data_1PJJ
# 
_entry.id   1PJJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1PJJ         
NDB   PD0447       
RCSB  RCSB019364   
WWPDB D_1000019364 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1KFV 'First crystal structure obtained with a blunt 13mer DNA duplex' unspecified 
PDB 1EE8 'Crystal structure of the free Fpg'                              unspecified 
PDB 1K82 .                                                                unspecified 
PDB 1L1T .                                                                unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1PJJ 
_pdbx_database_status.recvd_initial_deposition_date   2003-06-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Serre, L.'            1 
'Pereira de Jesus, K.' 2 
'Boiteux, S.'          3 
'Zelwer, C.'           4 
'Castaing, B.'         5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Structural insights into abasic site for Fpg specific binding and catalysis: comparative high-resolution crystallographic studies of Fpg bound to various models of abasic site analogues-containing DNA.
;
'Nucleic Acids Res.'       33 5936 5944 2005 NARHAD UK 0305-1048 0389 ? 16243784 10.1093/nar/gki879        
1       
;Crystallization and primary X-ray crystallographic studies of a complex between th Lactococcus lactis Fpg DNA- repair enzyme and an abasic site containing DNA
;
'Acta Crystallogr.,Sect.D' 58 679  682  2002 ABCRE6 DK 0907-4449 0766 ? ?        10.1107/S0907444902001397 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pereira de Jesus, K.'  1  
primary 'Serre, L.'             2  
primary 'Zelwer, C.'            3  
primary 'Castaing, B.'          4  
1       'Pereira de Jesus, K.'  5  
1       'Serre, L.'             6  
1       'Hervouet, N.'          7  
1       'Bouckson-Castaing, V.' 8  
1       'Zelwer, C.'            9  
1       'Castaing, B.'          10 
# 
_cell.entry_id           1PJJ 
_cell.length_a           91.892 
_cell.length_b           91.892 
_cell.length_c           142.420 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1PJJ 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*CP*TP*CP*TP*TP*TP*(3DR)P*TP*TP*TP*CP*TP*CP*G)-3')
;
4054.614  1   ?        ?   ? ? 
2 polymer     syn 
;DNA (5'-D(*GP*CP*GP*AP*GP*AP*AP*AP*CP*AP*AP*AP*GP*A)-3')
;
4355.884  1   ?        ?   ? ? 
3 polymer     man 'Formamidopyrimidine-DNA glycosylase'                          31076.154 1   3.2.2.23 P1G ? ? 
4 non-polymer syn 'ZINC ION'                                                     65.409    1   ?        ?   ? ? 
5 non-polymer syn GLYCEROL                                                       92.094    3   ?        ?   ? ? 
6 water       nat water                                                          18.015    278 ?        ?   ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'FAPY-DNA glycosylase' 
# 
_entity_name_sys.entity_id   3 
_entity_name_sys.name        3.2.2.23 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes '(DC)(DT)(DC)(DT)(DT)(DT)(3DR)(DT)(DT)(DT)(DC)(DT)(DC)(DG)' CTCTTTNTTTCTCG D ? 
2 polydeoxyribonucleotide no no  '(DG)(DC)(DG)(DA)(DG)(DA)(DA)(DA)(DC)(DA)(DA)(DA)(DG)(DA)' GCGAGAAACAAAGA E ? 
3 'polypeptide(L)'        no no  
;GELPEVETVRRELEKRIVGQKIISIEATYPRMVLTGFEQLKKELTGKTIQGISRRGKYLIFEIGDDFRLISHLRMEGKYR
LATLDAPREKHDHLTMKFADGQLIYADVRKFGTWELISTDQVLPYFLKKKIGPEPTYEDFDEKLFREKLRKSTKKIKPYL
LEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLIESSIHLLHDSIIEILQKAIKLGGSSIRTYSALGSTGKMQNELQVYGK
TGEKCSRCGAEIQKIKVAGRGTHFCPVCQQK
;
;GELPEVETVRRELEKRIVGQKIISIEATYPRMVLTGFEQLKKELTGKTIQGISRRGKYLIFEIGDDFRLISHLRMEGKYR
LATLDAPREKHDHLTMKFADGQLIYADVRKFGTWELISTDQVLPYFLKKKIGPEPTYEDFDEKLFREKLRKSTKKIKPYL
LEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLIESSIHLLHDSIIEILQKAIKLGGSSIRTYSALGSTGKMQNELQVYGK
TGEKCSRCGAEIQKIKVAGRGTHFCPVCQQK
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DT  n 
1 3   DC  n 
1 4   DT  n 
1 5   DT  n 
1 6   DT  n 
1 7   3DR n 
1 8   DT  n 
1 9   DT  n 
1 10  DT  n 
1 11  DC  n 
1 12  DT  n 
1 13  DC  n 
1 14  DG  n 
2 1   DG  n 
2 2   DC  n 
2 3   DG  n 
2 4   DA  n 
2 5   DG  n 
2 6   DA  n 
2 7   DA  n 
2 8   DA  n 
2 9   DC  n 
2 10  DA  n 
2 11  DA  n 
2 12  DA  n 
2 13  DG  n 
2 14  DA  n 
3 1   GLY n 
3 2   GLU n 
3 3   LEU n 
3 4   PRO n 
3 5   GLU n 
3 6   VAL n 
3 7   GLU n 
3 8   THR n 
3 9   VAL n 
3 10  ARG n 
3 11  ARG n 
3 12  GLU n 
3 13  LEU n 
3 14  GLU n 
3 15  LYS n 
3 16  ARG n 
3 17  ILE n 
3 18  VAL n 
3 19  GLY n 
3 20  GLN n 
3 21  LYS n 
3 22  ILE n 
3 23  ILE n 
3 24  SER n 
3 25  ILE n 
3 26  GLU n 
3 27  ALA n 
3 28  THR n 
3 29  TYR n 
3 30  PRO n 
3 31  ARG n 
3 32  MET n 
3 33  VAL n 
3 34  LEU n 
3 35  THR n 
3 36  GLY n 
3 37  PHE n 
3 38  GLU n 
3 39  GLN n 
3 40  LEU n 
3 41  LYS n 
3 42  LYS n 
3 43  GLU n 
3 44  LEU n 
3 45  THR n 
3 46  GLY n 
3 47  LYS n 
3 48  THR n 
3 49  ILE n 
3 50  GLN n 
3 51  GLY n 
3 52  ILE n 
3 53  SER n 
3 54  ARG n 
3 55  ARG n 
3 56  GLY n 
3 57  LYS n 
3 58  TYR n 
3 59  LEU n 
3 60  ILE n 
3 61  PHE n 
3 62  GLU n 
3 63  ILE n 
3 64  GLY n 
3 65  ASP n 
3 66  ASP n 
3 67  PHE n 
3 68  ARG n 
3 69  LEU n 
3 70  ILE n 
3 71  SER n 
3 72  HIS n 
3 73  LEU n 
3 74  ARG n 
3 75  MET n 
3 76  GLU n 
3 77  GLY n 
3 78  LYS n 
3 79  TYR n 
3 80  ARG n 
3 81  LEU n 
3 82  ALA n 
3 83  THR n 
3 84  LEU n 
3 85  ASP n 
3 86  ALA n 
3 87  PRO n 
3 88  ARG n 
3 89  GLU n 
3 90  LYS n 
3 91  HIS n 
3 92  ASP n 
3 93  HIS n 
3 94  LEU n 
3 95  THR n 
3 96  MET n 
3 97  LYS n 
3 98  PHE n 
3 99  ALA n 
3 100 ASP n 
3 101 GLY n 
3 102 GLN n 
3 103 LEU n 
3 104 ILE n 
3 105 TYR n 
3 106 ALA n 
3 107 ASP n 
3 108 VAL n 
3 109 ARG n 
3 110 LYS n 
3 111 PHE n 
3 112 GLY n 
3 113 THR n 
3 114 TRP n 
3 115 GLU n 
3 116 LEU n 
3 117 ILE n 
3 118 SER n 
3 119 THR n 
3 120 ASP n 
3 121 GLN n 
3 122 VAL n 
3 123 LEU n 
3 124 PRO n 
3 125 TYR n 
3 126 PHE n 
3 127 LEU n 
3 128 LYS n 
3 129 LYS n 
3 130 LYS n 
3 131 ILE n 
3 132 GLY n 
3 133 PRO n 
3 134 GLU n 
3 135 PRO n 
3 136 THR n 
3 137 TYR n 
3 138 GLU n 
3 139 ASP n 
3 140 PHE n 
3 141 ASP n 
3 142 GLU n 
3 143 LYS n 
3 144 LEU n 
3 145 PHE n 
3 146 ARG n 
3 147 GLU n 
3 148 LYS n 
3 149 LEU n 
3 150 ARG n 
3 151 LYS n 
3 152 SER n 
3 153 THR n 
3 154 LYS n 
3 155 LYS n 
3 156 ILE n 
3 157 LYS n 
3 158 PRO n 
3 159 TYR n 
3 160 LEU n 
3 161 LEU n 
3 162 GLU n 
3 163 GLN n 
3 164 THR n 
3 165 LEU n 
3 166 VAL n 
3 167 ALA n 
3 168 GLY n 
3 169 LEU n 
3 170 GLY n 
3 171 ASN n 
3 172 ILE n 
3 173 TYR n 
3 174 VAL n 
3 175 ASP n 
3 176 GLU n 
3 177 VAL n 
3 178 LEU n 
3 179 TRP n 
3 180 LEU n 
3 181 ALA n 
3 182 LYS n 
3 183 ILE n 
3 184 HIS n 
3 185 PRO n 
3 186 GLU n 
3 187 LYS n 
3 188 GLU n 
3 189 THR n 
3 190 ASN n 
3 191 GLN n 
3 192 LEU n 
3 193 ILE n 
3 194 GLU n 
3 195 SER n 
3 196 SER n 
3 197 ILE n 
3 198 HIS n 
3 199 LEU n 
3 200 LEU n 
3 201 HIS n 
3 202 ASP n 
3 203 SER n 
3 204 ILE n 
3 205 ILE n 
3 206 GLU n 
3 207 ILE n 
3 208 LEU n 
3 209 GLN n 
3 210 LYS n 
3 211 ALA n 
3 212 ILE n 
3 213 LYS n 
3 214 LEU n 
3 215 GLY n 
3 216 GLY n 
3 217 SER n 
3 218 SER n 
3 219 ILE n 
3 220 ARG n 
3 221 THR n 
3 222 TYR n 
3 223 SER n 
3 224 ALA n 
3 225 LEU n 
3 226 GLY n 
3 227 SER n 
3 228 THR n 
3 229 GLY n 
3 230 LYS n 
3 231 MET n 
3 232 GLN n 
3 233 ASN n 
3 234 GLU n 
3 235 LEU n 
3 236 GLN n 
3 237 VAL n 
3 238 TYR n 
3 239 GLY n 
3 240 LYS n 
3 241 THR n 
3 242 GLY n 
3 243 GLU n 
3 244 LYS n 
3 245 CYS n 
3 246 SER n 
3 247 ARG n 
3 248 CYS n 
3 249 GLY n 
3 250 ALA n 
3 251 GLU n 
3 252 ILE n 
3 253 GLN n 
3 254 LYS n 
3 255 ILE n 
3 256 LYS n 
3 257 VAL n 
3 258 ALA n 
3 259 GLY n 
3 260 ARG n 
3 261 GLY n 
3 262 THR n 
3 263 HIS n 
3 264 PHE n 
3 265 CYS n 
3 266 PRO n 
3 267 VAL n 
3 268 CYS n 
3 269 GLN n 
3 270 GLN n 
3 271 LYS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Lactococcus 
_entity_src_gen.pdbx_gene_src_gene                 'MUTM OR FPG' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Lactococcus lactis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1358 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pmal-c 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP FPG_LACLC P42371 3 
;PELPEVETVRRELEKRIVGQKIISIEATYPRMVLTGFEQLKKELTGKTIQGISRRGKYLIFEIGDDFRLISHLRMEGKYR
LATLDAPREKHDHLTMKFADGQLIYADVRKFGTWELISTDQVLPYFLKKKIGPEPTYDEDFDEKLFREKLRKSTKKIKPY
LLEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLIESSIHLLHDSIIEILQKAIKLGGSSIRTYSALGSTGKMQNELQVYG
KTGEKCSRCGAEIQKIKVAGRGTHFCPVCQQK
;
2 ? 
2 PDB 1PJJ      1PJJ   1 ? ? ? 
3 PDB 1PJJ      1PJJ   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1PJJ A 1 ? 271 ? P42371 2  ? 273 ? 1  271 
2 2 1PJJ D 1 ? 14  ? 1PJJ   1  ? 14  ? 1  14  
3 3 1PJJ E 1 ? 14  ? 1PJJ   15 ? 28  ? 15 28  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1PJJ GLY A 1 ? UNP P42371 PRO 2   ENGINEERED       1 1 
1 1PJJ ?   A ? ? UNP P42371 ASP 138 'SEE REMARK 999' ? 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3DR 'DNA linking'       . "1',2'-DIDEOXYRIBOFURANOSE-5'-PHOSPHATE" 'ABASIC DIDEOXYRIBOSE'          'C5 H11 O6 P'     198.111 
ALA 'L-peptide linking' y ALANINE                                  ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                 ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?                               'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                 ?                               'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ?                               'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ?                               'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ?                               'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ?                               'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                  ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                                 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                                ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                    ?                               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                   ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                               ?                               'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ?                               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                  ?                               'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                   ?                               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                 ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                   ?                               'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                               ?                               'Zn 2'            65.409  
# 
_exptl.entry_id          1PJJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.78 
_exptl_crystal.density_percent_sol   67.43 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    'citrate, Hepes, glycerol, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 citrate  ? ? ? 
1 2 1 Hepes    ? ? ? 
1 3 1 glycerol ? ? ? 
1 4 1 water    ? ? ? 
1 5 2 citrate  ? ? ? 
1 6 2 glycerol ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2002-07-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Mirror 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.93 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.93 
# 
_reflns.entry_id                     1PJJ 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.9 
_reflns.d_resolution_low             43.7 
_reflns.number_all                   48837 
_reflns.number_obs                   48787 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            0.077 
_reflns.pdbx_Rsym_value              0.073 
_reflns.pdbx_netI_over_sigmaI        5.2 
_reflns.B_iso_Wilson_estimate        27.689 
_reflns.pdbx_redundancy              9.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.9 
_reflns_shell.d_res_low              2.0 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.516 
_reflns_shell.pdbx_Rsym_value        0.488 
_reflns_shell.meanI_over_sigI_obs    0.8 
_reflns_shell.pdbx_redundancy        9.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      7019 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1PJJ 
_refine.ls_d_res_high                            1.9 
_refine.ls_d_res_low                             35 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     48742 
_refine.ls_number_reflns_obs                     48703 
_refine.ls_number_reflns_R_free                  2425 
_refine.ls_percent_reflns_obs                    99.9 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.202 
_refine.ls_R_factor_R_free                       0.22 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1KFV' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.B_iso_mean                               31 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2164 
_refine_hist.pdbx_number_atoms_nucleic_acid   557 
_refine_hist.pdbx_number_atoms_ligand         19 
_refine_hist.number_atoms_solvent             278 
_refine_hist.number_atoms_total               3018 
_refine_hist.d_res_high                       1.9 
_refine_hist.d_res_low                        35 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.9 
_refine_ls_shell.d_res_low                        1.91 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.337 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.404 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             67 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1PJJ 
_struct.title                     'Complex between the Lactococcus lactis Fpg and an abasic site containing DNA.' 
_struct.pdbx_descriptor           'Formamidopyrimidine-DNA glycosylase (E.C.3.2.2.23)/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1PJJ 
_struct_keywords.pdbx_keywords   hydrolase/DNA 
_struct_keywords.text            'DNA repair, Fpg, MutM, abasic site, hydrolase-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU C 2   ? VAL C 18  ? GLU A 2   VAL A 18  1 ? 17 
HELX_P HELX_P2  2  TYR C 29  ? VAL C 33  ? TYR A 29  VAL A 33  5 ? 5  
HELX_P HELX_P3  3  GLY C 36  ? THR C 45  ? GLY A 36  THR A 45  1 ? 10 
HELX_P HELX_P4  4  GLN C 121 ? LYS C 130 ? GLN A 121 LYS A 130 1 ? 10 
HELX_P HELX_P5  5  ASP C 141 ? LYS C 151 ? ASP A 141 LYS A 151 1 ? 11 
HELX_P HELX_P6  6  LYS C 155 ? GLU C 162 ? LYS A 155 GLU A 162 1 ? 8  
HELX_P HELX_P7  7  GLY C 170 ? ALA C 181 ? GLY A 170 ALA A 181 1 ? 12 
HELX_P HELX_P8  8  GLU C 188 ? LEU C 192 ? GLU A 188 LEU A 192 5 ? 5  
HELX_P HELX_P9  9  ILE C 193 ? LEU C 214 ? ILE A 193 LEU A 214 1 ? 22 
HELX_P HELX_P10 10 LYS C 230 ? LEU C 235 ? LYS A 230 LEU A 235 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D ZN  .  ZN    ? ? ? 1_555 C CYS 245 SG ? ? A ZN  300 A CYS 245 1_555 ? ? ? ? ? ? ?            2.400 ? 
metalc2  metalc ? ? D ZN  .  ZN    ? ? ? 1_555 C CYS 248 SG ? ? A ZN  300 A CYS 248 1_555 ? ? ? ? ? ? ?            2.463 ? 
metalc3  metalc ? ? D ZN  .  ZN    ? ? ? 1_555 C CYS 265 SG ? ? A ZN  300 A CYS 265 1_555 ? ? ? ? ? ? ?            2.189 ? 
metalc4  metalc ? ? D ZN  .  ZN    ? ? ? 1_555 C CYS 268 SG ? ? A ZN  300 A CYS 268 1_555 ? ? ? ? ? ? ?            2.365 ? 
covale1  covale ? ? A DT  6  "O3'" ? ? ? 1_555 A 3DR 7   P  ? ? D DT  6   D 3DR 7   1_555 ? ? ? ? ? ? ?            1.602 ? 
covale2  covale ? ? A 3DR 7  "O3'" ? ? ? 1_555 A DT  8   P  ? ? D 3DR 7   D DT  8   1_555 ? ? ? ? ? ? ?            1.595 ? 
hydrog1  hydrog ? ? A DT  2  N3    ? ? ? 1_555 B DA  14  N1 ? ? D DT  2   E DA  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DT  2  O4    ? ? ? 1_555 B DA  14  N6 ? ? D DT  2   E DA  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DC  3  N3    ? ? ? 1_555 B DG  13  N1 ? ? D DC  3   E DG  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DC  3  N4    ? ? ? 1_555 B DG  13  O6 ? ? D DC  3   E DG  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DC  3  O2    ? ? ? 1_555 B DG  13  N2 ? ? D DC  3   E DG  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DT  4  N3    ? ? ? 1_555 B DA  12  N1 ? ? D DT  4   E DA  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DT  4  O4    ? ? ? 1_555 B DA  12  N6 ? ? D DT  4   E DA  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DT  5  N3    ? ? ? 1_555 B DA  11  N1 ? ? D DT  5   E DA  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DT  5  O4    ? ? ? 1_555 B DA  11  N6 ? ? D DT  5   E DA  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DT  6  N3    ? ? ? 1_555 B DA  10  N1 ? ? D DT  6   E DA  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DT  6  O4    ? ? ? 1_555 B DA  10  N6 ? ? D DT  6   E DA  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DT  8  N3    ? ? ? 1_555 B DA  8   N1 ? ? D DT  8   E DA  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DT  8  O4    ? ? ? 1_555 B DA  8   N6 ? ? D DT  8   E DA  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DT  9  N3    ? ? ? 1_555 B DA  7   N1 ? ? D DT  9   E DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DT  9  O4    ? ? ? 1_555 B DA  7   N6 ? ? D DT  9   E DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DT  10 N3    ? ? ? 1_555 B DA  6   N1 ? ? D DT  10  E DA  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DT  10 O4    ? ? ? 1_555 B DA  6   N6 ? ? D DT  10  E DA  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DC  11 N3    ? ? ? 1_555 B DG  5   N1 ? ? D DC  11  E DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DC  11 N4    ? ? ? 1_555 B DG  5   O6 ? ? D DC  11  E DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DC  11 O2    ? ? ? 1_555 B DG  5   N2 ? ? D DC  11  E DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DT  12 N3    ? ? ? 1_555 B DA  4   N1 ? ? D DT  12  E DA  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DT  12 O4    ? ? ? 1_555 B DA  4   N6 ? ? D DT  12  E DA  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DC  13 N3    ? ? ? 1_555 B DG  3   N1 ? ? D DC  13  E DG  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DC  13 N4    ? ? ? 1_555 B DG  3   O6 ? ? D DC  13  E DG  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DC  13 O2    ? ? ? 1_555 B DG  3   N2 ? ? D DC  13  E DG  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DG  14 N1    ? ? ? 1_555 B DC  2   N3 ? ? D DG  14  E DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DG  14 N2    ? ? ? 1_555 B DC  2   O2 ? ? D DG  14  E DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DG  14 O6    ? ? ? 1_555 B DC  2   N4 ? ? D DG  14  E DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER C 24  ? ALA C 27  ? SER A 24  ALA A 27  
A 2 ASP C 92  ? LYS C 97  ? ASP A 92  LYS A 97  
A 3 GLN C 102 ? ALA C 106 ? GLN A 102 ALA A 106 
A 4 LYS C 78  ? ALA C 82  ? LYS A 78  ALA A 82  
B 1 ILE C 49  ? ARG C 55  ? ILE A 49  ARG A 55  
B 2 TYR C 58  ? ILE C 63  ? TYR A 58  ILE A 63  
B 3 PHE C 67  ? HIS C 72  ? PHE A 67  HIS A 72  
B 4 THR C 113 ? SER C 118 ? THR A 113 SER A 118 
C 1 GLN C 253 ? VAL C 257 ? GLN A 253 VAL A 257 
C 2 ARG C 260 ? PHE C 264 ? ARG A 260 PHE A 264 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER C 24  ? N SER A 24  O LYS C 97  ? O LYS A 97  
A 2 3 N LEU C 94  ? N LEU A 94  O TYR C 105 ? O TYR A 105 
A 3 4 O ALA C 106 ? O ALA A 106 N LYS C 78  ? N LYS A 78  
B 1 2 N SER C 53  ? N SER A 53  O ILE C 60  ? O ILE A 60  
B 2 3 N LEU C 59  ? N LEU A 59  O SER C 71  ? O SER A 71  
B 3 4 N ILE C 70  ? N ILE A 70  O GLU C 115 ? O GLU A 115 
C 1 2 N ILE C 255 ? N ILE A 255 O THR C 262 ? O THR A 262 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 300'   
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL A 1002' 
AC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 1003' 
AC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE GOL A 1004' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  CYS C 245 ? CYS A 245  . ? 1_555 ? 
2  AC1 4  CYS C 248 ? CYS A 248  . ? 1_555 ? 
3  AC1 4  CYS C 265 ? CYS A 265  . ? 1_555 ? 
4  AC1 4  CYS C 268 ? CYS A 268  . ? 1_555 ? 
5  AC2 7  ARG C 16  ? ARG A 16   . ? 1_555 ? 
6  AC2 7  GLN C 20  ? GLN A 20   . ? 1_555 ? 
7  AC2 7  LEU C 81  ? LEU A 81   . ? 1_555 ? 
8  AC2 7  THR C 83  ? THR A 83   . ? 8_775 ? 
9  AC2 7  ASP C 85  ? ASP A 85   . ? 8_775 ? 
10 AC2 7  ASP C 100 ? ASP A 100  . ? 1_555 ? 
11 AC2 7  GLY C 101 ? GLY A 101  . ? 1_555 ? 
12 AC3 8  GLY C 259 ? GLY A 259  . ? 1_555 ? 
13 AC3 8  HOH J .   ? HOH A 1202 . ? 1_555 ? 
14 AC3 8  HOH J .   ? HOH A 1209 . ? 1_555 ? 
15 AC3 8  HOH J .   ? HOH A 1211 . ? 1_555 ? 
16 AC3 8  DT  A 8   ? DT  D 8    . ? 1_555 ? 
17 AC3 8  DA  B 7   ? DA  E 21   . ? 1_555 ? 
18 AC3 8  HOH I .   ? HOH E 220  . ? 1_555 ? 
19 AC3 8  HOH I .   ? HOH E 268  . ? 1_555 ? 
20 AC4 12 LEU C 34  ? LEU A 34   . ? 1_555 ? 
21 AC4 12 TYR C 58  ? TYR A 58   . ? 1_555 ? 
22 AC4 12 HIS C 72  ? HIS A 72   . ? 1_555 ? 
23 AC4 12 ARG C 74  ? ARG A 74   . ? 1_555 ? 
24 AC4 12 THR C 113 ? THR A 113  . ? 1_555 ? 
25 AC4 12 GLU C 115 ? GLU A 115  . ? 1_555 ? 
26 AC4 12 TYR C 125 ? TYR A 125  . ? 1_555 ? 
27 AC4 12 LYS C 129 ? LYS A 129  . ? 1_555 ? 
28 AC4 12 HOH J .   ? HOH A 1065 . ? 1_555 ? 
29 AC4 12 HOH J .   ? HOH A 1159 . ? 1_555 ? 
30 AC4 12 DT  A 9   ? DT  D 9    . ? 1_555 ? 
31 AC4 12 DT  A 10  ? DT  D 10   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1PJJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1PJJ 
_atom_sites.fract_transf_matrix[1][1]   0.010882 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010882 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007021 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DC  A 1 1   ? 91.177  56.903  26.564 1.00 47.80 ? 1    DC  D "O5'" 1 
ATOM   2    C  "C5'" . DC  A 1 1   ? 91.104  55.533  26.156 1.00 47.77 ? 1    DC  D "C5'" 1 
ATOM   3    C  "C4'" . DC  A 1 1   ? 91.839  54.637  27.124 1.00 46.47 ? 1    DC  D "C4'" 1 
ATOM   4    O  "O4'" . DC  A 1 1   ? 93.268  54.810  26.927 1.00 45.98 ? 1    DC  D "O4'" 1 
ATOM   5    C  "C3'" . DC  A 1 1   ? 91.551  55.002  28.580 1.00 47.10 ? 1    DC  D "C3'" 1 
ATOM   6    O  "O3'" . DC  A 1 1   ? 91.289  53.879  29.417 1.00 46.36 ? 1    DC  D "O3'" 1 
ATOM   7    C  "C2'" . DC  A 1 1   ? 92.805  55.704  29.050 1.00 46.81 ? 1    DC  D "C2'" 1 
ATOM   8    C  "C1'" . DC  A 1 1   ? 93.902  55.176  28.144 1.00 44.95 ? 1    DC  D "C1'" 1 
ATOM   9    N  N1    . DC  A 1 1   ? 94.858  56.258  27.863 1.00 42.21 ? 1    DC  D N1    1 
ATOM   10   C  C2    . DC  A 1 1   ? 96.168  56.149  28.337 1.00 39.98 ? 1    DC  D C2    1 
ATOM   11   O  O2    . DC  A 1 1   ? 96.530  55.084  28.861 1.00 38.07 ? 1    DC  D O2    1 
ATOM   12   N  N3    . DC  A 1 1   ? 97.006  57.204  28.207 1.00 39.71 ? 1    DC  D N3    1 
ATOM   13   C  C4    . DC  A 1 1   ? 96.585  58.320  27.608 1.00 40.35 ? 1    DC  D C4    1 
ATOM   14   N  N4    . DC  A 1 1   ? 97.425  59.353  27.544 1.00 40.15 ? 1    DC  D N4    1 
ATOM   15   C  C5    . DC  A 1 1   ? 95.276  58.431  27.055 1.00 41.49 ? 1    DC  D C5    1 
ATOM   16   C  C6    . DC  A 1 1   ? 94.457  57.384  27.199 1.00 40.67 ? 1    DC  D C6    1 
ATOM   17   P  P     . DT  A 1 2   ? 90.764  54.136  30.915 1.00 46.81 ? 2    DT  D P     1 
ATOM   18   O  OP1   . DT  A 1 2   ? 89.733  53.118  31.237 1.00 46.58 ? 2    DT  D OP1   1 
ATOM   19   O  OP2   . DT  A 1 2   ? 90.431  55.579  31.021 1.00 45.10 ? 2    DT  D OP2   1 
ATOM   20   O  "O5'" . DT  A 1 2   ? 92.046  53.858  31.813 1.00 44.42 ? 2    DT  D "O5'" 1 
ATOM   21   C  "C5'" . DT  A 1 2   ? 92.716  52.604  31.752 1.00 44.72 ? 2    DT  D "C5'" 1 
ATOM   22   C  "C4'" . DT  A 1 2   ? 93.766  52.525  32.835 1.00 44.59 ? 2    DT  D "C4'" 1 
ATOM   23   O  "O4'" . DT  A 1 2   ? 94.858  53.426  32.529 1.00 42.89 ? 2    DT  D "O4'" 1 
ATOM   24   C  "C3'" . DT  A 1 2   ? 93.252  52.930  34.214 1.00 45.31 ? 2    DT  D "C3'" 1 
ATOM   25   O  "O3'" . DT  A 1 2   ? 93.800  52.076  35.213 1.00 47.99 ? 2    DT  D "O3'" 1 
ATOM   26   C  "C2'" . DT  A 1 2   ? 93.748  54.355  34.382 1.00 43.84 ? 2    DT  D "C2'" 1 
ATOM   27   C  "C1'" . DT  A 1 2   ? 95.038  54.368  33.577 1.00 41.51 ? 2    DT  D "C1'" 1 
ATOM   28   N  N1    . DT  A 1 2   ? 95.336  55.675  32.958 1.00 38.43 ? 2    DT  D N1    1 
ATOM   29   C  C2    . DT  A 1 2   ? 96.572  56.246  33.185 1.00 36.35 ? 2    DT  D C2    1 
ATOM   30   O  O2    . DT  A 1 2   ? 97.423  55.738  33.895 1.00 36.47 ? 2    DT  D O2    1 
ATOM   31   N  N3    . DT  A 1 2   ? 96.771  57.445  32.550 1.00 34.41 ? 2    DT  D N3    1 
ATOM   32   C  C4    . DT  A 1 2   ? 95.877  58.121  31.742 1.00 34.30 ? 2    DT  D C4    1 
ATOM   33   O  O4    . DT  A 1 2   ? 96.203  59.184  31.223 1.00 35.35 ? 2    DT  D O4    1 
ATOM   34   C  C5    . DT  A 1 2   ? 94.595  57.484  31.571 1.00 35.69 ? 2    DT  D C5    1 
ATOM   35   C  C7    . DT  A 1 2   ? 93.553  58.170  30.747 1.00 36.46 ? 2    DT  D C7    1 
ATOM   36   C  C6    . DT  A 1 2   ? 94.394  56.303  32.170 1.00 37.13 ? 2    DT  D C6    1 
ATOM   37   P  P     . DC  A 1 3   ? 93.315  52.227  36.732 1.00 50.77 ? 3    DC  D P     1 
ATOM   38   O  OP1   . DC  A 1 3   ? 93.429  50.889  37.368 1.00 50.52 ? 3    DC  D OP1   1 
ATOM   39   O  OP2   . DC  A 1 3   ? 92.016  52.947  36.753 1.00 50.03 ? 3    DC  D OP2   1 
ATOM   40   O  "O5'" . DC  A 1 3   ? 94.424  53.175  37.360 1.00 48.76 ? 3    DC  D "O5'" 1 
ATOM   41   C  "C5'" . DC  A 1 3   ? 95.791  52.801  37.308 1.00 47.74 ? 3    DC  D "C5'" 1 
ATOM   42   C  "C4'" . DC  A 1 3   ? 96.633  53.818  38.035 1.00 46.29 ? 3    DC  D "C4'" 1 
ATOM   43   O  "O4'" . DC  A 1 3   ? 96.827  54.992  37.210 1.00 44.81 ? 3    DC  D "O4'" 1 
ATOM   44   C  "C3'" . DC  A 1 3   ? 96.013  54.304  39.344 1.00 46.20 ? 3    DC  D "C3'" 1 
ATOM   45   O  "O3'" . DC  A 1 3   ? 97.018  54.354  40.355 1.00 48.10 ? 3    DC  D "O3'" 1 
ATOM   46   C  "C2'" . DC  A 1 3   ? 95.491  55.690  39.000 1.00 45.19 ? 3    DC  D "C2'" 1 
ATOM   47   C  "C1'" . DC  A 1 3   ? 96.468  56.156  37.935 1.00 43.27 ? 3    DC  D "C1'" 1 
ATOM   48   N  N1    . DC  A 1 3   ? 95.933  57.135  36.972 1.00 40.45 ? 3    DC  D N1    1 
ATOM   49   C  C2    . DC  A 1 3   ? 96.752  58.196  36.571 1.00 39.23 ? 3    DC  D C2    1 
ATOM   50   O  O2    . DC  A 1 3   ? 97.891  58.288  37.053 1.00 38.64 ? 3    DC  D O2    1 
ATOM   51   N  N3    . DC  A 1 3   ? 96.284  59.091  35.670 1.00 36.99 ? 3    DC  D N3    1 
ATOM   52   C  C4    . DC  A 1 3   ? 95.051  58.958  35.178 1.00 36.95 ? 3    DC  D C4    1 
ATOM   53   N  N4    . DC  A 1 3   ? 94.633  59.864  34.289 1.00 34.42 ? 3    DC  D N4    1 
ATOM   54   C  C5    . DC  A 1 3   ? 94.190  57.892  35.576 1.00 37.07 ? 3    DC  D C5    1 
ATOM   55   C  C6    . DC  A 1 3   ? 94.667  57.012  36.468 1.00 39.05 ? 3    DC  D C6    1 
ATOM   56   P  P     . DT  A 1 4   ? 96.659  54.933  41.807 1.00 49.28 ? 4    DT  D P     1 
ATOM   57   O  OP1   . DT  A 1 4   ? 97.455  54.157  42.790 1.00 49.08 ? 4    DT  D OP1   1 
ATOM   58   O  OP2   . DT  A 1 4   ? 95.182  55.024  41.961 1.00 48.28 ? 4    DT  D OP2   1 
ATOM   59   O  "O5'" . DT  A 1 4   ? 97.253  56.405  41.740 1.00 46.29 ? 4    DT  D "O5'" 1 
ATOM   60   C  "C5'" . DT  A 1 4   ? 98.588  56.610  41.298 1.00 44.27 ? 4    DT  D "C5'" 1 
ATOM   61   C  "C4'" . DT  A 1 4   ? 98.987  58.049  41.502 1.00 42.05 ? 4    DT  D "C4'" 1 
ATOM   62   O  "O4'" . DT  A 1 4   ? 98.484  58.877  40.427 1.00 41.06 ? 4    DT  D "O4'" 1 
ATOM   63   C  "C3'" . DT  A 1 4   ? 98.463  58.654  42.803 1.00 41.34 ? 4    DT  D "C3'" 1 
ATOM   64   O  "O3'" . DT  A 1 4   ? 99.509  59.365  43.452 1.00 41.14 ? 4    DT  D "O3'" 1 
ATOM   65   C  "C2'" . DT  A 1 4   ? 97.352  59.588  42.350 1.00 40.39 ? 4    DT  D "C2'" 1 
ATOM   66   C  "C1'" . DT  A 1 4   ? 97.797  59.999  40.955 1.00 40.37 ? 4    DT  D "C1'" 1 
ATOM   67   N  N1    . DT  A 1 4   ? 96.691  60.323  40.030 1.00 39.22 ? 4    DT  D N1    1 
ATOM   68   C  C2    . DT  A 1 4   ? 96.813  61.436  39.224 1.00 39.21 ? 4    DT  D C2    1 
ATOM   69   O  O2    . DT  A 1 4   ? 97.785  62.176  39.245 1.00 40.77 ? 4    DT  D O2    1 
ATOM   70   N  N3    . DT  A 1 4   ? 95.745  61.656  38.388 1.00 36.89 ? 4    DT  D N3    1 
ATOM   71   C  C4    . DT  A 1 4   ? 94.595  60.897  38.286 1.00 37.30 ? 4    DT  D C4    1 
ATOM   72   O  O4    . DT  A 1 4   ? 93.720  61.218  37.487 1.00 38.41 ? 4    DT  D O4    1 
ATOM   73   C  C5    . DT  A 1 4   ? 94.531  59.753  39.164 1.00 37.15 ? 4    DT  D C5    1 
ATOM   74   C  C7    . DT  A 1 4   ? 93.317  58.880  39.130 1.00 37.39 ? 4    DT  D C7    1 
ATOM   75   C  C6    . DT  A 1 4   ? 95.568  59.525  39.979 1.00 37.71 ? 4    DT  D C6    1 
ATOM   76   P  P     . DT  A 1 5   ? 99.270  59.971  44.916 1.00 41.47 ? 5    DT  D P     1 
ATOM   77   O  OP1   . DT  A 1 5   ? 100.528 59.774  45.678 1.00 40.43 ? 5    DT  D OP1   1 
ATOM   78   O  OP2   . DT  A 1 5   ? 97.986  59.467  45.466 1.00 40.85 ? 5    DT  D OP2   1 
ATOM   79   O  "O5'" . DT  A 1 5   ? 99.109  61.518  44.609 1.00 38.06 ? 5    DT  D "O5'" 1 
ATOM   80   C  "C5'" . DT  A 1 5   ? 100.038 62.177  43.761 1.00 36.94 ? 5    DT  D "C5'" 1 
ATOM   81   C  "C4'" . DT  A 1 5   ? 99.661  63.630  43.640 1.00 36.29 ? 5    DT  D "C4'" 1 
ATOM   82   O  "O4'" . DT  A 1 5   ? 98.780  63.824  42.503 1.00 37.80 ? 5    DT  D "O4'" 1 
ATOM   83   C  "C3'" . DT  A 1 5   ? 98.898  64.093  44.879 1.00 35.10 ? 5    DT  D "C3'" 1 
ATOM   84   O  "O3'" . DT  A 1 5   ? 99.494  65.225  45.491 1.00 31.64 ? 5    DT  D "O3'" 1 
ATOM   85   C  "C2'" . DT  A 1 5   ? 97.496  64.395  44.381 1.00 36.03 ? 5    DT  D "C2'" 1 
ATOM   86   C  "C1'" . DT  A 1 5   ? 97.656  64.603  42.882 1.00 37.29 ? 5    DT  D "C1'" 1 
ATOM   87   N  N1    . DT  A 1 5   ? 96.476  64.113  42.131 1.00 34.42 ? 5    DT  D N1    1 
ATOM   88   C  C2    . DT  A 1 5   ? 96.068  64.770  40.983 1.00 34.00 ? 5    DT  D C2    1 
ATOM   89   O  O2    . DT  A 1 5   ? 96.660  65.722  40.505 1.00 34.91 ? 5    DT  D O2    1 
ATOM   90   N  N3    . DT  A 1 5   ? 94.923  64.264  40.414 1.00 32.28 ? 5    DT  D N3    1 
ATOM   91   C  C4    . DT  A 1 5   ? 94.165  63.199  40.864 1.00 32.83 ? 5    DT  D C4    1 
ATOM   92   O  O4    . DT  A 1 5   ? 93.142  62.878  40.265 1.00 32.57 ? 5    DT  D O4    1 
ATOM   93   C  C5    . DT  A 1 5   ? 94.666  62.544  42.052 1.00 32.71 ? 5    DT  D C5    1 
ATOM   94   C  C7    . DT  A 1 5   ? 93.920  61.373  42.606 1.00 32.88 ? 5    DT  D C7    1 
ATOM   95   C  C6    . DT  A 1 5   ? 95.782  63.023  42.610 1.00 33.07 ? 5    DT  D C6    1 
ATOM   96   P  P     . DT  A 1 6   ? 98.978  65.694  46.934 1.00 28.55 ? 6    DT  D P     1 
ATOM   97   O  OP1   . DT  A 1 6   ? 100.159 66.172  47.698 1.00 27.40 ? 6    DT  D OP1   1 
ATOM   98   O  OP2   . DT  A 1 6   ? 98.111  64.640  47.506 1.00 28.94 ? 6    DT  D OP2   1 
ATOM   99   O  "O5'" . DT  A 1 6   ? 98.091  66.957  46.564 1.00 23.86 ? 6    DT  D "O5'" 1 
ATOM   100  C  "C5'" . DT  A 1 6   ? 98.663  68.017  45.811 1.00 23.79 ? 6    DT  D "C5'" 1 
ATOM   101  C  "C4'" . DT  A 1 6   ? 97.627  69.075  45.525 1.00 24.32 ? 6    DT  D "C4'" 1 
ATOM   102  O  "O4'" . DT  A 1 6   ? 96.908  68.715  44.322 1.00 25.37 ? 6    DT  D "O4'" 1 
ATOM   103  C  "C3'" . DT  A 1 6   ? 96.587  69.170  46.634 1.00 22.25 ? 6    DT  D "C3'" 1 
ATOM   104  O  "O3'" . DT  A 1 6   ? 96.732  70.316  47.444 1.00 22.54 ? 6    DT  D "O3'" 1 
ATOM   105  C  "C2'" . DT  A 1 6   ? 95.240  69.147  45.937 1.00 25.94 ? 6    DT  D "C2'" 1 
ATOM   106  C  "C1'" . DT  A 1 6   ? 95.526  69.025  44.449 1.00 25.29 ? 6    DT  D "C1'" 1 
ATOM   107  N  N1    . DT  A 1 6   ? 94.754  67.882  43.934 1.00 24.44 ? 6    DT  D N1    1 
ATOM   108  C  C2    . DT  A 1 6   ? 94.090  67.974  42.730 1.00 25.23 ? 6    DT  D C2    1 
ATOM   109  O  O2    . DT  A 1 6   ? 94.164  68.944  41.993 1.00 24.37 ? 6    DT  D O2    1 
ATOM   110  N  N3    . DT  A 1 6   ? 93.326  66.872  42.419 1.00 24.45 ? 6    DT  D N3    1 
ATOM   111  C  C4    . DT  A 1 6   ? 93.170  65.720  43.172 1.00 24.48 ? 6    DT  D C4    1 
ATOM   112  O  O4    . DT  A 1 6   ? 92.420  64.829  42.783 1.00 25.90 ? 6    DT  D O4    1 
ATOM   113  C  C5    . DT  A 1 6   ? 93.928  65.680  44.400 1.00 25.77 ? 6    DT  D C5    1 
ATOM   114  C  C7    . DT  A 1 6   ? 93.839  64.470  45.276 1.00 26.53 ? 6    DT  D C7    1 
ATOM   115  C  C6    . DT  A 1 6   ? 94.678  66.742  44.706 1.00 24.87 ? 6    DT  D C6    1 
HETATM 116  O  "O5'" . 3DR A 1 7   ? 96.690  71.526  49.645 1.00 24.37 ? 7    3DR D "O5'" 1 
HETATM 117  P  P     . 3DR A 1 7   ? 96.981  70.103  49.012 1.00 22.72 ? 7    3DR D P     1 
HETATM 118  O  OP1   . 3DR A 1 7   ? 98.415  69.817  49.268 1.00 24.92 ? 7    3DR D OP1   1 
HETATM 119  O  OP2   . 3DR A 1 7   ? 95.973  69.162  49.555 1.00 23.05 ? 7    3DR D OP2   1 
HETATM 120  C  "C2'" . 3DR A 1 7   ? 93.942  75.095  49.400 1.00 24.77 ? 7    3DR D "C2'" 1 
HETATM 121  C  "C5'" . 3DR A 1 7   ? 95.403  72.093  49.572 1.00 24.43 ? 7    3DR D "C5'" 1 
HETATM 122  C  "C4'" . 3DR A 1 7   ? 95.390  73.410  50.304 1.00 26.22 ? 7    3DR D "C4'" 1 
HETATM 123  O  "O4'" . 3DR A 1 7   ? 96.171  74.398  49.593 1.00 25.80 ? 7    3DR D "O4'" 1 
HETATM 124  C  "C1'" . 3DR A 1 7   ? 95.387  75.562  49.368 1.00 26.46 ? 7    3DR D "C1'" 1 
HETATM 125  C  "C3'" . 3DR A 1 7   ? 93.997  74.007  50.456 1.00 23.53 ? 7    3DR D "C3'" 1 
HETATM 126  O  "O3'" . 3DR A 1 7   ? 93.680  74.318  51.795 1.00 20.57 ? 7    3DR D "O3'" 1 
ATOM   127  P  P     . DT  A 1 8   ? 92.960  73.225  52.707 1.00 20.94 ? 8    DT  D P     1 
ATOM   128  O  OP1   . DT  A 1 8   ? 92.540  73.957  53.933 1.00 20.45 ? 8    DT  D OP1   1 
ATOM   129  O  OP2   . DT  A 1 8   ? 93.802  72.006  52.827 1.00 20.79 ? 8    DT  D OP2   1 
ATOM   130  O  "O5'" . DT  A 1 8   ? 91.647  72.845  51.889 1.00 19.89 ? 8    DT  D "O5'" 1 
ATOM   131  C  "C5'" . DT  A 1 8   ? 90.730  73.862  51.509 1.00 20.55 ? 8    DT  D "C5'" 1 
ATOM   132  C  "C4'" . DT  A 1 8   ? 89.328  73.491  51.930 1.00 19.71 ? 8    DT  D "C4'" 1 
ATOM   133  O  "O4'" . DT  A 1 8   ? 88.824  72.454  51.056 1.00 20.76 ? 8    DT  D "O4'" 1 
ATOM   134  C  "C3'" . DT  A 1 8   ? 89.170  72.980  53.365 1.00 20.16 ? 8    DT  D "C3'" 1 
ATOM   135  O  "O3'" . DT  A 1 8   ? 88.082  73.681  53.993 1.00 21.50 ? 8    DT  D "O3'" 1 
ATOM   136  C  "C2'" . DT  A 1 8   ? 88.914  71.487  53.194 1.00 20.11 ? 8    DT  D "C2'" 1 
ATOM   137  C  "C1'" . DT  A 1 8   ? 88.284  71.380  51.804 1.00 21.32 ? 8    DT  D "C1'" 1 
ATOM   138  N  N1    . DT  A 1 8   ? 88.571  70.137  51.047 1.00 22.03 ? 8    DT  D N1    1 
ATOM   139  C  C2    . DT  A 1 8   ? 87.558  69.568  50.294 1.00 23.53 ? 8    DT  D C2    1 
ATOM   140  O  O2    . DT  A 1 8   ? 86.425  70.015  50.242 1.00 23.17 ? 8    DT  D O2    1 
ATOM   141  N  N3    . DT  A 1 8   ? 87.928  68.447  49.592 1.00 21.53 ? 8    DT  D N3    1 
ATOM   142  C  C4    . DT  A 1 8   ? 89.175  67.850  49.564 1.00 23.63 ? 8    DT  D C4    1 
ATOM   143  O  O4    . DT  A 1 8   ? 89.364  66.851  48.869 1.00 22.75 ? 8    DT  D O4    1 
ATOM   144  C  C5    . DT  A 1 8   ? 90.180  68.485  50.382 1.00 24.27 ? 8    DT  D C5    1 
ATOM   145  C  C7    . DT  A 1 8   ? 91.559  67.902  50.415 1.00 23.93 ? 8    DT  D C7    1 
ATOM   146  C  C6    . DT  A 1 8   ? 89.832  69.578  51.079 1.00 24.45 ? 8    DT  D C6    1 
ATOM   147  P  P     . DT  A 1 9   ? 87.716  73.411  55.545 1.00 23.15 ? 9    DT  D P     1 
ATOM   148  O  OP1   . DT  A 1 9   ? 87.227  74.706  56.098 1.00 22.52 ? 9    DT  D OP1   1 
ATOM   149  O  OP2   . DT  A 1 9   ? 88.804  72.683  56.238 1.00 23.16 ? 9    DT  D OP2   1 
ATOM   150  O  "O5'" . DT  A 1 9   ? 86.441  72.481  55.418 1.00 21.26 ? 9    DT  D "O5'" 1 
ATOM   151  C  "C5'" . DT  A 1 9   ? 85.377  72.912  54.587 1.00 19.51 ? 9    DT  D "C5'" 1 
ATOM   152  C  "C4'" . DT  A 1 9   ? 84.427  71.781  54.289 1.00 20.83 ? 9    DT  D "C4'" 1 
ATOM   153  O  "O4'" . DT  A 1 9   ? 85.051  70.774  53.457 1.00 19.29 ? 9    DT  D "O4'" 1 
ATOM   154  C  "C3'" . DT  A 1 9   ? 83.827  71.054  55.492 1.00 20.34 ? 9    DT  D "C3'" 1 
ATOM   155  O  "O3'" . DT  A 1 9   ? 82.409  71.145  55.364 1.00 24.09 ? 9    DT  D "O3'" 1 
ATOM   156  C  "C2'" . DT  A 1 9   ? 84.325  69.619  55.339 1.00 21.07 ? 9    DT  D "C2'" 1 
ATOM   157  C  "C1'" . DT  A 1 9   ? 84.569  69.503  53.839 1.00 21.65 ? 9    DT  D "C1'" 1 
ATOM   158  N  N1    . DT  A 1 9   ? 85.566  68.497  53.398 1.00 19.80 ? 9    DT  D N1    1 
ATOM   159  C  C2    . DT  A 1 9   ? 85.195  67.593  52.421 1.00 23.32 ? 9    DT  D C2    1 
ATOM   160  O  O2    . DT  A 1 9   ? 84.074  67.550  51.932 1.00 22.56 ? 9    DT  D O2    1 
ATOM   161  N  N3    . DT  A 1 9   ? 86.193  66.731  52.031 1.00 21.77 ? 9    DT  D N3    1 
ATOM   162  C  C4    . DT  A 1 9   ? 87.483  66.672  52.513 1.00 22.77 ? 9    DT  D C4    1 
ATOM   163  O  O4    . DT  A 1 9   ? 88.271  65.846  52.055 1.00 24.12 ? 9    DT  D O4    1 
ATOM   164  C  C5    . DT  A 1 9   ? 87.797  67.625  53.551 1.00 21.18 ? 9    DT  D C5    1 
ATOM   165  C  C7    . DT  A 1 9   ? 89.168  67.615  54.147 1.00 19.34 ? 9    DT  D C7    1 
ATOM   166  C  C6    . DT  A 1 9   ? 86.836  68.481  53.937 1.00 21.24 ? 9    DT  D C6    1 
ATOM   167  P  P     . DT  A 1 10  ? 81.455  70.766  56.597 1.00 24.91 ? 10   DT  D P     1 
ATOM   168  O  OP1   . DT  A 1 10  ? 80.269  71.649  56.464 1.00 26.13 ? 10   DT  D OP1   1 
ATOM   169  O  OP2   . DT  A 1 10  ? 82.200  70.718  57.874 1.00 24.60 ? 10   DT  D OP2   1 
ATOM   170  O  "O5'" . DT  A 1 10  ? 81.003  69.296  56.210 1.00 25.46 ? 10   DT  D "O5'" 1 
ATOM   171  C  "C5'" . DT  A 1 10  ? 80.358  69.067  54.967 1.00 29.46 ? 10   DT  D "C5'" 1 
ATOM   172  C  "C4'" . DT  A 1 10  ? 80.150  67.590  54.750 1.00 32.39 ? 10   DT  D "C4'" 1 
ATOM   173  O  "O4'" . DT  A 1 10  ? 81.360  66.959  54.264 1.00 30.79 ? 10   DT  D "O4'" 1 
ATOM   174  C  "C3'" . DT  A 1 10  ? 79.730  66.820  56.002 1.00 34.84 ? 10   DT  D "C3'" 1 
ATOM   175  O  "O3'" . DT  A 1 10  ? 78.642  65.969  55.667 1.00 41.80 ? 10   DT  D "O3'" 1 
ATOM   176  C  "C2'" . DT  A 1 10  ? 80.953  65.980  56.329 1.00 32.61 ? 10   DT  D "C2'" 1 
ATOM   177  C  "C1'" . DT  A 1 10  ? 81.534  65.735  54.950 1.00 30.00 ? 10   DT  D "C1'" 1 
ATOM   178  N  N1    . DT  A 1 10  ? 82.965  65.395  54.925 1.00 27.59 ? 10   DT  D N1    1 
ATOM   179  C  C2    . DT  A 1 10  ? 83.395  64.462  54.005 1.00 27.08 ? 10   DT  D C2    1 
ATOM   180  O  O2    . DT  A 1 10  ? 82.652  63.925  53.197 1.00 25.98 ? 10   DT  D O2    1 
ATOM   181  N  N3    . DT  A 1 10  ? 84.735  64.179  54.063 1.00 24.25 ? 10   DT  D N3    1 
ATOM   182  C  C4    . DT  A 1 10  ? 85.665  64.726  54.927 1.00 23.57 ? 10   DT  D C4    1 
ATOM   183  O  O4    . DT  A 1 10  ? 86.832  64.361  54.873 1.00 23.49 ? 10   DT  D O4    1 
ATOM   184  C  C5    . DT  A 1 10  ? 85.146  65.713  55.850 1.00 24.26 ? 10   DT  D C5    1 
ATOM   185  C  C7    . DT  A 1 10  ? 86.083  66.377  56.812 1.00 24.97 ? 10   DT  D C7    1 
ATOM   186  C  C6    . DT  A 1 10  ? 83.841  65.991  55.803 1.00 23.98 ? 10   DT  D C6    1 
ATOM   187  P  P     . DC  A 1 11  ? 77.811  65.231  56.825 1.00 44.17 ? 11   DC  D P     1 
ATOM   188  O  OP1   . DC  A 1 11  ? 76.612  66.057  57.114 1.00 44.48 ? 11   DC  D OP1   1 
ATOM   189  O  OP2   . DC  A 1 11  ? 78.709  64.826  57.938 1.00 42.73 ? 11   DC  D OP2   1 
ATOM   190  O  "O5'" . DC  A 1 11  ? 77.336  63.931  56.051 1.00 45.86 ? 11   DC  D "O5'" 1 
ATOM   191  C  "C5'" . DC  A 1 11  ? 77.146  63.983  54.642 1.00 44.11 ? 11   DC  D "C5'" 1 
ATOM   192  C  "C4'" . DC  A 1 11  ? 77.533  62.664  54.023 1.00 44.81 ? 11   DC  D "C4'" 1 
ATOM   193  O  "O4'" . DC  A 1 11  ? 78.977  62.582  53.879 1.00 41.94 ? 11   DC  D "O4'" 1 
ATOM   194  C  "C3'" . DC  A 1 11  ? 77.110  61.489  54.902 1.00 44.80 ? 11   DC  D "C3'" 1 
ATOM   195  O  "O3'" . DC  A 1 11  ? 76.406  60.488  54.179 1.00 46.82 ? 11   DC  D "O3'" 1 
ATOM   196  C  "C2'" . DC  A 1 11  ? 78.417  60.929  55.430 1.00 43.45 ? 11   DC  D "C2'" 1 
ATOM   197  C  "C1'" . DC  A 1 11  ? 79.432  61.333  54.376 1.00 41.11 ? 11   DC  D "C1'" 1 
ATOM   198  N  N1    . DC  A 1 11  ? 80.775  61.518  54.956 1.00 36.55 ? 11   DC  D N1    1 
ATOM   199  C  C2    . DC  A 1 11  ? 81.860  60.812  54.415 1.00 34.57 ? 11   DC  D C2    1 
ATOM   200  O  O2    . DC  A 1 11  ? 81.684  60.108  53.412 1.00 34.57 ? 11   DC  D O2    1 
ATOM   201  N  N3    . DC  A 1 11  ? 83.073  60.918  55.000 1.00 32.80 ? 11   DC  D N3    1 
ATOM   202  C  C4    . DC  A 1 11  ? 83.229  61.696  56.073 1.00 32.52 ? 11   DC  D C4    1 
ATOM   203  N  N4    . DC  A 1 11  ? 84.437  61.748  56.637 1.00 31.03 ? 11   DC  D N4    1 
ATOM   204  C  C5    . DC  A 1 11  ? 82.153  62.452  56.620 1.00 32.37 ? 11   DC  D C5    1 
ATOM   205  C  C6    . DC  A 1 11  ? 80.957  62.338  56.033 1.00 34.04 ? 11   DC  D C6    1 
ATOM   206  P  P     . DT  A 1 12  ? 75.745  59.267  54.983 1.00 47.29 ? 12   DT  D P     1 
ATOM   207  O  OP1   . DT  A 1 12  ? 74.310  59.188  54.603 1.00 49.46 ? 12   DT  D OP1   1 
ATOM   208  O  OP2   . DT  A 1 12  ? 76.116  59.385  56.418 1.00 45.89 ? 12   DT  D OP2   1 
ATOM   209  O  "O5'" . DT  A 1 12  ? 76.504  58.007  54.388 1.00 47.43 ? 12   DT  D "O5'" 1 
ATOM   210  C  "C5'" . DT  A 1 12  ? 76.756  57.911  52.992 1.00 47.55 ? 12   DT  D "C5'" 1 
ATOM   211  C  "C4'" . DT  A 1 12  ? 77.587  56.684  52.710 1.00 47.72 ? 12   DT  D "C4'" 1 
ATOM   212  O  "O4'" . DT  A 1 12  ? 78.948  56.912  53.145 1.00 46.82 ? 12   DT  D "O4'" 1 
ATOM   213  C  "C3'" . DT  A 1 12  ? 77.099  55.448  53.462 1.00 48.38 ? 12   DT  D "C3'" 1 
ATOM   214  O  "O3'" . DT  A 1 12  ? 77.201  54.293  52.626 1.00 50.73 ? 12   DT  D "O3'" 1 
ATOM   215  C  "C2'" . DT  A 1 12  ? 78.027  55.370  54.663 1.00 46.49 ? 12   DT  D "C2'" 1 
ATOM   216  C  "C1'" . DT  A 1 12  ? 79.325  55.958  54.126 1.00 44.86 ? 12   DT  D "C1'" 1 
ATOM   217  N  N1    . DT  A 1 12  ? 80.162  56.654  55.127 1.00 40.65 ? 12   DT  D N1    1 
ATOM   218  C  C2    . DT  A 1 12  ? 81.501  56.333  55.187 1.00 39.11 ? 12   DT  D C2    1 
ATOM   219  O  O2    . DT  A 1 12  ? 82.014  55.480  54.483 1.00 38.26 ? 12   DT  D O2    1 
ATOM   220  N  N3    . DT  A 1 12  ? 82.220  57.049  56.110 1.00 36.78 ? 12   DT  D N3    1 
ATOM   221  C  C4    . DT  A 1 12  ? 81.746  58.025  56.964 1.00 36.59 ? 12   DT  D C4    1 
ATOM   222  O  O4    . DT  A 1 12  ? 82.517  58.602  57.722 1.00 36.84 ? 12   DT  D O4    1 
ATOM   223  C  C5    . DT  A 1 12  ? 80.331  58.289  56.872 1.00 37.67 ? 12   DT  D C5    1 
ATOM   224  C  C7    . DT  A 1 12  ? 79.725  59.304  57.790 1.00 37.20 ? 12   DT  D C7    1 
ATOM   225  C  C6    . DT  A 1 12  ? 79.619  57.604  55.966 1.00 38.83 ? 12   DT  D C6    1 
ATOM   226  P  P     . DC  A 1 13  ? 76.619  52.888  53.141 1.00 52.94 ? 13   DC  D P     1 
ATOM   227  O  OP1   . DC  A 1 13  ? 76.111  52.151  51.954 1.00 53.16 ? 13   DC  D OP1   1 
ATOM   228  O  OP2   . DC  A 1 13  ? 75.718  53.128  54.299 1.00 51.57 ? 13   DC  D OP2   1 
ATOM   229  O  "O5'" . DC  A 1 13  ? 77.922  52.149  53.666 1.00 49.94 ? 13   DC  D "O5'" 1 
ATOM   230  C  "C5'" . DC  A 1 13  ? 79.064  52.036  52.829 1.00 48.81 ? 13   DC  D "C5'" 1 
ATOM   231  C  "C4'" . DC  A 1 13  ? 80.175  51.332  53.567 1.00 47.71 ? 13   DC  D "C4'" 1 
ATOM   232  O  "O4'" . DC  A 1 13  ? 80.853  52.247  54.462 1.00 46.85 ? 13   DC  D "O4'" 1 
ATOM   233  C  "C3'" . DC  A 1 13  ? 79.688  50.168  54.428 1.00 47.42 ? 13   DC  D "C3'" 1 
ATOM   234  O  "O3'" . DC  A 1 13  ? 80.556  49.053  54.254 1.00 48.78 ? 13   DC  D "O3'" 1 
ATOM   235  C  "C2'" . DC  A 1 13  ? 79.762  50.711  55.846 1.00 46.45 ? 13   DC  D "C2'" 1 
ATOM   236  C  "C1'" . DC  A 1 13  ? 80.925  51.688  55.762 1.00 44.58 ? 13   DC  D "C1'" 1 
ATOM   237  N  N1    . DC  A 1 13  ? 80.893  52.799  56.732 1.00 41.70 ? 13   DC  D N1    1 
ATOM   238  C  C2    . DC  A 1 13  ? 82.071  53.139  57.406 1.00 40.50 ? 13   DC  D C2    1 
ATOM   239  O  O2    . DC  A 1 13  ? 83.100  52.480  57.191 1.00 41.04 ? 13   DC  D O2    1 
ATOM   240  N  N3    . DC  A 1 13  ? 82.062  54.174  58.276 1.00 38.12 ? 13   DC  D N3    1 
ATOM   241  C  C4    . DC  A 1 13  ? 80.934  54.854  58.492 1.00 38.65 ? 13   DC  D C4    1 
ATOM   242  N  N4    . DC  A 1 13  ? 80.974  55.871  59.355 1.00 36.80 ? 13   DC  D N4    1 
ATOM   243  C  C5    . DC  A 1 13  ? 79.715  54.520  57.831 1.00 38.67 ? 13   DC  D C5    1 
ATOM   244  C  C6    . DC  A 1 13  ? 79.740  53.495  56.967 1.00 40.38 ? 13   DC  D C6    1 
ATOM   245  P  P     . DG  A 1 14  ? 80.048  47.584  54.651 1.00 49.23 ? 14   DG  D P     1 
ATOM   246  O  OP1   . DG  A 1 14  ? 80.477  46.675  53.556 1.00 49.84 ? 14   DG  D OP1   1 
ATOM   247  O  OP2   . DG  A 1 14  ? 78.613  47.648  55.036 1.00 48.30 ? 14   DG  D OP2   1 
ATOM   248  O  "O5'" . DG  A 1 14  ? 80.911  47.254  55.945 1.00 47.34 ? 14   DG  D "O5'" 1 
ATOM   249  C  "C5'" . DG  A 1 14  ? 82.333  47.238  55.874 1.00 44.86 ? 14   DG  D "C5'" 1 
ATOM   250  C  "C4'" . DG  A 1 14  ? 82.926  47.141  57.259 1.00 44.41 ? 14   DG  D "C4'" 1 
ATOM   251  O  "O4'" . DG  A 1 14  ? 82.822  48.415  57.944 1.00 43.67 ? 14   DG  D "O4'" 1 
ATOM   252  C  "C3'" . DG  A 1 14  ? 82.248  46.114  58.169 1.00 43.57 ? 14   DG  D "C3'" 1 
ATOM   253  O  "O3'" . DG  A 1 14  ? 83.248  45.532  59.006 1.00 45.14 ? 14   DG  D "O3'" 1 
ATOM   254  C  "C2'" . DG  A 1 14  ? 81.352  46.974  59.044 1.00 42.43 ? 14   DG  D "C2'" 1 
ATOM   255  C  "C1'" . DG  A 1 14  ? 82.215  48.212  59.210 1.00 41.45 ? 14   DG  D "C1'" 1 
ATOM   256  N  N9    . DG  A 1 14  ? 81.514  49.438  59.585 1.00 39.01 ? 14   DG  D N9    1 
ATOM   257  C  C8    . DG  A 1 14  ? 80.202  49.760  59.337 1.00 37.56 ? 14   DG  D C8    1 
ATOM   258  N  N7    . DG  A 1 14  ? 79.861  50.926  59.819 1.00 37.48 ? 14   DG  D N7    1 
ATOM   259  C  C5    . DG  A 1 14  ? 81.018  51.404  60.417 1.00 35.58 ? 14   DG  D C5    1 
ATOM   260  C  C6    . DG  A 1 14  ? 81.259  52.619  61.114 1.00 34.90 ? 14   DG  D C6    1 
ATOM   261  O  O6    . DG  A 1 14  ? 80.468  53.541  61.355 1.00 34.95 ? 14   DG  D O6    1 
ATOM   262  N  N1    . DG  A 1 14  ? 82.576  52.704  61.555 1.00 32.81 ? 14   DG  D N1    1 
ATOM   263  C  C2    . DG  A 1 14  ? 83.539  51.744  61.357 1.00 34.18 ? 14   DG  D C2    1 
ATOM   264  N  N2    . DG  A 1 14  ? 84.757  52.014  61.855 1.00 30.47 ? 14   DG  D N2    1 
ATOM   265  N  N3    . DG  A 1 14  ? 83.325  50.603  60.716 1.00 34.69 ? 14   DG  D N3    1 
ATOM   266  C  C4    . DG  A 1 14  ? 82.051  50.502  60.276 1.00 36.57 ? 14   DG  D C4    1 
ATOM   267  O  "O5'" . DG  B 2 1   ? 79.424  60.356  67.869 1.00 55.45 ? 15   DG  E "O5'" 1 
ATOM   268  C  "C5'" . DG  B 2 1   ? 80.047  60.612  69.133 1.00 54.50 ? 15   DG  E "C5'" 1 
ATOM   269  C  "C4'" . DG  B 2 1   ? 81.264  59.743  69.341 1.00 54.53 ? 15   DG  E "C4'" 1 
ATOM   270  O  "O4'" . DG  B 2 1   ? 80.869  58.351  69.228 1.00 53.50 ? 15   DG  E "O4'" 1 
ATOM   271  C  "C3'" . DG  B 2 1   ? 82.353  59.969  68.293 1.00 55.69 ? 15   DG  E "C3'" 1 
ATOM   272  O  "O3'" . DG  B 2 1   ? 83.660  59.984  68.863 1.00 58.30 ? 15   DG  E "O3'" 1 
ATOM   273  C  "C2'" . DG  B 2 1   ? 82.206  58.798  67.341 1.00 53.62 ? 15   DG  E "C2'" 1 
ATOM   274  C  "C1'" . DG  B 2 1   ? 81.590  57.698  68.191 1.00 50.04 ? 15   DG  E "C1'" 1 
ATOM   275  N  N9    . DG  B 2 1   ? 80.640  56.921  67.399 1.00 45.50 ? 15   DG  E N9    1 
ATOM   276  C  C8    . DG  B 2 1   ? 79.391  57.323  66.989 1.00 43.92 ? 15   DG  E C8    1 
ATOM   277  N  N7    . DG  B 2 1   ? 78.813  56.467  66.192 1.00 42.86 ? 15   DG  E N7    1 
ATOM   278  C  C5    . DG  B 2 1   ? 79.725  55.425  66.087 1.00 42.08 ? 15   DG  E C5    1 
ATOM   279  C  C6    . DG  B 2 1   ? 79.666  54.223  65.333 1.00 40.05 ? 15   DG  E C6    1 
ATOM   280  O  O6    . DG  B 2 1   ? 78.782  53.843  64.557 1.00 39.49 ? 15   DG  E O6    1 
ATOM   281  N  N1    . DG  B 2 1   ? 80.794  53.437  65.536 1.00 38.54 ? 15   DG  E N1    1 
ATOM   282  C  C2    . DG  B 2 1   ? 81.852  53.768  66.342 1.00 40.70 ? 15   DG  E C2    1 
ATOM   283  N  N2    . DG  B 2 1   ? 82.841  52.864  66.416 1.00 39.91 ? 15   DG  E N2    1 
ATOM   284  N  N3    . DG  B 2 1   ? 81.935  54.899  67.029 1.00 41.33 ? 15   DG  E N3    1 
ATOM   285  C  C4    . DG  B 2 1   ? 80.843  55.674  66.856 1.00 42.86 ? 15   DG  E C4    1 
ATOM   286  P  P     . DC  B 2 2   ? 84.912  60.379  67.935 1.00 60.89 ? 16   DC  E P     1 
ATOM   287  O  OP1   . DC  B 2 2   ? 85.983  60.943  68.801 1.00 60.21 ? 16   DC  E OP1   1 
ATOM   288  O  OP2   . DC  B 2 2   ? 84.404  61.169  66.783 1.00 58.51 ? 16   DC  E OP2   1 
ATOM   289  O  "O5'" . DC  B 2 2   ? 85.407  58.976  67.368 1.00 58.47 ? 16   DC  E "O5'" 1 
ATOM   290  C  "C5'" . DC  B 2 2   ? 86.149  58.079  68.185 1.00 55.86 ? 16   DC  E "C5'" 1 
ATOM   291  C  "C4'" . DC  B 2 2   ? 86.935  57.130  67.314 1.00 53.85 ? 16   DC  E "C4'" 1 
ATOM   292  O  "O4'" . DC  B 2 2   ? 86.013  56.197  66.695 1.00 52.44 ? 16   DC  E "O4'" 1 
ATOM   293  C  "C3'" . DC  B 2 2   ? 87.667  57.841  66.176 1.00 53.75 ? 16   DC  E "C3'" 1 
ATOM   294  O  "O3'" . DC  B 2 2   ? 88.988  57.331  65.993 1.00 54.89 ? 16   DC  E "O3'" 1 
ATOM   295  C  "C2'" . DC  B 2 2   ? 86.801  57.569  64.960 1.00 52.51 ? 16   DC  E "C2'" 1 
ATOM   296  C  "C1'" . DC  B 2 2   ? 86.131  56.240  65.282 1.00 49.48 ? 16   DC  E "C1'" 1 
ATOM   297  N  N1    . DC  B 2 2   ? 84.776  56.133  64.707 1.00 45.18 ? 16   DC  E N1    1 
ATOM   298  C  C2    . DC  B 2 2   ? 84.429  54.990  63.970 1.00 41.58 ? 16   DC  E C2    1 
ATOM   299  O  O2    . DC  B 2 2   ? 85.250  54.068  63.864 1.00 41.26 ? 16   DC  E O2    1 
ATOM   300  N  N3    . DC  B 2 2   ? 83.208  54.922  63.393 1.00 39.24 ? 16   DC  E N3    1 
ATOM   301  C  C4    . DC  B 2 2   ? 82.348  55.935  63.531 1.00 39.77 ? 16   DC  E C4    1 
ATOM   302  N  N4    . DC  B 2 2   ? 81.165  55.843  62.919 1.00 38.10 ? 16   DC  E N4    1 
ATOM   303  C  C5    . DC  B 2 2   ? 82.664  57.093  64.298 1.00 40.21 ? 16   DC  E C5    1 
ATOM   304  C  C6    . DC  B 2 2   ? 83.874  57.148  64.866 1.00 43.11 ? 16   DC  E C6    1 
ATOM   305  P  P     . DG  B 2 3   ? 90.035  58.148  65.084 1.00 56.05 ? 17   DG  E P     1 
ATOM   306  O  OP1   . DG  B 2 3   ? 91.261  58.414  65.881 1.00 56.75 ? 17   DG  E OP1   1 
ATOM   307  O  OP2   . DG  B 2 3   ? 89.312  59.281  64.444 1.00 55.76 ? 17   DG  E OP2   1 
ATOM   308  O  "O5'" . DG  B 2 3   ? 90.415  57.112  63.943 1.00 53.57 ? 17   DG  E "O5'" 1 
ATOM   309  C  "C5'" . DG  B 2 3   ? 90.893  55.818  64.282 1.00 51.10 ? 17   DG  E "C5'" 1 
ATOM   310  C  "C4'" . DG  B 2 3   ? 90.999  54.972  63.040 1.00 49.48 ? 17   DG  E "C4'" 1 
ATOM   311  O  "O4'" . DG  B 2 3   ? 89.671  54.704  62.534 1.00 47.95 ? 17   DG  E "O4'" 1 
ATOM   312  C  "C3'" . DG  B 2 3   ? 91.757  55.654  61.907 1.00 49.78 ? 17   DG  E "C3'" 1 
ATOM   313  O  "O3'" . DG  B 2 3   ? 92.553  54.687  61.223 1.00 51.31 ? 17   DG  E "O3'" 1 
ATOM   314  C  "C2'" . DG  B 2 3   ? 90.655  56.229  61.032 1.00 48.08 ? 17   DG  E "C2'" 1 
ATOM   315  C  "C1'" . DG  B 2 3   ? 89.500  55.258  61.238 1.00 45.92 ? 17   DG  E "C1'" 1 
ATOM   316  N  N9    . DG  B 2 3   ? 88.176  55.875  61.202 1.00 42.68 ? 17   DG  E N9    1 
ATOM   317  C  C8    . DG  B 2 3   ? 87.795  57.049  61.808 1.00 41.85 ? 17   DG  E C8    1 
ATOM   318  N  N7    . DG  B 2 3   ? 86.536  57.340  61.618 1.00 40.49 ? 17   DG  E N7    1 
ATOM   319  C  C5    . DG  B 2 3   ? 86.056  56.298  60.835 1.00 39.61 ? 17   DG  E C5    1 
ATOM   320  C  C6    . DG  B 2 3   ? 84.754  56.061  60.313 1.00 37.60 ? 17   DG  E C6    1 
ATOM   321  O  O6    . DG  B 2 3   ? 83.729  56.741  60.448 1.00 35.84 ? 17   DG  E O6    1 
ATOM   322  N  N1    . DG  B 2 3   ? 84.709  54.889  59.569 1.00 37.43 ? 17   DG  E N1    1 
ATOM   323  C  C2    . DG  B 2 3   ? 85.772  54.045  59.359 1.00 37.78 ? 17   DG  E C2    1 
ATOM   324  N  N2    . DG  B 2 3   ? 85.522  52.957  58.616 1.00 37.87 ? 17   DG  E N2    1 
ATOM   325  N  N3    . DG  B 2 3   ? 86.989  54.251  59.842 1.00 38.68 ? 17   DG  E N3    1 
ATOM   326  C  C4    . DG  B 2 3   ? 87.058  55.388  60.565 1.00 40.10 ? 17   DG  E C4    1 
ATOM   327  P  P     . DA  B 2 4   ? 93.336  55.100  59.888 1.00 52.75 ? 18   DA  E P     1 
ATOM   328  O  OP1   . DA  B 2 4   ? 94.578  54.283  59.827 1.00 53.01 ? 18   DA  E OP1   1 
ATOM   329  O  OP2   . DA  B 2 4   ? 93.422  56.583  59.814 1.00 53.16 ? 18   DA  E OP2   1 
ATOM   330  O  "O5'" . DA  B 2 4   ? 92.357  54.591  58.747 1.00 50.80 ? 18   DA  E "O5'" 1 
ATOM   331  C  "C5'" . DA  B 2 4   ? 91.892  53.249  58.753 1.00 48.62 ? 18   DA  E "C5'" 1 
ATOM   332  C  "C4'" . DA  B 2 4   ? 91.240  52.935  57.433 1.00 47.57 ? 18   DA  E "C4'" 1 
ATOM   333  O  "O4'" . DA  B 2 4   ? 89.908  53.496  57.395 1.00 46.61 ? 18   DA  E "O4'" 1 
ATOM   334  C  "C3'" . DA  B 2 4   ? 91.995  53.538  56.254 1.00 47.65 ? 18   DA  E "C3'" 1 
ATOM   335  O  "O3'" . DA  B 2 4   ? 92.029  52.606  55.178 1.00 49.62 ? 18   DA  E "O3'" 1 
ATOM   336  C  "C2'" . DA  B 2 4   ? 91.199  54.789  55.916 1.00 46.41 ? 18   DA  E "C2'" 1 
ATOM   337  C  "C1'" . DA  B 2 4   ? 89.780  54.418  56.323 1.00 44.84 ? 18   DA  E "C1'" 1 
ATOM   338  N  N9    . DA  B 2 4   ? 88.962  55.533  56.805 1.00 41.84 ? 18   DA  E N9    1 
ATOM   339  C  C8    . DA  B 2 4   ? 89.359  56.607  57.566 1.00 40.76 ? 18   DA  E C8    1 
ATOM   340  N  N7    . DA  B 2 4   ? 88.380  57.422  57.881 1.00 39.39 ? 18   DA  E N7    1 
ATOM   341  C  C5    . DA  B 2 4   ? 87.266  56.855  57.279 1.00 37.79 ? 18   DA  E C5    1 
ATOM   342  C  C6    . DA  B 2 4   ? 85.909  57.236  57.244 1.00 37.56 ? 18   DA  E C6    1 
ATOM   343  N  N6    . DA  B 2 4   ? 85.422  58.323  57.852 1.00 33.79 ? 18   DA  E N6    1 
ATOM   344  N  N1    . DA  B 2 4   ? 85.056  56.449  56.553 1.00 36.72 ? 18   DA  E N1    1 
ATOM   345  C  C2    . DA  B 2 4   ? 85.540  55.358  55.944 1.00 37.85 ? 18   DA  E C2    1 
ATOM   346  N  N3    . DA  B 2 4   ? 86.788  54.896  55.907 1.00 38.36 ? 18   DA  E N3    1 
ATOM   347  C  C4    . DA  B 2 4   ? 87.612  55.698  56.603 1.00 39.84 ? 18   DA  E C4    1 
ATOM   348  P  P     . DG  B 2 5   ? 92.731  53.014  53.800 1.00 51.21 ? 19   DG  E P     1 
ATOM   349  O  OP1   . DG  B 2 5   ? 93.265  51.767  53.190 1.00 52.24 ? 19   DG  E OP1   1 
ATOM   350  O  OP2   . DG  B 2 5   ? 93.640  54.163  54.048 1.00 51.81 ? 19   DG  E OP2   1 
ATOM   351  O  "O5'" . DG  B 2 5   ? 91.497  53.509  52.937 1.00 51.21 ? 19   DG  E "O5'" 1 
ATOM   352  C  "C5'" . DG  B 2 5   ? 90.318  52.719  52.881 1.00 49.27 ? 19   DG  E "C5'" 1 
ATOM   353  C  "C4'" . DG  B 2 5   ? 89.286  53.382  52.006 1.00 47.76 ? 19   DG  E "C4'" 1 
ATOM   354  O  "O4'" . DG  B 2 5   ? 88.533  54.369  52.752 1.00 45.80 ? 19   DG  E "O4'" 1 
ATOM   355  C  "C3'" . DG  B 2 5   ? 89.862  54.099  50.786 1.00 47.81 ? 19   DG  E "C3'" 1 
ATOM   356  O  "O3'" . DG  B 2 5   ? 89.147  53.688  49.624 1.00 50.05 ? 19   DG  E "O3'" 1 
ATOM   357  C  "C2'" . DG  B 2 5   ? 89.647  55.574  51.095 1.00 45.75 ? 19   DG  E "C2'" 1 
ATOM   358  C  "C1'" . DG  B 2 5   ? 88.418  55.554  51.989 1.00 43.40 ? 19   DG  E "C1'" 1 
ATOM   359  N  N9    . DG  B 2 5   ? 88.299  56.677  52.917 1.00 40.10 ? 19   DG  E N9    1 
ATOM   360  C  C8    . DG  B 2 5   ? 89.310  57.288  53.619 1.00 38.47 ? 19   DG  E C8    1 
ATOM   361  N  N7    . DG  B 2 5   ? 88.893  58.281  54.360 1.00 37.82 ? 19   DG  E N7    1 
ATOM   362  C  C5    . DG  B 2 5   ? 87.523  58.329  54.136 1.00 35.96 ? 19   DG  E C5    1 
ATOM   363  C  C6    . DG  B 2 5   ? 86.532  59.208  54.659 1.00 34.66 ? 19   DG  E C6    1 
ATOM   364  O  O6    . DG  B 2 5   ? 86.673  60.154  55.443 1.00 32.69 ? 19   DG  E O6    1 
ATOM   365  N  N1    . DG  B 2 5   ? 85.267  58.899  54.172 1.00 35.04 ? 19   DG  E N1    1 
ATOM   366  C  C2    . DG  B 2 5   ? 84.987  57.880  53.295 1.00 35.87 ? 19   DG  E C2    1 
ATOM   367  N  N2    . DG  B 2 5   ? 83.700  57.739  52.950 1.00 33.31 ? 19   DG  E N2    1 
ATOM   368  N  N3    . DG  B 2 5   ? 85.900  57.059  52.795 1.00 35.61 ? 19   DG  E N3    1 
ATOM   369  C  C4    . DG  B 2 5   ? 87.138  57.341  53.255 1.00 37.72 ? 19   DG  E C4    1 
ATOM   370  P  P     . DA  B 2 6   ? 89.430  54.400  48.217 1.00 52.62 ? 20   DA  E P     1 
ATOM   371  O  OP1   . DA  B 2 6   ? 89.404  53.339  47.176 1.00 53.11 ? 20   DA  E OP1   1 
ATOM   372  O  OP2   . DA  B 2 6   ? 90.612  55.294  48.331 1.00 52.24 ? 20   DA  E OP2   1 
ATOM   373  O  "O5'" . DA  B 2 6   ? 88.128  55.289  48.047 1.00 50.51 ? 20   DA  E "O5'" 1 
ATOM   374  C  "C5'" . DA  B 2 6   ? 86.887  54.816  48.551 1.00 49.33 ? 20   DA  E "C5'" 1 
ATOM   375  C  "C4'" . DA  B 2 6   ? 85.841  55.891  48.421 1.00 48.01 ? 20   DA  E "C4'" 1 
ATOM   376  O  "O4'" . DA  B 2 6   ? 85.924  56.833  49.519 1.00 46.37 ? 20   DA  E "O4'" 1 
ATOM   377  C  "C3'" . DA  B 2 6   ? 86.002  56.705  47.141 1.00 47.66 ? 20   DA  E "C3'" 1 
ATOM   378  O  "O3'" . DA  B 2 6   ? 84.724  56.927  46.573 1.00 50.45 ? 20   DA  E "O3'" 1 
ATOM   379  C  "C2'" . DA  B 2 6   ? 86.594  58.016  47.626 1.00 45.35 ? 20   DA  E "C2'" 1 
ATOM   380  C  "C1'" . DA  B 2 6   ? 85.957  58.150  48.997 1.00 43.22 ? 20   DA  E "C1'" 1 
ATOM   381  N  N9    . DA  B 2 6   ? 86.691  58.998  49.936 1.00 38.19 ? 20   DA  E N9    1 
ATOM   382  C  C8    . DA  B 2 6   ? 88.038  59.008  50.200 1.00 36.40 ? 20   DA  E C8    1 
ATOM   383  N  N7    . DA  B 2 6   ? 88.397  59.911  51.080 1.00 35.27 ? 20   DA  E N7    1 
ATOM   384  C  C5    . DA  B 2 6   ? 87.206  60.535  51.422 1.00 33.38 ? 20   DA  E C5    1 
ATOM   385  C  C6    . DA  B 2 6   ? 86.910  61.586  52.307 1.00 30.63 ? 20   DA  E C6    1 
ATOM   386  N  N6    . DA  B 2 6   ? 87.833  62.222  53.035 1.00 27.38 ? 20   DA  E N6    1 
ATOM   387  N  N1    . DA  B 2 6   ? 85.618  61.967  52.419 1.00 27.62 ? 20   DA  E N1    1 
ATOM   388  C  C2    . DA  B 2 6   ? 84.695  61.330  51.687 1.00 30.10 ? 20   DA  E C2    1 
ATOM   389  N  N3    . DA  B 2 6   ? 84.850  60.331  50.819 1.00 31.80 ? 20   DA  E N3    1 
ATOM   390  C  C4    . DA  B 2 6   ? 86.145  59.977  50.732 1.00 34.65 ? 20   DA  E C4    1 
ATOM   391  P  P     . DA  B 2 7   ? 84.598  57.282  45.018 1.00 52.64 ? 21   DA  E P     1 
ATOM   392  O  OP1   . DA  B 2 7   ? 84.148  56.048  44.322 1.00 51.53 ? 21   DA  E OP1   1 
ATOM   393  O  OP2   . DA  B 2 7   ? 85.831  57.978  44.564 1.00 51.49 ? 21   DA  E OP2   1 
ATOM   394  O  "O5'" . DA  B 2 7   ? 83.401  58.323  45.024 1.00 49.53 ? 21   DA  E "O5'" 1 
ATOM   395  C  "C5'" . DA  B 2 7   ? 82.385  58.240  46.021 1.00 47.15 ? 21   DA  E "C5'" 1 
ATOM   396  C  "C4'" . DA  B 2 7   ? 81.796  59.606  46.262 1.00 45.34 ? 21   DA  E "C4'" 1 
ATOM   397  O  "O4'" . DA  B 2 7   ? 82.544  60.325  47.275 1.00 43.37 ? 21   DA  E "O4'" 1 
ATOM   398  C  "C3'" . DA  B 2 7   ? 81.834  60.464  45.002 1.00 44.63 ? 21   DA  E "C3'" 1 
ATOM   399  O  "O3'" . DA  B 2 7   ? 80.569  61.064  44.754 1.00 45.10 ? 21   DA  E "O3'" 1 
ATOM   400  C  "C2'" . DA  B 2 7   ? 82.916  61.494  45.282 1.00 43.00 ? 21   DA  E "C2'" 1 
ATOM   401  C  "C1'" . DA  B 2 7   ? 82.898  61.613  46.797 1.00 41.35 ? 21   DA  E "C1'" 1 
ATOM   402  N  N9    . DA  B 2 7   ? 84.191  61.970  47.385 1.00 37.17 ? 21   DA  E N9    1 
ATOM   403  C  C8    . DA  B 2 7   ? 85.418  61.434  47.087 1.00 35.55 ? 21   DA  E C8    1 
ATOM   404  N  N7    . DA  B 2 7   ? 86.404  61.951  47.776 1.00 33.14 ? 21   DA  E N7    1 
ATOM   405  C  C5    . DA  B 2 7   ? 85.788  62.895  48.585 1.00 31.99 ? 21   DA  E C5    1 
ATOM   406  C  C6    . DA  B 2 7   ? 86.291  63.785  49.551 1.00 29.26 ? 21   DA  E C6    1 
ATOM   407  N  N6    . DA  B 2 7   ? 87.582  63.863  49.883 1.00 24.98 ? 21   DA  E N6    1 
ATOM   408  N  N1    . DA  B 2 7   ? 85.412  64.597  50.176 1.00 26.81 ? 21   DA  E N1    1 
ATOM   409  C  C2    . DA  B 2 7   ? 84.118  64.508  49.851 1.00 28.12 ? 21   DA  E C2    1 
ATOM   410  N  N3    . DA  B 2 7   ? 83.522  63.710  48.964 1.00 31.84 ? 21   DA  E N3    1 
ATOM   411  C  C4    . DA  B 2 7   ? 84.425  62.919  48.356 1.00 33.46 ? 21   DA  E C4    1 
ATOM   412  P  P     . DA  B 2 8   ? 80.224  61.572  43.272 1.00 47.37 ? 22   DA  E P     1 
ATOM   413  O  OP1   . DA  B 2 8   ? 78.819  61.202  42.954 1.00 44.17 ? 22   DA  E OP1   1 
ATOM   414  O  OP2   . DA  B 2 8   ? 81.324  61.149  42.366 1.00 43.48 ? 22   DA  E OP2   1 
ATOM   415  O  "O5'" . DA  B 2 8   ? 80.296  63.149  43.426 1.00 41.90 ? 22   DA  E "O5'" 1 
ATOM   416  C  "C5'" . DA  B 2 8   ? 79.493  63.816  44.389 1.00 38.45 ? 22   DA  E "C5'" 1 
ATOM   417  C  "C4'" . DA  B 2 8   ? 79.821  65.286  44.371 1.00 35.13 ? 22   DA  E "C4'" 1 
ATOM   418  O  "O4'" . DA  B 2 8   ? 80.881  65.532  45.329 1.00 32.61 ? 22   DA  E "O4'" 1 
ATOM   419  C  "C3'" . DA  B 2 8   ? 80.373  65.682  43.004 1.00 34.10 ? 22   DA  E "C3'" 1 
ATOM   420  O  "O3'" . DA  B 2 8   ? 79.562  66.588  42.275 1.00 32.59 ? 22   DA  E "O3'" 1 
ATOM   421  C  "C2'" . DA  B 2 8   ? 81.758  66.242  43.268 1.00 32.86 ? 22   DA  E "C2'" 1 
ATOM   422  C  "C1'" . DA  B 2 8   ? 81.855  66.401  44.778 1.00 31.12 ? 22   DA  E "C1'" 1 
ATOM   423  N  N9    . DA  B 2 8   ? 83.173  65.960  45.240 1.00 26.89 ? 22   DA  E N9    1 
ATOM   424  C  C8    . DA  B 2 8   ? 83.913  64.946  44.684 1.00 26.84 ? 22   DA  E C8    1 
ATOM   425  N  N7    . DA  B 2 8   ? 85.104  64.810  45.205 1.00 25.21 ? 22   DA  E N7    1 
ATOM   426  C  C5    . DA  B 2 8   ? 85.148  65.785  46.189 1.00 24.33 ? 22   DA  E C5    1 
ATOM   427  C  C6    . DA  B 2 8   ? 86.156  66.169  47.079 1.00 23.76 ? 22   DA  E C6    1 
ATOM   428  N  N6    . DA  B 2 8   ? 87.362  65.601  47.108 1.00 22.04 ? 22   DA  E N6    1 
ATOM   429  N  N1    . DA  B 2 8   ? 85.887  67.176  47.940 1.00 22.34 ? 22   DA  E N1    1 
ATOM   430  C  C2    . DA  B 2 8   ? 84.680  67.753  47.891 1.00 23.21 ? 22   DA  E C2    1 
ATOM   431  N  N3    . DA  B 2 8   ? 83.650  67.487  47.088 1.00 24.65 ? 22   DA  E N3    1 
ATOM   432  C  C4    . DA  B 2 8   ? 83.954  66.483  46.245 1.00 25.30 ? 22   DA  E C4    1 
ATOM   433  P  P     . DC  B 2 9   ? 79.525  66.456  40.676 1.00 34.66 ? 23   DC  E P     1 
ATOM   434  O  OP1   . DC  B 2 9   ? 78.436  67.319  40.152 1.00 34.45 ? 23   DC  E OP1   1 
ATOM   435  O  OP2   . DC  B 2 9   ? 79.573  65.016  40.318 1.00 34.32 ? 23   DC  E OP2   1 
ATOM   436  O  "O5'" . DC  B 2 9   ? 80.915  67.077  40.237 1.00 31.50 ? 23   DC  E "O5'" 1 
ATOM   437  C  "C5'" . DC  B 2 9   ? 81.251  68.391  40.639 1.00 29.42 ? 23   DC  E "C5'" 1 
ATOM   438  C  "C4'" . DC  B 2 9   ? 82.600  68.773  40.088 1.00 27.86 ? 23   DC  E "C4'" 1 
ATOM   439  O  "O4'" . DC  B 2 9   ? 83.656  68.257  40.934 1.00 26.24 ? 23   DC  E "O4'" 1 
ATOM   440  C  "C3'" . DC  B 2 9   ? 82.873  68.253  38.678 1.00 28.83 ? 23   DC  E "C3'" 1 
ATOM   441  O  "O3'" . DC  B 2 9   ? 83.061  69.345  37.794 1.00 28.77 ? 23   DC  E "O3'" 1 
ATOM   442  C  "C2'" . DC  B 2 9   ? 84.144  67.423  38.817 1.00 29.89 ? 23   DC  E "C2'" 1 
ATOM   443  C  "C1'" . DC  B 2 9   ? 84.760  67.898  40.129 1.00 28.44 ? 23   DC  E "C1'" 1 
ATOM   444  N  N1    . DC  B 2 9   ? 85.521  66.858  40.851 1.00 25.94 ? 23   DC  E N1    1 
ATOM   445  C  C2    . DC  B 2 9   ? 86.817  67.149  41.318 1.00 25.20 ? 23   DC  E C2    1 
ATOM   446  O  O2    . DC  B 2 9   ? 87.302  68.272  41.107 1.00 23.97 ? 23   DC  E O2    1 
ATOM   447  N  N3    . DC  B 2 9   ? 87.509  66.194  41.979 1.00 25.35 ? 23   DC  E N3    1 
ATOM   448  C  C4    . DC  B 2 9   ? 86.970  64.988  42.170 1.00 25.96 ? 23   DC  E C4    1 
ATOM   449  N  N4    . DC  B 2 9   ? 87.701  64.073  42.811 1.00 25.28 ? 23   DC  E N4    1 
ATOM   450  C  C5    . DC  B 2 9   ? 85.660  64.665  41.707 1.00 25.08 ? 23   DC  E C5    1 
ATOM   451  C  C6    . DC  B 2 9   ? 84.976  65.622  41.063 1.00 24.99 ? 23   DC  E C6    1 
ATOM   452  P  P     . DA  B 2 10  ? 83.183  69.084  36.219 1.00 29.95 ? 24   DA  E P     1 
ATOM   453  O  OP1   . DA  B 2 10  ? 82.318  70.094  35.563 1.00 28.83 ? 24   DA  E OP1   1 
ATOM   454  O  OP2   . DA  B 2 10  ? 83.008  67.642  35.905 1.00 30.29 ? 24   DA  E OP2   1 
ATOM   455  O  "O5'" . DA  B 2 10  ? 84.690  69.490  35.960 1.00 27.89 ? 24   DA  E "O5'" 1 
ATOM   456  C  "C5'" . DA  B 2 10  ? 85.146  70.751  36.416 1.00 25.99 ? 24   DA  E "C5'" 1 
ATOM   457  C  "C4'" . DA  B 2 10  ? 86.636  70.868  36.238 1.00 25.60 ? 24   DA  E "C4'" 1 
ATOM   458  O  "O4'" . DA  B 2 10  ? 87.336  70.148  37.280 1.00 25.46 ? 24   DA  E "O4'" 1 
ATOM   459  C  "C3'" . DA  B 2 10  ? 87.164  70.347  34.903 1.00 27.28 ? 24   DA  E "C3'" 1 
ATOM   460  O  "O3'" . DA  B 2 10  ? 87.901  71.395  34.286 1.00 30.09 ? 24   DA  E "O3'" 1 
ATOM   461  C  "C2'" . DA  B 2 10  ? 88.043  69.161  35.284 1.00 26.29 ? 24   DA  E "C2'" 1 
ATOM   462  C  "C1'" . DA  B 2 10  ? 88.441  69.461  36.726 1.00 24.97 ? 24   DA  E "C1'" 1 
ATOM   463  N  N9    . DA  B 2 10  ? 88.698  68.289  37.569 1.00 25.40 ? 24   DA  E N9    1 
ATOM   464  C  C8    . DA  B 2 10  ? 88.001  67.106  37.608 1.00 25.12 ? 24   DA  E C8    1 
ATOM   465  N  N7    . DA  B 2 10  ? 88.469  66.242  38.476 1.00 24.39 ? 24   DA  E N7    1 
ATOM   466  C  C5    . DA  B 2 10  ? 89.549  66.896  39.049 1.00 23.94 ? 24   DA  E C5    1 
ATOM   467  C  C6    . DA  B 2 10  ? 90.469  66.513  40.042 1.00 23.61 ? 24   DA  E C6    1 
ATOM   468  N  N6    . DA  B 2 10  ? 90.445  65.328  40.660 1.00 22.80 ? 24   DA  E N6    1 
ATOM   469  N  N1    . DA  B 2 10  ? 91.429  67.399  40.384 1.00 21.57 ? 24   DA  E N1    1 
ATOM   470  C  C2    . DA  B 2 10  ? 91.454  68.586  39.765 1.00 22.57 ? 24   DA  E C2    1 
ATOM   471  N  N3    . DA  B 2 10  ? 90.645  69.062  38.818 1.00 24.38 ? 24   DA  E N3    1 
ATOM   472  C  C4    . DA  B 2 10  ? 89.703  68.158  38.500 1.00 23.62 ? 24   DA  E C4    1 
ATOM   473  P  P     . DA  B 2 11  ? 88.461  71.214  32.796 1.00 32.02 ? 25   DA  E P     1 
ATOM   474  O  OP1   . DA  B 2 11  ? 88.250  72.514  32.110 1.00 30.82 ? 25   DA  E OP1   1 
ATOM   475  O  OP2   . DA  B 2 11  ? 87.922  69.969  32.200 1.00 31.11 ? 25   DA  E OP2   1 
ATOM   476  O  "O5'" . DA  B 2 11  ? 90.013  71.052  33.076 1.00 31.31 ? 25   DA  E "O5'" 1 
ATOM   477  C  "C5'" . DA  B 2 11  ? 90.657  71.976  33.942 1.00 35.40 ? 25   DA  E "C5'" 1 
ATOM   478  C  "C4'" . DA  B 2 11  ? 92.048  71.504  34.279 1.00 38.21 ? 25   DA  E "C4'" 1 
ATOM   479  O  "O4'" . DA  B 2 11  ? 92.012  70.435  35.255 1.00 38.56 ? 25   DA  E "O4'" 1 
ATOM   480  C  "C3'" . DA  B 2 11  ? 92.833  70.974  33.081 1.00 41.50 ? 25   DA  E "C3'" 1 
ATOM   481  O  "O3'" . DA  B 2 11  ? 94.147  71.513  33.128 1.00 46.63 ? 25   DA  E "O3'" 1 
ATOM   482  C  "C2'" . DA  B 2 11  ? 92.875  69.474  33.317 1.00 40.16 ? 25   DA  E "C2'" 1 
ATOM   483  C  "C1'" . DA  B 2 11  ? 92.880  69.399  34.833 1.00 38.27 ? 25   DA  E "C1'" 1 
ATOM   484  N  N9    . DA  B 2 11  ? 92.395  68.139  35.396 1.00 36.09 ? 25   DA  E N9    1 
ATOM   485  C  C8    . DA  B 2 11  ? 91.321  67.385  34.993 1.00 35.21 ? 25   DA  E C8    1 
ATOM   486  N  N7    . DA  B 2 11  ? 91.153  66.287  35.693 1.00 33.51 ? 25   DA  E N7    1 
ATOM   487  C  C5    . DA  B 2 11  ? 92.184  66.323  36.620 1.00 33.83 ? 25   DA  E C5    1 
ATOM   488  C  C6    . DA  B 2 11  ? 92.565  65.439  37.644 1.00 32.27 ? 25   DA  E C6    1 
ATOM   489  N  N6    . DA  B 2 11  ? 91.922  64.302  37.917 1.00 32.33 ? 25   DA  E N6    1 
ATOM   490  N  N1    . DA  B 2 11  ? 93.644  65.768  38.388 1.00 33.64 ? 25   DA  E N1    1 
ATOM   491  C  C2    . DA  B 2 11  ? 94.289  66.908  38.112 1.00 33.37 ? 25   DA  E C2    1 
ATOM   492  N  N3    . DA  B 2 11  ? 94.030  67.818  37.175 1.00 35.80 ? 25   DA  E N3    1 
ATOM   493  C  C4    . DA  B 2 11  ? 92.953  67.461  36.454 1.00 34.98 ? 25   DA  E C4    1 
ATOM   494  P  P     . DA  B 2 12  ? 95.018  71.611  31.788 1.00 48.62 ? 26   DA  E P     1 
ATOM   495  O  OP1   . DA  B 2 12  ? 95.090  73.044  31.408 1.00 47.66 ? 26   DA  E OP1   1 
ATOM   496  O  OP2   . DA  B 2 12  ? 94.528  70.609  30.807 1.00 47.44 ? 26   DA  E OP2   1 
ATOM   497  O  "O5'" . DA  B 2 12  ? 96.450  71.171  32.308 1.00 48.52 ? 26   DA  E "O5'" 1 
ATOM   498  C  "C5'" . DA  B 2 12  ? 96.885  71.574  33.601 1.00 49.51 ? 26   DA  E "C5'" 1 
ATOM   499  C  "C4'" . DA  B 2 12  ? 97.788  70.521  34.191 1.00 50.99 ? 26   DA  E "C4'" 1 
ATOM   500  O  "O4'" . DA  B 2 12  ? 97.021  69.417  34.735 1.00 49.55 ? 26   DA  E "O4'" 1 
ATOM   501  C  "C3'" . DA  B 2 12  ? 98.746  69.913  33.167 1.00 52.01 ? 26   DA  E "C3'" 1 
ATOM   502  O  "O3'" . DA  B 2 12  ? 100.042 69.794  33.738 1.00 56.40 ? 26   DA  E "O3'" 1 
ATOM   503  C  "C2'" . DA  B 2 12  ? 98.166  68.533  32.914 1.00 49.93 ? 26   DA  E "C2'" 1 
ATOM   504  C  "C1'" . DA  B 2 12  ? 97.592  68.204  34.276 1.00 47.42 ? 26   DA  E "C1'" 1 
ATOM   505  N  N9    . DA  B 2 12  ? 96.560  67.167  34.286 1.00 42.94 ? 26   DA  E N9    1 
ATOM   506  C  C8    . DA  B 2 12  ? 95.507  66.992  33.422 1.00 41.72 ? 26   DA  E C8    1 
ATOM   507  N  N7    . DA  B 2 12  ? 94.769  65.940  33.693 1.00 40.06 ? 26   DA  E N7    1 
ATOM   508  C  C5    . DA  B 2 12  ? 95.374  65.390  34.816 1.00 39.75 ? 26   DA  E C5    1 
ATOM   509  C  C6    . DA  B 2 12  ? 95.074  64.258  35.598 1.00 37.70 ? 26   DA  E C6    1 
ATOM   510  N  N6    . DA  B 2 12  ? 94.042  63.446  35.365 1.00 36.06 ? 26   DA  E N6    1 
ATOM   511  N  N1    . DA  B 2 12  ? 95.881  63.989  36.647 1.00 38.07 ? 26   DA  E N1    1 
ATOM   512  C  C2    . DA  B 2 12  ? 96.911  64.807  36.890 1.00 38.37 ? 26   DA  E C2    1 
ATOM   513  N  N3    . DA  B 2 12  ? 97.293  65.900  36.233 1.00 39.32 ? 26   DA  E N3    1 
ATOM   514  C  C4    . DA  B 2 12  ? 96.475  66.138  35.194 1.00 40.49 ? 26   DA  E C4    1 
ATOM   515  P  P     . DG  B 2 13  ? 101.314 69.614  32.780 1.00 58.92 ? 27   DG  E P     1 
ATOM   516  O  OP1   . DG  B 2 13  ? 102.116 70.862  32.884 1.00 58.43 ? 27   DG  E OP1   1 
ATOM   517  O  OP2   . DG  B 2 13  ? 100.854 69.139  31.447 1.00 57.83 ? 27   DG  E OP2   1 
ATOM   518  O  "O5'" . DG  B 2 13  ? 102.118 68.436  33.478 1.00 56.97 ? 27   DG  E "O5'" 1 
ATOM   519  C  "C5'" . DG  B 2 13  ? 102.338 68.449  34.883 1.00 56.66 ? 27   DG  E "C5'" 1 
ATOM   520  C  "C4'" . DG  B 2 13  ? 102.622 67.051  35.372 1.00 56.36 ? 27   DG  E "C4'" 1 
ATOM   521  O  "O4'" . DG  B 2 13  ? 101.400 66.273  35.430 1.00 55.12 ? 27   DG  E "O4'" 1 
ATOM   522  C  "C3'" . DG  B 2 13  ? 103.581 66.272  34.470 1.00 57.02 ? 27   DG  E "C3'" 1 
ATOM   523  O  "O3'" . DG  B 2 13  ? 104.512 65.545  35.269 1.00 59.65 ? 27   DG  E "O3'" 1 
ATOM   524  C  "C2'" . DG  B 2 13  ? 102.668 65.316  33.722 1.00 54.52 ? 27   DG  E "C2'" 1 
ATOM   525  C  "C1'" . DG  B 2 13  ? 101.606 65.037  34.766 1.00 52.57 ? 27   DG  E "C1'" 1 
ATOM   526  N  N9    . DG  B 2 13  ? 100.323 64.572  34.246 1.00 48.46 ? 27   DG  E N9    1 
ATOM   527  C  C8    . DG  B 2 13  ? 99.572  65.131  33.240 1.00 47.52 ? 27   DG  E C8    1 
ATOM   528  N  N7    . DG  B 2 13  ? 98.470  64.471  32.995 1.00 45.43 ? 27   DG  E N7    1 
ATOM   529  C  C5    . DG  B 2 13  ? 98.494  63.417  33.898 1.00 43.80 ? 27   DG  E C5    1 
ATOM   530  C  C6    . DG  B 2 13  ? 97.567  62.363  34.110 1.00 42.05 ? 27   DG  E C6    1 
ATOM   531  O  O6    . DG  B 2 13  ? 96.501  62.141  33.525 1.00 40.93 ? 27   DG  E O6    1 
ATOM   532  N  N1    . DG  B 2 13  ? 97.985  61.511  35.126 1.00 42.13 ? 27   DG  E N1    1 
ATOM   533  C  C2    . DG  B 2 13  ? 99.144  61.650  35.848 1.00 43.13 ? 27   DG  E C2    1 
ATOM   534  N  N2    . DG  B 2 13  ? 99.369  60.722  36.791 1.00 44.15 ? 27   DG  E N2    1 
ATOM   535  N  N3    . DG  B 2 13  ? 100.016 62.625  35.662 1.00 44.35 ? 27   DG  E N3    1 
ATOM   536  C  C4    . DG  B 2 13  ? 99.630  63.466  34.678 1.00 46.03 ? 27   DG  E C4    1 
ATOM   537  P  P     . DA  B 2 14  ? 105.696 64.729  34.562 1.00 61.24 ? 28   DA  E P     1 
ATOM   538  O  OP1   . DA  B 2 14  ? 106.968 65.172  35.192 1.00 61.79 ? 28   DA  E OP1   1 
ATOM   539  O  OP2   . DA  B 2 14  ? 105.533 64.823  33.086 1.00 60.42 ? 28   DA  E OP2   1 
ATOM   540  O  "O5'" . DA  B 2 14  ? 105.406 63.228  35.003 1.00 59.40 ? 28   DA  E "O5'" 1 
ATOM   541  C  "C5'" . DA  B 2 14  ? 105.227 62.901  36.378 1.00 56.31 ? 28   DA  E "C5'" 1 
ATOM   542  C  "C4'" . DA  B 2 14  ? 104.947 61.425  36.522 1.00 54.73 ? 28   DA  E "C4'" 1 
ATOM   543  O  "O4'" . DA  B 2 14  ? 103.610 61.137  36.044 1.00 54.04 ? 28   DA  E "O4'" 1 
ATOM   544  C  "C3'" . DA  B 2 14  ? 105.882 60.550  35.689 1.00 53.68 ? 28   DA  E "C3'" 1 
ATOM   545  O  "O3'" . DA  B 2 14  ? 105.984 59.262  36.298 1.00 54.06 ? 28   DA  E "O3'" 1 
ATOM   546  C  "C2'" . DA  B 2 14  ? 105.100 60.380  34.400 1.00 52.86 ? 28   DA  E "C2'" 1 
ATOM   547  C  "C1'" . DA  B 2 14  ? 103.682 60.259  34.929 1.00 51.26 ? 28   DA  E "C1'" 1 
ATOM   548  N  N9    . DA  B 2 14  ? 102.630 60.635  33.984 1.00 48.46 ? 28   DA  E N9    1 
ATOM   549  C  C8    . DA  B 2 14  ? 102.586 61.712  33.132 1.00 46.94 ? 28   DA  E C8    1 
ATOM   550  N  N7    . DA  B 2 14  ? 101.498 61.760  32.397 1.00 45.84 ? 28   DA  E N7    1 
ATOM   551  C  C5    . DA  B 2 14  ? 100.777 60.642  32.796 1.00 43.88 ? 28   DA  E C5    1 
ATOM   552  C  C6    . DA  B 2 14  ? 99.535  60.121  32.390 1.00 43.09 ? 28   DA  E C6    1 
ATOM   553  N  N6    . DA  B 2 14  ? 98.766  60.680  31.453 1.00 40.72 ? 28   DA  E N6    1 
ATOM   554  N  N1    . DA  B 2 14  ? 99.104  58.988  32.988 1.00 41.66 ? 28   DA  E N1    1 
ATOM   555  C  C2    . DA  B 2 14  ? 99.876  58.424  33.924 1.00 42.75 ? 28   DA  E C2    1 
ATOM   556  N  N3    . DA  B 2 14  ? 101.061 58.815  34.387 1.00 43.74 ? 28   DA  E N3    1 
ATOM   557  C  C4    . DA  B 2 14  ? 101.460 59.943  33.775 1.00 45.37 ? 28   DA  E C4    1 
ATOM   558  N  N     . GLY C 3 1   ? 91.316  78.302  49.678 1.00 27.81 ? 1    GLY A N     1 
ATOM   559  C  CA    . GLY C 3 1   ? 92.568  78.582  50.429 1.00 23.73 ? 1    GLY A CA    1 
ATOM   560  C  C     . GLY C 3 1   ? 92.417  78.365  51.922 1.00 22.53 ? 1    GLY A C     1 
ATOM   561  O  O     . GLY C 3 1   ? 91.361  77.940  52.406 1.00 22.93 ? 1    GLY A O     1 
ATOM   562  N  N     . GLU C 3 2   ? 93.480  78.657  52.660 1.00 18.28 ? 2    GLU A N     1 
ATOM   563  C  CA    . GLU C 3 2   ? 93.467  78.498  54.106 1.00 18.46 ? 2    GLU A CA    1 
ATOM   564  C  C     . GLU C 3 2   ? 93.170  79.859  54.730 1.00 17.50 ? 2    GLU A C     1 
ATOM   565  O  O     . GLU C 3 2   ? 92.975  80.833  54.004 1.00 17.45 ? 2    GLU A O     1 
ATOM   566  C  CB    . GLU C 3 2   ? 94.812  77.909  54.552 1.00 17.44 ? 2    GLU A CB    1 
ATOM   567  C  CG    . GLU C 3 2   ? 94.991  76.494  53.971 1.00 20.60 ? 2    GLU A CG    1 
ATOM   568  C  CD    . GLU C 3 2   ? 96.392  75.923  54.132 1.00 22.14 ? 2    GLU A CD    1 
ATOM   569  O  OE1   . GLU C 3 2   ? 96.899  75.878  55.274 1.00 22.93 ? 2    GLU A OE1   1 
ATOM   570  O  OE2   . GLU C 3 2   ? 96.974  75.503  53.107 1.00 23.63 ? 2    GLU A OE2   1 
ATOM   571  N  N     . LEU C 3 3   ? 93.128  79.940  56.057 1.00 17.90 ? 3    LEU A N     1 
ATOM   572  C  CA    . LEU C 3 3   ? 92.793  81.208  56.711 1.00 18.83 ? 3    LEU A CA    1 
ATOM   573  C  C     . LEU C 3 3   ? 93.544  82.453  56.204 1.00 19.97 ? 3    LEU A C     1 
ATOM   574  O  O     . LEU C 3 3   ? 92.927  83.486  55.937 1.00 19.29 ? 3    LEU A O     1 
ATOM   575  C  CB    . LEU C 3 3   ? 92.939  81.076  58.236 1.00 19.86 ? 3    LEU A CB    1 
ATOM   576  C  CG    . LEU C 3 3   ? 92.466  82.276  59.074 1.00 20.17 ? 3    LEU A CG    1 
ATOM   577  C  CD1   . LEU C 3 3   ? 91.966  81.802  60.436 1.00 20.81 ? 3    LEU A CD1   1 
ATOM   578  C  CD2   . LEU C 3 3   ? 93.601  83.274  59.232 1.00 21.81 ? 3    LEU A CD2   1 
ATOM   579  N  N     . PRO C 3 4   ? 94.876  82.374  56.049 1.00 19.92 ? 4    PRO A N     1 
ATOM   580  C  CA    . PRO C 3 4   ? 95.616  83.549  55.567 1.00 20.38 ? 4    PRO A CA    1 
ATOM   581  C  C     . PRO C 3 4   ? 95.139  84.080  54.210 1.00 20.79 ? 4    PRO A C     1 
ATOM   582  O  O     . PRO C 3 4   ? 95.021  85.296  54.011 1.00 19.82 ? 4    PRO A O     1 
ATOM   583  C  CB    . PRO C 3 4   ? 97.058  83.048  55.516 1.00 20.72 ? 4    PRO A CB    1 
ATOM   584  C  CG    . PRO C 3 4   ? 97.097  82.042  56.647 1.00 19.71 ? 4    PRO A CG    1 
ATOM   585  C  CD    . PRO C 3 4   ? 95.801  81.287  56.414 1.00 19.58 ? 4    PRO A CD    1 
ATOM   586  N  N     . GLU C 3 5   ? 94.878  83.167  53.279 1.00 18.54 ? 5    GLU A N     1 
ATOM   587  C  CA    . GLU C 3 5   ? 94.422  83.546  51.949 1.00 18.68 ? 5    GLU A CA    1 
ATOM   588  C  C     . GLU C 3 5   ? 93.010  84.121  51.989 1.00 19.42 ? 5    GLU A C     1 
ATOM   589  O  O     . GLU C 3 5   ? 92.709  85.095  51.291 1.00 19.06 ? 5    GLU A O     1 
ATOM   590  C  CB    . GLU C 3 5   ? 94.466  82.337  51.007 1.00 19.95 ? 5    GLU A CB    1 
ATOM   591  C  CG    . GLU C 3 5   ? 95.878  81.844  50.701 1.00 19.68 ? 5    GLU A CG    1 
ATOM   592  C  CD    . GLU C 3 5   ? 96.568  81.214  51.901 1.00 21.80 ? 5    GLU A CD    1 
ATOM   593  O  OE1   . GLU C 3 5   ? 97.782  81.450  52.076 1.00 21.01 ? 5    GLU A OE1   1 
ATOM   594  O  OE2   . GLU C 3 5   ? 95.906  80.473  52.663 1.00 22.67 ? 5    GLU A OE2   1 
ATOM   595  N  N     . VAL C 3 6   ? 92.149  83.517  52.804 1.00 18.24 ? 6    VAL A N     1 
ATOM   596  C  CA    . VAL C 3 6   ? 90.773  83.984  52.930 1.00 18.05 ? 6    VAL A CA    1 
ATOM   597  C  C     . VAL C 3 6   ? 90.773  85.370  53.579 1.00 18.94 ? 6    VAL A C     1 
ATOM   598  O  O     . VAL C 3 6   ? 90.037  86.265  53.155 1.00 17.26 ? 6    VAL A O     1 
ATOM   599  C  CB    . VAL C 3 6   ? 89.928  83.002  53.774 1.00 17.47 ? 6    VAL A CB    1 
ATOM   600  C  CG1   . VAL C 3 6   ? 88.503  83.533  53.936 1.00 15.93 ? 6    VAL A CG1   1 
ATOM   601  C  CG2   . VAL C 3 6   ? 89.903  81.626  53.093 1.00 18.81 ? 6    VAL A CG2   1 
ATOM   602  N  N     . GLU C 3 7   ? 91.613  85.556  54.595 1.00 17.81 ? 7    GLU A N     1 
ATOM   603  C  CA    . GLU C 3 7   ? 91.695  86.852  55.263 1.00 19.57 ? 7    GLU A CA    1 
ATOM   604  C  C     . GLU C 3 7   ? 92.198  87.918  54.280 1.00 19.02 ? 7    GLU A C     1 
ATOM   605  O  O     . GLU C 3 7   ? 91.755  89.070  54.317 1.00 19.46 ? 7    GLU A O     1 
ATOM   606  C  CB    . GLU C 3 7   ? 92.621  86.771  56.486 1.00 18.31 ? 7    GLU A CB    1 
ATOM   607  C  CG    . GLU C 3 7   ? 92.895  88.123  57.156 1.00 21.36 ? 7    GLU A CG    1 
ATOM   608  C  CD    . GLU C 3 7   ? 91.644  88.796  57.707 1.00 21.46 ? 7    GLU A CD    1 
ATOM   609  O  OE1   . GLU C 3 7   ? 91.700  90.017  57.967 1.00 23.52 ? 7    GLU A OE1   1 
ATOM   610  O  OE2   . GLU C 3 7   ? 90.611  88.116  57.890 1.00 21.20 ? 7    GLU A OE2   1 
ATOM   611  N  N     . THR C 3 8   ? 93.115  87.530  53.395 1.00 18.00 ? 8    THR A N     1 
ATOM   612  C  CA    . THR C 3 8   ? 93.657  88.455  52.406 1.00 20.34 ? 8    THR A CA    1 
ATOM   613  C  C     . THR C 3 8   ? 92.548  88.905  51.451 1.00 20.56 ? 8    THR A C     1 
ATOM   614  O  O     . THR C 3 8   ? 92.434  90.088  51.122 1.00 19.75 ? 8    THR A O     1 
ATOM   615  C  CB    . THR C 3 8   ? 94.810  87.794  51.610 1.00 20.99 ? 8    THR A CB    1 
ATOM   616  O  OG1   . THR C 3 8   ? 95.887  87.494  52.507 1.00 21.79 ? 8    THR A OG1   1 
ATOM   617  C  CG2   . THR C 3 8   ? 95.321  88.725  50.512 1.00 23.50 ? 8    THR A CG2   1 
ATOM   618  N  N     . VAL C 3 9   ? 91.729  87.958  51.010 1.00 19.59 ? 9    VAL A N     1 
ATOM   619  C  CA    . VAL C 3 9   ? 90.619  88.282  50.119 1.00 20.15 ? 9    VAL A CA    1 
ATOM   620  C  C     . VAL C 3 9   ? 89.624  89.167  50.875 1.00 19.59 ? 9    VAL A C     1 
ATOM   621  O  O     . VAL C 3 9   ? 89.101  90.137  50.323 1.00 20.55 ? 9    VAL A O     1 
ATOM   622  C  CB    . VAL C 3 9   ? 89.913  86.997  49.633 1.00 20.17 ? 9    VAL A CB    1 
ATOM   623  C  CG1   . VAL C 3 9   ? 88.596  87.339  48.925 1.00 21.15 ? 9    VAL A CG1   1 
ATOM   624  C  CG2   . VAL C 3 9   ? 90.838  86.245  48.686 1.00 20.74 ? 9    VAL A CG2   1 
ATOM   625  N  N     . ARG C 3 10  ? 89.376  88.836  52.140 1.00 19.26 ? 10   ARG A N     1 
ATOM   626  C  CA    . ARG C 3 10  ? 88.445  89.611  52.959 1.00 20.12 ? 10   ARG A CA    1 
ATOM   627  C  C     . ARG C 3 10  ? 88.864  91.074  53.046 1.00 21.27 ? 10   ARG A C     1 
ATOM   628  O  O     . ARG C 3 10  ? 88.035  91.976  52.925 1.00 21.67 ? 10   ARG A O     1 
ATOM   629  C  CB    . ARG C 3 10  ? 88.357  89.047  54.381 1.00 19.90 ? 10   ARG A CB    1 
ATOM   630  C  CG    . ARG C 3 10  ? 87.299  89.750  55.243 1.00 19.58 ? 10   ARG A CG    1 
ATOM   631  C  CD    . ARG C 3 10  ? 87.570  89.608  56.736 1.00 20.20 ? 10   ARG A CD    1 
ATOM   632  N  NE    . ARG C 3 10  ? 88.666  90.465  57.181 1.00 22.05 ? 10   ARG A NE    1 
ATOM   633  C  CZ    . ARG C 3 10  ? 88.589  91.788  57.305 1.00 24.40 ? 10   ARG A CZ    1 
ATOM   634  N  NH1   . ARG C 3 10  ? 87.459  92.426  57.023 1.00 23.29 ? 10   ARG A NH1   1 
ATOM   635  N  NH2   . ARG C 3 10  ? 89.650  92.478  57.705 1.00 24.33 ? 10   ARG A NH2   1 
ATOM   636  N  N     . ARG C 3 11  ? 90.153  91.308  53.264 1.00 21.81 ? 11   ARG A N     1 
ATOM   637  C  CA    . ARG C 3 11  ? 90.665  92.667  53.383 1.00 24.15 ? 11   ARG A CA    1 
ATOM   638  C  C     . ARG C 3 11  ? 90.539  93.457  52.091 1.00 24.63 ? 11   ARG A C     1 
ATOM   639  O  O     . ARG C 3 11  ? 90.197  94.642  52.111 1.00 25.14 ? 11   ARG A O     1 
ATOM   640  C  CB    . ARG C 3 11  ? 92.123  92.639  53.843 1.00 23.16 ? 11   ARG A CB    1 
ATOM   641  C  CG    . ARG C 3 11  ? 92.273  92.107  55.256 1.00 25.27 ? 11   ARG A CG    1 
ATOM   642  C  CD    . ARG C 3 11  ? 93.717  92.093  55.725 1.00 26.39 ? 11   ARG A CD    1 
ATOM   643  N  NE    . ARG C 3 11  ? 93.795  91.684  57.126 1.00 26.64 ? 11   ARG A NE    1 
ATOM   644  C  CZ    . ARG C 3 11  ? 94.907  91.706  57.856 1.00 29.63 ? 11   ARG A CZ    1 
ATOM   645  N  NH1   . ARG C 3 11  ? 96.050  92.118  57.321 1.00 28.88 ? 11   ARG A NH1   1 
ATOM   646  N  NH2   . ARG C 3 11  ? 94.870  91.328  59.128 1.00 28.48 ? 11   ARG A NH2   1 
ATOM   647  N  N     . GLU C 3 12  ? 90.810  92.805  50.967 1.00 25.10 ? 12   GLU A N     1 
ATOM   648  C  CA    . GLU C 3 12  ? 90.708  93.473  49.679 1.00 27.50 ? 12   GLU A CA    1 
ATOM   649  C  C     . GLU C 3 12  ? 89.254  93.819  49.377 1.00 26.65 ? 12   GLU A C     1 
ATOM   650  O  O     . GLU C 3 12  ? 88.956  94.920  48.910 1.00 27.52 ? 12   GLU A O     1 
ATOM   651  C  CB    . GLU C 3 12  ? 91.306  92.592  48.576 1.00 29.30 ? 12   GLU A CB    1 
ATOM   652  C  CG    . GLU C 3 12  ? 92.833  92.601  48.582 1.00 36.37 ? 12   GLU A CG    1 
ATOM   653  C  CD    . GLU C 3 12  ? 93.450  91.676  47.545 1.00 39.90 ? 12   GLU A CD    1 
ATOM   654  O  OE1   . GLU C 3 12  ? 92.942  91.621  46.404 1.00 43.09 ? 12   GLU A OE1   1 
ATOM   655  O  OE2   . GLU C 3 12  ? 94.459  91.015  47.868 1.00 42.59 ? 12   GLU A OE2   1 
ATOM   656  N  N     . LEU C 3 13  ? 88.348  92.887  49.657 1.00 23.91 ? 13   LEU A N     1 
ATOM   657  C  CA    . LEU C 3 13  ? 86.928  93.123  49.424 1.00 24.11 ? 13   LEU A CA    1 
ATOM   658  C  C     . LEU C 3 13  ? 86.401  94.249  50.314 1.00 25.15 ? 13   LEU A C     1 
ATOM   659  O  O     . LEU C 3 13  ? 85.612  95.085  49.871 1.00 26.68 ? 13   LEU A O     1 
ATOM   660  C  CB    . LEU C 3 13  ? 86.128  91.846  49.690 1.00 23.78 ? 13   LEU A CB    1 
ATOM   661  C  CG    . LEU C 3 13  ? 86.270  90.736  48.646 1.00 25.84 ? 13   LEU A CG    1 
ATOM   662  C  CD1   . LEU C 3 13  ? 85.546  89.489  49.129 1.00 25.29 ? 13   LEU A CD1   1 
ATOM   663  C  CD2   . LEU C 3 13  ? 85.695  91.205  47.314 1.00 25.62 ? 13   LEU A CD2   1 
ATOM   664  N  N     . GLU C 3 14  ? 86.836  94.260  51.571 1.00 24.38 ? 14   GLU A N     1 
ATOM   665  C  CA    . GLU C 3 14  ? 86.411  95.277  52.527 1.00 25.71 ? 14   GLU A CA    1 
ATOM   666  C  C     . GLU C 3 14  ? 86.814  96.661  52.038 1.00 27.15 ? 14   GLU A C     1 
ATOM   667  O  O     . GLU C 3 14  ? 86.062  97.627  52.153 1.00 26.13 ? 14   GLU A O     1 
ATOM   668  C  CB    . GLU C 3 14  ? 87.054  95.003  53.885 1.00 27.71 ? 14   GLU A CB    1 
ATOM   669  C  CG    . GLU C 3 14  ? 86.903  96.118  54.898 1.00 29.30 ? 14   GLU A CG    1 
ATOM   670  C  CD    . GLU C 3 14  ? 87.412  95.712  56.268 1.00 31.40 ? 14   GLU A CD    1 
ATOM   671  O  OE1   . GLU C 3 14  ? 86.656  95.059  57.020 1.00 30.92 ? 14   GLU A OE1   1 
ATOM   672  O  OE2   . GLU C 3 14  ? 88.577  96.029  56.587 1.00 34.33 ? 14   GLU A OE2   1 
ATOM   673  N  N     . LYS C 3 15  ? 88.014  96.737  51.482 1.00 26.58 ? 15   LYS A N     1 
ATOM   674  C  CA    . LYS C 3 15  ? 88.556  97.982  50.973 1.00 29.31 ? 15   LYS A CA    1 
ATOM   675  C  C     . LYS C 3 15  ? 87.914  98.436  49.662 1.00 28.45 ? 15   LYS A C     1 
ATOM   676  O  O     . LYS C 3 15  ? 87.862  99.634  49.379 1.00 29.30 ? 15   LYS A O     1 
ATOM   677  C  CB    . LYS C 3 15  ? 90.071  97.814  50.799 1.00 32.09 ? 15   LYS A CB    1 
ATOM   678  C  CG    . LYS C 3 15  ? 90.771  98.874  49.977 1.00 39.11 ? 15   LYS A CG    1 
ATOM   679  C  CD    . LYS C 3 15  ? 92.277  98.598  49.952 1.00 43.11 ? 15   LYS A CD    1 
ATOM   680  C  CE    . LYS C 3 15  ? 92.999  99.440  48.904 1.00 46.34 ? 15   LYS A CE    1 
ATOM   681  N  NZ    . LYS C 3 15  ? 92.597  99.068  47.509 1.00 48.52 ? 15   LYS A NZ    1 
ATOM   682  N  N     . ARG C 3 16  ? 87.390  97.499  48.876 1.00 25.28 ? 16   ARG A N     1 
ATOM   683  C  CA    . ARG C 3 16  ? 86.827  97.871  47.586 1.00 25.89 ? 16   ARG A CA    1 
ATOM   684  C  C     . ARG C 3 16  ? 85.322  97.811  47.321 1.00 26.51 ? 16   ARG A C     1 
ATOM   685  O  O     . ARG C 3 16  ? 84.817  98.629  46.550 1.00 26.39 ? 16   ARG A O     1 
ATOM   686  C  CB    . ARG C 3 16  ? 87.566  97.099  46.486 1.00 25.75 ? 16   ARG A CB    1 
ATOM   687  C  CG    . ARG C 3 16  ? 89.052  97.469  46.423 1.00 26.40 ? 16   ARG A CG    1 
ATOM   688  C  CD    . ARG C 3 16  ? 89.840  96.601  45.464 1.00 28.25 ? 16   ARG A CD    1 
ATOM   689  N  NE    . ARG C 3 16  ? 89.450  96.794  44.070 1.00 28.95 ? 16   ARG A NE    1 
ATOM   690  C  CZ    . ARG C 3 16  ? 89.987  96.122  43.056 1.00 28.57 ? 16   ARG A CZ    1 
ATOM   691  N  NH1   . ARG C 3 16  ? 90.933  95.223  43.290 1.00 27.54 ? 16   ARG A NH1   1 
ATOM   692  N  NH2   . ARG C 3 16  ? 89.571  96.337  41.814 1.00 27.34 ? 16   ARG A NH2   1 
ATOM   693  N  N     . ILE C 3 17  ? 84.596  96.879  47.936 1.00 23.78 ? 17   ILE A N     1 
ATOM   694  C  CA    . ILE C 3 17  ? 83.162  96.791  47.661 1.00 23.46 ? 17   ILE A CA    1 
ATOM   695  C  C     . ILE C 3 17  ? 82.205  97.244  48.760 1.00 23.92 ? 17   ILE A C     1 
ATOM   696  O  O     . ILE C 3 17  ? 80.993  97.289  48.546 1.00 24.04 ? 17   ILE A O     1 
ATOM   697  C  CB    . ILE C 3 17  ? 82.756  95.359  47.225 1.00 21.95 ? 17   ILE A CB    1 
ATOM   698  C  CG1   . ILE C 3 17  ? 82.891  94.384  48.390 1.00 21.34 ? 17   ILE A CG1   1 
ATOM   699  C  CG2   . ILE C 3 17  ? 83.633  94.904  46.069 1.00 23.38 ? 17   ILE A CG2   1 
ATOM   700  C  CD1   . ILE C 3 17  ? 82.399  92.992  48.061 1.00 22.18 ? 17   ILE A CD1   1 
ATOM   701  N  N     . VAL C 3 18  ? 82.723  97.579  49.933 1.00 23.99 ? 18   VAL A N     1 
ATOM   702  C  CA    . VAL C 3 18  ? 81.845  98.035  51.001 1.00 26.15 ? 18   VAL A CA    1 
ATOM   703  C  C     . VAL C 3 18  ? 81.224  99.361  50.567 1.00 27.37 ? 18   VAL A C     1 
ATOM   704  O  O     . VAL C 3 18  ? 81.932  100.286 50.166 1.00 25.74 ? 18   VAL A O     1 
ATOM   705  C  CB    . VAL C 3 18  ? 82.616  98.217  52.326 1.00 26.76 ? 18   VAL A CB    1 
ATOM   706  C  CG1   . VAL C 3 18  ? 81.733  98.909  53.364 1.00 27.79 ? 18   VAL A CG1   1 
ATOM   707  C  CG2   . VAL C 3 18  ? 83.058  96.855  52.848 1.00 27.48 ? 18   VAL A CG2   1 
ATOM   708  N  N     . GLY C 3 19  ? 79.898  99.434  50.625 1.00 27.14 ? 19   GLY A N     1 
ATOM   709  C  CA    . GLY C 3 19  ? 79.202  100.642 50.223 1.00 27.99 ? 19   GLY A CA    1 
ATOM   710  C  C     . GLY C 3 19  ? 78.587  100.512 48.841 1.00 29.05 ? 19   GLY A C     1 
ATOM   711  O  O     . GLY C 3 19  ? 77.805  101.368 48.418 1.00 28.83 ? 19   GLY A O     1 
ATOM   712  N  N     . GLN C 3 20  ? 78.926  99.432  48.139 1.00 27.49 ? 20   GLN A N     1 
ATOM   713  C  CA    . GLN C 3 20  ? 78.414  99.195  46.791 1.00 29.34 ? 20   GLN A CA    1 
ATOM   714  C  C     . GLN C 3 20  ? 77.016  98.587  46.777 1.00 28.62 ? 20   GLN A C     1 
ATOM   715  O  O     . GLN C 3 20  ? 76.723  97.647  47.516 1.00 27.20 ? 20   GLN A O     1 
ATOM   716  C  CB    . GLN C 3 20  ? 79.353  98.261  46.022 1.00 31.12 ? 20   GLN A CB    1 
ATOM   717  C  CG    . GLN C 3 20  ? 80.763  98.791  45.843 1.00 38.17 ? 20   GLN A CG    1 
ATOM   718  C  CD    . GLN C 3 20  ? 80.857  99.841  44.757 1.00 42.77 ? 20   GLN A CD    1 
ATOM   719  O  OE1   . GLN C 3 20  ? 80.673  99.545  43.575 1.00 44.54 ? 20   GLN A OE1   1 
ATOM   720  N  NE2   . GLN C 3 20  ? 81.143  101.077 45.152 1.00 44.68 ? 20   GLN A NE2   1 
ATOM   721  N  N     . LYS C 3 21  ? 76.160  99.122  45.917 1.00 27.46 ? 21   LYS A N     1 
ATOM   722  C  CA    . LYS C 3 21  ? 74.808  98.616  45.781 1.00 27.22 ? 21   LYS A CA    1 
ATOM   723  C  C     . LYS C 3 21  ? 74.819  97.524  44.715 1.00 25.96 ? 21   LYS A C     1 
ATOM   724  O  O     . LYS C 3 21  ? 75.306  97.734  43.605 1.00 25.58 ? 21   LYS A O     1 
ATOM   725  C  CB    . LYS C 3 21  ? 73.866  99.751  45.366 1.00 29.87 ? 21   LYS A CB    1 
ATOM   726  C  CG    . LYS C 3 21  ? 72.420  99.332  45.141 1.00 33.65 ? 21   LYS A CG    1 
ATOM   727  C  CD    . LYS C 3 21  ? 71.552  100.562 44.889 1.00 36.55 ? 21   LYS A CD    1 
ATOM   728  C  CE    . LYS C 3 21  ? 70.126  100.186 44.543 1.00 39.81 ? 21   LYS A CE    1 
ATOM   729  N  NZ    . LYS C 3 21  ? 70.056  99.434  43.259 1.00 42.84 ? 21   LYS A NZ    1 
ATOM   730  N  N     . ILE C 3 22  ? 74.300  96.353  45.059 1.00 25.58 ? 22   ILE A N     1 
ATOM   731  C  CA    . ILE C 3 22  ? 74.240  95.246  44.115 1.00 25.59 ? 22   ILE A CA    1 
ATOM   732  C  C     . ILE C 3 22  ? 73.164  95.561  43.077 1.00 26.86 ? 22   ILE A C     1 
ATOM   733  O  O     . ILE C 3 22  ? 71.983  95.662  43.412 1.00 26.43 ? 22   ILE A O     1 
ATOM   734  C  CB    . ILE C 3 22  ? 73.877  93.924  44.828 1.00 25.35 ? 22   ILE A CB    1 
ATOM   735  C  CG1   . ILE C 3 22  ? 74.949  93.579  45.862 1.00 25.15 ? 22   ILE A CG1   1 
ATOM   736  C  CG2   . ILE C 3 22  ? 73.738  92.800  43.809 1.00 25.17 ? 22   ILE A CG2   1 
ATOM   737  C  CD1   . ILE C 3 22  ? 74.621  92.357  46.706 1.00 25.03 ? 22   ILE A CD1   1 
ATOM   738  N  N     . ILE C 3 23  ? 73.572  95.723  41.822 1.00 25.78 ? 23   ILE A N     1 
ATOM   739  C  CA    . ILE C 3 23  ? 72.627  96.031  40.754 1.00 27.01 ? 23   ILE A CA    1 
ATOM   740  C  C     . ILE C 3 23  ? 71.916  94.767  40.292 1.00 26.78 ? 23   ILE A C     1 
ATOM   741  O  O     . ILE C 3 23  ? 70.698  94.752  40.119 1.00 26.10 ? 23   ILE A O     1 
ATOM   742  C  CB    . ILE C 3 23  ? 73.338  96.676  39.546 1.00 27.32 ? 23   ILE A CB    1 
ATOM   743  C  CG1   . ILE C 3 23  ? 74.057  97.954  39.991 1.00 28.27 ? 23   ILE A CG1   1 
ATOM   744  C  CG2   . ILE C 3 23  ? 72.326  96.972  38.439 1.00 28.41 ? 23   ILE A CG2   1 
ATOM   745  C  CD1   . ILE C 3 23  ? 73.153  98.979  40.650 1.00 30.85 ? 23   ILE A CD1   1 
ATOM   746  N  N     . SER C 3 24  ? 72.683  93.703  40.087 1.00 25.84 ? 24   SER A N     1 
ATOM   747  C  CA    . SER C 3 24  ? 72.113  92.435  39.665 1.00 25.47 ? 24   SER A CA    1 
ATOM   748  C  C     . SER C 3 24  ? 73.064  91.308  40.035 1.00 26.76 ? 24   SER A C     1 
ATOM   749  O  O     . SER C 3 24  ? 74.231  91.548  40.367 1.00 24.45 ? 24   SER A O     1 
ATOM   750  C  CB    . SER C 3 24  ? 71.853  92.431  38.154 1.00 27.15 ? 24   SER A CB    1 
ATOM   751  O  OG    . SER C 3 24  ? 73.060  92.505  37.417 1.00 29.58 ? 24   SER A OG    1 
ATOM   752  N  N     . ILE C 3 25  ? 72.550  90.083  39.993 1.00 25.55 ? 25   ILE A N     1 
ATOM   753  C  CA    . ILE C 3 25  ? 73.333  88.897  40.311 1.00 25.31 ? 25   ILE A CA    1 
ATOM   754  C  C     . ILE C 3 25  ? 72.978  87.836  39.279 1.00 26.29 ? 25   ILE A C     1 
ATOM   755  O  O     . ILE C 3 25  ? 71.800  87.566  39.045 1.00 27.21 ? 25   ILE A O     1 
ATOM   756  C  CB    . ILE C 3 25  ? 72.995  88.374  41.722 1.00 25.26 ? 25   ILE A CB    1 
ATOM   757  C  CG1   . ILE C 3 25  ? 73.257  89.475  42.753 1.00 26.64 ? 25   ILE A CG1   1 
ATOM   758  C  CG2   . ILE C 3 25  ? 73.829  87.138  42.043 1.00 25.05 ? 25   ILE A CG2   1 
ATOM   759  C  CD1   . ILE C 3 25  ? 72.760  89.147  44.153 1.00 27.37 ? 25   ILE A CD1   1 
ATOM   760  N  N     . GLU C 3 26  ? 73.991  87.252  38.645 1.00 25.47 ? 26   GLU A N     1 
ATOM   761  C  CA    . GLU C 3 26  ? 73.760  86.228  37.633 1.00 24.71 ? 26   GLU A CA    1 
ATOM   762  C  C     . GLU C 3 26  ? 74.550  84.975  37.977 1.00 25.08 ? 26   GLU A C     1 
ATOM   763  O  O     . GLU C 3 26  ? 75.553  85.038  38.694 1.00 24.01 ? 26   GLU A O     1 
ATOM   764  C  CB    . GLU C 3 26  ? 74.192  86.729  36.249 1.00 27.77 ? 26   GLU A CB    1 
ATOM   765  C  CG    . GLU C 3 26  ? 73.773  88.153  35.933 1.00 33.65 ? 26   GLU A CG    1 
ATOM   766  C  CD    . GLU C 3 26  ? 74.156  88.579  34.521 1.00 38.78 ? 26   GLU A CD    1 
ATOM   767  O  OE1   . GLU C 3 26  ? 75.300  88.308  34.094 1.00 41.36 ? 26   GLU A OE1   1 
ATOM   768  O  OE2   . GLU C 3 26  ? 73.312  89.194  33.836 1.00 41.78 ? 26   GLU A OE2   1 
ATOM   769  N  N     . ALA C 3 27  ? 74.104  83.838  37.457 1.00 23.50 ? 27   ALA A N     1 
ATOM   770  C  CA    . ALA C 3 27  ? 74.778  82.578  37.716 1.00 24.90 ? 27   ALA A CA    1 
ATOM   771  C  C     . ALA C 3 27  ? 74.768  81.648  36.513 1.00 25.92 ? 27   ALA A C     1 
ATOM   772  O  O     . ALA C 3 27  ? 73.767  81.542  35.803 1.00 26.02 ? 27   ALA A O     1 
ATOM   773  C  CB    . ALA C 3 27  ? 74.127  81.876  38.902 1.00 24.59 ? 27   ALA A CB    1 
ATOM   774  N  N     . THR C 3 28  ? 75.894  80.985  36.274 1.00 25.17 ? 28   THR A N     1 
ATOM   775  C  CA    . THR C 3 28  ? 75.966  80.014  35.195 1.00 24.29 ? 28   THR A CA    1 
ATOM   776  C  C     . THR C 3 28  ? 75.998  78.660  35.893 1.00 24.42 ? 28   THR A C     1 
ATOM   777  O  O     . THR C 3 28  ? 75.770  77.622  35.275 1.00 24.00 ? 28   THR A O     1 
ATOM   778  C  CB    . THR C 3 28  ? 77.217  80.207  34.295 1.00 25.56 ? 28   THR A CB    1 
ATOM   779  O  OG1   . THR C 3 28  ? 78.394  80.321  35.102 1.00 25.94 ? 28   THR A OG1   1 
ATOM   780  C  CG2   . THR C 3 28  ? 77.062  81.459  33.444 1.00 25.53 ? 28   THR A CG2   1 
ATOM   781  N  N     . TYR C 3 29  ? 76.271  78.687  37.199 1.00 23.02 ? 29   TYR A N     1 
ATOM   782  C  CA    . TYR C 3 29  ? 76.297  77.471  38.010 1.00 23.22 ? 29   TYR A CA    1 
ATOM   783  C  C     . TYR C 3 29  ? 75.525  77.738  39.301 1.00 22.83 ? 29   TYR A C     1 
ATOM   784  O  O     . TYR C 3 29  ? 76.092  77.774  40.395 1.00 20.95 ? 29   TYR A O     1 
ATOM   785  C  CB    . TYR C 3 29  ? 77.730  77.050  38.341 1.00 24.77 ? 29   TYR A CB    1 
ATOM   786  C  CG    . TYR C 3 29  ? 77.814  75.661  38.942 1.00 27.31 ? 29   TYR A CG    1 
ATOM   787  C  CD1   . TYR C 3 29  ? 78.342  75.459  40.217 1.00 28.14 ? 29   TYR A CD1   1 
ATOM   788  C  CD2   . TYR C 3 29  ? 77.341  74.549  38.241 1.00 29.31 ? 29   TYR A CD2   1 
ATOM   789  C  CE1   . TYR C 3 29  ? 78.397  74.184  40.782 1.00 30.13 ? 29   TYR A CE1   1 
ATOM   790  C  CE2   . TYR C 3 29  ? 77.389  73.269  38.797 1.00 30.94 ? 29   TYR A CE2   1 
ATOM   791  C  CZ    . TYR C 3 29  ? 77.918  73.097  40.067 1.00 31.89 ? 29   TYR A CZ    1 
ATOM   792  O  OH    . TYR C 3 29  ? 77.969  71.838  40.618 1.00 35.62 ? 29   TYR A OH    1 
ATOM   793  N  N     . PRO C 3 30  ? 74.204  77.925  39.185 1.00 21.71 ? 30   PRO A N     1 
ATOM   794  C  CA    . PRO C 3 30  ? 73.343  78.195  40.341 1.00 21.64 ? 30   PRO A CA    1 
ATOM   795  C  C     . PRO C 3 30  ? 73.345  77.152  41.457 1.00 20.62 ? 30   PRO A C     1 
ATOM   796  O  O     . PRO C 3 30  ? 73.025  77.476  42.598 1.00 20.73 ? 30   PRO A O     1 
ATOM   797  C  CB    . PRO C 3 30  ? 71.958  78.370  39.708 1.00 22.79 ? 30   PRO A CB    1 
ATOM   798  C  CG    . PRO C 3 30  ? 72.036  77.520  38.467 1.00 23.14 ? 30   PRO A CG    1 
ATOM   799  C  CD    . PRO C 3 30  ? 73.414  77.854  37.944 1.00 21.61 ? 30   PRO A CD    1 
ATOM   800  N  N     . ARG C 3 31  ? 73.714  75.916  41.141 1.00 19.22 ? 31   ARG A N     1 
ATOM   801  C  CA    . ARG C 3 31  ? 73.718  74.854  42.144 1.00 22.37 ? 31   ARG A CA    1 
ATOM   802  C  C     . ARG C 3 31  ? 74.702  75.033  43.305 1.00 20.65 ? 31   ARG A C     1 
ATOM   803  O  O     . ARG C 3 31  ? 74.567  74.366  44.332 1.00 19.23 ? 31   ARG A O     1 
ATOM   804  C  CB    . ARG C 3 31  ? 73.951  73.497  41.468 1.00 25.86 ? 31   ARG A CB    1 
ATOM   805  C  CG    . ARG C 3 31  ? 72.733  72.989  40.697 1.00 34.15 ? 31   ARG A CG    1 
ATOM   806  C  CD    . ARG C 3 31  ? 73.118  71.936  39.671 1.00 38.78 ? 31   ARG A CD    1 
ATOM   807  N  NE    . ARG C 3 31  ? 73.819  70.808  40.275 1.00 44.71 ? 31   ARG A NE    1 
ATOM   808  C  CZ    . ARG C 3 31  ? 74.432  69.858  39.578 1.00 47.78 ? 31   ARG A CZ    1 
ATOM   809  N  NH1   . ARG C 3 31  ? 74.432  69.903  38.250 1.00 48.90 ? 31   ARG A NH1   1 
ATOM   810  N  NH2   . ARG C 3 31  ? 75.045  68.862  40.205 1.00 49.36 ? 31   ARG A NH2   1 
ATOM   811  N  N     . MET C 3 32  ? 75.679  75.926  43.165 1.00 20.11 ? 32   MET A N     1 
ATOM   812  C  CA    . MET C 3 32  ? 76.637  76.128  44.256 1.00 20.22 ? 32   MET A CA    1 
ATOM   813  C  C     . MET C 3 32  ? 76.062  77.005  45.369 1.00 19.76 ? 32   MET A C     1 
ATOM   814  O  O     . MET C 3 32  ? 76.676  77.156  46.430 1.00 18.47 ? 32   MET A O     1 
ATOM   815  C  CB    . MET C 3 32  ? 77.965  76.717  43.744 1.00 18.61 ? 32   MET A CB    1 
ATOM   816  C  CG    . MET C 3 32  ? 77.891  78.129  43.206 1.00 19.01 ? 32   MET A CG    1 
ATOM   817  S  SD    . MET C 3 32  ? 79.563  78.855  43.088 1.00 19.72 ? 32   MET A SD    1 
ATOM   818  C  CE    . MET C 3 32  ? 79.842  79.298  44.826 1.00 19.00 ? 32   MET A CE    1 
ATOM   819  N  N     . VAL C 3 33  ? 74.893  77.597  45.129 1.00 19.78 ? 33   VAL A N     1 
ATOM   820  C  CA    . VAL C 3 33  ? 74.243  78.399  46.163 1.00 19.16 ? 33   VAL A CA    1 
ATOM   821  C  C     . VAL C 3 33  ? 73.354  77.389  46.887 1.00 21.24 ? 33   VAL A C     1 
ATOM   822  O  O     . VAL C 3 33  ? 72.254  77.057  46.429 1.00 20.49 ? 33   VAL A O     1 
ATOM   823  C  CB    . VAL C 3 33  ? 73.384  79.539  45.565 1.00 20.35 ? 33   VAL A CB    1 
ATOM   824  C  CG1   . VAL C 3 33  ? 72.718  80.328  46.689 1.00 19.03 ? 33   VAL A CG1   1 
ATOM   825  C  CG2   . VAL C 3 33  ? 74.263  80.472  44.728 1.00 19.93 ? 33   VAL A CG2   1 
ATOM   826  N  N     . LEU C 3 34  ? 73.850  76.888  48.012 1.00 21.69 ? 34   LEU A N     1 
ATOM   827  C  CA    . LEU C 3 34  ? 73.151  75.859  48.768 1.00 21.41 ? 34   LEU A CA    1 
ATOM   828  C  C     . LEU C 3 34  ? 71.774  76.236  49.309 1.00 22.46 ? 34   LEU A C     1 
ATOM   829  O  O     . LEU C 3 34  ? 70.965  75.357  49.596 1.00 21.92 ? 34   LEU A O     1 
ATOM   830  C  CB    . LEU C 3 34  ? 74.051  75.354  49.903 1.00 20.79 ? 34   LEU A CB    1 
ATOM   831  C  CG    . LEU C 3 34  ? 75.454  74.887  49.471 1.00 22.97 ? 34   LEU A CG    1 
ATOM   832  C  CD1   . LEU C 3 34  ? 76.173  74.261  50.655 1.00 21.94 ? 34   LEU A CD1   1 
ATOM   833  C  CD2   . LEU C 3 34  ? 75.352  73.868  48.343 1.00 23.22 ? 34   LEU A CD2   1 
ATOM   834  N  N     . THR C 3 35  ? 71.504  77.531  49.442 1.00 22.02 ? 35   THR A N     1 
ATOM   835  C  CA    . THR C 3 35  ? 70.214  77.975  49.948 1.00 22.93 ? 35   THR A CA    1 
ATOM   836  C  C     . THR C 3 35  ? 69.232  78.342  48.829 1.00 23.06 ? 35   THR A C     1 
ATOM   837  O  O     . THR C 3 35  ? 68.123  78.795  49.099 1.00 23.51 ? 35   THR A O     1 
ATOM   838  C  CB    . THR C 3 35  ? 70.383  79.174  50.910 1.00 23.47 ? 35   THR A CB    1 
ATOM   839  O  OG1   . THR C 3 35  ? 71.234  80.158  50.310 1.00 22.29 ? 35   THR A OG1   1 
ATOM   840  C  CG2   . THR C 3 35  ? 71.004  78.716  52.229 1.00 23.25 ? 35   THR A CG2   1 
ATOM   841  N  N     . GLY C 3 36  ? 69.638  78.126  47.577 1.00 23.28 ? 36   GLY A N     1 
ATOM   842  C  CA    . GLY C 3 36  ? 68.787  78.442  46.437 1.00 22.63 ? 36   GLY A CA    1 
ATOM   843  C  C     . GLY C 3 36  ? 69.197  79.730  45.740 1.00 21.77 ? 36   GLY A C     1 
ATOM   844  O  O     . GLY C 3 36  ? 69.127  80.804  46.332 1.00 21.60 ? 36   GLY A O     1 
ATOM   845  N  N     . PHE C 3 37  ? 69.612  79.637  44.479 1.00 21.83 ? 37   PHE A N     1 
ATOM   846  C  CA    . PHE C 3 37  ? 70.052  80.830  43.759 1.00 23.42 ? 37   PHE A CA    1 
ATOM   847  C  C     . PHE C 3 37  ? 68.975  81.883  43.502 1.00 23.93 ? 37   PHE A C     1 
ATOM   848  O  O     . PHE C 3 37  ? 69.176  83.063  43.785 1.00 23.38 ? 37   PHE A O     1 
ATOM   849  C  CB    . PHE C 3 37  ? 70.692  80.468  42.418 1.00 23.27 ? 37   PHE A CB    1 
ATOM   850  C  CG    . PHE C 3 37  ? 71.044  81.675  41.587 1.00 26.35 ? 37   PHE A CG    1 
ATOM   851  C  CD1   . PHE C 3 37  ? 72.073  82.526  41.979 1.00 27.47 ? 37   PHE A CD1   1 
ATOM   852  C  CD2   . PHE C 3 37  ? 70.284  82.016  40.473 1.00 27.06 ? 37   PHE A CD2   1 
ATOM   853  C  CE1   . PHE C 3 37  ? 72.336  83.706  41.278 1.00 27.86 ? 37   PHE A CE1   1 
ATOM   854  C  CE2   . PHE C 3 37  ? 70.538  83.193  39.767 1.00 27.77 ? 37   PHE A CE2   1 
ATOM   855  C  CZ    . PHE C 3 37  ? 71.567  84.040  40.174 1.00 27.28 ? 37   PHE A CZ    1 
ATOM   856  N  N     . GLU C 3 38  ? 67.844  81.470  42.943 1.00 25.36 ? 38   GLU A N     1 
ATOM   857  C  CA    . GLU C 3 38  ? 66.778  82.422  42.658 1.00 27.03 ? 38   GLU A CA    1 
ATOM   858  C  C     . GLU C 3 38  ? 66.354  83.156  43.919 1.00 25.55 ? 38   GLU A C     1 
ATOM   859  O  O     . GLU C 3 38  ? 66.056  84.348  43.883 1.00 26.76 ? 38   GLU A O     1 
ATOM   860  C  CB    . GLU C 3 38  ? 65.585  81.708  42.022 1.00 28.94 ? 38   GLU A CB    1 
ATOM   861  C  CG    . GLU C 3 38  ? 65.889  81.196  40.624 1.00 32.56 ? 38   GLU A CG    1 
ATOM   862  C  CD    . GLU C 3 38  ? 66.224  82.317  39.651 1.00 35.35 ? 38   GLU A CD    1 
ATOM   863  O  OE1   . GLU C 3 38  ? 66.887  82.039  38.629 1.00 37.43 ? 38   GLU A OE1   1 
ATOM   864  O  OE2   . GLU C 3 38  ? 65.819  83.474  39.902 1.00 34.69 ? 38   GLU A OE2   1 
ATOM   865  N  N     . GLN C 3 39  ? 66.344  82.447  45.038 1.00 25.39 ? 39   GLN A N     1 
ATOM   866  C  CA    . GLN C 3 39  ? 65.965  83.056  46.300 1.00 26.22 ? 39   GLN A CA    1 
ATOM   867  C  C     . GLN C 3 39  ? 67.004  84.099  46.709 1.00 26.73 ? 39   GLN A C     1 
ATOM   868  O  O     . GLN C 3 39  ? 66.658  85.195  47.163 1.00 26.29 ? 39   GLN A O     1 
ATOM   869  C  CB    . GLN C 3 39  ? 65.816  81.976  47.378 1.00 27.29 ? 39   GLN A CB    1 
ATOM   870  C  CG    . GLN C 3 39  ? 64.713  80.953  47.061 1.00 28.83 ? 39   GLN A CG    1 
ATOM   871  C  CD    . GLN C 3 39  ? 65.216  79.718  46.320 1.00 30.34 ? 39   GLN A CD    1 
ATOM   872  O  OE1   . GLN C 3 39  ? 66.070  79.804  45.432 1.00 27.81 ? 39   GLN A OE1   1 
ATOM   873  N  NE2   . GLN C 3 39  ? 64.673  78.560  46.678 1.00 30.01 ? 39   GLN A NE2   1 
ATOM   874  N  N     . LEU C 3 40  ? 68.280  83.766  46.531 1.00 25.13 ? 40   LEU A N     1 
ATOM   875  C  CA    . LEU C 3 40  ? 69.351  84.694  46.873 1.00 24.11 ? 40   LEU A CA    1 
ATOM   876  C  C     . LEU C 3 40  ? 69.286  85.922  45.973 1.00 23.59 ? 40   LEU A C     1 
ATOM   877  O  O     . LEU C 3 40  ? 69.397  87.054  46.441 1.00 23.42 ? 40   LEU A O     1 
ATOM   878  C  CB    . LEU C 3 40  ? 70.720  84.011  46.732 1.00 24.16 ? 40   LEU A CB    1 
ATOM   879  C  CG    . LEU C 3 40  ? 71.934  84.924  46.941 1.00 24.82 ? 40   LEU A CG    1 
ATOM   880  C  CD1   . LEU C 3 40  ? 73.076  84.146  47.565 1.00 23.02 ? 40   LEU A CD1   1 
ATOM   881  C  CD2   . LEU C 3 40  ? 72.347  85.530  45.609 1.00 24.50 ? 40   LEU A CD2   1 
ATOM   882  N  N     . LYS C 3 41  ? 69.096  85.691  44.679 1.00 24.18 ? 41   LYS A N     1 
ATOM   883  C  CA    . LYS C 3 41  ? 69.011  86.780  43.710 1.00 28.26 ? 41   LYS A CA    1 
ATOM   884  C  C     . LYS C 3 41  ? 67.866  87.732  44.063 1.00 29.60 ? 41   LYS A C     1 
ATOM   885  O  O     . LYS C 3 41  ? 68.014  88.952  43.998 1.00 29.50 ? 41   LYS A O     1 
ATOM   886  C  CB    . LYS C 3 41  ? 68.799  86.205  42.305 1.00 28.38 ? 41   LYS A CB    1 
ATOM   887  C  CG    . LYS C 3 41  ? 68.573  87.236  41.208 1.00 29.53 ? 41   LYS A CG    1 
ATOM   888  C  CD    . LYS C 3 41  ? 68.215  86.535  39.902 1.00 34.05 ? 41   LYS A CD    1 
ATOM   889  C  CE    . LYS C 3 41  ? 67.863  87.528  38.804 1.00 37.10 ? 41   LYS A CE    1 
ATOM   890  N  NZ    . LYS C 3 41  ? 69.019  88.403  38.469 1.00 40.36 ? 41   LYS A NZ    1 
ATOM   891  N  N     . LYS C 3 42  ? 66.726  87.170  44.449 1.00 30.52 ? 42   LYS A N     1 
ATOM   892  C  CA    . LYS C 3 42  ? 65.572  87.991  44.801 1.00 32.74 ? 42   LYS A CA    1 
ATOM   893  C  C     . LYS C 3 42  ? 65.816  88.813  46.062 1.00 32.14 ? 42   LYS A C     1 
ATOM   894  O  O     . LYS C 3 42  ? 65.460  89.986  46.125 1.00 33.54 ? 42   LYS A O     1 
ATOM   895  C  CB    . LYS C 3 42  ? 64.335  87.111  44.995 1.00 34.52 ? 42   LYS A CB    1 
ATOM   896  C  CG    . LYS C 3 42  ? 63.046  87.893  45.225 1.00 40.60 ? 42   LYS A CG    1 
ATOM   897  C  CD    . LYS C 3 42  ? 61.855  86.959  45.385 1.00 44.64 ? 42   LYS A CD    1 
ATOM   898  C  CE    . LYS C 3 42  ? 60.551  87.737  45.522 1.00 47.56 ? 42   LYS A CE    1 
ATOM   899  N  NZ    . LYS C 3 42  ? 60.580  88.671  46.685 1.00 50.70 ? 42   LYS A NZ    1 
ATOM   900  N  N     . GLU C 3 43  ? 66.441  88.199  47.060 1.00 31.76 ? 43   GLU A N     1 
ATOM   901  C  CA    . GLU C 3 43  ? 66.712  88.866  48.329 1.00 31.51 ? 43   GLU A CA    1 
ATOM   902  C  C     . GLU C 3 43  ? 67.834  89.906  48.335 1.00 30.65 ? 43   GLU A C     1 
ATOM   903  O  O     . GLU C 3 43  ? 67.733  90.920  49.026 1.00 30.32 ? 43   GLU A O     1 
ATOM   904  C  CB    . GLU C 3 43  ? 67.017  87.818  49.402 1.00 34.71 ? 43   GLU A CB    1 
ATOM   905  C  CG    . GLU C 3 43  ? 65.842  86.918  49.748 1.00 40.43 ? 43   GLU A CG    1 
ATOM   906  C  CD    . GLU C 3 43  ? 64.975  87.488  50.852 1.00 44.17 ? 43   GLU A CD    1 
ATOM   907  O  OE1   . GLU C 3 43  ? 64.639  88.690  50.794 1.00 46.24 ? 43   GLU A OE1   1 
ATOM   908  O  OE2   . GLU C 3 43  ? 64.624  86.730  51.782 1.00 47.88 ? 43   GLU A OE2   1 
ATOM   909  N  N     . LEU C 3 44  ? 68.895  89.667  47.571 1.00 28.12 ? 44   LEU A N     1 
ATOM   910  C  CA    . LEU C 3 44  ? 70.033  90.581  47.573 1.00 27.07 ? 44   LEU A CA    1 
ATOM   911  C  C     . LEU C 3 44  ? 70.109  91.666  46.502 1.00 26.17 ? 44   LEU A C     1 
ATOM   912  O  O     . LEU C 3 44  ? 70.838  92.639  46.668 1.00 25.67 ? 44   LEU A O     1 
ATOM   913  C  CB    . LEU C 3 44  ? 71.333  89.770  47.555 1.00 26.19 ? 44   LEU A CB    1 
ATOM   914  C  CG    . LEU C 3 44  ? 71.508  88.780  48.709 1.00 26.28 ? 44   LEU A CG    1 
ATOM   915  C  CD1   . LEU C 3 44  ? 72.847  88.062  48.562 1.00 27.62 ? 44   LEU A CD1   1 
ATOM   916  C  CD2   . LEU C 3 44  ? 71.444  89.517  50.039 1.00 26.45 ? 44   LEU A CD2   1 
ATOM   917  N  N     . THR C 3 45  ? 69.379  91.516  45.405 1.00 26.48 ? 45   THR A N     1 
ATOM   918  C  CA    . THR C 3 45  ? 69.433  92.536  44.365 1.00 27.35 ? 45   THR A CA    1 
ATOM   919  C  C     . THR C 3 45  ? 68.925  93.865  44.922 1.00 28.61 ? 45   THR A C     1 
ATOM   920  O  O     . THR C 3 45  ? 67.880  93.915  45.571 1.00 28.96 ? 45   THR A O     1 
ATOM   921  C  CB    . THR C 3 45  ? 68.593  92.130  43.145 1.00 27.60 ? 45   THR A CB    1 
ATOM   922  O  OG1   . THR C 3 45  ? 69.122  90.921  42.590 1.00 29.80 ? 45   THR A OG1   1 
ATOM   923  C  CG2   . THR C 3 45  ? 68.628  93.215  42.082 1.00 28.20 ? 45   THR A CG2   1 
ATOM   924  N  N     . GLY C 3 46  ? 69.679  94.933  44.679 1.00 27.28 ? 46   GLY A N     1 
ATOM   925  C  CA    . GLY C 3 46  ? 69.293  96.245  45.165 1.00 26.58 ? 46   GLY A CA    1 
ATOM   926  C  C     . GLY C 3 46  ? 69.826  96.566  46.550 1.00 27.99 ? 46   GLY A C     1 
ATOM   927  O  O     . GLY C 3 46  ? 69.739  97.709  47.004 1.00 26.73 ? 46   GLY A O     1 
ATOM   928  N  N     . LYS C 3 47  ? 70.380  95.563  47.229 1.00 27.50 ? 47   LYS A N     1 
ATOM   929  C  CA    . LYS C 3 47  ? 70.923  95.761  48.570 1.00 28.54 ? 47   LYS A CA    1 
ATOM   930  C  C     . LYS C 3 47  ? 72.361  96.278  48.519 1.00 28.32 ? 47   LYS A C     1 
ATOM   931  O  O     . LYS C 3 47  ? 73.047  96.136  47.506 1.00 27.87 ? 47   LYS A O     1 
ATOM   932  C  CB    . LYS C 3 47  ? 70.876  94.450  49.361 1.00 29.94 ? 47   LYS A CB    1 
ATOM   933  C  CG    . LYS C 3 47  ? 69.476  93.880  49.550 1.00 34.33 ? 47   LYS A CG    1 
ATOM   934  C  CD    . LYS C 3 47  ? 68.613  94.801  50.398 1.00 38.34 ? 47   LYS A CD    1 
ATOM   935  C  CE    . LYS C 3 47  ? 67.254  94.176  50.697 1.00 41.56 ? 47   LYS A CE    1 
ATOM   936  N  NZ    . LYS C 3 47  ? 66.444  93.951  49.463 1.00 42.94 ? 47   LYS A NZ    1 
ATOM   937  N  N     . THR C 3 48  ? 72.808  96.865  49.622 1.00 27.35 ? 48   THR A N     1 
ATOM   938  C  CA    . THR C 3 48  ? 74.152  97.418  49.716 1.00 29.07 ? 48   THR A CA    1 
ATOM   939  C  C     . THR C 3 48  ? 75.063  96.612  50.639 1.00 28.47 ? 48   THR A C     1 
ATOM   940  O  O     . THR C 3 48  ? 74.646  96.171  51.708 1.00 29.54 ? 48   THR A O     1 
ATOM   941  C  CB    . THR C 3 48  ? 74.093  98.872  50.213 1.00 30.22 ? 48   THR A CB    1 
ATOM   942  O  OG1   . THR C 3 48  ? 73.437  99.679  49.225 1.00 30.58 ? 48   THR A OG1   1 
ATOM   943  C  CG2   . THR C 3 48  ? 75.492  99.416  50.473 1.00 29.60 ? 48   THR A CG2   1 
ATOM   944  N  N     . ILE C 3 49  ? 76.309  96.420  50.215 1.00 27.79 ? 49   ILE A N     1 
ATOM   945  C  CA    . ILE C 3 49  ? 77.278  95.675  51.010 1.00 27.26 ? 49   ILE A CA    1 
ATOM   946  C  C     . ILE C 3 49  ? 77.758  96.566  52.153 1.00 26.89 ? 49   ILE A C     1 
ATOM   947  O  O     . ILE C 3 49  ? 78.327  97.634  51.925 1.00 27.71 ? 49   ILE A O     1 
ATOM   948  C  CB    . ILE C 3 49  ? 78.465  95.218  50.131 1.00 27.93 ? 49   ILE A CB    1 
ATOM   949  C  CG1   . ILE C 3 49  ? 77.941  94.290  49.029 1.00 28.08 ? 49   ILE A CG1   1 
ATOM   950  C  CG2   . ILE C 3 49  ? 79.509  94.495  50.982 1.00 26.43 ? 49   ILE A CG2   1 
ATOM   951  C  CD1   . ILE C 3 49  ? 78.992  93.817  48.050 1.00 32.10 ? 49   ILE A CD1   1 
ATOM   952  N  N     A GLN C 3 50  ? 77.529  96.115  53.383 0.50 26.04 ? 50   GLN A N     1 
ATOM   953  N  N     B GLN C 3 50  ? 77.517  96.121  53.384 0.50 25.97 ? 50   GLN A N     1 
ATOM   954  C  CA    A GLN C 3 50  ? 77.908  96.882  54.563 0.50 26.69 ? 50   GLN A CA    1 
ATOM   955  C  CA    B GLN C 3 50  ? 77.909  96.874  54.573 0.50 26.62 ? 50   GLN A CA    1 
ATOM   956  C  C     A GLN C 3 50  ? 79.279  96.504  55.119 0.50 25.67 ? 50   GLN A C     1 
ATOM   957  C  C     B GLN C 3 50  ? 79.294  96.513  55.095 0.50 25.65 ? 50   GLN A C     1 
ATOM   958  O  O     A GLN C 3 50  ? 79.925  97.310  55.791 0.50 25.85 ? 50   GLN A O     1 
ATOM   959  O  O     B GLN C 3 50  ? 79.965  97.339  55.717 0.50 25.98 ? 50   GLN A O     1 
ATOM   960  C  CB    A GLN C 3 50  ? 76.843  96.709  55.648 0.50 27.52 ? 50   GLN A CB    1 
ATOM   961  C  CB    B GLN C 3 50  ? 76.893  96.656  55.699 0.50 27.12 ? 50   GLN A CB    1 
ATOM   962  C  CG    A GLN C 3 50  ? 75.411  96.797  55.128 0.50 30.09 ? 50   GLN A CG    1 
ATOM   963  C  CG    B GLN C 3 50  ? 75.640  97.508  55.609 0.50 29.90 ? 50   GLN A CG    1 
ATOM   964  C  CD    A GLN C 3 50  ? 75.064  98.153  54.531 0.50 32.09 ? 50   GLN A CD    1 
ATOM   965  C  CD    B GLN C 3 50  ? 74.693  97.266  56.772 0.50 30.04 ? 50   GLN A CD    1 
ATOM   966  O  OE1   A GLN C 3 50  ? 73.978  98.337  53.976 0.50 33.14 ? 50   GLN A OE1   1 
ATOM   967  O  OE1   B GLN C 3 50  ? 75.111  97.220  57.931 0.50 31.77 ? 50   GLN A OE1   1 
ATOM   968  N  NE2   A GLN C 3 50  ? 75.979  99.109  54.648 0.50 32.96 ? 50   GLN A NE2   1 
ATOM   969  N  NE2   B GLN C 3 50  ? 73.410  97.119  56.469 0.50 30.64 ? 50   GLN A NE2   1 
ATOM   970  N  N     . GLY C 3 51  ? 79.718  95.280  54.847 1.00 24.57 ? 51   GLY A N     1 
ATOM   971  C  CA    . GLY C 3 51  ? 81.018  94.847  55.329 1.00 22.51 ? 51   GLY A CA    1 
ATOM   972  C  C     . GLY C 3 51  ? 81.341  93.414  54.952 1.00 21.02 ? 51   GLY A C     1 
ATOM   973  O  O     . GLY C 3 51  ? 80.513  92.720  54.365 1.00 19.32 ? 51   GLY A O     1 
ATOM   974  N  N     . ILE C 3 52  ? 82.553  92.978  55.279 1.00 19.76 ? 52   ILE A N     1 
ATOM   975  C  CA    . ILE C 3 52  ? 82.984  91.611  54.982 1.00 20.73 ? 52   ILE A CA    1 
ATOM   976  C  C     . ILE C 3 52  ? 83.732  91.071  56.193 1.00 20.06 ? 52   ILE A C     1 
ATOM   977  O  O     . ILE C 3 52  ? 84.744  91.640  56.601 1.00 19.92 ? 52   ILE A O     1 
ATOM   978  C  CB    . ILE C 3 52  ? 83.967  91.552  53.785 1.00 21.93 ? 52   ILE A CB    1 
ATOM   979  C  CG1   . ILE C 3 52  ? 83.460  92.416  52.623 1.00 23.22 ? 52   ILE A CG1   1 
ATOM   980  C  CG2   . ILE C 3 52  ? 84.154  90.094  53.351 1.00 20.84 ? 52   ILE A CG2   1 
ATOM   981  C  CD1   . ILE C 3 52  ? 82.162  91.944  52.022 1.00 28.90 ? 52   ILE A CD1   1 
ATOM   982  N  N     . SER C 3 53  ? 83.236  89.980  56.765 1.00 20.46 ? 53   SER A N     1 
ATOM   983  C  CA    . SER C 3 53  ? 83.880  89.366  57.920 1.00 21.51 ? 53   SER A CA    1 
ATOM   984  C  C     . SER C 3 53  ? 84.410  87.994  57.529 1.00 20.20 ? 53   SER A C     1 
ATOM   985  O  O     . SER C 3 53  ? 84.272  87.570  56.381 1.00 20.73 ? 53   SER A O     1 
ATOM   986  C  CB    . SER C 3 53  ? 82.885  89.218  59.076 1.00 22.77 ? 53   SER A CB    1 
ATOM   987  O  OG    . SER C 3 53  ? 82.477  90.487  59.552 1.00 28.71 ? 53   SER A OG    1 
ATOM   988  N  N     . ARG C 3 54  ? 85.024  87.312  58.489 1.00 19.95 ? 54   ARG A N     1 
ATOM   989  C  CA    . ARG C 3 54  ? 85.572  85.980  58.261 1.00 20.07 ? 54   ARG A CA    1 
ATOM   990  C  C     . ARG C 3 54  ? 85.542  85.193  59.559 1.00 19.50 ? 54   ARG A C     1 
ATOM   991  O  O     . ARG C 3 54  ? 85.692  85.756  60.642 1.00 18.96 ? 54   ARG A O     1 
ATOM   992  C  CB    . ARG C 3 54  ? 87.029  86.063  57.768 1.00 18.26 ? 54   ARG A CB    1 
ATOM   993  C  CG    . ARG C 3 54  ? 87.699  84.695  57.568 1.00 20.40 ? 54   ARG A CG    1 
ATOM   994  C  CD    . ARG C 3 54  ? 89.203  84.821  57.312 1.00 19.40 ? 54   ARG A CD    1 
ATOM   995  N  NE    . ARG C 3 54  ? 89.883  85.539  58.390 1.00 19.59 ? 54   ARG A NE    1 
ATOM   996  C  CZ    . ARG C 3 54  ? 89.958  85.117  59.650 1.00 22.12 ? 54   ARG A CZ    1 
ATOM   997  N  NH1   . ARG C 3 54  ? 89.401  83.966  60.009 1.00 18.48 ? 54   ARG A NH1   1 
ATOM   998  N  NH2   . ARG C 3 54  ? 90.577  85.859  60.563 1.00 22.42 ? 54   ARG A NH2   1 
ATOM   999  N  N     . ARG C 3 55  ? 85.328  83.889  59.438 1.00 18.02 ? 55   ARG A N     1 
ATOM   1000 C  CA    . ARG C 3 55  ? 85.329  82.988  60.584 1.00 19.77 ? 55   ARG A CA    1 
ATOM   1001 C  C     . ARG C 3 55  ? 86.023  81.753  60.029 1.00 18.42 ? 55   ARG A C     1 
ATOM   1002 O  O     . ARG C 3 55  ? 85.524  81.132  59.095 1.00 17.43 ? 55   ARG A O     1 
ATOM   1003 C  CB    . ARG C 3 55  ? 83.902  82.646  61.024 1.00 19.09 ? 55   ARG A CB    1 
ATOM   1004 C  CG    . ARG C 3 55  ? 83.833  81.681  62.207 1.00 19.00 ? 55   ARG A CG    1 
ATOM   1005 C  CD    . ARG C 3 55  ? 84.325  82.295  63.522 1.00 19.71 ? 55   ARG A CD    1 
ATOM   1006 N  NE    . ARG C 3 55  ? 84.073  81.375  64.636 1.00 19.59 ? 55   ARG A NE    1 
ATOM   1007 C  CZ    . ARG C 3 55  ? 84.983  80.568  65.177 1.00 20.08 ? 55   ARG A CZ    1 
ATOM   1008 N  NH1   . ARG C 3 55  ? 86.235  80.563  64.730 1.00 17.96 ? 55   ARG A NH1   1 
ATOM   1009 N  NH2   . ARG C 3 55  ? 84.624  79.722  66.136 1.00 20.28 ? 55   ARG A NH2   1 
ATOM   1010 N  N     . GLY C 3 56  ? 87.184  81.412  60.578 1.00 17.16 ? 56   GLY A N     1 
ATOM   1011 C  CA    . GLY C 3 56  ? 87.906  80.268  60.052 1.00 16.74 ? 56   GLY A CA    1 
ATOM   1012 C  C     . GLY C 3 56  ? 88.214  80.530  58.585 1.00 16.32 ? 56   GLY A C     1 
ATOM   1013 O  O     . GLY C 3 56  ? 88.705  81.605  58.243 1.00 16.98 ? 56   GLY A O     1 
ATOM   1014 N  N     . LYS C 3 57  ? 87.922  79.566  57.713 1.00 15.81 ? 57   LYS A N     1 
ATOM   1015 C  CA    . LYS C 3 57  ? 88.176  79.738  56.281 1.00 15.85 ? 57   LYS A CA    1 
ATOM   1016 C  C     . LYS C 3 57  ? 86.926  80.250  55.562 1.00 17.15 ? 57   LYS A C     1 
ATOM   1017 O  O     . LYS C 3 57  ? 86.873  80.264  54.336 1.00 16.43 ? 57   LYS A O     1 
ATOM   1018 C  CB    . LYS C 3 57  ? 88.612  78.406  55.653 1.00 16.27 ? 57   LYS A CB    1 
ATOM   1019 C  CG    . LYS C 3 57  ? 89.911  77.838  56.225 1.00 16.73 ? 57   LYS A CG    1 
ATOM   1020 C  CD    . LYS C 3 57  ? 90.155  76.406  55.741 1.00 17.16 ? 57   LYS A CD    1 
ATOM   1021 C  CE    . LYS C 3 57  ? 91.244  75.716  56.573 1.00 16.61 ? 57   LYS A CE    1 
ATOM   1022 N  NZ    . LYS C 3 57  ? 91.358  74.251  56.257 1.00 16.74 ? 57   LYS A NZ    1 
ATOM   1023 N  N     . TYR C 3 58  ? 85.924  80.669  56.330 1.00 15.57 ? 58   TYR A N     1 
ATOM   1024 C  CA    . TYR C 3 58  ? 84.668  81.162  55.762 1.00 16.31 ? 58   TYR A CA    1 
ATOM   1025 C  C     . TYR C 3 58  ? 84.599  82.677  55.599 1.00 16.34 ? 58   TYR A C     1 
ATOM   1026 O  O     . TYR C 3 58  ? 84.892  83.426  56.536 1.00 17.77 ? 58   TYR A O     1 
ATOM   1027 C  CB    . TYR C 3 58  ? 83.484  80.753  56.647 1.00 16.92 ? 58   TYR A CB    1 
ATOM   1028 C  CG    . TYR C 3 58  ? 83.194  79.274  56.723 1.00 18.27 ? 58   TYR A CG    1 
ATOM   1029 C  CD1   . TYR C 3 58  ? 82.097  78.727  56.060 1.00 18.74 ? 58   TYR A CD1   1 
ATOM   1030 C  CD2   . TYR C 3 58  ? 83.989  78.428  57.495 1.00 19.52 ? 58   TYR A CD2   1 
ATOM   1031 C  CE1   . TYR C 3 58  ? 81.794  77.372  56.171 1.00 20.13 ? 58   TYR A CE1   1 
ATOM   1032 C  CE2   . TYR C 3 58  ? 83.697  77.074  57.608 1.00 20.81 ? 58   TYR A CE2   1 
ATOM   1033 C  CZ    . TYR C 3 58  ? 82.601  76.556  56.948 1.00 20.93 ? 58   TYR A CZ    1 
ATOM   1034 O  OH    . TYR C 3 58  ? 82.311  75.220  57.069 1.00 25.35 ? 58   TYR A OH    1 
ATOM   1035 N  N     . LEU C 3 59  ? 84.190  83.119  54.413 1.00 16.32 ? 59   LEU A N     1 
ATOM   1036 C  CA    . LEU C 3 59  ? 84.010  84.541  54.142 1.00 17.92 ? 59   LEU A CA    1 
ATOM   1037 C  C     . LEU C 3 59  ? 82.553  84.854  54.479 1.00 19.54 ? 59   LEU A C     1 
ATOM   1038 O  O     . LEU C 3 59  ? 81.660  84.048  54.202 1.00 20.25 ? 59   LEU A O     1 
ATOM   1039 C  CB    . LEU C 3 59  ? 84.248  84.857  52.668 1.00 20.61 ? 59   LEU A CB    1 
ATOM   1040 C  CG    . LEU C 3 59  ? 85.669  85.143  52.199 1.00 24.58 ? 59   LEU A CG    1 
ATOM   1041 C  CD1   . LEU C 3 59  ? 85.637  85.395  50.693 1.00 26.41 ? 59   LEU A CD1   1 
ATOM   1042 C  CD2   . LEU C 3 59  ? 86.231  86.366  52.935 1.00 22.99 ? 59   LEU A CD2   1 
ATOM   1043 N  N     . ILE C 3 60  ? 82.315  86.021  55.068 1.00 19.37 ? 60   ILE A N     1 
ATOM   1044 C  CA    . ILE C 3 60  ? 80.967  86.427  55.450 1.00 19.69 ? 60   ILE A CA    1 
ATOM   1045 C  C     . ILE C 3 60  ? 80.657  87.820  54.908 1.00 20.73 ? 60   ILE A C     1 
ATOM   1046 O  O     . ILE C 3 60  ? 81.170  88.815  55.419 1.00 20.69 ? 60   ILE A O     1 
ATOM   1047 C  CB    . ILE C 3 60  ? 80.817  86.464  56.993 1.00 21.53 ? 60   ILE A CB    1 
ATOM   1048 C  CG1   . ILE C 3 60  ? 81.242  85.119  57.594 1.00 21.20 ? 60   ILE A CG1   1 
ATOM   1049 C  CG2   . ILE C 3 60  ? 79.369  86.771  57.372 1.00 22.11 ? 60   ILE A CG2   1 
ATOM   1050 C  CD1   . ILE C 3 60  ? 81.369  85.142  59.109 1.00 22.89 ? 60   ILE A CD1   1 
ATOM   1051 N  N     . PHE C 3 61  ? 79.831  87.881  53.866 1.00 19.65 ? 61   PHE A N     1 
ATOM   1052 C  CA    . PHE C 3 61  ? 79.431  89.152  53.274 1.00 20.20 ? 61   PHE A CA    1 
ATOM   1053 C  C     . PHE C 3 61  ? 78.261  89.656  54.106 1.00 20.67 ? 61   PHE A C     1 
ATOM   1054 O  O     . PHE C 3 61  ? 77.320  88.910  54.362 1.00 20.30 ? 61   PHE A O     1 
ATOM   1055 C  CB    . PHE C 3 61  ? 78.955  88.958  51.829 1.00 20.77 ? 61   PHE A CB    1 
ATOM   1056 C  CG    . PHE C 3 61  ? 80.050  88.605  50.861 1.00 21.70 ? 61   PHE A CG    1 
ATOM   1057 C  CD1   . PHE C 3 61  ? 80.718  89.601  50.152 1.00 22.86 ? 61   PHE A CD1   1 
ATOM   1058 C  CD2   . PHE C 3 61  ? 80.398  87.279  50.643 1.00 22.53 ? 61   PHE A CD2   1 
ATOM   1059 C  CE1   . PHE C 3 61  ? 81.718  89.280  49.237 1.00 23.61 ? 61   PHE A CE1   1 
ATOM   1060 C  CE2   . PHE C 3 61  ? 81.398  86.944  49.730 1.00 23.58 ? 61   PHE A CE2   1 
ATOM   1061 C  CZ    . PHE C 3 61  ? 82.058  87.948  49.026 1.00 24.28 ? 61   PHE A CZ    1 
ATOM   1062 N  N     . GLU C 3 62  ? 78.331  90.911  54.532 1.00 21.14 ? 62   GLU A N     1 
ATOM   1063 C  CA    . GLU C 3 62  ? 77.271  91.522  55.327 1.00 21.52 ? 62   GLU A CA    1 
ATOM   1064 C  C     . GLU C 3 62  ? 76.550  92.444  54.352 1.00 21.36 ? 62   GLU A C     1 
ATOM   1065 O  O     . GLU C 3 62  ? 77.073  93.487  53.964 1.00 21.30 ? 62   GLU A O     1 
ATOM   1066 C  CB    . GLU C 3 62  ? 77.906  92.279  56.493 1.00 23.47 ? 62   GLU A CB    1 
ATOM   1067 C  CG    . GLU C 3 62  ? 78.949  91.405  57.203 1.00 26.35 ? 62   GLU A CG    1 
ATOM   1068 C  CD    . GLU C 3 62  ? 79.665  92.095  58.346 1.00 29.79 ? 62   GLU A CD    1 
ATOM   1069 O  OE1   . GLU C 3 62  ? 79.962  93.305  58.232 1.00 29.73 ? 62   GLU A OE1   1 
ATOM   1070 O  OE2   . GLU C 3 62  ? 79.949  91.411  59.355 1.00 31.72 ? 62   GLU A OE2   1 
ATOM   1071 N  N     . ILE C 3 63  ? 75.358  92.029  53.941 1.00 23.92 ? 63   ILE A N     1 
ATOM   1072 C  CA    . ILE C 3 63  ? 74.577  92.761  52.949 1.00 26.30 ? 63   ILE A CA    1 
ATOM   1073 C  C     . ILE C 3 63  ? 73.225  93.174  53.510 1.00 27.57 ? 63   ILE A C     1 
ATOM   1074 O  O     . ILE C 3 63  ? 72.455  92.342  53.975 1.00 27.65 ? 63   ILE A O     1 
ATOM   1075 C  CB    . ILE C 3 63  ? 74.387  91.876  51.703 1.00 24.97 ? 63   ILE A CB    1 
ATOM   1076 C  CG1   . ILE C 3 63  ? 75.753  91.313  51.283 1.00 25.11 ? 63   ILE A CG1   1 
ATOM   1077 C  CG2   . ILE C 3 63  ? 73.740  92.674  50.575 1.00 25.68 ? 63   ILE A CG2   1 
ATOM   1078 C  CD1   . ILE C 3 63  ? 75.710  90.343  50.114 1.00 24.26 ? 63   ILE A CD1   1 
ATOM   1079 N  N     . GLY C 3 64  ? 72.928  94.465  53.449 1.00 31.66 ? 64   GLY A N     1 
ATOM   1080 C  CA    . GLY C 3 64  ? 71.677  94.927  54.019 1.00 35.88 ? 64   GLY A CA    1 
ATOM   1081 C  C     . GLY C 3 64  ? 71.917  94.815  55.510 1.00 37.58 ? 64   GLY A C     1 
ATOM   1082 O  O     . GLY C 3 64  ? 73.025  94.471  55.926 1.00 39.96 ? 64   GLY A O     1 
ATOM   1083 N  N     . ASP C 3 65  ? 70.910  95.072  56.332 1.00 38.98 ? 65   ASP A N     1 
ATOM   1084 C  CA    . ASP C 3 65  ? 71.137  94.985  57.767 1.00 37.23 ? 65   ASP A CA    1 
ATOM   1085 C  C     . ASP C 3 65  ? 70.850  93.611  58.354 1.00 36.73 ? 65   ASP A C     1 
ATOM   1086 O  O     . ASP C 3 65  ? 71.254  93.320  59.482 1.00 39.38 ? 65   ASP A O     1 
ATOM   1087 C  CB    . ASP C 3 65  ? 70.309  96.051  58.489 0.50 38.07 ? 65   ASP A CB    1 
ATOM   1088 C  CG    . ASP C 3 65  ? 71.162  96.953  59.363 0.50 37.39 ? 65   ASP A CG    1 
ATOM   1089 O  OD1   . ASP C 3 65  ? 72.216  97.423  58.886 0.50 36.98 ? 65   ASP A OD1   1 
ATOM   1090 O  OD2   . ASP C 3 65  ? 70.776  97.198  60.524 0.50 38.38 ? 65   ASP A OD2   1 
ATOM   1091 N  N     . ASP C 3 66  ? 70.191  92.750  57.585 1.00 33.74 ? 66   ASP A N     1 
ATOM   1092 C  CA    . ASP C 3 66  ? 69.837  91.427  58.092 1.00 32.50 ? 66   ASP A CA    1 
ATOM   1093 C  C     . ASP C 3 66  ? 70.354  90.224  57.301 1.00 31.05 ? 66   ASP A C     1 
ATOM   1094 O  O     . ASP C 3 66  ? 70.080  89.085  57.678 1.00 31.56 ? 66   ASP A O     1 
ATOM   1095 C  CB    . ASP C 3 66  ? 68.316  91.314  58.186 1.00 34.61 ? 66   ASP A CB    1 
ATOM   1096 C  CG    . ASP C 3 66  ? 67.652  91.297  56.819 0.50 35.23 ? 66   ASP A CG    1 
ATOM   1097 O  OD1   . ASP C 3 66  ? 67.860  92.253  56.041 0.50 34.63 ? 66   ASP A OD1   1 
ATOM   1098 O  OD2   . ASP C 3 66  ? 66.927  90.326  56.518 0.50 37.47 ? 66   ASP A OD2   1 
ATOM   1099 N  N     . PHE C 3 67  ? 71.083  90.454  56.214 1.00 28.67 ? 67   PHE A N     1 
ATOM   1100 C  CA    . PHE C 3 67  ? 71.578  89.334  55.415 1.00 27.97 ? 67   PHE A CA    1 
ATOM   1101 C  C     . PHE C 3 67  ? 73.066  89.066  55.564 1.00 24.21 ? 67   PHE A C     1 
ATOM   1102 O  O     . PHE C 3 67  ? 73.867  89.984  55.708 1.00 23.59 ? 67   PHE A O     1 
ATOM   1103 C  CB    . PHE C 3 67  ? 71.275  89.550  53.929 1.00 32.15 ? 67   PHE A CB    1 
ATOM   1104 C  CG    . PHE C 3 67  ? 69.814  89.504  53.592 1.00 36.21 ? 67   PHE A CG    1 
ATOM   1105 C  CD1   . PHE C 3 67  ? 69.055  88.374  53.885 1.00 38.01 ? 67   PHE A CD1   1 
ATOM   1106 C  CD2   . PHE C 3 67  ? 69.199  90.587  52.968 1.00 38.30 ? 67   PHE A CD2   1 
ATOM   1107 C  CE1   . PHE C 3 67  ? 67.697  88.320  53.558 1.00 39.76 ? 67   PHE A CE1   1 
ATOM   1108 C  CE2   . PHE C 3 67  ? 67.844  90.544  52.636 1.00 39.56 ? 67   PHE A CE2   1 
ATOM   1109 C  CZ    . PHE C 3 67  ? 67.093  89.407  52.933 1.00 40.48 ? 67   PHE A CZ    1 
ATOM   1110 N  N     . ARG C 3 68  ? 73.417  87.788  55.522 1.00 23.41 ? 68   ARG A N     1 
ATOM   1111 C  CA    . ARG C 3 68  ? 74.801  87.357  55.624 1.00 22.95 ? 68   ARG A CA    1 
ATOM   1112 C  C     . ARG C 3 68  ? 75.025  86.276  54.574 1.00 21.46 ? 68   ARG A C     1 
ATOM   1113 O  O     . ARG C 3 68  ? 74.379  85.228  54.606 1.00 21.75 ? 68   ARG A O     1 
ATOM   1114 C  CB    . ARG C 3 68  ? 75.074  86.799  57.021 1.00 24.06 ? 68   ARG A CB    1 
ATOM   1115 C  CG    . ARG C 3 68  ? 74.932  87.830  58.142 1.00 24.94 ? 68   ARG A CG    1 
ATOM   1116 C  CD    . ARG C 3 68  ? 76.041  88.853  58.059 1.00 25.24 ? 68   ARG A CD    1 
ATOM   1117 N  NE    . ARG C 3 68  ? 76.019  89.826  59.152 1.00 25.37 ? 68   ARG A NE    1 
ATOM   1118 C  CZ    . ARG C 3 68  ? 75.383  90.993  59.113 1.00 26.76 ? 68   ARG A CZ    1 
ATOM   1119 N  NH1   . ARG C 3 68  ? 74.695  91.345  58.034 1.00 25.47 ? 68   ARG A NH1   1 
ATOM   1120 N  NH2   . ARG C 3 68  ? 75.479  91.831  60.140 1.00 26.27 ? 68   ARG A NH2   1 
ATOM   1121 N  N     . LEU C 3 69  ? 75.916  86.546  53.628 1.00 19.43 ? 69   LEU A N     1 
ATOM   1122 C  CA    . LEU C 3 69  ? 76.224  85.573  52.587 1.00 17.41 ? 69   LEU A CA    1 
ATOM   1123 C  C     . LEU C 3 69  ? 77.509  84.859  53.005 1.00 17.47 ? 69   LEU A C     1 
ATOM   1124 O  O     . LEU C 3 69  ? 78.577  85.463  53.038 1.00 18.20 ? 69   LEU A O     1 
ATOM   1125 C  CB    . LEU C 3 69  ? 76.412  86.280  51.240 1.00 18.43 ? 69   LEU A CB    1 
ATOM   1126 C  CG    . LEU C 3 69  ? 76.902  85.429  50.059 1.00 20.06 ? 69   LEU A CG    1 
ATOM   1127 C  CD1   . LEU C 3 69  ? 76.003  84.213  49.876 1.00 21.05 ? 69   LEU A CD1   1 
ATOM   1128 C  CD2   . LEU C 3 69  ? 76.932  86.284  48.796 1.00 18.26 ? 69   LEU A CD2   1 
ATOM   1129 N  N     . ILE C 3 70  ? 77.394  83.581  53.353 1.00 16.73 ? 70   ILE A N     1 
ATOM   1130 C  CA    . ILE C 3 70  ? 78.555  82.808  53.785 1.00 17.49 ? 70   ILE A CA    1 
ATOM   1131 C  C     . ILE C 3 70  ? 79.143  82.084  52.583 1.00 15.54 ? 70   ILE A C     1 
ATOM   1132 O  O     . ILE C 3 70  ? 78.472  81.290  51.920 1.00 17.08 ? 70   ILE A O     1 
ATOM   1133 C  CB    . ILE C 3 70  ? 78.163  81.821  54.907 1.00 18.92 ? 70   ILE A CB    1 
ATOM   1134 C  CG1   . ILE C 3 70  ? 77.661  82.625  56.118 1.00 19.08 ? 70   ILE A CG1   1 
ATOM   1135 C  CG2   . ILE C 3 70  ? 79.361  80.950  55.303 1.00 19.21 ? 70   ILE A CG2   1 
ATOM   1136 C  CD1   . ILE C 3 70  ? 77.403  81.792  57.360 1.00 23.92 ? 70   ILE A CD1   1 
ATOM   1137 N  N     . SER C 3 71  ? 80.403  82.387  52.299 1.00 15.33 ? 71   SER A N     1 
ATOM   1138 C  CA    . SER C 3 71  ? 81.094  81.821  51.151 1.00 16.13 ? 71   SER A CA    1 
ATOM   1139 C  C     . SER C 3 71  ? 82.337  81.034  51.537 1.00 17.57 ? 71   SER A C     1 
ATOM   1140 O  O     . SER C 3 71  ? 83.141  81.492  52.347 1.00 18.00 ? 71   SER A O     1 
ATOM   1141 C  CB    . SER C 3 71  ? 81.481  82.955  50.195 1.00 16.68 ? 71   SER A CB    1 
ATOM   1142 O  OG    . SER C 3 71  ? 82.487  82.548  49.279 1.00 18.27 ? 71   SER A OG    1 
ATOM   1143 N  N     . HIS C 3 72  ? 82.476  79.838  50.973 1.00 17.19 ? 72   HIS A N     1 
ATOM   1144 C  CA    . HIS C 3 72  ? 83.649  79.025  51.241 1.00 17.32 ? 72   HIS A CA    1 
ATOM   1145 C  C     . HIS C 3 72  ? 84.307  78.757  49.890 1.00 17.92 ? 72   HIS A C     1 
ATOM   1146 O  O     . HIS C 3 72  ? 83.640  78.334  48.942 1.00 17.49 ? 72   HIS A O     1 
ATOM   1147 C  CB    . HIS C 3 72  ? 83.263  77.711  51.919 1.00 18.24 ? 72   HIS A CB    1 
ATOM   1148 C  CG    . HIS C 3 72  ? 84.397  77.067  52.654 1.00 18.79 ? 72   HIS A CG    1 
ATOM   1149 N  ND1   . HIS C 3 72  ? 85.502  76.548  52.011 1.00 19.38 ? 72   HIS A ND1   1 
ATOM   1150 C  CD2   . HIS C 3 72  ? 84.623  76.908  53.980 1.00 18.76 ? 72   HIS A CD2   1 
ATOM   1151 C  CE1   . HIS C 3 72  ? 86.358  76.096  52.911 1.00 19.23 ? 72   HIS A CE1   1 
ATOM   1152 N  NE2   . HIS C 3 72  ? 85.850  76.302  54.113 1.00 17.51 ? 72   HIS A NE2   1 
ATOM   1153 N  N     . LEU C 3 73  ? 85.608  79.016  49.799 1.00 16.79 ? 73   LEU A N     1 
ATOM   1154 C  CA    . LEU C 3 73  ? 86.343  78.820  48.547 1.00 17.39 ? 73   LEU A CA    1 
ATOM   1155 C  C     . LEU C 3 73  ? 86.805  77.383  48.330 1.00 17.22 ? 73   LEU A C     1 
ATOM   1156 O  O     . LEU C 3 73  ? 87.202  77.017  47.221 1.00 17.76 ? 73   LEU A O     1 
ATOM   1157 C  CB    . LEU C 3 73  ? 87.585  79.713  48.514 1.00 18.30 ? 73   LEU A CB    1 
ATOM   1158 C  CG    . LEU C 3 73  ? 87.472  81.186  48.894 1.00 21.81 ? 73   LEU A CG    1 
ATOM   1159 C  CD1   . LEU C 3 73  ? 88.859  81.807  48.825 1.00 25.02 ? 73   LEU A CD1   1 
ATOM   1160 C  CD2   . LEU C 3 73  ? 86.517  81.901  47.968 1.00 23.08 ? 73   LEU A CD2   1 
ATOM   1161 N  N     . ARG C 3 74  ? 86.760  76.581  49.388 1.00 16.78 ? 74   ARG A N     1 
ATOM   1162 C  CA    . ARG C 3 74  ? 87.212  75.199  49.337 1.00 16.72 ? 74   ARG A CA    1 
ATOM   1163 C  C     . ARG C 3 74  ? 88.632  75.125  48.748 1.00 17.30 ? 74   ARG A C     1 
ATOM   1164 O  O     . ARG C 3 74  ? 89.519  75.869  49.169 1.00 16.64 ? 74   ARG A O     1 
ATOM   1165 C  CB    . ARG C 3 74  ? 86.235  74.321  48.534 1.00 17.68 ? 74   ARG A CB    1 
ATOM   1166 C  CG    . ARG C 3 74  ? 84.870  74.076  49.210 1.00 18.65 ? 74   ARG A CG    1 
ATOM   1167 C  CD    . ARG C 3 74  ? 84.977  73.294  50.527 1.00 19.18 ? 74   ARG A CD    1 
ATOM   1168 N  NE    . ARG C 3 74  ? 83.651  72.971  51.063 1.00 22.49 ? 74   ARG A NE    1 
ATOM   1169 C  CZ    . ARG C 3 74  ? 83.076  71.772  51.000 1.00 21.55 ? 74   ARG A CZ    1 
ATOM   1170 N  NH1   . ARG C 3 74  ? 83.702  70.750  50.434 1.00 20.93 ? 74   ARG A NH1   1 
ATOM   1171 N  NH2   . ARG C 3 74  ? 81.849  71.597  51.481 1.00 23.67 ? 74   ARG A NH2   1 
ATOM   1172 N  N     . MET C 3 75  ? 88.838  74.257  47.761 1.00 17.54 ? 75   MET A N     1 
ATOM   1173 C  CA    . MET C 3 75  ? 90.163  74.061  47.181 1.00 19.00 ? 75   MET A CA    1 
ATOM   1174 C  C     . MET C 3 75  ? 90.686  75.038  46.136 1.00 21.73 ? 75   MET A C     1 
ATOM   1175 O  O     . MET C 3 75  ? 91.879  75.353  46.140 1.00 22.65 ? 75   MET A O     1 
ATOM   1176 C  CB    . MET C 3 75  ? 90.257  72.650  46.586 1.00 18.14 ? 75   MET A CB    1 
ATOM   1177 C  CG    . MET C 3 75  ? 90.131  71.521  47.596 1.00 22.13 ? 75   MET A CG    1 
ATOM   1178 S  SD    . MET C 3 75  ? 91.551  71.433  48.701 1.00 23.21 ? 75   MET A SD    1 
ATOM   1179 C  CE    . MET C 3 75  ? 92.772  70.646  47.633 1.00 23.16 ? 75   MET A CE    1 
ATOM   1180 N  N     . GLU C 3 76  ? 89.815  75.519  45.251 1.00 22.22 ? 76   GLU A N     1 
ATOM   1181 C  CA    . GLU C 3 76  ? 90.252  76.393  44.157 1.00 24.68 ? 76   GLU A CA    1 
ATOM   1182 C  C     . GLU C 3 76  ? 89.451  77.666  43.912 1.00 23.56 ? 76   GLU A C     1 
ATOM   1183 O  O     . GLU C 3 76  ? 89.702  78.368  42.929 1.00 22.53 ? 76   GLU A O     1 
ATOM   1184 C  CB    . GLU C 3 76  ? 90.244  75.595  42.855 1.00 28.38 ? 76   GLU A CB    1 
ATOM   1185 C  CG    . GLU C 3 76  ? 90.872  74.238  42.961 1.00 34.83 ? 76   GLU A CG    1 
ATOM   1186 C  CD    . GLU C 3 76  ? 92.167  74.156  42.210 1.00 39.73 ? 76   GLU A CD    1 
ATOM   1187 O  OE1   . GLU C 3 76  ? 93.057  74.993  42.474 1.00 45.10 ? 76   GLU A OE1   1 
ATOM   1188 O  OE2   . GLU C 3 76  ? 92.294  73.256  41.355 1.00 42.95 ? 76   GLU A OE2   1 
ATOM   1189 N  N     . GLY C 3 77  ? 88.483  77.957  44.775 1.00 20.71 ? 77   GLY A N     1 
ATOM   1190 C  CA    . GLY C 3 77  ? 87.674  79.148  44.586 1.00 17.36 ? 77   GLY A CA    1 
ATOM   1191 C  C     . GLY C 3 77  ? 88.473  80.439  44.508 1.00 17.40 ? 77   GLY A C     1 
ATOM   1192 O  O     . GLY C 3 77  ? 89.393  80.662  45.290 1.00 15.90 ? 77   GLY A O     1 
ATOM   1193 N  N     . LYS C 3 78  ? 88.111  81.298  43.566 1.00 17.09 ? 78   LYS A N     1 
ATOM   1194 C  CA    . LYS C 3 78  ? 88.801  82.568  43.395 1.00 19.91 ? 78   LYS A CA    1 
ATOM   1195 C  C     . LYS C 3 78  ? 87.831  83.683  43.053 1.00 20.42 ? 78   LYS A C     1 
ATOM   1196 O  O     . LYS C 3 78  ? 86.906  83.497  42.261 1.00 20.29 ? 78   LYS A O     1 
ATOM   1197 C  CB    . LYS C 3 78  ? 89.847  82.462  42.281 1.00 22.81 ? 78   LYS A CB    1 
ATOM   1198 C  CG    . LYS C 3 78  ? 90.932  81.432  42.551 1.00 30.08 ? 78   LYS A CG    1 
ATOM   1199 C  CD    . LYS C 3 78  ? 91.815  81.236  41.330 1.00 35.38 ? 78   LYS A CD    1 
ATOM   1200 C  CE    . LYS C 3 78  ? 92.829  80.122  41.552 1.00 38.54 ? 78   LYS A CE    1 
ATOM   1201 N  NZ    . LYS C 3 78  ? 93.643  79.866  40.326 1.00 42.42 ? 78   LYS A NZ    1 
ATOM   1202 N  N     . TYR C 3 79  ? 88.053  84.845  43.656 1.00 19.61 ? 79   TYR A N     1 
ATOM   1203 C  CA    . TYR C 3 79  ? 87.227  86.017  43.399 1.00 18.83 ? 79   TYR A CA    1 
ATOM   1204 C  C     . TYR C 3 79  ? 88.058  87.032  42.629 1.00 19.78 ? 79   TYR A C     1 
ATOM   1205 O  O     . TYR C 3 79  ? 89.279  87.093  42.782 1.00 19.23 ? 79   TYR A O     1 
ATOM   1206 C  CB    . TYR C 3 79  ? 86.799  86.679  44.710 1.00 16.39 ? 79   TYR A CB    1 
ATOM   1207 C  CG    . TYR C 3 79  ? 85.608  86.057  45.396 1.00 18.02 ? 79   TYR A CG    1 
ATOM   1208 C  CD1   . TYR C 3 79  ? 84.311  86.278  44.920 1.00 16.76 ? 79   TYR A CD1   1 
ATOM   1209 C  CD2   . TYR C 3 79  ? 85.771  85.282  46.541 1.00 17.16 ? 79   TYR A CD2   1 
ATOM   1210 C  CE1   . TYR C 3 79  ? 83.203  85.746  45.578 1.00 16.98 ? 79   TYR A CE1   1 
ATOM   1211 C  CE2   . TYR C 3 79  ? 84.670  84.737  47.206 1.00 16.08 ? 79   TYR A CE2   1 
ATOM   1212 C  CZ    . TYR C 3 79  ? 83.392  84.976  46.717 1.00 17.11 ? 79   TYR A CZ    1 
ATOM   1213 O  OH    . TYR C 3 79  ? 82.307  84.435  47.362 1.00 18.12 ? 79   TYR A OH    1 
ATOM   1214 N  N     . ARG C 3 80  ? 87.402  87.823  41.792 1.00 19.34 ? 80   ARG A N     1 
ATOM   1215 C  CA    . ARG C 3 80  ? 88.104  88.878  41.080 1.00 20.44 ? 80   ARG A CA    1 
ATOM   1216 C  C     . ARG C 3 80  ? 87.127  90.004  40.811 1.00 20.32 ? 80   ARG A C     1 
ATOM   1217 O  O     . ARG C 3 80  ? 85.926  89.771  40.641 1.00 18.02 ? 80   ARG A O     1 
ATOM   1218 C  CB    . ARG C 3 80  ? 88.731  88.369  39.768 1.00 20.50 ? 80   ARG A CB    1 
ATOM   1219 C  CG    . ARG C 3 80  ? 87.797  88.203  38.574 1.00 21.74 ? 80   ARG A CG    1 
ATOM   1220 C  CD    . ARG C 3 80  ? 88.617  87.793  37.344 1.00 23.51 ? 80   ARG A CD    1 
ATOM   1221 N  NE    . ARG C 3 80  ? 87.826  87.634  36.125 1.00 23.05 ? 80   ARG A NE    1 
ATOM   1222 C  CZ    . ARG C 3 80  ? 87.062  86.580  35.849 1.00 23.28 ? 80   ARG A CZ    1 
ATOM   1223 N  NH1   . ARG C 3 80  ? 86.973  85.571  36.708 1.00 20.57 ? 80   ARG A NH1   1 
ATOM   1224 N  NH2   . ARG C 3 80  ? 86.400  86.526  34.700 1.00 19.55 ? 80   ARG A NH2   1 
ATOM   1225 N  N     . LEU C 3 81  ? 87.638  91.231  40.828 1.00 19.11 ? 81   LEU A N     1 
ATOM   1226 C  CA    . LEU C 3 81  ? 86.822  92.397  40.546 1.00 20.02 ? 81   LEU A CA    1 
ATOM   1227 C  C     . LEU C 3 81  ? 87.142  92.774  39.103 1.00 21.25 ? 81   LEU A C     1 
ATOM   1228 O  O     . LEU C 3 81  ? 88.302  93.009  38.757 1.00 22.87 ? 81   LEU A O     1 
ATOM   1229 C  CB    . LEU C 3 81  ? 87.164  93.532  41.513 1.00 20.68 ? 81   LEU A CB    1 
ATOM   1230 C  CG    . LEU C 3 81  ? 86.573  93.317  42.913 1.00 21.48 ? 81   LEU A CG    1 
ATOM   1231 C  CD1   . LEU C 3 81  ? 87.118  94.338  43.887 1.00 22.64 ? 81   LEU A CD1   1 
ATOM   1232 C  CD2   . LEU C 3 81  ? 85.057  93.410  42.829 1.00 20.87 ? 81   LEU A CD2   1 
ATOM   1233 N  N     . ALA C 3 82  ? 86.117  92.812  38.261 1.00 20.00 ? 82   ALA A N     1 
ATOM   1234 C  CA    . ALA C 3 82  ? 86.318  93.109  36.848 1.00 21.77 ? 82   ALA A CA    1 
ATOM   1235 C  C     . ALA C 3 82  ? 85.399  94.189  36.301 1.00 22.40 ? 82   ALA A C     1 
ATOM   1236 O  O     . ALA C 3 82  ? 84.460  94.622  36.968 1.00 20.73 ? 82   ALA A O     1 
ATOM   1237 C  CB    . ALA C 3 82  ? 86.143  91.830  36.038 1.00 23.51 ? 82   ALA A CB    1 
ATOM   1238 N  N     . THR C 3 83  ? 85.684  94.623  35.075 1.00 22.34 ? 83   THR A N     1 
ATOM   1239 C  CA    . THR C 3 83  ? 84.868  95.634  34.421 1.00 23.30 ? 83   THR A CA    1 
ATOM   1240 C  C     . THR C 3 83  ? 83.563  94.965  34.010 1.00 24.06 ? 83   THR A C     1 
ATOM   1241 O  O     . THR C 3 83  ? 83.504  93.742  33.859 1.00 24.69 ? 83   THR A O     1 
ATOM   1242 C  CB    . THR C 3 83  ? 85.559  96.185  33.160 1.00 25.16 ? 83   THR A CB    1 
ATOM   1243 O  OG1   . THR C 3 83  ? 85.871  95.100  32.276 1.00 25.12 ? 83   THR A OG1   1 
ATOM   1244 C  CG2   . THR C 3 83  ? 86.845  96.919  33.534 1.00 23.49 ? 83   THR A CG2   1 
ATOM   1245 N  N     . LEU C 3 84  ? 82.519  95.761  33.824 1.00 24.44 ? 84   LEU A N     1 
ATOM   1246 C  CA    . LEU C 3 84  ? 81.226  95.215  33.442 1.00 25.85 ? 84   LEU A CA    1 
ATOM   1247 C  C     . LEU C 3 84  ? 81.252  94.536  32.079 1.00 27.22 ? 84   LEU A C     1 
ATOM   1248 O  O     . LEU C 3 84  ? 80.434  93.662  31.802 1.00 28.45 ? 84   LEU A O     1 
ATOM   1249 C  CB    . LEU C 3 84  ? 80.169  96.321  33.454 1.00 27.28 ? 84   LEU A CB    1 
ATOM   1250 C  CG    . LEU C 3 84  ? 79.832  96.885  34.835 1.00 28.05 ? 84   LEU A CG    1 
ATOM   1251 C  CD1   . LEU C 3 84  ? 78.807  98.001  34.701 1.00 28.48 ? 84   LEU A CD1   1 
ATOM   1252 C  CD2   . LEU C 3 84  ? 79.292  95.769  35.721 1.00 29.33 ? 84   LEU A CD2   1 
ATOM   1253 N  N     . ASP C 3 85  ? 82.204  94.919  31.233 1.00 26.88 ? 85   ASP A N     1 
ATOM   1254 C  CA    . ASP C 3 85  ? 82.299  94.336  29.897 1.00 27.80 ? 85   ASP A CA    1 
ATOM   1255 C  C     . ASP C 3 85  ? 83.326  93.207  29.821 1.00 27.81 ? 85   ASP A C     1 
ATOM   1256 O  O     . ASP C 3 85  ? 83.623  92.706  28.739 1.00 26.96 ? 85   ASP A O     1 
ATOM   1257 C  CB    . ASP C 3 85  ? 82.659  95.429  28.879 1.00 28.61 ? 85   ASP A CB    1 
ATOM   1258 C  CG    . ASP C 3 85  ? 84.133  95.797  28.912 1.00 29.11 ? 85   ASP A CG    1 
ATOM   1259 O  OD1   . ASP C 3 85  ? 84.732  95.764  30.006 1.00 30.02 ? 85   ASP A OD1   1 
ATOM   1260 O  OD2   . ASP C 3 85  ? 84.694  96.127  27.845 1.00 29.93 ? 85   ASP A OD2   1 
ATOM   1261 N  N     . ALA C 3 86  ? 83.862  92.802  30.968 1.00 27.65 ? 86   ALA A N     1 
ATOM   1262 C  CA    . ALA C 3 86  ? 84.862  91.742  31.004 1.00 27.89 ? 86   ALA A CA    1 
ATOM   1263 C  C     . ALA C 3 86  ? 84.326  90.461  30.378 1.00 29.09 ? 86   ALA A C     1 
ATOM   1264 O  O     . ALA C 3 86  ? 83.195  90.057  30.639 1.00 28.36 ? 86   ALA A O     1 
ATOM   1265 C  CB    . ALA C 3 86  ? 85.294  91.478  32.441 1.00 27.99 ? 86   ALA A CB    1 
ATOM   1266 N  N     . PRO C 3 87  ? 85.135  89.805  29.537 1.00 29.29 ? 87   PRO A N     1 
ATOM   1267 C  CA    . PRO C 3 87  ? 84.691  88.566  28.896 1.00 30.41 ? 87   PRO A CA    1 
ATOM   1268 C  C     . PRO C 3 87  ? 84.589  87.411  29.888 1.00 30.75 ? 87   PRO A C     1 
ATOM   1269 O  O     . PRO C 3 87  ? 85.325  87.354  30.872 1.00 29.48 ? 87   PRO A O     1 
ATOM   1270 C  CB    . PRO C 3 87  ? 85.760  88.330  27.834 1.00 31.61 ? 87   PRO A CB    1 
ATOM   1271 C  CG    . PRO C 3 87  ? 86.990  88.874  28.482 1.00 31.21 ? 87   PRO A CG    1 
ATOM   1272 C  CD    . PRO C 3 87  ? 86.491  90.172  29.092 1.00 30.37 ? 87   PRO A CD    1 
ATOM   1273 N  N     . ARG C 3 88  ? 83.667  86.494  29.627 1.00 30.16 ? 88   ARG A N     1 
ATOM   1274 C  CA    . ARG C 3 88  ? 83.494  85.342  30.498 1.00 32.07 ? 88   ARG A CA    1 
ATOM   1275 C  C     . ARG C 3 88  ? 84.686  84.397  30.412 1.00 30.36 ? 88   ARG A C     1 
ATOM   1276 O  O     . ARG C 3 88  ? 85.262  84.203  29.343 1.00 29.49 ? 88   ARG A O     1 
ATOM   1277 C  CB    . ARG C 3 88  ? 82.222  84.567  30.126 1.00 35.16 ? 88   ARG A CB    1 
ATOM   1278 C  CG    . ARG C 3 88  ? 82.208  83.156  30.705 1.00 41.79 ? 88   ARG A CG    1 
ATOM   1279 C  CD    . ARG C 3 88  ? 80.881  82.429  30.528 1.00 44.79 ? 88   ARG A CD    1 
ATOM   1280 N  NE    . ARG C 3 88  ? 80.941  81.063  31.059 1.00 48.95 ? 88   ARG A NE    1 
ATOM   1281 C  CZ    . ARG C 3 88  ? 81.324  80.751  32.297 1.00 49.31 ? 88   ARG A CZ    1 
ATOM   1282 N  NH1   . ARG C 3 88  ? 81.684  81.703  33.142 1.00 53.21 ? 88   ARG A NH1   1 
ATOM   1283 N  NH2   . ARG C 3 88  ? 81.354  79.484  32.695 1.00 50.20 ? 88   ARG A NH2   1 
ATOM   1284 N  N     . GLU C 3 89  ? 85.067  83.833  31.551 1.00 27.79 ? 89   GLU A N     1 
ATOM   1285 C  CA    . GLU C 3 89  ? 86.151  82.865  31.595 1.00 27.35 ? 89   GLU A CA    1 
ATOM   1286 C  C     . GLU C 3 89  ? 85.492  81.516  31.868 1.00 27.24 ? 89   GLU A C     1 
ATOM   1287 O  O     . GLU C 3 89  ? 84.452  81.446  32.526 1.00 24.74 ? 89   GLU A O     1 
ATOM   1288 C  CB    . GLU C 3 89  ? 87.171  83.236  32.674 1.00 28.88 ? 89   GLU A CB    1 
ATOM   1289 C  CG    . GLU C 3 89  ? 88.156  84.298  32.195 1.00 33.03 ? 89   GLU A CG    1 
ATOM   1290 C  CD    . GLU C 3 89  ? 89.135  84.743  33.266 1.00 36.28 ? 89   GLU A CD    1 
ATOM   1291 O  OE1   . GLU C 3 89  ? 89.410  83.956  34.198 1.00 37.93 ? 89   GLU A OE1   1 
ATOM   1292 O  OE2   . GLU C 3 89  ? 89.644  85.879  33.166 1.00 38.29 ? 89   GLU A OE2   1 
ATOM   1293 N  N     . LYS C 3 90  ? 86.092  80.454  31.346 1.00 26.25 ? 90   LYS A N     1 
ATOM   1294 C  CA    . LYS C 3 90  ? 85.544  79.109  31.461 1.00 27.67 ? 90   LYS A CA    1 
ATOM   1295 C  C     . LYS C 3 90  ? 84.956  78.683  32.802 1.00 27.28 ? 90   LYS A C     1 
ATOM   1296 O  O     . LYS C 3 90  ? 83.842  78.157  32.853 1.00 28.03 ? 90   LYS A O     1 
ATOM   1297 C  CB    . LYS C 3 90  ? 86.592  78.078  31.035 1.00 29.69 ? 90   LYS A CB    1 
ATOM   1298 C  CG    . LYS C 3 90  ? 86.029  76.672  30.916 1.00 33.57 ? 90   LYS A CG    1 
ATOM   1299 C  CD    . LYS C 3 90  ? 87.050  75.700  30.354 1.00 36.18 ? 90   LYS A CD    1 
ATOM   1300 C  CE    . LYS C 3 90  ? 86.426  74.329  30.148 1.00 39.19 ? 90   LYS A CE    1 
ATOM   1301 N  NZ    . LYS C 3 90  ? 87.417  73.352  29.609 1.00 42.74 ? 90   LYS A NZ    1 
ATOM   1302 N  N     . HIS C 3 91  ? 85.680  78.916  33.887 1.00 24.44 ? 91   HIS A N     1 
ATOM   1303 C  CA    . HIS C 3 91  ? 85.190  78.484  35.187 1.00 23.69 ? 91   HIS A CA    1 
ATOM   1304 C  C     . HIS C 3 91  ? 84.507  79.517  36.083 1.00 21.50 ? 91   HIS A C     1 
ATOM   1305 O  O     . HIS C 3 91  ? 84.395  79.315  37.294 1.00 19.76 ? 91   HIS A O     1 
ATOM   1306 C  CB    . HIS C 3 91  ? 86.327  77.772  35.919 1.00 24.46 ? 91   HIS A CB    1 
ATOM   1307 C  CG    . HIS C 3 91  ? 86.867  76.598  35.159 1.00 26.08 ? 91   HIS A CG    1 
ATOM   1308 N  ND1   . HIS C 3 91  ? 86.100  75.491  34.863 1.00 26.36 ? 91   HIS A ND1   1 
ATOM   1309 C  CD2   . HIS C 3 91  ? 88.068  76.390  34.570 1.00 27.66 ? 91   HIS A CD2   1 
ATOM   1310 C  CE1   . HIS C 3 91  ? 86.805  74.653  34.123 1.00 28.20 ? 91   HIS A CE1   1 
ATOM   1311 N  NE2   . HIS C 3 91  ? 88.003  75.176  33.931 1.00 28.25 ? 91   HIS A NE2   1 
ATOM   1312 N  N     . ASP C 3 92  ? 84.041  80.613  35.487 1.00 20.67 ? 92   ASP A N     1 
ATOM   1313 C  CA    . ASP C 3 92  ? 83.311  81.636  36.234 1.00 20.13 ? 92   ASP A CA    1 
ATOM   1314 C  C     . ASP C 3 92  ? 81.922  81.050  36.496 1.00 21.29 ? 92   ASP A C     1 
ATOM   1315 O  O     . ASP C 3 92  ? 81.291  80.526  35.577 1.00 20.51 ? 92   ASP A O     1 
ATOM   1316 C  CB    . ASP C 3 92  ? 83.138  82.914  35.407 1.00 19.84 ? 92   ASP A CB    1 
ATOM   1317 C  CG    . ASP C 3 92  ? 84.437  83.642  35.168 1.00 21.06 ? 92   ASP A CG    1 
ATOM   1318 O  OD1   . ASP C 3 92  ? 85.436  83.327  35.849 1.00 19.66 ? 92   ASP A OD1   1 
ATOM   1319 O  OD2   . ASP C 3 92  ? 84.447  84.545  34.303 1.00 22.37 ? 92   ASP A OD2   1 
ATOM   1320 N  N     . HIS C 3 93  ? 81.434  81.158  37.728 1.00 19.73 ? 93   HIS A N     1 
ATOM   1321 C  CA    . HIS C 3 93  ? 80.127  80.598  38.062 1.00 19.71 ? 93   HIS A CA    1 
ATOM   1322 C  C     . HIS C 3 93  ? 79.081  81.599  38.519 1.00 20.04 ? 93   HIS A C     1 
ATOM   1323 O  O     . HIS C 3 93  ? 77.894  81.422  38.245 1.00 21.93 ? 93   HIS A O     1 
ATOM   1324 C  CB    . HIS C 3 93  ? 80.278  79.534  39.151 1.00 19.16 ? 93   HIS A CB    1 
ATOM   1325 C  CG    . HIS C 3 93  ? 81.215  78.430  38.785 1.00 19.39 ? 93   HIS A CG    1 
ATOM   1326 N  ND1   . HIS C 3 93  ? 81.098  77.715  37.613 1.00 20.53 ? 93   HIS A ND1   1 
ATOM   1327 C  CD2   . HIS C 3 93  ? 82.276  77.906  39.443 1.00 20.48 ? 93   HIS A CD2   1 
ATOM   1328 C  CE1   . HIS C 3 93  ? 82.048  76.797  37.564 1.00 20.58 ? 93   HIS A CE1   1 
ATOM   1329 N  NE2   . HIS C 3 93  ? 82.776  76.892  38.663 1.00 21.31 ? 93   HIS A NE2   1 
ATOM   1330 N  N     . LEU C 3 94  ? 79.511  82.637  39.227 1.00 20.03 ? 94   LEU A N     1 
ATOM   1331 C  CA    . LEU C 3 94  ? 78.582  83.637  39.746 1.00 19.97 ? 94   LEU A CA    1 
ATOM   1332 C  C     . LEU C 3 94  ? 79.155  85.036  39.631 1.00 21.47 ? 94   LEU A C     1 
ATOM   1333 O  O     . LEU C 3 94  ? 80.371  85.223  39.652 1.00 20.69 ? 94   LEU A O     1 
ATOM   1334 C  CB    . LEU C 3 94  ? 78.306  83.383  41.230 1.00 20.65 ? 94   LEU A CB    1 
ATOM   1335 C  CG    . LEU C 3 94  ? 77.855  82.001  41.700 1.00 21.87 ? 94   LEU A CG    1 
ATOM   1336 C  CD1   . LEU C 3 94  ? 77.963  81.923  43.228 1.00 22.20 ? 94   LEU A CD1   1 
ATOM   1337 C  CD2   . LEU C 3 94  ? 76.430  81.746  41.237 1.00 21.93 ? 94   LEU A CD2   1 
ATOM   1338 N  N     . THR C 3 95  ? 78.274  86.020  39.516 1.00 21.35 ? 95   THR A N     1 
ATOM   1339 C  CA    . THR C 3 95  ? 78.722  87.397  39.469 1.00 22.50 ? 95   THR A CA    1 
ATOM   1340 C  C     . THR C 3 95  ? 77.750  88.327  40.168 1.00 22.82 ? 95   THR A C     1 
ATOM   1341 O  O     . THR C 3 95  ? 76.529  88.207  40.044 1.00 22.46 ? 95   THR A O     1 
ATOM   1342 C  CB    . THR C 3 95  ? 78.939  87.916  38.037 1.00 24.52 ? 95   THR A CB    1 
ATOM   1343 O  OG1   . THR C 3 95  ? 79.428  89.264  38.112 1.00 26.82 ? 95   THR A OG1   1 
ATOM   1344 C  CG2   . THR C 3 95  ? 77.640  87.909  37.245 1.00 23.31 ? 95   THR A CG2   1 
ATOM   1345 N  N     . MET C 3 96  ? 78.325  89.253  40.916 1.00 22.49 ? 96   MET A N     1 
ATOM   1346 C  CA    . MET C 3 96  ? 77.583  90.253  41.653 1.00 24.95 ? 96   MET A CA    1 
ATOM   1347 C  C     . MET C 3 96  ? 77.930  91.536  40.908 1.00 25.05 ? 96   MET A C     1 
ATOM   1348 O  O     . MET C 3 96  ? 79.063  92.010  40.981 1.00 24.09 ? 96   MET A O     1 
ATOM   1349 C  CB    . MET C 3 96  ? 78.113  90.288  43.082 1.00 26.80 ? 96   MET A CB    1 
ATOM   1350 C  CG    . MET C 3 96  ? 77.255  90.981  44.091 1.00 30.95 ? 96   MET A CG    1 
ATOM   1351 S  SD    . MET C 3 96  ? 77.967  90.690  45.721 1.00 31.91 ? 96   MET A SD    1 
ATOM   1352 C  CE    . MET C 3 96  ? 77.190  89.159  46.163 1.00 32.25 ? 96   MET A CE    1 
ATOM   1353 N  N     . LYS C 3 97  ? 76.968  92.081  40.170 1.00 25.17 ? 97   LYS A N     1 
ATOM   1354 C  CA    . LYS C 3 97  ? 77.220  93.292  39.397 1.00 26.50 ? 97   LYS A CA    1 
ATOM   1355 C  C     . LYS C 3 97  ? 76.901  94.601  40.103 1.00 26.42 ? 97   LYS A C     1 
ATOM   1356 O  O     . LYS C 3 97  ? 75.821  94.779  40.668 1.00 25.79 ? 97   LYS A O     1 
ATOM   1357 C  CB    . LYS C 3 97  ? 76.467  93.230  38.069 1.00 27.03 ? 97   LYS A CB    1 
ATOM   1358 C  CG    . LYS C 3 97  ? 76.911  92.074  37.191 1.00 29.41 ? 97   LYS A CG    1 
ATOM   1359 C  CD    . LYS C 3 97  ? 76.282  92.136  35.812 1.00 31.00 ? 97   LYS A CD    1 
ATOM   1360 C  CE    . LYS C 3 97  ? 76.815  91.020  34.931 1.00 32.67 ? 97   LYS A CE    1 
ATOM   1361 N  NZ    . LYS C 3 97  ? 76.255  91.102  33.556 1.00 35.18 ? 97   LYS A NZ    1 
ATOM   1362 N  N     . PHE C 3 98  ? 77.863  95.515  40.061 1.00 25.98 ? 98   PHE A N     1 
ATOM   1363 C  CA    . PHE C 3 98  ? 77.722  96.827  40.667 1.00 26.90 ? 98   PHE A CA    1 
ATOM   1364 C  C     . PHE C 3 98  ? 77.614  97.841  39.533 1.00 27.81 ? 98   PHE A C     1 
ATOM   1365 O  O     . PHE C 3 98  ? 77.635  97.468  38.362 1.00 27.05 ? 98   PHE A O     1 
ATOM   1366 C  CB    . PHE C 3 98  ? 78.943  97.140  41.535 1.00 25.25 ? 98   PHE A CB    1 
ATOM   1367 C  CG    . PHE C 3 98  ? 79.262  96.064  42.534 1.00 27.04 ? 98   PHE A CG    1 
ATOM   1368 C  CD1   . PHE C 3 98  ? 78.352  95.728  43.529 1.00 26.80 ? 98   PHE A CD1   1 
ATOM   1369 C  CD2   . PHE C 3 98  ? 80.468  95.371  42.466 1.00 27.56 ? 98   PHE A CD2   1 
ATOM   1370 C  CE1   . PHE C 3 98  ? 78.636  94.711  44.446 1.00 28.46 ? 98   PHE A CE1   1 
ATOM   1371 C  CE2   . PHE C 3 98  ? 80.761  94.353  43.378 1.00 28.30 ? 98   PHE A CE2   1 
ATOM   1372 C  CZ    . PHE C 3 98  ? 79.844  94.023  44.368 1.00 26.59 ? 98   PHE A CZ    1 
ATOM   1373 N  N     . ALA C 3 99  ? 77.511  99.119  39.880 1.00 28.58 ? 99   ALA A N     1 
ATOM   1374 C  CA    . ALA C 3 99  ? 77.394  100.170 38.876 1.00 30.66 ? 99   ALA A CA    1 
ATOM   1375 C  C     . ALA C 3 99  ? 78.660  100.357 38.037 1.00 31.45 ? 99   ALA A C     1 
ATOM   1376 O  O     . ALA C 3 99  ? 78.578  100.628 36.842 1.00 32.20 ? 99   ALA A O     1 
ATOM   1377 C  CB    . ALA C 3 99  ? 77.019  101.485 39.551 1.00 30.23 ? 99   ALA A CB    1 
ATOM   1378 N  N     . ASP C 3 100 ? 79.829  100.209 38.652 1.00 31.77 ? 100  ASP A N     1 
ATOM   1379 C  CA    . ASP C 3 100 ? 81.083  100.398 37.923 1.00 33.61 ? 100  ASP A CA    1 
ATOM   1380 C  C     . ASP C 3 100 ? 82.016  99.191  37.909 1.00 31.50 ? 100  ASP A C     1 
ATOM   1381 O  O     . ASP C 3 100 ? 83.234  99.341  37.779 1.00 31.07 ? 100  ASP A O     1 
ATOM   1382 C  CB    . ASP C 3 100 ? 81.833  101.599 38.493 1.00 36.85 ? 100  ASP A CB    1 
ATOM   1383 C  CG    . ASP C 3 100 ? 81.731  101.681 40.000 1.00 41.92 ? 100  ASP A CG    1 
ATOM   1384 O  OD1   . ASP C 3 100 ? 81.820  100.624 40.663 1.00 43.61 ? 100  ASP A OD1   1 
ATOM   1385 O  OD2   . ASP C 3 100 ? 81.564  102.805 40.524 1.00 44.28 ? 100  ASP A OD2   1 
ATOM   1386 N  N     . GLY C 3 101 ? 81.451  97.996  38.032 1.00 27.91 ? 101  GLY A N     1 
ATOM   1387 C  CA    . GLY C 3 101 ? 82.275  96.802  38.024 1.00 25.80 ? 101  GLY A CA    1 
ATOM   1388 C  C     . GLY C 3 101 ? 81.509  95.616  38.561 1.00 25.21 ? 101  GLY A C     1 
ATOM   1389 O  O     . GLY C 3 101 ? 80.354  95.751  38.965 1.00 25.30 ? 101  GLY A O     1 
ATOM   1390 N  N     . GLN C 3 102 ? 82.143  94.450  38.575 1.00 22.89 ? 102  GLN A N     1 
ATOM   1391 C  CA    . GLN C 3 102 ? 81.472  93.254  39.067 1.00 23.28 ? 102  GLN A CA    1 
ATOM   1392 C  C     . GLN C 3 102 ? 82.421  92.335  39.821 1.00 22.92 ? 102  GLN A C     1 
ATOM   1393 O  O     . GLN C 3 102 ? 83.623  92.301  39.539 1.00 22.75 ? 102  GLN A O     1 
ATOM   1394 C  CB    . GLN C 3 102 ? 80.842  92.494  37.897 1.00 22.22 ? 102  GLN A CB    1 
ATOM   1395 C  CG    . GLN C 3 102 ? 81.852  92.022  36.851 1.00 22.98 ? 102  GLN A CG    1 
ATOM   1396 C  CD    . GLN C 3 102 ? 81.195  91.282  35.698 1.00 25.51 ? 102  GLN A CD    1 
ATOM   1397 O  OE1   . GLN C 3 102 ? 80.347  90.413  35.910 1.00 24.75 ? 102  GLN A OE1   1 
ATOM   1398 N  NE2   . GLN C 3 102 ? 81.594  91.613  34.470 1.00 22.14 ? 102  GLN A NE2   1 
ATOM   1399 N  N     . LEU C 3 103 ? 81.873  91.605  40.791 1.00 21.00 ? 103  LEU A N     1 
ATOM   1400 C  CA    . LEU C 3 103 ? 82.645  90.653  41.580 1.00 19.85 ? 103  LEU A CA    1 
ATOM   1401 C  C     . LEU C 3 103 ? 82.292  89.283  41.014 1.00 19.63 ? 103  LEU A C     1 
ATOM   1402 O  O     . LEU C 3 103 ? 81.135  88.858  41.073 1.00 19.37 ? 103  LEU A O     1 
ATOM   1403 C  CB    . LEU C 3 103 ? 82.250  90.731  43.063 1.00 19.56 ? 103  LEU A CB    1 
ATOM   1404 C  CG    . LEU C 3 103 ? 82.865  89.685  44.000 1.00 18.40 ? 103  LEU A CG    1 
ATOM   1405 C  CD1   . LEU C 3 103 ? 84.384  89.810  43.994 1.00 19.56 ? 103  LEU A CD1   1 
ATOM   1406 C  CD2   . LEU C 3 103 ? 82.325  89.883  45.416 1.00 20.85 ? 103  LEU A CD2   1 
ATOM   1407 N  N     . ILE C 3 104 ? 83.289  88.601  40.457 1.00 17.54 ? 104  ILE A N     1 
ATOM   1408 C  CA    . ILE C 3 104 ? 83.087  87.294  39.841 1.00 17.55 ? 104  ILE A CA    1 
ATOM   1409 C  C     . ILE C 3 104 ? 83.701  86.162  40.655 1.00 18.62 ? 104  ILE A C     1 
ATOM   1410 O  O     . ILE C 3 104 ? 84.838  86.270  41.113 1.00 19.04 ? 104  ILE A O     1 
ATOM   1411 C  CB    . ILE C 3 104 ? 83.717  87.265  38.418 1.00 19.45 ? 104  ILE A CB    1 
ATOM   1412 C  CG1   . ILE C 3 104 ? 83.061  88.330  37.533 1.00 19.47 ? 104  ILE A CG1   1 
ATOM   1413 C  CG2   . ILE C 3 104 ? 83.563  85.887  37.795 1.00 17.36 ? 104  ILE A CG2   1 
ATOM   1414 C  CD1   . ILE C 3 104 ? 83.727  88.491  36.171 1.00 21.28 ? 104  ILE A CD1   1 
ATOM   1415 N  N     . TYR C 3 105 ? 82.946  85.082  40.838 1.00 17.78 ? 105  TYR A N     1 
ATOM   1416 C  CA    . TYR C 3 105 ? 83.451  83.918  41.559 1.00 17.51 ? 105  TYR A CA    1 
ATOM   1417 C  C     . TYR C 3 105 ? 83.716  82.804  40.555 1.00 17.73 ? 105  TYR A C     1 
ATOM   1418 O  O     . TYR C 3 105 ? 82.843  82.450  39.765 1.00 19.31 ? 105  TYR A O     1 
ATOM   1419 C  CB    . TYR C 3 105 ? 82.448  83.406  42.600 1.00 17.09 ? 105  TYR A CB    1 
ATOM   1420 C  CG    . TYR C 3 105 ? 82.973  82.195  43.359 1.00 17.57 ? 105  TYR A CG    1 
ATOM   1421 C  CD1   . TYR C 3 105 ? 83.981  82.332  44.319 1.00 18.14 ? 105  TYR A CD1   1 
ATOM   1422 C  CD2   . TYR C 3 105 ? 82.506  80.907  43.074 1.00 16.65 ? 105  TYR A CD2   1 
ATOM   1423 C  CE1   . TYR C 3 105 ? 84.514  81.216  44.975 1.00 18.56 ? 105  TYR A CE1   1 
ATOM   1424 C  CE2   . TYR C 3 105 ? 83.031  79.781  43.725 1.00 17.23 ? 105  TYR A CE2   1 
ATOM   1425 C  CZ    . TYR C 3 105 ? 84.037  79.945  44.674 1.00 19.36 ? 105  TYR A CZ    1 
ATOM   1426 O  OH    . TYR C 3 105 ? 84.568  78.848  45.321 1.00 17.32 ? 105  TYR A OH    1 
ATOM   1427 N  N     . ALA C 3 106 ? 84.928  82.260  40.589 1.00 17.29 ? 106  ALA A N     1 
ATOM   1428 C  CA    . ALA C 3 106 ? 85.319  81.177  39.695 1.00 17.67 ? 106  ALA A CA    1 
ATOM   1429 C  C     . ALA C 3 106 ? 85.826  80.023  40.550 1.00 16.83 ? 106  ALA A C     1 
ATOM   1430 O  O     . ALA C 3 106 ? 86.392  80.236  41.622 1.00 19.16 ? 106  ALA A O     1 
ATOM   1431 C  CB    . ALA C 3 106 ? 86.416  81.650  38.740 1.00 18.38 ? 106  ALA A CB    1 
ATOM   1432 N  N     . ASP C 3 107 ? 85.628  78.799  40.078 1.00 17.90 ? 107  ASP A N     1 
ATOM   1433 C  CA    . ASP C 3 107 ? 86.059  77.629  40.833 1.00 18.22 ? 107  ASP A CA    1 
ATOM   1434 C  C     . ASP C 3 107 ? 86.116  76.448  39.874 1.00 18.04 ? 107  ASP A C     1 
ATOM   1435 O  O     . ASP C 3 107 ? 85.089  75.880  39.513 1.00 18.71 ? 107  ASP A O     1 
ATOM   1436 C  CB    . ASP C 3 107 ? 85.057  77.374  41.971 1.00 18.03 ? 107  ASP A CB    1 
ATOM   1437 C  CG    . ASP C 3 107 ? 85.540  76.335  42.974 1.00 19.38 ? 107  ASP A CG    1 
ATOM   1438 O  OD1   . ASP C 3 107 ? 85.103  76.405  44.144 1.00 21.05 ? 107  ASP A OD1   1 
ATOM   1439 O  OD2   . ASP C 3 107 ? 86.335  75.449  42.606 1.00 18.87 ? 107  ASP A OD2   1 
ATOM   1440 N  N     . VAL C 3 108 ? 87.327  76.081  39.463 1.00 19.73 ? 108  VAL A N     1 
ATOM   1441 C  CA    . VAL C 3 108 ? 87.508  74.982  38.523 1.00 18.83 ? 108  VAL A CA    1 
ATOM   1442 C  C     . VAL C 3 108 ? 86.863  73.673  38.966 1.00 20.07 ? 108  VAL A C     1 
ATOM   1443 O  O     . VAL C 3 108 ? 86.181  73.015  38.177 1.00 20.60 ? 108  VAL A O     1 
ATOM   1444 C  CB    . VAL C 3 108 ? 89.009  74.718  38.252 1.00 22.06 ? 108  VAL A CB    1 
ATOM   1445 C  CG1   . VAL C 3 108 ? 89.173  73.488  37.363 1.00 20.62 ? 108  VAL A CG1   1 
ATOM   1446 C  CG2   . VAL C 3 108 ? 89.636  75.928  37.580 1.00 22.66 ? 108  VAL A CG2   1 
ATOM   1447 N  N     . ARG C 3 109 ? 87.056  73.303  40.228 1.00 18.04 ? 109  ARG A N     1 
ATOM   1448 C  CA    . ARG C 3 109 ? 86.512  72.047  40.731 1.00 18.81 ? 109  ARG A CA    1 
ATOM   1449 C  C     . ARG C 3 109 ? 85.061  72.105  41.214 1.00 19.32 ? 109  ARG A C     1 
ATOM   1450 O  O     . ARG C 3 109 ? 84.477  71.076  41.566 1.00 20.21 ? 109  ARG A O     1 
ATOM   1451 C  CB    . ARG C 3 109 ? 87.438  71.506  41.829 1.00 18.32 ? 109  ARG A CB    1 
ATOM   1452 C  CG    . ARG C 3 109 ? 88.882  71.358  41.332 1.00 20.52 ? 109  ARG A CG    1 
ATOM   1453 C  CD    . ARG C 3 109 ? 89.819  70.747  42.363 1.00 20.38 ? 109  ARG A CD    1 
ATOM   1454 N  NE    . ARG C 3 109 ? 89.531  69.339  42.617 1.00 20.49 ? 109  ARG A NE    1 
ATOM   1455 C  CZ    . ARG C 3 109 ? 90.139  68.609  43.546 1.00 20.67 ? 109  ARG A CZ    1 
ATOM   1456 N  NH1   . ARG C 3 109 ? 91.076  69.153  44.311 1.00 21.15 ? 109  ARG A NH1   1 
ATOM   1457 N  NH2   . ARG C 3 109 ? 89.803  67.339  43.721 1.00 20.78 ? 109  ARG A NH2   1 
ATOM   1458 N  N     . LYS C 3 110 ? 84.481  73.302  41.214 1.00 17.72 ? 110  LYS A N     1 
ATOM   1459 C  CA    . LYS C 3 110 ? 83.098  73.496  41.639 1.00 20.06 ? 110  LYS A CA    1 
ATOM   1460 C  C     . LYS C 3 110 ? 82.826  73.052  43.084 1.00 19.40 ? 110  LYS A C     1 
ATOM   1461 O  O     . LYS C 3 110 ? 81.722  72.618  43.402 1.00 20.42 ? 110  LYS A O     1 
ATOM   1462 C  CB    . LYS C 3 110 ? 82.142  72.747  40.693 1.00 20.38 ? 110  LYS A CB    1 
ATOM   1463 C  CG    . LYS C 3 110 ? 82.038  73.313  39.271 1.00 23.13 ? 110  LYS A CG    1 
ATOM   1464 C  CD    . LYS C 3 110 ? 81.046  72.481  38.448 1.00 25.11 ? 110  LYS A CD    1 
ATOM   1465 C  CE    . LYS C 3 110 ? 80.752  73.090  37.081 1.00 27.41 ? 110  LYS A CE    1 
ATOM   1466 N  NZ    . LYS C 3 110 ? 81.934  73.056  36.180 1.00 29.06 ? 110  LYS A NZ    1 
ATOM   1467 N  N     . PHE C 3 111 ? 83.817  73.168  43.961 1.00 18.72 ? 111  PHE A N     1 
ATOM   1468 C  CA    . PHE C 3 111 ? 83.624  72.763  45.354 1.00 17.46 ? 111  PHE A CA    1 
ATOM   1469 C  C     . PHE C 3 111 ? 83.077  73.895  46.217 1.00 18.16 ? 111  PHE A C     1 
ATOM   1470 O  O     . PHE C 3 111 ? 82.368  73.652  47.201 1.00 18.03 ? 111  PHE A O     1 
ATOM   1471 C  CB    . PHE C 3 111 ? 84.944  72.278  45.972 1.00 17.66 ? 111  PHE A CB    1 
ATOM   1472 C  CG    . PHE C 3 111 ? 85.446  70.966  45.426 1.00 18.42 ? 111  PHE A CG    1 
ATOM   1473 C  CD1   . PHE C 3 111 ? 84.663  70.187  44.580 1.00 19.17 ? 111  PHE A CD1   1 
ATOM   1474 C  CD2   . PHE C 3 111 ? 86.707  70.497  45.791 1.00 20.47 ? 111  PHE A CD2   1 
ATOM   1475 C  CE1   . PHE C 3 111 ? 85.131  68.956  44.105 1.00 19.00 ? 111  PHE A CE1   1 
ATOM   1476 C  CE2   . PHE C 3 111 ? 87.183  69.270  45.327 1.00 20.01 ? 111  PHE A CE2   1 
ATOM   1477 C  CZ    . PHE C 3 111 ? 86.391  68.499  44.480 1.00 21.08 ? 111  PHE A CZ    1 
ATOM   1478 N  N     . GLY C 3 112 ? 83.423  75.125  45.847 1.00 16.58 ? 112  GLY A N     1 
ATOM   1479 C  CA    . GLY C 3 112 ? 82.997  76.301  46.595 1.00 16.81 ? 112  GLY A CA    1 
ATOM   1480 C  C     . GLY C 3 112 ? 81.500  76.400  46.801 1.00 17.72 ? 112  GLY A C     1 
ATOM   1481 O  O     . GLY C 3 112 ? 80.726  75.909  45.984 1.00 17.16 ? 112  GLY A O     1 
ATOM   1482 N  N     . THR C 3 113 ? 81.097  77.068  47.879 1.00 17.67 ? 113  THR A N     1 
ATOM   1483 C  CA    . THR C 3 113 ? 79.684  77.197  48.220 1.00 18.88 ? 113  THR A CA    1 
ATOM   1484 C  C     . THR C 3 113 ? 79.264  78.585  48.689 1.00 18.95 ? 113  THR A C     1 
ATOM   1485 O  O     . THR C 3 113 ? 80.069  79.348  49.221 1.00 17.61 ? 113  THR A O     1 
ATOM   1486 C  CB    . THR C 3 113 ? 79.322  76.213  49.348 1.00 18.49 ? 113  THR A CB    1 
ATOM   1487 O  OG1   . THR C 3 113 ? 80.091  76.536  50.515 1.00 18.19 ? 113  THR A OG1   1 
ATOM   1488 C  CG2   . THR C 3 113 ? 79.634  74.782  48.930 1.00 19.63 ? 113  THR A CG2   1 
ATOM   1489 N  N     . TRP C 3 114 ? 77.983  78.887  48.494 1.00 17.12 ? 114  TRP A N     1 
ATOM   1490 C  CA    . TRP C 3 114 ? 77.378  80.146  48.912 1.00 17.49 ? 114  TRP A CA    1 
ATOM   1491 C  C     . TRP C 3 114 ? 76.117  79.782  49.698 1.00 18.21 ? 114  TRP A C     1 
ATOM   1492 O  O     . TRP C 3 114 ? 75.353  78.913  49.276 1.00 18.60 ? 114  TRP A O     1 
ATOM   1493 C  CB    . TRP C 3 114 ? 76.957  80.979  47.700 1.00 18.16 ? 114  TRP A CB    1 
ATOM   1494 C  CG    . TRP C 3 114 ? 77.948  81.995  47.225 1.00 17.48 ? 114  TRP A CG    1 
ATOM   1495 C  CD1   . TRP C 3 114 ? 79.305  81.964  47.376 1.00 17.08 ? 114  TRP A CD1   1 
ATOM   1496 C  CD2   . TRP C 3 114 ? 77.657  83.154  46.438 1.00 16.71 ? 114  TRP A CD2   1 
ATOM   1497 N  NE1   . TRP C 3 114 ? 79.877  83.033  46.724 1.00 17.14 ? 114  TRP A NE1   1 
ATOM   1498 C  CE2   . TRP C 3 114 ? 78.886  83.779  46.141 1.00 18.10 ? 114  TRP A CE2   1 
ATOM   1499 C  CE3   . TRP C 3 114 ? 76.473  83.724  45.951 1.00 18.25 ? 114  TRP A CE3   1 
ATOM   1500 C  CZ2   . TRP C 3 114 ? 78.968  84.948  45.376 1.00 17.74 ? 114  TRP A CZ2   1 
ATOM   1501 C  CZ3   . TRP C 3 114 ? 76.552  84.887  45.189 1.00 18.19 ? 114  TRP A CZ3   1 
ATOM   1502 C  CH2   . TRP C 3 114 ? 77.794  85.485  44.911 1.00 20.36 ? 114  TRP A CH2   1 
ATOM   1503 N  N     . GLU C 3 115 ? 75.910  80.440  50.831 1.00 17.23 ? 115  GLU A N     1 
ATOM   1504 C  CA    . GLU C 3 115 ? 74.732  80.194  51.654 1.00 19.67 ? 115  GLU A CA    1 
ATOM   1505 C  C     . GLU C 3 115 ? 74.237  81.510  52.218 1.00 20.11 ? 115  GLU A C     1 
ATOM   1506 O  O     . GLU C 3 115 ? 74.987  82.235  52.869 1.00 19.62 ? 115  GLU A O     1 
ATOM   1507 C  CB    . GLU C 3 115 ? 75.065  79.246  52.802 1.00 20.77 ? 115  GLU A CB    1 
ATOM   1508 C  CG    . GLU C 3 115 ? 75.116  77.785  52.415 1.00 24.37 ? 115  GLU A CG    1 
ATOM   1509 C  CD    . GLU C 3 115 ? 75.737  76.943  53.499 1.00 24.90 ? 115  GLU A CD    1 
ATOM   1510 O  OE1   . GLU C 3 115 ? 76.932  77.151  53.774 1.00 26.18 ? 115  GLU A OE1   1 
ATOM   1511 O  OE2   . GLU C 3 115 ? 75.038  76.089  54.080 1.00 28.40 ? 115  GLU A OE2   1 
ATOM   1512 N  N     . LEU C 3 116 ? 72.967  81.813  51.973 1.00 20.68 ? 116  LEU A N     1 
ATOM   1513 C  CA    . LEU C 3 116 ? 72.379  83.049  52.459 1.00 22.91 ? 116  LEU A CA    1 
ATOM   1514 C  C     . LEU C 3 116 ? 71.607  82.779  53.741 1.00 25.43 ? 116  LEU A C     1 
ATOM   1515 O  O     . LEU C 3 116 ? 70.685  81.963  53.756 1.00 25.45 ? 116  LEU A O     1 
ATOM   1516 C  CB    . LEU C 3 116 ? 71.437  83.637  51.404 1.00 24.80 ? 116  LEU A CB    1 
ATOM   1517 C  CG    . LEU C 3 116 ? 70.774  84.975  51.747 1.00 25.89 ? 116  LEU A CG    1 
ATOM   1518 C  CD1   . LEU C 3 116 ? 71.840  86.015  52.084 1.00 24.95 ? 116  LEU A CD1   1 
ATOM   1519 C  CD2   . LEU C 3 116 ? 69.929  85.437  50.559 1.00 27.15 ? 116  LEU A CD2   1 
ATOM   1520 N  N     . ILE C 3 117 ? 72.001  83.446  54.821 1.00 25.56 ? 117  ILE A N     1 
ATOM   1521 C  CA    . ILE C 3 117 ? 71.322  83.283  56.101 1.00 26.99 ? 117  ILE A CA    1 
ATOM   1522 C  C     . ILE C 3 117 ? 71.166  84.644  56.766 1.00 26.67 ? 117  ILE A C     1 
ATOM   1523 O  O     . ILE C 3 117 ? 71.747  85.628  56.315 1.00 27.58 ? 117  ILE A O     1 
ATOM   1524 C  CB    . ILE C 3 117 ? 72.093  82.338  57.044 1.00 27.95 ? 117  ILE A CB    1 
ATOM   1525 C  CG1   . ILE C 3 117 ? 73.433  82.957  57.434 1.00 26.53 ? 117  ILE A CG1   1 
ATOM   1526 C  CG2   . ILE C 3 117 ? 72.311  80.986  56.364 1.00 29.42 ? 117  ILE A CG2   1 
ATOM   1527 C  CD1   . ILE C 3 117 ? 74.175  82.153  58.478 1.00 28.46 ? 117  ILE A CD1   1 
ATOM   1528 N  N     . SER C 3 118 ? 70.380  84.701  57.837 1.00 26.11 ? 118  SER A N     1 
ATOM   1529 C  CA    . SER C 3 118 ? 70.149  85.961  58.528 1.00 26.60 ? 118  SER A CA    1 
ATOM   1530 C  C     . SER C 3 118 ? 71.220  86.260  59.562 1.00 25.52 ? 118  SER A C     1 
ATOM   1531 O  O     . SER C 3 118 ? 71.910  85.365  60.047 1.00 24.10 ? 118  SER A O     1 
ATOM   1532 C  CB    . SER C 3 118 ? 68.779  85.953  59.208 1.00 28.91 ? 118  SER A CB    1 
ATOM   1533 O  OG    . SER C 3 118 ? 68.784  85.057  60.301 1.00 33.57 ? 118  SER A OG    1 
ATOM   1534 N  N     . THR C 3 119 ? 71.339  87.534  59.900 1.00 25.32 ? 119  THR A N     1 
ATOM   1535 C  CA    . THR C 3 119 ? 72.324  87.987  60.864 1.00 26.23 ? 119  THR A CA    1 
ATOM   1536 C  C     . THR C 3 119 ? 72.326  87.190  62.167 1.00 26.17 ? 119  THR A C     1 
ATOM   1537 O  O     . THR C 3 119 ? 73.389  86.826  62.661 1.00 23.99 ? 119  THR A O     1 
ATOM   1538 C  CB    . THR C 3 119 ? 72.117  89.471  61.184 1.00 24.85 ? 119  THR A CB    1 
ATOM   1539 O  OG1   . THR C 3 119 ? 72.167  90.222  59.966 1.00 25.14 ? 119  THR A OG1   1 
ATOM   1540 C  CG2   . THR C 3 119 ? 73.202  89.974  62.124 1.00 26.26 ? 119  THR A CG2   1 
ATOM   1541 N  N     . ASP C 3 120 ? 71.154  86.905  62.727 1.00 26.36 ? 120  ASP A N     1 
ATOM   1542 C  CA    . ASP C 3 120 ? 71.130  86.158  63.985 1.00 28.17 ? 120  ASP A CA    1 
ATOM   1543 C  C     . ASP C 3 120 ? 71.338  84.654  63.834 1.00 26.76 ? 120  ASP A C     1 
ATOM   1544 O  O     . ASP C 3 120 ? 71.351  83.931  64.826 1.00 26.07 ? 120  ASP A O     1 
ATOM   1545 C  CB    . ASP C 3 120 ? 69.837  86.427  64.775 1.00 31.94 ? 120  ASP A CB    1 
ATOM   1546 C  CG    . ASP C 3 120 ? 68.585  86.145  63.976 1.00 36.28 ? 120  ASP A CG    1 
ATOM   1547 O  OD1   . ASP C 3 120 ? 68.544  85.130  63.249 1.00 38.06 ? 120  ASP A OD1   1 
ATOM   1548 O  OD2   . ASP C 3 120 ? 67.628  86.940  64.089 1.00 42.41 ? 120  ASP A OD2   1 
ATOM   1549 N  N     . GLN C 3 121 ? 71.514  84.185  62.602 1.00 24.82 ? 121  GLN A N     1 
ATOM   1550 C  CA    . GLN C 3 121 ? 71.735  82.760  62.364 1.00 25.66 ? 121  GLN A CA    1 
ATOM   1551 C  C     . GLN C 3 121 ? 73.220  82.439  62.175 1.00 23.65 ? 121  GLN A C     1 
ATOM   1552 O  O     . GLN C 3 121 ? 73.603  81.272  62.110 1.00 21.81 ? 121  GLN A O     1 
ATOM   1553 C  CB    . GLN C 3 121 ? 70.967  82.297  61.123 1.00 27.86 ? 121  GLN A CB    1 
ATOM   1554 C  CG    . GLN C 3 121 ? 69.460  82.424  61.234 1.00 33.81 ? 121  GLN A CG    1 
ATOM   1555 C  CD    . GLN C 3 121 ? 68.750  81.948  59.981 1.00 37.27 ? 121  GLN A CD    1 
ATOM   1556 O  OE1   . GLN C 3 121 ? 69.009  82.437  58.874 1.00 37.77 ? 121  GLN A OE1   1 
ATOM   1557 N  NE2   . GLN C 3 121 ? 67.847  80.986  60.146 1.00 40.97 ? 121  GLN A NE2   1 
ATOM   1558 N  N     . VAL C 3 122 ? 74.051  83.474  62.091 1.00 23.30 ? 122  VAL A N     1 
ATOM   1559 C  CA    . VAL C 3 122 ? 75.491  83.290  61.892 1.00 23.52 ? 122  VAL A CA    1 
ATOM   1560 C  C     . VAL C 3 122 ? 76.188  82.548  63.030 1.00 23.99 ? 122  VAL A C     1 
ATOM   1561 O  O     . VAL C 3 122 ? 76.873  81.552  62.794 1.00 23.73 ? 122  VAL A O     1 
ATOM   1562 C  CB    . VAL C 3 122 ? 76.202  84.648  61.665 1.00 23.98 ? 122  VAL A CB    1 
ATOM   1563 C  CG1   . VAL C 3 122 ? 77.717  84.447  61.575 1.00 26.10 ? 122  VAL A CG1   1 
ATOM   1564 C  CG2   . VAL C 3 122 ? 75.692  85.284  60.386 1.00 23.92 ? 122  VAL A CG2   1 
ATOM   1565 N  N     . LEU C 3 123 ? 76.030  83.017  64.264 1.00 23.84 ? 123  LEU A N     1 
ATOM   1566 C  CA    . LEU C 3 123 ? 76.676  82.326  65.375 1.00 23.53 ? 123  LEU A CA    1 
ATOM   1567 C  C     . LEU C 3 123 ? 76.223  80.865  65.455 1.00 22.47 ? 123  LEU A C     1 
ATOM   1568 O  O     . LEU C 3 123 ? 77.048  79.964  65.607 1.00 20.97 ? 123  LEU A O     1 
ATOM   1569 C  CB    . LEU C 3 123 ? 76.415  83.058  66.698 1.00 26.51 ? 123  LEU A CB    1 
ATOM   1570 C  CG    . LEU C 3 123 ? 77.020  84.467  66.755 1.00 27.88 ? 123  LEU A CG    1 
ATOM   1571 C  CD1   . LEU C 3 123 ? 76.870  85.035  68.163 1.00 30.29 ? 123  LEU A CD1   1 
ATOM   1572 C  CD2   . LEU C 3 123 ? 78.493  84.421  66.361 1.00 29.60 ? 123  LEU A CD2   1 
ATOM   1573 N  N     . PRO C 3 124 ? 74.905  80.607  65.347 1.00 21.72 ? 124  PRO A N     1 
ATOM   1574 C  CA    . PRO C 3 124 ? 74.415  79.223  65.407 1.00 20.44 ? 124  PRO A CA    1 
ATOM   1575 C  C     . PRO C 3 124 ? 74.987  78.377  64.259 1.00 21.02 ? 124  PRO A C     1 
ATOM   1576 O  O     . PRO C 3 124 ? 75.280  77.192  64.422 1.00 21.35 ? 124  PRO A O     1 
ATOM   1577 C  CB    . PRO C 3 124 ? 72.903  79.388  65.288 1.00 22.42 ? 124  PRO A CB    1 
ATOM   1578 C  CG    . PRO C 3 124 ? 72.662  80.735  65.913 1.00 23.29 ? 124  PRO A CG    1 
ATOM   1579 C  CD    . PRO C 3 124 ? 73.782  81.561  65.345 1.00 22.20 ? 124  PRO A CD    1 
ATOM   1580 N  N     . TYR C 3 125 ? 75.128  78.998  63.094 1.00 20.11 ? 125  TYR A N     1 
ATOM   1581 C  CA    . TYR C 3 125 ? 75.669  78.328  61.914 1.00 19.33 ? 125  TYR A CA    1 
ATOM   1582 C  C     . TYR C 3 125 ? 77.059  77.763  62.204 1.00 19.23 ? 125  TYR A C     1 
ATOM   1583 O  O     . TYR C 3 125 ? 77.351  76.607  61.892 1.00 20.51 ? 125  TYR A O     1 
ATOM   1584 C  CB    . TYR C 3 125 ? 75.757  79.321  60.747 1.00 19.23 ? 125  TYR A CB    1 
ATOM   1585 C  CG    . TYR C 3 125 ? 76.427  78.781  59.494 1.00 19.95 ? 125  TYR A CG    1 
ATOM   1586 C  CD1   . TYR C 3 125 ? 75.674  78.225  58.455 1.00 21.72 ? 125  TYR A CD1   1 
ATOM   1587 C  CD2   . TYR C 3 125 ? 77.815  78.834  59.347 1.00 21.02 ? 125  TYR A CD2   1 
ATOM   1588 C  CE1   . TYR C 3 125 ? 76.289  77.737  57.294 1.00 22.46 ? 125  TYR A CE1   1 
ATOM   1589 C  CE2   . TYR C 3 125 ? 78.441  78.343  58.191 1.00 23.02 ? 125  TYR A CE2   1 
ATOM   1590 C  CZ    . TYR C 3 125 ? 77.672  77.801  57.173 1.00 22.21 ? 125  TYR A CZ    1 
ATOM   1591 O  OH    . TYR C 3 125 ? 78.288  77.327  56.035 1.00 22.44 ? 125  TYR A OH    1 
ATOM   1592 N  N     . PHE C 3 126 ? 77.921  78.579  62.796 1.00 18.40 ? 126  PHE A N     1 
ATOM   1593 C  CA    . PHE C 3 126 ? 79.265  78.117  63.094 1.00 20.56 ? 126  PHE A CA    1 
ATOM   1594 C  C     . PHE C 3 126 ? 79.326  77.201  64.305 1.00 20.71 ? 126  PHE A C     1 
ATOM   1595 O  O     . PHE C 3 126 ? 80.227  76.372  64.413 1.00 20.71 ? 126  PHE A O     1 
ATOM   1596 C  CB    . PHE C 3 126 ? 80.205  79.314  63.231 1.00 20.04 ? 126  PHE A CB    1 
ATOM   1597 C  CG    . PHE C 3 126 ? 80.477  79.997  61.922 1.00 20.14 ? 126  PHE A CG    1 
ATOM   1598 C  CD1   . PHE C 3 126 ? 81.169  79.330  60.913 1.00 21.00 ? 126  PHE A CD1   1 
ATOM   1599 C  CD2   . PHE C 3 126 ? 79.984  81.273  61.666 1.00 20.48 ? 126  PHE A CD2   1 
ATOM   1600 C  CE1   . PHE C 3 126 ? 81.361  79.923  59.666 1.00 21.37 ? 126  PHE A CE1   1 
ATOM   1601 C  CE2   . PHE C 3 126 ? 80.170  81.876  60.421 1.00 21.24 ? 126  PHE A CE2   1 
ATOM   1602 C  CZ    . PHE C 3 126 ? 80.859  81.199  59.419 1.00 22.03 ? 126  PHE A CZ    1 
ATOM   1603 N  N     . LEU C 3 127 ? 78.368  77.334  65.218 1.00 21.71 ? 127  LEU A N     1 
ATOM   1604 C  CA    . LEU C 3 127 ? 78.341  76.440  66.368 1.00 22.69 ? 127  LEU A CA    1 
ATOM   1605 C  C     . LEU C 3 127 ? 78.009  75.050  65.823 1.00 23.15 ? 127  LEU A C     1 
ATOM   1606 O  O     . LEU C 3 127 ? 78.585  74.054  66.249 1.00 24.08 ? 127  LEU A O     1 
ATOM   1607 C  CB    . LEU C 3 127 ? 77.282  76.888  67.386 1.00 23.15 ? 127  LEU A CB    1 
ATOM   1608 C  CG    . LEU C 3 127 ? 77.642  78.135  68.208 1.00 26.32 ? 127  LEU A CG    1 
ATOM   1609 C  CD1   . LEU C 3 127 ? 76.474  78.544  69.096 1.00 27.09 ? 127  LEU A CD1   1 
ATOM   1610 C  CD2   . LEU C 3 127 ? 78.867  77.839  69.060 1.00 26.31 ? 127  LEU A CD2   1 
ATOM   1611 N  N     . LYS C 3 128 ? 77.096  74.991  64.856 1.00 23.92 ? 128  LYS A N     1 
ATOM   1612 C  CA    . LYS C 3 128 ? 76.704  73.718  64.259 1.00 24.81 ? 128  LYS A CA    1 
ATOM   1613 C  C     . LYS C 3 128 ? 77.883  73.083  63.512 1.00 26.17 ? 128  LYS A C     1 
ATOM   1614 O  O     . LYS C 3 128 ? 78.023  71.861  63.491 1.00 26.31 ? 128  LYS A O     1 
ATOM   1615 C  CB    . LYS C 3 128 ? 75.521  73.920  63.304 1.00 26.72 ? 128  LYS A CB    1 
ATOM   1616 C  CG    . LYS C 3 128 ? 74.946  72.630  62.729 1.00 28.44 ? 128  LYS A CG    1 
ATOM   1617 C  CD    . LYS C 3 128 ? 73.714  72.905  61.867 1.00 29.84 ? 128  LYS A CD    1 
ATOM   1618 C  CE    . LYS C 3 128 ? 73.121  71.614  61.312 1.00 32.41 ? 128  LYS A CE    1 
ATOM   1619 N  NZ    . LYS C 3 128 ? 71.870  71.856  60.531 1.00 32.82 ? 128  LYS A NZ    1 
ATOM   1620 N  N     . LYS C 3 129 ? 78.723  73.919  62.905 1.00 25.90 ? 129  LYS A N     1 
ATOM   1621 C  CA    . LYS C 3 129 ? 79.899  73.450  62.170 1.00 25.74 ? 129  LYS A CA    1 
ATOM   1622 C  C     . LYS C 3 129 ? 81.002  72.989  63.124 1.00 26.27 ? 129  LYS A C     1 
ATOM   1623 O  O     . LYS C 3 129 ? 81.985  72.384  62.696 1.00 26.33 ? 129  LYS A O     1 
ATOM   1624 C  CB    . LYS C 3 129 ? 80.468  74.566  61.288 1.00 25.51 ? 129  LYS A CB    1 
ATOM   1625 C  CG    . LYS C 3 129 ? 79.563  75.048  60.170 1.00 27.30 ? 129  LYS A CG    1 
ATOM   1626 C  CD    . LYS C 3 129 ? 79.357  73.981  59.122 1.00 27.64 ? 129  LYS A CD    1 
ATOM   1627 C  CE    . LYS C 3 129 ? 78.532  74.514  57.963 1.00 26.79 ? 129  LYS A CE    1 
ATOM   1628 N  NZ    . LYS C 3 129 ? 78.192  73.416  57.019 1.00 30.50 ? 129  LYS A NZ    1 
ATOM   1629 N  N     . LYS C 3 130 ? 80.845  73.293  64.409 1.00 25.99 ? 130  LYS A N     1 
ATOM   1630 C  CA    . LYS C 3 130 ? 81.826  72.915  65.427 1.00 27.39 ? 130  LYS A CA    1 
ATOM   1631 C  C     . LYS C 3 130 ? 83.213  73.526  65.205 1.00 26.53 ? 130  LYS A C     1 
ATOM   1632 O  O     . LYS C 3 130 ? 84.230  72.961  65.620 1.00 26.38 ? 130  LYS A O     1 
ATOM   1633 C  CB    . LYS C 3 130 ? 81.928  71.388  65.514 1.00 31.83 ? 130  LYS A CB    1 
ATOM   1634 C  CG    . LYS C 3 130 ? 80.649  70.737  66.027 1.00 36.07 ? 130  LYS A CG    1 
ATOM   1635 C  CD    . LYS C 3 130 ? 80.773  69.227  66.152 1.00 41.25 ? 130  LYS A CD    1 
ATOM   1636 C  CE    . LYS C 3 130 ? 79.473  68.622  66.681 1.00 44.23 ? 130  LYS A CE    1 
ATOM   1637 N  NZ    . LYS C 3 130 ? 79.500  67.127  66.720 1.00 46.21 ? 130  LYS A NZ    1 
ATOM   1638 N  N     . ILE C 3 131 ? 83.245  74.688  64.559 1.00 23.24 ? 131  ILE A N     1 
ATOM   1639 C  CA    . ILE C 3 131 ? 84.497  75.386  64.290 1.00 22.04 ? 131  ILE A CA    1 
ATOM   1640 C  C     . ILE C 3 131 ? 85.158  75.799  65.605 1.00 21.10 ? 131  ILE A C     1 
ATOM   1641 O  O     . ILE C 3 131 ? 84.493  76.306  66.506 1.00 20.93 ? 131  ILE A O     1 
ATOM   1642 C  CB    . ILE C 3 131 ? 84.252  76.656  63.442 1.00 23.23 ? 131  ILE A CB    1 
ATOM   1643 C  CG1   . ILE C 3 131 ? 83.503  76.289  62.160 1.00 25.85 ? 131  ILE A CG1   1 
ATOM   1644 C  CG2   . ILE C 3 131 ? 85.579  77.327  63.107 1.00 25.66 ? 131  ILE A CG2   1 
ATOM   1645 C  CD1   . ILE C 3 131 ? 84.216  75.256  61.292 1.00 29.32 ? 131  ILE A CD1   1 
ATOM   1646 N  N     . GLY C 3 132 ? 86.466  75.576  65.707 1.00 19.68 ? 132  GLY A N     1 
ATOM   1647 C  CA    . GLY C 3 132 ? 87.195  75.941  66.908 1.00 20.37 ? 132  GLY A CA    1 
ATOM   1648 C  C     . GLY C 3 132 ? 87.536  77.421  66.961 1.00 19.86 ? 132  GLY A C     1 
ATOM   1649 O  O     . GLY C 3 132 ? 87.095  78.194  66.112 1.00 19.11 ? 132  GLY A O     1 
ATOM   1650 N  N     . PRO C 3 133 ? 88.343  77.846  67.944 1.00 20.10 ? 133  PRO A N     1 
ATOM   1651 C  CA    . PRO C 3 133 ? 88.732  79.254  68.093 1.00 19.87 ? 133  PRO A CA    1 
ATOM   1652 C  C     . PRO C 3 133 ? 89.631  79.825  67.003 1.00 19.47 ? 133  PRO A C     1 
ATOM   1653 O  O     . PRO C 3 133 ? 90.394  79.097  66.362 1.00 18.85 ? 133  PRO A O     1 
ATOM   1654 C  CB    . PRO C 3 133 ? 89.421  79.274  69.457 1.00 21.71 ? 133  PRO A CB    1 
ATOM   1655 C  CG    . PRO C 3 133 ? 90.035  77.902  69.534 1.00 19.89 ? 133  PRO A CG    1 
ATOM   1656 C  CD    . PRO C 3 133 ? 88.929  77.019  69.014 1.00 19.10 ? 133  PRO A CD    1 
ATOM   1657 N  N     . GLU C 3 134 ? 89.533  81.137  66.799 1.00 16.99 ? 134  GLU A N     1 
ATOM   1658 C  CA    . GLU C 3 134 ? 90.376  81.815  65.822 1.00 18.64 ? 134  GLU A CA    1 
ATOM   1659 C  C     . GLU C 3 134 ? 91.802  81.701  66.352 1.00 18.88 ? 134  GLU A C     1 
ATOM   1660 O  O     . GLU C 3 134 ? 92.012  81.649  67.564 1.00 19.20 ? 134  GLU A O     1 
ATOM   1661 C  CB    . GLU C 3 134 ? 89.986  83.290  65.705 1.00 18.16 ? 134  GLU A CB    1 
ATOM   1662 C  CG    . GLU C 3 134 ? 88.673  83.534  64.988 1.00 19.50 ? 134  GLU A CG    1 
ATOM   1663 C  CD    . GLU C 3 134 ? 88.722  83.095  63.536 1.00 20.35 ? 134  GLU A CD    1 
ATOM   1664 O  OE1   . GLU C 3 134 ? 89.722  83.417  62.859 1.00 20.16 ? 134  GLU A OE1   1 
ATOM   1665 O  OE2   . GLU C 3 134 ? 87.760  82.441  63.073 1.00 19.31 ? 134  GLU A OE2   1 
ATOM   1666 N  N     . PRO C 3 135 ? 92.797  81.660  65.454 1.00 20.34 ? 135  PRO A N     1 
ATOM   1667 C  CA    . PRO C 3 135 ? 94.209  81.544  65.832 1.00 20.66 ? 135  PRO A CA    1 
ATOM   1668 C  C     . PRO C 3 135 ? 94.860  82.837  66.333 1.00 21.83 ? 135  PRO A C     1 
ATOM   1669 O  O     . PRO C 3 135 ? 95.768  83.371  65.696 1.00 22.81 ? 135  PRO A O     1 
ATOM   1670 C  CB    . PRO C 3 135 ? 94.854  81.035  64.551 1.00 21.59 ? 135  PRO A CB    1 
ATOM   1671 C  CG    . PRO C 3 135 ? 94.088  81.788  63.503 1.00 20.33 ? 135  PRO A CG    1 
ATOM   1672 C  CD    . PRO C 3 135 ? 92.646  81.661  63.987 1.00 21.13 ? 135  PRO A CD    1 
ATOM   1673 N  N     . THR C 3 136 ? 94.389  83.333  67.471 1.00 21.78 ? 136  THR A N     1 
ATOM   1674 C  CA    . THR C 3 136 ? 94.935  84.550  68.061 1.00 24.55 ? 136  THR A CA    1 
ATOM   1675 C  C     . THR C 3 136 ? 95.201  84.290  69.535 1.00 24.62 ? 136  THR A C     1 
ATOM   1676 O  O     . THR C 3 136 ? 94.611  83.389  70.130 1.00 24.22 ? 136  THR A O     1 
ATOM   1677 C  CB    . THR C 3 136 ? 93.955  85.737  67.945 1.00 24.17 ? 136  THR A CB    1 
ATOM   1678 O  OG1   . THR C 3 136 ? 92.794  85.479  68.742 1.00 23.26 ? 136  THR A OG1   1 
ATOM   1679 C  CG2   . THR C 3 136 ? 93.531  85.938  66.495 1.00 24.19 ? 136  THR A CG2   1 
ATOM   1680 N  N     . TYR C 3 137 ? 96.099  85.070  70.125 1.00 26.53 ? 137  TYR A N     1 
ATOM   1681 C  CA    . TYR C 3 137 ? 96.407  84.892  71.535 1.00 27.29 ? 137  TYR A CA    1 
ATOM   1682 C  C     . TYR C 3 137 ? 95.164  85.124  72.376 1.00 28.05 ? 137  TYR A C     1 
ATOM   1683 O  O     . TYR C 3 137 ? 94.976  84.486  73.411 1.00 27.61 ? 137  TYR A O     1 
ATOM   1684 C  CB    . TYR C 3 137 ? 97.532  85.840  71.956 1.00 28.17 ? 137  TYR A CB    1 
ATOM   1685 C  CG    . TYR C 3 137 ? 98.886  85.384  71.468 1.00 29.10 ? 137  TYR A CG    1 
ATOM   1686 C  CD1   . TYR C 3 137 ? 99.461  84.213  71.959 1.00 30.77 ? 137  TYR A CD1   1 
ATOM   1687 C  CD2   . TYR C 3 137 ? 99.571  86.091  70.482 1.00 30.46 ? 137  TYR A CD2   1 
ATOM   1688 C  CE1   . TYR C 3 137 ? 100.688 83.753  71.479 1.00 32.21 ? 137  TYR A CE1   1 
ATOM   1689 C  CE2   . TYR C 3 137 ? 100.799 85.639  69.992 1.00 33.01 ? 137  TYR A CE2   1 
ATOM   1690 C  CZ    . TYR C 3 137 ? 101.349 84.469  70.494 1.00 33.74 ? 137  TYR A CZ    1 
ATOM   1691 O  OH    . TYR C 3 137 ? 102.551 84.006  70.002 1.00 35.18 ? 137  TYR A OH    1 
ATOM   1692 N  N     . GLU C 3 138 ? 94.298  86.017  71.909 1.00 28.68 ? 138  GLU A N     1 
ATOM   1693 C  CA    . GLU C 3 138 ? 93.072  86.335  72.628 1.00 29.80 ? 138  GLU A CA    1 
ATOM   1694 C  C     . GLU C 3 138 ? 92.034  85.213  72.626 1.00 28.47 ? 138  GLU A C     1 
ATOM   1695 O  O     . GLU C 3 138 ? 91.412  84.947  73.650 1.00 27.22 ? 138  GLU A O     1 
ATOM   1696 C  CB    . GLU C 3 138 ? 92.423  87.602  72.050 1.00 34.07 ? 138  GLU A CB    1 
ATOM   1697 C  CG    . GLU C 3 138 ? 93.275  88.858  72.145 1.00 39.17 ? 138  GLU A CG    1 
ATOM   1698 C  CD    . GLU C 3 138 ? 94.393  88.903  71.113 1.00 42.69 ? 138  GLU A CD    1 
ATOM   1699 O  OE1   . GLU C 3 138 ? 95.234  89.822  71.192 1.00 46.31 ? 138  GLU A OE1   1 
ATOM   1700 O  OE2   . GLU C 3 138 ? 94.432  88.029  70.221 1.00 43.30 ? 138  GLU A OE2   1 
ATOM   1701 N  N     . ASP C 3 139 ? 91.850  84.554  71.485 1.00 25.64 ? 139  ASP A N     1 
ATOM   1702 C  CA    . ASP C 3 139 ? 90.837  83.502  71.372 1.00 26.95 ? 139  ASP A CA    1 
ATOM   1703 C  C     . ASP C 3 139 ? 91.300  82.052  71.529 1.00 24.38 ? 139  ASP A C     1 
ATOM   1704 O  O     . ASP C 3 139 ? 90.532  81.197  71.967 1.00 24.25 ? 139  ASP A O     1 
ATOM   1705 C  CB    . ASP C 3 139 ? 90.112  83.640  70.028 1.00 29.84 ? 139  ASP A CB    1 
ATOM   1706 C  CG    . ASP C 3 139 ? 89.189  84.845  69.979 1.00 35.90 ? 139  ASP A CG    1 
ATOM   1707 O  OD1   . ASP C 3 139 ? 89.340  85.758  70.824 1.00 36.22 ? 139  ASP A OD1   1 
ATOM   1708 O  OD2   . ASP C 3 139 ? 88.317  84.882  69.084 1.00 38.48 ? 139  ASP A OD2   1 
ATOM   1709 N  N     . PHE C 3 140 ? 92.550  81.785  71.169 1.00 23.25 ? 140  PHE A N     1 
ATOM   1710 C  CA    . PHE C 3 140 ? 93.113  80.436  71.224 1.00 21.83 ? 140  PHE A CA    1 
ATOM   1711 C  C     . PHE C 3 140 ? 93.709  80.141  72.606 1.00 22.21 ? 140  PHE A C     1 
ATOM   1712 O  O     . PHE C 3 140 ? 94.868  80.445  72.865 1.00 21.71 ? 140  PHE A O     1 
ATOM   1713 C  CB    . PHE C 3 140 ? 94.192  80.320  70.138 1.00 21.18 ? 140  PHE A CB    1 
ATOM   1714 C  CG    . PHE C 3 140 ? 94.677  78.915  69.882 1.00 19.56 ? 140  PHE A CG    1 
ATOM   1715 C  CD1   . PHE C 3 140 ? 95.848  78.706  69.154 1.00 18.73 ? 140  PHE A CD1   1 
ATOM   1716 C  CD2   . PHE C 3 140 ? 93.972  77.809  70.349 1.00 17.24 ? 140  PHE A CD2   1 
ATOM   1717 C  CE1   . PHE C 3 140 ? 96.311  77.415  68.894 1.00 16.11 ? 140  PHE A CE1   1 
ATOM   1718 C  CE2   . PHE C 3 140 ? 94.425  76.514  70.096 1.00 19.49 ? 140  PHE A CE2   1 
ATOM   1719 C  CZ    . PHE C 3 140 ? 95.597  76.316  69.367 1.00 18.75 ? 140  PHE A CZ    1 
ATOM   1720 N  N     . ASP C 3 141 ? 92.906  79.551  73.485 1.00 21.70 ? 141  ASP A N     1 
ATOM   1721 C  CA    . ASP C 3 141 ? 93.348  79.225  74.839 1.00 23.20 ? 141  ASP A CA    1 
ATOM   1722 C  C     . ASP C 3 141 ? 94.187  77.951  74.892 1.00 21.81 ? 141  ASP A C     1 
ATOM   1723 O  O     . ASP C 3 141 ? 93.689  76.857  74.627 1.00 21.03 ? 141  ASP A O     1 
ATOM   1724 C  CB    . ASP C 3 141 ? 92.134  79.084  75.757 1.00 24.77 ? 141  ASP A CB    1 
ATOM   1725 C  CG    . ASP C 3 141 ? 92.480  78.437  77.084 1.00 27.27 ? 141  ASP A CG    1 
ATOM   1726 O  OD1   . ASP C 3 141 ? 93.542  78.768  77.654 1.00 27.49 ? 141  ASP A OD1   1 
ATOM   1727 O  OD2   . ASP C 3 141 ? 91.685  77.601  77.556 1.00 29.61 ? 141  ASP A OD2   1 
ATOM   1728 N  N     . GLU C 3 142 ? 95.457  78.099  75.254 1.00 21.25 ? 142  GLU A N     1 
ATOM   1729 C  CA    . GLU C 3 142 ? 96.366  76.962  75.321 1.00 21.99 ? 142  GLU A CA    1 
ATOM   1730 C  C     . GLU C 3 142 ? 95.942  75.884  76.311 1.00 21.94 ? 142  GLU A C     1 
ATOM   1731 O  O     . GLU C 3 142 ? 96.202  74.706  76.084 1.00 20.98 ? 142  GLU A O     1 
ATOM   1732 C  CB    . GLU C 3 142 ? 97.788  77.427  75.662 1.00 23.46 ? 142  GLU A CB    1 
ATOM   1733 C  CG    . GLU C 3 142 ? 98.824  76.314  75.548 1.00 26.40 ? 142  GLU A CG    1 
ATOM   1734 C  CD    . GLU C 3 142 ? 100.225 76.758  75.929 1.00 29.59 ? 142  GLU A CD    1 
ATOM   1735 O  OE1   . GLU C 3 142 ? 100.658 77.835  75.473 1.00 32.49 ? 142  GLU A OE1   1 
ATOM   1736 O  OE2   . GLU C 3 142 ? 100.903 76.019  76.674 1.00 31.55 ? 142  GLU A OE2   1 
ATOM   1737 N  N     . LYS C 3 143 ? 95.293  76.278  77.404 1.00 22.10 ? 143  LYS A N     1 
ATOM   1738 C  CA    . LYS C 3 143 ? 94.871  75.312  78.413 1.00 24.41 ? 143  LYS A CA    1 
ATOM   1739 C  C     . LYS C 3 143 ? 93.861  74.308  77.879 1.00 22.61 ? 143  LYS A C     1 
ATOM   1740 O  O     . LYS C 3 143 ? 94.018  73.104  78.079 1.00 24.08 ? 143  LYS A O     1 
ATOM   1741 C  CB    . LYS C 3 143 ? 94.303  76.034  79.643 1.00 27.14 ? 143  LYS A CB    1 
ATOM   1742 C  CG    . LYS C 3 143 ? 95.301  76.960  80.326 1.00 30.15 ? 143  LYS A CG    1 
ATOM   1743 C  CD    . LYS C 3 143 ? 94.733  77.505  81.635 1.00 33.78 ? 143  LYS A CD    1 
ATOM   1744 C  CE    . LYS C 3 143 ? 95.725  78.405  82.359 1.00 34.99 ? 143  LYS A CE    1 
ATOM   1745 N  NZ    . LYS C 3 143 ? 95.983  79.664  81.609 1.00 36.41 ? 143  LYS A NZ    1 
ATOM   1746 N  N     . LEU C 3 144 ? 92.824  74.792  77.204 1.00 22.68 ? 144  LEU A N     1 
ATOM   1747 C  CA    . LEU C 3 144 ? 91.817  73.898  76.635 1.00 22.49 ? 144  LEU A CA    1 
ATOM   1748 C  C     . LEU C 3 144 ? 92.465  73.071  75.529 1.00 21.27 ? 144  LEU A C     1 
ATOM   1749 O  O     . LEU C 3 144 ? 92.197  71.879  75.389 1.00 21.83 ? 144  LEU A O     1 
ATOM   1750 C  CB    . LEU C 3 144 ? 90.648  74.701  76.054 1.00 23.52 ? 144  LEU A CB    1 
ATOM   1751 C  CG    . LEU C 3 144 ? 89.533  73.861  75.424 1.00 25.83 ? 144  LEU A CG    1 
ATOM   1752 C  CD1   . LEU C 3 144 ? 88.957  72.914  76.471 1.00 27.63 ? 144  LEU A CD1   1 
ATOM   1753 C  CD2   . LEU C 3 144 ? 88.446  74.773  74.862 1.00 25.90 ? 144  LEU A CD2   1 
ATOM   1754 N  N     . PHE C 3 145 ? 93.311  73.727  74.742 1.00 20.23 ? 145  PHE A N     1 
ATOM   1755 C  CA    . PHE C 3 145 ? 94.034  73.081  73.648 1.00 20.76 ? 145  PHE A CA    1 
ATOM   1756 C  C     . PHE C 3 145 ? 94.765  71.867  74.225 1.00 21.60 ? 145  PHE A C     1 
ATOM   1757 O  O     . PHE C 3 145 ? 94.618  70.743  73.739 1.00 19.87 ? 145  PHE A O     1 
ATOM   1758 C  CB    . PHE C 3 145 ? 95.045  74.077  73.062 1.00 19.41 ? 145  PHE A CB    1 
ATOM   1759 C  CG    . PHE C 3 145 ? 95.818  73.563  71.870 1.00 18.47 ? 145  PHE A CG    1 
ATOM   1760 C  CD1   . PHE C 3 145 ? 97.201  73.720  71.813 1.00 19.74 ? 145  PHE A CD1   1 
ATOM   1761 C  CD2   . PHE C 3 145 ? 95.166  73.000  70.776 1.00 18.81 ? 145  PHE A CD2   1 
ATOM   1762 C  CE1   . PHE C 3 145 ? 97.928  73.331  70.683 1.00 18.86 ? 145  PHE A CE1   1 
ATOM   1763 C  CE2   . PHE C 3 145 ? 95.884  72.606  69.638 1.00 19.04 ? 145  PHE A CE2   1 
ATOM   1764 C  CZ    . PHE C 3 145 ? 97.266  72.774  69.594 1.00 19.45 ? 145  PHE A CZ    1 
ATOM   1765 N  N     . ARG C 3 146 ? 95.537  72.103  75.282 1.00 21.72 ? 146  ARG A N     1 
ATOM   1766 C  CA    . ARG C 3 146 ? 96.302  71.040  75.925 1.00 23.28 ? 146  ARG A CA    1 
ATOM   1767 C  C     . ARG C 3 146 ? 95.434  69.892  76.422 1.00 24.17 ? 146  ARG A C     1 
ATOM   1768 O  O     . ARG C 3 146 ? 95.778  68.718  76.243 1.00 22.42 ? 146  ARG A O     1 
ATOM   1769 C  CB    . ARG C 3 146 ? 97.119  71.603  77.092 1.00 24.61 ? 146  ARG A CB    1 
ATOM   1770 C  CG    . ARG C 3 146 ? 97.928  70.543  77.833 1.00 27.19 ? 146  ARG A CG    1 
ATOM   1771 C  CD    . ARG C 3 146 ? 98.940  71.168  78.775 1.00 33.38 ? 146  ARG A CD    1 
ATOM   1772 N  NE    . ARG C 3 146 ? 98.310  71.964  79.825 1.00 36.49 ? 146  ARG A NE    1 
ATOM   1773 C  CZ    . ARG C 3 146 ? 98.532  73.260  80.014 1.00 39.01 ? 146  ARG A CZ    1 
ATOM   1774 N  NH1   . ARG C 3 146 ? 99.371  73.916  79.218 1.00 40.41 ? 146  ARG A NH1   1 
ATOM   1775 N  NH2   . ARG C 3 146 ? 97.923  73.901  81.003 1.00 38.43 ? 146  ARG A NH2   1 
ATOM   1776 N  N     . GLU C 3 147 ? 94.311  70.222  77.049 1.00 23.83 ? 147  GLU A N     1 
ATOM   1777 C  CA    . GLU C 3 147 ? 93.421  69.189  77.564 1.00 26.39 ? 147  GLU A CA    1 
ATOM   1778 C  C     . GLU C 3 147 ? 92.831  68.315  76.468 1.00 25.78 ? 147  GLU A C     1 
ATOM   1779 O  O     . GLU C 3 147 ? 92.684  67.106  76.644 1.00 24.95 ? 147  GLU A O     1 
ATOM   1780 C  CB    . GLU C 3 147 ? 92.301  69.816  78.398 1.00 29.58 ? 147  GLU A CB    1 
ATOM   1781 C  CG    . GLU C 3 147 ? 92.787  70.309  79.748 1.00 36.92 ? 147  GLU A CG    1 
ATOM   1782 C  CD    . GLU C 3 147 ? 93.533  69.226  80.511 1.00 41.55 ? 147  GLU A CD    1 
ATOM   1783 O  OE1   . GLU C 3 147 ? 92.906  68.193  80.828 1.00 44.49 ? 147  GLU A OE1   1 
ATOM   1784 O  OE2   . GLU C 3 147 ? 94.743  69.401  80.784 1.00 43.16 ? 147  GLU A OE2   1 
ATOM   1785 N  N     . LYS C 3 148 ? 92.493  68.914  75.333 1.00 24.40 ? 148  LYS A N     1 
ATOM   1786 C  CA    . LYS C 3 148 ? 91.931  68.133  74.240 1.00 25.30 ? 148  LYS A CA    1 
ATOM   1787 C  C     . LYS C 3 148 ? 92.987  67.225  73.619 1.00 24.50 ? 148  LYS A C     1 
ATOM   1788 O  O     . LYS C 3 148 ? 92.692  66.097  73.222 1.00 24.85 ? 148  LYS A O     1 
ATOM   1789 C  CB    . LYS C 3 148 ? 91.321  69.056  73.183 1.00 27.02 ? 148  LYS A CB    1 
ATOM   1790 C  CG    . LYS C 3 148 ? 90.027  69.716  73.651 1.00 29.37 ? 148  LYS A CG    1 
ATOM   1791 C  CD    . LYS C 3 148 ? 89.333  70.455  72.524 1.00 32.54 ? 148  LYS A CD    1 
ATOM   1792 C  CE    . LYS C 3 148 ? 88.003  71.032  72.994 1.00 35.79 ? 148  LYS A CE    1 
ATOM   1793 N  NZ    . LYS C 3 148 ? 87.276  71.724  71.894 1.00 37.41 ? 148  LYS A NZ    1 
ATOM   1794 N  N     . LEU C 3 149 ? 94.221  67.711  73.543 1.00 22.40 ? 149  LEU A N     1 
ATOM   1795 C  CA    . LEU C 3 149 ? 95.300  66.907  72.983 1.00 23.36 ? 149  LEU A CA    1 
ATOM   1796 C  C     . LEU C 3 149 ? 95.614  65.730  73.907 1.00 25.05 ? 149  LEU A C     1 
ATOM   1797 O  O     . LEU C 3 149 ? 95.880  64.619  73.450 1.00 24.02 ? 149  LEU A O     1 
ATOM   1798 C  CB    . LEU C 3 149 ? 96.557  67.761  72.791 1.00 19.89 ? 149  LEU A CB    1 
ATOM   1799 C  CG    . LEU C 3 149 ? 96.451  68.879  71.750 1.00 19.80 ? 149  LEU A CG    1 
ATOM   1800 C  CD1   . LEU C 3 149 ? 97.720  69.722  71.774 1.00 19.19 ? 149  LEU A CD1   1 
ATOM   1801 C  CD2   . LEU C 3 149 ? 96.227  68.273  70.362 1.00 18.31 ? 149  LEU A CD2   1 
ATOM   1802 N  N     . ARG C 3 150 ? 95.574  65.978  75.211 1.00 27.46 ? 150  ARG A N     1 
ATOM   1803 C  CA    . ARG C 3 150 ? 95.871  64.937  76.188 1.00 31.54 ? 150  ARG A CA    1 
ATOM   1804 C  C     . ARG C 3 150 ? 94.847  63.806  76.208 1.00 32.64 ? 150  ARG A C     1 
ATOM   1805 O  O     . ARG C 3 150 ? 95.181  62.665  76.523 1.00 32.95 ? 150  ARG A O     1 
ATOM   1806 C  CB    . ARG C 3 150 ? 95.987  65.548  77.586 1.00 34.25 ? 150  ARG A CB    1 
ATOM   1807 C  CG    . ARG C 3 150 ? 97.247  66.377  77.794 1.00 39.73 ? 150  ARG A CG    1 
ATOM   1808 C  CD    . ARG C 3 150 ? 97.288  66.948  79.204 1.00 44.77 ? 150  ARG A CD    1 
ATOM   1809 N  NE    . ARG C 3 150 ? 98.571  67.569  79.523 1.00 47.73 ? 150  ARG A NE    1 
ATOM   1810 C  CZ    . ARG C 3 150 ? 98.811  68.239  80.646 1.00 50.63 ? 150  ARG A CZ    1 
ATOM   1811 N  NH1   . ARG C 3 150 ? 97.851  68.375  81.551 1.00 51.05 ? 150  ARG A NH1   1 
ATOM   1812 N  NH2   . ARG C 3 150 ? 100.010 68.768  80.869 1.00 51.29 ? 150  ARG A NH2   1 
ATOM   1813 N  N     . LYS C 3 151 ? 93.605  64.124  75.860 1.00 33.56 ? 151  LYS A N     1 
ATOM   1814 C  CA    . LYS C 3 151 ? 92.526  63.142  75.855 1.00 36.48 ? 151  LYS A CA    1 
ATOM   1815 C  C     . LYS C 3 151 ? 92.380  62.350  74.555 1.00 36.80 ? 151  LYS A C     1 
ATOM   1816 O  O     . LYS C 3 151 ? 91.550  61.443  74.475 1.00 36.97 ? 151  LYS A O     1 
ATOM   1817 C  CB    . LYS C 3 151 ? 91.186  63.831  76.133 1.00 38.30 ? 151  LYS A CB    1 
ATOM   1818 C  CG    . LYS C 3 151 ? 90.965  64.282  77.565 1.00 42.67 ? 151  LYS A CG    1 
ATOM   1819 C  CD    . LYS C 3 151 ? 89.529  64.762  77.735 1.00 46.17 ? 151  LYS A CD    1 
ATOM   1820 C  CE    . LYS C 3 151 ? 89.159  64.933  79.199 1.00 49.04 ? 151  LYS A CE    1 
ATOM   1821 N  NZ    . LYS C 3 151 ? 87.710  65.256  79.360 1.00 51.93 ? 151  LYS A NZ    1 
ATOM   1822 N  N     . SER C 3 152 ? 93.181  62.670  73.546 1.00 35.25 ? 152  SER A N     1 
ATOM   1823 C  CA    . SER C 3 152 ? 93.047  61.993  72.262 1.00 33.77 ? 152  SER A CA    1 
ATOM   1824 C  C     . SER C 3 152 ? 94.204  61.108  71.813 1.00 32.80 ? 152  SER A C     1 
ATOM   1825 O  O     . SER C 3 152 ? 95.352  61.308  72.205 1.00 32.81 ? 152  SER A O     1 
ATOM   1826 C  CB    . SER C 3 152 ? 92.759  63.040  71.179 1.00 33.09 ? 152  SER A CB    1 
ATOM   1827 O  OG    . SER C 3 152 ? 92.640  62.445  69.903 1.00 33.45 ? 152  SER A OG    1 
ATOM   1828 N  N     . THR C 3 153 ? 93.880  60.124  70.977 1.00 32.88 ? 153  THR A N     1 
ATOM   1829 C  CA    . THR C 3 153 ? 94.878  59.212  70.428 1.00 32.28 ? 153  THR A CA    1 
ATOM   1830 C  C     . THR C 3 153 ? 95.036  59.503  68.940 1.00 32.25 ? 153  THR A C     1 
ATOM   1831 O  O     . THR C 3 153 ? 95.795  58.826  68.243 1.00 31.59 ? 153  THR A O     1 
ATOM   1832 C  CB    . THR C 3 153 ? 94.471  57.725  70.606 1.00 34.73 ? 153  THR A CB    1 
ATOM   1833 O  OG1   . THR C 3 153 ? 93.156  57.515  70.075 1.00 35.34 ? 153  THR A OG1   1 
ATOM   1834 C  CG2   . THR C 3 153 ? 94.491  57.338  72.074 1.00 35.29 ? 153  THR A CG2   1 
ATOM   1835 N  N     . LYS C 3 154 ? 94.311  60.515  68.459 1.00 29.35 ? 154  LYS A N     1 
ATOM   1836 C  CA    . LYS C 3 154 ? 94.385  60.907  67.054 1.00 26.36 ? 154  LYS A CA    1 
ATOM   1837 C  C     . LYS C 3 154 ? 95.785  61.411  66.735 1.00 25.27 ? 154  LYS A C     1 
ATOM   1838 O  O     . LYS C 3 154 ? 96.515  61.855  67.628 1.00 24.97 ? 154  LYS A O     1 
ATOM   1839 C  CB    . LYS C 3 154 ? 93.387  62.032  66.744 1.00 26.04 ? 154  LYS A CB    1 
ATOM   1840 C  CG    . LYS C 3 154 ? 91.918  61.653  66.819 1.00 27.31 ? 154  LYS A CG    1 
ATOM   1841 C  CD    . LYS C 3 154 ? 91.045  62.863  66.517 1.00 27.27 ? 154  LYS A CD    1 
ATOM   1842 C  CE    . LYS C 3 154 ? 89.565  62.526  66.609 1.00 29.92 ? 154  LYS A CE    1 
ATOM   1843 N  NZ    . LYS C 3 154 ? 88.720  63.728  66.381 1.00 30.83 ? 154  LYS A NZ    1 
ATOM   1844 N  N     . LYS C 3 155 ? 96.153  61.341  65.460 1.00 23.30 ? 155  LYS A N     1 
ATOM   1845 C  CA    . LYS C 3 155 ? 97.446  61.824  65.008 1.00 22.78 ? 155  LYS A CA    1 
ATOM   1846 C  C     . LYS C 3 155 ? 97.298  63.338  64.928 1.00 22.23 ? 155  LYS A C     1 
ATOM   1847 O  O     . LYS C 3 155 ? 96.254  63.847  64.511 1.00 21.39 ? 155  LYS A O     1 
ATOM   1848 C  CB    . LYS C 3 155 ? 97.784  61.231  63.637 1.00 24.25 ? 155  LYS A CB    1 
ATOM   1849 C  CG    . LYS C 3 155 ? 97.901  59.712  63.661 1.00 27.44 ? 155  LYS A CG    1 
ATOM   1850 C  CD    . LYS C 3 155 ? 98.120  59.142  62.274 1.00 30.57 ? 155  LYS A CD    1 
ATOM   1851 C  CE    . LYS C 3 155 ? 98.231  57.628  62.332 1.00 33.30 ? 155  LYS A CE    1 
ATOM   1852 N  NZ    . LYS C 3 155 ? 98.355  57.037  60.973 1.00 35.89 ? 155  LYS A NZ    1 
ATOM   1853 N  N     . ILE C 3 156 ? 98.346  64.053  65.315 1.00 20.87 ? 156  ILE A N     1 
ATOM   1854 C  CA    . ILE C 3 156 ? 98.308  65.508  65.348 1.00 19.62 ? 156  ILE A CA    1 
ATOM   1855 C  C     . ILE C 3 156 ? 97.945  66.226  64.048 1.00 20.22 ? 156  ILE A C     1 
ATOM   1856 O  O     . ILE C 3 156 ? 97.150  67.165  64.079 1.00 20.59 ? 156  ILE A O     1 
ATOM   1857 C  CB    . ILE C 3 156 ? 99.643  66.076  65.920 1.00 18.27 ? 156  ILE A CB    1 
ATOM   1858 C  CG1   . ILE C 3 156 ? 99.532  67.592  66.117 1.00 18.09 ? 156  ILE A CG1   1 
ATOM   1859 C  CG2   . ILE C 3 156 ? 100.808 65.725  65.001 1.00 18.44 ? 156  ILE A CG2   1 
ATOM   1860 C  CD1   . ILE C 3 156 ? 98.483  68.011  67.146 1.00 17.20 ? 156  ILE A CD1   1 
ATOM   1861 N  N     . LYS C 3 157 ? 98.492  65.810  62.906 1.00 18.86 ? 157  LYS A N     1 
ATOM   1862 C  CA    . LYS C 3 157 ? 98.150  66.508  61.666 1.00 19.56 ? 157  LYS A CA    1 
ATOM   1863 C  C     . LYS C 3 157 ? 96.659  66.411  61.333 1.00 20.05 ? 157  LYS A C     1 
ATOM   1864 O  O     . LYS C 3 157 ? 96.005  67.428  61.101 1.00 18.28 ? 157  LYS A O     1 
ATOM   1865 C  CB    . LYS C 3 157 ? 98.988  66.007  60.478 1.00 19.87 ? 157  LYS A CB    1 
ATOM   1866 C  CG    . LYS C 3 157 ? 98.466  66.526  59.135 1.00 19.03 ? 157  LYS A CG    1 
ATOM   1867 C  CD    . LYS C 3 157 ? 99.507  66.513  58.025 1.00 18.79 ? 157  LYS A CD    1 
ATOM   1868 C  CE    . LYS C 3 157 ? 98.868  66.980  56.709 1.00 18.39 ? 157  LYS A CE    1 
ATOM   1869 N  NZ    . LYS C 3 157 ? 99.847  67.105  55.588 1.00 19.80 ? 157  LYS A NZ    1 
ATOM   1870 N  N     . PRO C 3 158 ? 96.100  65.191  61.311 1.00 21.13 ? 158  PRO A N     1 
ATOM   1871 C  CA    . PRO C 3 158 ? 94.674  65.044  60.999 1.00 20.81 ? 158  PRO A CA    1 
ATOM   1872 C  C     . PRO C 3 158 ? 93.788  65.781  62.006 1.00 21.20 ? 158  PRO A C     1 
ATOM   1873 O  O     . PRO C 3 158 ? 92.775  66.373  61.639 1.00 20.44 ? 158  PRO A O     1 
ATOM   1874 C  CB    . PRO C 3 158 ? 94.460  63.532  61.057 1.00 23.12 ? 158  PRO A CB    1 
ATOM   1875 C  CG    . PRO C 3 158 ? 95.797  62.986  60.669 1.00 24.17 ? 158  PRO A CG    1 
ATOM   1876 C  CD    . PRO C 3 158 ? 96.752  63.873  61.414 1.00 22.26 ? 158  PRO A CD    1 
ATOM   1877 N  N     . TYR C 3 159 ? 94.173  65.746  63.278 1.00 19.85 ? 159  TYR A N     1 
ATOM   1878 C  CA    . TYR C 3 159 ? 93.382  66.408  64.308 1.00 19.42 ? 159  TYR A CA    1 
ATOM   1879 C  C     . TYR C 3 159 ? 93.372  67.925  64.083 1.00 19.45 ? 159  TYR A C     1 
ATOM   1880 O  O     . TYR C 3 159 ? 92.324  68.561  64.178 1.00 18.41 ? 159  TYR A O     1 
ATOM   1881 C  CB    . TYR C 3 159 ? 93.930  66.072  65.703 1.00 19.72 ? 159  TYR A CB    1 
ATOM   1882 C  CG    . TYR C 3 159 ? 92.922  66.235  66.833 1.00 19.78 ? 159  TYR A CG    1 
ATOM   1883 C  CD1   . TYR C 3 159 ? 91.652  66.769  66.600 1.00 19.43 ? 159  TYR A CD1   1 
ATOM   1884 C  CD2   . TYR C 3 159 ? 93.248  65.862  68.139 1.00 20.85 ? 159  TYR A CD2   1 
ATOM   1885 C  CE1   . TYR C 3 159 ? 90.734  66.929  67.636 1.00 20.91 ? 159  TYR A CE1   1 
ATOM   1886 C  CE2   . TYR C 3 159 ? 92.335  66.017  69.184 1.00 22.23 ? 159  TYR A CE2   1 
ATOM   1887 C  CZ    . TYR C 3 159 ? 91.081  66.552  68.923 1.00 22.14 ? 159  TYR A CZ    1 
ATOM   1888 O  OH    . TYR C 3 159 ? 90.180  66.715  69.951 1.00 22.73 ? 159  TYR A OH    1 
ATOM   1889 N  N     . LEU C 3 160 ? 94.530  68.499  63.768 1.00 17.81 ? 160  LEU A N     1 
ATOM   1890 C  CA    . LEU C 3 160 ? 94.617  69.938  63.527 1.00 19.16 ? 160  LEU A CA    1 
ATOM   1891 C  C     . LEU C 3 160 ? 93.829  70.353  62.284 1.00 19.27 ? 160  LEU A C     1 
ATOM   1892 O  O     . LEU C 3 160 ? 93.308  71.468  62.213 1.00 19.44 ? 160  LEU A O     1 
ATOM   1893 C  CB    . LEU C 3 160 ? 96.082  70.369  63.371 1.00 19.85 ? 160  LEU A CB    1 
ATOM   1894 C  CG    . LEU C 3 160 ? 96.927  70.436  64.652 1.00 20.77 ? 160  LEU A CG    1 
ATOM   1895 C  CD1   . LEU C 3 160 ? 98.388  70.678  64.299 1.00 18.29 ? 160  LEU A CD1   1 
ATOM   1896 C  CD2   . LEU C 3 160 ? 96.413  71.548  65.547 1.00 19.46 ? 160  LEU A CD2   1 
ATOM   1897 N  N     . LEU C 3 161 ? 93.748  69.457  61.305 1.00 16.58 ? 161  LEU A N     1 
ATOM   1898 C  CA    . LEU C 3 161 ? 93.022  69.742  60.073 1.00 17.19 ? 161  LEU A CA    1 
ATOM   1899 C  C     . LEU C 3 161 ? 91.509  69.755  60.282 1.00 17.46 ? 161  LEU A C     1 
ATOM   1900 O  O     . LEU C 3 161 ? 90.775  70.290  59.456 1.00 19.69 ? 161  LEU A O     1 
ATOM   1901 C  CB    . LEU C 3 161 ? 93.379  68.710  58.996 1.00 16.38 ? 161  LEU A CB    1 
ATOM   1902 C  CG    . LEU C 3 161 ? 94.762  68.849  58.347 1.00 19.00 ? 161  LEU A CG    1 
ATOM   1903 C  CD1   . LEU C 3 161 ? 94.999  67.691  57.377 1.00 18.43 ? 161  LEU A CD1   1 
ATOM   1904 C  CD2   . LEU C 3 161 ? 94.849  70.181  57.603 1.00 18.15 ? 161  LEU A CD2   1 
ATOM   1905 N  N     . GLU C 3 162 ? 91.051  69.171  61.385 1.00 19.00 ? 162  GLU A N     1 
ATOM   1906 C  CA    . GLU C 3 162 ? 89.621  69.108  61.699 1.00 21.63 ? 162  GLU A CA    1 
ATOM   1907 C  C     . GLU C 3 162 ? 88.929  70.460  61.910 1.00 21.88 ? 162  GLU A C     1 
ATOM   1908 O  O     . GLU C 3 162 ? 87.703  70.547  61.795 1.00 21.37 ? 162  GLU A O     1 
ATOM   1909 C  CB    . GLU C 3 162 ? 89.395  68.259  62.947 1.00 24.31 ? 162  GLU A CB    1 
ATOM   1910 C  CG    . GLU C 3 162 ? 89.423  66.763  62.728 1.00 27.71 ? 162  GLU A CG    1 
ATOM   1911 C  CD    . GLU C 3 162 ? 89.120  66.004  64.005 1.00 29.77 ? 162  GLU A CD    1 
ATOM   1912 O  OE1   . GLU C 3 162 ? 88.389  66.551  64.865 1.00 33.43 ? 162  GLU A OE1   1 
ATOM   1913 O  OE2   . GLU C 3 162 ? 89.599  64.862  64.149 1.00 33.13 ? 162  GLU A OE2   1 
ATOM   1914 N  N     . GLN C 3 163 ? 89.709  71.492  62.229 1.00 19.50 ? 163  GLN A N     1 
ATOM   1915 C  CA    . GLN C 3 163 ? 89.193  72.847  62.481 1.00 20.73 ? 163  GLN A CA    1 
ATOM   1916 C  C     . GLN C 3 163 ? 88.539  72.957  63.861 1.00 20.11 ? 163  GLN A C     1 
ATOM   1917 O  O     . GLN C 3 163 ? 88.002  74.009  64.212 1.00 21.85 ? 163  GLN A O     1 
ATOM   1918 C  CB    . GLN C 3 163 ? 88.150  73.260  61.426 1.00 19.78 ? 163  GLN A CB    1 
ATOM   1919 C  CG    . GLN C 3 163 ? 88.628  73.202  59.990 1.00 21.30 ? 163  GLN A CG    1 
ATOM   1920 C  CD    . GLN C 3 163 ? 89.831  74.078  59.746 1.00 20.86 ? 163  GLN A CD    1 
ATOM   1921 O  OE1   . GLN C 3 163 ? 89.740  75.309  59.772 1.00 19.43 ? 163  GLN A OE1   1 
ATOM   1922 N  NE2   . GLN C 3 163 ? 90.977  73.446  59.511 1.00 19.27 ? 163  GLN A NE2   1 
ATOM   1923 N  N     . THR C 3 164 ? 88.590  71.880  64.638 1.00 19.78 ? 164  THR A N     1 
ATOM   1924 C  CA    . THR C 3 164 ? 87.975  71.855  65.963 1.00 20.13 ? 164  THR A CA    1 
ATOM   1925 C  C     . THR C 3 164 ? 88.870  72.342  67.107 1.00 19.85 ? 164  THR A C     1 
ATOM   1926 O  O     . THR C 3 164 ? 88.379  72.939  68.067 1.00 20.52 ? 164  THR A O     1 
ATOM   1927 C  CB    . THR C 3 164 ? 87.471  70.436  66.295 1.00 22.71 ? 164  THR A CB    1 
ATOM   1928 O  OG1   . THR C 3 164 ? 88.567  69.516  66.217 1.00 22.08 ? 164  THR A OG1   1 
ATOM   1929 C  CG2   . THR C 3 164 ? 86.376  70.009  65.307 1.00 20.99 ? 164  THR A CG2   1 
ATOM   1930 N  N     . LEU C 3 165 ? 90.172  72.084  67.015 1.00 18.59 ? 165  LEU A N     1 
ATOM   1931 C  CA    . LEU C 3 165 ? 91.117  72.518  68.052 1.00 18.85 ? 165  LEU A CA    1 
ATOM   1932 C  C     . LEU C 3 165 ? 91.414  74.005  67.887 1.00 18.94 ? 165  LEU A C     1 
ATOM   1933 O  O     . LEU C 3 165 ? 91.652  74.723  68.859 1.00 18.27 ? 165  LEU A O     1 
ATOM   1934 C  CB    . LEU C 3 165 ? 92.432  71.742  67.939 1.00 18.86 ? 165  LEU A CB    1 
ATOM   1935 C  CG    . LEU C 3 165 ? 92.400  70.231  68.193 1.00 19.96 ? 165  LEU A CG    1 
ATOM   1936 C  CD1   . LEU C 3 165 ? 93.735  69.628  67.767 1.00 18.91 ? 165  LEU A CD1   1 
ATOM   1937 C  CD2   . LEU C 3 165 ? 92.118  69.957  69.671 1.00 21.66 ? 165  LEU A CD2   1 
ATOM   1938 N  N     . VAL C 3 166 ? 91.408  74.443  66.634 1.00 18.53 ? 166  VAL A N     1 
ATOM   1939 C  CA    . VAL C 3 166 ? 91.671  75.827  66.268 1.00 19.43 ? 166  VAL A CA    1 
ATOM   1940 C  C     . VAL C 3 166 ? 91.242  75.912  64.812 1.00 19.09 ? 166  VAL A C     1 
ATOM   1941 O  O     . VAL C 3 166 ? 91.339  74.931  64.078 1.00 17.80 ? 166  VAL A O     1 
ATOM   1942 C  CB    . VAL C 3 166 ? 93.180  76.164  66.398 1.00 20.10 ? 166  VAL A CB    1 
ATOM   1943 C  CG1   . VAL C 3 166 ? 93.992  75.261  65.490 1.00 20.49 ? 166  VAL A CG1   1 
ATOM   1944 C  CG2   . VAL C 3 166 ? 93.431  77.630  66.059 1.00 20.22 ? 166  VAL A CG2   1 
ATOM   1945 N  N     . ALA C 3 167 ? 90.767  77.076  64.393 1.00 18.09 ? 167  ALA A N     1 
ATOM   1946 C  CA    . ALA C 3 167 ? 90.297  77.240  63.024 1.00 19.44 ? 167  ALA A CA    1 
ATOM   1947 C  C     . ALA C 3 167 ? 91.315  77.871  62.089 1.00 18.84 ? 167  ALA A C     1 
ATOM   1948 O  O     . ALA C 3 167 ? 92.112  78.710  62.506 1.00 20.19 ? 167  ALA A O     1 
ATOM   1949 C  CB    . ALA C 3 167 ? 89.017  78.083  63.019 1.00 18.60 ? 167  ALA A CB    1 
ATOM   1950 N  N     . GLY C 3 168 ? 91.292  77.451  60.827 1.00 18.58 ? 168  GLY A N     1 
ATOM   1951 C  CA    . GLY C 3 168 ? 92.171  78.055  59.843 1.00 18.74 ? 168  GLY A CA    1 
ATOM   1952 C  C     . GLY C 3 168 ? 93.288  77.270  59.188 1.00 18.90 ? 168  GLY A C     1 
ATOM   1953 O  O     . GLY C 3 168 ? 93.727  77.648  58.102 1.00 17.94 ? 168  GLY A O     1 
ATOM   1954 N  N     . LEU C 3 169 ? 93.763  76.201  59.822 1.00 18.18 ? 169  LEU A N     1 
ATOM   1955 C  CA    . LEU C 3 169 ? 94.854  75.426  59.239 1.00 19.20 ? 169  LEU A CA    1 
ATOM   1956 C  C     . LEU C 3 169 ? 94.410  74.513  58.108 1.00 19.96 ? 169  LEU A C     1 
ATOM   1957 O  O     . LEU C 3 169 ? 93.391  73.825  58.207 1.00 19.21 ? 169  LEU A O     1 
ATOM   1958 C  CB    . LEU C 3 169 ? 95.553  74.584  60.313 1.00 19.24 ? 169  LEU A CB    1 
ATOM   1959 C  CG    . LEU C 3 169 ? 96.230  75.344  61.454 1.00 18.20 ? 169  LEU A CG    1 
ATOM   1960 C  CD1   . LEU C 3 169 ? 96.581  74.372  62.571 1.00 18.02 ? 169  LEU A CD1   1 
ATOM   1961 C  CD2   . LEU C 3 169 ? 97.481  76.051  60.931 1.00 18.85 ? 169  LEU A CD2   1 
ATOM   1962 N  N     . GLY C 3 170 ? 95.193  74.530  57.034 1.00 18.43 ? 170  GLY A N     1 
ATOM   1963 C  CA    . GLY C 3 170 ? 94.940  73.691  55.877 1.00 18.87 ? 170  GLY A CA    1 
ATOM   1964 C  C     . GLY C 3 170 ? 96.201  72.872  55.657 1.00 20.24 ? 170  GLY A C     1 
ATOM   1965 O  O     . GLY C 3 170 ? 97.083  72.865  56.516 1.00 18.82 ? 170  GLY A O     1 
ATOM   1966 N  N     . ASN C 3 171 ? 96.316  72.201  54.515 1.00 19.28 ? 171  ASN A N     1 
ATOM   1967 C  CA    . ASN C 3 171 ? 97.483  71.364  54.282 1.00 20.50 ? 171  ASN A CA    1 
ATOM   1968 C  C     . ASN C 3 171 ? 98.817  72.091  54.291 1.00 18.92 ? 171  ASN A C     1 
ATOM   1969 O  O     . ASN C 3 171 ? 99.802  71.568  54.815 1.00 19.31 ? 171  ASN A O     1 
ATOM   1970 C  CB    . ASN C 3 171 ? 97.333  70.571  52.979 1.00 19.93 ? 171  ASN A CB    1 
ATOM   1971 C  CG    . ASN C 3 171 ? 98.075  69.247  53.028 1.00 21.44 ? 171  ASN A CG    1 
ATOM   1972 O  OD1   . ASN C 3 171 ? 98.028  68.546  54.038 1.00 20.24 ? 171  ASN A OD1   1 
ATOM   1973 N  ND2   . ASN C 3 171 ? 98.753  68.893  51.939 1.00 21.55 ? 171  ASN A ND2   1 
ATOM   1974 N  N     . ILE C 3 172 ? 98.865  73.290  53.719 1.00 19.78 ? 172  ILE A N     1 
ATOM   1975 C  CA    . ILE C 3 172 ? 100.119 74.033  53.689 1.00 20.98 ? 172  ILE A CA    1 
ATOM   1976 C  C     . ILE C 3 172 ? 100.577 74.484  55.077 1.00 22.24 ? 172  ILE A C     1 
ATOM   1977 O  O     . ILE C 3 172 ? 101.694 74.183  55.499 1.00 21.99 ? 172  ILE A O     1 
ATOM   1978 C  CB    . ILE C 3 172 ? 100.023 75.286  52.784 1.00 21.94 ? 172  ILE A CB    1 
ATOM   1979 C  CG1   . ILE C 3 172 ? 99.753  74.870  51.334 1.00 20.74 ? 172  ILE A CG1   1 
ATOM   1980 C  CG2   . ILE C 3 172 ? 101.318 76.091  52.874 1.00 21.38 ? 172  ILE A CG2   1 
ATOM   1981 C  CD1   . ILE C 3 172 ? 99.654  76.042  50.365 1.00 22.72 ? 172  ILE A CD1   1 
ATOM   1982 N  N     . TYR C 3 173 ? 99.719  75.193  55.803 1.00 20.72 ? 173  TYR A N     1 
ATOM   1983 C  CA    . TYR C 3 173 ? 100.140 75.683  57.102 1.00 20.26 ? 173  TYR A CA    1 
ATOM   1984 C  C     . TYR C 3 173 ? 100.235 74.636  58.204 1.00 20.02 ? 173  TYR A C     1 
ATOM   1985 O  O     . TYR C 3 173 ? 100.976 74.830  59.168 1.00 20.97 ? 173  TYR A O     1 
ATOM   1986 C  CB    . TYR C 3 173 ? 99.275  76.878  57.515 1.00 19.31 ? 173  TYR A CB    1 
ATOM   1987 C  CG    . TYR C 3 173 ? 99.402  78.008  56.513 1.00 20.26 ? 173  TYR A CG    1 
ATOM   1988 C  CD1   . TYR C 3 173 ? 98.312  78.410  55.736 1.00 17.66 ? 173  TYR A CD1   1 
ATOM   1989 C  CD2   . TYR C 3 173 ? 100.638 78.614  56.276 1.00 19.77 ? 173  TYR A CD2   1 
ATOM   1990 C  CE1   . TYR C 3 173 ? 98.454  79.380  54.742 1.00 19.35 ? 173  TYR A CE1   1 
ATOM   1991 C  CE2   . TYR C 3 173 ? 100.793 79.585  55.285 1.00 20.73 ? 173  TYR A CE2   1 
ATOM   1992 C  CZ    . TYR C 3 173 ? 99.698  79.962  54.520 1.00 20.46 ? 173  TYR A CZ    1 
ATOM   1993 O  OH    . TYR C 3 173 ? 99.845  80.902  53.524 1.00 20.64 ? 173  TYR A OH    1 
ATOM   1994 N  N     . VAL C 3 174 ? 99.520  73.520  58.076 1.00 19.82 ? 174  VAL A N     1 
ATOM   1995 C  CA    . VAL C 3 174 ? 99.645  72.493  59.102 1.00 19.40 ? 174  VAL A CA    1 
ATOM   1996 C  C     . VAL C 3 174 ? 101.060 71.902  58.968 1.00 19.51 ? 174  VAL A C     1 
ATOM   1997 O  O     . VAL C 3 174 ? 101.730 71.638  59.963 1.00 16.94 ? 174  VAL A O     1 
ATOM   1998 C  CB    . VAL C 3 174 ? 98.579  71.366  58.961 1.00 21.08 ? 174  VAL A CB    1 
ATOM   1999 C  CG1   . VAL C 3 174 ? 98.866  70.481  57.755 1.00 19.50 ? 174  VAL A CG1   1 
ATOM   2000 C  CG2   . VAL C 3 174 ? 98.556  70.531  60.236 1.00 23.83 ? 174  VAL A CG2   1 
ATOM   2001 N  N     . ASP C 3 175 ? 101.515 71.722  57.731 1.00 19.24 ? 175  ASP A N     1 
ATOM   2002 C  CA    . ASP C 3 175 ? 102.861 71.188  57.491 1.00 18.99 ? 175  ASP A CA    1 
ATOM   2003 C  C     . ASP C 3 175 ? 103.914 72.179  57.992 1.00 19.09 ? 175  ASP A C     1 
ATOM   2004 O  O     . ASP C 3 175 ? 104.878 71.793  58.653 1.00 19.60 ? 175  ASP A O     1 
ATOM   2005 C  CB    . ASP C 3 175 ? 103.071 70.910  55.996 1.00 20.74 ? 175  ASP A CB    1 
ATOM   2006 C  CG    . ASP C 3 175 ? 102.561 69.537  55.573 1.00 20.04 ? 175  ASP A CG    1 
ATOM   2007 O  OD1   . ASP C 3 175 ? 101.951 68.832  56.409 1.00 21.75 ? 175  ASP A OD1   1 
ATOM   2008 O  OD2   . ASP C 3 175 ? 102.771 69.158  54.399 1.00 21.95 ? 175  ASP A OD2   1 
ATOM   2009 N  N     . GLU C 3 176 ? 103.726 73.459  57.687 1.00 19.25 ? 176  GLU A N     1 
ATOM   2010 C  CA    . GLU C 3 176 ? 104.669 74.482  58.122 1.00 20.05 ? 176  GLU A CA    1 
ATOM   2011 C  C     . GLU C 3 176 ? 104.710 74.606  59.650 1.00 22.16 ? 176  GLU A C     1 
ATOM   2012 O  O     . GLU C 3 176 ? 105.782 74.766  60.241 1.00 21.55 ? 176  GLU A O     1 
ATOM   2013 C  CB    . GLU C 3 176 ? 104.304 75.838  57.506 1.00 21.02 ? 176  GLU A CB    1 
ATOM   2014 C  CG    . GLU C 3 176 ? 104.492 75.922  55.997 1.00 21.33 ? 176  GLU A CG    1 
ATOM   2015 C  CD    . GLU C 3 176 ? 105.950 75.774  55.574 1.00 24.28 ? 176  GLU A CD    1 
ATOM   2016 O  OE1   . GLU C 3 176 ? 106.814 76.428  56.191 1.00 23.85 ? 176  GLU A OE1   1 
ATOM   2017 O  OE2   . GLU C 3 176 ? 106.230 75.017  54.621 1.00 23.68 ? 176  GLU A OE2   1 
ATOM   2018 N  N     . VAL C 3 177 ? 103.542 74.524  60.283 1.00 19.91 ? 177  VAL A N     1 
ATOM   2019 C  CA    . VAL C 3 177 ? 103.443 74.638  61.735 1.00 20.30 ? 177  VAL A CA    1 
ATOM   2020 C  C     . VAL C 3 177 ? 104.109 73.469  62.457 1.00 18.72 ? 177  VAL A C     1 
ATOM   2021 O  O     . VAL C 3 177 ? 104.823 73.659  63.449 1.00 18.89 ? 177  VAL A O     1 
ATOM   2022 C  CB    . VAL C 3 177 ? 101.953 74.738  62.181 1.00 21.92 ? 177  VAL A CB    1 
ATOM   2023 C  CG1   . VAL C 3 177 ? 101.816 74.432  63.666 1.00 24.37 ? 177  VAL A CG1   1 
ATOM   2024 C  CG2   . VAL C 3 177 ? 101.423 76.144  61.899 1.00 23.68 ? 177  VAL A CG2   1 
ATOM   2025 N  N     . LEU C 3 178 ? 103.877 72.257  61.972 1.00 17.41 ? 178  LEU A N     1 
ATOM   2026 C  CA    . LEU C 3 178 ? 104.474 71.099  62.617 1.00 20.28 ? 178  LEU A CA    1 
ATOM   2027 C  C     . LEU C 3 178 ? 105.997 71.099  62.456 1.00 20.47 ? 178  LEU A C     1 
ATOM   2028 O  O     . LEU C 3 178 ? 106.713 70.655  63.351 1.00 21.75 ? 178  LEU A O     1 
ATOM   2029 C  CB    . LEU C 3 178 ? 103.843 69.811  62.081 1.00 18.57 ? 178  LEU A CB    1 
ATOM   2030 C  CG    . LEU C 3 178 ? 102.370 69.661  62.510 1.00 19.94 ? 178  LEU A CG    1 
ATOM   2031 C  CD1   . LEU C 3 178 ? 101.753 68.417  61.898 1.00 19.23 ? 178  LEU A CD1   1 
ATOM   2032 C  CD2   . LEU C 3 178 ? 102.294 69.569  64.031 1.00 19.72 ? 178  LEU A CD2   1 
ATOM   2033 N  N     . TRP C 3 179 ? 106.493 71.611  61.332 1.00 20.97 ? 179  TRP A N     1 
ATOM   2034 C  CA    . TRP C 3 179 ? 107.939 71.682  61.126 1.00 21.90 ? 179  TRP A CA    1 
ATOM   2035 C  C     . TRP C 3 179 ? 108.512 72.718  62.089 1.00 23.34 ? 179  TRP A C     1 
ATOM   2036 O  O     . TRP C 3 179 ? 109.549 72.494  62.721 1.00 23.36 ? 179  TRP A O     1 
ATOM   2037 C  CB    . TRP C 3 179 ? 108.275 72.096  59.688 1.00 22.29 ? 179  TRP A CB    1 
ATOM   2038 C  CG    . TRP C 3 179 ? 109.759 72.329  59.454 1.00 22.88 ? 179  TRP A CG    1 
ATOM   2039 C  CD1   . TRP C 3 179 ? 110.696 71.396  59.102 1.00 23.97 ? 179  TRP A CD1   1 
ATOM   2040 C  CD2   . TRP C 3 179 ? 110.463 73.575  59.575 1.00 23.43 ? 179  TRP A CD2   1 
ATOM   2041 N  NE1   . TRP C 3 179 ? 111.936 71.984  58.991 1.00 23.41 ? 179  TRP A NE1   1 
ATOM   2042 C  CE2   . TRP C 3 179 ? 111.822 73.320  59.276 1.00 24.08 ? 179  TRP A CE2   1 
ATOM   2043 C  CE3   . TRP C 3 179 ? 110.078 74.882  59.906 1.00 23.48 ? 179  TRP A CE3   1 
ATOM   2044 C  CZ2   . TRP C 3 179 ? 112.798 74.324  59.297 1.00 22.88 ? 179  TRP A CZ2   1 
ATOM   2045 C  CZ3   . TRP C 3 179 ? 111.049 75.883  59.929 1.00 24.92 ? 179  TRP A CZ3   1 
ATOM   2046 C  CH2   . TRP C 3 179 ? 112.397 75.594  59.624 1.00 24.53 ? 179  TRP A CH2   1 
ATOM   2047 N  N     . LEU C 3 180 ? 107.840 73.859  62.199 1.00 22.86 ? 180  LEU A N     1 
ATOM   2048 C  CA    . LEU C 3 180 ? 108.310 74.909  63.091 1.00 23.42 ? 180  LEU A CA    1 
ATOM   2049 C  C     . LEU C 3 180 ? 108.338 74.430  64.539 1.00 23.52 ? 180  LEU A C     1 
ATOM   2050 O  O     . LEU C 3 180 ? 109.271 74.738  65.284 1.00 24.31 ? 180  LEU A O     1 
ATOM   2051 C  CB    . LEU C 3 180 ? 107.425 76.156  62.979 1.00 24.83 ? 180  LEU A CB    1 
ATOM   2052 C  CG    . LEU C 3 180 ? 107.841 77.334  63.869 1.00 25.49 ? 180  LEU A CG    1 
ATOM   2053 C  CD1   . LEU C 3 180 ? 109.290 77.719  63.567 1.00 26.28 ? 180  LEU A CD1   1 
ATOM   2054 C  CD2   . LEU C 3 180 ? 106.919 78.522  63.624 1.00 24.35 ? 180  LEU A CD2   1 
ATOM   2055 N  N     . ALA C 3 181 ? 107.323 73.664  64.932 1.00 21.89 ? 181  ALA A N     1 
ATOM   2056 C  CA    . ALA C 3 181 ? 107.232 73.157  66.299 1.00 20.95 ? 181  ALA A CA    1 
ATOM   2057 C  C     . ALA C 3 181 ? 107.984 71.839  66.511 1.00 21.68 ? 181  ALA A C     1 
ATOM   2058 O  O     . ALA C 3 181 ? 107.942 71.264  67.602 1.00 20.40 ? 181  ALA A O     1 
ATOM   2059 C  CB    . ALA C 3 181 ? 105.765 72.987  66.690 1.00 20.96 ? 181  ALA A CB    1 
ATOM   2060 N  N     . LYS C 3 182 ? 108.657 71.362  65.466 1.00 22.48 ? 182  LYS A N     1 
ATOM   2061 C  CA    . LYS C 3 182 ? 109.430 70.122  65.528 1.00 23.48 ? 182  LYS A CA    1 
ATOM   2062 C  C     . LYS C 3 182 ? 108.616 68.913  66.000 1.00 23.65 ? 182  LYS A C     1 
ATOM   2063 O  O     . LYS C 3 182 ? 109.048 68.152  66.865 1.00 24.44 ? 182  LYS A O     1 
ATOM   2064 C  CB    . LYS C 3 182 ? 110.653 70.330  66.429 1.00 26.78 ? 182  LYS A CB    1 
ATOM   2065 C  CG    . LYS C 3 182 ? 111.557 71.466  65.956 1.00 29.24 ? 182  LYS A CG    1 
ATOM   2066 C  CD    . LYS C 3 182 ? 112.673 71.772  66.950 1.00 34.68 ? 182  LYS A CD    1 
ATOM   2067 C  CE    . LYS C 3 182 ? 113.478 72.985  66.500 1.00 38.73 ? 182  LYS A CE    1 
ATOM   2068 N  NZ    . LYS C 3 182 ? 114.552 73.366  67.467 1.00 43.14 ? 182  LYS A NZ    1 
ATOM   2069 N  N     . ILE C 3 183 ? 107.441 68.736  65.409 1.00 21.35 ? 183  ILE A N     1 
ATOM   2070 C  CA    . ILE C 3 183 ? 106.550 67.634  65.750 1.00 20.90 ? 183  ILE A CA    1 
ATOM   2071 C  C     . ILE C 3 183 ? 106.239 66.819  64.498 1.00 20.48 ? 183  ILE A C     1 
ATOM   2072 O  O     . ILE C 3 183 ? 105.890 67.384  63.464 1.00 20.04 ? 183  ILE A O     1 
ATOM   2073 C  CB    . ILE C 3 183 ? 105.221 68.172  66.340 1.00 19.63 ? 183  ILE A CB    1 
ATOM   2074 C  CG1   . ILE C 3 183 ? 105.502 68.891  67.665 1.00 21.16 ? 183  ILE A CG1   1 
ATOM   2075 C  CG2   . ILE C 3 183 ? 104.228 67.034  66.520 1.00 18.91 ? 183  ILE A CG2   1 
ATOM   2076 C  CD1   . ILE C 3 183 ? 104.307 69.668  68.225 1.00 19.93 ? 183  ILE A CD1   1 
ATOM   2077 N  N     . HIS C 3 184 ? 106.369 65.498  64.590 1.00 20.94 ? 184  HIS A N     1 
ATOM   2078 C  CA    . HIS C 3 184 ? 106.087 64.630  63.447 1.00 22.89 ? 184  HIS A CA    1 
ATOM   2079 C  C     . HIS C 3 184 ? 104.573 64.574  63.246 1.00 21.19 ? 184  HIS A C     1 
ATOM   2080 O  O     . HIS C 3 184 ? 103.818 64.423  64.206 1.00 21.01 ? 184  HIS A O     1 
ATOM   2081 C  CB    . HIS C 3 184 ? 106.649 63.225  63.693 1.00 23.96 ? 184  HIS A CB    1 
ATOM   2082 C  CG    . HIS C 3 184 ? 106.582 62.330  62.494 1.00 25.56 ? 184  HIS A CG    1 
ATOM   2083 N  ND1   . HIS C 3 184 ? 105.436 61.658  62.125 1.00 25.96 ? 184  HIS A ND1   1 
ATOM   2084 C  CD2   . HIS C 3 184 ? 107.515 62.023  61.561 1.00 25.80 ? 184  HIS A CD2   1 
ATOM   2085 C  CE1   . HIS C 3 184 ? 105.665 60.976  61.017 1.00 26.89 ? 184  HIS A CE1   1 
ATOM   2086 N  NE2   . HIS C 3 184 ? 106.919 61.181  60.654 1.00 26.68 ? 184  HIS A NE2   1 
ATOM   2087 N  N     . PRO C 3 185 ? 104.110 64.692  61.991 1.00 21.14 ? 185  PRO A N     1 
ATOM   2088 C  CA    . PRO C 3 185 ? 102.673 64.663  61.686 1.00 21.25 ? 185  PRO A CA    1 
ATOM   2089 C  C     . PRO C 3 185 ? 101.872 63.447  62.153 1.00 23.16 ? 185  PRO A C     1 
ATOM   2090 O  O     . PRO C 3 185 ? 100.654 63.539  62.331 1.00 22.50 ? 185  PRO A O     1 
ATOM   2091 C  CB    . PRO C 3 185 ? 102.639 64.838  60.164 1.00 21.91 ? 185  PRO A CB    1 
ATOM   2092 C  CG    . PRO C 3 185 ? 103.946 64.238  59.721 1.00 22.70 ? 185  PRO A CG    1 
ATOM   2093 C  CD    . PRO C 3 185 ? 104.904 64.793  60.754 1.00 20.83 ? 185  PRO A CD    1 
ATOM   2094 N  N     . GLU C 3 186 ? 102.536 62.313  62.353 1.00 22.62 ? 186  GLU A N     1 
ATOM   2095 C  CA    . GLU C 3 186 ? 101.827 61.114  62.790 1.00 24.53 ? 186  GLU A CA    1 
ATOM   2096 C  C     . GLU C 3 186 ? 101.865 60.897  64.299 1.00 24.71 ? 186  GLU A C     1 
ATOM   2097 O  O     . GLU C 3 186 ? 101.398 59.878  64.801 1.00 24.39 ? 186  GLU A O     1 
ATOM   2098 C  CB    . GLU C 3 186 ? 102.386 59.883  62.073 1.00 26.69 ? 186  GLU A CB    1 
ATOM   2099 C  CG    . GLU C 3 186 ? 102.193 59.929  60.568 1.00 27.79 ? 186  GLU A CG    1 
ATOM   2100 C  CD    . GLU C 3 186 ? 102.787 58.722  59.869 1.00 31.63 ? 186  GLU A CD    1 
ATOM   2101 O  OE1   . GLU C 3 186 ? 103.990 58.453  60.066 1.00 33.80 ? 186  GLU A OE1   1 
ATOM   2102 O  OE2   . GLU C 3 186 ? 102.053 58.047  59.122 1.00 32.11 ? 186  GLU A OE2   1 
ATOM   2103 N  N     . LYS C 3 187 ? 102.410 61.864  65.022 1.00 24.48 ? 187  LYS A N     1 
ATOM   2104 C  CA    . LYS C 3 187 ? 102.494 61.762  66.475 1.00 25.97 ? 187  LYS A CA    1 
ATOM   2105 C  C     . LYS C 3 187 ? 101.107 61.773  67.123 1.00 25.87 ? 187  LYS A C     1 
ATOM   2106 O  O     . LYS C 3 187 ? 100.300 62.662  66.853 1.00 25.46 ? 187  LYS A O     1 
ATOM   2107 C  CB    . LYS C 3 187 ? 103.328 62.926  67.018 1.00 27.61 ? 187  LYS A CB    1 
ATOM   2108 C  CG    . LYS C 3 187 ? 103.470 62.967  68.532 1.00 33.17 ? 187  LYS A CG    1 
ATOM   2109 C  CD    . LYS C 3 187 ? 104.190 61.741  69.077 1.00 37.33 ? 187  LYS A CD    1 
ATOM   2110 C  CE    . LYS C 3 187 ? 105.528 61.533  68.383 1.00 40.77 ? 187  LYS A CE    1 
ATOM   2111 N  NZ    . LYS C 3 187 ? 106.329 62.787  68.359 1.00 44.75 ? 187  LYS A NZ    1 
ATOM   2112 N  N     . GLU C 3 188 ? 100.821 60.781  67.964 1.00 25.05 ? 188  GLU A N     1 
ATOM   2113 C  CA    . GLU C 3 188 ? 99.535  60.740  68.657 1.00 27.78 ? 188  GLU A CA    1 
ATOM   2114 C  C     . GLU C 3 188 ? 99.563  61.924  69.619 1.00 26.50 ? 188  GLU A C     1 
ATOM   2115 O  O     . GLU C 3 188 ? 100.555 62.130  70.321 1.00 27.57 ? 188  GLU A O     1 
ATOM   2116 C  CB    . GLU C 3 188 ? 99.365  59.422  69.419 1.00 30.35 ? 188  GLU A CB    1 
ATOM   2117 C  CG    . GLU C 3 188 ? 99.200  58.214  68.503 1.00 35.36 ? 188  GLU A CG    1 
ATOM   2118 C  CD    . GLU C 3 188 ? 98.801  56.951  69.248 1.00 38.95 ? 188  GLU A CD    1 
ATOM   2119 O  OE1   . GLU C 3 188 ? 98.546  55.928  68.579 1.00 42.27 ? 188  GLU A OE1   1 
ATOM   2120 O  OE2   . GLU C 3 188 ? 98.736  56.976  70.497 1.00 41.76 ? 188  GLU A OE2   1 
ATOM   2121 N  N     . THR C 3 189 ? 98.486  62.702  69.655 1.00 24.86 ? 189  THR A N     1 
ATOM   2122 C  CA    . THR C 3 189 ? 98.461  63.893  70.495 1.00 23.28 ? 189  THR A CA    1 
ATOM   2123 C  C     . THR C 3 189 ? 98.646  63.669  71.992 1.00 23.91 ? 189  THR A C     1 
ATOM   2124 O  O     . THR C 3 189 ? 99.192  64.535  72.675 1.00 22.07 ? 189  THR A O     1 
ATOM   2125 C  CB    . THR C 3 189 ? 97.171  64.733  70.266 1.00 22.58 ? 189  THR A CB    1 
ATOM   2126 O  OG1   . THR C 3 189 ? 96.038  64.052  70.814 1.00 22.98 ? 189  THR A OG1   1 
ATOM   2127 C  CG2   . THR C 3 189 ? 96.947  64.966  68.775 1.00 21.73 ? 189  THR A CG2   1 
ATOM   2128 N  N     . ASN C 3 190 ? 98.211  62.522  72.511 1.00 25.88 ? 190  ASN A N     1 
ATOM   2129 C  CA    . ASN C 3 190 ? 98.362  62.272  73.944 1.00 28.82 ? 190  ASN A CA    1 
ATOM   2130 C  C     . ASN C 3 190 ? 99.816  62.029  74.331 1.00 29.47 ? 190  ASN A C     1 
ATOM   2131 O  O     . ASN C 3 190 ? 100.142 61.922  75.512 1.00 29.69 ? 190  ASN A O     1 
ATOM   2132 C  CB    . ASN C 3 190 ? 97.493  61.091  74.405 1.00 32.59 ? 190  ASN A CB    1 
ATOM   2133 C  CG    . ASN C 3 190 ? 97.829  59.792  73.692 1.00 34.55 ? 190  ASN A CG    1 
ATOM   2134 O  OD1   . ASN C 3 190 ? 98.991  59.494  73.430 1.00 37.91 ? 190  ASN A OD1   1 
ATOM   2135 N  ND2   . ASN C 3 190 ? 96.807  59.003  73.395 1.00 38.13 ? 190  ASN A ND2   1 
ATOM   2136 N  N     . GLN C 3 191 ? 100.695 61.953  73.337 1.00 29.88 ? 191  GLN A N     1 
ATOM   2137 C  CA    . GLN C 3 191 ? 102.113 61.739  73.600 1.00 31.21 ? 191  GLN A CA    1 
ATOM   2138 C  C     . GLN C 3 191 ? 102.897 63.046  73.635 1.00 30.96 ? 191  GLN A C     1 
ATOM   2139 O  O     . GLN C 3 191 ? 104.091 63.049  73.930 1.00 30.56 ? 191  GLN A O     1 
ATOM   2140 C  CB    . GLN C 3 191 ? 102.717 60.812  72.545 1.00 33.52 ? 191  GLN A CB    1 
ATOM   2141 C  CG    . GLN C 3 191 ? 102.415 59.343  72.773 1.00 39.18 ? 191  GLN A CG    1 
ATOM   2142 C  CD    . GLN C 3 191 ? 102.956 58.463  71.666 1.00 42.02 ? 191  GLN A CD    1 
ATOM   2143 O  OE1   . GLN C 3 191 ? 104.081 58.654  71.197 1.00 45.50 ? 191  GLN A OE1   1 
ATOM   2144 N  NE2   . GLN C 3 191 ? 102.159 57.483  71.244 1.00 43.93 ? 191  GLN A NE2   1 
ATOM   2145 N  N     . LEU C 3 192 ? 102.230 64.155  73.334 1.00 28.45 ? 192  LEU A N     1 
ATOM   2146 C  CA    . LEU C 3 192 ? 102.893 65.456  73.332 1.00 27.43 ? 192  LEU A CA    1 
ATOM   2147 C  C     . LEU C 3 192 ? 103.039 66.002  74.749 1.00 28.11 ? 192  LEU A C     1 
ATOM   2148 O  O     . LEU C 3 192 ? 102.062 66.064  75.493 1.00 27.76 ? 192  LEU A O     1 
ATOM   2149 C  CB    . LEU C 3 192 ? 102.097 66.451  72.483 1.00 24.68 ? 192  LEU A CB    1 
ATOM   2150 C  CG    . LEU C 3 192 ? 101.959 66.122  70.994 1.00 24.07 ? 192  LEU A CG    1 
ATOM   2151 C  CD1   . LEU C 3 192 ? 100.905 67.023  70.365 1.00 25.18 ? 192  LEU A CD1   1 
ATOM   2152 C  CD2   . LEU C 3 192 ? 103.305 66.299  70.303 1.00 25.01 ? 192  LEU A CD2   1 
ATOM   2153 N  N     . ILE C 3 193 ? 104.254 66.397  75.121 1.00 27.90 ? 193  ILE A N     1 
ATOM   2154 C  CA    . ILE C 3 193 ? 104.485 66.945  76.454 1.00 29.94 ? 193  ILE A CA    1 
ATOM   2155 C  C     . ILE C 3 193 ? 104.115 68.427  76.468 1.00 29.69 ? 193  ILE A C     1 
ATOM   2156 O  O     . ILE C 3 193 ? 104.000 69.055  75.415 1.00 28.66 ? 193  ILE A O     1 
ATOM   2157 C  CB    . ILE C 3 193 ? 105.960 66.767  76.906 1.00 30.61 ? 193  ILE A CB    1 
ATOM   2158 C  CG1   . ILE C 3 193 ? 106.897 67.569  76.003 1.00 31.36 ? 193  ILE A CG1   1 
ATOM   2159 C  CG2   . ILE C 3 193 ? 106.335 65.288  76.874 1.00 31.80 ? 193  ILE A CG2   1 
ATOM   2160 C  CD1   . ILE C 3 193 ? 108.355 67.485  76.423 1.00 34.10 ? 193  ILE A CD1   1 
ATOM   2161 N  N     . GLU C 3 194 ? 103.937 68.978  77.664 1.00 28.62 ? 194  GLU A N     1 
ATOM   2162 C  CA    . GLU C 3 194 ? 103.539 70.374  77.824 1.00 30.06 ? 194  GLU A CA    1 
ATOM   2163 C  C     . GLU C 3 194 ? 104.364 71.402  77.046 1.00 29.18 ? 194  GLU A C     1 
ATOM   2164 O  O     . GLU C 3 194 ? 103.803 72.311  76.430 1.00 28.68 ? 194  GLU A O     1 
ATOM   2165 C  CB    . GLU C 3 194 ? 103.524 70.748  79.313 1.00 32.78 ? 194  GLU A CB    1 
ATOM   2166 C  CG    . GLU C 3 194 ? 102.770 72.040  79.615 1.00 37.62 ? 194  GLU A CG    1 
ATOM   2167 C  CD    . GLU C 3 194 ? 102.718 72.366  81.097 1.00 43.07 ? 194  GLU A CD    1 
ATOM   2168 O  OE1   . GLU C 3 194 ? 102.260 71.507  81.883 1.00 44.87 ? 194  GLU A OE1   1 
ATOM   2169 O  OE2   . GLU C 3 194 ? 103.131 73.485  81.477 1.00 44.53 ? 194  GLU A OE2   1 
ATOM   2170 N  N     . SER C 3 195 ? 105.686 71.274  77.073 1.00 27.06 ? 195  SER A N     1 
ATOM   2171 C  CA    . SER C 3 195 ? 106.537 72.226  76.367 1.00 26.95 ? 195  SER A CA    1 
ATOM   2172 C  C     . SER C 3 195 ? 106.323 72.186  74.854 1.00 25.07 ? 195  SER A C     1 
ATOM   2173 O  O     . SER C 3 195 ? 106.373 73.217  74.189 1.00 25.36 ? 195  SER A O     1 
ATOM   2174 C  CB    . SER C 3 195 ? 108.012 71.967  76.691 1.00 26.77 ? 195  SER A CB    1 
ATOM   2175 O  OG    . SER C 3 195 ? 108.376 70.650  76.336 1.00 30.43 ? 195  SER A OG    1 
ATOM   2176 N  N     A SER C 3 196 ? 106.090 70.991  74.321 0.50 24.37 ? 196  SER A N     1 
ATOM   2177 N  N     B SER C 3 196 ? 106.092 70.992  74.314 0.50 24.65 ? 196  SER A N     1 
ATOM   2178 C  CA    A SER C 3 196 ? 105.867 70.823  72.891 0.50 23.33 ? 196  SER A CA    1 
ATOM   2179 C  CA    B SER C 3 196 ? 105.861 70.839  72.882 0.50 23.89 ? 196  SER A CA    1 
ATOM   2180 C  C     A SER C 3 196 ? 104.512 71.421  72.509 0.50 22.96 ? 196  SER A C     1 
ATOM   2181 C  C     B SER C 3 196 ? 104.512 71.451  72.518 0.50 23.32 ? 196  SER A C     1 
ATOM   2182 O  O     A SER C 3 196 ? 104.370 72.044  71.455 0.50 22.06 ? 196  SER A O     1 
ATOM   2183 O  O     B SER C 3 196 ? 104.372 72.110  71.486 0.50 22.61 ? 196  SER A O     1 
ATOM   2184 C  CB    A SER C 3 196 ? 105.902 69.337  72.526 0.50 22.61 ? 196  SER A CB    1 
ATOM   2185 C  CB    B SER C 3 196 ? 105.859 69.359  72.487 0.50 23.51 ? 196  SER A CB    1 
ATOM   2186 O  OG    A SER C 3 196 ? 105.794 69.150  71.127 0.50 23.35 ? 196  SER A OG    1 
ATOM   2187 O  OG    B SER C 3 196 ? 107.129 68.766  72.682 0.50 25.63 ? 196  SER A OG    1 
ATOM   2188 N  N     . ILE C 3 197 ? 103.520 71.222  73.372 1.00 21.94 ? 197  ILE A N     1 
ATOM   2189 C  CA    . ILE C 3 197 ? 102.181 71.748  73.134 1.00 22.02 ? 197  ILE A CA    1 
ATOM   2190 C  C     . ILE C 3 197 ? 102.225 73.271  73.183 1.00 22.80 ? 197  ILE A C     1 
ATOM   2191 O  O     . ILE C 3 197 ? 101.517 73.952  72.438 1.00 22.73 ? 197  ILE A O     1 
ATOM   2192 C  CB    . ILE C 3 197 ? 101.188 71.203  74.173 1.00 20.76 ? 197  ILE A CB    1 
ATOM   2193 C  CG1   . ILE C 3 197 ? 100.999 69.699  73.943 1.00 19.59 ? 197  ILE A CG1   1 
ATOM   2194 C  CG2   . ILE C 3 197 ? 99.855  71.943  74.072 1.00 19.85 ? 197  ILE A CG2   1 
ATOM   2195 C  CD1   . ILE C 3 197 ? 100.120 69.012  74.976 1.00 19.89 ? 197  ILE A CD1   1 
ATOM   2196 N  N     . HIS C 3 198 ? 103.073 73.804  74.056 1.00 22.28 ? 198  HIS A N     1 
ATOM   2197 C  CA    . HIS C 3 198 ? 103.211 75.248  74.162 1.00 21.64 ? 198  HIS A CA    1 
ATOM   2198 C  C     . HIS C 3 198 ? 103.838 75.804  72.886 1.00 22.01 ? 198  HIS A C     1 
ATOM   2199 O  O     . HIS C 3 198 ? 103.388 76.821  72.360 1.00 21.92 ? 198  HIS A O     1 
ATOM   2200 C  CB    . HIS C 3 198 ? 104.086 75.621  75.359 1.00 24.72 ? 198  HIS A CB    1 
ATOM   2201 C  CG    . HIS C 3 198 ? 104.371 77.087  75.453 1.00 27.80 ? 198  HIS A CG    1 
ATOM   2202 N  ND1   . HIS C 3 198 ? 103.383 78.026  75.656 1.00 29.96 ? 198  HIS A ND1   1 
ATOM   2203 C  CD2   . HIS C 3 198 ? 105.529 77.780  75.335 1.00 30.84 ? 198  HIS A CD2   1 
ATOM   2204 C  CE1   . HIS C 3 198 ? 103.918 79.234  75.660 1.00 30.78 ? 198  HIS A CE1   1 
ATOM   2205 N  NE2   . HIS C 3 198 ? 105.219 79.112  75.467 1.00 31.61 ? 198  HIS A NE2   1 
ATOM   2206 N  N     . LEU C 3 199 ? 104.880 75.138  72.390 1.00 21.52 ? 199  LEU A N     1 
ATOM   2207 C  CA    . LEU C 3 199 ? 105.550 75.588  71.171 1.00 22.14 ? 199  LEU A CA    1 
ATOM   2208 C  C     . LEU C 3 199 ? 104.598 75.479  69.986 1.00 21.04 ? 199  LEU A C     1 
ATOM   2209 O  O     . LEU C 3 199 ? 104.579 76.343  69.107 1.00 20.73 ? 199  LEU A O     1 
ATOM   2210 C  CB    . LEU C 3 199 ? 106.805 74.748  70.898 1.00 22.15 ? 199  LEU A CB    1 
ATOM   2211 C  CG    . LEU C 3 199 ? 107.558 75.069  69.598 1.00 23.89 ? 199  LEU A CG    1 
ATOM   2212 C  CD1   . LEU C 3 199 ? 107.891 76.556  69.539 1.00 22.37 ? 199  LEU A CD1   1 
ATOM   2213 C  CD2   . LEU C 3 199 ? 108.824 74.236  69.515 1.00 24.52 ? 199  LEU A CD2   1 
ATOM   2214 N  N     . LEU C 3 200 ? 103.820 74.404  69.960 1.00 20.12 ? 200  LEU A N     1 
ATOM   2215 C  CA    . LEU C 3 200 ? 102.855 74.194  68.881 1.00 19.63 ? 200  LEU A CA    1 
ATOM   2216 C  C     . LEU C 3 200 ? 101.825 75.321  68.895 1.00 19.73 ? 200  LEU A C     1 
ATOM   2217 O  O     . LEU C 3 200 ? 101.540 75.931  67.865 1.00 20.95 ? 200  LEU A O     1 
ATOM   2218 C  CB    . LEU C 3 200 ? 102.152 72.847  69.057 1.00 19.00 ? 200  LEU A CB    1 
ATOM   2219 C  CG    . LEU C 3 200 ? 101.014 72.527  68.080 1.00 19.17 ? 200  LEU A CG    1 
ATOM   2220 C  CD1   . LEU C 3 200 ? 101.497 72.663  66.640 1.00 20.34 ? 200  LEU A CD1   1 
ATOM   2221 C  CD2   . LEU C 3 200 ? 100.515 71.127  68.345 1.00 19.67 ? 200  LEU A CD2   1 
ATOM   2222 N  N     . HIS C 3 201 ? 101.273 75.591  70.073 1.00 19.97 ? 201  HIS A N     1 
ATOM   2223 C  CA    . HIS C 3 201 ? 100.275 76.646  70.237 1.00 19.88 ? 201  HIS A CA    1 
ATOM   2224 C  C     . HIS C 3 201 ? 100.774 77.992  69.697 1.00 21.37 ? 201  HIS A C     1 
ATOM   2225 O  O     . HIS C 3 201 ? 100.098 78.638  68.891 1.00 17.57 ? 201  HIS A O     1 
ATOM   2226 C  CB    . HIS C 3 201 ? 99.897  76.761  71.721 1.00 18.59 ? 201  HIS A CB    1 
ATOM   2227 C  CG    . HIS C 3 201 ? 99.040  77.946  72.049 1.00 20.22 ? 201  HIS A CG    1 
ATOM   2228 N  ND1   . HIS C 3 201 ? 99.566  79.170  72.405 1.00 20.36 ? 201  HIS A ND1   1 
ATOM   2229 C  CD2   . HIS C 3 201 ? 97.694  78.086  72.098 1.00 20.45 ? 201  HIS A CD2   1 
ATOM   2230 C  CE1   . HIS C 3 201 ? 98.580  80.012  72.664 1.00 21.79 ? 201  HIS A CE1   1 
ATOM   2231 N  NE2   . HIS C 3 201 ? 97.434  79.380  72.485 1.00 21.73 ? 201  HIS A NE2   1 
ATOM   2232 N  N     . ASP C 3 202 ? 101.962 78.409  70.122 1.00 21.16 ? 202  ASP A N     1 
ATOM   2233 C  CA    . ASP C 3 202 ? 102.505 79.681  69.667 1.00 22.13 ? 202  ASP A CA    1 
ATOM   2234 C  C     . ASP C 3 202 ? 102.858 79.657  68.184 1.00 21.32 ? 202  ASP A C     1 
ATOM   2235 O  O     . ASP C 3 202 ? 102.709 80.663  67.496 1.00 22.45 ? 202  ASP A O     1 
ATOM   2236 C  CB    . ASP C 3 202 ? 103.751 80.063  70.480 1.00 25.95 ? 202  ASP A CB    1 
ATOM   2237 C  CG    . ASP C 3 202 ? 103.431 80.400  71.929 1.00 30.60 ? 202  ASP A CG    1 
ATOM   2238 O  OD1   . ASP C 3 202 ? 102.239 80.407  72.311 1.00 33.30 ? 202  ASP A OD1   1 
ATOM   2239 O  OD2   . ASP C 3 202 ? 104.383 80.659  72.694 1.00 34.44 ? 202  ASP A OD2   1 
ATOM   2240 N  N     . SER C 3 203 ? 103.319 78.510  67.690 1.00 19.98 ? 203  SER A N     1 
ATOM   2241 C  CA    . SER C 3 203 ? 103.695 78.390  66.286 1.00 21.25 ? 203  SER A CA    1 
ATOM   2242 C  C     . SER C 3 203 ? 102.480 78.514  65.364 1.00 19.90 ? 203  SER A C     1 
ATOM   2243 O  O     . SER C 3 203 ? 102.573 79.095  64.283 1.00 21.20 ? 203  SER A O     1 
ATOM   2244 C  CB    . SER C 3 203 ? 104.412 77.059  66.045 1.00 22.85 ? 203  SER A CB    1 
ATOM   2245 O  OG    . SER C 3 203 ? 105.617 77.001  66.795 1.00 23.16 ? 203  SER A OG    1 
ATOM   2246 N  N     . ILE C 3 204 ? 101.349 77.958  65.786 1.00 19.17 ? 204  ILE A N     1 
ATOM   2247 C  CA    . ILE C 3 204 ? 100.122 78.052  64.996 1.00 18.77 ? 204  ILE A CA    1 
ATOM   2248 C  C     . ILE C 3 204 ? 99.757  79.533  64.839 1.00 19.24 ? 204  ILE A C     1 
ATOM   2249 O  O     . ILE C 3 204 ? 99.468  80.006  63.734 1.00 19.57 ? 204  ILE A O     1 
ATOM   2250 C  CB    . ILE C 3 204 ? 98.958  77.305  65.689 1.00 18.64 ? 204  ILE A CB    1 
ATOM   2251 C  CG1   . ILE C 3 204 ? 99.198  75.793  65.610 1.00 17.69 ? 204  ILE A CG1   1 
ATOM   2252 C  CG2   . ILE C 3 204 ? 97.622  77.672  65.036 1.00 19.09 ? 204  ILE A CG2   1 
ATOM   2253 C  CD1   . ILE C 3 204 ? 98.228  74.962  66.449 1.00 18.05 ? 204  ILE A CD1   1 
ATOM   2254 N  N     . ILE C 3 205 ? 99.786  80.265  65.947 1.00 19.40 ? 205  ILE A N     1 
ATOM   2255 C  CA    . ILE C 3 205 ? 99.461  81.689  65.918 1.00 20.77 ? 205  ILE A CA    1 
ATOM   2256 C  C     . ILE C 3 205 ? 100.475 82.491  65.106 1.00 21.69 ? 205  ILE A C     1 
ATOM   2257 O  O     . ILE C 3 205 ? 100.097 83.310  64.265 1.00 21.14 ? 205  ILE A O     1 
ATOM   2258 C  CB    . ILE C 3 205 ? 99.381  82.265  67.351 1.00 21.32 ? 205  ILE A CB    1 
ATOM   2259 C  CG1   . ILE C 3 205 ? 98.208  81.617  68.093 1.00 21.22 ? 205  ILE A CG1   1 
ATOM   2260 C  CG2   . ILE C 3 205 ? 99.198  83.778  67.302 1.00 21.38 ? 205  ILE A CG2   1 
ATOM   2261 C  CD1   . ILE C 3 205 ? 98.149  81.922  69.571 1.00 20.90 ? 205  ILE A CD1   1 
ATOM   2262 N  N     . GLU C 3 206 ? 101.761 82.244  65.340 1.00 22.12 ? 206  GLU A N     1 
ATOM   2263 C  CA    . GLU C 3 206 ? 102.810 82.969  64.625 1.00 23.81 ? 206  GLU A CA    1 
ATOM   2264 C  C     . GLU C 3 206 ? 102.819 82.752  63.114 1.00 23.15 ? 206  GLU A C     1 
ATOM   2265 O  O     . GLU C 3 206 ? 102.904 83.710  62.347 1.00 23.33 ? 206  GLU A O     1 
ATOM   2266 C  CB    . GLU C 3 206 ? 104.184 82.612  65.204 1.00 25.72 ? 206  GLU A CB    1 
ATOM   2267 C  CG    . GLU C 3 206 ? 104.378 83.089  66.631 0.50 28.36 ? 206  GLU A CG    1 
ATOM   2268 C  CD    . GLU C 3 206 ? 104.046 84.559  66.798 0.50 30.25 ? 206  GLU A CD    1 
ATOM   2269 O  OE1   . GLU C 3 206 ? 104.621 85.389  66.063 0.50 32.66 ? 206  GLU A OE1   1 
ATOM   2270 O  OE2   . GLU C 3 206 ? 103.210 84.887  67.665 0.50 32.20 ? 206  GLU A OE2   1 
ATOM   2271 N  N     . ILE C 3 207 ? 102.733 81.496  62.688 1.00 22.74 ? 207  ILE A N     1 
ATOM   2272 C  CA    . ILE C 3 207 ? 102.738 81.170  61.268 1.00 25.13 ? 207  ILE A CA    1 
ATOM   2273 C  C     . ILE C 3 207 ? 101.563 81.807  60.523 1.00 24.44 ? 207  ILE A C     1 
ATOM   2274 O  O     . ILE C 3 207 ? 101.735 82.397  59.454 1.00 22.96 ? 207  ILE A O     1 
ATOM   2275 C  CB    . ILE C 3 207 ? 102.684 79.639  61.049 1.00 27.07 ? 207  ILE A CB    1 
ATOM   2276 C  CG1   . ILE C 3 207 ? 104.045 79.015  61.374 1.00 29.89 ? 207  ILE A CG1   1 
ATOM   2277 C  CG2   . ILE C 3 207 ? 102.292 79.322  59.600 1.00 28.39 ? 207  ILE A CG2   1 
ATOM   2278 C  CD1   . ILE C 3 207 ? 105.119 79.321  60.344 1.00 31.25 ? 207  ILE A CD1   1 
ATOM   2279 N  N     . LEU C 3 208 ? 100.367 81.678  61.082 1.00 23.96 ? 208  LEU A N     1 
ATOM   2280 C  CA    . LEU C 3 208 ? 99.191  82.234  60.430 1.00 23.80 ? 208  LEU A CA    1 
ATOM   2281 C  C     . LEU C 3 208 ? 99.213  83.759  60.398 1.00 23.92 ? 208  LEU A C     1 
ATOM   2282 O  O     . LEU C 3 208 ? 98.865  84.363  59.384 1.00 23.06 ? 208  LEU A O     1 
ATOM   2283 C  CB    . LEU C 3 208 ? 97.920  81.708  61.109 1.00 22.70 ? 208  LEU A CB    1 
ATOM   2284 C  CG    . LEU C 3 208 ? 97.764  80.191  60.935 1.00 22.01 ? 208  LEU A CG    1 
ATOM   2285 C  CD1   . LEU C 3 208 ? 96.518  79.694  61.658 1.00 24.87 ? 208  LEU A CD1   1 
ATOM   2286 C  CD2   . LEU C 3 208 ? 97.692  79.853  59.444 1.00 22.66 ? 208  LEU A CD2   1 
ATOM   2287 N  N     . GLN C 3 209 ? 99.637  84.389  61.489 1.00 23.92 ? 209  GLN A N     1 
ATOM   2288 C  CA    . GLN C 3 209 ? 99.686  85.845  61.510 1.00 25.93 ? 209  GLN A CA    1 
ATOM   2289 C  C     . GLN C 3 209 ? 100.733 86.340  60.516 1.00 26.58 ? 209  GLN A C     1 
ATOM   2290 O  O     . GLN C 3 209 ? 100.543 87.364  59.860 1.00 26.14 ? 209  GLN A O     1 
ATOM   2291 C  CB    . GLN C 3 209 ? 99.990  86.360  62.919 1.00 28.71 ? 209  GLN A CB    1 
ATOM   2292 C  CG    . GLN C 3 209 ? 98.866  86.112  63.929 1.00 33.81 ? 209  GLN A CG    1 
ATOM   2293 C  CD    . GLN C 3 209 ? 97.499  86.589  63.433 1.00 38.31 ? 209  GLN A CD    1 
ATOM   2294 O  OE1   . GLN C 3 209 ? 97.370  87.684  62.876 1.00 40.14 ? 209  GLN A OE1   1 
ATOM   2295 N  NE2   . GLN C 3 209 ? 96.472  85.769  63.648 1.00 38.18 ? 209  GLN A NE2   1 
ATOM   2296 N  N     . LYS C 3 210 ? 101.834 85.603  60.393 1.00 25.94 ? 210  LYS A N     1 
ATOM   2297 C  CA    . LYS C 3 210 ? 102.883 85.973  59.449 1.00 26.27 ? 210  LYS A CA    1 
ATOM   2298 C  C     . LYS C 3 210 ? 102.348 85.834  58.021 1.00 25.89 ? 210  LYS A C     1 
ATOM   2299 O  O     . LYS C 3 210 ? 102.568 86.702  57.169 1.00 25.07 ? 210  LYS A O     1 
ATOM   2300 C  CB    . LYS C 3 210 ? 104.102 85.066  59.630 1.00 27.65 ? 210  LYS A CB    1 
ATOM   2301 C  CG    . LYS C 3 210 ? 105.192 85.293  58.601 1.00 29.64 ? 210  LYS A CG    1 
ATOM   2302 C  CD    . LYS C 3 210 ? 106.338 84.318  58.796 1.00 32.77 ? 210  LYS A CD    1 
ATOM   2303 C  CE    . LYS C 3 210 ? 107.385 84.488  57.715 1.00 33.34 ? 210  LYS A CE    1 
ATOM   2304 N  NZ    . LYS C 3 210 ? 108.504 83.522  57.899 1.00 37.96 ? 210  LYS A NZ    1 
ATOM   2305 N  N     . ALA C 3 211 ? 101.643 84.734  57.766 1.00 24.66 ? 211  ALA A N     1 
ATOM   2306 C  CA    . ALA C 3 211 ? 101.074 84.483  56.450 1.00 23.45 ? 211  ALA A CA    1 
ATOM   2307 C  C     . ALA C 3 211 ? 100.087 85.585  56.076 1.00 23.64 ? 211  ALA A C     1 
ATOM   2308 O  O     . ALA C 3 211 ? 100.019 86.002  54.920 1.00 24.66 ? 211  ALA A O     1 
ATOM   2309 C  CB    . ALA C 3 211 ? 100.385 83.129  56.431 1.00 22.72 ? 211  ALA A CB    1 
ATOM   2310 N  N     . ILE C 3 212 ? 99.316  86.051  57.054 1.00 24.95 ? 212  ILE A N     1 
ATOM   2311 C  CA    . ILE C 3 212 ? 98.347  87.118  56.814 1.00 26.48 ? 212  ILE A CA    1 
ATOM   2312 C  C     . ILE C 3 212 ? 99.093  88.394  56.445 1.00 28.22 ? 212  ILE A C     1 
ATOM   2313 O  O     . ILE C 3 212 ? 98.752  89.077  55.478 1.00 27.69 ? 212  ILE A O     1 
ATOM   2314 C  CB    . ILE C 3 212 ? 97.485  87.388  58.068 1.00 25.27 ? 212  ILE A CB    1 
ATOM   2315 C  CG1   . ILE C 3 212 ? 96.528  86.217  58.298 1.00 22.31 ? 212  ILE A CG1   1 
ATOM   2316 C  CG2   . ILE C 3 212 ? 96.723  88.704  57.910 1.00 22.65 ? 212  ILE A CG2   1 
ATOM   2317 C  CD1   . ILE C 3 212 ? 95.762  86.298  59.605 1.00 23.19 ? 212  ILE A CD1   1 
ATOM   2318 N  N     . LYS C 3 213 ? 100.121 88.706  57.225 1.00 29.37 ? 213  LYS A N     1 
ATOM   2319 C  CA    . LYS C 3 213 ? 100.927 89.893  56.985 1.00 31.03 ? 213  LYS A CA    1 
ATOM   2320 C  C     . LYS C 3 213 ? 101.504 89.901  55.567 1.00 31.10 ? 213  LYS A C     1 
ATOM   2321 O  O     . LYS C 3 213 ? 101.574 90.953  54.926 1.00 30.70 ? 213  LYS A O     1 
ATOM   2322 C  CB    . LYS C 3 213 ? 102.056 89.960  58.022 1.00 33.97 ? 213  LYS A CB    1 
ATOM   2323 C  CG    . LYS C 3 213 ? 103.095 91.038  57.767 1.00 39.58 ? 213  LYS A CG    1 
ATOM   2324 C  CD    . LYS C 3 213 ? 104.255 90.920  58.753 1.00 43.54 ? 213  LYS A CD    1 
ATOM   2325 C  CE    . LYS C 3 213 ? 105.349 91.949  58.469 1.00 46.77 ? 213  LYS A CE    1 
ATOM   2326 N  NZ    . LYS C 3 213 ? 105.981 91.773  57.126 1.00 47.66 ? 213  LYS A NZ    1 
ATOM   2327 N  N     . LEU C 3 214 ? 101.897 88.729  55.071 1.00 29.27 ? 214  LEU A N     1 
ATOM   2328 C  CA    . LEU C 3 214 ? 102.483 88.627  53.737 1.00 29.39 ? 214  LEU A CA    1 
ATOM   2329 C  C     . LEU C 3 214 ? 101.484 88.397  52.608 1.00 28.69 ? 214  LEU A C     1 
ATOM   2330 O  O     . LEU C 3 214 ? 101.879 88.076  51.489 1.00 27.18 ? 214  LEU A O     1 
ATOM   2331 C  CB    . LEU C 3 214 ? 103.539 87.518  53.702 1.00 29.93 ? 214  LEU A CB    1 
ATOM   2332 C  CG    . LEU C 3 214 ? 104.703 87.644  54.692 1.00 32.90 ? 214  LEU A CG    1 
ATOM   2333 C  CD1   . LEU C 3 214 ? 105.753 86.590  54.369 1.00 30.93 ? 214  LEU A CD1   1 
ATOM   2334 C  CD2   . LEU C 3 214 ? 105.312 89.033  54.612 1.00 33.80 ? 214  LEU A CD2   1 
ATOM   2335 N  N     . GLY C 3 215 ? 100.195 88.545  52.903 1.00 27.83 ? 215  GLY A N     1 
ATOM   2336 C  CA    . GLY C 3 215 ? 99.180  88.376  51.873 1.00 27.52 ? 215  GLY A CA    1 
ATOM   2337 C  C     . GLY C 3 215 ? 98.903  86.954  51.420 1.00 26.97 ? 215  GLY A C     1 
ATOM   2338 O  O     . GLY C 3 215 ? 98.412  86.735  50.309 1.00 26.40 ? 215  GLY A O     1 
ATOM   2339 N  N     . GLY C 3 216 ? 99.214  85.985  52.273 1.00 26.26 ? 216  GLY A N     1 
ATOM   2340 C  CA    . GLY C 3 216 ? 98.971  84.595  51.937 1.00 27.02 ? 216  GLY A CA    1 
ATOM   2341 C  C     . GLY C 3 216 ? 99.964  83.982  50.972 1.00 27.88 ? 216  GLY A C     1 
ATOM   2342 O  O     . GLY C 3 216 ? 100.887 84.648  50.502 1.00 28.43 ? 216  GLY A O     1 
ATOM   2343 N  N     . SER C 3 217 ? 99.769  82.698  50.682 1.00 28.59 ? 217  SER A N     1 
ATOM   2344 C  CA    . SER C 3 217 ? 100.634 81.967  49.769 1.00 31.67 ? 217  SER A CA    1 
ATOM   2345 C  C     . SER C 3 217 ? 99.984  81.849  48.396 1.00 35.74 ? 217  SER A C     1 
ATOM   2346 O  O     . SER C 3 217 ? 98.865  81.352  48.263 1.00 36.24 ? 217  SER A O     1 
ATOM   2347 C  CB    . SER C 3 217 ? 100.926 80.563  50.312 1.00 29.56 ? 217  SER A CB    1 
ATOM   2348 O  OG    . SER C 3 217 ? 101.691 80.616  51.507 1.00 28.47 ? 217  SER A OG    1 
ATOM   2349 N  N     . SER C 3 218 ? 100.690 82.320  47.377 1.00 39.07 ? 218  SER A N     1 
ATOM   2350 C  CA    . SER C 3 218 ? 100.193 82.250  46.010 1.00 42.34 ? 218  SER A CA    1 
ATOM   2351 C  C     . SER C 3 218 ? 101.196 81.441  45.203 1.00 43.55 ? 218  SER A C     1 
ATOM   2352 O  O     . SER C 3 218 ? 102.096 82.002  44.579 1.00 45.28 ? 218  SER A O     1 
ATOM   2353 C  CB    . SER C 3 218 ? 100.063 83.653  45.412 1.00 42.61 ? 218  SER A CB    1 
ATOM   2354 O  OG    . SER C 3 218 ? 99.244  84.484  46.219 1.00 45.39 ? 218  SER A OG    1 
ATOM   2355 N  N     . ILE C 3 219 ? 101.055 80.120  45.238 0.50 43.86 ? 219  ILE A N     1 
ATOM   2356 C  CA    . ILE C 3 219 ? 101.951 79.245  44.499 0.50 43.60 ? 219  ILE A CA    1 
ATOM   2357 C  C     . ILE C 3 219 ? 101.416 79.141  43.075 0.50 44.06 ? 219  ILE A C     1 
ATOM   2358 O  O     . ILE C 3 219 ? 101.698 78.186  42.351 0.50 44.26 ? 219  ILE A O     1 
ATOM   2359 C  CB    . ILE C 3 219 ? 102.018 77.844  45.147 0.50 43.24 ? 219  ILE A CB    1 
ATOM   2360 C  CG1   . ILE C 3 219 ? 102.334 77.982  46.639 0.50 42.58 ? 219  ILE A CG1   1 
ATOM   2361 C  CG2   . ILE C 3 219 ? 103.102 77.006  44.477 0.50 43.54 ? 219  ILE A CG2   1 
ATOM   2362 C  CD1   . ILE C 3 219 ? 102.421 76.664  47.383 0.50 41.38 ? 219  ILE A CD1   1 
ATOM   2363 N  N     . ARG C 3 220 ? 100.636 80.145  42.687 0.50 44.03 ? 220  ARG A N     1 
ATOM   2364 C  CA    . ARG C 3 220 ? 100.062 80.181  41.357 0.50 44.05 ? 220  ARG A CA    1 
ATOM   2365 C  C     . ARG C 3 220 ? 99.981  81.601  40.829 0.50 44.07 ? 220  ARG A C     1 
ATOM   2366 O  O     . ARG C 3 220 ? 100.729 81.979  39.929 0.50 44.38 ? 220  ARG A O     1 
ATOM   2367 N  N     . THR C 3 221 ? 99.073  82.392  41.395 0.50 44.11 ? 221  THR A N     1 
ATOM   2368 C  CA    . THR C 3 221 ? 98.912  83.768  40.959 0.50 43.58 ? 221  THR A CA    1 
ATOM   2369 C  C     . THR C 3 221 ? 97.795  83.917  39.942 0.50 43.57 ? 221  THR A C     1 
ATOM   2370 O  O     . THR C 3 221 ? 97.060  82.968  39.673 0.50 43.72 ? 221  THR A O     1 
ATOM   2371 N  N     . TYR C 3 222 ? 97.664  85.112  39.374 0.50 43.51 ? 222  TYR A N     1 
ATOM   2372 C  CA    . TYR C 3 222 ? 96.625  85.344  38.388 0.50 43.12 ? 222  TYR A CA    1 
ATOM   2373 C  C     . TYR C 3 222 ? 95.788  86.568  38.697 0.50 42.94 ? 222  TYR A C     1 
ATOM   2374 O  O     . TYR C 3 222 ? 95.831  87.096  39.807 0.50 43.53 ? 222  TYR A O     1 
ATOM   2375 N  N     . SER C 3 223 ? 95.026  87.023  37.708 0.50 42.50 ? 223  SER A N     1 
ATOM   2376 C  CA    . SER C 3 223 ? 94.186  88.189  37.900 0.50 41.71 ? 223  SER A CA    1 
ATOM   2377 C  C     . SER C 3 223 ? 93.020  87.906  38.825 0.50 41.30 ? 223  SER A C     1 
ATOM   2378 O  O     . SER C 3 223 ? 91.886  87.746  38.374 0.50 41.78 ? 223  SER A O     1 
ATOM   2379 N  N     . ALA C 3 224 ? 93.299  87.841  40.123 1.00 40.67 ? 224  ALA A N     1 
ATOM   2380 C  CA    . ALA C 3 224 ? 92.271  87.583  41.125 1.00 39.11 ? 224  ALA A CA    1 
ATOM   2381 C  C     . ALA C 3 224 ? 92.670  88.198  42.462 1.00 38.23 ? 224  ALA A C     1 
ATOM   2382 O  O     . ALA C 3 224 ? 93.849  88.472  42.707 1.00 35.89 ? 224  ALA A O     1 
ATOM   2383 C  CB    . ALA C 3 224 ? 92.060  86.079  41.285 1.00 38.83 ? 224  ALA A CB    1 
ATOM   2384 N  N     . LEU C 3 225 ? 91.686  88.416  43.327 1.00 36.42 ? 225  LEU A N     1 
ATOM   2385 C  CA    . LEU C 3 225 ? 91.954  88.994  44.636 1.00 36.83 ? 225  LEU A CA    1 
ATOM   2386 C  C     . LEU C 3 225 ? 92.881  88.077  45.431 1.00 38.49 ? 225  LEU A C     1 
ATOM   2387 O  O     . LEU C 3 225 ? 92.791  86.849  45.335 1.00 35.86 ? 225  LEU A O     1 
ATOM   2388 C  CB    . LEU C 3 225 ? 90.646  89.200  45.401 1.00 35.29 ? 225  LEU A CB    1 
ATOM   2389 C  CG    . LEU C 3 225 ? 89.606  90.082  44.709 1.00 34.18 ? 225  LEU A CG    1 
ATOM   2390 C  CD1   . LEU C 3 225 ? 88.362  90.174  45.584 1.00 35.54 ? 225  LEU A CD1   1 
ATOM   2391 C  CD2   . LEU C 3 225 ? 90.188  91.464  44.448 1.00 34.28 ? 225  LEU A CD2   1 
ATOM   2392 N  N     . GLY C 3 226 ? 93.777  88.686  46.205 1.00 39.98 ? 226  GLY A N     1 
ATOM   2393 C  CA    . GLY C 3 226 ? 94.711  87.924  47.014 1.00 41.75 ? 226  GLY A CA    1 
ATOM   2394 C  C     . GLY C 3 226 ? 95.658  87.041  46.223 1.00 43.49 ? 226  GLY A C     1 
ATOM   2395 O  O     . GLY C 3 226 ? 95.987  85.941  46.660 1.00 45.68 ? 226  GLY A O     1 
ATOM   2396 N  N     . SER C 3 227 ? 96.102  87.512  45.062 1.00 43.69 ? 227  SER A N     1 
ATOM   2397 C  CA    . SER C 3 227 ? 97.014  86.734  44.228 1.00 44.54 ? 227  SER A CA    1 
ATOM   2398 C  C     . SER C 3 227 ? 98.436  87.294  44.256 1.00 43.79 ? 227  SER A C     1 
ATOM   2399 O  O     . SER C 3 227 ? 99.326  86.783  43.577 1.00 44.63 ? 227  SER A O     1 
ATOM   2400 C  CB    . SER C 3 227 ? 96.508  86.698  42.783 1.00 45.17 ? 227  SER A CB    1 
ATOM   2401 O  OG    . SER C 3 227 ? 96.438  88.007  42.240 1.00 47.55 ? 227  SER A OG    1 
ATOM   2402 N  N     . THR C 3 228 ? 98.644  88.344  45.043 1.00 43.25 ? 228  THR A N     1 
ATOM   2403 C  CA    . THR C 3 228 ? 99.959  88.966  45.155 1.00 42.51 ? 228  THR A CA    1 
ATOM   2404 C  C     . THR C 3 228 ? 100.639 88.608  46.477 1.00 40.79 ? 228  THR A C     1 
ATOM   2405 O  O     . THR C 3 228 ? 101.452 89.377  46.992 1.00 39.54 ? 228  THR A O     1 
ATOM   2406 C  CB    . THR C 3 228 ? 99.854  90.504  45.052 1.00 42.67 ? 228  THR A CB    1 
ATOM   2407 O  OG1   . THR C 3 228 ? 99.007  91.000  46.097 1.00 43.54 ? 228  THR A OG1   1 
ATOM   2408 C  CG2   . THR C 3 228 ? 99.270  90.908  43.705 1.00 43.80 ? 228  THR A CG2   1 
ATOM   2409 N  N     . GLY C 3 229 ? 100.304 87.439  47.019 1.00 39.68 ? 229  GLY A N     1 
ATOM   2410 C  CA    . GLY C 3 229 ? 100.890 87.007  48.278 1.00 38.74 ? 229  GLY A CA    1 
ATOM   2411 C  C     . GLY C 3 229 ? 102.372 86.697  48.169 1.00 38.53 ? 229  GLY A C     1 
ATOM   2412 O  O     . GLY C 3 229 ? 102.867 86.382  47.085 1.00 38.30 ? 229  GLY A O     1 
ATOM   2413 N  N     . LYS C 3 230 ? 103.086 86.781  49.289 1.00 37.24 ? 230  LYS A N     1 
ATOM   2414 C  CA    . LYS C 3 230 ? 104.521 86.513  49.293 1.00 37.51 ? 230  LYS A CA    1 
ATOM   2415 C  C     . LYS C 3 230 ? 104.912 85.443  50.312 1.00 35.87 ? 230  LYS A C     1 
ATOM   2416 O  O     . LYS C 3 230 ? 106.097 85.156  50.498 1.00 35.68 ? 230  LYS A O     1 
ATOM   2417 C  CB    . LYS C 3 230 ? 105.299 87.800  49.594 1.00 39.64 ? 230  LYS A CB    1 
ATOM   2418 C  CG    . LYS C 3 230 ? 104.737 89.053  48.928 1.00 44.89 ? 230  LYS A CG    1 
ATOM   2419 C  CD    . LYS C 3 230 ? 104.601 88.911  47.412 1.00 48.99 ? 230  LYS A CD    1 
ATOM   2420 C  CE    . LYS C 3 230 ? 105.948 88.938  46.702 1.00 51.71 ? 230  LYS A CE    1 
ATOM   2421 N  NZ    . LYS C 3 230 ? 106.794 87.760  47.031 1.00 54.18 ? 230  LYS A NZ    1 
ATOM   2422 N  N     . MET C 3 231 ? 103.921 84.850  50.971 1.00 32.11 ? 231  MET A N     1 
ATOM   2423 C  CA    . MET C 3 231 ? 104.203 83.825  51.969 1.00 29.41 ? 231  MET A CA    1 
ATOM   2424 C  C     . MET C 3 231 ? 104.809 82.569  51.350 1.00 28.98 ? 231  MET A C     1 
ATOM   2425 O  O     . MET C 3 231 ? 105.553 81.850  52.016 1.00 27.80 ? 231  MET A O     1 
ATOM   2426 C  CB    . MET C 3 231 ? 102.931 83.462  52.742 1.00 27.43 ? 231  MET A CB    1 
ATOM   2427 C  CG    . MET C 3 231 ? 103.159 82.474  53.890 1.00 27.23 ? 231  MET A CG    1 
ATOM   2428 S  SD    . MET C 3 231 ? 104.249 83.093  55.204 1.00 26.67 ? 231  MET A SD    1 
ATOM   2429 C  CE    . MET C 3 231 ? 104.353 81.637  56.245 1.00 29.12 ? 231  MET A CE    1 
ATOM   2430 N  N     . GLN C 3 232 ? 104.507 82.301  50.081 1.00 29.82 ? 232  GLN A N     1 
ATOM   2431 C  CA    . GLN C 3 232 ? 105.052 81.110  49.438 1.00 32.05 ? 232  GLN A CA    1 
ATOM   2432 C  C     . GLN C 3 232 ? 106.580 81.128  49.406 1.00 33.28 ? 232  GLN A C     1 
ATOM   2433 O  O     . GLN C 3 232 ? 107.217 80.079  49.297 1.00 32.43 ? 232  GLN A O     1 
ATOM   2434 C  CB    . GLN C 3 232 ? 104.490 80.934  48.016 1.00 33.60 ? 232  GLN A CB    1 
ATOM   2435 C  CG    . GLN C 3 232 ? 104.861 82.000  46.989 1.00 36.26 ? 232  GLN A CG    1 
ATOM   2436 C  CD    . GLN C 3 232 ? 104.238 83.355  47.270 1.00 38.69 ? 232  GLN A CD    1 
ATOM   2437 O  OE1   . GLN C 3 232 ? 103.130 83.451  47.802 1.00 37.40 ? 232  GLN A OE1   1 
ATOM   2438 N  NE2   . GLN C 3 232 ? 104.943 84.415  46.892 1.00 40.98 ? 232  GLN A NE2   1 
ATOM   2439 N  N     . ASN C 3 233 ? 107.164 82.318  49.517 1.00 33.60 ? 233  ASN A N     1 
ATOM   2440 C  CA    . ASN C 3 233 ? 108.618 82.449  49.514 1.00 36.12 ? 233  ASN A CA    1 
ATOM   2441 C  C     . ASN C 3 233 ? 109.186 82.169  50.903 1.00 36.12 ? 233  ASN A C     1 
ATOM   2442 O  O     . ASN C 3 233 ? 110.402 82.158  51.095 1.00 36.24 ? 233  ASN A O     1 
ATOM   2443 C  CB    . ASN C 3 233 ? 109.039 83.860  49.080 1.00 38.70 ? 233  ASN A CB    1 
ATOM   2444 C  CG    . ASN C 3 233 ? 108.514 84.231  47.706 1.00 41.85 ? 233  ASN A CG    1 
ATOM   2445 O  OD1   . ASN C 3 233 ? 108.474 83.403  46.794 1.00 43.52 ? 233  ASN A OD1   1 
ATOM   2446 N  ND2   . ASN C 3 233 ? 108.120 85.490  47.547 1.00 44.92 ? 233  ASN A ND2   1 
ATOM   2447 N  N     . GLU C 3 234 ? 108.303 81.938  51.870 1.00 34.08 ? 234  GLU A N     1 
ATOM   2448 C  CA    . GLU C 3 234 ? 108.727 81.677  53.242 1.00 33.46 ? 234  GLU A CA    1 
ATOM   2449 C  C     . GLU C 3 234 ? 108.469 80.244  53.684 1.00 31.08 ? 234  GLU A C     1 
ATOM   2450 O  O     . GLU C 3 234 ? 108.792 79.876  54.816 1.00 30.87 ? 234  GLU A O     1 
ATOM   2451 C  CB    . GLU C 3 234 ? 108.012 82.630  54.202 1.00 35.34 ? 234  GLU A CB    1 
ATOM   2452 C  CG    . GLU C 3 234 ? 108.286 84.099  53.951 1.00 39.86 ? 234  GLU A CG    1 
ATOM   2453 C  CD    . GLU C 3 234 ? 109.730 84.474  54.218 1.00 43.42 ? 234  GLU A CD    1 
ATOM   2454 O  OE1   . GLU C 3 234 ? 110.200 84.264  55.359 1.00 45.31 ? 234  GLU A OE1   1 
ATOM   2455 O  OE2   . GLU C 3 234 ? 110.393 84.980  53.288 1.00 45.58 ? 234  GLU A OE2   1 
ATOM   2456 N  N     . LEU C 3 235 ? 107.890 79.438  52.800 1.00 28.33 ? 235  LEU A N     1 
ATOM   2457 C  CA    . LEU C 3 235 ? 107.586 78.049  53.127 1.00 27.81 ? 235  LEU A CA    1 
ATOM   2458 C  C     . LEU C 3 235 ? 108.861 77.243  53.362 1.00 28.95 ? 235  LEU A C     1 
ATOM   2459 O  O     . LEU C 3 235 ? 109.801 77.294  52.565 1.00 28.36 ? 235  LEU A O     1 
ATOM   2460 C  CB    . LEU C 3 235 ? 106.752 77.414  52.009 1.00 26.27 ? 235  LEU A CB    1 
ATOM   2461 C  CG    . LEU C 3 235 ? 105.434 78.146  51.723 1.00 26.03 ? 235  LEU A CG    1 
ATOM   2462 C  CD1   . LEU C 3 235 ? 104.701 77.471  50.576 1.00 25.35 ? 235  LEU A CD1   1 
ATOM   2463 C  CD2   . LEU C 3 235 ? 104.576 78.156  52.980 1.00 24.71 ? 235  LEU A CD2   1 
ATOM   2464 N  N     . GLN C 3 236 ? 108.882 76.494  54.457 1.00 27.98 ? 236  GLN A N     1 
ATOM   2465 C  CA    . GLN C 3 236 ? 110.045 75.698  54.814 1.00 29.14 ? 236  GLN A CA    1 
ATOM   2466 C  C     . GLN C 3 236 ? 109.960 74.233  54.405 1.00 28.26 ? 236  GLN A C     1 
ATOM   2467 O  O     . GLN C 3 236 ? 110.988 73.588  54.207 1.00 27.74 ? 236  GLN A O     1 
ATOM   2468 C  CB    . GLN C 3 236 ? 110.288 75.793  56.322 1.00 28.58 ? 236  GLN A CB    1 
ATOM   2469 C  CG    . GLN C 3 236 ? 110.631 77.194  56.791 1.00 31.48 ? 236  GLN A CG    1 
ATOM   2470 C  CD    . GLN C 3 236 ? 111.863 77.738  56.094 1.00 36.06 ? 236  GLN A CD    1 
ATOM   2471 O  OE1   . GLN C 3 236 ? 112.912 77.093  56.081 1.00 35.33 ? 236  GLN A OE1   1 
ATOM   2472 N  NE2   . GLN C 3 236 ? 111.742 78.927  55.507 1.00 37.19 ? 236  GLN A NE2   1 
ATOM   2473 N  N     . VAL C 3 237 ? 108.749 73.700  54.275 1.00 25.83 ? 237  VAL A N     1 
ATOM   2474 C  CA    . VAL C 3 237 ? 108.612 72.298  53.902 1.00 25.41 ? 237  VAL A CA    1 
ATOM   2475 C  C     . VAL C 3 237 ? 107.565 71.965  52.848 1.00 25.75 ? 237  VAL A C     1 
ATOM   2476 O  O     . VAL C 3 237 ? 107.784 71.082  52.015 1.00 24.12 ? 237  VAL A O     1 
ATOM   2477 C  CB    . VAL C 3 237 ? 108.329 71.410  55.142 1.00 25.07 ? 237  VAL A CB    1 
ATOM   2478 C  CG1   . VAL C 3 237 ? 109.546 71.386  56.048 1.00 26.66 ? 237  VAL A CG1   1 
ATOM   2479 C  CG2   . VAL C 3 237 ? 107.107 71.931  55.898 1.00 24.45 ? 237  VAL A CG2   1 
ATOM   2480 N  N     . TYR C 3 238 ? 106.426 72.653  52.879 1.00 25.46 ? 238  TYR A N     1 
ATOM   2481 C  CA    . TYR C 3 238 ? 105.374 72.357  51.918 1.00 24.10 ? 238  TYR A CA    1 
ATOM   2482 C  C     . TYR C 3 238 ? 105.852 72.471  50.470 1.00 23.74 ? 238  TYR A C     1 
ATOM   2483 O  O     . TYR C 3 238 ? 106.282 73.535  50.032 1.00 23.95 ? 238  TYR A O     1 
ATOM   2484 C  CB    . TYR C 3 238 ? 104.168 73.274  52.125 1.00 23.89 ? 238  TYR A CB    1 
ATOM   2485 C  CG    . TYR C 3 238 ? 103.031 72.908  51.203 1.00 22.67 ? 238  TYR A CG    1 
ATOM   2486 C  CD1   . TYR C 3 238 ? 102.173 71.851  51.507 1.00 22.66 ? 238  TYR A CD1   1 
ATOM   2487 C  CD2   . TYR C 3 238 ? 102.865 73.562  49.984 1.00 21.84 ? 238  TYR A CD2   1 
ATOM   2488 C  CE1   . TYR C 3 238 ? 101.180 71.451  50.608 1.00 22.25 ? 238  TYR A CE1   1 
ATOM   2489 C  CE2   . TYR C 3 238 ? 101.885 73.173  49.086 1.00 22.04 ? 238  TYR A CE2   1 
ATOM   2490 C  CZ    . TYR C 3 238 ? 101.048 72.119  49.399 1.00 22.30 ? 238  TYR A CZ    1 
ATOM   2491 O  OH    . TYR C 3 238 ? 100.090 71.724  48.493 1.00 23.64 ? 238  TYR A OH    1 
ATOM   2492 N  N     . GLY C 3 239 ? 105.761 71.367  49.735 1.00 23.97 ? 239  GLY A N     1 
ATOM   2493 C  CA    . GLY C 3 239 ? 106.192 71.353  48.348 1.00 27.38 ? 239  GLY A CA    1 
ATOM   2494 C  C     . GLY C 3 239 ? 107.703 71.459  48.196 1.00 29.49 ? 239  GLY A C     1 
ATOM   2495 O  O     . GLY C 3 239 ? 108.197 71.801  47.119 1.00 29.44 ? 239  GLY A O     1 
ATOM   2496 N  N     . LYS C 3 240 ? 108.440 71.164  49.266 1.00 29.63 ? 240  LYS A N     1 
ATOM   2497 C  CA    . LYS C 3 240 ? 109.901 71.247  49.229 1.00 29.73 ? 240  LYS A CA    1 
ATOM   2498 C  C     . LYS C 3 240 ? 110.562 69.874  49.221 1.00 29.69 ? 240  LYS A C     1 
ATOM   2499 O  O     . LYS C 3 240 ? 111.735 69.742  49.573 1.00 29.79 ? 240  LYS A O     1 
ATOM   2500 C  CB    . LYS C 3 240 ? 110.424 72.042  50.429 1.00 30.58 ? 240  LYS A CB    1 
ATOM   2501 C  CG    . LYS C 3 240 ? 109.853 73.444  50.566 1.00 33.09 ? 240  LYS A CG    1 
ATOM   2502 C  CD    . LYS C 3 240 ? 110.166 74.315  49.364 1.00 35.37 ? 240  LYS A CD    1 
ATOM   2503 C  CE    . LYS C 3 240 ? 109.641 75.728  49.571 1.00 36.50 ? 240  LYS A CE    1 
ATOM   2504 N  NZ    . LYS C 3 240 ? 109.880 76.597  48.386 1.00 38.61 ? 240  LYS A NZ    1 
ATOM   2505 N  N     . THR C 3 241 ? 109.806 68.859  48.820 1.00 30.08 ? 241  THR A N     1 
ATOM   2506 C  CA    . THR C 3 241 ? 110.312 67.496  48.759 1.00 31.54 ? 241  THR A CA    1 
ATOM   2507 C  C     . THR C 3 241 ? 111.675 67.466  48.064 1.00 32.14 ? 241  THR A C     1 
ATOM   2508 O  O     . THR C 3 241 ? 111.856 68.075  47.007 1.00 30.53 ? 241  THR A O     1 
ATOM   2509 C  CB    . THR C 3 241 ? 109.344 66.594  47.974 1.00 31.95 ? 241  THR A CB    1 
ATOM   2510 O  OG1   . THR C 3 241 ? 108.025 66.724  48.519 1.00 33.34 ? 241  THR A OG1   1 
ATOM   2511 C  CG2   . THR C 3 241 ? 109.777 65.138  48.054 1.00 31.69 ? 241  THR A CG2   1 
ATOM   2512 N  N     . GLY C 3 242 ? 112.632 66.771  48.669 1.00 33.11 ? 242  GLY A N     1 
ATOM   2513 C  CA    . GLY C 3 242 ? 113.953 66.663  48.072 1.00 32.57 ? 242  GLY A CA    1 
ATOM   2514 C  C     . GLY C 3 242 ? 114.901 67.805  48.363 1.00 32.67 ? 242  GLY A C     1 
ATOM   2515 O  O     . GLY C 3 242 ? 116.106 67.676  48.145 1.00 34.02 ? 242  GLY A O     1 
ATOM   2516 N  N     . GLU C 3 243 ? 114.376 68.928  48.841 1.00 31.36 ? 243  GLU A N     1 
ATOM   2517 C  CA    . GLU C 3 243 ? 115.222 70.068  49.160 1.00 32.23 ? 243  GLU A CA    1 
ATOM   2518 C  C     . GLU C 3 243 ? 115.755 69.902  50.579 1.00 32.51 ? 243  GLU A C     1 
ATOM   2519 O  O     . GLU C 3 243 ? 115.295 69.030  51.316 1.00 31.92 ? 243  GLU A O     1 
ATOM   2520 C  CB    . GLU C 3 243 ? 114.439 71.376  49.009 1.00 34.32 ? 243  GLU A CB    1 
ATOM   2521 C  CG    . GLU C 3 243 ? 114.065 71.682  47.555 1.00 37.18 ? 243  GLU A CG    1 
ATOM   2522 C  CD    . GLU C 3 243 ? 113.261 72.964  47.394 1.00 39.82 ? 243  GLU A CD    1 
ATOM   2523 O  OE1   . GLU C 3 243 ? 113.718 74.029  47.862 1.00 40.48 ? 243  GLU A OE1   1 
ATOM   2524 O  OE2   . GLU C 3 243 ? 112.169 72.906  46.788 1.00 42.75 ? 243  GLU A OE2   1 
ATOM   2525 N  N     . LYS C 3 244 ? 116.724 70.732  50.950 1.00 33.24 ? 244  LYS A N     1 
ATOM   2526 C  CA    . LYS C 3 244 ? 117.353 70.661  52.268 1.00 35.50 ? 244  LYS A CA    1 
ATOM   2527 C  C     . LYS C 3 244 ? 116.619 71.477  53.327 1.00 33.88 ? 244  LYS A C     1 
ATOM   2528 O  O     . LYS C 3 244 ? 116.153 72.584  53.059 1.00 34.48 ? 244  LYS A O     1 
ATOM   2529 C  CB    . LYS C 3 244 ? 118.799 71.168  52.180 1.00 39.19 ? 244  LYS A CB    1 
ATOM   2530 C  CG    . LYS C 3 244 ? 119.569 70.680  50.958 1.00 44.30 ? 244  LYS A CG    1 
ATOM   2531 C  CD    . LYS C 3 244 ? 120.149 69.288  51.146 1.00 48.28 ? 244  LYS A CD    1 
ATOM   2532 C  CE    . LYS C 3 244 ? 121.321 69.312  52.125 1.00 51.33 ? 244  LYS A CE    1 
ATOM   2533 N  NZ    . LYS C 3 244 ? 122.364 70.302  51.735 1.00 52.52 ? 244  LYS A NZ    1 
ATOM   2534 N  N     . CYS C 3 245 ? 116.518 70.922  54.530 1.00 32.53 ? 245  CYS A N     1 
ATOM   2535 C  CA    . CYS C 3 245 ? 115.876 71.613  55.641 1.00 29.97 ? 245  CYS A CA    1 
ATOM   2536 C  C     . CYS C 3 245 ? 116.767 72.802  55.989 1.00 31.97 ? 245  CYS A C     1 
ATOM   2537 O  O     . CYS C 3 245 ? 117.990 72.668  56.042 1.00 30.96 ? 245  CYS A O     1 
ATOM   2538 C  CB    . CYS C 3 245 ? 115.754 70.675  56.845 1.00 28.15 ? 245  CYS A CB    1 
ATOM   2539 S  SG    . CYS C 3 245 ? 115.250 71.485  58.369 1.00 25.96 ? 245  CYS A SG    1 
ATOM   2540 N  N     . SER C 3 246 ? 116.161 73.961  56.223 1.00 31.43 ? 246  SER A N     1 
ATOM   2541 C  CA    . SER C 3 246 ? 116.924 75.164  56.542 1.00 33.67 ? 246  SER A CA    1 
ATOM   2542 C  C     . SER C 3 246 ? 117.554 75.158  57.933 1.00 34.19 ? 246  SER A C     1 
ATOM   2543 O  O     . SER C 3 246 ? 118.391 76.008  58.237 1.00 35.40 ? 246  SER A O     1 
ATOM   2544 C  CB    . SER C 3 246 ? 116.037 76.403  56.401 1.00 34.65 ? 246  SER A CB    1 
ATOM   2545 O  OG    . SER C 3 246 ? 115.024 76.407  57.390 1.00 36.24 ? 246  SER A OG    1 
ATOM   2546 N  N     . ARG C 3 247 ? 117.156 74.213  58.779 1.00 33.68 ? 247  ARG A N     1 
ATOM   2547 C  CA    . ARG C 3 247 ? 117.707 74.140  60.128 1.00 34.40 ? 247  ARG A CA    1 
ATOM   2548 C  C     . ARG C 3 247 ? 118.840 73.138  60.283 1.00 34.52 ? 247  ARG A C     1 
ATOM   2549 O  O     . ARG C 3 247 ? 119.898 73.471  60.818 1.00 36.52 ? 247  ARG A O     1 
ATOM   2550 C  CB    . ARG C 3 247 ? 116.616 73.802  61.152 1.00 33.84 ? 247  ARG A CB    1 
ATOM   2551 C  CG    . ARG C 3 247 ? 115.777 74.985  61.592 1.00 33.82 ? 247  ARG A CG    1 
ATOM   2552 C  CD    . ARG C 3 247 ? 114.822 74.596  62.715 1.00 32.25 ? 247  ARG A CD    1 
ATOM   2553 N  NE    . ARG C 3 247 ? 114.063 73.399  62.367 1.00 32.26 ? 247  ARG A NE    1 
ATOM   2554 C  CZ    . ARG C 3 247 ? 112.789 73.199  62.687 1.00 28.21 ? 247  ARG A CZ    1 
ATOM   2555 N  NH1   . ARG C 3 247 ? 112.121 74.122  63.368 1.00 26.22 ? 247  ARG A NH1   1 
ATOM   2556 N  NH2   . ARG C 3 247 ? 112.185 72.079  62.319 1.00 27.07 ? 247  ARG A NH2   1 
ATOM   2557 N  N     . CYS C 3 248 ? 118.626 71.914  59.815 1.00 33.51 ? 248  CYS A N     1 
ATOM   2558 C  CA    . CYS C 3 248 ? 119.637 70.874  59.965 1.00 32.63 ? 248  CYS A CA    1 
ATOM   2559 C  C     . CYS C 3 248 ? 120.326 70.454  58.676 1.00 33.10 ? 248  CYS A C     1 
ATOM   2560 O  O     . CYS C 3 248 ? 121.449 69.951  58.711 1.00 34.15 ? 248  CYS A O     1 
ATOM   2561 C  CB    . CYS C 3 248 ? 119.018 69.643  60.619 1.00 31.60 ? 248  CYS A CB    1 
ATOM   2562 S  SG    . CYS C 3 248 ? 117.939 68.719  59.525 1.00 27.03 ? 248  CYS A SG    1 
ATOM   2563 N  N     . GLY C 3 249 ? 119.653 70.634  57.544 1.00 32.17 ? 249  GLY A N     1 
ATOM   2564 C  CA    . GLY C 3 249 ? 120.250 70.266  56.275 1.00 30.20 ? 249  GLY A CA    1 
ATOM   2565 C  C     . GLY C 3 249 ? 119.802 68.939  55.698 1.00 29.96 ? 249  GLY A C     1 
ATOM   2566 O  O     . GLY C 3 249 ? 120.225 68.577  54.605 1.00 31.28 ? 249  GLY A O     1 
ATOM   2567 N  N     . ALA C 3 250 ? 118.959 68.202  56.416 1.00 28.72 ? 250  ALA A N     1 
ATOM   2568 C  CA    . ALA C 3 250 ? 118.474 66.921  55.907 1.00 28.02 ? 250  ALA A CA    1 
ATOM   2569 C  C     . ALA C 3 250 ? 117.457 67.178  54.796 1.00 28.56 ? 250  ALA A C     1 
ATOM   2570 O  O     . ALA C 3 250 ? 116.853 68.250  54.743 1.00 29.39 ? 250  ALA A O     1 
ATOM   2571 C  CB    . ALA C 3 250 ? 117.828 66.116  57.024 1.00 26.95 ? 250  ALA A CB    1 
ATOM   2572 N  N     . GLU C 3 251 ? 117.269 66.203  53.913 1.00 27.93 ? 251  GLU A N     1 
ATOM   2573 C  CA    . GLU C 3 251 ? 116.313 66.360  52.820 1.00 29.62 ? 251  GLU A CA    1 
ATOM   2574 C  C     . GLU C 3 251 ? 114.874 66.258  53.292 1.00 28.65 ? 251  GLU A C     1 
ATOM   2575 O  O     . GLU C 3 251 ? 114.516 65.346  54.036 1.00 28.00 ? 251  GLU A O     1 
ATOM   2576 C  CB    . GLU C 3 251 ? 116.524 65.306  51.732 1.00 31.05 ? 251  GLU A CB    1 
ATOM   2577 C  CG    . GLU C 3 251 ? 117.638 65.612  50.759 1.00 34.85 ? 251  GLU A CG    1 
ATOM   2578 C  CD    . GLU C 3 251 ? 117.518 64.808  49.478 1.00 34.20 ? 251  GLU A CD    1 
ATOM   2579 O  OE1   . GLU C 3 251 ? 118.424 64.913  48.630 1.00 37.02 ? 251  GLU A OE1   1 
ATOM   2580 O  OE2   . GLU C 3 251 ? 116.516 64.075  49.315 1.00 35.71 ? 251  GLU A OE2   1 
ATOM   2581 N  N     . ILE C 3 252 ? 114.049 67.196  52.848 1.00 28.08 ? 252  ILE A N     1 
ATOM   2582 C  CA    . ILE C 3 252 ? 112.641 67.177  53.207 1.00 27.11 ? 252  ILE A CA    1 
ATOM   2583 C  C     . ILE C 3 252 ? 112.002 65.991  52.497 1.00 27.68 ? 252  ILE A C     1 
ATOM   2584 O  O     . ILE C 3 252 ? 112.206 65.787  51.295 1.00 29.11 ? 252  ILE A O     1 
ATOM   2585 C  CB    . ILE C 3 252 ? 111.936 68.480  52.768 1.00 25.82 ? 252  ILE A CB    1 
ATOM   2586 C  CG1   . ILE C 3 252 ? 112.527 69.670  53.530 1.00 25.48 ? 252  ILE A CG1   1 
ATOM   2587 C  CG2   . ILE C 3 252 ? 110.431 68.366  52.993 1.00 25.06 ? 252  ILE A CG2   1 
ATOM   2588 C  CD1   . ILE C 3 252 ? 112.475 69.528  55.052 1.00 27.04 ? 252  ILE A CD1   1 
ATOM   2589 N  N     . GLN C 3 253 ? 111.233 65.207  53.244 1.00 25.97 ? 253  GLN A N     1 
ATOM   2590 C  CA    . GLN C 3 253 ? 110.557 64.038  52.697 1.00 26.77 ? 253  GLN A CA    1 
ATOM   2591 C  C     . GLN C 3 253 ? 109.058 64.293  52.569 1.00 27.65 ? 253  GLN A C     1 
ATOM   2592 O  O     . GLN C 3 253 ? 108.512 65.182  53.223 1.00 27.05 ? 253  GLN A O     1 
ATOM   2593 C  CB    . GLN C 3 253 ? 110.753 62.832  53.618 1.00 28.59 ? 253  GLN A CB    1 
ATOM   2594 C  CG    . GLN C 3 253 ? 112.198 62.441  53.897 1.00 32.08 ? 253  GLN A CG    1 
ATOM   2595 C  CD    . GLN C 3 253 ? 112.904 61.889  52.679 1.00 34.99 ? 253  GLN A CD    1 
ATOM   2596 O  OE1   . GLN C 3 253 ? 112.272 61.316  51.794 1.00 38.44 ? 253  GLN A OE1   1 
ATOM   2597 N  NE2   . GLN C 3 253 ? 114.227 62.038  52.636 1.00 37.39 ? 253  GLN A NE2   1 
ATOM   2598 N  N     . LYS C 3 254 ? 108.399 63.508  51.726 1.00 26.97 ? 254  LYS A N     1 
ATOM   2599 C  CA    . LYS C 3 254 ? 106.955 63.623  51.560 1.00 27.93 ? 254  LYS A CA    1 
ATOM   2600 C  C     . LYS C 3 254 ? 106.327 62.251  51.721 1.00 28.43 ? 254  LYS A C     1 
ATOM   2601 O  O     . LYS C 3 254 ? 106.791 61.274  51.130 1.00 29.47 ? 254  LYS A O     1 
ATOM   2602 C  CB    . LYS C 3 254 ? 106.584 64.185  50.184 1.00 29.18 ? 254  LYS A CB    1 
ATOM   2603 C  CG    . LYS C 3 254 ? 105.069 64.219  49.955 1.00 27.94 ? 254  LYS A CG    1 
ATOM   2604 C  CD    . LYS C 3 254 ? 104.684 64.854  48.625 1.00 29.87 ? 254  LYS A CD    1 
ATOM   2605 C  CE    . LYS C 3 254 ? 103.162 64.889  48.469 1.00 27.25 ? 254  LYS A CE    1 
ATOM   2606 N  NZ    . LYS C 3 254 ? 102.737 65.491  47.171 1.00 28.18 ? 254  LYS A NZ    1 
ATOM   2607 N  N     . ILE C 3 255 ? 105.288 62.173  52.546 1.00 26.90 ? 255  ILE A N     1 
ATOM   2608 C  CA    . ILE C 3 255 ? 104.578 60.922  52.769 1.00 26.56 ? 255  ILE A CA    1 
ATOM   2609 C  C     . ILE C 3 255 ? 103.083 61.203  52.740 1.00 26.77 ? 255  ILE A C     1 
ATOM   2610 O  O     . ILE C 3 255 ? 102.667 62.348  52.556 1.00 26.52 ? 255  ILE A O     1 
ATOM   2611 C  CB    . ILE C 3 255 ? 104.923 60.290  54.141 1.00 27.21 ? 255  ILE A CB    1 
ATOM   2612 C  CG1   . ILE C 3 255 ? 104.548 61.251  55.274 1.00 26.55 ? 255  ILE A CG1   1 
ATOM   2613 C  CG2   . ILE C 3 255 ? 106.404 59.943  54.195 1.00 26.69 ? 255  ILE A CG2   1 
ATOM   2614 C  CD1   . ILE C 3 255 ? 104.697 60.644  56.662 1.00 27.85 ? 255  ILE A CD1   1 
ATOM   2615 N  N     . LYS C 3 256 ? 102.286 60.153  52.904 1.00 26.86 ? 256  LYS A N     1 
ATOM   2616 C  CA    . LYS C 3 256 ? 100.833 60.286  52.933 1.00 29.13 ? 256  LYS A CA    1 
ATOM   2617 C  C     . LYS C 3 256 ? 100.348 60.039  54.350 1.00 28.69 ? 256  LYS A C     1 
ATOM   2618 O  O     . LYS C 3 256 ? 100.691 59.032  54.962 1.00 28.66 ? 256  LYS A O     1 
ATOM   2619 C  CB    . LYS C 3 256 ? 100.161 59.274  52.002 1.00 32.42 ? 256  LYS A CB    1 
ATOM   2620 C  CG    . LYS C 3 256 ? 99.762  59.825  50.650 1.00 37.83 ? 256  LYS A CG    1 
ATOM   2621 C  CD    . LYS C 3 256 ? 98.876  58.836  49.902 1.00 41.36 ? 256  LYS A CD    1 
ATOM   2622 C  CE    . LYS C 3 256 ? 98.334  59.440  48.615 1.00 43.42 ? 256  LYS A CE    1 
ATOM   2623 N  NZ    . LYS C 3 256 ? 97.519  60.660  48.886 1.00 45.61 ? 256  LYS A NZ    1 
ATOM   2624 N  N     . VAL C 3 257 ? 99.558  60.969  54.871 1.00 27.40 ? 257  VAL A N     1 
ATOM   2625 C  CA    . VAL C 3 257 ? 99.010  60.843  56.213 1.00 25.55 ? 257  VAL A CA    1 
ATOM   2626 C  C     . VAL C 3 257 ? 97.516  61.118  56.132 1.00 26.94 ? 257  VAL A C     1 
ATOM   2627 O  O     . VAL C 3 257 ? 97.098  62.221  55.776 1.00 26.43 ? 257  VAL A O     1 
ATOM   2628 C  CB    . VAL C 3 257 ? 99.661  61.846  57.188 1.00 25.28 ? 257  VAL A CB    1 
ATOM   2629 C  CG1   . VAL C 3 257 ? 98.972  61.765  58.552 1.00 24.73 ? 257  VAL A CG1   1 
ATOM   2630 C  CG2   . VAL C 3 257 ? 101.152 61.545  57.329 1.00 23.81 ? 257  VAL A CG2   1 
ATOM   2631 N  N     . ALA C 3 258 ? 96.719  60.106  56.454 1.00 27.00 ? 258  ALA A N     1 
ATOM   2632 C  CA    . ALA C 3 258 ? 95.264  60.220  56.410 1.00 29.16 ? 258  ALA A CA    1 
ATOM   2633 C  C     . ALA C 3 258 ? 94.803  60.751  55.054 1.00 29.47 ? 258  ALA A C     1 
ATOM   2634 O  O     . ALA C 3 258 ? 93.874  61.559  54.970 1.00 29.94 ? 258  ALA A O     1 
ATOM   2635 C  CB    . ALA C 3 258 ? 94.767  61.127  57.537 1.00 29.06 ? 258  ALA A CB    1 
ATOM   2636 N  N     . GLY C 3 259 ? 95.473  60.302  53.996 1.00 29.06 ? 259  GLY A N     1 
ATOM   2637 C  CA    . GLY C 3 259 ? 95.109  60.707  52.650 1.00 27.96 ? 259  GLY A CA    1 
ATOM   2638 C  C     . GLY C 3 259 ? 95.625  62.044  52.156 1.00 26.08 ? 259  GLY A C     1 
ATOM   2639 O  O     . GLY C 3 259 ? 95.312  62.445  51.032 1.00 28.72 ? 259  GLY A O     1 
ATOM   2640 N  N     . ARG C 3 260 ? 96.415  62.740  52.967 1.00 23.36 ? 260  ARG A N     1 
ATOM   2641 C  CA    . ARG C 3 260 ? 96.937  64.040  52.561 1.00 22.44 ? 260  ARG A CA    1 
ATOM   2642 C  C     . ARG C 3 260 ? 98.444  64.050  52.337 1.00 22.09 ? 260  ARG A C     1 
ATOM   2643 O  O     . ARG C 3 260 ? 99.187  63.396  53.067 1.00 24.20 ? 260  ARG A O     1 
ATOM   2644 C  CB    . ARG C 3 260 ? 96.584  65.098  53.615 1.00 22.27 ? 260  ARG A CB    1 
ATOM   2645 C  CG    . ARG C 3 260 ? 95.091  65.220  53.900 1.00 21.56 ? 260  ARG A CG    1 
ATOM   2646 C  CD    . ARG C 3 260 ? 94.310  65.545  52.633 1.00 21.89 ? 260  ARG A CD    1 
ATOM   2647 N  NE    . ARG C 3 260 ? 94.631  66.867  52.098 1.00 19.19 ? 260  ARG A NE    1 
ATOM   2648 C  CZ    . ARG C 3 260 ? 94.154  68.010  52.584 1.00 20.29 ? 260  ARG A CZ    1 
ATOM   2649 N  NH1   . ARG C 3 260 ? 93.328  68.001  53.627 1.00 17.87 ? 260  ARG A NH1   1 
ATOM   2650 N  NH2   . ARG C 3 260 ? 94.492  69.163  52.016 1.00 17.80 ? 260  ARG A NH2   1 
ATOM   2651 N  N     . GLY C 3 261 ? 98.883  64.792  51.321 1.00 22.07 ? 261  GLY A N     1 
ATOM   2652 C  CA    . GLY C 3 261 ? 100.305 64.908  51.041 1.00 21.54 ? 261  GLY A CA    1 
ATOM   2653 C  C     . GLY C 3 261 ? 100.915 65.573  52.258 1.00 22.21 ? 261  GLY A C     1 
ATOM   2654 O  O     . GLY C 3 261 ? 100.403 66.589  52.726 1.00 19.63 ? 261  GLY A O     1 
ATOM   2655 N  N     . THR C 3 262 ? 102.014 65.020  52.765 1.00 22.95 ? 262  THR A N     1 
ATOM   2656 C  CA    . THR C 3 262 ? 102.633 65.545  53.976 1.00 21.98 ? 262  THR A CA    1 
ATOM   2657 C  C     . THR C 3 262 ? 104.145 65.719  53.852 1.00 23.43 ? 262  THR A C     1 
ATOM   2658 O  O     . THR C 3 262 ? 104.870 64.759  53.588 1.00 23.18 ? 262  THR A O     1 
ATOM   2659 C  CB    . THR C 3 262 ? 102.318 64.603  55.149 1.00 22.04 ? 262  THR A CB    1 
ATOM   2660 O  OG1   . THR C 3 262 ? 100.899 64.418  55.228 1.00 21.85 ? 262  THR A OG1   1 
ATOM   2661 C  CG2   . THR C 3 262 ? 102.831 65.170  56.460 1.00 21.22 ? 262  THR A CG2   1 
ATOM   2662 N  N     . HIS C 3 263 ? 104.608 66.947  54.060 1.00 22.03 ? 263  HIS A N     1 
ATOM   2663 C  CA    . HIS C 3 263 ? 106.024 67.280  53.950 1.00 23.95 ? 263  HIS A CA    1 
ATOM   2664 C  C     . HIS C 3 263 ? 106.652 67.516  55.321 1.00 24.88 ? 263  HIS A C     1 
ATOM   2665 O  O     . HIS C 3 263 ? 106.103 68.255  56.140 1.00 23.69 ? 263  HIS A O     1 
ATOM   2666 C  CB    . HIS C 3 263 ? 106.179 68.531  53.084 1.00 23.37 ? 263  HIS A CB    1 
ATOM   2667 C  CG    . HIS C 3 263 ? 105.382 68.482  51.817 1.00 26.66 ? 263  HIS A CG    1 
ATOM   2668 N  ND1   . HIS C 3 263 ? 104.005 68.562  51.803 1.00 26.92 ? 263  HIS A ND1   1 
ATOM   2669 C  CD2   . HIS C 3 263 ? 105.761 68.298  50.530 1.00 27.43 ? 263  HIS A CD2   1 
ATOM   2670 C  CE1   . HIS C 3 263 ? 103.571 68.425  50.562 1.00 29.89 ? 263  HIS A CE1   1 
ATOM   2671 N  NE2   . HIS C 3 263 ? 104.616 68.263  49.770 1.00 28.17 ? 263  HIS A NE2   1 
ATOM   2672 N  N     . PHE C 3 264 ? 107.813 66.912  55.568 1.00 24.47 ? 264  PHE A N     1 
ATOM   2673 C  CA    . PHE C 3 264 ? 108.462 67.075  56.868 1.00 24.21 ? 264  PHE A CA    1 
ATOM   2674 C  C     . PHE C 3 264 ? 109.960 66.759  56.833 1.00 25.86 ? 264  PHE A C     1 
ATOM   2675 O  O     . PHE C 3 264 ? 110.443 66.113  55.899 1.00 24.57 ? 264  PHE A O     1 
ATOM   2676 C  CB    . PHE C 3 264 ? 107.787 66.149  57.886 1.00 22.82 ? 264  PHE A CB    1 
ATOM   2677 C  CG    . PHE C 3 264 ? 108.153 64.696  57.713 1.00 27.02 ? 264  PHE A CG    1 
ATOM   2678 C  CD1   . PHE C 3 264 ? 109.066 64.087  58.572 1.00 27.07 ? 264  PHE A CD1   1 
ATOM   2679 C  CD2   . PHE C 3 264 ? 107.622 63.949  56.661 1.00 27.53 ? 264  PHE A CD2   1 
ATOM   2680 C  CE1   . PHE C 3 264 ? 109.448 62.755  58.385 1.00 25.94 ? 264  PHE A CE1   1 
ATOM   2681 C  CE2   . PHE C 3 264 ? 107.997 62.619  56.464 1.00 28.37 ? 264  PHE A CE2   1 
ATOM   2682 C  CZ    . PHE C 3 264 ? 108.913 62.022  57.329 1.00 27.95 ? 264  PHE A CZ    1 
ATOM   2683 N  N     . CYS C 3 265 ? 110.682 67.231  57.850 1.00 25.97 ? 265  CYS A N     1 
ATOM   2684 C  CA    . CYS C 3 265 ? 112.113 66.952  57.989 1.00 25.28 ? 265  CYS A CA    1 
ATOM   2685 C  C     . CYS C 3 265 ? 112.219 65.793  58.984 1.00 25.30 ? 265  CYS A C     1 
ATOM   2686 O  O     . CYS C 3 265 ? 111.810 65.922  60.142 1.00 22.76 ? 265  CYS A O     1 
ATOM   2687 C  CB    . CYS C 3 265 ? 112.874 68.162  58.539 1.00 24.49 ? 265  CYS A CB    1 
ATOM   2688 S  SG    . CYS C 3 265 ? 114.622 67.800  58.992 1.00 24.27 ? 265  CYS A SG    1 
ATOM   2689 N  N     . PRO C 3 266 ? 112.762 64.645  58.540 1.00 24.99 ? 266  PRO A N     1 
ATOM   2690 C  CA    . PRO C 3 266 ? 112.929 63.443  59.364 1.00 25.74 ? 266  PRO A CA    1 
ATOM   2691 C  C     . PRO C 3 266 ? 113.859 63.623  60.565 1.00 24.97 ? 266  PRO A C     1 
ATOM   2692 O  O     . PRO C 3 266 ? 113.832 62.825  61.497 1.00 27.44 ? 266  PRO A O     1 
ATOM   2693 C  CB    . PRO C 3 266 ? 113.473 62.410  58.374 1.00 25.51 ? 266  PRO A CB    1 
ATOM   2694 C  CG    . PRO C 3 266 ? 113.025 62.914  57.041 1.00 25.67 ? 266  PRO A CG    1 
ATOM   2695 C  CD    . PRO C 3 266 ? 113.234 64.397  57.169 1.00 25.99 ? 266  PRO A CD    1 
ATOM   2696 N  N     . VAL C 3 267 ? 114.688 64.657  60.535 1.00 25.26 ? 267  VAL A N     1 
ATOM   2697 C  CA    . VAL C 3 267 ? 115.609 64.920  61.636 1.00 26.07 ? 267  VAL A CA    1 
ATOM   2698 C  C     . VAL C 3 267 ? 114.949 65.820  62.682 1.00 26.34 ? 267  VAL A C     1 
ATOM   2699 O  O     . VAL C 3 267 ? 114.881 65.475  63.862 1.00 25.59 ? 267  VAL A O     1 
ATOM   2700 C  CB    . VAL C 3 267 ? 116.908 65.597  61.121 1.00 25.35 ? 267  VAL A CB    1 
ATOM   2701 C  CG1   . VAL C 3 267 ? 117.745 66.100  62.290 1.00 24.34 ? 267  VAL A CG1   1 
ATOM   2702 C  CG2   . VAL C 3 267 ? 117.713 64.598  60.294 1.00 25.29 ? 267  VAL A CG2   1 
ATOM   2703 N  N     . CYS C 3 268 ? 114.455 66.968  62.233 1.00 27.11 ? 268  CYS A N     1 
ATOM   2704 C  CA    . CYS C 3 268 ? 113.805 67.930  63.114 1.00 26.90 ? 268  CYS A CA    1 
ATOM   2705 C  C     . CYS C 3 268 ? 112.476 67.439  63.685 1.00 26.78 ? 268  CYS A C     1 
ATOM   2706 O  O     . CYS C 3 268 ? 112.068 67.858  64.769 1.00 26.74 ? 268  CYS A O     1 
ATOM   2707 C  CB    . CYS C 3 268 ? 113.574 69.244  62.365 1.00 27.30 ? 268  CYS A CB    1 
ATOM   2708 S  SG    . CYS C 3 268 ? 115.077 70.169  61.986 1.00 28.38 ? 268  CYS A SG    1 
ATOM   2709 N  N     . GLN C 3 269 ? 111.803 66.554  62.957 1.00 25.24 ? 269  GLN A N     1 
ATOM   2710 C  CA    . GLN C 3 269 ? 110.517 66.029  63.395 1.00 26.58 ? 269  GLN A CA    1 
ATOM   2711 C  C     . GLN C 3 269 ? 110.597 64.523  63.641 1.00 27.61 ? 269  GLN A C     1 
ATOM   2712 O  O     . GLN C 3 269 ? 110.150 63.725  62.820 1.00 26.95 ? 269  GLN A O     1 
ATOM   2713 C  CB    . GLN C 3 269 ? 109.447 66.359  62.340 1.00 24.25 ? 269  GLN A CB    1 
ATOM   2714 C  CG    . GLN C 3 269 ? 109.181 67.863  62.203 1.00 24.12 ? 269  GLN A CG    1 
ATOM   2715 C  CD    . GLN C 3 269 ? 108.413 68.230  60.940 1.00 24.73 ? 269  GLN A CD    1 
ATOM   2716 O  OE1   . GLN C 3 269 ? 109.006 68.552  59.906 1.00 23.35 ? 269  GLN A OE1   1 
ATOM   2717 N  NE2   . GLN C 3 269 ? 107.088 68.172  61.015 1.00 21.49 ? 269  GLN A NE2   1 
ATOM   2718 N  N     . GLN C 3 270 ? 111.174 64.147  64.781 1.00 28.88 ? 270  GLN A N     1 
ATOM   2719 C  CA    . GLN C 3 270 ? 111.335 62.741  65.144 1.00 30.73 ? 270  GLN A CA    1 
ATOM   2720 C  C     . GLN C 3 270 ? 110.003 62.035  65.334 1.00 32.93 ? 270  GLN A C     1 
ATOM   2721 O  O     . GLN C 3 270 ? 109.121 62.528  66.035 1.00 30.56 ? 270  GLN A O     1 
ATOM   2722 C  CB    . GLN C 3 270 ? 112.170 62.612  66.422 1.00 29.75 ? 270  GLN A CB    1 
ATOM   2723 C  CG    . GLN C 3 270 ? 113.636 62.986  66.252 1.00 30.68 ? 270  GLN A CG    1 
ATOM   2724 C  CD    . GLN C 3 270 ? 114.356 62.082  65.268 1.00 30.75 ? 270  GLN A CD    1 
ATOM   2725 O  OE1   . GLN C 3 270 ? 114.393 60.862  65.438 1.00 31.72 ? 270  GLN A OE1   1 
ATOM   2726 N  NE2   . GLN C 3 270 ? 114.937 62.678  64.233 1.00 30.66 ? 270  GLN A NE2   1 
ATOM   2727 N  N     . LYS C 3 271 ? 109.874 60.868  64.708 1.00 37.15 ? 271  LYS A N     1 
ATOM   2728 C  CA    . LYS C 3 271 ? 108.655 60.075  64.786 1.00 41.68 ? 271  LYS A CA    1 
ATOM   2729 C  C     . LYS C 3 271 ? 108.517 59.415  66.155 1.00 44.15 ? 271  LYS A C     1 
ATOM   2730 O  O     . LYS C 3 271 ? 107.412 59.484  66.739 1.00 45.19 ? 271  LYS A O     1 
ATOM   2731 C  CB    . LYS C 3 271 ? 108.652 59.008  63.687 1.00 41.75 ? 271  LYS A CB    1 
ATOM   2732 C  CG    . LYS C 3 271 ? 107.321 58.293  63.536 1.00 44.64 ? 271  LYS A CG    1 
ATOM   2733 C  CD    . LYS C 3 271 ? 107.325 57.331  62.362 1.00 46.51 ? 271  LYS A CD    1 
ATOM   2734 C  CE    . LYS C 3 271 ? 105.965 56.663  62.203 1.00 48.36 ? 271  LYS A CE    1 
ATOM   2735 N  NZ    . LYS C 3 271 ? 105.938 55.694  61.071 1.00 49.72 ? 271  LYS A NZ    1 
ATOM   2736 O  OXT   . LYS C 3 271 ? 109.516 58.828  66.622 1.00 47.59 ? 271  LYS A OXT   1 
HETATM 2737 ZN ZN    . ZN  D 4 .   ? 115.642 69.575  59.768 1.00 27.98 ? 300  ZN  A ZN    1 
HETATM 2738 C  C1    . GOL E 5 .   ? 84.325  98.646  42.586 1.00 57.29 ? 1002 GOL A C1    1 
HETATM 2739 O  O1    . GOL E 5 .   ? 83.420  98.486  43.905 1.00 58.19 ? 1002 GOL A O1    1 
HETATM 2740 C  C2    . GOL E 5 .   ? 84.182  97.902  41.416 1.00 57.91 ? 1002 GOL A C2    1 
HETATM 2741 O  O2    . GOL E 5 .   ? 82.969  98.082  40.862 1.00 56.81 ? 1002 GOL A O2    1 
HETATM 2742 C  C3    . GOL E 5 .   ? 85.192  97.280  41.212 1.00 56.97 ? 1002 GOL A C3    1 
HETATM 2743 O  O3    . GOL E 5 .   ? 86.637  96.723  41.401 1.00 60.30 ? 1002 GOL A O3    1 
HETATM 2744 C  C1    . GOL F 5 .   ? 91.770  64.002  50.308 1.00 57.22 ? 1003 GOL A C1    1 
HETATM 2745 O  O1    . GOL F 5 .   ? 91.878  62.910  51.490 1.00 56.32 ? 1003 GOL A O1    1 
HETATM 2746 C  C2    . GOL F 5 .   ? 91.675  63.727  48.941 1.00 58.56 ? 1003 GOL A C2    1 
HETATM 2747 O  O2    . GOL F 5 .   ? 90.655  64.394  48.375 1.00 58.71 ? 1003 GOL A O2    1 
HETATM 2748 C  C3    . GOL F 5 .   ? 92.546  62.953  48.619 1.00 58.97 ? 1003 GOL A C3    1 
HETATM 2749 O  O3    . GOL F 5 .   ? 93.780  62.001  48.727 1.00 60.36 ? 1003 GOL A O3    1 
HETATM 2750 C  C1    A GOL G 5 .   ? 81.321  73.903  53.502 0.70 30.49 ? 1004 GOL A C1    1 
HETATM 2751 C  C1    B GOL G 5 .   ? 81.032  74.772  54.014 0.30 10.09 ? 1004 GOL A C1    1 
HETATM 2752 O  O1    A GOL G 5 .   ? 81.753  74.823  52.256 0.70 25.47 ? 1004 GOL A O1    1 
HETATM 2753 O  O1    B GOL G 5 .   ? 80.794  74.056  55.438 0.30 13.17 ? 1004 GOL A O1    1 
HETATM 2754 C  C2    A GOL G 5 .   ? 80.058  73.330  53.669 0.70 30.65 ? 1004 GOL A C2    1 
HETATM 2755 C  C2    B GOL G 5 .   ? 80.315  74.531  52.841 0.30 13.07 ? 1004 GOL A C2    1 
HETATM 2756 O  O2    A GOL G 5 .   ? 80.091  71.997  53.545 0.70 33.10 ? 1004 GOL A O2    1 
HETATM 2757 O  O2    B GOL G 5 .   ? 81.144  74.437  51.779 0.30 7.51  ? 1004 GOL A O2    1 
HETATM 2758 C  C3    A GOL G 5 .   ? 79.267  74.200  53.870 0.70 31.88 ? 1004 GOL A C3    1 
HETATM 2759 C  C3    B GOL G 5 .   ? 79.126  74.465  53.092 0.30 9.47  ? 1004 GOL A C3    1 
HETATM 2760 O  O3    A GOL G 5 .   ? 78.710  75.630  54.074 0.70 35.32 ? 1004 GOL A O3    1 
HETATM 2761 O  O3    B GOL G 5 .   ? 77.791  74.473  53.916 0.30 9.27  ? 1004 GOL A O3    1 
HETATM 2762 O  O     . HOH H 6 .   ? 94.092  67.240  48.040 1.00 26.28 ? 23   HOH D O     1 
HETATM 2763 O  O     . HOH H 6 .   ? 90.859  71.053  56.789 1.00 22.55 ? 47   HOH D O     1 
HETATM 2764 O  O     . HOH H 6 .   ? 83.358  68.378  58.356 1.00 33.24 ? 68   HOH D O     1 
HETATM 2765 O  O     . HOH H 6 .   ? 78.517  56.869  60.131 1.00 37.40 ? 76   HOH D O     1 
HETATM 2766 O  O     . HOH H 6 .   ? 91.035  61.635  41.199 1.00 44.19 ? 85   HOH D O     1 
HETATM 2767 O  O     . HOH H 6 .   ? 88.814  64.062  56.581 1.00 31.43 ? 86   HOH D O     1 
HETATM 2768 O  O     . HOH H 6 .   ? 91.427  60.524  36.414 1.00 39.03 ? 92   HOH D O     1 
HETATM 2769 O  O     . HOH H 6 .   ? 100.608 68.119  49.162 1.00 31.10 ? 114  HOH D O     1 
HETATM 2770 O  O     . HOH H 6 .   ? 81.142  70.667  60.474 1.00 34.40 ? 117  HOH D O     1 
HETATM 2771 O  O     . HOH H 6 .   ? 78.037  54.239  61.131 1.00 39.02 ? 123  HOH D O     1 
HETATM 2772 O  O     . HOH H 6 .   ? 84.954  72.129  59.459 1.00 38.05 ? 166  HOH D O     1 
HETATM 2773 O  O     . HOH H 6 .   ? 82.602  66.021  59.497 1.00 52.24 ? 192  HOH D O     1 
HETATM 2774 O  O     . HOH H 6 .   ? 85.514  74.547  58.212 1.00 33.78 ? 197  HOH D O     1 
HETATM 2775 O  O     . HOH H 6 .   ? 96.146  61.736  46.036 1.00 38.74 ? 204  HOH D O     1 
HETATM 2776 O  O     . HOH H 6 .   ? 87.389  69.888  56.732 1.00 35.46 ? 206  HOH D O     1 
HETATM 2777 O  O     . HOH H 6 .   ? 81.181  68.452  51.145 1.00 48.49 ? 222  HOH D O     1 
HETATM 2778 O  O     . HOH H 6 .   ? 95.625  64.469  48.376 1.00 47.40 ? 231  HOH D O     1 
HETATM 2779 O  O     . HOH H 6 .   ? 91.068  57.123  33.404 1.00 46.22 ? 236  HOH D O     1 
HETATM 2780 O  O     . HOH H 6 .   ? 89.878  57.587  29.260 1.00 48.08 ? 243  HOH D O     1 
HETATM 2781 O  O     . HOH H 6 .   ? 91.922  59.841  33.794 1.00 47.68 ? 244  HOH D O     1 
HETATM 2782 O  O     . HOH H 6 .   ? 93.989  57.638  42.520 1.00 42.58 ? 246  HOH D O     1 
HETATM 2783 O  O     . HOH H 6 .   ? 76.641  57.212  58.183 1.00 45.08 ? 251  HOH D O     1 
HETATM 2784 O  O     . HOH H 6 .   ? 77.743  68.890  57.835 1.00 53.91 ? 265  HOH D O     1 
HETATM 2785 O  O     . HOH H 6 .   ? 90.119  64.379  44.557 1.00 48.35 ? 275  HOH D O     1 
HETATM 2786 O  O     . HOH I 6 .   ? 89.302  64.541  35.047 1.00 51.99 ? 110  HOH E O     1 
HETATM 2787 O  O     . HOH I 6 .   ? 81.643  68.792  48.531 1.00 35.27 ? 165  HOH E O     1 
HETATM 2788 O  O     . HOH I 6 .   ? 91.894  60.520  59.881 1.00 43.74 ? 173  HOH E O     1 
HETATM 2789 O  O     . HOH I 6 .   ? 78.213  69.639  38.784 1.00 46.23 ? 182  HOH E O     1 
HETATM 2790 O  O     . HOH I 6 .   ? 92.019  71.362  38.143 1.00 43.48 ? 199  HOH E O     1 
HETATM 2791 O  O     . HOH I 6 .   ? 84.049  72.099  33.319 1.00 48.75 ? 200  HOH E O     1 
HETATM 2792 O  O     . HOH I 6 .   ? 90.856  60.479  51.965 1.00 46.32 ? 220  HOH E O     1 
HETATM 2793 O  O     . HOH I 6 .   ? 94.146  59.422  61.158 1.00 45.62 ? 228  HOH E O     1 
HETATM 2794 O  O     . HOH I 6 .   ? 89.044  60.258  59.285 1.00 50.10 ? 229  HOH E O     1 
HETATM 2795 O  O     . HOH I 6 .   ? 88.960  62.475  39.852 1.00 46.60 ? 247  HOH E O     1 
HETATM 2796 O  O     . HOH I 6 .   ? 89.815  62.740  36.696 1.00 39.60 ? 248  HOH E O     1 
HETATM 2797 O  O     . HOH I 6 .   ? 88.676  52.100  60.508 1.00 45.22 ? 252  HOH E O     1 
HETATM 2798 O  O     . HOH I 6 .   ? 80.504  65.024  48.841 1.00 55.53 ? 253  HOH E O     1 
HETATM 2799 O  O     . HOH I 6 .   ? 85.505  66.400  35.952 1.00 48.36 ? 254  HOH E O     1 
HETATM 2800 O  O     . HOH I 6 .   ? 87.538  63.801  38.419 1.00 48.04 ? 267  HOH E O     1 
HETATM 2801 O  O     . HOH I 6 .   ? 89.181  61.692  48.413 1.00 59.72 ? 268  HOH E O     1 
HETATM 2802 O  O     . HOH J 6 .   ? 89.096  76.976  51.635 1.00 19.23 ? 1005 HOH A O     1 
HETATM 2803 O  O     . HOH J 6 .   ? 87.246  74.784  45.141 1.00 18.53 ? 1006 HOH A O     1 
HETATM 2804 O  O     . HOH J 6 .   ? 87.498  79.365  51.775 1.00 17.31 ? 1007 HOH A O     1 
HETATM 2805 O  O     . HOH J 6 .   ? 82.431  80.632  47.586 1.00 18.10 ? 1008 HOH A O     1 
HETATM 2806 O  O     . HOH J 6 .   ? 70.812  76.973  43.953 1.00 20.26 ? 1009 HOH A O     1 
HETATM 2807 O  O     . HOH J 6 .   ? 92.779  74.383  61.848 1.00 20.85 ? 1010 HOH A O     1 
HETATM 2808 O  O     . HOH J 6 .   ? 104.147 68.121  47.109 1.00 27.62 ? 1011 HOH A O     1 
HETATM 2809 O  O     . HOH J 6 .   ? 92.739  71.492  43.952 1.00 21.34 ? 1012 HOH A O     1 
HETATM 2810 O  O     . HOH J 6 .   ? 69.613  81.586  49.008 1.00 22.68 ? 1013 HOH A O     1 
HETATM 2811 O  O     . HOH J 6 .   ? 92.136  65.900  55.367 1.00 22.77 ? 1014 HOH A O     1 
HETATM 2812 O  O     . HOH J 6 .   ? 78.739  78.376  52.020 1.00 20.68 ? 1015 HOH A O     1 
HETATM 2813 O  O     . HOH J 6 .   ? 81.503  82.184  65.266 1.00 24.37 ? 1016 HOH A O     1 
HETATM 2814 O  O     . HOH J 6 .   ? 89.532  77.846  40.212 1.00 25.27 ? 1017 HOH A O     1 
HETATM 2815 O  O     . HOH J 6 .   ? 74.033  74.672  38.435 1.00 25.31 ? 1018 HOH A O     1 
HETATM 2816 O  O     . HOH J 6 .   ? 96.778  66.413  50.197 1.00 22.91 ? 1019 HOH A O     1 
HETATM 2817 O  O     . HOH J 6 .   ? 91.612  71.134  64.738 1.00 23.13 ? 1020 HOH A O     1 
HETATM 2818 O  O     . HOH J 6 .   ? 81.700  76.239  43.102 1.00 18.11 ? 1021 HOH A O     1 
HETATM 2819 O  O     . HOH J 6 .   ? 105.532 69.118  58.645 1.00 20.88 ? 1022 HOH A O     1 
HETATM 2820 O  O     . HOH J 6 .   ? 69.565  90.392  39.990 1.00 26.82 ? 1023 HOH A O     1 
HETATM 2821 O  O     . HOH J 6 .   ? 83.990  94.933  56.869 1.00 25.30 ? 1024 HOH A O     1 
HETATM 2822 O  O     . HOH J 6 .   ? 84.249  74.330  36.750 1.00 22.28 ? 1025 HOH A O     1 
HETATM 2823 O  O     . HOH J 6 .   ? 107.409 76.647  58.912 1.00 23.76 ? 1026 HOH A O     1 
HETATM 2824 O  O     . HOH J 6 .   ? 79.560  80.634  66.585 1.00 24.95 ? 1027 HOH A O     1 
HETATM 2825 O  O     . HOH J 6 .   ? 110.032 61.868  49.945 1.00 28.43 ? 1028 HOH A O     1 
HETATM 2826 O  O     . HOH J 6 .   ? 74.671  85.661  64.786 1.00 24.51 ? 1029 HOH A O     1 
HETATM 2827 O  O     . HOH J 6 .   ? 79.610  77.867  35.281 1.00 25.12 ? 1030 HOH A O     1 
HETATM 2828 O  O     . HOH J 6 .   ? 75.348  71.920  44.973 1.00 31.03 ? 1031 HOH A O     1 
HETATM 2829 O  O     . HOH J 6 .   ? 90.321  85.176  45.332 1.00 23.09 ? 1032 HOH A O     1 
HETATM 2830 O  O     . HOH J 6 .   ? 87.625  76.924  58.836 1.00 23.50 ? 1033 HOH A O     1 
HETATM 2831 O  O     . HOH J 6 .   ? 77.276  70.364  59.962 1.00 52.95 ? 1034 HOH A O     1 
HETATM 2832 O  O     . HOH J 6 .   ? 88.162  93.028  34.066 1.00 28.29 ? 1035 HOH A O     1 
HETATM 2833 O  O     . HOH J 6 .   ? 93.558  64.025  56.915 1.00 28.50 ? 1036 HOH A O     1 
HETATM 2834 O  O     . HOH J 6 .   ? 88.748  73.663  70.956 1.00 25.71 ? 1037 HOH A O     1 
HETATM 2835 O  O     . HOH J 6 .   ? 91.459  76.528  72.854 1.00 20.02 ? 1038 HOH A O     1 
HETATM 2836 O  O     . HOH J 6 .   ? 96.345  64.337  57.423 1.00 24.87 ? 1039 HOH A O     1 
HETATM 2837 O  O     . HOH J 6 .   ? 90.292  65.594  72.364 1.00 25.48 ? 1040 HOH A O     1 
HETATM 2838 O  O     . HOH J 6 .   ? 81.969  85.738  33.793 1.00 28.48 ? 1041 HOH A O     1 
HETATM 2839 O  O     . HOH J 6 .   ? 91.267  65.469  59.726 1.00 30.16 ? 1042 HOH A O     1 
HETATM 2840 O  O     . HOH J 6 .   ? 80.964  71.363  47.721 1.00 27.85 ? 1043 HOH A O     1 
HETATM 2841 O  O     . HOH J 6 .   ? 93.651  86.795  62.852 1.00 30.61 ? 1044 HOH A O     1 
HETATM 2842 O  O     . HOH J 6 .   ? 83.164  97.014  25.875 1.00 32.68 ? 1045 HOH A O     1 
HETATM 2843 O  O     . HOH J 6 .   ? 91.629  67.281  46.573 1.00 29.65 ? 1046 HOH A O     1 
HETATM 2844 O  O     . HOH J 6 .   ? 75.858  75.126  59.893 1.00 24.80 ? 1047 HOH A O     1 
HETATM 2845 O  O     . HOH J 6 .   ? 91.243  74.121  71.497 1.00 24.23 ? 1048 HOH A O     1 
HETATM 2846 O  O     . HOH J 6 .   ? 103.159 67.801  58.685 1.00 26.57 ? 1049 HOH A O     1 
HETATM 2847 O  O     . HOH J 6 .   ? 81.885  76.512  67.160 1.00 26.93 ? 1050 HOH A O     1 
HETATM 2848 O  O     . HOH J 6 .   ? 81.785  79.120  66.744 1.00 27.37 ? 1051 HOH A O     1 
HETATM 2849 O  O     . HOH J 6 .   ? 87.349  82.519  68.207 1.00 26.49 ? 1052 HOH A O     1 
HETATM 2850 O  O     . HOH J 6 .   ? 62.002  78.703  48.099 1.00 30.74 ? 1053 HOH A O     1 
HETATM 2851 O  O     . HOH J 6 .   ? 87.909  82.249  35.742 1.00 31.33 ? 1054 HOH A O     1 
HETATM 2852 O  O     . HOH J 6 .   ? 96.825  77.867  51.442 1.00 33.73 ? 1055 HOH A O     1 
HETATM 2853 O  O     . HOH J 6 .   ? 111.582 61.367  61.841 1.00 30.75 ? 1056 HOH A O     1 
HETATM 2854 O  O     . HOH J 6 .   ? 90.622  91.393  40.910 1.00 27.03 ? 1057 HOH A O     1 
HETATM 2855 O  O     . HOH J 6 .   ? 91.327  85.388  63.407 1.00 28.10 ? 1058 HOH A O     1 
HETATM 2856 O  O     . HOH J 6 .   ? 103.326 57.578  52.627 1.00 33.90 ? 1059 HOH A O     1 
HETATM 2857 O  O     . HOH J 6 .   ? 75.590  96.726  36.621 1.00 30.06 ? 1060 HOH A O     1 
HETATM 2858 O  O     . HOH J 6 .   ? 76.556  99.815  42.535 1.00 27.86 ? 1061 HOH A O     1 
HETATM 2859 O  O     . HOH J 6 .   ? 90.317  94.708  39.668 1.00 31.33 ? 1062 HOH A O     1 
HETATM 2860 O  O     . HOH J 6 .   ? 73.016  85.168  66.810 1.00 35.00 ? 1063 HOH A O     1 
HETATM 2861 O  O     . HOH J 6 .   ? 83.287  85.761  62.545 1.00 45.10 ? 1064 HOH A O     1 
HETATM 2862 O  O     . HOH J 6 .   ? 75.717  74.365  56.023 1.00 29.44 ? 1065 HOH A O     1 
HETATM 2863 O  O     . HOH J 6 .   ? 116.081 63.207  54.719 1.00 26.73 ? 1066 HOH A O     1 
HETATM 2864 O  O     . HOH J 6 .   ? 96.715  80.622  75.871 1.00 26.98 ? 1067 HOH A O     1 
HETATM 2865 O  O     . HOH J 6 .   ? 91.106  77.478  80.324 1.00 31.70 ? 1068 HOH A O     1 
HETATM 2866 O  O     . HOH J 6 .   ? 70.936  97.711  51.767 1.00 35.76 ? 1069 HOH A O     1 
HETATM 2867 O  O     . HOH J 6 .   ? 96.262  89.457  54.393 1.00 29.50 ? 1070 HOH A O     1 
HETATM 2868 O  O     . HOH J 6 .   ? 96.928  82.584  74.062 1.00 29.03 ? 1071 HOH A O     1 
HETATM 2869 O  O     . HOH J 6 .   ? 112.635 59.388  64.040 1.00 33.19 ? 1072 HOH A O     1 
HETATM 2870 O  O     . HOH J 6 .   ? 101.146 73.390  76.975 1.00 31.17 ? 1073 HOH A O     1 
HETATM 2871 O  O     . HOH J 6 .   ? 84.959  77.739  69.137 1.00 38.24 ? 1074 HOH A O     1 
HETATM 2872 O  O     . HOH J 6 .   ? 111.077 65.950  67.084 1.00 27.29 ? 1075 HOH A O     1 
HETATM 2873 O  O     . HOH J 6 .   ? 106.237 65.836  73.039 1.00 33.02 ? 1076 HOH A O     1 
HETATM 2874 O  O     . HOH J 6 .   ? 87.650  85.038  39.573 1.00 26.85 ? 1077 HOH A O     1 
HETATM 2875 O  O     . HOH J 6 .   ? 79.408  73.775  45.076 1.00 30.94 ? 1078 HOH A O     1 
HETATM 2876 O  O     . HOH J 6 .   ? 73.658  94.865  36.293 1.00 37.37 ? 1079 HOH A O     1 
HETATM 2877 O  O     . HOH J 6 .   ? 79.255  82.884  35.489 1.00 28.83 ? 1080 HOH A O     1 
HETATM 2878 O  O     . HOH J 6 .   ? 107.938 75.277  74.753 1.00 31.13 ? 1081 HOH A O     1 
HETATM 2879 O  O     . HOH J 6 .   ? 99.236  62.583  48.729 1.00 32.78 ? 1082 HOH A O     1 
HETATM 2880 O  O     . HOH J 6 .   ? 71.409  84.073  36.235 1.00 31.47 ? 1083 HOH A O     1 
HETATM 2881 O  O     . HOH J 6 .   ? 88.848  88.985  60.112 1.00 31.82 ? 1084 HOH A O     1 
HETATM 2882 O  O     . HOH J 6 .   ? 87.158  88.349  32.265 1.00 29.74 ? 1085 HOH A O     1 
HETATM 2883 O  O     . HOH J 6 .   ? 85.709  73.290  68.909 1.00 40.31 ? 1086 HOH A O     1 
HETATM 2884 O  O     . HOH J 6 .   ? 89.052  77.778  76.704 1.00 38.06 ? 1087 HOH A O     1 
HETATM 2885 O  O     . HOH J 6 .   ? 72.532  91.146  35.119 1.00 41.22 ? 1088 HOH A O     1 
HETATM 2886 O  O     . HOH J 6 .   ? 102.631 76.655  78.594 1.00 42.36 ? 1089 HOH A O     1 
HETATM 2887 O  O     . HOH J 6 .   ? 107.507 64.557  66.957 1.00 34.12 ? 1090 HOH A O     1 
HETATM 2888 O  O     . HOH J 6 .   ? 88.539  89.797  34.467 1.00 36.76 ? 1091 HOH A O     1 
HETATM 2889 O  O     . HOH J 6 .   ? 102.832 58.640  68.420 1.00 37.59 ? 1092 HOH A O     1 
HETATM 2890 O  O     . HOH J 6 .   ? 107.293 79.185  67.183 1.00 33.25 ? 1093 HOH A O     1 
HETATM 2891 O  O     . HOH J 6 .   ? 77.353  84.410  36.184 1.00 32.76 ? 1094 HOH A O     1 
HETATM 2892 O  O     . HOH J 6 .   ? 86.279  89.473  60.392 1.00 34.15 ? 1095 HOH A O     1 
HETATM 2893 O  O     . HOH J 6 .   ? 108.046 70.493  70.126 1.00 29.16 ? 1096 HOH A O     1 
HETATM 2894 O  O     . HOH J 6 .   ? 69.892  86.354  36.968 1.00 48.87 ? 1097 HOH A O     1 
HETATM 2895 O  O     . HOH J 6 .   ? 103.989 86.119  63.255 1.00 32.34 ? 1098 HOH A O     1 
HETATM 2896 O  O     . HOH J 6 .   ? 99.798  80.249  76.066 1.00 37.56 ? 1099 HOH A O     1 
HETATM 2897 O  O     . HOH J 6 .   ? 80.693  90.851  31.752 1.00 44.66 ? 1100 HOH A O     1 
HETATM 2898 O  O     . HOH J 6 .   ? 97.465  78.797  48.917 1.00 31.11 ? 1101 HOH A O     1 
HETATM 2899 O  O     . HOH J 6 .   ? 96.639  85.012  49.003 1.00 33.37 ? 1102 HOH A O     1 
HETATM 2900 O  O     . HOH J 6 .   ? 96.829  57.823  53.947 1.00 34.57 ? 1103 HOH A O     1 
HETATM 2901 O  O     . HOH J 6 .   ? 64.918  85.216  41.646 1.00 37.43 ? 1104 HOH A O     1 
HETATM 2902 O  O     . HOH J 6 .   ? 73.766  75.827  66.127 1.00 28.70 ? 1105 HOH A O     1 
HETATM 2903 O  O     . HOH J 6 .   ? 83.021  97.997  31.191 1.00 35.06 ? 1106 HOH A O     1 
HETATM 2904 O  O     . HOH J 6 .   ? 77.041  87.397  64.011 1.00 28.70 ? 1107 HOH A O     1 
HETATM 2905 O  O     . HOH J 6 .   ? 67.401  81.977  50.765 1.00 29.97 ? 1108 HOH A O     1 
HETATM 2906 O  O     . HOH J 6 .   ? 90.250  66.606  57.393 1.00 39.03 ? 1109 HOH A O     1 
HETATM 2907 O  O     . HOH J 6 .   ? 78.214  71.695  46.599 1.00 35.49 ? 1110 HOH A O     1 
HETATM 2908 O  O     . HOH J 6 .   ? 90.146  87.039  65.183 1.00 33.82 ? 1111 HOH A O     1 
HETATM 2909 O  O     . HOH J 6 .   ? 91.730  62.940  58.428 1.00 37.09 ? 1112 HOH A O     1 
HETATM 2910 O  O     . HOH J 6 .   ? 102.250 69.911  46.505 1.00 46.48 ? 1113 HOH A O     1 
HETATM 2911 O  O     . HOH J 6 .   ? 99.487  65.290  75.266 1.00 27.51 ? 1114 HOH A O     1 
HETATM 2912 O  O     . HOH J 6 .   ? 77.105  88.598  61.519 1.00 31.44 ? 1115 HOH A O     1 
HETATM 2913 O  O     . HOH J 6 .   ? 63.395  79.315  50.342 1.00 34.63 ? 1116 HOH A O     1 
HETATM 2914 O  O     . HOH J 6 .   ? 89.351  78.157  73.398 1.00 41.23 ? 1117 HOH A O     1 
HETATM 2915 O  O     . HOH J 6 .   ? 86.788  75.489  71.834 1.00 39.51 ? 1118 HOH A O     1 
HETATM 2916 O  O     . HOH J 6 .   ? 110.924 76.349  66.820 1.00 31.41 ? 1119 HOH A O     1 
HETATM 2917 O  O     . HOH J 6 .   ? 92.578  88.073  60.749 1.00 35.64 ? 1120 HOH A O     1 
HETATM 2918 O  O     . HOH J 6 .   ? 88.663  64.255  69.274 1.00 45.53 ? 1121 HOH A O     1 
HETATM 2919 O  O     . HOH J 6 .   ? 93.950  73.453  45.816 1.00 32.59 ? 1122 HOH A O     1 
HETATM 2920 O  O     . HOH J 6 .   ? 76.130  72.473  58.922 1.00 25.81 ? 1123 HOH A O     1 
HETATM 2921 O  O     . HOH J 6 .   ? 110.034 78.675  67.106 1.00 32.72 ? 1124 HOH A O     1 
HETATM 2922 O  O     . HOH J 6 .   ? 80.151  83.621  33.052 1.00 32.87 ? 1125 HOH A O     1 
HETATM 2923 O  O     . HOH J 6 .   ? 92.384  90.620  38.441 1.00 60.64 ? 1126 HOH A O     1 
HETATM 2924 O  O     . HOH J 6 .   ? 98.402  73.639  47.607 1.00 37.01 ? 1127 HOH A O     1 
HETATM 2925 O  O     . HOH J 6 .   ? 81.638  87.930  32.386 1.00 38.19 ? 1128 HOH A O     1 
HETATM 2926 O  O     . HOH J 6 .   ? 88.047  79.944  34.202 1.00 33.86 ? 1129 HOH A O     1 
HETATM 2927 O  O     . HOH J 6 .   ? 85.953  99.766  53.826 1.00 45.79 ? 1130 HOH A O     1 
HETATM 2928 O  O     . HOH J 6 .   ? 64.258  87.708  41.133 1.00 47.46 ? 1131 HOH A O     1 
HETATM 2929 O  O     . HOH J 6 .   ? 92.375  93.835  41.308 1.00 49.59 ? 1132 HOH A O     1 
HETATM 2930 O  O     . HOH J 6 .   ? 81.178  84.378  63.413 1.00 44.74 ? 1133 HOH A O     1 
HETATM 2931 O  O     . HOH J 6 .   ? 113.132 76.352  64.888 1.00 36.04 ? 1134 HOH A O     1 
HETATM 2932 O  O     . HOH J 6 .   ? 94.221  60.297  63.574 1.00 33.35 ? 1135 HOH A O     1 
HETATM 2933 O  O     . HOH J 6 .   ? 105.981 57.482  58.797 1.00 43.13 ? 1136 HOH A O     1 
HETATM 2934 O  O     . HOH J 6 .   ? 88.446  80.856  29.832 1.00 40.12 ? 1137 HOH A O     1 
HETATM 2935 O  O     . HOH J 6 .   ? 108.846 79.033  59.668 1.00 41.41 ? 1138 HOH A O     1 
HETATM 2936 O  O     . HOH J 6 .   ? 91.141  82.799  46.387 1.00 35.54 ? 1139 HOH A O     1 
HETATM 2937 O  O     . HOH J 6 .   ? 84.723  71.840  62.309 1.00 31.40 ? 1140 HOH A O     1 
HETATM 2938 O  O     . HOH J 6 .   ? 82.868  73.187  58.374 1.00 41.36 ? 1141 HOH A O     1 
HETATM 2939 O  O     . HOH J 6 .   ? 106.318 75.215  47.910 1.00 37.74 ? 1142 HOH A O     1 
HETATM 2940 O  O     . HOH J 6 .   ? 95.046  72.212  80.587 1.00 44.73 ? 1143 HOH A O     1 
HETATM 2941 O  O     . HOH J 6 .   ? 76.386  85.123  33.953 1.00 38.69 ? 1144 HOH A O     1 
HETATM 2942 O  O     . HOH J 6 .   ? 107.440 80.150  69.750 1.00 37.44 ? 1145 HOH A O     1 
HETATM 2943 O  O     . HOH J 6 .   ? 96.577  82.406  47.207 1.00 47.00 ? 1146 HOH A O     1 
HETATM 2944 O  O     . HOH J 6 .   ? 95.087  79.301  47.925 1.00 41.05 ? 1147 HOH A O     1 
HETATM 2945 O  O     . HOH J 6 .   ? 76.638  101.845 45.332 1.00 37.45 ? 1148 HOH A O     1 
HETATM 2946 O  O     . HOH J 6 .   ? 89.445  82.765  38.168 1.00 38.96 ? 1149 HOH A O     1 
HETATM 2947 O  O     . HOH J 6 .   ? 88.164  69.196  69.380 1.00 43.73 ? 1150 HOH A O     1 
HETATM 2948 O  O     . HOH J 6 .   ? 109.352 70.021  74.124 1.00 34.57 ? 1151 HOH A O     1 
HETATM 2949 O  O     . HOH J 6 .   ? 108.450 77.645  73.441 1.00 38.00 ? 1152 HOH A O     1 
HETATM 2950 O  O     . HOH J 6 .   ? 106.595 79.364  72.086 1.00 45.57 ? 1153 HOH A O     1 
HETATM 2951 O  O     . HOH J 6 .   ? 99.013  89.408  60.958 1.00 35.63 ? 1154 HOH A O     1 
HETATM 2952 O  O     . HOH J 6 .   ? 112.662 63.470  49.685 1.00 40.96 ? 1155 HOH A O     1 
HETATM 2953 O  O     . HOH J 6 .   ? 106.822 68.293  46.522 1.00 44.54 ? 1156 HOH A O     1 
HETATM 2954 O  O     . HOH J 6 .   ? 91.989  70.263  54.327 1.00 21.67 ? 1157 HOH A O     1 
HETATM 2955 O  O     . HOH J 6 .   ? 70.753  99.532  48.954 1.00 36.56 ? 1158 HOH A O     1 
HETATM 2956 O  O     . HOH J 6 .   ? 78.195  71.127  51.939 1.00 42.86 ? 1159 HOH A O     1 
HETATM 2957 O  O     . HOH J 6 .   ? 121.005 65.927  53.284 1.00 52.23 ? 1160 HOH A O     1 
HETATM 2958 O  O     . HOH J 6 .   ? 90.410  86.452  67.873 1.00 39.33 ? 1161 HOH A O     1 
HETATM 2959 O  O     . HOH J 6 .   ? 90.749  96.198  54.367 1.00 38.78 ? 1162 HOH A O     1 
HETATM 2960 O  O     . HOH J 6 .   ? 97.138  87.230  68.223 1.00 36.79 ? 1163 HOH A O     1 
HETATM 2961 O  O     . HOH J 6 .   ? 83.038  97.471  56.784 1.00 39.25 ? 1164 HOH A O     1 
HETATM 2962 O  O     . HOH J 6 .   ? 80.472  92.276  61.809 1.00 36.33 ? 1165 HOH A O     1 
HETATM 2963 O  O     . HOH J 6 .   ? 91.796  61.213  62.777 1.00 36.85 ? 1166 HOH A O     1 
HETATM 2964 O  O     . HOH J 6 .   ? 78.363  75.705  34.552 1.00 40.94 ? 1167 HOH A O     1 
HETATM 2965 O  O     . HOH J 6 .   ? 113.959 59.959  67.874 1.00 37.59 ? 1168 HOH A O     1 
HETATM 2966 O  O     . HOH J 6 .   ? 91.310  79.319  46.610 1.00 43.14 ? 1169 HOH A O     1 
HETATM 2967 O  O     . HOH J 6 .   ? 103.402 63.335  45.483 1.00 37.99 ? 1170 HOH A O     1 
HETATM 2968 O  O     . HOH J 6 .   ? 107.123 69.739  79.234 1.00 38.97 ? 1171 HOH A O     1 
HETATM 2969 O  O     . HOH J 6 .   ? 77.880  93.261  32.641 1.00 44.27 ? 1172 HOH A O     1 
HETATM 2970 O  O     . HOH J 6 .   ? 98.131  91.616  59.741 1.00 42.43 ? 1173 HOH A O     1 
HETATM 2971 O  O     . HOH J 6 .   ? 82.500  93.690  59.068 1.00 42.88 ? 1174 HOH A O     1 
HETATM 2972 O  O     . HOH J 6 .   ? 112.490 75.216  68.824 1.00 45.02 ? 1175 HOH A O     1 
HETATM 2973 O  O     . HOH J 6 .   ? 115.937 77.795  59.679 1.00 46.30 ? 1176 HOH A O     1 
HETATM 2974 O  O     . HOH J 6 .   ? 102.283 57.499  56.486 1.00 43.69 ? 1177 HOH A O     1 
HETATM 2975 O  O     . HOH J 6 .   ? 74.940  73.623  67.671 1.00 41.42 ? 1178 HOH A O     1 
HETATM 2976 O  O     . HOH J 6 .   ? 69.205  96.740  40.959 1.00 40.68 ? 1179 HOH A O     1 
HETATM 2977 O  O     . HOH J 6 .   ? 79.494  99.971  55.935 1.00 40.43 ? 1180 HOH A O     1 
HETATM 2978 O  O     . HOH J 6 .   ? 94.483  92.048  51.421 1.00 40.29 ? 1181 HOH A O     1 
HETATM 2979 O  O     . HOH J 6 .   ? 74.393  99.353  36.131 1.00 49.07 ? 1182 HOH A O     1 
HETATM 2980 O  O     . HOH J 6 .   ? 81.300  87.972  61.911 1.00 42.81 ? 1183 HOH A O     1 
HETATM 2981 O  O     . HOH J 6 .   ? 79.381  88.413  60.277 1.00 41.87 ? 1184 HOH A O     1 
HETATM 2982 O  O     . HOH J 6 .   ? 86.043  69.891  59.002 1.00 39.74 ? 1185 HOH A O     1 
HETATM 2983 O  O     . HOH J 6 .   ? 90.020  79.999  38.672 1.00 45.29 ? 1186 HOH A O     1 
HETATM 2984 O  O     . HOH J 6 .   ? 81.537  75.402  69.602 1.00 49.92 ? 1187 HOH A O     1 
HETATM 2985 O  O     . HOH J 6 .   ? 82.824  80.235  69.471 1.00 46.87 ? 1188 HOH A O     1 
HETATM 2986 O  O     . HOH J 6 .   ? 90.011  91.378  37.358 1.00 34.45 ? 1189 HOH A O     1 
HETATM 2987 O  O     . HOH J 6 .   ? 92.536  94.218  45.571 1.00 44.27 ? 1190 HOH A O     1 
HETATM 2988 O  O     . HOH J 6 .   ? 78.034  84.705  31.686 1.00 37.46 ? 1191 HOH A O     1 
HETATM 2989 O  O     . HOH J 6 .   ? 95.667  89.629  62.009 1.00 50.35 ? 1192 HOH A O     1 
HETATM 2990 O  O     . HOH J 6 .   ? 110.392 70.037  45.529 1.00 45.22 ? 1193 HOH A O     1 
HETATM 2991 O  O     . HOH J 6 .   ? 71.061  80.753  36.588 1.00 38.84 ? 1194 HOH A O     1 
HETATM 2992 O  O     . HOH J 6 .   ? 68.667  80.242  37.703 1.00 41.81 ? 1195 HOH A O     1 
HETATM 2993 O  O     . HOH J 6 .   ? 100.969 57.370  64.976 1.00 38.88 ? 1196 HOH A O     1 
HETATM 2994 O  O     . HOH J 6 .   ? 88.803  68.498  58.106 1.00 39.58 ? 1197 HOH A O     1 
HETATM 2995 O  O     . HOH J 6 .   ? 119.032 63.817  53.849 1.00 45.26 ? 1198 HOH A O     1 
HETATM 2996 O  O     . HOH J 6 .   ? 97.816  57.608  57.073 1.00 49.29 ? 1199 HOH A O     1 
HETATM 2997 O  O     . HOH J 6 .   ? 99.608  58.037  59.013 1.00 42.46 ? 1200 HOH A O     1 
HETATM 2998 O  O     . HOH J 6 .   ? 87.043  66.460  67.395 1.00 52.31 ? 1201 HOH A O     1 
HETATM 2999 O  O     . HOH J 6 .   ? 93.678  61.011  46.299 1.00 50.33 ? 1202 HOH A O     1 
HETATM 3000 O  O     . HOH J 6 .   ? 90.875  61.661  55.155 1.00 50.52 ? 1203 HOH A O     1 
HETATM 3001 O  O     . HOH J 6 .   ? 85.023  92.666  59.501 1.00 49.23 ? 1204 HOH A O     1 
HETATM 3002 O  O     . HOH J 6 .   ? 93.145  81.583  47.619 1.00 50.05 ? 1205 HOH A O     1 
HETATM 3003 O  O     . HOH J 6 .   ? 76.276  101.148 35.812 1.00 43.49 ? 1206 HOH A O     1 
HETATM 3004 O  O     . HOH J 6 .   ? 109.490 71.681  72.138 1.00 40.83 ? 1207 HOH A O     1 
HETATM 3005 O  O     . HOH J 6 .   ? 87.992  85.027  28.621 1.00 45.83 ? 1208 HOH A O     1 
HETATM 3006 O  O     . HOH J 6 .   ? 90.703  64.745  53.251 1.00 41.50 ? 1209 HOH A O     1 
HETATM 3007 O  O     . HOH J 6 .   ? 82.846  98.577  34.334 1.00 34.83 ? 1210 HOH A O     1 
HETATM 3008 O  O     . HOH J 6 .   ? 94.874  59.459  49.284 1.00 49.99 ? 1211 HOH A O     1 
HETATM 3009 O  O     . HOH J 6 .   ? 68.242  85.935  55.316 1.00 46.05 ? 1212 HOH A O     1 
HETATM 3010 O  O     . HOH J 6 .   ? 119.448 62.524  48.405 1.00 34.90 ? 1213 HOH A O     1 
HETATM 3011 O  O     . HOH J 6 .   ? 85.535  85.620  64.745 1.00 44.03 ? 1214 HOH A O     1 
HETATM 3012 O  O     . HOH J 6 .   ? 68.742  88.591  61.807 1.00 36.04 ? 1215 HOH A O     1 
HETATM 3013 O  O     . HOH J 6 .   ? 106.322 82.220  62.722 1.00 48.78 ? 1216 HOH A O     1 
HETATM 3014 O  O     . HOH J 6 .   ? 107.057 81.728  65.479 1.00 39.99 ? 1217 HOH A O     1 
HETATM 3015 O  O     . HOH J 6 .   ? 113.833 68.330  45.008 1.00 50.52 ? 1218 HOH A O     1 
HETATM 3016 O  O     . HOH J 6 .   ? 103.649 88.528  61.661 1.00 41.72 ? 1219 HOH A O     1 
HETATM 3017 O  O     . HOH J 6 .   ? 83.636  81.218  73.050 1.00 42.39 ? 1220 HOH A O     1 
HETATM 3018 O  O     . HOH J 6 .   ? 103.991 67.134  79.930 1.00 49.25 ? 1221 HOH A O     1 
HETATM 3019 O  O     . HOH J 6 .   ? 96.555  73.666  45.702 1.00 43.93 ? 1222 HOH A O     1 
HETATM 3020 O  O     . HOH J 6 .   ? 93.497  77.462  46.626 1.00 47.75 ? 1223 HOH A O     1 
HETATM 3021 O  O     . HOH J 6 .   ? 85.047  84.084  66.780 1.00 42.60 ? 1224 HOH A O     1 
HETATM 3022 O  O     . HOH J 6 .   ? 79.629  86.545  63.582 1.00 46.11 ? 1225 HOH A O     1 
HETATM 3023 O  O     . HOH J 6 .   ? 71.299  95.954  34.995 1.00 53.15 ? 1226 HOH A O     1 
HETATM 3024 O  O     . HOH J 6 .   ? 73.880  93.687  33.518 1.00 51.11 ? 1227 HOH A O     1 
HETATM 3025 O  O     . HOH J 6 .   ? 79.768  88.527  34.090 1.00 40.73 ? 1228 HOH A O     1 
HETATM 3026 O  O     . HOH J 6 .   ? 81.955  86.701  27.073 1.00 47.80 ? 1229 HOH A O     1 
HETATM 3027 O  O     . HOH J 6 .   ? 110.172 73.985  73.147 1.00 48.80 ? 1230 HOH A O     1 
HETATM 3028 O  O     . HOH J 6 .   ? 107.805 75.738  77.466 1.00 46.69 ? 1231 HOH A O     1 
HETATM 3029 O  O     . HOH J 6 .   ? 83.847  69.134  62.343 1.00 49.05 ? 1232 HOH A O     1 
HETATM 3030 O  O     . HOH J 6 .   ? 120.321 66.487  49.709 1.00 53.82 ? 1233 HOH A O     1 
HETATM 3031 O  O     . HOH J 6 .   ? 92.169  77.214  40.044 1.00 46.54 ? 1234 HOH A O     1 
HETATM 3032 O  O     . HOH J 6 .   ? 108.184 81.152  61.057 1.00 42.17 ? 1235 HOH A O     1 
HETATM 3033 O  O     . HOH J 6 .   ? 92.478  96.229  46.999 1.00 57.06 ? 1236 HOH A O     1 
HETATM 3034 O  O     . HOH J 6 .   ? 66.652  96.713  42.776 1.00 47.42 ? 1237 HOH A O     1 
HETATM 3035 O  O     . HOH J 6 .   ? 75.443  102.189 42.582 1.00 40.66 ? 1238 HOH A O     1 
HETATM 3036 O  O     . HOH J 6 .   ? 111.430 79.485  60.136 1.00 48.46 ? 1239 HOH A O     1 
HETATM 3037 O  O     . HOH J 6 .   ? 71.879  78.733  61.599 1.00 44.18 ? 1240 HOH A O     1 
HETATM 3038 O  O     . HOH J 6 .   ? 105.427 74.651  78.726 1.00 52.66 ? 1241 HOH A O     1 
HETATM 3039 O  O     . HOH J 6 .   ? 68.555  94.369  38.611 1.00 44.81 ? 1242 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   1   1   DC  CYT D . n 
A 1 2   DT  2   2   2   DT  THY D . n 
A 1 3   DC  3   3   3   DC  CYT D . n 
A 1 4   DT  4   4   4   DT  THY D . n 
A 1 5   DT  5   5   5   DT  THY D . n 
A 1 6   DT  6   6   6   DT  THY D . n 
A 1 7   3DR 7   7   7   3DR 3DR D . n 
A 1 8   DT  8   8   8   DT  THY D . n 
A 1 9   DT  9   9   9   DT  THY D . n 
A 1 10  DT  10  10  10  DT  THY D . n 
A 1 11  DC  11  11  11  DC  CYT D . n 
A 1 12  DT  12  12  12  DT  THY D . n 
A 1 13  DC  13  13  13  DC  CYT D . n 
A 1 14  DG  14  14  14  DG  GUA D . n 
B 2 1   DG  1   15  15  DG  GUA E . n 
B 2 2   DC  2   16  16  DC  CYT E . n 
B 2 3   DG  3   17  17  DG  GUA E . n 
B 2 4   DA  4   18  18  DA  ADE E . n 
B 2 5   DG  5   19  19  DG  GUA E . n 
B 2 6   DA  6   20  20  DA  ADE E . n 
B 2 7   DA  7   21  21  DA  ADE E . n 
B 2 8   DA  8   22  22  DA  ADE E . n 
B 2 9   DC  9   23  23  DC  CYT E . n 
B 2 10  DA  10  24  24  DA  ADE E . n 
B 2 11  DA  11  25  25  DA  ADE E . n 
B 2 12  DA  12  26  26  DA  ADE E . n 
B 2 13  DG  13  27  27  DG  GUA E . n 
B 2 14  DA  14  28  28  DA  ADE E . n 
C 3 1   GLY 1   1   1   GLY GLY A . n 
C 3 2   GLU 2   2   2   GLU GLU A . n 
C 3 3   LEU 3   3   3   LEU LEU A . n 
C 3 4   PRO 4   4   4   PRO PRO A . n 
C 3 5   GLU 5   5   5   GLU GLU A . n 
C 3 6   VAL 6   6   6   VAL VAL A . n 
C 3 7   GLU 7   7   7   GLU GLU A . n 
C 3 8   THR 8   8   8   THR THR A . n 
C 3 9   VAL 9   9   9   VAL VAL A . n 
C 3 10  ARG 10  10  10  ARG ARG A . n 
C 3 11  ARG 11  11  11  ARG ARG A . n 
C 3 12  GLU 12  12  12  GLU GLU A . n 
C 3 13  LEU 13  13  13  LEU LEU A . n 
C 3 14  GLU 14  14  14  GLU GLU A . n 
C 3 15  LYS 15  15  15  LYS LYS A . n 
C 3 16  ARG 16  16  16  ARG ARG A . n 
C 3 17  ILE 17  17  17  ILE ILE A . n 
C 3 18  VAL 18  18  18  VAL VAL A . n 
C 3 19  GLY 19  19  19  GLY GLY A . n 
C 3 20  GLN 20  20  20  GLN GLN A . n 
C 3 21  LYS 21  21  21  LYS LYS A . n 
C 3 22  ILE 22  22  22  ILE ILE A . n 
C 3 23  ILE 23  23  23  ILE ILE A . n 
C 3 24  SER 24  24  24  SER SER A . n 
C 3 25  ILE 25  25  25  ILE ILE A . n 
C 3 26  GLU 26  26  26  GLU GLU A . n 
C 3 27  ALA 27  27  27  ALA ALA A . n 
C 3 28  THR 28  28  28  THR THR A . n 
C 3 29  TYR 29  29  29  TYR TYR A . n 
C 3 30  PRO 30  30  30  PRO PRO A . n 
C 3 31  ARG 31  31  31  ARG ARG A . n 
C 3 32  MET 32  32  32  MET MET A . n 
C 3 33  VAL 33  33  33  VAL VAL A . n 
C 3 34  LEU 34  34  34  LEU LEU A . n 
C 3 35  THR 35  35  35  THR THR A . n 
C 3 36  GLY 36  36  36  GLY GLY A . n 
C 3 37  PHE 37  37  37  PHE PHE A . n 
C 3 38  GLU 38  38  38  GLU GLU A . n 
C 3 39  GLN 39  39  39  GLN GLN A . n 
C 3 40  LEU 40  40  40  LEU LEU A . n 
C 3 41  LYS 41  41  41  LYS LYS A . n 
C 3 42  LYS 42  42  42  LYS LYS A . n 
C 3 43  GLU 43  43  43  GLU GLU A . n 
C 3 44  LEU 44  44  44  LEU LEU A . n 
C 3 45  THR 45  45  45  THR THR A . n 
C 3 46  GLY 46  46  46  GLY GLY A . n 
C 3 47  LYS 47  47  47  LYS LYS A . n 
C 3 48  THR 48  48  48  THR THR A . n 
C 3 49  ILE 49  49  49  ILE ILE A . n 
C 3 50  GLN 50  50  50  GLN GLN A . n 
C 3 51  GLY 51  51  51  GLY GLY A . n 
C 3 52  ILE 52  52  52  ILE ILE A . n 
C 3 53  SER 53  53  53  SER SER A . n 
C 3 54  ARG 54  54  54  ARG ARG A . n 
C 3 55  ARG 55  55  55  ARG ARG A . n 
C 3 56  GLY 56  56  56  GLY GLY A . n 
C 3 57  LYS 57  57  57  LYS LYS A . n 
C 3 58  TYR 58  58  58  TYR TYR A . n 
C 3 59  LEU 59  59  59  LEU LEU A . n 
C 3 60  ILE 60  60  60  ILE ILE A . n 
C 3 61  PHE 61  61  61  PHE PHE A . n 
C 3 62  GLU 62  62  62  GLU GLU A . n 
C 3 63  ILE 63  63  63  ILE ILE A . n 
C 3 64  GLY 64  64  64  GLY GLY A . n 
C 3 65  ASP 65  65  65  ASP ASP A . n 
C 3 66  ASP 66  66  66  ASP ASP A . n 
C 3 67  PHE 67  67  67  PHE PHE A . n 
C 3 68  ARG 68  68  68  ARG ARG A . n 
C 3 69  LEU 69  69  69  LEU LEU A . n 
C 3 70  ILE 70  70  70  ILE ILE A . n 
C 3 71  SER 71  71  71  SER SER A . n 
C 3 72  HIS 72  72  72  HIS HIS A . n 
C 3 73  LEU 73  73  73  LEU LEU A . n 
C 3 74  ARG 74  74  74  ARG ARG A . n 
C 3 75  MET 75  75  75  MET MET A . n 
C 3 76  GLU 76  76  76  GLU GLU A . n 
C 3 77  GLY 77  77  77  GLY GLY A . n 
C 3 78  LYS 78  78  78  LYS LYS A . n 
C 3 79  TYR 79  79  79  TYR TYR A . n 
C 3 80  ARG 80  80  80  ARG ARG A . n 
C 3 81  LEU 81  81  81  LEU LEU A . n 
C 3 82  ALA 82  82  82  ALA ALA A . n 
C 3 83  THR 83  83  83  THR THR A . n 
C 3 84  LEU 84  84  84  LEU LEU A . n 
C 3 85  ASP 85  85  85  ASP ASP A . n 
C 3 86  ALA 86  86  86  ALA ALA A . n 
C 3 87  PRO 87  87  87  PRO PRO A . n 
C 3 88  ARG 88  88  88  ARG ARG A . n 
C 3 89  GLU 89  89  89  GLU GLU A . n 
C 3 90  LYS 90  90  90  LYS LYS A . n 
C 3 91  HIS 91  91  91  HIS HIS A . n 
C 3 92  ASP 92  92  92  ASP ASP A . n 
C 3 93  HIS 93  93  93  HIS HIS A . n 
C 3 94  LEU 94  94  94  LEU LEU A . n 
C 3 95  THR 95  95  95  THR THR A . n 
C 3 96  MET 96  96  96  MET MET A . n 
C 3 97  LYS 97  97  97  LYS LYS A . n 
C 3 98  PHE 98  98  98  PHE PHE A . n 
C 3 99  ALA 99  99  99  ALA ALA A . n 
C 3 100 ASP 100 100 100 ASP ASP A . n 
C 3 101 GLY 101 101 101 GLY GLY A . n 
C 3 102 GLN 102 102 102 GLN GLN A . n 
C 3 103 LEU 103 103 103 LEU LEU A . n 
C 3 104 ILE 104 104 104 ILE ILE A . n 
C 3 105 TYR 105 105 105 TYR TYR A . n 
C 3 106 ALA 106 106 106 ALA ALA A . n 
C 3 107 ASP 107 107 107 ASP ASP A . n 
C 3 108 VAL 108 108 108 VAL VAL A . n 
C 3 109 ARG 109 109 109 ARG ARG A . n 
C 3 110 LYS 110 110 110 LYS LYS A . n 
C 3 111 PHE 111 111 111 PHE PHE A . n 
C 3 112 GLY 112 112 112 GLY GLY A . n 
C 3 113 THR 113 113 113 THR THR A . n 
C 3 114 TRP 114 114 114 TRP TRP A . n 
C 3 115 GLU 115 115 115 GLU GLU A . n 
C 3 116 LEU 116 116 116 LEU LEU A . n 
C 3 117 ILE 117 117 117 ILE ILE A . n 
C 3 118 SER 118 118 118 SER SER A . n 
C 3 119 THR 119 119 119 THR THR A . n 
C 3 120 ASP 120 120 120 ASP ASP A . n 
C 3 121 GLN 121 121 121 GLN GLN A . n 
C 3 122 VAL 122 122 122 VAL VAL A . n 
C 3 123 LEU 123 123 123 LEU LEU A . n 
C 3 124 PRO 124 124 124 PRO PRO A . n 
C 3 125 TYR 125 125 125 TYR TYR A . n 
C 3 126 PHE 126 126 126 PHE PHE A . n 
C 3 127 LEU 127 127 127 LEU LEU A . n 
C 3 128 LYS 128 128 128 LYS LYS A . n 
C 3 129 LYS 129 129 129 LYS LYS A . n 
C 3 130 LYS 130 130 130 LYS LYS A . n 
C 3 131 ILE 131 131 131 ILE ILE A . n 
C 3 132 GLY 132 132 132 GLY GLY A . n 
C 3 133 PRO 133 133 133 PRO PRO A . n 
C 3 134 GLU 134 134 134 GLU GLU A . n 
C 3 135 PRO 135 135 135 PRO PRO A . n 
C 3 136 THR 136 136 136 THR THR A . n 
C 3 137 TYR 137 137 137 TYR TYR A . n 
C 3 138 GLU 138 138 138 GLU GLU A . n 
C 3 139 ASP 139 139 139 ASP ASP A . n 
C 3 140 PHE 140 140 140 PHE PHE A . n 
C 3 141 ASP 141 141 141 ASP ASP A . n 
C 3 142 GLU 142 142 142 GLU GLU A . n 
C 3 143 LYS 143 143 143 LYS LYS A . n 
C 3 144 LEU 144 144 144 LEU LEU A . n 
C 3 145 PHE 145 145 145 PHE PHE A . n 
C 3 146 ARG 146 146 146 ARG ARG A . n 
C 3 147 GLU 147 147 147 GLU GLU A . n 
C 3 148 LYS 148 148 148 LYS LYS A . n 
C 3 149 LEU 149 149 149 LEU LEU A . n 
C 3 150 ARG 150 150 150 ARG ARG A . n 
C 3 151 LYS 151 151 151 LYS LYS A . n 
C 3 152 SER 152 152 152 SER SER A . n 
C 3 153 THR 153 153 153 THR THR A . n 
C 3 154 LYS 154 154 154 LYS LYS A . n 
C 3 155 LYS 155 155 155 LYS LYS A . n 
C 3 156 ILE 156 156 156 ILE ILE A . n 
C 3 157 LYS 157 157 157 LYS LYS A . n 
C 3 158 PRO 158 158 158 PRO PRO A . n 
C 3 159 TYR 159 159 159 TYR TYR A . n 
C 3 160 LEU 160 160 160 LEU LEU A . n 
C 3 161 LEU 161 161 161 LEU LEU A . n 
C 3 162 GLU 162 162 162 GLU GLU A . n 
C 3 163 GLN 163 163 163 GLN GLN A . n 
C 3 164 THR 164 164 164 THR THR A . n 
C 3 165 LEU 165 165 165 LEU LEU A . n 
C 3 166 VAL 166 166 166 VAL VAL A . n 
C 3 167 ALA 167 167 167 ALA ALA A . n 
C 3 168 GLY 168 168 168 GLY GLY A . n 
C 3 169 LEU 169 169 169 LEU LEU A . n 
C 3 170 GLY 170 170 170 GLY GLY A . n 
C 3 171 ASN 171 171 171 ASN ASN A . n 
C 3 172 ILE 172 172 172 ILE ILE A . n 
C 3 173 TYR 173 173 173 TYR TYR A . n 
C 3 174 VAL 174 174 174 VAL VAL A . n 
C 3 175 ASP 175 175 175 ASP ASP A . n 
C 3 176 GLU 176 176 176 GLU GLU A . n 
C 3 177 VAL 177 177 177 VAL VAL A . n 
C 3 178 LEU 178 178 178 LEU LEU A . n 
C 3 179 TRP 179 179 179 TRP TRP A . n 
C 3 180 LEU 180 180 180 LEU LEU A . n 
C 3 181 ALA 181 181 181 ALA ALA A . n 
C 3 182 LYS 182 182 182 LYS LYS A . n 
C 3 183 ILE 183 183 183 ILE ILE A . n 
C 3 184 HIS 184 184 184 HIS HIS A . n 
C 3 185 PRO 185 185 185 PRO PRO A . n 
C 3 186 GLU 186 186 186 GLU GLU A . n 
C 3 187 LYS 187 187 187 LYS LYS A . n 
C 3 188 GLU 188 188 188 GLU GLU A . n 
C 3 189 THR 189 189 189 THR THR A . n 
C 3 190 ASN 190 190 190 ASN ASN A . n 
C 3 191 GLN 191 191 191 GLN GLN A . n 
C 3 192 LEU 192 192 192 LEU LEU A . n 
C 3 193 ILE 193 193 193 ILE ILE A . n 
C 3 194 GLU 194 194 194 GLU GLU A . n 
C 3 195 SER 195 195 195 SER SER A . n 
C 3 196 SER 196 196 196 SER SER A . n 
C 3 197 ILE 197 197 197 ILE ILE A . n 
C 3 198 HIS 198 198 198 HIS HIS A . n 
C 3 199 LEU 199 199 199 LEU LEU A . n 
C 3 200 LEU 200 200 200 LEU LEU A . n 
C 3 201 HIS 201 201 201 HIS HIS A . n 
C 3 202 ASP 202 202 202 ASP ASP A . n 
C 3 203 SER 203 203 203 SER SER A . n 
C 3 204 ILE 204 204 204 ILE ILE A . n 
C 3 205 ILE 205 205 205 ILE ILE A . n 
C 3 206 GLU 206 206 206 GLU GLU A . n 
C 3 207 ILE 207 207 207 ILE ILE A . n 
C 3 208 LEU 208 208 208 LEU LEU A . n 
C 3 209 GLN 209 209 209 GLN GLN A . n 
C 3 210 LYS 210 210 210 LYS LYS A . n 
C 3 211 ALA 211 211 211 ALA ALA A . n 
C 3 212 ILE 212 212 212 ILE ILE A . n 
C 3 213 LYS 213 213 213 LYS LYS A . n 
C 3 214 LEU 214 214 214 LEU LEU A . n 
C 3 215 GLY 215 215 215 GLY GLY A . n 
C 3 216 GLY 216 216 216 GLY GLY A . n 
C 3 217 SER 217 217 217 SER SER A . n 
C 3 218 SER 218 218 218 SER SER A . n 
C 3 219 ILE 219 219 219 ILE ILE A . n 
C 3 220 ARG 220 220 220 ARG GLY A . n 
C 3 221 THR 221 221 221 THR GLY A . n 
C 3 222 TYR 222 222 222 TYR GLY A . n 
C 3 223 SER 223 223 223 SER GLY A . n 
C 3 224 ALA 224 224 224 ALA ALA A . n 
C 3 225 LEU 225 225 225 LEU LEU A . n 
C 3 226 GLY 226 226 226 GLY GLY A . n 
C 3 227 SER 227 227 227 SER SER A . n 
C 3 228 THR 228 228 228 THR THR A . n 
C 3 229 GLY 229 229 229 GLY GLY A . n 
C 3 230 LYS 230 230 230 LYS LYS A . n 
C 3 231 MET 231 231 231 MET MET A . n 
C 3 232 GLN 232 232 232 GLN GLN A . n 
C 3 233 ASN 233 233 233 ASN ASN A . n 
C 3 234 GLU 234 234 234 GLU GLU A . n 
C 3 235 LEU 235 235 235 LEU LEU A . n 
C 3 236 GLN 236 236 236 GLN GLN A . n 
C 3 237 VAL 237 237 237 VAL VAL A . n 
C 3 238 TYR 238 238 238 TYR TYR A . n 
C 3 239 GLY 239 239 239 GLY GLY A . n 
C 3 240 LYS 240 240 240 LYS LYS A . n 
C 3 241 THR 241 241 241 THR THR A . n 
C 3 242 GLY 242 242 242 GLY GLY A . n 
C 3 243 GLU 243 243 243 GLU GLU A . n 
C 3 244 LYS 244 244 244 LYS LYS A . n 
C 3 245 CYS 245 245 245 CYS CYS A . n 
C 3 246 SER 246 246 246 SER SER A . n 
C 3 247 ARG 247 247 247 ARG ARG A . n 
C 3 248 CYS 248 248 248 CYS CYS A . n 
C 3 249 GLY 249 249 249 GLY GLY A . n 
C 3 250 ALA 250 250 250 ALA ALA A . n 
C 3 251 GLU 251 251 251 GLU GLU A . n 
C 3 252 ILE 252 252 252 ILE ILE A . n 
C 3 253 GLN 253 253 253 GLN GLN A . n 
C 3 254 LYS 254 254 254 LYS LYS A . n 
C 3 255 ILE 255 255 255 ILE ILE A . n 
C 3 256 LYS 256 256 256 LYS LYS A . n 
C 3 257 VAL 257 257 257 VAL VAL A . n 
C 3 258 ALA 258 258 258 ALA ALA A . n 
C 3 259 GLY 259 259 259 GLY GLY A . n 
C 3 260 ARG 260 260 260 ARG ARG A . n 
C 3 261 GLY 261 261 261 GLY GLY A . n 
C 3 262 THR 262 262 262 THR THR A . n 
C 3 263 HIS 263 263 263 HIS HIS A . n 
C 3 264 PHE 264 264 264 PHE PHE A . n 
C 3 265 CYS 265 265 265 CYS CYS A . n 
C 3 266 PRO 266 266 266 PRO PRO A . n 
C 3 267 VAL 267 267 267 VAL VAL A . n 
C 3 268 CYS 268 268 268 CYS CYS A . n 
C 3 269 GLN 269 269 269 GLN GLN A . n 
C 3 270 GLN 270 270 270 GLN GLN A . n 
C 3 271 LYS 271 271 271 LYS LYS A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? C CYS 245 ? A CYS 245 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 248 ? A CYS 248 ? 1_555 111.8 ? 
2 SG ? C CYS 245 ? A CYS 245 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 265 ? A CYS 265 ? 1_555 111.3 ? 
3 SG ? C CYS 248 ? A CYS 248 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 265 ? A CYS 265 ? 1_555 96.8  ? 
4 SG ? C CYS 245 ? A CYS 245 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 268 ? A CYS 268 ? 1_555 107.9 ? 
5 SG ? C CYS 248 ? A CYS 248 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 268 ? A CYS 268 ? 1_555 113.7 ? 
6 SG ? C CYS 265 ? A CYS 265 ? 1_555 ZN ? D ZN . ? A ZN 300 ? 1_555 SG ? C CYS 268 ? A CYS 268 ? 1_555 115.1 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-06-08 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOSFLM 'data reduction' .         ? 1 
SCALA  'data scaling'   .         ? 2 
AMoRE  phasing          .         ? 3 
CNS    refinement       .         ? 4 
CCP4   'data scaling'   '(SCALA)' ? 5 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;sequence
The author maintains that the Asp137 is 
an error in the sequence database. This 
residue does not exist.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 74  ? ? 51.64   -129.94 
2 1 ASP A 107 ? ? -161.88 103.17  
3 1 ARG A 220 ? ? -144.85 -71.32  
4 1 THR A 221 ? ? 96.02   -172.95 
5 1 TYR A 222 ? ? 128.77  165.31  
6 1 VAL A 237 ? ? -136.04 -37.26  
7 1 GLN A 269 ? ? -116.46 77.60   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DC D 1  ? ? 0.060 'SIDE CHAIN' 
2 1 DG E 15 ? ? 0.051 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 220 ? CB  ? C ARG 220 CB  
2  1 Y 1 A ARG 220 ? CG  ? C ARG 220 CG  
3  1 Y 1 A ARG 220 ? CD  ? C ARG 220 CD  
4  1 Y 1 A ARG 220 ? NE  ? C ARG 220 NE  
5  1 Y 1 A ARG 220 ? CZ  ? C ARG 220 CZ  
6  1 Y 1 A ARG 220 ? NH1 ? C ARG 220 NH1 
7  1 Y 1 A ARG 220 ? NH2 ? C ARG 220 NH2 
8  1 Y 1 A THR 221 ? CB  ? C THR 221 CB  
9  1 Y 1 A THR 221 ? OG1 ? C THR 221 OG1 
10 1 Y 1 A THR 221 ? CG2 ? C THR 221 CG2 
11 1 Y 1 A TYR 222 ? CB  ? C TYR 222 CB  
12 1 Y 1 A TYR 222 ? CG  ? C TYR 222 CG  
13 1 Y 1 A TYR 222 ? CD1 ? C TYR 222 CD1 
14 1 Y 1 A TYR 222 ? CD2 ? C TYR 222 CD2 
15 1 Y 1 A TYR 222 ? CE1 ? C TYR 222 CE1 
16 1 Y 1 A TYR 222 ? CE2 ? C TYR 222 CE2 
17 1 Y 1 A TYR 222 ? CZ  ? C TYR 222 CZ  
18 1 Y 1 A TYR 222 ? OH  ? C TYR 222 OH  
19 1 Y 1 A SER 223 ? CB  ? C SER 223 CB  
20 1 Y 1 A SER 223 ? OG  ? C SER 223 OG  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1PJJ 'b-form double helix'  
1PJJ 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DT 2  1_555 B DA 14 1_555 -0.358 -0.098 -0.159 3.430  -8.071  1.423  1  D_DT2:DA28_E  D 2  ? E 28 ? 20 1 
1 A DC 3  1_555 B DG 13 1_555 0.195  -0.014 -0.213 2.113  -8.294  1.459  2  D_DC3:DG27_E  D 3  ? E 27 ? 19 1 
1 A DT 4  1_555 B DA 12 1_555 -0.140 -0.011 0.041  -4.237 -10.004 2.156  3  D_DT4:DA26_E  D 4  ? E 26 ? 20 1 
1 A DT 5  1_555 B DA 11 1_555 -0.222 -0.105 -0.381 5.649  -6.510  2.649  4  D_DT5:DA25_E  D 5  ? E 25 ? 20 1 
1 A DT 6  1_555 B DA 10 1_555 0.036  -0.114 -0.564 16.331 -1.212  0.843  5  D_DT6:DA24_E  D 6  ? E 24 ? 20 1 
1 A DT 8  1_555 B DA 8  1_555 -0.111 -0.048 -0.080 -9.661 -0.819  -1.728 6  D_DT8:DA22_E  D 8  ? E 22 ? 20 1 
1 A DT 9  1_555 B DA 7  1_555 -0.072 -0.030 -0.219 0.175  -9.773  0.393  7  D_DT9:DA21_E  D 9  ? E 21 ? 20 1 
1 A DT 10 1_555 B DA 6  1_555 -0.042 -0.065 -0.268 3.848  -4.891  0.461  8  D_DT10:DA20_E D 10 ? E 20 ? 20 1 
1 A DC 11 1_555 B DG 5  1_555 0.217  0.017  -0.363 2.517  -12.949 -1.667 9  D_DC11:DG19_E D 11 ? E 19 ? 19 1 
1 A DT 12 1_555 B DA 4  1_555 -0.234 -0.037 -0.080 -0.603 -12.599 -2.473 10 D_DT12:DA18_E D 12 ? E 18 ? 20 1 
1 A DC 13 1_555 B DG 3  1_555 0.210  0.021  0.161  -4.523 -7.051  1.378  11 D_DC13:DG17_E D 13 ? E 17 ? 19 1 
1 A DG 14 1_555 B DC 2  1_555 -0.074 -0.100 -0.285 3.340  -5.229  -1.551 12 D_DG14:DC16_E D 14 ? E 16 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DT 2  1_555 B DA 14 1_555 A DC 3  1_555 B DG 13 1_555 0.321  -0.155 3.344 1.791  3.636  38.113 -0.702 -0.259 3.327 5.548  
-2.733 38.320 1  DD_DT2DC3:DG27DA28_EE   D 2  ? E 28 ? D 3  ? E 27 ? 
1 A DC 3  1_555 B DG 13 1_555 A DT 4  1_555 B DA 12 1_555 0.296  -0.438 3.498 0.498  6.120  33.206 -1.805 -0.424 3.370 10.595 
-0.863 33.754 2  DD_DC3DT4:DA26DG27_EE   D 3  ? E 27 ? D 4  ? E 26 ? 
1 A DT 4  1_555 B DA 12 1_555 A DT 5  1_555 B DA 11 1_555 0.163  -0.021 3.049 2.514  3.771  31.502 -0.681 0.131  3.029 6.901  
-4.600 31.818 3  DD_DT4DT5:DA25DA26_EE   D 4  ? E 26 ? D 5  ? E 25 ? 
1 A DT 5  1_555 B DA 11 1_555 A DT 6  1_555 B DA 10 1_555 -0.156 0.246  3.179 1.905  11.519 28.276 -1.792 0.670  3.030 22.409 
-3.705 30.546 4  DD_DT5DT6:DA24DA25_EE   D 5  ? E 25 ? D 6  ? E 24 ? 
1 A DT 8  1_555 B DA 8  1_555 A DT 9  1_555 B DA 7  1_555 0.316  0.121  3.153 0.341  6.441  30.171 -0.988 -0.530 3.114 12.199 
-0.646 30.837 5  DD_DT8DT9:DA21DA22_EE   D 8  ? E 22 ? D 9  ? E 21 ? 
1 A DT 9  1_555 B DA 7  1_555 A DT 10 1_555 B DA 6  1_555 0.501  -0.077 3.310 1.522  3.188  33.818 -0.649 -0.611 3.308 5.461  
-2.608 33.997 6  DD_DT9DT10:DA20DA21_EE  D 9  ? E 21 ? D 10 ? E 20 ? 
1 A DT 10 1_555 B DA 6  1_555 A DC 11 1_555 B DG 5  1_555 -0.637 -0.265 3.343 -0.453 -1.653 34.049 -0.184 1.013  3.360 -2.820 
0.773  34.091 7  DD_DT10DC11:DG19DA20_EE D 10 ? E 20 ? D 11 ? E 19 ? 
1 A DC 11 1_555 B DG 5  1_555 A DT 12 1_555 B DA 4  1_555 -0.676 -0.225 3.465 -1.646 5.929  31.592 -1.529 0.908  3.397 10.763 
2.988  32.171 8  DD_DC11DT12:DA18DG19_EE D 11 ? E 19 ? D 12 ? E 18 ? 
1 A DT 12 1_555 B DA 4  1_555 A DC 13 1_555 B DG 3  1_555 0.361  -0.002 3.449 -2.140 4.017  36.590 -0.575 -0.876 3.404 6.368  
3.392  36.862 9  DD_DT12DC13:DG17DA18_EE D 12 ? E 18 ? D 13 ? E 17 ? 
1 A DC 13 1_555 B DG 3  1_555 A DG 14 1_555 B DC 2  1_555 0.394  0.665  3.270 3.682  8.728  32.954 -0.290 -0.071 3.355 15.005 
-6.329 34.252 10 DD_DC13DG14:DC16DG17_EE D 13 ? E 17 ? D 14 ? E 16 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 GLYCEROL   GOL 
6 water      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ZN  1   300  300 ZN  ZN  A . 
E 5 GOL 1   1002 2   GOL GOL A . 
F 5 GOL 1   1003 3   GOL GOL A . 
G 5 GOL 1   1004 4   GOL GOL A . 
H 6 HOH 1   23   23  HOH WAT D . 
H 6 HOH 2   47   47  HOH WAT D . 
H 6 HOH 3   68   68  HOH WAT D . 
H 6 HOH 4   76   76  HOH WAT D . 
H 6 HOH 5   85   85  HOH WAT D . 
H 6 HOH 6   86   86  HOH WAT D . 
H 6 HOH 7   92   92  HOH WAT D . 
H 6 HOH 8   114  114 HOH WAT D . 
H 6 HOH 9   117  117 HOH WAT D . 
H 6 HOH 10  123  123 HOH WAT D . 
H 6 HOH 11  166  166 HOH WAT D . 
H 6 HOH 12  192  192 HOH WAT D . 
H 6 HOH 13  197  197 HOH WAT D . 
H 6 HOH 14  204  204 HOH WAT D . 
H 6 HOH 15  206  206 HOH WAT D . 
H 6 HOH 16  222  222 HOH WAT D . 
H 6 HOH 17  231  231 HOH WAT D . 
H 6 HOH 18  236  236 HOH WAT D . 
H 6 HOH 19  243  243 HOH WAT D . 
H 6 HOH 20  244  244 HOH WAT D . 
H 6 HOH 21  246  246 HOH WAT D . 
H 6 HOH 22  251  251 HOH WAT D . 
H 6 HOH 23  265  265 HOH WAT D . 
H 6 HOH 24  275  275 HOH WAT D . 
I 6 HOH 1   110  110 HOH WAT E . 
I 6 HOH 2   165  165 HOH WAT E . 
I 6 HOH 3   173  173 HOH WAT E . 
I 6 HOH 4   182  182 HOH WAT E . 
I 6 HOH 5   199  199 HOH WAT E . 
I 6 HOH 6   200  200 HOH WAT E . 
I 6 HOH 7   220  220 HOH WAT E . 
I 6 HOH 8   228  228 HOH WAT E . 
I 6 HOH 9   229  229 HOH WAT E . 
I 6 HOH 10  247  247 HOH WAT E . 
I 6 HOH 11  248  248 HOH WAT E . 
I 6 HOH 12  252  252 HOH WAT E . 
I 6 HOH 13  253  253 HOH WAT E . 
I 6 HOH 14  254  254 HOH WAT E . 
I 6 HOH 15  267  267 HOH WAT E . 
I 6 HOH 16  268  268 HOH WAT E . 
J 6 HOH 1   1005 1   HOH WAT A . 
J 6 HOH 2   1006 2   HOH WAT A . 
J 6 HOH 3   1007 3   HOH WAT A . 
J 6 HOH 4   1008 4   HOH WAT A . 
J 6 HOH 5   1009 5   HOH WAT A . 
J 6 HOH 6   1010 6   HOH WAT A . 
J 6 HOH 7   1011 7   HOH WAT A . 
J 6 HOH 8   1012 8   HOH WAT A . 
J 6 HOH 9   1013 9   HOH WAT A . 
J 6 HOH 10  1014 10  HOH WAT A . 
J 6 HOH 11  1015 11  HOH WAT A . 
J 6 HOH 12  1016 12  HOH WAT A . 
J 6 HOH 13  1017 13  HOH WAT A . 
J 6 HOH 14  1018 14  HOH WAT A . 
J 6 HOH 15  1019 15  HOH WAT A . 
J 6 HOH 16  1020 16  HOH WAT A . 
J 6 HOH 17  1021 17  HOH WAT A . 
J 6 HOH 18  1022 18  HOH WAT A . 
J 6 HOH 19  1023 19  HOH WAT A . 
J 6 HOH 20  1024 20  HOH WAT A . 
J 6 HOH 21  1025 21  HOH WAT A . 
J 6 HOH 22  1026 22  HOH WAT A . 
J 6 HOH 23  1027 24  HOH WAT A . 
J 6 HOH 24  1028 25  HOH WAT A . 
J 6 HOH 25  1029 26  HOH WAT A . 
J 6 HOH 26  1030 27  HOH WAT A . 
J 6 HOH 27  1031 28  HOH WAT A . 
J 6 HOH 28  1032 29  HOH WAT A . 
J 6 HOH 29  1033 30  HOH WAT A . 
J 6 HOH 30  1034 31  HOH WAT A . 
J 6 HOH 31  1035 32  HOH WAT A . 
J 6 HOH 32  1036 33  HOH WAT A . 
J 6 HOH 33  1037 34  HOH WAT A . 
J 6 HOH 34  1038 35  HOH WAT A . 
J 6 HOH 35  1039 36  HOH WAT A . 
J 6 HOH 36  1040 37  HOH WAT A . 
J 6 HOH 37  1041 38  HOH WAT A . 
J 6 HOH 38  1042 39  HOH WAT A . 
J 6 HOH 39  1043 40  HOH WAT A . 
J 6 HOH 40  1044 41  HOH WAT A . 
J 6 HOH 41  1045 42  HOH WAT A . 
J 6 HOH 42  1046 43  HOH WAT A . 
J 6 HOH 43  1047 44  HOH WAT A . 
J 6 HOH 44  1048 45  HOH WAT A . 
J 6 HOH 45  1049 46  HOH WAT A . 
J 6 HOH 46  1050 48  HOH WAT A . 
J 6 HOH 47  1051 49  HOH WAT A . 
J 6 HOH 48  1052 50  HOH WAT A . 
J 6 HOH 49  1053 51  HOH WAT A . 
J 6 HOH 50  1054 52  HOH WAT A . 
J 6 HOH 51  1055 53  HOH WAT A . 
J 6 HOH 52  1056 54  HOH WAT A . 
J 6 HOH 53  1057 55  HOH WAT A . 
J 6 HOH 54  1058 56  HOH WAT A . 
J 6 HOH 55  1059 57  HOH WAT A . 
J 6 HOH 56  1060 58  HOH WAT A . 
J 6 HOH 57  1061 59  HOH WAT A . 
J 6 HOH 58  1062 60  HOH WAT A . 
J 6 HOH 59  1063 61  HOH WAT A . 
J 6 HOH 60  1064 62  HOH WAT A . 
J 6 HOH 61  1065 63  HOH WAT A . 
J 6 HOH 62  1066 64  HOH WAT A . 
J 6 HOH 63  1067 65  HOH WAT A . 
J 6 HOH 64  1068 66  HOH WAT A . 
J 6 HOH 65  1069 67  HOH WAT A . 
J 6 HOH 66  1070 69  HOH WAT A . 
J 6 HOH 67  1071 70  HOH WAT A . 
J 6 HOH 68  1072 71  HOH WAT A . 
J 6 HOH 69  1073 72  HOH WAT A . 
J 6 HOH 70  1074 73  HOH WAT A . 
J 6 HOH 71  1075 74  HOH WAT A . 
J 6 HOH 72  1076 75  HOH WAT A . 
J 6 HOH 73  1077 77  HOH WAT A . 
J 6 HOH 74  1078 78  HOH WAT A . 
J 6 HOH 75  1079 79  HOH WAT A . 
J 6 HOH 76  1080 80  HOH WAT A . 
J 6 HOH 77  1081 81  HOH WAT A . 
J 6 HOH 78  1082 82  HOH WAT A . 
J 6 HOH 79  1083 83  HOH WAT A . 
J 6 HOH 80  1084 84  HOH WAT A . 
J 6 HOH 81  1085 87  HOH WAT A . 
J 6 HOH 82  1086 88  HOH WAT A . 
J 6 HOH 83  1087 89  HOH WAT A . 
J 6 HOH 84  1088 90  HOH WAT A . 
J 6 HOH 85  1089 91  HOH WAT A . 
J 6 HOH 86  1090 93  HOH WAT A . 
J 6 HOH 87  1091 94  HOH WAT A . 
J 6 HOH 88  1092 95  HOH WAT A . 
J 6 HOH 89  1093 96  HOH WAT A . 
J 6 HOH 90  1094 97  HOH WAT A . 
J 6 HOH 91  1095 98  HOH WAT A . 
J 6 HOH 92  1096 99  HOH WAT A . 
J 6 HOH 93  1097 100 HOH WAT A . 
J 6 HOH 94  1098 101 HOH WAT A . 
J 6 HOH 95  1099 102 HOH WAT A . 
J 6 HOH 96  1100 103 HOH WAT A . 
J 6 HOH 97  1101 104 HOH WAT A . 
J 6 HOH 98  1102 105 HOH WAT A . 
J 6 HOH 99  1103 106 HOH WAT A . 
J 6 HOH 100 1104 107 HOH WAT A . 
J 6 HOH 101 1105 108 HOH WAT A . 
J 6 HOH 102 1106 109 HOH WAT A . 
J 6 HOH 103 1107 111 HOH WAT A . 
J 6 HOH 104 1108 112 HOH WAT A . 
J 6 HOH 105 1109 113 HOH WAT A . 
J 6 HOH 106 1110 115 HOH WAT A . 
J 6 HOH 107 1111 116 HOH WAT A . 
J 6 HOH 108 1112 118 HOH WAT A . 
J 6 HOH 109 1113 119 HOH WAT A . 
J 6 HOH 110 1114 120 HOH WAT A . 
J 6 HOH 111 1115 121 HOH WAT A . 
J 6 HOH 112 1116 122 HOH WAT A . 
J 6 HOH 113 1117 124 HOH WAT A . 
J 6 HOH 114 1118 125 HOH WAT A . 
J 6 HOH 115 1119 126 HOH WAT A . 
J 6 HOH 116 1120 127 HOH WAT A . 
J 6 HOH 117 1121 128 HOH WAT A . 
J 6 HOH 118 1122 129 HOH WAT A . 
J 6 HOH 119 1123 130 HOH WAT A . 
J 6 HOH 120 1124 131 HOH WAT A . 
J 6 HOH 121 1125 132 HOH WAT A . 
J 6 HOH 122 1126 133 HOH WAT A . 
J 6 HOH 123 1127 134 HOH WAT A . 
J 6 HOH 124 1128 135 HOH WAT A . 
J 6 HOH 125 1129 136 HOH WAT A . 
J 6 HOH 126 1130 137 HOH WAT A . 
J 6 HOH 127 1131 138 HOH WAT A . 
J 6 HOH 128 1132 139 HOH WAT A . 
J 6 HOH 129 1133 140 HOH WAT A . 
J 6 HOH 130 1134 141 HOH WAT A . 
J 6 HOH 131 1135 142 HOH WAT A . 
J 6 HOH 132 1136 143 HOH WAT A . 
J 6 HOH 133 1137 144 HOH WAT A . 
J 6 HOH 134 1138 145 HOH WAT A . 
J 6 HOH 135 1139 146 HOH WAT A . 
J 6 HOH 136 1140 147 HOH WAT A . 
J 6 HOH 137 1141 148 HOH WAT A . 
J 6 HOH 138 1142 149 HOH WAT A . 
J 6 HOH 139 1143 150 HOH WAT A . 
J 6 HOH 140 1144 151 HOH WAT A . 
J 6 HOH 141 1145 152 HOH WAT A . 
J 6 HOH 142 1146 153 HOH WAT A . 
J 6 HOH 143 1147 154 HOH WAT A . 
J 6 HOH 144 1148 155 HOH WAT A . 
J 6 HOH 145 1149 156 HOH WAT A . 
J 6 HOH 146 1150 157 HOH WAT A . 
J 6 HOH 147 1151 158 HOH WAT A . 
J 6 HOH 148 1152 159 HOH WAT A . 
J 6 HOH 149 1153 160 HOH WAT A . 
J 6 HOH 150 1154 161 HOH WAT A . 
J 6 HOH 151 1155 162 HOH WAT A . 
J 6 HOH 152 1156 163 HOH WAT A . 
J 6 HOH 153 1157 164 HOH WAT A . 
J 6 HOH 154 1158 167 HOH WAT A . 
J 6 HOH 155 1159 168 HOH WAT A . 
J 6 HOH 156 1160 169 HOH WAT A . 
J 6 HOH 157 1161 170 HOH WAT A . 
J 6 HOH 158 1162 171 HOH WAT A . 
J 6 HOH 159 1163 172 HOH WAT A . 
J 6 HOH 160 1164 174 HOH WAT A . 
J 6 HOH 161 1165 175 HOH WAT A . 
J 6 HOH 162 1166 176 HOH WAT A . 
J 6 HOH 163 1167 177 HOH WAT A . 
J 6 HOH 164 1168 178 HOH WAT A . 
J 6 HOH 165 1169 179 HOH WAT A . 
J 6 HOH 166 1170 180 HOH WAT A . 
J 6 HOH 167 1171 181 HOH WAT A . 
J 6 HOH 168 1172 183 HOH WAT A . 
J 6 HOH 169 1173 184 HOH WAT A . 
J 6 HOH 170 1174 185 HOH WAT A . 
J 6 HOH 171 1175 186 HOH WAT A . 
J 6 HOH 172 1176 187 HOH WAT A . 
J 6 HOH 173 1177 188 HOH WAT A . 
J 6 HOH 174 1178 189 HOH WAT A . 
J 6 HOH 175 1179 190 HOH WAT A . 
J 6 HOH 176 1180 191 HOH WAT A . 
J 6 HOH 177 1181 193 HOH WAT A . 
J 6 HOH 178 1182 194 HOH WAT A . 
J 6 HOH 179 1183 195 HOH WAT A . 
J 6 HOH 180 1184 196 HOH WAT A . 
J 6 HOH 181 1185 198 HOH WAT A . 
J 6 HOH 182 1186 201 HOH WAT A . 
J 6 HOH 183 1187 202 HOH WAT A . 
J 6 HOH 184 1188 203 HOH WAT A . 
J 6 HOH 185 1189 205 HOH WAT A . 
J 6 HOH 186 1190 207 HOH WAT A . 
J 6 HOH 187 1191 208 HOH WAT A . 
J 6 HOH 188 1192 209 HOH WAT A . 
J 6 HOH 189 1193 210 HOH WAT A . 
J 6 HOH 190 1194 211 HOH WAT A . 
J 6 HOH 191 1195 212 HOH WAT A . 
J 6 HOH 192 1196 213 HOH WAT A . 
J 6 HOH 193 1197 214 HOH WAT A . 
J 6 HOH 194 1198 215 HOH WAT A . 
J 6 HOH 195 1199 216 HOH WAT A . 
J 6 HOH 196 1200 217 HOH WAT A . 
J 6 HOH 197 1201 218 HOH WAT A . 
J 6 HOH 198 1202 219 HOH WAT A . 
J 6 HOH 199 1203 221 HOH WAT A . 
J 6 HOH 200 1204 223 HOH WAT A . 
J 6 HOH 201 1205 224 HOH WAT A . 
J 6 HOH 202 1206 225 HOH WAT A . 
J 6 HOH 203 1207 226 HOH WAT A . 
J 6 HOH 204 1208 227 HOH WAT A . 
J 6 HOH 205 1209 230 HOH WAT A . 
J 6 HOH 206 1210 232 HOH WAT A . 
J 6 HOH 207 1211 233 HOH WAT A . 
J 6 HOH 208 1212 234 HOH WAT A . 
J 6 HOH 209 1213 235 HOH WAT A . 
J 6 HOH 210 1214 237 HOH WAT A . 
J 6 HOH 211 1215 238 HOH WAT A . 
J 6 HOH 212 1216 239 HOH WAT A . 
J 6 HOH 213 1217 240 HOH WAT A . 
J 6 HOH 214 1218 241 HOH WAT A . 
J 6 HOH 215 1219 242 HOH WAT A . 
J 6 HOH 216 1220 245 HOH WAT A . 
J 6 HOH 217 1221 249 HOH WAT A . 
J 6 HOH 218 1222 250 HOH WAT A . 
J 6 HOH 219 1223 255 HOH WAT A . 
J 6 HOH 220 1224 256 HOH WAT A . 
J 6 HOH 221 1225 257 HOH WAT A . 
J 6 HOH 222 1226 258 HOH WAT A . 
J 6 HOH 223 1227 259 HOH WAT A . 
J 6 HOH 224 1228 260 HOH WAT A . 
J 6 HOH 225 1229 261 HOH WAT A . 
J 6 HOH 226 1230 262 HOH WAT A . 
J 6 HOH 227 1231 263 HOH WAT A . 
J 6 HOH 228 1232 264 HOH WAT A . 
J 6 HOH 229 1233 266 HOH WAT A . 
J 6 HOH 230 1234 269 HOH WAT A . 
J 6 HOH 231 1235 270 HOH WAT A . 
J 6 HOH 232 1236 271 HOH WAT A . 
J 6 HOH 233 1237 272 HOH WAT A . 
J 6 HOH 234 1238 273 HOH WAT A . 
J 6 HOH 235 1239 274 HOH WAT A . 
J 6 HOH 236 1240 276 HOH WAT A . 
J 6 HOH 237 1241 277 HOH WAT A . 
J 6 HOH 238 1242 278 HOH WAT A . 
#