  1.00 0.00 ? 32 ILE A HA   18 
ATOM 11226 H HB   . ILE A 1 32 ? -11.496 -5.924  38.724  1.00 0.00 ? 32 ILE A HB   18 
ATOM 11227 H HG12 . ILE A 1 32 ? -13.459 -4.083  37.317  1.00 0.00 ? 32 ILE A HG12 18 
ATOM 11228 H HG13 . ILE A 1 32 ? -13.909 -5.154  38.665  1.00 0.00 ? 32 ILE A HG13 18 
ATOM 11229 H HG21 . ILE A 1 32 ? -10.554 -3.956  37.565  1.00 0.00 ? 32 ILE A HG21 18 
ATOM 11230 H HG22 . ILE A 1 32 ? -10.150 -5.461  36.707  1.00 0.00 ? 32 ILE A HG22 18 
ATOM 11231 H HG23 . ILE A 1 32 ? -11.441 -4.403  36.089  1.00 0.00 ? 32 ILE A HG23 18 
ATOM 11232 H HD11 . ILE A 1 32 ? -13.502 -2.860  39.449  1.00 0.00 ? 32 ILE A HD11 18 
ATOM 11233 H HD12 . ILE A 1 32 ? -12.314 -3.998  40.119  1.00 0.00 ? 32 ILE A HD12 18 
ATOM 11234 H HD13 . ILE A 1 32 ? -11.862 -2.927  38.771  1.00 0.00 ? 32 ILE A HD13 18 
ATOM 11235 N N    . LEU A 1 33 ? -10.807 -8.368  37.360  1.00 0.00 ? 33 LEU A N    18 
ATOM 11236 C CA   . LEU A 1 33 ? -9.672  -9.213  36.999  1.00 0.00 ? 33 LEU A CA   18 
ATOM 11237 C C    . LEU A 1 33 ? -10.066 -10.195 35.908  1.00 0.00 ? 33 LEU A C    18 
ATOM 11238 O O    . LEU A 1 33 ? -9.367  -10.350 34.908  1.00 0.00 ? 33 LEU A O    18 
ATOM 11239 C CB   . LEU A 1 33 ? -9.188  -10.008 38.214  1.00 0.00 ? 33 LEU A CB   18 
ATOM 11240 C CG   . LEU A 1 33 ? -8.465  -9.211  39.301  1.00 0.00 ? 33 LEU A CG   18 
ATOM 11241 C CD1  . LEU A 1 33 ? -8.154  -10.095 40.499  1.00 0.00 ? 33 LEU A CD1  18 
ATOM 11242 C CD2  . LEU A 1 33 ? -7.154  -8.647  38.773  1.00 0.00 ? 33 LEU A CD2  18 
ATOM 11243 H H    . LEU A 1 33 ? -11.159 -8.419  38.306  1.00 0.00 ? 33 LEU A H    18 
ATOM 11244 H HA   . LEU A 1 33 ? -8.864  -8.577  36.639  1.00 0.00 ? 33 LEU A HA   18 
ATOM 11245 H HB2  . LEU A 1 33 ? -10.059 -10.479 38.671  1.00 0.00 ? 33 LEU A HB2  18 
ATOM 11246 H HB3  . LEU A 1 33 ? -8.505  -10.777 37.856  1.00 0.00 ? 33 LEU A HB3  18 
ATOM 11247 H HG   . LEU A 1 33 ? -9.108  -8.389  39.618  1.00 0.00 ? 33 LEU A HG   18 
ATOM 11248 H HD11 . LEU A 1 33 ? -7.649  -9.513  41.270  1.00 0.00 ? 33 LEU A HD11 18 
ATOM 11249 H HD12 . LEU A 1 33 ? -9.084  -10.497 40.903  1.00 0.00 ? 33 LEU A HD12 18 
ATOM 11250 H HD13 . LEU A 1 33 ? -7.509  -10.915 40.186  1.00 0.00 ? 33 LEU A HD13 18 
ATOM 11251 H HD21 . LEU A 1 33 ? -6.655  -8.072  39.553  1.00 0.00 ? 33 LEU A HD21 18 
ATOM 11252 H HD22 . LEU A 1 33 ? -6.508  -9.466  38.460  1.00 0.00 ? 33 LEU A HD22 18 
ATOM 11253 H HD23 . LEU A 1 33 ? -7.357  -7.997  37.921  1.00 0.00 ? 33 LEU A HD23 18 
ATOM 11254 N N    . ALA A 1 34 ? -11.200 -10.858 36.114  1.00 0.00 ? 34 ALA A N    18 
ATOM 11255 C CA   . ALA A 1 34 ? -11.716 -11.837 35.160  1.00 0.00 ? 34 ALA A CA   18 
ATOM 11256 C C    . ALA A 1 34 ? -11.948 -11.188 33.805  1.00 0.00 ? 34 ALA A C    18 
ATOM 11257 O O    . ALA A 1 34 ? -11.651 -11.770 32.762  1.00 0.00 ? 34 ALA A O    18 
ATOM 11258 C CB   . ALA A 1 34 ? -13.036 -12.412 35.652  1.00 0.00 ? 34 ALA A CB   18 
ATOM 11259 H H    . ALA A 1 34 ? -11.731 -10.687 36.956  1.00 0.00 ? 34 ALA A H    18 
ATOM 11260 H HA   . ALA A 1 34 ? -10.989 -12.641 35.056  1.00 0.00 ? 34 ALA A HA   18 
ATOM 11261 H HB1  . ALA A 1 34 ? -13.405 -13.151 34.941  1.00 0.00 ? 34 ALA A HB1  18 
ATOM 11262 H HB2  . ALA A 1 34 ? -12.886 -12.887 36.622  1.00 0.00 ? 34 ALA A HB2  18 
ATOM 11263 H HB3  . ALA A 1 34 ? -13.767 -11.609 35.751  1.00 0.00 ? 34 ALA A HB3  18 
ATOM 11264 N N    . VAL A 1 35 ? -12.485 -9.972  33.834  1.00 0.00 ? 35 VAL A N    18 
ATOM 11265 C CA   . VAL A 1 35 ? -12.769 -9.216  32.618  1.00 0.00 ? 35 VAL A CA   18 
ATOM 11266 C C    . VAL A 1 35 ? -11.513 -9.067  31.777  1.00 0.00 ? 35 VAL A C    18 
ATOM 11267 O O    . VAL A 1 35 ? -11.540 -9.229  30.558  1.00 0.00 ? 35 VAL A O    18 
ATOM 11268 C CB   . VAL A 1 35 ? -13.292 -7.804  32.941  1.00 0.00 ? 35 VAL A CB   18 
ATOM 11269 C CG1  . VAL A 1 35 ? -13.382 -6.967  31.674  1.00 0.00 ? 35 VAL A CG1  18 
ATOM 11270 C CG2  . VAL A 1 35 ? -14.676 -7.879  33.566  1.00 0.00 ? 35 VAL A CG2  18 
ATOM 11271 H H    . VAL A 1 35 ? -12.709 -9.547  34.723  1.00 0.00 ? 35 VAL A H    18 
ATOM 11272 H HA   . VAL A 1 35 ? -13.525 -9.754  32.047  1.00 0.00 ? 35 VAL A HA   18 
ATOM 11273 H HB   . VAL A 1 35 ? -12.607 -7.325  33.641  1.00 0.00 ? 35 VAL A HB   18 
ATOM 11274 H HG11 . VAL A 1 35 ? -13.745 -5.968  31.916  1.00 0.00 ? 35 VAL A HG11 18 
ATOM 11275 H HG12 . VAL A 1 35 ? -12.395 -6.892  31.218  1.00 0.00 ? 35 VAL A HG12 18 
ATOM 11276 H HG13 . VAL A 1 35 ? -14.070 -7.441  30.974  1.00 0.00 ? 35 VAL A HG13 18 
ATOM 11277 H HG21 . VAL A 1 35 ? -15.032 -6.875  33.798  1.00 0.00 ? 35 VAL A HG21 18 
ATOM 11278 H HG22 . VAL A 1 35 ? -15.365 -8.353  32.867  1.00 0.00 ? 35 VAL A HG22 18 
ATOM 11279 H HG23 . VAL A 1 35 ? -14.628 -8.466  34.483  1.00 0.00 ? 35 VAL A HG23 18 
ATOM 11280 N N    . ALA A 1 36 ? -10.407 -8.756  32.447  1.00 0.00 ? 36 ALA A N    18 
ATOM 11281 C CA   . ALA A 1 36 ? -9.118  -8.578  31.785  1.00 0.00 ? 36 ALA A CA   18 
ATOM 11282 C C    . ALA A 1 36 ? -8.649  -9.887  31.171  1.00 0.00 ? 36 ALA A C    18 
ATOM 11283 O O    . ALA A 1 36 ? -8.208  -9.929  30.023  1.00 0.00 ? 36 ALA A O    18 
ATOM 11284 C CB   . ALA A 1 36 ? -8.069  -8.111  32.783  1.00 0.00 ? 36 ALA A CB   18 
ATOM 11285 H H    . ALA A 1 36 ? -10.450 -8.635  33.449  1.00 0.00 ? 36 ALA A H    18 
ATOM 11286 H HA   . ALA A 1 36 ? -9.228  -7.829  31.000  1.00 0.00 ? 36 ALA A HA   18 
ATOM 11287 H HB1  . ALA A 1 36 ? -7.115  -7.966  32.276  1.00 0.00 ? 36 ALA A HB1  18 
ATOM 11288 H HB2  . ALA A 1 36 ? -8.388  -7.168  33.229  1.00 0.00 ? 36 ALA A HB2  18 
ATOM 11289 H HB3  . ALA A 1 36 ? -7.954  -8.861  33.565  1.00 0.00 ? 36 ALA A HB3  18 
ATOM 11290 N N    . GLY A 1 37 ? -8.750  -10.958 31.953  1.00 0.00 ? 37 GLY A N    18 
ATOM 11291 C CA   . GLY A 1 37 ? -8.343  -12.288 31.512  1.00 0.00 ? 37 GLY A CA   18 
ATOM 11292 C C    . GLY A 1 37 ? -8.946  -12.606 30.153  1.00 0.00 ? 37 GLY A C    18 
ATOM 11293 O O    . GLY A 1 37 ? -8.233  -12.850 29.181  1.00 0.00 ? 37 GLY A O    18 
ATOM 11294 H H    . GLY A 1 37 ? -9.121  -10.858 32.887  1.00 0.00 ? 37 GLY A H    18 
ATOM 11295 H HA2  . GLY A 1 37 ? -7.256  -12.325 31.441  1.00 0.00 ? 37 GLY A HA2  18 
ATOM 11296 H HA3  . GLY A 1 37 ? -8.683  -13.026 32.238  1.00 0.00 ? 37 GLY A HA3  18 
ATOM 11297 N N    . LEU A 1 38 ? -10.275 -12.600 30.099  1.00 0.00 ? 38 LEU A N    18 
ATOM 11298 C CA   . LEU A 1 38 ? -11.008 -12.885 28.868  1.00 0.00 ? 38 LEU A CA   18 
ATOM 11299 C C    . LEU A 1 38 ? -10.646 -11.878 27.789  1.00 0.00 ? 38 LEU A C    18 
ATOM 11300 O O    . LEU A 1 38 ? -10.504 -12.225 26.618  1.00 0.00 ? 38 LEU A O    18 
ATOM 11301 C CB   . LEU A 1 38 ? -12.516 -12.811 29.113  1.00 0.00 ? 38 LEU A CB   18 
ATOM 11302 C CG   . LEU A 1 38 ? -13.123 -13.936 29.954  1.00 0.00 ? 38 LEU A CG   18 
ATOM 11303 C CD1  . LEU A 1 38 ? -14.596 -13.670 30.225  1.00 0.00 ? 38 LEU A CD1  18 
ATOM 11304 C CD2  . LEU A 1 38 ? -13.005 -15.270 29.233  1.00 0.00 ? 38 LEU A CD2  18 
ATOM 11305 H H    . LEU A 1 38 ? -10.807 -12.392 30.933  1.00 0.00 ? 38 LEU A H    18 
ATOM 11306 H HA   . LEU A 1 38 ? -10.747 -13.887 28.529  1.00 0.00 ? 38 LEU A HA   18 
ATOM 11307 H HB2  . LEU A 1 38 ? -12.725 -11.868 29.620  1.00 0.00 ? 38 LEU A HB2  18 
ATOM 11308 H HB3  . LEU A 1 38 ? -13.011 -12.818 28.142  1.00 0.00 ? 38 LEU A HB3  18 
ATOM 11309 H HG   . LEU A 1 38 ? -12.589 -13.992 30.902  1.00 0.00 ? 38 LEU A HG   18 
ATOM 11310 H HD11 . LEU A 1 38 ? -15.014 -14.472 30.833  1.00 0.00 ? 38 LEU A HD11 18 
ATOM 11311 H HD12 . LEU A 1 38 ? -14.702 -12.723 30.756  1.00 0.00 ? 38 LEU A HD12 18 
ATOM 11312 H HD13 . LEU A 1 38 ? -15.135 -13.617 29.279  1.00 0.00 ? 38 LEU A HD13 18 
ATOM 11313 H HD21 . LEU A 1 38 ? -13.431 -16.063 29.847  1.00 0.00 ? 38 LEU A HD21 18 
ATOM 11314 H HD22 . LEU A 1 38 ? -13.544 -15.218 28.287  1.00 0.00 ? 38 LEU A HD22 18 
ATOM 11315 H HD23 . LEU A 1 38 ? -11.954 -15.486 29.042  1.00 0.00 ? 38 LEU A HD23 18 
ATOM 11316 N N    . ILE A 1 39 ? -10.499 -10.622 28.200  1.00 0.00 ? 39 ILE A N    18 
ATOM 11317 C CA   . ILE A 1 39 ? -10.151 -9.537  27.287  1.00 0.00 ? 39 ILE A CA   18 
ATOM 11318 C C    . ILE A 1 39 ? -8.832  -9.827  26.592  1.00 0.00 ? 39 ILE A C    18 
ATOM 11319 O O    . ILE A 1 39 ? -8.694  -9.638  25.384  1.00 0.00 ? 39 ILE A O    18 
ATOM 11320 C CB   . ILE A 1 39 ? -10.008 -8.197  28.032  1.00 0.00 ? 39 ILE A CB   18 
ATOM 11321 C CG1  . ILE A 1 39 ? -11.365 -7.737  28.568  1.00 0.00 ? 39 ILE A CG1  18 
ATOM 11322 C CG2  . ILE A 1 39 ? -9.470  -7.123  27.098  1.00 0.00 ? 39 ILE A CG2  18 
ATOM 11323 C CD1  . ILE A 1 39 ? -12.403 -7.513  27.490  1.00 0.00 ? 39 ILE A CD1  18 
ATOM 11324 H H    . ILE A 1 39 ? -10.630 -10.399 29.177  1.00 0.00 ? 39 ILE A H    18 
ATOM 11325 H HA   . ILE A 1 39 ? -10.941 -9.448  26.541  1.00 0.00 ? 39 ILE A HA   18 
ATOM 11326 H HB   . ILE A 1 39 ? -9.318  -8.328  28.865  1.00 0.00 ? 39 ILE A HB   18 
ATOM 11327 H HG12 . ILE A 1 39 ? -11.740 -8.497  29.253  1.00 0.00 ? 39 ILE A HG12 18 
ATOM 11328 H HG13 . ILE A 1 39 ? -11.223 -6.800  29.107  1.00 0.00 ? 39 ILE A HG13 18 
ATOM 11329 H HG21 . ILE A 1 39 ? -9.364  -6.182  27.639  1.00 0.00 ? 39 ILE A HG21 18 
ATOM 11330 H HG22 . ILE A 1 39 ? -8.498  -7.431  26.714  1.00 0.00 ? 39 ILE A HG22 18 
ATOM 11331 H HG23 . ILE A 1 39 ? -10.162 -6.985  26.267  1.00 0.00 ? 39 ILE A HG23 18 
ATOM 11332 H HD11 . ILE A 1 39 ? -13.347 -7.188  27.929  1.00 0.00 ? 39 ILE A HD11 18 
ATOM 11333 H HD12 . ILE A 1 39 ? -12.048 -6.746  26.802  1.00 0.00 ? 39 ILE A HD12 18 
ATOM 11334 H HD13 . ILE A 1 39 ? -12.564 -8.443  26.946  1.00 0.00 ? 39 ILE A HD13 18 
ATOM 11335 N N    . TYR A 1 40 ? -7.861  -10.290 27.374  1.00 0.00 ? 40 TYR A N    18 
ATOM 11336 C CA   . TYR A 1 40 ? -6.534  -10.617 26.859  1.00 0.00 ? 40 TYR A CA   18 
ATOM 11337 C C    . TYR A 1 40 ? -6.598  -11.839 25.958  1.00 0.00 ? 40 TYR A C    18 
ATOM 11338 O O    . TYR A 1 40 ? -5.963  -11.887 24.906  1.00 0.00 ? 40 TYR A O    18 
ATOM 11339 C CB   . TYR A 1 40 ? -5.571  -10.915 28.010  1.00 0.00 ? 40 TYR A CB   18 
ATOM 11340 C CG   . TYR A 1 40 ? -4.163  -11.239 27.563  1.00 0.00 ? 40 TYR A CG   18 
ATOM 11341 C CD1  . TYR A 1 40 ? -3.292  -10.230 27.172  1.00 0.00 ? 40 TYR A CD1  18 
ATOM 11342 C CD2  . TYR A 1 40 ? -3.711  -12.552 27.533  1.00 0.00 ? 40 TYR A CD2  18 
ATOM 11343 C CE1  . TYR A 1 40 ? -2.004  -10.517 26.762  1.00 0.00 ? 40 TYR A CE1  18 
ATOM 11344 C CE2  . TYR A 1 40 ? -2.426  -12.857 27.126  1.00 0.00 ? 40 TYR A CE2  18 
ATOM 11345 C CZ   . TYR A 1 40 ? -1.572  -11.825 26.739  1.00 0.00 ? 40 TYR A CZ   18 
ATOM 11346 O OH   . TYR A 1 40 ? -0.289  -12.112 26.331  1.00 0.00 ? 40 TYR A OH   18 
ATOM 11347 H H    . TYR A 1 40 ? -8.037  -10.422 28.360  1.00 0.00 ? 40 TYR A H    18 
ATOM 11348 H HA   . TYR A 1 40 ? -6.162  -9.766  26.289  1.00 0.00 ? 40 TYR A HA   18 
ATOM 11349 H HB2  . TYR A 1 40 ? -5.535  -10.044 28.665  1.00 0.00 ? 40 TYR A HB2  18 
ATOM 11350 H HB3  . TYR A 1 40 ? -5.959  -11.762 28.576  1.00 0.00 ? 40 TYR A HB3  18 
ATOM 11351 H HD1  . TYR A 1 40 ? -3.628  -9.203  27.189  1.00 0.00 ? 40 TYR A HD1  18 
ATOM 11352 H HD2  . TYR A 1 40 ? -4.376  -13.348 27.833  1.00 0.00 ? 40 TYR A HD2  18 
ATOM 11353 H HE1  . TYR A 1 40 ? -1.340  -9.720  26.461  1.00 0.00 ? 40 TYR A HE1  18 
ATOM 11354 H HE2  . TYR A 1 40 ? -2.088  -13.882 27.108  1.00 0.00 ? 40 TYR A HE2  18 
ATOM 11355 H HH   . TYR A 1 40 ? -0.090  -13.050 26.352  1.00 0.00 ? 40 TYR A HH   18 
ATOM 11356 N N    . SER A 1 41 ? -7.377  -12.829 26.386  1.00 0.00 ? 41 SER A N    18 
ATOM 11357 C CA   . SER A 1 41 ? -7.546  -14.068 25.635  1.00 0.00 ? 41 SER A CA   18 
ATOM 11358 C C    . SER A 1 41 ? -8.121  -13.783 24.257  1.00 0.00 ? 41 SER A C    18 
ATOM 11359 O O    . SER A 1 41 ? -7.603  -14.248 23.243  1.00 0.00 ? 41 SER A O    18 
ATOM 11360 C CB   . SER A 1 41 ? -8.498  -15.014 26.369  1.00 0.00 ? 41 SER A CB   18 
ATOM 11361 O OG   . SER A 1 41 ? -7.941  -15.447 27.598  1.00 0.00 ? 41 SER A OG   18 
ATOM 11362 H H    . SER A 1 41 ? -7.874  -12.729 27.260  1.00 0.00 ? 41 SER A H    18 
ATOM 11363 H HA   . SER A 1 41 ? -6.573  -14.547 25.528  1.00 0.00 ? 41 SER A HA   18 
ATOM 11364 H HB2  . SER A 1 41 ? -9.435  -14.493 26.567  1.00 0.00 ? 41 SER A HB2  18 
ATOM 11365 H HB3  . SER A 1 41 ? -8.691  -15.883 25.741  1.00 0.00 ? 41 SER A HB3  18 
ATOM 11366 H HG   . SER A 1 41 ? -8.563  -16.037 28.031  1.00 0.00 ? 41 SER A HG   18 
ATOM 11367 N N    . MET A 1 42 ? -9.203  -13.009 24.235  1.00 0.00 ? 42 MET A N    18 
ATOM 11368 C CA   . MET A 1 42 ? -9.873  -12.642 22.991  1.00 0.00 ? 42 MET A CA   18 
ATOM 11369 C C    . MET A 1 42 ? -8.955  -11.803 22.118  1.00 0.00 ? 42 MET A C    18 
ATOM 11370 O O    . MET A 1 42 ? -8.895  -11.980 20.902  1.00 0.00 ? 42 MET A O    18 
ATOM 11371 C CB   . MET A 1 42 ? -11.137 -11.830 23.282  1.00 0.00 ? 42 MET A CB   18 
ATOM 11372 C CG   . MET A 1 42 ? -11.946 -11.476 22.045  1.00 0.00 ? 42 MET A CG   18 
ATOM 11373 S SD   . MET A 1 42 ? -13.442 -10.548 22.434  1.00 0.00 ? 42 MET A SD   18 
ATOM 11374 C CE   . MET A 1 42 ? -12.744 -8.974  22.931  1.00 0.00 ? 42 MET A CE   18 
ATOM 11375 H H    . MET A 1 42 ? -9.583  -12.659 25.103  1.00 0.00 ? 42 MET A H    18 
ATOM 11376 H HA   . MET A 1 42 ? -10.145 -13.553 22.458  1.00 0.00 ? 42 MET A HA   18 
ATOM 11377 H HB2  . MET A 1 42 ? -11.772 -12.411 23.951  1.00 0.00 ? 42 MET A HB2  18 
ATOM 11378 H HB3  . MET A 1 42 ? -10.843 -10.903 23.775  1.00 0.00 ? 42 MET A HB3  18 
ATOM 11379 H HG2  . MET A 1 42 ? -11.326 -10.878 21.377  1.00 0.00 ? 42 MET A HG2  18 
ATOM 11380 H HG3  . MET A 1 42 ? -12.227 -12.395 21.532  1.00 0.00 ? 42 MET A HG3  18 
ATOM 11381 H HE1  . MET A 1 42 ? -13.542 -8.283  23.205  1.00 0.00 ? 42 MET A HE1  18 
ATOM 11382 H HE2  . MET A 1 42 ? -12.088 -9.123  23.788  1.00 0.00 ? 42 MET A HE2  18 
ATOM 11383 H HE3  . MET A 1 42 ? -12.172 -8.554  22.104  1.00 0.00 ? 42 MET A HE3  18 
ATOM 11384 N N    . LEU A 1 43 ? -8.237  -10.883 22.757  1.00 0.00 ? 43 LEU A N    18 
ATOM 11385 C CA   . LEU A 1 43 ? -7.308  -9.997  22.063  1.00 0.00 ? 43 LEU A CA   18 
ATOM 11386 C C    . LEU A 1 43 ? -6.047  -10.749 21.672  1.00 0.00 ? 43 LEU A C    18 
ATOM 11387 O O    . LEU A 1 43 ? -5.506  -10.562 20.583  1.00 0.00 ? 43 LEU A O    18 
ATOM 11388 C CB   . LEU A 1 43 ? -6.912  -8.824  22.963  1.00 0.00 ? 43 LEU A CB   18 
ATOM 11389 C CG   . LEU A 1 43 ? -8.001  -7.785  23.240  1.00 0.00 ? 43 LEU A CG   18 
ATOM 11390 C CD1  . LEU A 1 43 ? -7.514  -6.751  24.244  1.00 0.00 ? 43 LEU A CD1  18 
ATOM 11391 C CD2  . LEU A 1 43 ? -8.389  -7.060  21.961  1.00 0.00 ? 43 LEU A CD2  18 
ATOM 11392 H H    . LEU A 1 43 ? -8.331  -10.785 23.758  1.00 0.00 ? 43 LEU A H    18 
ATOM 11393 H HA   . LEU A 1 43 ? -7.794  -9.614  21.165  1.00 0.00 ? 43 LEU A HA   18 
ATOM 11394 H HB2  . LEU A 1 43 ? -6.593  -9.233  23.921  1.00 0.00 ? 43 LEU A HB2  18 
ATOM 11395 H HB3  . LEU A 1 43 ? -6.076  -8.310  22.490  1.00 0.00 ? 43 LEU A HB3  18 
ATOM 11396 H HG   . LEU A 1 43 ? -8.877  -8.293  23.644  1.00 0.00 ? 43 LEU A HG   18 
ATOM 11397 H HD11 . LEU A 1 43 ? -8.302  -6.023  24.440  1.00 0.00 ? 43 LEU A HD11 18 
ATOM 11398 H HD12 . LEU A 1 43 ? -7.245  -7.249  25.175  1.00 0.00 ? 43 LEU A HD12 18 
ATOM 11399 H HD13 . LEU A 1 43 ? -6.642  -6.237  23.841  1.00 0.00 ? 43 LEU A HD13 18 
ATOM 11400 H HD21 . LEU A 1 43 ? -9.173  -6.331  22.170  1.00 0.00 ? 43 LEU A HD21 18 
ATOM 11401 H HD22 . LEU A 1 43 ? -7.517  -6.545  21.558  1.00 0.00 ? 43 LEU A HD22 18 
ATOM 11402 H HD23 . LEU A 1 43 ? -8.755  -7.783  21.232  1.00 0.00 ? 43 LEU A HD23 18 
ATOM 11403 N N    . ARG A 1 44 ? -5.583  -11.605 22.578  1.00 0.00 ? 44 ARG A N    18 
ATOM 11404 C CA   . ARG A 1 44 ? -4.382  -12.403 22.355  1.00 0.00 ? 44 ARG A CA   18 
ATOM 11405 C C    . ARG A 1 44 ? -4.709  -13.640 21.534  1.00 0.00 ? 44 ARG A C    18 
ATOM 11406 O O    . ARG A 1 44 ? -3.897  -14.109 20.738  1.00 0.00 ? 44 ARG A O    18 
ATOM 11407 C CB   . ARG A 1 44 ? -3.782  -12.853 23.689  1.00 0.00 ? 44 ARG A CB   18 
ATOM 11408 C CG   . ARG A 1 44 ? -2.474  -13.615 23.555  1.00 0.00 ? 44 ARG A CG   18 
ATOM 11409 C CD   . ARG A 1 44 ? -1.364  -12.719 23.030  1.00 0.00 ? 44 ARG A CD   18 
ATOM 11410 N NE   . ARG A 1 44 ? -0.095  -13.433 22.912  1.00 0.00 ? 44 ARG A NE   18 
ATOM 11411 C CZ   . ARG A 1 44 ? 0.990   -12.936 22.326  1.00 0.00 ? 44 ARG A CZ   18 
ATOM 11412 N NH1  . ARG A 1 44 ? 0.962   -11.718 21.803  1.00 0.00 ? 44 ARG A NH1  18 
ATOM 11413 N NH2  . ARG A 1 44 ? 2.100   -13.658 22.265  1.00 0.00 ? 44 ARG A NH2  18 
ATOM 11414 H H    . ARG A 1 44 ? -6.072  -11.713 23.455  1.00 0.00 ? 44 ARG A H    18 
ATOM 11415 H HA   . ARG A 1 44 ? -3.653  -11.795 21.819  1.00 0.00 ? 44 ARG A HA   18 
ATOM 11416 H HB2  . ARG A 1 44 ? -3.602  -11.968 24.300  1.00 0.00 ? 44 ARG A HB2  18 
ATOM 11417 H HB3  . ARG A 1 44 ? -4.505  -13.498 24.189  1.00 0.00 ? 44 ARG A HB3  18 
ATOM 11418 H HG2  . ARG A 1 44 ? -2.187  -14.000 24.533  1.00 0.00 ? 44 ARG A HG2  18 
ATOM 11419 H HG3  . ARG A 1 44 ? -2.617  -14.446 22.864  1.00 0.00 ? 44 ARG A HG3  18 
ATOM 11420 H HD2  . ARG A 1 44 ? -1.650  -12.341 22.048  1.00 0.00 ? 44 ARG A HD2  18 
ATOM 11421 H HD3  . ARG A 1 44 ? -1.235  -11.879 23.713  1.00 0.00 ? 44 ARG A HD3  18 
ATOM 11422 H HE   . ARG A 1 44 ? -0.051  -14.362 23.304  1.00 0.00 ? 44 ARG A HE   18 
ATOM 11423 H HH11 . ARG A 1 44 ? 0.116   -11.167 21.850  1.00 0.00 ? 44 ARG A HH11 18 
ATOM 11424 H HH12 . ARG A 1 44 ? 1.786   -11.340 21.358  1.00 0.00 ? 44 ARG A HH12 18 
ATOM 11425 H HH21 . ARG A 1 44 ? 2.121   -14.585 22.664  1.00 0.00 ? 44 ARG A HH21 18 
ATOM 11426 H HH22 . ARG A 1 44 ? 2.923   -13.280 21.820  1.00 0.00 ? 44 ARG A HH22 18 
ATOM 11427 N N    . LYS A 1 45 ? -5.915  -14.163 21.740  1.00 0.00 ? 45 LYS A N    18 
ATOM 11428 C CA   . LYS A 1 45 ? -6.381  -15.351 21.030  1.00 0.00 ? 45 LYS A CA   18 
ATOM 11429 C C    . LYS A 1 45 ? -6.711  -15.013 19.586  1.00 0.00 ? 45 LYS A C    18 
ATOM 11430 O O    . LYS A 1 45 ? -6.320  -15.723 18.661  1.00 0.00 ? 45 LYS A O    18 
ATOM 11431 C CB   . LYS A 1 45 ? -7.639  -15.913 21.695  1.00 0.00 ? 45 LYS A CB   18 
ATOM 11432 C CG   . LYS A 1 45 ? -8.165  -17.186 21.051  1.00 0.00 ? 45 LYS A CG   18 
ATOM 11433 C CD   . LYS A 1 45 ? -9.380  -17.719 21.793  1.00 0.00 ? 45 LYS A CD   18 
ATOM 11434 C CE   . LYS A 1 45 ? -9.915  -18.983 21.141  1.00 0.00 ? 45 LYS A CE   18 
ATOM 11435 N NZ   . LYS A 1 45 ? -11.099 -19.523 21.865  1.00 0.00 ? 45 LYS A NZ   18 
ATOM 11436 H H    . LYS A 1 45 ? -6.538  -13.731 22.408  1.00 0.00 ? 45 LYS A H    18 
ATOM 11437 H HA   . LYS A 1 45 ? -5.594  -16.104 21.054  1.00 0.00 ? 45 LYS A HA   18 
ATOM 11438 H HB2  . LYS A 1 45 ? -7.408  -16.127 22.739  1.00 0.00 ? 45 LYS A HB2  18 
ATOM 11439 H HB3  . LYS A 1 45 ? -8.421  -15.155 21.644  1.00 0.00 ? 45 LYS A HB3  18 
ATOM 11440 H HG2  . LYS A 1 45 ? -8.445  -16.972 20.019  1.00 0.00 ? 45 LYS A HG2  18 
ATOM 11441 H HG3  . LYS A 1 45 ? -7.381  -17.942 21.066  1.00 0.00 ? 45 LYS A HG3  18 
ATOM 11442 H HD2  . LYS A 1 45 ? -9.098  -17.942 22.822  1.00 0.00 ? 45 LYS A HD2  18 
ATOM 11443 H HD3  . LYS A 1 45 ? -10.162 -16.958 21.787  1.00 0.00 ? 45 LYS A HD3  18 
ATOM 11444 H HE2  . LYS A 1 45 ? -10.202 -18.757 20.114  1.00 0.00 ? 45 LYS A HE2  18 
ATOM 11445 H HE3  . LYS A 1 45 ? -9.129  -19.738 21.136  1.00 0.00 ? 45 LYS A HE3  18 
ATOM 11446 H HZ1  . LYS A 1 45 ? -11.428 -20.360 21.406  1.00 0.00 ? 45 LYS A HZ1  18 
ATOM 11447 H HZ2  . LYS A 1 45 ? -10.840 -19.742 22.816  1.00 0.00 ? 45 LYS A HZ2  18 
ATOM 11448 H HZ3  . LYS A 1 45 ? -11.836 -18.831 21.868  1.00 0.00 ? 45 LYS A HZ3  18 
ATOM 11449 N N    . ALA A 1 46 ? -7.439  -13.914 19.405  1.00 0.00 ? 46 ALA A N    18 
ATOM 11450 C CA   . ALA A 1 46 ? -7.840  -13.453 18.079  1.00 0.00 ? 46 ALA A CA   18 
ATOM 11451 C C    . ALA A 1 46 ? -8.658  -12.175 18.203  1.00 0.00 ? 46 ALA A C    18 
ATOM 11452 O O    . ALA A 1 46 ? -8.890  -11.687 19.307  1.00 0.00 ? 46 ALA A O    18 
ATOM 11453 C CB   . ALA A 1 46 ? -8.647  -14.546 17.383  1.00 0.00 ? 46 ALA A CB   18 
ATOM 11454 H H    . ALA A 1 46 ? -7.731  -13.372 20.206  1.00 0.00 ? 46 ALA A H    18 
ATOM 11455 H HA   . ALA A 1 46 ? -6.946  -13.245 17.493  1.00 0.00 ? 46 ALA A HA   18 
ATOM 11456 H HB1  . ALA A 1 46 ? -8.932  -14.206 16.388  1.00 0.00 ? 46 ALA A HB1  18 
ATOM 11457 H HB2  . ALA A 1 46 ? -8.040  -15.447 17.300  1.00 0.00 ? 46 ALA A HB2  18 
ATOM 11458 H HB3  . ALA A 1 46 ? -9.542  -14.763 17.965  1.00 0.00 ? 46 ALA A HB3  18 
ATOM 11459 N N    . GLY A 1 1  ? -17.563 -45.448 79.972  1.00 0.00 ? 1  GLY A N    19 
ATOM 11460 C CA   . GLY A 1 1  ? -18.917 -45.962 80.015  1.00 0.00 ? 1  GLY A CA   19 
ATOM 11461 C C    . GLY A 1 1  ? -19.737 -45.361 78.885  1.00 0.00 ? 1  GLY A C    19 
ATOM 11462 O O    . GLY A 1 1  ? -19.236 -44.562 78.097  1.00 0.00 ? 1  GLY A O    19 
ATOM 11463 H H1   . GLY A 1 1  ? -17.319 -44.789 79.246  1.00 0.00 ? 1  GLY A H1   19 
ATOM 11464 H HA2  . GLY A 1 1  ? -18.897 -47.046 79.910  1.00 0.00 ? 1  GLY A HA2  19 
ATOM 11465 H HA3  . GLY A 1 1  ? -19.373 -45.701 80.970  1.00 0.00 ? 1  GLY A HA3  19 
ATOM 11466 N N    . VAL A 1 2  ? -21.005 -45.759 78.820  1.00 0.00 ? 2  VAL A N    19 
ATOM 11467 C CA   . VAL A 1 2  ? -21.923 -45.274 77.794  1.00 0.00 ? 2  VAL A CA   19 
ATOM 11468 C C    . VAL A 1 2  ? -22.255 -43.809 78.025  1.00 0.00 ? 2  VAL A C    19 
ATOM 11469 O O    . VAL A 1 2  ? -22.272 -43.006 77.093  1.00 0.00 ? 2  VAL A O    19 
ATOM 11470 C CB   . VAL A 1 2  ? -23.244 -46.065 77.799  1.00 0.00 ? 2  VAL A CB   19 
ATOM 11471 C CG1  . VAL A 1 2  ? -24.252 -45.426 76.856  1.00 0.00 ? 2  VAL A CG1  19 
ATOM 11472 C CG2  . VAL A 1 2  ? -23.009 -47.499 77.351  1.00 0.00 ? 2  VAL A CG2  19 
ATOM 11473 H H    . VAL A 1 2  ? -21.355 -46.419 79.499  1.00 0.00 ? 2  VAL A H    19 
ATOM 11474 H HA   . VAL A 1 2  ? -21.443 -45.386 76.822  1.00 0.00 ? 2  VAL A HA   19 
ATOM 11475 H HB   . VAL A 1 2  ? -23.650 -46.066 78.811  1.00 0.00 ? 2  VAL A HB   19 
ATOM 11476 H HG11 . VAL A 1 2  ? -25.186 -45.988 76.875  1.00 0.00 ? 2  VAL A HG11 19 
ATOM 11477 H HG12 . VAL A 1 2  ? -24.443 -44.400 77.171  1.00 0.00 ? 2  VAL A HG12 19 
ATOM 11478 H HG13 . VAL A 1 2  ? -23.851 -45.426 75.843  1.00 0.00 ? 2  VAL A HG13 19 
ATOM 11479 H HG21 . VAL A 1 2  ? -23.949 -48.050 77.368  1.00 0.00 ? 2  VAL A HG21 19 
ATOM 11480 H HG22 . VAL A 1 2  ? -22.607 -47.500 76.338  1.00 0.00 ? 2  VAL A HG22 19 
ATOM 11481 H HG23 . VAL A 1 2  ? -22.298 -47.976 78.025  1.00 0.00 ? 2  VAL A HG23 19 
ATOM 11482 N N    . ILE A 1 3  ? -22.518 -43.471 79.284  1.00 0.00 ? 3  ILE A N    19 
ATOM 11483 C CA   . ILE A 1 3  ? -22.853 -42.104 79.671  1.00 0.00 ? 3  ILE A CA   19 
ATOM 11484 C C    . ILE A 1 3  ? -21.662 -41.184 79.463  1.00 0.00 ? 3  ILE A C    19 
ATOM 11485 O O    . ILE A 1 3  ? -21.806 -40.046 79.019  1.00 0.00 ? 3  ILE A O    19 
ATOM 11486 C CB   . ILE A 1 3  ? -23.261 -42.021 81.154  1.00 0.00 ? 3  ILE A CB   19 
ATOM 11487 C CG1  . ILE A 1 3  ? -24.579 -42.762 81.386  1.00 0.00 ? 3  ILE A CG1  19 
ATOM 11488 C CG2  . ILE A 1 3  ? -23.443 -40.571 81.576  1.00 0.00 ? 3  ILE A CG2  19 
ATOM 11489 C CD1  . ILE A 1 3  ? -24.929 -42.943 82.847  1.00 0.00 ? 3  ILE A CD1  19 
ATOM 11490 H H    . ILE A 1 3  ? -22.487 -44.176 80.006  1.00 0.00 ? 3  ILE A H    19 
ATOM 11491 H HA   . ILE A 1 3  ? -23.685 -41.765 79.052  1.00 0.00 ? 3  ILE A HA   19 
ATOM 11492 H HB   . ILE A 1 3  ? -22.480 -42.477 81.761  1.00 0.00 ? 3  ILE A HB   19 
ATOM 11493 H HG12 . ILE A 1 3  ? -25.380 -42.197 80.909  1.00 0.00 ? 3  ILE A HG12 19 
ATOM 11494 H HG13 . ILE A 1 3  ? -24.506 -43.747 80.926  1.00 0.00 ? 3  ILE A HG13 19 
ATOM 11495 H HG21 . ILE A 1 3  ? -23.722 -40.524 82.629  1.00 0.00 ? 3  ILE A HG21 19 
ATOM 11496 H HG22 . ILE A 1 3  ? -22.509 -40.030 81.426  1.00 0.00 ? 3  ILE A HG22 19 
ATOM 11497 H HG23 . ILE A 1 3  ? -24.229 -40.114 80.974  1.00 0.00 ? 3  ILE A HG23 19 
ATOM 11498 H HD11 . ILE A 1 3  ? -25.876 -43.474 82.951  1.00 0.00 ? 3  ILE A HD11 19 
ATOM 11499 H HD12 . ILE A 1 3  ? -24.143 -43.516 83.337  1.00 0.00 ? 3  ILE A HD12 19 
ATOM 11500 H HD13 . ILE A 1 3  ? -25.015 -41.965 83.321  1.00 0.00 ? 3  ILE A HD13 19 
ATOM 11501 N N    . ASP A 1 4  ? -20.478 -41.694 79.791  1.00 0.00 ? 4  ASP A N    19 
ATOM 11502 C CA   . ASP A 1 4  ? -19.237 -40.938 79.651  1.00 0.00 ? 4  ASP A CA   19 
ATOM 11503 C C    . ASP A 1 4  ? -19.116 -40.370 78.246  1.00 0.00 ? 4  ASP A C    19 
ATOM 11504 O O    . ASP A 1 4  ? -18.689 -39.232 78.055  1.00 0.00 ? 4  ASP A O    19 
ATOM 11505 C CB   . ASP A 1 4  ? -18.028 -41.838 79.915  1.00 0.00 ? 4  ASP A CB   19 
ATOM 11506 C CG   . ASP A 1 4  ? -17.888 -42.212 81.377  1.00 0.00 ? 4  ASP A CG   19 
ATOM 11507 O OD1  . ASP A 1 4  ? -16.859 -42.820 81.739  1.00 0.00 ? 4  ASP A OD1  19 
ATOM 11508 O OD2  . ASP A 1 4  ? -18.807 -41.896 82.162  1.00 0.00 ? 4  ASP A OD2  19 
ATOM 11509 H H    . ASP A 1 4  ? -20.425 -42.636 80.151  1.00 0.00 ? 4  ASP A H    19 
ATOM 11510 H HA   . ASP A 1 4  ? -19.242 -40.120 80.372  1.00 0.00 ? 4  ASP A HA   19 
ATOM 11511 H HB2  . ASP A 1 4  ? -18.136 -42.750 79.329  1.00 0.00 ? 4  ASP A HB2  19 
ATOM 11512 H HB3  . ASP A 1 4  ? -17.126 -41.313 79.600  1.00 0.00 ? 4  ASP A HB3  19 
ATOM 11513 H HD2  . ASP A 1 4  ? -18.653 -42.163 83.071  1.00 0.00 ? 4  ASP A HD2  19 
ATOM 11514 N N    . THR A 1 5  ? -19.499 -41.180 77.263  1.00 0.00 ? 5  THR A N    19 
ATOM 11515 C CA   . THR A 1 5  ? -19.444 -40.784 75.859  1.00 0.00 ? 5  THR A CA   19 
ATOM 11516 C C    . THR A 1 5  ? -20.788 -40.236 75.408  1.00 0.00 ? 5  THR A C    19 
ATOM 11517 O O    . THR A 1 5  ? -20.955 -39.822 74.262  1.00 0.00 ? 5  THR A O    19 
ATOM 11518 C CB   . THR A 1 5  ? -19.089 -41.975 74.950  1.00 0.00 ? 5  THR A CB   19 
ATOM 11519 O OG1  . THR A 1 5  ? -20.099 -42.986 75.065  1.00 0.00 ? 5  THR A OG1  19 
ATOM 11520 C CG2  . THR A 1 5  ? -17.748 -42.571 75.352  1.00 0.00 ? 5  THR A CG2  19 
ATOM 11521 H H    . THR A 1 5  ? -19.843 -42.103 77.485  1.00 0.00 ? 5  THR A H    19 
ATOM 11522 H HA   . THR A 1 5  ? -18.683 -40.011 75.749  1.00 0.00 ? 5  THR A HA   19 
ATOM 11523 H HB   . THR A 1 5  ? -19.036 -41.631 73.917  1.00 0.00 ? 5  THR A HB   19 
ATOM 11524 H HG1  . THR A 1 5  ? -19.868 -43.717 74.488  1.00 0.00 ? 5  THR A HG1  19 
ATOM 11525 H HG21 . THR A 1 5  ? -17.508 -43.410 74.700  1.00 0.00 ? 5  THR A HG21 19 
ATOM 11526 H HG22 . THR A 1 5  ? -16.973 -41.810 75.263  1.00 0.00 ? 5  THR A HG22 19 
ATOM 11527 H HG23 . THR A 1 5  ? -17.801 -42.917 76.384  1.00 0.00 ? 5  THR A HG23 19 
ATOM 11528 N N    . SER A 1 6  ? -21.748 -40.238 76.329  1.00 0.00 ? 6  SER A N    19 
ATOM 11529 C CA   . SER A 1 6  ? -23.094 -39.745 76.053  1.00 0.00 ? 6  SER A CA   19 
ATOM 11530 C C    . SER A 1 6  ? -23.036 -38.382 75.381  1.00 0.00 ? 6  SER A C    19 
ATOM 11531 O O    . SER A 1 6  ? -23.518 -38.202 74.264  1.00 0.00 ? 6  SER A O    19 
ATOM 11532 C CB   . SER A 1 6  ? -23.892 -39.610 77.352  1.00 0.00 ? 6  SER A CB   19 
ATOM 11533 O OG   . SER A 1 6  ? -25.198 -39.123 77.099  1.00 0.00 ? 6  SER A OG   19 
ATOM 11534 H H    . SER A 1 6  ? -21.550 -40.589 77.255  1.00 0.00 ? 6  SER A H    19 
ATOM 11535 H HA   . SER A 1 6  ? -23.597 -40.452 75.393  1.00 0.00 ? 6  SER A HA   19 
ATOM 11536 H HB2  . SER A 1 6  ? -23.964 -40.587 77.830  1.00 0.00 ? 6  SER A HB2  19 
ATOM 11537 H HB3  . SER A 1 6  ? -23.377 -38.916 78.017  1.00 0.00 ? 6  SER A HB3  19 
ATOM 11538 H HG   . SER A 1 6  ? -25.671 -39.050 77.932  1.00 0.00 ? 6  SER A HG   19 
ATOM 11539 N N    . ALA A 1 7  ? -22.436 -37.423 76.080  1.00 0.00 ? 7  ALA A N    19 
ATOM 11540 C CA   . ALA A 1 7  ? -22.297 -36.060 75.574  1.00 0.00 ? 7  ALA A CA   19 
ATOM 11541 C C    . ALA A 1 7  ? -21.504 -36.051 74.277  1.00 0.00 ? 7  ALA A C    19 
ATOM 11542 O O    . ALA A 1 7  ? -21.838 -35.339 73.331  1.00 0.00 ? 7  ALA A O    19 
ATOM 11543 C CB   . ALA A 1 7  ? -21.571 -35.189 76.588  1.00 0.00 ? 7  ALA A CB   19 
ATOM 11544 H H    . ALA A 1 7  ? -22.061 -37.633 76.994  1.00 0.00 ? 7  ALA A H    19 
ATOM 11545 H HA   . ALA A 1 7  ? -23.291 -35.651 75.393  1.00 0.00 ? 7  ALA A HA   19 
ATOM 11546 H HB1  . ALA A 1 7  ? -21.486 -34.171 76.207  1.00 0.00 ? 7  ALA A HB1  19 
ATOM 11547 H HB2  . ALA A 1 7  ? -22.131 -35.179 77.524  1.00 0.00 ? 7  ALA A HB2  19 
ATOM 11548 H HB3  . ALA A 1 7  ? -20.575 -35.593 76.765  1.00 0.00 ? 7  ALA A HB3  19 
ATOM 11549 N N    . VAL A 1 8  ? -20.445 -36.855 74.246  1.00 0.00 ? 8  VAL A N    19 
ATOM 11550 C CA   . VAL A 1 8  ? -19.581 -36.962 73.074  1.00 0.00 ? 8  VAL A CA   19 
ATOM 11551 C C    . VAL A 1 8  ? -20.358 -37.508 71.888  1.00 0.00 ? 8  VAL A C    19 
ATOM 11552 O O    . VAL A 1 8  ? -20.209 -37.040 70.760  1.00 0.00 ? 8  VAL A O    19 
ATOM 11553 C CB   . VAL A 1 8  ? -18.391 -37.904 73.334  1.00 0.00 ? 8  VAL A CB   19 
ATOM 11554 C CG1  . VAL A 1 8  ? -17.626 -38.164 72.046  1.00 0.00 ? 8  VAL A CG1  19 
ATOM 11555 C CG2  . VAL A 1 8  ? -17.435 -37.288 74.345  1.00 0.00 ? 8  VAL A CG2  19 
ATOM 11556 H H    . VAL A 1 8  ? -20.222 -37.415 75.056  1.00 0.00 ? 8  VAL A H    19 
ATOM 11557 H HA   . VAL A 1 8  ? -19.204 -35.968 72.833  1.00 0.00 ? 8  VAL A HA   19 
ATOM 11558 H HB   . VAL A 1 8  ? -18.769 -38.848 73.725  1.00 0.00 ? 8  VAL A HB   19 
ATOM 11559 H HG11 . VAL A 1 8  ? -16.793 -38.838 72.241  1.00 0.00 ? 8  VAL A HG11 19 
ATOM 11560 H HG12 . VAL A 1 8  ? -18.294 -38.617 71.313  1.00 0.00 ? 8  VAL A HG12 19 
ATOM 11561 H HG13 . VAL A 1 8  ? -17.245 -37.220 71.655  1.00 0.00 ? 8  VAL A HG13 19 
ATOM 11562 H HG21 . VAL A 1 8  ? -16.603 -37.966 74.528  1.00 0.00 ? 8  VAL A HG21 19 
ATOM 11563 H HG22 . VAL A 1 8  ? -17.054 -36.344 73.955  1.00 0.00 ? 8  VAL A HG22 19 
ATOM 11564 H HG23 . VAL A 1 8  ? -17.965 -37.106 75.280  1.00 0.00 ? 8  VAL A HG23 19 
ATOM 11565 N N    . GLU A 1 9  ? -21.192 -38.508 72.158  1.00 0.00 ? 9  GLU A N    19 
ATOM 11566 C CA   . GLU A 1 9  ? -22.011 -39.141 71.128  1.00 0.00 ? 9  GLU A CA   19 
ATOM 11567 C C    . GLU A 1 9  ? -22.883 -38.109 70.431  1.00 0.00 ? 9  GLU A C    19 
ATOM 11568 O O    . GLU A 1 9  ? -23.080 -38.158 69.218  1.00 0.00 ? 9  GLU A O    19 
ATOM 11569 C CB   . GLU A 1 9  ? -22.921 -40.204 71.746  1.00 0.00 ? 9  GLU A CB   19 
ATOM 11570 C CG   . GLU A 1 9  ? -23.762 -40.965 70.734  1.00 0.00 ? 9  GLU A CG   19 
ATOM 11571 C CD   . GLU A 1 9  ? -24.612 -42.044 71.376  1.00 0.00 ? 9  GLU A CD   19 
ATOM 11572 O OE1  . GLU A 1 9  ? -24.545 -42.194 72.614  1.00 0.00 ? 9  GLU A OE1  19 
ATOM 11573 O OE2  . GLU A 1 9  ? -25.346 -42.738 70.641  1.00 0.00 ? 9  GLU A OE2  19 
ATOM 11574 H H    . GLU A 1 9  ? -21.270 -38.848 73.106  1.00 0.00 ? 9  GLU A H    19 
ATOM 11575 H HA   . GLU A 1 9  ? -21.353 -39.611 70.397  1.00 0.00 ? 9  GLU A HA   19 
ATOM 11576 H HB2  . GLU A 1 9  ? -22.297 -40.920 72.280  1.00 0.00 ? 9  GLU A HB2  19 
ATOM 11577 H HB3  . GLU A 1 9  ? -23.594 -39.712 72.449  1.00 0.00 ? 9  GLU A HB3  19 
ATOM 11578 H HG2  . GLU A 1 9  ? -24.418 -40.260 70.223  1.00 0.00 ? 9  GLU A HG2  19 
ATOM 11579 H HG3  . GLU A 1 9  ? -23.098 -41.429 70.005  1.00 0.00 ? 9  GLU A HG3  19 
ATOM 11580 H HE2  . GLU A 1 9  ? -25.856 -43.400 71.113  1.00 0.00 ? 9  GLU A HE2  19 
ATOM 11581 N N    . SER A 1 10 ? -23.403 -37.172 71.217  1.00 0.00 ? 10 SER A N    19 
ATOM 11582 C CA   . SER A 1 10 ? -24.261 -36.109 70.701  1.00 0.00 ? 10 SER A CA   19 
ATOM 11583 C C    . SER A 1 10 ? -23.424 -34.992 70.100  1.00 0.00 ? 10 SER A C    19 
ATOM 11584 O O    . SER A 1 10 ? -23.684 -34.529 68.991  1.00 0.00 ? 10 SER A O    19 
ATOM 11585 C CB   . SER A 1 10 ? -25.118 -35.520 71.823  1.00 0.00 ? 10 SER A CB   19 
ATOM 11586 O OG   . SER A 1 10 ? -26.007 -36.490 72.349  1.00 0.00 ? 10 SER A OG   19 
ATOM 11587 H H    . SER A 1 10 ? -23.204 -37.185 72.207  1.00 0.00 ? 10 SER A H    19 
ATOM 11588 H HA   . SER A 1 10 ? -24.912 -36.526 69.933  1.00 0.00 ? 10 SER A HA   19 
ATOM 11589 H HB2  . SER A 1 10 ? -24.466 -35.165 72.621  1.00 0.00 ? 10 SER A HB2  19 
ATOM 11590 H HB3  . SER A 1 10 ? -25.697 -34.684 71.429  1.00 0.00 ? 10 SER A HB3  19 
ATOM 11591 H HG   . SER A 1 10 ? -26.528 -36.088 73.049  1.00 0.00 ? 10 SER A HG   19 
ATOM 11592 N N    . ALA A 1 11 ? -22.411 -34.566 70.851  1.00 0.00 ? 11 ALA A N    19 
ATOM 11593 C CA   . ALA A 1 11 ? -21.514 -33.500 70.416  1.00 0.00 ? 11 ALA A CA   19 
ATOM 11594 C C    . ALA A 1 11 ? -20.691 -33.950 69.220  1.00 0.00 ? 11 ALA A C    19 
ATOM 11595 O O    . ALA A 1 11 ? -20.447 -33.182 68.291  1.00 0.00 ? 11 ALA A O    19 
ATOM 11596 C CB   . ALA A 1 11 ? -20.562 -33.117 71.539  1.00 0.00 ? 11 ALA A CB   19 
ATOM 11597 H H    . ALA A 1 11 ? -22.249 -34.987 71.755  1.00 0.00 ? 11 ALA A H    19 
ATOM 11598 H HA   . ALA A 1 11 ? -22.112 -32.632 70.138  1.00 0.00 ? 11 ALA A HA   19 
ATOM 11599 H HB1  . ALA A 1 11 ? -19.907 -32.310 71.209  1.00 0.00 ? 11 ALA A HB1  19 
ATOM 11600 H HB2  . ALA A 1 11 ? -21.137 -32.785 72.404  1.00 0.00 ? 11 ALA A HB2  19 
ATOM 11601 H HB3  . ALA A 1 11 ? -19.960 -33.982 71.814  1.00 0.00 ? 11 ALA A HB3  19 
ATOM 11602 N N    . ILE A 1 12 ? -20.267 -35.210 69.256  1.00 0.00 ? 12 ILE A N    19 
ATOM 11603 C CA   . ILE A 1 12 ? -19.467 -35.795 68.185  1.00 0.00 ? 12 ILE A CA   19 
ATOM 11604 C C    . ILE A 1 12 ? -20.288 -35.915 66.912  1.00 0.00 ? 12 ILE A C    19 
ATOM 11605 O O    . ILE A 1 12 ? -19.831 -35.568 65.824  1.00 0.00 ? 12 ILE A O    19 
ATOM 11606 C CB   . ILE A 1 12 ? -18.966 -37.202 68.559  1.00 0.00 ? 12 ILE A CB   19 
ATOM 11607 C CG1  . ILE A 1 12 ? -17.966 -37.122 69.715  1.00 0.00 ? 12 ILE A CG1  19 
ATOM 11608 C CG2  . ILE A 1 12 ? -18.277 -37.856 67.371  1.00 0.00 ? 12 ILE A CG2  19 
ATOM 11609 C CD1  . ILE A 1 12 ? -16.733 -36.305 69.400  1.00 0.00 ? 12 ILE A CD1  19 
ATOM 11610 H H    . ILE A 1 12 ? -20.503 -35.791 70.048  1.00 0.00 ? 12 ILE A H    19 
ATOM 11611 H HA   . ILE A 1 12 ? -18.610 -35.147 68.003  1.00 0.00 ? 12 ILE A HA   19 
ATOM 11612 H HB   . ILE A 1 12 ? -19.818 -37.811 68.861  1.00 0.00 ? 12 ILE A HB   19 
ATOM 11613 H HG12 . ILE A 1 12 ? -18.467 -36.671 70.572  1.00 0.00 ? 12 ILE A HG12 19 
ATOM 11614 H HG13 . ILE A 1 12 ? -17.652 -38.134 69.968  1.00 0.00 ? 12 ILE A HG13 19 
ATOM 11615 H HG21 . ILE A 1 12 ? -17.936 -38.854 67.645  1.00 0.00 ? 12 ILE A HG21 19 
ATOM 11616 H HG22 . ILE A 1 12 ? -18.980 -37.929 66.541  1.00 0.00 ? 12 ILE A HG22 19 
ATOM 11617 H HG23 . ILE A 1 12 ? -17.422 -37.251 67.071  1.00 0.00 ? 12 ILE A HG23 19 
ATOM 11618 H HD11 . ILE A 1 12 ? -16.060 -36.282 70.257  1.00 0.00 ? 12 ILE A HD11 19 
ATOM 11619 H HD12 . ILE A 1 12 ? -16.215 -36.749 68.550  1.00 0.00 ? 12 ILE A HD12 19 
ATOM 11620 H HD13 . ILE A 1 12 ? -17.030 -35.286 69.152  1.00 0.00 ? 12 ILE A HD13 19 
ATOM 11621 N N    . THR A 1 13 ? -21.512 -36.414 67.063  1.00 0.00 ? 13 THR A N    19 
ATOM 11622 C CA   . THR A 1 13 ? -22.426 -36.593 65.938  1.00 0.00 ? 13 THR A CA   19 
ATOM 11623 C C    . THR A 1 13 ? -22.795 -35.249 65.332  1.00 0.00 ? 13 THR A C    19 
ATOM 11624 O O    . THR A 1 13 ? -22.847 -35.093 64.113  1.00 0.00 ? 13 THR A O    19 
ATOM 11625 C CB   . THR A 1 13 ? -23.729 -37.289 66.374  1.00 0.00 ? 13 THR A CB   19 
ATOM 11626 O OG1  . THR A 1 13 ? -23.429 -38.595 66.881  1.00 0.00 ? 13 THR A OG1  19 
ATOM 11627 C CG2  . THR A 1 13 ? -24.681 -37.424 65.196  1.00 0.00 ? 13 THR A CG2  19 
ATOM 11628 H H    . THR A 1 13 ? -21.831 -36.681 67.984  1.00 0.00 ? 13 THR A H    19 
ATOM 11629 H HA   . THR A 1 13 ? -21.930 -37.205 65.185  1.00 0.00 ? 13 THR A HA   19 
ATOM 11630 H HB   . THR A 1 13 ? -24.206 -36.697 67.156  1.00 0.00 ? 13 THR A HB   19 
ATOM 11631 H HG1  . THR A 1 13 ? -24.249 -39.012 67.156  1.00 0.00 ? 13 THR A HG1  19 
ATOM 11632 H HG21 . THR A 1 13 ? -25.599 -37.915 65.518  1.00 0.00 ? 13 THR A HG21 19 
ATOM 11633 H HG22 . THR A 1 13 ? -24.919 -36.433 64.807  1.00 0.00 ? 13 THR A HG22 19 
ATOM 11634 H HG23 . THR A 1 13 ? -24.208 -38.017 64.414  1.00 0.00 ? 13 THR A HG23 19 
ATOM 11635 N N    . ASP A 1 14 ? -23.051 -34.276 66.203  1.00 0.00 ? 14 ASP A N    19 
ATOM 11636 C CA   . ASP A 1 14 ? -23.420 -32.928 65.781  1.00 0.00 ? 14 ASP A CA   19 
ATOM 11637 C C    . ASP A 1 14 ? -22.240 -32.237 65.120  1.00 0.00 ? 14 ASP A C    19 
ATOM 11638 O O    . ASP A 1 14 ? -22.357 -31.683 64.028  1.00 0.00 ? 14 ASP A O    19 
ATOM 11639 C CB   . ASP A 1 14 ? -23.859 -32.091 66.984  1.00 0.00 ? 14 ASP A CB   19 
ATOM 11640 C CG   . ASP A 1 14 ? -25.204 -32.523 67.535  1.00 0.00 ? 14 ASP A CG   19 
ATOM 11641 O OD1  . ASP A 1 14 ? -25.730 -31.829 68.430  1.00 0.00 ? 14 ASP A OD1  19 
ATOM 11642 O OD2  . ASP A 1 14 ? -25.731 -33.556 67.072  1.00 0.00 ? 14 ASP A OD2  19 
ATOM 11643 H H    . ASP A 1 14 ? -22.992 -34.465 67.193  1.00 0.00 ? 14 ASP A H    19 
ATOM 11644 H HA   . ASP A 1 14 ? -24.244 -32.996 65.070  1.00 0.00 ? 14 ASP A HA   19 
ATOM 11645 H HB2  . ASP A 1 14 ? -23.111 -32.188 67.771  1.00 0.00 ? 14 ASP A HB2  19 
ATOM 11646 H HB3  . ASP A 1 14 ? -23.925 -31.046 66.679  1.00 0.00 ? 14 ASP A HB3  19 
ATOM 11647 H HD2  . ASP A 1 14 ? -26.580 -33.770 67.466  1.00 0.00 ? 14 ASP A HD2  19 
ATOM 11648 N N    . GLY A 1 15 ? -21.097 -32.276 65.798  1.00 0.00 ? 15 GLY A N    19 
ATOM 11649 C CA   . GLY A 1 15 ? -19.871 -31.659 65.298  1.00 0.00 ? 15 GLY A CA   19 
ATOM 11650 C C    . GLY A 1 15 ? -19.166 -32.588 64.323  1.00 0.00 ? 15 GLY A C    19 
ATOM 11651 O O    . GLY A 1 15 ? -19.085 -32.312 63.127  1.00 0.00 ? 15 GLY A O    19 
ATOM 11652 H H    . GLY A 1 15 ? -21.065 -32.746 66.691  1.00 0.00 ? 15 GLY A H    19 
ATOM 11653 H HA2  . GLY A 1 15 ? -20.120 -30.726 64.791  1.00 0.00 ? 15 GLY A HA2  19 
ATOM 11654 H HA3  . GLY A 1 15 ? -19.208 -31.447 66.137  1.00 0.00 ? 15 GLY A HA3  19 
ATOM 11655 N N    . GLN A 1 16 ? -18.655 -33.696 64.852  1.00 0.00 ? 16 GLN A N    19 
ATOM 11656 C CA   . GLN A 1 16 ? -17.948 -34.689 64.050  1.00 0.00 ? 16 GLN A CA   19 
ATOM 11657 C C    . GLN A 1 16 ? -18.754 -35.043 62.810  1.00 0.00 ? 16 GLN A C    19 
ATOM 11658 O O    . GLN A 1 16 ? -18.263 -34.955 61.686  1.00 0.00 ? 16 GLN A O    19 
ATOM 11659 C CB   . GLN A 1 16 ? -17.719 -35.967 64.859  1.00 0.00 ? 16 GLN A CB   19 
ATOM 11660 C CG   . GLN A 1 16 ? -16.948 -37.044 64.114  1.00 0.00 ? 16 GLN A CG   19 
ATOM 11661 C CD   . GLN A 1 16 ? -15.529 -36.624 63.786  1.00 0.00 ? 16 GLN A CD   19 
ATOM 11662 O OE1  . GLN A 1 16 ? -14.764 -36.241 64.672  1.00 0.00 ? 16 GLN A OE1  19 
ATOM 11663 N NE2  . GLN A 1 16 ? -15.173 -36.694 62.509  1.00 0.00 ? 16 GLN A NE2  19 
ATOM 11664 H H    . GLN A 1 16 ? -18.754 -33.865 65.843  1.00 0.00 ? 16 GLN A H    19 
ATOM 11665 H HA   . GLN A 1 16 ? -16.986 -34.275 63.750  1.00 0.00 ? 16 GLN A HA   19 
ATOM 11666 H HB2  . GLN A 1 16 ? -17.161 -35.707 65.759  1.00 0.00 ? 16 GLN A HB2  19 
ATOM 11667 H HB3  . GLN A 1 16 ? -18.691 -36.373 65.139  1.00 0.00 ? 16 GLN A HB3  19 
ATOM 11668 H HG2  . GLN A 1 16 ? -16.914 -37.941 64.732  1.00 0.00 ? 16 GLN A HG2  19 
ATOM 11669 H HG3  . GLN A 1 16 ? -17.471 -37.268 63.184  1.00 0.00 ? 16 GLN A HG3  19 
ATOM 11670 H HE21 . GLN A 1 16 ? -15.837 -37.014 61.818  1.00 0.00 ? 16 GLN A HE21 19 
ATOM 11671 H HE22 . GLN A 1 16 ? -14.240 -36.426 62.231  1.00 0.00 ? 16 GLN A HE22 19 
ATOM 11672 N N    . GLY A 1 17 ? -20.002 -35.447 63.032  1.00 0.00 ? 17 GLY A N    19 
ATOM 11673 C CA   . GLY A 1 17 ? -20.904 -35.823 61.947  1.00 0.00 ? 17 GLY A CA   19 
ATOM 11674 C C    . GLY A 1 17 ? -20.941 -34.736 60.885  1.00 0.00 ? 17 GLY A C    19 
ATOM 11675 O O    . GLY A 1 17 ? -20.835 -35.010 59.691  1.00 0.00 ? 17 GLY A O    19 
ATOM 11676 H H    . GLY A 1 17 ? -20.348 -35.499 63.980  1.00 0.00 ? 17 GLY A H    19 
ATOM 11677 H HA2  . GLY A 1 17 ? -20.557 -36.753 61.497  1.00 0.00 ? 17 GLY A HA2  19 
ATOM 11678 H HA3  . GLY A 1 17 ? -21.908 -35.968 62.348  1.00 0.00 ? 17 GLY A HA3  19 
ATOM 11679 N N    . ASP A 1 18 ? -21.095 -33.495 61.338  1.00 0.00 ? 18 ASP A N    19 
ATOM 11680 C CA   . ASP A 1 18 ? -21.151 -32.340 60.446  1.00 0.00 ? 18 ASP A CA   19 
ATOM 11681 C C    . ASP A 1 18 ? -19.911 -32.287 59.567  1.00 0.00 ? 18 ASP A C    19 
ATOM 11682 O O    . ASP A 1 18 ? -19.867 -31.563 58.574  1.00 0.00 ? 18 ASP A O    19 
ATOM 11683 C CB   . ASP A 1 18 ? -21.228 -31.043 61.253  1.00 0.00 ? 18 ASP A CB   19 
ATOM 11684 C CG   . ASP A 1 18 ? -22.564 -30.867 61.947  1.00 0.00 ? 18 ASP A CG   19 
ATOM 11685 O OD1  . ASP A 1 18 ? -23.059 -29.721 62.003  1.00 0.00 ? 18 ASP A OD1  19 
ATOM 11686 O OD2  . ASP A 1 18 ? -23.117 -31.875 62.436  1.00 0.00 ? 18 ASP A OD2  19 
ATOM 11687 H H    . ASP A 1 18 ? -21.178 -33.334 62.332  1.00 0.00 ? 18 ASP A H    19 
ATOM 11688 H HA   . ASP A 1 18 ? -22.037 -32.426 59.817  1.00 0.00 ? 18 ASP A HA   19 
ATOM 11689 H HB2  . ASP A 1 18 ? -20.441 -31.051 62.007  1.00 0.00 ? 18 ASP A HB2  19 
ATOM 11690 H HB3  . ASP A 1 18 ? -21.071 -30.201 60.579  1.00 0.00 ? 18 ASP A HB3  19 
ATOM 11691 H HD2  . ASP A 1 18 ? -23.959 -31.691 62.860  1.00 0.00 ? 18 ASP A HD2  19 
ATOM 11692 N N    . MET A 1 19 ? -18.903 -33.067 59.946  1.00 0.00 ? 19 MET A N    19 
ATOM 11693 C CA   . MET A 1 19 ? -17.645 -33.130 59.209  1.00 0.00 ? 19 MET A CA   19 
ATOM 11694 C C    . MET A 1 19 ? -17.870 -33.701 57.819  1.00 0.00 ? 19 MET A C    19 
ATOM 11695 O O    . MET A 1 19 ? -17.323 -33.211 56.833  1.00 0.00 ? 19 MET A O    19 
ATOM 11696 C CB   . MET A 1 19 ? -16.639 -34.021 59.941  1.00 0.00 ? 19 MET A CB   19 
ATOM 11697 C CG   . MET A 1 19 ? -15.269 -34.078 59.286  1.00 0.00 ? 19 MET A CG   19 
ATOM 11698 S SD   . MET A 1 19 ? -14.110 -35.126 60.186  1.00 0.00 ? 19 MET A SD   19 
ATOM 11699 C CE   . MET A 1 19 ? -13.849 -34.150 61.665  1.00 0.00 ? 19 MET A CE   19 
ATOM 11700 H H    . MET A 1 19 ? -19.001 -33.639 60.773  1.00 0.00 ? 19 MET A H    19 
ATOM 11701 H HA   . MET A 1 19 ? -17.239 -32.122 59.124  1.00 0.00 ? 19 MET A HA   19 
ATOM 11702 H HB2  . MET A 1 19 ? -16.519 -33.640 60.955  1.00 0.00 ? 19 MET A HB2  19 
ATOM 11703 H HB3  . MET A 1 19 ? -17.043 -35.032 59.979  1.00 0.00 ? 19 MET A HB3  19 
ATOM 11704 H HG2  . MET A 1 19 ? -15.379 -34.465 58.273  1.00 0.00 ? 19 MET A HG2  19 
ATOM 11705 H HG3  . MET A 1 19 ? -14.862 -33.068 59.232  1.00 0.00 ? 19 MET A HG3  19 
ATOM 11706 H HE1  . MET A 1 19 ? -13.153 -34.661 62.330  1.00 0.00 ? 19 MET A HE1  19 
ATOM 11707 H HE2  . MET A 1 19 ? -13.438 -33.178 61.390  1.00 0.00 ? 19 MET A HE2  19 
ATOM 11708 H HE3  . MET A 1 19 ? -14.801 -34.009 62.178  1.00 0.00 ? 19 MET A HE3  19 
ATOM 11709 N N    . LYS A 1 20 ? -18.686 -34.750 57.754  1.00 0.00 ? 20 LYS A N    19 
ATOM 11710 C CA   . LYS A 1 20 ? -19.005 -35.413 56.493  1.00 0.00 ? 20 LYS A CA   19 
ATOM 11711 C C    . LYS A 1 20 ? -19.612 -34.424 55.510  1.00 0.00 ? 20 LYS A C    19 
ATOM 11712 O O    . LYS A 1 20 ? -19.291 -34.429 54.323  1.00 0.00 ? 20 LYS A O    19 
ATOM 11713 C CB   . LYS A 1 20 ? -20.008 -36.545 56.722  1.00 0.00 ? 20 LYS A CB   19 
ATOM 11714 C CG   . LYS A 1 20 ? -20.351 -37.333 55.468  1.00 0.00 ? 20 LYS A CG   19 
ATOM 11715 C CD   . LYS A 1 20 ? -21.307 -38.474 55.777  1.00 0.00 ? 20 LYS A CD   19 
ATOM 11716 C CE   . LYS A 1 20 ? -21.662 -39.253 54.521  1.00 0.00 ? 20 LYS A CE   19 
ATOM 11717 N NZ   . LYS A 1 20 ? -22.588 -40.382 54.811  1.00 0.00 ? 20 LYS A NZ   19 
ATOM 11718 H H    . LYS A 1 20 ? -19.105 -35.108 58.600  1.00 0.00 ? 20 LYS A H    19 
ATOM 11719 H HA   . LYS A 1 20 ? -18.088 -35.824 56.072  1.00 0.00 ? 20 LYS A HA   19 
ATOM 11720 H HB2  . LYS A 1 20 ? -19.586 -37.233 57.454  1.00 0.00 ? 20 LYS A HB2  19 
ATOM 11721 H HB3  . LYS A 1 20 ? -20.928 -36.113 57.117  1.00 0.00 ? 20 LYS A HB3  19 
ATOM 11722 H HG2  . LYS A 1 20 ? -20.819 -36.664 54.745  1.00 0.00 ? 20 LYS A HG2  19 
ATOM 11723 H HG3  . LYS A 1 20 ? -19.435 -37.742 55.044  1.00 0.00 ? 20 LYS A HG3  19 
ATOM 11724 H HD2  . LYS A 1 20 ? -20.836 -39.148 56.492  1.00 0.00 ? 20 LYS A HD2  19 
ATOM 11725 H HD3  . LYS A 1 20 ? -22.220 -38.065 56.211  1.00 0.00 ? 20 LYS A HD3  19 
ATOM 11726 H HE2  . LYS A 1 20 ? -22.139 -38.578 53.809  1.00 0.00 ? 20 LYS A HE2  19 
ATOM 11727 H HE3  . LYS A 1 20 ? -20.748 -39.650 54.081  1.00 0.00 ? 20 LYS A HE3  19 
ATOM 11728 H HZ1  . LYS A 1 20 ? -22.803 -40.876 53.957  1.00 0.00 ? 20 LYS A HZ1  19 
ATOM 11729 H HZ2  . LYS A 1 20 ? -22.151 -41.016 55.464  1.00 0.00 ? 20 LYS A HZ2  19 
ATOM 11730 H HZ3  . LYS A 1 20 ? -23.442 -40.021 55.212  1.00 0.00 ? 20 LYS A HZ3  19 
ATOM 11731 N N    . ALA A 1 21 ? -20.496 -33.573 56.023  1.00 0.00 ? 21 ALA A N    19 
ATOM 11732 C CA   . ALA A 1 21 ? -21.168 -32.563 55.211  1.00 0.00 ? 21 ALA A CA   19 
ATOM 11733 C C    . ALA A 1 21 ? -20.179 -31.504 54.753  1.00 0.00 ? 21 ALA A C    19 
ATOM 11734 O O    . ALA A 1 21 ? -20.208 -31.059 53.607  1.00 0.00 ? 21 ALA A O    19 
ATOM 11735 C CB   . ALA A 1 21 ? -22.266 -31.882 56.014  1.00 0.00 ? 21 ALA A CB   19 
ATOM 11736 H H    . ALA A 1 21 ? -20.719 -33.618 57.007  1.00 0.00 ? 21 ALA A H    19 
ATOM 11737 H HA   . ALA A 1 21 ? -21.607 -33.049 54.340  1.00 0.00 ? 21 ALA A HA   19 
ATOM 11738 H HB1  . ALA A 1 21 ? -22.771 -31.140 55.395  1.00 0.00 ? 21 ALA A HB1  19 
ATOM 11739 H HB2  . ALA A 1 21 ? -22.989 -32.628 56.346  1.00 0.00 ? 21 ALA A HB2  19 
ATOM 11740 H HB3  . ALA A 1 21 ? -21.828 -31.389 56.882  1.00 0.00 ? 21 ALA A HB3  19 
ATOM 11741 N N    . ILE A 1 22 ? -19.298 -31.106 55.668  1.00 0.00 ? 22 ILE A N    19 
ATOM 11742 C CA   . ILE A 1 22 ? -18.283 -30.095 55.385  1.00 0.00 ? 22 ILE A CA   19 
ATOM 11743 C C    . ILE A 1 22 ? -17.317 -30.594 54.323  1.00 0.00 ? 22 ILE A C    19 
ATOM 11744 O O    . ILE A 1 22 ? -17.032 -29.903 53.347  1.00 0.00 ? 22 ILE A O    19 
ATOM 11745 C CB   . ILE A 1 22 ? -17.466 -29.748 56.643  1.00 0.00 ? 22 ILE A CB   19 
ATOM 11746 C CG1  . ILE A 1 22 ? -18.347 -29.037 57.672  1.00 0.00 ? 22 ILE A CG1  19 
ATOM 11747 C CG2  . ILE A 1 22 ? -16.304 -28.832 56.288  1.00 0.00 ? 22 ILE A CG2  19 
ATOM 11748 C CD1  . ILE A 1 22 ? -17.696 -28.880 59.029  1.00 0.00 ? 22 ILE A CD1  19 
ATOM 11749 H H    . ILE A 1 22 ? -19.323 -31.511 56.593  1.00 0.00 ? 22 ILE A H    19 
ATOM 11750 H HA   . ILE A 1 22 ? -18.784 -29.196 55.025  1.00 0.00 ? 22 ILE A HA   19 
ATOM 11751 H HB   . ILE A 1 22 ? -17.078 -30.669 57.077  1.00 0.00 ? 22 ILE A HB   19 
ATOM 11752 H HG12 . ILE A 1 22 ? -18.590 -28.045 57.291  1.00 0.00 ? 22 ILE A HG12 19 
ATOM 11753 H HG13 . ILE A 1 22 ? -19.265 -29.612 57.796  1.00 0.00 ? 22 ILE A HG13 19 
ATOM 11754 H HG21 . ILE A 1 22 ? -15.728 -28.601 57.184  1.00 0.00 ? 22 ILE A HG21 19 
ATOM 11755 H HG22 . ILE A 1 22 ? -15.661 -29.328 55.562  1.00 0.00 ? 22 ILE A HG22 19 
ATOM 11756 H HG23 . ILE A 1 22 ? -16.690 -27.907 55.859  1.00 0.00 ? 22 ILE A HG23 19 
ATOM 11757 H HD11 . ILE A 1 22 ? -18.367 -28.367 59.718  1.00 0.00 ? 22 ILE A HD11 19 
ATOM 11758 H HD12 . ILE A 1 22 ? -17.457 -29.865 59.430  1.00 0.00 ? 22 ILE A HD12 19 
ATOM 11759 H HD13 . ILE A 1 22 ? -16.781 -28.298 58.924  1.00 0.00 ? 22 ILE A HD13 19 
ATOM 11760 N N    . GLY A 1 23 ? -16.816 -31.809 54.527  1.00 0.00 ? 23 GLY A N    19 
ATOM 11761 C CA   . GLY A 1 23 ? -15.875 -32.431 53.599  1.00 0.00 ? 23 GLY A CA   19 
ATOM 11762 C C    . GLY A 1 23 ? -16.552 -32.718 52.268  1.00 0.00 ? 23 GLY A C    19 
ATOM 11763 O O    . GLY A 1 23 ? -15.992 -32.465 51.202  1.00 0.00 ? 23 GLY A O    19 
ATOM 11764 H H    . GLY A 1 23 ? -17.089 -32.328 55.349  1.00 0.00 ? 23 GLY A H    19 
ATOM 11765 H HA2  . GLY A 1 23 ? -15.033 -31.758 53.436  1.00 0.00 ? 23 GLY A HA2  19 
ATOM 11766 H HA3  . GLY A 1 23 ? -15.513 -33.365 54.027  1.00 0.00 ? 23 GLY A HA3  19 
ATOM 11767 N N    . GLY A 1 24 ? -17.767 -33.252 52.345  1.00 0.00 ? 24 GLY A N    19 
ATOM 11768 C CA   . GLY A 1 24 ? -18.548 -33.587 51.158  1.00 0.00 ? 24 GLY A CA   19 
ATOM 11769 C C    . GLY A 1 24 ? -18.962 -32.324 50.419  1.00 0.00 ? 24 GLY A C    19 
ATOM 11770 O O    . GLY A 1 24 ? -18.705 -32.172 49.226  1.00 0.00 ? 24 GLY A O    19 
ATOM 11771 H H    . GLY A 1 24 ? -18.174 -33.436 53.251  1.00 0.00 ? 24 GLY A H    19 
ATOM 11772 H HA2  . GLY A 1 24 ? -17.947 -34.209 50.496  1.00 0.00 ? 24 GLY A HA2  19 
ATOM 11773 H HA3  . GLY A 1 24 ? -19.441 -34.136 51.458  1.00 0.00 ? 24 GLY A HA3  19 
ATOM 11774 N N    . TYR A 1 25 ? -19.607 -31.417 51.147  1.00 0.00 ? 25 TYR A N    19 
ATOM 11775 C CA   . TYR A 1 25 ? -20.071 -30.153 50.585  1.00 0.00 ? 25 TYR A CA   19 
ATOM 11776 C C    . TYR A 1 25 ? -18.915 -29.394 49.956  1.00 0.00 ? 25 TYR A C    19 
ATOM 11777 O O    . TYR A 1 25 ? -19.055 -28.783 48.897  1.00 0.00 ? 25 TYR A O    19 
ATOM 11778 C CB   . TYR A 1 25 ? -20.688 -29.276 51.676  1.00 0.00 ? 25 TYR A CB   19 
ATOM 11779 C CG   . TYR A 1 25 ? -21.183 -27.937 51.179  1.00 0.00 ? 25 TYR A CG   19 
ATOM 11780 C CD1  . TYR A 1 25 ? -22.388 -27.833 50.494  1.00 0.00 ? 25 TYR A CD1  19 
ATOM 11781 C CD2  . TYR A 1 25 ? -20.445 -26.781 51.395  1.00 0.00 ? 25 TYR A CD2  19 
ATOM 11782 C CE1  . TYR A 1 25 ? -22.848 -26.613 50.036  1.00 0.00 ? 25 TYR A CE1  19 
ATOM 11783 C CE2  . TYR A 1 25 ? -20.889 -25.552 50.943  1.00 0.00 ? 25 TYR A CE2  19 
ATOM 11784 C CZ   . TYR A 1 25 ? -22.102 -25.477 50.259  1.00 0.00 ? 25 TYR A CZ   19 
ATOM 11785 O OH   . TYR A 1 25 ? -22.558 -24.261 49.804  1.00 0.00 ? 25 TYR A OH   19 
ATOM 11786 H H    . TYR A 1 25 ? -19.789 -31.599 52.124  1.00 0.00 ? 25 TYR A H    19 
ATOM 11787 H HA   . TYR A 1 25 ? -20.823 -30.363 49.824  1.00 0.00 ? 25 TYR A HA   19 
ATOM 11788 H HB2  . TYR A 1 25 ? -21.528 -29.812 52.119  1.00 0.00 ? 25 TYR A HB2  19 
ATOM 11789 H HB3  . TYR A 1 25 ? -19.938 -29.102 52.447  1.00 0.00 ? 25 TYR A HB3  19 
ATOM 11790 H HD1  . TYR A 1 25 ? -22.976 -28.721 50.317  1.00 0.00 ? 25 TYR A HD1  19 
ATOM 11791 H HD2  . TYR A 1 25 ? -19.507 -26.842 51.926  1.00 0.00 ? 25 TYR A HD2  19 
ATOM 11792 H HE1  . TYR A 1 25 ? -23.788 -26.550 49.506  1.00 0.00 ? 25 TYR A HE1  19 
ATOM 11793 H HE2  . TYR A 1 25 ? -20.304 -24.661 51.118  1.00 0.00 ? 25 TYR A HE2  19 
ATOM 11794 H HH   . TYR A 1 25 ? -21.965 -23.535 50.011  1.00 0.00 ? 25 TYR A HH   19 
ATOM 11795 N N    . ILE A 1 26 ? -17.766 -29.440 50.624  1.00 0.00 ? 26 ILE A N    19 
ATOM 11796 C CA   . ILE A 1 26 ? -16.561 -28.763 50.152  1.00 0.00 ? 26 ILE A CA   19 
ATOM 11797 C C    . ILE A 1 26 ? -15.951 -29.518 48.982  1.00 0.00 ? 26 ILE A C    19 
ATOM 11798 O O    . ILE A 1 26 ? -15.564 -28.926 47.976  1.00 0.00 ? 26 ILE A O    19 
ATOM 11799 C CB   . ILE A 1 26 ? -15.497 -28.667 51.261  1.00 0.00 ? 26 ILE A CB   19 
ATOM 11800 C CG1  . ILE A 1 26 ? -15.977 -27.745 52.383  1.00 0.00 ? 26 ILE A CG1  19 
ATOM 11801 C CG2  . ILE A 1 26 ? -14.196 -28.110 50.703  1.00 0.00 ? 26 ILE A CG2  19 
ATOM 11802 C CD1  . ILE A 1 26 ? -15.108 -27.786 53.621  1.00 0.00 ? 26 ILE A CD1  19 
ATOM 11803 H H    . ILE A 1 26 ? -17.714 -29.959 51.489  1.00 0.00 ? 26 ILE A H    19 
ATOM 11804 H HA   . ILE A 1 26 ? -16.834 -27.757 49.831  1.00 0.00 ? 26 ILE A HA   19 
ATOM 11805 H HB   . ILE A 1 26 ? -15.318 -29.663 51.665  1.00 0.00 ? 26 ILE A HB   19 
ATOM 11806 H HG12 . ILE A 1 26 ? -15.990 -26.722 52.006  1.00 0.00 ? 26 ILE A HG12 19 
ATOM 11807 H HG13 . ILE A 1 26 ? -16.988 -28.041 52.663  1.00 0.00 ? 26 ILE A HG13 19 
ATOM 11808 H HG21 . ILE A 1 26 ? -13.448 -28.056 51.494  1.00 0.00 ? 26 ILE A HG21 19 
ATOM 11809 H HG22 . ILE A 1 26 ? -13.835 -28.761 49.908  1.00 0.00 ? 26 ILE A HG22 19 
ATOM 11810 H HG23 . ILE A 1 26 ? -14.372 -27.111 50.303  1.00 0.00 ? 26 ILE A HG23 19 
ATOM 11811 H HD11 . ILE A 1 26 ? -15.497 -27.110 54.384  1.00 0.00 ? 26 ILE A HD11 19 
ATOM 11812 H HD12 . ILE A 1 26 ? -15.094 -28.801 54.017  1.00 0.00 ? 26 ILE A HD12 19 
ATOM 11813 H HD13 . ILE A 1 26 ? -14.095 -27.483 53.359  1.00 0.00 ? 26 ILE A HD13 19 
ATOM 11814 N N    . VAL A 1 27 ? -15.871 -30.837 49.128  1.00 0.00 ? 27 VAL A N    19 
ATOM 11815 C CA   . VAL A 1 27 ? -15.310 -31.704 48.095  1.00 0.00 ? 27 VAL A CA   19 
ATOM 11816 C C    . VAL A 1 27 ? -16.290 -31.863 46.944  1.00 0.00 ? 27 VAL A C    19 
ATOM 11817 O O    . VAL A 1 27 ? -15.896 -32.037 45.792  1.00 0.00 ? 27 VAL A O    19 
ATOM 11818 C CB   . VAL A 1 27 ? -14.995 -33.107 48.646  1.00 0.00 ? 27 VAL A CB   19 
ATOM 11819 C CG1  . VAL A 1 27 ? -14.585 -34.042 47.518  1.00 0.00 ? 27 VAL A CG1  19 
ATOM 11820 C CG2  . VAL A 1 27 ? -13.857 -33.041 49.653  1.00 0.00 ? 27 VAL A CG2  19 
ATOM 11821 H H    . VAL A 1 27 ? -16.207 -31.264 49.979  1.00 0.00 ? 27 VAL A H    19 
ATOM 11822 H HA   . VAL A 1 27 ? -14.391 -31.250 47.727  1.00 0.00 ? 27 VAL A HA   19 
ATOM 11823 H HB   . VAL A 1 27 ? -15.886 -33.501 49.135  1.00 0.00 ? 27 VAL A HB   19 
ATOM 11824 H HG11 . VAL A 1 27 ? -14.373 -35.033 47.918  1.00 0.00 ? 27 VAL A HG11 19 
ATOM 11825 H HG12 . VAL A 1 27 ? -15.396 -34.111 46.792  1.00 0.00 ? 27 VAL A HG12 19 
ATOM 11826 H HG13 . VAL A 1 27 ? -13.693 -33.651 47.030  1.00 0.00 ? 27 VAL A HG13 19 
ATOM 11827 H HG21 . VAL A 1 27 ? -13.650 -34.037 50.042  1.00 0.00 ? 27 VAL A HG21 19 
ATOM 11828 H HG22 . VAL A 1 27 ? -12.964 -32.649 49.165  1.00 0.00 ? 27 VAL A HG22 19 
ATOM 11829 H HG23 . VAL A 1 27 ? -14.139 -32.383 50.476  1.00 0.00 ? 27 VAL A HG23 19 
ATOM 11830 N N    . GLY A 1 28 ? -17.577 -31.801 47.272  1.00 0.00 ? 28 GLY A N    19 
ATOM 11831 C CA   . GLY A 1 28 ? -18.642 -31.936 46.283  1.00 0.00 ? 28 GLY A CA   19 
ATOM 11832 C C    . GLY A 1 28 ? -18.763 -30.666 45.455  1.00 0.00 ? 28 GLY A C    19 
ATOM 11833 O O    . GLY A 1 28 ? -19.257 -30.686 44.329  1.00 0.00 ? 28 GLY A O    19 
ATOM 11834 H H    . GLY A 1 28 ? -17.839 -31.655 48.237  1.00 0.00 ? 28 GLY A H    19 
ATOM 11835 H HA2  . GLY A 1 28 ? -18.417 -32.774 45.624  1.00 0.00 ? 28 GLY A HA2  19 
ATOM 11836 H HA3  . GLY A 1 28 ? -19.587 -32.123 46.795  1.00 0.00 ? 28 GLY A HA3  19 
ATOM 11837 N N    . ALA A 1 29 ? -18.304 -29.559 46.031  1.00 0.00 ? 29 ALA A N    19 
ATOM 11838 C CA   . ALA A 1 29 ? -18.349 -28.259 45.369  1.00 0.00 ? 29 ALA A CA   19 
ATOM 11839 C C    . ALA A 1 29 ? -17.139 -28.080 44.464  1.00 0.00 ? 29 ALA A C    19 
ATOM 11840 O O    . ALA A 1 29 ? -17.217 -27.440 43.417  1.00 0.00 ? 29 ALA A O    19 
ATOM 11841 C CB   . ALA A 1 29 ? -18.351 -27.139 46.399  1.00 0.00 ? 29 ALA A CB   19 
ATOM 11842 H H    . ALA A 1 29 ? -17.910 -29.608 46.959  1.00 0.00 ? 29 ALA A H    19 
ATOM 11843 H HA   . ALA A 1 29 ? -19.259 -28.201 44.772  1.00 0.00 ? 29 ALA A HA   19 
ATOM 11844 H HB1  . ALA A 1 29 ? -18.400 -26.173 45.895  1.00 0.00 ? 29 ALA A HB1  19 
ATOM 11845 H HB2  . ALA A 1 29 ? -19.217 -27.249 47.053  1.00 0.00 ? 29 ALA A HB2  19 
ATOM 11846 H HB3  . ALA A 1 29 ? -17.439 -27.191 46.993  1.00 0.00 ? 29 ALA A HB3  19 
ATOM 11847 N N    . LEU A 1 30 ? -16.018 -28.658 44.885  1.00 0.00 ? 30 LEU A N    19 
ATOM 11848 C CA   . LEU A 1 30 ? -14.770 -28.580 44.130  1.00 0.00 ? 30 LEU A CA   19 
ATOM 11849 C C    . LEU A 1 30 ? -14.973 -29.088 42.712  1.00 0.00 ? 30 LEU A C    19 
ATOM 11850 O O    . LEU A 1 30 ? -14.317 -28.637 41.775  1.00 0.00 ? 30 LEU A O    19 
ATOM 11851 C CB   . LEU A 1 30 ? -13.686 -29.429 44.797  1.00 0.00 ? 30 LEU A CB   19 
ATOM 11852 C CG   . LEU A 1 30 ? -13.144 -28.910 46.130  1.00 0.00 ? 30 LEU A CG   19 
ATOM 11853 C CD1  . LEU A 1 30 ? -12.172 -29.909 46.741  1.00 0.00 ? 30 LEU A CD1  19 
ATOM 11854 C CD2  . LEU A 1 30 ? -12.410 -27.592 45.936  1.00 0.00 ? 30 LEU A CD2  19 
ATOM 11855 H H    . LEU A 1 30 ? -16.019 -29.171 45.755  1.00 0.00 ? 30 LEU A H    19 
ATOM 11856 H HA   . LEU A 1 30 ? -14.445 -27.540 44.099  1.00 0.00 ? 30 LEU A HA   19 
ATOM 11857 H HB2  . LEU A 1 30 ? -14.102 -30.421 44.971  1.00 0.00 ? 30 LEU A HB2  19 
ATOM 11858 H HB3  . LEU A 1 30 ? -12.849 -29.502 44.104  1.00 0.00 ? 30 LEU A HB3  19 
ATOM 11859 H HG   . LEU A 1 30 ? -13.980 -28.758 46.813  1.00 0.00 ? 30 LEU A HG   19 
ATOM 11860 H HD11 . LEU A 1 30 ? -11.802 -29.532 47.695  1.00 0.00 ? 30 LEU A HD11 19 
ATOM 11861 H HD12 . LEU A 1 30 ? -12.683 -30.858 46.903  1.00 0.00 ? 30 LEU A HD12 19 
ATOM 11862 H HD13 . LEU A 1 30 ? -11.333 -30.059 46.062  1.00 0.00 ? 30 LEU A HD13 19 
ATOM 11863 H HD21 . LEU A 1 30 ? -12.040 -27.228 46.894  1.00 0.00 ? 30 LEU A HD21 19 
ATOM 11864 H HD22 . LEU A 1 30 ? -11.570 -27.741 45.258  1.00 0.00 ? 30 LEU A HD22 19 
ATOM 11865 H HD23 . LEU A 1 30 ? -13.094 -26.856 45.511  1.00 0.00 ? 30 LEU A HD23 19 
ATOM 11866 N N    . VAL A 1 31 ? -15.894 -30.036 42.567  1.00 0.00 ? 31 VAL A N    19 
ATOM 11867 C CA   . VAL A 1 31 ? -16.209 -30.628 41.269  1.00 0.00 ? 31 VAL A CA   19 
ATOM 11868 C C    . VAL A 1 31 ? -16.577 -29.546 40.267  1.00 0.00 ? 31 VAL A C    19 
ATOM 11869 O O    . VAL A 1 31 ? -16.268 -29.646 39.081  1.00 0.00 ? 31 VAL A O    19 
ATOM 11870 C CB   . VAL A 1 31 ? -17.395 -31.606 41.367  1.00 0.00 ? 31 VAL A CB   19 
ATOM 11871 C CG1  . VAL A 1 31 ? -17.850 -32.032 39.980  1.00 0.00 ? 31 VAL A CG1  19 
ATOM 11872 C CG2  . VAL A 1 31 ? -16.995 -32.850 42.146  1.00 0.00 ? 31 VAL A CG2  19 
ATOM 11873 H H    . VAL A 1 31 ? -16.400 -30.366 43.377  1.00 0.00 ? 31 VAL A H    19 
ATOM 11874 H HA   . VAL A 1 31 ? -15.331 -31.166 40.914  1.00 0.00 ? 31 VAL A HA   19 
ATOM 11875 H HB   . VAL A 1 31 ? -18.220 -31.110 41.880  1.00 0.00 ? 31 VAL A HB   19 
ATOM 11876 H HG11 . VAL A 1 31 ? -18.695 -32.716 40.062  1.00 0.00 ? 31 VAL A HG11 19 
ATOM 11877 H HG12 . VAL A 1 31 ? -18.153 -31.152 39.412  1.00 0.00 ? 31 VAL