data_1PKD
# 
_entry.id   1PKD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1PKD         
RCSB  RCSB019387   
WWPDB D_1000019387 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1QMZ 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1PKD 
_pdbx_database_status.recvd_initial_deposition_date   2003-06-05 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Johnson, L.N.'  1 
'De Moliner, E.' 2 
'Brown, N.R.'    3 
'Song, H.'       4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The Crystal Structure of UCN-01 in Complex with Phospho-CDK2/Cyclin A'                            'To be Published' ?  ? 
?   ?    ?      ?  ?         0353 ? ? ?                               
1       'Structural studies with inhibitors of the cell cycle regulatory kinase cyclin dependent kinase 2' Pharmacol.Ther.   93 
113 124 2002 PHTHDT UK 0163-7258 0792 ? ? '10.1016/S0163-7258(02)00181-X' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Johnson, L.N.'  1  
primary 'De Moliner, E.' 2  
primary 'Brown, N.R.'    3  
primary 'Song, H.'       4  
1       'Johnson, L.N.'  5  
1       'De Moliner, E.' 6  
1       'Brown, N.R.'    7  
1       'Song, H.'       8  
1       'Barford, D.'    9  
1       'Endicott, J.A.' 10 
1       'Noble, .M.E.'   11 
# 
_cell.entry_id           1PKD 
_cell.length_a           73.62 
_cell.length_b           134.57 
_cell.length_c           147.97 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1PKD 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cell division protein kinase 2' 33873.195 2   2.7.1.- ? ? ? 
2 polymer     man 'Cyclin A2'                      29624.297 2   ?       ? ? ? 
3 non-polymer syn 7-HYDROXYSTAUROSPORINE           482.530   2   ?       ? ? ? 
4 water       nat water                            18.015    402 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'p33 protein kinase' 
2 'Cyclin A'           
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;SMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLV
FEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY
(TPO)HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPD
YKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHL
;
;SMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLV
FEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY
THEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPS
FPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHL
;
A,C ? 
2 'polypeptide(L)' no no  
;VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQ
LVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAM
FLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK
NSKYHGVSLLNPPETLNL
;
;VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQ
LVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAM
FLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK
NSKYHGVSLLNPPETLNL
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   GLU n 
1 4   ASN n 
1 5   PHE n 
1 6   GLN n 
1 7   LYS n 
1 8   VAL n 
1 9   GLU n 
1 10  LYS n 
1 11  ILE n 
1 12  GLY n 
1 13  GLU n 
1 14  GLY n 
1 15  THR n 
1 16  TYR n 
1 17  GLY n 
1 18  VAL n 
1 19  VAL n 
1 20  TYR n 
1 21  LYS n 
1 22  ALA n 
1 23  ARG n 
1 24  ASN n 
1 25  LYS n 
1 26  LEU n 
1 27  THR n 
1 28  GLY n 
1 29  GLU n 
1 30  VAL n 
1 31  VAL n 
1 32  ALA n 
1 33  LEU n 
1 34  LYS n 
1 35  LYS n 
1 36  ILE n 
1 37  ARG n 
1 38  LEU n 
1 39  ASP n 
1 40  THR n 
1 41  GLU n 
1 42  THR n 
1 43  GLU n 
1 44  GLY n 
1 45  VAL n 
1 46  PRO n 
1 47  SER n 
1 48  THR n 
1 49  ALA n 
1 50  ILE n 
1 51  ARG n 
1 52  GLU n 
1 53  ILE n 
1 54  SER n 
1 55  LEU n 
1 56  LEU n 
1 57  LYS n 
1 58  GLU n 
1 59  LEU n 
1 60  ASN n 
1 61  HIS n 
1 62  PRO n 
1 63  ASN n 
1 64  ILE n 
1 65  VAL n 
1 66  LYS n 
1 67  LEU n 
1 68  LEU n 
1 69  ASP n 
1 70  VAL n 
1 71  ILE n 
1 72  HIS n 
1 73  THR n 
1 74  GLU n 
1 75  ASN n 
1 76  LYS n 
1 77  LEU n 
1 78  TYR n 
1 79  LEU n 
1 80  VAL n 
1 81  PHE n 
1 82  GLU n 
1 83  PHE n 
1 84  LEU n 
1 85  HIS n 
1 86  GLN n 
1 87  ASP n 
1 88  LEU n 
1 89  LYS n 
1 90  LYS n 
1 91  PHE n 
1 92  MET n 
1 93  ASP n 
1 94  ALA n 
1 95  SER n 
1 96  ALA n 
1 97  LEU n 
1 98  THR n 
1 99  GLY n 
1 100 ILE n 
1 101 PRO n 
1 102 LEU n 
1 103 PRO n 
1 104 LEU n 
1 105 ILE n 
1 106 LYS n 
1 107 SER n 
1 108 TYR n 
1 109 LEU n 
1 110 PHE n 
1 111 GLN n 
1 112 LEU n 
1 113 LEU n 
1 114 GLN n 
1 115 GLY n 
1 116 LEU n 
1 117 ALA n 
1 118 PHE n 
1 119 CYS n 
1 120 HIS n 
1 121 SER n 
1 122 HIS n 
1 123 ARG n 
1 124 VAL n 
1 125 LEU n 
1 126 HIS n 
1 127 ARG n 
1 128 ASP n 
1 129 LEU n 
1 130 LYS n 
1 131 PRO n 
1 132 GLN n 
1 133 ASN n 
1 134 LEU n 
1 135 LEU n 
1 136 ILE n 
1 137 ASN n 
1 138 THR n 
1 139 GLU n 
1 140 GLY n 
1 141 ALA n 
1 142 ILE n 
1 143 LYS n 
1 144 LEU n 
1 145 ALA n 
1 146 ASP n 
1 147 PHE n 
1 148 GLY n 
1 149 LEU n 
1 150 ALA n 
1 151 ARG n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 VAL n 
1 156 PRO n 
1 157 VAL n 
1 158 ARG n 
1 159 THR n 
1 160 TYR n 
1 161 TPO n 
1 162 HIS n 
1 163 GLU n 
1 164 VAL n 
1 165 VAL n 
1 166 THR n 
1 167 LEU n 
1 168 TRP n 
1 169 TYR n 
1 170 ARG n 
1 171 ALA n 
1 172 PRO n 
1 173 GLU n 
1 174 ILE n 
1 175 LEU n 
1 176 LEU n 
1 177 GLY n 
1 178 CYS n 
1 179 LYS n 
1 180 TYR n 
1 181 TYR n 
1 182 SER n 
1 183 THR n 
1 184 ALA n 
1 185 VAL n 
1 186 ASP n 
1 187 ILE n 
1 188 TRP n 
1 189 SER n 
1 190 LEU n 
1 191 GLY n 
1 192 CYS n 
1 193 ILE n 
1 194 PHE n 
1 195 ALA n 
1 196 GLU n 
1 197 MET n 
1 198 VAL n 
1 199 THR n 
1 200 ARG n 
1 201 ARG n 
1 202 ALA n 
1 203 LEU n 
1 204 PHE n 
1 205 PRO n 
1 206 GLY n 
1 207 ASP n 
1 208 SER n 
1 209 GLU n 
1 210 ILE n 
1 211 ASP n 
1 212 GLN n 
1 213 LEU n 
1 214 PHE n 
1 215 ARG n 
1 216 ILE n 
1 217 PHE n 
1 218 ARG n 
1 219 THR n 
1 220 LEU n 
1 221 GLY n 
1 222 THR n 
1 223 PRO n 
1 224 ASP n 
1 225 GLU n 
1 226 VAL n 
1 227 VAL n 
1 228 TRP n 
1 229 PRO n 
1 230 GLY n 
1 231 VAL n 
1 232 THR n 
1 233 SER n 
1 234 MET n 
1 235 PRO n 
1 236 ASP n 
1 237 TYR n 
1 238 LYS n 
1 239 PRO n 
1 240 SER n 
1 241 PHE n 
1 242 PRO n 
1 243 LYS n 
1 244 TRP n 
1 245 ALA n 
1 246 ARG n 
1 247 GLN n 
1 248 ASP n 
1 249 PHE n 
1 250 SER n 
1 251 LYS n 
1 252 VAL n 
1 253 VAL n 
1 254 PRO n 
1 255 PRO n 
1 256 LEU n 
1 257 ASP n 
1 258 GLU n 
1 259 ASP n 
1 260 GLY n 
1 261 ARG n 
1 262 SER n 
1 263 LEU n 
1 264 LEU n 
1 265 SER n 
1 266 GLN n 
1 267 MET n 
1 268 LEU n 
1 269 HIS n 
1 270 TYR n 
1 271 ASP n 
1 272 PRO n 
1 273 ASN n 
1 274 LYS n 
1 275 ARG n 
1 276 ILE n 
1 277 SER n 
1 278 ALA n 
1 279 LYS n 
1 280 ALA n 
1 281 ALA n 
1 282 LEU n 
1 283 ALA n 
1 284 HIS n 
1 285 PRO n 
1 286 PHE n 
1 287 PHE n 
1 288 GLN n 
1 289 ASP n 
1 290 VAL n 
1 291 THR n 
1 292 LYS n 
1 293 PRO n 
1 294 VAL n 
1 295 PRO n 
1 296 HIS n 
1 297 LEU n 
2 1   VAL n 
2 2   PRO n 
2 3   ASP n 
2 4   TYR n 
2 5   HIS n 
2 6   GLU n 
2 7   ASP n 
2 8   ILE n 
2 9   HIS n 
2 10  THR n 
2 11  TYR n 
2 12  LEU n 
2 13  ARG n 
2 14  GLU n 
2 15  MET n 
2 16  GLU n 
2 17  VAL n 
2 18  LYS n 
2 19  CYS n 
2 20  LYS n 
2 21  PRO n 
2 22  LYS n 
2 23  VAL n 
2 24  GLY n 
2 25  TYR n 
2 26  MET n 
2 27  LYS n 
2 28  LYS n 
2 29  GLN n 
2 30  PRO n 
2 31  ASP n 
2 32  ILE n 
2 33  THR n 
2 34  ASN n 
2 35  SER n 
2 36  MET n 
2 37  ARG n 
2 38  ALA n 
2 39  ILE n 
2 40  LEU n 
2 41  VAL n 
2 42  ASP n 
2 43  TRP n 
2 44  LEU n 
2 45  VAL n 
2 46  GLU n 
2 47  VAL n 
2 48  GLY n 
2 49  GLU n 
2 50  GLU n 
2 51  TYR n 
2 52  LYS n 
2 53  LEU n 
2 54  GLN n 
2 55  ASN n 
2 56  GLU n 
2 57  THR n 
2 58  LEU n 
2 59  HIS n 
2 60  LEU n 
2 61  ALA n 
2 62  VAL n 
2 63  ASN n 
2 64  TYR n 
2 65  ILE n 
2 66  ASP n 
2 67  ARG n 
2 68  PHE n 
2 69  LEU n 
2 70  SER n 
2 71  SER n 
2 72  MET n 
2 73  SER n 
2 74  VAL n 
2 75  LEU n 
2 76  ARG n 
2 77  GLY n 
2 78  LYS n 
2 79  LEU n 
2 80  GLN n 
2 81  LEU n 
2 82  VAL n 
2 83  GLY n 
2 84  THR n 
2 85  ALA n 
2 86  ALA n 
2 87  MET n 
2 88  LEU n 
2 89  LEU n 
2 90  ALA n 
2 91  SER n 
2 92  LYS n 
2 93  PHE n 
2 94  GLU n 
2 95  GLU n 
2 96  ILE n 
2 97  TYR n 
2 98  PRO n 
2 99  PRO n 
2 100 GLU n 
2 101 VAL n 
2 102 ALA n 
2 103 GLU n 
2 104 PHE n 
2 105 VAL n 
2 106 TYR n 
2 107 ILE n 
2 108 THR n 
2 109 ASP n 
2 110 ASP n 
2 111 THR n 
2 112 TYR n 
2 113 THR n 
2 114 LYS n 
2 115 LYS n 
2 116 GLN n 
2 117 VAL n 
2 118 LEU n 
2 119 ARG n 
2 120 MET n 
2 121 GLU n 
2 122 HIS n 
2 123 LEU n 
2 124 VAL n 
2 125 LEU n 
2 126 LYS n 
2 127 VAL n 
2 128 LEU n 
2 129 THR n 
2 130 PHE n 
2 131 ASP n 
2 132 LEU n 
2 133 ALA n 
2 134 ALA n 
2 135 PRO n 
2 136 THR n 
2 137 VAL n 
2 138 ASN n 
2 139 GLN n 
2 140 PHE n 
2 141 LEU n 
2 142 THR n 
2 143 GLN n 
2 144 TYR n 
2 145 PHE n 
2 146 LEU n 
2 147 HIS n 
2 148 GLN n 
2 149 GLN n 
2 150 PRO n 
2 151 ALA n 
2 152 ASN n 
2 153 CYS n 
2 154 LYS n 
2 155 VAL n 
2 156 GLU n 
2 157 SER n 
2 158 LEU n 
2 159 ALA n 
2 160 MET n 
2 161 PHE n 
2 162 LEU n 
2 163 GLY n 
2 164 GLU n 
2 165 LEU n 
2 166 SER n 
2 167 LEU n 
2 168 ILE n 
2 169 ASP n 
2 170 ALA n 
2 171 ASP n 
2 172 PRO n 
2 173 TYR n 
2 174 LEU n 
2 175 LYS n 
2 176 TYR n 
2 177 LEU n 
2 178 PRO n 
2 179 SER n 
2 180 VAL n 
2 181 ILE n 
2 182 ALA n 
2 183 GLY n 
2 184 ALA n 
2 185 ALA n 
2 186 PHE n 
2 187 HIS n 
2 188 LEU n 
2 189 ALA n 
2 190 LEU n 
2 191 TYR n 
2 192 THR n 
2 193 VAL n 
2 194 THR n 
2 195 GLY n 
2 196 GLN n 
2 197 SER n 
2 198 TRP n 
2 199 PRO n 
2 200 GLU n 
2 201 SER n 
2 202 LEU n 
2 203 ILE n 
2 204 ARG n 
2 205 LYS n 
2 206 THR n 
2 207 GLY n 
2 208 TYR n 
2 209 THR n 
2 210 LEU n 
2 211 GLU n 
2 212 SER n 
2 213 LEU n 
2 214 LYS n 
2 215 PRO n 
2 216 CYS n 
2 217 LEU n 
2 218 MET n 
2 219 ASP n 
2 220 LEU n 
2 221 HIS n 
2 222 GLN n 
2 223 THR n 
2 224 TYR n 
2 225 LEU n 
2 226 LYS n 
2 227 ALA n 
2 228 PRO n 
2 229 GLN n 
2 230 HIS n 
2 231 ALA n 
2 232 GLN n 
2 233 GLN n 
2 234 SER n 
2 235 ILE n 
2 236 ARG n 
2 237 GLU n 
2 238 LYS n 
2 239 TYR n 
2 240 LYS n 
2 241 ASN n 
2 242 SER n 
2 243 LYS n 
2 244 TYR n 
2 245 HIS n 
2 246 GLY n 
2 247 VAL n 
2 248 SER n 
2 249 LEU n 
2 250 LEU n 
2 251 ASN n 
2 252 PRO n 
2 253 PRO n 
2 254 GLU n 
2 255 THR n 
2 256 LEU n 
2 257 ASN n 
2 258 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo CDK2                    ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? B834      ? ? ? ? ? ? ? Plasmid ? ? ? 'pGEX 6P' ? ? 
2 1 sample ? ? ? human Homo 'CCNA2 OR CCNA OR CCN1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? B834pET21 ? ? ? ? ? ? ? Plasmid ? ? ? pET21d    ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP CDK2_HUMAN  P24941 1 1   ? ? 
2 UNP CCNA2_HUMAN P20248 2 175 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1PKD A 2 ? 297 ? P24941 1   ? 296 ? 1   296 
2 2 1PKD B 1 ? 258 ? P20248 175 ? 432 ? 175 432 
3 1 1PKD C 2 ? 297 ? P24941 1   ? 296 ? 1   296 
4 2 1PKD D 1 ? 258 ? P20248 175 ? 432 ? 175 432 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1PKD SER A 1   ? UNP P24941 ?   ?   'CLONING ARTIFACT' 0   1 
1 1PKD TPO A 161 ? UNP P24941 THR 160 'MODIFIED RESIDUE' 160 2 
3 1PKD SER C 1   ? UNP P24941 ?   ?   'CLONING ARTIFACT' 0   3 
3 1PKD TPO C 161 ? UNP P24941 THR 160 'MODIFIED RESIDUE' 160 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                ?                  'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE               ?                  'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE             ?                  'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'        ?                  'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE               ?                  'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE              ?                  'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'        ?                  'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                ?                  'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE              ?                  'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                  ?                  'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE             ?                  'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                ?                  'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                 ?                  'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE             ?                  'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE          ?                  'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                ?                  'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                 ?                  'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE              ?                  'C4 H9 N O3'     119.119 
TPO 'L-peptide linking' n PHOSPHOTHREONINE       PHOSPHONOTHREONINE 'C4 H10 N O6 P'  199.099 
TRP 'L-peptide linking' y TRYPTOPHAN             ?                  'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE               ?                  'C9 H11 N O3'    181.189 
UCN non-polymer         . 7-HYDROXYSTAUROSPORINE ?                  'C28 H26 N4 O4'  482.530 
VAL 'L-peptide linking' y VALINE                 ?                  'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1PKD 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.88 
_exptl_crystal.density_percent_sol   57.36 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_details    
'1.25M (NH4)2SO4, 0.8M KCl, 100mM HEPES, pH 7.4, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.934 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.934 
# 
_reflns.entry_id                     1PKD 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.30 
_reflns.d_resolution_low             100.00 
_reflns.number_all                   65518 
_reflns.number_obs                   57525 
_reflns.percent_possible_obs         87.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.09 
_reflns.pdbx_netI_over_sigmaI        4.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.38 
_reflns_shell.percent_possible_all   80.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.331 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1PKD 
_refine.ls_number_reflns_obs                     54590 
_refine.ls_number_reflns_all                     57525 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             100.00 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    87.03 
_refine.ls_R_factor_obs                          0.21818 
_refine.ls_R_factor_all                          0.21818 
_refine.ls_R_factor_R_work                       0.2155 
_refine.ls_R_factor_R_free                       0.26831 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2904 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.936 
_refine.correlation_coeff_Fo_to_Fc_free          0.896 
_refine.B_iso_mean                               42.484 
_refine.aniso_B[1][1]                            -0.76 
_refine.aniso_B[2][2]                            0.81 
_refine.aniso_B[3][3]                            -0.05 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1QMZ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.394 
_refine.pdbx_overall_ESU_R_Free                  0.273 
_refine.overall_SU_ML                            0.200 
_refine.overall_SU_B                             8.272 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8942 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         72 
_refine_hist.number_atoms_solvent             402 
_refine_hist.number_atoms_total               9416 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        100.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.009 0.022 ? 9254  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.540 1.982 ? 12586 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.824 5.000 ? 1106  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.095 0.200 ? 1420  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.004 0.020 ? 6888  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.218 0.200 ? 4648  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.162 0.200 ? 496   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.311 0.200 ? 216   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.215 0.200 ? 15    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.844 1.500 ? 5562  'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.598 2.000 ? 9046  'X-RAY DIFFRACTION' ? 
r_scbond_it              1.765 3.000 ? 3688  'X-RAY DIFFRACTION' ? 
r_scangle_it             3.079 4.500 ? 3540  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.360 
_refine_ls_shell.number_reflns_R_work             3636 
_refine_ls_shell.R_factor_R_work                  0.268 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.343 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             203 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1PKD 
_struct.title                     'THE CRYSTAL STRUCTURE OF UCN-01 IN COMPLEX WITH PHOSPHO-CDK2/CYCLIN A' 
_struct.pdbx_descriptor           'Cell division protein kinase 2 (E.C.2.7.1.-), Cyclin A2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1PKD 
_struct_keywords.pdbx_keywords   'TRANSFERASE/CELL CYCLE' 
_struct_keywords.text            'Protein kinase-drug complex, TRANSFERASE-CELL CYCLE COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 
;The asymmetric unit contains two molecules of the phospho-CDK2/cyclin A
in complex with the radiosensitizing anti-cancer drug UCN-01
;
? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 1   ? GLU A 3   ? SER A 0   GLU A 2   5 ? 3  
HELX_P HELX_P2  2  PRO A 46  ? LYS A 57  ? PRO A 45  LYS A 56  1 ? 12 
HELX_P HELX_P3  3  LEU A 88  ? ALA A 94  ? LEU A 87  ALA A 93  1 ? 7  
HELX_P HELX_P4  4  PRO A 101 ? HIS A 122 ? PRO A 100 HIS A 121 1 ? 22 
HELX_P HELX_P5  5  LYS A 130 ? GLN A 132 ? LYS A 129 GLN A 131 5 ? 3  
HELX_P HELX_P6  6  THR A 166 ? ARG A 170 ? THR A 165 ARG A 169 5 ? 5  
HELX_P HELX_P7  7  ALA A 171 ? LEU A 176 ? ALA A 170 LEU A 175 1 ? 6  
HELX_P HELX_P8  8  THR A 183 ? ARG A 200 ? THR A 182 ARG A 199 1 ? 18 
HELX_P HELX_P9  9  SER A 208 ? GLY A 221 ? SER A 207 GLY A 220 1 ? 14 
HELX_P HELX_P10 10 GLY A 230 ? MET A 234 ? GLY A 229 MET A 233 5 ? 5  
HELX_P HELX_P11 11 ASP A 248 ? VAL A 253 ? ASP A 247 VAL A 252 1 ? 6  
HELX_P HELX_P12 12 ASP A 257 ? LEU A 268 ? ASP A 256 LEU A 267 1 ? 12 
HELX_P HELX_P13 13 SER A 277 ? ALA A 283 ? SER A 276 ALA A 282 1 ? 7  
HELX_P HELX_P14 14 HIS A 284 ? GLN A 288 ? HIS A 283 GLN A 287 5 ? 5  
HELX_P HELX_P15 15 TYR B 4   ? CYS B 19  ? TYR B 178 CYS B 193 1 ? 16 
HELX_P HELX_P16 16 THR B 33  ? LYS B 52  ? THR B 207 LYS B 226 1 ? 20 
HELX_P HELX_P17 17 GLN B 54  ? SER B 70  ? GLN B 228 SER B 244 1 ? 17 
HELX_P HELX_P18 18 LEU B 75  ? GLY B 77  ? LEU B 249 GLY B 251 5 ? 3  
HELX_P HELX_P19 19 LYS B 78  ? GLU B 95  ? LYS B 252 GLU B 269 1 ? 18 
HELX_P HELX_P20 20 GLU B 100 ? THR B 108 ? GLU B 274 THR B 282 1 ? 9  
HELX_P HELX_P21 21 THR B 113 ? LEU B 128 ? THR B 287 LEU B 302 1 ? 16 
HELX_P HELX_P22 22 THR B 136 ? LEU B 146 ? THR B 310 LEU B 320 1 ? 11 
HELX_P HELX_P23 23 ASN B 152 ? ASP B 169 ? ASN B 326 ASP B 343 1 ? 18 
HELX_P HELX_P24 24 ASP B 169 ? LEU B 174 ? ASP B 343 LEU B 348 1 ? 6  
HELX_P HELX_P25 25 LEU B 177 ? GLY B 195 ? LEU B 351 GLY B 369 1 ? 19 
HELX_P HELX_P26 26 PRO B 199 ? GLY B 207 ? PRO B 373 GLY B 381 1 ? 9  
HELX_P HELX_P27 27 THR B 209 ? LYS B 226 ? THR B 383 LYS B 400 1 ? 18 
HELX_P HELX_P28 28 ALA B 227 ? HIS B 230 ? ALA B 401 HIS B 404 5 ? 4  
HELX_P HELX_P29 29 GLN B 233 ? TYR B 239 ? GLN B 407 TYR B 413 1 ? 7  
HELX_P HELX_P30 30 LYS B 240 ? HIS B 245 ? LYS B 414 HIS B 419 5 ? 6  
HELX_P HELX_P31 31 GLY B 246 ? LEU B 250 ? GLY B 420 LEU B 424 5 ? 5  
HELX_P HELX_P32 32 SER C 1   ? GLU C 3   ? SER C 0   GLU C 2   5 ? 3  
HELX_P HELX_P33 33 PRO C 46  ? LYS C 57  ? PRO C 45  LYS C 56  1 ? 12 
HELX_P HELX_P34 34 LEU C 88  ? SER C 95  ? LEU C 87  SER C 94  1 ? 8  
HELX_P HELX_P35 35 PRO C 101 ? SER C 121 ? PRO C 100 SER C 120 1 ? 21 
HELX_P HELX_P36 36 THR C 166 ? ARG C 170 ? THR C 165 ARG C 169 5 ? 5  
HELX_P HELX_P37 37 ALA C 171 ? LEU C 176 ? ALA C 170 LEU C 175 1 ? 6  
HELX_P HELX_P38 38 THR C 183 ? ARG C 200 ? THR C 182 ARG C 199 1 ? 18 
HELX_P HELX_P39 39 SER C 208 ? GLY C 221 ? SER C 207 GLY C 220 1 ? 14 
HELX_P HELX_P40 40 GLY C 230 ? MET C 234 ? GLY C 229 MET C 233 5 ? 5  
HELX_P HELX_P41 41 ASP C 248 ? VAL C 253 ? ASP C 247 VAL C 252 1 ? 6  
HELX_P HELX_P42 42 ASP C 257 ? LEU C 268 ? ASP C 256 LEU C 267 1 ? 12 
HELX_P HELX_P43 43 SER C 277 ? ALA C 283 ? SER C 276 ALA C 282 1 ? 7  
HELX_P HELX_P44 44 HIS C 284 ? GLN C 288 ? HIS C 283 GLN C 287 5 ? 5  
HELX_P HELX_P45 45 TYR D 4   ? CYS D 19  ? TYR D 178 CYS D 193 1 ? 16 
HELX_P HELX_P46 46 GLY D 24  ? GLN D 29  ? GLY D 198 GLN D 203 5 ? 6  
HELX_P HELX_P47 47 THR D 33  ? TYR D 51  ? THR D 207 TYR D 225 1 ? 19 
HELX_P HELX_P48 48 GLN D 54  ? MET D 72  ? GLN D 228 MET D 246 1 ? 19 
HELX_P HELX_P49 49 LEU D 75  ? GLY D 77  ? LEU D 249 GLY D 251 5 ? 3  
HELX_P HELX_P50 50 LYS D 78  ? GLU D 95  ? LYS D 252 GLU D 269 1 ? 18 
HELX_P HELX_P51 51 GLU D 100 ? ILE D 107 ? GLU D 274 ILE D 281 1 ? 8  
HELX_P HELX_P52 52 THR D 113 ? LEU D 128 ? THR D 287 LEU D 302 1 ? 16 
HELX_P HELX_P53 53 THR D 136 ? LEU D 146 ? THR D 310 LEU D 320 1 ? 11 
HELX_P HELX_P54 54 ASN D 152 ? SER D 166 ? ASN D 326 SER D 340 1 ? 15 
HELX_P HELX_P55 55 ASP D 169 ? LEU D 174 ? ASP D 343 LEU D 348 1 ? 6  
HELX_P HELX_P56 56 LEU D 177 ? GLY D 195 ? LEU D 351 GLY D 369 1 ? 19 
HELX_P HELX_P57 57 PRO D 199 ? GLY D 207 ? PRO D 373 GLY D 381 1 ? 9  
HELX_P HELX_P58 58 THR D 209 ? ALA D 227 ? THR D 383 ALA D 401 1 ? 19 
HELX_P HELX_P59 59 PRO D 228 ? HIS D 230 ? PRO D 402 HIS D 404 5 ? 3  
HELX_P HELX_P60 60 GLN D 233 ? TYR D 239 ? GLN D 407 TYR D 413 1 ? 7  
HELX_P HELX_P61 61 LYS D 240 ? HIS D 245 ? LYS D 414 HIS D 419 5 ? 6  
HELX_P HELX_P62 62 GLY D 246 ? LEU D 250 ? GLY D 420 LEU D 424 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A TYR 160 C ? ? ? 1_555 A TPO 161 N ? ? A TYR 159 A TPO 160 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale2 covale ? ? A TPO 161 C ? ? ? 1_555 A HIS 162 N ? ? A TPO 160 A HIS 161 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale3 covale ? ? C TYR 160 C ? ? ? 1_555 C TPO 161 N ? ? C TYR 159 C TPO 160 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale4 covale ? ? C TPO 161 C ? ? ? 1_555 C HIS 162 N ? ? C TPO 160 C HIS 161 1_555 ? ? ? ? ? ? ? 1.328 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 2 ? 
D ? 5 ? 
E ? 3 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 5   ? GLU A 13  ? PHE A 4   GLU A 12  
A 2 GLY A 17  ? ASN A 24  ? GLY A 16  ASN A 23  
A 3 VAL A 30  ? ARG A 37  ? VAL A 29  ARG A 36  
A 4 LYS A 76  ? GLU A 82  ? LYS A 75  GLU A 81  
A 5 LEU A 67  ? ILE A 71  ? LEU A 66  ILE A 70  
B 1 GLN A 86  ? ASP A 87  ? GLN A 85  ASP A 86  
B 2 LEU A 134 ? ILE A 136 ? LEU A 133 ILE A 135 
B 3 ILE A 142 ? LEU A 144 ? ILE A 141 LEU A 143 
C 1 VAL A 124 ? LEU A 125 ? VAL A 123 LEU A 124 
C 2 ARG A 151 ? ALA A 152 ? ARG A 150 ALA A 151 
D 1 PHE C 5   ? GLU C 13  ? PHE C 4   GLU C 12  
D 2 GLY C 17  ? ASN C 24  ? GLY C 16  ASN C 23  
D 3 VAL C 30  ? ARG C 37  ? VAL C 29  ARG C 36  
D 4 LYS C 76  ? GLU C 82  ? LYS C 75  GLU C 81  
D 5 LEU C 67  ? ILE C 71  ? LEU C 66  ILE C 70  
E 1 GLN C 86  ? ASP C 87  ? GLN C 85  ASP C 86  
E 2 LEU C 134 ? ILE C 136 ? LEU C 133 ILE C 135 
E 3 ILE C 142 ? LEU C 144 ? ILE C 141 LEU C 143 
F 1 VAL C 124 ? LEU C 125 ? VAL C 123 LEU C 124 
F 2 ARG C 151 ? ALA C 152 ? ARG C 150 ALA C 151 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 9   ? N GLU A 8   O LYS A 21  ? O LYS A 20  
A 2 3 N VAL A 18  ? N VAL A 17  O LYS A 35  ? O LYS A 34  
A 3 4 N ALA A 32  ? N ALA A 31  O PHE A 81  ? O PHE A 80  
A 4 5 O TYR A 78  ? O TYR A 77  N ILE A 71  ? N ILE A 70  
B 1 2 N GLN A 86  ? N GLN A 85  O ILE A 136 ? O ILE A 135 
B 2 3 N LEU A 135 ? N LEU A 134 O LYS A 143 ? O LYS A 142 
C 1 2 N LEU A 125 ? N LEU A 124 O ARG A 151 ? O ARG A 150 
D 1 2 N GLN C 6   ? N GLN C 5   O ARG C 23  ? O ARG C 22  
D 2 3 N ALA C 22  ? N ALA C 21  O VAL C 31  ? O VAL C 30  
D 3 4 N ILE C 36  ? N ILE C 35  O LEU C 77  ? O LEU C 76  
D 4 5 O TYR C 78  ? O TYR C 77  N ILE C 71  ? N ILE C 70  
E 1 2 N GLN C 86  ? N GLN C 85  O ILE C 136 ? O ILE C 135 
E 2 3 N LEU C 135 ? N LEU C 134 O LYS C 143 ? O LYS C 142 
F 1 2 N LEU C 125 ? N LEU C 124 O ARG C 151 ? O ARG C 150 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE UCN A 410' 
AC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE UCN C 411' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 ILE A 11  ? ILE A 10  . ? 1_555 ? 
2  AC1 14 GLY A 12  ? GLY A 11  . ? 1_555 ? 
3  AC1 14 ALA A 32  ? ALA A 31  . ? 1_555 ? 
4  AC1 14 LYS A 34  ? LYS A 33  . ? 1_555 ? 
5  AC1 14 VAL A 65  ? VAL A 64  . ? 1_555 ? 
6  AC1 14 PHE A 81  ? PHE A 80  . ? 1_555 ? 
7  AC1 14 GLU A 82  ? GLU A 81  . ? 1_555 ? 
8  AC1 14 PHE A 83  ? PHE A 82  . ? 1_555 ? 
9  AC1 14 LEU A 84  ? LEU A 83  . ? 1_555 ? 
10 AC1 14 HIS A 85  ? HIS A 84  . ? 1_555 ? 
11 AC1 14 ASP A 87  ? ASP A 86  . ? 1_555 ? 
12 AC1 14 GLN A 132 ? GLN A 131 . ? 1_555 ? 
13 AC1 14 ASN A 133 ? ASN A 132 . ? 1_555 ? 
14 AC1 14 LEU A 135 ? LEU A 134 . ? 1_555 ? 
15 AC2 14 ILE C 11  ? ILE C 10  . ? 1_555 ? 
16 AC2 14 GLY C 12  ? GLY C 11  . ? 1_555 ? 
17 AC2 14 VAL C 19  ? VAL C 18  . ? 1_555 ? 
18 AC2 14 ALA C 32  ? ALA C 31  . ? 1_555 ? 
19 AC2 14 LYS C 34  ? LYS C 33  . ? 1_555 ? 
20 AC2 14 VAL C 65  ? VAL C 64  . ? 1_555 ? 
21 AC2 14 PHE C 81  ? PHE C 80  . ? 1_555 ? 
22 AC2 14 GLU C 82  ? GLU C 81  . ? 1_555 ? 
23 AC2 14 PHE C 83  ? PHE C 82  . ? 1_555 ? 
24 AC2 14 LEU C 84  ? LEU C 83  . ? 1_555 ? 
25 AC2 14 HIS C 85  ? HIS C 84  . ? 1_555 ? 
26 AC2 14 GLN C 132 ? GLN C 131 . ? 1_555 ? 
27 AC2 14 ASN C 133 ? ASN C 132 . ? 1_555 ? 
28 AC2 14 LEU C 135 ? LEU C 134 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1PKD 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1PKD 
_atom_sites.fract_transf_matrix[1][1]   0.013583 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007431 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006758 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 1   ? 15.455  130.106 40.582  1.00 55.54  ? 0   SER A N   1 
ATOM   2    C CA  . SER A 1 1   ? 15.805  129.223 41.743  1.00 55.08  ? 0   SER A CA  1 
ATOM   3    C C   . SER A 1 1   ? 15.261  127.812 41.490  1.00 54.53  ? 0   SER A C   1 
ATOM   4    O O   . SER A 1 1   ? 15.965  126.803 41.609  1.00 54.33  ? 0   SER A O   1 
ATOM   5    C CB  . SER A 1 1   ? 15.234  129.820 43.031  1.00 55.32  ? 0   SER A CB  1 
ATOM   6    O OG  . SER A 1 1   ? 16.141  130.738 43.635  1.00 55.73  ? 0   SER A OG  1 
ATOM   7    N N   . MET A 1 2   ? 13.996  127.789 41.089  1.00 53.82  ? 1   MET A N   1 
ATOM   8    C CA  . MET A 1 2   ? 13.248  126.590 40.780  1.00 52.67  ? 1   MET A CA  1 
ATOM   9    C C   . MET A 1 2   ? 13.440  126.160 39.332  1.00 51.84  ? 1   MET A C   1 
ATOM   10   O O   . MET A 1 2   ? 12.839  125.179 38.889  1.00 51.71  ? 1   MET A O   1 
ATOM   11   C CB  . MET A 1 2   ? 11.770  126.883 41.022  1.00 52.77  ? 1   MET A CB  1 
ATOM   12   C CG  . MET A 1 2   ? 11.437  127.098 42.486  1.00 53.37  ? 1   MET A CG  1 
ATOM   13   S SD  . MET A 1 2   ? 11.819  125.619 43.434  1.00 53.97  ? 1   MET A SD  1 
ATOM   14   C CE  . MET A 1 2   ? 10.680  124.461 42.673  1.00 52.91  ? 1   MET A CE  1 
ATOM   15   N N   . GLU A 1 3   ? 14.274  126.895 38.599  1.00 50.54  ? 2   GLU A N   1 
ATOM   16   C CA  . GLU A 1 3   ? 14.464  126.655 37.178  1.00 49.67  ? 2   GLU A CA  1 
ATOM   17   C C   . GLU A 1 3   ? 15.169  125.333 36.881  1.00 48.10  ? 2   GLU A C   1 
ATOM   18   O O   . GLU A 1 3   ? 15.030  124.796 35.786  1.00 48.11  ? 2   GLU A O   1 
ATOM   19   C CB  . GLU A 1 3   ? 15.198  127.834 36.525  1.00 50.51  ? 2   GLU A CB  1 
ATOM   20   C CG  . GLU A 1 3   ? 15.428  127.703 35.020  1.00 53.19  ? 2   GLU A CG  1 
ATOM   21   C CD  . GLU A 1 3   ? 16.907  127.575 34.676  1.00 57.17  ? 2   GLU A CD  1 
ATOM   22   O OE1 . GLU A 1 3   ? 17.394  126.432 34.511  1.00 59.92  ? 2   GLU A OE1 1 
ATOM   23   O OE2 . GLU A 1 3   ? 17.594  128.615 34.581  1.00 58.01  ? 2   GLU A OE2 1 
ATOM   24   N N   . ASN A 1 4   ? 15.910  124.790 37.844  1.00 46.19  ? 3   ASN A N   1 
ATOM   25   C CA  . ASN A 1 4   ? 16.546  123.490 37.617  1.00 44.41  ? 3   ASN A CA  1 
ATOM   26   C C   . ASN A 1 4   ? 15.676  122.290 37.974  1.00 43.13  ? 3   ASN A C   1 
ATOM   27   O O   . ASN A 1 4   ? 16.074  121.146 37.753  1.00 42.88  ? 3   ASN A O   1 
ATOM   28   C CB  . ASN A 1 4   ? 17.924  123.413 38.273  1.00 44.30  ? 3   ASN A CB  1 
ATOM   29   C CG  . ASN A 1 4   ? 18.917  124.391 37.658  1.00 44.21  ? 3   ASN A CG  1 
ATOM   30   O OD1 . ASN A 1 4   ? 18.937  124.606 36.435  1.00 45.74  ? 3   ASN A OD1 1 
ATOM   31   N ND2 . ASN A 1 4   ? 19.740  124.992 38.499  1.00 42.84  ? 3   ASN A ND2 1 
ATOM   32   N N   . PHE A 1 5   ? 14.478  122.558 38.491  1.00 41.58  ? 4   PHE A N   1 
ATOM   33   C CA  . PHE A 1 5   ? 13.543  121.493 38.848  1.00 40.54  ? 4   PHE A CA  1 
ATOM   34   C C   . PHE A 1 5   ? 12.363  121.403 37.883  1.00 40.67  ? 4   PHE A C   1 
ATOM   35   O O   . PHE A 1 5   ? 11.901  122.406 37.359  1.00 40.35  ? 4   PHE A O   1 
ATOM   36   C CB  . PHE A 1 5   ? 13.067  121.642 40.299  1.00 39.75  ? 4   PHE A CB  1 
ATOM   37   C CG  . PHE A 1 5   ? 14.150  121.414 41.309  1.00 37.36  ? 4   PHE A CG  1 
ATOM   38   C CD1 . PHE A 1 5   ? 14.616  120.136 41.570  1.00 35.61  ? 4   PHE A CD1 1 
ATOM   39   C CD2 . PHE A 1 5   ? 14.709  122.476 41.998  1.00 35.99  ? 4   PHE A CD2 1 
ATOM   40   C CE1 . PHE A 1 5   ? 15.627  119.922 42.499  1.00 35.80  ? 4   PHE A CE1 1 
ATOM   41   C CE2 . PHE A 1 5   ? 15.729  122.271 42.931  1.00 35.14  ? 4   PHE A CE2 1 
ATOM   42   C CZ  . PHE A 1 5   ? 16.191  120.997 43.179  1.00 34.09  ? 4   PHE A CZ  1 
ATOM   43   N N   . GLN A 1 6   ? 11.892  120.181 37.663  1.00 40.94  ? 5   GLN A N   1 
ATOM   44   C CA  . GLN A 1 6   ? 10.836  119.887 36.711  1.00 41.48  ? 5   GLN A CA  1 
ATOM   45   C C   . GLN A 1 6   ? 9.807   119.001 37.408  1.00 41.63  ? 5   GLN A C   1 
ATOM   46   O O   . GLN A 1 6   ? 10.056  117.814 37.636  1.00 41.62  ? 5   GLN A O   1 
ATOM   47   C CB  . GLN A 1 6   ? 11.447  119.170 35.495  1.00 41.67  ? 5   GLN A CB  1 
ATOM   48   C CG  . GLN A 1 6   ? 10.462  118.554 34.506  1.00 43.49  ? 5   GLN A CG  1 
ATOM   49   C CD  . GLN A 1 6   ? 9.603   119.599 33.816  1.00 46.42  ? 5   GLN A CD  1 
ATOM   50   O OE1 . GLN A 1 6   ? 10.081  120.322 32.936  1.00 48.30  ? 5   GLN A OE1 1 
ATOM   51   N NE2 . GLN A 1 6   ? 8.340   119.692 34.223  1.00 46.57  ? 5   GLN A NE2 1 
ATOM   52   N N   . LYS A 1 7   ? 8.664   119.586 37.758  1.00 42.00  ? 6   LYS A N   1 
ATOM   53   C CA  . LYS A 1 7   ? 7.619   118.882 38.498  1.00 42.63  ? 6   LYS A CA  1 
ATOM   54   C C   . LYS A 1 7   ? 7.063   117.720 37.696  1.00 43.05  ? 6   LYS A C   1 
ATOM   55   O O   . LYS A 1 7   ? 6.731   117.871 36.520  1.00 43.26  ? 6   LYS A O   1 
ATOM   56   C CB  . LYS A 1 7   ? 6.491   119.829 38.874  1.00 42.59  ? 6   LYS A CB  1 
ATOM   57   C CG  . LYS A 1 7   ? 6.949   121.003 39.702  1.00 43.97  ? 6   LYS A CG  1 
ATOM   58   C CD  . LYS A 1 7   ? 5.981   121.272 40.824  1.00 44.88  ? 6   LYS A CD  1 
ATOM   59   C CE  . LYS A 1 7   ? 6.129   122.682 41.331  1.00 45.48  ? 6   LYS A CE  1 
ATOM   60   N NZ  . LYS A 1 7   ? 5.461   123.629 40.414  1.00 46.63  ? 6   LYS A NZ  1 
ATOM   61   N N   . VAL A 1 8   ? 6.976   116.561 38.337  1.00 43.27  ? 7   VAL A N   1 
ATOM   62   C CA  . VAL A 1 8   ? 6.491   115.371 37.666  1.00 43.97  ? 7   VAL A CA  1 
ATOM   63   C C   . VAL A 1 8   ? 5.019   115.118 37.994  1.00 44.50  ? 7   VAL A C   1 
ATOM   64   O O   . VAL A 1 8   ? 4.208   114.896 37.096  1.00 44.57  ? 7   VAL A O   1 
ATOM   65   C CB  . VAL A 1 8   ? 7.349   114.132 37.992  1.00 43.76  ? 7   VAL A CB  1 
ATOM   66   C CG1 . VAL A 1 8   ? 6.878   112.947 37.177  1.00 44.02  ? 7   VAL A CG1 1 
ATOM   67   C CG2 . VAL A 1 8   ? 8.824   114.404 37.730  1.00 43.47  ? 7   VAL A CG2 1 
ATOM   68   N N   . GLU A 1 9   ? 4.682   115.150 39.278  1.00 45.28  ? 8   GLU A N   1 
ATOM   69   C CA  . GLU A 1 9   ? 3.305   114.954 39.719  1.00 46.16  ? 8   GLU A CA  1 
ATOM   70   C C   . GLU A 1 9   ? 3.142   115.354 41.179  1.00 46.42  ? 8   GLU A C   1 
ATOM   71   O O   . GLU A 1 9   ? 4.101   115.303 41.951  1.00 46.39  ? 8   GLU A O   1 
ATOM   72   C CB  . GLU A 1 9   ? 2.869   113.495 39.505  1.00 46.32  ? 8   GLU A CB  1 
ATOM   73   C CG  . GLU A 1 9   ? 3.286   112.525 40.599  1.00 47.55  ? 8   GLU A CG  1 
ATOM   74   C CD  . GLU A 1 9   ? 3.116   111.069 40.203  1.00 50.12  ? 8   GLU A CD  1 
ATOM   75   O OE1 . GLU A 1 9   ? 2.668   110.793 39.067  1.00 51.76  ? 8   GLU A OE1 1 
ATOM   76   O OE2 . GLU A 1 9   ? 3.441   110.191 41.029  1.00 51.03  ? 8   GLU A OE2 1 
ATOM   77   N N   . LYS A 1 10  ? 1.929   115.765 41.540  1.00 47.10  ? 9   LYS A N   1 
ATOM   78   C CA  . LYS A 1 10  ? 1.557   115.998 42.932  1.00 47.80  ? 9   LYS A CA  1 
ATOM   79   C C   . LYS A 1 10  ? 1.595   114.651 43.659  1.00 48.47  ? 9   LYS A C   1 
ATOM   80   O O   . LYS A 1 10  ? 1.206   113.629 43.099  1.00 48.82  ? 9   LYS A O   1 
ATOM   81   C CB  . LYS A 1 10  ? 0.162   116.615 43.003  1.00 47.83  ? 9   LYS A CB  1 
ATOM   82   C CG  . LYS A 1 10  ? -0.137  117.420 44.255  1.00 47.80  ? 9   LYS A CG  1 
ATOM   83   C CD  . LYS A 1 10  ? -0.577  116.527 45.396  1.00 48.82  ? 9   LYS A CD  1 
ATOM   84   C CE  . LYS A 1 10  ? -1.861  117.021 46.044  1.00 50.08  ? 9   LYS A CE  1 
ATOM   85   N NZ  . LYS A 1 10  ? -1.627  118.165 46.960  1.00 50.30  ? 9   LYS A NZ  1 
ATOM   86   N N   . ILE A 1 11  ? 2.054   114.662 44.904  1.00 49.20  ? 10  ILE A N   1 
ATOM   87   C CA  . ILE A 1 11  ? 2.384   113.435 45.629  1.00 50.25  ? 10  ILE A CA  1 
ATOM   88   C C   . ILE A 1 11  ? 1.716   113.360 47.012  1.00 50.92  ? 10  ILE A C   1 
ATOM   89   O O   . ILE A 1 11  ? 1.563   112.280 47.585  1.00 50.76  ? 10  ILE A O   1 
ATOM   90   C CB  . ILE A 1 11  ? 3.932   113.354 45.740  1.00 50.62  ? 10  ILE A CB  1 
ATOM   91   C CG1 . ILE A 1 11  ? 4.463   112.019 45.252  1.00 51.05  ? 10  ILE A CG1 1 
ATOM   92   C CG2 . ILE A 1 11  ? 4.441   113.651 47.143  1.00 50.40  ? 10  ILE A CG2 1 
ATOM   93   C CD1 . ILE A 1 11  ? 5.976   111.961 45.382  1.00 52.84  ? 10  ILE A CD1 1 
ATOM   94   N N   . GLY A 1 12  ? 1.324   114.517 47.536  1.00 51.82  ? 11  GLY A N   1 
ATOM   95   C CA  . GLY A 1 12  ? 0.760   114.622 48.866  1.00 53.42  ? 11  GLY A CA  1 
ATOM   96   C C   . GLY A 1 12  ? 0.559   116.073 49.228  1.00 54.53  ? 11  GLY A C   1 
ATOM   97   O O   . GLY A 1 12  ? 0.807   116.954 48.412  1.00 54.70  ? 11  GLY A O   1 
ATOM   98   N N   . GLU A 1 13  ? 0.124   116.324 50.455  1.00 55.95  ? 12  GLU A N   1 
ATOM   99   C CA  . GLU A 1 13  ? -0.262  117.665 50.871  1.00 57.75  ? 12  GLU A CA  1 
ATOM   100  C C   . GLU A 1 13  ? -0.314  117.796 52.392  1.00 58.26  ? 12  GLU A C   1 
ATOM   101  O O   . GLU A 1 13  ? -0.703  116.862 53.091  1.00 58.38  ? 12  GLU A O   1 
ATOM   102  C CB  . GLU A 1 13  ? -1.620  118.006 50.257  1.00 58.19  ? 12  GLU A CB  1 
ATOM   103  C CG  . GLU A 1 13  ? -2.219  119.336 50.671  1.00 61.01  ? 12  GLU A CG  1 
ATOM   104  C CD  . GLU A 1 13  ? -3.726  119.251 50.784  1.00 64.88  ? 12  GLU A CD  1 
ATOM   105  O OE1 . GLU A 1 13  ? -4.246  119.312 51.931  1.00 66.21  ? 12  GLU A OE1 1 
ATOM   106  O OE2 . GLU A 1 13  ? -4.384  119.107 49.720  1.00 65.70  ? 12  GLU A OE2 1 
ATOM   107  N N   . GLY A 1 14  ? 0.089   118.962 52.890  1.00 58.97  ? 13  GLY A N   1 
ATOM   108  C CA  . GLY A 1 14  ? 0.028   119.261 54.309  1.00 59.85  ? 13  GLY A CA  1 
ATOM   109  C C   . GLY A 1 14  ? -0.990  120.343 54.617  1.00 60.27  ? 13  GLY A C   1 
ATOM   110  O O   . GLY A 1 14  ? -2.034  120.425 53.970  1.00 60.55  ? 13  GLY A O   1 
ATOM   111  N N   . THR A 1 15  ? -0.688  121.169 55.614  1.00 60.43  ? 14  THR A N   1 
ATOM   112  C CA  . THR A 1 15  ? -1.565  122.274 55.980  1.00 60.60  ? 14  THR A CA  1 
ATOM   113  C C   . THR A 1 15  ? -1.118  123.539 55.263  1.00 60.33  ? 14  THR A C   1 
ATOM   114  O O   . THR A 1 15  ? -1.939  124.342 54.811  1.00 60.56  ? 14  THR A O   1 
ATOM   115  C CB  . THR A 1 15  ? -1.580  122.462 57.508  1.00 60.84  ? 14  THR A CB  1 
ATOM   116  O OG1 . THR A 1 15  ? -2.167  121.302 58.113  1.00 61.44  ? 14  THR A OG1 1 
ATOM   117  C CG2 . THR A 1 15  ? -2.537  123.584 57.919  1.00 61.17  ? 14  THR A CG2 1 
ATOM   118  N N   . TYR A 1 16  ? 0.193   123.698 55.146  1.00 59.71  ? 15  TYR A N   1 
ATOM   119  C CA  . TYR A 1 16  ? 0.770   124.820 54.426  1.00 58.87  ? 15  TYR A CA  1 
ATOM   120  C C   . TYR A 1 16  ? 1.309   124.336 53.094  1.00 57.14  ? 15  TYR A C   1 
ATOM   121  O O   . TYR A 1 16  ? 1.096   124.974 52.057  1.00 57.48  ? 15  TYR A O   1 
ATOM   122  C CB  . TYR A 1 16  ? 1.882   125.459 55.260  1.00 59.80  ? 15  TYR A CB  1 
ATOM   123  C CG  . TYR A 1 16  ? 1.461   125.742 56.682  1.00 62.13  ? 15  TYR A CG  1 
ATOM   124  C CD1 . TYR A 1 16  ? 0.877   126.961 57.025  1.00 64.76  ? 15  TYR A CD1 1 
ATOM   125  C CD2 . TYR A 1 16  ? 1.622   124.784 57.680  1.00 64.76  ? 15  TYR A CD2 1 
ATOM   126  C CE1 . TYR A 1 16  ? 0.473   127.221 58.330  1.00 66.56  ? 15  TYR A CE1 1 
ATOM   127  C CE2 . TYR A 1 16  ? 1.221   125.035 58.988  1.00 66.61  ? 15  TYR A CE2 1 
ATOM   128  C CZ  . TYR A 1 16  ? 0.651   126.255 59.303  1.00 67.00  ? 15  TYR A CZ  1 
ATOM   129  O OH  . TYR A 1 16  ? 0.251   126.511 60.591  1.00 68.90  ? 15  TYR A OH  1 
ATOM   130  N N   . GLY A 1 17  ? 1.975   123.182 53.128  1.00 54.86  ? 16  GLY A N   1 
ATOM   131  C CA  . GLY A 1 17  ? 2.702   122.681 51.978  1.00 51.49  ? 16  GLY A CA  1 
ATOM   132  C C   . GLY A 1 17  ? 1.996   121.682 51.083  1.00 48.97  ? 16  GLY A C   1 
ATOM   133  O O   . GLY A 1 17  ? 1.191   120.866 51.536  1.00 49.08  ? 16  GLY A O   1 
ATOM   134  N N   . VAL A 1 18  ? 2.317   121.765 49.796  1.00 45.95  ? 17  VAL A N   1 
ATOM   135  C CA  . VAL A 1 18  ? 1.949   120.764 48.808  1.00 42.59  ? 17  VAL A CA  1 
ATOM   136  C C   . VAL A 1 18  ? 3.233   120.060 48.400  1.00 40.27  ? 17  VAL A C   1 
ATOM   137  O O   . VAL A 1 18  ? 4.243   120.708 48.142  1.00 40.16  ? 17  VAL A O   1 
ATOM   138  C CB  . VAL A 1 18  ? 1.302   121.423 47.574  1.00 42.70  ? 17  VAL A CB  1 
ATOM   139  C CG1 . VAL A 1 18  ? 0.983   120.392 46.499  1.00 41.38  ? 17  VAL A CG1 1 
ATOM   140  C CG2 . VAL A 1 18  ? 0.042   122.174 47.982  1.00 42.76  ? 17  VAL A CG2 1 
ATOM   141  N N   . VAL A 1 19  ? 3.202   118.738 48.340  1.00 37.39  ? 18  VAL A N   1 
ATOM   142  C CA  . VAL A 1 19  ? 4.400   117.981 47.994  1.00 34.77  ? 18  VAL A CA  1 
ATOM   143  C C   . VAL A 1 19  ? 4.293   117.405 46.588  1.00 33.93  ? 18  VAL A C   1 
ATOM   144  O O   . VAL A 1 19  ? 3.331   116.703 46.289  1.00 33.64  ? 18  VAL A O   1 
ATOM   145  C CB  . VAL A 1 19  ? 4.699   116.880 49.042  1.00 34.25  ? 18  VAL A CB  1 
ATOM   146  C CG1 . VAL A 1 19  ? 5.974   116.148 48.713  1.00 33.16  ? 18  VAL A CG1 1 
ATOM   147  C CG2 . VAL A 1 19  ? 4.793   117.489 50.445  1.00 33.60  ? 18  VAL A CG2 1 
ATOM   148  N N   . TYR A 1 20  ? 5.284   117.718 45.744  1.00 32.59  ? 19  TYR A N   1 
ATOM   149  C CA  . TYR A 1 20  ? 5.428   117.168 44.397  1.00 31.94  ? 19  TYR A CA  1 
ATOM   150  C C   . TYR A 1 20  ? 6.662   116.281 44.251  1.00 31.13  ? 19  TYR A C   1 
ATOM   151  O O   . TYR A 1 20  ? 7.722   116.569 44.823  1.00 30.93  ? 19  TYR A O   1 
ATOM   152  C CB  . TYR A 1 20  ? 5.597   118.290 43.372  1.00 32.58  ? 19  TYR A CB  1 
ATOM   153  C CG  . TYR A 1 20  ? 4.547   119.365 43.408  1.00 34.59  ? 19  TYR A CG  1 
ATOM   154  C CD1 . TYR A 1 20  ? 4.602   120.386 44.363  1.00 35.84  ? 19  TYR A CD1 1 
ATOM   155  C CD2 . TYR A 1 20  ? 3.507   119.381 42.474  1.00 36.52  ? 19  TYR A CD2 1 
ATOM   156  C CE1 . TYR A 1 20  ? 3.643   121.377 44.405  1.00 38.35  ? 19  TYR A CE1 1 
ATOM   157  C CE2 . TYR A 1 20  ? 2.535   120.376 42.507  1.00 38.54  ? 19  TYR A CE2 1 
ATOM   158  C CZ  . TYR A 1 20  ? 2.611   121.370 43.472  1.00 40.09  ? 19  TYR A CZ  1 
ATOM   159  O OH  . TYR A 1 20  ? 1.661   122.367 43.519  1.00 43.48  ? 19  TYR A OH  1 
ATOM   160  N N   . LYS A 1 21  ? 6.528   115.219 43.459  1.00 29.90  ? 20  LYS A N   1 
ATOM   161  C CA  . LYS A 1 21  ? 7.676   114.516 42.902  1.00 29.41  ? 20  LYS A CA  1 
ATOM   162  C C   . LYS A 1 21  ? 8.227   115.419 41.809  1.00 29.15  ? 20  LYS A C   1 
ATOM   163  O O   . LYS A 1 21  ? 7.471   115.928 40.996  1.00 29.16  ? 20  LYS A O   1 
ATOM   164  C CB  . LYS A 1 21  ? 7.257   113.168 42.311  1.00 28.95  ? 20  LYS A CB  1 
ATOM   165  C CG  . LYS A 1 21  ? 8.385   112.371 41.686  1.00 29.81  ? 20  LYS A CG  1 
ATOM   166  C CD  . LYS A 1 21  ? 7.878   111.094 41.071  1.00 33.32  ? 20  LYS A CD  1 
ATOM   167  C CE  . LYS A 1 21  ? 9.012   110.126 40.752  1.00 36.52  ? 20  LYS A CE  1 
ATOM   168  N NZ  . LYS A 1 21  ? 8.534   108.991 39.897  1.00 39.17  ? 20  LYS A NZ  1 
ATOM   169  N N   . ALA A 1 22  ? 9.534   115.645 41.809  1.00 29.36  ? 21  ALA A N   1 
ATOM   170  C CA  . ALA A 1 22  ? 10.164  116.513 40.822  1.00 29.61  ? 21  ALA A CA  1 
ATOM   171  C C   . ALA A 1 22  ? 11.530  115.965 40.467  1.00 30.40  ? 21  ALA A C   1 
ATOM   172  O O   . ALA A 1 22  ? 12.029  115.064 41.137  1.00 30.53  ? 21  ALA A O   1 
ATOM   173  C CB  . ALA A 1 22  ? 10.274  117.921 41.343  1.00 28.94  ? 21  ALA A CB  1 
ATOM   174  N N   . ARG A 1 23  ? 12.129  116.496 39.403  1.00 31.47  ? 22  ARG A N   1 
ATOM   175  C CA  . ARG A 1 23  ? 13.422  116.018 38.951  1.00 32.86  ? 22  ARG A CA  1 
ATOM   176  C C   . ARG A 1 23  ? 14.378  117.175 38.687  1.00 33.04  ? 22  ARG A C   1 
ATOM   177  O O   . ARG A 1 23  ? 13.974  118.218 38.178  1.00 33.67  ? 22  ARG A O   1 
ATOM   178  C CB  . ARG A 1 23  ? 13.254  115.080 37.747  1.00 33.41  ? 22  ARG A CB  1 
ATOM   179  C CG  . ARG A 1 23  ? 13.893  115.514 36.443  1.00 36.97  ? 22  ARG A CG  1 
ATOM   180  C CD  . ARG A 1 23  ? 14.538  114.363 35.645  1.00 43.12  ? 22  ARG A CD  1 
ATOM   181  N NE  . ARG A 1 23  ? 13.757  113.117 35.697  1.00 47.84  ? 22  ARG A NE  1 
ATOM   182  C CZ  . ARG A 1 23  ? 14.252  111.916 36.022  1.00 49.09  ? 22  ARG A CZ  1 
ATOM   183  N NH1 . ARG A 1 23  ? 15.537  111.777 36.339  1.00 50.09  ? 22  ARG A NH1 1 
ATOM   184  N NH2 . ARG A 1 23  ? 13.460  110.851 36.037  1.00 48.70  ? 22  ARG A NH2 1 
ATOM   185  N N   . ASN A 1 24  ? 15.636  116.998 39.081  1.00 32.99  ? 23  ASN A N   1 
ATOM   186  C CA  . ASN A 1 24  ? 16.668  117.994 38.831  1.00 33.00  ? 23  ASN A CA  1 
ATOM   187  C C   . ASN A 1 24  ? 17.140  117.827 37.393  1.00 33.08  ? 23  ASN A C   1 
ATOM   188  O O   . ASN A 1 24  ? 17.716  116.795 37.039  1.00 32.66  ? 23  ASN A O   1 
ATOM   189  C CB  . ASN A 1 24  ? 17.827  117.829 39.824  1.00 32.87  ? 23  ASN A CB  1 
ATOM   190  C CG  . ASN A 1 24  ? 18.929  118.861 39.621  1.00 33.51  ? 23  ASN A CG  1 
ATOM   191  O OD1 . ASN A 1 24  ? 19.316  119.156 38.490  1.00 34.45  ? 23  ASN A OD1 1 
ATOM   192  N ND2 . ASN A 1 24  ? 19.440  119.410 40.718  1.00 32.09  ? 23  ASN A ND2 1 
ATOM   193  N N   . LYS A 1 25  ? 16.893  118.835 36.558  1.00 32.97  ? 24  LYS A N   1 
ATOM   194  C CA  . LYS A 1 25  ? 17.140  118.687 35.119  1.00 33.03  ? 24  LYS A CA  1 
ATOM   195  C C   . LYS A 1 25  ? 18.621  118.513 34.814  1.00 32.32  ? 24  LYS A C   1 
ATOM   196  O O   . LYS A 1 25  ? 18.976  117.910 33.816  1.00 32.94  ? 24  LYS A O   1 
ATOM   197  C CB  . LYS A 1 25  ? 16.578  119.868 34.315  1.00 33.43  ? 24  LYS A CB  1 
ATOM   198  C CG  . LYS A 1 25  ? 15.082  120.134 34.466  1.00 35.87  ? 24  LYS A CG  1 
ATOM   199  C CD  . LYS A 1 25  ? 14.732  121.491 33.829  1.00 40.43  ? 24  LYS A CD  1 
ATOM   200  C CE  . LYS A 1 25  ? 13.597  122.187 34.558  1.00 43.50  ? 24  LYS A CE  1 
ATOM   201  N NZ  . LYS A 1 25  ? 12.442  122.517 33.654  1.00 45.13  ? 24  LYS A NZ  1 
ATOM   202  N N   . LEU A 1 26  ? 19.474  119.041 35.685  1.00 31.48  ? 25  LEU A N   1 
ATOM   203  C CA  . LEU A 1 26  ? 20.918  119.031 35.487  1.00 30.47  ? 25  LEU A CA  1 
ATOM   204  C C   . LEU A 1 26  ? 21.643  117.808 36.084  1.00 30.55  ? 25  LEU A C   1 
ATOM   205  O O   . LEU A 1 26  ? 22.558  117.267 35.456  1.00 29.99  ? 25  LEU A O   1 
ATOM   206  C CB  . LEU A 1 26  ? 21.528  120.334 36.022  1.00 29.95  ? 25  LEU A CB  1 
ATOM   207  C CG  . LEU A 1 26  ? 21.035  121.604 35.308  1.00 29.05  ? 25  LEU A CG  1 
ATOM   208  C CD1 . LEU A 1 26  ? 21.571  122.875 35.966  1.00 26.08  ? 25  LEU A CD1 1 
ATOM   209  C CD2 . LEU A 1 26  ? 21.366  121.569 33.800  1.00 26.02  ? 25  LEU A CD2 1 
ATOM   210  N N   . THR A 1 27  ? 21.247  117.377 37.285  1.00 30.24  ? 26  THR A N   1 
ATOM   211  C CA  . THR A 1 27  ? 21.850  116.186 37.893  1.00 29.78  ? 26  THR A CA  1 
ATOM   212  C C   . THR A 1 27  ? 21.024  114.925 37.642  1.00 29.94  ? 26  THR A C   1 
ATOM   213  O O   . THR A 1 27  ? 21.522  113.801 37.801  1.00 30.09  ? 26  THR A O   1 
ATOM   214  C CB  . THR A 1 27  ? 22.022  116.367 39.407  1.00 29.77  ? 26  THR A CB  1 
ATOM   215  O OG1 . THR A 1 27  ? 20.736  116.513 40.009  1.00 28.80  ? 26  THR A OG1 1 
ATOM   216  C CG2 . THR A 1 27  ? 22.741  117.678 39.729  1.00 29.05  ? 26  THR A CG2 1 
ATOM   217  N N   . GLY A 1 28  ? 19.757  115.112 37.279  1.00 29.59  ? 27  GLY A N   1 
ATOM   218  C CA  . GLY A 1 28  ? 18.845  113.998 37.058  1.00 29.04  ? 27  GLY A CA  1 
ATOM   219  C C   . GLY A 1 28  ? 18.212  113.473 38.330  1.00 28.86  ? 27  GLY A C   1 
ATOM   220  O O   . GLY A 1 28  ? 17.350  112.599 38.287  1.00 28.83  ? 27  GLY A O   1 
ATOM   221  N N   . GLU A 1 29  ? 18.647  113.990 39.471  1.00 28.77  ? 28  GLU A N   1 
ATOM   222  C CA  . GLU A 1 29  ? 18.158  113.474 40.738  1.00 29.08  ? 28  GLU A CA  1 
ATOM   223  C C   . GLU A 1 29  ? 16.652  113.739 40.870  1.00 28.66  ? 28  GLU A C   1 
ATOM   224  O O   . GLU A 1 29  ? 16.187  114.859 40.606  1.00 28.41  ? 28  GLU A O   1 
ATOM   225  C CB  . GLU A 1 29  ? 18.924  114.065 41.934  1.00 29.22  ? 28  GLU A CB  1 
ATOM   226  C CG  . GLU A 1 29  ? 18.277  113.683 43.261  1.00 31.14  ? 28  GLU A CG  1 
ATOM   227  C CD  . GLU A 1 29  ? 19.037  114.122 44.493  1.00 33.87  ? 28  GLU A CD  1 
ATOM   228  O OE1 . GLU A 1 29  ? 19.522  115.276 44.548  1.00 34.58  ? 28  GLU A OE1 1 
ATOM   229  O OE2 . GLU A 1 29  ? 19.123  113.296 45.431  1.00 37.30  ? 28  GLU A OE2 1 
ATOM   230  N N   . VAL A 1 30  ? 15.914  112.690 41.241  1.00 27.70  ? 29  VAL A N   1 
ATOM   231  C CA  . VAL A 1 30  ? 14.508  112.792 41.594  1.00 27.00  ? 29  VAL A CA  1 
ATOM   232  C C   . VAL A 1 30  ? 14.444  113.186 43.065  1.00 26.89  ? 29  VAL A C   1 
ATOM   233  O O   . VAL A 1 30  ? 15.150  112.630 43.911  1.00 26.51  ? 29  VAL A O   1 
ATOM   234  C CB  . VAL A 1 30  ? 13.742  111.460 41.322  1.00 27.45  ? 29  VAL A CB  1 
ATOM   235  C CG1 . VAL A 1 30  ? 12.310  111.530 41.819  1.00 26.45  ? 29  VAL A CG1 1 
ATOM   236  C CG2 . VAL A 1 30  ? 13.768  111.107 39.807  1.00 27.73  ? 29  VAL A CG2 1 
ATOM   237  N N   . VAL A 1 31  ? 13.601  114.171 43.347  1.00 26.57  ? 30  VAL A N   1 
ATOM   238  C CA  . VAL A 1 31  ? 13.479  114.786 44.657  1.00 26.13  ? 30  VAL A CA  1 
ATOM   239  C C   . VAL A 1 31  ? 12.002  114.972 45.008  1.00 26.81  ? 30  VAL A C   1 
ATOM   240  O O   . VAL A 1 31  ? 11.128  114.878 44.146  1.00 26.65  ? 30  VAL A O   1 
ATOM   241  C CB  . VAL A 1 31  ? 14.165  116.179 44.678  1.00 25.93  ? 30  VAL A CB  1 
ATOM   242  C CG1 . VAL A 1 31  ? 15.616  116.095 44.173  1.00 24.23  ? 30  VAL A CG1 1 
ATOM   243  C CG2 . VAL A 1 31  ? 13.363  117.189 43.852  1.00 25.11  ? 30  VAL A CG2 1 
ATOM   244  N N   . ALA A 1 32  ? 11.731  115.248 46.273  1.00 27.97  ? 31  ALA A N   1 
ATOM   245  C CA  . ALA A 1 32  ? 10.411  115.682 46.703  1.00 29.06  ? 31  ALA A CA  1 
ATOM   246  C C   . ALA A 1 32  ? 10.462  117.158 47.086  1.00 30.36  ? 31  ALA A C   1 
ATOM   247  O O   . ALA A 1 32  ? 11.275  117.562 47.922  1.00 30.42  ? 31  ALA A O   1 
ATOM   248  C CB  . ALA A 1 32  ? 9.927   114.847 47.861  1.00 28.21  ? 31  ALA A CB  1 
ATOM   249  N N   . LEU A 1 33  ? 9.578   117.948 46.474  1.00 32.14  ? 32  LEU A N   1 
ATOM   250  C CA  . LEU A 1 33  ? 9.501   119.383 46.706  1.00 33.65  ? 32  LEU A CA  1 
ATOM   251  C C   . LEU A 1 33  ? 8.272   119.711 47.506  1.00 34.78  ? 32  LEU A C   1 
ATOM   252  O O   . LEU A 1 33  ? 7.154   119.481 47.043  1.00 34.93  ? 32  LEU A O   1 
ATOM   253  C CB  . LEU A 1 33  ? 9.380   120.129 45.385  1.00 33.83  ? 32  LEU A CB  1 
ATOM   254  C CG  . LEU A 1 33  ? 10.543  120.292 44.429  1.00 34.65  ? 32  LEU A CG  1 
ATOM   255  C CD1 . LEU A 1 33  ? 9.976   120.786 43.112  1.00 34.33  ? 32  LEU A CD1 1 
ATOM   256  C CD2 . LEU A 1 33  ? 11.521  121.308 44.994  1.00 36.36  ? 32  LEU A CD2 1 
ATOM   257  N N   . LYS A 1 34  ? 8.470   120.268 48.692  1.00 36.17  ? 33  LYS A N   1 
ATOM   258  C CA  . LYS A 1 34  ? 7.362   120.722 49.511  1.00 38.22  ? 33  LYS A CA  1 
ATOM   259  C C   . LYS A 1 34  ? 7.235   122.227 49.362  1.00 40.03  ? 33  LYS A C   1 
ATOM   260  O O   . LYS A 1 34  ? 8.077   122.993 49.840  1.00 39.83  ? 33  LYS A O   1 
ATOM   261  C CB  . LYS A 1 34  ? 7.587   120.336 50.967  1.00 38.14  ? 33  LYS A CB  1 
ATOM   262  C CG  . LYS A 1 34  ? 6.499   120.760 51.929  1.00 38.43  ? 33  LYS A CG  1 
ATOM   263  C CD  . LYS A 1 34  ? 6.690   120.021 53.252  1.00 40.18  ? 33  LYS A CD  1 
ATOM   264  C CE  . LYS A 1 34  ? 6.437   120.906 54.466  1.00 41.64  ? 33  LYS A CE  1 
ATOM   265  N NZ  . LYS A 1 34  ? 5.276   120.390 55.240  1.00 43.46  ? 33  LYS A NZ  1 
ATOM   266  N N   . LYS A 1 35  ? 6.186   122.638 48.668  1.00 42.65  ? 34  LYS A N   1 
ATOM   267  C CA  . LYS A 1 35  ? 5.916   124.042 48.443  1.00 45.68  ? 34  LYS A CA  1 
ATOM   268  C C   . LYS A 1 35  ? 5.162   124.573 49.653  1.00 47.62  ? 34  LYS A C   1 
ATOM   269  O O   . LYS A 1 35  ? 4.066   124.104 49.952  1.00 47.90  ? 34  LYS A O   1 
ATOM   270  C CB  . LYS A 1 35  ? 5.107   124.205 47.157  1.00 45.40  ? 34  LYS A CB  1 
ATOM   271  C CG  . LYS A 1 35  ? 4.738   125.633 46.809  1.00 47.02  ? 34  LYS A CG  1 
ATOM   272  C CD  . LYS A 1 35  ? 3.228   125.859 46.888  1.00 49.62  ? 34  LYS A CD  1 
ATOM   273  C CE  . LYS A 1 35  ? 2.513   125.429 45.615  1.00 50.64  ? 34  LYS A CE  1 
ATOM   274  N NZ  . LYS A 1 35  ? 3.219   125.928 44.393  1.00 52.92  ? 34  LYS A NZ  1 
ATOM   275  N N   . ILE A 1 36  ? 5.764   125.527 50.360  1.00 50.50  ? 35  ILE A N   1 
ATOM   276  C CA  . ILE A 1 36  ? 5.149   126.128 51.543  1.00 53.54  ? 35  ILE A CA  1 
ATOM   277  C C   . ILE A 1 36  ? 4.698   127.548 51.209  1.00 56.26  ? 35  ILE A C   1 
ATOM   278  O O   . ILE A 1 36  ? 5.509   128.382 50.809  1.00 56.48  ? 35  ILE A O   1 
ATOM   279  C CB  . ILE A 1 36  ? 6.130   126.118 52.755  1.00 53.15  ? 35  ILE A CB  1 
ATOM   280  C CG1 . ILE A 1 36  ? 6.400   124.690 53.232  1.00 52.77  ? 35  ILE A CG1 1 
ATOM   281  C CG2 . ILE A 1 36  ? 5.580   126.942 53.916  1.00 53.44  ? 35  ILE A CG2 1 
ATOM   282  C CD1 . ILE A 1 36  ? 7.598   124.556 54.155  1.00 51.73  ? 35  ILE A CD1 1 
ATOM   283  N N   . ARG A 1 37  ? 3.404   127.813 51.365  1.00 59.99  ? 36  ARG A N   1 
ATOM   284  C CA  . ARG A 1 37  ? 2.839   129.131 51.048  1.00 63.97  ? 36  ARG A CA  1 
ATOM   285  C C   . ARG A 1 37  ? 3.121   130.161 52.142  1.00 65.59  ? 36  ARG A C   1 
ATOM   286  O O   . ARG A 1 37  ? 2.973   129.868 53.331  1.00 65.76  ? 36  ARG A O   1 
ATOM   287  C CB  . ARG A 1 37  ? 1.333   129.031 50.803  1.00 64.51  ? 36  ARG A CB  1 
ATOM   288  C CG  . ARG A 1 37  ? 0.917   129.249 49.352  1.00 68.08  ? 36  ARG A CG  1 
ATOM   289  C CD  . ARG A 1 37  ? -0.476  128.720 49.030  1.00 73.80  ? 36  ARG A CD  1 
ATOM   290  N NE  . ARG A 1 37  ? -0.535  128.069 47.721  1.00 78.18  ? 36  ARG A NE  1 
ATOM   291  C CZ  . ARG A 1 37  ? -1.564  128.155 46.879  1.00 80.68  ? 36  ARG A CZ  1 
ATOM   292  N NH1 . ARG A 1 37  ? -2.640  128.871 47.196  1.00 81.60  ? 36  ARG A NH1 1 
ATOM   293  N NH2 . ARG A 1 37  ? -1.520  127.522 45.712  1.00 81.79  ? 36  ARG A NH2 1 
ATOM   294  N N   . LEU A 1 38  ? 3.530   131.360 51.736  1.00 68.04  ? 37  LEU A N   1 
ATOM   295  C CA  . LEU A 1 38  ? 3.855   132.421 52.688  1.00 70.69  ? 37  LEU A CA  1 
ATOM   296  C C   . LEU A 1 38  ? 2.943   133.638 52.533  1.00 72.77  ? 37  LEU A C   1 
ATOM   297  O O   . LEU A 1 38  ? 2.624   134.055 51.409  1.00 73.02  ? 37  LEU A O   1 
ATOM   298  C CB  . LEU A 1 38  ? 5.321   132.853 52.558  1.00 70.33  ? 37  LEU A CB  1 
ATOM   299  C CG  . LEU A 1 38  ? 6.459   131.877 52.859  1.00 69.91  ? 37  LEU A CG  1 
ATOM   300  C CD1 . LEU A 1 38  ? 7.793   132.586 52.678  1.00 69.10  ? 37  LEU A CD1 1 
ATOM   301  C CD2 . LEU A 1 38  ? 6.347   131.288 54.256  1.00 69.07  ? 37  LEU A CD2 1 
ATOM   302  N N   . ASP A 1 39  ? 2.534   134.206 53.667  1.00 75.28  ? 38  ASP A N   1 
ATOM   303  C CA  . ASP A 1 39  ? 1.704   135.414 53.665  1.00 77.72  ? 38  ASP A CA  1 
ATOM   304  C C   . ASP A 1 39  ? 2.330   136.563 54.444  1.00 78.83  ? 38  ASP A C   1 
ATOM   305  O O   . ASP A 1 39  ? 2.620   136.436 55.638  1.00 79.05  ? 38  ASP A O   1 
ATOM   306  C CB  . ASP A 1 39  ? 0.285   135.134 54.176  1.00 77.96  ? 38  ASP A CB  1 
ATOM   307  C CG  . ASP A 1 39  ? 0.246   134.121 55.309  1.00 79.34  ? 38  ASP A CG  1 
ATOM   308  O OD1 . ASP A 1 39  ? 1.311   133.782 55.875  1.00 80.66  ? 38  ASP A OD1 1 
ATOM   309  O OD2 . ASP A 1 39  ? -0.827  133.613 55.702  1.00 80.67  ? 38  ASP A OD2 1 
ATOM   310  N N   . THR A 1 40  ? 2.534   137.678 53.743  1.00 80.24  ? 39  THR A N   1 
ATOM   311  C CA  . THR A 1 40  ? 3.081   138.899 54.332  1.00 81.46  ? 39  THR A CA  1 
ATOM   312  C C   . THR A 1 40  ? 2.075   139.546 55.276  1.00 81.62  ? 39  THR A C   1 
ATOM   313  O O   . THR A 1 40  ? 2.429   139.960 56.384  1.00 81.94  ? 39  THR A O   1 
ATOM   314  C CB  . THR A 1 40  ? 3.478   139.909 53.229  1.00 81.78  ? 39  THR A CB  1 
ATOM   315  O OG1 . THR A 1 40  ? 4.318   139.267 52.258  1.00 82.55  ? 39  THR A OG1 1 
ATOM   316  C CG2 . THR A 1 40  ? 4.362   141.023 53.803  1.00 82.50  ? 39  THR A CG2 1 
ATOM   317  N N   . GLU A 1 41  ? 0.819   139.626 54.831  1.00 81.68  ? 40  GLU A N   1 
ATOM   318  C CA  . GLU A 1 41  ? -0.210  140.328 55.596  1.00 81.53  ? 40  GLU A CA  1 
ATOM   319  C C   . GLU A 1 41  ? -0.927  139.414 56.602  1.00 80.08  ? 40  GLU A C   1 
ATOM   320  O O   . GLU A 1 41  ? -2.158  139.451 56.720  1.00 80.43  ? 40  GLU A O   1 
ATOM   321  C CB  . GLU A 1 41  ? -1.205  141.038 54.655  1.00 82.32  ? 40  GLU A CB  1 
ATOM   322  C CG  . GLU A 1 41  ? -0.583  141.763 53.454  1.00 85.67  ? 40  GLU A CG  1 
ATOM   323  C CD  . GLU A 1 41  ? 0.497   142.786 53.818  1.00 90.05  ? 40  GLU A CD  1 
ATOM   324  O OE1 . GLU A 1 41  ? 0.402   143.442 54.890  1.00 92.19  ? 40  GLU A OE1 1 
ATOM   325  O OE2 . GLU A 1 41  ? 1.451   142.942 53.019  1.00 91.34  ? 40  GLU A OE2 1 
ATOM   326  N N   . THR A 1 42  ? -0.148  138.598 57.321  1.00 77.86  ? 41  THR A N   1 
ATOM   327  C CA  . THR A 1 42  ? -0.680  137.673 58.330  1.00 75.21  ? 41  THR A CA  1 
ATOM   328  C C   . THR A 1 42  ? 0.328   137.360 59.445  1.00 72.63  ? 41  THR A C   1 
ATOM   329  O O   . THR A 1 42  ? 0.494   138.155 60.374  1.00 72.54  ? 41  THR A O   1 
ATOM   330  C CB  . THR A 1 42  ? -1.198  136.360 57.681  1.00 75.67  ? 41  THR A CB  1 
ATOM   331  O OG1 . THR A 1 42  ? -1.436  136.564 56.283  1.00 76.10  ? 41  THR A OG1 1 
ATOM   332  C CG2 . THR A 1 42  ? -2.579  135.996 58.228  1.00 76.22  ? 41  THR A CG2 1 
ATOM   333  N N   . GLU A 1 43  ? 0.992   136.206 59.353  1.00 69.05  ? 42  GLU A N   1 
ATOM   334  C CA  . GLU A 1 43  ? 1.855   135.739 60.439  1.00 65.52  ? 42  GLU A CA  1 
ATOM   335  C C   . GLU A 1 43  ? 3.300   135.480 60.022  1.00 61.52  ? 42  GLU A C   1 
ATOM   336  O O   . GLU A 1 43  ? 4.175   135.345 60.871  1.00 61.50  ? 42  GLU A O   1 
ATOM   337  C CB  . GLU A 1 43  ? 1.256   134.508 61.140  1.00 66.38  ? 42  GLU A CB  1 
ATOM   338  C CG  . GLU A 1 43  ? 1.553   134.439 62.640  1.00 69.46  ? 42  GLU A CG  1 
ATOM   339  C CD  . GLU A 1 43  ? 1.747   133.014 63.144  1.00 74.02  ? 42  GLU A CD  1 
ATOM   340  O OE1 . GLU A 1 43  ? 0.732   132.315 63.395  1.00 76.11  ? 42  GLU A OE1 1 
ATOM   341  O OE2 . GLU A 1 43  ? 2.915   132.586 63.295  1.00 75.86  ? 42  GLU A OE2 1 
ATOM   342  N N   . GLY A 1 44  ? 3.548   135.428 58.720  1.00 56.99  ? 43  GLY A N   1 
ATOM   343  C CA  . GLY A 1 44  ? 4.897   135.257 58.208  1.00 51.26  ? 43  GLY A CA  1 
ATOM   344  C C   . GLY A 1 44  ? 5.207   133.808 57.897  1.00 47.12  ? 43  GLY A C   1 
ATOM   345  O O   . GLY A 1 44  ? 4.350   133.089 57.385  1.00 46.58  ? 43  GLY A O   1 
ATOM   346  N N   . VAL A 1 45  ? 6.433   133.386 58.200  1.00 43.03  ? 44  VAL A N   1 
ATOM   347  C CA  . VAL A 1 45  ? 6.819   131.982 58.066  1.00 39.04  ? 44  VAL A CA  1 
ATOM   348  C C   . VAL A 1 45  ? 6.237   131.176 59.243  1.00 36.64  ? 44  VAL A C   1 
ATOM   349  O O   . VAL A 1 45  ? 6.523   131.473 60.407  1.00 36.00  ? 44  VAL A O   1 
ATOM   350  C CB  . VAL A 1 45  ? 8.355   131.797 57.967  1.00 39.04  ? 44  VAL A CB  1 
ATOM   351  C CG1 . VAL A 1 45  ? 8.732   130.313 57.871  1.00 38.35  ? 44  VAL A CG1 1 
ATOM   352  C CG2 . VAL A 1 45  ? 8.920   132.555 56.765  1.00 38.55  ? 44  VAL A CG2 1 
ATOM   353  N N   . PRO A 1 46  ? 5.410   130.176 58.929  1.00 34.03  ? 45  PRO A N   1 
ATOM   354  C CA  . PRO A 1 46  ? 4.793   129.312 59.942  1.00 32.70  ? 45  PRO A CA  1 
ATOM   355  C C   . PRO A 1 46  ? 5.845   128.714 60.871  1.00 31.33  ? 45  PRO A C   1 
ATOM   356  O O   . PRO A 1 46  ? 6.925   128.342 60.390  1.00 30.84  ? 45  PRO A O   1 
ATOM   357  C CB  . PRO A 1 46  ? 4.163   128.196 59.102  1.00 32.07  ? 45  PRO A CB  1 
ATOM   358  C CG  . PRO A 1 46  ? 3.913   128.806 57.813  1.00 33.29  ? 45  PRO A CG  1 
ATOM   359  C CD  . PRO A 1 46  ? 5.005   129.795 57.565  1.00 33.81  ? 45  PRO A CD  1 
ATOM   360  N N   . SER A 1 47  ? 5.543   128.626 62.162  1.00 29.92  ? 46  SER A N   1 
ATOM   361  C CA  . SER A 1 47  ? 6.475   128.028 63.137  1.00 29.50  ? 46  SER A CA  1 
ATOM   362  C C   . SER A 1 47  ? 6.797   126.566 62.821  1.00 28.51  ? 46  SER A C   1 
ATOM   363  O O   . SER A 1 47  ? 7.902   126.105 63.082  1.00 28.61  ? 46  SER A O   1 
ATOM   364  C CB  . SER A 1 47  ? 5.934   128.134 64.571  1.00 29.74  ? 46  SER A CB  1 
ATOM   365  O OG  . SER A 1 47  ? 4.534   127.895 64.607  1.00 31.41  ? 46  SER A OG  1 
ATOM   366  N N   . THR A 1 48  ? 5.846   125.845 62.237  1.00 27.79  ? 47  THR A N   1 
ATOM   367  C CA  . THR A 1 48  ? 6.088   124.460 61.856  1.00 27.58  ? 47  THR A CA  1 
ATOM   368  C C   . THR A 1 48  ? 7.199   124.381 60.839  1.00 26.72  ? 47  THR A C   1 
ATOM   369  O O   . THR A 1 48  ? 8.024   123.483 60.912  1.00 26.00  ? 47  THR A O   1 
ATOM   370  C CB  . THR A 1 48  ? 4.828   123.793 61.288  1.00 27.76  ? 47  THR A CB  1 
ATOM   371  O OG1 . THR A 1 48  ? 4.183   124.714 60.404  1.00 29.97  ? 47  THR A OG1 1 
ATOM   372  C CG2 . THR A 1 48  ? 3.806   123.580 62.397  1.00 29.25  ? 47  THR A CG2 1 
ATOM   373  N N   . ALA A 1 49  ? 7.224   125.322 59.892  1.00 26.44  ? 48  ALA A N   1 
ATOM   374  C CA  . ALA A 1 49  ? 8.297   125.350 58.899  1.00 25.76  ? 48  ALA A CA  1 
ATOM   375  C C   . ALA A 1 49  ? 9.594   125.833 59.537  1.00 25.67  ? 48  ALA A C   1 
ATOM   376  O O   . ALA A 1 49  ? 10.663  125.375 59.176  1.00 26.08  ? 48  ALA A O   1 
ATOM   377  C CB  . ALA A 1 49  ? 7.924   126.199 57.679  1.00 25.26  ? 48  ALA A CB  1 
ATOM   378  N N   . ILE A 1 50  ? 9.508   126.739 60.500  1.00 25.64  ? 49  ILE A N   1 
ATOM   379  C CA  . ILE A 1 50  ? 10.719  127.240 61.142  1.00 26.03  ? 49  ILE A CA  1 
ATOM   380  C C   . ILE A 1 50  ? 11.441  126.108 61.892  1.00 26.33  ? 49  ILE A C   1 
ATOM   381  O O   . ILE A 1 50  ? 12.672  125.960 61.809  1.00 26.62  ? 49  ILE A O   1 
ATOM   382  C CB  . ILE A 1 50  ? 10.378  128.464 62.016  1.00 26.48  ? 49  ILE A CB  1 
ATOM   383  C CG1 . ILE A 1 50  ? 10.484  129.724 61.171  1.00 25.99  ? 49  ILE A CG1 1 
ATOM   384  C CG2 . ILE A 1 50  ? 11.246  128.565 63.294  1.00 26.48  ? 49  ILE A CG2 1 
ATOM   385  C CD1 . ILE A 1 50  ? 9.466   130.720 61.529  1.00 28.16  ? 49  ILE A CD1 1 
ATOM   386  N N   . ARG A 1 51  ? 10.661  125.271 62.568  1.00 26.42  ? 50  ARG A N   1 
ATOM   387  C CA  . ARG A 1 51  ? 11.208  124.108 63.252  1.00 26.01  ? 50  ARG A CA  1 
ATOM   388  C C   . ARG A 1 51  ? 11.598  122.985 62.293  1.00 25.75  ? 50  ARG A C   1 
ATOM   389  O O   . ARG A 1 51  ? 12.694  122.442 62.403  1.00 25.34  ? 50  ARG A O   1 
ATOM   390  C CB  . ARG A 1 51  ? 10.216  123.580 64.275  1.00 26.32  ? 50  ARG A CB  1 
ATOM   391  C CG  . ARG A 1 51  ? 9.978   124.501 65.457  1.00 26.62  ? 50  ARG A CG  1 
ATOM   392  C CD  . ARG A 1 51  ? 8.908   123.943 66.376  1.00 25.25  ? 50  ARG A CD  1 
ATOM   393  N NE  . ARG A 1 51  ? 8.708   124.719 67.589  1.00 23.30  ? 50  ARG A NE  1 
ATOM   394  C CZ  . ARG A 1 51  ? 7.664   124.534 68.393  1.00 23.92  ? 50  ARG A CZ  1 
ATOM   395  N NH1 . ARG A 1 51  ? 6.768   123.583 68.112  1.00 20.27  ? 50  ARG A NH1 1 
ATOM   396  N NH2 . ARG A 1 51  ? 7.525   125.268 69.485  1.00 21.61  ? 50  ARG A NH2 1 
ATOM   397  N N   . GLU A 1 52  ? 10.707  122.615 61.372  1.00 25.54  ? 51  GLU A N   1 
ATOM   398  C CA  . GLU A 1 52  ? 11.031  121.530 60.452  1.00 25.78  ? 51  GLU A CA  1 
ATOM   399  C C   . GLU A 1 52  ? 12.401  121.792 59.803  1.00 24.63  ? 51  GLU A C   1 
ATOM   400  O O   . GLU A 1 52  ? 13.253  120.924 59.831  1.00 24.19  ? 51  GLU A O   1 
ATOM   401  C CB  . GLU A 1 52  ? 9.931   121.274 59.399  1.00 25.79  ? 51  GLU A CB  1 
ATOM   402  C CG  . GLU A 1 52  ? 10.455  120.568 58.152  1.00 29.83  ? 51  GLU A CG  1 
ATOM   403  C CD  . GLU A 1 52  ? 9.496   119.539 57.563  1.00 37.67  ? 51  GLU A CD  1 
ATOM   404  O OE1 . GLU A 1 52  ? 8.432   119.966 57.044  1.00 38.82  ? 51  GLU A OE1 1 
ATOM   405  O OE2 . GLU A 1 52  ? 9.814   118.300 57.599  1.00 39.90  ? 51  GLU A OE2 1 
ATOM   406  N N   . ILE A 1 53  ? 12.603  122.994 59.257  1.00 23.97  ? 52  ILE A N   1 
ATOM   407  C CA  . ILE A 1 53  ? 13.837  123.339 58.543  1.00 23.29  ? 52  ILE A CA  1 
ATOM   408  C C   . ILE A 1 53  ? 15.065  123.367 59.451  1.00 22.89  ? 52  ILE A C   1 
ATOM   409  O O   . ILE A 1 53  ? 16.013  122.619 59.214  1.00 23.15  ? 52  ILE A O   1 
ATOM   410  C CB  . ILE A 1 53  ? 13.701  124.672 57.780  1.00 23.33  ? 52  ILE A CB  1 
ATOM   411  C CG1 . ILE A 1 53  ? 12.738  124.518 56.597  1.00 24.09  ? 52  ILE A CG1 1 
ATOM   412  C CG2 . ILE A 1 53  ? 15.051  125.116 57.243  1.00 23.32  ? 52  ILE A CG2 1 
ATOM   413  C CD1 . ILE A 1 53  ? 11.863  125.713 56.355  1.00 23.08  ? 52  ILE A CD1 1 
ATOM   414  N N   . SER A 1 54  ? 15.060  124.220 60.474  1.00 22.01  ? 53  SER A N   1 
ATOM   415  C CA  . SER A 1 54  ? 16.210  124.286 61.388  1.00 22.23  ? 53  SER A CA  1 
ATOM   416  C C   . SER A 1 54  ? 16.539  122.951 62.079  1.00 22.10  ? 53  SER A C   1 
ATOM   417  O O   . SER A 1 54  ? 17.706  122.608 62.261  1.00 21.42  ? 53  SER A O   1 
ATOM   418  C CB  . SER A 1 54  ? 16.056  125.406 62.420  1.00 22.04  ? 53  SER A CB  1 
ATOM   419  O OG  . SER A 1 54  ? 14.914  125.221 63.218  1.00 21.84  ? 53  SER A OG  1 
ATOM   420  N N   . LEU A 1 55  ? 15.522  122.176 62.435  1.00 21.99  ? 54  LEU A N   1 
ATOM   421  C CA  . LEU A 1 55  ? 15.823  120.879 63.029  1.00 22.31  ? 54  LEU A CA  1 
ATOM   422  C C   . LEU A 1 55  ? 16.331  119.933 61.972  1.00 23.21  ? 54  LEU A C   1 
ATOM   423  O O   . LEU A 1 55  ? 17.309  119.238 62.200  1.00 22.62  ? 54  LEU A O   1 
ATOM   424  C CB  . LEU A 1 55  ? 14.652  120.312 63.835  1.00 21.65  ? 54  LEU A CB  1 
ATOM   425  C CG  . LEU A 1 55  ? 14.250  121.230 65.016  1.00 21.36  ? 54  LEU A CG  1 
ATOM   426  C CD1 . LEU A 1 55  ? 13.056  120.660 65.775  1.00 19.34  ? 54  LEU A CD1 1 
ATOM   427  C CD2 . LEU A 1 55  ? 15.400  121.496 65.954  1.00 16.74  ? 54  LEU A CD2 1 
ATOM   428  N N   . LEU A 1 56  ? 15.724  119.957 60.786  1.00 25.13  ? 55  LEU A N   1 
ATOM   429  C CA  . LEU A 1 56  ? 16.111  119.010 59.748  1.00 27.34  ? 55  LEU A CA  1 
ATOM   430  C C   . LEU A 1 56  ? 17.521  119.193 59.141  1.00 28.94  ? 55  LEU A C   1 
ATOM   431  O O   . LEU A 1 56  ? 18.135  118.221 58.686  1.00 29.48  ? 55  LEU A O   1 
ATOM   432  C CB  . LEU A 1 56  ? 15.030  118.895 58.676  1.00 27.33  ? 55  LEU A CB  1 
ATOM   433  C CG  . LEU A 1 56  ? 14.731  117.489 58.171  1.00 28.01  ? 55  LEU A CG  1 
ATOM   434  C CD1 . LEU A 1 56  ? 14.574  116.496 59.293  1.00 28.48  ? 55  LEU A CD1 1 
ATOM   435  C CD2 . LEU A 1 56  ? 13.482  117.533 57.345  1.00 30.86  ? 55  LEU A CD2 1 
ATOM   436  N N   . LYS A 1 57  ? 18.055  120.408 59.170  1.00 30.61  ? 56  LYS A N   1 
ATOM   437  C CA  . LYS A 1 57  ? 19.426  120.630 58.694  1.00 32.96  ? 56  LYS A CA  1 
ATOM   438  C C   . LYS A 1 57  ? 20.503  120.089 59.637  1.00 33.33  ? 56  LYS A C   1 
ATOM   439  O O   . LYS A 1 57  ? 21.684  120.028 59.269  1.00 33.85  ? 56  LYS A O   1 
ATOM   440  C CB  . LYS A 1 57  ? 19.710  122.111 58.485  1.00 33.26  ? 56  LYS A CB  1 
ATOM   441  C CG  . LYS A 1 57  ? 18.750  122.852 57.583  1.00 36.74  ? 56  LYS A CG  1 
ATOM   442  C CD  . LYS A 1 57  ? 19.079  124.332 57.636  1.00 40.97  ? 56  LYS A CD  1 
ATOM   443  C CE  . LYS A 1 57  ? 18.836  124.880 59.038  1.00 42.57  ? 56  LYS A CE  1 
ATOM   444  N NZ  . LYS A 1 57  ? 19.439  124.088 60.160  1.00 44.87  ? 56  LYS A NZ  1 
ATOM   445  N N   . GLU A 1 58  ? 20.109  119.745 60.858  1.00 33.45  ? 57  GLU A N   1 
ATOM   446  C CA  . GLU A 1 58  ? 21.037  119.164 61.832  1.00 33.48  ? 57  GLU A CA  1 
ATOM   447  C C   . GLU A 1 58  ? 21.011  117.631 61.780  1.00 33.15  ? 57  GLU A C   1 
ATOM   448  O O   . GLU A 1 58  ? 21.941  116.972 62.238  1.00 33.89  ? 57  GLU A O   1 
ATOM   449  C CB  . GLU A 1 58  ? 20.698  119.649 63.243  1.00 33.28  ? 57  GLU A CB  1 
ATOM   450  C CG  . GLU A 1 58  ? 20.784  121.157 63.395  1.00 34.49  ? 57  GLU A CG  1 
ATOM   451  C CD  . GLU A 1 58  ? 20.933  121.635 64.833  1.00 35.99  ? 57  GLU A CD  1 
ATOM   452  O OE1 . GLU A 1 58  ? 21.029  120.827 65.786  1.00 36.62  ? 57  GLU A OE1 1 
ATOM   453  O OE2 . GLU A 1 58  ? 20.961  122.862 65.009  1.00 38.87  ? 57  GLU A OE2 1 
ATOM   454  N N   . LEU A 1 59  ? 19.947  117.078 61.207  1.00 32.09  ? 58  LEU A N   1 
ATOM   455  C CA  . LEU A 1 59  ? 19.693  115.648 61.266  1.00 31.39  ? 58  LEU A CA  1 
ATOM   456  C C   . LEU A 1 59  ? 20.064  114.958 59.984  1.00 31.15  ? 58  LEU A C   1 
ATOM   457  O O   . LEU A 1 59  ? 19.199  114.582 59.190  1.00 31.99  ? 58  LEU A O   1 
ATOM   458  C CB  . LEU A 1 59  ? 18.224  115.364 61.610  1.00 30.73  ? 58  LEU A CB  1 
ATOM   459  C CG  . LEU A 1 59  ? 17.760  116.016 62.909  1.00 29.69  ? 58  LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 59  ? 16.251  115.907 63.054  1.00 28.93  ? 58  LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 59  ? 18.490  115.439 64.125  1.00 27.07  ? 58  LEU A CD2 1 
ATOM   462  N N   . ASN A 1 60  ? 21.351  114.780 59.763  1.00 30.52  ? 59  ASN A N   1 
ATOM   463  C CA  . ASN A 1 60  ? 21.729  114.013 58.603  1.00 30.01  ? 59  ASN A CA  1 
ATOM   464  C C   . ASN A 1 60  ? 22.104  112.585 58.999  1.00 28.40  ? 59  ASN A C   1 
ATOM   465  O O   . ASN A 1 60  ? 23.017  112.332 59.793  1.00 28.48  ? 59  ASN A O   1 
ATOM   466  C CB  . ASN A 1 60  ? 22.655  114.790 57.654  1.00 31.25  ? 59  ASN A CB  1 
ATOM   467  C CG  . ASN A 1 60  ? 24.092  114.389 57.754  1.00 35.95  ? 59  ASN A CG  1 
ATOM   468  O OD1 . ASN A 1 60  ? 24.817  114.818 58.674  1.00 40.90  ? 59  ASN A OD1 1 
ATOM   469  N ND2 . ASN A 1 60  ? 24.547  113.591 56.780  1.00 39.38  ? 59  ASN A ND2 1 
ATOM   470  N N   . HIS A 1 61  ? 21.281  111.662 58.514  1.00 25.73  ? 60  HIS A N   1 
ATOM   471  C CA  . HIS A 1 61  ? 21.311  110.302 58.969  1.00 23.89  ? 60  HIS A CA  1 
ATOM   472  C C   . HIS A 1 61  ? 20.641  109.459 57.892  1.00 22.94  ? 60  HIS A C   1 
ATOM   473  O O   . HIS A 1 61  ? 19.677  109.895 57.287  1.00 22.90  ? 60  HIS A O   1 
ATOM   474  C CB  . HIS A 1 61  ? 20.601  110.154 60.327  1.00 23.31  ? 60  HIS A CB  1 
ATOM   475  C CG  . HIS A 1 61  ? 20.590  108.749 60.831  1.00 22.50  ? 60  HIS A CG  1 
ATOM   476  N ND1 . HIS A 1 61  ? 21.596  108.231 61.623  1.00 22.61  ? 60  HIS A ND1 1 
ATOM   477  C CD2 . HIS A 1 61  ? 19.730  107.733 60.600  1.00 20.31  ? 60  HIS A CD2 1 
ATOM   478  C CE1 . HIS A 1 61  ? 21.343  106.961 61.876  1.00 22.05  ? 60  HIS A CE1 1 
ATOM   479  N NE2 . HIS A 1 61  ? 20.219  106.632 61.262  1.00 23.70  ? 60  HIS A NE2 1 
ATOM   480  N N   . PRO A 1 62  ? 21.168  108.271 57.622  1.00 21.76  ? 61  PRO A N   1 
ATOM   481  C CA  . PRO A 1 62  ? 20.607  107.432 56.553  1.00 21.33  ? 61  PRO A CA  1 
ATOM   482  C C   . PRO A 1 62  ? 19.143  107.011 56.750  1.00 20.42  ? 61  PRO A C   1 
ATOM   483  O O   . PRO A 1 62  ? 18.554  106.558 55.787  1.00 20.01  ? 61  PRO A O   1 
ATOM   484  C CB  . PRO A 1 62  ? 21.559  106.217 56.504  1.00 20.56  ? 61  PRO A CB  1 
ATOM   485  C CG  . PRO A 1 62  ? 22.218  106.213 57.855  1.00 21.61  ? 61  PRO A CG  1 
ATOM   486  C CD  . PRO A 1 62  ? 22.357  107.664 58.249  1.00 21.27  ? 61  PRO A CD  1 
ATOM   487  N N   . ASN A 1 63  ? 18.577  107.156 57.941  1.00 20.37  ? 62  ASN A N   1 
ATOM   488  C CA  . ASN A 1 63  ? 17.191  106.747 58.192  1.00 20.33  ? 62  ASN A CA  1 
ATOM   489  C C   . ASN A 1 63  ? 16.336  107.933 58.580  1.00 20.51  ? 62  ASN A C   1 
ATOM   490  O O   . ASN A 1 63  ? 15.297  107.802 59.218  1.00 20.64  ? 62  ASN A O   1 
ATOM   491  C CB  . ASN A 1 63  ? 17.109  105.646 59.255  1.00 19.91  ? 62  ASN A CB  1 
ATOM   492  C CG  . ASN A 1 63  ? 17.906  104.425 58.873  1.00 20.87  ? 62  ASN A CG  1 
ATOM   493  O OD1 . ASN A 1 63  ? 18.941  104.164 59.460  1.00 19.24  ? 62  ASN A OD1 1 
ATOM   494  N ND2 . ASN A 1 63  ? 17.436  103.678 57.853  1.00 19.51  ? 62  ASN A ND2 1 
ATOM   495  N N   . ILE A 1 64  ? 16.804  109.108 58.197  1.00 20.64  ? 63  ILE A N   1 
ATOM   496  C CA  . ILE A 1 64  ? 16.012  110.314 58.317  1.00 20.09  ? 63  ILE A CA  1 
ATOM   497  C C   . ILE A 1 64  ? 16.007  110.896 56.901  1.00 20.47  ? 63  ILE A C   1 
ATOM   498  O O   . ILE A 1 64  ? 17.073  111.088 56.305  1.00 20.15  ? 63  ILE A O   1 
ATOM   499  C CB  . ILE A 1 64  ? 16.638  111.261 59.362  1.00 19.47  ? 63  ILE A CB  1 
ATOM   500  C CG1 . ILE A 1 64  ? 16.662  110.585 60.741  1.00 19.48  ? 63  ILE A CG1 1 
ATOM   501  C CG2 . ILE A 1 64  ? 15.881  112.564 59.433  1.00 19.36  ? 63  ILE A CG2 1 
ATOM   502  C CD1 . ILE A 1 64  ? 17.315  111.399 61.873  1.00 20.50  ? 63  ILE A CD1 1 
ATOM   503  N N   . VAL A 1 65  ? 14.819  111.122 56.344  1.00 20.45  ? 64  VAL A N   1 
ATOM   504  C CA  . VAL A 1 65  ? 14.726  111.724 55.016  1.00 20.79  ? 64  VAL A CA  1 
ATOM   505  C C   . VAL A 1 65  ? 15.439  113.066 54.995  1.00 20.67  ? 64  VAL A C   1 
ATOM   506  O O   . VAL A 1 65  ? 15.149  113.950 55.788  1.00 19.97  ? 64  VAL A O   1 
ATOM   507  C CB  . VAL A 1 65  ? 13.278  111.874 54.491  1.00 20.95  ? 64  VAL A CB  1 
ATOM   508  C CG1 . VAL A 1 65  ? 13.301  112.464 53.079  1.00 21.46  ? 64  VAL A CG1 1 
ATOM   509  C CG2 . VAL A 1 65  ? 12.588  110.528 54.447  1.00 21.29  ? 64  VAL A CG2 1 
ATOM   510  N N   . LYS A 1 66  ? 16.387  113.187 54.076  1.00 20.96  ? 65  LYS A N   1 
ATOM   511  C CA  . LYS A 1 66  ? 17.299  114.323 54.032  1.00 21.78  ? 65  LYS A CA  1 
ATOM   512  C C   . LYS A 1 66  ? 16.723  115.557 53.351  1.00 21.83  ? 65  LYS A C   1 
ATOM   513  O O   . LYS A 1 66  ? 16.192  115.478 52.245  1.00 21.24  ? 65  LYS A O   1 
ATOM   514  C CB  . LYS A 1 66  ? 18.587  113.909 53.323  1.00 22.44  ? 65  LYS A CB  1 
ATOM   515  C CG  . LYS A 1 66  ? 19.709  114.898 53.456  1.00 24.03  ? 65  LYS A CG  1 
ATOM   516  C CD  . LYS A 1 66  ? 20.963  114.343 52.803  1.00 28.83  ? 65  LYS A CD  1 
ATOM   517  C CE  . LYS A 1 66  ? 22.113  115.333 52.899  1.00 31.31  ? 65  LYS A CE  1 
ATOM   518  N NZ  . LYS A 1 66  ? 23.259  114.844 52.103  1.00 35.19  ? 65  LYS A NZ  1 
ATOM   519  N N   . LEU A 1 67  ? 16.837  116.695 54.030  1.00 22.24  ? 66  LEU A N   1 
ATOM   520  C CA  . LEU A 1 67  ? 16.529  117.985 53.435  1.00 22.52  ? 66  LEU A CA  1 
ATOM   521  C C   . LEU A 1 67  ? 17.755  118.418 52.645  1.00 23.06  ? 66  LEU A C   1 
ATOM   522  O O   . LEU A 1 67  ? 18.807  118.666 53.222  1.00 23.04  ? 66  LEU A O   1 
ATOM   523  C CB  . LEU A 1 67  ? 16.190  119.008 54.519  1.00 22.25  ? 66  LEU A CB  1 
ATOM   524  C CG  . LEU A 1 67  ? 15.968  120.466 54.091  1.00 21.92  ? 66  LEU A CG  1 
ATOM   525  C CD1 . LEU A 1 67  ? 14.766  120.568 53.124  1.00 20.35  ? 66  LEU A CD1 1 
ATOM   526  C CD2 . LEU A 1 67  ? 15.754  121.343 55.297  1.00 18.43  ? 66  LEU A CD2 1 
ATOM   527  N N   . LEU A 1 68  ? 17.607  118.475 51.326  1.00 23.65  ? 67  LEU A N   1 
ATOM   528  C CA  . LEU A 1 68  ? 18.698  118.776 50.408  1.00 24.80  ? 67  LEU A CA  1 
ATOM   529  C C   . LEU A 1 68  ? 18.929  120.263 50.236  1.00 25.44  ? 67  LEU A C   1 
ATOM   530  O O   . LEU A 1 68  ? 20.062  120.691 50.017  1.00 25.09  ? 67  LEU A O   1 
ATOM   531  C CB  . LEU A 1 68  ? 18.435  118.139 49.036  1.00 24.77  ? 67  LEU A CB  1 
ATOM   532  C CG  . LEU A 1 68  ? 18.128  116.627 49.065  1.00 26.42  ? 67  LEU A CG  1 
ATOM   533  C CD1 . LEU A 1 68  ? 17.764  116.101 47.683  1.00 26.06  ? 67  LEU A CD1 1 
ATOM   534  C CD2 . LEU A 1 68  ? 19.294  115.841 49.662  1.00 27.45  ? 67  LEU A CD2 1 
ATOM   535  N N   . ASP A 1 69  ? 17.854  121.048 50.341  1.00 26.44  ? 68  ASP A N   1 
ATOM   536  C CA  . ASP A 1 69  ? 17.909  122.463 50.016  1.00 27.36  ? 68  ASP A CA  1 
ATOM   537  C C   . ASP A 1 69  ? 16.639  123.202 50.401  1.00 27.75  ? 68  ASP A C   1 
ATOM   538  O O   . ASP A 1 69  ? 15.557  122.620 50.455  1.00 26.94  ? 68  ASP A O   1 
ATOM   539  C CB  . ASP A 1 69  ? 18.209  122.677 48.514  1.00 27.57  ? 68  ASP A CB  1 
ATOM   540  C CG  . ASP A 1 69  ? 19.086  123.911 48.259  1.00 30.20  ? 68  ASP A CG  1 
ATOM   541  O OD1 . ASP A 1 69  ? 19.473  124.609 49.237  1.00 33.02  ? 68  ASP A OD1 1 
ATOM   542  O OD2 . ASP A 1 69  ? 19.440  124.271 47.113  1.00 31.89  ? 68  ASP A OD2 1 
ATOM   543  N N   . VAL A 1 70  ? 16.791  124.494 50.672  1.00 28.34  ? 69  VAL A N   1 
ATOM   544  C CA  . VAL A 1 70  ? 15.650  125.356 50.920  1.00 30.08  ? 69  VAL A CA  1 
ATOM   545  C C   . VAL A 1 70  ? 15.699  126.458 49.879  1.00 31.61  ? 69  VAL A C   1 
ATOM   546  O O   . VAL A 1 70  ? 16.666  127.202 49.797  1.00 31.63  ? 69  VAL A O   1 
ATOM   547  C CB  . VAL A 1 70  ? 15.674  125.968 52.346  1.00 29.84  ? 69  VAL A CB  1 
ATOM   548  C CG1 . VAL A 1 70  ? 14.501  126.915 52.548  1.00 30.05  ? 69  VAL A CG1 1 
ATOM   549  C CG2 . VAL A 1 70  ? 15.673  124.874 53.418  1.00 29.00  ? 69  VAL A CG2 1 
ATOM   550  N N   . ILE A 1 71  ? 14.660  126.562 49.071  1.00 33.99  ? 70  ILE A N   1 
ATOM   551  C CA  . ILE A 1 71  ? 14.632  127.606 48.066  1.00 36.40  ? 70  ILE A CA  1 
ATOM   552  C C   . ILE A 1 71  ? 13.666  128.731 48.450  1.00 38.50  ? 70  ILE A C   1 
ATOM   553  O O   . ILE A 1 71  ? 12.489  128.511 48.732  1.00 38.24  ? 70  ILE A O   1 
ATOM   554  C CB  . ILE A 1 71  ? 14.389  127.014 46.663  1.00 36.39  ? 70  ILE A CB  1 
ATOM   555  C CG1 . ILE A 1 71  ? 15.655  126.265 46.213  1.00 36.06  ? 70  ILE A CG1 1 
ATOM   556  C CG2 . ILE A 1 71  ? 14.040  128.130 45.665  1.00 36.14  ? 70  ILE A CG2 1 
ATOM   557  C CD1 . ILE A 1 71  ? 15.414  125.059 45.330  1.00 37.65  ? 70  ILE A CD1 1 
ATOM   558  N N   . HIS A 1 72  ? 14.212  129.938 48.486  1.00 41.73  ? 71  HIS A N   1 
ATOM   559  C CA  . HIS A 1 72  ? 13.496  131.108 48.956  1.00 44.93  ? 71  HIS A CA  1 
ATOM   560  C C   . HIS A 1 72  ? 12.905  131.894 47.817  1.00 46.81  ? 71  HIS A C   1 
ATOM   561  O O   . HIS A 1 72  ? 13.106  131.587 46.630  1.00 47.13  ? 71  HIS A O   1 
ATOM   562  C CB  . HIS A 1 72  ? 14.420  132.023 49.749  1.00 45.26  ? 71  HIS A CB  1 
ATOM   563  C CG  . HIS A 1 72  ? 15.065  131.351 50.912  1.00 47.27  ? 71  HIS A CG  1 
ATOM   564  N ND1 . HIS A 1 72  ? 14.481  131.305 52.158  1.00 48.60  ? 71  HIS A ND1 1 
ATOM   565  C CD2 . HIS A 1 72  ? 16.241  130.687 51.016  1.00 49.09  ? 71  HIS A CD2 1 
ATOM   566  C CE1 . HIS A 1 72  ? 15.276  130.649 52.985  1.00 50.34  ? 71  HIS A CE1 1 
ATOM   567  N NE2 . HIS A 1 72  ? 16.349  130.261 52.318  1.00 50.27  ? 71  HIS A NE2 1 
ATOM   568  N N   . THR A 1 73  ? 12.206  132.946 48.211  1.00 49.00  ? 72  THR A N   1 
ATOM   569  C CA  . THR A 1 73  ? 11.332  133.698 47.339  1.00 50.95  ? 72  THR A CA  1 
ATOM   570  C C   . THR A 1 73  ? 10.506  134.499 48.334  1.00 51.97  ? 72  THR A C   1 
ATOM   571  O O   . THR A 1 73  ? 10.215  134.031 49.442  1.00 51.81  ? 72  THR A O   1 
ATOM   572  C CB  . THR A 1 73  ? 10.481  132.713 46.484  1.00 51.01  ? 72  THR A CB  1 
ATOM   573  O OG1 . THR A 1 73  ? 11.180  132.390 45.269  1.00 51.68  ? 72  THR A OG1 1 
ATOM   574  C CG2 . THR A 1 73  ? 9.243   133.343 45.979  1.00 52.01  ? 72  THR A CG2 1 
ATOM   575  N N   . GLU A 1 74  ? 10.171  135.728 47.965  1.00 53.40  ? 73  GLU A N   1 
ATOM   576  C CA  . GLU A 1 74  ? 9.452   136.611 48.875  1.00 54.62  ? 73  GLU A CA  1 
ATOM   577  C C   . GLU A 1 74  ? 8.010   136.132 49.055  1.00 54.18  ? 73  GLU A C   1 
ATOM   578  O O   . GLU A 1 74  ? 7.345   136.462 50.044  1.00 54.27  ? 73  GLU A O   1 
ATOM   579  C CB  . GLU A 1 74  ? 9.527   138.067 48.386  1.00 55.50  ? 73  GLU A CB  1 
ATOM   580  C CG  . GLU A 1 74  ? 10.911  138.497 47.875  1.00 59.07  ? 73  GLU A CG  1 
ATOM   581  C CD  . GLU A 1 74  ? 12.045  138.284 48.883  1.00 63.79  ? 73  GLU A CD  1 
ATOM   582  O OE1 . GLU A 1 74  ? 12.026  138.926 49.962  1.00 66.17  ? 73  GLU A OE1 1 
ATOM   583  O OE2 . GLU A 1 74  ? 12.967  137.477 48.601  1.00 65.60  ? 73  GLU A OE2 1 
ATOM   584  N N   . ASN A 1 75  ? 7.562   135.315 48.103  1.00 53.42  ? 74  ASN A N   1 
ATOM   585  C CA  . ASN A 1 75  ? 6.226   134.722 48.121  1.00 52.31  ? 74  ASN A CA  1 
ATOM   586  C C   . ASN A 1 75  ? 6.181   133.278 48.649  1.00 50.93  ? 74  ASN A C   1 
ATOM   587  O O   . ASN A 1 75  ? 5.218   132.884 49.320  1.00 50.99  ? 74  ASN A O   1 
ATOM   588  C CB  . ASN A 1 75  ? 5.589   134.802 46.721  1.00 53.03  ? 74  ASN A CB  1 
ATOM   589  C CG  . ASN A 1 75  ? 6.624   134.729 45.583  1.00 54.07  ? 74  ASN A CG  1 
ATOM   590  O OD1 . ASN A 1 75  ? 7.500   135.587 45.460  1.00 55.58  ? 74  ASN A OD1 1 
ATOM   591  N ND2 . ASN A 1 75  ? 6.515   133.700 44.750  1.00 55.83  ? 74  ASN A ND2 1 
ATOM   592  N N   . LYS A 1 76  ? 7.216   132.492 48.346  1.00 48.77  ? 75  LYS A N   1 
ATOM   593  C CA  . LYS A 1 76  ? 7.201   131.054 48.640  1.00 46.54  ? 75  LYS A CA  1 
ATOM   594  C C   . LYS A 1 76  ? 8.496   130.467 49.217  1.00 44.17  ? 75  LYS A C   1 
ATOM   595  O O   . LYS A 1 76  ? 9.584   131.015 49.066  1.00 43.41  ? 75  LYS A O   1 
ATOM   596  C CB  . LYS A 1 76  ? 6.782   130.258 47.397  1.00 47.04  ? 75  LYS A CB  1 
ATOM   597  C CG  . LYS A 1 76  ? 5.272   130.204 47.167  1.00 48.88  ? 75  LYS A CG  1 
ATOM   598  C CD  . LYS A 1 76  ? 4.894   129.140 46.141  1.00 51.23  ? 75  LYS A CD  1 
ATOM   599  C CE  . LYS A 1 76  ? 5.043   129.639 44.708  1.00 53.62  ? 75  LYS A CE  1 
ATOM   600  N NZ  . LYS A 1 76  ? 4.729   128.561 43.706  1.00 55.17  ? 75  LYS A NZ  1 
ATOM   601  N N   . LEU A 1 77  ? 8.335   129.331 49.879  1.00 41.48  ? 76  LEU A N   1 
ATOM   602  C CA  . LEU A 1 77  ? 9.420   128.587 50.468  1.00 39.00  ? 76  LEU A CA  1 
ATOM   603  C C   . LEU A 1 77  ? 9.313   127.185 49.903  1.00 37.57  ? 76  LEU A C   1 
ATOM   604  O O   . LEU A 1 77  ? 8.278   126.525 50.037  1.00 36.78  ? 76  LEU A O   1 
ATOM   605  C CB  . LEU A 1 77  ? 9.246   128.569 51.987  1.00 39.21  ? 76  LEU A CB  1 
ATOM   606  C CG  . LEU A 1 77  ? 10.411  128.315 52.943  1.00 38.65  ? 76  LEU A CG  1 
ATOM   607  C CD1 . LEU A 1 77  ? 11.553  129.297 52.734  1.00 37.83  ? 76  LEU A CD1 1 
ATOM   608  C CD2 . LEU A 1 77  ? 9.885   128.408 54.358  1.00 38.23  ? 76  LEU A CD2 1 
ATOM   609  N N   . TYR A 1 78  ? 10.372  126.745 49.237  1.00 36.09  ? 77  TYR A N   1 
ATOM   610  C CA  . TYR A 1 78  ? 10.410  125.419 48.647  1.00 34.77  ? 77  TYR A CA  1 
ATOM   611  C C   . TYR A 1 78  ? 11.434  124.587 49.390  1.00 33.34  ? 77  TYR A C   1 
ATOM   612  O O   . TYR A 1 78  ? 12.603  124.969 49.495  1.00 32.67  ? 77  TYR A O   1 
ATOM   613  C CB  . TYR A 1 78  ? 10.797  125.503 47.174  1.00 35.58  ? 77  TYR A CB  1 
ATOM   614  C CG  . TYR A 1 78  ? 9.645   125.769 46.226  1.00 37.84  ? 77  TYR A CG  1 
ATOM   615  C CD1 . TYR A 1 78  ? 8.849   124.726 45.763  1.00 39.50  ? 77  TYR A CD1 1 
ATOM   616  C CD2 . TYR A 1 78  ? 9.367   127.066 45.773  1.00 40.24  ? 77  TYR A CD2 1 
ATOM   617  C CE1 . TYR A 1 78  ? 7.798   124.957 44.880  1.00 41.64  ? 77  TYR A CE1 1 
ATOM   618  C CE2 . TYR A 1 78  ? 8.311   127.309 44.885  1.00 41.43  ? 77  TYR A CE2 1 
ATOM   619  C CZ  . TYR A 1 78  ? 7.533   126.245 44.448  1.00 42.27  ? 77  TYR A CZ  1 
ATOM   620  O OH  . TYR A 1 78  ? 6.487   126.451 43.573  1.00 45.95  ? 77  TYR A OH  1 
ATOM   621  N N   . LEU A 1 79  ? 10.987  123.451 49.916  1.00 31.50  ? 78  LEU A N   1 
ATOM   622  C CA  . LEU A 1 79  ? 11.891  122.523 50.573  1.00 29.68  ? 78  LEU A CA  1 
ATOM   623  C C   . LEU A 1 79  ? 12.173  121.384 49.629  1.00 28.04  ? 78  LEU A C   1 
ATOM   624  O O   . LEU A 1 79  ? 11.261  120.785 49.087  1.00 27.88  ? 78  LEU A O   1 
ATOM   625  C CB  . LEU A 1 79  ? 11.292  121.997 51.879  1.00 29.45  ? 78  LEU A CB  1 
ATOM   626  C CG  . LEU A 1 79  ? 10.897  122.993 52.968  1.00 30.14  ? 78  LEU A CG  1 
ATOM   627  C CD1 . LEU A 1 79  ? 10.920  122.303 54.326  1.00 28.96  ? 78  LEU A CD1 1 
ATOM   628  C CD2 . LEU A 1 79  ? 11.786  124.239 52.966  1.00 31.70  ? 78  LEU A CD2 1 
ATOM   629  N N   . VAL A 1 80  ? 13.447  121.100 49.424  1.00 26.48  ? 79  VAL A N   1 
ATOM   630  C CA  . VAL A 1 80  ? 13.855  120.004 48.552  1.00 25.04  ? 79  VAL A CA  1 
ATOM   631  C C   . VAL A 1 80  ? 14.347  118.828 49.392  1.00 24.47  ? 79  VAL A C   1 
ATOM   632  O O   . VAL A 1 80  ? 15.351  118.923 50.089  1.00 24.49  ? 79  VAL A O   1 
ATOM   633  C CB  . VAL A 1 80  ? 14.911  120.460 47.523  1.00 24.60  ? 79  VAL A CB  1 
ATOM   634  C CG1 . VAL A 1 80  ? 15.112  119.410 46.458  1.00 22.84  ? 79  VAL A CG1 1 
ATOM   635  C CG2 . VAL A 1 80  ? 14.475  121.778 46.896  1.00 24.74  ? 79  VAL A CG2 1 
ATOM   636  N N   . PHE A 1 81  ? 13.592  117.742 49.338  1.00 23.59  ? 80  PHE A N   1 
ATOM   637  C CA  . PHE A 1 81  ? 13.885  116.531 50.072  1.00 22.90  ? 80  PHE A CA  1 
ATOM   638  C C   . PHE A 1 81  ? 14.324  115.433 49.113  1.00 23.38  ? 80  PHE A C   1 
ATOM   639  O O   . PHE A 1 81  ? 13.936  115.394 47.945  1.00 23.24  ? 80  PHE A O   1 
ATOM   640  C CB  . PHE A 1 81  ? 12.633  116.007 50.778  1.00 22.30  ? 80  PHE A CB  1 
ATOM   641  C CG  . PHE A 1 81  ? 12.109  116.885 51.881  1.00 20.63  ? 80  PHE A CG  1 
ATOM   642  C CD1 . PHE A 1 81  ? 11.029  117.737 51.655  1.00 20.00  ? 80  PHE A CD1 1 
ATOM   643  C CD2 . PHE A 1 81  ? 12.644  116.808 53.167  1.00 19.14  ? 80  PHE A CD2 1 
ATOM   644  C CE1 . PHE A 1 81  ? 10.501  118.518 52.707  1.00 19.71  ? 80  PHE A CE1 1 
ATOM   645  C CE2 . PHE A 1 81  ? 12.143  117.581 54.208  1.00 15.48  ? 80  PHE A CE2 1 
ATOM   646  C CZ  . PHE A 1 81  ? 11.065  118.442 53.982  1.00 18.33  ? 80  PHE A CZ  1 
ATOM   647  N N   . GLU A 1 82  ? 15.136  114.538 49.639  1.00 23.71  ? 81  GLU A N   1 
ATOM   648  C CA  . GLU A 1 82  ? 15.399  113.239 49.064  1.00 24.16  ? 81  GLU A CA  1 
ATOM   649  C C   . GLU A 1 82  ? 14.050  112.537 48.795  1.00 24.67  ? 81  GLU A C   1 
ATOM   650  O O   . GLU A 1 82  ? 13.106  112.666 49.584  1.00 24.09  ? 81  GLU A O   1 
ATOM   651  C CB  . GLU A 1 82  ? 16.240  112.481 50.098  1.00 23.86  ? 81  GLU A CB  1 
ATOM   652  C CG  . GLU A 1 82  ? 16.318  110.977 49.949  1.00 25.61  ? 81  GLU A CG  1 
ATOM   653  C CD  . GLU A 1 82  ? 16.795  110.274 51.213  1.00 27.68  ? 81  GLU A CD  1 
ATOM   654  O OE1 . GLU A 1 82  ? 17.086  109.050 51.115  1.00 28.46  ? 81  GLU A OE1 1 
ATOM   655  O OE2 . GLU A 1 82  ? 16.870  110.923 52.300  1.00 26.70  ? 81  GLU A OE2 1 
ATOM   656  N N   . PHE A 1 83  ? 13.955  111.819 47.676  1.00 25.47  ? 82  PHE A N   1 
ATOM   657  C CA  . PHE A 1 83  ? 12.709  111.190 47.282  1.00 26.17  ? 82  PHE A CA  1 
ATOM   658  C C   . PHE A 1 83  ? 12.656  109.705 47.649  1.00 27.13  ? 82  PHE A C   1 
ATOM   659  O O   . PHE A 1 83  ? 13.616  108.966 47.427  1.00 27.29  ? 82  PHE A O   1 
ATOM   660  C CB  . PHE A 1 83  ? 12.474  111.376 45.790  1.00 26.05  ? 82  PHE A CB  1 
ATOM   661  C CG  . PHE A 1 83  ? 11.237  110.688 45.287  1.00 26.56  ? 82  PHE A CG  1 
ATOM   662  C CD1 . PHE A 1 83  ? 9.988   111.243 45.499  1.00 26.92  ? 82  PHE A CD1 1 
ATOM   663  C CD2 . PHE A 1 83  ? 11.323  109.478 44.605  1.00 27.48  ? 82  PHE A CD2 1 
ATOM   664  C CE1 . PHE A 1 83  ? 8.841   110.602 45.031  1.00 26.78  ? 82  PHE A CE1 1 
ATOM   665  C CE2 . PHE A 1 83  ? 10.176  108.836 44.129  1.00 27.69  ? 82  PHE A CE2 1 
ATOM   666  C CZ  . PHE A 1 83  ? 8.940   109.395 44.355  1.00 26.15  ? 82  PHE A CZ  1 
ATOM   667  N N   . LEU A 1 84  ? 11.532  109.277 48.212  1.00 27.76  ? 83  LEU A N   1 
ATOM   668  C CA  . LEU A 1 84  ? 11.329  107.870 48.555  1.00 29.64  ? 83  LEU A CA  1 
ATOM   669  C C   . LEU A 1 84  ? 10.018  107.414 47.938  1.00 30.97  ? 83  LEU A C   1 
ATOM   670  O O   . LEU A 1 84  ? 9.103   108.202 47.815  1.00 30.99  ? 83  LEU A O   1 
ATOM   671  C CB  . LEU A 1 84  ? 11.332  107.679 50.073  1.00 28.96  ? 83  LEU A CB  1 
ATOM   672  C CG  . LEU A 1 84  ? 12.775  107.683 50.610  1.00 29.04  ? 83  LEU A CG  1 
ATOM   673  C CD1 . LEU A 1 84  ? 13.172  109.053 51.143  1.00 26.46  ? 83  LEU A CD1 1 
ATOM   674  C CD2 . LEU A 1 84  ? 13.008  106.582 51.627  1.00 26.51  ? 83  LEU A CD2 1 
ATOM   675  N N   . HIS A 1 85  ? 9.930   106.146 47.566  1.00 33.12  ? 84  HIS A N   1 
ATOM   676  C CA  . HIS A 1 85  ? 8.878   105.677 46.661  1.00 35.52  ? 84  HIS A CA  1 
ATOM   677  C C   . HIS A 1 85  ? 7.488   105.500 47.280  1.00 35.62  ? 84  HIS A C   1 
ATOM   678  O O   . HIS A 1 85  ? 6.500   105.889 46.672  1.00 35.76  ? 84  HIS A O   1 
ATOM   679  C CB  . HIS A 1 85  ? 9.370   104.464 45.858  1.00 36.62  ? 84  HIS A CB  1 
ATOM   680  C CG  . HIS A 1 85  ? 10.696  104.706 45.199  1.00 40.67  ? 84  HIS A CG  1 
ATOM   681  N ND1 . HIS A 1 85  ? 10.818  105.027 43.862  1.00 44.20  ? 84  HIS A ND1 1 
ATOM   682  C CD2 . HIS A 1 85  ? 11.954  104.733 45.710  1.00 42.98  ? 84  HIS A CD2 1 
ATOM   683  C CE1 . HIS A 1 85  ? 12.096  105.211 43.571  1.00 45.34  ? 84  HIS A CE1 1 
ATOM   684  N NE2 . HIS A 1 85  ? 12.805  105.041 44.675  1.00 44.98  ? 84  HIS A NE2 1 
ATOM   685  N N   . GLN A 1 86  ? 7.399   104.947 48.484  1.00 36.18  ? 85  GLN A N   1 
ATOM   686  C CA  . GLN A 1 86  ? 6.132   105.031 49.231  1.00 36.88  ? 85  GLN A CA  1 
ATOM   687  C C   . GLN A 1 86  ? 6.277   105.175 50.732  1.00 36.84  ? 85  GLN A C   1 
ATOM   688  O O   . GLN A 1 86  ? 7.388   105.199 51.260  1.00 37.12  ? 85  GLN A O   1 
ATOM   689  C CB  . GLN A 1 86  ? 5.151   103.891 48.901  1.00 37.02  ? 85  GLN A CB  1 
ATOM   690  C CG  . GLN A 1 86  ? 5.709   102.495 48.911  1.00 38.54  ? 85  GLN A CG  1 
ATOM   691  C CD  . GLN A 1 86  ? 4.616   101.450 48.786  1.00 39.41  ? 85  GLN A CD  1 
ATOM   692  O OE1 . GLN A 1 86  ? 3.450   101.793 48.654  1.00 41.23  ? 85  GLN A OE1 1 
ATOM   693  N NE2 . GLN A 1 86  ? 4.992   100.178 48.828  1.00 39.05  ? 85  GLN A NE2 1 
ATOM   694  N N   . ASP A 1 87  ? 5.130   105.320 51.390  1.00 36.95  ? 86  ASP A N   1 
ATOM   695  C CA  . ASP A 1 87  ? 5.025   105.343 52.837  1.00 36.91  ? 86  ASP A CA  1 
ATOM   696  C C   . ASP A 1 87  ? 4.710   103.935 53.356  1.00 36.58  ? 86  ASP A C   1 
ATOM   697  O O   . ASP A 1 87  ? 4.366   103.036 52.575  1.00 36.58  ? 86  ASP A O   1 
ATOM   698  C CB  . ASP A 1 87  ? 3.977   106.375 53.276  1.00 37.52  ? 86  ASP A CB  1 
ATOM   699  C CG  . ASP A 1 87  ? 2.561   105.967 52.920  1.00 39.85  ? 86  ASP A CG  1 
ATOM   700  O OD1 . ASP A 1 87  ? 2.294   104.751 52.844  1.00 43.60  ? 86  ASP A OD1 1 
ATOM   701  O OD2 . ASP A 1 87  ? 1.637   106.784 52.713  1.00 42.16  ? 86  ASP A OD2 1 
ATOM   702  N N   . LEU A 1 88  ? 4.831   103.738 54.664  1.00 35.79  ? 87  LEU A N   1 
ATOM   703  C CA  . LEU A 1 88  ? 4.682   102.409 55.248  1.00 35.55  ? 87  LEU A CA  1 
ATOM   704  C C   . LEU A 1 88  ? 3.232   101.903 55.240  1.00 35.88  ? 87  LEU A C   1 
ATOM   705  O O   . LEU A 1 88  ? 2.990   100.717 55.041  1.00 35.53  ? 87  LEU A O   1 
ATOM   706  C CB  . LEU A 1 88  ? 5.276   102.366 56.665  1.00 35.03  ? 87  LEU A CB  1 
ATOM   707  C CG  . LEU A 1 88  ? 5.179   101.032 57.391  1.00 33.42  ? 87  LEU A CG  1 
ATOM   708  C CD1 . LEU A 1 88  ? 6.021   99.967  56.678  1.00 31.99  ? 87  LEU A CD1 1 
ATOM   709  C CD2 . LEU A 1 88  ? 5.559   101.172 58.872  1.00 32.28  ? 87  LEU A CD2 1 
ATOM   710  N N   . LYS A 1 89  ? 2.279   102.803 55.448  1.00 36.86  ? 88  LYS A N   1 
ATOM   711  C CA  . LYS A 1 89  ? 0.871   102.444 55.437  1.00 38.18  ? 88  LYS A CA  1 
ATOM   712  C C   . LYS A 1 89  ? 0.451   101.875 54.075  1.00 38.80  ? 88  LYS A C   1 
ATOM   713  O O   . LYS A 1 89  ? -0.169  100.809 54.016  1.00 38.67  ? 88  LYS A O   1 
ATOM   714  C CB  . LYS A 1 89  ? 0.009   103.641 55.829  1.00 38.50  ? 88  LYS A CB  1 
ATOM   715  C CG  . LYS A 1 89  ? -1.489  103.353 55.864  1.00 40.59  ? 88  LYS A CG  1 
ATOM   716  C CD  . LYS A 1 89  ? -2.019  103.370 57.297  1.00 43.83  ? 88  LYS A CD  1 
ATOM   717  C CE  . LYS A 1 89  ? -3.454  102.838 57.375  1.00 45.30  ? 88  LYS A CE  1 
ATOM   718  N NZ  . LYS A 1 89  ? -3.493  101.347 57.207  1.00 46.73  ? 88  LYS A NZ  1 
ATOM   719  N N   . LYS A 1 90  ? 0.815   102.562 52.988  1.00 39.49  ? 89  LYS A N   1 
ATOM   720  C CA  . LYS A 1 90  ? 0.502   102.083 51.636  1.00 40.36  ? 89  LYS A CA  1 
ATOM   721  C C   . LYS A 1 90  ? 1.123   100.717 51.375  1.00 40.51  ? 89  LYS A C   1 
ATOM   722  O O   . LYS A 1 90  ? 0.496   99.848  50.768  1.00 40.89  ? 89  LYS A O   1 
ATOM   723  C CB  . LYS A 1 90  ? 0.928   103.091 50.568  1.00 40.48  ? 89  LYS A CB  1 
ATOM   724  C CG  . LYS A 1 90  ? -0.204  103.527 49.632  1.00 43.22  ? 89  LYS A CG  1 
ATOM   725  C CD  . LYS A 1 90  ? 0.330   104.024 48.272  1.00 45.93  ? 89  LYS A CD  1 
ATOM   726  C CE  . LYS A 1 90  ? -0.574  103.617 47.093  1.00 47.20  ? 89  LYS A CE  1 
ATOM   727  N NZ  . LYS A 1 90  ? -0.387  102.190 46.691  1.00 48.82  ? 89  LYS A NZ  1 
ATOM   728  N N   . PHE A 1 91  ? 2.348   100.518 51.854  1.00 40.83  ? 90  PHE A N   1 
ATOM   729  C CA  . PHE A 1 91  ? 3.002   99.221  51.740  1.00 40.94  ? 90  PHE A CA  1 
ATOM   730  C C   . PHE A 1 91  ? 2.227   98.125  52.478  1.00 42.49  ? 90  PHE A C   1 
ATOM   731  O O   . PHE A 1 91  ? 2.097   97.008  51.982  1.00 42.56  ? 90  PHE A O   1 
ATOM   732  C CB  . PHE A 1 91  ? 4.429   99.312  52.257  1.00 40.09  ? 90  PHE A CB  1 
ATOM   733  C CG  . PHE A 1 91  ? 5.165   98.006  52.254  1.00 37.33  ? 90  PHE A CG  1 
ATOM   734  C CD1 . PHE A 1 91  ? 5.521   97.399  51.063  1.00 34.56  ? 90  PHE A CD1 1 
ATOM   735  C CD2 . PHE A 1 91  ? 5.502   97.385  53.451  1.00 34.59  ? 90  PHE A CD2 1 
ATOM   736  C CE1 . PHE A 1 91  ? 6.200   96.198  51.064  1.00 34.11  ? 90  PHE A CE1 1 
ATOM   737  C CE2 . PHE A 1 91  ? 6.190   96.184  53.459  1.00 34.28  ? 90  PHE A CE2 1 
ATOM   738  C CZ  . PHE A 1 91  ? 6.535   95.585  52.263  1.00 33.59  ? 90  PHE A CZ  1 
ATOM   739  N N   . MET A 1 92  ? 1.718   98.455  53.659  1.00 44.51  ? 91  MET A N   1 
ATOM   740  C CA  . MET A 1 92  ? 0.909   97.537  54.462  1.00 46.73  ? 91  MET A CA  1 
ATOM   741  C C   . MET A 1 92  ? -0.463  97.223  53.840  1.00 48.48  ? 91  MET A C   1 
ATOM   742  O O   . MET A 1 92  ? -0.901  96.078  53.874  1.00 48.75  ? 91  MET A O   1 
ATOM   743  C CB  . MET A 1 92  ? 0.716   98.103  55.865  1.00 46.44  ? 91  MET A CB  1 
ATOM   744  C CG  . MET A 1 92  ? 1.964   98.077  56.714  1.00 46.64  ? 91  MET A CG  1 
ATOM   745  S SD  . MET A 1 92  ? 1.595   98.421  58.423  1.00 48.28  ? 91  MET A SD  1 
ATOM   746  C CE  . MET A 1 92  ? 1.226   100.172 58.351  1.00 44.95  ? 91  MET A CE  1 
ATOM   747  N N   . ASP A 1 93  ? -1.130  98.239  53.283  1.00 50.74  ? 92  ASP A N   1 
ATOM   748  C CA  . ASP A 1 93  ? -2.379  98.058  52.534  1.00 53.05  ? 92  ASP A CA  1 
ATOM   749  C C   . ASP A 1 93  ? -2.212  97.143  51.315  1.00 54.76  ? 92  ASP A C   1 
ATOM   750  O O   . ASP A 1 93  ? -3.165  96.488  50.894  1.00 55.25  ? 92  ASP A O   1 
ATOM   751  C CB  . ASP A 1 93  ? -2.941  99.406  52.069  1.00 52.88  ? 92  ASP A CB  1 
ATOM   752  C CG  . ASP A 1 93  ? -3.291  100.344 53.227  1.00 53.56  ? 92  ASP A CG  1 
ATOM   753  O OD1 . ASP A 1 93  ? -3.468  99.872  54.370  1.00 53.38  ? 92  ASP A OD1 1 
ATOM   754  O OD2 . ASP A 1 93  ? -3.415  101.584 53.077  1.00 54.65  ? 92  ASP A OD2 1 
ATOM   755  N N   . ALA A 1 94  ? -1.005  97.109  50.754  1.00 56.99  ? 93  ALA A N   1 
ATOM   756  C CA  . ALA A 1 94  ? -0.690  96.268  49.598  1.00 59.36  ? 93  ALA A CA  1 
ATOM   757  C C   . ALA A 1 94  ? -0.043  94.933  49.986  1.00 61.08  ? 93  ALA A C   1 
ATOM   758  O O   . ALA A 1 94  ? 0.172   94.074  49.128  1.00 61.31  ? 93  ALA A O   1 
ATOM   759  C CB  . ALA A 1 94  ? 0.197   97.025  48.627  1.00 59.29  ? 93  ALA A CB  1 
ATOM   760  N N   . SER A 1 95  ? 0.282   94.783  51.271  1.00 63.30  ? 94  SER A N   1 
ATOM   761  C CA  . SER A 1 95  ? 0.750   93.519  51.843  1.00 65.49  ? 94  SER A CA  1 
ATOM   762  C C   . SER A 1 95  ? -0.395  92.863  52.608  1.00 67.01  ? 94  SER A C   1 
ATOM   763  O O   . SER A 1 95  ? -0.189  91.887  53.332  1.00 67.20  ? 94  SER A O   1 
ATOM   764  C CB  . SER A 1 95  ? 1.917   93.755  52.810  1.00 65.40  ? 94  SER A CB  1 
ATOM   765  O OG  . SER A 1 95  ? 3.125   94.040  52.125  1.00 66.07  ? 94  SER A OG  1 
ATOM   766  N N   . ALA A 1 96  ? -1.601  93.405  52.426  1.00 68.86  ? 95  ALA A N   1 
ATOM   767  C CA  . ALA A 1 96  ? -2.769  93.067  53.247  1.00 70.47  ? 95  ALA A CA  1 
ATOM   768  C C   . ALA A 1 96  ? -3.302  91.641  53.084  1.00 71.32  ? 95  ALA A C   1 
ATOM   769  O O   . ALA A 1 96  ? -4.154  91.202  53.866  1.00 71.81  ? 95  ALA A O   1 
ATOM   770  C CB  . ALA A 1 96  ? -3.895  94.090  53.028  1.00 70.63  ? 95  ALA A CB  1 
ATOM   771  N N   . LEU A 1 97  ? -2.798  90.920  52.086  1.00 72.09  ? 96  LEU A N   1 
ATOM   772  C CA  . LEU A 1 97  ? -3.232  89.544  51.853  1.00 72.58  ? 96  LEU A CA  1 
ATOM   773  C C   . LEU A 1 97  ? -2.254  88.504  52.405  1.00 72.04  ? 96  LEU A C   1 
ATOM   774  O O   . LEU A 1 97  ? -2.675  87.474  52.940  1.00 72.42  ? 96  LEU A O   1 
ATOM   775  C CB  . LEU A 1 97  ? -3.509  89.306  50.363  1.00 73.15  ? 96  LEU A CB  1 
ATOM   776  C CG  . LEU A 1 97  ? -4.973  89.474  49.939  1.00 74.80  ? 96  LEU A CG  1 
ATOM   777  C CD1 . LEU A 1 97  ? -5.084  89.931  48.480  1.00 76.46  ? 96  LEU A CD1 1 
ATOM   778  C CD2 . LEU A 1 97  ? -5.762  88.185  50.181  1.00 76.59  ? 96  LEU A CD2 1 
ATOM   779  N N   . THR A 1 98  ? -0.957  88.780  52.279  1.00 71.01  ? 97  THR A N   1 
ATOM   780  C CA  . THR A 1 98  ? 0.082   87.846  52.730  1.00 69.69  ? 97  THR A CA  1 
ATOM   781  C C   . THR A 1 98  ? 0.694   88.258  54.060  1.00 68.08  ? 97  THR A C   1 
ATOM   782  O O   . THR A 1 98  ? 1.101   87.411  54.860  1.00 68.36  ? 97  THR A O   1 
ATOM   783  C CB  . THR A 1 98  ? 1.204   87.734  51.681  1.00 69.98  ? 97  THR A CB  1 
ATOM   784  O OG1 . THR A 1 98  ? 1.348   88.986  50.995  1.00 70.28  ? 97  THR A OG1 1 
ATOM   785  C CG2 . THR A 1 98  ? 0.822   86.732  50.584  1.00 70.59  ? 97  THR A CG2 1 
ATOM   786  N N   . GLY A 1 99  ? 0.769   89.563  54.285  1.00 65.82  ? 98  GLY A N   1 
ATOM   787  C CA  . GLY A 1 99  ? 1.471   90.084  55.434  1.00 63.06  ? 98  GLY A CA  1 
ATOM   788  C C   . GLY A 1 99  ? 2.895   90.458  55.090  1.00 60.85  ? 98  GLY A C   1 
ATOM   789  O O   . GLY A 1 99  ? 3.379   90.187  53.985  1.00 60.72  ? 98  GLY A O   1 
ATOM   790  N N   . ILE A 1 100 ? 3.556   91.093  56.054  1.00 58.58  ? 99  ILE A N   1 
ATOM   791  C CA  . ILE A 1 100 ? 4.947   91.503  55.916  1.00 55.85  ? 99  ILE A CA  1 
ATOM   792  C C   . ILE A 1 100 ? 5.824   90.448  56.586  1.00 53.70  ? 99  ILE A C   1 
ATOM   793  O O   . ILE A 1 100 ? 5.646   90.155  57.764  1.00 53.64  ? 99  ILE A O   1 
ATOM   794  C CB  . ILE A 1 100 ? 5.165   92.912  56.540  1.00 55.97  ? 99  ILE A CB  1 
ATOM   795  C CG1 . ILE A 1 100 ? 4.160   93.916  55.965  1.00 55.59  ? 99  ILE A CG1 1 
ATOM   796  C CG2 . ILE A 1 100 ? 6.598   93.404  56.312  1.00 55.84  ? 99  ILE A CG2 1 
ATOM   797  C CD1 . ILE A 1 100 ? 4.102   95.224  56.721  1.00 55.17  ? 99  ILE A CD1 1 
ATOM   798  N N   . PRO A 1 101 ? 6.769   89.883  55.841  1.00 51.83  ? 100 PRO A N   1 
ATOM   799  C CA  . PRO A 1 101 ? 7.652   88.846  56.381  1.00 50.55  ? 100 PRO A CA  1 
ATOM   800  C C   . PRO A 1 101 ? 8.503   89.382  57.529  1.00 49.48  ? 100 PRO A C   1 
ATOM   801  O O   . PRO A 1 101 ? 8.987   90.518  57.488  1.00 49.46  ? 100 PRO A O   1 
ATOM   802  C CB  . PRO A 1 101 ? 8.539   88.452  55.196  1.00 50.62  ? 100 PRO A CB  1 
ATOM   803  C CG  . PRO A 1 101 ? 8.210   89.348  54.082  1.00 50.93  ? 100 PRO A CG  1 
ATOM   804  C CD  . PRO A 1 101 ? 7.077   90.221  54.444  1.00 51.59  ? 100 PRO A CD  1 
ATOM   805  N N   . LEU A 1 102 ? 8.669   88.547  58.545  1.00 47.93  ? 101 LEU A N   1 
ATOM   806  C CA  . LEU A 1 102 ? 9.375   88.891  59.771  1.00 46.49  ? 101 LEU A CA  1 
ATOM   807  C C   . LEU A 1 102 ? 10.786  89.485  59.582  1.00 45.19  ? 101 LEU A C   1 
ATOM   808  O O   . LEU A 1 102 ? 11.158  90.387  60.330  1.00 45.07  ? 101 LEU A O   1 
ATOM   809  C CB  . LEU A 1 102 ? 9.435   87.668  60.685  1.00 46.42  ? 101 LEU A CB  1 
ATOM   810  C CG  . LEU A 1 102 ? 9.398   87.816  62.207  1.00 47.26  ? 101 LEU A CG  1 
ATOM   811  C CD1 . LEU A 1 102 ? 10.707  87.293  62.806  1.00 48.15  ? 101 LEU A CD1 1 
ATOM   812  C CD2 . LEU A 1 102 ? 9.098   89.232  62.677  1.00 47.74  ? 101 LEU A CD2 1 
ATOM   813  N N   . PRO A 1 103 ? 11.573  88.985  58.625  1.00 43.71  ? 102 PRO A N   1 
ATOM   814  C CA  . PRO A 1 103 ? 12.864  89.604  58.301  1.00 42.31  ? 102 PRO A CA  1 
ATOM   815  C C   . PRO A 1 103 ? 12.747  91.087  57.940  1.00 40.62  ? 102 PRO A C   1 
ATOM   816  O O   . PRO A 1 103 ? 13.596  91.890  58.351  1.00 40.66  ? 102 PRO A O   1 
ATOM   817  C CB  . PRO A 1 103 ? 13.341  88.801  57.077  1.00 42.84  ? 102 PRO A CB  1 
ATOM   818  C CG  . PRO A 1 103 ? 12.097  88.108  56.559  1.00 43.40  ? 102 PRO A CG  1 
ATOM   819  C CD  . PRO A 1 103 ? 11.338  87.781  57.802  1.00 43.82  ? 102 PRO A CD  1 
ATOM   820  N N   . LEU A 1 104 ? 11.712  91.438  57.185  1.00 38.11  ? 103 LEU A N   1 
ATOM   821  C CA  . LEU A 1 104 ? 11.495  92.817  56.769  1.00 36.04  ? 103 LEU A CA  1 
ATOM   822  C C   . LEU A 1 104 ? 11.067  93.721  57.938  1.00 34.47  ? 103 LEU A C   1 
ATOM   823  O O   . LEU A 1 104 ? 11.561  94.843  58.075  1.00 34.03  ? 103 LEU A O   1 
ATOM   824  C CB  . LEU A 1 104 ? 10.481  92.853  55.636  1.00 35.86  ? 103 LEU A CB  1 
ATOM   825  C CG  . LEU A 1 104 ? 10.355  94.101  54.779  1.00 35.78  ? 103 LEU A CG  1 
ATOM   826  C CD1 . LEU A 1 104 ? 11.723  94.647  54.336  1.00 35.75  ? 103 LEU A CD1 1 
ATOM   827  C CD2 . LEU A 1 104 ? 9.480   93.775  53.587  1.00 35.17  ? 103 LEU A CD2 1 
ATOM   828  N N   . ILE A 1 105 ? 10.172  93.209  58.782  1.00 32.20  ? 104 ILE A N   1 
ATOM   829  C CA  . ILE A 1 105 ? 9.735   93.889  59.995  1.00 30.23  ? 104 ILE A CA  1 
ATOM   830  C C   . ILE A 1 105 ? 10.910  94.195  60.937  1.00 29.20  ? 104 ILE A C   1 
ATOM   831  O O   . ILE A 1 105 ? 10.999  95.282  61.507  1.00 28.99  ? 104 ILE A O   1 
ATOM   832  C CB  . ILE A 1 105 ? 8.666   93.025  60.706  1.00 30.26  ? 104 ILE A CB  1 
ATOM   833  C CG1 . ILE A 1 105 ? 7.351   93.061  59.922  1.00 29.95  ? 104 ILE A CG1 1 
ATOM   834  C CG2 . ILE A 1 105 ? 8.474   93.449  62.185  1.00 29.19  ? 104 ILE A CG2 1 
ATOM   835  C CD1 . ILE A 1 105 ? 6.281   92.112  60.447  1.00 29.77  ? 104 ILE A CD1 1 
ATOM   836  N N   . LYS A 1 106 ? 11.796  93.219  61.099  1.00 28.05  ? 105 LYS A N   1 
ATOM   837  C CA  . LYS A 1 106 ? 12.959  93.337  61.950  1.00 27.43  ? 105 LYS A CA  1 
ATOM   838  C C   . LYS A 1 106 ? 13.917  94.385  61.389  1.00 26.52  ? 105 LYS A C   1 
ATOM   839  O O   . LYS A 1 106 ? 14.471  95.196  62.128  1.00 26.25  ? 105 LYS A O   1 
ATOM   840  C CB  . LYS A 1 106 ? 13.657  91.989  62.032  1.00 27.79  ? 105 LYS A CB  1 
ATOM   841  C CG  . LYS A 1 106 ? 14.402  91.770  63.322  1.00 29.92  ? 105 LYS A CG  1 
ATOM   842  C CD  . LYS A 1 106 ? 14.909  90.322  63.444  1.00 32.96  ? 105 LYS A CD  1 
ATOM   843  C CE  . LYS A 1 106 ? 13.794  89.324  63.670  1.00 32.13  ? 105 LYS A CE  1 
ATOM   844  N NZ  . LYS A 1 106 ? 14.339  87.940  63.502  1.00 34.74  ? 105 LYS A NZ  1 
ATOM   845  N N   . SER A 1 107 ? 14.089  94.362  60.071  1.00 25.43  ? 106 SER A N   1 
ATOM   846  C CA  . SER A 1 107 ? 14.921  95.329  59.381  1.00 24.67  ? 106 SER A CA  1 
ATOM   847  C C   . SER A 1 107 ? 14.374  96.732  59.492  1.00 23.88  ? 106 SER A C   1 
ATOM   848  O O   . SER A 1 107 ? 15.130  97.679  59.689  1.00 23.88  ? 106 SER A O   1 
ATOM   849  C CB  . SER A 1 107 ? 15.047  94.966  57.911  1.00 24.72  ? 106 SER A CB  1 
ATOM   850  O OG  . SER A 1 107 ? 15.696  96.012  57.212  1.00 25.95  ? 106 SER A OG  1 
ATOM   851  N N   . TYR A 1 108 ? 13.060  96.862  59.369  1.00 23.26  ? 107 TYR A N   1 
ATOM   852  C CA  . TYR A 1 108 ? 12.413  98.167  59.395  1.00 22.75  ? 107 TYR A CA  1 
ATOM   853  C C   . TYR A 1 108 ? 12.490  98.738  60.791  1.00 21.81  ? 107 TYR A C   1 
ATOM   854  O O   . TYR A 1 108 ? 12.878  99.885  60.974  1.00 21.26  ? 107 TYR A O   1 
ATOM   855  C CB  . TYR A 1 108 ? 10.956  98.064  58.932  1.00 22.98  ? 107 TYR A CB  1 
ATOM   856  C CG  . TYR A 1 108 ? 10.778  98.147  57.439  1.00 25.38  ? 107 TYR A CG  1 
ATOM   857  C CD1 . TYR A 1 108 ? 11.850  98.480  56.600  1.00 27.95  ? 107 TYR A CD1 1 
ATOM   858  C CD2 . TYR A 1 108 ? 9.532   97.907  56.856  1.00 27.98  ? 107 TYR A CD2 1 
ATOM   859  C CE1 . TYR A 1 108 ? 11.685  98.583  55.226  1.00 29.03  ? 107 TYR A CE1 1 
ATOM   860  C CE2 . TYR A 1 108 ? 9.354   97.995  55.478  1.00 29.92  ? 107 TYR A CE2 1 
ATOM   861  C CZ  . TYR A 1 108 ? 10.434  98.335  54.668  1.00 30.55  ? 107 TYR A CZ  1 
ATOM   862  O OH  . TYR A 1 108 ? 10.258  98.434  53.309  1.00 28.96  ? 107 TYR A OH  1 
ATOM   863  N N   . LEU A 1 109 ? 12.122  97.925  61.773  1.00 21.25  ? 108 LEU A N   1 
ATOM   864  C CA  . LEU A 1 109 ? 12.227  98.327  63.165  1.00 20.75  ? 108 LEU A CA  1 
ATOM   865  C C   . LEU A 1 109 ? 13.635  98.819  63.539  1.00 20.88  ? 108 LEU A C   1 
ATOM   866  O O   . LEU A 1 109 ? 13.785  99.864  64.169  1.00 20.14  ? 108 LEU A O   1 
ATOM   867  C CB  . LEU A 1 109 ? 11.841  97.173  64.082  1.00 20.27  ? 108 LEU A CB  1 
ATOM   868  C CG  . LEU A 1 109 ? 11.569  97.669  65.493  1.00 19.23  ? 108 LEU A CG  1 
ATOM   869  C CD1 . LEU A 1 109 ? 10.626  98.872  65.442  1.00 15.74  ? 108 LEU A CD1 1 
ATOM   870  C CD2 . LEU A 1 109 ? 11.012  96.558  66.375  1.00 17.93  ? 108 LEU A CD2 1 
ATOM   871  N N   . PHE A 1 110 ? 14.641  98.032  63.164  1.00 21.39  ? 109 PHE A N   1 
ATOM   872  C CA  . PHE A 1 110 ? 16.034  98.303  63.484  1.00 22.16  ? 109 PHE A CA  1 
ATOM   873  C C   . PHE A 1 110 ? 16.521  99.610  62.853  1.00 22.43  ? 109 PHE A C   1 
ATOM   874  O O   . PHE A 1 110 ? 17.291  100.355 63.467  1.00 23.01  ? 109 PHE A O   1 
ATOM   875  C CB  . PHE A 1 110 ? 16.901  97.135  63.019  1.00 22.65  ? 109 PHE A CB  1 
ATOM   876  C CG  . PHE A 1 110 ? 18.292  97.149  63.582  1.00 24.07  ? 109 PHE A CG  1 
ATOM   877  C CD1 . PHE A 1 110 ? 18.524  96.830  64.911  1.00 23.39  ? 109 PHE A CD1 1 
ATOM   878  C CD2 . PHE A 1 110 ? 19.370  97.495  62.782  1.00 25.90  ? 109 PHE A CD2 1 
ATOM   879  C CE1 . PHE A 1 110 ? 19.807  96.836  65.433  1.00 23.93  ? 109 PHE A CE1 1 
ATOM   880  C CE2 . PHE A 1 110 ? 20.668  97.520  63.315  1.00 25.40  ? 109 PHE A CE2 1 
ATOM   881  C CZ  . PHE A 1 110 ? 20.878  97.191  64.631  1.00 24.25  ? 109 PHE A CZ  1 
ATOM   882  N N   . GLN A 1 111 ? 16.062  99.878  61.631  1.00 22.10  ? 110 GLN A N   1 
ATOM   883  C CA  . GLN A 1 111 ? 16.354  101.130 60.931  1.00 21.45  ? 110 GLN A CA  1 
ATOM   884  C C   . GLN A 1 111 ? 15.674  102.330 61.570  1.00 21.21  ? 110 GLN A C   1 
ATOM   885  O O   . GLN A 1 111 ? 16.299  103.381 61.750  1.00 21.53  ? 110 GLN A O   1 
ATOM   886  C CB  . GLN A 1 111 ? 15.920  101.030 59.489  1.00 21.22  ? 110 GLN A CB  1 
ATOM   887  C CG  . GLN A 1 111 ? 16.796  100.155 58.689  1.00 20.95  ? 110 GLN A CG  1 
ATOM   888  C CD  . GLN A 1 111 ? 16.486  100.232 57.212  1.00 24.01  ? 110 GLN A CD  1 
ATOM   889  O OE1 . GLN A 1 111 ? 16.831  101.214 56.554  1.00 23.30  ? 110 GLN A OE1 1 
ATOM   890  N NE2 . GLN A 1 111 ? 15.852  99.183  56.677  1.00 24.88  ? 110 GLN A NE2 1 
ATOM   891  N N   . LEU A 1 112 ? 14.403  102.161 61.925  1.00 20.21  ? 111 LEU A N   1 
ATOM   892  C CA  . LEU A 1 112 ? 13.636  103.195 62.623  1.00 19.15  ? 111 LEU A CA  1 
ATOM   893  C C   . LEU A 1 112 ? 14.246  103.574 63.963  1.00 17.90  ? 111 LEU A C   1 
ATOM   894  O O   . LEU A 1 112 ? 14.311  104.760 64.311  1.00 17.81  ? 111 LEU A O   1 
ATOM   895  C CB  . LEU A 1 112 ? 12.184  102.752 62.834  1.00 18.75  ? 111 LEU A CB  1 
ATOM   896  C CG  . LEU A 1 112 ? 11.389  102.669 61.515  1.00 21.00  ? 111 LEU A CG  1 
ATOM   897  C CD1 . LEU A 1 112 ? 10.097  101.885 61.648  1.00 19.20  ? 111 LEU A CD1 1 
ATOM   898  C CD2 . LEU A 1 112 ? 11.145  104.056 60.917  1.00 19.47  ? 111 LEU A CD2 1 
ATOM   899  N N   . LEU A 1 113 ? 14.661  102.564 64.719  1.00 16.62  ? 112 LEU A N   1 
ATOM   900  C CA  . LEU A 1 113 ? 15.294  102.777 66.017  1.00 16.40  ? 112 LEU A CA  1 
ATOM   901  C C   . LEU A 1 113 ? 16.612  103.532 65.865  1.00 16.15  ? 112 LEU A C   1 
ATOM   902  O O   . LEU A 1 113 ? 16.944  104.342 66.699  1.00 16.00  ? 112 LEU A O   1 
ATOM   903  C CB  . LEU A 1 113 ? 15.493  101.451 66.773  1.00 15.84  ? 112 LEU A CB  1 
ATOM   904  C CG  . LEU A 1 113 ? 14.206  100.848 67.379  1.00 16.32  ? 112 LEU A CG  1 
ATOM   905  C CD1 . LEU A 1 113 ? 14.366  99.391  67.698  1.00 14.43  ? 112 LEU A CD1 1 
ATOM   906  C CD2 . LEU A 1 113 ? 13.766  101.573 68.629  1.00 16.11  ? 112 LEU A CD2 1 
ATOM   907  N N   . GLN A 1 114 ? 17.339  103.276 64.782  1.00 16.86  ? 113 GLN A N   1 
ATOM   908  C CA  . GLN A 1 114 ? 18.538  104.038 64.465  1.00 17.43  ? 113 GLN A CA  1 
ATOM   909  C C   . GLN A 1 114 ? 18.258  105.510 64.213  1.00 17.46  ? 113 GLN A C   1 
ATOM   910  O O   . GLN A 1 114 ? 18.941  106.355 64.771  1.00 17.37  ? 113 GLN A O   1 
ATOM   911  C CB  . GLN A 1 114 ? 19.220  103.463 63.250  1.00 17.49  ? 113 GLN A CB  1 
ATOM   912  C CG  . GLN A 1 114 ? 20.187  102.361 63.548  1.00 19.70  ? 113 GLN A CG  1 
ATOM   913  C CD  . GLN A 1 114 ? 20.748  101.815 62.277  1.00 21.09  ? 113 GLN A CD  1 
ATOM   914  O OE1 . GLN A 1 114 ? 21.516  102.485 61.616  1.00 24.54  ? 113 GLN A OE1 1 
ATOM   915  N NE2 . GLN A 1 114 ? 20.327  100.623 61.904  1.00 22.91  ? 113 GLN A NE2 1 
ATOM   916  N N   . GLY A 1 115 ? 17.263  105.805 63.367  1.00 17.74  ? 114 GLY A N   1 
ATOM   917  C CA  . GLY A 1 115 ? 16.866  107.172 63.059  1.00 17.70  ? 114 GLY A CA  1 
ATOM   918  C C   . GLY A 1 115 ? 16.382  107.888 64.299  1.00 18.31  ? 114 GLY A C   1 
ATOM   919  O O   . GLY A 1 115 ? 16.785  109.023 64.592  1.00 19.23  ? 114 GLY A O   1 
ATOM   920  N N   . LEU A 1 116 ? 15.538  107.202 65.056  1.00 18.64  ? 115 LEU A N   1 
ATOM   921  C CA  . LEU A 1 116 ? 15.030  107.720 66.318  1.00 18.73  ? 115 LEU A CA  1 
ATOM   922  C C   . LEU A 1 116 ? 16.105  107.957 67.354  1.00 18.70  ? 115 LEU A C   1 
ATOM   923  O O   . LEU A 1 116 ? 16.019  108.952 68.073  1.00 19.63  ? 115 LEU A O   1 
ATOM   924  C CB  . LEU A 1 116 ? 13.944  106.808 66.902  1.00 18.84  ? 115 LEU A CB  1 
ATOM   925  C CG  . LEU A 1 116 ? 12.941  107.508 67.808  1.00 19.96  ? 115 LEU A CG  1 
ATOM   926  C CD1 . LEU A 1 116 ? 12.285  108.715 67.077  1.00 20.69  ? 115 LEU A CD1 1 
ATOM   927  C CD2 . LEU A 1 116 ? 11.882  106.520 68.316  1.00 20.16  ? 115 LEU A CD2 1 
ATOM   928  N N   . ALA A 1 117 ? 17.098  107.070 67.464  1.00 18.42  ? 116 ALA A N   1 
ATOM   929  C CA  . ALA A 1 117 ? 18.172  107.299 68.448  1.00 19.00  ? 116 ALA A CA  1 
ATOM   930  C C   . ALA A 1 117 ? 19.050  108.464 68.016  1.00 19.00  ? 116 ALA A C   1 
ATOM   931  O O   . ALA A 1 117 ? 19.566  109.189 68.854  1.00 19.83  ? 116 ALA A O   1 
ATOM   932  C CB  . ALA A 1 117 ? 19.018  106.068 68.658  1.00 18.85  ? 116 ALA A CB  1 
ATOM   933  N N   . PHE A 1 118 ? 19.222  108.634 66.708  1.00 19.39  ? 117 PHE A N   1 
ATOM   934  C CA  . PHE A 1 118 ? 19.913  109.798 66.178  1.00 19.56  ? 117 PHE A CA  1 
ATOM   935  C C   . PHE A 1 118 ? 19.147  111.081 66.543  1.00 19.53  ? 117 PHE A C   1 
ATOM   936  O O   . PHE A 1 118 ? 19.767  112.022 67.051  1.00 20.74  ? 117 PHE A O   1 
ATOM   937  C CB  . PHE A 1 118 ? 20.153  109.673 64.667  1.00 19.81  ? 117 PHE A CB  1 
ATOM   938  C CG  . PHE A 1 118 ? 21.131  110.692 64.117  1.00 21.36  ? 117 PHE A CG  1 
ATOM   939  C CD1 . PHE A 1 118 ? 22.506  110.424 64.093  1.00 22.11  ? 117 PHE A CD1 1 
ATOM   940  C CD2 . PHE A 1 118 ? 20.682  111.916 63.645  1.00 21.65  ? 117 PHE A CD2 1 
ATOM   941  C CE1 . PHE A 1 118 ? 23.413  111.363 63.597  1.00 23.62  ? 117 PHE A CE1 1 
ATOM   942  C CE2 . PHE A 1 118 ? 21.574  112.858 63.154  1.00 23.73  ? 117 PHE A CE2 1 
ATOM   943  C CZ  . PHE A 1 118 ? 22.945  112.586 63.127  1.00 24.11  ? 117 PHE A CZ  1 
ATOM   944  N N   . CYS A 1 119 ? 17.827  111.139 66.330  1.00 18.95  ? 118 CYS A N   1 
ATOM   945  C CA  . CYS A 1 119 ? 17.064  112.343 66.763  1.00 19.32  ? 118 CYS A CA  1 
ATOM   946  C C   . CYS A 1 119 ? 17.234  112.671 68.239  1.00 18.54  ? 118 CYS A C   1 
ATOM   947  O O   . CYS A 1 119 ? 17.511  113.815 68.606  1.00 18.42  ? 118 CYS A O   1 
ATOM   948  C CB  . CYS A 1 119 ? 15.560  112.234 66.483  1.00 18.91  ? 118 CYS A CB  1 
ATOM   949  S SG  . CYS A 1 119 ? 15.206  112.027 64.749  1.00 22.68  ? 118 CYS A SG  1 
ATOM   950  N N   . HIS A 1 120 ? 17.023  111.679 69.086  1.00 18.25  ? 119 HIS A N   1 
ATOM   951  C CA  . HIS A 1 120 ? 17.076  111.926 70.526  1.00 19.16  ? 119 HIS A CA  1 
ATOM   952  C C   . HIS A 1 120 ? 18.462  112.335 71.021  1.00 19.23  ? 119 HIS A C   1 
ATOM   953  O O   . HIS A 1 120 ? 18.584  113.160 71.909  1.00 19.74  ? 119 HIS A O   1 
ATOM   954  C CB  . HIS A 1 120 ? 16.528  110.713 71.280  1.00 18.94  ? 119 HIS A CB  1 
ATOM   955  C CG  . HIS A 1 120 ? 15.092  110.426 70.969  1.00 18.46  ? 119 HIS A CG  1 
ATOM   956  N ND1 . HIS A 1 120 ? 14.489  109.222 71.265  1.00 19.32  ? 119 HIS A ND1 1 
ATOM   957  C CD2 . HIS A 1 120 ? 14.131  111.202 70.409  1.00 17.71  ? 119 HIS A CD2 1 
ATOM   958  C CE1 . HIS A 1 120 ? 13.222  109.263 70.887  1.00 18.68  ? 119 HIS A CE1 1 
ATOM   959  N NE2 . HIS A 1 120 ? 12.980  110.452 70.360  1.00 19.88  ? 119 HIS A NE2 1 
ATOM   960  N N   . SER A 1 121 ? 19.507  111.804 70.408  1.00 20.05  ? 120 SER A N   1 
ATOM   961  C CA  . SER A 1 121 ? 20.856  112.142 70.846  1.00 20.92  ? 120 SER A CA  1 
ATOM   962  C C   . SER A 1 121 ? 21.229  113.519 70.280  1.00 21.25  ? 120 SER A C   1 
ATOM   963  O O   . SER A 1 121 ? 22.251  114.094 70.642  1.00 21.61  ? 120 SER A O   1 
ATOM   964  C CB  . SER A 1 121 ? 21.845  111.038 70.455  1.00 20.37  ? 120 SER A CB  1 
ATOM   965  O OG  . SER A 1 121 ? 22.200  111.144 69.079  1.00 22.57  ? 120 SER A OG  1 
ATOM   966  N N   . HIS A 1 122 ? 20.366  114.057 69.417  1.00 21.37  ? 121 HIS A N   1 
ATOM   967  C CA  . HIS A 1 122 ? 20.517  115.423 68.922  1.00 21.64  ? 121 HIS A CA  1 
ATOM   968  C C   . HIS A 1 122 ? 19.417  116.348 69.444  1.00 21.34  ? 121 HIS A C   1 
ATOM   969  O O   . HIS A 1 122 ? 19.074  117.352 68.805  1.00 21.46  ? 121 HIS A O   1 
ATOM   970  C CB  . HIS A 1 122 ? 20.571  115.430 67.398  1.00 22.16  ? 121 HIS A CB  1 
ATOM   971  C CG  . HIS A 1 122 ? 21.865  114.923 66.853  1.00 24.94  ? 121 HIS A CG  1 
ATOM   972  N ND1 . HIS A 1 122 ? 22.295  113.628 67.045  1.00 29.62  ? 121 HIS A ND1 1 
ATOM   973  C CD2 . HIS A 1 122 ? 22.834  115.540 66.141  1.00 28.24  ? 121 HIS A CD2 1 
ATOM   974  C CE1 . HIS A 1 122 ? 23.471  113.468 66.464  1.00 30.07  ? 121 HIS A CE1 1 
ATOM   975  N NE2 . HIS A 1 122 ? 23.821  114.616 65.912  1.00 30.54  ? 121 HIS A NE2 1 
ATOM   976  N N   . ARG A 1 123 ? 18.907  116.002 70.629  1.00 20.01  ? 122 ARG A N   1 
ATOM   977  C CA  . ARG A 1 123 ? 17.813  116.684 71.315  1.00 18.97  ? 122 ARG A CA  1 
ATOM   978  C C   . ARG A 1 123 ? 16.575  117.072 70.467  1.00 18.56  ? 122 ARG A C   1 
ATOM   979  O O   . ARG A 1 123 ? 16.031  118.174 70.607  1.00 17.94  ? 122 ARG A O   1 
ATOM   980  C CB  . ARG A 1 123 ? 18.336  117.856 72.168  1.00 19.60  ? 122 ARG A CB  1 
ATOM   981  C CG  . ARG A 1 123 ? 19.227  118.899 71.453  1.00 19.62  ? 122 ARG A CG  1 
ATOM   982  C CD  . ARG A 1 123 ? 18.432  120.031 70.782  1.00 20.75  ? 122 ARG A CD  1 
ATOM   983  N NE  . ARG A 1 123 ? 19.290  121.048 70.177  1.00 23.33  ? 122 ARG A NE  1 
ATOM   984  C CZ  . ARG A 1 123 ? 19.709  121.050 68.909  1.00 23.67  ? 122 ARG A CZ  1 
ATOM   985  N NH1 . ARG A 1 123 ? 19.366  120.066 68.077  1.00 24.36  ? 122 ARG A NH1 1 
ATOM   986  N NH2 . ARG A 1 123 ? 20.490  122.042 68.475  1.00 23.24  ? 122 ARG A NH2 1 
ATOM   987  N N   . VAL A 1 124 ? 16.124  116.159 69.613  1.00 17.73  ? 123 VAL A N   1 
ATOM   988  C CA  . VAL A 1 124 ? 14.921  116.391 68.815  1.00 17.78  ? 123 VAL A CA  1 
ATOM   989  C C   . VAL A 1 124 ? 13.868  115.322 69.119  1.00 18.14  ? 123 VAL A C   1 
ATOM   990  O O   . VAL A 1 124 ? 14.166  114.125 69.120  1.00 17.76  ? 123 VAL A O   1 
ATOM   991  C CB  . VAL A 1 124 ? 15.236  116.416 67.290  1.00 17.92  ? 123 VAL A CB  1 
ATOM   992  C CG1 . VAL A 1 124 ? 13.930  116.449 66.430  1.00 17.75  ? 123 VAL A CG1 1 
ATOM   993  C CG2 . VAL A 1 124 ? 16.149  117.603 66.937  1.00 17.84  ? 123 VAL A CG2 1 
ATOM   994  N N   . LEU A 1 125 ? 12.648  115.775 69.394  1.00 19.09  ? 124 LEU A N   1 
ATOM   995  C CA  . LEU A 1 125 ? 11.468  114.913 69.501  1.00 19.62  ? 124 LEU A CA  1 
ATOM   996  C C   . LEU A 1 125 ? 10.734  115.005 68.188  1.00 19.65  ? 124 LEU A C   1 
ATOM   997  O O   . LEU A 1 125 ? 10.514  116.110 67.715  1.00 20.58  ? 124 LEU A O   1 
ATOM   998  C CB  . LEU A 1 125 ? 10.526  115.416 70.605  1.00 19.39  ? 124 LEU A CB  1 
ATOM   999  C CG  . LEU A 1 125 ? 11.006  115.320 72.059  1.00 21.54  ? 124 LEU A CG  1 
ATOM   1000 C CD1 . LEU A 1 125 ? 9.906   115.710 73.056  1.00 24.67  ? 124 LEU A CD1 1 
ATOM   1001 C CD2 . LEU A 1 125 ? 11.521  113.934 72.364  1.00 22.06  ? 124 LEU A CD2 1 
ATOM   1002 N N   . HIS A 1 126 ? 10.325  113.875 67.619  1.00 19.11  ? 125 HIS A N   1 
ATOM   1003 C CA  . HIS A 1 126 ? 9.585   113.883 66.360  1.00 19.45  ? 125 HIS A CA  1 
ATOM   1004 C C   . HIS A 1 126 ? 8.116   114.250 66.600  1.00 19.66  ? 125 HIS A C   1 
ATOM   1005 O O   . HIS A 1 126 ? 7.594   115.194 65.990  1.00 18.44  ? 125 HIS A O   1 
ATOM   1006 C CB  . HIS A 1 126 ? 9.705   112.530 65.636  1.00 18.52  ? 125 HIS A CB  1 
ATOM   1007 C CG  . HIS A 1 126 ? 9.036   112.502 64.300  1.00 19.31  ? 125 HIS A CG  1 
ATOM   1008 N ND1 . HIS A 1 126 ? 7.675   112.327 64.150  1.00 18.61  ? 125 HIS A ND1 1 
ATOM   1009 C CD2 . HIS A 1 126 ? 9.539   112.621 63.045  1.00 19.98  ? 125 HIS A CD2 1 
ATOM   1010 C CE1 . HIS A 1 126 ? 7.369   112.340 62.863  1.00 18.91  ? 125 HIS A CE1 1 
ATOM   1011 N NE2 . HIS A 1 126 ? 8.481   112.517 62.169  1.00 18.38  ? 125 HIS A NE2 1 
ATOM   1012 N N   . ARG A 1 127 ? 7.480   113.483 67.490  1.00 20.21  ? 126 ARG A N   1 
ATOM   1013 C CA  . ARG A 1 127 ? 6.119   113.730 67.978  1.00 21.66  ? 126 ARG A CA  1 
ATOM   1014 C C   . ARG A 1 127 ? 4.993   113.468 66.981  1.00 22.20  ? 126 ARG A C   1 
ATOM   1015 O O   . ARG A 1 127 ? 3.899   113.985 67.148  1.00 23.07  ? 126 ARG A O   1 
ATOM   1016 C CB  . ARG A 1 127 ? 5.980   115.135 68.585  1.00 21.00  ? 126 ARG A CB  1 
ATOM   1017 C CG  . ARG A 1 127 ? 6.948   115.375 69.719  1.00 21.87  ? 126 ARG A CG  1 
ATOM   1018 C CD  . ARG A 1 127 ? 6.807   116.688 70.450  1.00 22.31  ? 126 ARG A CD  1 
ATOM   1019 N NE  . ARG A 1 127 ? 6.670   117.817 69.556  1.00 21.09  ? 126 ARG A NE  1 
ATOM   1020 C CZ  . ARG A 1 127 ? 6.337   119.042 69.935  1.00 23.04  ? 126 ARG A CZ  1 
ATOM   1021 N NH1 . ARG A 1 127 ? 6.108   119.319 71.220  1.00 22.49  ? 126 ARG A NH1 1 
ATOM   1022 N NH2 . ARG A 1 127 ? 6.234   119.999 69.014  1.00 22.40  ? 126 ARG A NH2 1 
ATOM   1023 N N   . ASP A 1 128 ? 5.254   112.670 65.961  1.00 22.78  ? 127 ASP A N   1 
ATOM   1024 C CA  . ASP A 1 128 ? 4.220   112.252 65.034  1.00 24.59  ? 127 ASP A CA  1 
ATOM   1025 C C   . ASP A 1 128 ? 4.652   111.027 64.245  1.00 24.76  ? 127 ASP A C   1 
ATOM   1026 O O   . ASP A 1 128 ? 4.450   110.955 63.027  1.00 24.70  ? 127 ASP A O   1 
ATOM   1027 C CB  . ASP A 1 128 ? 3.798   113.379 64.082  1.00 25.65  ? 127 ASP A CB  1 
ATOM   1028 C CG  . ASP A 1 128 ? 2.311   113.289 63.689  1.00 29.42  ? 127 ASP A CG  1 
ATOM   1029 O OD1 . ASP A 1 128 ? 1.505   112.732 64.469  1.00 33.34  ? 127 ASP A OD1 1 
ATOM   1030 O OD2 . ASP A 1 128 ? 1.853   113.737 62.618  1.00 31.88  ? 127 ASP A OD2 1 
ATOM   1031 N N   . LEU A 1 129 ? 5.258   110.069 64.943  1.00 24.86  ? 128 LEU A N   1 
ATOM   1032 C CA  . LEU A 1 129 ? 5.583   108.794 64.323  1.00 25.40  ? 128 LEU A CA  1 
ATOM   1033 C C   . LEU A 1 129 ? 4.277   108.029 64.137  1.00 25.58  ? 128 LEU A C   1 
ATOM   1034 O O   . LEU A 1 129 ? 3.498   107.858 65.093  1.00 25.61  ? 128 LEU A O   1 
ATOM   1035 C CB  . LEU A 1 129 ? 6.574   107.990 65.176  1.00 25.21  ? 128 LEU A CB  1 
ATOM   1036 C CG  . LEU A 1 129 ? 7.919   108.665 65.472  1.00 26.57  ? 128 LEU A CG  1 
ATOM   1037 C CD1 . LEU A 1 129 ? 8.702   107.860 66.481  1.00 26.18  ? 128 LEU A CD1 1 
ATOM   1038 C CD2 . LEU A 1 129 ? 8.720   108.838 64.185  1.00 27.57  ? 128 LEU A CD2 1 
ATOM   1039 N N   . LYS A 1 130 ? 4.036   107.621 62.894  1.00 25.15  ? 129 LYS A N   1 
ATOM   1040 C CA  . LYS A 1 130 ? 2.875   106.840 62.494  1.00 24.67  ? 129 LYS A CA  1 
ATOM   1041 C C   . LYS A 1 130 ? 3.275   106.377 61.120  1.00 24.41  ? 129 LYS A C   1 
ATOM   1042 O O   . LYS A 1 130 ? 4.150   106.989 60.521  1.00 24.29  ? 129 LYS A O   1 
ATOM   1043 C CB  . LYS A 1 130 ? 1.628   107.717 62.436  1.00 25.06  ? 129 LYS A CB  1 
ATOM   1044 C CG  . LYS A 1 130 ? 1.691   108.816 61.400  1.00 25.54  ? 129 LYS A CG  1 
ATOM   1045 C CD  . LYS A 1 130 ? 0.470   109.662 61.476  1.00 27.63  ? 129 LYS A CD  1 
ATOM   1046 C CE  . LYS A 1 130 ? 0.531   110.756 60.439  1.00 30.32  ? 129 LYS A CE  1 
ATOM   1047 N NZ  . LYS A 1 130 ? -0.576  111.723 60.704  1.00 34.72  ? 129 LYS A NZ  1 
ATOM   1048 N N   . PRO A 1 131 ? 2.692   105.294 60.612  1.00 24.31  ? 130 PRO A N   1 
ATOM   1049 C CA  . PRO A 1 131 ? 3.214   104.676 59.374  1.00 24.33  ? 130 PRO A CA  1 
ATOM   1050 C C   . PRO A 1 131 ? 3.142   105.555 58.115  1.00 24.64  ? 130 PRO A C   1 
ATOM   1051 O O   . PRO A 1 131 ? 3.908   105.311 57.189  1.00 24.79  ? 130 PRO A O   1 
ATOM   1052 C CB  . PRO A 1 131 ? 2.357   103.414 59.211  1.00 24.24  ? 130 PRO A CB  1 
ATOM   1053 C CG  . PRO A 1 131 ? 1.734   103.201 60.574  1.00 23.31  ? 130 PRO A CG  1 
ATOM   1054 C CD  . PRO A 1 131 ? 1.530   104.569 61.153  1.00 23.76  ? 130 PRO A CD  1 
ATOM   1055 N N   . GLN A 1 132 ? 2.252   106.543 58.080  1.00 25.20  ? 131 GLN A N   1 
ATOM   1056 C CA  . GLN A 1 132 ? 2.159   107.477 56.954  1.00 25.93  ? 131 GLN A CA  1 
ATOM   1057 C C   . GLN A 1 132 ? 3.405   108.373 56.881  1.00 25.93  ? 131 GLN A C   1 
ATOM   1058 O O   . GLN A 1 132 ? 3.798   108.810 55.791  1.00 25.60  ? 131 GLN A O   1 
ATOM   1059 C CB  . GLN A 1 132 ? 0.894   108.352 57.058  1.00 26.78  ? 131 GLN A CB  1 
ATOM   1060 C CG  . GLN A 1 132 ? -0.436  107.590 57.162  1.00 29.58  ? 131 GLN A CG  1 
ATOM   1061 C CD  . GLN A 1 132 ? -0.869  107.366 58.624  1.00 32.60  ? 131 GLN A CD  1 
ATOM   1062 O OE1 . GLN A 1 132 ? -1.422  108.266 59.239  1.00 37.88  ? 131 GLN A OE1 1 
ATOM   1063 N NE2 . GLN A 1 132 ? -0.615  106.185 59.163  1.00 30.54  ? 131 GLN A NE2 1 
ATOM   1064 N N   . ASN A 1 133 ? 4.039   108.624 58.033  1.00 25.45  ? 132 ASN A N   1 
ATOM   1065 C CA  . ASN A 1 133 ? 5.266   109.431 58.070  1.00 25.20  ? 132 ASN A CA  1 
ATOM   1066 C C   . ASN A 1 133 ? 6.554   108.652 57.935  1.00 25.02  ? 132 ASN A C   1 
ATOM   1067 O O   . ASN A 1 133 ? 7.640   109.183 58.154  1.00 25.46  ? 132 ASN A O   1 
ATOM   1068 C CB  . ASN A 1 133 ? 5.311   110.327 59.312  1.00 24.80  ? 132 ASN A CB  1 
ATOM   1069 C CG  . ASN A 1 133 ? 4.291   111.414 59.244  1.00 24.31  ? 132 ASN A CG  1 
ATOM   1070 O OD1 . ASN A 1 133 ? 3.777   111.695 58.175  1.00 22.77  ? 132 ASN A OD1 1 
ATOM   1071 N ND2 . ASN A 1 133 ? 3.960   112.015 60.383  1.00 24.02  ? 132 ASN A ND2 1 
ATOM   1072 N N   . LEU A 1 134 ? 6.449   107.393 57.559  1.00 24.84  ? 133 LEU A N   1 
ATOM   1073 C CA  . LEU A 1 134 ? 7.642   106.583 57.455  1.00 24.48  ? 133 LEU A CA  1 
ATOM   1074 C C   . LEU A 1 134 ? 7.775   106.156 56.020  1.00 25.12  ? 133 LEU A C   1 
ATOM   1075 O O   . LEU A 1 134 ? 6.961   105.388 55.511  1.00 25.75  ? 133 LEU A O   1 
ATOM   1076 C CB  . LEU A 1 134 ? 7.560   105.383 58.411  1.00 23.92  ? 133 LEU A CB  1 
ATOM   1077 C CG  . LEU A 1 134 ? 7.340   105.666 59.905  1.00 21.57  ? 133 LEU A CG  1 
ATOM   1078 C CD1 . LEU A 1 134 ? 7.237   104.353 60.686  1.00 18.53  ? 133 LEU A CD1 1 
ATOM   1079 C CD2 . LEU A 1 134 ? 8.461   106.564 60.486  1.00 18.56  ? 133 LEU A CD2 1 
ATOM   1080 N N   . LEU A 1 135 ? 8.799   106.665 55.354  1.00 25.53  ? 134 LEU A N   1 
ATOM   1081 C CA  . LEU A 1 135 ? 8.941   106.425 53.922  1.00 25.54  ? 134 LEU A CA  1 
ATOM   1082 C C   . LEU A 1 135 ? 9.944   105.300 53.628  1.00 25.60  ? 134 LEU A C   1 
ATOM   1083 O O   . LEU A 1 135 ? 10.906  105.101 54.367  1.00 26.13  ? 134 LEU A O   1 
ATOM   1084 C CB  . LEU A 1 135 ? 9.278   107.719 53.192  1.00 25.02  ? 134 LEU A CB  1 
ATOM   1085 C CG  . LEU A 1 135 ? 8.270   108.870 53.381  1.00 25.86  ? 134 LEU A CG  1 
ATOM   1086 C CD1 . LEU A 1 135 ? 8.779   110.129 52.723  1.00 24.85  ? 134 LEU A CD1 1 
ATOM   1087 C CD2 . LEU A 1 135 ? 6.874   108.557 52.857  1.00 25.58  ? 134 LEU A CD2 1 
ATOM   1088 N N   . ILE A 1 136 ? 9.684   104.561 52.557  1.00 25.38  ? 135 ILE A N   1 
ATOM   1089 C CA  . ILE A 1 136 ? 10.461  103.389 52.208  1.00 25.95  ? 135 ILE A CA  1 
ATOM   1090 C C   . ILE A 1 136 ? 10.922  103.522 50.757  1.00 26.08  ? 135 ILE A C   1 
ATOM   1091 O O   . ILE A 1 136 ? 10.200  104.042 49.925  1.00 25.25  ? 135 ILE A O   1 
ATOM   1092 C CB  . ILE A 1 136 ? 9.625   102.081 52.420  1.00 26.22  ? 135 ILE A CB  1 
ATOM   1093 C CG1 . ILE A 1 136 ? 8.363   102.079 51.558  1.00 27.18  ? 135 ILE A CG1 1 
ATOM   1094 C CG2 . ILE A 1 136 ? 9.232   101.896 53.883  1.00 24.16  ? 135 ILE A CG2 1 
ATOM   1095 C CD1 . ILE A 1 136 ? 7.521   100.808 51.702  1.00 31.02  ? 135 ILE A CD1 1 
ATOM   1096 N N   . ASN A 1 137 ? 12.137  103.088 50.458  1.00 26.67  ? 136 ASN A N   1 
ATOM   1097 C CA  . ASN A 1 137 ? 12.595  103.115 49.074  1.00 27.61  ? 136 ASN A CA  1 
ATOM   1098 C C   . ASN A 1 137 ? 12.712  101.691 48.517  1.00 29.04  ? 136 ASN A C   1 
ATOM   1099 O O   . ASN A 1 137 ? 12.436  100.719 49.224  1.00 29.01  ? 136 ASN A O   1 
ATOM   1100 C CB  . ASN A 1 137 ? 13.907  103.905 48.938  1.00 26.97  ? 136 ASN A CB  1 
ATOM   1101 C CG  . ASN A 1 137 ? 15.105  103.197 49.568  1.00 26.55  ? 136 ASN A CG  1 
ATOM   1102 O OD1 . ASN A 1 137 ? 15.077  101.992 49.853  1.00 26.23  ? 136 ASN A OD1 1 
ATOM   1103 N ND2 . ASN A 1 137 ? 16.161  103.954 49.794  1.00 25.47  ? 136 ASN A ND2 1 
ATOM   1104 N N   . THR A 1 138 ? 13.154  101.558 47.274  1.00 30.55  ? 137 THR A N   1 
ATOM   1105 C CA  . THR A 1 138 ? 13.258  100.229 46.674  1.00 32.43  ? 137 THR A CA  1 
ATOM   1106 C C   . THR A 1 138 ? 14.479  99.435  47.134  1.00 33.19  ? 137 THR A C   1 
ATOM   1107 O O   . THR A 1 138 ? 14.616  98.280  46.751  1.00 34.38  ? 137 THR A O   1 
ATOM   1108 C CB  . THR A 1 138 ? 13.267  100.314 45.145  1.00 32.54  ? 137 THR A CB  1 
ATOM   1109 O OG1 . THR A 1 138 ? 14.284  101.237 44.732  1.00 32.82  ? 137 THR A OG1 1 
ATOM   1110 C CG2 . THR A 1 138 ? 11.950  100.917 44.628  1.00 33.11  ? 137 THR A CG2 1 
ATOM   1111 N N   . GLU A 1 139 ? 15.356  100.048 47.932  1.00 33.44  ? 138 GLU A N   1 
ATOM   1112 C CA  . GLU A 1 139 ? 16.552  99.376  48.458  1.00 33.74  ? 138 GLU A CA  1 
ATOM   1113 C C   . GLU A 1 139 ? 16.291  98.739  49.819  1.00 32.74  ? 138 GLU A C   1 
ATOM   1114 O O   . GLU A 1 139 ? 17.150  98.051  50.365  1.00 33.22  ? 138 GLU A O   1 
ATOM   1115 C CB  . GLU A 1 139 ? 17.730  100.355 48.593  1.00 34.48  ? 138 GLU A CB  1 
ATOM   1116 C CG  . GLU A 1 139 ? 18.316  100.840 47.278  1.00 38.24  ? 138 GLU A CG  1 
ATOM   1117 C CD  . GLU A 1 139 ? 18.979  99.723  46.500  1.00 44.58  ? 138 GLU A CD  1 
ATOM   1118 O OE1 . GLU A 1 139 ? 20.212  99.514  46.654  1.00 47.29  ? 138 GLU A OE1 1 
ATOM   1119 O OE2 . GLU A 1 139 ? 18.257  99.042  45.742  1.00 47.20  ? 138 GLU A OE2 1 
ATOM   1120 N N   . GLY A 1 140 ? 15.110  98.971  50.373  1.00 31.37  ? 139 GLY A N   1 
ATOM   1121 C CA  . GLY A 1 140 ? 14.778  98.421  51.672  1.00 29.20  ? 139 GLY A CA  1 
ATOM   1122 C C   . GLY A 1 140 ? 15.112  99.345  52.825  1.00 27.57  ? 139 GLY A C   1 
ATOM   1123 O O   . GLY A 1 140 ? 14.986  98.961  53.990  1.00 27.05  ? 139 GLY A O   1 
ATOM   1124 N N   . ALA A 1 141 ? 15.546  100.565 52.517  1.00 26.11  ? 140 ALA A N   1 
ATOM   1125 C CA  . ALA A 1 141 ? 15.648  101.574 53.568  1.00 24.98  ? 140 ALA A CA  1 
ATOM   1126 C C   . ALA A 1 141 ? 14.250  102.039 53.989  1.00 23.66  ? 140 ALA A C   1 
ATOM   1127 O O   . ALA A 1 141 ? 13.325  102.031 53.188  1.00 23.93  ? 140 ALA A O   1 
ATOM   1128 C CB  . ALA A 1 141 ? 16.491  102.744 53.123  1.00 24.90  ? 140 ALA A CB  1 
ATOM   1129 N N   . ILE A 1 142 ? 14.103  102.377 55.262  1.00 22.27  ? 141 ILE A N   1 
ATOM   1130 C CA  . ILE A 1 142 ? 12.954  103.095 55.761  1.00 21.60  ? 141 ILE A CA  1 
ATOM   1131 C C   . ILE A 1 142 ? 13.486  104.308 56.534  1.00 21.86  ? 141 ILE A C   1 
ATOM   1132 O O   . ILE A 1 142 ? 14.505  104.211 57.232  1.00 21.19  ? 141 ILE A O   1 
ATOM   1133 C CB  . ILE A 1 142 ? 12.038  102.192 56.661  1.00 21.74  ? 141 ILE A CB  1 
ATOM   1134 C CG1 . ILE A 1 142 ? 10.748  102.939 57.049  1.00 19.43  ? 141 ILE A CG1 1 
ATOM   1135 C CG2 . ILE A 1 142 ? 12.794  101.700 57.897  1.00 20.69  ? 141 ILE A CG2 1 
ATOM   1136 C CD1 . ILE A 1 142 ? 9.631   102.038 57.593  1.00 18.35  ? 141 ILE A CD1 1 
ATOM   1137 N N   . LYS A 1 143 ? 12.785  105.435 56.408  1.00 21.59  ? 142 LYS A N   1 
ATOM   1138 C CA  . LYS A 1 143 ? 13.233  106.688 56.995  1.00 22.21  ? 142 LYS A CA  1 
ATOM   1139 C C   . LYS A 1 143 ? 12.124  107.529 57.579  1.00 22.10  ? 142 LYS A C   1 
ATOM   1140 O O   . LYS A 1 143 ? 10.992  107.517 57.078  1.00 21.37  ? 142 LYS A O   1 
ATOM   1141 C CB  . LYS A 1 143 ? 13.946  107.543 55.960  1.00 22.29  ? 142 LYS A CB  1 
ATOM   1142 C CG  . LYS A 1 143 ? 14.565  106.781 54.858  1.00 23.25  ? 142 LYS A CG  1 
ATOM   1143 C CD  . LYS A 1 143 ? 15.973  107.191 54.712  1.00 24.91  ? 142 LYS A CD  1 
ATOM   1144 C CE  . LYS A 1 143 ? 16.281  107.472 53.287  1.00 25.36  ? 142 LYS A CE  1 
ATOM   1145 N NZ  . LYS A 1 143 ? 17.664  107.061 52.959  1.00 24.51  ? 142 LYS A NZ  1 
ATOM   1146 N N   . LEU A 1 144 ? 12.487  108.296 58.610  1.00 21.91  ? 143 LEU A N   1 
ATOM   1147 C CA  . LEU A 1 144 ? 11.564  109.204 59.263  1.00 22.24  ? 143 LEU A CA  1 
ATOM   1148 C C   . LEU A 1 144 ? 11.327  110.453 58.407  1.00 22.73  ? 143 LEU A C   1 
ATOM   1149 O O   . LEU A 1 144 ? 12.276  111.062 57.892  1.00 22.00  ? 143 LEU A O   1 
ATOM   1150 C CB  . LEU A 1 144 ? 12.074  109.612 60.646  1.00 22.40  ? 143 LEU A CB  1 
ATOM   1151 C CG  . LEU A 1 144 ? 12.593  108.624 61.703  1.00 24.77  ? 143 LEU A CG  1 
ATOM   1152 C CD1 . LEU A 1 144 ? 12.660  109.306 63.066  1.00 24.15  ? 143 LEU A CD1 1 
ATOM   1153 C CD2 . LEU A 1 144 ? 11.752  107.370 61.800  1.00 26.69  ? 143 LEU A CD2 1 
ATOM   1154 N N   . ALA A 1 145 ? 10.056  110.832 58.276  1.00 22.84  ? 144 ALA A N   1 
ATOM   1155 C CA  . ALA A 1 145 ? 9.685   112.003 57.501  1.00 23.15  ? 144 ALA A CA  1 
ATOM   1156 C C   . ALA A 1 145 ? 8.695   112.827 58.287  1.00 23.36  ? 144 ALA A C   1 
ATOM   1157 O O   . ALA A 1 145 ? 8.229   112.412 59.358  1.00 23.24  ? 144 ALA A O   1 
ATOM   1158 C CB  . ALA A 1 145 ? 9.109   111.605 56.148  1.00 23.02  ? 144 ALA A CB  1 
ATOM   1159 N N   . ASP A 1 146 ? 8.413   114.011 57.750  1.00 23.47  ? 145 ASP A N   1 
ATOM   1160 C CA  . ASP A 1 146 ? 7.558   115.021 58.367  1.00 23.70  ? 145 ASP A CA  1 
ATOM   1161 C C   . ASP A 1 146 ? 7.964   115.418 59.781  1.00 23.81  ? 145 ASP A C   1 
ATOM   1162 O O   . ASP A 1 146 ? 7.427   114.904 60.765  1.00 24.79  ? 145 ASP A O   1 
ATOM   1163 C CB  . ASP A 1 146 ? 6.081   114.635 58.320  1.00 23.97  ? 145 ASP A CB  1 
ATOM   1164 C CG  . ASP A 1 146 ? 5.171   115.840 58.503  1.00 26.18  ? 145 ASP A CG  1 
ATOM   1165 O OD1 . ASP A 1 146 ? 5.706   116.945 58.767  1.00 26.73  ? 145 ASP A OD1 1 
ATOM   1166 O OD2 . ASP A 1 146 ? 3.920   115.776 58.420  1.00 27.14  ? 145 ASP A OD2 1 
ATOM   1167 N N   . PHE A 1 147 ? 8.908   116.348 59.862  1.00 23.35  ? 146 PHE A N   1 
ATOM   1168 C CA  . PHE A 1 147 ? 9.346   116.928 61.113  1.00 22.79  ? 146 PHE A CA  1 
ATOM   1169 C C   . PHE A 1 147 ? 8.574   118.199 61.408  1.00 23.23  ? 146 PHE A C   1 
ATOM   1170 O O   . PHE A 1 147 ? 9.038   119.058 62.147  1.00 23.13  ? 146 PHE A O   1 
ATOM   1171 C CB  . PHE A 1 147 ? 10.857  117.165 61.085  1.00 22.33  ? 146 PHE A CB  1 
ATOM   1172 C CG  . PHE A 1 147 ? 11.652  115.922 61.357  1.00 21.59  ? 146 PHE A CG  1 
ATOM   1173 C CD1 . PHE A 1 147 ? 11.756  114.920 60.395  1.00 19.09  ? 146 PHE A CD1 1 
ATOM   1174 C CD2 . PHE A 1 147 ? 12.256  115.727 62.599  1.00 19.79  ? 146 PHE A CD2 1 
ATOM   1175 C CE1 . PHE A 1 147 ? 12.476  113.752 60.652  1.00 16.65  ? 146 PHE A CE1 1 
ATOM   1176 C CE2 . PHE A 1 147 ? 12.968  114.563 62.859  1.00 18.39  ? 146 PHE A CE2 1 
ATOM   1177 C CZ  . PHE A 1 147 ? 13.078  113.581 61.884  1.00 18.77  ? 146 PHE A CZ  1 
ATOM   1178 N N   . GLY A 1 148 ? 7.372   118.299 60.842  1.00 23.77  ? 147 GLY A N   1 
ATOM   1179 C CA  . GLY A 1 148 ? 6.498   119.433 61.096  1.00 24.06  ? 147 GLY A CA  1 
ATOM   1180 C C   . GLY A 1 148 ? 6.144   119.623 62.559  1.00 24.14  ? 147 GLY A C   1 
ATOM   1181 O O   . GLY A 1 148 ? 6.076   120.748 63.028  1.00 25.21  ? 147 GLY A O   1 
ATOM   1182 N N   . LEU A 1 149 ? 5.945   118.530 63.282  1.00 23.56  ? 148 LEU A N   1 
ATOM   1183 C CA  . LEU A 1 149 ? 5.564   118.597 64.686  1.00 23.84  ? 148 LEU A CA  1 
ATOM   1184 C C   . LEU A 1 149 ? 6.736   118.465 65.665  1.00 23.15  ? 148 LEU A C   1 
ATOM   1185 O O   . LEU A 1 149 ? 6.533   118.478 66.865  1.00 23.01  ? 148 LEU A O   1 
ATOM   1186 C CB  . LEU A 1 149 ? 4.531   117.507 64.979  1.00 24.24  ? 148 LEU A CB  1 
ATOM   1187 C CG  . LEU A 1 149 ? 3.069   117.915 65.193  1.00 27.26  ? 148 LEU A CG  1 
ATOM   1188 C CD1 . LEU A 1 149 ? 2.474   118.710 64.042  1.00 27.35  ? 148 LEU A CD1 1 
ATOM   1189 C CD2 . LEU A 1 149 ? 2.213   116.662 65.469  1.00 29.78  ? 148 LEU A CD2 1 
ATOM   1190 N N   . ALA A 1 150 ? 7.960   118.360 65.157  1.00 23.27  ? 149 ALA A N   1 
ATOM   1191 C CA  . ALA A 1 150 ? 9.120   118.129 66.009  1.00 22.79  ? 149 ALA A CA  1 
ATOM   1192 C C   . ALA A 1 150 ? 9.422   119.340 66.881  1.00 22.99  ? 149 ALA A C   1 
ATOM   1193 O O   . ALA A 1 150 ? 8.906   120.431 66.651  1.00 22.51  ? 149 ALA A O   1 
ATOM   1194 C CB  . ALA A 1 150 ? 10.318  117.764 65.169  1.00 22.64  ? 149 ALA A CB  1 
ATOM   1195 N N   . ARG A 1 151 ? 10.246  119.140 67.900  1.00 23.01  ? 150 ARG A N   1 
ATOM   1196 C CA  . ARG A 1 151 ? 10.802  120.270 68.635  1.00 22.50  ? 150 ARG A CA  1 
ATOM   1197 C C   . ARG A 1 151 ? 12.142  119.951 69.281  1.00 21.76  ? 150 ARG A C   1 
ATOM   1198 O O   . ARG A 1 151 ? 12.429  118.793 69.602  1.00 21.44  ? 150 ARG A O   1 
ATOM   1199 C CB  . ARG A 1 151 ? 9.772   120.895 69.607  1.00 23.28  ? 150 ARG A CB  1 
ATOM   1200 C CG  . ARG A 1 151 ? 9.619   120.284 70.972  1.00 23.58  ? 150 ARG A CG  1 
ATOM   1201 C CD  . ARG A 1 151 ? 9.696   121.329 72.118  1.00 26.10  ? 150 ARG A CD  1 
ATOM   1202 N NE  . ARG A 1 151 ? 8.601   122.312 72.165  1.00 26.60  ? 150 ARG A NE  1 
ATOM   1203 C CZ  . ARG A 1 151 ? 8.742   123.586 72.558  1.00 25.59  ? 150 ARG A CZ  1 
ATOM   1204 N NH1 . ARG A 1 151 ? 9.941   124.041 72.920  1.00 25.65  ? 150 ARG A NH1 1 
ATOM   1205 N NH2 . ARG A 1 151 ? 7.693   124.409 72.598  1.00 21.94  ? 150 ARG A NH2 1 
ATOM   1206 N N   . ALA A 1 152 ? 12.980  120.972 69.429  1.00 20.76  ? 151 ALA A N   1 
ATOM   1207 C CA  . ALA A 1 152 ? 14.235  120.796 70.145  1.00 20.36  ? 151 ALA A CA  1 
ATOM   1208 C C   . ALA A 1 152 ? 13.895  120.758 71.631  1.00 20.40  ? 151 ALA A C   1 
ATOM   1209 O O   . ALA A 1 152 ? 13.269  121.687 72.134  1.00 21.28  ? 151 ALA A O   1 
ATOM   1210 C CB  . ALA A 1 152 ? 15.198  121.927 69.840  1.00 18.52  ? 151 ALA A CB  1 
ATOM   1211 N N   . PHE A 1 153 ? 14.288  119.699 72.325  1.00 20.36  ? 152 PHE A N   1 
ATOM   1212 C CA  . PHE A 1 153 ? 14.062  119.626 73.777  1.00 21.21  ? 152 PHE A CA  1 
ATOM   1213 C C   . PHE A 1 153 ? 15.298  120.001 74.621  1.00 22.00  ? 152 PHE A C   1 
ATOM   1214 O O   . PHE A 1 153 ? 16.411  120.093 74.095  1.00 22.69  ? 152 PHE A O   1 
ATOM   1215 C CB  . PHE A 1 153 ? 13.394  118.287 74.198  1.00 20.42  ? 152 PHE A CB  1 
ATOM   1216 C CG  . PHE A 1 153 ? 14.269  117.048 74.030  1.00 18.25  ? 152 PHE A CG  1 
ATOM   1217 C CD1 . PHE A 1 153 ? 14.314  116.364 72.826  1.00 17.98  ? 152 PHE A CD1 1 
ATOM   1218 C CD2 . PHE A 1 153 ? 14.990  116.544 75.106  1.00 16.57  ? 152 PHE A CD2 1 
ATOM   1219 C CE1 . PHE A 1 153 ? 15.107  115.213 72.678  1.00 16.57  ? 152 PHE A CE1 1 
ATOM   1220 C CE2 . PHE A 1 153 ? 15.773  115.425 74.987  1.00 15.20  ? 152 PHE A CE2 1 
ATOM   1221 C CZ  . PHE A 1 153 ? 15.839  114.750 73.762  1.00 17.70  ? 152 PHE A CZ  1 
ATOM   1222 N N   . GLY A 1 154 ? 15.075  120.312 75.901  1.00 23.08  ? 153 GLY A N   1 
ATOM   1223 C CA  . GLY A 1 154 ? 16.131  120.692 76.834  1.00 23.90  ? 153 GLY A CA  1 
ATOM   1224 C C   . GLY A 1 154 ? 16.324  119.553 77.808  1.00 25.23  ? 153 GLY A C   1 
ATOM   1225 O O   . GLY A 1 154 ? 15.477  118.656 77.879  1.00 24.97  ? 153 GLY A O   1 
ATOM   1226 N N   . VAL A 1 155 ? 17.400  119.537 78.580  1.00 26.43  ? 154 VAL A N   1 
ATOM   1227 C CA  . VAL A 1 155 ? 17.710  118.244 79.161  1.00 28.19  ? 154 VAL A CA  1 
ATOM   1228 C C   . VAL A 1 155 ? 16.817  117.700 80.296  1.00 29.79  ? 154 VAL A C   1 
ATOM   1229 O O   . VAL A 1 155 ? 16.191  116.632 80.083  1.00 31.78  ? 154 VAL A O   1 
ATOM   1230 C CB  . VAL A 1 155 ? 19.198  117.818 79.111  1.00 28.59  ? 154 VAL A CB  1 
ATOM   1231 C CG1 . VAL A 1 155 ? 19.568  116.870 80.261  1.00 28.10  ? 154 VAL A CG1 1 
ATOM   1232 C CG2 . VAL A 1 155 ? 19.435  117.125 77.791  1.00 28.77  ? 154 VAL A CG2 1 
ATOM   1233 N N   . PRO A 1 156 ? 16.644  118.379 81.438  1.00 29.25  ? 155 PRO A N   1 
ATOM   1234 C CA  . PRO A 1 156 ? 15.363  118.158 82.091  1.00 28.71  ? 155 PRO A CA  1 
ATOM   1235 C C   . PRO A 1 156 ? 14.505  118.902 81.076  1.00 28.03  ? 155 PRO A C   1 
ATOM   1236 O O   . PRO A 1 156 ? 14.781  120.076 80.814  1.00 27.49  ? 155 PRO A O   1 
ATOM   1237 C CB  . PRO A 1 156 ? 15.464  118.894 83.436  1.00 28.77  ? 155 PRO A CB  1 
ATOM   1238 C CG  . PRO A 1 156 ? 16.839  119.452 83.529  1.00 29.43  ? 155 PRO A CG  1 
ATOM   1239 C CD  . PRO A 1 156 ? 17.500  119.312 82.187  1.00 29.28  ? 155 PRO A CD  1 
ATOM   1240 N N   . VAL A 1 157 ? 13.568  118.213 80.434  1.00 27.08  ? 156 VAL A N   1 
ATOM   1241 C CA  . VAL A 1 157 ? 12.633  118.891 79.551  1.00 26.66  ? 156 VAL A CA  1 
ATOM   1242 C C   . VAL A 1 157 ? 11.842  119.892 80.393  1.00 26.67  ? 156 VAL A C   1 
ATOM   1243 O O   . VAL A 1 157 ? 11.928  119.897 81.623  1.00 26.89  ? 156 VAL A O   1 
ATOM   1244 C CB  . VAL A 1 157 ? 11.682  117.895 78.848  1.00 26.65  ? 156 VAL A CB  1 
ATOM   1245 C CG1 . VAL A 1 157 ? 12.487  116.859 78.042  1.00 25.35  ? 156 VAL A CG1 1 
ATOM   1246 C CG2 . VAL A 1 157 ? 10.747  117.193 79.871  1.00 26.46  ? 156 VAL A CG2 1 
ATOM   1247 N N   . ARG A 1 158 ? 11.090  120.763 79.744  1.00 26.69  ? 157 ARG A N   1 
ATOM   1248 C CA  . ARG A 1 158 ? 10.039  121.463 80.471  1.00 26.48  ? 157 ARG A CA  1 
ATOM   1249 C C   . ARG A 1 158 ? 8.724   121.115 79.796  1.00 25.82  ? 157 ARG A C   1 
ATOM   1250 O O   . ARG A 1 158 ? 8.688   120.269 78.891  1.00 25.37  ? 157 ARG A O   1 
ATOM   1251 C CB  . ARG A 1 158 ? 10.284  122.975 80.525  1.00 27.14  ? 157 ARG A CB  1 
ATOM   1252 C CG  . ARG A 1 158 ? 10.674  123.595 79.202  1.00 28.44  ? 157 ARG A CG  1 
ATOM   1253 C CD  . ARG A 1 158 ? 10.737  125.104 79.225  1.00 33.78  ? 157 ARG A CD  1 
ATOM   1254 N NE  . ARG A 1 158 ? 10.025  125.637 78.066  1.00 36.94  ? 157 ARG A NE  1 
ATOM   1255 C CZ  . ARG A 1 158 ? 10.592  125.874 76.899  1.00 37.09  ? 157 ARG A CZ  1 
ATOM   1256 N NH1 . ARG A 1 158 ? 11.895  125.656 76.752  1.00 38.27  ? 157 ARG A NH1 1 
ATOM   1257 N NH2 . ARG A 1 158 ? 9.859   126.333 75.888  1.00 36.89  ? 157 ARG A NH2 1 
ATOM   1258 N N   . THR A 1 159 ? 7.652   121.766 80.230  1.00 25.37  ? 158 THR A N   1 
ATOM   1259 C CA  . THR A 1 159 ? 6.342   121.597 79.613  1.00 25.39  ? 158 THR A CA  1 
ATOM   1260 C C   . THR A 1 159 ? 6.351   122.091 78.176  1.00 24.86  ? 158 THR A C   1 
ATOM   1261 O O   . THR A 1 159 ? 6.789   123.205 77.902  1.00 25.26  ? 158 THR A O   1 
ATOM   1262 C CB  . THR A 1 159 ? 5.285   122.328 80.453  1.00 25.46  ? 158 THR A CB  1 
ATOM   1263 O OG1 . THR A 1 159 ? 5.316   121.790 81.785  1.00 26.51  ? 158 THR A OG1 1 
ATOM   1264 C CG2 . THR A 1 159 ? 3.874   121.995 79.973  1.00 24.90  ? 158 THR A CG2 1 
ATOM   1265 N N   . TYR A 1 160 ? 5.891   121.239 77.270  1.00 24.73  ? 159 TYR A N   1 
ATOM   1266 C CA  . TYR A 1 160 ? 5.749   121.573 75.858  1.00 25.10  ? 159 TYR A CA  1 
ATOM   1267 C C   . TYR A 1 160 ? 4.298   121.378 75.457  1.00 25.68  ? 159 TYR A C   1 
ATOM   1268 O O   . TYR A 1 160 ? 3.477   121.005 76.290  1.00 25.81  ? 159 TYR A O   1 
ATOM   1269 C CB  . TYR A 1 160 ? 6.658   120.690 74.982  1.00 24.77  ? 159 TYR A CB  1 
ATOM   1270 C CG  . TYR A 1 160 ? 8.109   120.671 75.399  1.00 23.33  ? 159 TYR A CG  1 
ATOM   1271 C CD1 . TYR A 1 160 ? 8.824   121.855 75.584  1.00 23.30  ? 159 TYR A CD1 1 
ATOM   1272 C CD2 . TYR A 1 160 ? 8.769   119.474 75.596  1.00 23.15  ? 159 TYR A CD2 1 
ATOM   1273 C CE1 . TYR A 1 160 ? 10.159  121.840 75.966  1.00 23.52  ? 159 TYR A CE1 1 
ATOM   1274 C CE2 . TYR A 1 160 ? 10.107  119.449 75.975  1.00 23.71  ? 159 TYR A CE2 1 
ATOM   1275 C CZ  . TYR A 1 160 ? 10.788  120.630 76.159  1.00 23.47  ? 159 TYR A CZ  1 
ATOM   1276 O OH  . TYR A 1 160 ? 12.099  120.591 76.550  1.00 25.66  ? 159 TYR A OH  1 
HETATM 1277 N N   . TPO A 1 161 ? 3.995   121.641 74.187  1.00 26.87  ? 160 TPO A N   1 
HETATM 1278 C CA  . TPO A 1 161 ? 2.648   121.531 73.639  1.00 28.24  ? 160 TPO A CA  1 
HETATM 1279 C CB  . TPO A 1 161 ? 2.735   121.621 72.114  1.00 27.25  ? 160 TPO A CB  1 
HETATM 1280 C CG2 . TPO A 1 161 ? 1.352   121.617 71.475  1.00 26.47  ? 160 TPO A CG2 1 
HETATM 1281 O OG1 . TPO A 1 161 ? 3.371   122.846 71.794  1.00 25.37  ? 160 TPO A OG1 1 
HETATM 1282 P P   . TPO A 1 161 ? 4.801   122.895 71.061  1.00 20.21  ? 160 TPO A P   1 
HETATM 1283 O O1P . TPO A 1 161 ? 5.203   124.414 70.926  1.00 22.82  ? 160 TPO A O1P 1 
HETATM 1284 O O2P . TPO A 1 161 ? 5.823   122.147 72.016  1.00 21.40  ? 160 TPO A O2P 1 
HETATM 1285 O O3P . TPO A 1 161 ? 4.699   122.214 69.640  1.00 21.47  ? 160 TPO A O3P 1 
HETATM 1286 C C   . TPO A 1 161 ? 1.997   120.227 74.035  1.00 29.84  ? 160 TPO A C   1 
HETATM 1287 O O   . TPO A 1 161 ? 2.589   119.177 73.851  1.00 30.08  ? 160 TPO A O   1 
ATOM   1288 N N   . HIS A 1 162 ? 0.790   120.292 74.590  1.00 32.17  ? 161 HIS A N   1 
ATOM   1289 C CA  . HIS A 1 162 ? 0.043   119.076 74.961  1.00 34.59  ? 161 HIS A CA  1 
ATOM   1290 C C   . HIS A 1 162 ? -0.647  118.397 73.777  1.00 34.94  ? 161 HIS A C   1 
ATOM   1291 O O   . HIS A 1 162 ? -0.817  117.177 73.752  1.00 36.02  ? 161 HIS A O   1 
ATOM   1292 C CB  . HIS A 1 162 ? -0.996  119.367 76.051  1.00 35.28  ? 161 HIS A CB  1 
ATOM   1293 C CG  . HIS A 1 162 ? -1.875  118.191 76.367  1.00 39.71  ? 161 HIS A CG  1 
ATOM   1294 N ND1 . HIS A 1 162 ? -3.247  118.218 76.211  1.00 42.60  ? 161 HIS A ND1 1 
ATOM   1295 C CD2 . HIS A 1 162 ? -1.572  116.942 76.805  1.00 41.78  ? 161 HIS A CD2 1 
ATOM   1296 C CE1 . HIS A 1 162 ? -3.750  117.044 76.554  1.00 44.39  ? 161 HIS A CE1 1 
ATOM   1297 N NE2 . HIS A 1 162 ? -2.755  116.252 76.920  1.00 44.62  ? 161 HIS A NE2 1 
ATOM   1298 N N   . GLU A 1 163 ? -1.063  119.189 72.802  1.00 35.54  ? 162 GLU A N   1 
ATOM   1299 C CA  . GLU A 1 163 ? -1.828  118.685 71.668  1.00 36.20  ? 162 GLU A CA  1 
ATOM   1300 C C   . GLU A 1 163 ? -0.895  117.941 70.742  1.00 35.41  ? 162 GLU A C   1 
ATOM   1301 O O   . GLU A 1 163 ? -0.532  118.482 69.682  1.00 35.86  ? 162 GLU A O   1 
ATOM   1302 C CB  . GLU A 1 163 ? -2.452  119.858 70.895  1.00 37.22  ? 162 GLU A CB  1 
ATOM   1303 C CG  . GLU A 1 163 ? -3.571  120.616 71.618  1.00 40.88  ? 162 GLU A CG  1 
ATOM   1304 C CD  . GLU A 1 163 ? -3.142  121.209 72.949  1.00 45.02  ? 162 GLU A CD  1 
ATOM   1305 O OE1 . GLU A 1 163 ? -2.104  121.911 72.991  1.00 46.80  ? 162 GLU A OE1 1 
ATOM   1306 O OE2 . GLU A 1 163 ? -3.849  120.972 73.957  1.00 47.67  ? 162 GLU A OE2 1 
ATOM   1307 N N   . VAL A 1 164 ? -0.504  116.711 71.110  1.00 33.48  ? 163 VAL A N   1 
ATOM   1308 C CA  . VAL A 1 164 ? 0.647   116.100 70.434  1.00 31.43  ? 163 VAL A CA  1 
ATOM   1309 C C   . VAL A 1 164 ? 0.560   114.595 70.141  1.00 29.68  ? 163 VAL A C   1 
ATOM   1310 O O   . VAL A 1 164 ? 0.142   113.812 70.977  1.00 29.51  ? 163 VAL A O   1 
ATOM   1311 C CB  . VAL A 1 164 ? 1.991   116.546 71.128  1.00 31.94  ? 163 VAL A CB  1 
ATOM   1312 C CG1 . VAL A 1 164 ? 2.892   115.384 71.494  1.00 31.33  ? 163 VAL A CG1 1 
ATOM   1313 C CG2 . VAL A 1 164 ? 2.736   117.563 70.260  1.00 32.13  ? 163 VAL A CG2 1 
ATOM   1314 N N   . VAL A 1 165 ? 0.970   114.232 68.924  1.00 27.64  ? 164 VAL A N   1 
ATOM   1315 C CA  . VAL A 1 165 ? 0.961   112.875 68.397  1.00 25.94  ? 164 VAL A CA  1 
ATOM   1316 C C   . VAL A 1 165 ? -0.450  112.493 67.944  1.00 25.80  ? 164 VAL A C   1 
ATOM   1317 O O   . VAL A 1 165 ? -1.416  112.735 68.642  1.00 25.99  ? 164 VAL A O   1 
ATOM   1318 C CB  . VAL A 1 165 ? 1.596   111.812 69.390  1.00 25.80  ? 164 VAL A CB  1 
ATOM   1319 C CG1 . VAL A 1 165 ? 1.807   110.486 68.700  1.00 23.31  ? 164 VAL A CG1 1 
ATOM   1320 C CG2 . VAL A 1 165 ? 2.930   112.312 69.974  1.00 23.90  ? 164 VAL A CG2 1 
ATOM   1321 N N   . THR A 1 166 ? -0.561  111.936 66.750  1.00 25.58  ? 165 THR A N   1 
ATOM   1322 C CA  . THR A 1 166 ? -1.820  111.387 66.256  1.00 25.73  ? 165 THR A CA  1 
ATOM   1323 C C   . THR A 1 166 ? -2.356  110.418 67.287  1.00 25.77  ? 165 THR A C   1 
ATOM   1324 O O   . THR A 1 166 ? -1.598  109.640 67.864  1.00 26.83  ? 165 THR A O   1 
ATOM   1325 C CB  . THR A 1 166 ? -1.553  110.673 64.939  1.00 25.49  ? 165 THR A CB  1 
ATOM   1326 O OG1 . THR A 1 166 ? -1.112  111.652 63.999  1.00 26.55  ? 165 THR A OG1 1 
ATOM   1327 C CG2 . THR A 1 166 ? -2.838  110.125 64.304  1.00 24.87  ? 165 THR A CG2 1 
ATOM   1328 N N   . LEU A 1 167 ? -3.656  110.489 67.536  1.00 25.36  ? 166 LEU A N   1 
ATOM   1329 C CA  . LEU A 1 167 ? -4.285  109.761 68.634  1.00 24.84  ? 166 LEU A CA  1 
ATOM   1330 C C   . LEU A 1 167 ? -3.822  108.309 68.849  1.00 23.95  ? 166 LEU A C   1 
ATOM   1331 O O   . LEU A 1 167 ? -3.477  107.918 69.965  1.00 23.65  ? 166 LEU A O   1 
ATOM   1332 C CB  . LEU A 1 167 ? -5.815  109.806 68.479  1.00 25.18  ? 166 LEU A CB  1 
ATOM   1333 C CG  . LEU A 1 167 ? -6.583  109.395 69.743  1.00 25.93  ? 166 LEU A CG  1 
ATOM   1334 C CD1 . LEU A 1 167 ? -6.069  110.120 70.989  1.00 25.08  ? 166 LEU A CD1 1 
ATOM   1335 C CD2 . LEU A 1 167 ? -8.063  109.652 69.537  1.00 25.82  ? 166 LEU A CD2 1 
ATOM   1336 N N   . TRP A 1 168 ? -3.831  107.526 67.779  1.00 23.13  ? 167 TRP A N   1 
ATOM   1337 C CA  . TRP A 1 168 ? -3.604  106.082 67.859  1.00 22.93  ? 167 TRP A CA  1 
ATOM   1338 C C   . TRP A 1 168 ? -2.215  105.729 68.357  1.00 22.16  ? 167 TRP A C   1 
ATOM   1339 O O   . TRP A 1 168 ? -1.977  104.597 68.807  1.00 22.38  ? 167 TRP A O   1 
ATOM   1340 C CB  . TRP A 1 168 ? -3.798  105.441 66.479  1.00 22.78  ? 167 TRP A CB  1 
ATOM   1341 C CG  . TRP A 1 168 ? -5.203  105.441 66.006  1.00 23.80  ? 167 TRP A CG  1 
ATOM   1342 C CD1 . TRP A 1 168 ? -6.299  105.932 66.666  1.00 22.88  ? 167 TRP A CD1 1 
ATOM   1343 C CD2 . TRP A 1 168 ? -5.684  104.934 64.757  1.00 24.06  ? 167 TRP A CD2 1 
ATOM   1344 N NE1 . TRP A 1 168 ? -7.427  105.758 65.900  1.00 23.89  ? 167 TRP A NE1 1 
ATOM   1345 C CE2 . TRP A 1 168 ? -7.082  105.144 64.726  1.00 24.48  ? 167 TRP A CE2 1 
ATOM   1346 C CE3 . TRP A 1 168 ? -5.080  104.299 63.664  1.00 24.68  ? 167 TRP A CE3 1 
ATOM   1347 C CZ2 . TRP A 1 168 ? -7.884  104.755 63.638  1.00 25.15  ? 167 TRP A CZ2 1 
ATOM   1348 C CZ3 . TRP A 1 168 ? -5.876  103.916 62.581  1.00 24.89  ? 167 TRP A CZ3 1 
ATOM   1349 C CH2 . TRP A 1 168 ? -7.263  104.143 62.582  1.00 23.78  ? 167 TRP A CH2 1 
ATOM   1350 N N   . TYR A 1 169 ? -1.307  106.701 68.260  1.00 21.18  ? 168 TYR A N   1 
ATOM   1351 C CA  . TYR A 1 169 ? 0.104   106.472 68.503  1.00 20.12  ? 168 TYR A CA  1 
ATOM   1352 C C   . TYR A 1 169 ? 0.532   107.297 69.695  1.00 20.07  ? 168 TYR A C   1 
ATOM   1353 O O   . TYR A 1 169 ? 1.708   107.344 70.038  1.00 19.97  ? 168 TYR A O   1 
ATOM   1354 C CB  . TYR A 1 169 ? 0.919   106.775 67.223  1.00 19.91  ? 168 TYR A CB  1 
ATOM   1355 C CG  . TYR A 1 169 ? 0.409   105.980 66.034  1.00 18.70  ? 168 TYR A CG  1 
ATOM   1356 C CD1 . TYR A 1 169 ? 0.745   104.648 65.885  1.00 18.91  ? 168 TYR A CD1 1 
ATOM   1357 C CD2 . TYR A 1 169 ? -0.458  106.552 65.093  1.00 17.74  ? 168 TYR A CD2 1 
ATOM   1358 C CE1 . TYR A 1 169 ? 0.252   103.902 64.844  1.00 19.43  ? 168 TYR A CE1 1 
ATOM   1359 C CE2 . TYR A 1 169 ? -0.965  105.809 64.040  1.00 16.47  ? 168 TYR A CE2 1 
ATOM   1360 C CZ  . TYR A 1 169 ? -0.602  104.486 63.918  1.00 19.54  ? 168 TYR A CZ  1 
ATOM   1361 O OH  . TYR A 1 169 ? -1.074  103.712 62.875  1.00 20.76  ? 168 TYR A OH  1 
ATOM   1362 N N   . ARG A 1 170 ? -0.446  107.934 70.334  1.00 19.89  ? 169 ARG A N   1 
ATOM   1363 C CA  . ARG A 1 170 ? -0.194  108.841 71.451  1.00 19.81  ? 169 ARG A CA  1 
ATOM   1364 C C   . ARG A 1 170 ? 0.003   108.082 72.758  1.00 20.23  ? 169 ARG A C   1 
ATOM   1365 O O   . ARG A 1 170 ? -0.791  107.198 73.087  1.00 20.70  ? 169 ARG A O   1 
ATOM   1366 C CB  . ARG A 1 170 ? -1.337  109.843 71.589  1.00 19.21  ? 169 ARG A CB  1 
ATOM   1367 C CG  . ARG A 1 170 ? -1.183  110.796 72.748  1.00 20.09  ? 169 ARG A CG  1 
ATOM   1368 C CD  . ARG A 1 170 ? -2.177  111.950 72.767  1.00 19.06  ? 169 ARG A CD  1 
ATOM   1369 N NE  . ARG A 1 170 ? -2.523  112.420 71.431  1.00 18.89  ? 169 ARG A NE  1 
ATOM   1370 C CZ  . ARG A 1 170 ? -3.636  113.087 71.133  1.00 18.11  ? 169 ARG A CZ  1 
ATOM   1371 N NH1 . ARG A 1 170 ? -4.528  113.363 72.079  1.00 17.67  ? 169 ARG A NH1 1 
ATOM   1372 N NH2 . ARG A 1 170 ? -3.858  113.466 69.886  1.00 12.85  ? 169 ARG A NH2 1 
ATOM   1373 N N   . ALA A 1 171 ? 1.050   108.447 73.499  1.00 19.93  ? 170 ALA A N   1 
ATOM   1374 C CA  . ALA A 1 171 ? 1.419   107.763 74.733  1.00 20.35  ? 170 ALA A CA  1 
ATOM   1375 C C   . ALA A 1 171 ? 0.533   108.121 75.932  1.00 20.94  ? 170 ALA A C   1 
ATOM   1376 O O   . ALA A 1 171 ? 0.021   109.228 76.012  1.00 21.01  ? 170 ALA A O   1 
ATOM   1377 C CB  . ALA A 1 171 ? 2.911   108.023 75.069  1.00 19.69  ? 170 ALA A CB  1 
ATOM   1378 N N   . PRO A 1 172 ? 0.418   107.208 76.907  1.00 21.66  ? 171 PRO A N   1 
ATOM   1379 C CA  . PRO A 1 172 ? -0.465  107.436 78.060  1.00 21.42  ? 171 PRO A CA  1 
ATOM   1380 C C   . PRO A 1 172 ? -0.078  108.638 78.894  1.00 21.62  ? 171 PRO A C   1 
ATOM   1381 O O   . PRO A 1 172 ? -0.971  109.303 79.409  1.00 21.69  ? 171 PRO A O   1 
ATOM   1382 C CB  . PRO A 1 172 ? -0.353  106.135 78.875  1.00 21.69  ? 171 PRO A CB  1 
ATOM   1383 C CG  . PRO A 1 172 ? 0.885   105.458 78.393  1.00 21.27  ? 171 PRO A CG  1 
ATOM   1384 C CD  . PRO A 1 172 ? 1.133   105.917 76.994  1.00 20.99  ? 171 PRO A CD  1 
ATOM   1385 N N   . GLU A 1 173 ? 1.208   108.952 79.015  1.00 21.98  ? 172 GLU A N   1 
ATOM   1386 C CA  . GLU A 1 173 ? 1.583   110.147 79.766  1.00 22.20  ? 172 GLU A CA  1 
ATOM   1387 C C   . GLU A 1 173 ? 1.057   111.439 79.138  1.00 22.43  ? 172 GLU A C   1 
ATOM   1388 O O   . GLU A 1 173 ? 0.789   112.411 79.841  1.00 22.65  ? 172 GLU A O   1 
ATOM   1389 C CB  . GLU A 1 173 ? 3.095   110.199 80.058  1.00 22.65  ? 172 GLU A CB  1 
ATOM   1390 C CG  . GLU A 1 173 ? 4.010   110.308 78.848  1.00 23.32  ? 172 GLU A CG  1 
ATOM   1391 C CD  . GLU A 1 173 ? 4.407   108.970 78.260  1.00 24.78  ? 172 GLU A CD  1 
ATOM   1392 O OE1 . GLU A 1 173 ? 5.487   108.910 77.632  1.00 25.25  ? 172 GLU A OE1 1 
ATOM   1393 O OE2 . GLU A 1 173 ? 3.649   107.975 78.406  1.00 25.76  ? 172 GLU A OE2 1 
ATOM   1394 N N   . ILE A 1 174 ? 0.886   111.451 77.820  1.00 22.91  ? 173 ILE A N   1 
ATOM   1395 C CA  . ILE A 1 174 ? 0.302   112.612 77.146  1.00 23.00  ? 173 ILE A CA  1 
ATOM   1396 C C   . ILE A 1 174 ? -1.200  112.568 77.368  1.00 23.57  ? 173 ILE A C   1 
ATOM   1397 O O   . ILE A 1 174 ? -1.811  113.578 77.749  1.00 23.35  ? 173 ILE A O   1 
ATOM   1398 C CB  . ILE A 1 174 ? 0.624   112.616 75.635  1.00 23.20  ? 173 ILE A CB  1 
ATOM   1399 C CG1 . ILE A 1 174 ? 2.136   112.694 75.413  1.00 23.36  ? 173 ILE A CG1 1 
ATOM   1400 C CG2 . ILE A 1 174 ? -0.106  113.791 74.924  1.00 22.16  ? 173 ILE A CG2 1 
ATOM   1401 C CD1 . ILE A 1 174 ? 2.563   112.452 73.971  1.00 21.79  ? 173 ILE A CD1 1 
ATOM   1402 N N   . LEU A 1 175 ? -1.776  111.386 77.147  1.00 23.25  ? 174 LEU A N   1 
ATOM   1403 C CA  . LEU A 1 175 ? -3.183  111.148 77.430  1.00 24.29  ? 174 LEU A CA  1 
ATOM   1404 C C   . LEU A 1 175 ? -3.597  111.521 78.868  1.00 24.90  ? 174 LEU A C   1 
ATOM   1405 O O   . LEU A 1 175 ? -4.662  112.078 79.072  1.00 24.92  ? 174 LEU A O   1 
ATOM   1406 C CB  . LEU A 1 175 ? -3.550  109.697 77.113  1.00 23.92  ? 174 LEU A CB  1 
ATOM   1407 C CG  . LEU A 1 175 ? -3.582  109.370 75.618  1.00 23.25  ? 174 LEU A CG  1 
ATOM   1408 C CD1 . LEU A 1 175 ? -3.530  107.892 75.400  1.00 22.44  ? 174 LEU A CD1 1 
ATOM   1409 C CD2 . LEU A 1 175 ? -4.810  109.982 74.936  1.00 21.64  ? 174 LEU A CD2 1 
ATOM   1410 N N   . LEU A 1 176 ? -2.745  111.233 79.846  1.00 25.41  ? 175 LEU A N   1 
ATOM   1411 C CA  . LEU A 1 176 ? -3.027  111.576 81.238  1.00 26.42  ? 175 LEU A CA  1 
ATOM   1412 C C   . LEU A 1 176 ? -2.542  112.988 81.599  1.00 27.68  ? 175 LEU A C   1 
ATOM   1413 O O   . LEU A 1 176 ? -2.463  113.357 82.774  1.00 27.43  ? 175 LEU A O   1 
ATOM   1414 C CB  . LEU A 1 176 ? -2.420  110.527 82.171  1.00 25.92  ? 175 LEU A CB  1 
ATOM   1415 C CG  . LEU A 1 176 ? -3.045  109.130 82.042  1.00 25.52  ? 175 LEU A CG  1 
ATOM   1416 C CD1 . LEU A 1 176 ? -2.217  108.095 82.761  1.00 23.18  ? 175 LEU A CD1 1 
ATOM   1417 C CD2 . LEU A 1 176 ? -4.488  109.117 82.574  1.00 24.50  ? 175 LEU A CD2 1 
ATOM   1418 N N   . GLY A 1 177 ? -2.204  113.758 80.565  1.00 29.20  ? 176 GLY A N   1 
ATOM   1419 C CA  . GLY A 1 177 ? -1.798  115.142 80.700  1.00 30.82  ? 176 GLY A CA  1 
ATOM   1420 C C   . GLY A 1 177 ? -0.670  115.423 81.664  1.00 32.10  ? 176 GLY A C   1 
ATOM   1421 O O   . GLY A 1 177 ? -0.753  116.399 82.407  1.00 32.35  ? 176 GLY A O   1 
ATOM   1422 N N   . CYS A 1 178 ? 0.380   114.601 81.662  1.00 33.38  ? 177 CYS A N   1 
ATOM   1423 C CA  . CYS A 1 178 ? 1.557   114.880 82.496  1.00 35.28  ? 177 CYS A CA  1 
ATOM   1424 C C   . CYS A 1 178 ? 2.146   116.256 82.187  1.00 34.88  ? 177 CYS A C   1 
ATOM   1425 O O   . CYS A 1 178 ? 2.056   116.762 81.058  1.00 34.78  ? 177 CYS A O   1 
ATOM   1426 C CB  . CYS A 1 178 ? 2.648   113.804 82.331  1.00 35.93  ? 177 CYS A CB  1 
ATOM   1427 S SG  . CYS A 1 178 ? 4.127   114.020 83.388  1.00 43.65  ? 177 CYS A SG  1 
ATOM   1428 N N   . LYS A 1 179 ? 2.750   116.851 83.208  1.00 35.03  ? 178 LYS A N   1 
ATOM   1429 C CA  . LYS A 1 179 ? 3.394   118.153 83.099  1.00 35.10  ? 178 LYS A CA  1 
ATOM   1430 C C   . LYS A 1 179 ? 4.557   118.083 82.094  1.00 34.19  ? 178 LYS A C   1 
ATOM   1431 O O   . LYS A 1 179 ? 4.837   119.043 81.375  1.00 34.01  ? 178 LYS A O   1 
ATOM   1432 C CB  . LYS A 1 179 ? 3.907   118.559 84.489  1.00 35.47  ? 178 LYS A CB  1 
ATOM   1433 C CG  . LYS A 1 179 ? 4.220   120.036 84.649  1.00 37.98  ? 178 LYS A CG  1 
ATOM   1434 C CD  . LYS A 1 179 ? 4.426   120.398 86.118  1.00 41.32  ? 178 LYS A CD  1 
ATOM   1435 C CE  . LYS A 1 179 ? 5.350   121.613 86.251  1.00 44.62  ? 178 LYS A CE  1 
ATOM   1436 N NZ  . LYS A 1 179 ? 4.687   122.805 86.872  1.00 45.64  ? 178 LYS A NZ  1 
ATOM   1437 N N   . TYR A 1 180 ? 5.195   116.915 82.051  1.00 33.18  ? 179 TYR A N   1 
ATOM   1438 C CA  . TYR A 1 180 ? 6.455   116.701 81.358  1.00 32.45  ? 179 TYR A CA  1 
ATOM   1439 C C   . TYR A 1 180 ? 6.403   115.412 80.574  1.00 30.62  ? 179 TYR A C   1 
ATOM   1440 O O   . TYR A 1 180 ? 6.004   114.375 81.088  1.00 30.95  ? 179 TYR A O   1 
ATOM   1441 C CB  . TYR A 1 180 ? 7.595   116.565 82.369  1.00 33.17  ? 179 TYR A CB  1 
ATOM   1442 C CG  . TYR A 1 180 ? 7.841   117.766 83.266  1.00 36.77  ? 179 TYR A CG  1 
ATOM   1443 C CD1 . TYR A 1 180 ? 8.039   119.041 82.735  1.00 39.01  ? 179 TYR A CD1 1 
ATOM   1444 C CD2 . TYR A 1 180 ? 7.909   117.612 84.658  1.00 40.75  ? 179 TYR A CD2 1 
ATOM   1445 C CE1 . TYR A 1 180 ? 8.279   120.143 83.571  1.00 41.83  ? 179 TYR A CE1 1 
ATOM   1446 C CE2 . TYR A 1 180 ? 8.153   118.710 85.505  1.00 42.70  ? 179 TYR A CE2 1 
ATOM   1447 C CZ  . TYR A 1 180 ? 8.334   119.966 84.951  1.00 43.71  ? 179 TYR A CZ  1 
ATOM   1448 O OH  . TYR A 1 180 ? 8.580   121.045 85.778  1.00 47.15  ? 179 TYR A OH  1 
ATOM   1449 N N   . TYR A 1 181 ? 6.806   115.477 79.321  1.00 28.45  ? 180 TYR A N   1 
ATOM   1450 C CA  . TYR A 1 181 ? 7.027   114.266 78.552  1.00 26.29  ? 180 TYR A CA  1 
ATOM   1451 C C   . TYR A 1 181 ? 8.346   114.401 77.790  1.00 25.28  ? 180 TYR A C   1 
ATOM   1452 O O   . TYR A 1 181 ? 8.865   115.514 77.613  1.00 24.97  ? 180 TYR A O   1 
ATOM   1453 C CB  . TYR A 1 181 ? 5.840   113.980 77.628  1.00 25.47  ? 180 TYR A CB  1 
ATOM   1454 C CG  . TYR A 1 181 ? 5.600   115.018 76.554  1.00 23.84  ? 180 TYR A CG  1 
ATOM   1455 C CD1 . TYR A 1 181 ? 6.453   115.128 75.457  1.00 20.76  ? 180 TYR A CD1 1 
ATOM   1456 C CD2 . TYR A 1 181 ? 4.503   115.873 76.622  1.00 23.64  ? 180 TYR A CD2 1 
ATOM   1457 C CE1 . TYR A 1 181 ? 6.228   116.062 74.462  1.00 20.40  ? 180 TYR A CE1 1 
ATOM   1458 C CE2 . TYR A 1 181 ? 4.262   116.815 75.624  1.00 22.62  ? 180 TYR A CE2 1 
ATOM   1459 C CZ  . TYR A 1 181 ? 5.138   116.906 74.544  1.00 21.79  ? 180 TYR A CZ  1 
ATOM   1460 O OH  . TYR A 1 181 ? 4.914   117.834 73.543  1.00 20.02  ? 180 TYR A OH  1 
ATOM   1461 N N   . SER A 1 182 ? 8.880   113.274 77.340  1.00 24.03  ? 181 SER A N   1 
ATOM   1462 C CA  . SER A 1 182 ? 10.197  113.273 76.737  1.00 23.12  ? 181 SER A CA  1 
ATOM   1463 C C   . SER A 1 182 ? 10.304  112.264 75.598  1.00 21.66  ? 181 SER A C   1 
ATOM   1464 O O   . SER A 1 182 ? 9.298   111.959 74.940  1.00 21.03  ? 181 SER A O   1 
ATOM   1465 C CB  . SER A 1 182 ? 11.242  113.003 77.812  1.00 23.70  ? 181 SER A CB  1 
ATOM   1466 O OG  . SER A 1 182 ? 12.514  113.431 77.342  1.00 28.05  ? 181 SER A OG  1 
ATOM   1467 N N   . THR A 1 183 ? 11.514  111.734 75.384  1.00 19.76  ? 182 THR A N   1 
ATOM   1468 C CA  . THR A 1 183 ? 11.812  110.858 74.245  1.00 18.34  ? 182 THR A CA  1 
ATOM   1469 C C   . THR A 1 183 ? 10.948  109.610 74.214  1.00 17.73  ? 182 THR A C   1 
ATOM   1470 O O   . THR A 1 183 ? 10.729  109.037 73.150  1.00 16.50  ? 182 THR A O   1 
ATOM   1471 C CB  . THR A 1 183 ? 13.294  110.440 74.258  1.00 18.48  ? 182 THR A CB  1 
ATOM   1472 O OG1 . THR A 1 183 ? 13.609  109.868 75.535  1.00 18.43  ? 182 THR A OG1 1 
ATOM   1473 C CG2 . THR A 1 183 ? 14.214  111.663 74.149  1.00 16.74  ? 182 THR A CG2 1 
ATOM   1474 N N   . ALA A 1 184 ? 10.481  109.206 75.399  1.00 17.14  ? 183 ALA A N   1 
ATOM   1475 C CA  . ALA A 1 184 ? 9.663   108.010 75.605  1.00 16.90  ? 183 ALA A CA  1 
ATOM   1476 C C   . ALA A 1 184 ? 8.358   108.060 74.799  1.00 17.09  ? 183 ALA A C   1 
ATOM   1477 O O   . ALA A 1 184 ? 7.870   107.019 74.331  1.00 16.88  ? 183 ALA A O   1 
ATOM   1478 C CB  . ALA A 1 184 ? 9.380   107.804 77.119  1.00 16.11  ? 183 ALA A CB  1 
ATOM   1479 N N   . VAL A 1 185 ? 7.817   109.262 74.584  1.00 17.75  ? 184 VAL A N   1 
ATOM   1480 C CA  . VAL A 1 185 ? 6.677   109.386 73.668  1.00 18.03  ? 184 VAL A CA  1 
ATOM   1481 C C   . VAL A 1 185 ? 6.978   108.900 72.246  1.00 18.40  ? 184 VAL A C   1 
ATOM   1482 O O   . VAL A 1 185 ? 6.105   108.331 71.622  1.00 19.77  ? 184 VAL A O   1 
ATOM   1483 C CB  . VAL A 1 185 ? 5.973   110.771 73.677  1.00 18.14  ? 184 VAL A CB  1 
ATOM   1484 C CG1 . VAL A 1 185 ? 5.911   111.356 75.096  1.00 17.77  ? 184 VAL A CG1 1 
ATOM   1485 C CG2 . VAL A 1 185 ? 6.602   111.737 72.686  1.00 18.79  ? 184 VAL A CG2 1 
ATOM   1486 N N   . ASP A 1 186 ? 8.197   109.055 71.735  1.00 18.14  ? 185 ASP A N   1 
ATOM   1487 C CA  . ASP A 1 186 ? 8.451   108.548 70.387  1.00 17.78  ? 185 ASP A CA  1 
ATOM   1488 C C   . ASP A 1 186 ? 8.555   107.023 70.381  1.00 17.75  ? 185 ASP A C   1 
ATOM   1489 O O   . ASP A 1 186 ? 8.162   106.353 69.411  1.00 17.70  ? 185 ASP A O   1 
ATOM   1490 C CB  . ASP A 1 186 ? 9.716   109.148 69.801  1.00 17.94  ? 185 ASP A CB  1 
ATOM   1491 C CG  . ASP A 1 186 ? 9.529   110.587 69.355  1.00 19.58  ? 185 ASP A CG  1 
ATOM   1492 O OD1 . ASP A 1 186 ? 8.383   110.996 69.032  1.00 18.95  ? 185 ASP A OD1 1 
ATOM   1493 O OD2 . ASP A 1 186 ? 10.496  111.379 69.290  1.00 21.76  ? 185 ASP A OD2 1 
ATOM   1494 N N   . ILE A 1 187 ? 9.104   106.478 71.460  1.00 16.94  ? 186 ILE A N   1 
ATOM   1495 C CA  . ILE A 1 187 ? 9.278   105.040 71.573  1.00 16.53  ? 186 ILE A CA  1 
ATOM   1496 C C   . ILE A 1 187 ? 7.904   104.354 71.653  1.00 16.33  ? 186 ILE A C   1 
ATOM   1497 O O   . ILE A 1 187 ? 7.675   103.309 71.026  1.00 15.63  ? 186 ILE A O   1 
ATOM   1498 C CB  . ILE A 1 187 ? 10.172  104.706 72.829  1.00 16.58  ? 186 ILE A CB  1 
ATOM   1499 C CG1 . ILE A 1 187 ? 11.608  105.221 72.612  1.00 15.33  ? 186 ILE A CG1 1 
ATOM   1500 C CG2 . ILE A 1 187 ? 10.130  103.222 73.139  1.00 13.63  ? 186 ILE A CG2 1 
ATOM   1501 C CD1 . ILE A 1 187 ? 12.350  104.511 71.517  1.00 17.08  ? 186 ILE A CD1 1 
ATOM   1502 N N   . TRP A 1 188 ? 6.987   104.980 72.385  1.00 16.83  ? 187 TRP A N   1 
ATOM   1503 C CA  . TRP A 1 188 ? 5.629   104.466 72.481  1.00 17.95  ? 187 TRP A CA  1 
ATOM   1504 C C   . TRP A 1 188 ? 5.025   104.353 71.092  1.00 18.13  ? 187 TRP A C   1 
ATOM   1505 O O   . TRP A 1 188 ? 4.511   103.291 70.748  1.00 19.41  ? 187 TRP A O   1 
ATOM   1506 C CB  . TRP A 1 188 ? 4.746   105.293 73.431  1.00 18.40  ? 187 TRP A CB  1 
ATOM   1507 C CG  . TRP A 1 188 ? 3.327   104.760 73.497  1.00 20.69  ? 187 TRP A CG  1 
ATOM   1508 C CD1 . TRP A 1 188 ? 2.338   104.966 72.582  1.00 21.35  ? 187 TRP A CD1 1 
ATOM   1509 C CD2 . TRP A 1 188 ? 2.768   103.892 74.501  1.00 21.18  ? 187 TRP A CD2 1 
ATOM   1510 N NE1 . TRP A 1 188 ? 1.196   104.308 72.966  1.00 23.38  ? 187 TRP A NE1 1 
ATOM   1511 C CE2 . TRP A 1 188 ? 1.432   103.637 74.137  1.00 22.07  ? 187 TRP A CE2 1 
ATOM   1512 C CE3 . TRP A 1 188 ? 3.255   103.327 75.687  1.00 21.75  ? 187 TRP A CE3 1 
ATOM   1513 C CZ2 . TRP A 1 188 ? 0.579   102.825 74.901  1.00 21.88  ? 187 TRP A CZ2 1 
ATOM   1514 C CZ3 . TRP A 1 188 ? 2.396   102.522 76.462  1.00 21.57  ? 187 TRP A CZ3 1 
ATOM   1515 C CH2 . TRP A 1 188 ? 1.078   102.285 76.058  1.00 22.36  ? 187 TRP A CH2 1 
ATOM   1516 N N   . SER A 1 189 ? 5.128   105.414 70.280  1.00 18.50  ? 188 SER A N   1 
ATOM   1517 C CA  . SER A 1 189 ? 4.621   105.389 68.905  1.00 18.34  ? 188 SER A CA  1 
ATOM   1518 C C   . SER A 1 189 ? 5.257   104.281 68.073  1.00 18.64  ? 188 SER A C   1 
ATOM   1519 O O   . SER A 1 189 ? 4.560   103.597 67.327  1.00 19.17  ? 188 SER A O   1 
ATOM   1520 C CB  . SER A 1 189 ? 4.786   106.738 68.181  1.00 18.52  ? 188 SER A CB  1 
ATOM   1521 O OG  . SER A 1 189 ? 4.345   107.837 68.951  1.00 18.26  ? 188 SER A OG  1 
ATOM   1522 N N   . LEU A 1 190 ? 6.568   104.091 68.182  1.00 19.02  ? 189 LEU A N   1 
ATOM   1523 C CA  . LEU A 1 190 ? 7.219   102.979 67.458  1.00 18.95  ? 189 LEU A CA  1 
ATOM   1524 C C   . LEU A 1 190 ? 6.751   101.587 67.915  1.00 18.64  ? 189 LEU A C   1 
ATOM   1525 O O   . LEU A 1 190 ? 6.709   100.660 67.110  1.00 18.49  ? 189 LEU A O   1 
ATOM   1526 C CB  . LEU A 1 190 ? 8.725   103.056 67.600  1.00 19.13  ? 189 LEU A CB  1 
ATOM   1527 C CG  . LEU A 1 190 ? 9.560   103.257 66.340  1.00 23.33  ? 189 LEU A CG  1 
ATOM   1528 C CD1 . LEU A 1 190 ? 10.964  102.745 66.620  1.00 25.13  ? 189 LEU A CD1 1 
ATOM   1529 C CD2 . LEU A 1 190 ? 8.969   102.600 65.074  1.00 25.32  ? 189 LEU A CD2 1 
ATOM   1530 N N   . GLY A 1 191 ? 6.461   101.438 69.213  1.00 18.35  ? 190 GLY A N   1 
ATOM   1531 C CA  . GLY A 1 191 ? 5.890   100.216 69.745  1.00 19.04  ? 190 GLY A CA  1 
ATOM   1532 C C   . GLY A 1 191 ? 4.615   99.889  68.988  1.00 19.55  ? 190 GLY A C   1 
ATOM   1533 O O   . GLY A 1 191 ? 4.495   98.823  68.372  1.00 19.95  ? 190 GLY A O   1 
ATOM   1534 N N   . CYS A 1 192 ? 3.694   100.854 68.991  1.00 20.13  ? 191 CYS A N   1 
ATOM   1535 C CA  . CYS A 1 192 ? 2.427   100.772 68.254  1.00 19.76  ? 191 CYS A CA  1 
ATOM   1536 C C   . CYS A 1 192 ? 2.620   100.427 66.811  1.00 19.72  ? 191 CYS A C   1 
ATOM   1537 O O   . CYS A 1 192 ? 1.945   99.525  66.295  1.00 20.35  ? 191 CYS A O   1 
ATOM   1538 C CB  . CYS A 1 192 ? 1.685   102.091 68.347  1.00 20.18  ? 191 CYS A CB  1 
ATOM   1539 S SG  . CYS A 1 192 ? 1.160   102.434 70.015  1.00 20.49  ? 191 CYS A SG  1 
ATOM   1540 N N   . ILE A 1 193 ? 3.550   101.123 66.157  1.00 19.79  ? 192 ILE A N   1 
ATOM   1541 C CA  . ILE A 1 193 ? 3.927   100.800 64.788  1.00 19.66  ? 192 ILE A CA  1 
ATOM   1542 C C   . ILE A 1 193 ? 4.518   99.388  64.668  1.00 20.30  ? 192 ILE A C   1 
ATOM   1543 O O   . ILE A 1 193 ? 4.212   98.699  63.701  1.00 20.23  ? 192 ILE A O   1 
ATOM   1544 C CB  . ILE A 1 193 ? 4.903   101.846 64.194  1.00 19.81  ? 192 ILE A CB  1 
ATOM   1545 C CG1 . ILE A 1 193 ? 4.239   103.216 64.093  1.00 20.41  ? 192 ILE A CG1 1 
ATOM   1546 C CG2 . ILE A 1 193 ? 5.395   101.398 62.779  1.00 19.43  ? 192 ILE A CG2 1 
ATOM   1547 C CD1 . ILE A 1 193 ? 5.227   104.389 64.193  1.00 21.12  ? 192 ILE A CD1 1 
ATOM   1548 N N   . PHE A 1 194 ? 5.367   98.964  65.620  1.00 20.91  ? 193 PHE A N   1 
ATOM   1549 C CA  . PHE A 1 194 ? 5.916   97.588  65.627  1.00 21.43  ? 193 PHE A CA  1 
ATOM   1550 C C   . PHE A 1 194 ? 4.737   96.603  65.624  1.00 22.25  ? 193 PHE A C   1 
ATOM   1551 O O   . PHE A 1 194 ? 4.646   95.734  64.757  1.00 22.10  ? 193 PHE A O   1 
ATOM   1552 C CB  . PHE A 1 194 ? 6.827   97.378  66.862  1.00 21.77  ? 193 PHE A CB  1 
ATOM   1553 C CG  . PHE A 1 194 ? 7.472   95.989  66.983  1.00 20.11  ? 193 PHE A CG  1 
ATOM   1554 C CD1 . PHE A 1 194 ? 7.504   95.079  65.922  1.00 19.38  ? 193 PHE A CD1 1 
ATOM   1555 C CD2 . PHE A 1 194 ? 8.073   95.617  68.192  1.00 21.52  ? 193 PHE A CD2 1 
ATOM   1556 C CE1 . PHE A 1 194 ? 8.111   93.822  66.057  1.00 17.73  ? 193 PHE A CE1 1 
ATOM   1557 C CE2 . PHE A 1 194 ? 8.693   94.353  68.343  1.00 19.31  ? 193 PHE A CE2 1 
ATOM   1558 C CZ  . PHE A 1 194 ? 8.707   93.462  67.268  1.00 18.78  ? 193 PHE A CZ  1 
ATOM   1559 N N   . ALA A 1 195 ? 3.811   96.771  66.562  1.00 23.24  ? 194 ALA A N   1 
ATOM   1560 C CA  . ALA A 1 195 ? 2.630   95.890  66.615  1.00 24.42  ? 194 ALA A CA  1 
ATOM   1561 C C   . ALA A 1 195 ? 1.866   95.906  65.296  1.00 24.81  ? 194 ALA A C   1 
ATOM   1562 O O   . ALA A 1 195 ? 1.504   94.854  64.773  1.00 25.75  ? 194 ALA A O   1 
ATOM   1563 C CB  . ALA A 1 195 ? 1.720   96.250  67.791  1.00 23.63  ? 194 ALA A CB  1 
ATOM   1564 N N   . GLU A 1 196 ? 1.670   97.094  64.736  1.00 26.08  ? 195 GLU A N   1 
ATOM   1565 C CA  . GLU A 1 196 ? 0.861   97.263  63.530  1.00 26.71  ? 195 GLU A CA  1 
ATOM   1566 C C   . GLU A 1 196 ? 1.521   96.646  62.307  1.00 27.69  ? 195 GLU A C   1 
ATOM   1567 O O   . GLU A 1 196 ? 0.841   96.133  61.421  1.00 27.94  ? 195 GLU A O   1 
ATOM   1568 C CB  . GLU A 1 196 ? 0.553   98.748  63.308  1.00 27.02  ? 195 GLU A CB  1 
ATOM   1569 C CG  . GLU A 1 196 ? -0.447  99.060  62.199  1.00 27.63  ? 195 GLU A CG  1 
ATOM   1570 C CD  . GLU A 1 196 ? -0.788  100.541 62.127  1.00 29.90  ? 195 GLU A CD  1 
ATOM   1571 O OE1 . GLU A 1 196 ? -0.761  101.237 63.170  1.00 32.25  ? 195 GLU A OE1 1 
ATOM   1572 O OE2 . GLU A 1 196 ? -1.086  101.023 61.025  1.00 30.16  ? 195 GLU A OE2 1 
ATOM   1573 N N   . MET A 1 197 ? 2.846   96.693  62.246  1.00 28.88  ? 196 MET A N   1 
ATOM   1574 C CA  . MET A 1 197 ? 3.571   95.986  61.195  1.00 29.98  ? 196 MET A CA  1 
ATOM   1575 C C   . MET A 1 197 ? 3.309   94.477  61.232  1.00 30.72  ? 196 MET A C   1 
ATOM   1576 O O   . MET A 1 197 ? 3.279   93.827  60.193  1.00 30.78  ? 196 MET A O   1 
ATOM   1577 C CB  . MET A 1 197 ? 5.073   96.268  61.275  1.00 30.01  ? 196 MET A CB  1 
ATOM   1578 C CG  . MET A 1 197 ? 5.486   97.558  60.568  1.00 30.90  ? 196 MET A CG  1 
ATOM   1579 S SD  . MET A 1 197 ? 7.269   97.719  60.311  1.00 32.12  ? 196 MET A SD  1 
ATOM   1580 C CE  . MET A 1 197 ? 7.857   97.925  62.034  1.00 29.12  ? 196 MET A CE  1 
ATOM   1581 N N   . VAL A 1 198 ? 3.113   93.926  62.423  1.00 31.56  ? 197 VAL A N   1 
ATOM   1582 C CA  . VAL A 1 198 ? 2.925   92.481  62.574  1.00 33.00  ? 197 VAL A CA  1 
ATOM   1583 C C   . VAL A 1 198 ? 1.555   91.998  62.070  1.00 33.65  ? 197 VAL A C   1 
ATOM   1584 O O   . VAL A 1 198 ? 1.469   91.019  61.345  1.00 33.55  ? 197 VAL A O   1 
ATOM   1585 C CB  . VAL A 1 198 ? 3.163   92.020  64.046  1.00 32.83  ? 197 VAL A CB  1 
ATOM   1586 C CG1 . VAL A 1 198 ? 2.926   90.519  64.198  1.00 32.70  ? 197 VAL A CG1 1 
ATOM   1587 C CG2 . VAL A 1 198 ? 4.568   92.373  64.504  1.00 32.91  ? 197 VAL A CG2 1 
ATOM   1588 N N   . THR A 1 199 ? 0.502   92.724  62.440  1.00 35.22  ? 198 THR A N   1 
ATOM   1589 C CA  . THR A 1 199 ? -0.880  92.330  62.175  1.00 36.38  ? 198 THR A CA  1 
ATOM   1590 C C   . THR A 1 199 ? -1.542  93.124  61.054  1.00 37.05  ? 198 THR A C   1 
ATOM   1591 O O   . THR A 1 199 ? -2.606  92.739  60.557  1.00 37.43  ? 198 THR A O   1 
ATOM   1592 C CB  . THR A 1 199 ? -1.712  92.545  63.420  1.00 36.25  ? 198 THR A CB  1 
ATOM   1593 O OG1 . THR A 1 199 ? -1.756  93.955  63.690  1.00 37.97  ? 198 THR A OG1 1 
ATOM   1594 C CG2 . THR A 1 199 ? -1.032  91.953  64.647  1.00 36.08  ? 198 THR A CG2 1 
ATOM   1595 N N   . ARG A 1 200 ? -0.938  94.249  60.689  1.00 37.48  ? 199 ARG A N   1 
ATOM   1596 C CA  . ARG A 1 200 ? -1.506  95.146  59.693  1.00 38.06  ? 199 ARG A CA  1 
ATOM   1597 C C   . ARG A 1 200 ? -2.837  95.716  60.172  1.00 37.81  ? 199 ARG A C   1 
ATOM   1598 O O   . ARG A 1 200 ? -3.740  95.968  59.371  1.00 38.88  ? 199 ARG A O   1 
ATOM   1599 C CB  . ARG A 1 200 ? -1.668  94.442  58.343  1.00 39.00  ? 199 ARG A CB  1 
ATOM   1600 C CG  . ARG A 1 200 ? -0.355  93.916  57.734  1.00 41.37  ? 199 ARG A CG  1 
ATOM   1601 C CD  . ARG A 1 200 ? -0.522  93.309  56.360  1.00 43.69  ? 199 ARG A CD  1 
ATOM   1602 N NE  . ARG A 1 200 ? -0.815  91.876  56.438  1.00 47.84  ? 199 ARG A NE  1 
ATOM   1603 C CZ  . ARG A 1 200 ? -2.040  91.328  56.400  1.00 49.63  ? 199 ARG A CZ  1 
ATOM   1604 N NH1 . ARG A 1 200 ? -3.132  92.084  56.301  1.00 49.08  ? 199 ARG A NH1 1 
ATOM   1605 N NH2 . ARG A 1 200 ? -2.169  90.006  56.470  1.00 49.16  ? 199 ARG A NH2 1 
ATOM   1606 N N   . ARG A 1 201 ? -2.970  95.883  61.482  1.00 36.61  ? 200 ARG A N   1 
ATOM   1607 C CA  . ARG A 1 201 ? -4.035  96.708  62.037  1.00 35.70  ? 200 ARG A CA  1 
ATOM   1608 C C   . ARG A 1 201 ? -3.553  97.475  63.267  1.00 33.69  ? 200 ARG A C   1 
ATOM   1609 O O   . ARG A 1 201 ? -2.770  96.968  64.067  1.00 33.03  ? 200 ARG A O   1 
ATOM   1610 C CB  . ARG A 1 201 ? -5.334  95.916  62.305  1.00 36.78  ? 200 ARG A CB  1 
ATOM   1611 C CG  . ARG A 1 201 ? -5.237  94.665  63.177  1.00 40.89  ? 200 ARG A CG  1 
ATOM   1612 C CD  . ARG A 1 201 ? -6.453  94.496  64.101  1.00 48.01  ? 200 ARG A CD  1 
ATOM   1613 N NE  . ARG A 1 201 ? -6.953  93.120  64.219  1.00 52.68  ? 200 ARG A NE  1 
ATOM   1614 C CZ  . ARG A 1 201 ? -7.848  92.549  63.404  1.00 55.60  ? 200 ARG A CZ  1 
ATOM   1615 N NH1 . ARG A 1 201 ? -8.353  93.209  62.362  1.00 56.92  ? 200 ARG A NH1 1 
ATOM   1616 N NH2 . ARG A 1 201 ? -8.232  91.298  63.629  1.00 57.05  ? 200 ARG A NH2 1 
ATOM   1617 N N   . ALA A 1 202 ? -4.008  98.711  63.395  1.00 31.59  ? 201 ALA A N   1 
ATOM   1618 C CA  . ALA A 1 202 ? -3.648  99.521  64.542  1.00 30.31  ? 201 ALA A CA  1 
ATOM   1619 C C   . ALA A 1 202 ? -3.855  98.763  65.852  1.00 29.33  ? 201 ALA A C   1 
ATOM   1620 O O   . ALA A 1 202 ? -4.815  97.996  66.004  1.00 29.44  ? 201 ALA A O   1 
ATOM   1621 C CB  . ALA A 1 202 ? -4.418  100.816 64.539  1.00 30.31  ? 201 ALA A CB  1 
ATOM   1622 N N   . LEU A 1 203 ? -2.930  98.970  66.785  1.00 27.62  ? 202 LEU A N   1 
ATOM   1623 C CA  . LEU A 1 203 ? -2.989  98.345  68.092  1.00 26.09  ? 202 LEU A CA  1 
ATOM   1624 C C   . LEU A 1 203 ? -4.054  99.006  68.969  1.00 25.52  ? 202 LEU A C   1 
ATOM   1625 O O   . LEU A 1 203 ? -4.872  98.320  69.594  1.00 25.76  ? 202 LEU A O   1 
ATOM   1626 C CB  . LEU A 1 203 ? -1.600  98.412  68.752  1.00 26.11  ? 202 LEU A CB  1 
ATOM   1627 C CG  . LEU A 1 203 ? -1.386  97.773  70.127  1.00 25.65  ? 202 LEU A CG  1 
ATOM   1628 C CD1 . LEU A 1 203 ? -1.731  96.288  70.096  1.00 24.73  ? 202 LEU A CD1 1 
ATOM   1629 C CD2 . LEU A 1 203 ? 0.041   97.993  70.615  1.00 23.31  ? 202 LEU A CD2 1 
ATOM   1630 N N   . PHE A 1 204 ? -4.048  100.335 69.011  1.00 24.63  ? 203 PHE A N   1 
ATOM   1631 C CA  . PHE A 1 204 ? -4.985  101.086 69.833  1.00 24.35  ? 203 PHE A CA  1 
ATOM   1632 C C   . PHE A 1 204 ? -5.723  102.120 68.978  1.00 24.62  ? 203 PHE A C   1 
ATOM   1633 O O   . PHE A 1 204 ? -5.385  103.307 69.010  1.00 25.44  ? 203 PHE A O   1 
ATOM   1634 C CB  . PHE A 1 204 ? -4.250  101.807 70.972  1.00 23.83  ? 203 PHE A CB  1 
ATOM   1635 C CG  . PHE A 1 204 ? -3.380  100.920 71.826  1.00 23.10  ? 203 PHE A CG  1 
ATOM   1636 C CD1 . PHE A 1 204 ? -3.911  99.824  72.503  1.00 22.70  ? 203 PHE A CD1 1 
ATOM   1637 C CD2 . PHE A 1 204 ? -2.026  101.207 71.986  1.00 21.19  ? 203 PHE A CD2 1 
ATOM   1638 C CE1 . PHE A 1 204 ? -3.113  99.018  73.315  1.00 20.43  ? 203 PHE A CE1 1 
ATOM   1639 C CE2 . PHE A 1 204 ? -1.220  100.397 72.801  1.00 21.17  ? 203 PHE A CE2 1 
ATOM   1640 C CZ  . PHE A 1 204 ? -1.770  99.312  73.471  1.00 20.10  ? 203 PHE A CZ  1 
ATOM   1641 N N   . PRO A 1 205 ? -6.721  101.694 68.212  1.00 24.92  ? 204 PRO A N   1 
ATOM   1642 C CA  . PRO A 1 205 ? -7.432  102.612 67.314  1.00 25.24  ? 204 PRO A CA  1 
ATOM   1643 C C   . PRO A 1 205 ? -8.561  103.419 67.982  1.00 26.08  ? 204 PRO A C   1 
ATOM   1644 O O   . PRO A 1 205 ? -9.700  103.266 67.599  1.00 26.32  ? 204 PRO A O   1 
ATOM   1645 C CB  . PRO A 1 205 ? -7.995  101.666 66.245  1.00 24.67  ? 204 PRO A CB  1 
ATOM   1646 C CG  . PRO A 1 205 ? -8.268  100.387 66.976  1.00 24.53  ? 204 PRO A CG  1 
ATOM   1647 C CD  . PRO A 1 205 ? -7.239  100.312 68.107  1.00 24.89  ? 204 PRO A CD  1 
ATOM   1648 N N   . GLY A 1 206 ? -8.258  104.283 68.944  1.00 27.46  ? 205 GLY A N   1 
ATOM   1649 C CA  . GLY A 1 206 ? -9.305  105.010 69.652  1.00 29.29  ? 205 GLY A CA  1 
ATOM   1650 C C   . GLY A 1 206 ? -9.992  106.120 68.870  1.00 30.66  ? 205 GLY A C   1 
ATOM   1651 O O   . GLY A 1 206 ? -9.562  106.480 67.780  1.00 30.95  ? 205 GLY A O   1 
ATOM   1652 N N   . ASP A 1 207 ? -11.057 106.676 69.442  1.00 31.87  ? 206 ASP A N   1 
ATOM   1653 C CA  . ASP A 1 207 ? -11.817 107.761 68.805  1.00 32.71  ? 206 ASP A CA  1 
ATOM   1654 C C   . ASP A 1 207 ? -11.749 109.048 69.620  1.00 31.92  ? 206 ASP A C   1 
ATOM   1655 O O   . ASP A 1 207 ? -12.051 110.121 69.122  1.00 32.86  ? 206 ASP A O   1 
ATOM   1656 C CB  . ASP A 1 207 ? -13.284 107.350 68.608  1.00 33.63  ? 206 ASP A CB  1 
ATOM   1657 C CG  . ASP A 1 207 ? -13.483 106.406 67.421  1.00 36.59  ? 206 ASP A CG  1 
ATOM   1658 O OD1 . ASP A 1 207 ? -13.152 106.791 66.274  1.00 38.93  ? 206 ASP A OD1 1 
ATOM   1659 O OD2 . ASP A 1 207 ? -13.980 105.258 67.539  1.00 41.37  ? 206 ASP A OD2 1 
ATOM   1660 N N   . SER A 1 208 ? -11.376 108.934 70.884  1.00 30.59  ? 207 SER A N   1 
ATOM   1661 C CA  . SER A 1 208 ? -11.188 110.093 71.732  1.00 29.65  ? 207 SER A CA  1 
ATOM   1662 C C   . SER A 1 208 ? -10.014 109.816 72.648  1.00 29.05  ? 207 SER A C   1 
ATOM   1663 O O   . SER A 1 208 ? -9.422  108.748 72.588  1.00 28.78  ? 207 SER A O   1 
ATOM   1664 C CB  . SER A 1 208 ? -12.452 110.372 72.552  1.00 29.65  ? 207 SER A CB  1 
ATOM   1665 O OG  . SER A 1 208 ? -12.906 109.196 73.190  1.00 29.18  ? 207 SER A OG  1 
ATOM   1666 N N   . GLU A 1 209 ? -9.672  110.774 73.495  1.00 28.45  ? 208 GLU A N   1 
ATOM   1667 C CA  . GLU A 1 209 ? -8.597  110.553 74.445  1.00 28.47  ? 208 GLU A CA  1 
ATOM   1668 C C   . GLU A 1 209 ? -8.959  109.443 75.426  1.00 28.02  ? 208 GLU A C   1 
ATOM   1669 O O   . GLU A 1 209 ? -8.165  108.538 75.656  1.00 28.52  ? 208 GLU A O   1 
ATOM   1670 C CB  . GLU A 1 209 ? -8.228  111.838 75.181  1.00 28.81  ? 208 GLU A CB  1 
ATOM   1671 C CG  . GLU A 1 209 ? -7.651  112.934 74.303  1.00 31.40  ? 208 GLU A CG  1 
ATOM   1672 C CD  . GLU A 1 209 ? -7.328  114.195 75.092  1.00 36.81  ? 208 GLU A CD  1 
ATOM   1673 O OE1 . GLU A 1 209 ? -6.719  114.094 76.190  1.00 39.26  ? 208 GLU A OE1 1 
ATOM   1674 O OE2 . GLU A 1 209 ? -7.686  115.293 74.625  1.00 38.07  ? 208 GLU A OE2 1 
ATOM   1675 N N   . ILE A 1 210 ? -10.168 109.483 75.970  1.00 27.36  ? 209 ILE A N   1 
ATOM   1676 C CA  . ILE A 1 210 ? -10.603 108.484 76.944  1.00 26.65  ? 209 ILE A CA  1 
ATOM   1677 C C   . ILE A 1 210 ? -10.761 107.085 76.323  1.00 25.80  ? 209 ILE A C   1 
ATOM   1678 O O   . ILE A 1 210 ? -10.374 106.070 76.906  1.00 25.71  ? 209 ILE A O   1 
ATOM   1679 C CB  . ILE A 1 210 ? -11.882 108.958 77.691  1.00 26.81  ? 209 ILE A CB  1 
ATOM   1680 C CG1 . ILE A 1 210 ? -12.119 108.095 78.919  1.00 27.63  ? 209 ILE A CG1 1 
ATOM   1681 C CG2 . ILE A 1 210 ? -13.111 108.931 76.782  1.00 28.03  ? 209 ILE A CG2 1 
ATOM   1682 C CD1 . ILE A 1 210 ? -11.235 108.511 80.101  1.00 30.88  ? 209 ILE A CD1 1 
ATOM   1683 N N   . ASP A 1 211 ? -11.301 107.052 75.122  1.00 24.85  ? 210 ASP A N   1 
ATOM   1684 C CA  . ASP A 1 211 ? -11.409 105.842 74.342  1.00 24.30  ? 210 ASP A CA  1 
ATOM   1685 C C   . ASP A 1 211 ? -10.027 105.222 74.112  1.00 23.43  ? 210 ASP A C   1 
ATOM   1686 O O   . ASP A 1 211 ? -9.834  104.035 74.366  1.00 23.03  ? 210 ASP A O   1 
ATOM   1687 C CB  . ASP A 1 211 ? -12.079 106.203 73.026  1.00 24.48  ? 210 ASP A CB  1 
ATOM   1688 C CG  . ASP A 1 211 ? -12.456 105.007 72.215  1.00 27.67  ? 210 ASP A CG  1 
ATOM   1689 O OD1 . ASP A 1 211 ? -12.886 103.995 72.816  1.00 31.11  ? 210 ASP A OD1 1 
ATOM   1690 O OD2 . ASP A 1 211 ? -12.386 105.002 70.958  1.00 30.33  ? 210 ASP A OD2 1 
ATOM   1691 N N   . GLN A 1 212 ? -9.076  106.032 73.633  1.00 22.73  ? 211 GLN A N   1 
ATOM   1692 C CA  . GLN A 1 212 ? -7.676  105.613 73.454  1.00 21.84  ? 211 GLN A CA  1 
ATOM   1693 C C   . GLN A 1 212 ? -7.091  105.042 74.744  1.00 20.86  ? 211 GLN A C   1 
ATOM   1694 O O   . GLN A 1 212 ? -6.447  104.003 74.750  1.00 20.16  ? 211 GLN A O   1 
ATOM   1695 C CB  . GLN A 1 212 ? -6.807  106.814 73.015  1.00 22.54  ? 211 GLN A CB  1 
ATOM   1696 C CG  . GLN A 1 212 ? -5.434  106.430 72.473  1.00 22.15  ? 211 GLN A CG  1 
ATOM   1697 C CD  . GLN A 1 212 ? -5.529  105.602 71.213  1.00 23.57  ? 211 GLN A CD  1 
ATOM   1698 O OE1 . GLN A 1 212 ? -6.476  105.728 70.442  1.00 23.49  ? 211 GLN A OE1 1 
ATOM   1699 N NE2 . GLN A 1 212 ? -4.557  104.746 71.007  1.00 25.18  ? 211 GLN A NE2 1 
ATOM   1700 N N   . LEU A 1 213 ? -7.311  105.756 75.832  1.00 20.25  ? 212 LEU A N   1 
ATOM   1701 C CA  . LEU A 1 213 ? -6.836  105.335 77.137  1.00 20.64  ? 212 LEU A CA  1 
ATOM   1702 C C   . LEU A 1 213 ? -7.409  103.983 77.554  1.00 20.32  ? 212 LEU A C   1 
ATOM   1703 O O   . LEU A 1 213 ? -6.670  103.083 77.960  1.00 19.76  ? 212 LEU A O   1 
ATOM   1704 C CB  . LEU A 1 213 ? -7.241  106.366 78.170  1.00 21.42  ? 212 LEU A CB  1 
ATOM   1705 C CG  . LEU A 1 213 ? -6.187  107.255 78.815  1.00 23.82  ? 212 LEU A CG  1 
ATOM   1706 C CD1 . LEU A 1 213 ? -6.878  107.820 80.036  1.00 26.72  ? 212 LEU A CD1 1 
ATOM   1707 C CD2 . LEU A 1 213 ? -4.910  106.489 79.192  1.00 25.10  ? 212 LEU A CD2 1 
ATOM   1708 N N   . PHE A 1 214 ? -8.732  103.845 77.452  1.00 20.19  ? 213 PHE A N   1 
ATOM   1709 C CA  . PHE A 1 214 ? -9.393  102.598 77.837  1.00 19.42  ? 213 PHE A CA  1 
ATOM   1710 C C   . PHE A 1 214 ? -8.913  101.438 76.959  1.00 18.74  ? 213 PHE A C   1 
ATOM   1711 O O   . PHE A 1 214 ? -8.735  100.348 77.456  1.00 18.98  ? 213 PHE A O   1 
ATOM   1712 C CB  . PHE A 1 214 ? -10.919 102.749 77.855  1.00 18.61  ? 213 PHE A CB  1 
ATOM   1713 C CG  . PHE A 1 214 ? -11.445 103.598 79.004  1.00 19.08  ? 213 PHE A CG  1 
ATOM   1714 C CD1 . PHE A 1 214 ? -10.591 104.095 79.998  1.00 18.46  ? 213 PHE A CD1 1 
ATOM   1715 C CD2 . PHE A 1 214 ? -12.805 103.905 79.086  1.00 18.40  ? 213 PHE A CD2 1 
ATOM   1716 C CE1 . PHE A 1 214 ? -11.101 104.891 81.047  1.00 19.31  ? 213 PHE A CE1 1 
ATOM   1717 C CE2 . PHE A 1 214 ? -13.320 104.696 80.129  1.00 17.81  ? 213 PHE A CE2 1 
ATOM   1718 C CZ  . PHE A 1 214 ? -12.486 105.176 81.105  1.00 18.38  ? 213 PHE A CZ  1 
ATOM   1719 N N   . ARG A 1 215 ? -8.653  101.672 75.678  1.00 18.88  ? 214 ARG A N   1 
ATOM   1720 C CA  . ARG A 1 215 ? -8.141  100.589 74.824  1.00 19.37  ? 214 ARG A CA  1 
ATOM   1721 C C   . ARG A 1 215 ? -6.747  100.154 75.245  1.00 18.96  ? 214 ARG A C   1 
ATOM   1722 O O   . ARG A 1 215 ? -6.409  98.987  75.160  1.00 19.68  ? 214 ARG A O   1 
ATOM   1723 C CB  . ARG A 1 215 ? -8.061  101.004 73.369  1.00 19.84  ? 214 ARG A CB  1 
ATOM   1724 C CG  . ARG A 1 215 ? -9.363  101.210 72.685  1.00 22.06  ? 214 ARG A CG  1 
ATOM   1725 C CD  . ARG A 1 215 ? -9.205  101.731 71.275  1.00 23.42  ? 214 ARG A CD  1 
ATOM   1726 N NE  . ARG A 1 215 ? -10.499 101.800 70.595  1.00 25.51  ? 214 ARG A NE  1 
ATOM   1727 C CZ  . ARG A 1 215 ? -11.029 100.802 69.914  1.00 26.26  ? 214 ARG A CZ  1 
ATOM   1728 N NH1 . ARG A 1 215 ? -10.381 99.647  69.811  1.00 28.23  ? 214 ARG A NH1 1 
ATOM   1729 N NH2 . ARG A 1 215 ? -12.206 100.956 69.332  1.00 26.64  ? 214 ARG A NH2 1 
ATOM   1730 N N   . ILE A 1 216 ? -5.935  101.112 75.670  1.00 18.94  ? 215 ILE A N   1 
ATOM   1731 C CA  . ILE A 1 216 ? -4.609  100.838 76.176  1.00 18.62  ? 215 ILE A CA  1 
ATOM   1732 C C   . ILE A 1 216 ? -4.714  100.008 77.472  1.00 18.61  ? 215 ILE A C   1 
ATOM   1733 O O   . ILE A 1 216 ? -4.220  98.892  77.516  1.00 18.79  ? 215 ILE A O   1 
ATOM   1734 C CB  . ILE A 1 216 ? -3.848  102.165 76.363  1.00 18.45  ? 215 ILE A CB  1 
ATOM   1735 C CG1 . ILE A 1 216 ? -3.510  102.778 74.995  1.00 19.57  ? 215 ILE A CG1 1 
ATOM   1736 C CG2 . ILE A 1 216 ? -2.583  101.952 77.183  1.00 18.79  ? 215 ILE A CG2 1 
ATOM   1737 C CD1 . ILE A 1 216 ? -2.815  104.149 75.081  1.00 19.05  ? 215 ILE A CD1 1 
ATOM   1738 N N   . PHE A 1 217 ? -5.387  100.548 78.490  1.00 18.47  ? 216 PHE A N   1 
ATOM   1739 C CA  . PHE A 1 217 ? -5.696  99.840  79.747  1.00 19.05  ? 216 PHE A CA  1 
ATOM   1740 C C   . PHE A 1 217 ? -6.204  98.389  79.573  1.00 20.45  ? 216 PHE A C   1 
ATOM   1741 O O   . PHE A 1 217 ? -5.772  97.484  80.306  1.00 20.45  ? 216 PHE A O   1 
ATOM   1742 C CB  . PHE A 1 217 ? -6.753  100.600 80.532  1.00 18.20  ? 216 PHE A CB  1 
ATOM   1743 C CG  . PHE A 1 217 ? -6.298  101.926 81.072  1.00 17.22  ? 216 PHE A CG  1 
ATOM   1744 C CD1 . PHE A 1 217 ? -4.995  102.399 80.865  1.00 16.53  ? 216 PHE A CD1 1 
ATOM   1745 C CD2 . PHE A 1 217 ? -7.177  102.701 81.814  1.00 16.22  ? 216 PHE A CD2 1 
ATOM   1746 C CE1 . PHE A 1 217 ? -4.591  103.624 81.386  1.00 13.94  ? 216 PHE A CE1 1 
ATOM   1747 C CE2 . PHE A 1 217 ? -6.781  103.935 82.332  1.00 17.21  ? 216 PHE A CE2 1 
ATOM   1748 C CZ  . PHE A 1 217 ? -5.478  104.387 82.121  1.00 16.25  ? 216 PHE A CZ  1 
ATOM   1749 N N   . ARG A 1 218 ? -7.123  98.165  78.631  1.00 20.46  ? 217 ARG A N   1 
ATOM   1750 C CA  . ARG A 1 218 ? -7.697  96.829  78.460  1.00 21.81  ? 217 ARG A CA  1 
ATOM   1751 C C   . ARG A 1 218 ? -6.710  95.848  77.850  1.00 22.14  ? 217 ARG A C   1 
ATOM   1752 O O   . ARG A 1 218 ? -6.941  94.656  77.899  1.00 22.81  ? 217 ARG A O   1 
ATOM   1753 C CB  . ARG A 1 218 ? -8.958  96.867  77.571  1.00 21.85  ? 217 ARG A CB  1 
ATOM   1754 C CG  . ARG A 1 218 ? -10.244 97.305  78.282  1.00 23.21  ? 217 ARG A CG  1 
ATOM   1755 C CD  . ARG A 1 218 ? -11.553 97.023  77.492  1.00 25.18  ? 217 ARG A CD  1 
ATOM   1756 N NE  . ARG A 1 218 ? -11.565 97.730  76.214  1.00 25.34  ? 217 ARG A NE  1 
ATOM   1757 C CZ  . ARG A 1 218 ? -11.976 98.986  76.033  1.00 26.41  ? 217 ARG A CZ  1 
ATOM   1758 N NH1 . ARG A 1 218 ? -11.939 99.514  74.819  1.00 26.15  ? 217 ARG A NH1 1 
ATOM   1759 N NH2 . ARG A 1 218 ? -12.450 99.708  77.042  1.00 26.81  ? 217 ARG A NH2 1 
ATOM   1760 N N   . THR A 1 219 ? -5.640  96.356  77.241  1.00 22.27  ? 218 THR A N   1 
ATOM   1761 C CA  . THR A 1 219 ? -4.600  95.529  76.639  1.00 22.32  ? 218 THR A CA  1 
ATOM   1762 C C   . THR A 1 219 ? -3.413  95.322  77.590  1.00 22.44  ? 218 THR A C   1 
ATOM   1763 O O   . THR A 1 219 ? -2.818  94.243  77.624  1.00 22.47  ? 218 THR A O   1 
ATOM   1764 C CB  . THR A 1 219 ? -4.090  96.210  75.357  1.00 22.83  ? 218 THR A CB  1 
ATOM   1765 O OG1 . THR A 1 219 ? -5.161  96.306  74.405  1.00 24.04  ? 218 THR A OG1 1 
ATOM   1766 C CG2 . THR A 1 219 ? -3.015  95.368  74.648  1.00 20.81  ? 218 THR A CG2 1 
ATOM   1767 N N   . LEU A 1 220 ? -3.052  96.371  78.324  1.00 22.04  ? 219 LEU A N   1 
ATOM   1768 C CA  . LEU A 1 220 ? -1.835  96.359  79.137  1.00 22.39  ? 219 LEU A CA  1 
ATOM   1769 C C   . LEU A 1 220 ? -2.151  96.344  80.616  1.00 22.25  ? 219 LEU A C   1 
ATOM   1770 O O   . LEU A 1 220 ? -1.243  96.265  81.444  1.00 22.58  ? 219 LEU A O   1 
ATOM   1771 C CB  . LEU A 1 220 ? -0.934  97.573  78.833  1.00 21.48  ? 219 LEU A CB  1 
ATOM   1772 C CG  . LEU A 1 220 ? -0.417  97.854  77.418  1.00 22.51  ? 219 LEU A CG  1 
ATOM   1773 C CD1 . LEU A 1 220 ? 0.426   99.144  77.389  1.00 21.64  ? 219 LEU A CD1 1 
ATOM   1774 C CD2 . LEU A 1 220 ? 0.360   96.682  76.853  1.00 22.47  ? 219 LEU A CD2 1 
ATOM   1775 N N   . GLY A 1 221 ? -3.439  96.426  80.932  1.00 22.80  ? 220 GLY A N   1 
ATOM   1776 C CA  . GLY A 1 221 ? -3.915  96.491  82.297  1.00 23.09  ? 220 GLY A CA  1 
ATOM   1777 C C   . GLY A 1 221 ? -3.969  97.936  82.707  1.00 24.15  ? 220 GLY A C   1 
ATOM   1778 O O   . GLY A 1 221 ? -3.232  98.759  82.161  1.00 24.36  ? 220 GLY A O   1 
ATOM   1779 N N   . THR A 1 222 ? -4.841  98.254  83.657  1.00 24.99  ? 221 THR A N   1 
ATOM   1780 C CA  . THR A 1 222 ? -4.932  99.601  84.180  1.00 26.44  ? 221 THR A CA  1 
ATOM   1781 C C   . THR A 1 222 ? -3.717  99.787  85.081  1.00 28.33  ? 221 THR A C   1 
ATOM   1782 O O   . THR A 1 222 ? -3.459  98.934  85.929  1.00 29.16  ? 221 THR A O   1 
ATOM   1783 C CB  . THR A 1 222 ? -6.240  99.765  84.978  1.00 26.11  ? 221 THR A CB  1 
ATOM   1784 O OG1 . THR A 1 222 ? -7.355  99.603  84.102  1.00 25.33  ? 221 THR A OG1 1 
ATOM   1785 C CG2 . THR A 1 222 ? -6.404  101.170 85.492  1.00 24.91  ? 221 THR A CG2 1 
ATOM   1786 N N   . PRO A 1 223 ? -2.963  100.874 84.895  1.00 29.62  ? 222 PRO A N   1 
ATOM   1787 C CA  . PRO A 1 223 ? -1.801  101.146 85.742  1.00 30.87  ? 222 PRO A CA  1 
ATOM   1788 C C   . PRO A 1 223 ? -2.164  101.597 87.160  1.00 32.11  ? 222 PRO A C   1 
ATOM   1789 O O   . PRO A 1 223 ? -3.102  102.359 87.360  1.00 32.64  ? 222 PRO A O   1 
ATOM   1790 C CB  . PRO A 1 223 ? -1.072  102.262 84.981  1.00 30.74  ? 222 PRO A CB  1 
ATOM   1791 C CG  . PRO A 1 223 ? -2.145  102.967 84.225  1.00 30.10  ? 222 PRO A CG  1 
ATOM   1792 C CD  . PRO A 1 223 ? -3.133  101.906 83.856  1.00 29.50  ? 222 PRO A CD  1 
ATOM   1793 N N   . ASP A 1 224 ? -1.416  101.092 88.134  1.00 33.65  ? 223 ASP A N   1 
ATOM   1794 C CA  . ASP A 1 224 ? -1.485  101.547 89.519  1.00 34.89  ? 223 ASP A CA  1 
ATOM   1795 C C   . ASP A 1 224 ? -0.090  102.045 89.968  1.00 35.31  ? 223 ASP A C   1 
ATOM   1796 O O   . ASP A 1 224 ? 0.858   102.071 89.173  1.00 34.59  ? 223 ASP A O   1 
ATOM   1797 C CB  . ASP A 1 224 ? -1.994  100.419 90.429  1.00 35.36  ? 223 ASP A CB  1 
ATOM   1798 C CG  . ASP A 1 224 ? -1.127  99.169  90.363  1.00 37.22  ? 223 ASP A CG  1 
ATOM   1799 O OD1 . ASP A 1 224 ? -0.044  99.206  89.741  1.00 40.06  ? 223 ASP A OD1 1 
ATOM   1800 O OD2 . ASP A 1 224 ? -1.444  98.090  90.902  1.00 40.18  ? 223 ASP A OD2 1 
ATOM   1801 N N   . GLU A 1 225 ? 0.033   102.424 91.240  1.00 36.11  ? 224 GLU A N   1 
ATOM   1802 C CA  . GLU A 1 225 ? 1.288   102.981 91.760  1.00 37.18  ? 224 GLU A CA  1 
ATOM   1803 C C   . GLU A 1 225 ? 2.461   101.997 91.697  1.00 37.05  ? 224 GLU A C   1 
ATOM   1804 O O   . GLU A 1 225 ? 3.607   102.415 91.569  1.00 37.82  ? 224 GLU A O   1 
ATOM   1805 C CB  . GLU A 1 225 ? 1.103   103.552 93.172  1.00 37.57  ? 224 GLU A CB  1 
ATOM   1806 C CG  . GLU A 1 225 ? 0.169   104.755 93.221  1.00 39.10  ? 224 GLU A CG  1 
ATOM   1807 C CD  . GLU A 1 225 ? 0.757   106.005 92.578  1.00 41.94  ? 224 GLU A CD  1 
ATOM   1808 O OE1 . GLU A 1 225 ? 1.997   106.163 92.576  1.00 43.81  ? 224 GLU A OE1 1 
ATOM   1809 O OE2 . GLU A 1 225 ? -0.018  106.851 92.086  1.00 42.42  ? 224 GLU A OE2 1 
ATOM   1810 N N   . VAL A 1 226 ? 2.162   100.704 91.749  1.00 36.36  ? 225 VAL A N   1 
ATOM   1811 C CA  . VAL A 1 226 ? 3.166   99.668  91.584  1.00 36.14  ? 225 VAL A CA  1 
ATOM   1812 C C   . VAL A 1 226 ? 3.810   99.722  90.190  1.00 35.88  ? 225 VAL A C   1 
ATOM   1813 O O   . VAL A 1 226 ? 5.027   99.897  90.068  1.00 35.44  ? 225 VAL A O   1 
ATOM   1814 C CB  . VAL A 1 226 ? 2.578   98.249  91.841  1.00 36.57  ? 225 VAL A CB  1 
ATOM   1815 C CG1 . VAL A 1 226 ? 3.673   97.192  91.775  1.00 36.98  ? 225 VAL A CG1 1 
ATOM   1816 C CG2 . VAL A 1 226 ? 1.848   98.185  93.186  1.00 37.24  ? 225 VAL A CG2 1 
ATOM   1817 N N   . VAL A 1 227 ? 3.003   99.565  89.141  1.00 35.20  ? 226 VAL A N   1 
ATOM   1818 C CA  . VAL A 1 227 ? 3.532   99.568  87.775  1.00 34.34  ? 226 VAL A CA  1 
ATOM   1819 C C   . VAL A 1 227 ? 4.070   100.957 87.345  1.00 33.67  ? 226 VAL A C   1 
ATOM   1820 O O   . VAL A 1 227 ? 5.009   101.053 86.546  1.00 33.76  ? 226 VAL A O   1 
ATOM   1821 C CB  . VAL A 1 227 ? 2.491   98.973  86.769  1.00 34.79  ? 226 VAL A CB  1 
ATOM   1822 C CG1 . VAL A 1 227 ? 1.250   99.841  86.681  1.00 34.74  ? 226 VAL A CG1 1 
ATOM   1823 C CG2 . VAL A 1 227 ? 3.099   98.729  85.376  1.00 35.01  ? 226 VAL A CG2 1 
ATOM   1824 N N   . TRP A 1 228 ? 3.505   102.027 87.899  1.00 32.52  ? 227 TRP A N   1 
ATOM   1825 C CA  . TRP A 1 228 ? 3.830   103.376 87.449  1.00 31.62  ? 227 TRP A CA  1 
ATOM   1826 C C   . TRP A 1 228 ? 3.689   104.381 88.587  1.00 32.10  ? 227 TRP A C   1 
ATOM   1827 O O   . TRP A 1 228 ? 2.638   105.016 88.715  1.00 31.47  ? 227 TRP A O   1 
ATOM   1828 C CB  . TRP A 1 228 ? 2.935   103.772 86.255  1.00 31.20  ? 227 TRP A CB  1 
ATOM   1829 C CG  . TRP A 1 228 ? 3.270   105.095 85.545  1.00 28.89  ? 227 TRP A CG  1 
ATOM   1830 C CD1 . TRP A 1 228 ? 4.305   105.961 85.821  1.00 28.71  ? 227 TRP A CD1 1 
ATOM   1831 C CD2 . TRP A 1 228 ? 2.543   105.689 84.460  1.00 27.27  ? 227 TRP A CD2 1 
ATOM   1832 N NE1 . TRP A 1 228 ? 4.263   107.042 84.971  1.00 27.95  ? 227 TRP A NE1 1 
ATOM   1833 C CE2 . TRP A 1 228 ? 3.195   106.904 84.124  1.00 27.19  ? 227 TRP A CE2 1 
ATOM   1834 C CE3 . TRP A 1 228 ? 1.410   105.310 83.720  1.00 25.31  ? 227 TRP A CE3 1 
ATOM   1835 C CZ2 . TRP A 1 228 ? 2.746   107.740 83.094  1.00 26.63  ? 227 TRP A CZ2 1 
ATOM   1836 C CZ3 . TRP A 1 228 ? 0.959   106.142 82.703  1.00 26.60  ? 227 TRP A CZ3 1 
ATOM   1837 C CH2 . TRP A 1 228 ? 1.625   107.345 82.396  1.00 26.65  ? 227 TRP A CH2 1 
ATOM   1838 N N   . PRO A 1 229 ? 4.733   104.540 89.411  1.00 32.47  ? 228 PRO A N   1 
ATOM   1839 C CA  . PRO A 1 229 ? 4.667   105.489 90.531  1.00 32.94  ? 228 PRO A CA  1 
ATOM   1840 C C   . PRO A 1 229 ? 4.290   106.885 90.014  1.00 33.46  ? 228 PRO A C   1 
ATOM   1841 O O   . PRO A 1 229 ? 4.812   107.308 88.977  1.00 33.42  ? 228 PRO A O   1 
ATOM   1842 C CB  . PRO A 1 229 ? 6.087   105.466 91.113  1.00 32.85  ? 228 PRO A CB  1 
ATOM   1843 C CG  . PRO A 1 229 ? 6.657   104.126 90.705  1.00 33.10  ? 228 PRO A CG  1 
ATOM   1844 C CD  . PRO A 1 229 ? 6.027   103.826 89.358  1.00 32.69  ? 228 PRO A CD  1 
ATOM   1845 N N   . GLY A 1 230 ? 3.367   107.555 90.701  1.00 33.59  ? 229 GLY A N   1 
ATOM   1846 C CA  . GLY A 1 230 ? 2.862   108.836 90.249  1.00 34.33  ? 229 GLY A CA  1 
ATOM   1847 C C   . GLY A 1 230 ? 1.631   108.811 89.346  1.00 34.93  ? 229 GLY A C   1 
ATOM   1848 O O   . GLY A 1 230 ? 0.960   109.837 89.222  1.00 35.26  ? 229 GLY A O   1 
ATOM   1849 N N   . VAL A 1 231 ? 1.316   107.675 88.720  1.00 35.27  ? 230 VAL A N   1 
ATOM   1850 C CA  . VAL A 1 231 ? 0.146   107.613 87.834  1.00 35.64  ? 230 VAL A CA  1 
ATOM   1851 C C   . VAL A 1 231 ? -1.127  108.247 88.441  1.00 36.85  ? 230 VAL A C   1 
ATOM   1852 O O   . VAL A 1 231 ? -1.773  109.064 87.788  1.00 36.51  ? 230 VAL A O   1 
ATOM   1853 C CB  . VAL A 1 231 ? -0.122  106.185 87.240  1.00 35.43  ? 230 VAL A CB  1 
ATOM   1854 C CG1 . VAL A 1 231 ? -0.721  105.232 88.270  1.00 33.74  ? 230 VAL A CG1 1 
ATOM   1855 C CG2 . VAL A 1 231 ? -1.015  106.285 86.001  1.00 34.73  ? 230 VAL A CG2 1 
ATOM   1856 N N   . THR A 1 232 ? -1.461  107.907 89.691  1.00 38.44  ? 231 THR A N   1 
ATOM   1857 C CA  . THR A 1 232 ? -2.684  108.438 90.317  1.00 40.09  ? 231 THR A CA  1 
ATOM   1858 C C   . THR A 1 232 ? -2.573  109.920 90.665  1.00 41.14  ? 231 THR A C   1 
ATOM   1859 O O   . THR A 1 232 ? -3.532  110.522 91.141  1.00 41.49  ? 231 THR A O   1 
ATOM   1860 C CB  . THR A 1 232 ? -3.172  107.603 91.556  1.00 40.27  ? 231 THR A CB  1 
ATOM   1861 O OG1 . THR A 1 232 ? -2.240  107.715 92.644  1.00 40.49  ? 231 THR A OG1 1 
ATOM   1862 C CG2 . THR A 1 232 ? -3.221  106.110 91.242  1.00 39.95  ? 231 THR A CG2 1 
ATOM   1863 N N   . SER A 1 233 ? -1.410  110.506 90.404  1.00 42.26  ? 232 SER A N   1 
ATOM   1864 C CA  . SER A 1 233 ? -1.204  111.926 90.636  1.00 43.35  ? 232 SER A CA  1 
ATOM   1865 C C   . SER A 1 233 ? -1.309  112.718 89.348  1.00 43.77  ? 232 SER A C   1 
ATOM   1866 O O   . SER A 1 233 ? -1.412  113.943 89.389  1.00 44.41  ? 232 SER A O   1 
ATOM   1867 C CB  . SER A 1 233 ? 0.158   112.178 91.281  1.00 43.44  ? 232 SER A CB  1 
ATOM   1868 O OG  . SER A 1 233 ? -0.014  112.543 92.633  1.00 44.71  ? 232 SER A OG  1 
ATOM   1869 N N   . MET A 1 234 ? -1.277  112.020 88.213  1.00 43.93  ? 233 MET A N   1 
ATOM   1870 C CA  . MET A 1 234 ? -1.381  112.660 86.904  1.00 44.10  ? 233 MET A CA  1 
ATOM   1871 C C   . MET A 1 234 ? -2.628  113.548 86.853  1.00 43.35  ? 233 MET A C   1 
ATOM   1872 O O   . MET A 1 234 ? -3.654  113.196 87.432  1.00 43.09  ? 233 MET A O   1 
ATOM   1873 C CB  . MET A 1 234 ? -1.415  111.611 85.782  1.00 44.76  ? 233 MET A CB  1 
ATOM   1874 C CG  . MET A 1 234 ? -0.140  110.780 85.610  1.00 46.99  ? 233 MET A CG  1 
ATOM   1875 S SD  . MET A 1 234 ? 1.120   111.681 84.717  1.00 54.97  ? 233 MET A SD  1 
ATOM   1876 C CE  . MET A 1 234 ? 0.932   111.052 83.094  1.00 54.38  ? 233 MET A CE  1 
ATOM   1877 N N   . PRO A 1 235 ? -2.527  114.707 86.196  1.00 42.92  ? 234 PRO A N   1 
ATOM   1878 C CA  . PRO A 1 235 ? -3.646  115.656 86.094  1.00 42.50  ? 234 PRO A CA  1 
ATOM   1879 C C   . PRO A 1 235 ? -4.961  115.094 85.554  1.00 42.12  ? 234 PRO A C   1 
ATOM   1880 O O   . PRO A 1 235 ? -6.005  115.529 86.030  1.00 42.63  ? 234 PRO A O   1 
ATOM   1881 C CB  . PRO A 1 235 ? -3.095  116.731 85.157  1.00 42.38  ? 234 PRO A CB  1 
ATOM   1882 C CG  . PRO A 1 235 ? -1.643  116.707 85.437  1.00 42.56  ? 234 PRO A CG  1 
ATOM   1883 C CD  . PRO A 1 235 ? -1.318  115.238 85.536  1.00 42.84  ? 234 PRO A CD  1 
ATOM   1884 N N   . ASP A 1 236 ? -4.930  114.164 84.602  1.00 41.38  ? 235 ASP A N   1 
ATOM   1885 C CA  . ASP A 1 236 ? -6.175  113.596 84.084  1.00 40.50  ? 235 ASP A CA  1 
ATOM   1886 C C   . ASP A 1 236 ? -6.417  112.150 84.518  1.00 39.78  ? 235 ASP A C   1 
ATOM   1887 O O   . ASP A 1 236 ? -7.210  111.426 83.912  1.00 39.52  ? 235 ASP A O   1 
ATOM   1888 C CB  . ASP A 1 236 ? -6.272  113.765 82.567  1.00 40.69  ? 235 ASP A CB  1 
ATOM   1889 C CG  . ASP A 1 236 ? -6.387  115.220 82.154  1.00 42.12  ? 235 ASP A CG  1 
ATOM   1890 O OD1 . ASP A 1 236 ? -7.033  115.999 82.882  1.00 44.77  ? 235 ASP A OD1 1 
ATOM   1891 O OD2 . ASP A 1 236 ? -5.855  115.690 81.131  1.00 44.60  ? 235 ASP A OD2 1 
ATOM   1892 N N   . TYR A 1 237 ? -5.741  111.733 85.582  1.00 38.92  ? 236 TYR A N   1 
ATOM   1893 C CA  . TYR A 1 237 ? -6.071  110.458 86.193  1.00 38.17  ? 236 TYR A CA  1 
ATOM   1894 C C   . TYR A 1 237 ? -7.354  110.604 87.000  1.00 36.84  ? 236 TYR A C   1 
ATOM   1895 O O   . TYR A 1 237 ? -7.539  111.596 87.692  1.00 36.72  ? 236 TYR A O   1 
ATOM   1896 C CB  . TYR A 1 237 ? -4.939  109.903 87.077  1.00 38.71  ? 236 TYR A CB  1 
ATOM   1897 C CG  . TYR A 1 237 ? -5.331  108.576 87.677  1.00 39.92  ? 236 TYR A CG  1 
ATOM   1898 C CD1 . TYR A 1 237 ? -5.946  108.508 88.928  1.00 42.07  ? 236 TYR A CD1 1 
ATOM   1899 C CD2 . TYR A 1 237 ? -5.158  107.394 86.961  1.00 41.94  ? 236 TYR A CD2 1 
ATOM   1900 C CE1 . TYR A 1 237 ? -6.350  107.287 89.468  1.00 43.94  ? 236 TYR A CE1 1 
ATOM   1901 C CE2 . TYR A 1 237 ? -5.559  106.166 87.486  1.00 44.45  ? 236 TYR A CE2 1 
ATOM   1902 C CZ  . TYR A 1 237 ? -6.154  106.123 88.740  1.00 45.06  ? 236 TYR A CZ  1 
ATOM   1903 O OH  . TYR A 1 237 ? -6.558  104.917 89.257  1.00 47.88  ? 236 TYR A OH  1 
ATOM   1904 N N   . LYS A 1 238 ? -8.232  109.613 86.887  1.00 35.48  ? 237 LYS A N   1 
ATOM   1905 C CA  . LYS A 1 238 ? -9.451  109.549 87.690  1.00 34.73  ? 237 LYS A CA  1 
ATOM   1906 C C   . LYS A 1 238 ? -9.531  108.221 88.436  1.00 33.43  ? 237 LYS A C   1 
ATOM   1907 O O   . LYS A 1 238 ? -9.344  107.170 87.827  1.00 33.36  ? 237 LYS A O   1 
ATOM   1908 C CB  . LYS A 1 238 ? -10.694 109.721 86.821  1.00 34.71  ? 237 LYS A CB  1 
ATOM   1909 C CG  . LYS A 1 238 ? -10.846 111.111 86.235  1.00 36.84  ? 237 LYS A CG  1 
ATOM   1910 C CD  . LYS A 1 238 ? -11.589 111.066 84.914  1.00 39.33  ? 237 LYS A CD  1 
ATOM   1911 C CE  . LYS A 1 238 ? -11.367 112.355 84.106  1.00 42.11  ? 237 LYS A CE  1 
ATOM   1912 N NZ  . LYS A 1 238 ? -10.853 112.074 82.711  1.00 42.80  ? 237 LYS A NZ  1 
ATOM   1913 N N   . PRO A 1 239 ? -9.812  108.271 89.742  1.00 32.30  ? 238 PRO A N   1 
ATOM   1914 C CA  . PRO A 1 239 ? -9.967  107.054 90.557  1.00 31.58  ? 238 PRO A CA  1 
ATOM   1915 C C   . PRO A 1 239 ? -11.070 106.126 90.044  1.00 30.62  ? 238 PRO A C   1 
ATOM   1916 O O   . PRO A 1 239 ? -11.073 104.945 90.371  1.00 30.60  ? 238 PRO A O   1 
ATOM   1917 C CB  . PRO A 1 239 ? -10.335 107.591 91.952  1.00 31.97  ? 238 PRO A CB  1 
ATOM   1918 C CG  . PRO A 1 239 ? -10.714 109.041 91.746  1.00 32.33  ? 238 PRO A CG  1 
ATOM   1919 C CD  . PRO A 1 239 ? -9.985  109.503 90.534  1.00 31.88  ? 238 PRO A CD  1 
ATOM   1920 N N   . SER A 1 240 ? -11.972 106.652 89.227  1.00 29.53  ? 239 SER A N   1 
ATOM   1921 C CA  . SER A 1 240 ? -13.080 105.864 88.703  1.00 28.70  ? 239 SER A CA  1 
ATOM   1922 C C   . SER A 1 240 ? -12.732 105.085 87.425  1.00 27.48  ? 239 SER A C   1 
ATOM   1923 O O   . SER A 1 240 ? -13.530 104.271 86.973  1.00 26.74  ? 239 SER A O   1 
ATOM   1924 C CB  . SER A 1 240 ? -14.296 106.759 88.474  1.00 28.84  ? 239 SER A CB  1 
ATOM   1925 O OG  . SER A 1 240 ? -14.022 107.704 87.456  1.00 30.65  ? 239 SER A OG  1 
ATOM   1926 N N   . PHE A 1 241 ? -11.554 105.336 86.845  1.00 26.37  ? 240 PHE A N   1 
ATOM   1927 C CA  . PHE A 1 241 ? -11.043 104.495 85.753  1.00 25.84  ? 240 PHE A CA  1 
ATOM   1928 C C   . PHE A 1 241 ? -11.293 103.023 86.058  1.00 25.25  ? 240 PHE A C   1 
ATOM   1929 O O   . PHE A 1 241 ? -10.912 102.548 87.130  1.00 25.12  ? 240 PHE A O   1 
ATOM   1930 C CB  . PHE A 1 241 ? -9.527  104.653 85.593  1.00 25.35  ? 240 PHE A CB  1 
ATOM   1931 C CG  . PHE A 1 241 ? -9.108  105.877 84.848  1.00 25.15  ? 240 PHE A CG  1 
ATOM   1932 C CD1 . PHE A 1 241 ? -10.034 106.667 84.182  1.00 25.37  ? 240 PHE A CD1 1 
ATOM   1933 C CD2 . PHE A 1 241 ? -7.769  106.256 84.833  1.00 24.67  ? 240 PHE A CD2 1 
ATOM   1934 C CE1 . PHE A 1 241 ? -9.628  107.808 83.498  1.00 25.92  ? 240 PHE A CE1 1 
ATOM   1935 C CE2 . PHE A 1 241 ? -7.356  107.402 84.147  1.00 24.32  ? 240 PHE A CE2 1 
ATOM   1936 C CZ  . PHE A 1 241 ? -8.283  108.166 83.474  1.00 24.66  ? 240 PHE A CZ  1 
ATOM   1937 N N   . PRO A 1 242 ? -11.929 102.299 85.146  1.00 25.12  ? 241 PRO A N   1 
ATOM   1938 C CA  . PRO A 1 242 ? -12.060 100.843 85.303  1.00 25.46  ? 241 PRO A CA  1 
ATOM   1939 C C   . PRO A 1 242 ? -10.699 100.149 85.506  1.00 26.40  ? 241 PRO A C   1 
ATOM   1940 O O   . PRO A 1 242 ? -9.694  100.595 84.933  1.00 26.11  ? 241 PRO A O   1 
ATOM   1941 C CB  . PRO A 1 242 ? -12.699 100.414 83.977  1.00 25.43  ? 241 PRO A CB  1 
ATOM   1942 C CG  . PRO A 1 242 ? -13.437 101.630 83.513  1.00 24.40  ? 241 PRO A CG  1 
ATOM   1943 C CD  . PRO A 1 242 ? -12.606 102.791 83.931  1.00 24.67  ? 241 PRO A CD  1 
ATOM   1944 N N   . LYS A 1 243 ? -10.664 99.092  86.318  1.00 27.08  ? 242 LYS A N   1 
ATOM   1945 C CA  . LYS A 1 243 ? -9.438  98.341  86.527  1.00 28.45  ? 242 LYS A CA  1 
ATOM   1946 C C   . LYS A 1 243 ? -9.431  97.076  85.686  1.00 28.11  ? 242 LYS A C   1 
ATOM   1947 O O   . LYS A 1 243 ? -10.001 96.068  86.081  1.00 29.18  ? 242 LYS A O   1 
ATOM   1948 C CB  . LYS A 1 243 ? -9.237  97.988  88.004  1.00 28.93  ? 242 LYS A CB  1 
ATOM   1949 C CG  . LYS A 1 243 ? -9.416  99.168  88.943  1.00 33.27  ? 242 LYS A CG  1 
ATOM   1950 C CD  . LYS A 1 243 ? -8.084  99.711  89.446  1.00 39.86  ? 242 LYS A CD  1 
ATOM   1951 C CE  . LYS A 1 243 ? -8.296  100.759 90.551  1.00 43.25  ? 242 LYS A CE  1 
ATOM   1952 N NZ  . LYS A 1 243 ? -8.557  100.120 91.886  1.00 45.91  ? 242 LYS A NZ  1 
ATOM   1953 N N   . TRP A 1 244 ? -8.789  97.121  84.526  1.00 27.06  ? 243 TRP A N   1 
ATOM   1954 C CA  . TRP A 1 244 ? -8.642  95.920  83.729  1.00 26.24  ? 243 TRP A CA  1 
ATOM   1955 C C   . TRP A 1 244 ? -7.341  95.188  84.061  1.00 26.62  ? 243 TRP A C   1 
ATOM   1956 O O   . TRP A 1 244 ? -6.339  95.801  84.434  1.00 25.22  ? 243 TRP A O   1 
ATOM   1957 C CB  . TRP A 1 244 ? -8.716  96.237  82.253  1.00 25.78  ? 243 TRP A CB  1 
ATOM   1958 C CG  . TRP A 1 244 ? -10.097 96.577  81.767  1.00 24.69  ? 243 TRP A CG  1 
ATOM   1959 C CD1 . TRP A 1 244 ? -11.131 95.702  81.501  1.00 22.33  ? 243 TRP A CD1 1 
ATOM   1960 C CD2 . TRP A 1 244 ? -10.589 97.878  81.463  1.00 22.23  ? 243 TRP A CD2 1 
ATOM   1961 N NE1 . TRP A 1 244 ? -12.224 96.391  81.032  1.00 20.80  ? 243 TRP A NE1 1 
ATOM   1962 C CE2 . TRP A 1 244 ? -11.926 97.729  81.008  1.00 22.65  ? 243 TRP A CE2 1 
ATOM   1963 C CE3 . TRP A 1 244 ? -10.031 99.165  81.499  1.00 22.76  ? 243 TRP A CE3 1 
ATOM   1964 C CZ2 . TRP A 1 244 ? -12.710 98.818  80.617  1.00 22.06  ? 243 TRP A CZ2 1 
ATOM   1965 C CZ3 . TRP A 1 244 ? -10.812 100.248 81.109  1.00 22.11  ? 243 TRP A CZ3 1 
ATOM   1966 C CH2 . TRP A 1 244 ? -12.136 100.062 80.669  1.00 23.02  ? 243 TRP A CH2 1 
ATOM   1967 N N   . ALA A 1 245 ? -7.393  93.865  83.965  1.00 27.59  ? 244 ALA A N   1 
ATOM   1968 C CA  . ALA A 1 245 ? -6.232  93.026  84.219  1.00 29.03  ? 244 ALA A CA  1 
ATOM   1969 C C   . ALA A 1 245 ? -5.335  93.068  82.988  1.00 29.84  ? 244 ALA A C   1 
ATOM   1970 O O   . ALA A 1 245 ? -5.820  93.186  81.857  1.00 29.47  ? 244 ALA A O   1 
ATOM   1971 C CB  . ALA A 1 245 ? -6.666  91.598  84.518  1.00 28.74  ? 244 ALA A CB  1 
ATOM   1972 N N   . ARG A 1 246 ? -4.030  93.005  83.212  1.00 31.16  ? 245 ARG A N   1 
ATOM   1973 C CA  . ARG A 1 246 ? -3.069  92.962  82.112  1.00 32.55  ? 245 ARG A CA  1 
ATOM   1974 C C   . ARG A 1 246 ? -3.230  91.638  81.370  1.00 33.84  ? 245 ARG A C   1 
ATOM   1975 O O   . ARG A 1 246 ? -3.334  90.587  81.981  1.00 33.69  ? 245 ARG A O   1 
ATOM   1976 C CB  . ARG A 1 246 ? -1.646  93.099  82.653  1.00 32.43  ? 245 ARG A CB  1 
ATOM   1977 C CG  . ARG A 1 246 ? -0.541  92.965  81.607  1.00 31.16  ? 245 ARG A CG  1 
ATOM   1978 C CD  . ARG A 1 246 ? 0.838   93.290  82.155  1.00 29.19  ? 245 ARG A CD  1 
ATOM   1979 N NE  . ARG A 1 246 ? 1.842   93.300  81.099  1.00 30.08  ? 245 ARG A NE  1 
ATOM   1980 C CZ  . ARG A 1 246 ? 2.236   94.380  80.409  1.00 29.60  ? 245 ARG A CZ  1 
ATOM   1981 N NH1 . ARG A 1 246 ? 1.710   95.585  80.629  1.00 27.34  ? 245 ARG A NH1 1 
ATOM   1982 N NH2 . ARG A 1 246 ? 3.162   94.235  79.476  1.00 28.76  ? 245 ARG A NH2 1 
ATOM   1983 N N   . GLN A 1 247 ? -3.256  91.698  80.049  1.00 35.73  ? 246 GLN A N   1 
ATOM   1984 C CA  . GLN A 1 247 ? -3.422  90.495  79.258  1.00 37.97  ? 246 GLN A CA  1 
ATOM   1985 C C   . GLN A 1 247 ? -2.111  89.756  79.066  1.00 38.14  ? 246 GLN A C   1 
ATOM   1986 O O   . GLN A 1 247 ? -1.045  90.360  79.096  1.00 37.84  ? 246 GLN A O   1 
ATOM   1987 C CB  . GLN A 1 247 ? -4.025  90.835  77.893  1.00 38.38  ? 246 GLN A CB  1 
ATOM   1988 C CG  . GLN A 1 247 ? -5.530  90.973  77.952  1.00 42.09  ? 246 GLN A CG  1 
ATOM   1989 C CD  . GLN A 1 247 ? -6.168  90.859  76.592  1.00 47.61  ? 246 GLN A CD  1 
ATOM   1990 O OE1 . GLN A 1 247 ? -5.531  91.177  75.571  1.00 47.87  ? 246 GLN A OE1 1 
ATOM   1991 N NE2 . GLN A 1 247 ? -7.432  90.400  76.559  1.00 48.22  ? 246 GLN A NE2 1 
ATOM   1992 N N   . ASP A 1 248 ? -2.217  88.442  78.874  1.00 38.93  ? 247 ASP A N   1 
ATOM   1993 C CA  . ASP A 1 248 ? -1.130  87.635  78.339  1.00 39.49  ? 247 ASP A CA  1 
ATOM   1994 C C   . ASP A 1 248 ? -0.587  88.373  77.127  1.00 38.77  ? 247 ASP A C   1 
ATOM   1995 O O   . ASP A 1 248 ? -1.336  88.698  76.197  1.00 38.87  ? 247 ASP A O   1 
ATOM   1996 C CB  . ASP A 1 248 ? -1.677  86.253  77.944  1.00 40.44  ? 247 ASP A CB  1 
ATOM   1997 C CG  . ASP A 1 248 ? -0.584  85.245  77.560  1.00 43.52  ? 247 ASP A CG  1 
ATOM   1998 O OD1 . ASP A 1 248 ? 0.608   85.627  77.458  1.00 46.38  ? 247 ASP A OD1 1 
ATOM   1999 O OD2 . ASP A 1 248 ? -0.843  84.028  77.323  1.00 46.96  ? 247 ASP A OD2 1 
ATOM   2000 N N   . PHE A 1 249 ? 0.709   88.663  77.140  1.00 37.99  ? 248 PHE A N   1 
ATOM   2001 C CA  . PHE A 1 249 ? 1.309   89.435  76.057  1.00 37.47  ? 248 PHE A CA  1 
ATOM   2002 C C   . PHE A 1 249 ? 1.366   88.707  74.709  1.00 37.09  ? 248 PHE A C   1 
ATOM   2003 O O   . PHE A 1 249 ? 1.379   89.344  73.657  1.00 37.72  ? 248 PHE A O   1 
ATOM   2004 C CB  . PHE A 1 249 ? 2.687   89.955  76.456  1.00 37.62  ? 248 PHE A CB  1 
ATOM   2005 C CG  . PHE A 1 249 ? 2.927   91.376  76.046  1.00 37.13  ? 248 PHE A CG  1 
ATOM   2006 C CD1 . PHE A 1 249 ? 2.370   92.423  76.772  1.00 35.96  ? 248 PHE A CD1 1 
ATOM   2007 C CD2 . PHE A 1 249 ? 3.693   91.673  74.924  1.00 36.06  ? 248 PHE A CD2 1 
ATOM   2008 C CE1 . PHE A 1 249 ? 2.583   93.758  76.398  1.00 36.95  ? 248 PHE A CE1 1 
ATOM   2009 C CE2 . PHE A 1 249 ? 3.912   93.004  74.551  1.00 37.27  ? 248 PHE A CE2 1 
ATOM   2010 C CZ  . PHE A 1 249 ? 3.353   94.048  75.294  1.00 35.21  ? 248 PHE A CZ  1 
ATOM   2011 N N   . SER A 1 250 ? 1.394   87.377  74.755  1.00 35.99  ? 249 SER A N   1 
ATOM   2012 C CA  . SER A 1 250 ? 1.300   86.529  73.570  1.00 34.79  ? 249 SER A CA  1 
ATOM   2013 C C   . SER A 1 250 ? -0.078  86.542  72.912  1.00 34.16  ? 249 SER A C   1 
ATOM   2014 O O   . SER A 1 250 ? -0.268  85.924  71.866  1.00 34.05  ? 249 SER A O   1 
ATOM   2015 C CB  . SER A 1 250 ? 1.664   85.083  73.936  1.00 34.72  ? 249 SER A CB  1 
ATOM   2016 O OG  . SER A 1 250 ? 0.747   84.577  74.888  1.00 32.98  ? 249 SER A OG  1 
ATOM   2017 N N   . LYS A 1 251 ? -1.042  87.211  73.529  1.00 33.60  ? 250 LYS A N   1 
ATOM   2018 C CA  . LYS A 1 251 ? -2.354  87.385  72.901  1.00 33.56  ? 250 LYS A CA  1 
ATOM   2019 C C   . LYS A 1 251 ? -2.500  88.773  72.292  1.00 33.09  ? 250 LYS A C   1 
ATOM   2020 O O   . LYS A 1 251 ? -3.381  88.993  71.473  1.00 33.67  ? 250 LYS A O   1 
ATOM   2021 C CB  . LYS A 1 251 ? -3.511  87.097  73.877  1.00 33.51  ? 250 LYS A CB  1 
ATOM   2022 C CG  . LYS A 1 251 ? -3.479  85.717  74.514  1.00 33.58  ? 250 LYS A CG  1 
ATOM   2023 C CD  . LYS A 1 251 ? -3.779  84.598  73.524  1.00 34.25  ? 250 LYS A CD  1 
ATOM   2024 C CE  . LYS A 1 251 ? -2.883  83.376  73.784  1.00 36.51  ? 250 LYS A CE  1 
ATOM   2025 N NZ  . LYS A 1 251 ? -2.898  82.903  75.193  1.00 37.64  ? 250 LYS A NZ  1 
ATOM   2026 N N   . VAL A 1 252 ? -1.625  89.699  72.681  1.00 32.50  ? 251 VAL A N   1 
ATOM   2027 C CA  . VAL A 1 252 ? -1.648  91.061  72.144  1.00 31.78  ? 251 VAL A CA  1 
ATOM   2028 C C   . VAL A 1 252 ? -1.191  91.088  70.684  1.00 31.01  ? 251 VAL A C   1 
ATOM   2029 O O   . VAL A 1 252 ? -1.801  91.755  69.859  1.00 31.48  ? 251 VAL A O   1 
ATOM   2030 C CB  . VAL A 1 252 ? -0.784  92.031  72.975  1.00 31.90  ? 251 VAL A CB  1 
ATOM   2031 C CG1 . VAL A 1 252 ? -0.803  93.429  72.358  1.00 32.23  ? 251 VAL A CG1 1 
ATOM   2032 C CG2 . VAL A 1 252 ? -1.275  92.083  74.390  1.00 31.66  ? 251 VAL A CG2 1 
ATOM   2033 N N   . VAL A 1 253 ? -0.116  90.367  70.380  1.00 29.58  ? 252 VAL A N   1 
ATOM   2034 C CA  . VAL A 1 253 ? 0.371   90.233  69.007  1.00 28.41  ? 252 VAL A CA  1 
ATOM   2035 C C   . VAL A 1 253 ? 0.745   88.767  68.765  1.00 27.50  ? 252 VAL A C   1 
ATOM   2036 O O   . VAL A 1 253 ? 1.931   88.395  68.813  1.00 27.26  ? 252 VAL A O   1 
ATOM   2037 C CB  . VAL A 1 253 ? 1.569   91.191  68.691  1.00 28.12  ? 252 VAL A CB  1 
ATOM   2038 C CG1 . VAL A 1 253 ? 1.918   91.115  67.216  1.00 29.08  ? 252 VAL A CG1 1 
ATOM   2039 C CG2 . VAL A 1 253 ? 1.216   92.616  69.011  1.00 27.59  ? 252 VAL A CG2 1 
ATOM   2040 N N   . PRO A 1 254 ? -0.273  87.938  68.526  1.00 26.54  ? 253 PRO A N   1 
ATOM   2041 C CA  . PRO A 1 254 ? -0.098  86.479  68.484  1.00 26.01  ? 253 PRO A CA  1 
ATOM   2042 C C   . PRO A 1 254 ? 1.085   85.934  67.664  1.00 25.59  ? 253 PRO A C   1 
ATOM   2043 O O   . PRO A 1 254 ? 1.720   85.032  68.196  1.00 24.64  ? 253 PRO A O   1 
ATOM   2044 C CB  . PRO A 1 254 ? -1.454  85.974  67.956  1.00 25.81  ? 253 PRO A CB  1 
ATOM   2045 C CG  . PRO A 1 254 ? -2.431  87.009  68.444  1.00 25.45  ? 253 PRO A CG  1 
ATOM   2046 C CD  . PRO A 1 254 ? -1.686  88.323  68.319  1.00 26.41  ? 253 PRO A CD  1 
ATOM   2047 N N   . PRO A 1 255 ? 1.380   86.413  66.448  1.00 25.98  ? 254 PRO A N   1 
ATOM   2048 C CA  . PRO A 1 255 ? 2.502   85.848  65.686  1.00 27.15  ? 254 PRO A CA  1 
ATOM   2049 C C   . PRO A 1 255 ? 3.898   86.172  66.236  1.00 28.72  ? 254 PRO A C   1 
ATOM   2050 O O   . PRO A 1 255 ? 4.862   85.600  65.743  1.00 29.57  ? 254 PRO A O   1 
ATOM   2051 C CB  . PRO A 1 255 ? 2.323   86.468  64.290  1.00 27.34  ? 254 PRO A CB  1 
ATOM   2052 C CG  . PRO A 1 255 ? 0.897   86.967  64.275  1.00 25.64  ? 254 PRO A CG  1 
ATOM   2053 C CD  . PRO A 1 255 ? 0.675   87.445  65.662  1.00 25.44  ? 254 PRO A CD  1 
ATOM   2054 N N   . LEU A 1 256 ? 4.021   87.055  67.220  1.00 29.73  ? 255 LEU A N   1 
ATOM   2055 C CA  . LEU A 1 256 ? 5.345   87.429  67.714  1.00 31.13  ? 255 LEU A CA  1 
ATOM   2056 C C   . LEU A 1 256 ? 5.966   86.315  68.534  1.00 31.89  ? 255 LEU A C   1 
ATOM   2057 O O   . LEU A 1 256 ? 5.280   85.664  69.320  1.00 32.16  ? 255 LEU A O   1 
ATOM   2058 C CB  . LEU A 1 256 ? 5.287   88.724  68.543  1.00 30.74  ? 255 LEU A CB  1 
ATOM   2059 C CG  . LEU A 1 256 ? 6.309   89.823  68.240  1.00 30.67  ? 255 LEU A CG  1 
ATOM   2060 C CD1 . LEU A 1 256 ? 6.686   89.923  66.749  1.00 28.54  ? 255 LEU A CD1 1 
ATOM   2061 C CD2 . LEU A 1 256 ? 5.809   91.168  68.768  1.00 29.03  ? 255 LEU A CD2 1 
ATOM   2062 N N   . ASP A 1 257 ? 7.266   86.105  68.321  1.00 33.13  ? 256 ASP A N   1 
ATOM   2063 C CA  . ASP A 1 257 ? 8.081   85.168  69.090  1.00 34.15  ? 256 ASP A CA  1 
ATOM   2064 C C   . ASP A 1 257 ? 8.509   85.787  70.439  1.00 33.68  ? 256 ASP A C   1 
ATOM   2065 O O   . ASP A 1 257 ? 8.194   86.949  70.724  1.00 33.86  ? 256 ASP A O   1 
ATOM   2066 C CB  . ASP A 1 257 ? 9.304   84.703  68.250  1.00 35.61  ? 256 ASP A CB  1 
ATOM   2067 C CG  . ASP A 1 257 ? 10.113  85.888  67.612  1.00 39.81  ? 256 ASP A CG  1 
ATOM   2068 O OD1 . ASP A 1 257 ? 9.720   86.385  66.519  1.00 43.74  ? 256 ASP A OD1 1 
ATOM   2069 O OD2 . ASP A 1 257 ? 11.168  86.369  68.114  1.00 42.63  ? 256 ASP A OD2 1 
ATOM   2070 N N   . GLU A 1 258 ? 9.219   85.022  71.268  1.00 32.91  ? 257 GLU A N   1 
ATOM   2071 C CA  . GLU A 1 258 ? 9.633   85.493  72.596  1.00 32.44  ? 257 GLU A CA  1 
ATOM   2072 C C   . GLU A 1 258 ? 10.401  86.832  72.593  1.00 30.68  ? 257 GLU A C   1 
ATOM   2073 O O   . GLU A 1 258 ? 10.126  87.708  73.420  1.00 29.98  ? 257 GLU A O   1 
ATOM   2074 C CB  . GLU A 1 258 ? 10.463  84.413  73.322  1.00 33.31  ? 257 GLU A CB  1 
ATOM   2075 C CG  . GLU A 1 258 ? 10.105  84.241  74.796  1.00 37.76  ? 257 GLU A CG  1 
ATOM   2076 C CD  . GLU A 1 258 ? 11.104  83.390  75.592  1.00 44.18  ? 257 GLU A CD  1 
ATOM   2077 O OE1 . GLU A 1 258 ? 11.337  83.718  76.787  1.00 46.22  ? 257 GLU A OE1 1 
ATOM   2078 O OE2 . GLU A 1 258 ? 11.650  82.393  75.046  1.00 45.21  ? 257 GLU A OE2 1 
ATOM   2079 N N   . ASP A 1 259 ? 11.362  86.975  71.678  1.00 29.02  ? 258 ASP A N   1 
ATOM   2080 C CA  . ASP A 1 259 ? 12.240  88.148  71.637  1.00 28.04  ? 258 ASP A CA  1 
ATOM   2081 C C   . ASP A 1 259 ? 11.451  89.407  71.258  1.00 26.49  ? 258 ASP A C   1 
ATOM   2082 O O   . ASP A 1 259 ? 11.553  90.428  71.926  1.00 25.80  ? 258 ASP A O   1 
ATOM   2083 C CB  . ASP A 1 259 ? 13.416  87.920  70.667  1.00 28.41  ? 258 ASP A CB  1 
ATOM   2084 C CG  . ASP A 1 259 ? 14.461  86.939  71.213  1.00 31.36  ? 258 ASP A CG  1 
ATOM   2085 O OD1 . ASP A 1 259 ? 14.500  86.717  72.448  1.00 33.42  ? 258 ASP A OD1 1 
ATOM   2086 O OD2 . ASP A 1 259 ? 15.296  86.347  70.477  1.00 34.53  ? 258 ASP A OD2 1 
ATOM   2087 N N   . GLY A 1 260 ? 10.654  89.299  70.197  1.00 25.55  ? 259 GLY A N   1 
ATOM   2088 C CA  . GLY A 1 260 ? 9.751   90.350  69.748  1.00 24.93  ? 259 GLY A CA  1 
ATOM   2089 C C   . GLY A 1 260 ? 8.820   90.807  70.843  1.00 24.80  ? 259 GLY A C   1 
ATOM   2090 O O   . GLY A 1 260 ? 8.723   92.006  71.108  1.00 24.22  ? 259 GLY A O   1 
ATOM   2091 N N   . ARG A 1 261 ? 8.156   89.845  71.491  1.00 24.62  ? 260 ARG A N   1 
ATOM   2092 C CA  . ARG A 1 261 ? 7.293   90.135  72.635  1.00 24.81  ? 260 ARG A CA  1 
ATOM   2093 C C   . ARG A 1 261 ? 8.046   90.846  73.741  1.00 23.87  ? 260 ARG A C   1 
ATOM   2094 O O   . ARG A 1 261 ? 7.534   91.774  74.333  1.00 24.44  ? 260 ARG A O   1 
ATOM   2095 C CB  . ARG A 1 261 ? 6.705   88.850  73.214  1.00 24.91  ? 260 ARG A CB  1 
ATOM   2096 C CG  . ARG A 1 261 ? 5.465   88.351  72.517  1.00 26.99  ? 260 ARG A CG  1 
ATOM   2097 C CD  . ARG A 1 261 ? 4.602   87.434  73.387  1.00 30.16  ? 260 ARG A CD  1 
ATOM   2098 N NE  . ARG A 1 261 ? 5.350   86.317  73.966  1.00 30.41  ? 260 ARG A NE  1 
ATOM   2099 C CZ  . ARG A 1 261 ? 5.652   85.204  73.320  1.00 32.82  ? 260 ARG A CZ  1 
ATOM   2100 N NH1 . ARG A 1 261 ? 5.272   85.032  72.060  1.00 33.78  ? 260 ARG A NH1 1 
ATOM   2101 N NH2 . ARG A 1 261 ? 6.342   84.251  73.935  1.00 33.40  ? 260 ARG A NH2 1 
ATOM   2102 N N   . SER A 1 262 ? 9.245   90.374  74.046  1.00 23.15  ? 261 SER A N   1 
ATOM   2103 C CA  . SER A 1 262 ? 10.085  91.011  75.057  1.00 23.08  ? 261 SER A CA  1 
ATOM   2104 C C   . SER A 1 262 ? 10.361  92.475  74.684  1.00 22.14  ? 261 SER A C   1 
ATOM   2105 O O   . SER A 1 262 ? 10.189  93.361  75.515  1.00 21.95  ? 261 SER A O   1 
ATOM   2106 C CB  . SER A 1 262 ? 11.408  90.248  75.228  1.00 23.35  ? 261 SER A CB  1 
ATOM   2107 O OG  . SER A 1 262 ? 12.357  91.050  75.915  1.00 25.86  ? 261 SER A OG  1 
ATOM   2108 N N   . LEU A 1 263 ? 10.766  92.705  73.433  1.00 21.13  ? 262 LEU A N   1 
ATOM   2109 C CA  . LEU A 1 263 ? 11.073  94.044  72.957  1.00 21.44  ? 262 LEU A CA  1 
ATOM   2110 C C   . LEU A 1 263 ? 9.829   94.942  72.927  1.00 21.64  ? 262 LEU A C   1 
ATOM   2111 O O   . LEU A 1 263 ? 9.853   96.062  73.449  1.00 20.96  ? 262 LEU A O   1 
ATOM   2112 C CB  . LEU A 1 263 ? 11.735  93.996  71.570  1.00 21.37  ? 262 LEU A CB  1 
ATOM   2113 C CG  . LEU A 1 263 ? 11.956  95.370  70.927  1.00 21.30  ? 262 LEU A CG  1 
ATOM   2114 C CD1 . LEU A 1 263 ? 12.815  96.312  71.848  1.00 20.81  ? 262 LEU A CD1 1 
ATOM   2115 C CD2 . LEU A 1 263 ? 12.542  95.226  69.526  1.00 18.98  ? 262 LEU A CD2 1 
ATOM   2116 N N   . LEU A 1 264 ? 8.746   94.440  72.336  1.00 21.58  ? 263 LEU A N   1 
ATOM   2117 C CA  . LEU A 1 264 ? 7.484   95.169  72.322  1.00 22.48  ? 263 LEU A CA  1 
ATOM   2118 C C   . LEU A 1 264 ? 7.045   95.570  73.717  1.00 23.31  ? 263 LEU A C   1 
ATOM   2119 O O   . LEU A 1 264 ? 6.668   96.735  73.946  1.00 24.21  ? 263 LEU A O   1 
ATOM   2120 C CB  . LEU A 1 264 ? 6.388   94.352  71.646  1.00 22.84  ? 263 LEU A CB  1 
ATOM   2121 C CG  . LEU A 1 264 ? 5.050   95.059  71.469  1.00 23.21  ? 263 LEU A CG  1 
ATOM   2122 C CD1 . LEU A 1 264 ? 5.168   96.273  70.551  1.00 20.08  ? 263 LEU A CD1 1 
ATOM   2123 C CD2 . LEU A 1 264 ? 4.074   94.050  70.902  1.00 24.95  ? 263 LEU A CD2 1 
ATOM   2124 N N   . SER A 1 265 ? 7.129   94.644  74.670  1.00 23.23  ? 264 SER A N   1 
ATOM   2125 C CA  . SER A 1 265 ? 6.777   94.985  76.055  1.00 23.58  ? 264 SER A CA  1 
ATOM   2126 C C   . SER A 1 265 ? 7.673   96.055  76.684  1.00 23.00  ? 264 SER A C   1 
ATOM   2127 O O   . SER A 1 265 ? 7.268   96.762  77.586  1.00 23.75  ? 264 SER A O   1 
ATOM   2128 C CB  . SER A 1 265 ? 6.690   93.722  76.945  1.00 23.76  ? 264 SER A CB  1 
ATOM   2129 O OG  . SER A 1 265 ? 7.981   93.227  77.298  1.00 26.44  ? 264 SER A OG  1 
ATOM   2130 N N   . GLN A 1 266 ? 8.891   96.207  76.205  1.00 23.14  ? 265 GLN A N   1 
ATOM   2131 C CA  . GLN A 1 266 ? 9.751   97.262  76.752  1.00 22.24  ? 265 GLN A CA  1 
ATOM   2132 C C   . GLN A 1 266 ? 9.432   98.645  76.155  1.00 21.26  ? 265 GLN A C   1 
ATOM   2133 O O   . GLN A 1 266 ? 9.574   99.658  76.836  1.00 20.92  ? 265 GLN A O   1 
ATOM   2134 C CB  . GLN A 1 266 ? 11.229  96.869  76.624  1.00 22.74  ? 265 GLN A CB  1 
ATOM   2135 C CG  . GLN A 1 266 ? 11.582  95.686  77.556  1.00 23.81  ? 265 GLN A CG  1 
ATOM   2136 C CD  . GLN A 1 266 ? 12.980  95.173  77.372  1.00 25.77  ? 265 GLN A CD  1 
ATOM   2137 O OE1 . GLN A 1 266 ? 13.181  94.055  76.891  1.00 26.76  ? 265 GLN A OE1 1 
ATOM   2138 N NE2 . GLN A 1 266 ? 13.960  95.974  77.775  1.00 26.66  ? 265 GLN A NE2 1 
ATOM   2139 N N   . MET A 1 267 ? 8.967   98.659  74.909  1.00 20.80  ? 266 MET A N   1 
ATOM   2140 C CA  . MET A 1 267 ? 8.488   99.865  74.200  1.00 20.95  ? 266 MET A CA  1 
ATOM   2141 C C   . MET A 1 267 ? 7.110   100.378 74.666  1.00 21.52  ? 266 MET A C   1 
ATOM   2142 O O   . MET A 1 267 ? 6.777   101.549 74.484  1.00 21.52  ? 266 MET A O   1 
ATOM   2143 C CB  . MET A 1 267 ? 8.466   99.595  72.684  1.00 20.64  ? 266 MET A CB  1 
ATOM   2144 C CG  . MET A 1 267 ? 9.827   99.186  72.141  1.00 20.45  ? 266 MET A CG  1 
ATOM   2145 S SD  . MET A 1 267 ? 9.881   98.775  70.373  1.00 22.61  ? 266 MET A SD  1 
ATOM   2146 C CE  . MET A 1 267 ? 10.051  100.394 69.663  1.00 22.22  ? 266 MET A CE  1 
ATOM   2147 N N   . LEU A 1 268 ? 6.336   99.500  75.304  1.00 22.61  ? 267 LEU A N   1 
ATOM   2148 C CA  . LEU A 1 268 ? 4.985   99.798  75.765  1.00 23.16  ? 267 LEU A CA  1 
ATOM   2149 C C   . LEU A 1 268 ? 4.867   99.807  77.277  1.00 23.90  ? 267 LEU A C   1 
ATOM   2150 O O   . LEU A 1 268 ? 3.769   99.692  77.831  1.00 23.70  ? 267 LEU A O   1 
ATOM   2151 C CB  . LEU A 1 268 ? 3.998   98.809  75.170  1.00 23.26  ? 267 LEU A CB  1 
ATOM   2152 C CG  . LEU A 1 268 ? 3.806   98.898  73.653  1.00 23.51  ? 267 LEU A CG  1 
ATOM   2153 C CD1 . LEU A 1 268 ? 2.725   97.926  73.225  1.00 22.92  ? 267 LEU A CD1 1 
ATOM   2154 C CD2 . LEU A 1 268 ? 3.446   100.311 73.233  1.00 22.23  ? 267 LEU A CD2 1 
ATOM   2155 N N   . HIS A 1 269 ? 6.006   99.955  77.947  1.00 24.63  ? 268 HIS A N   1 
ATOM   2156 C CA  . HIS A 1 269 ? 6.025   100.171 79.384  1.00 24.98  ? 268 HIS A CA  1 
ATOM   2157 C C   . HIS A 1 269 ? 5.254   101.430 79.744  1.00 24.81  ? 268 HIS A C   1 
ATOM   2158 O O   . HIS A 1 269 ? 5.470   102.480 79.147  1.00 24.75  ? 268 HIS A O   1 
ATOM   2159 C CB  . HIS A 1 269 ? 7.457   100.341 79.869  1.00 25.83  ? 268 HIS A CB  1 
ATOM   2160 C CG  . HIS A 1 269 ? 7.726   99.669  81.171  1.00 29.10  ? 268 HIS A CG  1 
ATOM   2161 N ND1 . HIS A 1 269 ? 8.095   98.342  81.259  1.00 32.94  ? 268 HIS A ND1 1 
ATOM   2162 C CD2 . HIS A 1 269 ? 7.659   100.131 82.443  1.00 31.91  ? 268 HIS A CD2 1 
ATOM   2163 C CE1 . HIS A 1 269 ? 8.256   98.021  82.535  1.00 34.40  ? 268 HIS A CE1 1 
ATOM   2164 N NE2 . HIS A 1 269 ? 7.998   99.087  83.273  1.00 32.88  ? 268 HIS A NE2 1 
ATOM   2165 N N   . TYR A 1 270 ? 4.379   101.330 80.741  1.00 24.52  ? 269 TYR A N   1 
ATOM   2166 C CA  . TYR A 1 270 ? 3.620   102.490 81.202  1.00 24.34  ? 269 TYR A CA  1 
ATOM   2167 C C   . TYR A 1 270 ? 4.502   103.646 81.618  1.00 24.55  ? 269 TYR A C   1 
ATOM   2168 O O   . TYR A 1 270 ? 4.285   104.777 81.177  1.00 24.52  ? 269 TYR A O   1 
ATOM   2169 C CB  . TYR A 1 270 ? 2.680   102.124 82.355  1.00 23.65  ? 269 TYR A CB  1 
ATOM   2170 C CG  . TYR A 1 270 ? 1.365   101.642 81.848  1.00 23.79  ? 269 TYR A CG  1 
ATOM   2171 C CD1 . TYR A 1 270 ? 0.576   102.466 81.038  1.00 23.37  ? 269 TYR A CD1 1 
ATOM   2172 C CD2 . TYR A 1 270 ? 0.917   100.360 82.126  1.00 22.51  ? 269 TYR A CD2 1 
ATOM   2173 C CE1 . TYR A 1 270 ? -0.618  102.042 80.547  1.00 23.24  ? 269 TYR A CE1 1 
ATOM   2174 C CE2 . TYR A 1 270 ? -0.292  99.918  81.617  1.00 23.70  ? 269 TYR A CE2 1 
ATOM   2175 C CZ  . TYR A 1 270 ? -1.056  100.771 80.835  1.00 22.74  ? 269 TYR A CZ  1 
ATOM   2176 O OH  . TYR A 1 270 ? -2.255  100.359 80.317  1.00 22.09  ? 269 TYR A OH  1 
ATOM   2177 N N   . ASP A 1 271 ? 5.478   103.359 82.479  1.00 24.85  ? 270 ASP A N   1 
ATOM   2178 C CA  . ASP A 1 271 ? 6.296   104.388 83.119  1.00 25.57  ? 270 ASP A CA  1 
ATOM   2179 C C   . ASP A 1 271 ? 7.348   104.906 82.131  1.00 25.69  ? 270 ASP A C   1 
ATOM   2180 O O   . ASP A 1 271 ? 8.235   104.158 81.742  1.00 24.95  ? 270 ASP A O   1 
ATOM   2181 C CB  . ASP A 1 271 ? 6.961   103.780 84.355  1.00 26.02  ? 270 ASP A CB  1 
ATOM   2182 C CG  . ASP A 1 271 ? 7.813   104.763 85.133  1.00 28.00  ? 270 ASP A CG  1 
ATOM   2183 O OD1 . ASP A 1 271 ? 8.226   105.828 84.616  1.00 30.31  ? 270 ASP A OD1 1 
ATOM   2184 O OD2 . ASP A 1 271 ? 8.122   104.535 86.319  1.00 33.25  ? 270 ASP A OD2 1 
ATOM   2185 N N   . PRO A 1 272 ? 7.260   106.170 81.717  1.00 26.59  ? 271 PRO A N   1 
ATOM   2186 C CA  . PRO A 1 272 ? 8.205   106.713 80.728  1.00 27.36  ? 271 PRO A CA  1 
ATOM   2187 C C   . PRO A 1 272 ? 9.650   106.428 81.099  1.00 28.05  ? 271 PRO A C   1 
ATOM   2188 O O   . PRO A 1 272 ? 10.433  106.107 80.223  1.00 28.05  ? 271 PRO A O   1 
ATOM   2189 C CB  . PRO A 1 272 ? 7.929   108.213 80.773  1.00 27.05  ? 271 PRO A CB  1 
ATOM   2190 C CG  . PRO A 1 272 ? 6.504   108.280 81.090  1.00 27.48  ? 271 PRO A CG  1 
ATOM   2191 C CD  . PRO A 1 272 ? 6.276   107.185 82.125  1.00 26.74  ? 271 PRO A CD  1 
ATOM   2192 N N   . ASN A 1 273 ? 9.988   106.508 82.381  1.00 28.97  ? 272 ASN A N   1 
ATOM   2193 C CA  . ASN A 1 273 ? 11.359  106.247 82.802  1.00 29.96  ? 272 ASN A CA  1 
ATOM   2194 C C   . ASN A 1 273 ? 11.889  104.826 82.548  1.00 29.29  ? 272 ASN A C   1 
ATOM   2195 O O   . ASN A 1 273 ? 13.068  104.681 82.228  1.00 30.30  ? 272 ASN A O   1 
ATOM   2196 C CB  . ASN A 1 273 ? 11.623  106.765 84.225  1.00 30.52  ? 272 ASN A CB  1 
ATOM   2197 C CG  . ASN A 1 273 ? 11.847  108.278 84.245  1.00 35.04  ? 272 ASN A CG  1 
ATOM   2198 O OD1 . ASN A 1 273 ? 11.999  108.917 83.172  1.00 39.88  ? 272 ASN A OD1 1 
ATOM   2199 N ND2 . ASN A 1 273 ? 11.868  108.872 85.447  1.00 36.89  ? 272 ASN A ND2 1 
ATOM   2200 N N   . LYS A 1 274 ? 11.038  103.795 82.629  1.00 28.07  ? 273 LYS A N   1 
ATOM   2201 C CA  . LYS A 1 274 ? 11.474  102.412 82.320  1.00 26.62  ? 273 LYS A CA  1 
ATOM   2202 C C   . LYS A 1 274 ? 11.282  101.980 80.880  1.00 24.97  ? 273 LYS A C   1 
ATOM   2203 O O   . LYS A 1 274 ? 11.893  100.992 80.452  1.00 24.70  ? 273 LYS A O   1 
ATOM   2204 C CB  . LYS A 1 274 ? 10.784  101.357 83.195  1.00 27.49  ? 273 LYS A CB  1 
ATOM   2205 C CG  . LYS A 1 274 ? 10.152  101.874 84.444  1.00 30.49  ? 273 LYS A CG  1 
ATOM   2206 C CD  . LYS A 1 274 ? 10.506  100.994 85.639  1.00 37.25  ? 273 LYS A CD  1 
ATOM   2207 C CE  . LYS A 1 274 ? 11.849  101.419 86.285  1.00 40.49  ? 273 LYS A CE  1 
ATOM   2208 N NZ  . LYS A 1 274 ? 12.291  102.809 85.897  1.00 42.31  ? 273 LYS A NZ  1 
ATOM   2209 N N   . ARG A 1 275 ? 10.404  102.667 80.151  1.00 22.43  ? 274 ARG A N   1 
ATOM   2210 C CA  . ARG A 1 275 ? 10.221  102.393 78.732  1.00 21.08  ? 274 ARG A CA  1 
ATOM   2211 C C   . ARG A 1 275 ? 11.601  102.413 78.093  1.00 20.37  ? 274 ARG A C   1 
ATOM   2212 O O   . ARG A 1 275 ? 12.423  103.279 78.414  1.00 20.27  ? 274 ARG A O   1 
ATOM   2213 C CB  . ARG A 1 275 ? 9.309   103.454 78.089  1.00 20.16  ? 274 ARG A CB  1 
ATOM   2214 C CG  . ARG A 1 275 ? 8.571   102.989 76.829  1.00 20.04  ? 274 ARG A CG  1 
ATOM   2215 C CD  . ARG A 1 275 ? 7.463   103.955 76.379  1.00 19.11  ? 274 ARG A CD  1 
ATOM   2216 N NE  . ARG A 1 275 ? 6.548   104.288 77.478  1.00 16.59  ? 274 ARG A NE  1 
ATOM   2217 C CZ  . ARG A 1 275 ? 5.958   105.452 77.621  1.00 18.35  ? 274 ARG A CZ  1 
ATOM   2218 N NH1 . ARG A 1 275 ? 6.179   106.415 76.728  1.00 16.95  ? 274 ARG A NH1 1 
ATOM   2219 N NH2 . ARG A 1 275 ? 5.139   105.664 78.659  1.00 17.82  ? 274 ARG A NH2 1 
ATOM   2220 N N   . ILE A 1 276 ? 11.882  101.457 77.222  1.00 19.51  ? 275 ILE A N   1 
ATOM   2221 C CA  . ILE A 1 276 ? 13.233  101.361 76.666  1.00 19.22  ? 275 ILE A CA  1 
ATOM   2222 C C   . ILE A 1 276 ? 13.558  102.591 75.779  1.00 19.65  ? 275 ILE A C   1 
ATOM   2223 O O   . ILE A 1 276 ? 12.656  103.191 75.177  1.00 20.35  ? 275 ILE A O   1 
ATOM   2224 C CB  . ILE A 1 276 ? 13.376  100.030 75.922  1.00 19.51  ? 275 ILE A CB  1 
ATOM   2225 C CG1 . ILE A 1 276 ? 14.842  99.703  75.590  1.00 19.79  ? 275 ILE A CG1 1 
ATOM   2226 C CG2 . ILE A 1 276 ? 12.441  99.965  74.699  1.00 17.39  ? 275 ILE A CG2 1 
ATOM   2227 C CD1 . ILE A 1 276 ? 15.026  98.282  75.076  1.00 18.07  ? 275 ILE A CD1 1 
ATOM   2228 N N   . SER A 1 277 ? 14.820  102.998 75.743  1.00 19.16  ? 276 SER A N   1 
ATOM   2229 C CA  . SER A 1 277 ? 15.259  104.051 74.844  1.00 19.72  ? 276 SER A CA  1 
ATOM   2230 C C   . SER A 1 277 ? 15.581  103.426 73.486  1.00 19.68  ? 276 SER A C   1 
ATOM   2231 O O   . SER A 1 277 ? 15.907  102.241 73.407  1.00 19.79  ? 276 SER A O   1 
ATOM   2232 C CB  . SER A 1 277 ? 16.491  104.754 75.414  1.00 19.51  ? 276 SER A CB  1 
ATOM   2233 O OG  . SER A 1 277 ? 17.605  103.902 75.343  1.00 20.00  ? 276 SER A OG  1 
ATOM   2234 N N   . ALA A 1 278 ? 15.485  104.205 72.417  1.00 20.16  ? 277 ALA A N   1 
ATOM   2235 C CA  . ALA A 1 278 ? 15.797  103.690 71.079  1.00 20.40  ? 277 ALA A CA  1 
ATOM   2236 C C   . ALA A 1 278 ? 17.218  103.115 71.015  1.00 21.03  ? 277 ALA A C   1 
ATOM   2237 O O   . ALA A 1 278 ? 17.485  102.127 70.338  1.00 21.19  ? 277 ALA A O   1 
ATOM   2238 C CB  . ALA A 1 278 ? 15.638  104.773 70.060  1.00 19.71  ? 277 ALA A CB  1 
ATOM   2239 N N   . LYS A 1 279 ? 18.124  103.774 71.717  1.00 21.92  ? 278 LYS A N   1 
ATOM   2240 C CA  . LYS A 1 279 ? 19.518  103.391 71.806  1.00 22.53  ? 278 LYS A CA  1 
ATOM   2241 C C   . LYS A 1 279 ? 19.633  101.992 72.410  1.00 22.36  ? 278 LYS A C   1 
ATOM   2242 O O   . LYS A 1 279 ? 20.200  101.077 71.793  1.00 21.87  ? 278 LYS A O   1 
ATOM   2243 C CB  . LYS A 1 279 ? 20.201  104.423 72.695  1.00 23.46  ? 278 LYS A CB  1 
ATOM   2244 C CG  . LYS A 1 279 ? 21.634  104.163 73.008  1.00 25.82  ? 278 LYS A CG  1 
ATOM   2245 C CD  . LYS A 1 279 ? 22.364  105.465 72.984  1.00 29.05  ? 278 LYS A CD  1 
ATOM   2246 C CE  . LYS A 1 279 ? 22.324  106.106 74.336  1.00 32.22  ? 278 LYS A CE  1 
ATOM   2247 N NZ  . LYS A 1 279 ? 23.469  107.046 74.428  1.00 36.57  ? 278 LYS A NZ  1 
ATOM   2248 N N   . ALA A 1 280 ? 19.067  101.830 73.608  1.00 22.07  ? 279 ALA A N   1 
ATOM   2249 C CA  . ALA A 1 280 ? 19.065  100.546 74.300  1.00 21.92  ? 279 ALA A CA  1 
ATOM   2250 C C   . ALA A 1 280 ? 18.411  99.436  73.483  1.00 21.82  ? 279 ALA A C   1 
ATOM   2251 O O   . ALA A 1 280 ? 18.861  98.301  73.515  1.00 22.37  ? 279 ALA A O   1 
ATOM   2252 C CB  . ALA A 1 280 ? 18.399  100.676 75.670  1.00 22.10  ? 279 ALA A CB  1 
ATOM   2253 N N   . ALA A 1 281 ? 17.374  99.759  72.722  1.00 21.80  ? 280 ALA A N   1 
ATOM   2254 C CA  . ALA A 1 281 ? 16.675  98.731  71.947  1.00 21.21  ? 280 ALA A CA  1 
ATOM   2255 C C   . ALA A 1 281 ? 17.484  98.186  70.792  1.00 20.84  ? 280 ALA A C   1 
ATOM   2256 O O   . ALA A 1 281 ? 17.232  97.078  70.333  1.00 19.98  ? 280 ALA A O   1 
ATOM   2257 C CB  . ALA A 1 281 ? 15.326  99.241  71.447  1.00 21.30  ? 280 ALA A CB  1 
ATOM   2258 N N   . LEU A 1 282 ? 18.440  98.964  70.293  1.00 20.78  ? 281 LEU A N   1 
ATOM   2259 C CA  . LEU A 1 282 ? 19.264  98.479  69.188  1.00 21.13  ? 281 LEU A CA  1 
ATOM   2260 C C   . LEU A 1 282 ? 20.017  97.186  69.550  1.00 21.62  ? 281 LEU A C   1 
ATOM   2261 O O   . LEU A 1 282 ? 20.248  96.326  68.704  1.00 22.11  ? 281 LEU A O   1 
ATOM   2262 C CB  . LEU A 1 282 ? 20.238  99.558  68.739  1.00 21.05  ? 281 LEU A CB  1 
ATOM   2263 C CG  . LEU A 1 282 ? 19.589  100.685 67.937  1.00 21.20  ? 281 LEU A CG  1 
ATOM   2264 C CD1 . LEU A 1 282 ? 20.566  101.841 67.788  1.00 21.64  ? 281 LEU A CD1 1 
ATOM   2265 C CD2 . LEU A 1 282 ? 19.117  100.178 66.566  1.00 17.77  ? 281 LEU A CD2 1 
ATOM   2266 N N   . ALA A 1 283 ? 20.370  97.044  70.814  1.00 21.79  ? 282 ALA A N   1 
ATOM   2267 C CA  . ALA A 1 283 ? 21.086  95.866  71.272  1.00 23.24  ? 282 ALA A CA  1 
ATOM   2268 C C   . ALA A 1 283 ? 20.158  94.709  71.668  1.00 23.89  ? 282 ALA A C   1 
ATOM   2269 O O   . ALA A 1 283 ? 20.616  93.720  72.219  1.00 24.63  ? 282 ALA A O   1 
ATOM   2270 C CB  . ALA A 1 283 ? 21.988  96.239  72.445  1.00 22.76  ? 282 ALA A CB  1 
ATOM   2271 N N   . HIS A 1 284 ? 18.858  94.818  71.401  1.00 24.66  ? 283 HIS A N   1 
ATOM   2272 C CA  . HIS A 1 284 ? 17.938  93.758  71.833  1.00 24.56  ? 283 HIS A CA  1 
ATOM   2273 C C   . HIS A 1 284 ? 18.195  92.481  71.034  1.00 24.82  ? 283 HIS A C   1 
ATOM   2274 O O   . HIS A 1 284 ? 18.458  92.558  69.833  1.00 25.76  ? 283 HIS A O   1 
ATOM   2275 C CB  . HIS A 1 284 ? 16.473  94.205  71.719  1.00 24.00  ? 283 HIS A CB  1 
ATOM   2276 C CG  . HIS A 1 284 ? 15.524  93.386  72.539  1.00 22.39  ? 283 HIS A CG  1 
ATOM   2277 N ND1 . HIS A 1 284 ? 15.013  92.182  72.102  1.00 20.29  ? 283 HIS A ND1 1 
ATOM   2278 C CD2 . HIS A 1 284 ? 14.992  93.596  73.767  1.00 19.63  ? 283 HIS A CD2 1 
ATOM   2279 C CE1 . HIS A 1 284 ? 14.218  91.680  73.028  1.00 17.94  ? 283 HIS A CE1 1 
ATOM   2280 N NE2 . HIS A 1 284 ? 14.178  92.523  74.044  1.00 19.37  ? 283 HIS A NE2 1 
ATOM   2281 N N   . PRO A 1 285 ? 18.145  91.319  71.696  1.00 24.91  ? 284 PRO A N   1 
ATOM   2282 C CA  . PRO A 1 285 ? 18.241  90.017  71.015  1.00 24.65  ? 284 PRO A CA  1 
ATOM   2283 C C   . PRO A 1 285 ? 17.256  89.832  69.868  1.00 24.53  ? 284 PRO A C   1 
ATOM   2284 O O   . PRO A 1 285 ? 17.511  88.989  68.995  1.00 24.02  ? 284 PRO A O   1 
ATOM   2285 C CB  . PRO A 1 285 ? 17.926  88.997  72.118  1.00 24.71  ? 284 PRO A CB  1 
ATOM   2286 C CG  . PRO A 1 285 ? 17.706  89.752  73.355  1.00 24.53  ? 284 PRO A CG  1 
ATOM   2287 C CD  . PRO A 1 285 ? 18.064  91.170  73.160  1.00 25.01  ? 284 PRO A CD  1 
ATOM   2288 N N   . PHE A 1 286 ? 16.162  90.597  69.855  1.00 24.02  ? 285 PHE A N   1 
ATOM   2289 C CA  . PHE A 1 286 ? 15.238  90.543  68.726  1.00 23.96  ? 285 PHE A CA  1 
ATOM   2290 C C   . PHE A 1 286 ? 15.972  90.760  67.432  1.00 24.30  ? 285 PHE A C   1 
ATOM   2291 O O   . PHE A 1 286 ? 15.592  90.207  66.427  1.00 24.78  ? 285 PHE A O   1 
ATOM   2292 C CB  . PHE A 1 286 ? 14.114  91.593  68.831  1.00 23.73  ? 285 PHE A CB  1 
ATOM   2293 C CG  . PHE A 1 286 ? 13.115  91.521  67.692  1.00 23.34  ? 285 PHE A CG  1 
ATOM   2294 C CD1 . PHE A 1 286 ? 12.398  90.352  67.459  1.00 20.44  ? 285 PHE A CD1 1 
ATOM   2295 C CD2 . PHE A 1 286 ? 12.912  92.607  66.846  1.00 23.27  ? 285 PHE A CD2 1 
ATOM   2296 C CE1 . PHE A 1 286 ? 11.487  90.269  66.422  1.00 20.43  ? 285 PHE A CE1 1 
ATOM   2297 C CE2 . PHE A 1 286 ? 11.995  92.540  65.803  1.00 23.29  ? 285 PHE A CE2 1 
ATOM   2298 C CZ  . PHE A 1 286 ? 11.274  91.354  65.593  1.00 22.44  ? 285 PHE A CZ  1 
ATOM   2299 N N   . PHE A 1 287 ? 17.022  91.579  67.459  1.00 25.48  ? 286 PHE A N   1 
ATOM   2300 C CA  . PHE A 1 287 ? 17.741  91.956  66.243  1.00 26.84  ? 286 PHE A CA  1 
ATOM   2301 C C   . PHE A 1 287 ? 19.010  91.144  65.965  1.00 29.53  ? 286 PHE A C   1 
ATOM   2302 O O   . PHE A 1 287 ? 19.786  91.499  65.056  1.00 29.55  ? 286 PHE A O   1 
ATOM   2303 C CB  . PHE A 1 287 ? 18.099  93.447  66.290  1.00 25.23  ? 286 PHE A CB  1 
ATOM   2304 C CG  . PHE A 1 287 ? 16.915  94.352  66.476  1.00 22.61  ? 286 PHE A CG  1 
ATOM   2305 C CD1 . PHE A 1 287 ? 15.965  94.499  65.467  1.00 21.79  ? 286 PHE A CD1 1 
ATOM   2306 C CD2 . PHE A 1 287 ? 16.742  95.051  67.654  1.00 19.26  ? 286 PHE A CD2 1 
ATOM   2307 C CE1 . PHE A 1 287 ? 14.877  95.353  65.632  1.00 18.87  ? 286 PHE A CE1 1 
ATOM   2308 C CE2 . PHE A 1 287 ? 15.664  95.887  67.834  1.00 18.68  ? 286 PHE A CE2 1 
ATOM   2309 C CZ  . PHE A 1 287 ? 14.733  96.052  66.807  1.00 17.80  ? 286 PHE A CZ  1 
ATOM   2310 N N   . GLN A 1 288 ? 19.231  90.071  66.729  1.00 32.53  ? 287 GLN A N   1 
ATOM   2311 C CA  . GLN A 1 288 ? 20.484  89.316  66.632  1.00 36.14  ? 287 GLN A CA  1 
ATOM   2312 C C   . GLN A 1 288 ? 20.851  88.866  65.215  1.00 38.34  ? 287 GLN A C   1 
ATOM   2313 O O   . GLN A 1 288 ? 22.028  88.702  64.903  1.00 39.19  ? 287 GLN A O   1 
ATOM   2314 C CB  . GLN A 1 288 ? 20.545  88.146  67.637  1.00 36.00  ? 287 GLN A CB  1 
ATOM   2315 C CG  . GLN A 1 288 ? 19.434  87.080  67.546  1.00 38.26  ? 287 GLN A CG  1 
ATOM   2316 C CD  . GLN A 1 288 ? 19.419  86.148  68.774  1.00 39.84  ? 287 GLN A CD  1 
ATOM   2317 O OE1 . GLN A 1 288 ? 20.457  85.623  69.168  1.00 41.92  ? 287 GLN A OE1 1 
ATOM   2318 N NE2 . GLN A 1 288 ? 18.250  85.952  69.366  1.00 39.86  ? 287 GLN A NE2 1 
ATOM   2319 N N   . ASP A 1 289 ? 19.859  88.732  64.346  1.00 41.26  ? 288 ASP A N   1 
ATOM   2320 C CA  . ASP A 1 289 ? 20.064  88.180  63.005  1.00 44.70  ? 288 ASP A CA  1 
ATOM   2321 C C   . ASP A 1 289 ? 19.601  89.140  61.908  1.00 46.47  ? 288 ASP A C   1 
ATOM   2322 O O   . ASP A 1 289 ? 19.325  88.720  60.776  1.00 46.62  ? 288 ASP A O   1 
ATOM   2323 C CB  . ASP A 1 289 ? 19.235  86.908  62.895  1.00 45.20  ? 288 ASP A CB  1 
ATOM   2324 C CG  . ASP A 1 289 ? 17.758  87.171  63.169  1.00 47.99  ? 288 ASP A CG  1 
ATOM   2325 O OD1 . ASP A 1 289 ? 16.940  86.921  62.250  1.00 51.72  ? 288 ASP A OD1 1 
ATOM   2326 O OD2 . ASP A 1 289 ? 17.333  87.668  64.253  1.00 49.01  ? 288 ASP A OD2 1 
ATOM   2327 N N   . VAL A 1 290 ? 19.489  90.421  62.251  1.00 49.02  ? 289 VAL A N   1 
ATOM   2328 C CA  . VAL A 1 290 ? 18.917  91.399  61.341  1.00 51.51  ? 289 VAL A CA  1 
ATOM   2329 C C   . VAL A 1 290 ? 19.779  91.551  60.089  1.00 54.30  ? 289 VAL A C   1 
ATOM   2330 O O   . VAL A 1 290 ? 21.001  91.668  60.155  1.00 54.18  ? 289 VAL A O   1 
ATOM   2331 C CB  . VAL A 1 290 ? 18.599  92.753  62.045  1.00 50.90  ? 289 VAL A CB  1 
ATOM   2332 C CG1 . VAL A 1 290 ? 19.838  93.617  62.203  1.00 50.53  ? 289 VAL A CG1 1 
ATOM   2333 C CG2 . VAL A 1 290 ? 17.520  93.498  61.297  1.00 50.38  ? 289 VAL A CG2 1 
ATOM   2334 N N   . THR A 1 291 ? 19.106  91.471  58.951  1.00 58.12  ? 290 THR A N   1 
ATOM   2335 C CA  . THR A 1 291 ? 19.675  91.748  57.647  1.00 62.05  ? 290 THR A CA  1 
ATOM   2336 C C   . THR A 1 291 ? 18.880  92.945  57.155  1.00 65.29  ? 290 THR A C   1 
ATOM   2337 O O   . THR A 1 291 ? 17.936  93.370  57.829  1.00 65.36  ? 290 THR A O   1 
ATOM   2338 C CB  . THR A 1 291 ? 19.508  90.510  56.700  1.00 61.81  ? 290 THR A CB  1 
ATOM   2339 O OG1 . THR A 1 291 ? 18.721  90.858  55.550  1.00 61.64  ? 290 THR A OG1 1 
ATOM   2340 C CG2 . THR A 1 291 ? 18.672  89.407  57.356  1.00 61.53  ? 290 THR A CG2 1 
ATOM   2341 N N   . LYS A 1 292 ? 19.253  93.508  56.010  1.00 69.64  ? 291 LYS A N   1 
ATOM   2342 C CA  . LYS A 1 292 ? 18.406  94.507  55.365  1.00 74.18  ? 291 LYS A CA  1 
ATOM   2343 C C   . LYS A 1 292 ? 17.737  93.909  54.121  1.00 78.20  ? 291 LYS A C   1 
ATOM   2344 O O   . LYS A 1 292 ? 18.159  94.195  52.994  1.00 78.21  ? 291 LYS A O   1 
ATOM   2345 C CB  . LYS A 1 292 ? 19.198  95.773  55.017  1.00 73.73  ? 291 LYS A CB  1 
ATOM   2346 C CG  . LYS A 1 292 ? 18.342  96.936  54.510  1.00 73.31  ? 291 LYS A CG  1 
ATOM   2347 C CD  . LYS A 1 292 ? 19.070  98.271  54.644  1.00 72.41  ? 291 LYS A CD  1 
ATOM   2348 C CE  . LYS A 1 292 ? 18.796  99.170  53.448  1.00 71.73  ? 291 LYS A CE  1 
ATOM   2349 N NZ  . LYS A 1 292 ? 19.225  100.572 53.712  1.00 71.41  ? 291 LYS A NZ  1 
ATOM   2350 N N   . PRO A 1 293 ? 16.702  93.082  54.308  1.00 82.48  ? 292 PRO A N   1 
ATOM   2351 C CA  . PRO A 1 293 ? 16.007  92.500  53.162  1.00 86.35  ? 292 PRO A CA  1 
ATOM   2352 C C   . PRO A 1 293 ? 15.385  93.623  52.357  1.00 90.67  ? 292 PRO A C   1 
ATOM   2353 O O   . PRO A 1 293 ? 14.832  94.578  52.901  1.00 90.94  ? 292 PRO A O   1 
ATOM   2354 C CB  . PRO A 1 293 ? 14.937  91.611  53.800  1.00 86.03  ? 292 PRO A CB  1 
ATOM   2355 C CG  . PRO A 1 293 ? 14.771  92.122  55.168  1.00 84.35  ? 292 PRO A CG  1 
ATOM   2356 C CD  . PRO A 1 293 ? 16.093  92.655  55.579  1.00 82.67  ? 292 PRO A CD  1 
ATOM   2357 N N   . VAL A 1 294 ? 15.531  93.515  51.051  1.00 95.99  ? 293 VAL A N   1 
ATOM   2358 C CA  . VAL A 1 294 ? 15.086  94.540  50.134  1.00 101.23 ? 293 VAL A CA  1 
ATOM   2359 C C   . VAL A 1 294 ? 13.810  93.985  49.498  1.00 105.10 ? 293 VAL A C   1 
ATOM   2360 O O   . VAL A 1 294 ? 13.900  93.207  48.550  1.00 105.41 ? 293 VAL A O   1 
ATOM   2361 C CB  . VAL A 1 294 ? 16.205  94.829  49.096  1.00 101.11 ? 293 VAL A CB  1 
ATOM   2362 C CG1 . VAL A 1 294 ? 15.822  95.916  48.142  1.00 101.51 ? 293 VAL A CG1 1 
ATOM   2363 C CG2 . VAL A 1 294 ? 17.516  95.190  49.800  1.00 101.64 ? 293 VAL A CG2 1 
ATOM   2364 N N   . PRO A 1 295 ? 12.642  94.378  50.033  1.00 109.10 ? 294 PRO A N   1 
ATOM   2365 C CA  . PRO A 1 295 ? 11.318  93.814  49.679  1.00 112.38 ? 294 PRO A CA  1 
ATOM   2366 C C   . PRO A 1 295 ? 11.034  93.573  48.179  1.00 115.65 ? 294 PRO A C   1 
ATOM   2367 O O   . PRO A 1 295 ? 11.981  93.298  47.448  1.00 116.13 ? 294 PRO A O   1 
ATOM   2368 C CB  . PRO A 1 295 ? 10.333  94.844  50.256  1.00 112.32 ? 294 PRO A CB  1 
ATOM   2369 C CG  . PRO A 1 295 ? 11.140  95.946  50.837  1.00 111.02 ? 294 PRO A CG  1 
ATOM   2370 C CD  . PRO A 1 295 ? 12.518  95.425  51.060  1.00 109.50 ? 294 PRO A CD  1 
ATOM   2371 N N   . HIS A 1 296 ? 9.776   93.633  47.727  1.00 119.27 ? 295 HIS A N   1 
ATOM   2372 C CA  . HIS A 1 296 ? 9.494   93.429  46.291  1.00 122.85 ? 295 HIS A CA  1 
ATOM   2373 C C   . HIS A 1 296 ? 8.700   94.530  45.509  1.00 124.10 ? 295 HIS A C   1 
ATOM   2374 O O   . HIS A 1 296 ? 8.027   94.205  44.525  1.00 124.58 ? 295 HIS A O   1 
ATOM   2375 C CB  . HIS A 1 296 ? 8.953   92.010  45.913  1.00 123.59 ? 295 HIS A CB  1 
ATOM   2376 C CG  . HIS A 1 296 ? 9.062   90.949  46.978  1.00 126.91 ? 295 HIS A CG  1 
ATOM   2377 N ND1 . HIS A 1 296 ? 8.150   89.914  47.072  1.00 129.82 ? 295 HIS A ND1 1 
ATOM   2378 C CD2 . HIS A 1 296 ? 9.978   90.727  47.954  1.00 129.55 ? 295 HIS A CD2 1 
ATOM   2379 C CE1 . HIS A 1 296 ? 8.482   89.119  48.075  1.00 131.11 ? 295 HIS A CE1 1 
ATOM   2380 N NE2 . HIS A 1 296 ? 9.586   89.592  48.630  1.00 131.00 ? 295 HIS A NE2 1 
ATOM   2381 N N   . LEU A 1 297 ? 8.784   95.803  45.905  1.00 125.62 ? 296 LEU A N   1 
ATOM   2382 C CA  . LEU A 1 297 ? 8.267   96.893  45.047  1.00 126.81 ? 296 LEU A CA  1 
ATOM   2383 C C   . LEU A 1 297 ? 9.368   97.806  44.516  1.00 127.08 ? 296 LEU A C   1 
ATOM   2384 O O   . LEU A 1 297 ? 9.664   97.810  43.321  1.00 127.40 ? 296 LEU A O   1 
ATOM   2385 C CB  . LEU A 1 297 ? 7.184   97.734  45.743  1.00 127.26 ? 296 LEU A CB  1 
ATOM   2386 C CG  . LEU A 1 297 ? 5.977   98.262  44.936  1.00 128.42 ? 296 LEU A CG  1 
ATOM   2387 C CD1 . LEU A 1 297 ? 6.295   99.575  44.224  1.00 129.67 ? 296 LEU A CD1 1 
ATOM   2388 C CD2 . LEU A 1 297 ? 5.410   97.236  43.942  1.00 129.51 ? 296 LEU A CD2 1 
ATOM   2389 N N   . VAL B 2 1   ? 17.159  112.262 76.590  1.00 56.59  ? 175 VAL B N   1 
ATOM   2390 C CA  . VAL B 2 1   ? 17.126  112.483 78.070  1.00 56.41  ? 175 VAL B CA  1 
ATOM   2391 C C   . VAL B 2 1   ? 18.132  111.549 78.804  1.00 55.63  ? 175 VAL B C   1 
ATOM   2392 O O   . VAL B 2 1   ? 19.083  111.136 78.162  1.00 55.83  ? 175 VAL B O   1 
ATOM   2393 C CB  . VAL B 2 1   ? 15.674  112.484 78.613  1.00 56.83  ? 175 VAL B CB  1 
ATOM   2394 C CG1 . VAL B 2 1   ? 15.116  113.907 78.569  1.00 57.67  ? 175 VAL B CG1 1 
ATOM   2395 C CG2 . VAL B 2 1   ? 14.784  111.523 77.833  1.00 56.85  ? 175 VAL B CG2 1 
ATOM   2396 N N   . PRO B 2 2   ? 17.968  111.214 80.095  1.00 54.43  ? 176 PRO B N   1 
ATOM   2397 C CA  . PRO B 2 2   ? 19.071  110.614 80.876  1.00 53.10  ? 176 PRO B CA  1 
ATOM   2398 C C   . PRO B 2 2   ? 19.781  109.393 80.258  1.00 51.51  ? 176 PRO B C   1 
ATOM   2399 O O   . PRO B 2 2   ? 20.796  108.923 80.793  1.00 51.40  ? 176 PRO B O   1 
ATOM   2400 C CB  . PRO B 2 2   ? 18.411  110.259 82.221  1.00 53.69  ? 176 PRO B CB  1 
ATOM   2401 C CG  . PRO B 2 2   ? 16.943  110.316 81.962  1.00 54.52  ? 176 PRO B CG  1 
ATOM   2402 C CD  . PRO B 2 2   ? 16.755  111.370 80.921  1.00 54.61  ? 176 PRO B CD  1 
ATOM   2403 N N   . ASP B 2 3   ? 19.243  108.896 79.146  1.00 48.99  ? 177 ASP B N   1 
ATOM   2404 C CA  . ASP B 2 3   ? 19.931  107.925 78.302  1.00 45.86  ? 177 ASP B CA  1 
ATOM   2405 C C   . ASP B 2 3   ? 20.790  108.691 77.273  1.00 42.88  ? 177 ASP B C   1 
ATOM   2406 O O   . ASP B 2 3   ? 21.734  108.127 76.686  1.00 42.97  ? 177 ASP B O   1 
ATOM   2407 C CB  . ASP B 2 3   ? 18.905  107.012 77.603  1.00 46.55  ? 177 ASP B CB  1 
ATOM   2408 C CG  . ASP B 2 3   ? 17.624  106.782 78.454  1.00 48.64  ? 177 ASP B CG  1 
ATOM   2409 O OD1 . ASP B 2 3   ? 17.653  105.889 79.338  1.00 50.79  ? 177 ASP B OD1 1 
ATOM   2410 O OD2 . ASP B 2 3   ? 16.557  107.438 78.316  1.00 48.06  ? 177 ASP B OD2 1 
ATOM   2411 N N   . TYR B 2 4   ? 20.460  109.976 77.088  1.00 38.37  ? 178 TYR B N   1 
ATOM   2412 C CA  . TYR B 2 4   ? 21.070  110.854 76.080  1.00 34.61  ? 178 TYR B CA  1 
ATOM   2413 C C   . TYR B 2 4   ? 21.733  112.123 76.640  1.00 33.25  ? 178 TYR B C   1 
ATOM   2414 O O   . TYR B 2 4   ? 22.292  112.896 75.877  1.00 32.54  ? 178 TYR B O   1 
ATOM   2415 C CB  . TYR B 2 4   ? 20.029  111.255 75.026  1.00 33.60  ? 178 TYR B CB  1 
ATOM   2416 C CG  . TYR B 2 4   ? 19.366  110.094 74.333  1.00 29.39  ? 178 TYR B CG  1 
ATOM   2417 C CD1 . TYR B 2 4   ? 19.994  109.438 73.281  1.00 25.13  ? 178 TYR B CD1 1 
ATOM   2418 C CD2 . TYR B 2 4   ? 18.118  109.646 74.739  1.00 24.90  ? 178 TYR B CD2 1 
ATOM   2419 C CE1 . TYR B 2 4   ? 19.394  108.379 72.638  1.00 22.48  ? 178 TYR B CE1 1 
ATOM   2420 C CE2 . TYR B 2 4   ? 17.513  108.569 74.114  1.00 24.21  ? 178 TYR B CE2 1 
ATOM   2421 C CZ  . TYR B 2 4   ? 18.154  107.947 73.057  1.00 22.12  ? 178 TYR B CZ  1 
ATOM   2422 O OH  . TYR B 2 4   ? 17.561  106.883 72.435  1.00 20.26  ? 178 TYR B OH  1 
ATOM   2423 N N   . HIS B 2 5   ? 21.657  112.327 77.957  1.00 32.60  ? 179 HIS B N   1 
ATOM   2424 C CA  . HIS B 2 5   ? 22.241  113.483 78.660  1.00 32.56  ? 179 HIS B CA  1 
ATOM   2425 C C   . HIS B 2 5   ? 23.623  113.839 78.120  1.00 31.05  ? 179 HIS B C   1 
ATOM   2426 O O   . HIS B 2 5   ? 23.874  114.970 77.710  1.00 29.72  ? 179 HIS B O   1 
ATOM   2427 C CB  . HIS B 2 5   ? 22.360  113.214 80.177  1.00 33.68  ? 179 HIS B CB  1 
ATOM   2428 C CG  . HIS B 2 5   ? 21.098  113.473 80.957  1.00 38.15  ? 179 HIS B CG  1 
ATOM   2429 N ND1 . HIS B 2 5   ? 19.894  113.803 80.362  1.00 41.50  ? 179 HIS B ND1 1 
ATOM   2430 C CD2 . HIS B 2 5   ? 20.851  113.424 82.291  1.00 41.20  ? 179 HIS B CD2 1 
ATOM   2431 C CE1 . HIS B 2 5   ? 18.965  113.951 81.296  1.00 42.11  ? 179 HIS B CE1 1 
ATOM   2432 N NE2 . HIS B 2 5   ? 19.518  113.727 82.475  1.00 42.03  ? 179 HIS B NE2 1 
ATOM   2433 N N   . GLU B 2 6   ? 24.500  112.840 78.110  1.00 29.92  ? 180 GLU B N   1 
ATOM   2434 C CA  . GLU B 2 6   ? 25.864  113.014 77.650  1.00 29.70  ? 180 GLU B CA  1 
ATOM   2435 C C   . GLU B 2 6   ? 25.997  113.195 76.140  1.00 27.92  ? 180 GLU B C   1 
ATOM   2436 O O   . GLU B 2 6   ? 26.781  114.040 75.696  1.00 27.53  ? 180 GLU B O   1 
ATOM   2437 C CB  . GLU B 2 6   ? 26.744  111.876 78.148  1.00 30.17  ? 180 GLU B CB  1 
ATOM   2438 C CG  . GLU B 2 6   ? 27.922  112.370 78.975  1.00 35.38  ? 180 GLU B CG  1 
ATOM   2439 C CD  . GLU B 2 6   ? 27.539  113.350 80.107  1.00 40.08  ? 180 GLU B CD  1 
ATOM   2440 O OE1 . GLU B 2 6   ? 27.406  114.583 79.848  1.00 38.95  ? 180 GLU B OE1 1 
ATOM   2441 O OE2 . GLU B 2 6   ? 27.400  112.879 81.272  1.00 42.13  ? 180 GLU B OE2 1 
ATOM   2442 N N   . ASP B 2 7   ? 25.236  112.420 75.362  1.00 25.90  ? 181 ASP B N   1 
ATOM   2443 C CA  . ASP B 2 7   ? 25.184  112.613 73.910  1.00 24.69  ? 181 ASP B CA  1 
ATOM   2444 C C   . ASP B 2 7   ? 24.790  114.052 73.595  1.00 22.75  ? 181 ASP B C   1 
ATOM   2445 O O   . ASP B 2 7   ? 25.461  114.726 72.827  1.00 21.87  ? 181 ASP B O   1 
ATOM   2446 C CB  . ASP B 2 7   ? 24.167  111.677 73.260  1.00 25.51  ? 181 ASP B CB  1 
ATOM   2447 C CG  . ASP B 2 7   ? 24.536  110.209 73.394  1.00 29.27  ? 181 ASP B CG  1 
ATOM   2448 O OD1 . ASP B 2 7   ? 25.746  109.873 73.400  1.00 33.52  ? 181 ASP B OD1 1 
ATOM   2449 O OD2 . ASP B 2 7   ? 23.670  109.306 73.470  1.00 32.72  ? 181 ASP B OD2 1 
ATOM   2450 N N   . ILE B 2 8   ? 23.701  114.512 74.214  1.00 21.34  ? 182 ILE B N   1 
ATOM   2451 C CA  . ILE B 2 8   ? 23.223  115.873 74.037  1.00 19.83  ? 182 ILE B CA  1 
ATOM   2452 C C   . ILE B 2 8   ? 24.263  116.921 74.478  1.00 19.80  ? 182 ILE B C   1 
ATOM   2453 O O   . ILE B 2 8   ? 24.538  117.856 73.733  1.00 19.72  ? 182 ILE B O   1 
ATOM   2454 C CB  . ILE B 2 8   ? 21.825  116.052 74.713  1.00 19.86  ? 182 ILE B CB  1 
ATOM   2455 C CG1 . ILE B 2 8   ? 20.764  115.280 73.911  1.00 19.36  ? 182 ILE B CG1 1 
ATOM   2456 C CG2 . ILE B 2 8   ? 21.408  117.514 74.806  1.00 16.73  ? 182 ILE B CG2 1 
ATOM   2457 C CD1 . ILE B 2 8   ? 19.597  114.852 74.725  1.00 18.31  ? 182 ILE B CD1 1 
ATOM   2458 N N   . HIS B 2 9   ? 24.855  116.756 75.656  1.00 19.61  ? 183 HIS B N   1 
ATOM   2459 C CA  . HIS B 2 9   ? 25.894  117.683 76.119  1.00 19.69  ? 183 HIS B CA  1 
ATOM   2460 C C   . HIS B 2 9   ? 27.040  117.796 75.101  1.00 19.70  ? 183 HIS B C   1 
ATOM   2461 O O   . HIS B 2 9   ? 27.392  118.897 74.696  1.00 20.35  ? 183 HIS B O   1 
ATOM   2462 C CB  . HIS B 2 9   ? 26.421  117.286 77.495  1.00 19.11  ? 183 HIS B CB  1 
ATOM   2463 C CG  . HIS B 2 9   ? 27.593  118.100 77.935  1.00 19.38  ? 183 HIS B CG  1 
ATOM   2464 N ND1 . HIS B 2 9   ? 27.457  119.336 78.534  1.00 19.46  ? 183 HIS B ND1 1 
ATOM   2465 C CD2 . HIS B 2 9   ? 28.922  117.875 77.835  1.00 17.87  ? 183 HIS B CD2 1 
ATOM   2466 C CE1 . HIS B 2 9   ? 28.651  119.822 78.808  1.00 18.97  ? 183 HIS B CE1 1 
ATOM   2467 N NE2 . HIS B 2 9   ? 29.556  118.952 78.397  1.00 19.85  ? 183 HIS B NE2 1 
ATOM   2468 N N   . THR B 2 10  ? 27.583  116.660 74.662  1.00 19.59  ? 184 THR B N   1 
ATOM   2469 C CA  . THR B 2 10  ? 28.616  116.608 73.612  1.00 19.76  ? 184 THR B CA  1 
ATOM   2470 C C   . THR B 2 10  ? 28.219  117.362 72.351  1.00 20.15  ? 184 THR B C   1 
ATOM   2471 O O   . THR B 2 10  ? 28.989  118.159 71.799  1.00 20.91  ? 184 THR B O   1 
ATOM   2472 C CB  . THR B 2 10  ? 28.873  115.139 73.234  1.00 19.59  ? 184 THR B CB  1 
ATOM   2473 O OG1 . THR B 2 10  ? 29.460  114.471 74.351  1.00 21.94  ? 184 THR B OG1 1 
ATOM   2474 C CG2 . THR B 2 10  ? 29.928  115.006 72.142  1.00 18.28  ? 184 THR B CG2 1 
ATOM   2475 N N   . TYR B 2 11  ? 27.016  117.087 71.882  1.00 20.10  ? 185 TYR B N   1 
ATOM   2476 C CA  . TYR B 2 11  ? 26.510  117.719 70.683  1.00 20.24  ? 185 TYR B CA  1 
ATOM   2477 C C   . TYR B 2 11  ? 26.300  119.237 70.832  1.00 20.29  ? 185 TYR B C   1 
ATOM   2478 O O   . TYR B 2 11  ? 26.620  119.994 69.932  1.00 20.05  ? 185 TYR B O   1 
ATOM   2479 C CB  . TYR B 2 11  ? 25.227  117.022 70.232  1.00 20.24  ? 185 TYR B CB  1 
ATOM   2480 C CG  . TYR B 2 11  ? 24.656  117.659 69.011  1.00 20.53  ? 185 TYR B CG  1 
ATOM   2481 C CD1 . TYR B 2 11  ? 25.332  117.595 67.797  1.00 22.12  ? 185 TYR B CD1 1 
ATOM   2482 C CD2 . TYR B 2 11  ? 23.471  118.372 69.075  1.00 20.27  ? 185 TYR B CD2 1 
ATOM   2483 C CE1 . TYR B 2 11  ? 24.820  118.219 66.667  1.00 24.20  ? 185 TYR B CE1 1 
ATOM   2484 C CE2 . TYR B 2 11  ? 22.945  118.980 67.954  1.00 23.03  ? 185 TYR B CE2 1 
ATOM   2485 C CZ  . TYR B 2 11  ? 23.620  118.903 66.763  1.00 24.27  ? 185 TYR B CZ  1 
ATOM   2486 O OH  . TYR B 2 11  ? 23.098  119.511 65.656  1.00 27.54  ? 185 TYR B OH  1 
ATOM   2487 N N   . LEU B 2 12  ? 25.757  119.684 71.960  1.00 21.01  ? 186 LEU B N   1 
ATOM   2488 C CA  . LEU B 2 12  ? 25.654  121.118 72.223  1.00 21.77  ? 186 LEU B CA  1 
ATOM   2489 C C   . LEU B 2 12  ? 27.030  121.802 72.283  1.00 22.16  ? 186 LEU B C   1 
ATOM   2490 O O   . LEU B 2 12  ? 27.157  122.960 71.905  1.00 22.04  ? 186 LEU B O   1 
ATOM   2491 C CB  . LEU B 2 12  ? 24.878  121.390 73.516  1.00 21.52  ? 186 LEU B CB  1 
ATOM   2492 C CG  . LEU B 2 12  ? 23.380  121.037 73.554  1.00 24.19  ? 186 LEU B CG  1 
ATOM   2493 C CD1 . LEU B 2 12  ? 22.765  121.453 74.888  1.00 25.29  ? 186 LEU B CD1 1 
ATOM   2494 C CD2 . LEU B 2 12  ? 22.579  121.624 72.389  1.00 23.10  ? 186 LEU B CD2 1 
ATOM   2495 N N   . ARG B 2 13  ? 28.049  121.085 72.759  1.00 22.51  ? 187 ARG B N   1 
ATOM   2496 C CA  . ARG B 2 13  ? 29.402  121.641 72.814  1.00 23.34  ? 187 ARG B CA  1 
ATOM   2497 C C   . ARG B 2 13  ? 30.002  121.850 71.429  1.00 23.87  ? 187 ARG B C   1 
ATOM   2498 O O   . ARG B 2 13  ? 30.711  122.818 71.203  1.00 24.66  ? 187 ARG B O   1 
ATOM   2499 C CB  . ARG B 2 13  ? 30.334  120.792 73.693  1.00 22.54  ? 187 ARG B CB  1 
ATOM   2500 C CG  . ARG B 2 13  ? 30.094  120.969 75.173  1.00 20.87  ? 187 ARG B CG  1 
ATOM   2501 C CD  . ARG B 2 13  ? 30.663  122.257 75.770  1.00 21.04  ? 187 ARG B CD  1 
ATOM   2502 N NE  . ARG B 2 13  ? 32.114  122.264 75.610  1.00 22.47  ? 187 ARG B NE  1 
ATOM   2503 C CZ  . ARG B 2 13  ? 32.961  121.807 76.515  1.00 20.17  ? 187 ARG B CZ  1 
ATOM   2504 N NH1 . ARG B 2 13  ? 32.508  121.355 77.665  1.00 19.45  ? 187 ARG B NH1 1 
ATOM   2505 N NH2 . ARG B 2 13  ? 34.259  121.798 76.260  1.00 20.43  ? 187 ARG B NH2 1 
ATOM   2506 N N   . GLU B 2 14  ? 29.706  120.959 70.499  1.00 24.81  ? 188 GLU B N   1 
ATOM   2507 C CA  . GLU B 2 14  ? 30.128  121.160 69.120  1.00 26.01  ? 188 GLU B CA  1 
ATOM   2508 C C   . GLU B 2 14  ? 29.310  122.270 68.448  1.00 25.87  ? 188 GLU B C   1 
ATOM   2509 O O   . GLU B 2 14  ? 29.851  123.062 67.679  1.00 25.98  ? 188 GLU B O   1 
ATOM   2510 C CB  . GLU B 2 14  ? 30.122  119.826 68.356  1.00 26.71  ? 188 GLU B CB  1 
ATOM   2511 C CG  . GLU B 2 14  ? 29.515  119.797 66.960  1.00 30.20  ? 188 GLU B CG  1 
ATOM   2512 C CD  . GLU B 2 14  ? 29.176  118.370 66.519  1.00 36.22  ? 188 GLU B CD  1 
ATOM   2513 O OE1 . GLU B 2 14  ? 29.044  117.461 67.387  1.00 37.86  ? 188 GLU B OE1 1 
ATOM   2514 O OE2 . GLU B 2 14  ? 29.047  118.145 65.299  1.00 38.31  ? 188 GLU B OE2 1 
ATOM   2515 N N   . MET B 2 15  ? 28.022  122.358 68.770  1.00 25.72  ? 189 MET B N   1 
ATOM   2516 C CA  . MET B 2 15  ? 27.166  123.346 68.133  1.00 25.94  ? 189 MET B CA  1 
ATOM   2517 C C   . MET B 2 15  ? 27.416  124.778 68.614  1.00 26.21  ? 189 MET B C   1 
ATOM   2518 O O   . MET B 2 15  ? 27.208  125.724 67.844  1.00 25.83  ? 189 MET B O   1 
ATOM   2519 C CB  . MET B 2 15  ? 25.696  122.995 68.306  1.00 25.92  ? 189 MET B CB  1 
ATOM   2520 C CG  . MET B 2 15  ? 25.187  121.825 67.462  1.00 29.24  ? 189 MET B CG  1 
ATOM   2521 S SD  . MET B 2 15  ? 25.837  121.598 65.755  1.00 36.65  ? 189 MET B SD  1 
ATOM   2522 C CE  . MET B 2 15  ? 25.103  123.028 64.904  1.00 32.30  ? 189 MET B CE  1 
ATOM   2523 N N   . GLU B 2 16  ? 27.843  124.947 69.868  1.00 26.51  ? 190 GLU B N   1 
ATOM   2524 C CA  . GLU B 2 16  ? 28.079  126.291 70.400  1.00 27.25  ? 190 GLU B CA  1 
ATOM   2525 C C   . GLU B 2 16  ? 29.285  126.951 69.732  1.00 27.95  ? 190 GLU B C   1 
ATOM   2526 O O   . GLU B 2 16  ? 29.322  128.163 69.590  1.00 28.18  ? 190 GLU B O   1 
ATOM   2527 C CB  . GLU B 2 16  ? 28.177  126.319 71.943  1.00 26.71  ? 190 GLU B CB  1 
ATOM   2528 C CG  . GLU B 2 16  ? 29.435  125.706 72.535  1.00 26.12  ? 190 GLU B CG  1 
ATOM   2529 C CD  . GLU B 2 16  ? 29.611  125.950 74.033  1.00 26.86  ? 190 GLU B CD  1 
ATOM   2530 O OE1 . GLU B 2 16  ? 28.856  126.750 74.619  1.00 28.34  ? 190 GLU B OE1 1 
ATOM   2531 O OE2 . GLU B 2 16  ? 30.532  125.343 74.635  1.00 25.46  ? 190 GLU B OE2 1 
ATOM   2532 N N   . VAL B 2 17  ? 30.257  126.146 69.316  1.00 29.49  ? 191 VAL B N   1 
ATOM   2533 C CA  . VAL B 2 17  ? 31.365  126.625 68.488  1.00 31.01  ? 191 VAL B CA  1 
ATOM   2534 C C   . VAL B 2 17  ? 30.878  127.078 67.098  1.00 32.38  ? 191 VAL B C   1 
ATOM   2535 O O   . VAL B 2 17  ? 31.361  128.076 66.564  1.00 33.26  ? 191 VAL B O   1 
ATOM   2536 C CB  . VAL B 2 17  ? 32.496  125.561 68.369  1.00 31.03  ? 191 VAL B CB  1 
ATOM   2537 C CG1 . VAL B 2 17  ? 33.574  125.998 67.400  1.00 30.95  ? 191 VAL B CG1 1 
ATOM   2538 C CG2 . VAL B 2 17  ? 33.132  125.289 69.729  1.00 30.96  ? 191 VAL B CG2 1 
ATOM   2539 N N   . LYS B 2 18  ? 29.918  126.367 66.514  1.00 33.66  ? 192 LYS B N   1 
ATOM   2540 C CA  . LYS B 2 18  ? 29.437  126.717 65.176  1.00 34.93  ? 192 LYS B CA  1 
ATOM   2541 C C   . LYS B 2 18  ? 28.599  127.982 65.161  1.00 35.83  ? 192 LYS B C   1 
ATOM   2542 O O   . LYS B 2 18  ? 28.623  128.711 64.173  1.00 36.43  ? 192 LYS B O   1 
ATOM   2543 C CB  . LYS B 2 18  ? 28.638  125.575 64.537  1.00 34.87  ? 192 LYS B CB  1 
ATOM   2544 C CG  . LYS B 2 18  ? 29.455  124.315 64.272  1.00 36.13  ? 192 LYS B CG  1 
ATOM   2545 C CD  . LYS B 2 18  ? 28.795  123.441 63.209  1.00 39.14  ? 192 LYS B CD  1 
ATOM   2546 C CE  . LYS B 2 18  ? 29.101  121.962 63.427  1.00 39.82  ? 192 LYS B CE  1 
ATOM   2547 N NZ  . LYS B 2 18  ? 30.550  121.646 63.254  1.00 41.13  ? 192 LYS B NZ  1 
ATOM   2548 N N   . CYS B 2 19  ? 27.861  128.226 66.247  1.00 36.43  ? 193 CYS B N   1 
ATOM   2549 C CA  . CYS B 2 19  ? 26.872  129.303 66.323  1.00 37.57  ? 193 CYS B CA  1 
ATOM   2550 C C   . CYS B 2 19  ? 27.417  130.534 67.021  1.00 37.19  ? 193 CYS B C   1 
ATOM   2551 O O   . CYS B 2 19  ? 26.676  131.473 67.310  1.00 37.44  ? 193 CYS B O   1 
ATOM   2552 C CB  . CYS B 2 19  ? 25.620  128.827 67.073  1.00 37.58  ? 193 CYS B CB  1 
ATOM   2553 S SG  . CYS B 2 19  ? 24.734  127.489 66.232  1.00 43.32  ? 193 CYS B SG  1 
ATOM   2554 N N   . LYS B 2 20  ? 28.710  130.519 67.316  1.00 37.05  ? 194 LYS B N   1 
ATOM   2555 C CA  . LYS B 2 20  ? 29.340  131.639 67.983  1.00 36.64  ? 194 LYS B CA  1 
ATOM   2556 C C   . LYS B 2 20  ? 29.343  132.872 67.081  1.00 36.30  ? 194 LYS B C   1 
ATOM   2557 O O   . LYS B 2 20  ? 29.753  132.798 65.919  1.00 36.15  ? 194 LYS B O   1 
ATOM   2558 C CB  . LYS B 2 20  ? 30.760  131.291 68.403  1.00 36.67  ? 194 LYS B CB  1 
ATOM   2559 C CG  . LYS B 2 20  ? 31.123  131.863 69.745  1.00 36.78  ? 194 LYS B CG  1 
ATOM   2560 C CD  . LYS B 2 20  ? 32.613  131.977 69.925  1.00 37.63  ? 194 LYS B CD  1 
ATOM   2561 C CE  . LYS B 2 20  ? 32.943  133.107 70.886  1.00 39.17  ? 194 LYS B CE  1 
ATOM   2562 N NZ  . LYS B 2 20  ? 33.789  132.593 72.000  1.00 40.95  ? 194 LYS B NZ  1 
ATOM   2563 N N   . PRO B 2 21  ? 28.882  133.996 67.628  1.00 35.86  ? 195 PRO B N   1 
ATOM   2564 C CA  . PRO B 2 21  ? 29.019  135.294 66.968  1.00 35.58  ? 195 PRO B CA  1 
ATOM   2565 C C   . PRO B 2 21  ? 30.506  135.622 66.815  1.00 35.92  ? 195 PRO B C   1 
ATOM   2566 O O   . PRO B 2 21  ? 31.330  135.008 67.517  1.00 35.55  ? 195 PRO B O   1 
ATOM   2567 C CB  . PRO B 2 21  ? 28.395  136.268 67.967  1.00 35.66  ? 195 PRO B CB  1 
ATOM   2568 C CG  . PRO B 2 21  ? 27.689  135.455 68.995  1.00 35.94  ? 195 PRO B CG  1 
ATOM   2569 C CD  . PRO B 2 21  ? 28.230  134.088 68.948  1.00 35.87  ? 195 PRO B CD  1 
ATOM   2570 N N   . LYS B 2 22  ? 30.876  136.545 65.929  1.00 36.21  ? 196 LYS B N   1 
ATOM   2571 C CA  . LYS B 2 22  ? 32.268  136.995 65.978  1.00 37.31  ? 196 LYS B CA  1 
ATOM   2572 C C   . LYS B 2 22  ? 32.495  138.007 67.105  1.00 37.04  ? 196 LYS B C   1 
ATOM   2573 O O   . LYS B 2 22  ? 31.683  138.903 67.339  1.00 36.57  ? 196 LYS B O   1 
ATOM   2574 C CB  . LYS B 2 22  ? 32.854  137.422 64.625  1.00 37.73  ? 196 LYS B CB  1 
ATOM   2575 C CG  . LYS B 2 22  ? 32.222  138.603 63.956  1.00 40.94  ? 196 LYS B CG  1 
ATOM   2576 C CD  . LYS B 2 22  ? 32.683  138.666 62.486  1.00 46.17  ? 196 LYS B CD  1 
ATOM   2577 C CE  . LYS B 2 22  ? 31.879  137.695 61.602  1.00 48.29  ? 196 LYS B CE  1 
ATOM   2578 N NZ  . LYS B 2 22  ? 32.651  136.513 61.112  1.00 49.43  ? 196 LYS B NZ  1 
ATOM   2579 N N   . VAL B 2 23  ? 33.589  137.802 67.826  1.00 37.10  ? 197 VAL B N   1 
ATOM   2580 C CA  . VAL B 2 23  ? 33.912  138.581 69.011  1.00 37.70  ? 197 VAL B CA  1 
ATOM   2581 C C   . VAL B 2 23  ? 34.077  140.064 68.715  1.00 37.82  ? 197 VAL B C   1 
ATOM   2582 O O   . VAL B 2 23  ? 33.622  140.906 69.487  1.00 38.04  ? 197 VAL B O   1 
ATOM   2583 C CB  . VAL B 2 23  ? 35.211  138.074 69.671  1.00 37.61  ? 197 VAL B CB  1 
ATOM   2584 C CG1 . VAL B 2 23  ? 35.429  138.769 71.009  1.00 37.80  ? 197 VAL B CG1 1 
ATOM   2585 C CG2 . VAL B 2 23  ? 35.164  136.562 69.849  1.00 38.40  ? 197 VAL B CG2 1 
ATOM   2586 N N   . GLY B 2 24  ? 34.727  140.377 67.600  1.00 38.01  ? 198 GLY B N   1 
ATOM   2587 C CA  . GLY B 2 24  ? 35.083  141.754 67.311  1.00 38.46  ? 198 GLY B CA  1 
ATOM   2588 C C   . GLY B 2 24  ? 34.090  142.560 66.497  1.00 38.41  ? 198 GLY B C   1 
ATOM   2589 O O   . GLY B 2 24  ? 34.452  143.632 65.998  1.00 38.81  ? 198 GLY B O   1 
ATOM   2590 N N   . TYR B 2 25  ? 32.847  142.082 66.393  1.00 37.74  ? 199 TYR B N   1 
ATOM   2591 C CA  . TYR B 2 25  ? 31.897  142.607 65.405  1.00 36.90  ? 199 TYR B CA  1 
ATOM   2592 C C   . TYR B 2 25  ? 31.424  144.047 65.611  1.00 37.42  ? 199 TYR B C   1 
ATOM   2593 O O   . TYR B 2 25  ? 31.020  144.705 64.644  1.00 37.12  ? 199 TYR B O   1 
ATOM   2594 C CB  . TYR B 2 25  ? 30.708  141.642 65.192  1.00 36.46  ? 199 TYR B CB  1 
ATOM   2595 C CG  . TYR B 2 25  ? 29.516  141.828 66.102  1.00 33.91  ? 199 TYR B CG  1 
ATOM   2596 C CD1 . TYR B 2 25  ? 28.651  142.895 65.930  1.00 33.01  ? 199 TYR B CD1 1 
ATOM   2597 C CD2 . TYR B 2 25  ? 29.238  140.918 67.116  1.00 32.82  ? 199 TYR B CD2 1 
ATOM   2598 C CE1 . TYR B 2 25  ? 27.557  143.070 66.753  1.00 32.91  ? 199 TYR B CE1 1 
ATOM   2599 C CE2 . TYR B 2 25  ? 28.133  141.081 67.947  1.00 31.97  ? 199 TYR B CE2 1 
ATOM   2600 C CZ  . TYR B 2 25  ? 27.298  142.166 67.753  1.00 32.34  ? 199 TYR B CZ  1 
ATOM   2601 O OH  . TYR B 2 25  ? 26.194  142.368 68.546  1.00 32.59  ? 199 TYR B OH  1 
ATOM   2602 N N   . MET B 2 26  ? 31.445  144.525 66.852  1.00 38.12  ? 200 MET B N   1 
ATOM   2603 C CA  . MET B 2 26  ? 30.984  145.883 67.150  1.00 39.14  ? 200 MET B CA  1 
ATOM   2604 C C   . MET B 2 26  ? 31.958  146.945 66.626  1.00 40.00  ? 200 MET B C   1 
ATOM   2605 O O   . MET B 2 26  ? 31.539  147.996 66.140  1.00 39.67  ? 200 MET B O   1 
ATOM   2606 C CB  . MET B 2 26  ? 30.738  146.073 68.641  1.00 39.03  ? 200 MET B CB  1 
ATOM   2607 C CG  . MET B 2 26  ? 29.678  147.131 68.951  1.00 39.06  ? 200 MET B CG  1 
ATOM   2608 S SD  . MET B 2 26  ? 28.081  146.823 68.136  1.00 40.33  ? 200 MET B SD  1 
ATOM   2609 C CE  . MET B 2 26  ? 27.347  145.618 69.264  1.00 40.94  ? 200 MET B CE  1 
ATOM   2610 N N   . LYS B 2 27  ? 33.252  146.641 66.727  1.00 41.28  ? 201 LYS B N   1 
ATOM   2611 C CA  . LYS B 2 27  ? 34.315  147.385 66.061  1.00 42.74  ? 201 LYS B CA  1 
ATOM   2612 C C   . LYS B 2 27  ? 33.974  147.665 64.593  1.00 43.03  ? 201 LYS B C   1 
ATOM   2613 O O   . LYS B 2 27  ? 34.249  148.756 64.083  1.00 43.15  ? 201 LYS B O   1 
ATOM   2614 C CB  . LYS B 2 27  ? 35.616  146.580 66.129  1.00 43.23  ? 201 LYS B CB  1 
ATOM   2615 C CG  . LYS B 2 27  ? 36.858  147.370 66.499  1.00 46.12  ? 201 LYS B CG  1 
ATOM   2616 C CD  . LYS B 2 27  ? 37.715  147.694 65.260  1.00 51.17  ? 201 LYS B CD  1 
ATOM   2617 C CE  . LYS B 2 27  ? 38.340  149.105 65.333  1.00 52.88  ? 201 LYS B CE  1 
ATOM   2618 N NZ  . LYS B 2 27  ? 37.348  150.176 65.683  1.00 53.42  ? 201 LYS B NZ  1 
ATOM   2619 N N   . LYS B 2 28  ? 33.356  146.683 63.936  1.00 43.04  ? 202 LYS B N   1 
ATOM   2620 C CA  . LYS B 2 28  ? 33.086  146.735 62.502  1.00 43.12  ? 202 LYS B CA  1 
ATOM   2621 C C   . LYS B 2 28  ? 31.743  147.380 62.159  1.00 42.72  ? 202 LYS B C   1 
ATOM   2622 O O   . LYS B 2 28  ? 31.446  147.597 60.988  1.00 42.94  ? 202 LYS B O   1 
ATOM   2623 C CB  . LYS B 2 28  ? 33.151  145.334 61.885  1.00 43.54  ? 202 LYS B CB  1 
ATOM   2624 C CG  . LYS B 2 28  ? 34.470  144.561 62.087  1.00 45.46  ? 202 LYS B CG  1 
ATOM   2625 C CD  . LYS B 2 28  ? 35.566  144.924 61.059  1.00 49.90  ? 202 LYS B CD  1 
ATOM   2626 C CE  . LYS B 2 28  ? 35.031  145.145 59.629  1.00 51.74  ? 202 LYS B CE  1 
ATOM   2627 N NZ  . LYS B 2 28  ? 34.861  146.607 59.315  1.00 53.02  ? 202 LYS B NZ  1 
ATOM   2628 N N   . GLN B 2 29  ? 30.930  147.673 63.172  1.00 41.91  ? 203 GLN B N   1 
ATOM   2629 C CA  . GLN B 2 29  ? 29.640  148.321 62.956  1.00 40.90  ? 203 GLN B CA  1 
ATOM   2630 C C   . GLN B 2 29  ? 29.830  149.828 63.087  1.00 40.96  ? 203 GLN B C   1 
ATOM   2631 O O   . GLN B 2 29  ? 30.103  150.327 64.183  1.00 41.41  ? 203 GLN B O   1 
ATOM   2632 C CB  . GLN B 2 29  ? 28.588  147.831 63.957  1.00 40.58  ? 203 GLN B CB  1 
ATOM   2633 C CG  . GLN B 2 29  ? 28.146  146.372 63.798  1.00 38.21  ? 203 GLN B CG  1 
ATOM   2634 C CD  . GLN B 2 29  ? 27.113  146.150 62.704  1.00 34.71  ? 203 GLN B CD  1 
ATOM   2635 O OE1 . GLN B 2 29  ? 26.421  147.079 62.280  1.00 33.32  ? 203 GLN B OE1 1 
ATOM   2636 N NE2 . GLN B 2 29  ? 26.997  144.910 62.258  1.00 32.35  ? 203 GLN B NE2 1 
ATOM   2637 N N   . PRO B 2 30  ? 29.689  150.548 61.975  1.00 40.83  ? 204 PRO B N   1 
ATOM   2638 C CA  . PRO B 2 30  ? 29.990  151.984 61.936  1.00 40.60  ? 204 PRO B CA  1 
ATOM   2639 C C   . PRO B 2 30  ? 29.045  152.794 62.814  1.00 40.33  ? 204 PRO B C   1 
ATOM   2640 O O   . PRO B 2 30  ? 29.472  153.744 63.475  1.00 41.01  ? 204 PRO B O   1 
ATOM   2641 C CB  . PRO B 2 30  ? 29.761  152.361 60.461  1.00 40.57  ? 204 PRO B CB  1 
ATOM   2642 C CG  . PRO B 2 30  ? 29.692  151.093 59.712  1.00 40.64  ? 204 PRO B CG  1 
ATOM   2643 C CD  . PRO B 2 30  ? 29.214  150.045 60.671  1.00 40.75  ? 204 PRO B CD  1 
ATOM   2644 N N   . ASP B 2 31  ? 27.780  152.396 62.828  1.00 39.49  ? 205 ASP B N   1 
ATOM   2645 C CA  . ASP B 2 31  ? 26.719  153.202 63.384  1.00 38.48  ? 205 ASP B CA  1 
ATOM   2646 C C   . ASP B 2 31  ? 26.144  152.738 64.719  1.00 37.67  ? 205 ASP B C   1 
ATOM   2647 O O   . ASP B 2 31  ? 25.313  153.450 65.307  1.00 37.82  ? 205 ASP B O   1 
ATOM   2648 C CB  . ASP B 2 31  ? 25.590  153.305 62.364  1.00 39.18  ? 205 ASP B CB  1 
ATOM   2649 C CG  . ASP B 2 31  ? 24.685  154.473 62.635  1.00 39.53  ? 205 ASP B CG  1 
ATOM   2650 O OD1 . ASP B 2 31  ? 25.214  155.576 62.891  1.00 41.09  ? 205 ASP B OD1 1 
ATOM   2651 O OD2 . ASP B 2 31  ? 23.444  154.381 62.621  1.00 40.14  ? 205 ASP B OD2 1 
ATOM   2652 N N   . ILE B 2 32  ? 26.545  151.554 65.187  1.00 36.12  ? 206 ILE B N   1 
ATOM   2653 C CA  . ILE B 2 32  ? 26.079  151.060 66.482  1.00 34.67  ? 206 ILE B CA  1 
ATOM   2654 C C   . ILE B 2 32  ? 27.207  150.667 67.438  1.00 33.88  ? 206 ILE B C   1 
ATOM   2655 O O   . ILE B 2 32  ? 28.332  150.387 67.006  1.00 33.48  ? 206 ILE B O   1 
ATOM   2656 C CB  . ILE B 2 32  ? 25.012  149.918 66.332  1.00 35.01  ? 206 ILE B CB  1 
ATOM   2657 C CG1 . ILE B 2 32  ? 25.577  148.701 65.599  1.00 34.60  ? 206 ILE B CG1 1 
ATOM   2658 C CG2 . ILE B 2 32  ? 23.729  150.450 65.676  1.00 34.65  ? 206 ILE B CG2 1 
ATOM   2659 C CD1 . ILE B 2 32  ? 24.518  147.766 65.025  1.00 35.72  ? 206 ILE B CD1 1 
ATOM   2660 N N   . THR B 2 33  ? 26.888  150.671 68.739  1.00 32.99  ? 207 THR B N   1 
ATOM   2661 C CA  . THR B 2 33  ? 27.845  150.399 69.816  1.00 32.15  ? 207 THR B CA  1 
ATOM   2662 C C   . THR B 2 33  ? 27.366  149.309 70.760  1.00 32.13  ? 207 THR B C   1 
ATOM   2663 O O   . THR B 2 33  ? 26.189  148.941 70.754  1.00 32.56  ? 207 THR B O   1 
ATOM   2664 C CB  . THR B 2 33  ? 28.090  151.669 70.674  1.00 32.20  ? 207 THR B CB  1 
ATOM   2665 O OG1 . THR B 2 33  ? 26.829  152.240 71.077  1.00 31.56  ? 207 THR B OG1 1 
ATOM   2666 C CG2 . THR B 2 33  ? 28.788  152.759 69.875  1.00 31.55  ? 207 THR B CG2 1 
ATOM   2667 N N   . ASN B 2 34  ? 28.278  148.828 71.606  1.00 31.85  ? 208 ASN B N   1 
ATOM   2668 C CA  . ASN B 2 34  ? 27.935  147.932 72.700  1.00 31.75  ? 208 ASN B CA  1 
ATOM   2669 C C   . ASN B 2 34  ? 26.817  148.520 73.547  1.00 32.21  ? 208 ASN B C   1 
ATOM   2670 O O   . ASN B 2 34  ? 25.939  147.802 74.043  1.00 32.29  ? 208 ASN B O   1 
ATOM   2671 C CB  . ASN B 2 34  ? 29.146  147.733 73.598  1.00 31.67  ? 208 ASN B CB  1 
ATOM   2672 C CG  . ASN B 2 34  ? 30.240  146.946 72.934  1.00 31.61  ? 208 ASN B CG  1 
ATOM   2673 O OD1 . ASN B 2 34  ? 29.989  146.076 72.102  1.00 30.66  ? 208 ASN B OD1 1 
ATOM   2674 N ND2 . ASN B 2 34  ? 31.474  147.246 73.302  1.00 33.63  ? 208 ASN B ND2 1 
ATOM   2675 N N   . SER B 2 35  ? 26.870  149.836 73.705  1.00 32.24  ? 209 SER B N   1 
ATOM   2676 C CA  . SER B 2 35  ? 25.954  150.563 74.557  1.00 32.75  ? 209 SER B CA  1 
ATOM   2677 C C   . SER B 2 35  ? 24.534  150.537 73.980  1.00 32.23  ? 209 SER B C   1 
ATOM   2678 O O   . SER B 2 35  ? 23.576  150.276 74.696  1.00 32.35  ? 209 SER B O   1 
ATOM   2679 C CB  . SER B 2 35  ? 26.493  151.981 74.787  1.00 32.90  ? 209 SER B CB  1 
ATOM   2680 O OG  . SER B 2 35  ? 25.446  152.907 75.020  1.00 35.80  ? 209 SER B OG  1 
ATOM   2681 N N   . MET B 2 36  ? 24.411  150.749 72.675  1.00 32.38  ? 210 MET B N   1 
ATOM   2682 C CA  . MET B 2 36  ? 23.128  150.599 71.973  1.00 31.80  ? 210 MET B CA  1 
ATOM   2683 C C   . MET B 2 36  ? 22.613  149.151 71.963  1.00 30.71  ? 210 MET B C   1 
ATOM   2684 O O   . MET B 2 36  ? 21.407  148.914 72.044  1.00 30.54  ? 210 MET B O   1 
ATOM   2685 C CB  . MET B 2 36  ? 23.242  151.108 70.535  1.00 32.68  ? 210 MET B CB  1 
ATOM   2686 C CG  . MET B 2 36  ? 23.821  152.527 70.385  1.00 35.21  ? 210 MET B CG  1 
ATOM   2687 S SD  . MET B 2 36  ? 23.937  152.988 68.627  1.00 39.41  ? 210 MET B SD  1 
ATOM   2688 C CE  . MET B 2 36  ? 22.205  153.091 68.300  1.00 38.81  ? 210 MET B CE  1 
ATOM   2689 N N   . ARG B 2 37  ? 23.523  148.190 71.855  1.00 29.80  ? 211 ARG B N   1 
ATOM   2690 C CA  . ARG B 2 37  ? 23.157  146.779 71.952  1.00 29.40  ? 211 ARG B CA  1 
ATOM   2691 C C   . ARG B 2 37  ? 22.571  146.464 73.333  1.00 29.07  ? 211 ARG B C   1 
ATOM   2692 O O   . ARG B 2 37  ? 21.568  145.748 73.433  1.00 28.84  ? 211 ARG B O   1 
ATOM   2693 C CB  . ARG B 2 37  ? 24.364  145.883 71.670  1.00 29.26  ? 211 ARG B CB  1 
ATOM   2694 C CG  . ARG B 2 37  ? 24.065  144.378 71.710  1.00 29.26  ? 211 ARG B CG  1 
ATOM   2695 C CD  . ARG B 2 37  ? 25.313  143.510 71.762  1.00 28.63  ? 211 ARG B CD  1 
ATOM   2696 N NE  . ARG B 2 37  ? 25.007  142.109 72.024  1.00 27.63  ? 211 ARG B NE  1 
ATOM   2697 C CZ  . ARG B 2 37  ? 24.811  141.588 73.236  1.00 28.27  ? 211 ARG B CZ  1 
ATOM   2698 N NH1 . ARG B 2 37  ? 24.881  142.358 74.317  1.00 26.59  ? 211 ARG B NH1 1 
ATOM   2699 N NH2 . ARG B 2 37  ? 24.532  140.286 73.370  1.00 27.10  ? 211 ARG B NH2 1 
ATOM   2700 N N   . ALA B 2 38  ? 23.213  147.000 74.380  1.00 28.57  ? 212 ALA B N   1 
ATOM   2701 C CA  . ALA B 2 38  ? 22.759  146.864 75.765  1.00 28.25  ? 212 ALA B CA  1 
ATOM   2702 C C   . ALA B 2 38  ? 21.322  147.344 75.927  1.00 28.37  ? 212 ALA B C   1 
ATOM   2703 O O   . ALA B 2 38  ? 20.515  146.681 76.576  1.00 28.71  ? 212 ALA B O   1 
ATOM   2704 C CB  . ALA B 2 38  ? 23.689  147.631 76.720  1.00 27.74  ? 212 ALA B CB  1 
ATOM   2705 N N   . ILE B 2 39  ? 21.012  148.488 75.318  1.00 28.51  ? 213 ILE B N   1 
ATOM   2706 C CA  . ILE B 2 39  ? 19.669  149.068 75.325  1.00 28.37  ? 213 ILE B CA  1 
ATOM   2707 C C   . ILE B 2 39  ? 18.618  148.141 74.684  1.00 28.43  ? 213 ILE B C   1 
ATOM   2708 O O   . ILE B 2 39  ? 17.544  147.913 75.253  1.00 28.76  ? 213 ILE B O   1 
ATOM   2709 C CB  . ILE B 2 39  ? 19.717  150.466 74.648  1.00 28.54  ? 213 ILE B CB  1 
ATOM   2710 C CG1 . ILE B 2 39  ? 20.524  151.436 75.535  1.00 29.23  ? 213 ILE B CG1 1 
ATOM   2711 C CG2 . ILE B 2 39  ? 18.306  151.002 74.369  1.00 28.28  ? 213 ILE B CG2 1 
ATOM   2712 C CD1 . ILE B 2 39  ? 20.570  152.864 75.048  1.00 28.94  ? 213 ILE B CD1 1 
ATOM   2713 N N   . LEU B 2 40  ? 18.943  147.604 73.510  1.00 28.24  ? 214 LEU B N   1 
ATOM   2714 C CA  . LEU B 2 40  ? 18.096  146.638 72.818  1.00 27.60  ? 214 LEU B CA  1 
ATOM   2715 C C   . LEU B 2 40  ? 17.772  145.394 73.676  1.00 27.42  ? 214 LEU B C   1 
ATOM   2716 O O   . LEU B 2 40  ? 16.602  145.093 73.937  1.00 27.71  ? 214 LEU B O   1 
ATOM   2717 C CB  . LEU B 2 40  ? 18.755  146.228 71.510  1.00 27.29  ? 214 LEU B CB  1 
ATOM   2718 C CG  . LEU B 2 40  ? 18.040  145.156 70.692  1.00 26.98  ? 214 LEU B CG  1 
ATOM   2719 C CD1 . LEU B 2 40  ? 16.727  145.700 70.153  1.00 27.19  ? 214 LEU B CD1 1 
ATOM   2720 C CD2 . LEU B 2 40  ? 18.937  144.710 69.574  1.00 25.70  ? 214 LEU B CD2 1 
ATOM   2721 N N   . VAL B 2 41  ? 18.806  144.690 74.119  1.00 26.99  ? 215 VAL B N   1 
ATOM   2722 C CA  . VAL B 2 41  ? 18.638  143.510 74.967  1.00 26.80  ? 215 VAL B CA  1 
ATOM   2723 C C   . VAL B 2 41  ? 17.800  143.798 76.227  1.00 26.71  ? 215 VAL B C   1 
ATOM   2724 O O   . VAL B 2 41  ? 16.937  142.997 76.621  1.00 26.47  ? 215 VAL B O   1 
ATOM   2725 C CB  . VAL B 2 41  ? 20.017  142.913 75.371  1.00 27.00  ? 215 VAL B CB  1 
ATOM   2726 C CG1 . VAL B 2 41  ? 19.845  141.634 76.188  1.00 26.41  ? 215 VAL B CG1 1 
ATOM   2727 C CG2 . VAL B 2 41  ? 20.880  142.654 74.126  1.00 26.72  ? 215 VAL B CG2 1 
ATOM   2728 N N   . ASP B 2 42  ? 18.042  144.940 76.855  1.00 26.70  ? 216 ASP B N   1 
ATOM   2729 C CA  . ASP B 2 42  ? 17.284  145.292 78.050  1.00 27.15  ? 216 ASP B CA  1 
ATOM   2730 C C   . ASP B 2 42  ? 15.797  145.493 77.716  1.00 26.76  ? 216 ASP B C   1 
ATOM   2731 O O   . ASP B 2 42  ? 14.922  145.063 78.470  1.00 26.86  ? 216 ASP B O   1 
ATOM   2732 C CB  . ASP B 2 42  ? 17.880  146.525 78.718  1.00 27.78  ? 216 ASP B CB  1 
ATOM   2733 C CG  . ASP B 2 42  ? 17.201  146.854 80.015  1.00 29.38  ? 216 ASP B CG  1 
ATOM   2734 O OD1 . ASP B 2 42  ? 16.345  147.751 79.997  1.00 30.27  ? 216 ASP B OD1 1 
ATOM   2735 O OD2 . ASP B 2 42  ? 17.428  146.246 81.090  1.00 32.53  ? 216 ASP B OD2 1 
ATOM   2736 N N   . TRP B 2 43  ? 15.524  146.109 76.567  1.00 26.17  ? 217 TRP B N   1 
ATOM   2737 C CA  . TRP B 2 43  ? 14.166  146.190 76.027  1.00 26.03  ? 217 TRP B CA  1 
ATOM   2738 C C   . TRP B 2 43  ? 13.591  144.801 75.756  1.00 26.06  ? 217 TRP B C   1 
ATOM   2739 O O   . TRP B 2 43  ? 12.446  144.532 76.106  1.00 26.22  ? 217 TRP B O   1 
ATOM   2740 C CB  . TRP B 2 43  ? 14.119  147.038 74.736  1.00 25.89  ? 217 TRP B CB  1 
ATOM   2741 C CG  . TRP B 2 43  ? 12.749  147.099 74.120  1.00 25.98  ? 217 TRP B CG  1 
ATOM   2742 C CD1 . TRP B 2 43  ? 11.630  147.696 74.650  1.00 26.00  ? 217 TRP B CD1 1 
ATOM   2743 C CD2 . TRP B 2 43  ? 12.333  146.509 72.878  1.00 26.29  ? 217 TRP B CD2 1 
ATOM   2744 N NE1 . TRP B 2 43  ? 10.558  147.523 73.807  1.00 25.98  ? 217 TRP B NE1 1 
ATOM   2745 C CE2 . TRP B 2 43  ? 10.959  146.804 72.711  1.00 25.93  ? 217 TRP B CE2 1 
ATOM   2746 C CE3 . TRP B 2 43  ? 12.990  145.782 71.870  1.00 25.47  ? 217 TRP B CE3 1 
ATOM   2747 C CZ2 . TRP B 2 43  ? 10.235  146.391 71.596  1.00 27.35  ? 217 TRP B CZ2 1 
ATOM   2748 C CZ3 . TRP B 2 43  ? 12.273  145.373 70.761  1.00 26.42  ? 217 TRP B CZ3 1 
ATOM   2749 C CH2 . TRP B 2 43  ? 10.907  145.671 70.631  1.00 27.82  ? 217 TRP B CH2 1 
ATOM   2750 N N   . LEU B 2 44  ? 14.383  143.926 75.133  1.00 26.05  ? 218 LEU B N   1 
ATOM   2751 C CA  . LEU B 2 44  ? 13.938  142.562 74.858  1.00 26.16  ? 218 LEU B CA  1 
ATOM   2752 C C   . LEU B 2 44  ? 13.597  141.818 76.144  1.00 26.51  ? 218 LEU B C   1 
ATOM   2753 O O   . LEU B 2 44  ? 12.626  141.055 76.176  1.00 25.98  ? 218 LEU B O   1 
ATOM   2754 C CB  . LEU B 2 44  ? 14.979  141.789 74.051  1.00 26.29  ? 218 LEU B CB  1 
ATOM   2755 C CG  . LEU B 2 44  ? 15.242  142.216 72.596  1.00 25.94  ? 218 LEU B CG  1 
ATOM   2756 C CD1 . LEU B 2 44  ? 16.256  141.265 71.987  1.00 25.30  ? 218 LEU B CD1 1 
ATOM   2757 C CD2 . LEU B 2 44  ? 13.955  142.186 71.794  1.00 26.24  ? 218 LEU B CD2 1 
ATOM   2758 N N   . VAL B 2 45  ? 14.390  142.041 77.197  1.00 26.95  ? 219 VAL B N   1 
ATOM   2759 C CA  . VAL B 2 45  ? 14.065  141.522 78.536  1.00 27.90  ? 219 VAL B CA  1 
ATOM   2760 C C   . VAL B 2 45  ? 12.665  141.967 79.010  1.00 28.81  ? 219 VAL B C   1 
ATOM   2761 O O   . VAL B 2 45  ? 11.891  141.136 79.486  1.00 28.83  ? 219 VAL B O   1 
ATOM   2762 C CB  . VAL B 2 45  ? 15.163  141.847 79.585  1.00 27.63  ? 219 VAL B CB  1 
ATOM   2763 C CG1 . VAL B 2 45  ? 14.698  141.528 80.987  1.00 27.06  ? 219 VAL B CG1 1 
ATOM   2764 C CG2 . VAL B 2 45  ? 16.442  141.077 79.278  1.00 27.16  ? 219 VAL B CG2 1 
ATOM   2765 N N   . GLU B 2 46  ? 12.339  143.255 78.856  1.00 30.20  ? 220 GLU B N   1 
ATOM   2766 C CA  . GLU B 2 46  ? 10.990  143.776 79.179  1.00 31.52  ? 220 GLU B CA  1 
ATOM   2767 C C   . GLU B 2 46  ? 9.899   143.142 78.301  1.00 31.75  ? 220 GLU B C   1 
ATOM   2768 O O   . GLU B 2 46  ? 8.853   142.722 78.803  1.00 31.76  ? 220 GLU B O   1 
ATOM   2769 C CB  . GLU B 2 46  ? 10.920  145.312 79.058  1.00 32.15  ? 220 GLU B CB  1 
ATOM   2770 C CG  . GLU B 2 46  ? 12.044  146.079 79.741  1.00 34.50  ? 220 GLU B CG  1 
ATOM   2771 C CD  . GLU B 2 46  ? 11.947  147.592 79.539  1.00 38.78  ? 220 GLU B CD  1 
ATOM   2772 O OE1 . GLU B 2 46  ? 11.393  148.271 80.431  1.00 40.99  ? 220 GLU B OE1 1 
ATOM   2773 O OE2 . GLU B 2 46  ? 12.429  148.113 78.501  1.00 38.84  ? 220 GLU B OE2 1 
ATOM   2774 N N   . VAL B 2 47  ? 10.148  143.056 76.993  1.00 32.07  ? 221 VAL B N   1 
ATOM   2775 C CA  . VAL B 2 47  ? 9.234   142.350 76.096  1.00 32.23  ? 221 VAL B CA  1 
ATOM   2776 C C   . VAL B 2 47  ? 8.967   140.927 76.609  1.00 33.01  ? 221 VAL B C   1 
ATOM   2777 O O   . VAL B 2 47  ? 7.801   140.515 76.746  1.00 32.88  ? 221 VAL B O   1 
ATOM   2778 C CB  . VAL B 2 47  ? 9.755   142.317 74.652  1.00 32.42  ? 221 VAL B CB  1 
ATOM   2779 C CG1 . VAL B 2 47  ? 8.868   141.427 73.775  1.00 31.57  ? 221 VAL B CG1 1 
ATOM   2780 C CG2 . VAL B 2 47  ? 9.837   143.731 74.086  1.00 32.20  ? 221 VAL B CG2 1 
ATOM   2781 N N   . GLY B 2 48  ? 10.052  140.198 76.891  1.00 33.21  ? 222 GLY B N   1 
ATOM   2782 C CA  . GLY B 2 48  ? 9.992   138.904 77.542  1.00 34.27  ? 222 GLY B CA  1 
ATOM   2783 C C   . GLY B 2 48  ? 9.088   138.863 78.767  1.00 35.24  ? 222 GLY B C   1 
ATOM   2784 O O   . GLY B 2 48  ? 8.259   137.967 78.888  1.00 34.66  ? 222 GLY B O   1 
ATOM   2785 N N   . GLU B 2 49  ? 9.230   139.829 79.671  1.00 36.66  ? 223 GLU B N   1 
ATOM   2786 C CA  . GLU B 2 49  ? 8.363   139.865 80.857  1.00 38.67  ? 223 GLU B CA  1 
ATOM   2787 C C   . GLU B 2 49  ? 6.936   140.308 80.536  1.00 39.08  ? 223 GLU B C   1 
ATOM   2788 O O   . GLU B 2 49  ? 5.988   139.816 81.130  1.00 39.38  ? 223 GLU B O   1 
ATOM   2789 C CB  . GLU B 2 49  ? 8.956   140.733 81.970  1.00 38.82  ? 223 GLU B CB  1 
ATOM   2790 C CG  . GLU B 2 49  ? 10.014  140.017 82.795  1.00 42.32  ? 223 GLU B CG  1 
ATOM   2791 C CD  . GLU B 2 49  ? 9.591   138.613 83.223  1.00 47.85  ? 223 GLU B CD  1 
ATOM   2792 O OE1 . GLU B 2 49  ? 8.736   138.487 84.140  1.00 50.38  ? 223 GLU B OE1 1 
ATOM   2793 O OE2 . GLU B 2 49  ? 10.109  137.628 82.641  1.00 49.49  ? 223 GLU B OE2 1 
ATOM   2794 N N   . GLU B 2 50  ? 6.792   141.228 79.591  1.00 39.89  ? 224 GLU B N   1 
ATOM   2795 C CA  . GLU B 2 50  ? 5.476   141.690 79.176  1.00 40.73  ? 224 GLU B CA  1 
ATOM   2796 C C   . GLU B 2 50  ? 4.653   140.539 78.585  1.00 40.29  ? 224 GLU B C   1 
ATOM   2797 O O   . GLU B 2 50  ? 3.469   140.411 78.879  1.00 40.17  ? 224 GLU B O   1 
ATOM   2798 C CB  . GLU B 2 50  ? 5.608   142.862 78.190  1.00 41.15  ? 224 GLU B CB  1 
ATOM   2799 C CG  . GLU B 2 50  ? 4.292   143.453 77.694  1.00 44.42  ? 224 GLU B CG  1 
ATOM   2800 C CD  . GLU B 2 50  ? 3.518   144.199 78.772  1.00 49.00  ? 224 GLU B CD  1 
ATOM   2801 O OE1 . GLU B 2 50  ? 4.104   144.526 79.837  1.00 50.50  ? 224 GLU B OE1 1 
ATOM   2802 O OE2 . GLU B 2 50  ? 2.313   144.463 78.549  1.00 51.21  ? 224 GLU B OE2 1 
ATOM   2803 N N   . TYR B 2 51  ? 5.285   139.691 77.775  1.00 40.01  ? 225 TYR B N   1 
ATOM   2804 C CA  . TYR B 2 51  ? 4.558   138.589 77.132  1.00 39.59  ? 225 TYR B CA  1 
ATOM   2805 C C   . TYR B 2 51  ? 4.709   137.227 77.812  1.00 38.72  ? 225 TYR B C   1 
ATOM   2806 O O   . TYR B 2 51  ? 4.118   136.240 77.367  1.00 38.78  ? 225 TYR B O   1 
ATOM   2807 C CB  . TYR B 2 51  ? 4.838   138.541 75.620  1.00 39.77  ? 225 TYR B CB  1 
ATOM   2808 C CG  . TYR B 2 51  ? 4.118   139.670 74.919  1.00 41.39  ? 225 TYR B CG  1 
ATOM   2809 C CD1 . TYR B 2 51  ? 4.797   140.826 74.555  1.00 42.93  ? 225 TYR B CD1 1 
ATOM   2810 C CD2 . TYR B 2 51  ? 2.742   139.608 74.677  1.00 42.54  ? 225 TYR B CD2 1 
ATOM   2811 C CE1 . TYR B 2 51  ? 4.140   141.883 73.948  1.00 43.91  ? 225 TYR B CE1 1 
ATOM   2812 C CE2 . TYR B 2 51  ? 2.072   140.666 74.070  1.00 43.59  ? 225 TYR B CE2 1 
ATOM   2813 C CZ  . TYR B 2 51  ? 2.783   141.802 73.707  1.00 44.44  ? 225 TYR B CZ  1 
ATOM   2814 O OH  . TYR B 2 51  ? 2.148   142.861 73.098  1.00 45.82  ? 225 TYR B OH  1 
ATOM   2815 N N   . LYS B 2 52  ? 5.466   137.200 78.907  1.00 37.67  ? 226 LYS B N   1 
ATOM   2816 C CA  . LYS B 2 52  ? 5.628   136.010 79.733  1.00 37.18  ? 226 LYS B CA  1 
ATOM   2817 C C   . LYS B 2 52  ? 6.304   134.913 78.923  1.00 36.14  ? 226 LYS B C   1 
ATOM   2818 O O   . LYS B 2 52  ? 5.866   133.762 78.932  1.00 35.77  ? 226 LYS B O   1 
ATOM   2819 C CB  . LYS B 2 52  ? 4.278   135.526 80.288  1.00 37.63  ? 226 LYS B CB  1 
ATOM   2820 C CG  . LYS B 2 52  ? 3.820   136.241 81.567  1.00 39.81  ? 226 LYS B CG  1 
ATOM   2821 C CD  . LYS B 2 52  ? 2.336   135.949 81.838  1.00 44.29  ? 226 LYS B CD  1 
ATOM   2822 C CE  . LYS B 2 52  ? 1.720   136.939 82.843  1.00 46.91  ? 226 LYS B CE  1 
ATOM   2823 N NZ  . LYS B 2 52  ? 1.787   136.445 84.258  1.00 47.86  ? 226 LYS B NZ  1 
ATOM   2824 N N   . LEU B 2 53  ? 7.368   135.297 78.219  1.00 34.70  ? 227 LEU B N   1 
ATOM   2825 C CA  . LEU B 2 53  ? 8.121   134.386 77.377  1.00 33.20  ? 227 LEU B CA  1 
ATOM   2826 C C   . LEU B 2 53  ? 9.110   133.574 78.212  1.00 32.37  ? 227 LEU B C   1 
ATOM   2827 O O   . LEU B 2 53  ? 9.542   134.009 79.276  1.00 31.87  ? 227 LEU B O   1 
ATOM   2828 C CB  . LEU B 2 53  ? 8.833   135.167 76.250  1.00 33.19  ? 227 LEU B CB  1 
ATOM   2829 C CG  . LEU B 2 53  ? 7.967   136.105 75.373  1.00 31.57  ? 227 LEU B CG  1 
ATOM   2830 C CD1 . LEU B 2 53  ? 8.812   136.911 74.381  1.00 30.24  ? 227 LEU B CD1 1 
ATOM   2831 C CD2 . LEU B 2 53  ? 6.886   135.348 74.617  1.00 29.37  ? 227 LEU B CD2 1 
ATOM   2832 N N   . GLN B 2 54  ? 9.466   132.392 77.721  1.00 31.60  ? 228 GLN B N   1 
ATOM   2833 C CA  . GLN B 2 54  ? 10.520  131.600 78.327  1.00 31.11  ? 228 GLN B CA  1 
ATOM   2834 C C   . GLN B 2 54  ? 11.832  132.373 78.312  1.00 31.02  ? 228 GLN B C   1 
ATOM   2835 O O   . GLN B 2 54  ? 12.080  133.175 77.404  1.00 30.54  ? 228 GLN B O   1 
ATOM   2836 C CB  . GLN B 2 54  ? 10.696  130.291 77.569  1.00 31.21  ? 228 GLN B CB  1 
ATOM   2837 C CG  . GLN B 2 54  ? 9.515   129.336 77.662  1.00 32.31  ? 228 GLN B CG  1 
ATOM   2838 C CD  . GLN B 2 54  ? 9.156   128.971 79.095  1.00 34.13  ? 228 GLN B CD  1 
ATOM   2839 O OE1 . GLN B 2 54  ? 10.023  128.596 79.888  1.00 35.36  ? 228 GLN B OE1 1 
ATOM   2840 N NE2 . GLN B 2 54  ? 7.880   129.094 79.432  1.00 34.95  ? 228 GLN B NE2 1 
ATOM   2841 N N   . ASN B 2 55  ? 12.678  132.131 79.309  1.00 30.98  ? 229 ASN B N   1 
ATOM   2842 C CA  . ASN B 2 55  ? 14.023  132.700 79.305  1.00 31.20  ? 229 ASN B CA  1 
ATOM   2843 C C   . ASN B 2 55  ? 14.848  132.180 78.131  1.00 30.41  ? 229 ASN B C   1 
ATOM   2844 O O   . ASN B 2 55  ? 15.741  132.860 77.638  1.00 30.32  ? 229 ASN B O   1 
ATOM   2845 C CB  . ASN B 2 55  ? 14.739  132.413 80.617  1.00 31.38  ? 229 ASN B CB  1 
ATOM   2846 C CG  . ASN B 2 55  ? 14.135  133.171 81.786  1.00 33.27  ? 229 ASN B CG  1 
ATOM   2847 O OD1 . ASN B 2 55  ? 13.450  134.184 81.602  1.00 32.80  ? 229 ASN B OD1 1 
ATOM   2848 N ND2 . ASN B 2 55  ? 14.374  132.670 83.008  1.00 35.72  ? 229 ASN B ND2 1 
ATOM   2849 N N   . GLU B 2 56  ? 14.528  130.968 77.690  1.00 29.78  ? 230 GLU B N   1 
ATOM   2850 C CA  . GLU B 2 56  ? 15.161  130.376 76.518  1.00 29.37  ? 230 GLU B CA  1 
ATOM   2851 C C   . GLU B 2 56  ? 14.981  131.241 75.255  1.00 28.39  ? 230 GLU B C   1 
ATOM   2852 O O   . GLU B 2 56  ? 15.937  131.504 74.529  1.00 27.90  ? 230 GLU B O   1 
ATOM   2853 C CB  . GLU B 2 56  ? 14.626  128.968 76.304  1.00 29.33  ? 230 GLU B CB  1 
ATOM   2854 C CG  . GLU B 2 56  ? 15.194  128.254 75.091  1.00 32.71  ? 230 GLU B CG  1 
ATOM   2855 C CD  . GLU B 2 56  ? 16.712  128.158 75.068  1.00 36.65  ? 230 GLU B CD  1 
ATOM   2856 O OE1 . GLU B 2 56  ? 17.403  128.734 75.945  1.00 38.84  ? 230 GLU B OE1 1 
ATOM   2857 O OE2 . GLU B 2 56  ? 17.216  127.481 74.149  1.00 39.08  ? 230 GLU B OE2 1 
ATOM   2858 N N   . THR B 2 57  ? 13.754  131.703 75.036  1.00 27.01  ? 231 THR B N   1 
ATOM   2859 C CA  . THR B 2 57  ? 13.410  132.549 73.907  1.00 26.31  ? 231 THR B CA  1 
ATOM   2860 C C   . THR B 2 57  ? 14.287  133.794 73.848  1.00 25.84  ? 231 THR B C   1 
ATOM   2861 O O   . THR B 2 57  ? 14.792  134.169 72.778  1.00 25.49  ? 231 THR B O   1 
ATOM   2862 C CB  . THR B 2 57  ? 11.951  132.941 74.029  1.00 26.16  ? 231 THR B CB  1 
ATOM   2863 O OG1 . THR B 2 57  ? 11.179  131.754 74.201  1.00 26.63  ? 231 THR B OG1 1 
ATOM   2864 C CG2 . THR B 2 57  ? 11.421  133.510 72.723  1.00 26.12  ? 231 THR B CG2 1 
ATOM   2865 N N   . LEU B 2 58  ? 14.440  134.430 75.006  1.00 24.97  ? 232 LEU B N   1 
ATOM   2866 C CA  . LEU B 2 58  ? 15.298  135.588 75.186  1.00 24.42  ? 232 LEU B CA  1 
ATOM   2867 C C   . LEU B 2 58  ? 16.737  135.257 74.784  1.00 23.52  ? 232 LEU B C   1 
ATOM   2868 O O   . LEU B 2 58  ? 17.329  135.983 73.992  1.00 23.77  ? 232 LEU B O   1 
ATOM   2869 C CB  . LEU B 2 58  ? 15.239  136.029 76.649  1.00 24.63  ? 232 LEU B CB  1 
ATOM   2870 C CG  . LEU B 2 58  ? 15.568  137.440 77.137  1.00 26.59  ? 232 LEU B CG  1 
ATOM   2871 C CD1 . LEU B 2 58  ? 16.464  137.381 78.383  1.00 27.43  ? 232 LEU B CD1 1 
ATOM   2872 C CD2 . LEU B 2 58  ? 16.126  138.397 76.074  1.00 25.55  ? 232 LEU B CD2 1 
ATOM   2873 N N   . HIS B 2 59  ? 17.290  134.163 75.317  1.00 22.22  ? 233 HIS B N   1 
ATOM   2874 C CA  . HIS B 2 59  ? 18.672  133.769 75.006  1.00 20.99  ? 233 HIS B CA  1 
ATOM   2875 C C   . HIS B 2 59  ? 18.846  133.460 73.521  1.00 20.60  ? 233 HIS B C   1 
ATOM   2876 O O   . HIS B 2 59  ? 19.856  133.841 72.933  1.00 20.90  ? 233 HIS B O   1 
ATOM   2877 C CB  . HIS B 2 59  ? 19.120  132.568 75.833  1.00 20.55  ? 233 HIS B CB  1 
ATOM   2878 C CG  . HIS B 2 59  ? 19.555  132.912 77.220  1.00 20.96  ? 233 HIS B CG  1 
ATOM   2879 N ND1 . HIS B 2 59  ? 18.665  133.085 78.262  1.00 21.65  ? 233 HIS B ND1 1 
ATOM   2880 C CD2 . HIS B 2 59  ? 20.788  133.101 77.745  1.00 19.53  ? 233 HIS B CD2 1 
ATOM   2881 C CE1 . HIS B 2 59  ? 19.332  133.386 79.361  1.00 19.11  ? 233 HIS B CE1 1 
ATOM   2882 N NE2 . HIS B 2 59  ? 20.620  133.404 79.074  1.00 18.62  ? 233 HIS B NE2 1 
ATOM   2883 N N   . LEU B 2 60  ? 17.875  132.797 72.902  1.00 19.73  ? 234 LEU B N   1 
ATOM   2884 C CA  . LEU B 2 60  ? 17.954  132.548 71.462  1.00 19.44  ? 234 LEU B CA  1 
ATOM   2885 C C   . LEU B 2 60  ? 17.945  133.845 70.647  1.00 19.56  ? 234 LEU B C   1 
ATOM   2886 O O   . LEU B 2 60  ? 18.750  134.018 69.725  1.00 18.55  ? 234 LEU B O   1 
ATOM   2887 C CB  . LEU B 2 60  ? 16.798  131.674 70.997  1.00 19.61  ? 234 LEU B CB  1 
ATOM   2888 C CG  . LEU B 2 60  ? 16.721  130.227 71.459  1.00 19.81  ? 234 LEU B CG  1 
ATOM   2889 C CD1 . LEU B 2 60  ? 15.371  129.691 71.040  1.00 20.62  ? 234 LEU B CD1 1 
ATOM   2890 C CD2 . LEU B 2 60  ? 17.854  129.414 70.831  1.00 18.90  ? 234 LEU B CD2 1 
ATOM   2891 N N   . ALA B 2 61  ? 17.019  134.744 70.986  1.00 19.86  ? 235 ALA B N   1 
ATOM   2892 C CA  . ALA B 2 61  ? 16.835  135.995 70.246  1.00 20.13  ? 235 ALA B CA  1 
ATOM   2893 C C   . ALA B 2 61  ? 18.122  136.805 70.221  1.00 20.43  ? 235 ALA B C   1 
ATOM   2894 O O   . ALA B 2 61  ? 18.508  137.325 69.165  1.00 21.05  ? 235 ALA B O   1 
ATOM   2895 C CB  . ALA B 2 61  ? 15.712  136.813 70.856  1.00 20.13  ? 235 ALA B CB  1 
ATOM   2896 N N   . VAL B 2 62  ? 18.776  136.909 71.379  1.00 20.39  ? 236 VAL B N   1 
ATOM   2897 C CA  . VAL B 2 62  ? 20.065  137.581 71.491  1.00 20.80  ? 236 VAL B CA  1 
ATOM   2898 C C   . VAL B 2 62  ? 21.126  136.859 70.637  1.00 21.27  ? 236 VAL B C   1 
ATOM   2899 O O   . VAL B 2 62  ? 21.932  137.519 69.973  1.00 21.89  ? 236 VAL B O   1 
ATOM   2900 C CB  . VAL B 2 62  ? 20.549  137.693 72.978  1.00 21.02  ? 236 VAL B CB  1 
ATOM   2901 C CG1 . VAL B 2 62  ? 21.973  138.228 73.051  1.00 20.92  ? 236 VAL B CG1 1 
ATOM   2902 C CG2 . VAL B 2 62  ? 19.612  138.574 73.823  1.00 20.25  ? 236 VAL B CG2 1 
ATOM   2903 N N   . ASN B 2 63  ? 21.142  135.522 70.671  1.00 20.79  ? 237 ASN B N   1 
ATOM   2904 C CA  . ASN B 2 63  ? 22.056  134.753 69.827  1.00 20.86  ? 237 ASN B CA  1 
ATOM   2905 C C   . ASN B 2 63  ? 21.844  135.088 68.342  1.00 20.41  ? 237 ASN B C   1 
ATOM   2906 O O   . ASN B 2 63  ? 22.821  135.259 67.615  1.00 19.69  ? 237 ASN B O   1 
ATOM   2907 C CB  . ASN B 2 63  ? 21.990  133.227 70.088  1.00 20.49  ? 237 ASN B CB  1 
ATOM   2908 C CG  . ASN B 2 63  ? 22.725  132.397 68.992  1.00 22.60  ? 237 ASN B CG  1 
ATOM   2909 O OD1 . ASN B 2 63  ? 22.129  132.010 67.969  1.00 21.42  ? 237 ASN B OD1 1 
ATOM   2910 N ND2 . ASN B 2 63  ? 24.016  132.142 69.205  1.00 21.47  ? 237 ASN B ND2 1 
ATOM   2911 N N   . TYR B 2 64  ? 20.577  135.217 67.915  1.00 20.62  ? 238 TYR B N   1 
ATOM   2912 C CA  . TYR B 2 64  ? 20.276  135.542 66.515  1.00 20.55  ? 238 TYR B CA  1 
ATOM   2913 C C   . TYR B 2 64  ? 20.765  136.927 66.147  1.00 20.79  ? 238 TYR B C   1 
ATOM   2914 O O   . TYR B 2 64  ? 21.268  137.126 65.041  1.00 20.24  ? 238 TYR B O   1 
ATOM   2915 C CB  . TYR B 2 64  ? 18.794  135.416 66.155  1.00 20.18  ? 238 TYR B CB  1 
ATOM   2916 C CG  . TYR B 2 64  ? 18.154  134.089 66.461  1.00 20.19  ? 238 TYR B CG  1 
ATOM   2917 C CD1 . TYR B 2 64  ? 18.912  132.932 66.640  1.00 18.62  ? 238 TYR B CD1 1 
ATOM   2918 C CD2 . TYR B 2 64  ? 16.772  133.994 66.590  1.00 20.77  ? 238 TYR B CD2 1 
ATOM   2919 C CE1 . TYR B 2 64  ? 18.306  131.720 66.950  1.00 18.40  ? 238 TYR B CE1 1 
ATOM   2920 C CE2 . TYR B 2 64  ? 16.156  132.774 66.904  1.00 19.89  ? 238 TYR B CE2 1 
ATOM   2921 C CZ  . TYR B 2 64  ? 16.929  131.650 67.074  1.00 18.95  ? 238 TYR B CZ  1 
ATOM   2922 O OH  . TYR B 2 64  ? 16.312  130.460 67.380  1.00 19.95  ? 238 TYR B OH  1 
ATOM   2923 N N   . ILE B 2 65  ? 20.617  137.869 67.080  1.00 21.34  ? 239 ILE B N   1 
ATOM   2924 C CA  . ILE B 2 65  ? 21.000  139.261 66.858  1.00 22.01  ? 239 ILE B CA  1 
ATOM   2925 C C   . ILE B 2 65  ? 22.506  139.374 66.726  1.00 22.15  ? 239 ILE B C   1 
ATOM   2926 O O   . ILE B 2 65  ? 22.997  140.005 65.794  1.00 21.91  ? 239 ILE B O   1 
ATOM   2927 C CB  . ILE B 2 65  ? 20.486  140.163 68.002  1.00 22.83  ? 239 ILE B CB  1 
ATOM   2928 C CG1 . ILE B 2 65  ? 18.971  140.364 67.886  1.00 22.90  ? 239 ILE B CG1 1 
ATOM   2929 C CG2 . ILE B 2 65  ? 21.201  141.512 68.006  1.00 22.35  ? 239 ILE B CG2 1 
ATOM   2930 C CD1 . ILE B 2 65  ? 18.316  140.691 69.207  1.00 25.66  ? 239 ILE B CD1 1 
ATOM   2931 N N   . ASP B 2 66  ? 23.233  138.735 67.644  1.00 21.85  ? 240 ASP B N   1 
ATOM   2932 C CA  . ASP B 2 66  ? 24.683  138.769 67.612  1.00 21.94  ? 240 ASP B CA  1 
ATOM   2933 C C   . ASP B 2 66  ? 25.244  138.130 66.339  1.00 21.31  ? 240 ASP B C   1 
ATOM   2934 O O   . ASP B 2 66  ? 26.236  138.594 65.785  1.00 20.37  ? 240 ASP B O   1 
ATOM   2935 C CB  . ASP B 2 66  ? 25.252  138.101 68.851  1.00 22.09  ? 240 ASP B CB  1 
ATOM   2936 C CG  . ASP B 2 66  ? 25.000  138.909 70.118  1.00 25.17  ? 240 ASP B CG  1 
ATOM   2937 O OD1 . ASP B 2 66  ? 24.976  140.161 70.074  1.00 28.02  ? 240 ASP B OD1 1 
ATOM   2938 O OD2 . ASP B 2 66  ? 24.815  138.369 71.217  1.00 28.78  ? 240 ASP B OD2 1 
ATOM   2939 N N   . ARG B 2 67  ? 24.595  137.070 65.880  1.00 21.20  ? 241 ARG B N   1 
ATOM   2940 C CA  . ARG B 2 67  ? 25.024  136.409 64.663  1.00 21.61  ? 241 ARG B CA  1 
ATOM   2941 C C   . ARG B 2 67  ? 24.659  137.228 63.444  1.00 21.85  ? 241 ARG B C   1 
ATOM   2942 O O   . ARG B 2 67  ? 25.425  137.266 62.495  1.00 22.51  ? 241 ARG B O   1 
ATOM   2943 C CB  . ARG B 2 67  ? 24.445  135.003 64.577  1.00 21.48  ? 241 ARG B CB  1 
ATOM   2944 C CG  . ARG B 2 67  ? 25.210  133.974 65.408  1.00 21.08  ? 241 ARG B CG  1 
ATOM   2945 C CD  . ARG B 2 67  ? 24.361  132.773 65.777  1.00 22.04  ? 241 ARG B CD  1 
ATOM   2946 N NE  . ARG B 2 67  ? 24.083  131.984 64.585  1.00 22.99  ? 241 ARG B NE  1 
ATOM   2947 C CZ  . ARG B 2 67  ? 23.021  131.214 64.407  1.00 22.58  ? 241 ARG B CZ  1 
ATOM   2948 N NH1 . ARG B 2 67  ? 22.106  131.070 65.354  1.00 21.26  ? 241 ARG B NH1 1 
ATOM   2949 N NH2 . ARG B 2 67  ? 22.888  130.567 63.265  1.00 23.01  ? 241 ARG B NH2 1 
ATOM   2950 N N   . PHE B 2 68  ? 23.501  137.888 63.476  1.00 22.47  ? 242 PHE B N   1 
ATOM   2951 C CA  . PHE B 2 68  ? 23.042  138.706 62.354  1.00 23.03  ? 242 PHE B CA  1 
ATOM   2952 C C   . PHE B 2 68  ? 23.969  139.910 62.213  1.00 23.92  ? 242 PHE B C   1 
ATOM   2953 O O   . PHE B 2 68  ? 24.395  140.256 61.091  1.00 24.00  ? 242 PHE B O   1 
ATOM   2954 C CB  . PHE B 2 68  ? 21.596  139.166 62.565  1.00 22.93  ? 242 PHE B CB  1 
ATOM   2955 C CG  . PHE B 2 68  ? 21.025  139.959 61.414  1.00 21.83  ? 242 PHE B CG  1 
ATOM   2956 C CD1 . PHE B 2 68  ? 20.281  139.337 60.427  1.00 20.74  ? 242 PHE B CD1 1 
ATOM   2957 C CD2 . PHE B 2 68  ? 21.218  141.331 61.331  1.00 23.04  ? 242 PHE B CD2 1 
ATOM   2958 C CE1 . PHE B 2 68  ? 19.759  140.067 59.355  1.00 22.66  ? 242 PHE B CE1 1 
ATOM   2959 C CE2 . PHE B 2 68  ? 20.694  142.071 60.256  1.00 22.64  ? 242 PHE B CE2 1 
ATOM   2960 C CZ  . PHE B 2 68  ? 19.962  141.441 59.282  1.00 21.50  ? 242 PHE B CZ  1 
ATOM   2961 N N   . LEU B 2 69  ? 24.293  140.521 63.355  1.00 23.88  ? 243 LEU B N   1 
ATOM   2962 C CA  . LEU B 2 69  ? 25.142  141.697 63.394  1.00 24.34  ? 243 LEU B CA  1 
ATOM   2963 C C   . LEU B 2 69  ? 26.608  141.375 63.158  1.00 25.61  ? 243 LEU B C   1 
ATOM   2964 O O   . LEU B 2 69  ? 27.391  142.282 62.893  1.00 26.77  ? 243 LEU B O   1 
ATOM   2965 C CB  . LEU B 2 69  ? 24.979  142.448 64.717  1.00 24.61  ? 243 LEU B CB  1 
ATOM   2966 C CG  . LEU B 2 69  ? 23.608  143.059 64.995  1.00 22.94  ? 243 LEU B CG  1 
ATOM   2967 C CD1 . LEU B 2 69  ? 23.670  143.855 66.254  1.00 21.75  ? 243 LEU B CD1 1 
ATOM   2968 C CD2 . LEU B 2 69  ? 23.178  143.925 63.830  1.00 22.69  ? 243 LEU B CD2 1 
ATOM   2969 N N   . SER B 2 70  ? 26.981  140.102 63.259  1.00 26.09  ? 244 SER B N   1 
ATOM   2970 C CA  . SER B 2 70  ? 28.303  139.636 62.863  1.00 27.21  ? 244 SER B CA  1 
ATOM   2971 C C   . SER B 2 70  ? 28.537  139.706 61.341  1.00 28.00  ? 244 SER B C   1 
ATOM   2972 O O   . SER B 2 70  ? 29.671  139.735 60.890  1.00 28.14  ? 244 SER B O   1 
ATOM   2973 C CB  . SER B 2 70  ? 28.505  138.187 63.309  1.00 27.02  ? 244 SER B CB  1 
ATOM   2974 O OG  . SER B 2 70  ? 28.847  138.104 64.683  1.00 28.84  ? 244 SER B OG  1 
ATOM   2975 N N   . SER B 2 71  ? 27.476  139.685 60.545  1.00 28.79  ? 245 SER B N   1 
ATOM   2976 C CA  . SER B 2 71  ? 27.654  139.738 59.098  1.00 29.76  ? 245 SER B CA  1 
ATOM   2977 C C   . SER B 2 71  ? 26.962  140.919 58.446  1.00 29.87  ? 245 SER B C   1 
ATOM   2978 O O   . SER B 2 71  ? 27.361  141.338 57.372  1.00 30.86  ? 245 SER B O   1 
ATOM   2979 C CB  . SER B 2 71  ? 27.219  138.437 58.427  1.00 30.10  ? 245 SER B CB  1 
ATOM   2980 O OG  . SER B 2 71  ? 25.955  138.004 58.899  1.00 31.79  ? 245 SER B OG  1 
ATOM   2981 N N   . MET B 2 72  ? 25.933  141.457 59.089  1.00 29.64  ? 246 MET B N   1 
ATOM   2982 C CA  . MET B 2 72  ? 25.165  142.542 58.495  1.00 28.84  ? 246 MET B CA  1 
ATOM   2983 C C   . MET B 2 72  ? 25.348  143.826 59.273  1.00 29.06  ? 246 MET B C   1 
ATOM   2984 O O   . MET B 2 72  ? 25.125  143.911 60.490  1.00 28.64  ? 246 MET B O   1 
ATOM   2985 C CB  . MET B 2 72  ? 23.684  142.201 58.387  1.00 29.04  ? 246 MET B CB  1 
ATOM   2986 C CG  . MET B 2 72  ? 23.410  140.882 57.707  1.00 28.19  ? 246 MET B CG  1 
ATOM   2987 S SD  . MET B 2 72  ? 23.598  140.973 55.907  1.00 28.37  ? 246 MET B SD  1 
ATOM   2988 C CE  . MET B 2 72  ? 22.118  141.906 55.514  1.00 23.38  ? 246 MET B CE  1 
ATOM   2989 N N   . SER B 2 73  ? 25.769  144.827 58.529  1.00 28.51  ? 247 SER B N   1 
ATOM   2990 C CA  . SER B 2 73  ? 26.012  146.136 59.050  1.00 28.87  ? 247 SER B CA  1 
ATOM   2991 C C   . SER B 2 73  ? 24.626  146.830 59.136  1.00 28.69  ? 247 SER B C   1 
ATOM   2992 O O   . SER B 2 73  ? 23.818  146.723 58.205  1.00 28.16  ? 247 SER B O   1 
ATOM   2993 C CB  . SER B 2 73  ? 27.037  146.798 58.121  1.00 28.29  ? 247 SER B CB  1 
ATOM   2994 O OG  . SER B 2 73  ? 26.921  148.180 58.133  1.00 30.56  ? 247 SER B OG  1 
ATOM   2995 N N   . VAL B 2 74  ? 24.318  147.455 60.278  1.00 28.72  ? 248 VAL B N   1 
ATOM   2996 C CA  . VAL B 2 74  ? 22.961  147.974 60.528  1.00 29.31  ? 248 VAL B CA  1 
ATOM   2997 C C   . VAL B 2 74  ? 22.940  149.422 61.053  1.00 30.22  ? 248 VAL B C   1 
ATOM   2998 O O   . VAL B 2 74  ? 23.794  149.824 61.851  1.00 30.66  ? 248 VAL B O   1 
ATOM   2999 C CB  . VAL B 2 74  ? 22.126  146.994 61.465  1.00 29.80  ? 248 VAL B CB  1 
ATOM   3000 C CG1 . VAL B 2 74  ? 20.710  147.495 61.743  1.00 27.74  ? 248 VAL B CG1 1 
ATOM   3001 C CG2 . VAL B 2 74  ? 22.043  145.586 60.857  1.00 28.92  ? 248 VAL B CG2 1 
ATOM   3002 N N   . LEU B 2 75  ? 21.970  150.210 60.593  1.00 31.16  ? 249 LEU B N   1 
ATOM   3003 C CA  . LEU B 2 75  ? 21.798  151.581 61.076  1.00 32.04  ? 249 LEU B CA  1 
ATOM   3004 C C   . LEU B 2 75  ? 21.079  151.600 62.414  1.00 32.38  ? 249 LEU B C   1 
ATOM   3005 O O   . LEU B 2 75  ? 20.250  150.733 62.692  1.00 32.40  ? 249 LEU B O   1 
ATOM   3006 C CB  . LEU B 2 75  ? 21.028  152.443 60.079  1.00 31.90  ? 249 LEU B CB  1 
ATOM   3007 C CG  . LEU B 2 75  ? 21.657  152.883 58.759  1.00 34.13  ? 249 LEU B CG  1 
ATOM   3008 C CD1 . LEU B 2 75  ? 21.050  154.232 58.352  1.00 35.81  ? 249 LEU B CD1 1 
ATOM   3009 C CD2 . LEU B 2 75  ? 23.193  152.936 58.805  1.00 35.78  ? 249 LEU B CD2 1 
ATOM   3010 N N   . ARG B 2 76  ? 21.374  152.615 63.221  1.00 32.40  ? 250 ARG B N   1 
ATOM   3011 C CA  . ARG B 2 76  ? 20.825  152.700 64.564  1.00 32.90  ? 250 ARG B CA  1 
ATOM   3012 C C   . ARG B 2 76  ? 19.299  152.717 64.579  1.00 32.63  ? 250 ARG B C   1 
ATOM   3013 O O   . ARG B 2 76  ? 18.694  152.182 65.496  1.00 32.76  ? 250 ARG B O   1 
ATOM   3014 C CB  . ARG B 2 76  ? 21.408  153.896 65.332  1.00 33.00  ? 250 ARG B CB  1 
ATOM   3015 C CG  . ARG B 2 76  ? 20.982  155.278 64.854  1.00 35.16  ? 250 ARG B CG  1 
ATOM   3016 C CD  . ARG B 2 76  ? 21.831  156.410 65.420  1.00 37.60  ? 250 ARG B CD  1 
ATOM   3017 N NE  . ARG B 2 76  ? 23.253  156.161 65.197  1.00 40.92  ? 250 ARG B NE  1 
ATOM   3018 C CZ  . ARG B 2 76  ? 24.241  156.710 65.899  1.00 42.89  ? 250 ARG B CZ  1 
ATOM   3019 N NH1 . ARG B 2 76  ? 23.977  157.557 66.889  1.00 42.76  ? 250 ARG B NH1 1 
ATOM   3020 N NH2 . ARG B 2 76  ? 25.504  156.407 65.610  1.00 43.12  ? 250 ARG B NH2 1 
ATOM   3021 N N   . GLY B 2 77  ? 18.690  153.307 63.551  1.00 32.49  ? 251 GLY B N   1 
ATOM   3022 C CA  . GLY B 2 77  ? 17.243  153.399 63.464  1.00 32.02  ? 251 GLY B CA  1 
ATOM   3023 C C   . GLY B 2 77  ? 16.567  152.083 63.107  1.00 31.89  ? 251 GLY B C   1 
ATOM   3024 O O   . GLY B 2 77  ? 15.336  151.986 63.158  1.00 31.66  ? 251 GLY B O   1 
ATOM   3025 N N   . LYS B 2 78  ? 17.380  151.080 62.758  1.00 31.45  ? 252 LYS B N   1 
ATOM   3026 C CA  . LYS B 2 78  ? 16.911  149.751 62.353  1.00 30.95  ? 252 LYS B CA  1 
ATOM   3027 C C   . LYS B 2 78  ? 17.302  148.650 63.351  1.00 30.51  ? 252 LYS B C   1 
ATOM   3028 O O   . LYS B 2 78  ? 16.881  147.496 63.200  1.00 30.45  ? 252 LYS B O   1 
ATOM   3029 C CB  . LYS B 2 78  ? 17.468  149.392 60.958  1.00 31.23  ? 252 LYS B CB  1 
ATOM   3030 C CG  . LYS B 2 78  ? 16.954  150.261 59.821  1.00 31.22  ? 252 LYS B CG  1 
ATOM   3031 C CD  . LYS B 2 78  ? 15.475  150.012 59.609  1.00 33.74  ? 252 LYS B CD  1 
ATOM   3032 C CE  . LYS B 2 78  ? 15.018  150.526 58.274  1.00 33.71  ? 252 LYS B CE  1 
ATOM   3033 N NZ  . LYS B 2 78  ? 14.392  151.843 58.512  1.00 35.44  ? 252 LYS B NZ  1 
ATOM   3034 N N   . LEU B 2 79  ? 18.100  148.991 64.358  1.00 29.63  ? 253 LEU B N   1 
ATOM   3035 C CA  . LEU B 2 79  ? 18.535  147.990 65.338  1.00 29.70  ? 253 LEU B CA  1 
ATOM   3036 C C   . LEU B 2 79  ? 17.353  147.271 66.011  1.00 29.05  ? 253 LEU B C   1 
ATOM   3037 O O   . LEU B 2 79  ? 17.368  146.047 66.187  1.00 29.32  ? 253 LEU B O   1 
ATOM   3038 C CB  . LEU B 2 79  ? 19.469  148.585 66.409  1.00 29.55  ? 253 LEU B CB  1 
ATOM   3039 C CG  . LEU B 2 79  ? 20.005  147.522 67.393  1.00 30.37  ? 253 LEU B CG  1 
ATOM   3040 C CD1 . LEU B 2 79  ? 20.842  146.426 66.687  1.00 28.60  ? 253 LEU B CD1 1 
ATOM   3041 C CD2 . LEU B 2 79  ? 20.793  148.145 68.535  1.00 29.57  ? 253 LEU B CD2 1 
ATOM   3042 N N   . GLN B 2 80  ? 16.328  148.034 66.357  1.00 28.13  ? 254 GLN B N   1 
ATOM   3043 C CA  . GLN B 2 80  ? 15.188  147.485 67.078  1.00 27.93  ? 254 GLN B CA  1 
ATOM   3044 C C   . GLN B 2 80  ? 14.289  146.636 66.176  1.00 27.34  ? 254 GLN B C   1 
ATOM   3045 O O   . GLN B 2 80  ? 13.618  145.718 66.659  1.00 28.13  ? 254 GLN B O   1 
ATOM   3046 C CB  . GLN B 2 80  ? 14.426  148.600 67.818  1.00 27.54  ? 254 GLN B CB  1 
ATOM   3047 C CG  . GLN B 2 80  ? 12.995  148.266 68.202  1.00 28.84  ? 254 GLN B CG  1 
ATOM   3048 C CD  . GLN B 2 80  ? 12.303  149.403 68.939  1.00 31.59  ? 254 GLN B CD  1 
ATOM   3049 O OE1 . GLN B 2 80  ? 11.560  149.161 69.895  1.00 34.16  ? 254 GLN B OE1 1 
ATOM   3050 N NE2 . GLN B 2 80  ? 12.537  150.637 68.500  1.00 30.26  ? 254 GLN B NE2 1 
ATOM   3051 N N   . LEU B 2 81  ? 14.294  146.926 64.876  1.00 26.25  ? 255 LEU B N   1 
ATOM   3052 C CA  . LEU B 2 81  ? 13.649  146.068 63.886  1.00 25.29  ? 255 LEU B CA  1 
ATOM   3053 C C   . LEU B 2 81  ? 14.296  144.679 63.819  1.00 24.95  ? 255 LEU B C   1 
ATOM   3054 O O   . LEU B 2 81  ? 13.602  143.660 63.705  1.00 25.23  ? 255 LEU B O   1 
ATOM   3055 C CB  . LEU B 2 81  ? 13.678  146.720 62.492  1.00 24.67  ? 255 LEU B CB  1 
ATOM   3056 C CG  . LEU B 2 81  ? 12.926  145.968 61.388  1.00 24.10  ? 255 LEU B CG  1 
ATOM   3057 C CD1 . LEU B 2 81  ? 11.467  145.736 61.762  1.00 23.37  ? 255 LEU B CD1 1 
ATOM   3058 C CD2 . LEU B 2 81  ? 13.040  146.696 60.024  1.00 24.16  ? 255 LEU B CD2 1 
ATOM   3059 N N   . VAL B 2 82  ? 15.623  144.645 63.876  1.00 24.25  ? 256 VAL B N   1 
ATOM   3060 C CA  . VAL B 2 82  ? 16.354  143.391 63.829  1.00 23.64  ? 256 VAL B CA  1 
ATOM   3061 C C   . VAL B 2 82  ? 15.968  142.615 65.063  1.00 23.50  ? 256 VAL B C   1 
ATOM   3062 O O   . VAL B 2 82  ? 15.664  141.420 64.986  1.00 23.25  ? 256 VAL B O   1 
ATOM   3063 C CB  . VAL B 2 82  ? 17.899  143.607 63.834  1.00 23.50  ? 256 VAL B CB  1 
ATOM   3064 C CG1 . VAL B 2 82  ? 18.609  142.286 63.701  1.00 22.50  ? 256 VAL B CG1 1 
ATOM   3065 C CG2 . VAL B 2 82  ? 18.314  144.513 62.699  1.00 23.42  ? 256 VAL B CG2 1 
ATOM   3066 N N   . GLY B 2 83  ? 15.958  143.330 66.192  1.00 23.34  ? 257 GLY B N   1 
ATOM   3067 C CA  . GLY B 2 83  ? 15.673  142.758 67.491  1.00 22.98  ? 257 GLY B CA  1 
ATOM   3068 C C   . GLY B 2 83  ? 14.268  142.207 67.589  1.00 22.61  ? 257 GLY B C   1 
ATOM   3069 O O   . GLY B 2 83  ? 14.054  141.202 68.241  1.00 22.44  ? 257 GLY B O   1 
ATOM   3070 N N   . THR B 2 84  ? 13.321  142.852 66.922  1.00 22.72  ? 258 THR B N   1 
ATOM   3071 C CA  . THR B 2 84  ? 11.931  142.415 66.958  1.00 23.84  ? 258 THR B CA  1 
ATOM   3072 C C   . THR B 2 84  ? 11.752  141.142 66.153  1.00 23.79  ? 258 THR B C   1 
ATOM   3073 O O   . THR B 2 84  ? 11.106  140.210 66.606  1.00 23.30  ? 258 THR B O   1 
ATOM   3074 C CB  . THR B 2 84  ? 11.020  143.528 66.408  1.00 24.23  ? 258 THR B CB  1 
ATOM   3075 O OG1 . THR B 2 84  ? 11.115  144.654 67.276  1.00 25.55  ? 258 THR B OG1 1 
ATOM   3076 C CG2 . THR B 2 84  ? 9.563   143.148 66.506  1.00 24.25  ? 258 THR B CG2 1 
ATOM   3077 N N   . ALA B 2 85  ? 12.332  141.126 64.951  1.00 24.37  ? 259 ALA B N   1 
ATOM   3078 C CA  . ALA B 2 85  ? 12.333  139.951 64.077  1.00 24.19  ? 259 ALA B CA  1 
ATOM   3079 C C   . ALA B 2 85  ? 13.014  138.761 64.774  1.00 24.11  ? 259 ALA B C   1 
ATOM   3080 O O   . ALA B 2 85  ? 12.506  137.648 64.732  1.00 24.25  ? 259 ALA B O   1 
ATOM   3081 C CB  . ALA B 2 85  ? 13.017  140.275 62.757  1.00 24.00  ? 259 ALA B CB  1 
ATOM   3082 N N   . ALA B 2 86  ? 14.143  139.008 65.432  1.00 24.12  ? 260 ALA B N   1 
ATOM   3083 C CA  . ALA B 2 86  ? 14.848  137.964 66.187  1.00 24.08  ? 260 ALA B CA  1 
ATOM   3084 C C   . ALA B 2 86  ? 13.963  137.344 67.267  1.00 24.14  ? 260 ALA B C   1 
ATOM   3085 O O   . ALA B 2 86  ? 13.919  136.123 67.421  1.00 24.29  ? 260 ALA B O   1 
ATOM   3086 C CB  . ALA B 2 86  ? 16.123  138.519 66.815  1.00 23.32  ? 260 ALA B CB  1 
ATOM   3087 N N   . MET B 2 87  ? 13.262  138.196 68.005  1.00 24.74  ? 261 MET B N   1 
ATOM   3088 C CA  . MET B 2 87  ? 12.456  137.778 69.143  1.00 25.37  ? 261 MET B CA  1 
ATOM   3089 C C   . MET B 2 87  ? 11.199  137.069 68.660  1.00 25.16  ? 261 MET B C   1 
ATOM   3090 O O   . MET B 2 87  ? 10.742  136.102 69.277  1.00 25.15  ? 261 MET B O   1 
ATOM   3091 C CB  . MET B 2 87  ? 12.119  138.982 70.026  1.00 26.13  ? 261 MET B CB  1 
ATOM   3092 C CG  . MET B 2 87  ? 11.576  138.631 71.404  1.00 28.59  ? 261 MET B CG  1 
ATOM   3093 S SD  . MET B 2 87  ? 12.888  138.148 72.526  1.00 36.70  ? 261 MET B SD  1 
ATOM   3094 C CE  . MET B 2 87  ? 12.355  136.542 72.969  1.00 35.60  ? 261 MET B CE  1 
ATOM   3095 N N   . LEU B 2 88  ? 10.660  137.532 67.540  1.00 24.83  ? 262 LEU B N   1 
ATOM   3096 C CA  . LEU B 2 88  ? 9.559   136.842 66.897  1.00 24.86  ? 262 LEU B CA  1 
ATOM   3097 C C   . LEU B 2 88  ? 9.999   135.453 66.402  1.00 24.08  ? 262 LEU B C   1 
ATOM   3098 O O   . LEU B 2 88  ? 9.283   134.479 66.596  1.00 24.33  ? 262 LEU B O   1 
ATOM   3099 C CB  . LEU B 2 88  ? 8.978   137.691 65.755  1.00 25.09  ? 262 LEU B CB  1 
ATOM   3100 C CG  . LEU B 2 88  ? 8.061   136.974 64.757  1.00 25.93  ? 262 LEU B CG  1 
ATOM   3101 C CD1 . LEU B 2 88  ? 6.672   136.671 65.343  1.00 25.60  ? 262 LEU B CD1 1 
ATOM   3102 C CD2 . LEU B 2 88  ? 7.943   137.768 63.456  1.00 26.62  ? 262 LEU B CD2 1 
ATOM   3103 N N   . LEU B 2 89  ? 11.175  135.362 65.785  1.00 23.41  ? 263 LEU B N   1 
ATOM   3104 C CA  . LEU B 2 89  ? 11.712  134.075 65.323  1.00 22.67  ? 263 LEU B CA  1 
ATOM   3105 C C   . LEU B 2 89  ? 11.975  133.155 66.506  1.00 22.40  ? 263 LEU B C   1 
ATOM   3106 O O   . LEU B 2 89  ? 11.609  131.972 66.488  1.00 22.03  ? 263 LEU B O   1 
ATOM   3107 C CB  . LEU B 2 89  ? 12.999  134.275 64.532  1.00 22.56  ? 263 LEU B CB  1 
ATOM   3108 C CG  . LEU B 2 89  ? 12.841  134.664 63.062  1.00 23.47  ? 263 LEU B CG  1 
ATOM   3109 C CD1 . LEU B 2 89  ? 14.212  134.865 62.455  1.00 23.46  ? 263 LEU B CD1 1 
ATOM   3110 C CD2 . LEU B 2 89  ? 12.062  133.594 62.270  1.00 24.28  ? 263 LEU B CD2 1 
ATOM   3111 N N   . ALA B 2 90  ? 12.603  133.707 67.542  1.00 22.12  ? 264 ALA B N   1 
ATOM   3112 C CA  . ALA B 2 90  ? 12.844  132.950 68.764  1.00 22.11  ? 264 ALA B CA  1 
ATOM   3113 C C   . ALA B 2 90  ? 11.544  132.394 69.363  1.00 21.78  ? 264 ALA B C   1 
ATOM   3114 O O   . ALA B 2 90  ? 11.505  131.244 69.782  1.00 21.67  ? 264 ALA B O   1 
ATOM   3115 C CB  . ALA B 2 90  ? 13.588  133.802 69.778  1.00 21.81  ? 264 ALA B CB  1 
ATOM   3116 N N   . SER B 2 91  ? 10.490  133.205 69.388  1.00 21.62  ? 265 SER B N   1 
ATOM   3117 C CA  . SER B 2 91  ? 9.202   132.792 69.959  1.00 22.01  ? 265 SER B CA  1 
ATOM   3118 C C   . SER B 2 91  ? 8.533   131.695 69.144  1.00 22.12  ? 265 SER B C   1 
ATOM   3119 O O   . SER B 2 91  ? 8.017   130.737 69.716  1.00 22.43  ? 265 SER B O   1 
ATOM   3120 C CB  . SER B 2 91  ? 8.252   133.977 70.109  1.00 21.89  ? 265 SER B CB  1 
ATOM   3121 O OG  . SER B 2 91  ? 8.801   134.966 70.977  1.00 23.67  ? 265 SER B OG  1 
ATOM   3122 N N   . LYS B 2 92  ? 8.547   131.824 67.817  1.00 22.16  ? 266 LYS B N   1 
ATOM   3123 C CA  . LYS B 2 92  ? 8.029   130.765 66.962  1.00 22.68  ? 266 LYS B CA  1 
ATOM   3124 C C   . LYS B 2 92  ? 8.834   129.493 67.170  1.00 22.92  ? 266 LYS B C   1 
ATOM   3125 O O   . LYS B 2 92  ? 8.262   128.411 67.189  1.00 23.02  ? 266 LYS B O   1 
ATOM   3126 C CB  . LYS B 2 92  ? 8.042   131.161 65.489  1.00 22.90  ? 266 LYS B CB  1 
ATOM   3127 C CG  . LYS B 2 92  ? 7.108   132.301 65.133  1.00 23.18  ? 266 LYS B CG  1 
ATOM   3128 C CD  . LYS B 2 92  ? 7.208   132.591 63.652  1.00 25.27  ? 266 LYS B CD  1 
ATOM   3129 C CE  . LYS B 2 92  ? 6.022   133.377 63.140  1.00 26.02  ? 266 LYS B CE  1 
ATOM   3130 N NZ  . LYS B 2 92  ? 6.278   133.795 61.737  1.00 26.58  ? 266 LYS B NZ  1 
ATOM   3131 N N   . PHE B 2 93  ? 10.154  129.608 67.355  1.00 22.96  ? 267 PHE B N   1 
ATOM   3132 C CA  . PHE B 2 93  ? 10.948  128.394 67.563  1.00 22.64  ? 267 PHE B CA  1 
ATOM   3133 C C   . PHE B 2 93  ? 10.645  127.694 68.912  1.00 22.60  ? 267 PHE B C   1 
ATOM   3134 O O   . PHE B 2 93  ? 10.426  126.490 68.948  1.00 22.63  ? 267 PHE B O   1 
ATOM   3135 C CB  . PHE B 2 93  ? 12.450  128.675 67.408  1.00 22.55  ? 267 PHE B CB  1 
ATOM   3136 C CG  . PHE B 2 93  ? 13.312  127.461 67.587  1.00 21.18  ? 267 PHE B CG  1 
ATOM   3137 C CD1 . PHE B 2 93  ? 13.640  126.659 66.501  1.00 19.70  ? 267 PHE B CD1 1 
ATOM   3138 C CD2 . PHE B 2 93  ? 13.767  127.099 68.852  1.00 20.77  ? 267 PHE B CD2 1 
ATOM   3139 C CE1 . PHE B 2 93  ? 14.428  125.519 66.667  1.00 19.14  ? 267 PHE B CE1 1 
ATOM   3140 C CE2 . PHE B 2 93  ? 14.552  125.955 69.030  1.00 20.26  ? 267 PHE B CE2 1 
ATOM   3141 C CZ  . PHE B 2 93  ? 14.881  125.168 67.930  1.00 20.20  ? 267 PHE B CZ  1 
ATOM   3142 N N   . GLU B 2 94  ? 10.598  128.471 69.991  1.00 22.66  ? 268 GLU B N   1 
ATOM   3143 C CA  . GLU B 2 94  ? 10.635  127.963 71.363  1.00 23.37  ? 268 GLU B CA  1 
ATOM   3144 C C   . GLU B 2 94  ? 9.318   127.997 72.189  1.00 23.37  ? 268 GLU B C   1 
ATOM   3145 O O   . GLU B 2 94  ? 9.142   127.192 73.104  1.00 23.15  ? 268 GLU B O   1 
ATOM   3146 C CB  . GLU B 2 94  ? 11.755  128.684 72.138  1.00 23.15  ? 268 GLU B CB  1 
ATOM   3147 C CG  . GLU B 2 94  ? 12.066  128.084 73.503  1.00 25.15  ? 268 GLU B CG  1 
ATOM   3148 C CD  . GLU B 2 94  ? 12.672  126.678 73.433  1.00 29.60  ? 268 GLU B CD  1 
ATOM   3149 O OE1 . GLU B 2 94  ? 13.433  126.368 72.478  1.00 30.58  ? 268 GLU B OE1 1 
ATOM   3150 O OE2 . GLU B 2 94  ? 12.401  125.863 74.346  1.00 30.66  ? 268 GLU B OE2 1 
ATOM   3151 N N   . GLU B 2 95  ? 8.416   128.927 71.878  1.00 23.69  ? 269 GLU B N   1 
ATOM   3152 C CA  . GLU B 2 95  ? 7.169   129.095 72.640  1.00 23.65  ? 269 GLU B CA  1 
ATOM   3153 C C   . GLU B 2 95  ? 6.049   128.158 72.219  1.00 23.64  ? 269 GLU B C   1 
ATOM   3154 O O   . GLU B 2 95  ? 5.895   127.861 71.030  1.00 23.71  ? 269 GLU B O   1 
ATOM   3155 C CB  . GLU B 2 95  ? 6.670   130.524 72.501  1.00 23.49  ? 269 GLU B CB  1 
ATOM   3156 C CG  . GLU B 2 95  ? 7.597   131.559 73.106  1.00 24.84  ? 269 GLU B CG  1 
ATOM   3157 C CD  . GLU B 2 95  ? 7.728   131.413 74.596  1.00 26.91  ? 269 GLU B CD  1 
ATOM   3158 O OE1 . GLU B 2 95  ? 6.712   131.162 75.268  1.00 32.04  ? 269 GLU B OE1 1 
ATOM   3159 O OE2 . GLU B 2 95  ? 8.843   131.557 75.103  1.00 28.23  ? 269 GLU B OE2 1 
ATOM   3160 N N   . ILE B 2 96  ? 5.272   127.695 73.197  1.00 24.20  ? 270 ILE B N   1 
ATOM   3161 C CA  . ILE B 2 96  ? 4.044   126.955 72.914  1.00 25.34  ? 270 ILE B CA  1 
ATOM   3162 C C   . ILE B 2 96  ? 3.042   127.882 72.252  1.00 26.19  ? 270 ILE B C   1 
ATOM   3163 O O   . ILE B 2 96  ? 2.513   127.558 71.195  1.00 26.65  ? 270 ILE B O   1 
ATOM   3164 C CB  . ILE B 2 96  ? 3.419   126.307 74.176  1.00 25.07  ? 270 ILE B CB  1 
ATOM   3165 C CG1 . ILE B 2 96  ? 4.405   125.329 74.831  1.00 24.04  ? 270 ILE B CG1 1 
ATOM   3166 C CG2 . ILE B 2 96  ? 2.123   125.561 73.783  1.00 24.77  ? 270 ILE B CG2 1 
ATOM   3167 C CD1 . ILE B 2 96  ? 4.027   124.897 76.244  1.00 21.70  ? 270 ILE B CD1 1 
ATOM   3168 N N   . TYR B 2 97  ? 2.812   129.039 72.868  1.00 27.56  ? 271 TYR B N   1 
ATOM   3169 C CA  . TYR B 2 97  ? 1.942   130.070 72.318  1.00 28.90  ? 271 TYR B CA  1 
ATOM   3170 C C   . TYR B 2 97  ? 2.734   131.344 72.051  1.00 28.87  ? 271 TYR B C   1 
ATOM   3171 O O   . TYR B 2 97  ? 2.826   132.229 72.913  1.00 29.07  ? 271 TYR B O   1 
ATOM   3172 C CB  . TYR B 2 97  ? 0.771   130.361 73.262  1.00 29.53  ? 271 TYR B CB  1 
ATOM   3173 C CG  . TYR B 2 97  ? -0.102  129.163 73.586  1.00 33.01  ? 271 TYR B CG  1 
ATOM   3174 C CD1 . TYR B 2 97  ? -0.984  128.635 72.642  1.00 35.59  ? 271 TYR B CD1 1 
ATOM   3175 C CD2 . TYR B 2 97  ? -0.050  128.561 74.851  1.00 36.76  ? 271 TYR B CD2 1 
ATOM   3176 C CE1 . TYR B 2 97  ? -1.794  127.533 72.948  1.00 38.05  ? 271 TYR B CE1 1 
ATOM   3177 C CE2 . TYR B 2 97  ? -0.856  127.460 75.164  1.00 38.46  ? 271 TYR B CE2 1 
ATOM   3178 C CZ  . TYR B 2 97  ? -1.726  126.958 74.212  1.00 39.69  ? 271 TYR B CZ  1 
ATOM   3179 O OH  . TYR B 2 97  ? -2.527  125.872 74.524  1.00 42.11  ? 271 TYR B OH  1 
ATOM   3180 N N   . PRO B 2 98  ? 3.338   131.435 70.870  1.00 28.95  ? 272 PRO B N   1 
ATOM   3181 C CA  . PRO B 2 98  ? 4.055   132.656 70.492  1.00 29.33  ? 272 PRO B CA  1 
ATOM   3182 C C   . PRO B 2 98  ? 3.083   133.835 70.409  1.00 30.38  ? 272 PRO B C   1 
ATOM   3183 O O   . PRO B 2 98  ? 1.932   133.622 70.052  1.00 30.75  ? 272 PRO B O   1 
ATOM   3184 C CB  . PRO B 2 98  ? 4.620   132.332 69.106  1.00 28.51  ? 272 PRO B CB  1 
ATOM   3185 C CG  . PRO B 2 98  ? 3.942   131.101 68.658  1.00 28.53  ? 272 PRO B CG  1 
ATOM   3186 C CD  . PRO B 2 98  ? 3.410   130.390 69.836  1.00 28.24  ? 272 PRO B CD  1 
ATOM   3187 N N   . PRO B 2 99  ? 3.519   135.049 70.728  1.00 31.22  ? 273 PRO B N   1 
ATOM   3188 C CA  . PRO B 2 99  ? 2.668   136.220 70.512  1.00 32.46  ? 273 PRO B CA  1 
ATOM   3189 C C   . PRO B 2 99  ? 2.473   136.381 69.022  1.00 33.58  ? 273 PRO B C   1 
ATOM   3190 O O   . PRO B 2 99  ? 3.391   136.053 68.259  1.00 33.64  ? 273 PRO B O   1 
ATOM   3191 C CB  . PRO B 2 99  ? 3.503   137.373 71.076  1.00 32.23  ? 273 PRO B CB  1 
ATOM   3192 C CG  . PRO B 2 99  ? 4.485   136.689 72.006  1.00 31.98  ? 273 PRO B CG  1 
ATOM   3193 C CD  . PRO B 2 99  ? 4.826   135.413 71.300  1.00 31.21  ? 273 PRO B CD  1 
ATOM   3194 N N   . GLU B 2 100 ? 1.299   136.843 68.602  1.00 35.07  ? 274 GLU B N   1 
ATOM   3195 C CA  . GLU B 2 100 ? 1.074   137.070 67.181  1.00 36.42  ? 274 GLU B CA  1 
ATOM   3196 C C   . GLU B 2 100 ? 1.881   138.265 66.697  1.00 36.34  ? 274 GLU B C   1 
ATOM   3197 O O   . GLU B 2 100 ? 2.383   139.058 67.497  1.00 36.31  ? 274 GLU B O   1 
ATOM   3198 C CB  . GLU B 2 100 ? -0.412  137.179 66.836  1.00 37.22  ? 274 GLU B CB  1 
ATOM   3199 C CG  . GLU B 2 100 ? -1.170  138.318 67.505  1.00 41.49  ? 274 GLU B CG  1 
ATOM   3200 C CD  . GLU B 2 100 ? -2.580  137.918 67.929  1.00 46.56  ? 274 GLU B CD  1 
ATOM   3201 O OE1 . GLU B 2 100 ? -2.961  136.726 67.748  1.00 48.57  ? 274 GLU B OE1 1 
ATOM   3202 O OE2 . GLU B 2 100 ? -3.310  138.799 68.446  1.00 48.32  ? 274 GLU B OE2 1 
ATOM   3203 N N   . VAL B 2 101 ? 2.041   138.363 65.384  1.00 36.65  ? 275 VAL B N   1 
ATOM   3204 C CA  . VAL B 2 101 ? 2.911   139.367 64.787  1.00 37.06  ? 275 VAL B CA  1 
ATOM   3205 C C   . VAL B 2 101 ? 2.470   140.787 65.161  1.00 37.41  ? 275 VAL B C   1 
ATOM   3206 O O   . VAL B 2 101 ? 3.317   141.651 65.426  1.00 37.78  ? 275 VAL B O   1 
ATOM   3207 C CB  . VAL B 2 101 ? 3.018   139.165 63.250  1.00 37.06  ? 275 VAL B CB  1 
ATOM   3208 C CG1 . VAL B 2 101 ? 3.980   140.153 62.624  1.00 36.83  ? 275 VAL B CG1 1 
ATOM   3209 C CG2 . VAL B 2 101 ? 3.471   137.742 62.945  1.00 37.42  ? 275 VAL B CG2 1 
ATOM   3210 N N   . ALA B 2 102 ? 1.156   141.014 65.209  1.00 37.51  ? 276 ALA B N   1 
ATOM   3211 C CA  . ALA B 2 102 ? 0.617   142.318 65.577  1.00 37.91  ? 276 ALA B CA  1 
ATOM   3212 C C   . ALA B 2 102 ? 1.097   142.740 66.959  1.00 38.26  ? 276 ALA B C   1 
ATOM   3213 O O   . ALA B 2 102 ? 1.343   143.920 67.183  1.00 38.53  ? 276 ALA B O   1 
ATOM   3214 C CB  . ALA B 2 102 ? -0.915  142.328 65.509  1.00 38.03  ? 276 ALA B CB  1 
ATOM   3215 N N   . GLU B 2 103 ? 1.252   141.781 67.872  1.00 38.38  ? 277 GLU B N   1 
ATOM   3216 C CA  . GLU B 2 103 ? 1.773   142.083 69.205  1.00 39.18  ? 277 GLU B CA  1 
ATOM   3217 C C   . GLU B 2 103 ? 3.225   142.553 69.155  1.00 38.94  ? 277 GLU B C   1 
ATOM   3218 O O   . GLU B 2 103 ? 3.607   143.448 69.903  1.00 38.62  ? 277 GLU B O   1 
ATOM   3219 C CB  . GLU B 2 103 ? 1.596   140.899 70.164  1.00 39.67  ? 277 GLU B CB  1 
ATOM   3220 C CG  . GLU B 2 103 ? 0.138   140.626 70.533  1.00 42.92  ? 277 GLU B CG  1 
ATOM   3221 C CD  . GLU B 2 103 ? -0.079  139.247 71.145  1.00 47.71  ? 277 GLU B CD  1 
ATOM   3222 O OE1 . GLU B 2 103 ? -0.517  139.167 72.322  1.00 49.62  ? 277 GLU B OE1 1 
ATOM   3223 O OE2 . GLU B 2 103 ? 0.179   138.235 70.453  1.00 49.55  ? 277 GLU B OE2 1 
ATOM   3224 N N   . PHE B 2 104 ? 4.019   141.971 68.256  1.00 39.15  ? 278 PHE B N   1 
ATOM   3225 C CA  . PHE B 2 104 ? 5.390   142.429 68.025  1.00 39.17  ? 278 PHE B CA  1 
ATOM   3226 C C   . PHE B 2 104 ? 5.440   143.806 67.369  1.00 39.98  ? 278 PHE B C   1 
ATOM   3227 O O   . PHE B 2 104 ? 6.265   144.634 67.736  1.00 40.02  ? 278 PHE B O   1 
ATOM   3228 C CB  . PHE B 2 104 ? 6.212   141.383 67.255  1.00 38.50  ? 278 PHE B CB  1 
ATOM   3229 C CG  . PHE B 2 104 ? 6.618   140.209 68.110  1.00 37.61  ? 278 PHE B CG  1 
ATOM   3230 C CD1 . PHE B 2 104 ? 7.715   140.301 68.968  1.00 36.59  ? 278 PHE B CD1 1 
ATOM   3231 C CD2 . PHE B 2 104 ? 5.870   139.035 68.104  1.00 35.03  ? 278 PHE B CD2 1 
ATOM   3232 C CE1 . PHE B 2 104 ? 8.075   139.224 69.787  1.00 35.90  ? 278 PHE B CE1 1 
ATOM   3233 C CE2 . PHE B 2 104 ? 6.219   137.957 68.920  1.00 34.71  ? 278 PHE B CE2 1 
ATOM   3234 C CZ  . PHE B 2 104 ? 7.322   138.048 69.762  1.00 33.87  ? 278 PHE B CZ  1 
ATOM   3235 N N   . VAL B 2 105 ? 4.537   144.057 66.423  1.00 41.20  ? 279 VAL B N   1 
ATOM   3236 C CA  . VAL B 2 105 ? 4.389   145.385 65.823  1.00 42.50  ? 279 VAL B CA  1 
ATOM   3237 C C   . VAL B 2 105 ? 4.004   146.425 66.879  1.00 43.87  ? 279 VAL B C   1 
ATOM   3238 O O   . VAL B 2 105 ? 4.604   147.496 66.952  1.00 43.86  ? 279 VAL B O   1 
ATOM   3239 C CB  . VAL B 2 105 ? 3.341   145.385 64.680  1.00 42.39  ? 279 VAL B CB  1 
ATOM   3240 C CG1 . VAL B 2 105 ? 3.091   146.800 64.163  1.00 41.56  ? 279 VAL B CG1 1 
ATOM   3241 C CG2 . VAL B 2 105 ? 3.789   144.467 63.548  1.00 41.73  ? 279 VAL B CG2 1 
ATOM   3242 N N   . TYR B 2 106 ? 3.014   146.087 67.699  1.00 45.80  ? 280 TYR B N   1 
ATOM   3243 C CA  . TYR B 2 106 ? 2.543   146.960 68.770  1.00 48.02  ? 280 TYR B CA  1 
ATOM   3244 C C   . TYR B 2 106 ? 3.629   147.364 69.777  1.00 48.81  ? 280 TYR B C   1 
ATOM   3245 O O   . TYR B 2 106 ? 3.717   148.530 70.151  1.00 48.99  ? 280 TYR B O   1 
ATOM   3246 C CB  . TYR B 2 106 ? 1.346   146.327 69.489  1.00 48.29  ? 280 TYR B CB  1 
ATOM   3247 C CG  . TYR B 2 106 ? 0.775   147.192 70.586  1.00 51.70  ? 280 TYR B CG  1 
ATOM   3248 C CD1 . TYR B 2 106 ? 0.412   148.525 70.338  1.00 54.82  ? 280 TYR B CD1 1 
ATOM   3249 C CD2 . TYR B 2 106 ? 0.603   146.691 71.874  1.00 53.93  ? 280 TYR B CD2 1 
ATOM   3250 C CE1 . TYR B 2 106 ? -0.103  149.332 71.347  1.00 56.25  ? 280 TYR B CE1 1 
ATOM   3251 C CE2 . TYR B 2 106 ? 0.084   147.486 72.890  1.00 56.39  ? 280 TYR B CE2 1 
ATOM   3252 C CZ  . TYR B 2 106 ? -0.269  148.807 72.619  1.00 57.58  ? 280 TYR B CZ  1 
ATOM   3253 O OH  . TYR B 2 106 ? -0.785  149.605 73.625  1.00 59.71  ? 280 TYR B OH  1 
ATOM   3254 N N   . ILE B 2 107 ? 4.455   146.408 70.203  1.00 50.14  ? 281 ILE B N   1 
ATOM   3255 C CA  . ILE B 2 107 ? 5.496   146.665 71.211  1.00 51.34  ? 281 ILE B CA  1 
ATOM   3256 C C   . ILE B 2 107 ? 6.602   147.612 70.742  1.00 52.35  ? 281 ILE B C   1 
ATOM   3257 O O   . ILE B 2 107 ? 7.335   148.168 71.566  1.00 52.15  ? 281 ILE B O   1 
ATOM   3258 C CB  . ILE B 2 107 ? 6.124   145.341 71.731  1.00 51.23  ? 281 ILE B CB  1 
ATOM   3259 C CG1 . ILE B 2 107 ? 6.836   144.599 70.601  1.00 51.31  ? 281 ILE B CG1 1 
ATOM   3260 C CG2 . ILE B 2 107 ? 5.076   144.469 72.355  1.00 51.34  ? 281 ILE B CG2 1 
ATOM   3261 C CD1 . ILE B 2 107 ? 8.030   143.794 71.025  1.00 53.13  ? 281 ILE B CD1 1 
ATOM   3262 N N   . THR B 2 108 ? 6.729   147.778 69.427  1.00 53.89  ? 282 THR B N   1 
ATOM   3263 C CA  . THR B 2 108 ? 7.651   148.763 68.855  1.00 55.59  ? 282 THR B CA  1 
ATOM   3264 C C   . THR B 2 108 ? 6.989   150.142 68.668  1.00 56.90  ? 282 THR B C   1 
ATOM   3265 O O   . THR B 2 108 ? 7.383   150.899 67.779  1.00 57.22  ? 282 THR B O   1 
ATOM   3266 C CB  . THR B 2 108 ? 8.255   148.261 67.511  1.00 55.63  ? 282 THR B CB  1 
ATOM   3267 O OG1 . THR B 2 108 ? 7.208   147.910 66.597  1.00 55.86  ? 282 THR B OG1 1 
ATOM   3268 C CG2 . THR B 2 108 ? 9.022   146.959 67.694  1.00 54.86  ? 282 THR B CG2 1 
ATOM   3269 N N   . ASP B 2 109 ? 6.005   150.454 69.523  1.00 58.43  ? 283 ASP B N   1 
ATOM   3270 C CA  . ASP B 2 109 ? 5.185   151.691 69.477  1.00 59.88  ? 283 ASP B CA  1 
ATOM   3271 C C   . ASP B 2 109 ? 5.134   152.416 68.117  1.00 59.67  ? 283 ASP B C   1 
ATOM   3272 O O   . ASP B 2 109 ? 5.622   153.541 67.973  1.00 59.91  ? 283 ASP B O   1 
ATOM   3273 C CB  . ASP B 2 109 ? 5.561   152.658 70.627  1.00 60.67  ? 283 ASP B CB  1 
ATOM   3274 C CG  . ASP B 2 109 ? 4.707   153.947 70.640  1.00 63.90  ? 283 ASP B CG  1 
ATOM   3275 O OD1 . ASP B 2 109 ? 3.473   153.883 70.388  1.00 67.42  ? 283 ASP B OD1 1 
ATOM   3276 O OD2 . ASP B 2 109 ? 5.191   155.080 70.885  1.00 66.37  ? 283 ASP B OD2 1 
ATOM   3277 N N   . ASP B 2 110 ? 4.549   151.744 67.125  1.00 59.43  ? 284 ASP B N   1 
ATOM   3278 C CA  . ASP B 2 110 ? 4.371   152.288 65.766  1.00 58.83  ? 284 ASP B CA  1 
ATOM   3279 C C   . ASP B 2 110 ? 5.640   152.798 65.048  1.00 57.34  ? 284 ASP B C   1 
ATOM   3280 O O   . ASP B 2 110 ? 5.553   153.517 64.047  1.00 56.97  ? 284 ASP B O   1 
ATOM   3281 C CB  . ASP B 2 110 ? 3.231   153.323 65.737  1.00 59.67  ? 284 ASP B CB  1 
ATOM   3282 C CG  . ASP B 2 110 ? 1.905   152.744 66.226  1.00 61.83  ? 284 ASP B CG  1 
ATOM   3283 O OD1 . ASP B 2 110 ? 1.647   151.538 65.970  1.00 64.24  ? 284 ASP B OD1 1 
ATOM   3284 O OD2 . ASP B 2 110 ? 1.071   153.415 66.882  1.00 63.76  ? 284 ASP B OD2 1 
ATOM   3285 N N   . THR B 2 111 ? 6.812   152.413 65.556  1.00 55.53  ? 285 THR B N   1 
ATOM   3286 C CA  . THR B 2 111 ? 8.079   152.724 64.892  1.00 53.49  ? 285 THR B CA  1 
ATOM   3287 C C   . THR B 2 111 ? 8.098   152.116 63.482  1.00 51.63  ? 285 THR B C   1 
ATOM   3288 O O   . THR B 2 111 ? 8.326   152.822 62.489  1.00 51.98  ? 285 THR B O   1 
ATOM   3289 C CB  . THR B 2 111 ? 9.271   152.206 65.731  1.00 53.76  ? 285 THR B CB  1 
ATOM   3290 O OG1 . THR B 2 111 ? 9.125   152.641 67.088  1.00 53.67  ? 285 THR B OG1 1 
ATOM   3291 C CG2 . THR B 2 111 ? 10.582  152.856 65.291  1.00 54.05  ? 285 THR B CG2 1 
ATOM   3292 N N   . TYR B 2 112 ? 7.830   150.813 63.407  1.00 48.61  ? 286 TYR B N   1 
ATOM   3293 C CA  . TYR B 2 112 ? 7.846   150.080 62.145  1.00 45.65  ? 286 TYR B CA  1 
ATOM   3294 C C   . TYR B 2 112 ? 6.462   149.522 61.789  1.00 44.49  ? 286 TYR B C   1 
ATOM   3295 O O   . TYR B 2 112 ? 5.534   149.553 62.611  1.00 44.39  ? 286 TYR B O   1 
ATOM   3296 C CB  . TYR B 2 112 ? 8.856   148.931 62.224  1.00 45.00  ? 286 TYR B CB  1 
ATOM   3297 C CG  . TYR B 2 112 ? 10.197  149.299 62.817  1.00 41.77  ? 286 TYR B CG  1 
ATOM   3298 C CD1 . TYR B 2 112 ? 11.148  149.988 62.066  1.00 38.31  ? 286 TYR B CD1 1 
ATOM   3299 C CD2 . TYR B 2 112 ? 10.524  148.935 64.125  1.00 39.65  ? 286 TYR B CD2 1 
ATOM   3300 C CE1 . TYR B 2 112 ? 12.383  150.322 62.603  1.00 36.16  ? 286 TYR B CE1 1 
ATOM   3301 C CE2 . TYR B 2 112 ? 11.763  149.261 64.674  1.00 37.69  ? 286 TYR B CE2 1 
ATOM   3302 C CZ  . TYR B 2 112 ? 12.682  149.955 63.904  1.00 36.77  ? 286 TYR B CZ  1 
ATOM   3303 O OH  . TYR B 2 112 ? 13.902  150.271 64.440  1.00 35.80  ? 286 TYR B OH  1 
ATOM   3304 N N   . THR B 2 113 ? 6.329   149.011 60.569  1.00 42.74  ? 287 THR B N   1 
ATOM   3305 C CA  . THR B 2 113 ? 5.090   148.371 60.151  1.00 41.78  ? 287 THR B CA  1 
ATOM   3306 C C   . THR B 2 113 ? 5.194   146.848 60.189  1.00 41.32  ? 287 THR B C   1 
ATOM   3307 O O   . THR B 2 113 ? 6.292   146.284 60.282  1.00 40.81  ? 287 THR B O   1 
ATOM   3308 C CB  . THR B 2 113 ? 4.659   148.834 58.743  1.00 41.69  ? 287 THR B CB  1 
ATOM   3309 O OG1 . THR B 2 113 ? 5.596   148.357 57.775  1.00 41.50  ? 287 THR B OG1 1 
ATOM   3310 C CG2 . THR B 2 113 ? 4.732   150.347 58.609  1.00 41.37  ? 287 THR B CG2 1 
ATOM   3311 N N   . LYS B 2 114 ? 4.033   146.201 60.113  1.00 40.85  ? 288 LYS B N   1 
ATOM   3312 C CA  . LYS B 2 114 ? 3.913   144.750 60.048  1.00 40.59  ? 288 LYS B CA  1 
ATOM   3313 C C   . LYS B 2 114 ? 4.682   144.160 58.878  1.00 40.00  ? 288 LYS B C   1 
ATOM   3314 O O   . LYS B 2 114 ? 5.324   143.118 59.012  1.00 39.66  ? 288 LYS B O   1 
ATOM   3315 C CB  . LYS B 2 114 ? 2.441   144.376 59.932  1.00 41.01  ? 288 LYS B CB  1 
ATOM   3316 C CG  . LYS B 2 114 ? 2.118   142.943 60.275  1.00 42.23  ? 288 LYS B CG  1 
ATOM   3317 C CD  . LYS B 2 114 ? 0.620   142.786 60.422  1.00 45.73  ? 288 LYS B CD  1 
ATOM   3318 C CE  . LYS B 2 114 ? 0.148   141.455 59.868  1.00 48.40  ? 288 LYS B CE  1 
ATOM   3319 N NZ  . LYS B 2 114 ? -1.081  141.622 59.037  1.00 50.65  ? 288 LYS B NZ  1 
ATOM   3320 N N   . LYS B 2 115 ? 4.607   144.831 57.731  1.00 39.50  ? 289 LYS B N   1 
ATOM   3321 C CA  . LYS B 2 115 ? 5.313   144.395 56.529  1.00 39.03  ? 289 LYS B CA  1 
ATOM   3322 C C   . LYS B 2 115 ? 6.825   144.439 56.709  1.00 37.92  ? 289 LYS B C   1 
ATOM   3323 O O   . LYS B 2 115 ? 7.526   143.616 56.142  1.00 37.67  ? 289 LYS B O   1 
ATOM   3324 C CB  . LYS B 2 115 ? 4.894   145.232 55.309  1.00 39.55  ? 289 LYS B CB  1 
ATOM   3325 C CG  . LYS B 2 115 ? 5.917   145.251 54.159  1.00 40.56  ? 289 LYS B CG  1 
ATOM   3326 C CD  . LYS B 2 115 ? 5.339   144.630 52.887  1.00 43.96  ? 289 LYS B CD  1 
ATOM   3327 C CE  . LYS B 2 115 ? 5.668   145.473 51.648  1.00 44.44  ? 289 LYS B CE  1 
ATOM   3328 N NZ  . LYS B 2 115 ? 5.130   146.864 51.756  1.00 44.83  ? 289 LYS B NZ  1 
ATOM   3329 N N   . GLN B 2 116 ? 7.313   145.413 57.478  1.00 36.94  ? 290 GLN B N   1 
ATOM   3330 C CA  . GLN B 2 116 ? 8.744   145.531 57.785  1.00 36.23  ? 290 GLN B CA  1 
ATOM   3331 C C   . GLN B 2 116 ? 9.257   144.382 58.671  1.00 34.87  ? 290 GLN B C   1 
ATOM   3332 O O   . GLN B 2 116 ? 10.249  143.734 58.350  1.00 34.72  ? 290 GLN B O   1 
ATOM   3333 C CB  . GLN B 2 116 ? 9.050   146.885 58.436  1.00 36.35  ? 290 GLN B CB  1 
ATOM   3334 C CG  . GLN B 2 116 ? 9.298   148.027 57.435  1.00 38.21  ? 290 GLN B CG  1 
ATOM   3335 C CD  . GLN B 2 116 ? 9.569   149.369 58.121  1.00 39.70  ? 290 GLN B CD  1 
ATOM   3336 O OE1 . GLN B 2 116 ? 8.781   149.817 58.957  1.00 40.59  ? 290 GLN B OE1 1 
ATOM   3337 N NE2 . GLN B 2 116 ? 10.686  149.997 57.780  1.00 39.69  ? 290 GLN B NE2 1 
ATOM   3338 N N   . VAL B 2 117 ? 8.571   144.153 59.784  1.00 33.68  ? 291 VAL B N   1 
ATOM   3339 C CA  . VAL B 2 117 ? 8.856   143.051 60.695  1.00 32.81  ? 291 VAL B CA  1 
ATOM   3340 C C   . VAL B 2 117 ? 8.948   141.718 59.942  1.00 31.90  ? 291 VAL B C   1 
ATOM   3341 O O   . VAL B 2 117 ? 9.920   140.974 60.080  1.00 31.02  ? 291 VAL B O   1 
ATOM   3342 C CB  . VAL B 2 117 ? 7.781   142.969 61.807  1.00 32.97  ? 291 VAL B CB  1 
ATOM   3343 C CG1 . VAL B 2 117 ? 7.953   141.699 62.654  1.00 34.08  ? 291 VAL B CG1 1 
ATOM   3344 C CG2 . VAL B 2 117 ? 7.816   144.225 62.700  1.00 32.73  ? 291 VAL B CG2 1 
ATOM   3345 N N   . LEU B 2 118 ? 7.947   141.450 59.115  1.00 31.24  ? 292 LEU B N   1 
ATOM   3346 C CA  . LEU B 2 118 ? 7.907   140.225 58.338  1.00 31.32  ? 292 LEU B CA  1 
ATOM   3347 C C   . LEU B 2 118 ? 9.028   140.096 57.269  1.00 30.84  ? 292 LEU B C   1 
ATOM   3348 O O   . LEU B 2 118 ? 9.544   139.004 57.028  1.00 30.10  ? 292 LEU B O   1 
ATOM   3349 C CB  . LEU B 2 118 ? 6.514   140.044 57.738  1.00 31.45  ? 292 LEU B CB  1 
ATOM   3350 C CG  . LEU B 2 118 ? 5.621   139.003 58.421  1.00 33.19  ? 292 LEU B CG  1 
ATOM   3351 C CD1 . LEU B 2 118 ? 5.900   138.841 59.914  1.00 32.49  ? 292 LEU B CD1 1 
ATOM   3352 C CD2 . LEU B 2 118 ? 4.134   139.289 58.187  1.00 32.16  ? 292 LEU B CD2 1 
ATOM   3353 N N   . ARG B 2 119 ? 9.414   141.209 56.650  1.00 30.20  ? 293 ARG B N   1 
ATOM   3354 C CA  . ARG B 2 119 ? 10.552  141.198 55.735  1.00 30.06  ? 293 ARG B CA  1 
ATOM   3355 C C   . ARG B 2 119 ? 11.868  141.010 56.505  1.00 28.64  ? 293 ARG B C   1 
ATOM   3356 O O   . ARG B 2 119 ? 12.714  140.227 56.101  1.00 28.40  ? 293 ARG B O   1 
ATOM   3357 C CB  . ARG B 2 119 ? 10.561  142.447 54.847  1.00 30.76  ? 293 ARG B CB  1 
ATOM   3358 C CG  . ARG B 2 119 ? 9.484   142.411 53.735  1.00 35.51  ? 293 ARG B CG  1 
ATOM   3359 C CD  . ARG B 2 119 ? 9.601   143.521 52.691  1.00 43.72  ? 293 ARG B CD  1 
ATOM   3360 N NE  . ARG B 2 119 ? 8.800   143.245 51.491  1.00 51.45  ? 293 ARG B NE  1 
ATOM   3361 C CZ  . ARG B 2 119 ? 8.897   143.924 50.336  1.00 55.26  ? 293 ARG B CZ  1 
ATOM   3362 N NH1 . ARG B 2 119 ? 9.772   144.922 50.204  1.00 56.95  ? 293 ARG B NH1 1 
ATOM   3363 N NH2 . ARG B 2 119 ? 8.127   143.596 49.299  1.00 56.25  ? 293 ARG B NH2 1 
ATOM   3364 N N   . MET B 2 120 ? 12.017  141.690 57.635  1.00 27.44  ? 294 MET B N   1 
ATOM   3365 C CA  . MET B 2 120 ? 13.161  141.442 58.504  1.00 26.83  ? 294 MET B CA  1 
ATOM   3366 C C   . MET B 2 120 ? 13.211  139.978 58.970  1.00 26.77  ? 294 MET B C   1 
ATOM   3367 O O   . MET B 2 120 ? 14.265  139.353 58.883  1.00 26.36  ? 294 MET B O   1 
ATOM   3368 C CB  . MET B 2 120 ? 13.209  142.420 59.685  1.00 26.12  ? 294 MET B CB  1 
ATOM   3369 C CG  . MET B 2 120 ? 14.499  142.335 60.484  1.00 26.74  ? 294 MET B CG  1 
ATOM   3370 S SD  . MET B 2 120 ? 16.032  142.697 59.573  1.00 27.58  ? 294 MET B SD  1 
ATOM   3371 C CE  . MET B 2 120 ? 16.011  144.444 59.636  1.00 28.22  ? 294 MET B CE  1 
ATOM   3372 N N   . GLU B 2 121 ? 12.085  139.427 59.439  1.00 27.04  ? 295 GLU B N   1 
ATOM   3373 C CA  . GLU B 2 121 ? 12.011  137.991 59.749  1.00 27.68  ? 295 GLU B CA  1 
ATOM   3374 C C   . GLU B 2 121 ? 12.654  137.122 58.640  1.00 28.02  ? 295 GLU B C   1 
ATOM   3375 O O   . GLU B 2 121 ? 13.482  136.254 58.925  1.00 27.72  ? 295 GLU B O   1 
ATOM   3376 C CB  . GLU B 2 121 ? 10.570  137.530 60.038  1.00 27.60  ? 295 GLU B CB  1 
ATOM   3377 C CG  . GLU B 2 121 ? 10.443  136.005 60.062  1.00 30.08  ? 295 GLU B CG  1 
ATOM   3378 C CD  . GLU B 2 121 ? 9.052   135.477 60.355  1.00 31.99  ? 295 GLU B CD  1 
ATOM   3379 O OE1 . GLU B 2 121 ? 8.254   135.323 59.406  1.00 32.83  ? 295 GLU B OE1 1 
ATOM   3380 O OE2 . GLU B 2 121 ? 8.767   135.184 61.537  1.00 33.93  ? 295 GLU B OE2 1 
ATOM   3381 N N   . HIS B 2 122 ? 12.270  137.379 57.385  1.00 28.54  ? 296 HIS B N   1 
ATOM   3382 C CA  . HIS B 2 122 ? 12.808  136.690 56.216  1.00 28.79  ? 296 HIS B CA  1 
ATOM   3383 C C   . HIS B 2 122 ? 14.323  136.873 56.044  1.00 27.97  ? 296 HIS B C   1 
ATOM   3384 O O   . HIS B 2 122 ? 15.060  135.885 55.873  1.00 27.88  ? 296 HIS B O   1 
ATOM   3385 C CB  . HIS B 2 122 ? 12.071  137.179 54.971  1.00 30.24  ? 296 HIS B CB  1 
ATOM   3386 C CG  . HIS B 2 122 ? 12.083  136.211 53.830  1.00 34.58  ? 296 HIS B CG  1 
ATOM   3387 N ND1 . HIS B 2 122 ? 11.371  135.029 53.845  1.00 38.92  ? 296 HIS B ND1 1 
ATOM   3388 C CD2 . HIS B 2 122 ? 12.700  136.265 52.623  1.00 39.21  ? 296 HIS B CD2 1 
ATOM   3389 C CE1 . HIS B 2 122 ? 11.566  134.384 52.705  1.00 40.54  ? 296 HIS B CE1 1 
ATOM   3390 N NE2 . HIS B 2 122 ? 12.363  135.116 51.944  1.00 41.70  ? 296 HIS B NE2 1 
ATOM   3391 N N   . LEU B 2 123 ? 14.786  138.127 56.099  1.00 26.67  ? 297 LEU B N   1 
ATOM   3392 C CA  . LEU B 2 123 ? 16.210  138.444 55.955  1.00 25.40  ? 297 LEU B CA  1 
ATOM   3393 C C   . LEU B 2 123 ? 17.044  137.770 57.044  1.00 24.88  ? 297 LEU B C   1 
ATOM   3394 O O   . LEU B 2 123 ? 18.096  137.193 56.757  1.00 23.72  ? 297 LEU B O   1 
ATOM   3395 C CB  . LEU B 2 123 ? 16.445  139.966 55.949  1.00 25.30  ? 297 LEU B CB  1 
ATOM   3396 C CG  . LEU B 2 123 ? 17.907  140.459 55.841  1.00 24.71  ? 297 LEU B CG  1 
ATOM   3397 C CD1 . LEU B 2 123 ? 18.531  140.164 54.488  1.00 22.20  ? 297 LEU B CD1 1 
ATOM   3398 C CD2 . LEU B 2 123 ? 18.017  141.946 56.162  1.00 24.56  ? 297 LEU B CD2 1 
ATOM   3399 N N   . VAL B 2 124 ? 16.559  137.833 58.289  1.00 24.64  ? 298 VAL B N   1 
ATOM   3400 C CA  . VAL B 2 124 ? 17.205  137.125 59.401  1.00 24.44  ? 298 VAL B CA  1 
ATOM   3401 C C   . VAL B 2 124 ? 17.358  135.618 59.116  1.00 24.78  ? 298 VAL B C   1 
ATOM   3402 O O   . VAL B 2 124 ? 18.452  135.072 59.256  1.00 24.46  ? 298 VAL B O   1 
ATOM   3403 C CB  . VAL B 2 124 ? 16.512  137.397 60.754  1.00 24.19  ? 298 VAL B CB  1 
ATOM   3404 C CG1 . VAL B 2 124 ? 17.031  136.467 61.819  1.00 24.52  ? 298 VAL B CG1 1 
ATOM   3405 C CG2 . VAL B 2 124 ? 16.770  138.810 61.191  1.00 23.45  ? 298 VAL B CG2 1 
ATOM   3406 N N   . LEU B 2 125 ? 16.283  134.960 58.679  1.00 25.01  ? 299 LEU B N   1 
ATOM   3407 C CA  . LEU B 2 125 ? 16.357  133.547 58.328  1.00 25.73  ? 299 LEU B CA  1 
ATOM   3408 C C   . LEU B 2 125 ? 17.389  133.273 57.242  1.00 26.60  ? 299 LEU B C   1 
ATOM   3409 O O   . LEU B 2 125 ? 18.192  132.353 57.370  1.00 27.15  ? 299 LEU B O   1 
ATOM   3410 C CB  . LEU B 2 125 ? 14.990  133.021 57.886  1.00 25.90  ? 299 LEU B CB  1 
ATOM   3411 C CG  . LEU B 2 125 ? 13.943  132.842 58.985  1.00 24.91  ? 299 LEU B CG  1 
ATOM   3412 C CD1 . LEU B 2 125 ? 12.538  132.643 58.377  1.00 23.44  ? 299 LEU B CD1 1 
ATOM   3413 C CD2 . LEU B 2 125 ? 14.352  131.687 59.934  1.00 21.91  ? 299 LEU B CD2 1 
ATOM   3414 N N   . LYS B 2 126 ? 17.378  134.074 56.179  1.00 27.71  ? 300 LYS B N   1 
ATOM   3415 C CA  . LYS B 2 126 ? 18.410  133.978 55.146  1.00 28.73  ? 300 LYS B CA  1 
ATOM   3416 C C   . LYS B 2 126 ? 19.810  134.177 55.744  1.00 27.61  ? 300 LYS B C   1 
ATOM   3417 O O   . LYS B 2 126 ? 20.713  133.383 55.505  1.00 28.20  ? 300 LYS B O   1 
ATOM   3418 C CB  . LYS B 2 126 ? 18.145  134.963 53.982  1.00 29.53  ? 300 LYS B CB  1 
ATOM   3419 C CG  . LYS B 2 126 ? 19.429  135.545 53.313  1.00 33.98  ? 300 LYS B CG  1 
ATOM   3420 C CD  . LYS B 2 126 ? 19.319  135.762 51.781  1.00 40.31  ? 300 LYS B CD  1 
ATOM   3421 C CE  . LYS B 2 126 ? 18.454  136.980 51.437  1.00 43.87  ? 300 LYS B CE  1 
ATOM   3422 N NZ  . LYS B 2 126 ? 16.978  136.631 51.510  1.00 48.27  ? 300 LYS B NZ  1 
ATOM   3423 N N   . VAL B 2 127 ? 19.999  135.216 56.533  1.00 26.54  ? 301 VAL B N   1 
ATOM   3424 C CA  . VAL B 2 127 ? 21.333  135.477 57.055  1.00 25.90  ? 301 VAL B CA  1 
ATOM   3425 C C   . VAL B 2 127 ? 21.817  134.314 57.932  1.00 25.89  ? 301 VAL B C   1 
ATOM   3426 O O   . VAL B 2 127 ? 22.963  133.887 57.813  1.00 25.66  ? 301 VAL B O   1 
ATOM   3427 C CB  . VAL B 2 127 ? 21.422  136.842 57.804  1.00 26.06  ? 301 VAL B CB  1 
ATOM   3428 C CG1 . VAL B 2 127 ? 22.770  137.003 58.517  1.00 25.24  ? 301 VAL B CG1 1 
ATOM   3429 C CG2 . VAL B 2 127 ? 21.196  137.998 56.831  1.00 26.02  ? 301 VAL B CG2 1 
ATOM   3430 N N   . LEU B 2 128 ? 20.942  133.786 58.791  1.00 25.60  ? 302 LEU B N   1 
ATOM   3431 C CA  . LEU B 2 128 ? 21.334  132.678 59.687  1.00 25.38  ? 302 LEU B CA  1 
ATOM   3432 C C   . LEU B 2 128 ? 21.300  131.307 59.000  1.00 25.10  ? 302 LEU B C   1 
ATOM   3433 O O   . LEU B 2 128 ? 21.574  130.286 59.626  1.00 25.13  ? 302 LEU B O   1 
ATOM   3434 C CB  . LEU B 2 128 ? 20.444  132.658 60.938  1.00 24.62  ? 302 LEU B CB  1 
ATOM   3435 C CG  . LEU B 2 128 ? 20.262  133.976 61.669  1.00 23.69  ? 302 LEU B CG  1 
ATOM   3436 C CD1 . LEU B 2 128 ? 19.343  133.777 62.848  1.00 24.31  ? 302 LEU B CD1 1 
ATOM   3437 C CD2 . LEU B 2 128 ? 21.594  134.605 62.103  1.00 24.08  ? 302 LEU B CD2 1 
ATOM   3438 N N   . THR B 2 129 ? 20.931  131.310 57.724  1.00 25.36  ? 303 THR B N   1 
ATOM   3439 C CA  . THR B 2 129 ? 20.664  130.112 56.925  1.00 25.84  ? 303 THR B CA  1 
ATOM   3440 C C   . THR B 2 129 ? 19.805  129.078 57.663  1.00 26.04  ? 303 THR B C   1 
ATOM   3441 O O   . THR B 2 129 ? 20.006  127.869 57.524  1.00 25.86  ? 303 THR B O   1 
ATOM   3442 C CB  . THR B 2 129 ? 21.960  129.514 56.314  1.00 25.91  ? 303 THR B CB  1 
ATOM   3443 O OG1 . THR B 2 129 ? 22.888  129.183 57.350  1.00 27.33  ? 303 THR B OG1 1 
ATOM   3444 C CG2 . THR B 2 129 ? 22.700  130.573 55.508  1.00 25.14  ? 303 THR B CG2 1 
ATOM   3445 N N   . PHE B 2 130 ? 18.828  129.588 58.419  1.00 26.16  ? 304 PHE B N   1 
ATOM   3446 C CA  . PHE B 2 130 ? 17.849  128.779 59.137  1.00 26.41  ? 304 PHE B CA  1 
ATOM   3447 C C   . PHE B 2 130 ? 18.419  127.998 60.332  1.00 26.20  ? 304 PHE B C   1 
ATOM   3448 O O   . PHE B 2 130 ? 17.789  127.054 60.809  1.00 26.06  ? 304 PHE B O   1 
ATOM   3449 C CB  . PHE B 2 130 ? 17.176  127.799 58.171  1.00 26.58  ? 304 PHE B CB  1 
ATOM   3450 C CG  . PHE B 2 130 ? 15.964  128.349 57.503  1.00 28.43  ? 304 PHE B CG  1 
ATOM   3451 C CD1 . PHE B 2 130 ? 14.754  128.441 58.185  1.00 30.79  ? 304 PHE B CD1 1 
ATOM   3452 C CD2 . PHE B 2 130 ? 16.026  128.775 56.190  1.00 29.85  ? 304 PHE B CD2 1 
ATOM   3453 C CE1 . PHE B 2 130 ? 13.621  128.957 57.557  1.00 31.21  ? 304 PHE B CE1 1 
ATOM   3454 C CE2 . PHE B 2 130 ? 14.908  129.291 55.563  1.00 31.90  ? 304 PHE B CE2 1 
ATOM   3455 C CZ  . PHE B 2 130 ? 13.705  129.382 56.244  1.00 30.90  ? 304 PHE B CZ  1 
ATOM   3456 N N   . ASP B 2 131 ? 19.606  128.365 60.798  1.00 25.77  ? 305 ASP B N   1 
ATOM   3457 C CA  . ASP B 2 131 ? 20.246  127.637 61.888  1.00 25.56  ? 305 ASP B CA  1 
ATOM   3458 C C   . ASP B 2 131 ? 19.792  128.210 63.232  1.00 24.62  ? 305 ASP B C   1 
ATOM   3459 O O   . ASP B 2 131 ? 20.539  128.929 63.903  1.00 24.66  ? 305 ASP B O   1 
ATOM   3460 C CB  . ASP B 2 131 ? 21.776  127.646 61.747  1.00 26.10  ? 305 ASP B CB  1 
ATOM   3461 C CG  . ASP B 2 131 ? 22.266  126.931 60.484  1.00 28.91  ? 305 ASP B CG  1 
ATOM   3462 O OD1 . ASP B 2 131 ? 21.905  125.748 60.253  1.00 30.95  ? 305 ASP B OD1 1 
ATOM   3463 O OD2 . ASP B 2 131 ? 23.039  127.474 59.659  1.00 33.39  ? 305 ASP B OD2 1 
ATOM   3464 N N   . LEU B 2 132 ? 18.563  127.871 63.618  1.00 23.66  ? 306 LEU B N   1 
ATOM   3465 C CA  . LEU B 2 132 ? 17.926  128.466 64.790  1.00 23.42  ? 306 LEU B CA  1 
ATOM   3466 C C   . LEU B 2 132 ? 18.107  127.693 66.110  1.00 22.83  ? 306 LEU B C   1 
ATOM   3467 O O   . LEU B 2 132 ? 17.883  128.243 67.191  1.00 22.72  ? 306 LEU B O   1 
ATOM   3468 C CB  . LEU B 2 132 ? 16.435  128.733 64.513  1.00 23.47  ? 306 LEU B CB  1 
ATOM   3469 C CG  . LEU B 2 132 ? 16.080  129.614 63.300  1.00 23.91  ? 306 LEU B CG  1 
ATOM   3470 C CD1 . LEU B 2 132 ? 14.629  130.053 63.420  1.00 25.55  ? 306 LEU B CD1 1 
ATOM   3471 C CD2 . LEU B 2 132 ? 16.978  130.853 63.153  1.00 22.72  ? 306 LEU B CD2 1 
ATOM   3472 N N   . ALA B 2 133 ? 18.518  126.435 66.019  1.00 22.38  ? 307 ALA B N   1 
ATOM   3473 C CA  . ALA B 2 133 ? 18.629  125.571 67.192  1.00 22.68  ? 307 ALA B CA  1 
ATOM   3474 C C   . ALA B 2 133 ? 19.971  125.772 67.890  1.00 23.16  ? 307 ALA B C   1 
ATOM   3475 O O   . ALA B 2 133 ? 20.746  124.837 68.071  1.00 23.75  ? 307 ALA B O   1 
ATOM   3476 C CB  . ALA B 2 133 ? 18.421  124.113 66.809  1.00 22.36  ? 307 ALA B CB  1 
ATOM   3477 N N   . ALA B 2 134 ? 20.217  127.014 68.288  1.00 23.25  ? 308 ALA B N   1 
ATOM   3478 C CA  . ALA B 2 134 ? 21.459  127.433 68.903  1.00 23.53  ? 308 ALA B CA  1 
ATOM   3479 C C   . ALA B 2 134 ? 21.487  127.087 70.393  1.00 23.68  ? 308 ALA B C   1 
ATOM   3480 O O   . ALA B 2 134 ? 20.493  127.285 71.093  1.00 23.37  ? 308 ALA B O   1 
ATOM   3481 C CB  . ALA B 2 134 ? 21.601  128.931 68.731  1.00 23.63  ? 308 ALA B CB  1 
ATOM   3482 N N   . PRO B 2 135 ? 22.629  126.601 70.880  1.00 23.98  ? 309 PRO B N   1 
ATOM   3483 C CA  . PRO B 2 135 ? 22.801  126.362 72.316  1.00 23.74  ? 309 PRO B CA  1 
ATOM   3484 C C   . PRO B 2 135 ? 22.952  127.705 73.034  1.00 23.70  ? 309 PRO B C   1 
ATOM   3485 O O   . PRO B 2 135 ? 23.518  128.645 72.487  1.00 23.86  ? 309 PRO B O   1 
ATOM   3486 C CB  . PRO B 2 135 ? 24.106  125.563 72.398  1.00 23.55  ? 309 PRO B CB  1 
ATOM   3487 C CG  . PRO B 2 135 ? 24.453  125.212 70.972  1.00 24.35  ? 309 PRO B CG  1 
ATOM   3488 C CD  . PRO B 2 135 ? 23.847  126.271 70.110  1.00 23.63  ? 309 PRO B CD  1 
ATOM   3489 N N   . THR B 2 136 ? 22.433  127.779 74.248  1.00 23.27  ? 310 THR B N   1 
ATOM   3490 C CA  . THR B 2 136 ? 22.435  129.012 75.008  1.00 23.00  ? 310 THR B CA  1 
ATOM   3491 C C   . THR B 2 136 ? 22.967  128.698 76.391  1.00 22.91  ? 310 THR B C   1 
ATOM   3492 O O   . THR B 2 136 ? 23.094  127.529 76.765  1.00 21.77  ? 310 THR B O   1 
ATOM   3493 C CB  . THR B 2 136 ? 21.003  129.576 75.109  1.00 23.15  ? 310 THR B CB  1 
ATOM   3494 O OG1 . THR B 2 136 ? 20.198  128.704 75.911  1.00 23.85  ? 310 THR B OG1 1 
ATOM   3495 C CG2 . THR B 2 136 ? 20.300  129.532 73.748  1.00 22.24  ? 310 THR B CG2 1 
ATOM   3496 N N   . VAL B 2 137 ? 23.287  129.751 77.138  1.00 23.19  ? 311 VAL B N   1 
ATOM   3497 C CA  . VAL B 2 137 ? 23.696  129.621 78.523  1.00 23.30  ? 311 VAL B CA  1 
ATOM   3498 C C   . VAL B 2 137 ? 22.617  128.834 79.253  1.00 23.87  ? 311 VAL B C   1 
ATOM   3499 O O   . VAL B 2 137 ? 22.914  127.917 80.018  1.00 23.89  ? 311 VAL B O   1 
ATOM   3500 C CB  . VAL B 2 137 ? 23.881  131.006 79.151  1.00 23.79  ? 311 VAL B CB  1 
ATOM   3501 C CG1 . VAL B 2 137 ? 23.907  130.928 80.666  1.00 23.29  ? 311 VAL B CG1 1 
ATOM   3502 C CG2 . VAL B 2 137 ? 25.156  131.643 78.620  1.00 23.68  ? 311 VAL B CG2 1 
ATOM   3503 N N   . ASN B 2 138 ? 21.362  129.179 78.970  1.00 24.15  ? 312 ASN B N   1 
ATOM   3504 C CA  . ASN B 2 138 ? 20.223  128.513 79.565  1.00 24.75  ? 312 ASN B CA  1 
ATOM   3505 C C   . ASN B 2 138 ? 20.252  126.987 79.419  1.00 23.91  ? 312 ASN B C   1 
ATOM   3506 O O   . ASN B 2 138 ? 20.057  126.266 80.397  1.00 24.19  ? 312 ASN B O   1 
ATOM   3507 C CB  . ASN B 2 138 ? 18.921  129.096 79.024  1.00 25.45  ? 312 ASN B CB  1 
ATOM   3508 C CG  . ASN B 2 138 ? 17.718  128.385 79.563  1.00 28.10  ? 312 ASN B CG  1 
ATOM   3509 O OD1 . ASN B 2 138 ? 17.338  128.593 80.717  1.00 31.09  ? 312 ASN B OD1 1 
ATOM   3510 N ND2 . ASN B 2 138 ? 17.123  127.502 78.747  1.00 29.50  ? 312 ASN B ND2 1 
ATOM   3511 N N   . GLN B 2 139 ? 20.547  126.500 78.221  1.00 23.40  ? 313 GLN B N   1 
ATOM   3512 C CA  . GLN B 2 139 ? 20.560  125.060 77.967  1.00 22.46  ? 313 GLN B CA  1 
ATOM   3513 C C   . GLN B 2 139 ? 21.671  124.360 78.732  1.00 21.48  ? 313 GLN B C   1 
ATOM   3514 O O   . GLN B 2 139 ? 21.466  123.264 79.212  1.00 21.28  ? 313 GLN B O   1 
ATOM   3515 C CB  . GLN B 2 139 ? 20.689  124.749 76.470  1.00 22.54  ? 313 GLN B CB  1 
ATOM   3516 C CG  . GLN B 2 139 ? 19.425  125.006 75.643  1.00 24.02  ? 313 GLN B CG  1 
ATOM   3517 C CD  . GLN B 2 139 ? 19.718  125.052 74.130  1.00 24.59  ? 313 GLN B CD  1 
ATOM   3518 O OE1 . GLN B 2 139 ? 20.234  124.089 73.566  1.00 24.78  ? 313 GLN B OE1 1 
ATOM   3519 N NE2 . GLN B 2 139 ? 19.420  126.175 73.497  1.00 22.71  ? 313 GLN B NE2 1 
ATOM   3520 N N   . PHE B 2 140 ? 22.848  124.978 78.843  1.00 20.01  ? 314 PHE B N   1 
ATOM   3521 C CA  . PHE B 2 140 ? 23.909  124.392 79.672  1.00 19.18  ? 314 PHE B CA  1 
ATOM   3522 C C   . PHE B 2 140 ? 23.600  124.419 81.181  1.00 18.94  ? 314 PHE B C   1 
ATOM   3523 O O   . PHE B 2 140 ? 23.877  123.451 81.890  1.00 18.76  ? 314 PHE B O   1 
ATOM   3524 C CB  . PHE B 2 140 ? 25.282  125.025 79.371  1.00 18.53  ? 314 PHE B CB  1 
ATOM   3525 C CG  . PHE B 2 140 ? 25.855  124.623 78.028  1.00 16.90  ? 314 PHE B CG  1 
ATOM   3526 C CD1 . PHE B 2 140 ? 26.546  123.411 77.877  1.00 16.17  ? 314 PHE B CD1 1 
ATOM   3527 C CD2 . PHE B 2 140 ? 25.698  125.444 76.918  1.00 14.02  ? 314 PHE B CD2 1 
ATOM   3528 C CE1 . PHE B 2 140 ? 27.070  123.006 76.612  1.00 15.88  ? 314 PHE B CE1 1 
ATOM   3529 C CE2 . PHE B 2 140 ? 26.226  125.065 75.652  1.00 16.66  ? 314 PHE B CE2 1 
ATOM   3530 C CZ  . PHE B 2 140 ? 26.914  123.841 75.502  1.00 15.54  ? 314 PHE B CZ  1 
ATOM   3531 N N   . LEU B 2 141 ? 23.030  125.523 81.652  1.00 19.07  ? 315 LEU B N   1 
ATOM   3532 C CA  . LEU B 2 141 ? 22.762  125.740 83.076  1.00 20.08  ? 315 LEU B CA  1 
ATOM   3533 C C   . LEU B 2 141 ? 21.840  124.649 83.588  1.00 20.76  ? 315 LEU B C   1 
ATOM   3534 O O   . LEU B 2 141 ? 22.034  124.043 84.636  1.00 21.48  ? 315 LEU B O   1 
ATOM   3535 C CB  . LEU B 2 141 ? 22.097  127.109 83.287  1.00 19.00  ? 315 LEU B CB  1 
ATOM   3536 C CG  . LEU B 2 141 ? 23.017  128.287 83.606  1.00 19.02  ? 315 LEU B CG  1 
ATOM   3537 C CD1 . LEU B 2 141 ? 22.202  129.541 83.809  1.00 18.11  ? 315 LEU B CD1 1 
ATOM   3538 C CD2 . LEU B 2 141 ? 23.897  128.024 84.838  1.00 17.73  ? 315 LEU B CD2 1 
ATOM   3539 N N   . THR B 2 142 ? 20.833  124.407 82.791  1.00 22.05  ? 316 THR B N   1 
ATOM   3540 C CA  . THR B 2 142 ? 19.781  123.486 83.099  1.00 23.30  ? 316 THR B CA  1 
ATOM   3541 C C   . THR B 2 142 ? 20.382  122.078 83.248  1.00 23.92  ? 316 THR B C   1 
ATOM   3542 O O   . THR B 2 142 ? 20.005  121.331 84.146  1.00 24.06  ? 316 THR B O   1 
ATOM   3543 C CB  . THR B 2 142 ? 18.742  123.671 81.963  1.00 23.59  ? 316 THR B CB  1 
ATOM   3544 O OG1 . THR B 2 142 ? 17.557  124.313 82.487  1.00 25.99  ? 316 THR B OG1 1 
ATOM   3545 C CG2 . THR B 2 142 ? 18.301  122.392 81.363  1.00 22.61  ? 316 THR B CG2 1 
ATOM   3546 N N   . GLN B 2 143 ? 21.365  121.734 82.416  1.00 24.45  ? 317 GLN B N   1 
ATOM   3547 C CA  . GLN B 2 143 ? 22.084  120.472 82.603  1.00 24.95  ? 317 GLN B CA  1 
ATOM   3548 C C   . GLN B 2 143 ? 22.984  120.435 83.840  1.00 24.45  ? 317 GLN B C   1 
ATOM   3549 O O   . GLN B 2 143 ? 23.069  119.414 84.505  1.00 24.45  ? 317 GLN B O   1 
ATOM   3550 C CB  . GLN B 2 143 ? 22.919  120.175 81.381  1.00 25.70  ? 317 GLN B CB  1 
ATOM   3551 C CG  . GLN B 2 143 ? 22.139  119.639 80.228  1.00 28.94  ? 317 GLN B CG  1 
ATOM   3552 C CD  . GLN B 2 143 ? 23.048  119.032 79.210  1.00 33.78  ? 317 GLN B CD  1 
ATOM   3553 O OE1 . GLN B 2 143 ? 23.581  119.754 78.370  1.00 35.91  ? 317 GLN B OE1 1 
ATOM   3554 N NE2 . GLN B 2 143 ? 23.272  117.709 79.295  1.00 34.55  ? 317 GLN B NE2 1 
ATOM   3555 N N   . TYR B 2 144 ? 23.678  121.536 84.122  1.00 24.16  ? 318 TYR B N   1 
ATOM   3556 C CA  . TYR B 2 144 ? 24.573  121.627 85.275  1.00 23.88  ? 318 TYR B CA  1 
ATOM   3557 C C   . TYR B 2 144 ? 23.790  121.513 86.579  1.00 24.61  ? 318 TYR B C   1 
ATOM   3558 O O   . TYR B 2 144 ? 24.270  120.906 87.539  1.00 24.44  ? 318 TYR B O   1 
ATOM   3559 C CB  . TYR B 2 144 ? 25.367  122.941 85.278  1.00 22.95  ? 318 TYR B CB  1 
ATOM   3560 C CG  . TYR B 2 144 ? 26.301  123.179 84.104  1.00 22.24  ? 318 TYR B CG  1 
ATOM   3561 C CD1 . TYR B 2 144 ? 26.565  122.183 83.157  1.00 20.19  ? 318 TYR B CD1 1 
ATOM   3562 C CD2 . TYR B 2 144 ? 26.918  124.422 83.938  1.00 20.56  ? 318 TYR B CD2 1 
ATOM   3563 C CE1 . TYR B 2 144 ? 27.424  122.418 82.084  1.00 18.93  ? 318 TYR B CE1 1 
ATOM   3564 C CE2 . TYR B 2 144 ? 27.769  124.666 82.878  1.00 20.46  ? 318 TYR B CE2 1 
ATOM   3565 C CZ  . TYR B 2 144 ? 28.017  123.656 81.947  1.00 20.91  ? 318 TYR B CZ  1 
ATOM   3566 O OH  . TYR B 2 144 ? 28.874  123.895 80.901  1.00 18.82  ? 318 TYR B OH  1 
ATOM   3567 N N   . PHE B 2 145 ? 22.596  122.108 86.607  1.00 25.27  ? 319 PHE B N   1 
ATOM   3568 C CA  . PHE B 2 145 ? 21.664  121.990 87.738  1.00 26.41  ? 319 PHE B CA  1 
ATOM   3569 C C   . PHE B 2 145 ? 21.432  120.545 88.209  1.00 27.54  ? 319 PHE B C   1 
ATOM   3570 O O   . PHE B 2 145 ? 21.214  120.299 89.398  1.00 27.55  ? 319 PHE B O   1 
ATOM   3571 C CB  . PHE B 2 145 ? 20.306  122.626 87.394  1.00 25.91  ? 319 PHE B CB  1 
ATOM   3572 C CG  . PHE B 2 145 ? 20.341  124.133 87.265  1.00 25.50  ? 319 PHE B CG  1 
ATOM   3573 C CD1 . PHE B 2 145 ? 21.443  124.858 87.680  1.00 23.70  ? 319 PHE B CD1 1 
ATOM   3574 C CD2 . PHE B 2 145 ? 19.257  124.820 86.733  1.00 25.22  ? 319 PHE B CD2 1 
ATOM   3575 C CE1 . PHE B 2 145 ? 21.473  126.230 87.558  1.00 24.48  ? 319 PHE B CE1 1 
ATOM   3576 C CE2 . PHE B 2 145 ? 19.276  126.200 86.616  1.00 24.29  ? 319 PHE B CE2 1 
ATOM   3577 C CZ  . PHE B 2 145 ? 20.393  126.906 87.032  1.00 24.08  ? 319 PHE B CZ  1 
ATOM   3578 N N   . LEU B 2 146 ? 21.493  119.588 87.293  1.00 28.55  ? 320 LEU B N   1 
ATOM   3579 C CA  . LEU B 2 146 ? 21.298  118.193 87.675  1.00 30.52  ? 320 LEU B CA  1 
ATOM   3580 C C   . LEU B 2 146 ? 22.372  117.663 88.628  1.00 32.09  ? 320 LEU B C   1 
ATOM   3581 O O   . LEU B 2 146 ? 22.203  116.597 89.217  1.00 31.94  ? 320 LEU B O   1 
ATOM   3582 C CB  . LEU B 2 146 ? 21.182  117.289 86.445  1.00 29.84  ? 320 LEU B CB  1 
ATOM   3583 C CG  . LEU B 2 146 ? 19.981  117.623 85.563  1.00 29.68  ? 320 LEU B CG  1 
ATOM   3584 C CD1 . LEU B 2 146 ? 19.887  116.668 84.381  1.00 31.02  ? 320 LEU B CD1 1 
ATOM   3585 C CD2 . LEU B 2 146 ? 18.694  117.613 86.380  1.00 29.37  ? 320 LEU B CD2 1 
ATOM   3586 N N   . HIS B 2 147 ? 23.457  118.415 88.783  1.00 34.01  ? 321 HIS B N   1 
ATOM   3587 C CA  . HIS B 2 147 ? 24.567  117.987 89.619  1.00 36.41  ? 321 HIS B CA  1 
ATOM   3588 C C   . HIS B 2 147 ? 24.548  118.607 91.020  1.00 38.79  ? 321 HIS B C   1 
ATOM   3589 O O   . HIS B 2 147 ? 25.497  118.428 91.780  1.00 39.21  ? 321 HIS B O   1 
ATOM   3590 C CB  . HIS B 2 147 ? 25.907  118.266 88.921  1.00 35.82  ? 321 HIS B CB  1 
ATOM   3591 C CG  . HIS B 2 147 ? 26.136  117.444 87.690  1.00 33.90  ? 321 HIS B CG  1 
ATOM   3592 N ND1 . HIS B 2 147 ? 27.186  116.560 87.571  1.00 33.56  ? 321 HIS B ND1 1 
ATOM   3593 C CD2 . HIS B 2 147 ? 25.457  117.379 86.521  1.00 32.25  ? 321 HIS B CD2 1 
ATOM   3594 C CE1 . HIS B 2 147 ? 27.134  115.972 86.388  1.00 31.67  ? 321 HIS B CE1 1 
ATOM   3595 N NE2 . HIS B 2 147 ? 26.096  116.456 85.730  1.00 32.00  ? 321 HIS B NE2 1 
ATOM   3596 N N   . GLN B 2 148 ? 23.484  119.330 91.375  1.00 41.66  ? 322 GLN B N   1 
ATOM   3597 C CA  . GLN B 2 148 ? 23.364  119.836 92.747  1.00 44.70  ? 322 GLN B CA  1 
ATOM   3598 C C   . GLN B 2 148 ? 23.046  118.697 93.716  1.00 46.92  ? 322 GLN B C   1 
ATOM   3599 O O   . GLN B 2 148 ? 22.116  117.913 93.479  1.00 47.12  ? 322 GLN B O   1 
ATOM   3600 C CB  . GLN B 2 148 ? 22.294  120.910 92.883  1.00 44.67  ? 322 GLN B CB  1 
ATOM   3601 C CG  . GLN B 2 148 ? 22.450  122.126 92.008  1.00 44.79  ? 322 GLN B CG  1 
ATOM   3602 C CD  . GLN B 2 148 ? 21.126  122.841 91.845  1.00 44.95  ? 322 GLN B CD  1 
ATOM   3603 O OE1 . GLN B 2 148 ? 20.858  123.820 92.543  1.00 44.94  ? 322 GLN B OE1 1 
ATOM   3604 N NE2 . GLN B 2 148 ? 20.276  122.330 90.954  1.00 43.82  ? 322 GLN B NE2 1 
ATOM   3605 N N   . GLN B 2 149 ? 23.815  118.617 94.808  1.00 49.74  ? 323 GLN B N   1 
ATOM   3606 C CA  . GLN B 2 149 ? 23.692  117.510 95.765  1.00 52.24  ? 323 GLN B CA  1 
ATOM   3607 C C   . GLN B 2 149 ? 22.299  117.527 96.408  1.00 52.50  ? 323 GLN B C   1 
ATOM   3608 O O   . GLN B 2 149 ? 21.491  116.626 96.148  1.00 53.33  ? 323 GLN B O   1 
ATOM   3609 C CB  . GLN B 2 149 ? 24.824  117.531 96.797  1.00 53.02  ? 323 GLN B CB  1 
ATOM   3610 C CG  . GLN B 2 149 ? 25.990  116.600 96.468  1.00 57.08  ? 323 GLN B CG  1 
ATOM   3611 C CD  . GLN B 2 149 ? 26.215  115.537 97.535  1.00 61.74  ? 323 GLN B CD  1 
ATOM   3612 O OE1 . GLN B 2 149 ? 26.332  115.850 98.725  1.00 63.89  ? 323 GLN B OE1 1 
ATOM   3613 N NE2 . GLN B 2 149 ? 26.277  114.279 97.112  1.00 63.76  ? 323 GLN B NE2 1 
ATOM   3614 N N   . PRO B 2 150 ? 22.011  118.525 97.244  1.00 52.54  ? 324 PRO B N   1 
ATOM   3615 C CA  . PRO B 2 150 ? 20.625  118.967 97.411  1.00 52.12  ? 324 PRO B CA  1 
ATOM   3616 C C   . PRO B 2 150 ? 20.309  120.017 96.337  1.00 51.32  ? 324 PRO B C   1 
ATOM   3617 O O   . PRO B 2 150 ? 21.059  120.990 96.193  1.00 51.44  ? 324 PRO B O   1 
ATOM   3618 C CB  . PRO B 2 150 ? 20.625  119.592 98.811  1.00 52.39  ? 324 PRO B CB  1 
ATOM   3619 C CG  . PRO B 2 150 ? 22.041  120.091 99.017  1.00 52.76  ? 324 PRO B CG  1 
ATOM   3620 C CD  . PRO B 2 150 ? 22.937  119.252 98.139  1.00 52.69  ? 324 PRO B CD  1 
ATOM   3621 N N   . ALA B 2 151 ? 19.236  119.808 95.577  1.00 50.26  ? 325 ALA B N   1 
ATOM   3622 C CA  . ALA B 2 151 ? 18.769  120.812 94.620  1.00 49.13  ? 325 ALA B CA  1 
ATOM   3623 C C   . ALA B 2 151 ? 18.314  122.048 95.379  1.00 48.22  ? 325 ALA B C   1 
ATOM   3624 O O   . ALA B 2 151 ? 17.568  121.942 96.358  1.00 48.61  ? 325 ALA B O   1 
ATOM   3625 C CB  . ALA B 2 151 ? 17.638  120.264 93.760  1.00 49.27  ? 325 ALA B CB  1 
ATOM   3626 N N   . ASN B 2 152 ? 18.781  123.213 94.941  1.00 46.58  ? 326 ASN B N   1 
ATOM   3627 C CA  . ASN B 2 152 ? 18.484  124.469 95.618  1.00 44.81  ? 326 ASN B CA  1 
ATOM   3628 C C   . ASN B 2 152 ? 17.923  125.475 94.619  1.00 43.66  ? 326 ASN B C   1 
ATOM   3629 O O   . ASN B 2 152 ? 18.619  125.903 93.692  1.00 43.46  ? 326 ASN B O   1 
ATOM   3630 C CB  . ASN B 2 152 ? 19.745  125.004 96.321  1.00 44.79  ? 326 ASN B CB  1 
ATOM   3631 C CG  . ASN B 2 152 ? 19.490  126.275 97.125  1.00 45.02  ? 326 ASN B CG  1 
ATOM   3632 O OD1 . ASN B 2 152 ? 18.800  127.188 96.675  1.00 46.12  ? 326 ASN B OD1 1 
ATOM   3633 N ND2 . ASN B 2 152 ? 20.067  126.343 98.314  1.00 45.35  ? 326 ASN B ND2 1 
ATOM   3634 N N   . CYS B 2 153 ? 16.664  125.853 94.822  1.00 42.07  ? 327 CYS B N   1 
ATOM   3635 C CA  . CYS B 2 153 ? 15.952  126.717 93.888  1.00 41.18  ? 327 CYS B CA  1 
ATOM   3636 C C   . CYS B 2 153 ? 16.534  128.132 93.804  1.00 38.87  ? 327 CYS B C   1 
ATOM   3637 O O   . CYS B 2 153 ? 16.435  128.776 92.762  1.00 38.56  ? 327 CYS B O   1 
ATOM   3638 C CB  . CYS B 2 153 ? 14.454  126.735 94.209  1.00 41.88  ? 327 CYS B CB  1 
ATOM   3639 S SG  . CYS B 2 153 ? 13.995  127.759 95.641  1.00 48.95  ? 327 CYS B SG  1 
ATOM   3640 N N   . LYS B 2 154 ? 17.169  128.586 94.888  1.00 36.37  ? 328 LYS B N   1 
ATOM   3641 C CA  . LYS B 2 154 ? 17.867  129.877 94.924  1.00 34.31  ? 328 LYS B CA  1 
ATOM   3642 C C   . LYS B 2 154 ? 19.158  129.873 94.106  1.00 32.35  ? 328 LYS B C   1 
ATOM   3643 O O   . LYS B 2 154 ? 19.492  130.862 93.460  1.00 31.38  ? 328 LYS B O   1 
ATOM   3644 C CB  . LYS B 2 154 ? 18.195  130.278 96.366  1.00 34.62  ? 328 LYS B CB  1 
ATOM   3645 C CG  . LYS B 2 154 ? 17.318  131.377 96.939  1.00 35.78  ? 328 LYS B CG  1 
ATOM   3646 C CD  . LYS B 2 154 ? 16.848  131.054 98.351  1.00 39.65  ? 328 LYS B CD  1 
ATOM   3647 C CE  . LYS B 2 154 ? 17.949  131.199 99.423  1.00 42.22  ? 328 LYS B CE  1 
ATOM   3648 N NZ  . LYS B 2 154 ? 18.966  132.261 99.107  1.00 44.54  ? 328 LYS B NZ  1 
ATOM   3649 N N   . VAL B 2 155 ? 19.891  128.767 94.163  1.00 30.61  ? 329 VAL B N   1 
ATOM   3650 C CA  . VAL B 2 155 ? 21.079  128.594 93.338  1.00 29.15  ? 329 VAL B CA  1 
ATOM   3651 C C   . VAL B 2 155 ? 20.697  128.647 91.857  1.00 28.62  ? 329 VAL B C   1 
ATOM   3652 O O   . VAL B 2 155 ? 21.290  129.394 91.086  1.00 27.63  ? 329 VAL B O   1 
ATOM   3653 C CB  . VAL B 2 155 ? 21.799  127.281 93.656  1.00 29.13  ? 329 VAL B CB  1 
ATOM   3654 C CG1 . VAL B 2 155 ? 22.987  127.073 92.702  1.00 28.92  ? 329 VAL B CG1 1 
ATOM   3655 C CG2 . VAL B 2 155 ? 22.281  127.283 95.096  1.00 28.07  ? 329 VAL B CG2 1 
ATOM   3656 N N   . GLU B 2 156 ? 19.678  127.878 91.487  1.00 28.45  ? 330 GLU B N   1 
ATOM   3657 C CA  . GLU B 2 156 ? 19.194  127.833 90.113  1.00 28.92  ? 330 GLU B CA  1 
ATOM   3658 C C   . GLU B 2 156 ? 18.771  129.205 89.609  1.00 28.26  ? 330 GLU B C   1 
ATOM   3659 O O   . GLU B 2 156 ? 19.267  129.644 88.578  1.00 28.55  ? 330 GLU B O   1 
ATOM   3660 C CB  . GLU B 2 156 ? 18.035  126.842 89.970  1.00 29.45  ? 330 GLU B CB  1 
ATOM   3661 C CG  . GLU B 2 156 ? 18.432  125.398 90.225  1.00 31.89  ? 330 GLU B CG  1 
ATOM   3662 C CD  . GLU B 2 156 ? 17.307  124.409 89.952  1.00 37.66  ? 330 GLU B CD  1 
ATOM   3663 O OE1 . GLU B 2 156 ? 16.349  124.750 89.213  1.00 40.31  ? 330 GLU B OE1 1 
ATOM   3664 O OE2 . GLU B 2 156 ? 17.379  123.270 90.471  1.00 40.44  ? 330 GLU B OE2 1 
ATOM   3665 N N   . SER B 2 157 ? 17.877  129.881 90.338  1.00 27.03  ? 331 SER B N   1 
ATOM   3666 C CA  . SER B 2 157 ? 17.382  131.191 89.928  1.00 25.86  ? 331 SER B CA  1 
ATOM   3667 C C   . SER B 2 157 ? 18.493  132.207 89.836  1.00 25.28  ? 331 SER B C   1 
ATOM   3668 O O   . SER B 2 157 ? 18.514  133.017 88.907  1.00 24.69  ? 331 SER B O   1 
ATOM   3669 C CB  . SER B 2 157 ? 16.318  131.719 90.892  1.00 25.98  ? 331 SER B CB  1 
ATOM   3670 O OG  . SER B 2 157 ? 15.067  131.082 90.705  1.00 27.41  ? 331 SER B OG  1 
ATOM   3671 N N   . LEU B 2 158 ? 19.408  132.193 90.807  1.00 24.36  ? 332 LEU B N   1 
ATOM   3672 C CA  . LEU B 2 158 ? 20.536  133.117 90.748  1.00 24.03  ? 332 LEU B CA  1 
ATOM   3673 C C   . LEU B 2 158 ? 21.473  132.810 89.576  1.00 24.09  ? 332 LEU B C   1 
ATOM   3674 O O   . LEU B 2 158 ? 22.013  133.727 88.958  1.00 23.76  ? 332 LEU B O   1 
ATOM   3675 C CB  . LEU B 2 158 ? 21.319  133.166 92.058  1.00 23.62  ? 332 LEU B CB  1 
ATOM   3676 C CG  . LEU B 2 158 ? 22.419  134.227 92.155  1.00 22.67  ? 332 LEU B CG  1 
ATOM   3677 C CD1 . LEU B 2 158 ? 21.858  135.654 92.031  1.00 19.84  ? 332 LEU B CD1 1 
ATOM   3678 C CD2 . LEU B 2 158 ? 23.210  134.060 93.483  1.00 22.80  ? 332 LEU B CD2 1 
ATOM   3679 N N   . ALA B 2 159 ? 21.671  131.532 89.271  1.00 23.86  ? 333 ALA B N   1 
ATOM   3680 C CA  . ALA B 2 159 ? 22.480  131.186 88.103  1.00 24.45  ? 333 ALA B CA  1 
ATOM   3681 C C   . ALA B 2 159 ? 21.880  131.775 86.806  1.00 24.48  ? 333 ALA B C   1 
ATOM   3682 O O   . ALA B 2 159 ? 22.588  132.388 86.019  1.00 24.06  ? 333 ALA B O   1 
ATOM   3683 C CB  . ALA B 2 159 ? 22.672  129.688 88.003  1.00 23.97  ? 333 ALA B CB  1 
ATOM   3684 N N   . MET B 2 160 ? 20.572  131.614 86.624  1.00 25.14  ? 334 MET B N   1 
ATOM   3685 C CA  . MET B 2 160 ? 19.856  132.165 85.478  1.00 26.15  ? 334 MET B CA  1 
ATOM   3686 C C   . MET B 2 160 ? 19.976  133.676 85.385  1.00 25.36  ? 334 MET B C   1 
ATOM   3687 O O   . MET B 2 160 ? 20.215  134.216 84.303  1.00 24.49  ? 334 MET B O   1 
ATOM   3688 C CB  . MET B 2 160 ? 18.382  131.775 85.538  1.00 27.19  ? 334 MET B CB  1 
ATOM   3689 C CG  . MET B 2 160 ? 18.080  130.374 85.013  1.00 32.49  ? 334 MET B CG  1 
ATOM   3690 S SD  . MET B 2 160 ? 16.880  129.566 86.128  1.00 44.35  ? 334 MET B SD  1 
ATOM   3691 C CE  . MET B 2 160 ? 15.489  130.808 86.109  1.00 42.25  ? 334 MET B CE  1 
ATOM   3692 N N   . PHE B 2 161 ? 19.804  134.345 86.527  1.00 25.36  ? 335 PHE B N   1 
ATOM   3693 C CA  . PHE B 2 161 ? 19.998  135.795 86.674  1.00 25.19  ? 335 PHE B CA  1 
ATOM   3694 C C   . PHE B 2 161 ? 21.353  136.254 86.152  1.00 25.11  ? 335 PHE B C   1 
ATOM   3695 O O   . PHE B 2 161 ? 21.421  137.094 85.255  1.00 25.59  ? 335 PHE B O   1 
ATOM   3696 C CB  . PHE B 2 161 ? 19.810  136.202 88.154  1.00 25.81  ? 335 PHE B CB  1 
ATOM   3697 C CG  . PHE B 2 161 ? 20.193  137.638 88.472  1.00 26.05  ? 335 PHE B CG  1 
ATOM   3698 C CD1 . PHE B 2 161 ? 19.508  138.711 87.898  1.00 26.14  ? 335 PHE B CD1 1 
ATOM   3699 C CD2 . PHE B 2 161 ? 21.219  137.906 89.375  1.00 26.63  ? 335 PHE B CD2 1 
ATOM   3700 C CE1 . PHE B 2 161 ? 19.846  140.037 88.210  1.00 26.29  ? 335 PHE B CE1 1 
ATOM   3701 C CE2 . PHE B 2 161 ? 21.580  139.231 89.697  1.00 27.43  ? 335 PHE B CE2 1 
ATOM   3702 C CZ  . PHE B 2 161 ? 20.888  140.300 89.103  1.00 27.33  ? 335 PHE B CZ  1 
ATOM   3703 N N   . LEU B 2 162 ? 22.427  135.698 86.701  1.00 25.09  ? 336 LEU B N   1 
ATOM   3704 C CA  . LEU B 2 162 ? 23.785  135.999 86.245  1.00 25.45  ? 336 LEU B CA  1 
ATOM   3705 C C   . LEU B 2 162 ? 23.974  135.633 84.774  1.00 25.91  ? 336 LEU B C   1 
ATOM   3706 O O   . LEU B 2 162 ? 24.668  136.336 84.037  1.00 26.37  ? 336 LEU B O   1 
ATOM   3707 C CB  . LEU B 2 162 ? 24.823  135.263 87.097  1.00 25.19  ? 336 LEU B CB  1 
ATOM   3708 C CG  . LEU B 2 162 ? 24.763  135.509 88.616  1.00 26.15  ? 336 LEU B CG  1 
ATOM   3709 C CD1 . LEU B 2 162 ? 25.676  134.581 89.387  1.00 23.03  ? 336 LEU B CD1 1 
ATOM   3710 C CD2 . LEU B 2 162 ? 25.091  136.970 88.951  1.00 27.09  ? 336 LEU B CD2 1 
ATOM   3711 N N   . GLY B 2 163 ? 23.358  134.533 84.352  1.00 25.82  ? 337 GLY B N   1 
ATOM   3712 C CA  . GLY B 2 163 ? 23.369  134.150 82.957  1.00 26.15  ? 337 GLY B CA  1 
ATOM   3713 C C   . GLY B 2 163 ? 22.762  135.250 82.122  1.00 26.40  ? 337 GLY B C   1 
ATOM   3714 O O   . GLY B 2 163 ? 23.330  135.630 81.100  1.00 26.88  ? 337 GLY B O   1 
ATOM   3715 N N   . GLU B 2 164 ? 21.630  135.785 82.573  1.00 26.52  ? 338 GLU B N   1 
ATOM   3716 C CA  . GLU B 2 164 ? 20.910  136.809 81.822  1.00 26.99  ? 338 GLU B CA  1 
ATOM   3717 C C   . GLU B 2 164 ? 21.687  138.107 81.768  1.00 27.17  ? 338 GLU B C   1 
ATOM   3718 O O   . GLU B 2 164 ? 21.746  138.752 80.721  1.00 27.15  ? 338 GLU B O   1 
ATOM   3719 C CB  . GLU B 2 164 ? 19.549  137.070 82.443  1.00 27.08  ? 338 GLU B CB  1 
ATOM   3720 C CG  . GLU B 2 164 ? 18.461  137.294 81.423  1.00 28.30  ? 338 GLU B CG  1 
ATOM   3721 C CD  . GLU B 2 164 ? 17.085  136.965 81.951  1.00 30.32  ? 338 GLU B CD  1 
ATOM   3722 O OE1 . GLU B 2 164 ? 16.271  137.911 82.025  1.00 33.14  ? 338 GLU B OE1 1 
ATOM   3723 O OE2 . GLU B 2 164 ? 16.805  135.784 82.265  1.00 29.07  ? 338 GLU B OE2 1 
ATOM   3724 N N   . LEU B 2 165 ? 22.287  138.481 82.900  1.00 27.13  ? 339 LEU B N   1 
ATOM   3725 C CA  . LEU B 2 165 ? 23.107  139.686 82.994  1.00 26.84  ? 339 LEU B CA  1 
ATOM   3726 C C   . LEU B 2 165 ? 24.191  139.743 81.936  1.00 26.66  ? 339 LEU B C   1 
ATOM   3727 O O   . LEU B 2 165 ? 24.523  140.814 81.434  1.00 26.42  ? 339 LEU B O   1 
ATOM   3728 C CB  . LEU B 2 165 ? 23.747  139.784 84.378  1.00 27.04  ? 339 LEU B CB  1 
ATOM   3729 C CG  . LEU B 2 165 ? 22.881  140.319 85.521  1.00 27.37  ? 339 LEU B CG  1 
ATOM   3730 C CD1 . LEU B 2 165 ? 23.754  140.489 86.749  1.00 27.78  ? 339 LEU B CD1 1 
ATOM   3731 C CD2 . LEU B 2 165 ? 22.143  141.635 85.174  1.00 26.48  ? 339 LEU B CD2 1 
ATOM   3732 N N   . SER B 2 166 ? 24.732  138.579 81.598  1.00 26.97  ? 340 SER B N   1 
ATOM   3733 C CA  . SER B 2 166 ? 25.847  138.480 80.667  1.00 27.39  ? 340 SER B CA  1 
ATOM   3734 C C   . SER B 2 166 ? 25.388  138.665 79.227  1.00 27.63  ? 340 SER B C   1 
ATOM   3735 O O   . SER B 2 166 ? 26.209  138.773 78.332  1.00 28.94  ? 340 SER B O   1 
ATOM   3736 C CB  . SER B 2 166 ? 26.545  137.126 80.810  1.00 27.24  ? 340 SER B CB  1 
ATOM   3737 O OG  . SER B 2 166 ? 25.811  136.108 80.144  1.00 27.28  ? 340 SER B OG  1 
ATOM   3738 N N   . LEU B 2 167 ? 24.081  138.678 78.999  1.00 27.42  ? 341 LEU B N   1 
ATOM   3739 C CA  . LEU B 2 167 ? 23.545  138.937 77.672  1.00 27.17  ? 341 LEU B CA  1 
ATOM   3740 C C   . LEU B 2 167 ? 23.680  140.414 77.282  1.00 27.33  ? 341 LEU B C   1 
ATOM   3741 O O   . LEU B 2 167 ? 23.791  140.757 76.091  1.00 27.39  ? 341 LEU B O   1 
ATOM   3742 C CB  . LEU B 2 167 ? 22.082  138.515 77.608  1.00 26.48  ? 341 LEU B CB  1 
ATOM   3743 C CG  . LEU B 2 167 ? 21.788  137.025 77.764  1.00 25.78  ? 341 LEU B CG  1 
ATOM   3744 C CD1 . LEU B 2 167 ? 20.287  136.822 77.613  1.00 24.01  ? 341 LEU B CD1 1 
ATOM   3745 C CD2 . LEU B 2 167 ? 22.560  136.157 76.762  1.00 24.03  ? 341 LEU B CD2 1 
ATOM   3746 N N   . ILE B 2 168 ? 23.685  141.271 78.295  1.00 27.20  ? 342 ILE B N   1 
ATOM   3747 C CA  . ILE B 2 168 ? 23.694  142.719 78.106  1.00 27.67  ? 342 ILE B CA  1 
ATOM   3748 C C   . ILE B 2 168 ? 25.037  143.301 77.642  1.00 27.90  ? 342 ILE B C   1 
ATOM   3749 O O   . ILE B 2 168 ? 25.061  144.257 76.875  1.00 28.05  ? 342 ILE B O   1 
ATOM   3750 C CB  . ILE B 2 168 ? 23.214  143.413 79.402  1.00 27.46  ? 342 ILE B CB  1 
ATOM   3751 C CG1 . ILE B 2 168 ? 21.760  143.022 79.708  1.00 27.50  ? 342 ILE B CG1 1 
ATOM   3752 C CG2 . ILE B 2 168 ? 23.409  144.922 79.327  1.00 27.58  ? 342 ILE B CG2 1 
ATOM   3753 C CD1 . ILE B 2 168 ? 20.691  143.912 79.109  1.00 27.63  ? 342 ILE B CD1 1 
ATOM   3754 N N   . ASP B 2 169 ? 26.142  142.733 78.098  1.00 28.92  ? 343 ASP B N   1 
ATOM   3755 C CA  . ASP B 2 169 ? 27.448  143.352 77.886  1.00 30.31  ? 343 ASP B CA  1 
ATOM   3756 C C   . ASP B 2 169 ? 28.302  142.550 76.896  1.00 30.72  ? 343 ASP B C   1 
ATOM   3757 O O   . ASP B 2 169 ? 28.970  141.580 77.264  1.00 30.56  ? 343 ASP B O   1 
ATOM   3758 C CB  . ASP B 2 169 ? 28.189  143.535 79.221  1.00 30.83  ? 343 ASP B CB  1 
ATOM   3759 C CG  . ASP B 2 169 ? 27.408  144.394 80.239  1.00 33.40  ? 343 ASP B CG  1 
ATOM   3760 O OD1 . ASP B 2 169 ? 27.121  145.577 79.941  1.00 36.51  ? 343 ASP B OD1 1 
ATOM   3761 O OD2 . ASP B 2 169 ? 27.063  143.970 81.372  1.00 33.45  ? 343 ASP B OD2 1 
ATOM   3762 N N   . ALA B 2 170 ? 28.282  142.968 75.634  1.00 31.74  ? 344 ALA B N   1 
ATOM   3763 C CA  . ALA B 2 170 ? 29.002  142.252 74.589  1.00 32.56  ? 344 ALA B CA  1 
ATOM   3764 C C   . ALA B 2 170 ? 30.494  142.311 74.855  1.00 33.54  ? 344 ALA B C   1 
ATOM   3765 O O   . ALA B 2 170 ? 31.212  141.366 74.556  1.00 33.45  ? 344 ALA B O   1 
ATOM   3766 C CB  . ALA B 2 170 ? 28.684  142.830 73.231  1.00 32.21  ? 344 ALA B CB  1 
ATOM   3767 N N   . ASP B 2 171 ? 30.945  143.414 75.453  1.00 35.20  ? 345 ASP B N   1 
ATOM   3768 C CA  . ASP B 2 171 ? 32.373  143.704 75.573  1.00 36.61  ? 345 ASP B CA  1 
ATOM   3769 C C   . ASP B 2 171 ? 33.156  142.495 76.032  1.00 36.30  ? 345 ASP B C   1 
ATOM   3770 O O   . ASP B 2 171 ? 33.892  141.883 75.219  1.00 38.10  ? 345 ASP B O   1 
ATOM   3771 C CB  . ASP B 2 171 ? 32.653  144.894 76.485  1.00 37.80  ? 345 ASP B CB  1 
ATOM   3772 C CG  . ASP B 2 171 ? 34.127  145.263 76.515  1.00 41.05  ? 345 ASP B CG  1 
ATOM   3773 O OD1 . ASP B 2 171 ? 34.969  144.330 76.548  1.00 42.58  ? 345 ASP B OD1 1 
ATOM   3774 O OD2 . ASP B 2 171 ? 34.535  146.459 76.503  1.00 45.87  ? 345 ASP B OD2 1 
ATOM   3775 N N   . PRO B 2 172 ? 33.017  142.119 77.301  1.00 34.77  ? 346 PRO B N   1 
ATOM   3776 C CA  . PRO B 2 172 ? 33.621  140.865 77.730  1.00 33.42  ? 346 PRO B CA  1 
ATOM   3777 C C   . PRO B 2 172 ? 32.859  139.680 77.109  1.00 32.76  ? 346 PRO B C   1 
ATOM   3778 O O   . PRO B 2 172 ? 33.477  138.934 76.360  1.00 32.52  ? 346 PRO B O   1 
ATOM   3779 C CB  . PRO B 2 172 ? 33.503  140.906 79.260  1.00 33.16  ? 346 PRO B CB  1 
ATOM   3780 C CG  . PRO B 2 172 ? 32.422  141.872 79.552  1.00 33.72  ? 346 PRO B CG  1 
ATOM   3781 C CD  . PRO B 2 172 ? 32.287  142.802 78.387  1.00 34.33  ? 346 PRO B CD  1 
ATOM   3782 N N   . TYR B 2 173 ? 31.548  139.563 77.338  1.00 31.89  ? 347 TYR B N   1 
ATOM   3783 C CA  . TYR B 2 173 ? 30.883  138.247 77.268  1.00 31.46  ? 347 TYR B CA  1 
ATOM   3784 C C   . TYR B 2 173 ? 30.777  137.550 75.911  1.00 31.22  ? 347 TYR B C   1 
ATOM   3785 O O   . TYR B 2 173 ? 30.595  136.344 75.863  1.00 30.59  ? 347 TYR B O   1 
ATOM   3786 C CB  . TYR B 2 173 ? 29.551  138.247 78.047  1.00 31.45  ? 347 TYR B CB  1 
ATOM   3787 C CG  . TYR B 2 173 ? 29.817  138.602 79.485  1.00 30.80  ? 347 TYR B CG  1 
ATOM   3788 C CD1 . TYR B 2 173 ? 30.564  137.750 80.298  1.00 30.29  ? 347 TYR B CD1 1 
ATOM   3789 C CD2 . TYR B 2 173 ? 29.395  139.816 80.011  1.00 29.93  ? 347 TYR B CD2 1 
ATOM   3790 C CE1 . TYR B 2 173 ? 30.854  138.087 81.617  1.00 30.11  ? 347 TYR B CE1 1 
ATOM   3791 C CE2 . TYR B 2 173 ? 29.685  140.167 81.330  1.00 29.73  ? 347 TYR B CE2 1 
ATOM   3792 C CZ  . TYR B 2 173 ? 30.417  139.295 82.117  1.00 29.84  ? 347 TYR B CZ  1 
ATOM   3793 O OH  . TYR B 2 173 ? 30.718  139.637 83.400  1.00 29.56  ? 347 TYR B OH  1 
ATOM   3794 N N   . LEU B 2 174 ? 30.922  138.296 74.826  1.00 31.18  ? 348 LEU B N   1 
ATOM   3795 C CA  . LEU B 2 174 ? 30.963  137.697 73.503  1.00 31.94  ? 348 LEU B CA  1 
ATOM   3796 C C   . LEU B 2 174 ? 32.193  136.825 73.317  1.00 32.10  ? 348 LEU B C   1 
ATOM   3797 O O   . LEU B 2 174 ? 32.223  135.987 72.430  1.00 32.56  ? 348 LEU B O   1 
ATOM   3798 C CB  . LEU B 2 174 ? 30.956  138.780 72.431  1.00 32.30  ? 348 LEU B CB  1 
ATOM   3799 C CG  . LEU B 2 174 ? 29.822  138.854 71.407  1.00 33.47  ? 348 LEU B CG  1 
ATOM   3800 C CD1 . LEU B 2 174 ? 28.477  138.353 71.940  1.00 34.36  ? 348 LEU B CD1 1 
ATOM   3801 C CD2 . LEU B 2 174 ? 29.697  140.290 70.941  1.00 33.15  ? 348 LEU B CD2 1 
ATOM   3802 N N   . LYS B 2 175 ? 33.212  137.019 74.146  1.00 32.40  ? 349 LYS B N   1 
ATOM   3803 C CA  . LYS B 2 175 ? 34.434  136.234 74.008  1.00 32.77  ? 349 LYS B CA  1 
ATOM   3804 C C   . LYS B 2 175 ? 34.318  134.858 74.679  1.00 31.53  ? 349 LYS B C   1 
ATOM   3805 O O   . LYS B 2 175 ? 35.176  133.995 74.483  1.00 31.98  ? 349 LYS B O   1 
ATOM   3806 C CB  . LYS B 2 175 ? 35.656  137.025 74.511  1.00 33.59  ? 349 LYS B CB  1 
ATOM   3807 C CG  . LYS B 2 175 ? 36.170  136.624 75.878  1.00 37.76  ? 349 LYS B CG  1 
ATOM   3808 C CD  . LYS B 2 175 ? 37.701  136.694 75.944  1.00 45.42  ? 349 LYS B CD  1 
ATOM   3809 C CE  . LYS B 2 175 ? 38.364  135.643 75.030  1.00 49.07  ? 349 LYS B CE  1 
ATOM   3810 N NZ  . LYS B 2 175 ? 39.424  134.856 75.747  1.00 51.14  ? 349 LYS B NZ  1 
ATOM   3811 N N   . TYR B 2 176 ? 33.260  134.655 75.459  1.00 29.32  ? 350 TYR B N   1 
ATOM   3812 C CA  . TYR B 2 176 ? 33.033  133.357 76.090  1.00 27.86  ? 350 TYR B CA  1 
ATOM   3813 C C   . TYR B 2 176 ? 31.868  132.572 75.481  1.00 26.27  ? 350 TYR B C   1 
ATOM   3814 O O   . TYR B 2 176 ? 30.833  133.146 75.102  1.00 25.37  ? 350 TYR B O   1 
ATOM   3815 C CB  . TYR B 2 176 ? 32.814  133.513 77.588  1.00 27.92  ? 350 TYR B CB  1 
ATOM   3816 C CG  . TYR B 2 176 ? 33.871  134.315 78.298  1.00 29.03  ? 350 TYR B CG  1 
ATOM   3817 C CD1 . TYR B 2 176 ? 35.107  133.755 78.601  1.00 30.02  ? 350 TYR B CD1 1 
ATOM   3818 C CD2 . TYR B 2 176 ? 33.622  135.634 78.696  1.00 29.98  ? 350 TYR B CD2 1 
ATOM   3819 C CE1 . TYR B 2 176 ? 36.076  134.484 79.275  1.00 31.42  ? 350 TYR B CE1 1 
ATOM   3820 C CE2 . TYR B 2 176 ? 34.585  136.376 79.367  1.00 30.64  ? 350 TYR B CE2 1 
ATOM   3821 C CZ  . TYR B 2 176 ? 35.804  135.795 79.657  1.00 31.49  ? 350 TYR B CZ  1 
ATOM   3822 O OH  . TYR B 2 176 ? 36.759  136.515 80.327  1.00 32.85  ? 350 TYR B OH  1 
ATOM   3823 N N   . LEU B 2 177 ? 32.056  131.252 75.402  1.00 24.71  ? 351 LEU B N   1 
ATOM   3824 C CA  . LEU B 2 177 ? 31.030  130.326 74.909  1.00 23.08  ? 351 LEU B CA  1 
ATOM   3825 C C   . LEU B 2 177 ? 29.939  130.164 75.968  1.00 22.00  ? 351 LEU B C   1 
ATOM   3826 O O   . LEU B 2 177 ? 30.205  130.364 77.152  1.00 20.70  ? 351 LEU B O   1 
ATOM   3827 C CB  . LEU B 2 177 ? 31.654  128.959 74.583  1.00 22.86  ? 351 LEU B CB  1 
ATOM   3828 C CG  . LEU B 2 177 ? 32.553  128.862 73.338  1.00 24.36  ? 351 LEU B CG  1 
ATOM   3829 C CD1 . LEU B 2 177 ? 33.466  127.620 73.376  1.00 23.52  ? 351 LEU B CD1 1 
ATOM   3830 C CD2 . LEU B 2 177 ? 31.733  128.896 72.048  1.00 24.17  ? 351 LEU B CD2 1 
ATOM   3831 N N   . PRO B 2 178 ? 28.722  129.808 75.543  1.00 21.42  ? 352 PRO B N   1 
ATOM   3832 C CA  . PRO B 2 178 ? 27.607  129.564 76.469  1.00 20.83  ? 352 PRO B CA  1 
ATOM   3833 C C   . PRO B 2 178 ? 27.928  128.576 77.587  1.00 20.68  ? 352 PRO B C   1 
ATOM   3834 O O   . PRO B 2 178 ? 27.447  128.781 78.707  1.00 20.48  ? 352 PRO B O   1 
ATOM   3835 C CB  . PRO B 2 178 ? 26.510  129.001 75.547  1.00 20.92  ? 352 PRO B CB  1 
ATOM   3836 C CG  . PRO B 2 178 ? 26.774  129.660 74.225  1.00 21.05  ? 352 PRO B CG  1 
ATOM   3837 C CD  . PRO B 2 178 ? 28.298  129.646 74.135  1.00 21.22  ? 352 PRO B CD  1 
ATOM   3838 N N   . SER B 2 179 ? 28.736  127.553 77.298  1.00 20.31  ? 353 SER B N   1 
ATOM   3839 C CA  . SER B 2 179 ? 29.080  126.512 78.269  1.00 20.36  ? 353 SER B CA  1 
ATOM   3840 C C   . SER B 2 179 ? 29.996  127.029 79.358  1.00 19.70  ? 353 SER B C   1 
ATOM   3841 O O   . SER B 2 179 ? 29.921  126.572 80.487  1.00 19.78  ? 353 SER B O   1 
ATOM   3842 C CB  . SER B 2 179 ? 29.735  125.311 77.574  1.00 20.43  ? 353 SER B CB  1 
ATOM   3843 O OG  . SER B 2 179 ? 31.018  125.657 77.056  1.00 20.89  ? 353 SER B OG  1 
ATOM   3844 N N   . VAL B 2 180 ? 30.858  127.977 78.997  1.00 20.17  ? 354 VAL B N   1 
ATOM   3845 C CA  . VAL B 2 180 ? 31.783  128.626 79.931  1.00 20.07  ? 354 VAL B CA  1 
ATOM   3846 C C   . VAL B 2 180 ? 31.065  129.688 80.772  1.00 20.43  ? 354 VAL B C   1 
ATOM   3847 O O   . VAL B 2 180 ? 31.299  129.792 81.982  1.00 21.08  ? 354 VAL B O   1 
ATOM   3848 C CB  . VAL B 2 180 ? 33.006  129.259 79.223  1.00 20.41  ? 354 VAL B CB  1 
ATOM   3849 C CG1 . VAL B 2 180 ? 33.947  129.954 80.267  1.00 20.74  ? 354 VAL B CG1 1 
ATOM   3850 C CG2 . VAL B 2 180 ? 33.801  128.205 78.412  1.00 19.38  ? 354 VAL B CG2 1 
ATOM   3851 N N   . ILE B 2 181 ? 30.167  130.457 80.172  1.00 20.02  ? 355 ILE B N   1 
ATOM   3852 C CA  . ILE B 2 181 ? 29.402  131.426 80.976  1.00 20.39  ? 355 ILE B CA  1 
ATOM   3853 C C   . ILE B 2 181 ? 28.511  130.736 82.005  1.00 20.47  ? 355 ILE B C   1 
ATOM   3854 O O   . ILE B 2 181 ? 28.389  131.184 83.157  1.00 21.58  ? 355 ILE B O   1 
ATOM   3855 C CB  . ILE B 2 181 ? 28.576  132.356 80.079  1.00 20.40  ? 355 ILE B CB  1 
ATOM   3856 C CG1 . ILE B 2 181 ? 29.519  133.228 79.246  1.00 20.54  ? 355 ILE B CG1 1 
ATOM   3857 C CG2 . ILE B 2 181 ? 27.633  133.225 80.933  1.00 21.17  ? 355 ILE B CG2 1 
ATOM   3858 C CD1 . ILE B 2 181 ? 28.819  133.981 78.105  1.00 21.97  ? 355 ILE B CD1 1 
ATOM   3859 N N   . ALA B 2 182 ? 27.902  129.635 81.583  1.00 20.41  ? 356 ALA B N   1 
ATOM   3860 C CA  . ALA B 2 182 ? 27.056  128.824 82.436  1.00 20.16  ? 356 ALA B CA  1 
ATOM   3861 C C   . ALA B 2 182 ? 27.865  128.256 83.582  1.00 20.09  ? 356 ALA B C   1 
ATOM   3862 O O   . ALA B 2 182 ? 27.427  128.261 84.723  1.00 20.14  ? 356 ALA B O   1 
ATOM   3863 C CB  . ALA B 2 182 ? 26.406  127.717 81.633  1.00 19.42  ? 356 ALA B CB  1 
ATOM   3864 N N   . GLY B 2 183 ? 29.055  127.763 83.273  1.00 20.86  ? 357 GLY B N   1 
ATOM   3865 C CA  . GLY B 2 183 ? 29.939  127.248 84.298  1.00 20.18  ? 357 GLY B CA  1 
ATOM   3866 C C   . GLY B 2 183 ? 30.204  128.312 85.336  1.00 20.51  ? 357 GLY B C   1 
ATOM   3867 O O   . GLY B 2 183 ? 30.049  128.059 86.529  1.00 20.38  ? 357 GLY B O   1 
ATOM   3868 N N   . ALA B 2 184 ? 30.589  129.504 84.880  1.00 20.81  ? 358 ALA B N   1 
ATOM   3869 C CA  . ALA B 2 184 ? 30.917  130.608 85.786  1.00 21.61  ? 358 ALA B CA  1 
ATOM   3870 C C   . ALA B 2 184 ? 29.705  131.039 86.606  1.00 21.75  ? 358 ALA B C   1 
ATOM   3871 O O   . ALA B 2 184 ? 29.815  131.315 87.798  1.00 21.85  ? 358 ALA B O   1 
ATOM   3872 C CB  . ALA B 2 184 ? 31.495  131.794 85.016  1.00 20.91  ? 358 ALA B CB  1 
ATOM   3873 N N   . ALA B 2 185 ? 28.553  131.077 85.952  1.00 22.06  ? 359 ALA B N   1 
ATOM   3874 C CA  . ALA B 2 185 ? 27.320  131.498 86.592  1.00 22.21  ? 359 ALA B CA  1 
ATOM   3875 C C   . ALA B 2 185 ? 26.857  130.471 87.618  1.00 22.78  ? 359 ALA B C   1 
ATOM   3876 O O   . ALA B 2 185 ? 26.341  130.839 88.668  1.00 22.23  ? 359 ALA B O   1 
ATOM   3877 C CB  . ALA B 2 185 ? 26.238  131.746 85.545  1.00 21.69  ? 359 ALA B CB  1 
ATOM   3878 N N   . PHE B 2 186 ? 27.032  129.189 87.313  1.00 23.41  ? 360 PHE B N   1 
ATOM   3879 C CA  . PHE B 2 186 ? 26.653  128.154 88.263  1.00 24.57  ? 360 PHE B CA  1 
ATOM   3880 C C   . PHE B 2 186 ? 27.533  128.222 89.514  1.00 24.77  ? 360 PHE B C   1 
ATOM   3881 O O   . PHE B 2 186 ? 27.021  128.202 90.632  1.00 24.72  ? 360 PHE B O   1 
ATOM   3882 C CB  . PHE B 2 186 ? 26.721  126.762 87.640  1.00 24.58  ? 360 PHE B CB  1 
ATOM   3883 C CG  . PHE B 2 186 ? 26.152  125.684 88.513  1.00 25.69  ? 360 PHE B CG  1 
ATOM   3884 C CD1 . PHE B 2 186 ? 24.996  125.911 89.269  1.00 27.56  ? 360 PHE B CD1 1 
ATOM   3885 C CD2 . PHE B 2 186 ? 26.756  124.448 88.585  1.00 26.52  ? 360 PHE B CD2 1 
ATOM   3886 C CE1 . PHE B 2 186 ? 24.455  124.921 90.073  1.00 26.02  ? 360 PHE B CE1 1 
ATOM   3887 C CE2 . PHE B 2 186 ? 26.219  123.434 89.394  1.00 28.08  ? 360 PHE B CE2 1 
ATOM   3888 C CZ  . PHE B 2 186 ? 25.075  123.673 90.139  1.00 27.75  ? 360 PHE B CZ  1 
ATOM   3889 N N   . HIS B 2 187 ? 28.843  128.311 89.321  1.00 25.10  ? 361 HIS B N   1 
ATOM   3890 C CA  . HIS B 2 187 ? 29.762  128.392 90.449  1.00 25.98  ? 361 HIS B CA  1 
ATOM   3891 C C   . HIS B 2 187 ? 29.502  129.637 91.289  1.00 26.59  ? 361 HIS B C   1 
ATOM   3892 O O   . HIS B 2 187 ? 29.482  129.561 92.505  1.00 26.41  ? 361 HIS B O   1 
ATOM   3893 C CB  . HIS B 2 187 ? 31.224  128.418 90.021  1.00 25.74  ? 361 HIS B CB  1 
ATOM   3894 C CG  . HIS B 2 187 ? 32.143  128.750 91.153  1.00 25.99  ? 361 HIS B CG  1 
ATOM   3895 N ND1 . HIS B 2 187 ? 32.515  127.820 92.096  1.00 26.21  ? 361 HIS B ND1 1 
ATOM   3896 C CD2 . HIS B 2 187 ? 32.699  129.922 91.539  1.00 26.77  ? 361 HIS B CD2 1 
ATOM   3897 C CE1 . HIS B 2 187 ? 33.303  128.395 92.989  1.00 28.23  ? 361 HIS B CE1 1 
ATOM   3898 N NE2 . HIS B 2 187 ? 33.430  129.671 92.673  1.00 26.81  ? 361 HIS B NE2 1 
ATOM   3899 N N   . LEU B 2 188 ? 29.315  130.776 90.629  1.00 27.09  ? 362 LEU B N   1 
ATOM   3900 C CA  . LEU B 2 188 ? 29.080  132.016 91.347  1.00 28.13  ? 362 LEU B CA  1 
ATOM   3901 C C   . LEU B 2 188 ? 27.782  131.953 92.148  1.00 28.61  ? 362 LEU B C   1 
ATOM   3902 O O   . LEU B 2 188 ? 27.741  132.423 93.282  1.00 29.01  ? 362 LEU B O   1 
ATOM   3903 C CB  . LEU B 2 188 ? 29.090  133.210 90.395  1.00 27.48  ? 362 LEU B CB  1 
ATOM   3904 C CG  . LEU B 2 188 ? 29.187  134.603 91.020  1.00 28.33  ? 362 LEU B CG  1 
ATOM   3905 C CD1 . LEU B 2 188 ? 30.230  134.676 92.143  1.00 26.52  ? 362 LEU B CD1 1 
ATOM   3906 C CD2 . LEU B 2 188 ? 29.473  135.641 89.943  1.00 26.41  ? 362 LEU B CD2 1 
ATOM   3907 N N   . ALA B 2 189 ? 26.745  131.350 91.565  1.00 28.95  ? 363 ALA B N   1 
ATOM   3908 C CA  . ALA B 2 189 ? 25.450  131.169 92.236  1.00 29.65  ? 363 ALA B CA  1 
ATOM   3909 C C   . ALA B 2 189 ? 25.557  130.198 93.406  1.00 30.45  ? 363 ALA B C   1 
ATOM   3910 O O   . ALA B 2 189 ? 25.008  130.443 94.474  1.00 30.62  ? 363 ALA B O   1 
ATOM   3911 C CB  . ALA B 2 189 ? 24.412  130.679 91.260  1.00 28.60  ? 363 ALA B CB  1 
ATOM   3912 N N   . LEU B 2 190 ? 26.256  129.091 93.183  1.00 31.34  ? 364 LEU B N   1 
ATOM   3913 C CA  . LEU B 2 190 ? 26.507  128.095 94.214  1.00 32.66  ? 364 LEU B CA  1 
ATOM   3914 C C   . LEU B 2 190 ? 27.200  128.748 95.394  1.00 33.22  ? 364 LEU B C   1 
ATOM   3915 O O   . LEU B 2 190 ? 26.732  128.648 96.528  1.00 33.42  ? 364 LEU B O   1 
ATOM   3916 C CB  . LEU B 2 190 ? 27.424  127.017 93.652  1.00 32.61  ? 364 LEU B CB  1 
ATOM   3917 C CG  . LEU B 2 190 ? 27.277  125.527 93.922  1.00 33.95  ? 364 LEU B CG  1 
ATOM   3918 C CD1 . LEU B 2 190 ? 25.920  125.131 94.498  1.00 35.67  ? 364 LEU B CD1 1 
ATOM   3919 C CD2 . LEU B 2 190 ? 27.532  124.832 92.600  1.00 35.63  ? 364 LEU B CD2 1 
ATOM   3920 N N   . TYR B 2 191 ? 28.322  129.410 95.108  1.00 33.75  ? 365 TYR B N   1 
ATOM   3921 C CA  . TYR B 2 191 ? 29.150  130.034 96.123  1.00 34.22  ? 365 TYR B CA  1 
ATOM   3922 C C   . TYR B 2 191 ? 28.383  131.062 96.947  1.00 34.10  ? 365 TYR B C   1 
ATOM   3923 O O   . TYR B 2 191 ? 28.359  130.972 98.174  1.00 34.44  ? 365 TYR B O   1 
ATOM   3924 C CB  . TYR B 2 191 ? 30.398  130.656 95.491  1.00 34.57  ? 365 TYR B CB  1 
ATOM   3925 C CG  . TYR B 2 191 ? 31.385  131.164 96.509  1.00 36.33  ? 365 TYR B CG  1 
ATOM   3926 C CD1 . TYR B 2 191 ? 32.091  130.284 97.330  1.00 38.91  ? 365 TYR B CD1 1 
ATOM   3927 C CD2 . TYR B 2 191 ? 31.605  132.523 96.661  1.00 38.88  ? 365 TYR B CD2 1 
ATOM   3928 C CE1 . TYR B 2 191 ? 32.995  130.755 98.288  1.00 41.49  ? 365 TYR B CE1 1 
ATOM   3929 C CE2 . TYR B 2 191 ? 32.502  133.007 97.605  1.00 41.25  ? 365 TYR B CE2 1 
ATOM   3930 C CZ  . TYR B 2 191 ? 33.189  132.120 98.421  1.00 42.44  ? 365 TYR B CZ  1 
ATOM   3931 O OH  . TYR B 2 191 ? 34.078  132.615 99.356  1.00 44.65  ? 365 TYR B OH  1 
ATOM   3932 N N   . THR B 2 192 ? 27.755  132.020 96.268  1.00 33.83  ? 366 THR B N   1 
ATOM   3933 C CA  . THR B 2 192 ? 26.952  133.057 96.916  1.00 34.04  ? 366 THR B CA  1 
ATOM   3934 C C   . THR B 2 192 ? 25.956  132.483 97.918  1.00 34.31  ? 366 THR B C   1 
ATOM   3935 O O   . THR B 2 192 ? 25.887  132.933 99.049  1.00 34.71  ? 366 THR B O   1 
ATOM   3936 C CB  . THR B 2 192 ? 26.176  133.869 95.861  1.00 33.77  ? 366 THR B CB  1 
ATOM   3937 O OG1 . THR B 2 192 ? 27.088  134.412 94.899  1.00 33.97  ? 366 THR B OG1 1 
ATOM   3938 C CG2 . THR B 2 192 ? 25.527  135.096 96.491  1.00 33.57  ? 366 THR B CG2 1 
ATOM   3939 N N   . VAL B 2 193 ? 25.193  131.484 97.491  1.00 34.50  ? 367 VAL B N   1 
ATOM   3940 C CA  . VAL B 2 193 ? 24.081  130.975 98.281  1.00 34.83  ? 367 VAL B CA  1 
ATOM   3941 C C   . VAL B 2 193 ? 24.522  129.990 99.380  1.00 35.29  ? 367 VAL B C   1 
ATOM   3942 O O   . VAL B 2 193 ? 24.075  130.099 100.521 1.00 35.10  ? 367 VAL B O   1 
ATOM   3943 C CB  . VAL B 2 193 ? 22.977  130.354 97.360  1.00 34.68  ? 367 VAL B CB  1 
ATOM   3944 C CG1 . VAL B 2 193 ? 21.935  129.592 98.167  1.00 34.71  ? 367 VAL B CG1 1 
ATOM   3945 C CG2 . VAL B 2 193 ? 22.301  131.448 96.530  1.00 33.85  ? 367 VAL B CG2 1 
ATOM   3946 N N   . THR B 2 194 ? 25.396  129.044 99.031  1.00 35.65  ? 368 THR B N   1 
ATOM   3947 C CA  . THR B 2 194 ? 25.712  127.903 99.899  1.00 35.96  ? 368 THR B CA  1 
ATOM   3948 C C   . THR B 2 194 ? 27.169  127.866 100.346 1.00 36.00  ? 368 THR B C   1 
ATOM   3949 O O   . THR B 2 194 ? 27.563  126.988 101.110 1.00 35.60  ? 368 THR B O   1 
ATOM   3950 C CB  . THR B 2 194 ? 25.428  126.563 99.168  1.00 36.28  ? 368 THR B CB  1 
ATOM   3951 O OG1 . THR B 2 194 ? 26.329  126.431 98.051  1.00 36.31  ? 368 THR B OG1 1 
ATOM   3952 C CG2 . THR B 2 194 ? 24.023  126.523 98.546  1.00 35.81  ? 368 THR B CG2 1 
ATOM   3953 N N   . GLY B 2 195 ? 27.987  128.770 99.822  1.00 36.41  ? 369 GLY B N   1 
ATOM   3954 C CA  . GLY B 2 195 ? 29.421  128.678 100.036 1.00 36.76  ? 369 GLY B CA  1 
ATOM   3955 C C   . GLY B 2 195 ? 30.114  127.541 99.294  1.00 36.84  ? 369 GLY B C   1 
ATOM   3956 O O   . GLY B 2 195 ? 31.334  127.440 99.363  1.00 37.55  ? 369 GLY B O   1 
ATOM   3957 N N   . GLN B 2 196 ? 29.362  126.695 98.587  1.00 36.87  ? 370 GLN B N   1 
ATOM   3958 C CA  . GLN B 2 196 ? 29.945  125.602 97.785  1.00 37.09  ? 370 GLN B CA  1 
ATOM   3959 C C   . GLN B 2 196 ? 30.671  126.063 96.490  1.00 36.47  ? 370 GLN B C   1 
ATOM   3960 O O   . GLN B 2 196 ? 30.575  127.220 96.078  1.00 35.94  ? 370 GLN B O   1 
ATOM   3961 C CB  . GLN B 2 196 ? 28.873  124.566 97.406  1.00 37.39  ? 370 GLN B CB  1 
ATOM   3962 C CG  . GLN B 2 196 ? 28.232  123.796 98.549  1.00 39.86  ? 370 GLN B CG  1 
ATOM   3963 C CD  . GLN B 2 196 ? 26.955  123.054 98.115  1.00 42.96  ? 370 GLN B CD  1 
ATOM   3964 O OE1 . GLN B 2 196 ? 26.809  121.862 98.380  1.00 44.58  ? 370 GLN B OE1 1 
ATOM   3965 N NE2 . GLN B 2 196 ? 26.030  123.765 97.460  1.00 44.37  ? 370 GLN B NE2 1 
ATOM   3966 N N   . SER B 2 197 ? 31.356  125.116 95.847  1.00 36.18  ? 371 SER B N   1 
ATOM   3967 C CA  . SER B 2 197 ? 32.203  125.357 94.680  1.00 35.90  ? 371 SER B CA  1 
ATOM   3968 C C   . SER B 2 197 ? 31.847  124.431 93.513  1.00 34.97  ? 371 SER B C   1 
ATOM   3969 O O   . SER B 2 197 ? 31.401  123.308 93.736  1.00 34.45  ? 371 SER B O   1 
ATOM   3970 C CB  . SER B 2 197 ? 33.652  125.071 95.068  1.00 36.17  ? 371 SER B CB  1 
ATOM   3971 O OG  . SER B 2 197 ? 34.446  126.239 95.029  1.00 38.85  ? 371 SER B OG  1 
ATOM   3972 N N   . TRP B 2 198 ? 32.067  124.903 92.278  1.00 34.17  ? 372 TRP B N   1 
ATOM   3973 C CA  . TRP B 2 198 ? 32.031  124.068 91.065  1.00 32.91  ? 372 TRP B CA  1 
ATOM   3974 C C   . TRP B 2 198 ? 32.308  122.616 91.436  1.00 33.28  ? 372 TRP B C   1 
ATOM   3975 O O   . TRP B 2 198 ? 33.426  122.283 91.850  1.00 33.57  ? 372 TRP B O   1 
ATOM   3976 C CB  . TRP B 2 198 ? 33.077  124.568 90.046  1.00 32.19  ? 372 TRP B CB  1 
ATOM   3977 C CG  . TRP B 2 198 ? 33.031  123.929 88.662  1.00 30.06  ? 372 TRP B CG  1 
ATOM   3978 C CD1 . TRP B 2 198 ? 34.002  123.158 88.080  1.00 29.29  ? 372 TRP B CD1 1 
ATOM   3979 C CD2 . TRP B 2 198 ? 31.984  124.042 87.683  1.00 27.92  ? 372 TRP B CD2 1 
ATOM   3980 N NE1 . TRP B 2 198 ? 33.617  122.776 86.814  1.00 27.46  ? 372 TRP B NE1 1 
ATOM   3981 C CE2 . TRP B 2 198 ? 32.379  123.297 86.550  1.00 27.72  ? 372 TRP B CE2 1 
ATOM   3982 C CE3 . TRP B 2 198 ? 30.742  124.685 87.653  1.00 27.39  ? 372 TRP B CE3 1 
ATOM   3983 C CZ2 . TRP B 2 198 ? 31.583  123.194 85.398  1.00 27.94  ? 372 TRP B CZ2 1 
ATOM   3984 C CZ3 . TRP B 2 198 ? 29.953  124.574 86.510  1.00 26.62  ? 372 TRP B CZ3 1 
ATOM   3985 C CH2 . TRP B 2 198 ? 30.379  123.843 85.402  1.00 25.78  ? 372 TRP B CH2 1 
ATOM   3986 N N   . PRO B 2 199 ? 31.296  121.757 91.321  1.00 33.28  ? 373 PRO B N   1 
ATOM   3987 C CA  . PRO B 2 199 ? 31.421  120.363 91.780  1.00 33.15  ? 373 PRO B CA  1 
ATOM   3988 C C   . PRO B 2 199 ? 32.269  119.468 90.887  1.00 33.41  ? 373 PRO B C   1 
ATOM   3989 O O   . PRO B 2 199 ? 32.163  119.481 89.656  1.00 33.26  ? 373 PRO B O   1 
ATOM   3990 C CB  . PRO B 2 199 ? 29.973  119.850 91.815  1.00 32.97  ? 373 PRO B CB  1 
ATOM   3991 C CG  . PRO B 2 199 ? 29.214  120.737 90.883  1.00 33.55  ? 373 PRO B CG  1 
ATOM   3992 C CD  . PRO B 2 199 ? 29.960  122.056 90.771  1.00 32.98  ? 373 PRO B CD  1 
ATOM   3993 N N   . GLU B 2 200 ? 33.080  118.649 91.548  1.00 33.53  ? 374 GLU B N   1 
ATOM   3994 C CA  . GLU B 2 200 ? 33.963  117.691 90.901  1.00 33.51  ? 374 GLU B CA  1 
ATOM   3995 C C   . GLU B 2 200 ? 33.280  116.904 89.779  1.00 32.26  ? 374 GLU B C   1 
ATOM   3996 O O   . GLU B 2 200 ? 33.901  116.632 88.746  1.00 32.55  ? 374 GLU B O   1 
ATOM   3997 C CB  . GLU B 2 200 ? 34.604  116.777 91.965  1.00 34.21  ? 374 GLU B CB  1 
ATOM   3998 C CG  . GLU B 2 200 ? 34.570  115.279 91.686  1.00 38.07  ? 374 GLU B CG  1 
ATOM   3999 C CD  . GLU B 2 200 ? 35.609  114.834 90.665  1.00 44.06  ? 374 GLU B CD  1 
ATOM   4000 O OE1 . GLU B 2 200 ? 36.467  115.666 90.260  1.00 46.85  ? 374 GLU B OE1 1 
ATOM   4001 O OE2 . GLU B 2 200 ? 35.562  113.648 90.258  1.00 45.39  ? 374 GLU B OE2 1 
ATOM   4002 N N   . SER B 2 201 ? 32.011  116.547 89.971  1.00 30.86  ? 375 SER B N   1 
ATOM   4003 C CA  . SER B 2 201 ? 31.267  115.817 88.944  1.00 29.39  ? 375 SER B CA  1 
ATOM   4004 C C   . SER B 2 201 ? 31.048  116.644 87.647  1.00 28.42  ? 375 SER B C   1 
ATOM   4005 O O   . SER B 2 201 ? 30.911  116.082 86.559  1.00 27.13  ? 375 SER B O   1 
ATOM   4006 C CB  . SER B 2 201 ? 29.952  115.262 89.508  1.00 29.62  ? 375 SER B CB  1 
ATOM   4007 O OG  . SER B 2 201 ? 28.947  116.266 89.602  1.00 30.55  ? 375 SER B OG  1 
ATOM   4008 N N   . LEU B 2 202 ? 31.057  117.970 87.757  1.00 27.75  ? 376 LEU B N   1 
ATOM   4009 C CA  . LEU B 2 202 ? 30.967  118.812 86.557  1.00 27.85  ? 376 LEU B CA  1 
ATOM   4010 C C   . LEU B 2 202 ? 32.308  118.967 85.838  1.00 27.70  ? 376 LEU B C   1 
ATOM   4011 O O   . LEU B 2 202 ? 32.361  119.222 84.633  1.00 27.70  ? 376 LEU B O   1 
ATOM   4012 C CB  . LEU B 2 202 ? 30.303  120.156 86.848  1.00 27.52  ? 376 LEU B CB  1 
ATOM   4013 C CG  . LEU B 2 202 ? 28.775  120.065 86.934  1.00 28.51  ? 376 LEU B CG  1 
ATOM   4014 C CD1 . LEU B 2 202 ? 28.215  121.327 87.519  1.00 27.99  ? 376 LEU B CD1 1 
ATOM   4015 C CD2 . LEU B 2 202 ? 28.149  119.818 85.565  1.00 29.01  ? 376 LEU B CD2 1 
ATOM   4016 N N   . ILE B 2 203 ? 33.389  118.792 86.578  1.00 28.12  ? 377 ILE B N   1 
ATOM   4017 C CA  . ILE B 2 203 ? 34.708  118.704 85.977  1.00 28.58  ? 377 ILE B CA  1 
ATOM   4018 C C   . ILE B 2 203 ? 34.757  117.479 85.079  1.00 28.54  ? 377 ILE B C   1 
ATOM   4019 O O   . ILE B 2 203 ? 35.236  117.552 83.950  1.00 28.73  ? 377 ILE B O   1 
ATOM   4020 C CB  . ILE B 2 203 ? 35.826  118.685 87.071  1.00 28.98  ? 377 ILE B CB  1 
ATOM   4021 C CG1 . ILE B 2 203 ? 35.809  120.008 87.841  1.00 28.85  ? 377 ILE B CG1 1 
ATOM   4022 C CG2 . ILE B 2 203 ? 37.198  118.442 86.441  1.00 28.15  ? 377 ILE B CG2 1 
ATOM   4023 C CD1 . ILE B 2 203 ? 36.417  119.931 89.212  1.00 31.52  ? 377 ILE B CD1 1 
ATOM   4024 N N   . ARG B 2 204 ? 34.226  116.360 85.557  1.00 28.80  ? 378 ARG B N   1 
ATOM   4025 C CA  . ARG B 2 204 ? 34.237  115.142 84.751  1.00 28.71  ? 378 ARG B CA  1 
ATOM   4026 C C   . ARG B 2 204 ? 33.291  115.241 83.571  1.00 27.82  ? 378 ARG B C   1 
ATOM   4027 O O   . ARG B 2 204 ? 33.555  114.656 82.522  1.00 27.80  ? 378 ARG B O   1 
ATOM   4028 C CB  . ARG B 2 204 ? 33.928  113.902 85.589  1.00 29.57  ? 378 ARG B CB  1 
ATOM   4029 C CG  . ARG B 2 204 ? 34.975  113.632 86.682  1.00 33.48  ? 378 ARG B CG  1 
ATOM   4030 C CD  . ARG B 2 204 ? 34.774  112.329 87.461  1.00 38.88  ? 378 ARG B CD  1 
ATOM   4031 N NE  . ARG B 2 204 ? 33.606  112.344 88.349  1.00 42.45  ? 378 ARG B NE  1 
ATOM   4032 C CZ  . ARG B 2 204 ? 32.428  111.795 88.053  1.00 44.81  ? 378 ARG B CZ  1 
ATOM   4033 N NH1 . ARG B 2 204 ? 31.428  111.847 88.923  1.00 45.36  ? 378 ARG B NH1 1 
ATOM   4034 N NH2 . ARG B 2 204 ? 32.240  111.206 86.879  1.00 46.40  ? 378 ARG B NH2 1 
ATOM   4035 N N   . LYS B 2 205 ? 32.196  115.978 83.736  1.00 26.77  ? 379 LYS B N   1 
ATOM   4036 C CA  . LYS B 2 205 ? 31.233  116.159 82.655  1.00 25.74  ? 379 LYS B CA  1 
ATOM   4037 C C   . LYS B 2 205 ? 31.799  117.100 81.579  1.00 24.92  ? 379 LYS B C   1 
ATOM   4038 O O   . LYS B 2 205 ? 31.827  116.769 80.397  1.00 24.73  ? 379 LYS B O   1 
ATOM   4039 C CB  . LYS B 2 205 ? 29.919  116.708 83.223  1.00 26.44  ? 379 LYS B CB  1 
ATOM   4040 C CG  . LYS B 2 205 ? 28.741  116.710 82.257  1.00 26.51  ? 379 LYS B CG  1 
ATOM   4041 C CD  . LYS B 2 205 ? 27.587  117.542 82.826  1.00 28.94  ? 379 LYS B CD  1 
ATOM   4042 C CE  . LYS B 2 205 ? 26.514  117.827 81.770  1.00 28.85  ? 379 LYS B CE  1 
ATOM   4043 N NZ  . LYS B 2 205 ? 25.961  116.533 81.247  1.00 29.47  ? 379 LYS B NZ  1 
ATOM   4044 N N   . THR B 2 206 ? 32.272  118.261 82.000  1.00 24.12  ? 380 THR B N   1 
ATOM   4045 C CA  . THR B 2 206 ? 32.586  119.336 81.065  1.00 23.83  ? 380 THR B CA  1 
ATOM   4046 C C   . THR B 2 206 ? 34.066  119.439 80.738  1.00 23.50  ? 380 THR B C   1 
ATOM   4047 O O   . THR B 2 206 ? 34.425  119.949 79.686  1.00 22.74  ? 380 THR B O   1 
ATOM   4048 C CB  . THR B 2 206 ? 32.106  120.696 81.609  1.00 23.52  ? 380 THR B CB  1 
ATOM   4049 O OG1 . THR B 2 206 ? 32.928  121.070 82.725  1.00 23.61  ? 380 THR B OG1 1 
ATOM   4050 C CG2 . THR B 2 206 ? 30.706  120.589 82.210  1.00 23.33  ? 380 THR B CG2 1 
ATOM   4051 N N   . GLY B 2 207 ? 34.916  119.014 81.665  1.00 23.74  ? 381 GLY B N   1 
ATOM   4052 C CA  . GLY B 2 207 ? 36.353  119.167 81.502  1.00 24.64  ? 381 GLY B CA  1 
ATOM   4053 C C   . GLY B 2 207 ? 36.842  120.527 81.958  1.00 25.30  ? 381 GLY B C   1 
ATOM   4054 O O   . GLY B 2 207 ? 38.032  120.817 81.878  1.00 25.46  ? 381 GLY B O   1 
ATOM   4055 N N   . TYR B 2 208 ? 35.917  121.362 82.424  1.00 25.76  ? 382 TYR B N   1 
ATOM   4056 C CA  . TYR B 2 208 ? 36.239  122.678 82.956  1.00 26.63  ? 382 TYR B CA  1 
ATOM   4057 C C   . TYR B 2 208 ? 36.533  122.589 84.454  1.00 27.75  ? 382 TYR B C   1 
ATOM   4058 O O   . TYR B 2 208 ? 35.854  121.887 85.191  1.00 28.17  ? 382 TYR B O   1 
ATOM   4059 C CB  . TYR B 2 208 ? 35.070  123.661 82.763  1.00 25.99  ? 382 TYR B CB  1 
ATOM   4060 C CG  . TYR B 2 208 ? 34.627  123.941 81.343  1.00 25.10  ? 382 TYR B CG  1 
ATOM   4061 C CD1 . TYR B 2 208 ? 35.540  123.967 80.276  1.00 24.65  ? 382 TYR B CD1 1 
ATOM   4062 C CD2 . TYR B 2 208 ? 33.293  124.217 81.070  1.00 23.14  ? 382 TYR B CD2 1 
ATOM   4063 C CE1 . TYR B 2 208 ? 35.118  124.236 78.977  1.00 24.96  ? 382 TYR B CE1 1 
ATOM   4064 C CE2 . TYR B 2 208 ? 32.861  124.486 79.779  1.00 23.62  ? 382 TYR B CE2 1 
ATOM   4065 C CZ  . TYR B 2 208 ? 33.773  124.493 78.737  1.00 24.99  ? 382 TYR B CZ  1 
ATOM   4066 O OH  . TYR B 2 208 ? 33.329  124.776 77.464  1.00 25.59  ? 382 TYR B OH  1 
ATOM   4067 N N   . THR B 2 209 ? 37.536  123.337 84.892  1.00 29.72  ? 383 THR B N   1 
ATOM   4068 C CA  . THR B 2 209 ? 37.896  123.463 86.298  1.00 31.21  ? 383 THR B CA  1 
ATOM   4069 C C   . THR B 2 209 ? 37.711  124.926 86.642  1.00 32.55  ? 383 THR B C   1 
ATOM   4070 O O   . THR B 2 209 ? 37.657  125.781 85.745  1.00 32.39  ? 383 THR B O   1 
ATOM   4071 C CB  . THR B 2 209 ? 39.388  123.127 86.489  1.00 31.15  ? 383 THR B CB  1 
ATOM   4072 O OG1 . THR B 2 209 ? 40.157  123.948 85.605  1.00 32.76  ? 383 THR B OG1 1 
ATOM   4073 C CG2 . THR B 2 209 ? 39.725  121.719 86.007  1.00 30.41  ? 383 THR B CG2 1 
ATOM   4074 N N   . LEU B 2 210 ? 37.651  125.213 87.939  1.00 34.25  ? 384 LEU B N   1 
ATOM   4075 C CA  . LEU B 2 210 ? 37.698  126.583 88.435  1.00 35.91  ? 384 LEU B CA  1 
ATOM   4076 C C   . LEU B 2 210 ? 38.810  127.396 87.780  1.00 36.91  ? 384 LEU B C   1 
ATOM   4077 O O   . LEU B 2 210 ? 38.637  128.600 87.539  1.00 37.00  ? 384 LEU B O   1 
ATOM   4078 C CB  . LEU B 2 210 ? 37.891  126.585 89.948  1.00 36.28  ? 384 LEU B CB  1 
ATOM   4079 C CG  . LEU B 2 210 ? 36.831  127.205 90.863  1.00 37.75  ? 384 LEU B CG  1 
ATOM   4080 C CD1 . LEU B 2 210 ? 35.462  127.431 90.176  1.00 37.84  ? 384 LEU B CD1 1 
ATOM   4081 C CD2 . LEU B 2 210 ? 36.677  126.332 92.096  1.00 37.70  ? 384 LEU B CD2 1 
ATOM   4082 N N   . GLU B 2 211 ? 39.942  126.744 87.494  1.00 38.02  ? 385 GLU B N   1 
ATOM   4083 C CA  . GLU B 2 211 ? 41.065  127.401 86.816  1.00 39.38  ? 385 GLU B CA  1 
ATOM   4084 C C   . GLU B 2 211 ? 40.724  127.819 85.377  1.00 38.93  ? 385 GLU B C   1 
ATOM   4085 O O   . GLU B 2 211 ? 41.064  128.927 84.955  1.00 39.27  ? 385 GLU B O   1 
ATOM   4086 C CB  . GLU B 2 211 ? 42.327  126.533 86.850  1.00 40.13  ? 385 GLU B CB  1 
ATOM   4087 C CG  . GLU B 2 211 ? 43.585  127.232 86.339  1.00 44.86  ? 385 GLU B CG  1 
ATOM   4088 C CD  . GLU B 2 211 ? 44.546  127.627 87.454  1.00 50.38  ? 385 GLU B CD  1 
ATOM   4089 O OE1 . GLU B 2 211 ? 44.670  128.845 87.753  1.00 51.87  ? 385 GLU B OE1 1 
ATOM   4090 O OE2 . GLU B 2 211 ? 45.183  126.717 88.034  1.00 52.59  ? 385 GLU B OE2 1 
ATOM   4091 N N   . SER B 2 212 ? 40.045  126.944 84.633  1.00 38.26  ? 386 SER B N   1 
ATOM   4092 C CA  . SER B 2 212 ? 39.662  127.257 83.256  1.00 37.00  ? 386 SER B CA  1 
ATOM   4093 C C   . SER B 2 212 ? 38.513  128.275 83.159  1.00 36.27  ? 386 SER B C   1 
ATOM   4094 O O   . SER B 2 212 ? 38.409  129.011 82.166  1.00 36.24  ? 386 SER B O   1 
ATOM   4095 C CB  . SER B 2 212 ? 39.327  125.977 82.490  1.00 37.27  ? 386 SER B CB  1 
ATOM   4096 O OG  . SER B 2 212 ? 38.050  125.484 82.851  1.00 37.59  ? 386 SER B OG  1 
ATOM   4097 N N   . LEU B 2 213 ? 37.667  128.318 84.190  1.00 35.31  ? 387 LEU B N   1 
ATOM   4098 C CA  . LEU B 2 213 ? 36.534  129.258 84.273  1.00 34.38  ? 387 LEU B CA  1 
ATOM   4099 C C   . LEU B 2 213 ? 36.908  130.648 84.811  1.00 34.14  ? 387 LEU B C   1 
ATOM   4100 O O   . LEU B 2 213 ? 36.224  131.639 84.548  1.00 34.09  ? 387 LEU B O   1 
ATOM   4101 C CB  . LEU B 2 213 ? 35.433  128.676 85.165  1.00 34.03  ? 387 LEU B CB  1 
ATOM   4102 C CG  . LEU B 2 213 ? 34.743  127.365 84.792  1.00 33.14  ? 387 LEU B CG  1 
ATOM   4103 C CD1 . LEU B 2 213 ? 33.755  126.960 85.877  1.00 31.75  ? 387 LEU B CD1 1 
ATOM   4104 C CD2 . LEU B 2 213 ? 34.042  127.524 83.463  1.00 31.79  ? 387 LEU B CD2 1 
ATOM   4105 N N   . LYS B 2 214 ? 37.987  130.699 85.582  1.00 34.15  ? 388 LYS B N   1 
ATOM   4106 C CA  . LYS B 2 214 ? 38.483  131.918 86.233  1.00 34.08  ? 388 LYS B CA  1 
ATOM   4107 C C   . LYS B 2 214 ? 38.359  133.237 85.442  1.00 33.30  ? 388 LYS B C   1 
ATOM   4108 O O   . LYS B 2 214 ? 37.825  134.192 85.981  1.00 33.13  ? 388 LYS B O   1 
ATOM   4109 C CB  . LYS B 2 214 ? 39.921  131.698 86.727  1.00 34.62  ? 388 LYS B CB  1 
ATOM   4110 C CG  . LYS B 2 214 ? 40.627  132.935 87.224  1.00 36.25  ? 388 LYS B CG  1 
ATOM   4111 C CD  . LYS B 2 214 ? 41.395  132.661 88.508  1.00 39.76  ? 388 LYS B CD  1 
ATOM   4112 C CE  . LYS B 2 214 ? 42.420  133.758 88.776  1.00 41.58  ? 388 LYS B CE  1 
ATOM   4113 N NZ  . LYS B 2 214 ? 41.958  135.113 88.314  1.00 43.25  ? 388 LYS B NZ  1 
ATOM   4114 N N   . PRO B 2 215 ? 38.829  133.313 84.195  1.00 32.81  ? 389 PRO B N   1 
ATOM   4115 C CA  . PRO B 2 215 ? 38.689  134.558 83.425  1.00 32.86  ? 389 PRO B CA  1 
ATOM   4116 C C   . PRO B 2 215 ? 37.233  135.052 83.349  1.00 32.70  ? 389 PRO B C   1 
ATOM   4117 O O   . PRO B 2 215 ? 36.953  136.193 83.714  1.00 33.01  ? 389 PRO B O   1 
ATOM   4118 C CB  . PRO B 2 215 ? 39.225  134.176 82.034  1.00 32.80  ? 389 PRO B CB  1 
ATOM   4119 C CG  . PRO B 2 215 ? 40.147  133.046 82.286  1.00 32.29  ? 389 PRO B CG  1 
ATOM   4120 C CD  . PRO B 2 215 ? 39.538  132.277 83.418  1.00 32.76  ? 389 PRO B CD  1 
ATOM   4121 N N   . CYS B 2 216 ? 36.322  134.189 82.908  1.00 32.64  ? 390 CYS B N   1 
ATOM   4122 C CA  . CYS B 2 216 ? 34.910  134.527 82.802  1.00 32.10  ? 390 CYS B CA  1 
ATOM   4123 C C   . CYS B 2 216 ? 34.324  134.826 84.172  1.00 32.35  ? 390 CYS B C   1 
ATOM   4124 O O   . CYS B 2 216 ? 33.544  135.778 84.342  1.00 31.26  ? 390 CYS B O   1 
ATOM   4125 C CB  . CYS B 2 216 ? 34.149  133.369 82.175  1.00 32.53  ? 390 CYS B CB  1 
ATOM   4126 S SG  . CYS B 2 216 ? 32.426  133.770 81.851  1.00 31.55  ? 390 CYS B SG  1 
ATOM   4127 N N   . LEU B 2 217 ? 34.718  133.999 85.139  1.00 32.52  ? 391 LEU B N   1 
ATOM   4128 C CA  . LEU B 2 217 ? 34.342  134.170 86.534  1.00 33.38  ? 391 LEU B CA  1 
ATOM   4129 C C   . LEU B 2 217 ? 34.825  135.498 87.115  1.00 33.47  ? 391 LEU B C   1 
ATOM   4130 O O   . LEU B 2 217 ? 34.128  136.109 87.913  1.00 33.27  ? 391 LEU B O   1 
ATOM   4131 C CB  . LEU B 2 217 ? 34.876  132.996 87.357  1.00 33.81  ? 391 LEU B CB  1 
ATOM   4132 C CG  . LEU B 2 217 ? 34.295  132.718 88.744  1.00 35.26  ? 391 LEU B CG  1 
ATOM   4133 C CD1 . LEU B 2 217 ? 32.761  132.700 88.754  1.00 35.86  ? 391 LEU B CD1 1 
ATOM   4134 C CD2 . LEU B 2 217 ? 34.852  131.394 89.256  1.00 37.42  ? 391 LEU B CD2 1 
ATOM   4135 N N   . MET B 2 218 ? 36.005  135.953 86.707  1.00 34.22  ? 392 MET B N   1 
ATOM   4136 C CA  . MET B 2 218 ? 36.486  137.292 87.079  1.00 35.07  ? 392 MET B CA  1 
ATOM   4137 C C   . MET B 2 218 ? 35.571  138.381 86.539  1.00 34.54  ? 392 MET B C   1 
ATOM   4138 O O   . MET B 2 218 ? 35.240  139.337 87.248  1.00 34.99  ? 392 MET B O   1 
ATOM   4139 C CB  . MET B 2 218 ? 37.896  137.550 86.541  1.00 35.64  ? 392 MET B CB  1 
ATOM   4140 C CG  . MET B 2 218 ? 38.975  136.665 87.116  1.00 38.91  ? 392 MET B CG  1 
ATOM   4141 S SD  . MET B 2 218 ? 39.113  136.939 88.850  1.00 47.35  ? 392 MET B SD  1 
ATOM   4142 C CE  . MET B 2 218 ? 38.778  135.310 89.479  1.00 45.79  ? 392 MET B CE  1 
ATOM   4143 N N   . ASP B 2 219 ? 35.188  138.255 85.271  1.00 34.08  ? 393 ASP B N   1 
ATOM   4144 C CA  . ASP B 2 219 ? 34.301  139.236 84.654  1.00 33.43  ? 393 ASP B CA  1 
ATOM   4145 C C   . ASP B 2 219 ? 32.899  139.169 85.267  1.00 32.63  ? 393 ASP B C   1 
ATOM   4146 O O   . ASP B 2 219 ? 32.337  140.193 85.621  1.00 32.66  ? 393 ASP B O   1 
ATOM   4147 C CB  . ASP B 2 219 ? 34.237  139.048 83.134  1.00 33.82  ? 393 ASP B CB  1 
ATOM   4148 C CG  . ASP B 2 219 ? 35.548  139.401 82.423  1.00 34.75  ? 393 ASP B CG  1 
ATOM   4149 O OD1 . ASP B 2 219 ? 36.351  140.228 82.931  1.00 37.01  ? 393 ASP B OD1 1 
ATOM   4150 O OD2 . ASP B 2 219 ? 35.846  138.894 81.322  1.00 34.48  ? 393 ASP B OD2 1 
ATOM   4151 N N   . LEU B 2 220 ? 32.340  137.969 85.400  1.00 32.14  ? 394 LEU B N   1 
ATOM   4152 C CA  . LEU B 2 220 ? 30.989  137.811 85.937  1.00 32.00  ? 394 LEU B CA  1 
ATOM   4153 C C   . LEU B 2 220 ? 30.879  138.270 87.399  1.00 32.36  ? 394 LEU B C   1 
ATOM   4154 O O   . LEU B 2 220 ? 29.897  138.897 87.797  1.00 31.93  ? 394 LEU B O   1 
ATOM   4155 C CB  . LEU B 2 220 ? 30.500  136.372 85.779  1.00 31.68  ? 394 LEU B CB  1 
ATOM   4156 C CG  . LEU B 2 220 ? 28.985  136.181 85.711  1.00 31.11  ? 394 LEU B CG  1 
ATOM   4157 C CD1 . LEU B 2 220 ? 28.403  136.808 84.450  1.00 30.63  ? 394 LEU B CD1 1 
ATOM   4158 C CD2 . LEU B 2 220 ? 28.626  134.690 85.780  1.00 30.10  ? 394 LEU B CD2 1 
ATOM   4159 N N   . HIS B 2 221 ? 31.897  137.971 88.192  1.00 32.64  ? 395 HIS B N   1 
ATOM   4160 C CA  . HIS B 2 221 ? 31.950  138.504 89.535  1.00 33.35  ? 395 HIS B CA  1 
ATOM   4161 C C   . HIS B 2 221 ? 31.819  140.030 89.537  1.00 33.56  ? 395 HIS B C   1 
ATOM   4162 O O   . HIS B 2 221 ? 30.997  140.566 90.278  1.00 33.33  ? 395 HIS B O   1 
ATOM   4163 C CB  . HIS B 2 221 ? 33.222  138.072 90.238  1.00 33.35  ? 395 HIS B CB  1 
ATOM   4164 C CG  . HIS B 2 221 ? 33.282  138.484 91.670  1.00 35.02  ? 395 HIS B CG  1 
ATOM   4165 N ND1 . HIS B 2 221 ? 32.221  138.320 92.536  1.00 35.26  ? 395 HIS B ND1 1 
ATOM   4166 C CD2 . HIS B 2 221 ? 34.279  139.048 92.392  1.00 35.82  ? 395 HIS B CD2 1 
ATOM   4167 C CE1 . HIS B 2 221 ? 32.565  138.769 93.730  1.00 36.74  ? 395 HIS B CE1 1 
ATOM   4168 N NE2 . HIS B 2 221 ? 33.810  139.210 93.671  1.00 36.11  ? 395 HIS B NE2 1 
ATOM   4169 N N   . GLN B 2 222 ? 32.599  140.729 88.705  1.00 33.71  ? 396 GLN B N   1 
ATOM   4170 C CA  . GLN B 2 222 ? 32.506  142.198 88.647  1.00 33.75  ? 396 GLN B CA  1 
ATOM   4171 C C   . GLN B 2 222 ? 31.131  142.651 88.190  1.00 32.94  ? 396 GLN B C   1 
ATOM   4172 O O   . GLN B 2 222 ? 30.573  143.592 88.744  1.00 32.85  ? 396 GLN B O   1 
ATOM   4173 C CB  . GLN B 2 222 ? 33.556  142.812 87.715  1.00 34.37  ? 396 GLN B CB  1 
ATOM   4174 C CG  . GLN B 2 222 ? 34.990  142.816 88.234  1.00 38.14  ? 396 GLN B CG  1 
ATOM   4175 C CD  . GLN B 2 222 ? 35.148  143.417 89.635  1.00 42.38  ? 396 GLN B CD  1 
ATOM   4176 O OE1 . GLN B 2 222 ? 35.824  142.827 90.483  1.00 43.68  ? 396 GLN B OE1 1 
ATOM   4177 N NE2 . GLN B 2 222 ? 34.535  144.582 89.875  1.00 43.61  ? 396 GLN B NE2 1 
ATOM   4178 N N   . THR B 2 223 ? 30.590  141.987 87.168  1.00 32.04  ? 397 THR B N   1 
ATOM   4179 C CA  . THR B 2 223 ? 29.282  142.340 86.632  1.00 31.29  ? 397 THR B CA  1 
ATOM   4180 C C   . THR B 2 223 ? 28.193  142.230 87.703  1.00 31.45  ? 397 THR B C   1 
ATOM   4181 O O   . THR B 2 223 ? 27.311  143.070 87.782  1.00 30.78  ? 397 THR B O   1 
ATOM   4182 C CB  . THR B 2 223 ? 28.958  141.471 85.391  1.00 31.44  ? 397 THR B CB  1 
ATOM   4183 O OG1 . THR B 2 223 ? 29.765  141.909 84.286  1.00 30.61  ? 397 THR B OG1 1 
ATOM   4184 C CG2 . THR B 2 223 ? 27.511  141.689 84.906  1.00 30.02  ? 397 THR B CG2 1 
ATOM   4185 N N   . TYR B 2 224 ? 28.277  141.185 88.519  1.00 31.50  ? 398 TYR B N   1 
ATOM   4186 C CA  . TYR B 2 224 ? 27.396  140.984 89.664  1.00 32.07  ? 398 TYR B CA  1 
ATOM   4187 C C   . TYR B 2 224 ? 27.489  142.127 90.692  1.00 33.05  ? 398 TYR B C   1 
ATOM   4188 O O   . TYR B 2 224 ? 26.456  142.667 91.122  1.00 33.18  ? 398 TYR B O   1 
ATOM   4189 C CB  . TYR B 2 224 ? 27.754  139.657 90.324  1.00 31.61  ? 398 TYR B CB  1 
ATOM   4190 C CG  . TYR B 2 224 ? 26.751  139.103 91.302  1.00 31.01  ? 398 TYR B CG  1 
ATOM   4191 C CD1 . TYR B 2 224 ? 25.455  139.606 91.391  1.00 29.85  ? 398 TYR B CD1 1 
ATOM   4192 C CD2 . TYR B 2 224 ? 27.101  138.052 92.134  1.00 29.76  ? 398 TYR B CD2 1 
ATOM   4193 C CE1 . TYR B 2 224 ? 24.544  139.070 92.290  1.00 28.84  ? 398 TYR B CE1 1 
ATOM   4194 C CE2 . TYR B 2 224 ? 26.201  137.518 93.023  1.00 29.80  ? 398 TYR B CE2 1 
ATOM   4195 C CZ  . TYR B 2 224 ? 24.930  138.031 93.101  1.00 29.25  ? 398 TYR B CZ  1 
ATOM   4196 O OH  . TYR B 2 224 ? 24.049  137.477 93.996  1.00 30.23  ? 398 TYR B OH  1 
ATOM   4197 N N   . LEU B 2 225 ? 28.717  142.484 91.079  1.00 33.68  ? 399 LEU B N   1 
ATOM   4198 C CA  . LEU B 2 225 ? 28.967  143.561 92.048  1.00 34.84  ? 399 LEU B CA  1 
ATOM   4199 C C   . LEU B 2 225 ? 28.446  144.921 91.603  1.00 35.32  ? 399 LEU B C   1 
ATOM   4200 O O   . LEU B 2 225 ? 27.924  145.678 92.420  1.00 35.71  ? 399 LEU B O   1 
ATOM   4201 C CB  . LEU B 2 225 ? 30.465  143.701 92.340  1.00 34.73  ? 399 LEU B CB  1 
ATOM   4202 C CG  . LEU B 2 225 ? 31.179  142.654 93.187  1.00 35.17  ? 399 LEU B CG  1 
ATOM   4203 C CD1 . LEU B 2 225 ? 32.667  142.967 93.136  1.00 36.29  ? 399 LEU B CD1 1 
ATOM   4204 C CD2 . LEU B 2 225 ? 30.671  142.636 94.633  1.00 34.78  ? 399 LEU B CD2 1 
ATOM   4205 N N   . LYS B 2 226 ? 28.611  145.221 90.316  1.00 35.81  ? 400 LYS B N   1 
ATOM   4206 C CA  . LYS B 2 226 ? 28.248  146.514 89.743  1.00 36.69  ? 400 LYS B CA  1 
ATOM   4207 C C   . LYS B 2 226 ? 26.834  146.547 89.162  1.00 36.53  ? 400 LYS B C   1 
ATOM   4208 O O   . LYS B 2 226 ? 26.453  147.531 88.521  1.00 36.62  ? 400 LYS B O   1 
ATOM   4209 C CB  . LYS B 2 226 ? 29.239  146.881 88.636  1.00 36.98  ? 400 LYS B CB  1 
ATOM   4210 C CG  . LYS B 2 226 ? 30.516  147.510 89.125  1.00 39.63  ? 400 LYS B CG  1 
ATOM   4211 C CD  . LYS B 2 226 ? 31.602  147.454 88.050  1.00 43.91  ? 400 LYS B CD  1 
ATOM   4212 C CE  . LYS B 2 226 ? 32.976  147.757 88.673  1.00 47.40  ? 400 LYS B CE  1 
ATOM   4213 N NZ  . LYS B 2 226 ? 34.086  146.918 88.108  1.00 49.44  ? 400 LYS B NZ  1 
ATOM   4214 N N   . ALA B 2 227 ? 26.069  145.475 89.375  1.00 36.48  ? 401 ALA B N   1 
ATOM   4215 C CA  . ALA B 2 227 ? 24.759  145.312 88.741  1.00 36.52  ? 401 ALA B CA  1 
ATOM   4216 C C   . ALA B 2 227 ? 23.773  146.442 89.086  1.00 37.06  ? 401 ALA B C   1 
ATOM   4217 O O   . ALA B 2 227 ? 23.140  146.989 88.177  1.00 37.00  ? 401 ALA B O   1 
ATOM   4218 C CB  . ALA B 2 227 ? 24.156  143.944 89.059  1.00 35.77  ? 401 ALA B CB  1 
ATOM   4219 N N   . PRO B 2 228 ? 23.629  146.784 90.376  1.00 37.32  ? 402 PRO B N   1 
ATOM   4220 C CA  . PRO B 2 228 ? 22.754  147.899 90.782  1.00 37.74  ? 402 PRO B CA  1 
ATOM   4221 C C   . PRO B 2 228 ? 23.128  149.253 90.173  1.00 37.89  ? 402 PRO B C   1 
ATOM   4222 O O   . PRO B 2 228 ? 22.281  150.144 90.146  1.00 37.68  ? 402 PRO B O   1 
ATOM   4223 C CB  . PRO B 2 228 ? 22.913  147.933 92.309  1.00 37.91  ? 402 PRO B CB  1 
ATOM   4224 C CG  . PRO B 2 228 ? 23.298  146.511 92.656  1.00 37.99  ? 402 PRO B CG  1 
ATOM   4225 C CD  . PRO B 2 228 ? 24.242  146.126 91.549  1.00 37.13  ? 402 PRO B CD  1 
ATOM   4226 N N   . GLN B 2 229 ? 24.353  149.380 89.661  1.00 38.43  ? 403 GLN B N   1 
ATOM   4227 C CA  . GLN B 2 229 ? 24.864  150.640 89.110  1.00 39.18  ? 403 GLN B CA  1 
ATOM   4228 C C   . GLN B 2 229 ? 24.788  150.741 87.576  1.00 38.77  ? 403 GLN B C   1 
ATOM   4229 O O   . GLN B 2 229 ? 24.985  151.822 87.019  1.00 38.85  ? 403 GLN B O   1 
ATOM   4230 C CB  . GLN B 2 229 ? 26.314  150.859 89.573  1.00 39.84  ? 403 GLN B CB  1 
ATOM   4231 C CG  . GLN B 2 229 ? 26.460  151.567 90.925  1.00 43.07  ? 403 GLN B CG  1 
ATOM   4232 C CD  . GLN B 2 229 ? 25.664  150.897 92.039  1.00 47.73  ? 403 GLN B CD  1 
ATOM   4233 O OE1 . GLN B 2 229 ? 24.713  151.485 92.576  1.00 49.51  ? 403 GLN B OE1 1 
ATOM   4234 N NE2 . GLN B 2 229 ? 26.039  149.659 92.379  1.00 49.43  ? 403 GLN B NE2 1 
ATOM   4235 N N   . HIS B 2 230 ? 24.503  149.619 86.908  1.00 38.05  ? 404 HIS B N   1 
ATOM   4236 C CA  . HIS B 2 230 ? 24.443  149.538 85.439  1.00 37.27  ? 404 HIS B CA  1 
ATOM   4237 C C   . HIS B 2 230 ? 23.327  150.421 84.880  1.00 36.68  ? 404 HIS B C   1 
ATOM   4238 O O   . HIS B 2 230 ? 22.263  150.523 85.486  1.00 36.81  ? 404 HIS B O   1 
ATOM   4239 C CB  . HIS B 2 230 ? 24.205  148.075 85.022  1.00 36.96  ? 404 HIS B CB  1 
ATOM   4240 C CG  . HIS B 2 230 ? 24.617  147.757 83.617  1.00 36.87  ? 404 HIS B CG  1 
ATOM   4241 N ND1 . HIS B 2 230 ? 23.785  147.945 82.536  1.00 36.23  ? 404 HIS B ND1 1 
ATOM   4242 C CD2 . HIS B 2 230 ? 25.761  147.226 83.121  1.00 36.15  ? 404 HIS B CD2 1 
ATOM   4243 C CE1 . HIS B 2 230 ? 24.404  147.571 81.432  1.00 35.72  ? 404 HIS B CE1 1 
ATOM   4244 N NE2 . HIS B 2 230 ? 25.603  147.128 81.760  1.00 35.71  ? 404 HIS B NE2 1 
ATOM   4245 N N   . ALA B 2 231 ? 23.562  151.045 83.726  1.00 36.19  ? 405 ALA B N   1 
ATOM   4246 C CA  . ALA B 2 231 ? 22.523  151.852 83.060  1.00 35.80  ? 405 ALA B CA  1 
ATOM   4247 C C   . ALA B 2 231 ? 21.238  151.057 82.772  1.00 35.48  ? 405 ALA B C   1 
ATOM   4248 O O   . ALA B 2 231 ? 20.148  151.635 82.703  1.00 35.65  ? 405 ALA B O   1 
ATOM   4249 C CB  . ALA B 2 231 ? 23.058  152.467 81.775  1.00 35.73  ? 405 ALA B CB  1 
ATOM   4250 N N   . GLN B 2 232 ? 21.371  149.741 82.608  1.00 34.28  ? 406 GLN B N   1 
ATOM   4251 C CA  . GLN B 2 232 ? 20.235  148.885 82.300  1.00 33.71  ? 406 GLN B CA  1 
ATOM   4252 C C   . GLN B 2 232 ? 19.830  148.065 83.516  1.00 32.88  ? 406 GLN B C   1 
ATOM   4253 O O   . GLN B 2 232 ? 20.668  147.412 84.147  1.00 33.02  ? 406 GLN B O   1 
ATOM   4254 C CB  . GLN B 2 232 ? 20.562  147.982 81.107  1.00 33.91  ? 406 GLN B CB  1 
ATOM   4255 C CG  . GLN B 2 232 ? 20.283  148.630 79.754  1.00 35.47  ? 406 GLN B CG  1 
ATOM   4256 C CD  . GLN B 2 232 ? 21.298  149.694 79.375  1.00 37.88  ? 406 GLN B CD  1 
ATOM   4257 O OE1 . GLN B 2 232 ? 22.507  149.483 79.499  1.00 41.04  ? 406 GLN B OE1 1 
ATOM   4258 N NE2 . GLN B 2 232 ? 20.813  150.834 78.908  1.00 36.94  ? 406 GLN B NE2 1 
ATOM   4259 N N   . GLN B 2 233 ? 18.541  148.090 83.838  1.00 31.87  ? 407 GLN B N   1 
ATOM   4260 C CA  . GLN B 2 233 ? 18.063  147.535 85.106  1.00 30.74  ? 407 GLN B CA  1 
ATOM   4261 C C   . GLN B 2 233 ? 16.911  146.541 84.991  1.00 30.19  ? 407 GLN B C   1 
ATOM   4262 O O   . GLN B 2 233 ? 16.444  146.034 86.012  1.00 30.14  ? 407 GLN B O   1 
ATOM   4263 C CB  . GLN B 2 233 ? 17.659  148.685 86.046  1.00 30.68  ? 407 GLN B CB  1 
ATOM   4264 C CG  . GLN B 2 233 ? 18.847  149.456 86.620  1.00 30.47  ? 407 GLN B CG  1 
ATOM   4265 C CD  . GLN B 2 233 ? 19.564  148.707 87.724  1.00 30.61  ? 407 GLN B CD  1 
ATOM   4266 O OE1 . GLN B 2 233 ? 18.932  148.219 88.648  1.00 33.01  ? 407 GLN B OE1 1 
ATOM   4267 N NE2 . GLN B 2 233 ? 20.883  148.624 87.635  1.00 30.59  ? 407 GLN B NE2 1 
ATOM   4268 N N   . SER B 2 234 ? 16.450  146.252 83.772  1.00 29.59  ? 408 SER B N   1 
ATOM   4269 C CA  . SER B 2 234 ? 15.269  145.388 83.593  1.00 29.76  ? 408 SER B CA  1 
ATOM   4270 C C   . SER B 2 234 ? 15.447  143.965 84.095  1.00 29.09  ? 408 SER B C   1 
ATOM   4271 O O   . SER B 2 234 ? 14.479  143.333 84.511  1.00 28.89  ? 408 SER B O   1 
ATOM   4272 C CB  . SER B 2 234 ? 14.808  145.336 82.134  1.00 29.83  ? 408 SER B CB  1 
ATOM   4273 O OG  . SER B 2 234 ? 14.574  146.638 81.642  1.00 31.01  ? 408 SER B OG  1 
ATOM   4274 N N   . ILE B 2 235 ? 16.669  143.453 84.021  1.00 29.02  ? 409 ILE B N   1 
ATOM   4275 C CA  . ILE B 2 235 ? 16.942  142.108 84.514  1.00 29.33  ? 409 ILE B CA  1 
ATOM   4276 C C   . ILE B 2 235 ? 16.847  142.079 86.036  1.00 29.71  ? 409 ILE B C   1 
ATOM   4277 O O   . ILE B 2 235 ? 16.125  141.250 86.587  1.00 29.13  ? 409 ILE B O   1 
ATOM   4278 C CB  . ILE B 2 235 ? 18.294  141.576 83.999  1.00 29.10  ? 409 ILE B CB  1 
ATOM   4279 C CG1 . ILE B 2 235 ? 18.203  141.313 82.490  1.00 28.24  ? 409 ILE B CG1 1 
ATOM   4280 C CG2 . ILE B 2 235 ? 18.673  140.290 84.724  1.00 28.64  ? 409 ILE B CG2 1 
ATOM   4281 C CD1 . ILE B 2 235 ? 19.540  141.275 81.788  1.00 26.92  ? 409 ILE B CD1 1 
ATOM   4282 N N   . ARG B 2 236 ? 17.538  143.012 86.697  1.00 30.57  ? 410 ARG B N   1 
ATOM   4283 C CA  . ARG B 2 236 ? 17.447  143.151 88.153  1.00 31.75  ? 410 ARG B CA  1 
ATOM   4284 C C   . ARG B 2 236 ? 16.008  143.256 88.636  1.00 32.03  ? 410 ARG B C   1 
ATOM   4285 O O   . ARG B 2 236 ? 15.635  142.561 89.584  1.00 31.97  ? 410 ARG B O   1 
ATOM   4286 C CB  . ARG B 2 236 ? 18.236  144.351 88.648  1.00 31.83  ? 410 ARG B CB  1 
ATOM   4287 C CG  . ARG B 2 236 ? 19.706  144.082 88.837  1.00 33.58  ? 410 ARG B CG  1 
ATOM   4288 C CD  . ARG B 2 236 ? 20.415  145.229 89.515  1.00 36.44  ? 410 ARG B CD  1 
ATOM   4289 N NE  . ARG B 2 236 ? 20.214  145.170 90.959  1.00 38.40  ? 410 ARG B NE  1 
ATOM   4290 C CZ  . ARG B 2 236 ? 19.616  146.106 91.683  1.00 39.34  ? 410 ARG B CZ  1 
ATOM   4291 N NH1 . ARG B 2 236 ? 19.500  145.930 92.992  1.00 40.11  ? 410 ARG B NH1 1 
ATOM   4292 N NH2 . ARG B 2 236 ? 19.139  147.212 91.119  1.00 38.41  ? 410 ARG B NH2 1 
ATOM   4293 N N   . GLU B 2 237 ? 15.215  144.107 87.976  1.00 32.82  ? 411 GLU B N   1 
ATOM   4294 C CA  . GLU B 2 237 ? 13.783  144.231 88.266  1.00 34.18  ? 411 GLU B CA  1 
ATOM   4295 C C   . GLU B 2 237 ? 13.045  142.918 88.032  1.00 33.89  ? 411 GLU B C   1 
ATOM   4296 O O   . GLU B 2 237 ? 12.203  142.529 88.845  1.00 33.93  ? 411 GLU B O   1 
ATOM   4297 C CB  . GLU B 2 237 ? 13.105  145.327 87.435  1.00 34.66  ? 411 GLU B CB  1 
ATOM   4298 C CG  . GLU B 2 237 ? 13.817  146.676 87.369  1.00 39.77  ? 411 GLU B CG  1 
ATOM   4299 C CD  . GLU B 2 237 ? 13.886  147.420 88.693  1.00 45.06  ? 411 GLU B CD  1 
ATOM   4300 O OE1 . GLU B 2 237 ? 12.888  147.409 89.461  1.00 47.43  ? 411 GLU B OE1 1 
ATOM   4301 O OE2 . GLU B 2 237 ? 14.949  148.035 88.956  1.00 47.75  ? 411 GLU B OE2 1 
ATOM   4302 N N   . LYS B 2 238 ? 13.352  142.247 86.918  1.00 33.80  ? 412 LYS B N   1 
ATOM   4303 C CA  . LYS B 2 238 ? 12.751  140.952 86.605  1.00 33.50  ? 412 LYS B CA  1 
ATOM   4304 C C   . LYS B 2 238 ? 13.021  139.932 87.724  1.00 33.95  ? 412 LYS B C   1 
ATOM   4305 O O   . LYS B 2 238 ? 12.099  139.273 88.200  1.00 33.84  ? 412 LYS B O   1 
ATOM   4306 C CB  . LYS B 2 238 ? 13.239  140.451 85.239  1.00 33.10  ? 412 LYS B CB  1 
ATOM   4307 C CG  . LYS B 2 238 ? 12.907  139.004 84.888  1.00 31.52  ? 412 LYS B CG  1 
ATOM   4308 C CD  . LYS B 2 238 ? 13.488  138.621 83.498  1.00 28.63  ? 412 LYS B CD  1 
ATOM   4309 C CE  . LYS B 2 238 ? 13.331  137.134 83.185  1.00 24.61  ? 412 LYS B CE  1 
ATOM   4310 N NZ  . LYS B 2 238 ? 13.892  136.816 81.831  1.00 26.45  ? 412 LYS B NZ  1 
ATOM   4311 N N   . TYR B 2 239 ? 14.269  139.819 88.163  1.00 34.19  ? 413 TYR B N   1 
ATOM   4312 C CA  . TYR B 2 239 ? 14.610  138.778 89.126  1.00 35.01  ? 413 TYR B CA  1 
ATOM   4313 C C   . TYR B 2 239 ? 14.299  139.122 90.595  1.00 36.53  ? 413 TYR B C   1 
ATOM   4314 O O   . TYR B 2 239 ? 14.620  138.355 91.513  1.00 35.99  ? 413 TYR B O   1 
ATOM   4315 C CB  . TYR B 2 239 ? 16.046  138.309 88.922  1.00 34.52  ? 413 TYR B CB  1 
ATOM   4316 C CG  . TYR B 2 239 ? 16.149  137.318 87.790  1.00 33.21  ? 413 TYR B CG  1 
ATOM   4317 C CD1 . TYR B 2 239 ? 16.132  137.743 86.455  1.00 31.50  ? 413 TYR B CD1 1 
ATOM   4318 C CD2 . TYR B 2 239 ? 16.233  135.951 88.050  1.00 31.87  ? 413 TYR B CD2 1 
ATOM   4319 C CE1 . TYR B 2 239 ? 16.214  136.818 85.396  1.00 31.63  ? 413 TYR B CE1 1 
ATOM   4320 C CE2 . TYR B 2 239 ? 16.308  135.021 87.010  1.00 31.89  ? 413 TYR B CE2 1 
ATOM   4321 C CZ  . TYR B 2 239 ? 16.294  135.462 85.687  1.00 31.44  ? 413 TYR B CZ  1 
ATOM   4322 O OH  . TYR B 2 239 ? 16.374  134.539 84.673  1.00 32.40  ? 413 TYR B OH  1 
ATOM   4323 N N   . LYS B 2 240 ? 13.651  140.276 90.784  1.00 38.18  ? 414 LYS B N   1 
ATOM   4324 C CA  . LYS B 2 240 ? 13.056  140.671 92.053  1.00 39.96  ? 414 LYS B CA  1 
ATOM   4325 C C   . LYS B 2 240 ? 11.782  139.865 92.308  1.00 40.90  ? 414 LYS B C   1 
ATOM   4326 O O   . LYS B 2 240 ? 11.322  139.766 93.447  1.00 41.41  ? 414 LYS B O   1 
ATOM   4327 C CB  . LYS B 2 240 ? 12.724  142.165 92.039  1.00 40.01  ? 414 LYS B CB  1 
ATOM   4328 C CG  . LYS B 2 240 ? 13.732  143.024 92.776  1.00 41.99  ? 414 LYS B CG  1 
ATOM   4329 C CD  . LYS B 2 240 ? 13.586  144.506 92.464  1.00 44.24  ? 414 LYS B CD  1 
ATOM   4330 C CE  . LYS B 2 240 ? 14.878  145.043 91.862  1.00 46.24  ? 414 LYS B CE  1 
ATOM   4331 N NZ  . LYS B 2 240 ? 15.407  146.222 92.606  1.00 47.22  ? 414 LYS B NZ  1 
ATOM   4332 N N   . ASN B 2 241 ? 11.221  139.291 91.249  1.00 41.59  ? 415 ASN B N   1 
ATOM   4333 C CA  . ASN B 2 241 ? 9.956   138.574 91.343  1.00 42.79  ? 415 ASN B CA  1 
ATOM   4334 C C   . ASN B 2 241 ? 10.023  137.249 92.095  1.00 42.95  ? 415 ASN B C   1 
ATOM   4335 O O   . ASN B 2 241 ? 11.012  136.512 92.005  1.00 43.60  ? 415 ASN B O   1 
ATOM   4336 C CB  . ASN B 2 241 ? 9.367   138.347 89.954  1.00 42.83  ? 415 ASN B CB  1 
ATOM   4337 C CG  . ASN B 2 241 ? 7.868   138.157 89.988  1.00 44.96  ? 415 ASN B CG  1 
ATOM   4338 O OD1 . ASN B 2 241 ? 7.364   137.033 89.896  1.00 46.59  ? 415 ASN B OD1 1 
ATOM   4339 N ND2 . ASN B 2 241 ? 7.139   139.263 90.124  1.00 47.47  ? 415 ASN B ND2 1 
ATOM   4340 N N   . SER B 2 242 ? 8.948   136.947 92.818  1.00 42.97  ? 416 SER B N   1 
ATOM   4341 C CA  . SER B 2 242 ? 8.829   135.695 93.566  1.00 42.85  ? 416 SER B CA  1 
ATOM   4342 C C   . SER B 2 242 ? 9.009   134.470 92.664  1.00 42.31  ? 416 SER B C   1 
ATOM   4343 O O   . SER B 2 242 ? 9.559   133.449 93.086  1.00 42.35  ? 416 SER B O   1 
ATOM   4344 C CB  . SER B 2 242 ? 7.488   135.641 94.311  1.00 42.98  ? 416 SER B CB  1 
ATOM   4345 O OG  . SER B 2 242 ? 6.486   134.996 93.539  1.00 44.04  ? 416 SER B OG  1 
ATOM   4346 N N   . LYS B 2 243 ? 8.541   134.587 91.423  1.00 41.42  ? 417 LYS B N   1 
ATOM   4347 C CA  . LYS B 2 243 ? 8.768   133.569 90.402  1.00 40.56  ? 417 LYS B CA  1 
ATOM   4348 C C   . LYS B 2 243 ? 10.252  133.158 90.307  1.00 39.23  ? 417 LYS B C   1 
ATOM   4349 O O   . LYS B 2 243 ? 10.560  131.999 90.042  1.00 39.14  ? 417 LYS B O   1 
ATOM   4350 C CB  . LYS B 2 243 ? 8.246   134.075 89.054  1.00 41.07  ? 417 LYS B CB  1 
ATOM   4351 C CG  . LYS B 2 243 ? 8.483   133.139 87.874  1.00 42.75  ? 417 LYS B CG  1 
ATOM   4352 C CD  . LYS B 2 243 ? 7.376   133.256 86.821  1.00 45.81  ? 417 LYS B CD  1 
ATOM   4353 C CE  . LYS B 2 243 ? 7.634   134.403 85.855  1.00 46.23  ? 417 LYS B CE  1 
ATOM   4354 N NZ  . LYS B 2 243 ? 6.964   135.647 86.325  1.00 48.10  ? 417 LYS B NZ  1 
ATOM   4355 N N   . TYR B 2 244 ? 11.162  134.102 90.541  1.00 37.87  ? 418 TYR B N   1 
ATOM   4356 C CA  . TYR B 2 244 ? 12.600  133.802 90.558  1.00 36.74  ? 418 TYR B CA  1 
ATOM   4357 C C   . TYR B 2 244 ? 13.202  133.931 91.955  1.00 35.65  ? 418 TYR B C   1 
ATOM   4358 O O   . TYR B 2 244 ? 14.395  134.229 92.102  1.00 35.47  ? 418 TYR B O   1 
ATOM   4359 C CB  . TYR B 2 244 ? 13.364  134.676 89.549  1.00 36.82  ? 418 TYR B CB  1 
ATOM   4360 C CG  . TYR B 2 244 ? 12.691  134.735 88.204  1.00 37.88  ? 418 TYR B CG  1 
ATOM   4361 C CD1 . TYR B 2 244 ? 12.775  133.668 87.316  1.00 38.83  ? 418 TYR B CD1 1 
ATOM   4362 C CD2 . TYR B 2 244 ? 11.934  135.845 87.834  1.00 39.06  ? 418 TYR B CD2 1 
ATOM   4363 C CE1 . TYR B 2 244 ? 12.139  133.710 86.090  1.00 40.52  ? 418 TYR B CE1 1 
ATOM   4364 C CE2 . TYR B 2 244 ? 11.297  135.895 86.616  1.00 39.76  ? 418 TYR B CE2 1 
ATOM   4365 C CZ  . TYR B 2 244 ? 11.402  134.827 85.748  1.00 40.63  ? 418 TYR B CZ  1 
ATOM   4366 O OH  . TYR B 2 244 ? 10.761  134.872 84.531  1.00 43.78  ? 418 TYR B OH  1 
ATOM   4367 N N   . HIS B 2 245 ? 12.368  133.710 92.975  1.00 34.34  ? 419 HIS B N   1 
ATOM   4368 C CA  . HIS B 2 245 ? 12.797  133.674 94.379  1.00 33.07  ? 419 HIS B CA  1 
ATOM   4369 C C   . HIS B 2 245 ? 13.538  134.932 94.819  1.00 31.92  ? 419 HIS B C   1 
ATOM   4370 O O   . HIS B 2 245 ? 14.333  134.892 95.767  1.00 32.04  ? 419 HIS B O   1 
ATOM   4371 C CB  . HIS B 2 245 ? 13.618  132.405 94.676  1.00 33.70  ? 419 HIS B CB  1 
ATOM   4372 C CG  . HIS B 2 245 ? 12.959  131.140 94.212  1.00 35.94  ? 419 HIS B CG  1 
ATOM   4373 N ND1 . HIS B 2 245 ? 13.063  130.675 92.915  1.00 39.82  ? 419 HIS B ND1 1 
ATOM   4374 C CD2 . HIS B 2 245 ? 12.163  130.260 94.862  1.00 37.56  ? 419 HIS B CD2 1 
ATOM   4375 C CE1 . HIS B 2 245 ? 12.373  129.553 92.792  1.00 39.24  ? 419 HIS B CE1 1 
ATOM   4376 N NE2 . HIS B 2 245 ? 11.814  129.282 93.958  1.00 39.71  ? 419 HIS B NE2 1 
ATOM   4377 N N   . GLY B 2 246 ? 13.251  136.041 94.131  1.00 30.26  ? 420 GLY B N   1 
ATOM   4378 C CA  . GLY B 2 246 ? 13.809  137.347 94.424  1.00 28.76  ? 420 GLY B CA  1 
ATOM   4379 C C   . GLY B 2 246 ? 15.319  137.393 94.519  1.00 28.09  ? 420 GLY B C   1 
ATOM   4380 O O   . GLY B 2 246 ? 15.846  138.180 95.310  1.00 27.88  ? 420 GLY B O   1 
ATOM   4381 N N   . VAL B 2 247 ? 16.015  136.589 93.710  1.00 27.18  ? 421 VAL B N   1 
ATOM   4382 C CA  . VAL B 2 247 ? 17.464  136.409 93.872  1.00 27.19  ? 421 VAL B CA  1 
ATOM   4383 C C   . VAL B 2 247 ? 18.303  137.643 93.561  1.00 28.02  ? 421 VAL B C   1 
ATOM   4384 O O   . VAL B 2 247 ? 19.458  137.735 93.997  1.00 27.87  ? 421 VAL B O   1 
ATOM   4385 C CB  . VAL B 2 247 ? 18.025  135.207 93.082  1.00 27.01  ? 421 VAL B CB  1 
ATOM   4386 C CG1 . VAL B 2 247 ? 17.406  133.902 93.563  1.00 25.88  ? 421 VAL B CG1 1 
ATOM   4387 C CG2 . VAL B 2 247 ? 17.854  135.409 91.557  1.00 26.72  ? 421 VAL B CG2 1 
ATOM   4388 N N   . SER B 2 248 ? 17.742  138.594 92.815  1.00 29.36  ? 422 SER B N   1 
ATOM   4389 C CA  . SER B 2 248 ? 18.461  139.848 92.560  1.00 30.66  ? 422 SER B CA  1 
ATOM   4390 C C   . SER B 2 248 ? 18.529  140.767 93.789  1.00 31.73  ? 422 SER B C   1 
ATOM   4391 O O   . SER B 2 248 ? 19.175  141.812 93.749  1.00 32.03  ? 422 SER B O   1 
ATOM   4392 C CB  . SER B 2 248 ? 17.924  140.576 91.337  1.00 30.68  ? 422 SER B CB  1 
ATOM   4393 O OG  . SER B 2 248 ? 16.663  141.160 91.574  1.00 30.95  ? 422 SER B OG  1 
ATOM   4394 N N   . LEU B 2 249 ? 17.898  140.357 94.887  1.00 33.01  ? 423 LEU B N   1 
ATOM   4395 C CA  . LEU B 2 249 ? 18.051  141.064 96.170  1.00 34.68  ? 423 LEU B CA  1 
ATOM   4396 C C   . LEU B 2 249 ? 19.154  140.481 97.062  1.00 35.60  ? 423 LEU B C   1 
ATOM   4397 O O   . LEU B 2 249 ? 19.639  141.156 97.965  1.00 36.22  ? 423 LEU B O   1 
ATOM   4398 C CB  . LEU B 2 249 ? 16.721  141.139 96.930  1.00 34.52  ? 423 LEU B CB  1 
ATOM   4399 C CG  . LEU B 2 249 ? 15.546  141.688 96.113  1.00 34.29  ? 423 LEU B CG  1 
ATOM   4400 C CD1 . LEU B 2 249 ? 14.254  141.510 96.873  1.00 34.08  ? 423 LEU B CD1 1 
ATOM   4401 C CD2 . LEU B 2 249 ? 15.773  143.146 95.737  1.00 33.75  ? 423 LEU B CD2 1 
ATOM   4402 N N   . LEU B 2 250 ? 19.549  139.236 96.796  1.00 36.73  ? 424 LEU B N   1 
ATOM   4403 C CA  . LEU B 2 250 ? 20.666  138.600 97.486  1.00 37.85  ? 424 LEU B CA  1 
ATOM   4404 C C   . LEU B 2 250 ? 21.911  139.443 97.286  1.00 38.94  ? 424 LEU B C   1 
ATOM   4405 O O   . LEU B 2 250 ? 22.060  140.079 96.249  1.00 39.51  ? 424 LEU B O   1 
ATOM   4406 C CB  . LEU B 2 250 ? 20.900  137.193 96.928  1.00 37.43  ? 424 LEU B CB  1 
ATOM   4407 C CG  . LEU B 2 250 ? 19.778  136.157 97.043  1.00 37.33  ? 424 LEU B CG  1 
ATOM   4408 C CD1 . LEU B 2 250 ? 20.097  134.930 96.204  1.00 35.86  ? 424 LEU B CD1 1 
ATOM   4409 C CD2 . LEU B 2 250 ? 19.548  135.747 98.505  1.00 36.97  ? 424 LEU B CD2 1 
ATOM   4410 N N   . ASN B 2 251 ? 22.805  139.453 98.269  1.00 40.65  ? 425 ASN B N   1 
ATOM   4411 C CA  . ASN B 2 251 ? 24.055  140.215 98.161  1.00 42.04  ? 425 ASN B CA  1 
ATOM   4412 C C   . ASN B 2 251 ? 25.217  139.395 97.596  1.00 43.10  ? 425 ASN B C   1 
ATOM   4413 O O   . ASN B 2 251 ? 25.493  138.292 98.073  1.00 42.97  ? 425 ASN B O   1 
ATOM   4414 C CB  . ASN B 2 251 ? 24.453  140.809 99.511  1.00 42.02  ? 425 ASN B CB  1 
ATOM   4415 C CG  . ASN B 2 251 ? 23.625  142.024 99.881  1.00 43.69  ? 425 ASN B CG  1 
ATOM   4416 O OD1 . ASN B 2 251 ? 22.877  141.993 100.862 1.00 45.97  ? 425 ASN B OD1 1 
ATOM   4417 N ND2 . ASN B 2 251 ? 23.747  143.104 99.099  1.00 44.53  ? 425 ASN B ND2 1 
ATOM   4418 N N   . PRO B 2 252 ? 25.892  139.931 96.581  1.00 44.43  ? 426 PRO B N   1 
ATOM   4419 C CA  . PRO B 2 252 ? 27.094  139.295 96.038  1.00 46.01  ? 426 PRO B CA  1 
ATOM   4420 C C   . PRO B 2 252 ? 28.198  139.164 97.087  1.00 48.09  ? 426 PRO B C   1 
ATOM   4421 O O   . PRO B 2 252 ? 28.284  140.012 97.987  1.00 48.16  ? 426 PRO B O   1 
ATOM   4422 C CB  . PRO B 2 252 ? 27.540  140.262 94.930  1.00 45.70  ? 426 PRO B CB  1 
ATOM   4423 C CG  . PRO B 2 252 ? 26.834  141.537 95.199  1.00 44.62  ? 426 PRO B CG  1 
ATOM   4424 C CD  . PRO B 2 252 ? 25.551  141.172 95.863  1.00 44.28  ? 426 PRO B CD  1 
ATOM   4425 N N   . PRO B 2 253 ? 29.031  138.128 96.974  1.00 50.05  ? 427 PRO B N   1 
ATOM   4426 C CA  . PRO B 2 253 ? 30.229  138.025 97.814  1.00 51.97  ? 427 PRO B CA  1 
ATOM   4427 C C   . PRO B 2 253 ? 31.234  139.098 97.378  1.00 54.18  ? 427 PRO B C   1 
ATOM   4428 O O   . PRO B 2 253 ? 31.238  139.485 96.206  1.00 53.69  ? 427 PRO B O   1 
ATOM   4429 C CB  . PRO B 2 253 ? 30.749  136.612 97.520  1.00 51.70  ? 427 PRO B CB  1 
ATOM   4430 C CG  . PRO B 2 253 ? 30.209  136.273 96.172  1.00 50.81  ? 427 PRO B CG  1 
ATOM   4431 C CD  . PRO B 2 253 ? 28.909  136.997 96.035  1.00 49.89  ? 427 PRO B CD  1 
ATOM   4432 N N   . GLU B 2 254 ? 32.045  139.595 98.307  1.00 57.18  ? 428 GLU B N   1 
ATOM   4433 C CA  . GLU B 2 254 ? 33.008  140.637 97.961  1.00 60.51  ? 428 GLU B CA  1 
ATOM   4434 C C   . GLU B 2 254 ? 34.290  140.047 97.387  1.00 62.52  ? 428 GLU B C   1 
ATOM   4435 O O   . GLU B 2 254 ? 34.985  140.704 96.620  1.00 62.84  ? 428 GLU B O   1 
ATOM   4436 C CB  . GLU B 2 254 ? 33.285  141.573 99.144  1.00 60.61  ? 428 GLU B CB  1 
ATOM   4437 C CG  . GLU B 2 254 ? 33.998  140.944 100.332 1.00 62.01  ? 428 GLU B CG  1 
ATOM   4438 C CD  . GLU B 2 254 ? 34.183  141.933 101.464 1.00 63.28  ? 428 GLU B CD  1 
ATOM   4439 O OE1 . GLU B 2 254 ? 33.382  141.894 102.422 1.00 64.24  ? 428 GLU B OE1 1 
ATOM   4440 O OE2 . GLU B 2 254 ? 35.123  142.754 101.390 1.00 63.37  ? 428 GLU B OE2 1 
ATOM   4441 N N   . THR B 2 255 ? 34.593  138.808 97.764  1.00 65.51  ? 429 THR B N   1 
ATOM   4442 C CA  . THR B 2 255 ? 35.685  138.053 97.153  1.00 68.67  ? 429 THR B CA  1 
ATOM   4443 C C   . THR B 2 255 ? 35.192  136.675 96.733  1.00 71.08  ? 429 THR B C   1 
ATOM   4444 O O   . THR B 2 255 ? 34.218  136.162 97.283  1.00 71.07  ? 429 THR B O   1 
ATOM   4445 C CB  . THR B 2 255 ? 36.900  137.906 98.113  1.00 68.37  ? 429 THR B CB  1 
ATOM   4446 O OG1 . THR B 2 255 ? 36.480  137.299 99.341  1.00 68.06  ? 429 THR B OG1 1 
ATOM   4447 C CG2 . THR B 2 255 ? 37.444  139.265 98.538  1.00 68.38  ? 429 THR B CG2 1 
ATOM   4448 N N   . LEU B 2 256 ? 35.872  136.086 95.755  1.00 74.55  ? 430 LEU B N   1 
ATOM   4449 C CA  . LEU B 2 256 ? 35.572  134.732 95.310  1.00 78.13  ? 430 LEU B CA  1 
ATOM   4450 C C   . LEU B 2 256 ? 36.485  133.715 95.987  1.00 80.82  ? 430 LEU B C   1 
ATOM   4451 O O   . LEU B 2 256 ? 36.212  132.512 95.954  1.00 81.17  ? 430 LEU B O   1 
ATOM   4452 C CB  . LEU B 2 256 ? 35.697  134.625 93.790  1.00 77.92  ? 430 LEU B CB  1 
ATOM   4453 C CG  . LEU B 2 256 ? 34.707  135.428 92.946  1.00 77.73  ? 430 LEU B CG  1 
ATOM   4454 C CD1 . LEU B 2 256 ? 34.835  135.057 91.482  1.00 77.32  ? 430 LEU B CD1 1 
ATOM   4455 C CD2 . LEU B 2 256 ? 33.297  135.205 93.434  1.00 77.54  ? 430 LEU B CD2 1 
ATOM   4456 N N   . ASN B 2 257 ? 37.557  134.216 96.605  1.00 84.20  ? 431 ASN B N   1 
ATOM   4457 C CA  . ASN B 2 257 ? 38.569  133.396 97.280  1.00 87.41  ? 431 ASN B CA  1 
ATOM   4458 C C   . ASN B 2 257 ? 39.166  132.321 96.367  1.00 89.00  ? 431 ASN B C   1 
ATOM   4459 O O   . ASN B 2 257 ? 39.161  131.131 96.700  1.00 89.43  ? 431 ASN B O   1 
ATOM   4460 C CB  . ASN B 2 257 ? 38.027  132.785 98.589  1.00 87.81  ? 431 ASN B CB  1 
ATOM   4461 C CG  . ASN B 2 257 ? 37.606  133.840 99.608  1.00 89.34  ? 431 ASN B CG  1 
ATOM   4462 O OD1 . ASN B 2 257 ? 36.486  133.808 100.122 1.00 90.69  ? 431 ASN B OD1 1 
ATOM   4463 N ND2 . ASN B 2 257 ? 38.505  134.774 99.908  1.00 90.73  ? 431 ASN B ND2 1 
ATOM   4464 N N   . LEU B 2 258 ? 39.670  132.757 95.213  1.00 90.83  ? 432 LEU B N   1 
ATOM   4465 C CA  . LEU B 2 258 ? 40.317  131.860 94.258  1.00 92.39  ? 432 LEU B CA  1 
ATOM   4466 C C   . LEU B 2 258 ? 41.837  131.983 94.328  1.00 92.68  ? 432 LEU B C   1 
ATOM   4467 O O   . LEU B 2 258 ? 42.372  133.043 94.658  1.00 92.99  ? 432 LEU B O   1 
ATOM   4468 C CB  . LEU B 2 258 ? 39.828  132.140 92.833  1.00 93.04  ? 432 LEU B CB  1 
ATOM   4469 C CG  . LEU B 2 258 ? 38.387  131.775 92.450  1.00 94.83  ? 432 LEU B CG  1 
ATOM   4470 C CD1 . LEU B 2 258 ? 38.133  132.140 91.002  1.00 96.73  ? 432 LEU B CD1 1 
ATOM   4471 C CD2 . LEU B 2 258 ? 38.082  130.297 92.682  1.00 96.76  ? 432 LEU B CD2 1 
ATOM   4472 N N   . SER C 1 1   ? -19.732 63.449  101.118 1.00 51.46  ? 0   SER C N   1 
ATOM   4473 C CA  . SER C 1 1   ? -19.310 62.362  100.189 1.00 51.44  ? 0   SER C CA  1 
ATOM   4474 C C   . SER C 1 1   ? -19.341 60.991  100.866 1.00 51.48  ? 0   SER C C   1 
ATOM   4475 O O   . SER C 1 1   ? -19.012 59.977  100.240 1.00 51.32  ? 0   SER C O   1 
ATOM   4476 C CB  . SER C 1 1   ? -17.915 62.636  99.614  1.00 51.27  ? 0   SER C CB  1 
ATOM   4477 O OG  . SER C 1 1   ? -17.546 63.998  99.743  1.00 50.95  ? 0   SER C OG  1 
ATOM   4478 N N   . MET C 1 2   ? -19.739 60.964  102.138 1.00 51.50  ? 1   MET C N   1 
ATOM   4479 C CA  . MET C 1 2   ? -19.873 59.705  102.870 1.00 51.81  ? 1   MET C CA  1 
ATOM   4480 C C   . MET C 1 2   ? -21.051 58.870  102.380 1.00 51.55  ? 1   MET C C   1 
ATOM   4481 O O   . MET C 1 2   ? -21.028 57.643  102.483 1.00 51.33  ? 1   MET C O   1 
ATOM   4482 C CB  . MET C 1 2   ? -19.975 59.953  104.375 1.00 52.12  ? 1   MET C CB  1 
ATOM   4483 C CG  . MET C 1 2   ? -18.620 60.106  105.077 1.00 53.17  ? 1   MET C CG  1 
ATOM   4484 S SD  . MET C 1 2   ? -17.175 59.467  104.162 1.00 55.47  ? 1   MET C SD  1 
ATOM   4485 C CE  . MET C 1 2   ? -17.247 57.728  104.655 1.00 53.94  ? 1   MET C CE  1 
ATOM   4486 N N   . GLU C 1 3   ? -22.064 59.544  101.832 1.00 51.53  ? 2   GLU C N   1 
ATOM   4487 C CA  . GLU C 1 3   ? -23.209 58.880  101.200 1.00 51.69  ? 2   GLU C CA  1 
ATOM   4488 C C   . GLU C 1 3   ? -22.782 57.807  100.210 1.00 50.37  ? 2   GLU C C   1 
ATOM   4489 O O   . GLU C 1 3   ? -23.384 56.737  100.168 1.00 50.27  ? 2   GLU C O   1 
ATOM   4490 C CB  . GLU C 1 3   ? -24.129 59.886  100.484 1.00 52.42  ? 2   GLU C CB  1 
ATOM   4491 C CG  . GLU C 1 3   ? -25.242 59.225  99.656  1.00 56.16  ? 2   GLU C CG  1 
ATOM   4492 C CD  . GLU C 1 3   ? -25.687 60.037  98.433  1.00 60.44  ? 2   GLU C CD  1 
ATOM   4493 O OE1 . GLU C 1 3   ? -25.014 59.990  97.369  1.00 61.75  ? 2   GLU C OE1 1 
ATOM   4494 O OE2 . GLU C 1 3   ? -26.739 60.714  98.526  1.00 62.37  ? 2   GLU C OE2 1 
ATOM   4495 N N   . ASN C 1 4   ? -21.742 58.092  99.431  1.00 49.05  ? 3   ASN C N   1 
ATOM   4496 C CA  . ASN C 1 4   ? -21.354 57.213  98.327  1.00 48.20  ? 3   ASN C CA  1 
ATOM   4497 C C   . ASN C 1 4   ? -20.337 56.113  98.616  1.00 47.31  ? 3   ASN C C   1 
ATOM   4498 O O   . ASN C 1 4   ? -19.953 55.384  97.703  1.00 47.51  ? 3   ASN C O   1 
ATOM   4499 C CB  . ASN C 1 4   ? -20.901 58.035  97.122  1.00 48.27  ? 3   ASN C CB  1 
ATOM   4500 C CG  . ASN C 1 4   ? -22.016 58.878  96.556  1.00 48.68  ? 3   ASN C CG  1 
ATOM   4501 O OD1 . ASN C 1 4   ? -23.105 58.362  96.246  1.00 49.52  ? 3   ASN C OD1 1 
ATOM   4502 N ND2 . ASN C 1 4   ? -21.769 60.182  96.430  1.00 46.12  ? 3   ASN C ND2 1 
ATOM   4503 N N   . PHE C 1 5   ? -19.909 55.983  99.867  1.00 46.25  ? 4   PHE C N   1 
ATOM   4504 C CA  . PHE C 1 5   ? -18.971 54.926  100.229 1.00 45.37  ? 4   PHE C CA  1 
ATOM   4505 C C   . PHE C 1 5   ? -19.650 53.838  101.053 1.00 45.70  ? 4   PHE C C   1 
ATOM   4506 O O   . PHE C 1 5   ? -20.269 54.119  102.077 1.00 45.65  ? 4   PHE C O   1 
ATOM   4507 C CB  . PHE C 1 5   ? -17.761 55.500  100.963 1.00 44.57  ? 4   PHE C CB  1 
ATOM   4508 C CG  . PHE C 1 5   ? -16.791 56.196  100.062 1.00 42.48  ? 4   PHE C CG  1 
ATOM   4509 C CD1 . PHE C 1 5   ? -15.946 55.471  99.228  1.00 41.02  ? 4   PHE C CD1 1 
ATOM   4510 C CD2 . PHE C 1 5   ? -16.724 57.579  100.038 1.00 40.55  ? 4   PHE C CD2 1 
ATOM   4511 C CE1 . PHE C 1 5   ? -15.052 56.120  98.386  1.00 40.04  ? 4   PHE C CE1 1 
ATOM   4512 C CE2 . PHE C 1 5   ? -15.835 58.237  99.205  1.00 39.02  ? 4   PHE C CE2 1 
ATOM   4513 C CZ  . PHE C 1 5   ? -14.997 57.512  98.376  1.00 39.60  ? 4   PHE C CZ  1 
ATOM   4514 N N   . GLN C 1 6   ? -19.558 52.603  100.574 1.00 46.23  ? 5   GLN C N   1 
ATOM   4515 C CA  . GLN C 1 6   ? -20.077 51.444  101.302 1.00 46.93  ? 5   GLN C CA  1 
ATOM   4516 C C   . GLN C 1 6   ? -18.931 50.792  102.061 1.00 46.85  ? 5   GLN C C   1 
ATOM   4517 O O   . GLN C 1 6   ? -17.971 50.316  101.457 1.00 46.53  ? 5   GLN C O   1 
ATOM   4518 C CB  . GLN C 1 6   ? -20.743 50.440  100.348 1.00 47.04  ? 5   GLN C CB  1 
ATOM   4519 C CG  . GLN C 1 6   ? -21.516 49.309  101.035 1.00 49.13  ? 5   GLN C CG  1 
ATOM   4520 C CD  . GLN C 1 6   ? -22.719 49.806  101.832 1.00 51.61  ? 5   GLN C CD  1 
ATOM   4521 O OE1 . GLN C 1 6   ? -23.759 50.138  101.256 1.00 53.67  ? 5   GLN C OE1 1 
ATOM   4522 N NE2 . GLN C 1 6   ? -22.576 49.865  103.153 1.00 51.61  ? 5   GLN C NE2 1 
ATOM   4523 N N   . LYS C 1 7   ? -19.019 50.800  103.387 1.00 47.32  ? 6   LYS C N   1 
ATOM   4524 C CA  . LYS C 1 7   ? -18.010 50.136  104.197 1.00 47.74  ? 6   LYS C CA  1 
ATOM   4525 C C   . LYS C 1 7   ? -18.171 48.627  104.060 1.00 47.89  ? 6   LYS C C   1 
ATOM   4526 O O   . LYS C 1 7   ? -19.286 48.110  104.076 1.00 47.86  ? 6   LYS C O   1 
ATOM   4527 C CB  . LYS C 1 7   ? -18.066 50.605  105.648 1.00 48.10  ? 6   LYS C CB  1 
ATOM   4528 C CG  . LYS C 1 7   ? -17.430 52.003  105.853 1.00 48.35  ? 6   LYS C CG  1 
ATOM   4529 C CD  . LYS C 1 7   ? -17.398 52.406  107.319 1.00 48.93  ? 6   LYS C CD  1 
ATOM   4530 C CE  . LYS C 1 7   ? -17.791 53.861  107.524 1.00 49.10  ? 6   LYS C CE  1 
ATOM   4531 N NZ  . LYS C 1 7   ? -17.806 54.214  108.971 1.00 49.06  ? 6   LYS C NZ  1 
ATOM   4532 N N   . VAL C 1 8   ? -17.048 47.943  103.869 1.00 48.02  ? 7   VAL C N   1 
ATOM   4533 C CA  . VAL C 1 8   ? -17.037 46.508  103.592 1.00 48.35  ? 7   VAL C CA  1 
ATOM   4534 C C   . VAL C 1 8   ? -16.545 45.707  104.805 1.00 48.64  ? 7   VAL C C   1 
ATOM   4535 O O   . VAL C 1 8   ? -17.073 44.629  105.096 1.00 49.08  ? 7   VAL C O   1 
ATOM   4536 C CB  . VAL C 1 8   ? -16.171 46.191  102.343 1.00 48.25  ? 7   VAL C CB  1 
ATOM   4537 C CG1 . VAL C 1 8   ? -16.001 44.689  102.143 1.00 48.27  ? 7   VAL C CG1 1 
ATOM   4538 C CG2 . VAL C 1 8   ? -16.773 46.834  101.091 1.00 48.01  ? 7   VAL C CG2 1 
ATOM   4539 N N   . GLU C 1 9   ? -15.544 46.244  105.503 1.00 48.67  ? 8   GLU C N   1 
ATOM   4540 C CA  . GLU C 1 9   ? -14.901 45.578  106.637 1.00 48.70  ? 8   GLU C CA  1 
ATOM   4541 C C   . GLU C 1 9   ? -13.773 46.445  107.194 1.00 48.11  ? 8   GLU C C   1 
ATOM   4542 O O   . GLU C 1 9   ? -13.140 47.204  106.449 1.00 47.81  ? 8   GLU C O   1 
ATOM   4543 C CB  . GLU C 1 9   ? -14.347 44.207  106.224 1.00 48.98  ? 8   GLU C CB  1 
ATOM   4544 C CG  . GLU C 1 9   ? -12.964 44.246  105.576 1.00 51.55  ? 8   GLU C CG  1 
ATOM   4545 C CD  . GLU C 1 9   ? -12.545 42.913  104.973 1.00 55.21  ? 8   GLU C CD  1 
ATOM   4546 O OE1 . GLU C 1 9   ? -13.266 42.402  104.084 1.00 56.75  ? 8   GLU C OE1 1 
ATOM   4547 O OE2 . GLU C 1 9   ? -11.490 42.378  105.385 1.00 56.79  ? 8   GLU C OE2 1 
ATOM   4548 N N   . LYS C 1 10  ? -13.520 46.319  108.496 1.00 47.40  ? 9   LYS C N   1 
ATOM   4549 C CA  . LYS C 1 10  ? -12.397 47.003  109.134 1.00 47.38  ? 9   LYS C CA  1 
ATOM   4550 C C   . LYS C 1 10  ? -11.089 46.272  108.802 1.00 46.78  ? 9   LYS C C   1 
ATOM   4551 O O   . LYS C 1 10  ? -11.037 45.048  108.867 1.00 46.62  ? 9   LYS C O   1 
ATOM   4552 C CB  . LYS C 1 10  ? -12.618 47.082  110.650 1.00 47.63  ? 9   LYS C CB  1 
ATOM   4553 C CG  . LYS C 1 10  ? -11.621 47.963  111.403 1.00 49.00  ? 9   LYS C CG  1 
ATOM   4554 C CD  . LYS C 1 10  ? -10.730 47.119  112.320 1.00 52.20  ? 9   LYS C CD  1 
ATOM   4555 C CE  . LYS C 1 10  ? -10.331 47.864  113.594 1.00 52.42  ? 9   LYS C CE  1 
ATOM   4556 N NZ  . LYS C 1 10  ? -11.513 48.347  114.359 1.00 53.70  ? 9   LYS C NZ  1 
ATOM   4557 N N   . ILE C 1 11  ? -10.043 47.011  108.435 1.00 46.31  ? 10  ILE C N   1 
ATOM   4558 C CA  . ILE C 1 11  ? -8.778  46.376  108.041 1.00 46.26  ? 10  ILE C CA  1 
ATOM   4559 C C   . ILE C 1 11  ? -7.559  46.791  108.861 1.00 46.82  ? 10  ILE C C   1 
ATOM   4560 O O   . ILE C 1 11  ? -6.476  46.231  108.695 1.00 46.64  ? 10  ILE C O   1 
ATOM   4561 C CB  . ILE C 1 11  ? -8.478  46.551  106.519 1.00 45.85  ? 10  ILE C CB  1 
ATOM   4562 C CG1 . ILE C 1 11  ? -8.526  48.024  106.109 1.00 44.60  ? 10  ILE C CG1 1 
ATOM   4563 C CG2 . ILE C 1 11  ? -9.401  45.672  105.680 1.00 45.31  ? 10  ILE C CG2 1 
ATOM   4564 C CD1 . ILE C 1 11  ? -7.969  48.293  104.721 1.00 44.03  ? 10  ILE C CD1 1 
ATOM   4565 N N   . GLY C 1 12  ? -7.737  47.766  109.739 1.00 47.78  ? 11  GLY C N   1 
ATOM   4566 C CA  . GLY C 1 12  ? -6.641  48.276  110.536 1.00 49.75  ? 11  GLY C CA  1 
ATOM   4567 C C   . GLY C 1 12  ? -7.151  49.297  111.518 1.00 51.38  ? 11  GLY C C   1 
ATOM   4568 O O   . GLY C 1 12  ? -8.327  49.656  111.484 1.00 51.21  ? 11  GLY C O   1 
ATOM   4569 N N   . GLU C 1 13  ? -6.267  49.768  112.390 1.00 53.28  ? 12  GLU C N   1 
ATOM   4570 C CA  . GLU C 1 13  ? -6.649  50.700  113.446 1.00 55.17  ? 12  GLU C CA  1 
ATOM   4571 C C   . GLU C 1 13  ? -5.430  51.324  114.099 1.00 56.37  ? 12  GLU C C   1 
ATOM   4572 O O   . GLU C 1 13  ? -4.443  50.638  114.378 1.00 56.56  ? 12  GLU C O   1 
ATOM   4573 C CB  . GLU C 1 13  ? -7.494  49.990  114.507 1.00 55.12  ? 12  GLU C CB  1 
ATOM   4574 C CG  . GLU C 1 13  ? -7.611  50.729  115.834 1.00 56.49  ? 12  GLU C CG  1 
ATOM   4575 C CD  . GLU C 1 13  ? -8.976  50.569  116.479 1.00 57.47  ? 12  GLU C CD  1 
ATOM   4576 O OE1 . GLU C 1 13  ? -9.477  51.557  117.070 1.00 57.44  ? 12  GLU C OE1 1 
ATOM   4577 O OE2 . GLU C 1 13  ? -9.544  49.455  116.393 1.00 57.76  ? 12  GLU C OE2 1 
ATOM   4578 N N   . GLY C 1 14  ? -5.518  52.631  114.333 1.00 57.75  ? 13  GLY C N   1 
ATOM   4579 C CA  . GLY C 1 14  ? -4.537  53.360  115.116 1.00 59.50  ? 13  GLY C CA  1 
ATOM   4580 C C   . GLY C 1 14  ? -5.205  54.062  116.284 1.00 60.56  ? 13  GLY C C   1 
ATOM   4581 O O   . GLY C 1 14  ? -6.364  53.778  116.606 1.00 60.55  ? 13  GLY C O   1 
ATOM   4582 N N   . THR C 1 15  ? -4.475  54.986  116.908 1.00 61.70  ? 14  THR C N   1 
ATOM   4583 C CA  . THR C 1 15  ? -4.985  55.744  118.054 1.00 62.89  ? 14  THR C CA  1 
ATOM   4584 C C   . THR C 1 15  ? -6.133  56.686  117.667 1.00 63.07  ? 14  THR C C   1 
ATOM   4585 O O   . THR C 1 15  ? -7.182  56.708  118.334 1.00 63.59  ? 14  THR C O   1 
ATOM   4586 C CB  . THR C 1 15  ? -3.828  56.498  118.763 1.00 63.06  ? 14  THR C CB  1 
ATOM   4587 O OG1 . THR C 1 15  ? -3.229  55.631  119.731 1.00 63.64  ? 14  THR C OG1 1 
ATOM   4588 C CG2 . THR C 1 15  ? -4.342  57.669  119.611 1.00 63.63  ? 14  THR C CG2 1 
ATOM   4589 N N   . TYR C 1 16  ? -5.936  57.442  116.586 1.00 62.96  ? 15  TYR C N   1 
ATOM   4590 C CA  . TYR C 1 16  ? -6.952  58.375  116.079 1.00 62.52  ? 15  TYR C CA  1 
ATOM   4591 C C   . TYR C 1 16  ? -7.709  57.761  114.906 1.00 60.90  ? 15  TYR C C   1 
ATOM   4592 O O   . TYR C 1 16  ? -8.942  57.883  114.814 1.00 61.16  ? 15  TYR C O   1 
ATOM   4593 C CB  . TYR C 1 16  ? -6.314  59.708  115.655 1.00 63.36  ? 15  TYR C CB  1 
ATOM   4594 C CG  . TYR C 1 16  ? -5.021  60.011  116.372 1.00 66.13  ? 15  TYR C CG  1 
ATOM   4595 C CD1 . TYR C 1 16  ? -5.008  60.822  117.508 1.00 68.38  ? 15  TYR C CD1 1 
ATOM   4596 C CD2 . TYR C 1 16  ? -3.811  59.464  115.929 1.00 68.17  ? 15  TYR C CD2 1 
ATOM   4597 C CE1 . TYR C 1 16  ? -3.823  61.094  118.180 1.00 70.33  ? 15  TYR C CE1 1 
ATOM   4598 C CE2 . TYR C 1 16  ? -2.624  59.723  116.596 1.00 70.23  ? 15  TYR C CE2 1 
ATOM   4599 C CZ  . TYR C 1 16  ? -2.635  60.541  117.719 1.00 71.08  ? 15  TYR C CZ  1 
ATOM   4600 O OH  . TYR C 1 16  ? -1.458  60.808  118.382 1.00 72.09  ? 15  TYR C OH  1 
ATOM   4601 N N   . GLY C 1 17  ? -6.961  57.097  114.023 1.00 58.47  ? 16  GLY C N   1 
ATOM   4602 C CA  . GLY C 1 17  ? -7.526  56.483  112.841 1.00 55.50  ? 16  GLY C CA  1 
ATOM   4603 C C   . GLY C 1 17  ? -8.179  55.131  113.053 1.00 53.17  ? 16  GLY C C   1 
ATOM   4604 O O   . GLY C 1 17  ? -7.865  54.405  113.989 1.00 53.64  ? 16  GLY C O   1 
ATOM   4605 N N   . VAL C 1 18  ? -9.139  54.823  112.192 1.00 50.73  ? 17  VAL C N   1 
ATOM   4606 C CA  . VAL C 1 18  ? -9.583  53.455  111.957 1.00 47.94  ? 17  VAL C CA  1 
ATOM   4607 C C   . VAL C 1 18  ? -9.658  53.328  110.439 1.00 46.04  ? 17  VAL C C   1 
ATOM   4608 O O   . VAL C 1 18  ? -10.224 54.196  109.769 1.00 45.52  ? 17  VAL C O   1 
ATOM   4609 C CB  . VAL C 1 18  ? -10.968 53.139  112.559 1.00 47.98  ? 17  VAL C CB  1 
ATOM   4610 C CG1 . VAL C 1 18  ? -11.342 51.684  112.289 1.00 47.56  ? 17  VAL C CG1 1 
ATOM   4611 C CG2 . VAL C 1 18  ? -11.006 53.418  114.049 1.00 48.22  ? 17  VAL C CG2 1 
ATOM   4612 N N   . VAL C 1 19  ? -9.075  52.261  109.902 1.00 43.69  ? 18  VAL C N   1 
ATOM   4613 C CA  . VAL C 1 19  ? -9.034  52.068  108.463 1.00 41.29  ? 18  VAL C CA  1 
ATOM   4614 C C   . VAL C 1 19  ? -10.051 51.025  108.031 1.00 40.09  ? 18  VAL C C   1 
ATOM   4615 O O   . VAL C 1 19  ? -10.047 49.904  108.543 1.00 39.52  ? 18  VAL C O   1 
ATOM   4616 C CB  . VAL C 1 19  ? -7.629  51.692  107.990 1.00 41.08  ? 18  VAL C CB  1 
ATOM   4617 C CG1 . VAL C 1 19  ? -7.546  51.732  106.473 1.00 40.90  ? 18  VAL C CG1 1 
ATOM   4618 C CG2 . VAL C 1 19  ? -6.608  52.636  108.595 1.00 41.05  ? 18  VAL C CG2 1 
ATOM   4619 N N   . TYR C 1 20  ? -10.924 51.409  107.099 1.00 38.54  ? 19  TYR C N   1 
ATOM   4620 C CA  . TYR C 1 20  ? -11.912 50.494  106.534 1.00 37.65  ? 19  TYR C CA  1 
ATOM   4621 C C   . TYR C 1 20  ? -11.619 50.236  105.083 1.00 36.32  ? 19  TYR C C   1 
ATOM   4622 O O   . TYR C 1 20  ? -11.120 51.109  104.378 1.00 35.97  ? 19  TYR C O   1 
ATOM   4623 C CB  . TYR C 1 20  ? -13.330 51.057  106.631 1.00 37.59  ? 19  TYR C CB  1 
ATOM   4624 C CG  . TYR C 1 20  ? -13.751 51.391  108.023 1.00 39.88  ? 19  TYR C CG  1 
ATOM   4625 C CD1 . TYR C 1 20  ? -13.448 52.632  108.574 1.00 41.79  ? 19  TYR C CD1 1 
ATOM   4626 C CD2 . TYR C 1 20  ? -14.445 50.464  108.806 1.00 42.69  ? 19  TYR C CD2 1 
ATOM   4627 C CE1 . TYR C 1 20  ? -13.823 52.951  109.859 1.00 44.29  ? 19  TYR C CE1 1 
ATOM   4628 C CE2 . TYR C 1 20  ? -14.829 50.775  110.107 1.00 44.28  ? 19  TYR C CE2 1 
ATOM   4629 C CZ  . TYR C 1 20  ? -14.512 52.026  110.620 1.00 45.24  ? 19  TYR C CZ  1 
ATOM   4630 O OH  . TYR C 1 20  ? -14.873 52.371  111.899 1.00 48.68  ? 19  TYR C OH  1 
ATOM   4631 N N   . LYS C 1 21  ? -11.935 49.029  104.644 1.00 35.13  ? 20  LYS C N   1 
ATOM   4632 C CA  . LYS C 1 21  ? -12.050 48.746  103.229 1.00 34.25  ? 20  LYS C CA  1 
ATOM   4633 C C   . LYS C 1 21  ? -13.429 49.225  102.826 1.00 34.08  ? 20  LYS C C   1 
ATOM   4634 O O   . LYS C 1 21  ? -14.425 48.936  103.518 1.00 33.85  ? 20  LYS C O   1 
ATOM   4635 C CB  . LYS C 1 21  ? -11.940 47.257  102.964 1.00 34.15  ? 20  LYS C CB  1 
ATOM   4636 C CG  . LYS C 1 21  ? -12.195 46.903  101.519 1.00 34.90  ? 20  LYS C CG  1 
ATOM   4637 C CD  . LYS C 1 21  ? -12.090 45.417  101.260 1.00 35.47  ? 20  LYS C CD  1 
ATOM   4638 C CE  . LYS C 1 21  ? -12.184 45.154  99.767  1.00 35.25  ? 20  LYS C CE  1 
ATOM   4639 N NZ  . LYS C 1 21  ? -12.198 43.715  99.449  1.00 36.80  ? 20  LYS C NZ  1 
ATOM   4640 N N   . ALA C 1 22  ? -13.495 49.978  101.730 1.00 33.27  ? 21  ALA C N   1 
ATOM   4641 C CA  . ALA C 1 22  ? -14.770 50.512  101.286 1.00 32.97  ? 21  ALA C CA  1 
ATOM   4642 C C   . ALA C 1 22  ? -14.911 50.552  99.770  1.00 32.74  ? 21  ALA C C   1 
ATOM   4643 O O   . ALA C 1 22  ? -13.925 50.562  99.045  1.00 32.96  ? 21  ALA C O   1 
ATOM   4644 C CB  . ALA C 1 22  ? -15.011 51.875  101.902 1.00 32.83  ? 21  ALA C CB  1 
ATOM   4645 N N   . ARG C 1 23  ? -16.155 50.551  99.313  1.00 32.65  ? 22  ARG C N   1 
ATOM   4646 C CA  . ARG C 1 23  ? -16.491 50.617  97.906  1.00 33.01  ? 22  ARG C CA  1 
ATOM   4647 C C   . ARG C 1 23  ? -17.247 51.905  97.591  1.00 32.25  ? 22  ARG C C   1 
ATOM   4648 O O   . ARG C 1 23  ? -18.254 52.223  98.242  1.00 31.37  ? 22  ARG C O   1 
ATOM   4649 C CB  . ARG C 1 23  ? -17.363 49.424  97.544  1.00 33.81  ? 22  ARG C CB  1 
ATOM   4650 C CG  . ARG C 1 23  ? -17.472 49.150  96.062  1.00 37.88  ? 22  ARG C CG  1 
ATOM   4651 C CD  . ARG C 1 23  ? -18.512 48.099  95.719  1.00 45.66  ? 22  ARG C CD  1 
ATOM   4652 N NE  . ARG C 1 23  ? -19.208 48.447  94.482  1.00 52.55  ? 22  ARG C NE  1 
ATOM   4653 C CZ  . ARG C 1 23  ? -20.391 49.064  94.416  1.00 55.55  ? 22  ARG C CZ  1 
ATOM   4654 N NH1 . ARG C 1 23  ? -21.042 49.400  95.529  1.00 57.42  ? 22  ARG C NH1 1 
ATOM   4655 N NH2 . ARG C 1 23  ? -20.929 49.339  93.229  1.00 56.25  ? 22  ARG C NH2 1 
ATOM   4656 N N   . ASN C 1 24  ? -16.746 52.645  96.602  1.00 31.87  ? 23  ASN C N   1 
ATOM   4657 C CA  . ASN C 1 24  ? -17.465 53.784  96.043  1.00 31.54  ? 23  ASN C CA  1 
ATOM   4658 C C   . ASN C 1 24  ? -18.669 53.231  95.282  1.00 31.88  ? 23  ASN C C   1 
ATOM   4659 O O   . ASN C 1 24  ? -18.502 52.492  94.311  1.00 31.80  ? 23  ASN C O   1 
ATOM   4660 C CB  . ASN C 1 24  ? -16.550 54.602  95.118  1.00 31.29  ? 23  ASN C CB  1 
ATOM   4661 C CG  . ASN C 1 24  ? -17.190 55.928  94.645  1.00 30.55  ? 23  ASN C CG  1 
ATOM   4662 O OD1 . ASN C 1 24  ? -18.340 55.954  94.189  1.00 27.13  ? 23  ASN C OD1 1 
ATOM   4663 N ND2 . ASN C 1 24  ? -16.427 57.027  94.743  1.00 28.78  ? 23  ASN C ND2 1 
ATOM   4664 N N   . LYS C 1 25  ? -19.869 53.571  95.742  1.00 31.93  ? 24  LYS C N   1 
ATOM   4665 C CA  . LYS C 1 25  ? -21.115 53.070  95.165  1.00 32.76  ? 24  LYS C CA  1 
ATOM   4666 C C   . LYS C 1 25  ? -21.304 53.449  93.701  1.00 32.79  ? 24  LYS C C   1 
ATOM   4667 O O   . LYS C 1 25  ? -21.852 52.671  92.923  1.00 33.54  ? 24  LYS C O   1 
ATOM   4668 C CB  . LYS C 1 25  ? -22.309 53.621  95.949  1.00 33.47  ? 24  LYS C CB  1 
ATOM   4669 C CG  . LYS C 1 25  ? -23.013 52.601  96.839  1.00 35.69  ? 24  LYS C CG  1 
ATOM   4670 C CD  . LYS C 1 25  ? -23.879 53.286  97.879  1.00 39.51  ? 24  LYS C CD  1 
ATOM   4671 C CE  . LYS C 1 25  ? -23.155 53.386  99.213  1.00 42.78  ? 24  LYS C CE  1 
ATOM   4672 N NZ  . LYS C 1 25  ? -23.932 54.177  100.211 1.00 43.87  ? 24  LYS C NZ  1 
ATOM   4673 N N   . LEU C 1 26  ? -20.864 54.646  93.332  1.00 32.13  ? 25  LEU C N   1 
ATOM   4674 C CA  . LEU C 1 26  ? -21.076 55.147  91.979  1.00 31.65  ? 25  LEU C CA  1 
ATOM   4675 C C   . LEU C 1 26  ? -20.038 54.675  90.957  1.00 31.05  ? 25  LEU C C   1 
ATOM   4676 O O   . LEU C 1 26  ? -20.410 54.320  89.855  1.00 30.50  ? 25  LEU C O   1 
ATOM   4677 C CB  . LEU C 1 26  ? -21.189 56.676  91.982  1.00 31.71  ? 25  LEU C CB  1 
ATOM   4678 C CG  . LEU C 1 26  ? -22.424 57.213  92.705  1.00 30.93  ? 25  LEU C CG  1 
ATOM   4679 C CD1 . LEU C 1 26  ? -22.277 58.711  92.895  1.00 31.01  ? 25  LEU C CD1 1 
ATOM   4680 C CD2 . LEU C 1 26  ? -23.708 56.872  91.957  1.00 29.98  ? 25  LEU C CD2 1 
ATOM   4681 N N   . THR C 1 27  ? -18.755 54.674  91.328  1.00 30.43  ? 26  THR C N   1 
ATOM   4682 C CA  . THR C 1 27  ? -17.671 54.314  90.406  1.00 29.64  ? 26  THR C CA  1 
ATOM   4683 C C   . THR C 1 27  ? -17.225 52.842  90.494  1.00 29.97  ? 26  THR C C   1 
ATOM   4684 O O   . THR C 1 27  ? -16.505 52.341  89.602  1.00 29.22  ? 26  THR C O   1 
ATOM   4685 C CB  . THR C 1 27  ? -16.445 55.208  90.643  1.00 29.97  ? 26  THR C CB  1 
ATOM   4686 O OG1 . THR C 1 27  ? -15.898 54.922  91.936  1.00 30.00  ? 26  THR C OG1 1 
ATOM   4687 C CG2 . THR C 1 27  ? -16.817 56.701  90.719  1.00 28.65  ? 26  THR C CG2 1 
ATOM   4688 N N   . GLY C 1 28  ? -17.647 52.160  91.564  1.00 29.84  ? 27  GLY C N   1 
ATOM   4689 C CA  . GLY C 1 28  ? -17.211 50.805  91.843  1.00 30.08  ? 27  GLY C CA  1 
ATOM   4690 C C   . GLY C 1 28  ? -15.859 50.686  92.539  1.00 30.52  ? 27  GLY C C   1 
ATOM   4691 O O   . GLY C 1 28  ? -15.517 49.607  93.012  1.00 30.96  ? 27  GLY C O   1 
ATOM   4692 N N   . GLU C 1 29  ? -15.101 51.783  92.621  1.00 30.58  ? 28  GLU C N   1 
ATOM   4693 C CA  . GLU C 1 29  ? -13.720 51.747  93.105  1.00 30.72  ? 28  GLU C CA  1 
ATOM   4694 C C   . GLU C 1 29  ? -13.614 51.363  94.571  1.00 30.74  ? 28  GLU C C   1 
ATOM   4695 O O   . GLU C 1 29  ? -14.149 52.051  95.446  1.00 31.04  ? 28  GLU C O   1 
ATOM   4696 C CB  . GLU C 1 29  ? -13.016 53.097  92.896  1.00 30.93  ? 28  GLU C CB  1 
ATOM   4697 C CG  . GLU C 1 29  ? -11.549 53.074  93.318  1.00 31.61  ? 28  GLU C CG  1 
ATOM   4698 C CD  . GLU C 1 29  ? -10.909 54.448  93.411  1.00 34.71  ? 28  GLU C CD  1 
ATOM   4699 O OE1 . GLU C 1 29  ? -11.642 55.451  93.613  1.00 34.51  ? 28  GLU C OE1 1 
ATOM   4700 O OE2 . GLU C 1 29  ? -9.650  54.524  93.297  1.00 37.11  ? 28  GLU C OE2 1 
ATOM   4701 N N   . VAL C 1 30  ? -12.896 50.277  94.835  1.00 30.30  ? 29  VAL C N   1 
ATOM   4702 C CA  . VAL C 1 30  ? -12.577 49.886  96.201  1.00 29.41  ? 29  VAL C CA  1 
ATOM   4703 C C   . VAL C 1 30  ? -11.466 50.791  96.746  1.00 29.01  ? 29  VAL C C   1 
ATOM   4704 O O   . VAL C 1 30  ? -10.465 51.042  96.081  1.00 28.50  ? 29  VAL C O   1 
ATOM   4705 C CB  . VAL C 1 30  ? -12.185 48.392  96.303  1.00 29.90  ? 29  VAL C CB  1 
ATOM   4706 C CG1 . VAL C 1 30  ? -12.169 47.956  97.753  1.00 28.19  ? 29  VAL C CG1 1 
ATOM   4707 C CG2 . VAL C 1 30  ? -13.154 47.515  95.485  1.00 29.34  ? 29  VAL C CG2 1 
ATOM   4708 N N   . VAL C 1 31  ? -11.667 51.296  97.957  1.00 28.70  ? 30  VAL C N   1 
ATOM   4709 C CA  . VAL C 1 31  ? -10.739 52.241  98.574  1.00 28.84  ? 30  VAL C CA  1 
ATOM   4710 C C   . VAL C 1 31  ? -10.478 51.844  100.025 1.00 29.33  ? 30  VAL C C   1 
ATOM   4711 O O   . VAL C 1 31  ? -11.194 51.001  100.594 1.00 29.39  ? 30  VAL C O   1 
ATOM   4712 C CB  . VAL C 1 31  ? -11.304 53.686  98.594  1.00 28.57  ? 30  VAL C CB  1 
ATOM   4713 C CG1 . VAL C 1 31  ? -11.506 54.249  97.182  1.00 27.69  ? 30  VAL C CG1 1 
ATOM   4714 C CG2 . VAL C 1 31  ? -12.598 53.752  99.418  1.00 28.62  ? 30  VAL C CG2 1 
ATOM   4715 N N   . ALA C 1 32  ? -9.464  52.465  100.618 1.00 29.72  ? 31  ALA C N   1 
ATOM   4716 C CA  . ALA C 1 32  ? -9.275  52.416  102.056 1.00 30.41  ? 31  ALA C CA  1 
ATOM   4717 C C   . ALA C 1 32  ? -9.658  53.770  102.655 1.00 31.22  ? 31  ALA C C   1 
ATOM   4718 O O   . ALA C 1 32  ? -9.140  54.812  102.240 1.00 31.75  ? 31  ALA C O   1 
ATOM   4719 C CB  . ALA C 1 32  ? -7.848  52.066  102.392 1.00 29.96  ? 31  ALA C CB  1 
ATOM   4720 N N   . LEU C 1 33  ? -10.573 53.743  103.618 1.00 32.29  ? 32  LEU C N   1 
ATOM   4721 C CA  . LEU C 1 33  ? -11.044 54.935  104.314 1.00 33.52  ? 32  LEU C CA  1 
ATOM   4722 C C   . LEU C 1 33  ? -10.437 55.014  105.695 1.00 34.25  ? 32  LEU C C   1 
ATOM   4723 O O   . LEU C 1 33  ? -10.625 54.106  106.502 1.00 34.40  ? 32  LEU C O   1 
ATOM   4724 C CB  . LEU C 1 33  ? -12.561 54.887  104.479 1.00 33.52  ? 32  LEU C CB  1 
ATOM   4725 C CG  . LEU C 1 33  ? -13.446 55.115  103.264 1.00 35.05  ? 32  LEU C CG  1 
ATOM   4726 C CD1 . LEU C 1 33  ? -14.898 55.214  103.714 1.00 35.51  ? 32  LEU C CD1 1 
ATOM   4727 C CD2 . LEU C 1 33  ? -13.036 56.386  102.524 1.00 35.40  ? 32  LEU C CD2 1 
ATOM   4728 N N   . LYS C 1 34  ? -9.708  56.087  105.976 1.00 35.01  ? 33  LYS C N   1 
ATOM   4729 C CA  . LYS C 1 34  ? -9.240  56.309  107.327 1.00 36.09  ? 33  LYS C CA  1 
ATOM   4730 C C   . LYS C 1 34  ? -10.110 57.338  108.052 1.00 36.87  ? 33  LYS C C   1 
ATOM   4731 O O   . LYS C 1 34  ? -10.106 58.520  107.714 1.00 36.75  ? 33  LYS C O   1 
ATOM   4732 C CB  . LYS C 1 34  ? -7.769  56.708  107.346 1.00 36.19  ? 33  LYS C CB  1 
ATOM   4733 C CG  . LYS C 1 34  ? -7.147  56.722  108.731 1.00 36.58  ? 33  LYS C CG  1 
ATOM   4734 C CD  . LYS C 1 34  ? -5.641  56.635  108.640 1.00 39.25  ? 33  LYS C CD  1 
ATOM   4735 C CE  . LYS C 1 34  ? -4.979  57.827  109.288 1.00 41.12  ? 33  LYS C CE  1 
ATOM   4736 N NZ  . LYS C 1 34  ? -4.013  57.381  110.357 1.00 45.27  ? 33  LYS C NZ  1 
ATOM   4737 N N   . LYS C 1 35  ? -10.853 56.870  109.051 1.00 37.79  ? 34  LYS C N   1 
ATOM   4738 C CA  . LYS C 1 35  ? -11.670 57.733  109.893 1.00 38.70  ? 34  LYS C CA  1 
ATOM   4739 C C   . LYS C 1 35  ? -10.808 58.259  111.039 1.00 39.12  ? 34  LYS C C   1 
ATOM   4740 O O   . LYS C 1 35  ? -10.208 57.473  111.769 1.00 39.42  ? 34  LYS C O   1 
ATOM   4741 C CB  . LYS C 1 35  ? -12.857 56.937  110.428 1.00 39.06  ? 34  LYS C CB  1 
ATOM   4742 C CG  . LYS C 1 35  ? -13.973 57.759  111.057 1.00 40.44  ? 34  LYS C CG  1 
ATOM   4743 C CD  . LYS C 1 35  ? -13.820 57.891  112.577 1.00 43.51  ? 34  LYS C CD  1 
ATOM   4744 C CE  . LYS C 1 35  ? -14.419 56.715  113.358 1.00 45.12  ? 34  LYS C CE  1 
ATOM   4745 N NZ  . LYS C 1 35  ? -15.362 55.875  112.559 1.00 46.20  ? 34  LYS C NZ  1 
ATOM   4746 N N   . ILE C 1 36  ? -10.726 59.583  111.178 1.00 39.71  ? 35  ILE C N   1 
ATOM   4747 C CA  . ILE C 1 36  ? -9.959  60.223  112.248 1.00 40.30  ? 35  ILE C CA  1 
ATOM   4748 C C   . ILE C 1 36  ? -10.889 61.091  113.100 1.00 41.54  ? 35  ILE C C   1 
ATOM   4749 O O   . ILE C 1 36  ? -11.479 62.049  112.598 1.00 41.79  ? 35  ILE C O   1 
ATOM   4750 C CB  . ILE C 1 36  ? -8.820  61.085  111.655 1.00 40.15  ? 35  ILE C CB  1 
ATOM   4751 C CG1 . ILE C 1 36  ? -7.812  60.215  110.897 1.00 38.41  ? 35  ILE C CG1 1 
ATOM   4752 C CG2 . ILE C 1 36  ? -8.128  61.915  112.752 1.00 39.81  ? 35  ILE C CG2 1 
ATOM   4753 C CD1 . ILE C 1 36  ? -6.897  60.998  109.986 1.00 36.36  ? 35  ILE C CD1 1 
ATOM   4754 N N   . ARG C 1 37  ? -11.029 60.759  114.381 1.00 42.84  ? 36  ARG C N   1 
ATOM   4755 C CA  . ARG C 1 37  ? -11.914 61.517  115.265 1.00 44.40  ? 36  ARG C CA  1 
ATOM   4756 C C   . ARG C 1 37  ? -11.307 62.871  115.608 1.00 44.75  ? 36  ARG C C   1 
ATOM   4757 O O   . ARG C 1 37  ? -10.122 62.966  115.964 1.00 44.86  ? 36  ARG C O   1 
ATOM   4758 C CB  . ARG C 1 37  ? -12.243 60.731  116.541 1.00 45.05  ? 36  ARG C CB  1 
ATOM   4759 C CG  . ARG C 1 37  ? -13.565 59.934  116.474 1.00 48.31  ? 36  ARG C CG  1 
ATOM   4760 C CD  . ARG C 1 37  ? -13.610 58.681  117.383 1.00 53.71  ? 36  ARG C CD  1 
ATOM   4761 N NE  . ARG C 1 37  ? -14.409 57.596  116.806 1.00 57.97  ? 36  ARG C NE  1 
ATOM   4762 C CZ  . ARG C 1 37  ? -15.013 56.624  117.499 1.00 60.52  ? 36  ARG C CZ  1 
ATOM   4763 N NH1 . ARG C 1 37  ? -14.932 56.570  118.829 1.00 61.79  ? 36  ARG C NH1 1 
ATOM   4764 N NH2 . ARG C 1 37  ? -15.710 55.695  116.852 1.00 61.44  ? 36  ARG C NH2 1 
ATOM   4765 N N   . LEU C 1 38  ? -12.112 63.920  115.458 1.00 45.06  ? 37  LEU C N   1 
ATOM   4766 C CA  . LEU C 1 38  ? -11.699 65.264  115.849 1.00 45.75  ? 37  LEU C CA  1 
ATOM   4767 C C   . LEU C 1 38  ? -12.194 65.619  117.262 1.00 46.49  ? 37  LEU C C   1 
ATOM   4768 O O   . LEU C 1 38  ? -12.905 64.841  117.895 1.00 46.37  ? 37  LEU C O   1 
ATOM   4769 C CB  . LEU C 1 38  ? -12.186 66.298  114.825 1.00 45.55  ? 37  LEU C CB  1 
ATOM   4770 C CG  . LEU C 1 38  ? -11.717 66.210  113.368 1.00 44.85  ? 37  LEU C CG  1 
ATOM   4771 C CD1 . LEU C 1 38  ? -12.266 67.373  112.586 1.00 44.61  ? 37  LEU C CD1 1 
ATOM   4772 C CD2 . LEU C 1 38  ? -10.211 66.163  113.250 1.00 44.11  ? 37  LEU C CD2 1 
ATOM   4773 N N   . ASP C 1 39  ? -11.820 66.802  117.742 1.00 47.80  ? 38  ASP C N   1 
ATOM   4774 C CA  . ASP C 1 39  ? -12.236 67.284  119.061 1.00 48.67  ? 38  ASP C CA  1 
ATOM   4775 C C   . ASP C 1 39  ? -13.294 68.373  118.975 1.00 49.05  ? 38  ASP C C   1 
ATOM   4776 O O   . ASP C 1 39  ? -14.509 68.113  118.972 1.00 49.49  ? 38  ASP C O   1 
ATOM   4777 C CB  . ASP C 1 39  ? -11.033 67.848  119.819 1.00 48.67  ? 38  ASP C CB  1 
ATOM   4778 C CG  . ASP C 1 39  ? -9.954  66.809  120.073 1.00 50.52  ? 38  ASP C CG  1 
ATOM   4779 O OD1 . ASP C 1 39  ? -10.273 65.622  120.313 1.00 51.79  ? 38  ASP C OD1 1 
ATOM   4780 O OD2 . ASP C 1 39  ? -8.742  67.099  120.073 1.00 53.23  ? 38  ASP C OD2 1 
ATOM   4781 N N   . THR C 1 40  ? -12.794 69.599  118.889 1.00 49.61  ? 39  THR C N   1 
ATOM   4782 C CA  . THR C 1 40  ? -13.561 70.840  119.013 1.00 49.72  ? 39  THR C CA  1 
ATOM   4783 C C   . THR C 1 40  ? -13.837 71.195  120.466 1.00 49.25  ? 39  THR C C   1 
ATOM   4784 O O   . THR C 1 40  ? -14.246 72.318  120.765 1.00 49.86  ? 39  THR C O   1 
ATOM   4785 C CB  . THR C 1 40  ? -14.854 70.879  118.135 1.00 50.28  ? 39  THR C CB  1 
ATOM   4786 O OG1 . THR C 1 40  ? -15.160 69.574  117.612 1.00 50.12  ? 39  THR C OG1 1 
ATOM   4787 C CG2 . THR C 1 40  ? -14.619 71.767  116.875 1.00 50.47  ? 39  THR C CG2 1 
ATOM   4788 N N   . GLU C 1 41  ? -13.584 70.260  121.376 1.00 48.16  ? 40  GLU C N   1 
ATOM   4789 C CA  . GLU C 1 41  ? -13.670 70.590  122.795 1.00 47.23  ? 40  GLU C CA  1 
ATOM   4790 C C   . GLU C 1 41  ? -12.297 70.644  123.471 1.00 46.66  ? 40  GLU C C   1 
ATOM   4791 O O   . GLU C 1 41  ? -12.152 71.280  124.516 1.00 46.85  ? 40  GLU C O   1 
ATOM   4792 C CB  . GLU C 1 41  ? -14.607 69.630  123.526 1.00 47.08  ? 40  GLU C CB  1 
ATOM   4793 C CG  . GLU C 1 41  ? -16.075 69.855  123.213 1.00 46.09  ? 40  GLU C CG  1 
ATOM   4794 C CD  . GLU C 1 41  ? -16.553 69.027  122.037 1.00 45.31  ? 40  GLU C CD  1 
ATOM   4795 O OE1 . GLU C 1 41  ? -17.223 69.593  121.147 1.00 45.47  ? 40  GLU C OE1 1 
ATOM   4796 O OE2 . GLU C 1 41  ? -16.267 67.809  122.000 1.00 44.94  ? 40  GLU C OE2 1 
ATOM   4797 N N   . THR C 1 42  ? -11.303 69.983  122.870 1.00 45.57  ? 41  THR C N   1 
ATOM   4798 C CA  . THR C 1 42  ? -9.968  69.870  123.462 1.00 44.93  ? 41  THR C CA  1 
ATOM   4799 C C   . THR C 1 42  ? -8.833  70.375  122.556 1.00 44.19  ? 41  THR C C   1 
ATOM   4800 O O   . THR C 1 42  ? -8.536  71.564  122.553 1.00 43.72  ? 41  THR C O   1 
ATOM   4801 C CB  . THR C 1 42  ? -9.689  68.424  123.966 1.00 44.89  ? 41  THR C CB  1 
ATOM   4802 O OG1 . THR C 1 42  ? -10.316 67.462  123.099 1.00 45.77  ? 41  THR C OG1 1 
ATOM   4803 C CG2 . THR C 1 42  ? -10.401 68.197  125.275 1.00 45.46  ? 41  THR C CG2 1 
ATOM   4804 N N   . GLU C 1 43  ? -8.223  69.477  121.784 1.00 43.33  ? 42  GLU C N   1 
ATOM   4805 C CA  . GLU C 1 43  ? -7.006  69.801  121.039 1.00 42.59  ? 42  GLU C CA  1 
ATOM   4806 C C   . GLU C 1 43  ? -7.192  70.017  119.525 1.00 40.73  ? 42  GLU C C   1 
ATOM   4807 O O   . GLU C 1 43  ? -6.276  70.468  118.847 1.00 40.28  ? 42  GLU C O   1 
ATOM   4808 C CB  . GLU C 1 43  ? -5.917  68.757  121.322 1.00 43.27  ? 42  GLU C CB  1 
ATOM   4809 C CG  . GLU C 1 43  ? -5.450  68.699  122.780 1.00 46.90  ? 42  GLU C CG  1 
ATOM   4810 C CD  . GLU C 1 43  ? -5.130  70.071  123.389 1.00 51.84  ? 42  GLU C CD  1 
ATOM   4811 O OE1 . GLU C 1 43  ? -4.030  70.631  123.125 1.00 52.53  ? 42  GLU C OE1 1 
ATOM   4812 O OE2 . GLU C 1 43  ? -5.980  70.588  124.153 1.00 53.80  ? 42  GLU C OE2 1 
ATOM   4813 N N   . GLY C 1 44  ? -8.376  69.706  119.007 1.00 39.25  ? 43  GLY C N   1 
ATOM   4814 C CA  . GLY C 1 44  ? -8.682  69.924  117.603 1.00 37.10  ? 43  GLY C CA  1 
ATOM   4815 C C   . GLY C 1 44  ? -8.128  68.830  116.711 1.00 35.89  ? 43  GLY C C   1 
ATOM   4816 O O   . GLY C 1 44  ? -8.188  67.652  117.065 1.00 35.84  ? 43  GLY C O   1 
ATOM   4817 N N   . VAL C 1 45  ? -7.596  69.215  115.551 1.00 34.52  ? 44  VAL C N   1 
ATOM   4818 C CA  . VAL C 1 45  ? -7.078  68.249  114.590 1.00 33.24  ? 44  VAL C CA  1 
ATOM   4819 C C   . VAL C 1 45  ? -5.723  67.802  115.124 1.00 32.94  ? 44  VAL C C   1 
ATOM   4820 O O   . VAL C 1 45  ? -4.885  68.634  115.445 1.00 32.90  ? 44  VAL C O   1 
ATOM   4821 C CB  . VAL C 1 45  ? -6.964  68.843  113.141 1.00 33.01  ? 44  VAL C CB  1 
ATOM   4822 C CG1 . VAL C 1 45  ? -6.515  67.783  112.132 1.00 31.55  ? 44  VAL C CG1 1 
ATOM   4823 C CG2 . VAL C 1 45  ? -8.280  69.448  112.689 1.00 32.42  ? 44  VAL C CG2 1 
ATOM   4824 N N   . PRO C 1 46  ? -5.515  66.498  115.265 1.00 32.74  ? 45  PRO C N   1 
ATOM   4825 C CA  . PRO C 1 46  ? -4.259  66.009  115.855 1.00 32.97  ? 45  PRO C CA  1 
ATOM   4826 C C   . PRO C 1 46  ? -3.079  66.301  114.933 1.00 33.34  ? 45  PRO C C   1 
ATOM   4827 O O   . PRO C 1 46  ? -3.210  66.180  113.718 1.00 33.66  ? 45  PRO C O   1 
ATOM   4828 C CB  . PRO C 1 46  ? -4.489  64.501  116.028 1.00 32.85  ? 45  PRO C CB  1 
ATOM   4829 C CG  . PRO C 1 46  ? -5.758  64.162  115.289 1.00 32.98  ? 45  PRO C CG  1 
ATOM   4830 C CD  . PRO C 1 46  ? -6.443  65.413  114.893 1.00 32.49  ? 45  PRO C CD  1 
ATOM   4831 N N   . SER C 1 47  ? -1.949  66.707  115.495 1.00 33.63  ? 46  SER C N   1 
ATOM   4832 C CA  . SER C 1 47  ? -0.802  67.083  114.679 1.00 34.23  ? 46  SER C CA  1 
ATOM   4833 C C   . SER C 1 47  ? -0.353  65.950  113.762 1.00 34.55  ? 46  SER C C   1 
ATOM   4834 O O   . SER C 1 47  ? 0.145   66.214  112.677 1.00 35.07  ? 46  SER C O   1 
ATOM   4835 C CB  . SER C 1 47  ? 0.355   67.563  115.545 1.00 34.31  ? 46  SER C CB  1 
ATOM   4836 O OG  . SER C 1 47  ? 0.825   66.505  116.353 1.00 34.55  ? 46  SER C OG  1 
ATOM   4837 N N   . THR C 1 48  ? -0.548  64.698  114.185 1.00 34.76  ? 47  THR C N   1 
ATOM   4838 C CA  . THR C 1 48  ? -0.269  63.533  113.341 1.00 35.06  ? 47  THR C CA  1 
ATOM   4839 C C   . THR C 1 48  ? -1.082  63.565  112.046 1.00 34.37  ? 47  THR C C   1 
ATOM   4840 O O   . THR C 1 48  ? -0.593  63.189  110.985 1.00 34.28  ? 47  THR C O   1 
ATOM   4841 C CB  . THR C 1 48  ? -0.565  62.232  114.093 1.00 35.26  ? 47  THR C CB  1 
ATOM   4842 O OG1 . THR C 1 48  ? 0.406   62.061  115.131 1.00 39.04  ? 47  THR C OG1 1 
ATOM   4843 C CG2 . THR C 1 48  ? -0.297  61.033  113.208 1.00 35.47  ? 47  THR C CG2 1 
ATOM   4844 N N   . ALA C 1 49  ? -2.325  64.016  112.149 1.00 33.64  ? 48  ALA C N   1 
ATOM   4845 C CA  . ALA C 1 49  ? -3.216  64.071  111.007 1.00 32.98  ? 48  ALA C CA  1 
ATOM   4846 C C   . ALA C 1 49  ? -2.826  65.239  110.091 1.00 32.82  ? 48  ALA C C   1 
ATOM   4847 O O   . ALA C 1 49  ? -2.925  65.137  108.864 1.00 32.13  ? 48  ALA C O   1 
ATOM   4848 C CB  . ALA C 1 49  ? -4.667  64.196  111.477 1.00 32.84  ? 48  ALA C CB  1 
ATOM   4849 N N   . ILE C 1 50  ? -2.356  66.332  110.696 1.00 32.71  ? 49  ILE C N   1 
ATOM   4850 C CA  . ILE C 1 50  ? -1.994  67.532  109.945 1.00 33.10  ? 49  ILE C CA  1 
ATOM   4851 C C   . ILE C 1 50  ? -0.724  67.312  109.126 1.00 33.43  ? 49  ILE C C   1 
ATOM   4852 O O   . ILE C 1 50  ? -0.585  67.844  108.027 1.00 33.78  ? 49  ILE C O   1 
ATOM   4853 C CB  . ILE C 1 50  ? -1.856  68.736  110.875 1.00 32.90  ? 49  ILE C CB  1 
ATOM   4854 C CG1 . ILE C 1 50  ? -3.229  69.351  111.129 1.00 32.38  ? 49  ILE C CG1 1 
ATOM   4855 C CG2 . ILE C 1 50  ? -0.877  69.765  110.297 1.00 32.93  ? 49  ILE C CG2 1 
ATOM   4856 C CD1 . ILE C 1 50  ? -3.358  70.011  112.492 1.00 34.35  ? 49  ILE C CD1 1 
ATOM   4857 N N   . ARG C 1 51  ? 0.188   66.509  109.656 1.00 33.71  ? 50  ARG C N   1 
ATOM   4858 C CA  . ARG C 1 51  ? 1.377   66.142  108.911 1.00 33.65  ? 50  ARG C CA  1 
ATOM   4859 C C   . ARG C 1 51  ? 1.080   65.111  107.836 1.00 33.60  ? 50  ARG C C   1 
ATOM   4860 O O   . ARG C 1 51  ? 1.541   65.277  106.712 1.00 33.94  ? 50  ARG C O   1 
ATOM   4861 C CB  . ARG C 1 51  ? 2.467   65.637  109.840 1.00 33.91  ? 50  ARG C CB  1 
ATOM   4862 C CG  . ARG C 1 51  ? 3.094   66.715  110.713 1.00 34.23  ? 50  ARG C CG  1 
ATOM   4863 C CD  . ARG C 1 51  ? 4.208   66.163  111.571 1.00 34.34  ? 50  ARG C CD  1 
ATOM   4864 N NE  . ARG C 1 51  ? 4.823   67.189  112.396 1.00 34.61  ? 50  ARG C NE  1 
ATOM   4865 C CZ  . ARG C 1 51  ? 5.595   66.941  113.443 1.00 33.73  ? 50  ARG C CZ  1 
ATOM   4866 N NH1 . ARG C 1 51  ? 5.851   65.691  113.805 1.00 31.99  ? 50  ARG C NH1 1 
ATOM   4867 N NH2 . ARG C 1 51  ? 6.118   67.951  114.125 1.00 33.65  ? 50  ARG C NH2 1 
ATOM   4868 N N   . GLU C 1 52  ? 0.322   64.060  108.163 1.00 33.32  ? 51  GLU C N   1 
ATOM   4869 C CA  . GLU C 1 52  ? 0.040   63.001  107.186 1.00 33.48  ? 51  GLU C CA  1 
ATOM   4870 C C   . GLU C 1 52  ? -0.541  63.597  105.914 1.00 32.93  ? 51  GLU C C   1 
ATOM   4871 O O   . GLU C 1 52  ? 0.053   63.462  104.853 1.00 32.44  ? 51  GLU C O   1 
ATOM   4872 C CB  . GLU C 1 52  ? -0.872  61.885  107.734 1.00 33.62  ? 51  GLU C CB  1 
ATOM   4873 C CG  . GLU C 1 52  ? -1.515  61.029  106.638 1.00 36.44  ? 51  GLU C CG  1 
ATOM   4874 C CD  . GLU C 1 52  ? -1.622  59.545  106.968 1.00 42.55  ? 51  GLU C CD  1 
ATOM   4875 O OE1 . GLU C 1 52  ? -2.163  59.222  108.053 1.00 43.24  ? 51  GLU C OE1 1 
ATOM   4876 O OE2 . GLU C 1 52  ? -1.180  58.691  106.130 1.00 44.95  ? 51  GLU C OE2 1 
ATOM   4877 N N   . ILE C 1 53  ? -1.687  64.266  106.056 1.00 32.64  ? 52  ILE C N   1 
ATOM   4878 C CA  . ILE C 1 53  ? -2.405  64.914  104.962 1.00 32.49  ? 52  ILE C CA  1 
ATOM   4879 C C   . ILE C 1 53  ? -1.588  65.959  104.213 1.00 32.76  ? 52  ILE C C   1 
ATOM   4880 O O   . ILE C 1 53  ? -1.455  65.868  102.990 1.00 33.03  ? 52  ILE C O   1 
ATOM   4881 C CB  . ILE C 1 53  ? -3.759  65.515  105.450 1.00 31.99  ? 52  ILE C CB  1 
ATOM   4882 C CG1 . ILE C 1 53  ? -4.646  64.416  106.036 1.00 31.77  ? 52  ILE C CG1 1 
ATOM   4883 C CG2 . ILE C 1 53  ? -4.500  66.150  104.287 1.00 32.30  ? 52  ILE C CG2 1 
ATOM   4884 C CD1 . ILE C 1 53  ? -5.705  64.903  106.982 1.00 30.08  ? 52  ILE C CD1 1 
ATOM   4885 N N   . SER C 1 54  ? -1.039  66.940  104.920 1.00 33.22  ? 53  SER C N   1 
ATOM   4886 C CA  . SER C 1 54  ? -0.295  68.017  104.251 1.00 34.33  ? 53  SER C CA  1 
ATOM   4887 C C   . SER C 1 54  ? 0.887   67.494  103.449 1.00 35.16  ? 53  SER C C   1 
ATOM   4888 O O   . SER C 1 54  ? 1.250   68.081  102.419 1.00 35.92  ? 53  SER C O   1 
ATOM   4889 C CB  . SER C 1 54  ? 0.198   69.074  105.242 1.00 34.05  ? 53  SER C CB  1 
ATOM   4890 O OG  . SER C 1 54  ? 1.058   68.504  106.216 1.00 35.10  ? 53  SER C OG  1 
ATOM   4891 N N   . LEU C 1 55  ? 1.480   66.397  103.917 1.00 35.34  ? 54  LEU C N   1 
ATOM   4892 C CA  . LEU C 1 55  ? 2.671   65.844  103.286 1.00 36.13  ? 54  LEU C CA  1 
ATOM   4893 C C   . LEU C 1 55  ? 2.332   64.859  102.185 1.00 36.87  ? 54  LEU C C   1 
ATOM   4894 O O   . LEU C 1 55  ? 3.025   64.807  101.171 1.00 36.64  ? 54  LEU C O   1 
ATOM   4895 C CB  . LEU C 1 55  ? 3.609   65.219  104.322 1.00 35.66  ? 54  LEU C CB  1 
ATOM   4896 C CG  . LEU C 1 55  ? 4.240   66.233  105.296 1.00 35.78  ? 54  LEU C CG  1 
ATOM   4897 C CD1 . LEU C 1 55  ? 5.034   65.528  106.391 1.00 35.58  ? 54  LEU C CD1 1 
ATOM   4898 C CD2 . LEU C 1 55  ? 5.107   67.261  104.583 1.00 35.08  ? 54  LEU C CD2 1 
ATOM   4899 N N   . LEU C 1 56  ? 1.256   64.098  102.383 1.00 37.91  ? 55  LEU C N   1 
ATOM   4900 C CA  . LEU C 1 56  ? 0.813   63.110  101.407 1.00 39.08  ? 55  LEU C CA  1 
ATOM   4901 C C   . LEU C 1 56  ? 0.196   63.763  100.177 1.00 39.77  ? 55  LEU C C   1 
ATOM   4902 O O   . LEU C 1 56  ? 0.162   63.169  99.097  1.00 39.70  ? 55  LEU C O   1 
ATOM   4903 C CB  . LEU C 1 56  ? -0.176  62.140  102.049 1.00 39.12  ? 55  LEU C CB  1 
ATOM   4904 C CG  . LEU C 1 56  ? -0.231  60.672  101.612 1.00 39.61  ? 55  LEU C CG  1 
ATOM   4905 C CD1 . LEU C 1 56  ? 1.139   60.087  101.286 1.00 41.42  ? 55  LEU C CD1 1 
ATOM   4906 C CD2 . LEU C 1 56  ? -0.893  59.887  102.703 1.00 39.20  ? 55  LEU C CD2 1 
ATOM   4907 N N   . LYS C 1 57  ? -0.305  64.981  100.357 1.00 41.21  ? 56  LYS C N   1 
ATOM   4908 C CA  . LYS C 1 57  ? -0.854  65.783  99.268  1.00 42.60  ? 56  LYS C CA  1 
ATOM   4909 C C   . LYS C 1 57  ? 0.196   66.079  98.199  1.00 43.21  ? 56  LYS C C   1 
ATOM   4910 O O   . LYS C 1 57  ? -0.121  66.129  97.012  1.00 43.83  ? 56  LYS C O   1 
ATOM   4911 C CB  . LYS C 1 57  ? -1.408  67.099  99.809  1.00 42.66  ? 56  LYS C CB  1 
ATOM   4912 C CG  . LYS C 1 57  ? -2.848  67.012  100.237 1.00 44.47  ? 56  LYS C CG  1 
ATOM   4913 C CD  . LYS C 1 57  ? -3.436  68.384  100.462 1.00 46.76  ? 56  LYS C CD  1 
ATOM   4914 C CE  . LYS C 1 57  ? -4.612  68.611  99.518  1.00 48.35  ? 56  LYS C CE  1 
ATOM   4915 N NZ  . LYS C 1 57  ? -4.316  69.668  98.499  1.00 49.17  ? 56  LYS C NZ  1 
ATOM   4916 N N   . GLU C 1 58  ? 1.441   66.251  98.636  1.00 43.81  ? 57  GLU C N   1 
ATOM   4917 C CA  . GLU C 1 58  ? 2.563   66.580  97.763  1.00 44.27  ? 57  GLU C CA  1 
ATOM   4918 C C   . GLU C 1 58  ? 3.301   65.352  97.233  1.00 44.26  ? 57  GLU C C   1 
ATOM   4919 O O   . GLU C 1 58  ? 4.248   65.483  96.452  1.00 44.78  ? 57  GLU C O   1 
ATOM   4920 C CB  . GLU C 1 58  ? 3.559   67.460  98.515  1.00 44.55  ? 57  GLU C CB  1 
ATOM   4921 C CG  . GLU C 1 58  ? 2.944   68.659  99.218  1.00 45.73  ? 57  GLU C CG  1 
ATOM   4922 C CD  . GLU C 1 58  ? 3.963   69.737  99.525  1.00 48.14  ? 57  GLU C CD  1 
ATOM   4923 O OE1 . GLU C 1 58  ? 5.182   69.437  99.502  1.00 48.26  ? 57  GLU C OE1 1 
ATOM   4924 O OE2 . GLU C 1 58  ? 3.543   70.892  99.786  1.00 49.91  ? 57  GLU C OE2 1 
ATOM   4925 N N   . LEU C 1 59  ? 2.880   64.164  97.645  1.00 43.80  ? 58  LEU C N   1 
ATOM   4926 C CA  . LEU C 1 59  ? 3.637   62.966  97.319  1.00 43.73  ? 58  LEU C CA  1 
ATOM   4927 C C   . LEU C 1 59  ? 2.928   62.089  96.289  1.00 43.79  ? 58  LEU C C   1 
ATOM   4928 O O   . LEU C 1 59  ? 2.426   61.001  96.595  1.00 44.14  ? 58  LEU C O   1 
ATOM   4929 C CB  . LEU C 1 59  ? 4.022   62.195  98.590  1.00 43.75  ? 58  LEU C CB  1 
ATOM   4930 C CG  . LEU C 1 59  ? 4.845   62.980  99.619  1.00 43.59  ? 58  LEU C CG  1 
ATOM   4931 C CD1 . LEU C 1 59  ? 4.998   62.192  100.915 1.00 44.53  ? 58  LEU C CD1 1 
ATOM   4932 C CD2 . LEU C 1 59  ? 6.203   63.403  99.081  1.00 43.17  ? 58  LEU C CD2 1 
ATOM   4933 N N   . ASN C 1 60  ? 2.900   62.595  95.062  1.00 43.47  ? 59  ASN C N   1 
ATOM   4934 C CA  . ASN C 1 60  ? 2.300   61.918  93.927  1.00 43.36  ? 59  ASN C CA  1 
ATOM   4935 C C   . ASN C 1 60  ? 3.338   61.027  93.242  1.00 42.38  ? 59  ASN C C   1 
ATOM   4936 O O   . ASN C 1 60  ? 4.164   61.509  92.469  1.00 42.69  ? 59  ASN C O   1 
ATOM   4937 C CB  . ASN C 1 60  ? 1.741   62.983  92.970  1.00 43.91  ? 59  ASN C CB  1 
ATOM   4938 C CG  . ASN C 1 60  ? 1.190   62.394  91.674  1.00 46.61  ? 59  ASN C CG  1 
ATOM   4939 O OD1 . ASN C 1 60  ? 1.589   62.808  90.567  1.00 50.15  ? 59  ASN C OD1 1 
ATOM   4940 N ND2 . ASN C 1 60  ? 0.261   61.442  91.796  1.00 47.97  ? 59  ASN C ND2 1 
ATOM   4941 N N   . HIS C 1 61  ? 3.306   59.732  93.548  1.00 41.36  ? 60  HIS C N   1 
ATOM   4942 C CA  . HIS C 1 61  ? 4.288   58.764  93.037  1.00 40.29  ? 60  HIS C CA  1 
ATOM   4943 C C   . HIS C 1 61  ? 3.698   57.343  92.996  1.00 39.73  ? 60  HIS C C   1 
ATOM   4944 O O   . HIS C 1 61  ? 2.932   56.967  93.891  1.00 40.30  ? 60  HIS C O   1 
ATOM   4945 C CB  . HIS C 1 61  ? 5.570   58.793  93.887  1.00 40.21  ? 60  HIS C CB  1 
ATOM   4946 C CG  . HIS C 1 61  ? 6.670   57.919  93.361  1.00 40.18  ? 60  HIS C CG  1 
ATOM   4947 N ND1 . HIS C 1 61  ? 7.749   58.417  92.662  1.00 40.67  ? 60  HIS C ND1 1 
ATOM   4948 C CD2 . HIS C 1 61  ? 6.854   56.579  93.429  1.00 39.32  ? 60  HIS C CD2 1 
ATOM   4949 C CE1 . HIS C 1 61  ? 8.548   57.421  92.318  1.00 40.18  ? 60  HIS C CE1 1 
ATOM   4950 N NE2 . HIS C 1 61  ? 8.027   56.294  92.770  1.00 40.46  ? 60  HIS C NE2 1 
ATOM   4951 N N   . PRO C 1 62  ? 4.030   56.563  91.958  1.00 38.84  ? 61  PRO C N   1 
ATOM   4952 C CA  . PRO C 1 62  ? 3.568   55.169  91.836  1.00 37.96  ? 61  PRO C CA  1 
ATOM   4953 C C   . PRO C 1 62  ? 3.829   54.263  93.049  1.00 37.10  ? 61  PRO C C   1 
ATOM   4954 O O   . PRO C 1 62  ? 3.087   53.298  93.234  1.00 36.98  ? 61  PRO C O   1 
ATOM   4955 C CB  . PRO C 1 62  ? 4.366   54.649  90.635  1.00 38.02  ? 61  PRO C CB  1 
ATOM   4956 C CG  . PRO C 1 62  ? 4.623   55.837  89.834  1.00 38.03  ? 61  PRO C CG  1 
ATOM   4957 C CD  . PRO C 1 62  ? 4.831   56.968  90.784  1.00 38.54  ? 61  PRO C CD  1 
ATOM   4958 N N   . ASN C 1 63  ? 4.847   54.556  93.852  1.00 36.15  ? 62  ASN C N   1 
ATOM   4959 C CA  . ASN C 1 63  ? 5.202   53.683  94.979  1.00 35.48  ? 62  ASN C CA  1 
ATOM   4960 C C   . ASN C 1 63  ? 4.872   54.242  96.366  1.00 35.42  ? 62  ASN C C   1 
ATOM   4961 O O   . ASN C 1 63  ? 5.380   53.761  97.383  1.00 35.63  ? 62  ASN C O   1 
ATOM   4962 C CB  . ASN C 1 63  ? 6.672   53.270  94.905  1.00 34.80  ? 62  ASN C CB  1 
ATOM   4963 C CG  . ASN C 1 63  ? 6.968   52.403  93.710  1.00 34.81  ? 62  ASN C CG  1 
ATOM   4964 O OD1 . ASN C 1 63  ? 7.804   52.755  92.880  1.00 36.45  ? 62  ASN C OD1 1 
ATOM   4965 N ND2 . ASN C 1 63  ? 6.297   51.253  93.613  1.00 33.11  ? 62  ASN C ND2 1 
ATOM   4966 N N   . ILE C 1 64  ? 4.033   55.273  96.396  1.00 35.00  ? 63  ILE C N   1 
ATOM   4967 C CA  . ILE C 1 64  ? 3.497   55.821  97.638  1.00 34.14  ? 63  ILE C CA  1 
ATOM   4968 C C   . ILE C 1 64  ? 1.987   55.667  97.548  1.00 34.04  ? 63  ILE C C   1 
ATOM   4969 O O   . ILE C 1 64  ? 1.406   55.994  96.505  1.00 34.46  ? 63  ILE C O   1 
ATOM   4970 C CB  . ILE C 1 64  ? 3.904   57.292  97.788  1.00 33.73  ? 63  ILE C CB  1 
ATOM   4971 C CG1 . ILE C 1 64  ? 5.429   57.397  97.873  1.00 32.66  ? 63  ILE C CG1 1 
ATOM   4972 C CG2 . ILE C 1 64  ? 3.250   57.914  99.023  1.00 34.58  ? 63  ILE C CG2 1 
ATOM   4973 C CD1 . ILE C 1 64  ? 5.967   58.796  97.823  1.00 31.37  ? 63  ILE C CD1 1 
ATOM   4974 N N   . VAL C 1 65  ? 1.353   55.141  98.603  1.00 33.45  ? 64  VAL C N   1 
ATOM   4975 C CA  . VAL C 1 65  ? -0.103  54.986  98.603  1.00 32.54  ? 64  VAL C CA  1 
ATOM   4976 C C   . VAL C 1 65  ? -0.727  56.365  98.424  1.00 32.02  ? 64  VAL C C   1 
ATOM   4977 O O   . VAL C 1 65  ? -0.392  57.303  99.135  1.00 31.83  ? 64  VAL C O   1 
ATOM   4978 C CB  . VAL C 1 65  ? -0.641  54.316  99.877  1.00 32.90  ? 64  VAL C CB  1 
ATOM   4979 C CG1 . VAL C 1 65  ? -2.173  54.388  99.931  1.00 32.97  ? 64  VAL C CG1 1 
ATOM   4980 C CG2 . VAL C 1 65  ? -0.184  52.865  99.952  1.00 33.14  ? 64  VAL C CG2 1 
ATOM   4981 N N   . LYS C 1 66  ? -1.604  56.479  97.434  1.00 30.99  ? 65  LYS C N   1 
ATOM   4982 C CA  . LYS C 1 66  ? -2.150  57.762  97.035  1.00 30.49  ? 65  LYS C CA  1 
ATOM   4983 C C   . LYS C 1 66  ? -3.301  58.173  97.929  1.00 29.09  ? 65  LYS C C   1 
ATOM   4984 O O   . LYS C 1 66  ? -4.209  57.385  98.196  1.00 28.80  ? 65  LYS C O   1 
ATOM   4985 C CB  . LYS C 1 66  ? -2.618  57.703  95.577  1.00 30.99  ? 65  LYS C CB  1 
ATOM   4986 C CG  . LYS C 1 66  ? -2.568  59.036  94.850  1.00 34.13  ? 65  LYS C CG  1 
ATOM   4987 C CD  . LYS C 1 66  ? -2.761  58.828  93.344  1.00 39.51  ? 65  LYS C CD  1 
ATOM   4988 C CE  . LYS C 1 66  ? -4.049  59.476  92.853  1.00 42.53  ? 65  LYS C CE  1 
ATOM   4989 N NZ  . LYS C 1 66  ? -4.402  59.039  91.457  1.00 45.85  ? 65  LYS C NZ  1 
ATOM   4990 N N   . LEU C 1 67  ? -3.251  59.407  98.404  1.00 28.10  ? 66  LEU C N   1 
ATOM   4991 C CA  . LEU C 1 67  ? -4.396  60.007  99.068  1.00 27.71  ? 66  LEU C CA  1 
ATOM   4992 C C   . LEU C 1 67  ? -5.313  60.622  98.006  1.00 27.53  ? 66  LEU C C   1 
ATOM   4993 O O   . LEU C 1 67  ? -4.926  61.550  97.300  1.00 26.65  ? 66  LEU C O   1 
ATOM   4994 C CB  . LEU C 1 67  ? -3.942  61.051  100.082 1.00 27.61  ? 66  LEU C CB  1 
ATOM   4995 C CG  . LEU C 1 67  ? -5.018  61.870  100.789 1.00 27.83  ? 66  LEU C CG  1 
ATOM   4996 C CD1 . LEU C 1 67  ? -5.867  60.982  101.695 1.00 27.95  ? 66  LEU C CD1 1 
ATOM   4997 C CD2 . LEU C 1 67  ? -4.351  62.965  101.597 1.00 27.82  ? 66  LEU C CD2 1 
ATOM   4998 N N   . LEU C 1 68  ? -6.526  60.083  97.904  1.00 27.66  ? 67  LEU C N   1 
ATOM   4999 C CA  . LEU C 1 68  ? -7.488  60.461  96.866  1.00 27.70  ? 67  LEU C CA  1 
ATOM   5000 C C   . LEU C 1 68  ? -8.375  61.635  97.268  1.00 28.19  ? 67  LEU C C   1 
ATOM   5001 O O   . LEU C 1 68  ? -8.716  62.467  96.430  1.00 28.69  ? 67  LEU C O   1 
ATOM   5002 C CB  . LEU C 1 68  ? -8.350  59.241  96.461  1.00 27.06  ? 67  LEU C CB  1 
ATOM   5003 C CG  . LEU C 1 68  ? -7.551  57.960  96.153  1.00 26.58  ? 67  LEU C CG  1 
ATOM   5004 C CD1 . LEU C 1 68  ? -8.431  56.731  95.969  1.00 24.68  ? 67  LEU C CD1 1 
ATOM   5005 C CD2 . LEU C 1 68  ? -6.658  58.145  94.921  1.00 26.27  ? 67  LEU C CD2 1 
ATOM   5006 N N   . ASP C 1 69  ? -8.759  61.702  98.541  1.00 28.56  ? 68  ASP C N   1 
ATOM   5007 C CA  . ASP C 1 69  ? -9.656  62.754  99.014  1.00 28.89  ? 68  ASP C CA  1 
ATOM   5008 C C   . ASP C 1 69  ? -9.581  62.923  100.535 1.00 29.12  ? 68  ASP C C   1 
ATOM   5009 O O   . ASP C 1 69  ? -9.153  62.017  101.247 1.00 28.54  ? 68  ASP C O   1 
ATOM   5010 C CB  . ASP C 1 69  ? -11.095 62.434  98.579  1.00 29.09  ? 68  ASP C CB  1 
ATOM   5011 C CG  . ASP C 1 69  ? -11.996 63.665  98.522  1.00 30.29  ? 68  ASP C CG  1 
ATOM   5012 O OD1 . ASP C 1 69  ? -11.538 64.788  98.831  1.00 31.39  ? 68  ASP C OD1 1 
ATOM   5013 O OD2 . ASP C 1 69  ? -13.197 63.596  98.165  1.00 32.52  ? 68  ASP C OD2 1 
ATOM   5014 N N   . VAL C 1 70  ? -9.978  64.101  101.015 1.00 29.71  ? 69  VAL C N   1 
ATOM   5015 C CA  . VAL C 1 70  ? -10.223 64.337  102.435 1.00 30.52  ? 69  VAL C CA  1 
ATOM   5016 C C   . VAL C 1 70  ? -11.639 64.857  102.550 1.00 30.99  ? 69  VAL C C   1 
ATOM   5017 O O   . VAL C 1 70  ? -11.971 65.870  101.943 1.00 30.94  ? 69  VAL C O   1 
ATOM   5018 C CB  . VAL C 1 70  ? -9.266  65.383  103.059 1.00 30.60  ? 69  VAL C CB  1 
ATOM   5019 C CG1 . VAL C 1 70  ? -9.243  65.246  104.584 1.00 31.24  ? 69  VAL C CG1 1 
ATOM   5020 C CG2 . VAL C 1 70  ? -7.851  65.255  102.502 1.00 31.50  ? 69  VAL C CG2 1 
ATOM   5021 N N   . ILE C 1 71  ? -12.473 64.151  103.308 1.00 31.96  ? 70  ILE C N   1 
ATOM   5022 C CA  . ILE C 1 71  ? -13.873 64.513  103.463 1.00 33.10  ? 70  ILE C CA  1 
ATOM   5023 C C   . ILE C 1 71  ? -14.079 64.995  104.879 1.00 34.46  ? 70  ILE C C   1 
ATOM   5024 O O   . ILE C 1 71  ? -13.766 64.280  105.834 1.00 34.26  ? 70  ILE C O   1 
ATOM   5025 C CB  . ILE C 1 71  ? -14.776 63.324  103.175 1.00 33.31  ? 70  ILE C CB  1 
ATOM   5026 C CG1 . ILE C 1 71  ? -14.688 62.934  101.701 1.00 32.67  ? 70  ILE C CG1 1 
ATOM   5027 C CG2 . ILE C 1 71  ? -16.219 63.639  103.577 1.00 33.09  ? 70  ILE C CG2 1 
ATOM   5028 C CD1 . ILE C 1 71  ? -14.987 61.470  101.468 1.00 34.31  ? 70  ILE C CD1 1 
ATOM   5029 N N   . HIS C 1 72  ? -14.630 66.199  105.004 1.00 35.87  ? 71  HIS C N   1 
ATOM   5030 C CA  . HIS C 1 72  ? -14.481 66.955  106.236 1.00 37.68  ? 71  HIS C CA  1 
ATOM   5031 C C   . HIS C 1 72  ? -15.396 66.639  107.411 1.00 38.98  ? 71  HIS C C   1 
ATOM   5032 O O   . HIS C 1 72  ? -14.936 65.957  108.316 1.00 40.21  ? 71  HIS C O   1 
ATOM   5033 C CB  . HIS C 1 72  ? -14.309 68.451  105.984 1.00 37.26  ? 71  HIS C CB  1 
ATOM   5034 C CG  . HIS C 1 72  ? -12.883 68.842  105.772 1.00 37.30  ? 71  HIS C CG  1 
ATOM   5035 N ND1 . HIS C 1 72  ? -12.233 68.666  104.567 1.00 38.19  ? 71  HIS C ND1 1 
ATOM   5036 C CD2 . HIS C 1 72  ? -11.964 69.348  106.625 1.00 37.23  ? 71  HIS C CD2 1 
ATOM   5037 C CE1 . HIS C 1 72  ? -10.983 69.076  104.681 1.00 37.74  ? 71  HIS C CE1 1 
ATOM   5038 N NE2 . HIS C 1 72  ? -10.796 69.500  105.919 1.00 37.90  ? 71  HIS C NE2 1 
ATOM   5039 N N   . THR C 1 73  ? -16.647 67.085  107.450 1.00 40.05  ? 72  THR C N   1 
ATOM   5040 C CA  . THR C 1 73  ? -17.444 66.834  108.662 1.00 41.05  ? 72  THR C CA  1 
ATOM   5041 C C   . THR C 1 73  ? -16.838 67.598  109.860 1.00 41.32  ? 72  THR C C   1 
ATOM   5042 O O   . THR C 1 73  ? -15.612 67.747  109.969 1.00 40.90  ? 72  THR C O   1 
ATOM   5043 C CB  . THR C 1 73  ? -17.492 65.297  108.940 1.00 41.07  ? 72  THR C CB  1 
ATOM   5044 O OG1 . THR C 1 73  ? -18.538 64.704  108.163 1.00 42.87  ? 72  THR C OG1 1 
ATOM   5045 C CG2 . THR C 1 73  ? -17.880 64.974  110.365 1.00 40.94  ? 72  THR C CG2 1 
ATOM   5046 N N   . GLU C 1 74  ? -17.680 68.078  110.768 1.00 41.81  ? 73  GLU C N   1 
ATOM   5047 C CA  . GLU C 1 74  ? -17.145 68.871  111.872 1.00 42.46  ? 73  GLU C CA  1 
ATOM   5048 C C   . GLU C 1 74  ? -16.552 68.040  113.003 1.00 41.48  ? 73  GLU C C   1 
ATOM   5049 O O   . GLU C 1 74  ? -15.772 68.562  113.795 1.00 41.60  ? 73  GLU C O   1 
ATOM   5050 C CB  . GLU C 1 74  ? -18.162 69.891  112.391 1.00 43.02  ? 73  GLU C CB  1 
ATOM   5051 C CG  . GLU C 1 74  ? -19.123 69.369  113.446 1.00 47.18  ? 73  GLU C CG  1 
ATOM   5052 C CD  . GLU C 1 74  ? -20.214 70.374  113.766 1.00 52.63  ? 73  GLU C CD  1 
ATOM   5053 O OE1 . GLU C 1 74  ? -20.430 70.666  114.965 1.00 53.84  ? 73  GLU C OE1 1 
ATOM   5054 O OE2 . GLU C 1 74  ? -20.845 70.885  112.807 1.00 55.20  ? 73  GLU C OE2 1 
ATOM   5055 N N   . ASN C 1 75  ? -16.907 66.753  113.054 1.00 40.59  ? 74  ASN C N   1 
ATOM   5056 C CA  . ASN C 1 75  ? -16.412 65.829  114.088 1.00 39.78  ? 74  ASN C CA  1 
ATOM   5057 C C   . ASN C 1 75  ? -15.402 64.756  113.637 1.00 39.07  ? 74  ASN C C   1 
ATOM   5058 O O   . ASN C 1 75  ? -14.700 64.176  114.466 1.00 39.20  ? 74  ASN C O   1 
ATOM   5059 C CB  . ASN C 1 75  ? -17.584 65.165  114.817 1.00 39.96  ? 74  ASN C CB  1 
ATOM   5060 C CG  . ASN C 1 75  ? -18.175 66.056  115.891 1.00 41.23  ? 74  ASN C CG  1 
ATOM   5061 O OD1 . ASN C 1 75  ? -17.663 66.133  117.026 1.00 45.14  ? 74  ASN C OD1 1 
ATOM   5062 N ND2 . ASN C 1 75  ? -19.254 66.741  115.546 1.00 41.57  ? 74  ASN C ND2 1 
ATOM   5063 N N   . LYS C 1 76  ? -15.330 64.486  112.337 1.00 38.15  ? 75  LYS C N   1 
ATOM   5064 C CA  . LYS C 1 76  ? -14.422 63.467  111.809 1.00 37.29  ? 75  LYS C CA  1 
ATOM   5065 C C   . LYS C 1 76  ? -13.737 63.945  110.554 1.00 36.10  ? 75  LYS C C   1 
ATOM   5066 O O   . LYS C 1 76  ? -14.236 64.821  109.873 1.00 36.09  ? 75  LYS C O   1 
ATOM   5067 C CB  . LYS C 1 76  ? -15.186 62.194  111.460 1.00 37.41  ? 75  LYS C CB  1 
ATOM   5068 C CG  . LYS C 1 76  ? -15.544 61.329  112.637 1.00 39.66  ? 75  LYS C CG  1 
ATOM   5069 C CD  . LYS C 1 76  ? -17.039 61.444  112.937 1.00 43.93  ? 75  LYS C CD  1 
ATOM   5070 C CE  . LYS C 1 76  ? -17.875 60.576  112.002 1.00 46.39  ? 75  LYS C CE  1 
ATOM   5071 N NZ  . LYS C 1 76  ? -17.215 59.251  111.754 1.00 47.58  ? 75  LYS C NZ  1 
ATOM   5072 N N   . LEU C 1 77  ? -12.587 63.357  110.260 1.00 34.79  ? 76  LEU C N   1 
ATOM   5073 C CA  . LEU C 1 77  ? -11.946 63.479  108.965 1.00 33.59  ? 76  LEU C CA  1 
ATOM   5074 C C   . LEU C 1 77  ? -11.924 62.076  108.369 1.00 33.12  ? 76  LEU C C   1 
ATOM   5075 O O   . LEU C 1 77  ? -11.595 61.104  109.072 1.00 32.53  ? 76  LEU C O   1 
ATOM   5076 C CB  . LEU C 1 77  ? -10.516 63.958  109.145 1.00 33.71  ? 76  LEU C CB  1 
ATOM   5077 C CG  . LEU C 1 77  ? -9.943  65.216  108.507 1.00 33.33  ? 76  LEU C CG  1 
ATOM   5078 C CD1 . LEU C 1 77  ? -11.000 66.207  108.051 1.00 33.85  ? 76  LEU C CD1 1 
ATOM   5079 C CD2 . LEU C 1 77  ? -9.052  65.841  109.527 1.00 31.77  ? 76  LEU C CD2 1 
ATOM   5080 N N   . TYR C 1 78  ? -12.292 61.959  107.095 1.00 32.05  ? 77  TYR C N   1 
ATOM   5081 C CA  . TYR C 1 78  ? -12.098 60.701  106.388 1.00 31.35  ? 77  TYR C CA  1 
ATOM   5082 C C   . TYR C 1 78  ? -11.097 60.890  105.294 1.00 30.06  ? 77  TYR C C   1 
ATOM   5083 O O   . TYR C 1 78  ? -11.285 61.725  104.407 1.00 30.20  ? 77  TYR C O   1 
ATOM   5084 C CB  . TYR C 1 78  ? -13.376 60.206  105.753 1.00 31.98  ? 77  TYR C CB  1 
ATOM   5085 C CG  . TYR C 1 78  ? -14.446 59.813  106.719 1.00 34.31  ? 77  TYR C CG  1 
ATOM   5086 C CD1 . TYR C 1 78  ? -14.605 58.486  107.093 1.00 35.90  ? 77  TYR C CD1 1 
ATOM   5087 C CD2 . TYR C 1 78  ? -15.329 60.765  107.230 1.00 35.63  ? 77  TYR C CD2 1 
ATOM   5088 C CE1 . TYR C 1 78  ? -15.605 58.111  107.964 1.00 38.36  ? 77  TYR C CE1 1 
ATOM   5089 C CE2 . TYR C 1 78  ? -16.329 60.405  108.104 1.00 38.85  ? 77  TYR C CE2 1 
ATOM   5090 C CZ  . TYR C 1 78  ? -16.464 59.070  108.467 1.00 40.11  ? 77  TYR C CZ  1 
ATOM   5091 O OH  . TYR C 1 78  ? -17.460 58.693  109.335 1.00 43.03  ? 77  TYR C OH  1 
ATOM   5092 N N   . LEU C 1 79  ? -10.038 60.094  105.333 1.00 28.72  ? 78  LEU C N   1 
ATOM   5093 C CA  . LEU C 1 79  ? -9.060  60.132  104.265 1.00 27.29  ? 78  LEU C CA  1 
ATOM   5094 C C   . LEU C 1 79  ? -9.323  58.945  103.359 1.00 26.73  ? 78  LEU C C   1 
ATOM   5095 O O   . LEU C 1 79  ? -9.447  57.820  103.817 1.00 27.16  ? 78  LEU C O   1 
ATOM   5096 C CB  . LEU C 1 79  ? -7.628  60.149  104.806 1.00 27.28  ? 78  LEU C CB  1 
ATOM   5097 C CG  . LEU C 1 79  ? -7.251  60.765  106.163 1.00 25.91  ? 78  LEU C CG  1 
ATOM   5098 C CD1 . LEU C 1 79  ? -5.763  60.913  106.243 1.00 24.00  ? 78  LEU C CD1 1 
ATOM   5099 C CD2 . LEU C 1 79  ? -7.914  62.085  106.452 1.00 26.57  ? 78  LEU C CD2 1 
ATOM   5100 N N   . VAL C 1 80  ? -9.478  59.214  102.072 1.00 26.13  ? 79  VAL C N   1 
ATOM   5101 C CA  . VAL C 1 80  ? -9.701  58.170  101.085 1.00 25.22  ? 79  VAL C CA  1 
ATOM   5102 C C   . VAL C 1 80  ? -8.349  57.855  100.459 1.00 24.86  ? 79  VAL C C   1 
ATOM   5103 O O   . VAL C 1 80  ? -7.668  58.752  99.974  1.00 24.84  ? 79  VAL C O   1 
ATOM   5104 C CB  . VAL C 1 80  ? -10.715 58.639  100.009 1.00 25.34  ? 79  VAL C CB  1 
ATOM   5105 C CG1 . VAL C 1 80  ? -11.110 57.500  99.090  1.00 25.24  ? 79  VAL C CG1 1 
ATOM   5106 C CG2 . VAL C 1 80  ? -11.947 59.260  100.665 1.00 24.34  ? 79  VAL C CG2 1 
ATOM   5107 N N   . PHE C 1 81  ? -7.966  56.579  100.498 1.00 24.82  ? 80  PHE C N   1 
ATOM   5108 C CA  . PHE C 1 81  ? -6.692  56.102  99.964  1.00 24.85  ? 80  PHE C CA  1 
ATOM   5109 C C   . PHE C 1 81  ? -6.928  55.065  98.893  1.00 25.78  ? 80  PHE C C   1 
ATOM   5110 O O   . PHE C 1 81  ? -7.942  54.357  98.948  1.00 25.61  ? 80  PHE C O   1 
ATOM   5111 C CB  . PHE C 1 81  ? -5.889  55.404  101.056 1.00 24.28  ? 80  PHE C CB  1 
ATOM   5112 C CG  . PHE C 1 81  ? -5.279  56.321  102.056 1.00 22.40  ? 80  PHE C CG  1 
ATOM   5113 C CD1 . PHE C 1 81  ? -5.846  56.461  103.318 1.00 22.03  ? 80  PHE C CD1 1 
ATOM   5114 C CD2 . PHE C 1 81  ? -4.123  57.008  101.761 1.00 19.53  ? 80  PHE C CD2 1 
ATOM   5115 C CE1 . PHE C 1 81  ? -5.278  57.305  104.263 1.00 21.41  ? 80  PHE C CE1 1 
ATOM   5116 C CE2 . PHE C 1 81  ? -3.541  57.843  102.697 1.00 19.79  ? 80  PHE C CE2 1 
ATOM   5117 C CZ  . PHE C 1 81  ? -4.116  58.004  103.948 1.00 19.28  ? 80  PHE C CZ  1 
ATOM   5118 N N   . GLU C 1 82  ? -5.993  54.949  97.940  1.00 27.35  ? 81  GLU C N   1 
ATOM   5119 C CA  . GLU C 1 82  ? -5.980  53.777  97.047  1.00 29.45  ? 81  GLU C CA  1 
ATOM   5120 C C   . GLU C 1 82  ? -5.859  52.502  97.889  1.00 30.10  ? 81  GLU C C   1 
ATOM   5121 O O   . GLU C 1 82  ? -5.174  52.477  98.913  1.00 29.51  ? 81  GLU C O   1 
ATOM   5122 C CB  . GLU C 1 82  ? -4.890  53.842  95.956  1.00 29.52  ? 81  GLU C CB  1 
ATOM   5123 C CG  . GLU C 1 82  ? -3.458  53.867  96.464  1.00 31.47  ? 81  GLU C CG  1 
ATOM   5124 C CD  . GLU C 1 82  ? -2.408  53.833  95.361  1.00 34.31  ? 81  GLU C CD  1 
ATOM   5125 O OE1 . GLU C 1 82  ? -2.383  52.864  94.556  1.00 36.58  ? 81  GLU C OE1 1 
ATOM   5126 O OE2 . GLU C 1 82  ? -1.572  54.763  95.312  1.00 34.25  ? 81  GLU C OE2 1 
ATOM   5127 N N   . PHE C 1 83  ? -6.576  51.469  97.467  1.00 31.76  ? 82  PHE C N   1 
ATOM   5128 C CA  . PHE C 1 83  ? -6.624  50.211  98.190  1.00 33.28  ? 82  PHE C CA  1 
ATOM   5129 C C   . PHE C 1 83  ? -5.600  49.221  97.650  1.00 34.75  ? 82  PHE C C   1 
ATOM   5130 O O   . PHE C 1 83  ? -5.559  48.934  96.450  1.00 34.33  ? 82  PHE C O   1 
ATOM   5131 C CB  . PHE C 1 83  ? -8.024  49.604  98.125  1.00 33.09  ? 82  PHE C CB  1 
ATOM   5132 C CG  . PHE C 1 83  ? -8.120  48.250  98.749  1.00 32.66  ? 82  PHE C CG  1 
ATOM   5133 C CD1 . PHE C 1 83  ? -8.131  48.108  100.139 1.00 32.98  ? 82  PHE C CD1 1 
ATOM   5134 C CD2 . PHE C 1 83  ? -8.176  47.112  97.956  1.00 33.42  ? 82  PHE C CD2 1 
ATOM   5135 C CE1 . PHE C 1 83  ? -8.212  46.854  100.731 1.00 32.31  ? 82  PHE C CE1 1 
ATOM   5136 C CE2 . PHE C 1 83  ? -8.261  45.844  98.539  1.00 34.10  ? 82  PHE C CE2 1 
ATOM   5137 C CZ  . PHE C 1 83  ? -8.284  45.719  99.934  1.00 33.33  ? 82  PHE C CZ  1 
ATOM   5138 N N   . LEU C 1 84  ? -4.773  48.708  98.556  1.00 36.63  ? 83  LEU C N   1 
ATOM   5139 C CA  . LEU C 1 84  ? -3.805  47.671  98.220  1.00 38.62  ? 83  LEU C CA  1 
ATOM   5140 C C   . LEU C 1 84  ? -4.216  46.391  98.933  1.00 39.99  ? 83  LEU C C   1 
ATOM   5141 O O   . LEU C 1 84  ? -5.123  46.414  99.764  1.00 40.49  ? 83  LEU C O   1 
ATOM   5142 C CB  . LEU C 1 84  ? -2.396  48.122  98.585  1.00 38.25  ? 83  LEU C CB  1 
ATOM   5143 C CG  . LEU C 1 84  ? -1.876  49.134  97.564  1.00 39.01  ? 83  LEU C CG  1 
ATOM   5144 C CD1 . LEU C 1 84  ? -2.018  50.574  98.061  1.00 39.34  ? 83  LEU C CD1 1 
ATOM   5145 C CD2 . LEU C 1 84  ? -0.453  48.828  97.156  1.00 39.19  ? 83  LEU C CD2 1 
ATOM   5146 N N   . HIS C 1 85  ? -3.576  45.272  98.614  1.00 41.60  ? 84  HIS C N   1 
ATOM   5147 C CA  . HIS C 1 85  ? -4.149  43.975  99.002  1.00 43.18  ? 84  HIS C CA  1 
ATOM   5148 C C   . HIS C 1 85  ? -3.701  43.390  100.342 1.00 42.81  ? 84  HIS C C   1 
ATOM   5149 O O   . HIS C 1 85  ? -4.495  42.760  101.036 1.00 42.65  ? 84  HIS C O   1 
ATOM   5150 C CB  . HIS C 1 85  ? -4.075  42.982  97.839  1.00 43.84  ? 84  HIS C CB  1 
ATOM   5151 C CG  . HIS C 1 85  ? -4.831  43.448  96.630  1.00 47.85  ? 84  HIS C CG  1 
ATOM   5152 N ND1 . HIS C 1 85  ? -6.097  43.993  96.713  1.00 51.25  ? 84  HIS C ND1 1 
ATOM   5153 C CD2 . HIS C 1 85  ? -4.492  43.488  95.320  1.00 50.63  ? 84  HIS C CD2 1 
ATOM   5154 C CE1 . HIS C 1 85  ? -6.513  44.328  95.504  1.00 52.44  ? 84  HIS C CE1 1 
ATOM   5155 N NE2 . HIS C 1 85  ? -5.557  44.034  94.641  1.00 52.51  ? 84  HIS C NE2 1 
ATOM   5156 N N   . GLN C 1 86  ? -2.448  43.617  100.707 1.00 42.94  ? 85  GLN C N   1 
ATOM   5157 C CA  . GLN C 1 86  ? -1.985  43.312  102.059 1.00 43.43  ? 85  GLN C CA  1 
ATOM   5158 C C   . GLN C 1 86  ? -0.676  44.010  102.339 1.00 43.06  ? 85  GLN C C   1 
ATOM   5159 O O   . GLN C 1 86  ? -0.017  44.495  101.418 1.00 42.79  ? 85  GLN C O   1 
ATOM   5160 C CB  . GLN C 1 86  ? -1.861  41.794  102.326 1.00 43.56  ? 85  GLN C CB  1 
ATOM   5161 C CG  . GLN C 1 86  ? -1.120  40.977  101.272 1.00 44.94  ? 85  GLN C CG  1 
ATOM   5162 C CD  . GLN C 1 86  ? -1.098  39.478  101.611 1.00 48.10  ? 85  GLN C CD  1 
ATOM   5163 O OE1 . GLN C 1 86  ? -2.151  38.861  101.841 1.00 49.35  ? 85  GLN C OE1 1 
ATOM   5164 N NE2 . GLN C 1 86  ? 0.094   38.897  101.646 1.00 47.40  ? 85  GLN C NE2 1 
ATOM   5165 N N   . ASP C 1 87  ? -0.323  44.077  103.621 1.00 42.78  ? 86  ASP C N   1 
ATOM   5166 C CA  . ASP C 1 87  ? 0.983   44.568  104.025 1.00 42.89  ? 86  ASP C CA  1 
ATOM   5167 C C   . ASP C 1 87  ? 2.030   43.490  103.770 1.00 42.24  ? 86  ASP C C   1 
ATOM   5168 O O   . ASP C 1 87  ? 1.696   42.320  103.555 1.00 41.88  ? 86  ASP C O   1 
ATOM   5169 C CB  . ASP C 1 87  ? 0.976   45.006  105.491 1.00 43.43  ? 86  ASP C CB  1 
ATOM   5170 C CG  . ASP C 1 87  ? 0.401   43.946  106.414 1.00 45.73  ? 86  ASP C CG  1 
ATOM   5171 O OD1 . ASP C 1 87  ? 1.193   43.145  106.958 1.00 46.60  ? 86  ASP C OD1 1 
ATOM   5172 O OD2 . ASP C 1 87  ? -0.830  43.834  106.648 1.00 49.02  ? 86  ASP C OD2 1 
ATOM   5173 N N   . LEU C 1 88  ? 3.292   43.900  103.774 1.00 41.85  ? 87  LEU C N   1 
ATOM   5174 C CA  . LEU C 1 88  ? 4.408   43.004  103.492 1.00 41.53  ? 87  LEU C CA  1 
ATOM   5175 C C   . LEU C 1 88  ? 4.617   41.998  104.632 1.00 41.90  ? 87  LEU C C   1 
ATOM   5176 O O   . LEU C 1 88  ? 4.945   40.835  104.383 1.00 41.68  ? 87  LEU C O   1 
ATOM   5177 C CB  . LEU C 1 88  ? 5.677   43.817  103.198 1.00 41.02  ? 87  LEU C CB  1 
ATOM   5178 C CG  . LEU C 1 88  ? 6.928   43.114  102.676 1.00 39.66  ? 87  LEU C CG  1 
ATOM   5179 C CD1 . LEU C 1 88  ? 6.736   42.600  101.266 1.00 38.69  ? 87  LEU C CD1 1 
ATOM   5180 C CD2 . LEU C 1 88  ? 8.107   44.058  102.755 1.00 37.36  ? 87  LEU C CD2 1 
ATOM   5181 N N   . LYS C 1 89  ? 4.398   42.435  105.872 1.00 42.18  ? 88  LYS C N   1 
ATOM   5182 C CA  . LYS C 1 89  ? 4.466   41.517  107.009 1.00 42.91  ? 88  LYS C CA  1 
ATOM   5183 C C   . LYS C 1 89  ? 3.569   40.296  106.807 1.00 42.86  ? 88  LYS C C   1 
ATOM   5184 O O   . LYS C 1 89  ? 4.027   39.173  106.948 1.00 42.76  ? 88  LYS C O   1 
ATOM   5185 C CB  . LYS C 1 89  ? 4.129   42.207  108.328 1.00 42.87  ? 88  LYS C CB  1 
ATOM   5186 C CG  . LYS C 1 89  ? 4.695   41.480  109.555 1.00 44.54  ? 88  LYS C CG  1 
ATOM   5187 C CD  . LYS C 1 89  ? 3.588   40.780  110.373 1.00 48.05  ? 88  LYS C CD  1 
ATOM   5188 C CE  . LYS C 1 89  ? 2.831   41.767  111.285 1.00 49.45  ? 88  LYS C CE  1 
ATOM   5189 N NZ  . LYS C 1 89  ? 2.041   41.132  112.378 1.00 50.86  ? 88  LYS C NZ  1 
ATOM   5190 N N   . LYS C 1 90  ? 2.306   40.523  106.460 1.00 43.08  ? 89  LYS C N   1 
ATOM   5191 C CA  . LYS C 1 90  ? 1.347   39.442  106.237 1.00 43.57  ? 89  LYS C CA  1 
ATOM   5192 C C   . LYS C 1 90  ? 1.765   38.528  105.090 1.00 43.40  ? 89  LYS C C   1 
ATOM   5193 O O   . LYS C 1 90  ? 1.438   37.344  105.081 1.00 43.88  ? 89  LYS C O   1 
ATOM   5194 C CB  . LYS C 1 90  ? -0.056  40.009  105.983 1.00 43.81  ? 89  LYS C CB  1 
ATOM   5195 C CG  . LYS C 1 90  ? -1.190  39.022  106.260 1.00 45.73  ? 89  LYS C CG  1 
ATOM   5196 C CD  . LYS C 1 90  ? -2.567  39.688  106.224 1.00 49.83  ? 89  LYS C CD  1 
ATOM   5197 C CE  . LYS C 1 90  ? -3.635  38.743  105.647 1.00 52.25  ? 89  LYS C CE  1 
ATOM   5198 N NZ  . LYS C 1 90  ? -3.777  38.872  104.157 1.00 53.72  ? 89  LYS C NZ  1 
ATOM   5199 N N   . PHE C 1 91  ? 2.491   39.088  104.131 1.00 43.33  ? 90  PHE C N   1 
ATOM   5200 C CA  . PHE C 1 91  ? 2.965   38.349  102.975 1.00 43.48  ? 90  PHE C CA  1 
ATOM   5201 C C   . PHE C 1 91  ? 4.201   37.524  103.302 1.00 44.38  ? 90  PHE C C   1 
ATOM   5202 O O   . PHE C 1 91  ? 4.372   36.417  102.786 1.00 44.30  ? 90  PHE C O   1 
ATOM   5203 C CB  . PHE C 1 91  ? 3.283   39.307  101.828 1.00 42.85  ? 90  PHE C CB  1 
ATOM   5204 C CG  . PHE C 1 91  ? 3.822   38.633  100.616 1.00 40.43  ? 90  PHE C CG  1 
ATOM   5205 C CD1 . PHE C 1 91  ? 3.049   37.713  99.916  1.00 39.84  ? 90  PHE C CD1 1 
ATOM   5206 C CD2 . PHE C 1 91  ? 5.107   38.911  100.171 1.00 39.45  ? 90  PHE C CD2 1 
ATOM   5207 C CE1 . PHE C 1 91  ? 3.551   37.073  98.772  1.00 39.19  ? 90  PHE C CE1 1 
ATOM   5208 C CE2 . PHE C 1 91  ? 5.624   38.281  99.033  1.00 37.99  ? 90  PHE C CE2 1 
ATOM   5209 C CZ  . PHE C 1 91  ? 4.844   37.366  98.333  1.00 38.28  ? 90  PHE C CZ  1 
ATOM   5210 N N   . MET C 1 92  ? 5.074   38.082  104.133 1.00 45.46  ? 91  MET C N   1 
ATOM   5211 C CA  . MET C 1 92  ? 6.238   37.354  104.603 1.00 46.82  ? 91  MET C CA  1 
ATOM   5212 C C   . MET C 1 92  ? 5.802   36.121  105.401 1.00 47.91  ? 91  MET C C   1 
ATOM   5213 O O   . MET C 1 92  ? 6.195   35.004  105.076 1.00 47.60  ? 91  MET C O   1 
ATOM   5214 C CB  . MET C 1 92  ? 7.185   38.280  105.367 1.00 46.66  ? 91  MET C CB  1 
ATOM   5215 C CG  . MET C 1 92  ? 8.013   39.160  104.417 1.00 46.58  ? 91  MET C CG  1 
ATOM   5216 S SD  . MET C 1 92  ? 9.131   40.375  105.161 1.00 48.87  ? 91  MET C SD  1 
ATOM   5217 C CE  . MET C 1 92  ? 8.200   40.864  106.581 1.00 47.63  ? 91  MET C CE  1 
ATOM   5218 N N   . ASP C 1 93  ? 4.932   36.320  106.387 1.00 49.60  ? 92  ASP C N   1 
ATOM   5219 C CA  . ASP C 1 93  ? 4.395   35.215  107.179 1.00 51.46  ? 92  ASP C CA  1 
ATOM   5220 C C   . ASP C 1 93  ? 3.757   34.122  106.315 1.00 52.62  ? 92  ASP C C   1 
ATOM   5221 O O   . ASP C 1 93  ? 3.956   32.930  106.574 1.00 52.62  ? 92  ASP C O   1 
ATOM   5222 C CB  . ASP C 1 93  ? 3.381   35.718  108.214 1.00 51.66  ? 92  ASP C CB  1 
ATOM   5223 C CG  . ASP C 1 93  ? 4.016   36.572  109.295 1.00 52.97  ? 92  ASP C CG  1 
ATOM   5224 O OD1 . ASP C 1 93  ? 5.183   36.310  109.665 1.00 54.30  ? 92  ASP C OD1 1 
ATOM   5225 O OD2 . ASP C 1 93  ? 3.418   37.534  109.830 1.00 54.61  ? 92  ASP C OD2 1 
ATOM   5226 N N   . ALA C 1 94  ? 2.998   34.529  105.295 1.00 53.88  ? 93  ALA C N   1 
ATOM   5227 C CA  . ALA C 1 94  ? 2.355   33.584  104.388 1.00 55.11  ? 93  ALA C CA  1 
ATOM   5228 C C   . ALA C 1 94  ? 3.392   32.864  103.533 1.00 56.24  ? 93  ALA C C   1 
ATOM   5229 O O   . ALA C 1 94  ? 3.110   31.813  102.965 1.00 56.66  ? 93  ALA C O   1 
ATOM   5230 C CB  . ALA C 1 94  ? 1.330   34.290  103.509 1.00 55.14  ? 93  ALA C CB  1 
ATOM   5231 N N   . SER C 1 95  ? 4.590   33.436  103.453 1.00 57.62  ? 94  SER C N   1 
ATOM   5232 C CA  . SER C 1 95  ? 5.693   32.844  102.705 1.00 59.07  ? 94  SER C CA  1 
ATOM   5233 C C   . SER C 1 95  ? 6.725   32.206  103.633 1.00 60.05  ? 94  SER C C   1 
ATOM   5234 O O   . SER C 1 95  ? 7.773   31.748  103.168 1.00 60.47  ? 94  SER C O   1 
ATOM   5235 C CB  . SER C 1 95  ? 6.381   33.910  101.857 1.00 58.82  ? 94  SER C CB  1 
ATOM   5236 O OG  . SER C 1 95  ? 5.565   34.309  100.775 1.00 59.66  ? 94  SER C OG  1 
ATOM   5237 N N   . ALA C 1 96  ? 6.429   32.177  104.935 1.00 61.07  ? 95  ALA C N   1 
ATOM   5238 C CA  . ALA C 1 96  ? 7.360   31.667  105.949 1.00 62.00  ? 95  ALA C CA  1 
ATOM   5239 C C   . ALA C 1 96  ? 8.054   30.381  105.504 1.00 62.69  ? 95  ALA C C   1 
ATOM   5240 O O   . ALA C 1 96  ? 9.274   30.266  105.599 1.00 62.56  ? 95  ALA C O   1 
ATOM   5241 C CB  . ALA C 1 96  ? 6.650   31.454  107.272 1.00 62.05  ? 95  ALA C CB  1 
ATOM   5242 N N   . LEU C 1 97  ? 7.268   29.433  104.999 1.00 63.44  ? 96  LEU C N   1 
ATOM   5243 C CA  . LEU C 1 97  ? 7.802   28.178  104.480 1.00 64.29  ? 96  LEU C CA  1 
ATOM   5244 C C   . LEU C 1 97  ? 8.315   28.315  103.042 1.00 64.80  ? 96  LEU C C   1 
ATOM   5245 O O   . LEU C 1 97  ? 9.426   27.868  102.744 1.00 65.23  ? 96  LEU C O   1 
ATOM   5246 C CB  . LEU C 1 97  ? 6.761   27.049  104.591 1.00 64.24  ? 96  LEU C CB  1 
ATOM   5247 C CG  . LEU C 1 97  ? 5.988   26.959  105.918 1.00 64.39  ? 96  LEU C CG  1 
ATOM   5248 C CD1 . LEU C 1 97  ? 4.917   25.874  105.884 1.00 64.06  ? 96  LEU C CD1 1 
ATOM   5249 C CD2 . LEU C 1 97  ? 6.925   26.758  107.106 1.00 64.03  ? 96  LEU C CD2 1 
ATOM   5250 N N   . THR C 1 98  ? 7.524   28.950  102.169 1.00 65.10  ? 97  THR C N   1 
ATOM   5251 C CA  . THR C 1 98  ? 7.822   29.007  100.731 1.00 65.21  ? 97  THR C CA  1 
ATOM   5252 C C   . THR C 1 98  ? 9.138   29.702  100.346 1.00 65.03  ? 97  THR C C   1 
ATOM   5253 O O   . THR C 1 98  ? 9.889   29.183  99.521  1.00 64.99  ? 97  THR C O   1 
ATOM   5254 C CB  . THR C 1 98  ? 6.595   29.520  99.913  1.00 65.43  ? 97  THR C CB  1 
ATOM   5255 O OG1 . THR C 1 98  ? 6.550   28.843  98.651  1.00 65.67  ? 97  THR C OG1 1 
ATOM   5256 C CG2 . THR C 1 98  ? 6.736   30.991  99.517  1.00 65.94  ? 97  THR C CG2 1 
ATOM   5257 N N   . GLY C 1 99  ? 9.413   30.865  100.939 1.00 64.91  ? 98  GLY C N   1 
ATOM   5258 C CA  . GLY C 1 99  ? 10.691  31.537  100.751 1.00 64.69  ? 98  GLY C CA  1 
ATOM   5259 C C   . GLY C 1 99  ? 10.701  32.953  100.186 1.00 64.53  ? 98  GLY C C   1 
ATOM   5260 O O   . GLY C 1 99  ? 11.554  33.769  100.568 1.00 64.65  ? 98  GLY C O   1 
ATOM   5261 N N   . ILE C 1 100 ? 9.754   33.252  99.297  1.00 63.97  ? 99  ILE C N   1 
ATOM   5262 C CA  . ILE C 1 100 ? 9.777   34.474  98.472  1.00 63.71  ? 99  ILE C CA  1 
ATOM   5263 C C   . ILE C 1 100 ? 10.929  34.430  97.449  1.00 63.20  ? 99  ILE C C   1 
ATOM   5264 O O   . ILE C 1 100 ? 12.101  34.609  97.813  1.00 63.35  ? 99  ILE C O   1 
ATOM   5265 C CB  . ILE C 1 100 ? 9.831   35.809  99.309  1.00 63.62  ? 99  ILE C CB  1 
ATOM   5266 C CG1 . ILE C 1 100 ? 8.767   35.841  100.405 1.00 63.79  ? 99  ILE C CG1 1 
ATOM   5267 C CG2 . ILE C 1 100 ? 9.654   37.019  98.398  1.00 63.68  ? 99  ILE C CG2 1 
ATOM   5268 C CD1 . ILE C 1 100 ? 8.851   37.063  101.322 1.00 63.24  ? 99  ILE C CD1 1 
ATOM   5269 N N   . PRO C 1 101 ? 10.595  34.188  96.180  1.00 62.58  ? 100 PRO C N   1 
ATOM   5270 C CA  . PRO C 1 101 ? 11.588  34.228  95.098  1.00 62.05  ? 100 PRO C CA  1 
ATOM   5271 C C   . PRO C 1 101 ? 12.408  35.517  95.108  1.00 61.65  ? 100 PRO C C   1 
ATOM   5272 O O   . PRO C 1 101 ? 11.876  36.589  95.412  1.00 61.45  ? 100 PRO C O   1 
ATOM   5273 C CB  . PRO C 1 101 ? 10.736  34.141  93.826  1.00 62.11  ? 100 PRO C CB  1 
ATOM   5274 C CG  . PRO C 1 101 ? 9.319   34.298  94.273  1.00 62.44  ? 100 PRO C CG  1 
ATOM   5275 C CD  . PRO C 1 101 ? 9.256   33.824  95.686  1.00 62.53  ? 100 PRO C CD  1 
ATOM   5276 N N   . LEU C 1 102 ? 13.691  35.394  94.776  1.00 61.08  ? 101 LEU C N   1 
ATOM   5277 C CA  . LEU C 1 102 ? 14.639  36.514  94.790  1.00 60.61  ? 101 LEU C CA  1 
ATOM   5278 C C   . LEU C 1 102 ? 14.385  37.653  93.772  1.00 59.76  ? 101 LEU C C   1 
ATOM   5279 O O   . LEU C 1 102 ? 14.693  38.811  94.082  1.00 59.68  ? 101 LEU C O   1 
ATOM   5280 C CB  . LEU C 1 102 ? 16.085  35.995  94.683  1.00 60.89  ? 101 LEU C CB  1 
ATOM   5281 C CG  . LEU C 1 102 ? 17.289  36.869  95.085  1.00 61.73  ? 101 LEU C CG  1 
ATOM   5282 C CD1 . LEU C 1 102 ? 17.845  37.644  93.878  1.00 62.15  ? 101 LEU C CD1 1 
ATOM   5283 C CD2 . LEU C 1 102 ? 17.008  37.816  96.265  1.00 62.32  ? 101 LEU C CD2 1 
ATOM   5284 N N   . PRO C 1 103 ? 13.874  37.356  92.569  1.00 58.88  ? 102 PRO C N   1 
ATOM   5285 C CA  . PRO C 1 103 ? 13.456  38.423  91.647  1.00 58.02  ? 102 PRO C CA  1 
ATOM   5286 C C   . PRO C 1 103 ? 12.402  39.352  92.261  1.00 57.06  ? 102 PRO C C   1 
ATOM   5287 O O   . PRO C 1 103 ? 12.527  40.568  92.120  1.00 57.07  ? 102 PRO C O   1 
ATOM   5288 C CB  . PRO C 1 103 ? 12.880  37.654  90.453  1.00 58.12  ? 102 PRO C CB  1 
ATOM   5289 C CG  . PRO C 1 103 ? 13.591  36.353  90.483  1.00 58.54  ? 102 PRO C CG  1 
ATOM   5290 C CD  . PRO C 1 103 ? 13.705  36.024  91.953  1.00 59.03  ? 102 PRO C CD  1 
ATOM   5291 N N   . LEU C 1 104 ? 11.409  38.784  92.946  1.00 55.75  ? 103 LEU C N   1 
ATOM   5292 C CA  . LEU C 1 104 ? 10.363  39.566  93.610  1.00 54.42  ? 103 LEU C CA  1 
ATOM   5293 C C   . LEU C 1 104 ? 10.893  40.480  94.721  1.00 53.05  ? 103 LEU C C   1 
ATOM   5294 O O   . LEU C 1 104 ? 10.497  41.643  94.802  1.00 52.92  ? 103 LEU C O   1 
ATOM   5295 C CB  . LEU C 1 104 ? 9.245   38.659  94.135  1.00 54.69  ? 103 LEU C CB  1 
ATOM   5296 C CG  . LEU C 1 104 ? 8.003   39.411  94.620  1.00 55.94  ? 103 LEU C CG  1 
ATOM   5297 C CD1 . LEU C 1 104 ? 6.804   39.133  93.728  1.00 56.82  ? 103 LEU C CD1 1 
ATOM   5298 C CD2 . LEU C 1 104 ? 7.698   39.044  96.066  1.00 57.52  ? 103 LEU C CD2 1 
ATOM   5299 N N   . ILE C 1 105 ? 11.792  39.963  95.559  1.00 51.55  ? 104 ILE C N   1 
ATOM   5300 C CA  . ILE C 1 105 ? 12.456  40.787  96.577  1.00 49.97  ? 104 ILE C CA  1 
ATOM   5301 C C   . ILE C 1 105 ? 13.214  41.920  95.894  1.00 48.81  ? 104 ILE C C   1 
ATOM   5302 O O   . ILE C 1 105 ? 13.180  43.066  96.346  1.00 48.85  ? 104 ILE C O   1 
ATOM   5303 C CB  . ILE C 1 105 ? 13.411  39.947  97.475  1.00 49.97  ? 104 ILE C CB  1 
ATOM   5304 C CG1 . ILE C 1 105 ? 12.616  39.125  98.496  1.00 50.54  ? 104 ILE C CG1 1 
ATOM   5305 C CG2 . ILE C 1 105 ? 14.414  40.847  98.215  1.00 49.28  ? 104 ILE C CG2 1 
ATOM   5306 C CD1 . ILE C 1 105 ? 13.135  37.703  98.691  1.00 51.16  ? 104 ILE C CD1 1 
ATOM   5307 N N   . LYS C 1 106 ? 13.887  41.589  94.798  1.00 47.35  ? 105 LYS C N   1 
ATOM   5308 C CA  . LYS C 1 106 ? 14.628  42.584  94.038  1.00 46.12  ? 105 LYS C CA  1 
ATOM   5309 C C   . LYS C 1 106 ? 13.690  43.685  93.538  1.00 44.56  ? 105 LYS C C   1 
ATOM   5310 O O   . LYS C 1 106 ? 13.972  44.864  93.717  1.00 44.17  ? 105 LYS C O   1 
ATOM   5311 C CB  . LYS C 1 106 ? 15.389  41.928  92.882  1.00 46.30  ? 105 LYS C CB  1 
ATOM   5312 C CG  . LYS C 1 106 ? 16.559  42.753  92.376  1.00 46.66  ? 105 LYS C CG  1 
ATOM   5313 C CD  . LYS C 1 106 ? 17.238  42.075  91.201  1.00 48.85  ? 105 LYS C CD  1 
ATOM   5314 C CE  . LYS C 1 106 ? 18.175  40.946  91.644  1.00 48.75  ? 105 LYS C CE  1 
ATOM   5315 N NZ  . LYS C 1 106 ? 19.448  40.992  90.870  1.00 48.63  ? 105 LYS C NZ  1 
ATOM   5316 N N   . SER C 1 107 ? 12.573  43.272  92.938  1.00 43.21  ? 106 SER C N   1 
ATOM   5317 C CA  . SER C 1 107 ? 11.504  44.169  92.496  1.00 41.87  ? 106 SER C CA  1 
ATOM   5318 C C   . SER C 1 107 ? 11.009  45.066  93.635  1.00 41.24  ? 106 SER C C   1 
ATOM   5319 O O   . SER C 1 107 ? 10.912  46.285  93.463  1.00 41.39  ? 106 SER C O   1 
ATOM   5320 C CB  . SER C 1 107 ? 10.336  43.361  91.919  1.00 41.71  ? 106 SER C CB  1 
ATOM   5321 O OG  . SER C 1 107 ? 9.242   44.196  91.562  1.00 40.93  ? 106 SER C OG  1 
ATOM   5322 N N   . TYR C 1 108 ? 10.721  44.460  94.791  1.00 40.02  ? 107 TYR C N   1 
ATOM   5323 C CA  . TYR C 1 108 ? 10.204  45.191  95.950  1.00 38.77  ? 107 TYR C CA  1 
ATOM   5324 C C   . TYR C 1 108 ? 11.218  46.177  96.503  1.00 38.56  ? 107 TYR C C   1 
ATOM   5325 O O   . TYR C 1 108 ? 10.871  47.316  96.795  1.00 38.68  ? 107 TYR C O   1 
ATOM   5326 C CB  . TYR C 1 108 ? 9.753   44.245  97.063  1.00 38.05  ? 107 TYR C CB  1 
ATOM   5327 C CG  . TYR C 1 108 ? 8.418   43.566  96.852  1.00 36.40  ? 107 TYR C CG  1 
ATOM   5328 C CD1 . TYR C 1 108 ? 7.634   43.819  95.729  1.00 35.61  ? 107 TYR C CD1 1 
ATOM   5329 C CD2 . TYR C 1 108 ? 7.939   42.659  97.792  1.00 35.52  ? 107 TYR C CD2 1 
ATOM   5330 C CE1 . TYR C 1 108 ? 6.409   43.177  95.552  1.00 33.78  ? 107 TYR C CE1 1 
ATOM   5331 C CE2 . TYR C 1 108 ? 6.725   42.022  97.626  1.00 34.66  ? 107 TYR C CE2 1 
ATOM   5332 C CZ  . TYR C 1 108 ? 5.963   42.280  96.505  1.00 34.12  ? 107 TYR C CZ  1 
ATOM   5333 O OH  . TYR C 1 108 ? 4.749   41.626  96.348  1.00 35.09  ? 107 TYR C OH  1 
ATOM   5334 N N   . LEU C 1 109 ? 12.468  45.756  96.648  1.00 38.31  ? 108 LEU C N   1 
ATOM   5335 C CA  . LEU C 1 109 ? 13.475  46.679  97.142  1.00 38.41  ? 108 LEU C CA  1 
ATOM   5336 C C   . LEU C 1 109 ? 13.627  47.862  96.193  1.00 38.18  ? 108 LEU C C   1 
ATOM   5337 O O   . LEU C 1 109 ? 13.693  49.003  96.634  1.00 38.48  ? 108 LEU C O   1 
ATOM   5338 C CB  . LEU C 1 109 ? 14.824  45.985  97.380  1.00 38.57  ? 108 LEU C CB  1 
ATOM   5339 C CG  . LEU C 1 109 ? 15.917  46.912  97.936  1.00 39.57  ? 108 LEU C CG  1 
ATOM   5340 C CD1 . LEU C 1 109 ? 15.466  47.642  99.192  1.00 40.37  ? 108 LEU C CD1 1 
ATOM   5341 C CD2 . LEU C 1 109 ? 17.221  46.169  98.200  1.00 41.52  ? 108 LEU C CD2 1 
ATOM   5342 N N   . PHE C 1 110 ? 13.668  47.581  94.893  1.00 38.24  ? 109 PHE C N   1 
ATOM   5343 C CA  . PHE C 1 110 ? 13.811  48.614  93.868  1.00 38.41  ? 109 PHE C CA  1 
ATOM   5344 C C   . PHE C 1 110 ? 12.706  49.671  94.010  1.00 38.32  ? 109 PHE C C   1 
ATOM   5345 O O   . PHE C 1 110 ? 12.987  50.870  94.106  1.00 38.61  ? 109 PHE C O   1 
ATOM   5346 C CB  . PHE C 1 110 ? 13.810  47.954  92.481  1.00 38.36  ? 109 PHE C CB  1 
ATOM   5347 C CG  . PHE C 1 110 ? 14.221  48.865  91.356  1.00 39.33  ? 109 PHE C CG  1 
ATOM   5348 C CD1 . PHE C 1 110 ? 15.419  49.575  91.402  1.00 39.99  ? 109 PHE C CD1 1 
ATOM   5349 C CD2 . PHE C 1 110 ? 13.411  48.990  90.228  1.00 40.59  ? 109 PHE C CD2 1 
ATOM   5350 C CE1 . PHE C 1 110 ? 15.799  50.413  90.348  1.00 40.76  ? 109 PHE C CE1 1 
ATOM   5351 C CE2 . PHE C 1 110 ? 13.778  49.830  89.163  1.00 41.65  ? 109 PHE C CE2 1 
ATOM   5352 C CZ  . PHE C 1 110 ? 14.975  50.543  89.223  1.00 41.22  ? 109 PHE C CZ  1 
ATOM   5353 N N   . GLN C 1 111 ? 11.457  49.214  94.071  1.00 38.26  ? 110 GLN C N   1 
ATOM   5354 C CA  . GLN C 1 111 ? 10.301  50.095  94.187  1.00 38.21  ? 110 GLN C CA  1 
ATOM   5355 C C   . GLN C 1 111 ? 10.320  50.910  95.493  1.00 38.72  ? 110 GLN C C   1 
ATOM   5356 O O   . GLN C 1 111 ? 10.071  52.130  95.482  1.00 38.94  ? 110 GLN C O   1 
ATOM   5357 C CB  . GLN C 1 111 ? 9.002   49.285  94.094  1.00 38.32  ? 110 GLN C CB  1 
ATOM   5358 C CG  . GLN C 1 111 ? 8.760   48.540  92.786  1.00 37.66  ? 110 GLN C CG  1 
ATOM   5359 C CD  . GLN C 1 111 ? 7.413   47.816  92.780  1.00 38.36  ? 110 GLN C CD  1 
ATOM   5360 O OE1 . GLN C 1 111 ? 6.366   48.452  92.914  1.00 38.21  ? 110 GLN C OE1 1 
ATOM   5361 N NE2 . GLN C 1 111 ? 7.437   46.488  92.620  1.00 36.96  ? 110 GLN C NE2 1 
ATOM   5362 N N   . LEU C 1 112 ? 10.613  50.244  96.617  1.00 38.63  ? 111 LEU C N   1 
ATOM   5363 C CA  . LEU C 1 112 ? 10.628  50.921  97.919  1.00 38.88  ? 111 LEU C CA  1 
ATOM   5364 C C   . LEU C 1 112 ? 11.620  52.066  97.907  1.00 38.74  ? 111 LEU C C   1 
ATOM   5365 O O   . LEU C 1 112 ? 11.358  53.132  98.458  1.00 38.90  ? 111 LEU C O   1 
ATOM   5366 C CB  . LEU C 1 112 ? 10.956  49.952  99.065  1.00 38.87  ? 111 LEU C CB  1 
ATOM   5367 C CG  . LEU C 1 112 ? 9.929   48.859  99.347  1.00 39.07  ? 111 LEU C CG  1 
ATOM   5368 C CD1 . LEU C 1 112 ? 10.537  47.743  100.174 1.00 39.59  ? 111 LEU C CD1 1 
ATOM   5369 C CD2 . LEU C 1 112 ? 8.720   49.444  100.028 1.00 40.08  ? 111 LEU C CD2 1 
ATOM   5370 N N   . LEU C 1 113 ? 12.760  51.825  97.264  1.00 38.87  ? 112 LEU C N   1 
ATOM   5371 C CA  . LEU C 1 113 ? 13.803  52.821  97.093  1.00 38.62  ? 112 LEU C CA  1 
ATOM   5372 C C   . LEU C 1 113 ? 13.343  53.973  96.205  1.00 38.60  ? 112 LEU C C   1 
ATOM   5373 O O   . LEU C 1 113 ? 13.682  55.127  96.469  1.00 38.42  ? 112 LEU C O   1 
ATOM   5374 C CB  . LEU C 1 113 ? 15.042  52.163  96.493  1.00 38.64  ? 112 LEU C CB  1 
ATOM   5375 C CG  . LEU C 1 113 ? 15.937  51.389  97.452  1.00 38.84  ? 112 LEU C CG  1 
ATOM   5376 C CD1 . LEU C 1 113 ? 16.743  50.396  96.679  1.00 39.16  ? 112 LEU C CD1 1 
ATOM   5377 C CD2 . LEU C 1 113 ? 16.851  52.329  98.208  1.00 39.69  ? 112 LEU C CD2 1 
ATOM   5378 N N   . GLN C 1 114 ? 12.574  53.665  95.157  1.00 38.77  ? 113 GLN C N   1 
ATOM   5379 C CA  . GLN C 1 114 ? 12.059  54.713  94.263  1.00 38.97  ? 113 GLN C CA  1 
ATOM   5380 C C   . GLN C 1 114 ? 11.104  55.615  95.033  1.00 38.59  ? 113 GLN C C   1 
ATOM   5381 O O   . GLN C 1 114 ? 11.200  56.833  94.954  1.00 38.66  ? 113 GLN C O   1 
ATOM   5382 C CB  . GLN C 1 114 ? 11.352  54.115  93.044  1.00 39.16  ? 113 GLN C CB  1 
ATOM   5383 C CG  . GLN C 1 114 ? 12.255  53.863  91.853  1.00 40.51  ? 113 GLN C CG  1 
ATOM   5384 C CD  . GLN C 1 114 ? 11.685  52.812  90.919  1.00 43.90  ? 113 GLN C CD  1 
ATOM   5385 O OE1 . GLN C 1 114 ? 11.177  53.140  89.849  1.00 46.56  ? 113 GLN C OE1 1 
ATOM   5386 N NE2 . GLN C 1 114 ? 11.761  51.548  91.320  1.00 45.38  ? 113 GLN C NE2 1 
ATOM   5387 N N   . GLY C 1 115 ? 10.199  55.002  95.797  1.00 38.59  ? 114 GLY C N   1 
ATOM   5388 C CA  . GLY C 1 115 ? 9.303   55.742  96.671  1.00 38.26  ? 114 GLY C CA  1 
ATOM   5389 C C   . GLY C 1 115 ? 10.052  56.622  97.652  1.00 38.00  ? 114 GLY C C   1 
ATOM   5390 O O   . GLY C 1 115 ? 9.713   57.794  97.845  1.00 37.78  ? 114 GLY C O   1 
ATOM   5391 N N   . LEU C 1 116 ? 11.093  56.058  98.255  1.00 37.82  ? 115 LEU C N   1 
ATOM   5392 C CA  . LEU C 1 116 ? 11.845  56.742  99.298  1.00 38.07  ? 115 LEU C CA  1 
ATOM   5393 C C   . LEU C 1 116 ? 12.748  57.847  98.726  1.00 37.82  ? 115 LEU C C   1 
ATOM   5394 O O   . LEU C 1 116 ? 12.847  58.944  99.294  1.00 37.99  ? 115 LEU C O   1 
ATOM   5395 C CB  . LEU C 1 116 ? 12.641  55.724  100.129 1.00 38.15  ? 115 LEU C CB  1 
ATOM   5396 C CG  . LEU C 1 116 ? 12.944  56.134  101.574 1.00 39.24  ? 115 LEU C CG  1 
ATOM   5397 C CD1 . LEU C 1 116 ? 11.670  56.207  102.420 1.00 38.11  ? 115 LEU C CD1 1 
ATOM   5398 C CD2 . LEU C 1 116 ? 13.964  55.173  102.197 1.00 39.98  ? 115 LEU C CD2 1 
ATOM   5399 N N   . ALA C 1 117 ? 13.390  57.563  97.597  1.00 37.19  ? 116 ALA C N   1 
ATOM   5400 C CA  . ALA C 1 117 ? 14.120  58.588  96.868  1.00 36.78  ? 116 ALA C CA  1 
ATOM   5401 C C   . ALA C 1 117 ? 13.225  59.812  96.666  1.00 36.57  ? 116 ALA C C   1 
ATOM   5402 O O   . ALA C 1 117 ? 13.655  60.943  96.910  1.00 36.43  ? 116 ALA C O   1 
ATOM   5403 C CB  . ALA C 1 117 ? 14.604  58.039  95.529  1.00 36.84  ? 116 ALA C CB  1 
ATOM   5404 N N   . PHE C 1 118 ? 11.978  59.565  96.241  1.00 36.25  ? 117 PHE C N   1 
ATOM   5405 C CA  . PHE C 1 118 ? 10.965  60.611  96.034  1.00 35.87  ? 117 PHE C CA  1 
ATOM   5406 C C   . PHE C 1 118 ? 10.604  61.343  97.323  1.00 35.58  ? 117 PHE C C   1 
ATOM   5407 O O   . PHE C 1 118 ? 10.479  62.559  97.313  1.00 35.88  ? 117 PHE C O   1 
ATOM   5408 C CB  . PHE C 1 118 ? 9.698   60.028  95.388  1.00 35.73  ? 117 PHE C CB  1 
ATOM   5409 C CG  . PHE C 1 118 ? 8.743   61.073  94.830  1.00 37.40  ? 117 PHE C CG  1 
ATOM   5410 C CD1 . PHE C 1 118 ? 8.792   61.436  93.479  1.00 38.60  ? 117 PHE C CD1 1 
ATOM   5411 C CD2 . PHE C 1 118 ? 7.773   61.660  95.639  1.00 37.45  ? 117 PHE C CD2 1 
ATOM   5412 C CE1 . PHE C 1 118 ? 7.909   62.383  92.953  1.00 38.93  ? 117 PHE C CE1 1 
ATOM   5413 C CE2 . PHE C 1 118 ? 6.886   62.605  95.127  1.00 37.97  ? 117 PHE C CE2 1 
ATOM   5414 C CZ  . PHE C 1 118 ? 6.953   62.968  93.782  1.00 39.05  ? 117 PHE C CZ  1 
ATOM   5415 N N   . CYS C 1 119 ? 10.412  60.621  98.426  1.00 35.16  ? 118 CYS C N   1 
ATOM   5416 C CA  . CYS C 1 119 ? 10.163  61.300  99.706  1.00 35.18  ? 118 CYS C CA  1 
ATOM   5417 C C   . CYS C 1 119 ? 11.324  62.208  100.057 1.00 35.01  ? 118 CYS C C   1 
ATOM   5418 O O   . CYS C 1 119 ? 11.128  63.376  100.337 1.00 35.07  ? 118 CYS C O   1 
ATOM   5419 C CB  . CYS C 1 119 ? 9.917   60.321  100.862 1.00 34.87  ? 118 CYS C CB  1 
ATOM   5420 S SG  . CYS C 1 119 ? 8.413   59.348  100.703 1.00 34.12  ? 118 CYS C SG  1 
ATOM   5421 N N   . HIS C 1 120 ? 12.536  61.669  100.031 1.00 35.56  ? 119 HIS C N   1 
ATOM   5422 C CA  . HIS C 1 120 ? 13.697  62.443  100.463 1.00 35.92  ? 119 HIS C CA  1 
ATOM   5423 C C   . HIS C 1 120 ? 13.952  63.645  99.574  1.00 36.20  ? 119 HIS C C   1 
ATOM   5424 O O   . HIS C 1 120 ? 14.257  64.721  100.088 1.00 36.53  ? 119 HIS C O   1 
ATOM   5425 C CB  . HIS C 1 120 ? 14.946  61.570  100.591 1.00 35.87  ? 119 HIS C CB  1 
ATOM   5426 C CG  . HIS C 1 120 ? 14.805  60.464  101.588 1.00 36.41  ? 119 HIS C CG  1 
ATOM   5427 N ND1 . HIS C 1 120 ? 13.909  60.513  102.637 1.00 36.81  ? 119 HIS C ND1 1 
ATOM   5428 C CD2 . HIS C 1 120 ? 15.432  59.268  101.684 1.00 37.26  ? 119 HIS C CD2 1 
ATOM   5429 C CE1 . HIS C 1 120 ? 13.991  59.396  103.335 1.00 36.71  ? 119 HIS C CE1 1 
ATOM   5430 N NE2 . HIS C 1 120 ? 14.907  58.623  102.779 1.00 37.25  ? 119 HIS C NE2 1 
ATOM   5431 N N   . SER C 1 121 ? 13.803  63.480  98.258  1.00 36.20  ? 120 SER C N   1 
ATOM   5432 C CA  . SER C 1 121 ? 13.946  64.620  97.342  1.00 37.00  ? 120 SER C CA  1 
ATOM   5433 C C   . SER C 1 121 ? 12.800  65.619  97.442  1.00 36.51  ? 120 SER C C   1 
ATOM   5434 O O   . SER C 1 121 ? 12.830  66.660  96.788  1.00 37.08  ? 120 SER C O   1 
ATOM   5435 C CB  . SER C 1 121 ? 14.081  64.157  95.897  1.00 37.07  ? 120 SER C CB  1 
ATOM   5436 O OG  . SER C 1 121 ? 13.227  63.058  95.656  1.00 39.99  ? 120 SER C OG  1 
ATOM   5437 N N   . HIS C 1 122 ? 11.784  65.296  98.237  1.00 36.22  ? 121 HIS C N   1 
ATOM   5438 C CA  . HIS C 1 122 ? 10.686  66.226  98.472  1.00 36.24  ? 121 HIS C CA  1 
ATOM   5439 C C   . HIS C 1 122 ? 10.622  66.627  99.939  1.00 35.47  ? 121 HIS C C   1 
ATOM   5440 O O   . HIS C 1 122 ? 9.569   67.027  100.443 1.00 35.38  ? 121 HIS C O   1 
ATOM   5441 C CB  . HIS C 1 122 ? 9.370   65.664  97.941  1.00 36.66  ? 121 HIS C CB  1 
ATOM   5442 C CG  . HIS C 1 122 ? 9.267   65.722  96.450  1.00 39.23  ? 121 HIS C CG  1 
ATOM   5443 N ND1 . HIS C 1 122 ? 9.517   64.635  95.639  1.00 42.02  ? 121 HIS C ND1 1 
ATOM   5444 C CD2 . HIS C 1 122 ? 8.980   66.751  95.619  1.00 41.59  ? 121 HIS C CD2 1 
ATOM   5445 C CE1 . HIS C 1 122 ? 9.373   64.988  94.374  1.00 42.48  ? 121 HIS C CE1 1 
ATOM   5446 N NE2 . HIS C 1 122 ? 9.044   66.267  94.335  1.00 43.17  ? 121 HIS C NE2 1 
ATOM   5447 N N   . ARG C 1 123 ? 11.792  66.537  100.583 1.00 34.64  ? 122 ARG C N   1 
ATOM   5448 C CA  . ARG C 1 123 ? 12.047  66.923  101.976 1.00 33.81  ? 122 ARG C CA  1 
ATOM   5449 C C   . ARG C 1 123 ? 11.107  66.316  103.043 1.00 33.49  ? 122 ARG C C   1 
ATOM   5450 O O   . ARG C 1 123 ? 10.823  66.920  104.070 1.00 33.51  ? 122 ARG C O   1 
ATOM   5451 C CB  . ARG C 1 123 ? 12.251  68.446  102.133 1.00 33.94  ? 122 ARG C CB  1 
ATOM   5452 C CG  . ARG C 1 123 ? 11.147  69.349  101.584 1.00 34.08  ? 122 ARG C CG  1 
ATOM   5453 C CD  . ARG C 1 123 ? 10.012  69.601  102.589 1.00 35.26  ? 122 ARG C CD  1 
ATOM   5454 N NE  . ARG C 1 123 ? 9.033   70.596  102.139 1.00 34.36  ? 122 ARG C NE  1 
ATOM   5455 C CZ  . ARG C 1 123 ? 7.959   70.327  101.407 1.00 32.95  ? 122 ARG C CZ  1 
ATOM   5456 N NH1 . ARG C 1 123 ? 7.713   69.089  101.005 1.00 31.99  ? 122 ARG C NH1 1 
ATOM   5457 N NH2 . ARG C 1 123 ? 7.129   71.308  101.070 1.00 32.95  ? 122 ARG C NH2 1 
ATOM   5458 N N   . VAL C 1 124 ? 10.706  65.070  102.817 1.00 32.88  ? 123 VAL C N   1 
ATOM   5459 C CA  . VAL C 1 124 ? 9.879   64.342  103.767 1.00 32.64  ? 123 VAL C CA  1 
ATOM   5460 C C   . VAL C 1 124 ? 10.636  63.157  104.366 1.00 32.24  ? 123 VAL C C   1 
ATOM   5461 O O   . VAL C 1 124 ? 11.179  62.330  103.636 1.00 32.57  ? 123 VAL C O   1 
ATOM   5462 C CB  . VAL C 1 124 ? 8.584   63.822  103.091 1.00 32.50  ? 123 VAL C CB  1 
ATOM   5463 C CG1 . VAL C 1 124 ? 7.790   62.899  104.044 1.00 32.44  ? 123 VAL C CG1 1 
ATOM   5464 C CG2 . VAL C 1 124 ? 7.724   64.993  102.590 1.00 32.54  ? 123 VAL C CG2 1 
ATOM   5465 N N   . LEU C 1 125 ? 10.668  63.078  105.693 1.00 31.84  ? 124 LEU C N   1 
ATOM   5466 C CA  . LEU C 1 125 ? 11.128  61.868  106.379 1.00 31.65  ? 124 LEU C CA  1 
ATOM   5467 C C   . LEU C 1 125 ? 9.934   60.975  106.699 1.00 31.21  ? 124 LEU C C   1 
ATOM   5468 O O   . LEU C 1 125 ? 8.969   61.439  107.281 1.00 31.68  ? 124 LEU C O   1 
ATOM   5469 C CB  . LEU C 1 125 ? 11.839  62.232  107.683 1.00 31.62  ? 124 LEU C CB  1 
ATOM   5470 C CG  . LEU C 1 125 ? 13.144  63.004  107.596 1.00 32.96  ? 124 LEU C CG  1 
ATOM   5471 C CD1 . LEU C 1 125 ? 13.557  63.535  108.968 1.00 33.00  ? 124 LEU C CD1 1 
ATOM   5472 C CD2 . LEU C 1 125 ? 14.234  62.124  106.970 1.00 33.63  ? 124 LEU C CD2 1 
ATOM   5473 N N   . HIS C 1 126 ? 9.987   59.700  106.340 1.00 30.89  ? 125 HIS C N   1 
ATOM   5474 C CA  . HIS C 1 126 ? 8.904   58.804  106.731 1.00 30.88  ? 125 HIS C CA  1 
ATOM   5475 C C   . HIS C 1 126 ? 8.958   58.506  108.236 1.00 31.38  ? 125 HIS C C   1 
ATOM   5476 O O   . HIS C 1 126 ? 7.985   58.752  108.953 1.00 30.93  ? 125 HIS C O   1 
ATOM   5477 C CB  . HIS C 1 126 ? 8.913   57.520  105.919 1.00 30.18  ? 125 HIS C CB  1 
ATOM   5478 C CG  . HIS C 1 126 ? 7.717   56.655  106.159 1.00 29.42  ? 125 HIS C CG  1 
ATOM   5479 N ND1 . HIS C 1 126 ? 7.667   55.714  107.165 1.00 28.75  ? 125 HIS C ND1 1 
ATOM   5480 C CD2 . HIS C 1 126 ? 6.527   56.581  105.516 1.00 29.73  ? 125 HIS C CD2 1 
ATOM   5481 C CE1 . HIS C 1 126 ? 6.497   55.098  107.133 1.00 29.63  ? 125 HIS C CE1 1 
ATOM   5482 N NE2 . HIS C 1 126 ? 5.785   55.606  106.140 1.00 30.13  ? 125 HIS C NE2 1 
ATOM   5483 N N   . ARG C 1 127 ? 10.103  57.979  108.685 1.00 32.26  ? 126 ARG C N   1 
ATOM   5484 C CA  . ARG C 1 127 ? 10.402  57.691  110.095 1.00 33.25  ? 126 ARG C CA  1 
ATOM   5485 C C   . ARG C 1 127 ? 9.569   56.572  110.732 1.00 34.40  ? 126 ARG C C   1 
ATOM   5486 O O   . ARG C 1 127 ? 9.449   56.493  111.958 1.00 34.99  ? 126 ARG C O   1 
ATOM   5487 C CB  . ARG C 1 127 ? 10.326  58.961  110.943 1.00 32.80  ? 126 ARG C CB  1 
ATOM   5488 C CG  . ARG C 1 127 ? 11.312  60.030  110.536 1.00 32.90  ? 126 ARG C CG  1 
ATOM   5489 C CD  . ARG C 1 127 ? 11.365  61.213  111.485 1.00 30.79  ? 126 ARG C CD  1 
ATOM   5490 N NE  . ARG C 1 127 ? 10.021  61.579  111.912 1.00 30.54  ? 126 ARG C NE  1 
ATOM   5491 C CZ  . ARG C 1 127 ? 9.730   62.607  112.678 1.00 29.90  ? 126 ARG C CZ  1 
ATOM   5492 N NH1 . ARG C 1 127 ? 10.695  63.403  113.124 1.00 32.08  ? 126 ARG C NH1 1 
ATOM   5493 N NH2 . ARG C 1 127 ? 8.470   62.837  113.007 1.00 29.11  ? 126 ARG C NH2 1 
ATOM   5494 N N   . ASP C 1 128 ? 9.014   55.692  109.910 1.00 35.63  ? 127 ASP C N   1 
ATOM   5495 C CA  . ASP C 1 128 ? 8.291   54.541  110.428 1.00 36.89  ? 127 ASP C CA  1 
ATOM   5496 C C   . ASP C 1 128 ? 8.234   53.434  109.403 1.00 37.13  ? 127 ASP C C   1 
ATOM   5497 O O   . ASP C 1 128 ? 7.190   52.811  109.213 1.00 37.60  ? 127 ASP C O   1 
ATOM   5498 C CB  . ASP C 1 128 ? 6.883   54.939  110.864 1.00 37.47  ? 127 ASP C CB  1 
ATOM   5499 C CG  . ASP C 1 128 ? 6.329   54.044  111.971 1.00 39.85  ? 127 ASP C CG  1 
ATOM   5500 O OD1 . ASP C 1 128 ? 7.122   53.411  112.723 1.00 40.56  ? 127 ASP C OD1 1 
ATOM   5501 O OD2 . ASP C 1 128 ? 5.089   53.922  112.155 1.00 41.23  ? 127 ASP C OD2 1 
ATOM   5502 N N   . LEU C 1 129 ? 9.358   53.186  108.736 1.00 37.64  ? 128 LEU C N   1 
ATOM   5503 C CA  . LEU C 1 129 ? 9.410   52.118  107.748 1.00 38.00  ? 128 LEU C CA  1 
ATOM   5504 C C   . LEU C 1 129 ? 9.529   50.776  108.466 1.00 37.91  ? 128 LEU C C   1 
ATOM   5505 O O   . LEU C 1 129 ? 10.379  50.595  109.342 1.00 38.35  ? 128 LEU C O   1 
ATOM   5506 C CB  . LEU C 1 129 ? 10.555  52.330  106.745 1.00 38.11  ? 128 LEU C CB  1 
ATOM   5507 C CG  . LEU C 1 129 ? 10.443  53.421  105.660 1.00 38.56  ? 128 LEU C CG  1 
ATOM   5508 C CD1 . LEU C 1 129 ? 11.585  53.283  104.662 1.00 38.95  ? 128 LEU C CD1 1 
ATOM   5509 C CD2 . LEU C 1 129 ? 9.113   53.400  104.917 1.00 38.74  ? 128 LEU C CD2 1 
ATOM   5510 N N   . LYS C 1 130 ? 8.631   49.869  108.115 1.00 37.35  ? 129 LYS C N   1 
ATOM   5511 C CA  . LYS C 1 130 ? 8.601   48.509  108.629 1.00 37.05  ? 129 LYS C CA  1 
ATOM   5512 C C   . LYS C 1 130 ? 7.617   47.779  107.727 1.00 36.47  ? 129 LYS C C   1 
ATOM   5513 O O   . LYS C 1 130 ? 6.800   48.433  107.092 1.00 36.54  ? 129 LYS C O   1 
ATOM   5514 C CB  . LYS C 1 130 ? 8.168   48.466  110.102 1.00 37.03  ? 129 LYS C CB  1 
ATOM   5515 C CG  . LYS C 1 130 ? 6.878   49.194  110.415 1.00 37.67  ? 129 LYS C CG  1 
ATOM   5516 C CD  . LYS C 1 130 ? 6.296   48.711  111.724 1.00 38.20  ? 129 LYS C CD  1 
ATOM   5517 C CE  . LYS C 1 130 ? 5.574   49.828  112.453 1.00 39.88  ? 129 LYS C CE  1 
ATOM   5518 N NZ  . LYS C 1 130 ? 4.106   49.562  112.580 1.00 41.83  ? 129 LYS C NZ  1 
ATOM   5519 N N   . PRO C 1 131 ? 7.690   46.447  107.656 1.00 36.16  ? 130 PRO C N   1 
ATOM   5520 C CA  . PRO C 1 131 ? 6.876   45.674  106.704 1.00 35.62  ? 130 PRO C CA  1 
ATOM   5521 C C   . PRO C 1 131 ? 5.354   45.814  106.870 1.00 35.03  ? 130 PRO C C   1 
ATOM   5522 O O   . PRO C 1 131 ? 4.620   45.591  105.903 1.00 34.94  ? 130 PRO C O   1 
ATOM   5523 C CB  . PRO C 1 131 ? 7.321   44.230  106.958 1.00 35.51  ? 130 PRO C CB  1 
ATOM   5524 C CG  . PRO C 1 131 ? 7.866   44.244  108.335 1.00 35.73  ? 130 PRO C CG  1 
ATOM   5525 C CD  . PRO C 1 131 ? 8.552   45.566  108.470 1.00 36.11  ? 130 PRO C CD  1 
ATOM   5526 N N   . GLN C 1 132 ? 4.895   46.170  108.066 1.00 34.30  ? 131 GLN C N   1 
ATOM   5527 C CA  . GLN C 1 132 ? 3.464   46.371  108.332 1.00 33.89  ? 131 GLN C CA  1 
ATOM   5528 C C   . GLN C 1 132 ? 2.930   47.620  107.627 1.00 33.12  ? 131 GLN C C   1 
ATOM   5529 O O   . GLN C 1 132 ? 1.713   47.732  107.384 1.00 33.08  ? 131 GLN C O   1 
ATOM   5530 C CB  . GLN C 1 132 ? 3.213   46.514  109.838 1.00 33.89  ? 131 GLN C CB  1 
ATOM   5531 C CG  . GLN C 1 132 ? 3.403   45.237  110.613 1.00 35.55  ? 131 GLN C CG  1 
ATOM   5532 C CD  . GLN C 1 132 ? 4.812   45.062  111.170 1.00 37.82  ? 131 GLN C CD  1 
ATOM   5533 O OE1 . GLN C 1 132 ? 5.778   45.656  110.683 1.00 37.97  ? 131 GLN C OE1 1 
ATOM   5534 N NE2 . GLN C 1 132 ? 4.928   44.228  112.190 1.00 40.40  ? 131 GLN C NE2 1 
ATOM   5535 N N   . ASN C 1 133 ? 3.843   48.552  107.338 1.00 31.94  ? 132 ASN C N   1 
ATOM   5536 C CA  . ASN C 1 133 ? 3.539   49.816  106.671 1.00 31.41  ? 132 ASN C CA  1 
ATOM   5537 C C   . ASN C 1 133 ? 3.809   49.827  105.158 1.00 31.21  ? 132 ASN C C   1 
ATOM   5538 O O   . ASN C 1 133 ? 3.688   50.856  104.505 1.00 31.48  ? 132 ASN C O   1 
ATOM   5539 C CB  . ASN C 1 133 ? 4.296   50.954  107.356 1.00 30.86  ? 132 ASN C CB  1 
ATOM   5540 C CG  . ASN C 1 133 ? 3.677   51.342  108.688 1.00 30.83  ? 132 ASN C CG  1 
ATOM   5541 O OD1 . ASN C 1 133 ? 2.599   50.859  109.051 1.00 30.72  ? 132 ASN C OD1 1 
ATOM   5542 N ND2 . ASN C 1 133 ? 4.351   52.213  109.422 1.00 29.15  ? 132 ASN C ND2 1 
ATOM   5543 N N   . LEU C 1 134 ? 4.188   48.680  104.608 1.00 31.31  ? 133 LEU C N   1 
ATOM   5544 C CA  . LEU C 1 134 ? 4.486   48.564  103.188 1.00 30.68  ? 133 LEU C CA  1 
ATOM   5545 C C   . LEU C 1 134 ? 3.425   47.693  102.581 1.00 31.18  ? 133 LEU C C   1 
ATOM   5546 O O   . LEU C 1 134 ? 3.243   46.538  102.988 1.00 31.16  ? 133 LEU C O   1 
ATOM   5547 C CB  . LEU C 1 134 ? 5.869   47.951  102.979 1.00 30.62  ? 133 LEU C CB  1 
ATOM   5548 C CG  . LEU C 1 134 ? 7.036   48.624  103.707 1.00 29.77  ? 133 LEU C CG  1 
ATOM   5549 C CD1 . LEU C 1 134 ? 8.339   47.867  103.457 1.00 28.85  ? 133 LEU C CD1 1 
ATOM   5550 C CD2 . LEU C 1 134 ? 7.163   50.077  103.296 1.00 29.25  ? 133 LEU C CD2 1 
ATOM   5551 N N   . LEU C 1 135 ? 2.692   48.249  101.625 1.00 31.54  ? 134 LEU C N   1 
ATOM   5552 C CA  . LEU C 1 135 ? 1.544   47.539  101.086 1.00 32.30  ? 134 LEU C CA  1 
ATOM   5553 C C   . LEU C 1 135 ? 1.810   47.040  99.677  1.00 33.01  ? 134 LEU C C   1 
ATOM   5554 O O   . LEU C 1 135 ? 2.548   47.657  98.926  1.00 33.21  ? 134 LEU C O   1 
ATOM   5555 C CB  . LEU C 1 135 ? 0.274   48.406  101.174 1.00 32.28  ? 134 LEU C CB  1 
ATOM   5556 C CG  . LEU C 1 135 ? -0.060  49.026  102.547 1.00 31.83  ? 134 LEU C CG  1 
ATOM   5557 C CD1 . LEU C 1 135 ? -1.198  50.016  102.421 1.00 32.77  ? 134 LEU C CD1 1 
ATOM   5558 C CD2 . LEU C 1 135 ? -0.436  47.966  103.566 1.00 31.74  ? 134 LEU C CD2 1 
ATOM   5559 N N   . ILE C 1 136 ? 1.224   45.899  99.333  1.00 34.27  ? 135 ILE C N   1 
ATOM   5560 C CA  . ILE C 1 136 ? 1.433   45.292  98.031  1.00 35.53  ? 135 ILE C CA  1 
ATOM   5561 C C   . ILE C 1 136 ? 0.095   44.938  97.391  1.00 36.69  ? 135 ILE C C   1 
ATOM   5562 O O   . ILE C 1 136 ? -0.909  44.775  98.087  1.00 36.55  ? 135 ILE C O   1 
ATOM   5563 C CB  . ILE C 1 136 ? 2.324   44.017  98.155  1.00 35.36  ? 135 ILE C CB  1 
ATOM   5564 C CG1 . ILE C 1 136 ? 1.523   42.860  98.776  1.00 35.88  ? 135 ILE C CG1 1 
ATOM   5565 C CG2 . ILE C 1 136 ? 3.600   44.320  98.935  1.00 35.89  ? 135 ILE C CG2 1 
ATOM   5566 C CD1 . ILE C 1 136 ? 2.320   41.623  99.122  1.00 36.57  ? 135 ILE C CD1 1 
ATOM   5567 N N   . ASN C 1 137 ? 0.083   44.816  96.066  1.00 38.00  ? 136 ASN C N   1 
ATOM   5568 C CA  . ASN C 1 137 ? -1.108  44.333  95.378  1.00 39.76  ? 136 ASN C CA  1 
ATOM   5569 C C   . ASN C 1 137 ? -0.816  43.080  94.555  1.00 40.99  ? 136 ASN C C   1 
ATOM   5570 O O   . ASN C 1 137 ? 0.329   42.609  94.531  1.00 41.24  ? 136 ASN C O   1 
ATOM   5571 C CB  . ASN C 1 137 ? -1.757  45.438  94.523  1.00 39.47  ? 136 ASN C CB  1 
ATOM   5572 C CG  . ASN C 1 137 ? -0.818  46.010  93.475  1.00 39.56  ? 136 ASN C CG  1 
ATOM   5573 O OD1 . ASN C 1 137 ? 0.147   45.373  93.066  1.00 40.38  ? 136 ASN C OD1 1 
ATOM   5574 N ND2 . ASN C 1 137 ? -1.103  47.227  93.037  1.00 39.65  ? 136 ASN C ND2 1 
ATOM   5575 N N   . THR C 1 138 ? -1.842  42.553  93.882  1.00 42.45  ? 137 THR C N   1 
ATOM   5576 C CA  . THR C 1 138 ? -1.674  41.396  92.997  1.00 43.98  ? 137 THR C CA  1 
ATOM   5577 C C   . THR C 1 138 ? -0.842  41.696  91.756  1.00 44.33  ? 137 THR C C   1 
ATOM   5578 O O   . THR C 1 138 ? -0.309  40.772  91.150  1.00 45.28  ? 137 THR C O   1 
ATOM   5579 C CB  . THR C 1 138 ? -3.029  40.781  92.577  1.00 44.07  ? 137 THR C CB  1 
ATOM   5580 O OG1 . THR C 1 138 ? -4.029  41.803  92.522  1.00 45.20  ? 137 THR C OG1 1 
ATOM   5581 C CG2 . THR C 1 138 ? -3.549  39.847  93.658  1.00 45.05  ? 137 THR C CG2 1 
ATOM   5582 N N   . GLU C 1 139 ? -0.722  42.970  91.380  1.00 44.61  ? 138 GLU C N   1 
ATOM   5583 C CA  . GLU C 1 139 ? 0.020   43.344  90.168  1.00 44.82  ? 138 GLU C CA  1 
ATOM   5584 C C   . GLU C 1 139 ? 1.536   43.529  90.372  1.00 43.94  ? 138 GLU C C   1 
ATOM   5585 O O   . GLU C 1 139 ? 2.232   44.017  89.479  1.00 44.70  ? 138 GLU C O   1 
ATOM   5586 C CB  . GLU C 1 139 ? -0.606  44.573  89.489  1.00 45.35  ? 138 GLU C CB  1 
ATOM   5587 C CG  . GLU C 1 139 ? -1.469  44.235  88.275  1.00 48.73  ? 138 GLU C CG  1 
ATOM   5588 C CD  . GLU C 1 139 ? -1.143  45.080  87.037  1.00 53.36  ? 138 GLU C CD  1 
ATOM   5589 O OE1 . GLU C 1 139 ? -1.532  46.276  86.998  1.00 54.78  ? 138 GLU C OE1 1 
ATOM   5590 O OE2 . GLU C 1 139 ? -0.507  44.545  86.091  1.00 53.89  ? 138 GLU C OE2 1 
ATOM   5591 N N   . GLY C 1 140 ? 2.053   43.145  91.536  1.00 42.65  ? 139 GLY C N   1 
ATOM   5592 C CA  . GLY C 1 140 ? 3.485   43.197  91.773  1.00 40.69  ? 139 GLY C CA  1 
ATOM   5593 C C   . GLY C 1 140 ? 4.065   44.523  92.242  1.00 39.25  ? 139 GLY C C   1 
ATOM   5594 O O   . GLY C 1 140 ? 5.289   44.688  92.257  1.00 39.13  ? 139 GLY C O   1 
ATOM   5595 N N   . ALA C 1 141 ? 3.204   45.464  92.630  1.00 37.87  ? 140 ALA C N   1 
ATOM   5596 C CA  . ALA C 1 141 ? 3.663   46.751  93.159  1.00 36.50  ? 140 ALA C CA  1 
ATOM   5597 C C   . ALA C 1 141 ? 3.794   46.731  94.684  1.00 35.31  ? 140 ALA C C   1 
ATOM   5598 O O   . ALA C 1 141 ? 3.121   45.956  95.361  1.00 34.48  ? 140 ALA C O   1 
ATOM   5599 C CB  . ALA C 1 141 ? 2.728   47.875  92.717  1.00 36.53  ? 140 ALA C CB  1 
ATOM   5600 N N   . ILE C 1 142 ? 4.671   47.580  95.211  1.00 34.32  ? 141 ILE C N   1 
ATOM   5601 C CA  . ILE C 1 142 ? 4.757   47.811  96.653  1.00 33.57  ? 141 ILE C CA  1 
ATOM   5602 C C   . ILE C 1 142 ? 4.839   49.303  96.913  1.00 33.30  ? 141 ILE C C   1 
ATOM   5603 O O   . ILE C 1 142 ? 5.481   50.029  96.162  1.00 33.29  ? 141 ILE C O   1 
ATOM   5604 C CB  . ILE C 1 142 ? 5.952   47.019  97.305  1.00 33.82  ? 141 ILE C CB  1 
ATOM   5605 C CG1 . ILE C 1 142 ? 5.949   47.175  98.834  1.00 33.75  ? 141 ILE C CG1 1 
ATOM   5606 C CG2 . ILE C 1 142 ? 7.293   47.411  96.688  1.00 32.37  ? 141 ILE C CG2 1 
ATOM   5607 C CD1 . ILE C 1 142 ? 6.850   46.172  99.566  1.00 35.48  ? 141 ILE C CD1 1 
ATOM   5608 N N   . LYS C 1 143 ? 4.174   49.767  97.966  1.00 33.25  ? 142 LYS C N   1 
ATOM   5609 C CA  . LYS C 1 143 ? 4.100   51.201  98.228  1.00 33.31  ? 142 LYS C CA  1 
ATOM   5610 C C   . LYS C 1 143 ? 4.233   51.557  99.704  1.00 33.16  ? 142 LYS C C   1 
ATOM   5611 O O   . LYS C 1 143 ? 3.715   50.845  100.554 1.00 33.35  ? 142 LYS C O   1 
ATOM   5612 C CB  . LYS C 1 143 ? 2.779   51.770  97.686  1.00 33.53  ? 142 LYS C CB  1 
ATOM   5613 C CG  . LYS C 1 143 ? 2.225   51.045  96.468  1.00 33.66  ? 142 LYS C CG  1 
ATOM   5614 C CD  . LYS C 1 143 ? 1.273   51.902  95.657  1.00 34.30  ? 142 LYS C CD  1 
ATOM   5615 C CE  . LYS C 1 143 ? 0.870   51.152  94.387  1.00 36.26  ? 142 LYS C CE  1 
ATOM   5616 N NZ  . LYS C 1 143 ? 0.449   52.052  93.280  1.00 38.16  ? 142 LYS C NZ  1 
ATOM   5617 N N   . LEU C 1 144 ? 4.907   52.671  99.992  1.00 32.94  ? 143 LEU C N   1 
ATOM   5618 C CA  . LEU C 1 144 ? 4.950   53.235  101.336 1.00 33.04  ? 143 LEU C CA  1 
ATOM   5619 C C   . LEU C 1 144 ? 3.570   53.721  101.805 1.00 33.22  ? 143 LEU C C   1 
ATOM   5620 O O   . LEU C 1 144 ? 2.840   54.395  101.065 1.00 33.44  ? 143 LEU C O   1 
ATOM   5621 C CB  . LEU C 1 144 ? 5.941   54.402  101.415 1.00 33.23  ? 143 LEU C CB  1 
ATOM   5622 C CG  . LEU C 1 144 ? 7.231   54.426  100.592 1.00 33.64  ? 143 LEU C CG  1 
ATOM   5623 C CD1 . LEU C 1 144 ? 8.103   55.597  101.019 1.00 32.76  ? 143 LEU C CD1 1 
ATOM   5624 C CD2 . LEU C 1 144 ? 7.990   53.126  100.725 1.00 34.89  ? 143 LEU C CD2 1 
ATOM   5625 N N   . ALA C 1 145 ? 3.219   53.362  103.033 1.00 33.07  ? 144 ALA C N   1 
ATOM   5626 C CA  . ALA C 1 145 ? 1.994   53.835  103.659 1.00 33.07  ? 144 ALA C CA  1 
ATOM   5627 C C   . ALA C 1 145 ? 2.248   54.257  105.106 1.00 32.96  ? 144 ALA C C   1 
ATOM   5628 O O   . ALA C 1 145 ? 3.334   54.046  105.651 1.00 32.84  ? 144 ALA C O   1 
ATOM   5629 C CB  . ALA C 1 145 ? 0.923   52.779  103.588 1.00 32.82  ? 144 ALA C CB  1 
ATOM   5630 N N   . ASP C 1 146 ? 1.216   54.851  105.703 1.00 32.74  ? 145 ASP C N   1 
ATOM   5631 C CA  . ASP C 1 146 ? 1.233   55.439  107.044 1.00 32.17  ? 145 ASP C CA  1 
ATOM   5632 C C   . ASP C 1 146 ? 2.286   56.512  107.228 1.00 31.69  ? 145 ASP C C   1 
ATOM   5633 O O   . ASP C 1 146 ? 3.374   56.253  107.735 1.00 32.01  ? 145 ASP C O   1 
ATOM   5634 C CB  . ASP C 1 146 ? 1.310   54.378  108.155 1.00 32.29  ? 145 ASP C CB  1 
ATOM   5635 C CG  . ASP C 1 146 ? 0.894   54.927  109.521 1.00 32.64  ? 145 ASP C CG  1 
ATOM   5636 O OD1 . ASP C 1 146 ? 0.670   56.152  109.656 1.00 32.01  ? 145 ASP C OD1 1 
ATOM   5637 O OD2 . ASP C 1 146 ? 0.756   54.198  110.525 1.00 35.02  ? 145 ASP C OD2 1 
ATOM   5638 N N   . PHE C 1 147 ? 1.930   57.729  106.838 1.00 31.31  ? 146 PHE C N   1 
ATOM   5639 C CA  . PHE C 1 147 ? 2.805   58.887  106.995 1.00 30.76  ? 146 PHE C CA  1 
ATOM   5640 C C   . PHE C 1 147 ? 2.528   59.662  108.299 1.00 31.03  ? 146 PHE C C   1 
ATOM   5641 O O   . PHE C 1 147 ? 2.852   60.848  108.422 1.00 30.50  ? 146 PHE C O   1 
ATOM   5642 C CB  . PHE C 1 147 ? 2.706   59.786  105.756 1.00 30.62  ? 146 PHE C CB  1 
ATOM   5643 C CG  . PHE C 1 147 ? 3.544   59.306  104.595 1.00 29.75  ? 146 PHE C CG  1 
ATOM   5644 C CD1 . PHE C 1 147 ? 3.156   58.192  103.845 1.00 27.98  ? 146 PHE C CD1 1 
ATOM   5645 C CD2 . PHE C 1 147 ? 4.728   59.964  104.263 1.00 28.37  ? 146 PHE C CD2 1 
ATOM   5646 C CE1 . PHE C 1 147 ? 3.943   57.734  102.785 1.00 29.01  ? 146 PHE C CE1 1 
ATOM   5647 C CE2 . PHE C 1 147 ? 5.518   59.528  103.200 1.00 28.58  ? 146 PHE C CE2 1 
ATOM   5648 C CZ  . PHE C 1 147 ? 5.130   58.416  102.453 1.00 28.84  ? 146 PHE C CZ  1 
ATOM   5649 N N   . GLY C 1 148 ? 1.960   58.968  109.284 1.00 31.52  ? 147 GLY C N   1 
ATOM   5650 C CA  . GLY C 1 148 ? 1.589   59.587  110.548 1.00 32.37  ? 147 GLY C CA  1 
ATOM   5651 C C   . GLY C 1 148 ? 2.788   60.074  111.349 1.00 33.15  ? 147 GLY C C   1 
ATOM   5652 O O   . GLY C 1 148 ? 2.707   61.060  112.092 1.00 33.30  ? 147 GLY C O   1 
ATOM   5653 N N   . LEU C 1 149 ? 3.914   59.390  111.184 1.00 33.29  ? 148 LEU C N   1 
ATOM   5654 C CA  . LEU C 1 149 ? 5.116   59.728  111.927 1.00 33.77  ? 148 LEU C CA  1 
ATOM   5655 C C   . LEU C 1 149 ? 6.066   60.572  111.070 1.00 33.76  ? 148 LEU C C   1 
ATOM   5656 O O   . LEU C 1 149 ? 7.163   60.924  111.513 1.00 33.41  ? 148 LEU C O   1 
ATOM   5657 C CB  . LEU C 1 149 ? 5.798   58.443  112.401 1.00 33.75  ? 148 LEU C CB  1 
ATOM   5658 C CG  . LEU C 1 149 ? 5.622   57.945  113.843 1.00 35.25  ? 148 LEU C CG  1 
ATOM   5659 C CD1 . LEU C 1 149 ? 4.857   58.906  114.741 1.00 34.43  ? 148 LEU C CD1 1 
ATOM   5660 C CD2 . LEU C 1 149 ? 4.981   56.567  113.866 1.00 36.45  ? 148 LEU C CD2 1 
ATOM   5661 N N   . ALA C 1 150 ? 5.631   60.889  109.843 1.00 33.71  ? 149 ALA C N   1 
ATOM   5662 C CA  . ALA C 1 150 ? 6.443   61.658  108.890 1.00 33.70  ? 149 ALA C CA  1 
ATOM   5663 C C   . ALA C 1 150 ? 6.682   63.101  109.316 1.00 33.70  ? 149 ALA C C   1 
ATOM   5664 O O   . ALA C 1 150 ? 6.000   63.613  110.188 1.00 33.66  ? 149 ALA C O   1 
ATOM   5665 C CB  . ALA C 1 150 ? 5.816   61.622  107.498 1.00 33.47  ? 149 ALA C CB  1 
ATOM   5666 N N   . ARG C 1 151 ? 7.656   63.754  108.693 1.00 33.96  ? 150 ARG C N   1 
ATOM   5667 C CA  . ARG C 1 151 ? 7.844   65.184  108.895 1.00 34.45  ? 150 ARG C CA  1 
ATOM   5668 C C   . ARG C 1 151 ? 8.691   65.832  107.789 1.00 34.68  ? 150 ARG C C   1 
ATOM   5669 O O   . ARG C 1 151 ? 9.584   65.202  107.226 1.00 34.48  ? 150 ARG C O   1 
ATOM   5670 C CB  . ARG C 1 151 ? 8.422   65.449  110.288 1.00 34.48  ? 150 ARG C CB  1 
ATOM   5671 C CG  . ARG C 1 151 ? 9.918   65.603  110.348 1.00 35.05  ? 150 ARG C CG  1 
ATOM   5672 C CD  . ARG C 1 151 ? 10.351  67.002  110.771 1.00 37.07  ? 150 ARG C CD  1 
ATOM   5673 N NE  . ARG C 1 151 ? 10.038  67.258  112.174 1.00 37.46  ? 150 ARG C NE  1 
ATOM   5674 C CZ  . ARG C 1 151 ? 9.702   68.440  112.670 1.00 37.76  ? 150 ARG C CZ  1 
ATOM   5675 N NH1 . ARG C 1 151 ? 9.634   69.507  111.884 1.00 36.45  ? 150 ARG C NH1 1 
ATOM   5676 N NH2 . ARG C 1 151 ? 9.434   68.556  113.965 1.00 38.28  ? 150 ARG C NH2 1 
ATOM   5677 N N   . ALA C 1 152 ? 8.404   67.090  107.489 1.00 35.30  ? 151 ALA C N   1 
ATOM   5678 C CA  . ALA C 1 152 ? 9.180   67.829  106.504 1.00 36.77  ? 151 ALA C CA  1 
ATOM   5679 C C   . ALA C 1 152 ? 10.507  68.251  107.129 1.00 37.76  ? 151 ALA C C   1 
ATOM   5680 O O   . ALA C 1 152 ? 10.527  68.927  108.160 1.00 38.15  ? 151 ALA C O   1 
ATOM   5681 C CB  . ALA C 1 152 ? 8.395   69.050  106.002 1.00 36.62  ? 151 ALA C CB  1 
ATOM   5682 N N   . PHE C 1 153 ? 11.614  67.831  106.527 1.00 38.58  ? 152 PHE C N   1 
ATOM   5683 C CA  . PHE C 1 153 ? 12.922  68.187  107.075 1.00 39.56  ? 152 PHE C CA  1 
ATOM   5684 C C   . PHE C 1 153 ? 13.552  69.432  106.443 1.00 40.60  ? 152 PHE C C   1 
ATOM   5685 O O   . PHE C 1 153 ? 13.277  69.763  105.287 1.00 40.93  ? 152 PHE C O   1 
ATOM   5686 C CB  . PHE C 1 153 ? 13.883  66.981  107.106 1.00 38.78  ? 152 PHE C CB  1 
ATOM   5687 C CG  . PHE C 1 153 ? 14.307  66.463  105.747 1.00 37.96  ? 152 PHE C CG  1 
ATOM   5688 C CD1 . PHE C 1 153 ? 13.637  65.394  105.156 1.00 36.36  ? 152 PHE C CD1 1 
ATOM   5689 C CD2 . PHE C 1 153 ? 15.428  66.988  105.093 1.00 37.05  ? 152 PHE C CD2 1 
ATOM   5690 C CE1 . PHE C 1 153 ? 14.048  64.880  103.913 1.00 34.96  ? 152 PHE C CE1 1 
ATOM   5691 C CE2 . PHE C 1 153 ? 15.843  66.485  103.858 1.00 35.42  ? 152 PHE C CE2 1 
ATOM   5692 C CZ  . PHE C 1 153 ? 15.147  65.429  103.267 1.00 34.78  ? 152 PHE C CZ  1 
ATOM   5693 N N   . GLY C 1 154 ? 14.359  70.141  107.230 1.00 42.08  ? 153 GLY C N   1 
ATOM   5694 C CA  . GLY C 1 154 ? 15.149  71.267  106.735 1.00 44.19  ? 153 GLY C CA  1 
ATOM   5695 C C   . GLY C 1 154 ? 16.469  70.764  106.170 1.00 45.32  ? 153 GLY C C   1 
ATOM   5696 O O   . GLY C 1 154 ? 16.854  69.623  106.447 1.00 45.60  ? 153 GLY C O   1 
ATOM   5697 N N   . VAL C 1 155 ? 17.170  71.586  105.391 1.00 46.47  ? 154 VAL C N   1 
ATOM   5698 C CA  . VAL C 1 155 ? 18.370  71.101  104.679 1.00 47.60  ? 154 VAL C CA  1 
ATOM   5699 C C   . VAL C 1 155 ? 19.498  70.647  105.630 1.00 48.29  ? 154 VAL C C   1 
ATOM   5700 O O   . VAL C 1 155 ? 19.699  69.424  105.777 1.00 49.05  ? 154 VAL C O   1 
ATOM   5701 C CB  . VAL C 1 155 ? 18.896  72.063  103.610 1.00 47.59  ? 154 VAL C CB  1 
ATOM   5702 C CG1 . VAL C 1 155 ? 18.634  71.484  102.239 1.00 47.60  ? 154 VAL C CG1 1 
ATOM   5703 C CG2 . VAL C 1 155 ? 18.281  73.440  103.784 1.00 47.98  ? 154 VAL C CG2 1 
ATOM   5704 N N   . PRO C 1 156 ? 20.225  71.570  106.280 1.00 48.03  ? 155 PRO C N   1 
ATOM   5705 C CA  . PRO C 1 156 ? 20.901  71.168  107.509 1.00 47.76  ? 155 PRO C CA  1 
ATOM   5706 C C   . PRO C 1 156 ? 19.729  70.918  108.436 1.00 47.68  ? 155 PRO C C   1 
ATOM   5707 O O   . PRO C 1 156 ? 19.010  71.869  108.771 1.00 47.83  ? 155 PRO C O   1 
ATOM   5708 C CB  . PRO C 1 156 ? 21.711  72.407  107.912 1.00 47.72  ? 155 PRO C CB  1 
ATOM   5709 C CG  . PRO C 1 156 ? 21.078  73.552  107.212 1.00 47.70  ? 155 PRO C CG  1 
ATOM   5710 C CD  . PRO C 1 156 ? 20.473  72.988  105.958 1.00 48.08  ? 155 PRO C CD  1 
ATOM   5711 N N   . VAL C 1 157 ? 19.478  69.653  108.770 1.00 47.45  ? 156 VAL C N   1 
ATOM   5712 C CA  . VAL C 1 157 ? 18.347  69.321  109.634 1.00 47.10  ? 156 VAL C CA  1 
ATOM   5713 C C   . VAL C 1 157 ? 18.524  70.067  110.940 1.00 47.00  ? 156 VAL C C   1 
ATOM   5714 O O   . VAL C 1 157 ? 19.613  70.575  111.222 1.00 47.28  ? 156 VAL C O   1 
ATOM   5715 C CB  . VAL C 1 157 ? 18.212  67.795  109.904 1.00 46.99  ? 156 VAL C CB  1 
ATOM   5716 C CG1 . VAL C 1 157 ? 18.066  67.024  108.599 1.00 46.45  ? 156 VAL C CG1 1 
ATOM   5717 C CG2 . VAL C 1 157 ? 19.381  67.259  110.751 1.00 46.68  ? 156 VAL C CG2 1 
ATOM   5718 N N   . ARG C 1 158 ? 17.458  70.177  111.719 1.00 46.73  ? 157 ARG C N   1 
ATOM   5719 C CA  . ARG C 1 158 ? 17.635  70.510  113.125 1.00 46.57  ? 157 ARG C CA  1 
ATOM   5720 C C   . ARG C 1 158 ? 17.175  69.335  113.982 1.00 45.91  ? 157 ARG C C   1 
ATOM   5721 O O   . ARG C 1 158 ? 16.939  68.231  113.470 1.00 45.63  ? 157 ARG C O   1 
ATOM   5722 C CB  . ARG C 1 158 ? 16.958  71.840  113.499 1.00 46.87  ? 157 ARG C CB  1 
ATOM   5723 C CG  . ARG C 1 158 ? 15.474  71.929  113.196 1.00 48.17  ? 157 ARG C CG  1 
ATOM   5724 C CD  . ARG C 1 158 ? 14.785  73.078  113.918 1.00 50.83  ? 157 ARG C CD  1 
ATOM   5725 N NE  . ARG C 1 158 ? 13.475  72.691  114.445 1.00 52.41  ? 157 ARG C NE  1 
ATOM   5726 C CZ  . ARG C 1 158 ? 12.333  72.815  113.774 1.00 52.64  ? 157 ARG C CZ  1 
ATOM   5727 N NH1 . ARG C 1 158 ? 12.330  73.321  112.543 1.00 52.49  ? 157 ARG C NH1 1 
ATOM   5728 N NH2 . ARG C 1 158 ? 11.193  72.439  114.335 1.00 52.43  ? 157 ARG C NH2 1 
ATOM   5729 N N   . THR C 1 159 ? 17.070  69.557  115.284 1.00 45.35  ? 158 THR C N   1 
ATOM   5730 C CA  . THR C 1 159 ? 16.635  68.501  116.176 1.00 44.84  ? 158 THR C CA  1 
ATOM   5731 C C   . THR C 1 159 ? 15.149  68.224  115.956 1.00 44.39  ? 158 THR C C   1 
ATOM   5732 O O   . THR C 1 159 ? 14.320  69.139  115.941 1.00 44.29  ? 158 THR C O   1 
ATOM   5733 C CB  . THR C 1 159 ? 16.969  68.854  117.629 1.00 44.75  ? 158 THR C CB  1 
ATOM   5734 O OG1 . THR C 1 159 ? 18.387  68.757  117.805 1.00 45.00  ? 158 THR C OG1 1 
ATOM   5735 C CG2 . THR C 1 159 ? 16.435  67.795  118.584 1.00 44.93  ? 158 THR C CG2 1 
ATOM   5736 N N   . TYR C 1 160 ? 14.837  66.957  115.726 1.00 43.74  ? 159 TYR C N   1 
ATOM   5737 C CA  . TYR C 1 160 ? 13.458  66.530  115.584 1.00 43.51  ? 159 TYR C CA  1 
ATOM   5738 C C   . TYR C 1 160 ? 13.099  65.589  116.734 1.00 43.43  ? 159 TYR C C   1 
ATOM   5739 O O   . TYR C 1 160 ? 13.885  65.431  117.678 1.00 43.03  ? 159 TYR C O   1 
ATOM   5740 C CB  . TYR C 1 160 ? 13.241  65.887  114.216 1.00 43.34  ? 159 TYR C CB  1 
ATOM   5741 C CG  . TYR C 1 160 ? 13.570  66.799  113.060 1.00 42.83  ? 159 TYR C CG  1 
ATOM   5742 C CD1 . TYR C 1 160 ? 13.114  68.120  113.029 1.00 42.37  ? 159 TYR C CD1 1 
ATOM   5743 C CD2 . TYR C 1 160 ? 14.350  66.343  111.994 1.00 43.46  ? 159 TYR C CD2 1 
ATOM   5744 C CE1 . TYR C 1 160 ? 13.420  68.962  111.954 1.00 42.61  ? 159 TYR C CE1 1 
ATOM   5745 C CE2 . TYR C 1 160 ? 14.666  67.174  110.922 1.00 42.34  ? 159 TYR C CE2 1 
ATOM   5746 C CZ  . TYR C 1 160 ? 14.196  68.476  110.909 1.00 42.68  ? 159 TYR C CZ  1 
ATOM   5747 O OH  . TYR C 1 160 ? 14.507  69.289  109.851 1.00 44.19  ? 159 TYR C OH  1 
HETATM 5748 N N   . TPO C 1 161 ? 11.916  64.981  116.659 1.00 43.52  ? 160 TPO C N   1 
HETATM 5749 C CA  . TPO C 1 161 ? 11.426  64.107  117.718 1.00 43.56  ? 160 TPO C CA  1 
HETATM 5750 C CB  . TPO C 1 161 ? 9.963   63.772  117.472 1.00 43.13  ? 160 TPO C CB  1 
HETATM 5751 C CG2 . TPO C 1 161 ? 9.359   62.952  118.614 1.00 42.06  ? 160 TPO C CG2 1 
HETATM 5752 O OG1 . TPO C 1 161 ? 9.269   65.011  117.330 1.00 41.17  ? 160 TPO C OG1 1 
HETATM 5753 P P   . TPO C 1 161 ? 8.695   65.459  115.892 1.00 38.32  ? 160 TPO C P   1 
HETATM 5754 O O1P . TPO C 1 161 ? 7.914   66.829  116.010 1.00 37.07  ? 160 TPO C O1P 1 
HETATM 5755 O O2P . TPO C 1 161 ? 9.920   65.614  114.885 1.00 39.63  ? 160 TPO C O2P 1 
HETATM 5756 O O3P . TPO C 1 161 ? 7.706   64.340  115.342 1.00 36.79  ? 160 TPO C O3P 1 
HETATM 5757 C C   . TPO C 1 161 ? 12.275  62.871  117.827 1.00 44.60  ? 160 TPO C C   1 
HETATM 5758 O O   . TPO C 1 161 ? 12.532  62.189  116.846 1.00 44.20  ? 160 TPO C O   1 
ATOM   5759 N N   . HIS C 1 162 ? 12.727  62.592  119.044 1.00 46.07  ? 161 HIS C N   1 
ATOM   5760 C CA  . HIS C 1 162 ? 13.553  61.422  119.295 1.00 47.81  ? 161 HIS C CA  1 
ATOM   5761 C C   . HIS C 1 162 ? 12.715  60.144  119.306 1.00 47.94  ? 161 HIS C C   1 
ATOM   5762 O O   . HIS C 1 162 ? 13.190  59.080  118.909 1.00 47.94  ? 161 HIS C O   1 
ATOM   5763 C CB  . HIS C 1 162 ? 14.322  61.569  120.607 1.00 48.55  ? 161 HIS C CB  1 
ATOM   5764 C CG  . HIS C 1 162 ? 15.088  60.341  120.983 1.00 51.34  ? 161 HIS C CG  1 
ATOM   5765 N ND1 . HIS C 1 162 ? 14.584  59.385  121.841 1.00 53.62  ? 161 HIS C ND1 1 
ATOM   5766 C CD2 . HIS C 1 162 ? 16.301  59.891  120.586 1.00 53.56  ? 161 HIS C CD2 1 
ATOM   5767 C CE1 . HIS C 1 162 ? 15.463  58.407  121.970 1.00 54.68  ? 161 HIS C CE1 1 
ATOM   5768 N NE2 . HIS C 1 162 ? 16.514  58.689  121.218 1.00 55.01  ? 161 HIS C NE2 1 
ATOM   5769 N N   . GLU C 1 163 ? 11.469  60.267  119.752 1.00 48.46  ? 162 GLU C N   1 
ATOM   5770 C CA  . GLU C 1 163 ? 10.542  59.135  119.859 1.00 49.14  ? 162 GLU C CA  1 
ATOM   5771 C C   . GLU C 1 163 ? 10.134  58.636  118.468 1.00 48.51  ? 162 GLU C C   1 
ATOM   5772 O O   . GLU C 1 163 ? 8.995   58.856  118.016 1.00 48.90  ? 162 GLU C O   1 
ATOM   5773 C CB  . GLU C 1 163 ? 9.302   59.539  120.669 1.00 49.64  ? 162 GLU C CB  1 
ATOM   5774 C CG  . GLU C 1 163 ? 9.563   59.807  122.148 1.00 52.74  ? 162 GLU C CG  1 
ATOM   5775 C CD  . GLU C 1 163 ? 10.177  61.176  122.403 1.00 56.56  ? 162 GLU C CD  1 
ATOM   5776 O OE1 . GLU C 1 163 ? 9.590   62.191  121.952 1.00 58.19  ? 162 GLU C OE1 1 
ATOM   5777 O OE2 . GLU C 1 163 ? 11.253  61.236  123.049 1.00 58.17  ? 162 GLU C OE2 1 
ATOM   5778 N N   . VAL C 1 164 ? 11.060  57.953  117.797 1.00 47.20  ? 163 VAL C N   1 
ATOM   5779 C CA  . VAL C 1 164 ? 10.935  57.758  116.358 1.00 45.89  ? 163 VAL C CA  1 
ATOM   5780 C C   . VAL C 1 164 ? 11.401  56.374  115.895 1.00 44.79  ? 163 VAL C C   1 
ATOM   5781 O O   . VAL C 1 164 ? 12.370  55.829  116.409 1.00 44.92  ? 163 VAL C O   1 
ATOM   5782 C CB  . VAL C 1 164 ? 11.617  58.948  115.606 1.00 46.03  ? 163 VAL C CB  1 
ATOM   5783 C CG1 . VAL C 1 164 ? 12.511  58.496  114.459 1.00 45.87  ? 163 VAL C CG1 1 
ATOM   5784 C CG2 . VAL C 1 164 ? 10.563  59.941  115.130 1.00 45.91  ? 163 VAL C CG2 1 
ATOM   5785 N N   . VAL C 1 165 ? 10.683  55.823  114.925 1.00 43.64  ? 164 VAL C N   1 
ATOM   5786 C CA  . VAL C 1 165 ? 10.900  54.471  114.389 1.00 42.60  ? 164 VAL C CA  1 
ATOM   5787 C C   . VAL C 1 165 ? 10.568  53.366  115.405 1.00 42.10  ? 164 VAL C C   1 
ATOM   5788 O O   . VAL C 1 165 ? 11.016  53.399  116.549 1.00 41.78  ? 164 VAL C O   1 
ATOM   5789 C CB  . VAL C 1 165 ? 12.332  54.248  113.756 1.00 42.64  ? 164 VAL C CB  1 
ATOM   5790 C CG1 . VAL C 1 165 ? 12.308  53.082  112.787 1.00 42.08  ? 164 VAL C CG1 1 
ATOM   5791 C CG2 . VAL C 1 165 ? 12.851  55.489  113.030 1.00 42.25  ? 164 VAL C CG2 1 
ATOM   5792 N N   . THR C 1 166 ? 9.750   52.410  114.977 1.00 41.70  ? 165 THR C N   1 
ATOM   5793 C CA  . THR C 1 166 ? 9.563   51.157  115.700 1.00 41.96  ? 165 THR C CA  1 
ATOM   5794 C C   . THR C 1 166 ? 10.952  50.569  115.972 1.00 41.91  ? 165 THR C C   1 
ATOM   5795 O O   . THR C 1 166 ? 11.794  50.508  115.064 1.00 41.86  ? 165 THR C O   1 
ATOM   5796 C CB  . THR C 1 166 ? 8.690   50.209  114.856 1.00 41.89  ? 165 THR C CB  1 
ATOM   5797 O OG1 . THR C 1 166 ? 7.370   50.756  114.763 1.00 42.65  ? 165 THR C OG1 1 
ATOM   5798 C CG2 . THR C 1 166 ? 8.457   48.867  115.552 1.00 42.07  ? 165 THR C CG2 1 
ATOM   5799 N N   . LEU C 1 167 ? 11.182  50.160  117.221 1.00 41.87  ? 166 LEU C N   1 
ATOM   5800 C CA  . LEU C 1 167 ? 12.524  49.823  117.724 1.00 41.82  ? 166 LEU C CA  1 
ATOM   5801 C C   . LEU C 1 167 ? 13.374  48.956  116.797 1.00 41.40  ? 166 LEU C C   1 
ATOM   5802 O O   . LEU C 1 167 ? 14.530  49.270  116.537 1.00 41.19  ? 166 LEU C O   1 
ATOM   5803 C CB  . LEU C 1 167 ? 12.442  49.152  119.105 1.00 41.97  ? 166 LEU C CB  1 
ATOM   5804 C CG  . LEU C 1 167 ? 13.797  48.736  119.703 1.00 42.60  ? 166 LEU C CG  1 
ATOM   5805 C CD1 . LEU C 1 167 ? 14.565  49.950  120.233 1.00 42.28  ? 166 LEU C CD1 1 
ATOM   5806 C CD2 . LEU C 1 167 ? 13.637  47.671  120.795 1.00 44.30  ? 166 LEU C CD2 1 
ATOM   5807 N N   . TRP C 1 168 ? 12.791  47.863  116.318 1.00 41.03  ? 167 TRP C N   1 
ATOM   5808 C CA  . TRP C 1 168 ? 13.506  46.888  115.508 1.00 40.75  ? 167 TRP C CA  1 
ATOM   5809 C C   . TRP C 1 168 ? 14.164  47.494  114.258 1.00 40.66  ? 167 TRP C C   1 
ATOM   5810 O O   . TRP C 1 168 ? 15.107  46.915  113.712 1.00 40.56  ? 167 TRP C O   1 
ATOM   5811 C CB  . TRP C 1 168 ? 12.552  45.770  115.090 1.00 40.75  ? 167 TRP C CB  1 
ATOM   5812 C CG  . TRP C 1 168 ? 12.146  44.840  116.189 1.00 40.70  ? 167 TRP C CG  1 
ATOM   5813 C CD1 . TRP C 1 168 ? 12.406  44.968  117.532 1.00 40.85  ? 167 TRP C CD1 1 
ATOM   5814 C CD2 . TRP C 1 168 ? 11.406  43.623  116.043 1.00 39.85  ? 167 TRP C CD2 1 
ATOM   5815 N NE1 . TRP C 1 168 ? 11.866  43.907  118.221 1.00 40.33  ? 167 TRP C NE1 1 
ATOM   5816 C CE2 . TRP C 1 168 ? 11.247  43.065  117.332 1.00 40.37  ? 167 TRP C CE2 1 
ATOM   5817 C CE3 . TRP C 1 168 ? 10.847  42.949  114.951 1.00 39.85  ? 167 TRP C CE3 1 
ATOM   5818 C CZ2 . TRP C 1 168 ? 10.556  41.865  117.555 1.00 40.78  ? 167 TRP C CZ2 1 
ATOM   5819 C CZ3 . TRP C 1 168 ? 10.168  41.756  115.171 1.00 40.29  ? 167 TRP C CZ3 1 
ATOM   5820 C CH2 . TRP C 1 168 ? 10.031  41.226  116.464 1.00 40.39  ? 167 TRP C CH2 1 
ATOM   5821 N N   . TYR C 1 169 ? 13.678  48.658  113.823 1.00 40.04  ? 168 TYR C N   1 
ATOM   5822 C CA  . TYR C 1 169 ? 14.092  49.246  112.540 1.00 39.65  ? 168 TYR C CA  1 
ATOM   5823 C C   . TYR C 1 169 ? 14.777  50.576  112.748 1.00 40.17  ? 168 TYR C C   1 
ATOM   5824 O O   . TYR C 1 169 ? 15.024  51.307  111.797 1.00 40.01  ? 168 TYR C O   1 
ATOM   5825 C CB  . TYR C 1 169 ? 12.896  49.367  111.586 1.00 38.71  ? 168 TYR C CB  1 
ATOM   5826 C CG  . TYR C 1 169 ? 12.189  48.042  111.420 1.00 36.90  ? 168 TYR C CG  1 
ATOM   5827 C CD1 . TYR C 1 169 ? 12.631  47.109  110.485 1.00 34.70  ? 168 TYR C CD1 1 
ATOM   5828 C CD2 . TYR C 1 169 ? 11.106  47.703  112.231 1.00 34.54  ? 168 TYR C CD2 1 
ATOM   5829 C CE1 . TYR C 1 169 ? 12.003  45.877  110.345 1.00 34.44  ? 168 TYR C CE1 1 
ATOM   5830 C CE2 . TYR C 1 169 ? 10.467  46.479  112.105 1.00 34.06  ? 168 TYR C CE2 1 
ATOM   5831 C CZ  . TYR C 1 169 ? 10.921  45.565  111.164 1.00 35.87  ? 168 TYR C CZ  1 
ATOM   5832 O OH  . TYR C 1 169 ? 10.282  44.345  111.040 1.00 37.90  ? 168 TYR C OH  1 
ATOM   5833 N N   . ARG C 1 170 ? 15.102  50.849  114.010 1.00 40.88  ? 169 ARG C N   1 
ATOM   5834 C CA  . ARG C 1 170 ? 15.697  52.100  114.448 1.00 41.89  ? 169 ARG C CA  1 
ATOM   5835 C C   . ARG C 1 170 ? 17.202  52.113  114.215 1.00 42.70  ? 169 ARG C C   1 
ATOM   5836 O O   . ARG C 1 170 ? 17.915  51.176  114.600 1.00 42.97  ? 169 ARG C O   1 
ATOM   5837 C CB  . ARG C 1 170 ? 15.408  52.292  115.934 1.00 41.88  ? 169 ARG C CB  1 
ATOM   5838 C CG  . ARG C 1 170 ? 15.749  53.656  116.510 1.00 41.96  ? 169 ARG C CG  1 
ATOM   5839 C CD  . ARG C 1 170 ? 15.209  53.858  117.931 1.00 41.22  ? 169 ARG C CD  1 
ATOM   5840 N NE  . ARG C 1 170 ? 13.776  53.568  118.011 1.00 41.12  ? 169 ARG C NE  1 
ATOM   5841 C CZ  . ARG C 1 170 ? 13.089  53.386  119.138 1.00 41.36  ? 169 ARG C CZ  1 
ATOM   5842 N NH1 . ARG C 1 170 ? 13.685  53.463  120.325 1.00 39.89  ? 169 ARG C NH1 1 
ATOM   5843 N NH2 . ARG C 1 170 ? 11.792  53.122  119.074 1.00 41.03  ? 169 ARG C NH2 1 
ATOM   5844 N N   . ALA C 1 171 ? 17.673  53.191  113.594 1.00 43.53  ? 170 ALA C N   1 
ATOM   5845 C CA  . ALA C 1 171 ? 19.089  53.378  113.299 1.00 44.50  ? 170 ALA C CA  1 
ATOM   5846 C C   . ALA C 1 171 ? 19.888  53.475  114.605 1.00 45.47  ? 170 ALA C C   1 
ATOM   5847 O O   . ALA C 1 171 ? 19.333  53.871  115.630 1.00 45.55  ? 170 ALA C O   1 
ATOM   5848 C CB  . ALA C 1 171 ? 19.275  54.627  112.470 1.00 44.09  ? 170 ALA C CB  1 
ATOM   5849 N N   . PRO C 1 172 ? 21.165  53.083  114.583 1.00 46.29  ? 171 PRO C N   1 
ATOM   5850 C CA  . PRO C 1 172 ? 22.058  53.283  115.734 1.00 47.04  ? 171 PRO C CA  1 
ATOM   5851 C C   . PRO C 1 172 ? 22.142  54.742  116.185 1.00 47.91  ? 171 PRO C C   1 
ATOM   5852 O O   . PRO C 1 172 ? 22.190  54.982  117.397 1.00 48.05  ? 171 PRO C O   1 
ATOM   5853 C CB  . PRO C 1 172 ? 23.419  52.811  115.210 1.00 47.12  ? 171 PRO C CB  1 
ATOM   5854 C CG  . PRO C 1 172 ? 23.270  52.802  113.716 1.00 47.12  ? 171 PRO C CG  1 
ATOM   5855 C CD  . PRO C 1 172 ? 21.848  52.381  113.483 1.00 46.38  ? 171 PRO C CD  1 
ATOM   5856 N N   . GLU C 1 173 ? 22.138  55.689  115.242 1.00 48.61  ? 172 GLU C N   1 
ATOM   5857 C CA  . GLU C 1 173 ? 22.219  57.116  115.580 1.00 49.28  ? 172 GLU C CA  1 
ATOM   5858 C C   . GLU C 1 173 ? 21.083  57.622  116.487 1.00 49.43  ? 172 GLU C C   1 
ATOM   5859 O O   . GLU C 1 173 ? 21.298  58.522  117.294 1.00 49.67  ? 172 GLU C O   1 
ATOM   5860 C CB  . GLU C 1 173 ? 22.383  58.001  114.326 1.00 49.42  ? 172 GLU C CB  1 
ATOM   5861 C CG  . GLU C 1 173 ? 21.238  57.971  113.315 1.00 50.63  ? 172 GLU C CG  1 
ATOM   5862 C CD  . GLU C 1 173 ? 21.529  57.082  112.113 1.00 53.05  ? 172 GLU C CD  1 
ATOM   5863 O OE1 . GLU C 1 173 ? 21.051  57.395  110.995 1.00 53.09  ? 172 GLU C OE1 1 
ATOM   5864 O OE2 . GLU C 1 173 ? 22.229  56.055  112.287 1.00 54.19  ? 172 GLU C OE2 1 
ATOM   5865 N N   . ILE C 1 174 ? 19.886  57.054  116.358 1.00 49.67  ? 173 ILE C N   1 
ATOM   5866 C CA  . ILE C 1 174 ? 18.779  57.413  117.255 1.00 49.92  ? 173 ILE C CA  1 
ATOM   5867 C C   . ILE C 1 174 ? 18.946  56.696  118.599 1.00 50.53  ? 173 ILE C C   1 
ATOM   5868 O O   . ILE C 1 174 ? 18.698  57.271  119.665 1.00 50.49  ? 173 ILE C O   1 
ATOM   5869 C CB  . ILE C 1 174 ? 17.394  57.088  116.620 1.00 49.77  ? 173 ILE C CB  1 
ATOM   5870 C CG1 . ILE C 1 174 ? 17.187  57.892  115.333 1.00 49.37  ? 173 ILE C CG1 1 
ATOM   5871 C CG2 . ILE C 1 174 ? 16.245  57.359  117.605 1.00 48.88  ? 173 ILE C CG2 1 
ATOM   5872 C CD1 . ILE C 1 174 ? 16.173  57.288  114.397 1.00 48.99  ? 173 ILE C CD1 1 
ATOM   5873 N N   . LEU C 1 175 ? 19.378  55.440  118.529 1.00 51.13  ? 174 LEU C N   1 
ATOM   5874 C CA  . LEU C 1 175 ? 19.581  54.625  119.711 1.00 51.75  ? 174 LEU C CA  1 
ATOM   5875 C C   . LEU C 1 175 ? 20.715  55.182  120.569 1.00 52.58  ? 174 LEU C C   1 
ATOM   5876 O O   . LEU C 1 175 ? 20.658  55.119  121.797 1.00 52.66  ? 174 LEU C O   1 
ATOM   5877 C CB  . LEU C 1 175 ? 19.845  53.173  119.312 1.00 51.45  ? 174 LEU C CB  1 
ATOM   5878 C CG  . LEU C 1 175 ? 18.612  52.328  118.966 1.00 51.13  ? 174 LEU C CG  1 
ATOM   5879 C CD1 . LEU C 1 175 ? 19.025  51.025  118.314 1.00 49.95  ? 174 LEU C CD1 1 
ATOM   5880 C CD2 . LEU C 1 175 ? 17.722  52.068  120.188 1.00 50.06  ? 174 LEU C CD2 1 
ATOM   5881 N N   . LEU C 1 176 ? 21.724  55.757  119.919 1.00 53.66  ? 175 LEU C N   1 
ATOM   5882 C CA  . LEU C 1 176 ? 22.831  56.402  120.625 1.00 54.72  ? 175 LEU C CA  1 
ATOM   5883 C C   . LEU C 1 176 ? 22.519  57.861  120.997 1.00 55.40  ? 175 LEU C C   1 
ATOM   5884 O O   . LEU C 1 176 ? 23.398  58.600  121.459 1.00 55.68  ? 175 LEU C O   1 
ATOM   5885 C CB  . LEU C 1 176 ? 24.131  56.286  119.817 1.00 54.83  ? 175 LEU C CB  1 
ATOM   5886 C CG  . LEU C 1 176 ? 24.700  54.862  119.701 1.00 55.35  ? 175 LEU C CG  1 
ATOM   5887 C CD1 . LEU C 1 176 ? 25.593  54.720  118.480 1.00 56.33  ? 175 LEU C CD1 1 
ATOM   5888 C CD2 . LEU C 1 176 ? 25.450  54.449  120.966 1.00 55.68  ? 175 LEU C CD2 1 
ATOM   5889 N N   . GLY C 1 177 ? 21.262  58.258  120.794 1.00 55.90  ? 176 GLY C N   1 
ATOM   5890 C CA  . GLY C 1 177 ? 20.764  59.563  121.195 1.00 56.64  ? 176 GLY C CA  1 
ATOM   5891 C C   . GLY C 1 177 ? 21.426  60.791  120.593 1.00 57.18  ? 176 GLY C C   1 
ATOM   5892 O O   . GLY C 1 177 ? 21.481  61.821  121.256 1.00 57.21  ? 176 GLY C O   1 
ATOM   5893 N N   . CYS C 1 178 ? 21.910  60.692  119.351 1.00 57.73  ? 177 CYS C N   1 
ATOM   5894 C CA  . CYS C 1 178 ? 22.523  61.829  118.651 1.00 58.35  ? 177 CYS C CA  1 
ATOM   5895 C C   . CYS C 1 178 ? 21.498  62.932  118.387 1.00 57.92  ? 177 CYS C C   1 
ATOM   5896 O O   . CYS C 1 178 ? 20.329  62.642  118.132 1.00 58.06  ? 177 CYS C O   1 
ATOM   5897 C CB  . CYS C 1 178 ? 23.173  61.384  117.334 1.00 58.61  ? 177 CYS C CB  1 
ATOM   5898 S SG  . CYS C 1 178 ? 23.785  62.753  116.302 1.00 61.70  ? 177 CYS C SG  1 
ATOM   5899 N N   . LYS C 1 179 ? 21.941  64.190  118.441 1.00 57.49  ? 178 LYS C N   1 
ATOM   5900 C CA  . LYS C 1 179 ? 21.025  65.337  118.363 1.00 56.95  ? 178 LYS C CA  1 
ATOM   5901 C C   . LYS C 1 179 ? 20.342  65.495  117.006 1.00 55.90  ? 178 LYS C C   1 
ATOM   5902 O O   . LYS C 1 179 ? 19.156  65.823  116.940 1.00 56.06  ? 178 LYS C O   1 
ATOM   5903 C CB  . LYS C 1 179 ? 21.711  66.647  118.800 1.00 57.34  ? 178 LYS C CB  1 
ATOM   5904 C CG  . LYS C 1 179 ? 22.525  67.381  117.734 1.00 58.63  ? 178 LYS C CG  1 
ATOM   5905 C CD  . LYS C 1 179 ? 23.412  68.461  118.351 1.00 61.43  ? 178 LYS C CD  1 
ATOM   5906 C CE  . LYS C 1 179 ? 22.673  69.789  118.524 1.00 62.63  ? 178 LYS C CE  1 
ATOM   5907 N NZ  . LYS C 1 179 ? 23.611  70.952  118.516 1.00 63.63  ? 178 LYS C NZ  1 
ATOM   5908 N N   . TYR C 1 180 ? 21.097  65.251  115.939 1.00 54.57  ? 179 TYR C N   1 
ATOM   5909 C CA  . TYR C 1 180 ? 20.598  65.381  114.583 1.00 53.22  ? 179 TYR C CA  1 
ATOM   5910 C C   . TYR C 1 180 ? 20.477  64.017  113.929 1.00 51.69  ? 179 TYR C C   1 
ATOM   5911 O O   . TYR C 1 180 ? 21.304  63.127  114.157 1.00 51.78  ? 179 TYR C O   1 
ATOM   5912 C CB  . TYR C 1 180 ? 21.539  66.241  113.733 1.00 53.83  ? 179 TYR C CB  1 
ATOM   5913 C CG  . TYR C 1 180 ? 21.816  67.636  114.248 1.00 55.74  ? 179 TYR C CG  1 
ATOM   5914 C CD1 . TYR C 1 180 ? 20.793  68.443  114.753 1.00 57.93  ? 179 TYR C CD1 1 
ATOM   5915 C CD2 . TYR C 1 180 ? 23.108  68.158  114.207 1.00 57.85  ? 179 TYR C CD2 1 
ATOM   5916 C CE1 . TYR C 1 180 ? 21.058  69.732  115.223 1.00 59.66  ? 179 TYR C CE1 1 
ATOM   5917 C CE2 . TYR C 1 180 ? 23.384  69.441  114.667 1.00 59.56  ? 179 TYR C CE2 1 
ATOM   5918 C CZ  . TYR C 1 180 ? 22.357  70.224  115.172 1.00 60.59  ? 179 TYR C CZ  1 
ATOM   5919 O OH  . TYR C 1 180 ? 22.634  71.497  115.631 1.00 61.93  ? 179 TYR C OH  1 
ATOM   5920 N N   . TYR C 1 181 ? 19.443  63.862  113.112 1.00 49.35  ? 180 TYR C N   1 
ATOM   5921 C CA  . TYR C 1 181 ? 19.353  62.737  112.196 1.00 47.29  ? 180 TYR C CA  1 
ATOM   5922 C C   . TYR C 1 181 ? 18.669  63.187  110.899 1.00 46.06  ? 180 TYR C C   1 
ATOM   5923 O O   . TYR C 1 181 ? 17.977  64.210  110.867 1.00 45.80  ? 180 TYR C O   1 
ATOM   5924 C CB  . TYR C 1 181 ? 18.639  61.542  112.848 1.00 47.01  ? 180 TYR C CB  1 
ATOM   5925 C CG  . TYR C 1 181 ? 17.209  61.808  113.259 1.00 45.98  ? 180 TYR C CG  1 
ATOM   5926 C CD1 . TYR C 1 181 ? 16.181  61.787  112.317 1.00 45.46  ? 180 TYR C CD1 1 
ATOM   5927 C CD2 . TYR C 1 181 ? 16.880  62.078  114.586 1.00 44.89  ? 180 TYR C CD2 1 
ATOM   5928 C CE1 . TYR C 1 181 ? 14.866  62.035  112.679 1.00 44.16  ? 180 TYR C CE1 1 
ATOM   5929 C CE2 . TYR C 1 181 ? 15.560  62.330  114.957 1.00 44.67  ? 180 TYR C CE2 1 
ATOM   5930 C CZ  . TYR C 1 181 ? 14.558  62.305  113.990 1.00 43.74  ? 180 TYR C CZ  1 
ATOM   5931 O OH  . TYR C 1 181 ? 13.242  62.547  114.322 1.00 43.67  ? 180 TYR C OH  1 
ATOM   5932 N N   . SER C 1 182 ? 18.866  62.431  109.830 1.00 44.37  ? 181 SER C N   1 
ATOM   5933 C CA  . SER C 1 182 ? 18.209  62.759  108.576 1.00 43.06  ? 181 SER C CA  1 
ATOM   5934 C C   . SER C 1 182 ? 17.732  61.523  107.843 1.00 41.84  ? 181 SER C C   1 
ATOM   5935 O O   . SER C 1 182 ? 17.240  60.579  108.459 1.00 41.59  ? 181 SER C O   1 
ATOM   5936 C CB  . SER C 1 182 ? 19.126  63.592  107.678 1.00 43.37  ? 181 SER C CB  1 
ATOM   5937 O OG  . SER C 1 182 ? 18.397  64.132  106.580 1.00 44.63  ? 181 SER C OG  1 
ATOM   5938 N N   . THR C 1 183 ? 17.901  61.541  106.523 1.00 40.50  ? 182 THR C N   1 
ATOM   5939 C CA  . THR C 1 183 ? 17.304  60.569  105.626 1.00 39.05  ? 182 THR C CA  1 
ATOM   5940 C C   . THR C 1 183 ? 17.911  59.192  105.805 1.00 38.32  ? 182 THR C C   1 
ATOM   5941 O O   . THR C 1 183 ? 17.256  58.185  105.523 1.00 38.35  ? 182 THR C O   1 
ATOM   5942 C CB  . THR C 1 183 ? 17.470  61.034  104.169 1.00 39.62  ? 182 THR C CB  1 
ATOM   5943 O OG1 . THR C 1 183 ? 18.865  61.129  103.859 1.00 39.57  ? 182 THR C OG1 1 
ATOM   5944 C CG2 . THR C 1 183 ? 16.996  62.481  104.013 1.00 39.31  ? 182 THR C CG2 1 
ATOM   5945 N N   . ALA C 1 184 ? 19.159  59.139  106.270 1.00 36.91  ? 183 ALA C N   1 
ATOM   5946 C CA  . ALA C 1 184 ? 19.811  57.861  106.511 1.00 36.00  ? 183 ALA C CA  1 
ATOM   5947 C C   . ALA C 1 184 ? 19.020  56.935  107.461 1.00 35.51  ? 183 ALA C C   1 
ATOM   5948 O O   . ALA C 1 184 ? 19.127  55.717  107.346 1.00 35.21  ? 183 ALA C O   1 
ATOM   5949 C CB  . ALA C 1 184 ? 21.245  58.064  106.994 1.00 35.95  ? 183 ALA C CB  1 
ATOM   5950 N N   . VAL C 1 185 ? 18.219  57.495  108.375 1.00 35.29  ? 184 VAL C N   1 
ATOM   5951 C CA  . VAL C 1 185 ? 17.382  56.657  109.252 1.00 35.21  ? 184 VAL C CA  1 
ATOM   5952 C C   . VAL C 1 185 ? 16.335  55.840  108.476 1.00 35.28  ? 184 VAL C C   1 
ATOM   5953 O O   . VAL C 1 185 ? 16.087  54.675  108.806 1.00 35.59  ? 184 VAL C O   1 
ATOM   5954 C CB  . VAL C 1 185 ? 16.755  57.424  110.475 1.00 35.05  ? 184 VAL C CB  1 
ATOM   5955 C CG1 . VAL C 1 185 ? 17.788  58.310  111.156 1.00 35.18  ? 184 VAL C CG1 1 
ATOM   5956 C CG2 . VAL C 1 185 ? 15.529  58.226  110.094 1.00 35.13  ? 184 VAL C CG2 1 
ATOM   5957 N N   . ASP C 1 186 ? 15.756  56.425  107.430 1.00 35.37  ? 185 ASP C N   1 
ATOM   5958 C CA  . ASP C 1 186 ? 14.843  55.687  106.553 1.00 35.35  ? 185 ASP C CA  1 
ATOM   5959 C C   . ASP C 1 186 ? 15.584  54.581  105.813 1.00 35.51  ? 185 ASP C C   1 
ATOM   5960 O O   . ASP C 1 186 ? 15.058  53.481  105.630 1.00 35.78  ? 185 ASP C O   1 
ATOM   5961 C CB  . ASP C 1 186 ? 14.145  56.622  105.550 1.00 35.20  ? 185 ASP C CB  1 
ATOM   5962 C CG  . ASP C 1 186 ? 12.951  57.375  106.156 1.00 34.90  ? 185 ASP C CG  1 
ATOM   5963 O OD1 . ASP C 1 186 ? 12.388  56.941  107.186 1.00 33.81  ? 185 ASP C OD1 1 
ATOM   5964 O OD2 . ASP C 1 186 ? 12.508  58.430  105.659 1.00 35.18  ? 185 ASP C OD2 1 
ATOM   5965 N N   . ILE C 1 187 ? 16.811  54.869  105.391 1.00 36.00  ? 186 ILE C N   1 
ATOM   5966 C CA  . ILE C 1 187 ? 17.630  53.869  104.694 1.00 36.51  ? 186 ILE C CA  1 
ATOM   5967 C C   . ILE C 1 187 ? 17.958  52.655  105.591 1.00 36.53  ? 186 ILE C C   1 
ATOM   5968 O O   . ILE C 1 187 ? 17.837  51.494  105.158 1.00 36.33  ? 186 ILE C O   1 
ATOM   5969 C CB  . ILE C 1 187 ? 18.915  54.527  104.099 1.00 36.61  ? 186 ILE C CB  1 
ATOM   5970 C CG1 . ILE C 1 187 ? 18.532  55.573  103.046 1.00 36.56  ? 186 ILE C CG1 1 
ATOM   5971 C CG2 . ILE C 1 187 ? 19.862  53.470  103.517 1.00 36.36  ? 186 ILE C CG2 1 
ATOM   5972 C CD1 . ILE C 1 187 ? 17.816  54.994  101.833 1.00 37.70  ? 186 ILE C CD1 1 
ATOM   5973 N N   . TRP C 1 188 ? 18.356  52.920  106.834 1.00 36.71  ? 187 TRP C N   1 
ATOM   5974 C CA  . TRP C 1 188 ? 18.651  51.840  107.772 1.00 37.04  ? 187 TRP C CA  1 
ATOM   5975 C C   . TRP C 1 188 ? 17.455  50.893  107.845 1.00 36.98  ? 187 TRP C C   1 
ATOM   5976 O O   . TRP C 1 188 ? 17.577  49.686  107.587 1.00 36.84  ? 187 TRP C O   1 
ATOM   5977 C CB  . TRP C 1 188 ? 18.989  52.396  109.153 1.00 37.41  ? 187 TRP C CB  1 
ATOM   5978 C CG  . TRP C 1 188 ? 19.252  51.327  110.182 1.00 39.29  ? 187 TRP C CG  1 
ATOM   5979 C CD1 . TRP C 1 188 ? 18.325  50.684  110.958 1.00 40.28  ? 187 TRP C CD1 1 
ATOM   5980 C CD2 . TRP C 1 188 ? 20.524  50.770  110.537 1.00 40.85  ? 187 TRP C CD2 1 
ATOM   5981 N NE1 . TRP C 1 188 ? 18.942  49.770  111.776 1.00 41.65  ? 187 TRP C NE1 1 
ATOM   5982 C CE2 . TRP C 1 188 ? 20.293  49.800  111.540 1.00 41.54  ? 187 TRP C CE2 1 
ATOM   5983 C CE3 . TRP C 1 188 ? 21.844  50.996  110.112 1.00 41.31  ? 187 TRP C CE3 1 
ATOM   5984 C CZ2 . TRP C 1 188 ? 21.330  49.054  112.123 1.00 41.90  ? 187 TRP C CZ2 1 
ATOM   5985 C CZ3 . TRP C 1 188 ? 22.875  50.255  110.692 1.00 42.03  ? 187 TRP C CZ3 1 
ATOM   5986 C CH2 . TRP C 1 188 ? 22.609  49.298  111.690 1.00 42.83  ? 187 TRP C CH2 1 
ATOM   5987 N N   . SER C 1 189 ? 16.291  51.460  108.160 1.00 36.75  ? 188 SER C N   1 
ATOM   5988 C CA  . SER C 1 189 ? 15.055  50.690  108.257 1.00 36.31  ? 188 SER C CA  1 
ATOM   5989 C C   . SER C 1 189 ? 14.840  49.818  107.021 1.00 36.32  ? 188 SER C C   1 
ATOM   5990 O O   . SER C 1 189 ? 14.462  48.649  107.130 1.00 36.20  ? 188 SER C O   1 
ATOM   5991 C CB  . SER C 1 189 ? 13.853  51.621  108.462 1.00 36.20  ? 188 SER C CB  1 
ATOM   5992 O OG  . SER C 1 189 ? 14.089  52.558  109.496 1.00 35.71  ? 188 SER C OG  1 
ATOM   5993 N N   . LEU C 1 190 ? 15.083  50.399  105.851 1.00 36.60  ? 189 LEU C N   1 
ATOM   5994 C CA  . LEU C 1 190 ? 14.973  49.680  104.584 1.00 36.89  ? 189 LEU C CA  1 
ATOM   5995 C C   . LEU C 1 190 ? 15.992  48.539  104.480 1.00 36.98  ? 189 LEU C C   1 
ATOM   5996 O O   . LEU C 1 190 ? 15.663  47.454  104.016 1.00 36.99  ? 189 LEU C O   1 
ATOM   5997 C CB  . LEU C 1 190 ? 15.123  50.651  103.409 1.00 36.77  ? 189 LEU C CB  1 
ATOM   5998 C CG  . LEU C 1 190 ? 14.004  50.646  102.370 1.00 37.26  ? 189 LEU C CG  1 
ATOM   5999 C CD1 . LEU C 1 190 ? 14.557  51.002  101.008 1.00 38.62  ? 189 LEU C CD1 1 
ATOM   6000 C CD2 . LEU C 1 190 ? 13.263  49.316  102.307 1.00 38.14  ? 189 LEU C CD2 1 
ATOM   6001 N N   . GLY C 1 191 ? 17.220  48.786  104.928 1.00 37.56  ? 190 GLY C N   1 
ATOM   6002 C CA  . GLY C 1 191 ? 18.231  47.741  105.015 1.00 37.83  ? 190 GLY C CA  1 
ATOM   6003 C C   . GLY C 1 191 ? 17.725  46.572  105.833 1.00 38.11  ? 190 GLY C C   1 
ATOM   6004 O O   . GLY C 1 191 ? 17.810  45.420  105.401 1.00 38.46  ? 190 GLY C O   1 
ATOM   6005 N N   . CYS C 1 192 ? 17.165  46.874  107.002 1.00 38.56  ? 191 CYS C N   1 
ATOM   6006 C CA  . CYS C 1 192 ? 16.576  45.860  107.874 1.00 38.76  ? 191 CYS C CA  1 
ATOM   6007 C C   . CYS C 1 192 ? 15.499  45.068  107.158 1.00 38.73  ? 191 CYS C C   1 
ATOM   6008 O O   . CYS C 1 192 ? 15.465  43.825  107.251 1.00 38.86  ? 191 CYS C O   1 
ATOM   6009 C CB  . CYS C 1 192 ? 15.982  46.501  109.122 1.00 38.61  ? 191 CYS C CB  1 
ATOM   6010 S SG  . CYS C 1 192 ? 17.196  47.178  110.264 1.00 41.61  ? 191 CYS C SG  1 
ATOM   6011 N N   . ILE C 1 193 ? 14.631  45.787  106.438 1.00 38.86  ? 192 ILE C N   1 
ATOM   6012 C CA  . ILE C 1 193 ? 13.501  45.174  105.721 1.00 38.69  ? 192 ILE C CA  1 
ATOM   6013 C C   . ILE C 1 193 ? 13.976  44.299  104.557 1.00 38.74  ? 192 ILE C C   1 
ATOM   6014 O O   . ILE C 1 193 ? 13.424  43.217  104.315 1.00 38.66  ? 192 ILE C O   1 
ATOM   6015 C CB  . ILE C 1 193 ? 12.473  46.257  105.260 1.00 39.04  ? 192 ILE C CB  1 
ATOM   6016 C CG1 . ILE C 1 193 ? 11.777  46.891  106.475 1.00 38.43  ? 192 ILE C CG1 1 
ATOM   6017 C CG2 . ILE C 1 193 ? 11.416  45.669  104.308 1.00 38.36  ? 192 ILE C CG2 1 
ATOM   6018 C CD1 . ILE C 1 193 ? 11.434  48.354  106.293 1.00 38.74  ? 192 ILE C CD1 1 
ATOM   6019 N N   . PHE C 1 194 ? 15.005  44.767  103.853 1.00 38.92  ? 193 PHE C N   1 
ATOM   6020 C CA  . PHE C 1 194 ? 15.668  43.975  102.811 1.00 39.24  ? 193 PHE C CA  1 
ATOM   6021 C C   . PHE C 1 194 ? 16.078  42.620  103.409 1.00 39.36  ? 193 PHE C C   1 
ATOM   6022 O O   . PHE C 1 194 ? 15.598  41.571  102.976 1.00 39.25  ? 193 PHE C O   1 
ATOM   6023 C CB  . PHE C 1 194 ? 16.866  44.765  102.256 1.00 39.07  ? 193 PHE C CB  1 
ATOM   6024 C CG  . PHE C 1 194 ? 17.647  44.064  101.169 1.00 38.65  ? 193 PHE C CG  1 
ATOM   6025 C CD1 . PHE C 1 194 ? 17.123  42.980  100.462 1.00 38.31  ? 193 PHE C CD1 1 
ATOM   6026 C CD2 . PHE C 1 194 ? 18.925  44.520  100.843 1.00 37.94  ? 193 PHE C CD2 1 
ATOM   6027 C CE1 . PHE C 1 194 ? 17.871  42.354  99.456  1.00 39.01  ? 193 PHE C CE1 1 
ATOM   6028 C CE2 . PHE C 1 194 ? 19.678  43.905  99.837  1.00 37.86  ? 193 PHE C CE2 1 
ATOM   6029 C CZ  . PHE C 1 194 ? 19.157  42.820  99.150  1.00 38.55  ? 193 PHE C CZ  1 
ATOM   6030 N N   . ALA C 1 195 ? 16.910  42.655  104.447 1.00 40.02  ? 194 ALA C N   1 
ATOM   6031 C CA  . ALA C 1 195 ? 17.353  41.432  105.132 1.00 40.29  ? 194 ALA C CA  1 
ATOM   6032 C C   . ALA C 1 195 ? 16.188  40.541  105.555 1.00 40.70  ? 194 ALA C C   1 
ATOM   6033 O O   . ALA C 1 195 ? 16.239  39.318  105.382 1.00 40.93  ? 194 ALA C O   1 
ATOM   6034 C CB  . ALA C 1 195 ? 18.208  41.781  106.322 1.00 40.49  ? 194 ALA C CB  1 
ATOM   6035 N N   . GLU C 1 196 ? 15.137  41.162  106.089 1.00 41.04  ? 195 GLU C N   1 
ATOM   6036 C CA  . GLU C 1 196 ? 13.944  40.444  106.537 1.00 41.24  ? 195 GLU C CA  1 
ATOM   6037 C C   . GLU C 1 196 ? 13.196  39.797  105.374 1.00 41.64  ? 195 GLU C C   1 
ATOM   6038 O O   . GLU C 1 196 ? 12.611  38.735  105.526 1.00 41.25  ? 195 GLU C O   1 
ATOM   6039 C CB  . GLU C 1 196 ? 13.012  41.372  107.347 1.00 41.09  ? 195 GLU C CB  1 
ATOM   6040 C CG  . GLU C 1 196 ? 11.802  40.682  107.972 1.00 40.01  ? 195 GLU C CG  1 
ATOM   6041 C CD  . GLU C 1 196 ? 11.079  41.528  109.017 1.00 40.12  ? 195 GLU C CD  1 
ATOM   6042 O OE1 . GLU C 1 196 ? 11.565  42.620  109.378 1.00 39.21  ? 195 GLU C OE1 1 
ATOM   6043 O OE2 . GLU C 1 196 ? 10.011  41.091  109.496 1.00 40.14  ? 195 GLU C OE2 1 
ATOM   6044 N N   . MET C 1 197 ? 13.213  40.434  104.212 1.00 42.82  ? 196 MET C N   1 
ATOM   6045 C CA  . MET C 1 197 ? 12.561  39.852  103.039 1.00 43.85  ? 196 MET C CA  1 
ATOM   6046 C C   . MET C 1 197 ? 13.263  38.560  102.604 1.00 44.77  ? 196 MET C C   1 
ATOM   6047 O O   . MET C 1 197 ? 12.629  37.627  102.120 1.00 44.99  ? 196 MET C O   1 
ATOM   6048 C CB  . MET C 1 197 ? 12.521  40.855  101.890 1.00 43.75  ? 196 MET C CB  1 
ATOM   6049 C CG  . MET C 1 197 ? 11.364  41.842  101.957 1.00 43.56  ? 196 MET C CG  1 
ATOM   6050 S SD  . MET C 1 197 ? 11.059  42.594  100.345 1.00 45.20  ? 196 MET C SD  1 
ATOM   6051 C CE  . MET C 1 197 ? 12.372  43.896  100.283 1.00 41.21  ? 196 MET C CE  1 
ATOM   6052 N N   . VAL C 1 198 ? 14.574  38.511  102.793 1.00 45.95  ? 197 VAL C N   1 
ATOM   6053 C CA  . VAL C 1 198 ? 15.359  37.339  102.429 1.00 47.19  ? 197 VAL C CA  1 
ATOM   6054 C C   . VAL C 1 198 ? 15.099  36.146  103.369 1.00 48.08  ? 197 VAL C C   1 
ATOM   6055 O O   . VAL C 1 198 ? 14.786  35.043  102.901 1.00 48.41  ? 197 VAL C O   1 
ATOM   6056 C CB  . VAL C 1 198 ? 16.859  37.681  102.376 1.00 47.13  ? 197 VAL C CB  1 
ATOM   6057 C CG1 . VAL C 1 198 ? 17.687  36.416  102.212 1.00 47.87  ? 197 VAL C CG1 1 
ATOM   6058 C CG2 . VAL C 1 198 ? 17.141  38.669  101.241 1.00 46.45  ? 197 VAL C CG2 1 
ATOM   6059 N N   . THR C 1 199 ? 15.189  36.381  104.680 1.00 48.98  ? 198 THR C N   1 
ATOM   6060 C CA  . THR C 1 199 ? 15.089  35.310  105.687 1.00 49.93  ? 198 THR C CA  1 
ATOM   6061 C C   . THR C 1 199 ? 13.697  35.130  106.301 1.00 50.32  ? 198 THR C C   1 
ATOM   6062 O O   . THR C 1 199 ? 13.493  34.242  107.131 1.00 50.06  ? 198 THR C O   1 
ATOM   6063 C CB  . THR C 1 199 ? 16.103  35.550  106.817 1.00 49.91  ? 198 THR C CB  1 
ATOM   6064 O OG1 . THR C 1 199 ? 15.636  36.622  107.648 1.00 50.59  ? 198 THR C OG1 1 
ATOM   6065 C CG2 . THR C 1 199 ? 17.431  36.072  106.263 1.00 50.32  ? 198 THR C CG2 1 
ATOM   6066 N N   . ARG C 1 200 ? 12.757  35.982  105.889 1.00 51.08  ? 199 ARG C N   1 
ATOM   6067 C CA  . ARG C 1 200 ? 11.389  36.041  106.436 1.00 51.68  ? 199 ARG C CA  1 
ATOM   6068 C C   . ARG C 1 200 ? 11.322  36.124  107.969 1.00 51.87  ? 199 ARG C C   1 
ATOM   6069 O O   . ARG C 1 200 ? 10.316  35.756  108.583 1.00 52.05  ? 199 ARG C O   1 
ATOM   6070 C CB  . ARG C 1 200 ? 10.501  34.912  105.890 1.00 51.86  ? 199 ARG C CB  1 
ATOM   6071 C CG  . ARG C 1 200 ? 10.335  34.921  104.382 1.00 52.74  ? 199 ARG C CG  1 
ATOM   6072 C CD  . ARG C 1 200 ? 10.360  33.537  103.752 1.00 54.83  ? 199 ARG C CD  1 
ATOM   6073 N NE  . ARG C 1 200 ? 11.716  32.996  103.671 1.00 56.97  ? 199 ARG C NE  1 
ATOM   6074 C CZ  . ARG C 1 200 ? 12.057  31.740  103.957 1.00 58.49  ? 199 ARG C CZ  1 
ATOM   6075 N NH1 . ARG C 1 200 ? 11.147  30.854  104.348 1.00 58.09  ? 199 ARG C NH1 1 
ATOM   6076 N NH2 . ARG C 1 200 ? 13.326  31.365  103.849 1.00 60.22  ? 199 ARG C NH2 1 
ATOM   6077 N N   . ARG C 1 201 ? 12.398  36.610  108.578 1.00 52.08  ? 200 ARG C N   1 
ATOM   6078 C CA  . ARG C 1 201 ? 12.389  36.954  109.995 1.00 52.50  ? 200 ARG C CA  1 
ATOM   6079 C C   . ARG C 1 201 ? 13.256  38.182  110.251 1.00 51.46  ? 200 ARG C C   1 
ATOM   6080 O O   . ARG C 1 201 ? 14.226  38.434  109.525 1.00 51.53  ? 200 ARG C O   1 
ATOM   6081 C CB  . ARG C 1 201 ? 12.804  35.765  110.875 1.00 53.34  ? 200 ARG C CB  1 
ATOM   6082 C CG  . ARG C 1 201 ? 14.186  35.181  110.597 1.00 57.34  ? 200 ARG C CG  1 
ATOM   6083 C CD  . ARG C 1 201 ? 14.521  33.979  111.476 1.00 64.85  ? 200 ARG C CD  1 
ATOM   6084 N NE  . ARG C 1 201 ? 15.925  33.969  111.902 1.00 70.41  ? 200 ARG C NE  1 
ATOM   6085 C CZ  . ARG C 1 201 ? 16.354  33.577  113.104 1.00 73.40  ? 200 ARG C CZ  1 
ATOM   6086 N NH1 . ARG C 1 201 ? 15.492  33.163  114.027 1.00 74.68  ? 200 ARG C NH1 1 
ATOM   6087 N NH2 . ARG C 1 201 ? 17.652  33.599  113.386 1.00 75.03  ? 200 ARG C NH2 1 
ATOM   6088 N N   . ALA C 1 202 ? 12.876  38.946  111.274 1.00 50.28  ? 201 ALA C N   1 
ATOM   6089 C CA  . ALA C 1 202 ? 13.521  40.214  111.621 1.00 48.99  ? 201 ALA C CA  1 
ATOM   6090 C C   . ALA C 1 202 ? 15.022  40.091  111.845 1.00 48.15  ? 201 ALA C C   1 
ATOM   6091 O O   . ALA C 1 202 ? 15.508  39.112  112.417 1.00 48.12  ? 201 ALA C O   1 
ATOM   6092 C CB  . ALA C 1 202 ? 12.856  40.827  112.849 1.00 49.05  ? 201 ALA C CB  1 
ATOM   6093 N N   . LEU C 1 203 ? 15.742  41.108  111.395 1.00 46.94  ? 202 LEU C N   1 
ATOM   6094 C CA  . LEU C 1 203 ? 17.189  41.148  111.500 1.00 45.82  ? 202 LEU C CA  1 
ATOM   6095 C C   . LEU C 1 203 ? 17.646  41.448  112.928 1.00 45.35  ? 202 LEU C C   1 
ATOM   6096 O O   . LEU C 1 203 ? 18.463  40.725  113.484 1.00 45.16  ? 202 LEU C O   1 
ATOM   6097 C CB  . LEU C 1 203 ? 17.740  42.183  110.524 1.00 45.68  ? 202 LEU C CB  1 
ATOM   6098 C CG  . LEU C 1 203 ? 19.245  42.426  110.465 1.00 45.04  ? 202 LEU C CG  1 
ATOM   6099 C CD1 . LEU C 1 203 ? 20.022  41.143  110.204 1.00 44.03  ? 202 LEU C CD1 1 
ATOM   6100 C CD2 . LEU C 1 203 ? 19.542  43.474  109.415 1.00 44.02  ? 202 LEU C CD2 1 
ATOM   6101 N N   . PHE C 1 204 ? 17.119  42.514  113.519 1.00 44.87  ? 203 PHE C N   1 
ATOM   6102 C CA  . PHE C 1 204 ? 17.455  42.868  114.894 1.00 44.48  ? 203 PHE C CA  1 
ATOM   6103 C C   . PHE C 1 204 ? 16.203  42.985  115.773 1.00 44.41  ? 203 PHE C C   1 
ATOM   6104 O O   . PHE C 1 204 ? 15.685  44.080  115.959 1.00 44.29  ? 203 PHE C O   1 
ATOM   6105 C CB  . PHE C 1 204 ? 18.254  44.178  114.935 1.00 44.19  ? 203 PHE C CB  1 
ATOM   6106 C CG  . PHE C 1 204 ? 19.399  44.235  113.966 1.00 43.97  ? 203 PHE C CG  1 
ATOM   6107 C CD1 . PHE C 1 204 ? 20.396  43.264  113.978 1.00 43.98  ? 203 PHE C CD1 1 
ATOM   6108 C CD2 . PHE C 1 204 ? 19.497  45.280  113.057 1.00 43.47  ? 203 PHE C CD2 1 
ATOM   6109 C CE1 . PHE C 1 204 ? 21.462  43.326  113.088 1.00 43.14  ? 203 PHE C CE1 1 
ATOM   6110 C CE2 . PHE C 1 204 ? 20.561  45.354  112.167 1.00 43.53  ? 203 PHE C CE2 1 
ATOM   6111 C CZ  . PHE C 1 204 ? 21.547  44.373  112.185 1.00 43.56  ? 203 PHE C CZ  1 
ATOM   6112 N N   . PRO C 1 205 ? 15.715  41.867  116.314 1.00 44.67  ? 204 PRO C N   1 
ATOM   6113 C CA  . PRO C 1 205 ? 14.502  41.883  117.143 1.00 44.73  ? 204 PRO C CA  1 
ATOM   6114 C C   . PRO C 1 205 ? 14.784  42.105  118.640 1.00 44.96  ? 204 PRO C C   1 
ATOM   6115 O O   . PRO C 1 205 ? 14.499  41.243  119.476 1.00 44.98  ? 204 PRO C O   1 
ATOM   6116 C CB  . PRO C 1 205 ? 13.888  40.503  116.882 1.00 44.57  ? 204 PRO C CB  1 
ATOM   6117 C CG  . PRO C 1 205 ? 15.054  39.622  116.468 1.00 44.56  ? 204 PRO C CG  1 
ATOM   6118 C CD  . PRO C 1 205 ? 16.257  40.501  116.180 1.00 44.67  ? 204 PRO C CD  1 
ATOM   6119 N N   . GLY C 1 206 ? 15.329  43.271  118.967 1.00 45.25  ? 205 GLY C N   1 
ATOM   6120 C CA  . GLY C 1 206 ? 15.606  43.624  120.348 1.00 46.06  ? 205 GLY C CA  1 
ATOM   6121 C C   . GLY C 1 206 ? 14.355  43.787  121.191 1.00 46.52  ? 205 GLY C C   1 
ATOM   6122 O O   . GLY C 1 206 ? 13.275  44.066  120.672 1.00 46.65  ? 205 GLY C O   1 
ATOM   6123 N N   . ASP C 1 207 ? 14.502  43.611  122.500 1.00 47.02  ? 206 ASP C N   1 
ATOM   6124 C CA  . ASP C 1 207 ? 13.398  43.830  123.433 1.00 47.43  ? 206 ASP C CA  1 
ATOM   6125 C C   . ASP C 1 207 ? 13.530  45.175  124.146 1.00 47.02  ? 206 ASP C C   1 
ATOM   6126 O O   . ASP C 1 207 ? 12.622  45.601  124.855 1.00 47.33  ? 206 ASP C O   1 
ATOM   6127 C CB  . ASP C 1 207 ? 13.314  42.688  124.450 1.00 47.97  ? 206 ASP C CB  1 
ATOM   6128 C CG  . ASP C 1 207 ? 13.025  41.342  123.796 1.00 49.70  ? 206 ASP C CG  1 
ATOM   6129 O OD1 . ASP C 1 207 ? 11.890  41.140  123.299 1.00 51.37  ? 206 ASP C OD1 1 
ATOM   6130 O OD2 . ASP C 1 207 ? 13.876  40.426  123.734 1.00 50.88  ? 206 ASP C OD2 1 
ATOM   6131 N N   . SER C 1 208 ? 14.660  45.846  123.951 1.00 46.54  ? 207 SER C N   1 
ATOM   6132 C CA  . SER C 1 208 ? 14.912  47.127  124.603 1.00 46.25  ? 207 SER C CA  1 
ATOM   6133 C C   . SER C 1 208 ? 15.997  47.904  123.873 1.00 45.95  ? 207 SER C C   1 
ATOM   6134 O O   . SER C 1 208 ? 16.661  47.365  122.990 1.00 45.90  ? 207 SER C O   1 
ATOM   6135 C CB  . SER C 1 208 ? 15.328  46.895  126.055 1.00 46.26  ? 207 SER C CB  1 
ATOM   6136 O OG  . SER C 1 208 ? 16.594  46.247  126.109 1.00 46.92  ? 207 SER C OG  1 
ATOM   6137 N N   . GLU C 1 209 ? 16.189  49.161  124.263 1.00 46.06  ? 208 GLU C N   1 
ATOM   6138 C CA  . GLU C 1 209 ? 17.205  50.010  123.651 1.00 46.57  ? 208 GLU C CA  1 
ATOM   6139 C C   . GLU C 1 209 ? 18.608  49.388  123.677 1.00 46.39  ? 208 GLU C C   1 
ATOM   6140 O O   . GLU C 1 209 ? 19.267  49.303  122.636 1.00 46.15  ? 208 GLU C O   1 
ATOM   6141 C CB  . GLU C 1 209 ? 17.210  51.398  124.292 1.00 46.88  ? 208 GLU C CB  1 
ATOM   6142 C CG  . GLU C 1 209 ? 16.184  52.344  123.690 1.00 49.13  ? 208 GLU C CG  1 
ATOM   6143 C CD  . GLU C 1 209 ? 16.524  53.805  123.920 1.00 52.20  ? 208 GLU C CD  1 
ATOM   6144 O OE1 . GLU C 1 209 ? 17.494  54.299  123.291 1.00 53.24  ? 208 GLU C OE1 1 
ATOM   6145 O OE2 . GLU C 1 209 ? 15.819  54.459  124.729 1.00 53.79  ? 208 GLU C OE2 1 
ATOM   6146 N N   . ILE C 1 210 ? 19.048  48.945  124.857 1.00 46.43  ? 209 ILE C N   1 
ATOM   6147 C CA  . ILE C 1 210 ? 20.375  48.348  125.021 1.00 46.48  ? 209 ILE C CA  1 
ATOM   6148 C C   . ILE C 1 210 ? 20.538  47.049  124.226 1.00 46.34  ? 209 ILE C C   1 
ATOM   6149 O O   . ILE C 1 210 ? 21.561  46.840  123.566 1.00 46.42  ? 209 ILE C O   1 
ATOM   6150 C CB  . ILE C 1 210 ? 20.722  48.181  126.544 1.00 46.73  ? 209 ILE C CB  1 
ATOM   6151 C CG1 . ILE C 1 210 ? 21.730  49.256  126.992 1.00 47.80  ? 209 ILE C CG1 1 
ATOM   6152 C CG2 . ILE C 1 210 ? 21.267  46.781  126.877 1.00 46.07  ? 209 ILE C CG2 1 
ATOM   6153 C CD1 . ILE C 1 210 ? 21.967  50.408  125.980 1.00 49.17  ? 209 ILE C CD1 1 
ATOM   6154 N N   . ASP C 1 211 ? 19.504  46.211  124.273 1.00 46.18  ? 210 ASP C N   1 
ATOM   6155 C CA  . ASP C 1 211 ? 19.472  44.916  123.593 1.00 46.03  ? 210 ASP C CA  1 
ATOM   6156 C C   . ASP C 1 211 ? 19.466  45.077  122.073 1.00 45.62  ? 210 ASP C C   1 
ATOM   6157 O O   . ASP C 1 211 ? 20.091  44.294  121.347 1.00 45.18  ? 210 ASP C O   1 
ATOM   6158 C CB  . ASP C 1 211 ? 18.238  44.140  124.061 1.00 46.44  ? 210 ASP C CB  1 
ATOM   6159 C CG  . ASP C 1 211 ? 18.067  42.814  123.357 1.00 47.87  ? 210 ASP C CG  1 
ATOM   6160 O OD1 . ASP C 1 211 ? 19.087  42.196  122.996 1.00 49.55  ? 210 ASP C OD1 1 
ATOM   6161 O OD2 . ASP C 1 211 ? 16.945  42.311  123.124 1.00 49.97  ? 210 ASP C OD2 1 
ATOM   6162 N N   . GLN C 1 212 ? 18.744  46.094  121.603 1.00 45.35  ? 211 GLN C N   1 
ATOM   6163 C CA  . GLN C 1 212 ? 18.715  46.442  120.187 1.00 44.77  ? 211 GLN C CA  1 
ATOM   6164 C C   . GLN C 1 212 ? 20.138  46.789  119.731 1.00 44.66  ? 211 GLN C C   1 
ATOM   6165 O O   . GLN C 1 212 ? 20.641  46.236  118.753 1.00 44.09  ? 211 GLN C O   1 
ATOM   6166 C CB  . GLN C 1 212 ? 17.734  47.602  119.960 1.00 44.49  ? 211 GLN C CB  1 
ATOM   6167 C CG  . GLN C 1 212 ? 17.445  47.987  118.517 1.00 43.65  ? 211 GLN C CG  1 
ATOM   6168 C CD  . GLN C 1 212 ? 16.839  46.875  117.687 1.00 43.77  ? 211 GLN C CD  1 
ATOM   6169 O OE1 . GLN C 1 212 ? 16.028  46.086  118.178 1.00 43.91  ? 211 GLN C OE1 1 
ATOM   6170 N NE2 . GLN C 1 212 ? 17.233  46.809  116.420 1.00 43.04  ? 211 GLN C NE2 1 
ATOM   6171 N N   . LEU C 1 213 ? 20.798  47.668  120.477 1.00 44.78  ? 212 LEU C N   1 
ATOM   6172 C CA  . LEU C 1 213 ? 22.166  48.062  120.165 1.00 44.83  ? 212 LEU C CA  1 
ATOM   6173 C C   . LEU C 1 213 ? 23.088  46.847  120.146 1.00 44.91  ? 212 LEU C C   1 
ATOM   6174 O O   . LEU C 1 213 ? 23.834  46.623  119.187 1.00 44.91  ? 212 LEU C O   1 
ATOM   6175 C CB  . LEU C 1 213 ? 22.661  49.087  121.179 1.00 44.61  ? 212 LEU C CB  1 
ATOM   6176 C CG  . LEU C 1 213 ? 22.545  50.563  120.821 1.00 45.19  ? 212 LEU C CG  1 
ATOM   6177 C CD1 . LEU C 1 213 ? 23.528  51.350  121.653 1.00 45.22  ? 212 LEU C CD1 1 
ATOM   6178 C CD2 . LEU C 1 213 ? 22.781  50.814  119.340 1.00 46.36  ? 212 LEU C CD2 1 
ATOM   6179 N N   . PHE C 1 214 ? 23.007  46.048  121.202 1.00 45.33  ? 213 PHE C N   1 
ATOM   6180 C CA  . PHE C 1 214 ? 23.836  44.853  121.328 1.00 45.60  ? 213 PHE C CA  1 
ATOM   6181 C C   . PHE C 1 214 ? 23.685  43.916  120.125 1.00 45.72  ? 213 PHE C C   1 
ATOM   6182 O O   . PHE C 1 214 ? 24.684  43.431  119.584 1.00 45.72  ? 213 PHE C O   1 
ATOM   6183 C CB  . PHE C 1 214 ? 23.539  44.132  122.646 1.00 45.55  ? 213 PHE C CB  1 
ATOM   6184 C CG  . PHE C 1 214 ? 24.144  44.793  123.864 1.00 46.36  ? 213 PHE C CG  1 
ATOM   6185 C CD1 . PHE C 1 214 ? 24.750  46.047  123.781 1.00 45.94  ? 213 PHE C CD1 1 
ATOM   6186 C CD2 . PHE C 1 214 ? 24.090  44.161  125.103 1.00 46.96  ? 213 PHE C CD2 1 
ATOM   6187 C CE1 . PHE C 1 214 ? 25.299  46.648  124.902 1.00 46.27  ? 213 PHE C CE1 1 
ATOM   6188 C CE2 . PHE C 1 214 ? 24.640  44.762  126.242 1.00 47.50  ? 213 PHE C CE2 1 
ATOM   6189 C CZ  . PHE C 1 214 ? 25.246  46.007  126.139 1.00 46.95  ? 213 PHE C CZ  1 
ATOM   6190 N N   . ARG C 1 215 ? 22.443  43.689  119.696 1.00 46.06  ? 214 ARG C N   1 
ATOM   6191 C CA  . ARG C 1 215 ? 22.148  42.840  118.533 1.00 46.40  ? 214 ARG C CA  1 
ATOM   6192 C C   . ARG C 1 215 ? 22.709  43.399  117.230 1.00 47.07  ? 214 ARG C C   1 
ATOM   6193 O O   . ARG C 1 215 ? 23.073  42.644  116.323 1.00 47.01  ? 214 ARG C O   1 
ATOM   6194 C CB  . ARG C 1 215 ? 20.652  42.688  118.365 1.00 46.06  ? 214 ARG C CB  1 
ATOM   6195 C CG  . ARG C 1 215 ? 20.015  41.706  119.275 1.00 45.51  ? 214 ARG C CG  1 
ATOM   6196 C CD  . ARG C 1 215 ? 18.528  41.704  119.112 1.00 44.90  ? 214 ARG C CD  1 
ATOM   6197 N NE  . ARG C 1 215 ? 17.872  40.937  120.154 1.00 45.26  ? 214 ARG C NE  1 
ATOM   6198 C CZ  . ARG C 1 215 ? 17.657  39.634  120.086 1.00 45.67  ? 214 ARG C CZ  1 
ATOM   6199 N NH1 . ARG C 1 215 ? 18.059  38.951  119.014 1.00 44.59  ? 214 ARG C NH1 1 
ATOM   6200 N NH2 . ARG C 1 215 ? 17.038  39.015  121.090 1.00 45.40  ? 214 ARG C NH2 1 
ATOM   6201 N N   . ILE C 1 216 ? 22.749  44.724  117.134 1.00 47.95  ? 215 ILE C N   1 
ATOM   6202 C CA  . ILE C 1 216 ? 23.293  45.384  115.958 1.00 49.15  ? 215 ILE C CA  1 
ATOM   6203 C C   . ILE C 1 216 ? 24.812  45.186  115.946 1.00 50.40  ? 215 ILE C C   1 
ATOM   6204 O O   . ILE C 1 216 ? 25.376  44.727  114.946 1.00 50.57  ? 215 ILE C O   1 
ATOM   6205 C CB  . ILE C 1 216 ? 22.884  46.886  115.921 1.00 48.74  ? 215 ILE C CB  1 
ATOM   6206 C CG1 . ILE C 1 216 ? 21.394  47.026  115.549 1.00 47.66  ? 215 ILE C CG1 1 
ATOM   6207 C CG2 . ILE C 1 216 ? 23.776  47.671  114.961 1.00 48.69  ? 215 ILE C CG2 1 
ATOM   6208 C CD1 . ILE C 1 216 ? 20.792  48.400  115.824 1.00 44.35  ? 215 ILE C CD1 1 
ATOM   6209 N N   . PHE C 1 217 ? 25.464  45.496  117.065 1.00 51.82  ? 216 PHE C N   1 
ATOM   6210 C CA  . PHE C 1 217 ? 26.904  45.250  117.193 1.00 53.50  ? 216 PHE C CA  1 
ATOM   6211 C C   . PHE C 1 217 ? 27.284  43.762  116.999 1.00 54.47  ? 216 PHE C C   1 
ATOM   6212 O O   . PHE C 1 217 ? 28.402  43.459  116.592 1.00 54.34  ? 216 PHE C O   1 
ATOM   6213 C CB  . PHE C 1 217 ? 27.455  45.775  118.526 1.00 53.54  ? 216 PHE C CB  1 
ATOM   6214 C CG  . PHE C 1 217 ? 27.010  47.170  118.894 1.00 53.85  ? 216 PHE C CG  1 
ATOM   6215 C CD1 . PHE C 1 217 ? 26.985  48.194  117.954 1.00 54.09  ? 216 PHE C CD1 1 
ATOM   6216 C CD2 . PHE C 1 217 ? 26.634  47.458  120.206 1.00 54.15  ? 216 PHE C CD2 1 
ATOM   6217 C CE1 . PHE C 1 217 ? 26.583  49.481  118.307 1.00 54.35  ? 216 PHE C CE1 1 
ATOM   6218 C CE2 . PHE C 1 217 ? 26.228  48.738  120.570 1.00 54.65  ? 216 PHE C CE2 1 
ATOM   6219 C CZ  . PHE C 1 217 ? 26.206  49.755  119.615 1.00 54.97  ? 216 PHE C CZ  1 
ATOM   6220 N N   . ARG C 1 218 ? 26.346  42.857  117.297 1.00 55.95  ? 217 ARG C N   1 
ATOM   6221 C CA  . ARG C 1 218 ? 26.490  41.412  117.058 1.00 57.42  ? 217 ARG C CA  1 
ATOM   6222 C C   . ARG C 1 218 ? 26.868  41.108  115.628 1.00 58.35  ? 217 ARG C C   1 
ATOM   6223 O O   . ARG C 1 218 ? 27.914  40.506  115.344 1.00 58.46  ? 217 ARG C O   1 
ATOM   6224 C CB  . ARG C 1 218 ? 25.166  40.683  117.321 1.00 57.57  ? 217 ARG C CB  1 
ATOM   6225 C CG  . ARG C 1 218 ? 24.963  40.171  118.712 1.00 58.27  ? 217 ARG C CG  1 
ATOM   6226 C CD  . ARG C 1 218 ? 24.867  38.653  118.809 1.00 60.30  ? 217 ARG C CD  1 
ATOM   6227 N NE  . ARG C 1 218 ? 25.124  38.147  120.159 1.00 60.68  ? 217 ARG C NE  1 
ATOM   6228 C CZ  . ARG C 1 218 ? 24.367  38.410  121.215 1.00 62.54  ? 217 ARG C CZ  1 
ATOM   6229 N NH1 . ARG C 1 218 ? 23.302  39.199  121.086 1.00 62.95  ? 217 ARG C NH1 1 
ATOM   6230 N NH2 . ARG C 1 218 ? 24.669  37.886  122.401 1.00 62.43  ? 217 ARG C NH2 1 
ATOM   6231 N N   . THR C 1 219 ? 25.970  41.528  114.745 1.00 59.38  ? 218 THR C N   1 
ATOM   6232 C CA  . THR C 1 219 ? 25.992  41.174  113.345 1.00 60.49  ? 218 THR C CA  1 
ATOM   6233 C C   . THR C 1 219 ? 26.993  42.047  112.602 1.00 61.49  ? 218 THR C C   1 
ATOM   6234 O O   . THR C 1 219 ? 27.715  41.562  111.732 1.00 61.50  ? 218 THR C O   1 
ATOM   6235 C CB  . THR C 1 219 ? 24.563  41.331  112.752 1.00 60.38  ? 218 THR C CB  1 
ATOM   6236 O OG1 . THR C 1 219 ? 23.590  40.844  113.690 1.00 59.86  ? 218 THR C OG1 1 
ATOM   6237 C CG2 . THR C 1 219 ? 24.370  40.423  111.554 1.00 60.14  ? 218 THR C CG2 1 
ATOM   6238 N N   . LEU C 1 220 ? 27.044  43.325  112.967 1.00 62.84  ? 219 LEU C N   1 
ATOM   6239 C CA  . LEU C 1 220 ? 27.803  44.305  112.201 1.00 64.56  ? 219 LEU C CA  1 
ATOM   6240 C C   . LEU C 1 220 ? 29.156  44.649  112.816 1.00 66.07  ? 219 LEU C C   1 
ATOM   6241 O O   . LEU C 1 220 ? 29.965  45.363  112.205 1.00 66.16  ? 219 LEU C O   1 
ATOM   6242 C CB  . LEU C 1 220 ? 26.972  45.574  111.975 1.00 64.34  ? 219 LEU C CB  1 
ATOM   6243 C CG  . LEU C 1 220 ? 25.607  45.450  111.284 1.00 63.99  ? 219 LEU C CG  1 
ATOM   6244 C CD1 . LEU C 1 220 ? 25.139  46.820  110.837 1.00 63.52  ? 219 LEU C CD1 1 
ATOM   6245 C CD2 . LEU C 1 220 ? 25.629  44.482  110.100 1.00 63.70  ? 219 LEU C CD2 1 
ATOM   6246 N N   . GLY C 1 221 ? 29.402  44.139  114.018 1.00 67.93  ? 220 GLY C N   1 
ATOM   6247 C CA  . GLY C 1 221 ? 30.671  44.352  114.680 1.00 70.41  ? 220 GLY C CA  1 
ATOM   6248 C C   . GLY C 1 221 ? 30.739  45.724  115.306 1.00 72.27  ? 220 GLY C C   1 
ATOM   6249 O O   . GLY C 1 221 ? 30.685  46.738  114.608 1.00 72.26  ? 220 GLY C O   1 
ATOM   6250 N N   . THR C 1 222 ? 30.840  45.736  116.632 1.00 74.37  ? 221 THR C N   1 
ATOM   6251 C CA  . THR C 1 222 ? 31.033  46.945  117.438 1.00 76.37  ? 221 THR C CA  1 
ATOM   6252 C C   . THR C 1 222 ? 31.786  48.053  116.684 1.00 77.82  ? 221 THR C C   1 
ATOM   6253 O O   . THR C 1 222 ? 32.913  47.843  116.235 1.00 77.92  ? 221 THR C O   1 
ATOM   6254 C CB  . THR C 1 222 ? 31.779  46.566  118.743 1.00 76.37  ? 221 THR C CB  1 
ATOM   6255 O OG1 . THR C 1 222 ? 31.109  45.466  119.375 1.00 76.29  ? 221 THR C OG1 1 
ATOM   6256 C CG2 . THR C 1 222 ? 31.675  47.668  119.775 1.00 76.47  ? 221 THR C CG2 1 
ATOM   6257 N N   . PRO C 1 223 ? 31.164  49.224  116.545 1.00 79.40  ? 222 PRO C N   1 
ATOM   6258 C CA  . PRO C 1 223 ? 31.733  50.311  115.740 1.00 80.76  ? 222 PRO C CA  1 
ATOM   6259 C C   . PRO C 1 223 ? 32.738  51.180  116.502 1.00 82.11  ? 222 PRO C C   1 
ATOM   6260 O O   . PRO C 1 223 ? 32.461  51.638  117.619 1.00 82.19  ? 222 PRO C O   1 
ATOM   6261 C CB  . PRO C 1 223 ? 30.500  51.133  115.343 1.00 80.64  ? 222 PRO C CB  1 
ATOM   6262 C CG  . PRO C 1 223 ? 29.492  50.884  116.434 1.00 80.25  ? 222 PRO C CG  1 
ATOM   6263 C CD  . PRO C 1 223 ? 29.874  49.607  117.143 1.00 79.52  ? 222 PRO C CD  1 
ATOM   6264 N N   . ASP C 1 224 ? 33.897  51.396  115.882 1.00 83.64  ? 223 ASP C N   1 
ATOM   6265 C CA  . ASP C 1 224 ? 34.928  52.282  116.425 1.00 85.12  ? 223 ASP C CA  1 
ATOM   6266 C C   . ASP C 1 224 ? 35.145  53.498  115.515 1.00 85.86  ? 223 ASP C C   1 
ATOM   6267 O O   . ASP C 1 224 ? 34.516  53.606  114.458 1.00 86.02  ? 223 ASP C O   1 
ATOM   6268 C CB  . ASP C 1 224 ? 36.238  51.515  116.685 1.00 85.27  ? 223 ASP C CB  1 
ATOM   6269 C CG  . ASP C 1 224 ? 37.038  51.249  115.413 1.00 85.98  ? 223 ASP C CG  1 
ATOM   6270 O OD1 . ASP C 1 224 ? 37.735  52.171  114.939 1.00 86.63  ? 223 ASP C OD1 1 
ATOM   6271 O OD2 . ASP C 1 224 ? 37.047  50.143  114.828 1.00 86.70  ? 223 ASP C OD2 1 
ATOM   6272 N N   . GLU C 1 225 ? 36.042  54.394  115.931 1.00 86.82  ? 224 GLU C N   1 
ATOM   6273 C CA  . GLU C 1 225 ? 36.292  55.672  115.250 1.00 87.66  ? 224 GLU C CA  1 
ATOM   6274 C C   . GLU C 1 225 ? 36.778  55.556  113.797 1.00 87.90  ? 224 GLU C C   1 
ATOM   6275 O O   . GLU C 1 225 ? 36.642  56.507  113.021 1.00 88.06  ? 224 GLU C O   1 
ATOM   6276 C CB  . GLU C 1 225 ? 37.280  56.522  116.059 1.00 87.87  ? 224 GLU C CB  1 
ATOM   6277 C CG  . GLU C 1 225 ? 36.675  57.245  117.256 1.00 89.14  ? 224 GLU C CG  1 
ATOM   6278 C CD  . GLU C 1 225 ? 35.893  58.499  116.882 1.00 90.62  ? 224 GLU C CD  1 
ATOM   6279 O OE1 . GLU C 1 225 ? 36.071  59.019  115.756 1.00 91.01  ? 224 GLU C OE1 1 
ATOM   6280 O OE2 . GLU C 1 225 ? 35.097  58.972  117.725 1.00 91.01  ? 224 GLU C OE2 1 
ATOM   6281 N N   . VAL C 1 226 ? 37.350  54.406  113.440 1.00 88.16  ? 225 VAL C N   1 
ATOM   6282 C CA  . VAL C 1 226 ? 37.808  54.154  112.069 1.00 88.32  ? 225 VAL C CA  1 
ATOM   6283 C C   . VAL C 1 226 ? 36.617  53.871  111.147 1.00 88.30  ? 225 VAL C C   1 
ATOM   6284 O O   . VAL C 1 226 ? 36.487  54.491  110.088 1.00 88.52  ? 225 VAL C O   1 
ATOM   6285 C CB  . VAL C 1 226 ? 38.857  53.001  112.003 1.00 88.40  ? 225 VAL C CB  1 
ATOM   6286 C CG1 . VAL C 1 226 ? 39.150  52.587  110.557 1.00 88.59  ? 225 VAL C CG1 1 
ATOM   6287 C CG2 . VAL C 1 226 ? 40.144  53.406  112.713 1.00 88.45  ? 225 VAL C CG2 1 
ATOM   6288 N N   . VAL C 1 227 ? 35.750  52.945  111.561 1.00 88.14  ? 226 VAL C N   1 
ATOM   6289 C CA  . VAL C 1 227 ? 34.562  52.585  110.781 1.00 87.90  ? 226 VAL C CA  1 
ATOM   6290 C C   . VAL C 1 227 ? 33.472  53.673  110.819 1.00 87.55  ? 226 VAL C C   1 
ATOM   6291 O O   . VAL C 1 227 ? 32.709  53.817  109.862 1.00 87.62  ? 226 VAL C O   1 
ATOM   6292 C CB  . VAL C 1 227 ? 34.008  51.169  111.169 1.00 87.96  ? 226 VAL C CB  1 
ATOM   6293 C CG1 . VAL C 1 227 ? 33.083  51.227  112.390 1.00 88.05  ? 226 VAL C CG1 1 
ATOM   6294 C CG2 . VAL C 1 227 ? 33.313  50.508  109.977 1.00 88.19  ? 226 VAL C CG2 1 
ATOM   6295 N N   . TRP C 1 228 ? 33.418  54.433  111.915 1.00 87.06  ? 227 TRP C N   1 
ATOM   6296 C CA  . TRP C 1 228 ? 32.454  55.528  112.080 1.00 86.61  ? 227 TRP C CA  1 
ATOM   6297 C C   . TRP C 1 228 ? 33.072  56.673  112.906 1.00 86.31  ? 227 TRP C C   1 
ATOM   6298 O O   . TRP C 1 228 ? 32.992  56.666  114.136 1.00 86.34  ? 227 TRP C O   1 
ATOM   6299 C CB  . TRP C 1 228 ? 31.149  55.003  112.716 1.00 86.60  ? 227 TRP C CB  1 
ATOM   6300 C CG  . TRP C 1 228 ? 30.038  56.033  112.974 1.00 86.45  ? 227 TRP C CG  1 
ATOM   6301 C CD1 . TRP C 1 228 ? 30.021  57.358  112.610 1.00 86.26  ? 227 TRP C CD1 1 
ATOM   6302 C CD2 . TRP C 1 228 ? 28.794  55.798  113.654 1.00 86.22  ? 227 TRP C CD2 1 
ATOM   6303 N NE1 . TRP C 1 228 ? 28.851  57.951  113.022 1.00 86.17  ? 227 TRP C NE1 1 
ATOM   6304 C CE2 . TRP C 1 228 ? 28.078  57.019  113.664 1.00 86.11  ? 227 TRP C CE2 1 
ATOM   6305 C CE3 . TRP C 1 228 ? 28.208  54.675  114.260 1.00 86.27  ? 227 TRP C CE3 1 
ATOM   6306 C CZ2 . TRP C 1 228 ? 26.809  57.146  114.250 1.00 85.81  ? 227 TRP C CZ2 1 
ATOM   6307 C CZ3 . TRP C 1 228 ? 26.945  54.803  114.844 1.00 86.16  ? 227 TRP C CZ3 1 
ATOM   6308 C CH2 . TRP C 1 228 ? 26.262  56.030  114.832 1.00 85.87  ? 227 TRP C CH2 1 
ATOM   6309 N N   . PRO C 1 229 ? 33.704  57.642  112.236 1.00 85.94  ? 228 PRO C N   1 
ATOM   6310 C CA  . PRO C 1 229 ? 34.256  58.820  112.920 1.00 85.69  ? 228 PRO C CA  1 
ATOM   6311 C C   . PRO C 1 229 ? 33.213  59.598  113.733 1.00 85.50  ? 228 PRO C C   1 
ATOM   6312 O O   . PRO C 1 229 ? 32.385  60.318  113.164 1.00 85.43  ? 228 PRO C O   1 
ATOM   6313 C CB  . PRO C 1 229 ? 34.799  59.672  111.766 1.00 85.64  ? 228 PRO C CB  1 
ATOM   6314 C CG  . PRO C 1 229 ? 35.085  58.686  110.687 1.00 85.73  ? 228 PRO C CG  1 
ATOM   6315 C CD  . PRO C 1 229 ? 33.975  57.676  110.785 1.00 85.93  ? 228 PRO C CD  1 
ATOM   6316 N N   . GLY C 1 230 ? 33.257  59.424  115.054 1.00 85.27  ? 229 GLY C N   1 
ATOM   6317 C CA  . GLY C 1 230 ? 32.399  60.161  115.967 1.00 85.13  ? 229 GLY C CA  1 
ATOM   6318 C C   . GLY C 1 230 ? 31.564  59.345  116.944 1.00 85.10  ? 229 GLY C C   1 
ATOM   6319 O O   . GLY C 1 230 ? 30.898  59.936  117.801 1.00 85.01  ? 229 GLY C O   1 
ATOM   6320 N N   . VAL C 1 231 ? 31.597  58.012  116.832 1.00 85.04  ? 230 VAL C N   1 
ATOM   6321 C CA  . VAL C 1 231 ? 30.766  57.138  117.680 1.00 85.09  ? 230 VAL C CA  1 
ATOM   6322 C C   . VAL C 1 231 ? 30.917  57.421  119.178 1.00 85.32  ? 230 VAL C C   1 
ATOM   6323 O O   . VAL C 1 231 ? 29.916  57.609  119.877 1.00 85.32  ? 230 VAL C O   1 
ATOM   6324 C CB  . VAL C 1 231 ? 30.998  55.605  117.446 1.00 85.05  ? 230 VAL C CB  1 
ATOM   6325 C CG1 . VAL C 1 231 ? 29.694  54.827  117.597 1.00 84.70  ? 230 VAL C CG1 1 
ATOM   6326 C CG2 . VAL C 1 231 ? 31.620  55.321  116.109 1.00 84.73  ? 230 VAL C CG2 1 
ATOM   6327 N N   . THR C 1 232 ? 32.165  57.458  119.654 1.00 85.59  ? 231 THR C N   1 
ATOM   6328 C CA  . THR C 1 232 ? 32.471  57.623  121.083 1.00 85.81  ? 231 THR C CA  1 
ATOM   6329 C C   . THR C 1 232 ? 31.853  58.876  121.703 1.00 85.95  ? 231 THR C C   1 
ATOM   6330 O O   . THR C 1 232 ? 31.395  58.847  122.848 1.00 86.00  ? 231 THR C O   1 
ATOM   6331 C CB  . THR C 1 232 ? 34.003  57.597  121.346 1.00 85.80  ? 231 THR C CB  1 
ATOM   6332 O OG1 . THR C 1 232 ? 34.681  58.409  120.378 1.00 85.91  ? 231 THR C OG1 1 
ATOM   6333 C CG2 . THR C 1 232 ? 34.578  56.207  121.103 1.00 85.96  ? 231 THR C CG2 1 
ATOM   6334 N N   . SER C 1 233 ? 31.829  59.963  120.934 1.00 86.14  ? 232 SER C N   1 
ATOM   6335 C CA  . SER C 1 233 ? 31.337  61.257  121.410 1.00 86.33  ? 232 SER C CA  1 
ATOM   6336 C C   . SER C 1 233 ? 29.823  61.456  121.224 1.00 86.41  ? 232 SER C C   1 
ATOM   6337 O O   . SER C 1 233 ? 29.346  62.589  121.087 1.00 86.36  ? 232 SER C O   1 
ATOM   6338 C CB  . SER C 1 233 ? 32.130  62.394  120.756 1.00 86.34  ? 232 SER C CB  1 
ATOM   6339 O OG  . SER C 1 233 ? 33.494  62.334  121.139 1.00 86.37  ? 232 SER C OG  1 
ATOM   6340 N N   . MET C 1 234 ? 29.081  60.348  121.226 1.00 86.49  ? 233 MET C N   1 
ATOM   6341 C CA  . MET C 1 234 ? 27.618  60.379  121.237 1.00 86.60  ? 233 MET C CA  1 
ATOM   6342 C C   . MET C 1 234 ? 27.100  60.175  122.668 1.00 86.30  ? 233 MET C C   1 
ATOM   6343 O O   . MET C 1 234 ? 27.659  59.370  123.417 1.00 86.37  ? 233 MET C O   1 
ATOM   6344 C CB  . MET C 1 234 ? 27.045  59.326  120.284 1.00 86.78  ? 233 MET C CB  1 
ATOM   6345 C CG  . MET C 1 234 ? 26.384  59.916  119.031 1.00 87.88  ? 233 MET C CG  1 
ATOM   6346 S SD  . MET C 1 234 ? 27.272  59.581  117.480 1.00 90.22  ? 233 MET C SD  1 
ATOM   6347 C CE  . MET C 1 234 ? 27.327  57.800  117.533 1.00 89.99  ? 233 MET C CE  1 
ATOM   6348 N N   . PRO C 1 235 ? 26.038  60.894  123.044 1.00 86.09  ? 234 PRO C N   1 
ATOM   6349 C CA  . PRO C 1 235 ? 25.632  61.009  124.457 1.00 85.87  ? 234 PRO C CA  1 
ATOM   6350 C C   . PRO C 1 235 ? 25.148  59.719  125.134 1.00 85.68  ? 234 PRO C C   1 
ATOM   6351 O O   . PRO C 1 235 ? 24.999  59.711  126.363 1.00 85.68  ? 234 PRO C O   1 
ATOM   6352 C CB  . PRO C 1 235 ? 24.492  62.041  124.413 1.00 85.85  ? 234 PRO C CB  1 
ATOM   6353 C CG  . PRO C 1 235 ? 24.619  62.707  123.075 1.00 86.00  ? 234 PRO C CG  1 
ATOM   6354 C CD  . PRO C 1 235 ? 25.138  61.654  122.155 1.00 86.04  ? 234 PRO C CD  1 
ATOM   6355 N N   . ASP C 1 236 ? 24.910  58.661  124.360 1.00 85.37  ? 235 ASP C N   1 
ATOM   6356 C CA  . ASP C 1 236 ? 24.470  57.379  124.915 1.00 85.17  ? 235 ASP C CA  1 
ATOM   6357 C C   . ASP C 1 236 ? 25.475  56.252  124.658 1.00 85.05  ? 235 ASP C C   1 
ATOM   6358 O O   . ASP C 1 236 ? 25.222  55.092  125.003 1.00 85.07  ? 235 ASP C O   1 
ATOM   6359 C CB  . ASP C 1 236 ? 23.078  57.002  124.392 1.00 85.15  ? 235 ASP C CB  1 
ATOM   6360 C CG  . ASP C 1 236 ? 21.962  57.758  125.098 1.00 85.05  ? 235 ASP C CG  1 
ATOM   6361 O OD1 . ASP C 1 236 ? 21.688  57.454  126.279 1.00 84.92  ? 235 ASP C OD1 1 
ATOM   6362 O OD2 . ASP C 1 236 ? 21.304  58.671  124.553 1.00 84.89  ? 235 ASP C OD2 1 
ATOM   6363 N N   . TYR C 1 237 ? 26.612  56.608  124.058 1.00 84.77  ? 236 TYR C N   1 
ATOM   6364 C CA  . TYR C 1 237 ? 27.728  55.685  123.872 1.00 84.54  ? 236 TYR C CA  1 
ATOM   6365 C C   . TYR C 1 237 ? 28.421  55.407  125.208 1.00 84.56  ? 236 TYR C C   1 
ATOM   6366 O O   . TYR C 1 237 ? 28.760  56.333  125.951 1.00 84.44  ? 236 TYR C O   1 
ATOM   6367 C CB  . TYR C 1 237 ? 28.731  56.256  122.857 1.00 84.50  ? 236 TYR C CB  1 
ATOM   6368 C CG  . TYR C 1 237 ? 29.912  55.351  122.553 1.00 84.31  ? 236 TYR C CG  1 
ATOM   6369 C CD1 . TYR C 1 237 ? 31.074  55.398  123.330 1.00 83.94  ? 236 TYR C CD1 1 
ATOM   6370 C CD2 . TYR C 1 237 ? 29.869  54.449  121.488 1.00 84.28  ? 236 TYR C CD2 1 
ATOM   6371 C CE1 . TYR C 1 237 ? 32.157  54.568  123.057 1.00 84.07  ? 236 TYR C CE1 1 
ATOM   6372 C CE2 . TYR C 1 237 ? 30.950  53.615  121.204 1.00 84.09  ? 236 TYR C CE2 1 
ATOM   6373 C CZ  . TYR C 1 237 ? 32.089  53.679  121.992 1.00 84.06  ? 236 TYR C CZ  1 
ATOM   6374 O OH  . TYR C 1 237 ? 33.158  52.857  121.720 1.00 83.85  ? 236 TYR C OH  1 
ATOM   6375 N N   . LYS C 1 238 ? 28.622  54.126  125.506 1.00 84.61  ? 237 LYS C N   1 
ATOM   6376 C CA  . LYS C 1 238 ? 29.361  53.705  126.695 1.00 84.67  ? 237 LYS C CA  1 
ATOM   6377 C C   . LYS C 1 238 ? 30.617  52.945  126.269 1.00 84.44  ? 237 LYS C C   1 
ATOM   6378 O O   . LYS C 1 238 ? 30.539  52.057  125.415 1.00 84.40  ? 237 LYS C O   1 
ATOM   6379 C CB  . LYS C 1 238 ? 28.491  52.823  127.600 1.00 84.80  ? 237 LYS C CB  1 
ATOM   6380 C CG  . LYS C 1 238 ? 27.212  53.486  128.111 1.00 85.53  ? 237 LYS C CG  1 
ATOM   6381 C CD  . LYS C 1 238 ? 26.081  52.471  128.231 1.00 86.63  ? 237 LYS C CD  1 
ATOM   6382 C CE  . LYS C 1 238 ? 24.745  53.145  128.509 1.00 87.28  ? 237 LYS C CE  1 
ATOM   6383 N NZ  . LYS C 1 238 ? 23.620  52.161  128.500 1.00 87.87  ? 237 LYS C NZ  1 
ATOM   6384 N N   . PRO C 1 239 ? 31.770  53.281  126.856 1.00 84.31  ? 238 PRO C N   1 
ATOM   6385 C CA  . PRO C 1 239 ? 33.038  52.626  126.497 1.00 84.12  ? 238 PRO C CA  1 
ATOM   6386 C C   . PRO C 1 239 ? 33.034  51.123  126.804 1.00 83.95  ? 238 PRO C C   1 
ATOM   6387 O O   . PRO C 1 239 ? 33.776  50.367  126.167 1.00 84.02  ? 238 PRO C O   1 
ATOM   6388 C CB  . PRO C 1 239 ? 34.069  53.346  127.378 1.00 84.14  ? 238 PRO C CB  1 
ATOM   6389 C CG  . PRO C 1 239 ? 33.410  54.621  127.787 1.00 84.21  ? 238 PRO C CG  1 
ATOM   6390 C CD  . PRO C 1 239 ? 31.955  54.294  127.913 1.00 84.27  ? 238 PRO C CD  1 
ATOM   6391 N N   . SER C 1 240 ? 32.182  50.713  127.745 1.00 83.64  ? 239 SER C N   1 
ATOM   6392 C CA  . SER C 1 240 ? 32.109  49.333  128.233 1.00 83.35  ? 239 SER C CA  1 
ATOM   6393 C C   . SER C 1 240 ? 31.490  48.307  127.273 1.00 83.11  ? 239 SER C C   1 
ATOM   6394 O O   . SER C 1 240 ? 31.441  47.120  127.604 1.00 83.08  ? 239 SER C O   1 
ATOM   6395 C CB  . SER C 1 240 ? 31.376  49.285  129.582 1.00 83.40  ? 239 SER C CB  1 
ATOM   6396 O OG  . SER C 1 240 ? 30.017  49.666  129.448 1.00 83.36  ? 239 SER C OG  1 
ATOM   6397 N N   . PHE C 1 241 ? 31.015  48.751  126.106 1.00 82.74  ? 240 PHE C N   1 
ATOM   6398 C CA  . PHE C 1 241 ? 30.495  47.833  125.090 1.00 82.43  ? 240 PHE C CA  1 
ATOM   6399 C C   . PHE C 1 241 ? 31.635  46.938  124.596 1.00 82.10  ? 240 PHE C C   1 
ATOM   6400 O O   . PHE C 1 241 ? 32.676  47.452  124.173 1.00 81.99  ? 240 PHE C O   1 
ATOM   6401 C CB  . PHE C 1 241 ? 29.900  48.597  123.900 1.00 82.64  ? 240 PHE C CB  1 
ATOM   6402 C CG  . PHE C 1 241 ? 28.689  49.441  124.236 1.00 83.13  ? 240 PHE C CG  1 
ATOM   6403 C CD1 . PHE C 1 241 ? 28.444  50.619  123.530 1.00 83.57  ? 240 PHE C CD1 1 
ATOM   6404 C CD2 . PHE C 1 241 ? 27.785  49.057  125.226 1.00 83.75  ? 240 PHE C CD2 1 
ATOM   6405 C CE1 . PHE C 1 241 ? 27.331  51.412  123.813 1.00 84.08  ? 240 PHE C CE1 1 
ATOM   6406 C CE2 . PHE C 1 241 ? 26.664  49.847  125.519 1.00 84.15  ? 240 PHE C CE2 1 
ATOM   6407 C CZ  . PHE C 1 241 ? 26.438  51.024  124.809 1.00 84.29  ? 240 PHE C CZ  1 
ATOM   6408 N N   . PRO C 1 242 ? 31.448  45.614  124.640 1.00 81.79  ? 241 PRO C N   1 
ATOM   6409 C CA  . PRO C 1 242 ? 32.533  44.675  124.322 1.00 81.55  ? 241 PRO C CA  1 
ATOM   6410 C C   . PRO C 1 242 ? 32.906  44.660  122.841 1.00 81.28  ? 241 PRO C C   1 
ATOM   6411 O O   . PRO C 1 242 ? 32.062  44.938  121.980 1.00 81.16  ? 241 PRO C O   1 
ATOM   6412 C CB  . PRO C 1 242 ? 31.974  43.315  124.761 1.00 81.49  ? 241 PRO C CB  1 
ATOM   6413 C CG  . PRO C 1 242 ? 30.790  43.643  125.580 1.00 81.57  ? 241 PRO C CG  1 
ATOM   6414 C CD  . PRO C 1 242 ? 30.210  44.899  124.989 1.00 81.69  ? 241 PRO C CD  1 
ATOM   6415 N N   . LYS C 1 243 ? 34.174  44.344  122.574 1.00 81.00  ? 242 LYS C N   1 
ATOM   6416 C CA  . LYS C 1 243 ? 34.741  44.373  121.228 1.00 80.73  ? 242 LYS C CA  1 
ATOM   6417 C C   . LYS C 1 243 ? 34.423  43.088  120.462 1.00 80.32  ? 242 LYS C C   1 
ATOM   6418 O O   . LYS C 1 243 ? 35.184  42.112  120.499 1.00 80.31  ? 242 LYS C O   1 
ATOM   6419 C CB  . LYS C 1 243 ? 36.257  44.599  121.292 1.00 80.91  ? 242 LYS C CB  1 
ATOM   6420 C CG  . LYS C 1 243 ? 36.676  46.060  121.251 1.00 81.42  ? 242 LYS C CG  1 
ATOM   6421 C CD  . LYS C 1 243 ? 38.185  46.197  121.421 1.00 82.68  ? 242 LYS C CD  1 
ATOM   6422 C CE  . LYS C 1 243 ? 38.610  47.659  121.495 1.00 83.39  ? 242 LYS C CE  1 
ATOM   6423 N NZ  . LYS C 1 243 ? 39.336  47.957  122.767 1.00 83.73  ? 242 LYS C NZ  1 
ATOM   6424 N N   . TRP C 1 244 ? 33.292  43.108  119.764 1.00 79.80  ? 243 TRP C N   1 
ATOM   6425 C CA  . TRP C 1 244 ? 32.833  41.964  118.993 1.00 79.27  ? 243 TRP C CA  1 
ATOM   6426 C C   . TRP C 1 244 ? 33.131  42.118  117.506 1.00 79.88  ? 243 TRP C C   1 
ATOM   6427 O O   . TRP C 1 244 ? 32.875  43.171  116.912 1.00 79.74  ? 243 TRP C O   1 
ATOM   6428 C CB  . TRP C 1 244 ? 31.341  41.794  119.183 1.00 78.57  ? 243 TRP C CB  1 
ATOM   6429 C CG  . TRP C 1 244 ? 30.946  40.898  120.317 1.00 76.00  ? 243 TRP C CG  1 
ATOM   6430 C CD1 . TRP C 1 244 ? 31.102  39.549  120.389 1.00 73.95  ? 243 TRP C CD1 1 
ATOM   6431 C CD2 . TRP C 1 244 ? 30.292  41.287  121.528 1.00 73.31  ? 243 TRP C CD2 1 
ATOM   6432 N NE1 . TRP C 1 244 ? 30.582  39.072  121.568 1.00 72.95  ? 243 TRP C NE1 1 
ATOM   6433 C CE2 . TRP C 1 244 ? 30.077  40.125  122.284 1.00 72.64  ? 243 TRP C CE2 1 
ATOM   6434 C CE3 . TRP C 1 244 ? 29.872  42.510  122.060 1.00 72.32  ? 243 TRP C CE3 1 
ATOM   6435 C CZ2 . TRP C 1 244 ? 29.460  40.152  123.537 1.00 72.09  ? 243 TRP C CZ2 1 
ATOM   6436 C CZ3 . TRP C 1 244 ? 29.234  42.528  123.298 1.00 71.35  ? 243 TRP C CZ3 1 
ATOM   6437 C CH2 . TRP C 1 244 ? 29.052  41.366  124.026 1.00 71.25  ? 243 TRP C CH2 1 
ATOM   6438 N N   . ALA C 1 245 ? 33.667  41.053  116.916 1.00 80.61  ? 244 ALA C N   1 
ATOM   6439 C CA  . ALA C 1 245 ? 33.997  41.033  115.497 1.00 81.46  ? 244 ALA C CA  1 
ATOM   6440 C C   . ALA C 1 245 ? 32.743  40.927  114.620 1.00 82.10  ? 244 ALA C C   1 
ATOM   6441 O O   . ALA C 1 245 ? 31.746  40.310  115.011 1.00 82.06  ? 244 ALA C O   1 
ATOM   6442 C CB  . ALA C 1 245 ? 34.971  39.899  115.197 1.00 81.25  ? 244 ALA C CB  1 
ATOM   6443 N N   . ARG C 1 246 ? 32.812  41.547  113.441 1.00 83.00  ? 245 ARG C N   1 
ATOM   6444 C CA  . ARG C 1 246 ? 31.738  41.526  112.449 1.00 83.91  ? 245 ARG C CA  1 
ATOM   6445 C C   . ARG C 1 246 ? 31.664  40.171  111.750 1.00 84.66  ? 245 ARG C C   1 
ATOM   6446 O O   . ARG C 1 246 ? 32.675  39.671  111.249 1.00 84.78  ? 245 ARG C O   1 
ATOM   6447 C CB  . ARG C 1 246 ? 31.981  42.635  111.414 1.00 83.82  ? 245 ARG C CB  1 
ATOM   6448 C CG  . ARG C 1 246 ? 31.011  42.668  110.232 1.00 83.87  ? 245 ARG C CG  1 
ATOM   6449 C CD  . ARG C 1 246 ? 31.587  43.341  108.983 1.00 84.00  ? 245 ARG C CD  1 
ATOM   6450 N NE  . ARG C 1 246 ? 30.568  43.959  108.127 1.00 83.96  ? 245 ARG C NE  1 
ATOM   6451 C CZ  . ARG C 1 246 ? 30.004  45.152  108.341 1.00 83.64  ? 245 ARG C CZ  1 
ATOM   6452 N NH1 . ARG C 1 246 ? 30.336  45.885  109.400 1.00 83.08  ? 245 ARG C NH1 1 
ATOM   6453 N NH2 . ARG C 1 246 ? 29.096  45.612  107.490 1.00 83.20  ? 245 ARG C NH2 1 
ATOM   6454 N N   . GLN C 1 247 ? 30.470  39.581  111.719 1.00 85.63  ? 246 GLN C N   1 
ATOM   6455 C CA  . GLN C 1 247 ? 30.230  38.382  110.910 1.00 86.63  ? 246 GLN C CA  1 
ATOM   6456 C C   . GLN C 1 247 ? 30.216  38.756  109.433 1.00 87.19  ? 246 GLN C C   1 
ATOM   6457 O O   . GLN C 1 247 ? 29.872  39.889  109.075 1.00 87.40  ? 246 GLN C O   1 
ATOM   6458 C CB  . GLN C 1 247 ? 28.898  37.702  111.253 1.00 86.64  ? 246 GLN C CB  1 
ATOM   6459 C CG  . GLN C 1 247 ? 28.211  38.175  112.521 1.00 87.21  ? 246 GLN C CG  1 
ATOM   6460 C CD  . GLN C 1 247 ? 27.535  37.040  113.269 1.00 87.72  ? 246 GLN C CD  1 
ATOM   6461 O OE1 . GLN C 1 247 ? 26.901  36.174  112.658 1.00 87.69  ? 246 GLN C OE1 1 
ATOM   6462 N NE2 . GLN C 1 247 ? 27.667  37.040  114.593 1.00 88.05  ? 246 GLN C NE2 1 
ATOM   6463 N N   . ASP C 1 248 ? 30.587  37.808  108.576 1.00 87.83  ? 247 ASP C N   1 
ATOM   6464 C CA  . ASP C 1 248 ? 30.496  38.034  107.137 1.00 88.40  ? 247 ASP C CA  1 
ATOM   6465 C C   . ASP C 1 248 ? 29.058  37.811  106.663 1.00 88.55  ? 247 ASP C C   1 
ATOM   6466 O O   . ASP C 1 248 ? 28.321  36.999  107.232 1.00 88.49  ? 247 ASP C O   1 
ATOM   6467 C CB  . ASP C 1 248 ? 31.545  37.219  106.359 1.00 88.55  ? 247 ASP C CB  1 
ATOM   6468 C CG  . ASP C 1 248 ? 31.001  35.918  105.807 1.00 89.11  ? 247 ASP C CG  1 
ATOM   6469 O OD1 . ASP C 1 248 ? 31.027  34.904  106.541 1.00 89.56  ? 247 ASP C OD1 1 
ATOM   6470 O OD2 . ASP C 1 248 ? 30.548  35.815  104.645 1.00 89.57  ? 247 ASP C OD2 1 
ATOM   6471 N N   . PHE C 1 249 ? 28.668  38.550  105.630 1.00 88.81  ? 248 PHE C N   1 
ATOM   6472 C CA  . PHE C 1 249 ? 27.268  38.636  105.226 1.00 89.01  ? 248 PHE C CA  1 
ATOM   6473 C C   . PHE C 1 249 ? 26.681  37.356  104.623 1.00 88.66  ? 248 PHE C C   1 
ATOM   6474 O O   . PHE C 1 249 ? 25.460  37.234  104.505 1.00 88.75  ? 248 PHE C O   1 
ATOM   6475 C CB  . PHE C 1 249 ? 27.042  39.852  104.324 1.00 89.39  ? 248 PHE C CB  1 
ATOM   6476 C CG  . PHE C 1 249 ? 26.901  41.146  105.084 1.00 90.86  ? 248 PHE C CG  1 
ATOM   6477 C CD1 . PHE C 1 249 ? 28.028  41.811  105.577 1.00 92.10  ? 248 PHE C CD1 1 
ATOM   6478 C CD2 . PHE C 1 249 ? 25.642  41.696  105.320 1.00 91.85  ? 248 PHE C CD2 1 
ATOM   6479 C CE1 . PHE C 1 249 ? 27.900  43.006  106.285 1.00 92.66  ? 248 PHE C CE1 1 
ATOM   6480 C CE2 . PHE C 1 249 ? 25.503  42.892  106.029 1.00 92.53  ? 248 PHE C CE2 1 
ATOM   6481 C CZ  . PHE C 1 249 ? 26.635  43.548  106.512 1.00 92.80  ? 248 PHE C CZ  1 
ATOM   6482 N N   . SER C 1 250 ? 27.541  36.406  104.256 1.00 88.17  ? 249 SER C N   1 
ATOM   6483 C CA  . SER C 1 250 ? 27.079  35.076  103.847 1.00 87.63  ? 249 SER C CA  1 
ATOM   6484 C C   . SER C 1 250 ? 26.606  34.262  105.063 1.00 87.09  ? 249 SER C C   1 
ATOM   6485 O O   . SER C 1 250 ? 26.032  33.180  104.915 1.00 87.14  ? 249 SER C O   1 
ATOM   6486 C CB  . SER C 1 250 ? 28.149  34.329  103.032 1.00 87.72  ? 249 SER C CB  1 
ATOM   6487 O OG  . SER C 1 250 ? 29.088  33.669  103.866 1.00 87.86  ? 249 SER C OG  1 
ATOM   6488 N N   . LYS C 1 251 ? 26.852  34.798  106.259 1.00 86.30  ? 250 LYS C N   1 
ATOM   6489 C CA  . LYS C 1 251 ? 26.286  34.264  107.495 1.00 85.51  ? 250 LYS C CA  1 
ATOM   6490 C C   . LYS C 1 251 ? 25.135  35.147  107.990 1.00 84.76  ? 250 LYS C C   1 
ATOM   6491 O O   . LYS C 1 251 ? 24.119  34.632  108.466 1.00 84.71  ? 250 LYS C O   1 
ATOM   6492 C CB  . LYS C 1 251 ? 27.365  34.098  108.576 1.00 85.66  ? 250 LYS C CB  1 
ATOM   6493 C CG  . LYS C 1 251 ? 27.667  32.641  108.991 1.00 85.92  ? 250 LYS C CG  1 
ATOM   6494 C CD  . LYS C 1 251 ? 27.648  31.652  107.813 1.00 86.58  ? 250 LYS C CD  1 
ATOM   6495 C CE  . LYS C 1 251 ? 28.976  31.621  107.059 1.00 86.99  ? 250 LYS C CE  1 
ATOM   6496 N NZ  . LYS C 1 251 ? 28.780  31.491  105.582 1.00 86.81  ? 250 LYS C NZ  1 
ATOM   6497 N N   . VAL C 1 252 ? 25.299  36.467  107.867 1.00 83.66  ? 251 VAL C N   1 
ATOM   6498 C CA  . VAL C 1 252 ? 24.228  37.434  108.144 1.00 82.65  ? 251 VAL C CA  1 
ATOM   6499 C C   . VAL C 1 252 ? 22.914  36.977  107.496 1.00 81.78  ? 251 VAL C C   1 
ATOM   6500 O O   . VAL C 1 252 ? 21.892  36.827  108.175 1.00 81.57  ? 251 VAL C O   1 
ATOM   6501 C CB  . VAL C 1 252 ? 24.595  38.871  107.630 1.00 82.77  ? 251 VAL C CB  1 
ATOM   6502 C CG1 . VAL C 1 252 ? 23.373  39.793  107.578 1.00 82.53  ? 251 VAL C CG1 1 
ATOM   6503 C CG2 . VAL C 1 252 ? 25.709  39.498  108.469 1.00 82.89  ? 251 VAL C CG2 1 
ATOM   6504 N N   . VAL C 1 253 ? 22.973  36.736  106.184 1.00 80.62  ? 252 VAL C N   1 
ATOM   6505 C CA  . VAL C 1 253 ? 21.807  36.416  105.370 1.00 79.52  ? 252 VAL C CA  1 
ATOM   6506 C C   . VAL C 1 253 ? 22.233  35.399  104.292 1.00 78.72  ? 252 VAL C C   1 
ATOM   6507 O O   . VAL C 1 253 ? 22.747  35.774  103.232 1.00 78.58  ? 252 VAL C O   1 
ATOM   6508 C CB  . VAL C 1 253 ? 21.166  37.727  104.785 1.00 79.55  ? 252 VAL C CB  1 
ATOM   6509 C CG1 . VAL C 1 253 ? 20.485  37.492  103.453 1.00 79.57  ? 252 VAL C CG1 1 
ATOM   6510 C CG2 . VAL C 1 253 ? 20.189  38.350  105.778 1.00 79.23  ? 252 VAL C CG2 1 
ATOM   6511 N N   . PRO C 1 254 ? 22.045  34.111  104.592 1.00 77.98  ? 253 PRO C N   1 
ATOM   6512 C CA  . PRO C 1 254 ? 22.530  33.011  103.735 1.00 77.33  ? 253 PRO C CA  1 
ATOM   6513 C C   . PRO C 1 254 ? 22.222  33.076  102.217 1.00 76.58  ? 253 PRO C C   1 
ATOM   6514 O O   . PRO C 1 254 ? 23.196  33.004  101.470 1.00 76.71  ? 253 PRO C O   1 
ATOM   6515 C CB  . PRO C 1 254 ? 21.936  31.738  104.376 1.00 77.26  ? 253 PRO C CB  1 
ATOM   6516 C CG  . PRO C 1 254 ? 21.079  32.183  105.529 1.00 77.65  ? 253 PRO C CG  1 
ATOM   6517 C CD  . PRO C 1 254 ? 21.389  33.616  105.817 1.00 78.01  ? 253 PRO C CD  1 
ATOM   6518 N N   . PRO C 1 255 ? 20.969  33.210  101.763 1.00 75.82  ? 254 PRO C N   1 
ATOM   6519 C CA  . PRO C 1 255 ? 20.650  33.004  100.339 1.00 75.18  ? 254 PRO C CA  1 
ATOM   6520 C C   . PRO C 1 255 ? 20.988  34.163  99.389  1.00 74.56  ? 254 PRO C C   1 
ATOM   6521 O O   . PRO C 1 255 ? 20.639  34.087  98.205  1.00 74.44  ? 254 PRO C O   1 
ATOM   6522 C CB  . PRO C 1 255 ? 19.130  32.761  100.351 1.00 75.22  ? 254 PRO C CB  1 
ATOM   6523 C CG  . PRO C 1 255 ? 18.733  32.741  101.811 1.00 75.46  ? 254 PRO C CG  1 
ATOM   6524 C CD  . PRO C 1 255 ? 19.759  33.557  102.527 1.00 75.67  ? 254 PRO C CD  1 
ATOM   6525 N N   . LEU C 1 256 ? 21.665  35.196  99.886  1.00 73.77  ? 255 LEU C N   1 
ATOM   6526 C CA  . LEU C 1 256 ? 21.970  36.380  99.087  1.00 73.18  ? 255 LEU C CA  1 
ATOM   6527 C C   . LEU C 1 256 ? 23.272  36.257  98.303  1.00 72.99  ? 255 LEU C C   1 
ATOM   6528 O O   . LEU C 1 256 ? 24.240  35.675  98.795  1.00 73.11  ? 255 LEU C O   1 
ATOM   6529 C CB  . LEU C 1 256 ? 22.022  37.615  99.986  1.00 73.04  ? 255 LEU C CB  1 
ATOM   6530 C CG  . LEU C 1 256 ? 21.446  38.933  99.465  1.00 72.51  ? 255 LEU C CG  1 
ATOM   6531 C CD1 . LEU C 1 256 ? 20.096  38.750  98.770  1.00 72.42  ? 255 LEU C CD1 1 
ATOM   6532 C CD2 . LEU C 1 256 ? 21.328  39.914  100.612 1.00 72.14  ? 255 LEU C CD2 1 
ATOM   6533 N N   . ASP C 1 257 ? 23.286  36.817  97.088  1.00 72.65  ? 256 ASP C N   1 
ATOM   6534 C CA  . ASP C 1 257 ? 24.477  36.828  96.222  1.00 72.30  ? 256 ASP C CA  1 
ATOM   6535 C C   . ASP C 1 257 ? 25.496  37.915  96.615  1.00 71.74  ? 256 ASP C C   1 
ATOM   6536 O O   . ASP C 1 257 ? 25.319  38.601  97.626  1.00 71.61  ? 256 ASP C O   1 
ATOM   6537 C CB  . ASP C 1 257 ? 24.080  36.936  94.732  1.00 72.60  ? 256 ASP C CB  1 
ATOM   6538 C CG  . ASP C 1 257 ? 23.347  38.249  94.385  1.00 73.56  ? 256 ASP C CG  1 
ATOM   6539 O OD1 . ASP C 1 257 ? 22.605  38.262  93.375  1.00 73.89  ? 256 ASP C OD1 1 
ATOM   6540 O OD2 . ASP C 1 257 ? 23.449  39.316  95.035  1.00 74.39  ? 256 ASP C OD2 1 
ATOM   6541 N N   . GLU C 1 258 ? 26.550  38.070  95.814  1.00 71.00  ? 257 GLU C N   1 
ATOM   6542 C CA  . GLU C 1 258 ? 27.614  39.042  96.098  1.00 70.41  ? 257 GLU C CA  1 
ATOM   6543 C C   . GLU C 1 258 ? 27.155  40.510  96.056  1.00 69.47  ? 257 GLU C C   1 
ATOM   6544 O O   . GLU C 1 258 ? 27.604  41.324  96.866  1.00 69.37  ? 257 GLU C O   1 
ATOM   6545 C CB  . GLU C 1 258 ? 28.804  38.832  95.155  1.00 70.78  ? 257 GLU C CB  1 
ATOM   6546 C CG  . GLU C 1 258 ? 30.127  39.374  95.685  1.00 72.21  ? 257 GLU C CG  1 
ATOM   6547 C CD  . GLU C 1 258 ? 31.104  39.746  94.580  1.00 74.70  ? 257 GLU C CD  1 
ATOM   6548 O OE1 . GLU C 1 258 ? 31.623  40.887  94.598  1.00 74.87  ? 257 GLU C OE1 1 
ATOM   6549 O OE2 . GLU C 1 258 ? 31.361  38.895  93.693  1.00 75.96  ? 257 GLU C OE2 1 
ATOM   6550 N N   . ASP C 1 259 ? 26.273  40.837  95.111  1.00 68.29  ? 258 ASP C N   1 
ATOM   6551 C CA  . ASP C 1 259 ? 25.759  42.201  94.954  1.00 67.08  ? 258 ASP C CA  1 
ATOM   6552 C C   . ASP C 1 259 ? 24.779  42.592  96.064  1.00 65.86  ? 258 ASP C C   1 
ATOM   6553 O O   . ASP C 1 259 ? 24.913  43.657  96.677  1.00 65.58  ? 258 ASP C O   1 
ATOM   6554 C CB  . ASP C 1 259 ? 25.086  42.364  93.590  1.00 67.29  ? 258 ASP C CB  1 
ATOM   6555 C CG  . ASP C 1 259 ? 26.067  42.285  92.435  1.00 68.15  ? 258 ASP C CG  1 
ATOM   6556 O OD1 . ASP C 1 259 ? 27.247  42.679  92.608  1.00 68.90  ? 258 ASP C OD1 1 
ATOM   6557 O OD2 . ASP C 1 259 ? 25.737  41.847  91.310  1.00 68.46  ? 258 ASP C OD2 1 
ATOM   6558 N N   . GLY C 1 260 ? 23.793  41.726  96.302  1.00 64.49  ? 259 GLY C N   1 
ATOM   6559 C CA  . GLY C 1 260 ? 22.830  41.907  97.373  1.00 62.81  ? 259 GLY C CA  1 
ATOM   6560 C C   . GLY C 1 260 ? 23.518  42.189  98.691  1.00 61.71  ? 259 GLY C C   1 
ATOM   6561 O O   . GLY C 1 260 ? 23.237  43.199  99.340  1.00 61.64  ? 259 GLY C O   1 
ATOM   6562 N N   . ARG C 1 261 ? 24.435  41.300  99.068  1.00 60.70  ? 260 ARG C N   1 
ATOM   6563 C CA  . ARG C 1 261 ? 25.235  41.452  100.281 1.00 59.80  ? 260 ARG C CA  1 
ATOM   6564 C C   . ARG C 1 261 ? 26.002  42.776  100.310 1.00 58.60  ? 260 ARG C C   1 
ATOM   6565 O O   . ARG C 1 261 ? 26.137  43.388  101.367 1.00 58.40  ? 260 ARG C O   1 
ATOM   6566 C CB  . ARG C 1 261 ? 26.199  40.266  100.449 1.00 60.29  ? 260 ARG C CB  1 
ATOM   6567 C CG  . ARG C 1 261 ? 25.511  38.903  100.633 1.00 61.72  ? 260 ARG C CG  1 
ATOM   6568 C CD  . ARG C 1 261 ? 26.427  37.765  101.099 1.00 64.45  ? 260 ARG C CD  1 
ATOM   6569 N NE  . ARG C 1 261 ? 27.687  37.711  100.355 1.00 67.14  ? 260 ARG C NE  1 
ATOM   6570 C CZ  . ARG C 1 261 ? 27.952  36.857  99.364  1.00 68.77  ? 260 ARG C CZ  1 
ATOM   6571 N NH1 . ARG C 1 261 ? 27.048  35.962  98.973  1.00 68.87  ? 260 ARG C NH1 1 
ATOM   6572 N NH2 . ARG C 1 261 ? 29.131  36.903  98.753  1.00 69.50  ? 260 ARG C NH2 1 
ATOM   6573 N N   . SER C 1 262 ? 26.490  43.212  99.149  1.00 57.44  ? 261 SER C N   1 
ATOM   6574 C CA  . SER C 1 262 ? 27.239  44.464  99.032  1.00 56.36  ? 261 SER C CA  1 
ATOM   6575 C C   . SER C 1 262 ? 26.355  45.677  99.333  1.00 55.68  ? 261 SER C C   1 
ATOM   6576 O O   . SER C 1 262 ? 26.706  46.512  100.178 1.00 55.75  ? 261 SER C O   1 
ATOM   6577 C CB  . SER C 1 262 ? 27.874  44.595  97.638  1.00 56.48  ? 261 SER C CB  1 
ATOM   6578 O OG  . SER C 1 262 ? 28.028  45.959  97.259  1.00 56.11  ? 261 SER C OG  1 
ATOM   6579 N N   . LEU C 1 263 ? 25.215  45.765  98.644  1.00 54.43  ? 262 LEU C N   1 
ATOM   6580 C CA  . LEU C 1 263 ? 24.265  46.861  98.847  1.00 53.27  ? 262 LEU C CA  1 
ATOM   6581 C C   . LEU C 1 263 ? 23.676  46.863  100.269 1.00 52.72  ? 262 LEU C C   1 
ATOM   6582 O O   . LEU C 1 263 ? 23.577  47.919  100.894 1.00 52.32  ? 262 LEU C O   1 
ATOM   6583 C CB  . LEU C 1 263 ? 23.155  46.833  97.778  1.00 53.28  ? 262 LEU C CB  1 
ATOM   6584 C CG  . LEU C 1 263 ? 21.808  47.531  98.042  1.00 52.47  ? 262 LEU C CG  1 
ATOM   6585 C CD1 . LEU C 1 263 ? 21.942  49.051  97.968  1.00 51.56  ? 262 LEU C CD1 1 
ATOM   6586 C CD2 . LEU C 1 263 ? 20.747  47.033  97.077  1.00 51.45  ? 262 LEU C CD2 1 
ATOM   6587 N N   . LEU C 1 264 ? 23.303  45.688  100.776 1.00 52.22  ? 263 LEU C N   1 
ATOM   6588 C CA  . LEU C 1 264 ? 22.762  45.590  102.137 1.00 52.05  ? 263 LEU C CA  1 
ATOM   6589 C C   . LEU C 1 264 ? 23.710  46.202  103.163 1.00 51.94  ? 263 LEU C C   1 
ATOM   6590 O O   . LEU C 1 264 ? 23.280  46.944  104.049 1.00 52.34  ? 263 LEU C O   1 
ATOM   6591 C CB  . LEU C 1 264 ? 22.420  44.139  102.522 1.00 51.88  ? 263 LEU C CB  1 
ATOM   6592 C CG  . LEU C 1 264 ? 22.179  43.868  104.021 1.00 51.72  ? 263 LEU C CG  1 
ATOM   6593 C CD1 . LEU C 1 264 ? 20.885  44.518  104.507 1.00 51.52  ? 263 LEU C CD1 1 
ATOM   6594 C CD2 . LEU C 1 264 ? 22.163  42.382  104.329 1.00 51.77  ? 263 LEU C CD2 1 
ATOM   6595 N N   . SER C 1 265 ? 24.997  45.897  103.020 1.00 51.81  ? 264 SER C N   1 
ATOM   6596 C CA  . SER C 1 265 ? 26.031  46.397  103.915 1.00 51.77  ? 264 SER C CA  1 
ATOM   6597 C C   . SER C 1 265 ? 26.190  47.903  103.783 1.00 51.67  ? 264 SER C C   1 
ATOM   6598 O O   . SER C 1 265 ? 26.498  48.578  104.762 1.00 51.68  ? 264 SER C O   1 
ATOM   6599 C CB  . SER C 1 265 ? 27.365  45.704  103.630 1.00 51.80  ? 264 SER C CB  1 
ATOM   6600 O OG  . SER C 1 265 ? 28.087  46.407  102.631 1.00 51.73  ? 264 SER C OG  1 
ATOM   6601 N N   . GLN C 1 266 ? 26.002  48.414  102.565 1.00 51.79  ? 265 GLN C N   1 
ATOM   6602 C CA  . GLN C 1 266 ? 26.056  49.853  102.302 1.00 51.91  ? 265 GLN C CA  1 
ATOM   6603 C C   . GLN C 1 266 ? 24.842  50.540  102.937 1.00 52.03  ? 265 GLN C C   1 
ATOM   6604 O O   . GLN C 1 266 ? 24.934  51.668  103.435 1.00 51.48  ? 265 GLN C O   1 
ATOM   6605 C CB  . GLN C 1 266 ? 26.132  50.135  100.793 1.00 51.74  ? 265 GLN C CB  1 
ATOM   6606 C CG  . GLN C 1 266 ? 27.485  49.761  100.160 1.00 51.55  ? 265 GLN C CG  1 
ATOM   6607 C CD  . GLN C 1 266 ? 27.478  49.803  98.625  1.00 50.92  ? 265 GLN C CD  1 
ATOM   6608 O OE1 . GLN C 1 266 ? 27.302  48.770  97.964  1.00 50.09  ? 265 GLN C OE1 1 
ATOM   6609 N NE2 . GLN C 1 266 ? 27.682  50.994  98.063  1.00 49.75  ? 265 GLN C NE2 1 
ATOM   6610 N N   . MET C 1 267 ? 23.716  49.825  102.932 1.00 52.49  ? 266 MET C N   1 
ATOM   6611 C CA  . MET C 1 267 ? 22.472  50.294  103.537 1.00 52.89  ? 266 MET C CA  1 
ATOM   6612 C C   . MET C 1 267 ? 22.515  50.219  105.058 1.00 53.49  ? 266 MET C C   1 
ATOM   6613 O O   . MET C 1 267 ? 21.807  50.962  105.738 1.00 53.43  ? 266 MET C O   1 
ATOM   6614 C CB  . MET C 1 267 ? 21.301  49.460  103.032 1.00 52.54  ? 266 MET C CB  1 
ATOM   6615 C CG  . MET C 1 267 ? 20.640  50.022  101.809 1.00 52.24  ? 266 MET C CG  1 
ATOM   6616 S SD  . MET C 1 267 ? 19.545  48.821  101.068 1.00 53.28  ? 266 MET C SD  1 
ATOM   6617 C CE  . MET C 1 267 ? 17.953  49.478  101.557 1.00 53.36  ? 266 MET C CE  1 
ATOM   6618 N N   . LEU C 1 268 ? 23.331  49.306  105.583 1.00 54.28  ? 267 LEU C N   1 
ATOM   6619 C CA  . LEU C 1 268 ? 23.434  49.111  107.025 1.00 55.25  ? 267 LEU C CA  1 
ATOM   6620 C C   . LEU C 1 268 ? 24.762  49.627  107.547 1.00 56.02  ? 267 LEU C C   1 
ATOM   6621 O O   . LEU C 1 268 ? 25.274  49.136  108.545 1.00 56.02  ? 267 LEU C O   1 
ATOM   6622 C CB  . LEU C 1 268 ? 23.246  47.637  107.397 1.00 55.04  ? 267 LEU C CB  1 
ATOM   6623 C CG  . LEU C 1 268 ? 21.863  47.007  107.221 1.00 55.05  ? 267 LEU C CG  1 
ATOM   6624 C CD1 . LEU C 1 268 ? 21.882  45.573  107.721 1.00 54.18  ? 267 LEU C CD1 1 
ATOM   6625 C CD2 . LEU C 1 268 ? 20.764  47.806  107.924 1.00 55.40  ? 267 LEU C CD2 1 
ATOM   6626 N N   . HIS C 1 269 ? 25.308  50.623  106.855 1.00 57.32  ? 268 HIS C N   1 
ATOM   6627 C CA  . HIS C 1 269 ? 26.536  51.289  107.266 1.00 58.41  ? 268 HIS C CA  1 
ATOM   6628 C C   . HIS C 1 269 ? 26.278  52.081  108.540 1.00 58.77  ? 268 HIS C C   1 
ATOM   6629 O O   . HIS C 1 269 ? 25.277  52.802  108.634 1.00 58.70  ? 268 HIS C O   1 
ATOM   6630 C CB  . HIS C 1 269 ? 27.013  52.223  106.155 1.00 58.91  ? 268 HIS C CB  1 
ATOM   6631 C CG  . HIS C 1 269 ? 28.491  52.458  106.147 1.00 60.59  ? 268 HIS C CG  1 
ATOM   6632 N ND1 . HIS C 1 269 ? 29.323  51.926  105.184 1.00 62.31  ? 268 HIS C ND1 1 
ATOM   6633 C CD2 . HIS C 1 269 ? 29.285  53.178  106.976 1.00 61.99  ? 268 HIS C CD2 1 
ATOM   6634 C CE1 . HIS C 1 269 ? 30.566  52.308  105.421 1.00 63.15  ? 268 HIS C CE1 1 
ATOM   6635 N NE2 . HIS C 1 269 ? 30.571  53.067  106.503 1.00 63.15  ? 268 HIS C NE2 1 
ATOM   6636 N N   . TYR C 1 270 ? 27.182  51.938  109.511 1.00 59.31  ? 269 TYR C N   1 
ATOM   6637 C CA  . TYR C 1 270 ? 27.071  52.601  110.816 1.00 59.79  ? 269 TYR C CA  1 
ATOM   6638 C C   . TYR C 1 270 ? 27.015  54.115  110.694 1.00 59.77  ? 269 TYR C C   1 
ATOM   6639 O O   . TYR C 1 270 ? 26.098  54.751  111.213 1.00 59.99  ? 269 TYR C O   1 
ATOM   6640 C CB  . TYR C 1 270 ? 28.232  52.195  111.736 1.00 59.95  ? 269 TYR C CB  1 
ATOM   6641 C CG  . TYR C 1 270 ? 27.960  50.967  112.580 1.00 60.75  ? 269 TYR C CG  1 
ATOM   6642 C CD1 . TYR C 1 270 ? 26.899  50.938  113.485 1.00 61.12  ? 269 TYR C CD1 1 
ATOM   6643 C CD2 . TYR C 1 270 ? 28.767  49.831  112.475 1.00 61.46  ? 269 TYR C CD2 1 
ATOM   6644 C CE1 . TYR C 1 270 ? 26.646  49.810  114.261 1.00 61.62  ? 269 TYR C CE1 1 
ATOM   6645 C CE2 . TYR C 1 270 ? 28.520  48.698  113.249 1.00 61.58  ? 269 TYR C CE2 1 
ATOM   6646 C CZ  . TYR C 1 270 ? 27.459  48.696  114.139 1.00 61.51  ? 269 TYR C CZ  1 
ATOM   6647 O OH  . TYR C 1 270 ? 27.205  47.585  114.909 1.00 61.34  ? 269 TYR C OH  1 
ATOM   6648 N N   . ASP C 1 271 ? 28.002  54.675  110.000 1.00 59.93  ? 270 ASP C N   1 
ATOM   6649 C CA  . ASP C 1 271 ? 28.117  56.110  109.784 1.00 60.11  ? 270 ASP C CA  1 
ATOM   6650 C C   . ASP C 1 271 ? 26.974  56.581  108.882 1.00 60.23  ? 270 ASP C C   1 
ATOM   6651 O O   . ASP C 1 271 ? 26.861  56.123  107.741 1.00 60.14  ? 270 ASP C O   1 
ATOM   6652 C CB  . ASP C 1 271 ? 29.479  56.413  109.150 1.00 60.21  ? 270 ASP C CB  1 
ATOM   6653 C CG  . ASP C 1 271 ? 29.721  57.900  108.916 1.00 61.00  ? 270 ASP C CG  1 
ATOM   6654 O OD1 . ASP C 1 271 ? 28.820  58.738  109.153 1.00 61.20  ? 270 ASP C OD1 1 
ATOM   6655 O OD2 . ASP C 1 271 ? 30.814  58.324  108.483 1.00 62.69  ? 270 ASP C OD2 1 
ATOM   6656 N N   . PRO C 1 272 ? 26.119  57.468  109.400 1.00 60.32  ? 271 PRO C N   1 
ATOM   6657 C CA  . PRO C 1 272 ? 24.984  58.003  108.631 1.00 60.47  ? 271 PRO C CA  1 
ATOM   6658 C C   . PRO C 1 272 ? 25.398  58.748  107.352 1.00 60.65  ? 271 PRO C C   1 
ATOM   6659 O O   . PRO C 1 272 ? 24.672  58.672  106.355 1.00 60.69  ? 271 PRO C O   1 
ATOM   6660 C CB  . PRO C 1 272 ? 24.305  58.961  109.620 1.00 60.49  ? 271 PRO C CB  1 
ATOM   6661 C CG  . PRO C 1 272 ? 24.742  58.483  110.974 1.00 60.67  ? 271 PRO C CG  1 
ATOM   6662 C CD  . PRO C 1 272 ? 26.153  58.007  110.774 1.00 60.27  ? 271 PRO C CD  1 
ATOM   6663 N N   . ASN C 1 273 ? 26.532  59.451  107.381 1.00 60.64  ? 272 ASN C N   1 
ATOM   6664 C CA  . ASN C 1 273 ? 27.045  60.125  106.187 1.00 60.56  ? 272 ASN C CA  1 
ATOM   6665 C C   . ASN C 1 273 ? 27.519  59.134  105.117 1.00 59.97  ? 272 ASN C C   1 
ATOM   6666 O O   . ASN C 1 273 ? 27.369  59.387  103.921 1.00 60.04  ? 272 ASN C O   1 
ATOM   6667 C CB  . ASN C 1 273 ? 28.157  61.128  106.546 1.00 61.05  ? 272 ASN C CB  1 
ATOM   6668 C CG  . ASN C 1 273 ? 27.658  62.287  107.430 1.00 62.52  ? 272 ASN C CG  1 
ATOM   6669 O OD1 . ASN C 1 273 ? 26.466  62.395  107.730 1.00 64.70  ? 272 ASN C OD1 1 
ATOM   6670 N ND2 . ASN C 1 273 ? 28.579  63.151  107.853 1.00 63.65  ? 272 ASN C ND2 1 
ATOM   6671 N N   . LYS C 1 274 ? 28.068  58.003  105.558 1.00 59.09  ? 273 LYS C N   1 
ATOM   6672 C CA  . LYS C 1 274 ? 28.601  56.975  104.656 1.00 58.14  ? 273 LYS C CA  1 
ATOM   6673 C C   . LYS C 1 274 ? 27.532  55.998  104.163 1.00 56.83  ? 273 LYS C C   1 
ATOM   6674 O O   . LYS C 1 274 ? 27.758  55.259  103.201 1.00 56.86  ? 273 LYS C O   1 
ATOM   6675 C CB  . LYS C 1 274 ? 29.743  56.197  105.331 1.00 58.54  ? 273 LYS C CB  1 
ATOM   6676 C CG  . LYS C 1 274 ? 31.010  57.010  105.590 1.00 60.09  ? 273 LYS C CG  1 
ATOM   6677 C CD  . LYS C 1 274 ? 32.094  56.728  104.549 1.00 62.94  ? 273 LYS C CD  1 
ATOM   6678 C CE  . LYS C 1 274 ? 33.467  57.236  105.006 1.00 64.82  ? 273 LYS C CE  1 
ATOM   6679 N NZ  . LYS C 1 274 ? 33.569  58.734  104.985 1.00 65.77  ? 273 LYS C NZ  1 
ATOM   6680 N N   . ARG C 1 275 ? 26.383  55.983  104.835 1.00 55.25  ? 274 ARG C N   1 
ATOM   6681 C CA  . ARG C 1 275 ? 25.259  55.136  104.442 1.00 53.59  ? 274 ARG C CA  1 
ATOM   6682 C C   . ARG C 1 275 ? 24.719  55.601  103.091 1.00 52.89  ? 274 ARG C C   1 
ATOM   6683 O O   . ARG C 1 275 ? 24.544  56.799  102.863 1.00 52.85  ? 274 ARG C O   1 
ATOM   6684 C CB  . ARG C 1 275 ? 24.158  55.195  105.500 1.00 53.31  ? 274 ARG C CB  1 
ATOM   6685 C CG  . ARG C 1 275 ? 23.160  54.040  105.462 1.00 51.87  ? 274 ARG C CG  1 
ATOM   6686 C CD  . ARG C 1 275 ? 22.236  53.988  106.679 1.00 49.55  ? 274 ARG C CD  1 
ATOM   6687 N NE  . ARG C 1 275 ? 22.978  54.086  107.936 1.00 47.65  ? 274 ARG C NE  1 
ATOM   6688 C CZ  . ARG C 1 275 ? 22.566  54.736  109.018 1.00 46.73  ? 274 ARG C CZ  1 
ATOM   6689 N NH1 . ARG C 1 275 ? 21.397  55.358  109.032 1.00 45.31  ? 274 ARG C NH1 1 
ATOM   6690 N NH2 . ARG C 1 275 ? 23.325  54.749  110.105 1.00 46.92  ? 274 ARG C NH2 1 
ATOM   6691 N N   . ILE C 1 276 ? 24.469  54.645  102.204 1.00 51.84  ? 275 ILE C N   1 
ATOM   6692 C CA  . ILE C 1 276 ? 23.998  54.929  100.856 1.00 51.07  ? 275 ILE C CA  1 
ATOM   6693 C C   . ILE C 1 276 ? 22.690  55.739  100.866 1.00 51.00  ? 275 ILE C C   1 
ATOM   6694 O O   . ILE C 1 276 ? 21.842  55.559  101.748 1.00 51.11  ? 275 ILE C O   1 
ATOM   6695 C CB  . ILE C 1 276 ? 23.856  53.592  100.061 1.00 50.76  ? 275 ILE C CB  1 
ATOM   6696 C CG1 . ILE C 1 276 ? 23.802  53.840  98.548  1.00 50.49  ? 275 ILE C CG1 1 
ATOM   6697 C CG2 . ILE C 1 276 ? 22.659  52.774  100.539 1.00 50.60  ? 275 ILE C CG2 1 
ATOM   6698 C CD1 . ILE C 1 276 ? 24.292  52.663  97.711  1.00 48.82  ? 275 ILE C CD1 1 
ATOM   6699 N N   . SER C 1 277 ? 22.547  56.652  99.910  1.00 50.61  ? 276 SER C N   1 
ATOM   6700 C CA  . SER C 1 277 ? 21.264  57.311  99.675  1.00 50.36  ? 276 SER C CA  1 
ATOM   6701 C C   . SER C 1 277 ? 20.353  56.389  98.864  1.00 50.21  ? 276 SER C C   1 
ATOM   6702 O O   . SER C 1 277 ? 20.831  55.503  98.149  1.00 50.20  ? 276 SER C O   1 
ATOM   6703 C CB  . SER C 1 277 ? 21.459  58.624  98.926  1.00 50.32  ? 276 SER C CB  1 
ATOM   6704 O OG  . SER C 1 277 ? 21.481  58.399  97.523  1.00 50.54  ? 276 SER C OG  1 
ATOM   6705 N N   . ALA C 1 278 ? 19.045  56.603  98.970  1.00 49.96  ? 277 ALA C N   1 
ATOM   6706 C CA  . ALA C 1 278 ? 18.077  55.866  98.157  1.00 49.95  ? 277 ALA C CA  1 
ATOM   6707 C C   . ALA C 1 278 ? 18.349  56.072  96.663  1.00 50.01  ? 277 ALA C C   1 
ATOM   6708 O O   . ALA C 1 278 ? 18.228  55.140  95.879  1.00 50.02  ? 277 ALA C O   1 
ATOM   6709 C CB  . ALA C 1 278 ? 16.663  56.292  98.502  1.00 49.63  ? 277 ALA C CB  1 
ATOM   6710 N N   . LYS C 1 279 ? 18.721  57.297  96.295  1.00 50.27  ? 278 LYS C N   1 
ATOM   6711 C CA  . LYS C 1 279 ? 19.045  57.665  94.921  1.00 50.86  ? 278 LYS C CA  1 
ATOM   6712 C C   . LYS C 1 279 ? 20.260  56.890  94.403  1.00 50.85  ? 278 LYS C C   1 
ATOM   6713 O O   . LYS C 1 279 ? 20.190  56.243  93.357  1.00 50.95  ? 278 LYS C O   1 
ATOM   6714 C CB  . LYS C 1 279 ? 19.282  59.178  94.843  1.00 51.08  ? 278 LYS C CB  1 
ATOM   6715 C CG  . LYS C 1 279 ? 19.748  59.702  93.493  1.00 52.43  ? 278 LYS C CG  1 
ATOM   6716 C CD  . LYS C 1 279 ? 20.708  60.879  93.665  1.00 55.11  ? 278 LYS C CD  1 
ATOM   6717 C CE  . LYS C 1 279 ? 19.962  62.207  93.805  1.00 55.80  ? 278 LYS C CE  1 
ATOM   6718 N NZ  . LYS C 1 279 ? 19.428  62.704  92.500  1.00 56.96  ? 278 LYS C NZ  1 
ATOM   6719 N N   . ALA C 1 280 ? 21.355  56.946  95.160  1.00 51.26  ? 279 ALA C N   1 
ATOM   6720 C CA  . ALA C 1 280 ? 22.581  56.215  94.851  1.00 51.45  ? 279 ALA C CA  1 
ATOM   6721 C C   . ALA C 1 280 ? 22.349  54.717  94.742  1.00 51.86  ? 279 ALA C C   1 
ATOM   6722 O O   . ALA C 1 280 ? 22.905  54.066  93.858  1.00 51.93  ? 279 ALA C O   1 
ATOM   6723 C CB  . ALA C 1 280 ? 23.634  56.502  95.890  1.00 51.45  ? 279 ALA C CB  1 
ATOM   6724 N N   . ALA C 1 281 ? 21.521  54.184  95.637  1.00 52.19  ? 280 ALA C N   1 
ATOM   6725 C CA  . ALA C 1 281 ? 21.244  52.753  95.697  1.00 52.95  ? 280 ALA C CA  1 
ATOM   6726 C C   . ALA C 1 281 ? 20.443  52.244  94.508  1.00 53.48  ? 280 ALA C C   1 
ATOM   6727 O O   . ALA C 1 281 ? 20.465  51.052  94.214  1.00 53.44  ? 280 ALA C O   1 
ATOM   6728 C CB  . ALA C 1 281 ? 20.537  52.402  97.004  1.00 52.99  ? 280 ALA C CB  1 
ATOM   6729 N N   . LEU C 1 282 ? 19.728  53.142  93.832  1.00 54.42  ? 281 LEU C N   1 
ATOM   6730 C CA  . LEU C 1 282 ? 18.941  52.767  92.652  1.00 55.05  ? 281 LEU C CA  1 
ATOM   6731 C C   . LEU C 1 282 ? 19.849  52.467  91.455  1.00 55.81  ? 281 LEU C C   1 
ATOM   6732 O O   . LEU C 1 282 ? 19.450  51.758  90.528  1.00 56.05  ? 281 LEU C O   1 
ATOM   6733 C CB  . LEU C 1 282 ? 17.925  53.856  92.296  1.00 54.77  ? 281 LEU C CB  1 
ATOM   6734 C CG  . LEU C 1 282 ? 16.692  54.002  93.194  1.00 54.51  ? 281 LEU C CG  1 
ATOM   6735 C CD1 . LEU C 1 282 ? 16.093  55.398  93.049  1.00 53.83  ? 281 LEU C CD1 1 
ATOM   6736 C CD2 . LEU C 1 282 ? 15.648  52.935  92.909  1.00 53.46  ? 281 LEU C CD2 1 
ATOM   6737 N N   . ALA C 1 283 ? 21.067  53.011  91.494  1.00 56.54  ? 282 ALA C N   1 
ATOM   6738 C CA  . ALA C 1 283 ? 22.088  52.765  90.473  1.00 57.25  ? 282 ALA C CA  1 
ATOM   6739 C C   . ALA C 1 283 ? 22.864  51.453  90.690  1.00 57.67  ? 282 ALA C C   1 
ATOM   6740 O O   . ALA C 1 283 ? 23.605  51.020  89.805  1.00 57.81  ? 282 ALA C O   1 
ATOM   6741 C CB  . ALA C 1 283 ? 23.057  53.951  90.401  1.00 57.15  ? 282 ALA C CB  1 
ATOM   6742 N N   . HIS C 1 284 ? 22.687  50.823  91.853  1.00 58.03  ? 283 HIS C N   1 
ATOM   6743 C CA  . HIS C 1 284 ? 23.457  49.632  92.233  1.00 58.30  ? 283 HIS C CA  1 
ATOM   6744 C C   . HIS C 1 284 ? 23.290  48.443  91.269  1.00 58.38  ? 283 HIS C C   1 
ATOM   6745 O O   . HIS C 1 284 ? 22.177  48.187  90.789  1.00 58.40  ? 283 HIS C O   1 
ATOM   6746 C CB  . HIS C 1 284 ? 23.106  49.211  93.660  1.00 58.52  ? 283 HIS C CB  1 
ATOM   6747 C CG  . HIS C 1 284 ? 24.170  48.400  94.330  1.00 59.01  ? 283 HIS C CG  1 
ATOM   6748 N ND1 . HIS C 1 284 ? 24.310  47.044  94.126  1.00 60.06  ? 283 HIS C ND1 1 
ATOM   6749 C CD2 . HIS C 1 284 ? 25.142  48.752  95.204  1.00 59.11  ? 283 HIS C CD2 1 
ATOM   6750 C CE1 . HIS C 1 284 ? 25.326  46.596  94.843  1.00 60.00  ? 283 HIS C CE1 1 
ATOM   6751 N NE2 . HIS C 1 284 ? 25.848  47.612  95.506  1.00 59.45  ? 283 HIS C NE2 1 
ATOM   6752 N N   . PRO C 1 285 ? 24.397  47.744  90.968  1.00 58.44  ? 284 PRO C N   1 
ATOM   6753 C CA  . PRO C 1 285 ? 24.378  46.562  90.086  1.00 58.28  ? 284 PRO C CA  1 
ATOM   6754 C C   . PRO C 1 285 ? 23.549  45.378  90.590  1.00 58.26  ? 284 PRO C C   1 
ATOM   6755 O O   . PRO C 1 285 ? 23.328  44.438  89.818  1.00 58.25  ? 284 PRO C O   1 
ATOM   6756 C CB  . PRO C 1 285 ? 25.855  46.163  89.997  1.00 58.25  ? 284 PRO C CB  1 
ATOM   6757 C CG  . PRO C 1 285 ? 26.484  46.762  91.205  1.00 58.40  ? 284 PRO C CG  1 
ATOM   6758 C CD  . PRO C 1 285 ? 25.772  48.069  91.398  1.00 58.51  ? 284 PRO C CD  1 
ATOM   6759 N N   . PHE C 1 286 ? 23.104  45.409  91.845  1.00 58.00  ? 285 PHE C N   1 
ATOM   6760 C CA  . PHE C 1 286 ? 22.163  44.405  92.325  1.00 57.80  ? 285 PHE C CA  1 
ATOM   6761 C C   . PHE C 1 286 ? 20.887  44.471  91.482  1.00 57.91  ? 285 PHE C C   1 
ATOM   6762 O O   . PHE C 1 286 ? 20.233  43.453  91.252  1.00 57.82  ? 285 PHE C O   1 
ATOM   6763 C CB  . PHE C 1 286 ? 21.856  44.599  93.819  1.00 57.62  ? 285 PHE C CB  1 
ATOM   6764 C CG  . PHE C 1 286 ? 20.761  43.702  94.339  1.00 56.97  ? 285 PHE C CG  1 
ATOM   6765 C CD1 . PHE C 1 286 ? 20.933  42.323  94.391  1.00 56.67  ? 285 PHE C CD1 1 
ATOM   6766 C CD2 . PHE C 1 286 ? 19.549  44.239  94.764  1.00 56.65  ? 285 PHE C CD2 1 
ATOM   6767 C CE1 . PHE C 1 286 ? 19.914  41.487  94.869  1.00 57.23  ? 285 PHE C CE1 1 
ATOM   6768 C CE2 . PHE C 1 286 ? 18.523  43.415  95.244  1.00 56.48  ? 285 PHE C CE2 1 
ATOM   6769 C CZ  . PHE C 1 286 ? 18.707  42.036  95.299  1.00 56.67  ? 285 PHE C CZ  1 
ATOM   6770 N N   . PHE C 1 287 ? 20.572  45.673  91.000  1.00 58.20  ? 286 PHE C N   1 
ATOM   6771 C CA  . PHE C 1 287 ? 19.332  45.938  90.270  1.00 58.63  ? 286 PHE C CA  1 
ATOM   6772 C C   . PHE C 1 287 ? 19.436  45.827  88.745  1.00 59.81  ? 286 PHE C C   1 
ATOM   6773 O O   . PHE C 1 287 ? 18.424  45.949  88.047  1.00 59.71  ? 286 PHE C O   1 
ATOM   6774 C CB  . PHE C 1 287 ? 18.786  47.318  90.652  1.00 58.00  ? 286 PHE C CB  1 
ATOM   6775 C CG  . PHE C 1 287 ? 18.383  47.427  92.089  1.00 55.97  ? 286 PHE C CG  1 
ATOM   6776 C CD1 . PHE C 1 287 ? 17.400  46.590  92.615  1.00 54.26  ? 286 PHE C CD1 1 
ATOM   6777 C CD2 . PHE C 1 287 ? 18.994  48.355  92.921  1.00 53.58  ? 286 PHE C CD2 1 
ATOM   6778 C CE1 . PHE C 1 287 ? 17.033  46.681  93.953  1.00 53.72  ? 286 PHE C CE1 1 
ATOM   6779 C CE2 . PHE C 1 287 ? 18.634  48.455  94.256  1.00 52.80  ? 286 PHE C CE2 1 
ATOM   6780 C CZ  . PHE C 1 287 ? 17.656  47.617  94.775  1.00 52.82  ? 286 PHE C CZ  1 
ATOM   6781 N N   . GLN C 1 288 ? 20.644  45.589  88.232  1.00 61.12  ? 287 GLN C N   1 
ATOM   6782 C CA  . GLN C 1 288 ? 20.876  45.514  86.785  1.00 62.54  ? 287 GLN C CA  1 
ATOM   6783 C C   . GLN C 1 288 ? 19.842  44.680  86.004  1.00 63.00  ? 287 GLN C C   1 
ATOM   6784 O O   . GLN C 1 288 ? 19.512  45.013  84.868  1.00 63.03  ? 287 GLN C O   1 
ATOM   6785 C CB  . GLN C 1 288 ? 22.315  45.063  86.479  1.00 62.74  ? 287 GLN C CB  1 
ATOM   6786 C CG  . GLN C 1 288 ? 22.600  43.572  86.711  1.00 64.84  ? 287 GLN C CG  1 
ATOM   6787 C CD  . GLN C 1 288 ? 24.069  43.201  86.509  1.00 67.29  ? 287 GLN C CD  1 
ATOM   6788 O OE1 . GLN C 1 288 ? 24.756  43.771  85.647  1.00 68.11  ? 287 GLN C OE1 1 
ATOM   6789 N NE2 . GLN C 1 288 ? 24.551  42.247  87.302  1.00 67.12  ? 287 GLN C NE2 1 
ATOM   6790 N N   . ASP C 1 289 ? 19.324  43.618  86.626  1.00 63.85  ? 288 ASP C N   1 
ATOM   6791 C CA  . ASP C 1 289 ? 18.386  42.703  85.965  1.00 64.73  ? 288 ASP C CA  1 
ATOM   6792 C C   . ASP C 1 289 ? 16.999  42.634  86.627  1.00 64.99  ? 288 ASP C C   1 
ATOM   6793 O O   . ASP C 1 289 ? 16.304  41.614  86.525  1.00 64.98  ? 288 ASP C O   1 
ATOM   6794 C CB  . ASP C 1 289 ? 19.003  41.294  85.839  1.00 65.05  ? 288 ASP C CB  1 
ATOM   6795 C CG  . ASP C 1 289 ? 19.280  40.630  87.197  1.00 66.00  ? 288 ASP C CG  1 
ATOM   6796 O OD1 . ASP C 1 289 ? 19.112  41.283  88.261  1.00 66.30  ? 288 ASP C OD1 1 
ATOM   6797 O OD2 . ASP C 1 289 ? 19.671  39.440  87.289  1.00 67.47  ? 288 ASP C OD2 1 
ATOM   6798 N N   . VAL C 1 290 ? 16.602  43.723  87.286  1.00 65.43  ? 289 VAL C N   1 
ATOM   6799 C CA  . VAL C 1 290 ? 15.326  43.790  88.003  1.00 65.68  ? 289 VAL C CA  1 
ATOM   6800 C C   . VAL C 1 290 ? 14.129  43.721  87.052  1.00 66.41  ? 289 VAL C C   1 
ATOM   6801 O O   . VAL C 1 290 ? 14.081  44.431  86.048  1.00 66.50  ? 289 VAL C O   1 
ATOM   6802 C CB  . VAL C 1 290 ? 15.249  45.051  88.922  1.00 65.47  ? 289 VAL C CB  1 
ATOM   6803 C CG1 . VAL C 1 290 ? 15.336  46.343  88.112  1.00 65.12  ? 289 VAL C CG1 1 
ATOM   6804 C CG2 . VAL C 1 290 ? 13.998  45.035  89.789  1.00 64.82  ? 289 VAL C CG2 1 
ATOM   6805 N N   . THR C 1 291 ? 13.185  42.834  87.363  1.00 67.45  ? 290 THR C N   1 
ATOM   6806 C CA  . THR C 1 291 ? 11.918  42.742  86.631  1.00 68.31  ? 290 THR C CA  1 
ATOM   6807 C C   . THR C 1 291 ? 10.759  43.141  87.553  1.00 69.32  ? 290 THR C C   1 
ATOM   6808 O O   . THR C 1 291 ? 10.986  43.673  88.641  1.00 69.27  ? 290 THR C O   1 
ATOM   6809 C CB  . THR C 1 291 ? 11.709  41.318  86.027  1.00 68.20  ? 290 THR C CB  1 
ATOM   6810 O OG1 . THR C 1 291 ? 11.817  40.317  87.052  1.00 67.67  ? 290 THR C OG1 1 
ATOM   6811 C CG2 . THR C 1 291 ? 12.840  40.965  85.056  1.00 67.92  ? 290 THR C CG2 1 
ATOM   6812 N N   . LYS C 1 292 ? 9.525   42.903  87.112  1.00 70.74  ? 291 LYS C N   1 
ATOM   6813 C CA  . LYS C 1 292 ? 8.344   43.154  87.937  1.00 72.12  ? 291 LYS C CA  1 
ATOM   6814 C C   . LYS C 1 292 ? 7.418   41.925  87.990  1.00 73.77  ? 291 LYS C C   1 
ATOM   6815 O O   . LYS C 1 292 ? 6.401   41.876  87.291  1.00 73.56  ? 291 LYS C O   1 
ATOM   6816 C CB  . LYS C 1 292 ? 7.597   44.407  87.453  1.00 71.73  ? 291 LYS C CB  1 
ATOM   6817 C CG  . LYS C 1 292 ? 6.589   44.969  88.456  1.00 70.44  ? 291 LYS C CG  1 
ATOM   6818 C CD  . LYS C 1 292 ? 6.607   46.492  88.490  1.00 68.50  ? 291 LYS C CD  1 
ATOM   6819 C CE  . LYS C 1 292 ? 5.608   47.051  89.503  1.00 66.82  ? 291 LYS C CE  1 
ATOM   6820 N NZ  . LYS C 1 292 ? 4.190   46.842  89.094  1.00 66.14  ? 291 LYS C NZ  1 
ATOM   6821 N N   . PRO C 1 293 ? 7.774   40.936  88.815  1.00 75.70  ? 292 PRO C N   1 
ATOM   6822 C CA  . PRO C 1 293 ? 6.962   39.721  88.971  1.00 77.73  ? 292 PRO C CA  1 
ATOM   6823 C C   . PRO C 1 293 ? 5.657   39.928  89.748  1.00 80.18  ? 292 PRO C C   1 
ATOM   6824 O O   . PRO C 1 293 ? 5.503   40.908  90.477  1.00 80.00  ? 292 PRO C O   1 
ATOM   6825 C CB  . PRO C 1 293 ? 7.887   38.780  89.756  1.00 77.29  ? 292 PRO C CB  1 
ATOM   6826 C CG  . PRO C 1 293 ? 9.226   39.419  89.723  1.00 76.21  ? 292 PRO C CG  1 
ATOM   6827 C CD  . PRO C 1 293 ? 8.987   40.883  89.650  1.00 75.51  ? 292 PRO C CD  1 
ATOM   6828 N N   . VAL C 1 294 ? 4.728   38.991  89.574  1.00 83.59  ? 293 VAL C N   1 
ATOM   6829 C CA  . VAL C 1 294 ? 3.492   38.938  90.351  1.00 87.07  ? 293 VAL C CA  1 
ATOM   6830 C C   . VAL C 1 294 ? 3.677   37.944  91.509  1.00 89.83  ? 293 VAL C C   1 
ATOM   6831 O O   . VAL C 1 294 ? 4.149   36.827  91.293  1.00 89.96  ? 293 VAL C O   1 
ATOM   6832 C CB  . VAL C 1 294 ? 2.276   38.564  89.443  1.00 86.83  ? 293 VAL C CB  1 
ATOM   6833 C CG1 . VAL C 1 294 ? 1.167   37.845  90.217  1.00 86.86  ? 293 VAL C CG1 1 
ATOM   6834 C CG2 . VAL C 1 294 ? 1.725   39.805  88.755  1.00 86.93  ? 293 VAL C CG2 1 
ATOM   6835 N N   . PRO C 1 295 ? 3.336   38.352  92.733  1.00 92.77  ? 294 PRO C N   1 
ATOM   6836 C CA  . PRO C 1 295 ? 3.460   37.475  93.905  1.00 95.31  ? 294 PRO C CA  1 
ATOM   6837 C C   . PRO C 1 295 ? 2.386   36.390  93.973  1.00 98.01  ? 294 PRO C C   1 
ATOM   6838 O O   . PRO C 1 295 ? 1.280   36.575  93.463  1.00 98.40  ? 294 PRO C O   1 
ATOM   6839 C CB  . PRO C 1 295 ? 3.300   38.442  95.078  1.00 95.21  ? 294 PRO C CB  1 
ATOM   6840 C CG  . PRO C 1 295 ? 2.454   39.539  94.545  1.00 94.17  ? 294 PRO C CG  1 
ATOM   6841 C CD  . PRO C 1 295 ? 2.819   39.684  93.096  1.00 92.95  ? 294 PRO C CD  1 
ATOM   6842 N N   . HIS C 1 296 ? 2.728   35.268  94.602  1.00 101.11 ? 295 HIS C N   1 
ATOM   6843 C CA  . HIS C 1 296 ? 1.795   34.171  94.849  1.00 104.12 ? 295 HIS C CA  1 
ATOM   6844 C C   . HIS C 1 296 ? 0.860   34.566  95.993  1.00 105.25 ? 295 HIS C C   1 
ATOM   6845 O O   . HIS C 1 296 ? 1.150   34.308  97.167  1.00 105.55 ? 295 HIS C O   1 
ATOM   6846 C CB  . HIS C 1 296 ? 2.577   32.891  95.185  1.00 104.75 ? 295 HIS C CB  1 
ATOM   6847 C CG  . HIS C 1 296 ? 1.733   31.657  95.289  1.00 107.46 ? 295 HIS C CG  1 
ATOM   6848 N ND1 . HIS C 1 296 ? 1.754   30.660  94.336  1.00 109.71 ? 295 HIS C ND1 1 
ATOM   6849 C CD2 . HIS C 1 296 ? 0.870   31.241  96.247  1.00 109.58 ? 295 HIS C CD2 1 
ATOM   6850 C CE1 . HIS C 1 296 ? 0.928   29.693  94.695  1.00 110.65 ? 295 HIS C CE1 1 
ATOM   6851 N NE2 . HIS C 1 296 ? 0.379   30.021  95.850  1.00 110.50 ? 295 HIS C NE2 1 
ATOM   6852 N N   . LEU C 1 297 ? -0.251  35.211  95.637  1.00 106.64 ? 296 LEU C N   1 
ATOM   6853 C CA  . LEU C 1 297 ? -1.244  35.667  96.610  1.00 107.77 ? 296 LEU C CA  1 
ATOM   6854 C C   . LEU C 1 297 ? -2.534  34.861  96.497  1.00 107.91 ? 296 LEU C C   1 
ATOM   6855 O O   . LEU C 1 297 ? -3.366  34.869  97.405  1.00 108.09 ? 296 LEU C O   1 
ATOM   6856 C CB  . LEU C 1 297 ? -1.537  37.166  96.432  1.00 108.30 ? 296 LEU C CB  1 
ATOM   6857 C CG  . LEU C 1 297 ? -0.478  38.209  96.817  1.00 109.61 ? 296 LEU C CG  1 
ATOM   6858 C CD1 . LEU C 1 297 ? -0.914  39.605  96.396  1.00 110.71 ? 296 LEU C CD1 1 
ATOM   6859 C CD2 . LEU C 1 297 ? -0.173  38.181  98.307  1.00 111.18 ? 296 LEU C CD2 1 
ATOM   6860 N N   . VAL D 2 1   ? 21.146  63.601  103.082 1.00 85.63  ? 175 VAL D N   1 
ATOM   6861 C CA  . VAL D 2 1   ? 22.308  63.610  102.139 1.00 85.41  ? 175 VAL D CA  1 
ATOM   6862 C C   . VAL D 2 1   ? 22.290  64.847  101.225 1.00 84.85  ? 175 VAL D C   1 
ATOM   6863 O O   . VAL D 2 1   ? 21.258  65.154  100.613 1.00 85.00  ? 175 VAL D O   1 
ATOM   6864 C CB  . VAL D 2 1   ? 22.381  62.317  101.260 1.00 85.49  ? 175 VAL D CB  1 
ATOM   6865 C CG1 . VAL D 2 1   ? 23.826  61.904  101.024 1.00 85.87  ? 175 VAL D CG1 1 
ATOM   6866 C CG2 . VAL D 2 1   ? 21.598  61.166  101.884 1.00 85.93  ? 175 VAL D CG2 1 
ATOM   6867 N N   . PRO D 2 2   ? 23.420  65.561  101.152 1.00 84.13  ? 176 PRO D N   1 
ATOM   6868 C CA  . PRO D 2 2   ? 23.641  66.591  100.124 1.00 83.25  ? 176 PRO D CA  1 
ATOM   6869 C C   . PRO D 2 2   ? 23.501  66.085  98.681  1.00 82.08  ? 176 PRO D C   1 
ATOM   6870 O O   . PRO D 2 2   ? 23.625  66.874  97.740  1.00 82.33  ? 176 PRO D O   1 
ATOM   6871 C CB  . PRO D 2 2   ? 25.074  67.059  100.401 1.00 83.49  ? 176 PRO D CB  1 
ATOM   6872 C CG  . PRO D 2 2   ? 25.274  66.782  101.849 1.00 84.08  ? 176 PRO D CG  1 
ATOM   6873 C CD  . PRO D 2 2   ? 24.558  65.479  102.089 1.00 84.28  ? 176 PRO D CD  1 
ATOM   6874 N N   . ASP D 2 3   ? 23.246  64.787  98.520  1.00 80.35  ? 177 ASP D N   1 
ATOM   6875 C CA  . ASP D 2 3   ? 22.826  64.214  97.243  1.00 78.48  ? 177 ASP D CA  1 
ATOM   6876 C C   . ASP D 2 3   ? 21.424  64.712  96.865  1.00 76.62  ? 177 ASP D C   1 
ATOM   6877 O O   . ASP D 2 3   ? 21.019  64.619  95.699  1.00 76.66  ? 177 ASP D O   1 
ATOM   6878 C CB  . ASP D 2 3   ? 22.813  62.683  97.332  1.00 78.99  ? 177 ASP D CB  1 
ATOM   6879 C CG  . ASP D 2 3   ? 24.178  62.053  97.072  1.00 79.90  ? 177 ASP D CG  1 
ATOM   6880 O OD1 . ASP D 2 3   ? 25.040  62.703  96.437  1.00 80.95  ? 177 ASP D OD1 1 
ATOM   6881 O OD2 . ASP D 2 3   ? 24.469  60.898  97.465  1.00 80.53  ? 177 ASP D OD2 1 
ATOM   6882 N N   . TYR D 2 4   ? 20.700  65.239  97.859  1.00 73.96  ? 178 TYR D N   1 
ATOM   6883 C CA  . TYR D 2 4   ? 19.347  65.771  97.679  1.00 71.23  ? 178 TYR D CA  1 
ATOM   6884 C C   . TYR D 2 4   ? 19.253  67.290  97.786  1.00 70.19  ? 178 TYR D C   1 
ATOM   6885 O O   . TYR D 2 4   ? 18.249  67.869  97.386  1.00 70.09  ? 178 TYR D O   1 
ATOM   6886 C CB  . TYR D 2 4   ? 18.388  65.155  98.699  1.00 70.63  ? 178 TYR D CB  1 
ATOM   6887 C CG  . TYR D 2 4   ? 18.213  63.669  98.561  1.00 67.39  ? 178 TYR D CG  1 
ATOM   6888 C CD1 . TYR D 2 4   ? 17.441  63.125  97.534  1.00 64.25  ? 178 TYR D CD1 1 
ATOM   6889 C CD2 . TYR D 2 4   ? 18.823  62.802  99.462  1.00 64.84  ? 178 TYR D CD2 1 
ATOM   6890 C CE1 . TYR D 2 4   ? 17.285  61.747  97.411  1.00 62.76  ? 178 TYR D CE1 1 
ATOM   6891 C CE2 . TYR D 2 4   ? 18.671  61.429  99.355  1.00 62.80  ? 178 TYR D CE2 1 
ATOM   6892 C CZ  . TYR D 2 4   ? 17.905  60.906  98.333  1.00 61.89  ? 178 TYR D CZ  1 
ATOM   6893 O OH  . TYR D 2 4   ? 17.771  59.544  98.236  1.00 60.11  ? 178 TYR D OH  1 
ATOM   6894 N N   . HIS D 2 5   ? 20.291  67.926  98.326  1.00 68.83  ? 179 HIS D N   1 
ATOM   6895 C CA  . HIS D 2 5   ? 20.297  69.376  98.569  1.00 67.67  ? 179 HIS D CA  1 
ATOM   6896 C C   . HIS D 2 5   ? 19.771  70.205  97.386  1.00 66.21  ? 179 HIS D C   1 
ATOM   6897 O O   . HIS D 2 5   ? 19.064  71.201  97.583  1.00 65.90  ? 179 HIS D O   1 
ATOM   6898 C CB  . HIS D 2 5   ? 21.701  69.858  98.969  1.00 68.05  ? 179 HIS D CB  1 
ATOM   6899 C CG  . HIS D 2 5   ? 22.061  69.594  100.406 1.00 69.81  ? 179 HIS D CG  1 
ATOM   6900 N ND1 . HIS D 2 5   ? 21.391  68.682  101.197 1.00 71.11  ? 179 HIS D ND1 1 
ATOM   6901 C CD2 . HIS D 2 5   ? 23.042  70.115  101.186 1.00 71.22  ? 179 HIS D CD2 1 
ATOM   6902 C CE1 . HIS D 2 5   ? 21.937  68.658  102.402 1.00 71.64  ? 179 HIS D CE1 1 
ATOM   6903 N NE2 . HIS D 2 5   ? 22.941  69.518  102.422 1.00 71.77  ? 179 HIS D NE2 1 
ATOM   6904 N N   . GLU D 2 6   ? 20.108  69.781  96.169  1.00 64.17  ? 180 GLU D N   1 
ATOM   6905 C CA  . GLU D 2 6   ? 19.715  70.503  94.966  1.00 62.41  ? 180 GLU D CA  1 
ATOM   6906 C C   . GLU D 2 6   ? 18.286  70.186  94.552  1.00 60.26  ? 180 GLU D C   1 
ATOM   6907 O O   . GLU D 2 6   ? 17.527  71.079  94.167  1.00 59.94  ? 180 GLU D O   1 
ATOM   6908 C CB  . GLU D 2 6   ? 20.694  70.220  93.815  1.00 63.04  ? 180 GLU D CB  1 
ATOM   6909 C CG  . GLU D 2 6   ? 21.069  71.452  92.992  1.00 65.64  ? 180 GLU D CG  1 
ATOM   6910 C CD  . GLU D 2 6   ? 21.754  72.558  93.806  1.00 69.32  ? 180 GLU D CD  1 
ATOM   6911 O OE1 . GLU D 2 6   ? 21.214  72.969  94.867  1.00 69.75  ? 180 GLU D OE1 1 
ATOM   6912 O OE2 . GLU D 2 6   ? 22.838  73.032  93.378  1.00 70.35  ? 180 GLU D OE2 1 
ATOM   6913 N N   . ASP D 2 7   ? 17.933  68.907  94.639  1.00 57.75  ? 181 ASP D N   1 
ATOM   6914 C CA  . ASP D 2 7   ? 16.588  68.432  94.332  1.00 55.29  ? 181 ASP D CA  1 
ATOM   6915 C C   . ASP D 2 7   ? 15.539  69.100  95.216  1.00 53.27  ? 181 ASP D C   1 
ATOM   6916 O O   . ASP D 2 7   ? 14.470  69.490  94.735  1.00 52.56  ? 181 ASP D O   1 
ATOM   6917 C CB  . ASP D 2 7   ? 16.520  66.912  94.489  1.00 55.51  ? 181 ASP D CB  1 
ATOM   6918 C CG  . ASP D 2 7   ? 16.498  66.189  93.161  1.00 56.11  ? 181 ASP D CG  1 
ATOM   6919 O OD1 . ASP D 2 7   ? 16.530  66.862  92.103  1.00 57.93  ? 181 ASP D OD1 1 
ATOM   6920 O OD2 . ASP D 2 7   ? 16.448  64.945  93.073  1.00 56.37  ? 181 ASP D OD2 1 
ATOM   6921 N N   . ILE D 2 8   ? 15.866  69.234  96.504  1.00 50.91  ? 182 ILE D N   1 
ATOM   6922 C CA  . ILE D 2 8   ? 15.000  69.900  97.469  1.00 48.70  ? 182 ILE D CA  1 
ATOM   6923 C C   . ILE D 2 8   ? 14.921  71.378  97.122  1.00 47.71  ? 182 ILE D C   1 
ATOM   6924 O O   . ILE D 2 8   ? 13.824  71.939  97.043  1.00 47.59  ? 182 ILE D O   1 
ATOM   6925 C CB  . ILE D 2 8   ? 15.486  69.677  98.922  1.00 48.45  ? 182 ILE D CB  1 
ATOM   6926 C CG1 . ILE D 2 8   ? 15.263  68.222  99.343  1.00 47.68  ? 182 ILE D CG1 1 
ATOM   6927 C CG2 . ILE D 2 8   ? 14.761  70.610  99.887  1.00 47.63  ? 182 ILE D CG2 1 
ATOM   6928 C CD1 . ILE D 2 8   ? 16.294  67.678  100.317 1.00 45.79  ? 182 ILE D CD1 1 
ATOM   6929 N N   . HIS D 2 9   ? 16.074  72.001  96.883  1.00 46.34  ? 183 HIS D N   1 
ATOM   6930 C CA  . HIS D 2 9   ? 16.094  73.395  96.439  1.00 45.07  ? 183 HIS D CA  1 
ATOM   6931 C C   . HIS D 2 9   ? 15.170  73.664  95.247  1.00 44.73  ? 183 HIS D C   1 
ATOM   6932 O O   . HIS D 2 9   ? 14.370  74.597  95.273  1.00 44.76  ? 183 HIS D O   1 
ATOM   6933 C CB  . HIS D 2 9   ? 17.497  73.889  96.093  1.00 44.39  ? 183 HIS D CB  1 
ATOM   6934 C CG  . HIS D 2 9   ? 17.490  75.298  95.607  1.00 42.51  ? 183 HIS D CG  1 
ATOM   6935 N ND1 . HIS D 2 9   ? 17.500  76.375  96.466  1.00 41.02  ? 183 HIS D ND1 1 
ATOM   6936 C CD2 . HIS D 2 9   ? 17.362  75.810  94.360  1.00 40.32  ? 183 HIS D CD2 1 
ATOM   6937 C CE1 . HIS D 2 9   ? 17.423  77.491  95.766  1.00 40.69  ? 183 HIS D CE1 1 
ATOM   6938 N NE2 . HIS D 2 9   ? 17.334  77.176  94.486  1.00 40.28  ? 183 HIS D NE2 1 
ATOM   6939 N N   . THR D 2 10  ? 15.301  72.846  94.209  1.00 44.55  ? 184 THR D N   1 
ATOM   6940 C CA  . THR D 2 10  ? 14.486  72.963  93.006  1.00 44.80  ? 184 THR D CA  1 
ATOM   6941 C C   . THR D 2 10  ? 13.003  72.713  93.289  1.00 44.55  ? 184 THR D C   1 
ATOM   6942 O O   . THR D 2 10  ? 12.135  73.317  92.645  1.00 44.31  ? 184 THR D O   1 
ATOM   6943 C CB  . THR D 2 10  ? 15.011  71.998  91.913  1.00 44.97  ? 184 THR D CB  1 
ATOM   6944 O OG1 . THR D 2 10  ? 16.333  72.396  91.524  1.00 46.58  ? 184 THR D OG1 1 
ATOM   6945 C CG2 . THR D 2 10  ? 14.220  72.145  90.617  1.00 45.28  ? 184 THR D CG2 1 
ATOM   6946 N N   . TYR D 2 11  ? 12.717  71.827  94.247  1.00 44.23  ? 185 TYR D N   1 
ATOM   6947 C CA  . TYR D 2 11  ? 11.328  71.554  94.627  1.00 43.91  ? 185 TYR D CA  1 
ATOM   6948 C C   . TYR D 2 11  ? 10.676  72.757  95.299  1.00 43.48  ? 185 TYR D C   1 
ATOM   6949 O O   . TYR D 2 11  ? 9.563   73.142  94.935  1.00 43.28  ? 185 TYR D O   1 
ATOM   6950 C CB  . TYR D 2 11  ? 11.188  70.316  95.526  1.00 43.82  ? 185 TYR D CB  1 
ATOM   6951 C CG  . TYR D 2 11  ? 9.741   70.051  95.902  1.00 44.24  ? 185 TYR D CG  1 
ATOM   6952 C CD1 . TYR D 2 11  ? 8.761   69.915  94.909  1.00 44.66  ? 185 TYR D CD1 1 
ATOM   6953 C CD2 . TYR D 2 11  ? 9.346   69.971  97.237  1.00 44.19  ? 185 TYR D CD2 1 
ATOM   6954 C CE1 . TYR D 2 11  ? 7.439   69.692  95.230  1.00 44.72  ? 185 TYR D CE1 1 
ATOM   6955 C CE2 . TYR D 2 11  ? 8.015   69.742  97.575  1.00 44.66  ? 185 TYR D CE2 1 
ATOM   6956 C CZ  . TYR D 2 11  ? 7.070   69.604  96.565  1.00 45.27  ? 185 TYR D CZ  1 
ATOM   6957 O OH  . TYR D 2 11  ? 5.752   69.383  96.876  1.00 45.63  ? 185 TYR D OH  1 
ATOM   6958 N N   . LEU D 2 12  ? 11.380  73.344  96.265  1.00 42.93  ? 186 LEU D N   1 
ATOM   6959 C CA  . LEU D 2 12  ? 10.859  74.471  97.026  1.00 43.03  ? 186 LEU D CA  1 
ATOM   6960 C C   . LEU D 2 12  ? 10.638  75.690  96.144  1.00 43.23  ? 186 LEU D C   1 
ATOM   6961 O O   . LEU D 2 12  ? 9.750   76.481  96.406  1.00 43.17  ? 186 LEU D O   1 
ATOM   6962 C CB  . LEU D 2 12  ? 11.782  74.815  98.203  1.00 42.68  ? 186 LEU D CB  1 
ATOM   6963 C CG  . LEU D 2 12  ? 12.030  73.713  99.246  1.00 42.93  ? 186 LEU D CG  1 
ATOM   6964 C CD1 . LEU D 2 12  ? 13.055  74.157  100.291 1.00 42.06  ? 186 LEU D CD1 1 
ATOM   6965 C CD2 . LEU D 2 12  ? 10.731  73.233  99.911  1.00 41.74  ? 186 LEU D CD2 1 
ATOM   6966 N N   . ARG D 2 13  ? 11.454  75.833  95.100  1.00 44.08  ? 187 ARG D N   1 
ATOM   6967 C CA  . ARG D 2 13  ? 11.322  76.946  94.165  1.00 44.51  ? 187 ARG D CA  1 
ATOM   6968 C C   . ARG D 2 13  ? 10.027  76.814  93.377  1.00 45.14  ? 187 ARG D C   1 
ATOM   6969 O O   . ARG D 2 13  ? 9.289   77.792  93.214  1.00 45.05  ? 187 ARG D O   1 
ATOM   6970 C CB  . ARG D 2 13  ? 12.534  77.028  93.235  1.00 44.56  ? 187 ARG D CB  1 
ATOM   6971 C CG  . ARG D 2 13  ? 13.777  77.607  93.898  1.00 44.48  ? 187 ARG D CG  1 
ATOM   6972 C CD  . ARG D 2 13  ? 13.737  79.108  94.086  1.00 45.46  ? 187 ARG D CD  1 
ATOM   6973 N NE  . ARG D 2 13  ? 13.673  79.772  92.788  1.00 47.06  ? 187 ARG D NE  1 
ATOM   6974 C CZ  . ARG D 2 13  ? 14.723  80.264  92.143  1.00 47.75  ? 187 ARG D CZ  1 
ATOM   6975 N NH1 . ARG D 2 13  ? 15.933  80.206  92.684  1.00 47.53  ? 187 ARG D NH1 1 
ATOM   6976 N NH2 . ARG D 2 13  ? 14.558  80.835  90.959  1.00 49.22  ? 187 ARG D NH2 1 
ATOM   6977 N N   . GLU D 2 14  ? 9.753   75.596  92.910  1.00 45.89  ? 188 GLU D N   1 
ATOM   6978 C CA  . GLU D 2 14  ? 8.452   75.247  92.348  1.00 47.00  ? 188 GLU D CA  1 
ATOM   6979 C C   . GLU D 2 14  ? 7.335   75.535  93.355  1.00 47.04  ? 188 GLU D C   1 
ATOM   6980 O O   . GLU D 2 14  ? 6.364   76.203  93.029  1.00 47.07  ? 188 GLU D O   1 
ATOM   6981 C CB  . GLU D 2 14  ? 8.436   73.771  91.930  1.00 47.32  ? 188 GLU D CB  1 
ATOM   6982 C CG  . GLU D 2 14  ? 7.201   73.323  91.158  1.00 50.30  ? 188 GLU D CG  1 
ATOM   6983 C CD  . GLU D 2 14  ? 6.944   71.823  91.280  1.00 54.98  ? 188 GLU D CD  1 
ATOM   6984 O OE1 . GLU D 2 14  ? 7.895   71.023  91.077  1.00 56.45  ? 188 GLU D OE1 1 
ATOM   6985 O OE2 . GLU D 2 14  ? 5.786   71.437  91.582  1.00 56.26  ? 188 GLU D OE2 1 
ATOM   6986 N N   . MET D 2 15  ? 7.502   75.056  94.585  1.00 47.49  ? 189 MET D N   1 
ATOM   6987 C CA  . MET D 2 15  ? 6.461   75.156  95.610  1.00 48.00  ? 189 MET D CA  1 
ATOM   6988 C C   . MET D 2 15  ? 6.155   76.578  96.107  1.00 47.89  ? 189 MET D C   1 
ATOM   6989 O O   . MET D 2 15  ? 5.004   76.885  96.435  1.00 47.99  ? 189 MET D O   1 
ATOM   6990 C CB  . MET D 2 15  ? 6.794   74.246  96.798  1.00 48.15  ? 189 MET D CB  1 
ATOM   6991 C CG  . MET D 2 15  ? 6.368   72.778  96.645  1.00 49.86  ? 189 MET D CG  1 
ATOM   6992 S SD  . MET D 2 15  ? 5.001   72.392  95.491  1.00 53.92  ? 189 MET D SD  1 
ATOM   6993 C CE  . MET D 2 15  ? 3.541   72.932  96.452  1.00 52.95  ? 189 MET D CE  1 
ATOM   6994 N N   . GLU D 2 16  ? 7.170   77.439  96.161  1.00 47.56  ? 190 GLU D N   1 
ATOM   6995 C CA  . GLU D 2 16  ? 7.003   78.798  96.696  1.00 47.36  ? 190 GLU D CA  1 
ATOM   6996 C C   . GLU D 2 16  ? 6.163   79.715  95.802  1.00 47.08  ? 190 GLU D C   1 
ATOM   6997 O O   . GLU D 2 16  ? 5.649   80.736  96.253  1.00 47.11  ? 190 GLU D O   1 
ATOM   6998 C CB  . GLU D 2 16  ? 8.363   79.436  97.015  1.00 47.63  ? 190 GLU D CB  1 
ATOM   6999 C CG  . GLU D 2 16  ? 9.234   79.752  95.802  1.00 48.69  ? 190 GLU D CG  1 
ATOM   7000 C CD  . GLU D 2 16  ? 10.240  80.868  96.057  1.00 50.76  ? 190 GLU D CD  1 
ATOM   7001 O OE1 . GLU D 2 16  ? 10.156  81.552  97.098  1.00 52.87  ? 190 GLU D OE1 1 
ATOM   7002 O OE2 . GLU D 2 16  ? 11.126  81.068  95.208  1.00 51.73  ? 190 GLU D OE2 1 
ATOM   7003 N N   . VAL D 2 17  ? 6.036   79.347  94.531  1.00 46.95  ? 191 VAL D N   1 
ATOM   7004 C CA  . VAL D 2 17  ? 5.172   80.054  93.592  1.00 46.74  ? 191 VAL D CA  1 
ATOM   7005 C C   . VAL D 2 17  ? 3.712   79.648  93.861  1.00 46.89  ? 191 VAL D C   1 
ATOM   7006 O O   . VAL D 2 17  ? 2.807   80.481  93.885  1.00 46.84  ? 191 VAL D O   1 
ATOM   7007 C CB  . VAL D 2 17  ? 5.615   79.744  92.125  1.00 46.74  ? 191 VAL D CB  1 
ATOM   7008 C CG1 . VAL D 2 17  ? 4.477   79.891  91.123  1.00 46.63  ? 191 VAL D CG1 1 
ATOM   7009 C CG2 . VAL D 2 17  ? 6.802   80.614  91.732  1.00 46.51  ? 191 VAL D CG2 1 
ATOM   7010 N N   . LYS D 2 18  ? 3.503   78.360  94.091  1.00 47.18  ? 192 LYS D N   1 
ATOM   7011 C CA  . LYS D 2 18  ? 2.170   77.803  94.283  1.00 47.77  ? 192 LYS D CA  1 
ATOM   7012 C C   . LYS D 2 18  ? 1.563   78.147  95.652  1.00 47.79  ? 192 LYS D C   1 
ATOM   7013 O O   . LYS D 2 18  ? 0.345   78.154  95.798  1.00 47.63  ? 192 LYS D O   1 
ATOM   7014 C CB  . LYS D 2 18  ? 2.199   76.287  94.049  1.00 47.83  ? 192 LYS D CB  1 
ATOM   7015 C CG  . LYS D 2 18  ? 2.953   75.880  92.765  1.00 49.03  ? 192 LYS D CG  1 
ATOM   7016 C CD  . LYS D 2 18  ? 2.284   74.730  92.020  1.00 51.23  ? 192 LYS D CD  1 
ATOM   7017 C CE  . LYS D 2 18  ? 3.313   73.731  91.474  1.00 51.68  ? 192 LYS D CE  1 
ATOM   7018 N NZ  . LYS D 2 18  ? 3.004   72.330  91.898  1.00 51.63  ? 192 LYS D NZ  1 
ATOM   7019 N N   . CYS D 2 19  ? 2.413   78.450  96.633  1.00 48.11  ? 193 CYS D N   1 
ATOM   7020 C CA  . CYS D 2 19  ? 1.963   78.782  97.993  1.00 48.86  ? 193 CYS D CA  1 
ATOM   7021 C C   . CYS D 2 19  ? 1.950   80.283  98.271  1.00 48.43  ? 193 CYS D C   1 
ATOM   7022 O O   . CYS D 2 19  ? 1.911   80.693  99.431  1.00 48.70  ? 193 CYS D O   1 
ATOM   7023 C CB  . CYS D 2 19  ? 2.848   78.100  99.046  1.00 48.56  ? 193 CYS D CB  1 
ATOM   7024 S SG  . CYS D 2 19  ? 2.553   76.332  99.270  1.00 51.81  ? 193 CYS D SG  1 
ATOM   7025 N N   . LYS D 2 20  ? 1.995   81.092  97.216  1.00 48.27  ? 194 LYS D N   1 
ATOM   7026 C CA  . LYS D 2 20  ? 2.127   82.544  97.358  1.00 48.15  ? 194 LYS D CA  1 
ATOM   7027 C C   . LYS D 2 20  ? 0.766   83.233  97.491  1.00 47.43  ? 194 LYS D C   1 
ATOM   7028 O O   . LYS D 2 20  ? -0.118  82.999  96.679  1.00 46.97  ? 194 LYS D O   1 
ATOM   7029 C CB  . LYS D 2 20  ? 2.914   83.130  96.175  1.00 48.45  ? 194 LYS D CB  1 
ATOM   7030 C CG  . LYS D 2 20  ? 3.016   84.655  96.199  1.00 50.56  ? 194 LYS D CG  1 
ATOM   7031 C CD  . LYS D 2 20  ? 3.705   85.225  94.960  1.00 53.45  ? 194 LYS D CD  1 
ATOM   7032 C CE  . LYS D 2 20  ? 3.832   86.747  95.082  1.00 54.91  ? 194 LYS D CE  1 
ATOM   7033 N NZ  . LYS D 2 20  ? 4.874   87.320  94.174  1.00 56.44  ? 194 LYS D NZ  1 
ATOM   7034 N N   . PRO D 2 21  ? 0.591   84.070  98.517  1.00 47.34  ? 195 PRO D N   1 
ATOM   7035 C CA  . PRO D 2 21  ? -0.634  84.871  98.653  1.00 47.13  ? 195 PRO D CA  1 
ATOM   7036 C C   . PRO D 2 21  ? -0.718  85.893  97.540  1.00 47.39  ? 195 PRO D C   1 
ATOM   7037 O O   . PRO D 2 21  ? 0.313   86.194  96.934  1.00 47.52  ? 195 PRO D O   1 
ATOM   7038 C CB  . PRO D 2 21  ? -0.452  85.580  99.994  1.00 46.73  ? 195 PRO D CB  1 
ATOM   7039 C CG  . PRO D 2 21  ? 0.992   85.558  100.246 1.00 46.96  ? 195 PRO D CG  1 
ATOM   7040 C CD  . PRO D 2 21  ? 1.522   84.299  99.639  1.00 47.32  ? 195 PRO D CD  1 
ATOM   7041 N N   . LYS D 2 22  ? -1.914  86.405  97.262  1.00 47.47  ? 196 LYS D N   1 
ATOM   7042 C CA  . LYS D 2 22  ? -2.037  87.486  96.291  1.00 47.87  ? 196 LYS D CA  1 
ATOM   7043 C C   . LYS D 2 22  ? -1.465  88.792  96.843  1.00 47.74  ? 196 LYS D C   1 
ATOM   7044 O O   . LYS D 2 22  ? -1.647  89.118  98.016  1.00 47.91  ? 196 LYS D O   1 
ATOM   7045 C CB  . LYS D 2 22  ? -3.477  87.646  95.790  1.00 48.17  ? 196 LYS D CB  1 
ATOM   7046 C CG  . LYS D 2 22  ? -4.502  88.067  96.822  1.00 49.24  ? 196 LYS D CG  1 
ATOM   7047 C CD  . LYS D 2 22  ? -5.720  88.680  96.139  1.00 51.64  ? 196 LYS D CD  1 
ATOM   7048 C CE  . LYS D 2 22  ? -6.851  87.669  95.940  1.00 52.58  ? 196 LYS D CE  1 
ATOM   7049 N NZ  . LYS D 2 22  ? -6.456  86.506  95.090  1.00 53.19  ? 196 LYS D NZ  1 
ATOM   7050 N N   . VAL D 2 23  ? -0.755  89.521  95.988  1.00 47.74  ? 197 VAL D N   1 
ATOM   7051 C CA  . VAL D 2 23  ? -0.069  90.749  96.382  1.00 47.58  ? 197 VAL D CA  1 
ATOM   7052 C C   . VAL D 2 23  ? -1.069  91.846  96.729  1.00 47.41  ? 197 VAL D C   1 
ATOM   7053 O O   . VAL D 2 23  ? -0.834  92.657  97.635  1.00 47.82  ? 197 VAL D O   1 
ATOM   7054 C CB  . VAL D 2 23  ? 0.901   91.235  95.275  1.00 47.66  ? 197 VAL D CB  1 
ATOM   7055 C CG1 . VAL D 2 23  ? 1.527   92.581  95.636  1.00 48.00  ? 197 VAL D CG1 1 
ATOM   7056 C CG2 . VAL D 2 23  ? 1.987   90.206  95.034  1.00 48.03  ? 197 VAL D CG2 1 
ATOM   7057 N N   . GLY D 2 24  ? -2.196  91.860  96.028  1.00 46.81  ? 198 GLY D N   1 
ATOM   7058 C CA  . GLY D 2 24  ? -3.172  92.911  96.229  1.00 46.39  ? 198 GLY D CA  1 
ATOM   7059 C C   . GLY D 2 24  ? -4.132  92.749  97.396  1.00 46.16  ? 198 GLY D C   1 
ATOM   7060 O O   . GLY D 2 24  ? -4.896  93.675  97.674  1.00 46.46  ? 198 GLY D O   1 
ATOM   7061 N N   . TYR D 2 25  ? -4.086  91.610  98.093  1.00 45.41  ? 199 TYR D N   1 
ATOM   7062 C CA  . TYR D 2 25  ? -5.181  91.208  98.996  1.00 44.59  ? 199 TYR D CA  1 
ATOM   7063 C C   . TYR D 2 25  ? -5.777  92.243  99.946  1.00 44.82  ? 199 TYR D C   1 
ATOM   7064 O O   . TYR D 2 25  ? -7.001  92.304  100.075 1.00 44.34  ? 199 TYR D O   1 
ATOM   7065 C CB  . TYR D 2 25  ? -4.907  89.853  99.696  1.00 44.15  ? 199 TYR D CB  1 
ATOM   7066 C CG  . TYR D 2 25  ? -4.201  89.841  101.044 1.00 41.57  ? 199 TYR D CG  1 
ATOM   7067 C CD1 . TYR D 2 25  ? -4.824  90.308  102.196 1.00 39.89  ? 199 TYR D CD1 1 
ATOM   7068 C CD2 . TYR D 2 25  ? -2.936  89.272  101.173 1.00 40.19  ? 199 TYR D CD2 1 
ATOM   7069 C CE1 . TYR D 2 25  ? -4.175  90.269  103.438 1.00 39.40  ? 199 TYR D CE1 1 
ATOM   7070 C CE2 . TYR D 2 25  ? -2.283  89.213  102.411 1.00 38.95  ? 199 TYR D CE2 1 
ATOM   7071 C CZ  . TYR D 2 25  ? -2.907  89.713  103.534 1.00 38.62  ? 199 TYR D CZ  1 
ATOM   7072 O OH  . TYR D 2 25  ? -2.265  89.653  104.748 1.00 37.67  ? 199 TYR D OH  1 
ATOM   7073 N N   . MET D 2 26  ? -4.933  93.067  100.573 1.00 45.23  ? 200 MET D N   1 
ATOM   7074 C CA  . MET D 2 26  ? -5.403  94.057  101.555 1.00 45.99  ? 200 MET D CA  1 
ATOM   7075 C C   . MET D 2 26  ? -6.373  95.070  100.939 1.00 46.69  ? 200 MET D C   1 
ATOM   7076 O O   . MET D 2 26  ? -7.305  95.535  101.606 1.00 46.64  ? 200 MET D O   1 
ATOM   7077 C CB  . MET D 2 26  ? -4.227  94.781  102.222 1.00 46.18  ? 200 MET D CB  1 
ATOM   7078 C CG  . MET D 2 26  ? -4.042  94.512  103.742 1.00 46.38  ? 200 MET D CG  1 
ATOM   7079 S SD  . MET D 2 26  ? -5.460  93.834  104.626 1.00 48.12  ? 200 MET D SD  1 
ATOM   7080 C CE  . MET D 2 26  ? -4.686  92.821  105.886 1.00 48.09  ? 200 MET D CE  1 
ATOM   7081 N N   . LYS D 2 27  ? -6.137  95.394  99.665  1.00 47.29  ? 201 LYS D N   1 
ATOM   7082 C CA  . LYS D 2 27  ? -7.009  96.246  98.864  1.00 48.04  ? 201 LYS D CA  1 
ATOM   7083 C C   . LYS D 2 27  ? -8.445  95.702  98.822  1.00 48.09  ? 201 LYS D C   1 
ATOM   7084 O O   . LYS D 2 27  ? -9.409  96.474  98.816  1.00 48.08  ? 201 LYS D O   1 
ATOM   7085 C CB  . LYS D 2 27  ? -6.457  96.347  97.431  1.00 48.52  ? 201 LYS D CB  1 
ATOM   7086 C CG  . LYS D 2 27  ? -5.879  97.702  97.023  1.00 50.08  ? 201 LYS D CG  1 
ATOM   7087 C CD  . LYS D 2 27  ? -5.950  97.877  95.497  1.00 53.29  ? 201 LYS D CD  1 
ATOM   7088 C CE  . LYS D 2 27  ? -6.374  99.292  95.088  1.00 55.53  ? 201 LYS D CE  1 
ATOM   7089 N NZ  . LYS D 2 27  ? -7.783  99.645  95.481  1.00 57.06  ? 201 LYS D NZ  1 
ATOM   7090 N N   . LYS D 2 28  ? -8.576  94.375  98.799  1.00 48.03  ? 202 LYS D N   1 
ATOM   7091 C CA  . LYS D 2 28  ? -9.883  93.717  98.728  1.00 48.21  ? 202 LYS D CA  1 
ATOM   7092 C C   . LYS D 2 28  ? -10.517 93.402  100.094 1.00 47.53  ? 202 LYS D C   1 
ATOM   7093 O O   . LYS D 2 28  ? -11.644 92.899  100.152 1.00 47.43  ? 202 LYS D O   1 
ATOM   7094 C CB  . LYS D 2 28  ? -9.807  92.438  97.870  1.00 48.80  ? 202 LYS D CB  1 
ATOM   7095 C CG  . LYS D 2 28  ? -9.301  92.621  96.418  1.00 51.30  ? 202 LYS D CG  1 
ATOM   7096 C CD  . LYS D 2 28  ? -9.785  93.935  95.760  1.00 55.45  ? 202 LYS D CD  1 
ATOM   7097 C CE  . LYS D 2 28  ? -11.186 93.813  95.156  1.00 57.46  ? 202 LYS D CE  1 
ATOM   7098 N NZ  . LYS D 2 28  ? -11.456 94.919  94.181  1.00 59.19  ? 202 LYS D NZ  1 
ATOM   7099 N N   . GLN D 2 29  ? -9.800  93.685  101.183 1.00 46.71  ? 203 GLN D N   1 
ATOM   7100 C CA  . GLN D 2 29  ? -10.352 93.521  102.531 1.00 46.04  ? 203 GLN D CA  1 
ATOM   7101 C C   . GLN D 2 29  ? -10.932 94.845  103.024 1.00 46.41  ? 203 GLN D C   1 
ATOM   7102 O O   . GLN D 2 29  ? -10.175 95.771  103.323 1.00 46.63  ? 203 GLN D O   1 
ATOM   7103 C CB  . GLN D 2 29  ? -9.284  93.027  103.511 1.00 45.53  ? 203 GLN D CB  1 
ATOM   7104 C CG  . GLN D 2 29  ? -8.821  91.594  103.295 1.00 43.28  ? 203 GLN D CG  1 
ATOM   7105 C CD  . GLN D 2 29  ? -9.757  90.549  103.891 1.00 39.52  ? 203 GLN D CD  1 
ATOM   7106 O OE1 . GLN D 2 29  ? -10.751 90.881  104.540 1.00 38.76  ? 203 GLN D OE1 1 
ATOM   7107 N NE2 . GLN D 2 29  ? -9.439  89.287  103.666 1.00 36.90  ? 203 GLN D NE2 1 
ATOM   7108 N N   . PRO D 2 30  ? -12.260 94.946  103.112 1.00 46.81  ? 204 PRO D N   1 
ATOM   7109 C CA  . PRO D 2 30  ? -12.900 96.207  103.516 1.00 47.29  ? 204 PRO D CA  1 
ATOM   7110 C C   . PRO D 2 30  ? -12.505 96.644  104.931 1.00 47.82  ? 204 PRO D C   1 
ATOM   7111 O O   . PRO D 2 30  ? -12.144 97.811  105.130 1.00 47.99  ? 204 PRO D O   1 
ATOM   7112 C CB  . PRO D 2 30  ? -14.406 95.902  103.442 1.00 47.19  ? 204 PRO D CB  1 
ATOM   7113 C CG  . PRO D 2 30  ? -14.530 94.638  102.642 1.00 47.22  ? 204 PRO D CG  1 
ATOM   7114 C CD  . PRO D 2 30  ? -13.248 93.885  102.836 1.00 46.82  ? 204 PRO D CD  1 
ATOM   7115 N N   . ASP D 2 31  ? -12.528 95.711  105.881 1.00 48.17  ? 205 ASP D N   1 
ATOM   7116 C CA  . ASP D 2 31  ? -12.398 96.055  107.297 1.00 48.56  ? 205 ASP D CA  1 
ATOM   7117 C C   . ASP D 2 31  ? -10.978 96.045  107.851 1.00 48.09  ? 205 ASP D C   1 
ATOM   7118 O O   . ASP D 2 31  ? -10.732 96.628  108.899 1.00 48.27  ? 205 ASP D O   1 
ATOM   7119 C CB  . ASP D 2 31  ? -13.314 95.169  108.156 1.00 49.12  ? 205 ASP D CB  1 
ATOM   7120 C CG  . ASP D 2 31  ? -13.645 95.798  109.510 1.00 51.04  ? 205 ASP D CG  1 
ATOM   7121 O OD1 . ASP D 2 31  ? -13.466 97.033  109.664 1.00 53.70  ? 205 ASP D OD1 1 
ATOM   7122 O OD2 . ASP D 2 31  ? -14.083 95.129  110.479 1.00 52.42  ? 205 ASP D OD2 1 
ATOM   7123 N N   . ILE D 2 32  ? -10.044 95.405  107.157 1.00 47.65  ? 206 ILE D N   1 
ATOM   7124 C CA  . ILE D 2 32  ? -8.684  95.300  107.672 1.00 47.36  ? 206 ILE D CA  1 
ATOM   7125 C C   . ILE D 2 32  ? -7.627  95.940  106.757 1.00 47.28  ? 206 ILE D C   1 
ATOM   7126 O O   . ILE D 2 32  ? -7.823  96.047  105.541 1.00 47.50  ? 206 ILE D O   1 
ATOM   7127 C CB  . ILE D 2 32  ? -8.334  93.825  108.067 1.00 47.44  ? 206 ILE D CB  1 
ATOM   7128 C CG1 . ILE D 2 32  ? -8.629  92.853  106.931 1.00 47.86  ? 206 ILE D CG1 1 
ATOM   7129 C CG2 . ILE D 2 32  ? -9.118  93.389  109.313 1.00 47.22  ? 206 ILE D CG2 1 
ATOM   7130 C CD1 . ILE D 2 32  ? -8.091  91.438  107.170 1.00 48.47  ? 206 ILE D CD1 1 
ATOM   7131 N N   . THR D 2 33  ? -6.518  96.378  107.359 1.00 46.72  ? 207 THR D N   1 
ATOM   7132 C CA  . THR D 2 33  ? -5.457  97.093  106.653 1.00 46.12  ? 207 THR D CA  1 
ATOM   7133 C C   . THR D 2 33  ? -4.099  96.436  106.854 1.00 46.11  ? 207 THR D C   1 
ATOM   7134 O O   . THR D 2 33  ? -3.953  95.510  107.660 1.00 46.16  ? 207 THR D O   1 
ATOM   7135 C CB  . THR D 2 33  ? -5.352  98.558  107.151 1.00 46.41  ? 207 THR D CB  1 
ATOM   7136 O OG1 . THR D 2 33  ? -4.898  98.564  108.514 1.00 46.01  ? 207 THR D OG1 1 
ATOM   7137 C CG2 . THR D 2 33  ? -6.725  99.249  107.201 1.00 45.98  ? 207 THR D CG2 1 
ATOM   7138 N N   . ASN D 2 34  ? -3.102  96.948  106.132 1.00 45.79  ? 208 ASN D N   1 
ATOM   7139 C CA  . ASN D 2 34  ? -1.711  96.521  106.275 1.00 45.60  ? 208 ASN D CA  1 
ATOM   7140 C C   . ASN D 2 34  ? -1.123  96.787  107.671 1.00 45.07  ? 208 ASN D C   1 
ATOM   7141 O O   . ASN D 2 34  ? -0.219  96.076  108.119 1.00 45.26  ? 208 ASN D O   1 
ATOM   7142 C CB  . ASN D 2 34  ? -0.838  97.190  105.204 1.00 45.54  ? 208 ASN D CB  1 
ATOM   7143 C CG  . ASN D 2 34  ? -0.807  96.413  103.888 1.00 46.75  ? 208 ASN D CG  1 
ATOM   7144 O OD1 . ASN D 2 34  ? -1.154  95.229  103.828 1.00 46.89  ? 208 ASN D OD1 1 
ATOM   7145 N ND2 . ASN D 2 34  ? -0.369  97.085  102.824 1.00 48.61  ? 208 ASN D ND2 1 
ATOM   7146 N N   . SER D 2 35  ? -1.642  97.813  108.340 1.00 44.40  ? 209 SER D N   1 
ATOM   7147 C CA  . SER D 2 35  ? -1.183  98.222  109.664 1.00 43.66  ? 209 SER D CA  1 
ATOM   7148 C C   . SER D 2 35  ? -1.686  97.236  110.716 1.00 43.12  ? 209 SER D C   1 
ATOM   7149 O O   . SER D 2 35  ? -0.954  96.858  111.643 1.00 42.64  ? 209 SER D O   1 
ATOM   7150 C CB  . SER D 2 35  ? -1.683  99.639  109.966 1.00 43.86  ? 209 SER D CB  1 
ATOM   7151 O OG  . SER D 2 35  ? -1.666  99.929  111.360 1.00 44.49  ? 209 SER D OG  1 
ATOM   7152 N N   . MET D 2 36  ? -2.948  96.829  110.552 1.00 42.60  ? 210 MET D N   1 
ATOM   7153 C CA  . MET D 2 36  ? -3.574  95.817  111.404 1.00 41.75  ? 210 MET D CA  1 
ATOM   7154 C C   . MET D 2 36  ? -2.802  94.510  111.288 1.00 41.14  ? 210 MET D C   1 
ATOM   7155 O O   . MET D 2 36  ? -2.522  93.849  112.290 1.00 41.12  ? 210 MET D O   1 
ATOM   7156 C CB  . MET D 2 36  ? -5.035  95.616  111.011 1.00 41.64  ? 210 MET D CB  1 
ATOM   7157 C CG  . MET D 2 36  ? -5.941  96.750  111.433 1.00 41.50  ? 210 MET D CG  1 
ATOM   7158 S SD  . MET D 2 36  ? -7.617  96.535  110.869 1.00 42.91  ? 210 MET D SD  1 
ATOM   7159 C CE  . MET D 2 36  ? -8.150  98.279  110.775 1.00 42.50  ? 210 MET D CE  1 
ATOM   7160 N N   . ARG D 2 37  ? -2.445  94.169  110.057 1.00 40.26  ? 211 ARG D N   1 
ATOM   7161 C CA  . ARG D 2 37  ? -1.642  92.996  109.765 1.00 40.01  ? 211 ARG D CA  1 
ATOM   7162 C C   . ARG D 2 37  ? -0.281  93.067  110.460 1.00 39.85  ? 211 ARG D C   1 
ATOM   7163 O O   . ARG D 2 37  ? 0.207   92.056  110.980 1.00 40.01  ? 211 ARG D O   1 
ATOM   7164 C CB  . ARG D 2 37  ? -1.470  92.840  108.246 1.00 39.71  ? 211 ARG D CB  1 
ATOM   7165 C CG  . ARG D 2 37  ? -0.692  91.601  107.826 1.00 39.15  ? 211 ARG D CG  1 
ATOM   7166 C CD  . ARG D 2 37  ? -0.178  91.635  106.401 1.00 37.91  ? 211 ARG D CD  1 
ATOM   7167 N NE  . ARG D 2 37  ? 0.753   90.543  106.107 1.00 38.22  ? 211 ARG D NE  1 
ATOM   7168 C CZ  . ARG D 2 37  ? 2.029   90.498  106.503 1.00 37.93  ? 211 ARG D CZ  1 
ATOM   7169 N NH1 . ARG D 2 37  ? 2.540   91.484  107.231 1.00 38.16  ? 211 ARG D NH1 1 
ATOM   7170 N NH2 . ARG D 2 37  ? 2.800   89.464  106.176 1.00 36.52  ? 211 ARG D NH2 1 
ATOM   7171 N N   . ALA D 2 38  ? 0.317   94.259  110.468 1.00 39.58  ? 212 ALA D N   1 
ATOM   7172 C CA  . ALA D 2 38  ? 1.632   94.483  111.068 1.00 39.22  ? 212 ALA D CA  1 
ATOM   7173 C C   . ALA D 2 38  ? 1.592   94.293  112.580 1.00 38.97  ? 212 ALA D C   1 
ATOM   7174 O O   . ALA D 2 38  ? 2.508   93.711  113.162 1.00 38.80  ? 212 ALA D O   1 
ATOM   7175 C CB  . ALA D 2 38  ? 2.157   95.868  110.713 1.00 39.44  ? 212 ALA D CB  1 
ATOM   7176 N N   . ILE D 2 39  ? 0.522   94.775  113.205 1.00 38.78  ? 213 ILE D N   1 
ATOM   7177 C CA  . ILE D 2 39  ? 0.278   94.529  114.628 1.00 38.72  ? 213 ILE D CA  1 
ATOM   7178 C C   . ILE D 2 39  ? 0.219   93.016  114.909 1.00 38.69  ? 213 ILE D C   1 
ATOM   7179 O O   . ILE D 2 39  ? 0.920   92.505  115.799 1.00 38.65  ? 213 ILE D O   1 
ATOM   7180 C CB  . ILE D 2 39  ? -1.022  95.244  115.075 1.00 38.65  ? 213 ILE D CB  1 
ATOM   7181 C CG1 . ILE D 2 39  ? -0.820  96.764  115.031 1.00 39.44  ? 213 ILE D CG1 1 
ATOM   7182 C CG2 . ILE D 2 39  ? -1.438  94.799  116.471 1.00 39.06  ? 213 ILE D CG2 1 
ATOM   7183 C CD1 . ILE D 2 39  ? -2.102  97.580  114.876 1.00 39.06  ? 213 ILE D CD1 1 
ATOM   7184 N N   . LEU D 2 40  ? -0.591  92.308  114.120 1.00 38.29  ? 214 LEU D N   1 
ATOM   7185 C CA  . LEU D 2 40  ? -0.814  90.882  114.308 1.00 37.87  ? 214 LEU D CA  1 
ATOM   7186 C C   . LEU D 2 40  ? 0.498   90.110  114.249 1.00 38.29  ? 214 LEU D C   1 
ATOM   7187 O O   . LEU D 2 40  ? 0.813   89.324  115.169 1.00 38.84  ? 214 LEU D O   1 
ATOM   7188 C CB  . LEU D 2 40  ? -1.798  90.355  113.261 1.00 37.59  ? 214 LEU D CB  1 
ATOM   7189 C CG  . LEU D 2 40  ? -2.151  88.868  113.276 1.00 36.68  ? 214 LEU D CG  1 
ATOM   7190 C CD1 . LEU D 2 40  ? -2.993  88.529  114.504 1.00 35.85  ? 214 LEU D CD1 1 
ATOM   7191 C CD2 . LEU D 2 40  ? -2.878  88.487  111.977 1.00 35.26  ? 214 LEU D CD2 1 
ATOM   7192 N N   . VAL D 2 41  ? 1.269   90.352  113.188 1.00 37.90  ? 215 VAL D N   1 
ATOM   7193 C CA  . VAL D 2 41  ? 2.564   89.696  113.012 1.00 37.90  ? 215 VAL D CA  1 
ATOM   7194 C C   . VAL D 2 41  ? 3.515   90.000  114.177 1.00 38.27  ? 215 VAL D C   1 
ATOM   7195 O O   . VAL D 2 41  ? 4.195   89.095  114.668 1.00 38.53  ? 215 VAL D O   1 
ATOM   7196 C CB  . VAL D 2 41  ? 3.207   90.026  111.652 1.00 37.27  ? 215 VAL D CB  1 
ATOM   7197 C CG1 . VAL D 2 41  ? 4.578   89.407  111.536 1.00 37.05  ? 215 VAL D CG1 1 
ATOM   7198 C CG2 . VAL D 2 41  ? 2.340   89.514  110.536 1.00 37.13  ? 215 VAL D CG2 1 
ATOM   7199 N N   . ASP D 2 42  ? 3.541   91.251  114.627 1.00 38.72  ? 216 ASP D N   1 
ATOM   7200 C CA  . ASP D 2 42  ? 4.368   91.634  115.773 1.00 39.57  ? 216 ASP D CA  1 
ATOM   7201 C C   . ASP D 2 42  ? 3.956   90.890  117.041 1.00 39.62  ? 216 ASP D C   1 
ATOM   7202 O O   . ASP D 2 42  ? 4.807   90.399  117.777 1.00 39.58  ? 216 ASP D O   1 
ATOM   7203 C CB  . ASP D 2 42  ? 4.310   93.146  116.004 1.00 39.89  ? 216 ASP D CB  1 
ATOM   7204 C CG  . ASP D 2 42  ? 5.478   93.656  116.844 1.00 41.49  ? 216 ASP D CG  1 
ATOM   7205 O OD1 . ASP D 2 42  ? 5.244   94.038  118.015 1.00 42.70  ? 216 ASP D OD1 1 
ATOM   7206 O OD2 . ASP D 2 42  ? 6.661   93.702  116.425 1.00 43.09  ? 216 ASP D OD2 1 
ATOM   7207 N N   . TRP D 2 43  ? 2.647   90.800  117.277 1.00 40.09  ? 217 TRP D N   1 
ATOM   7208 C CA  . TRP D 2 43  ? 2.101   90.046  118.407 1.00 40.13  ? 217 TRP D CA  1 
ATOM   7209 C C   . TRP D 2 43  ? 2.487   88.555  118.354 1.00 40.22  ? 217 TRP D C   1 
ATOM   7210 O O   . TRP D 2 43  ? 2.749   87.934  119.385 1.00 40.38  ? 217 TRP D O   1 
ATOM   7211 C CB  . TRP D 2 43  ? 0.581   90.229  118.500 1.00 39.89  ? 217 TRP D CB  1 
ATOM   7212 C CG  . TRP D 2 43  ? -0.056  89.327  119.516 1.00 40.24  ? 217 TRP D CG  1 
ATOM   7213 C CD1 . TRP D 2 43  ? 0.007   89.448  120.878 1.00 40.17  ? 217 TRP D CD1 1 
ATOM   7214 C CD2 . TRP D 2 43  ? -0.834  88.152  119.257 1.00 40.00  ? 217 TRP D CD2 1 
ATOM   7215 N NE1 . TRP D 2 43  ? -0.689  88.426  121.480 1.00 39.98  ? 217 TRP D NE1 1 
ATOM   7216 C CE2 . TRP D 2 43  ? -1.217  87.616  120.510 1.00 40.29  ? 217 TRP D CE2 1 
ATOM   7217 C CE3 . TRP D 2 43  ? -1.258  87.497  118.092 1.00 39.41  ? 217 TRP D CE3 1 
ATOM   7218 C CZ2 . TRP D 2 43  ? -1.996  86.462  120.626 1.00 40.59  ? 217 TRP D CZ2 1 
ATOM   7219 C CZ3 . TRP D 2 43  ? -2.027  86.347  118.210 1.00 39.66  ? 217 TRP D CZ3 1 
ATOM   7220 C CH2 . TRP D 2 43  ? -2.386  85.840  119.466 1.00 40.37  ? 217 TRP D CH2 1 
ATOM   7221 N N   . LEU D 2 44  ? 2.551   88.000  117.148 1.00 40.42  ? 218 LEU D N   1 
ATOM   7222 C CA  . LEU D 2 44  ? 2.979   86.616  116.954 1.00 40.47  ? 218 LEU D CA  1 
ATOM   7223 C C   . LEU D 2 44  ? 4.479   86.413  117.193 1.00 40.56  ? 218 LEU D C   1 
ATOM   7224 O O   . LEU D 2 44  ? 4.908   85.323  117.581 1.00 40.28  ? 218 LEU D O   1 
ATOM   7225 C CB  . LEU D 2 44  ? 2.593   86.128  115.555 1.00 40.56  ? 218 LEU D CB  1 
ATOM   7226 C CG  . LEU D 2 44  ? 1.094   85.914  115.306 1.00 41.34  ? 218 LEU D CG  1 
ATOM   7227 C CD1 . LEU D 2 44  ? 0.831   85.697  113.823 1.00 40.68  ? 218 LEU D CD1 1 
ATOM   7228 C CD2 . LEU D 2 44  ? 0.558   84.743  116.116 1.00 41.31  ? 218 LEU D CD2 1 
ATOM   7229 N N   . VAL D 2 45  ? 5.276   87.449  116.942 1.00 40.87  ? 219 VAL D N   1 
ATOM   7230 C CA  . VAL D 2 45  ? 6.689   87.425  117.328 1.00 41.41  ? 219 VAL D CA  1 
ATOM   7231 C C   . VAL D 2 45  ? 6.773   87.357  118.861 1.00 41.92  ? 219 VAL D C   1 
ATOM   7232 O O   . VAL D 2 45  ? 7.519   86.538  119.411 1.00 42.10  ? 219 VAL D O   1 
ATOM   7233 C CB  . VAL D 2 45  ? 7.475   88.626  116.745 1.00 41.54  ? 219 VAL D CB  1 
ATOM   7234 C CG1 . VAL D 2 45  ? 8.896   88.673  117.295 1.00 41.14  ? 219 VAL D CG1 1 
ATOM   7235 C CG2 . VAL D 2 45  ? 7.499   88.562  115.206 1.00 41.04  ? 219 VAL D CG2 1 
ATOM   7236 N N   . GLU D 2 46  ? 5.968   88.174  119.546 1.00 42.36  ? 220 GLU D N   1 
ATOM   7237 C CA  . GLU D 2 46  ? 5.864   88.091  121.009 1.00 43.06  ? 220 GLU D CA  1 
ATOM   7238 C C   . GLU D 2 46  ? 5.514   86.669  121.459 1.00 42.77  ? 220 GLU D C   1 
ATOM   7239 O O   . GLU D 2 46  ? 6.179   86.116  122.338 1.00 42.48  ? 220 GLU D O   1 
ATOM   7240 C CB  . GLU D 2 46  ? 4.844   89.086  121.575 1.00 43.35  ? 220 GLU D CB  1 
ATOM   7241 C CG  . GLU D 2 46  ? 4.966   90.507  121.037 1.00 45.82  ? 220 GLU D CG  1 
ATOM   7242 C CD  . GLU D 2 46  ? 4.577   91.568  122.056 1.00 49.20  ? 220 GLU D CD  1 
ATOM   7243 O OE1 . GLU D 2 46  ? 5.406   92.479  122.312 1.00 50.35  ? 220 GLU D OE1 1 
ATOM   7244 O OE2 . GLU D 2 46  ? 3.447   91.501  122.598 1.00 50.40  ? 220 GLU D OE2 1 
ATOM   7245 N N   . VAL D 2 47  ? 4.486   86.082  120.837 1.00 42.36  ? 221 VAL D N   1 
ATOM   7246 C CA  . VAL D 2 47  ? 4.029   84.742  121.197 1.00 42.06  ? 221 VAL D CA  1 
ATOM   7247 C C   . VAL D 2 47  ? 5.146   83.728  120.966 1.00 42.66  ? 221 VAL D C   1 
ATOM   7248 O O   . VAL D 2 47  ? 5.473   82.945  121.862 1.00 42.41  ? 221 VAL D O   1 
ATOM   7249 C CB  . VAL D 2 47  ? 2.730   84.348  120.434 1.00 42.01  ? 221 VAL D CB  1 
ATOM   7250 C CG1 . VAL D 2 47  ? 2.417   82.864  120.609 1.00 41.02  ? 221 VAL D CG1 1 
ATOM   7251 C CG2 . VAL D 2 47  ? 1.548   85.206  120.900 1.00 40.83  ? 221 VAL D CG2 1 
ATOM   7252 N N   . GLY D 2 48  ? 5.747   83.771  119.777 1.00 43.25  ? 222 GLY D N   1 
ATOM   7253 C CA  . GLY D 2 48  ? 6.899   82.947  119.452 1.00 44.52  ? 222 GLY D CA  1 
ATOM   7254 C C   . GLY D 2 48  ? 8.008   82.988  120.495 1.00 45.56  ? 222 GLY D C   1 
ATOM   7255 O O   . GLY D 2 48  ? 8.588   81.954  120.838 1.00 45.28  ? 222 GLY D O   1 
ATOM   7256 N N   . GLU D 2 49  ? 8.288   84.186  121.006 1.00 46.94  ? 223 GLU D N   1 
ATOM   7257 C CA  . GLU D 2 49  ? 9.267   84.378  122.080 1.00 48.40  ? 223 GLU D CA  1 
ATOM   7258 C C   . GLU D 2 49  ? 8.807   83.806  123.409 1.00 48.61  ? 223 GLU D C   1 
ATOM   7259 O O   . GLU D 2 49  ? 9.487   82.954  123.977 1.00 49.07  ? 223 GLU D O   1 
ATOM   7260 C CB  . GLU D 2 49  ? 9.635   85.859  122.225 1.00 48.80  ? 223 GLU D CB  1 
ATOM   7261 C CG  . GLU D 2 49  ? 10.705  86.293  121.239 1.00 51.48  ? 223 GLU D CG  1 
ATOM   7262 C CD  . GLU D 2 49  ? 11.784  85.238  121.077 1.00 55.36  ? 223 GLU D CD  1 
ATOM   7263 O OE1 . GLU D 2 49  ? 12.806  85.335  121.789 1.00 56.39  ? 223 GLU D OE1 1 
ATOM   7264 O OE2 . GLU D 2 49  ? 11.601  84.303  120.252 1.00 57.57  ? 223 GLU D OE2 1 
ATOM   7265 N N   . GLU D 2 50  ? 7.649   84.256  123.884 1.00 48.99  ? 224 GLU D N   1 
ATOM   7266 C CA  . GLU D 2 50  ? 7.055   83.761  125.121 1.00 49.46  ? 224 GLU D CA  1 
ATOM   7267 C C   . GLU D 2 50  ? 6.991   82.224  125.218 1.00 49.57  ? 224 GLU D C   1 
ATOM   7268 O O   . GLU D 2 50  ? 7.201   81.657  126.297 1.00 49.90  ? 224 GLU D O   1 
ATOM   7269 C CB  . GLU D 2 50  ? 5.672   84.395  125.319 1.00 49.69  ? 224 GLU D CB  1 
ATOM   7270 C CG  . GLU D 2 50  ? 4.760   83.720  126.341 1.00 51.79  ? 224 GLU D CG  1 
ATOM   7271 C CD  . GLU D 2 50  ? 5.180   83.927  127.791 1.00 54.64  ? 224 GLU D CD  1 
ATOM   7272 O OE1 . GLU D 2 50  ? 6.207   84.598  128.046 1.00 56.42  ? 224 GLU D OE1 1 
ATOM   7273 O OE2 . GLU D 2 50  ? 4.472   83.412  128.690 1.00 55.33  ? 224 GLU D OE2 1 
ATOM   7274 N N   . TYR D 2 51  ? 6.720   81.552  124.101 1.00 49.18  ? 225 TYR D N   1 
ATOM   7275 C CA  . TYR D 2 51  ? 6.628   80.095  124.106 1.00 48.89  ? 225 TYR D CA  1 
ATOM   7276 C C   . TYR D 2 51  ? 7.831   79.370  123.498 1.00 48.91  ? 225 TYR D C   1 
ATOM   7277 O O   . TYR D 2 51  ? 7.807   78.148  123.326 1.00 48.54  ? 225 TYR D O   1 
ATOM   7278 C CB  . TYR D 2 51  ? 5.310   79.646  123.474 1.00 48.85  ? 225 TYR D CB  1 
ATOM   7279 C CG  . TYR D 2 51  ? 4.130   80.010  124.338 1.00 48.57  ? 225 TYR D CG  1 
ATOM   7280 C CD1 . TYR D 2 51  ? 3.410   81.179  124.114 1.00 48.31  ? 225 TYR D CD1 1 
ATOM   7281 C CD2 . TYR D 2 51  ? 3.758   79.204  125.414 1.00 48.68  ? 225 TYR D CD2 1 
ATOM   7282 C CE1 . TYR D 2 51  ? 2.335   81.527  124.923 1.00 48.04  ? 225 TYR D CE1 1 
ATOM   7283 C CE2 . TYR D 2 51  ? 2.686   79.549  126.232 1.00 48.26  ? 225 TYR D CE2 1 
ATOM   7284 C CZ  . TYR D 2 51  ? 1.982   80.709  125.975 1.00 48.28  ? 225 TYR D CZ  1 
ATOM   7285 O OH  . TYR D 2 51  ? 0.921   81.047  126.775 1.00 48.96  ? 225 TYR D OH  1 
ATOM   7286 N N   . LYS D 2 52  ? 8.886   80.134  123.202 1.00 49.16  ? 226 LYS D N   1 
ATOM   7287 C CA  . LYS D 2 52  ? 10.153  79.597  122.684 1.00 49.31  ? 226 LYS D CA  1 
ATOM   7288 C C   . LYS D 2 52  ? 9.928   78.706  121.455 1.00 48.82  ? 226 LYS D C   1 
ATOM   7289 O O   . LYS D 2 52  ? 10.358  77.545  121.399 1.00 48.87  ? 226 LYS D O   1 
ATOM   7290 C CB  . LYS D 2 52  ? 10.941  78.871  123.786 1.00 49.63  ? 226 LYS D CB  1 
ATOM   7291 C CG  . LYS D 2 52  ? 11.223  79.733  125.023 1.00 51.54  ? 226 LYS D CG  1 
ATOM   7292 C CD  . LYS D 2 52  ? 12.629  79.482  125.560 1.00 54.76  ? 226 LYS D CD  1 
ATOM   7293 C CE  . LYS D 2 52  ? 12.846  80.188  126.894 1.00 56.49  ? 226 LYS D CE  1 
ATOM   7294 N NZ  . LYS D 2 52  ? 12.411  79.353  128.050 1.00 56.74  ? 226 LYS D NZ  1 
ATOM   7295 N N   . LEU D 2 53  ? 9.237   79.276  120.478 1.00 47.98  ? 227 LEU D N   1 
ATOM   7296 C CA  . LEU D 2 53  ? 8.875   78.564  119.272 1.00 47.21  ? 227 LEU D CA  1 
ATOM   7297 C C   . LEU D 2 53  ? 9.938   78.791  118.213 1.00 47.07  ? 227 LEU D C   1 
ATOM   7298 O O   . LEU D 2 53  ? 10.529  79.872  118.147 1.00 46.80  ? 227 LEU D O   1 
ATOM   7299 C CB  . LEU D 2 53  ? 7.518   79.053  118.762 1.00 47.17  ? 227 LEU D CB  1 
ATOM   7300 C CG  . LEU D 2 53  ? 6.287   78.952  119.673 1.00 46.13  ? 227 LEU D CG  1 
ATOM   7301 C CD1 . LEU D 2 53  ? 5.129   79.695  119.051 1.00 44.63  ? 227 LEU D CD1 1 
ATOM   7302 C CD2 . LEU D 2 53  ? 5.900   77.509  119.950 1.00 45.33  ? 227 LEU D CD2 1 
ATOM   7303 N N   . GLN D 2 54  ? 10.181  77.764  117.397 1.00 46.53  ? 228 GLN D N   1 
ATOM   7304 C CA  . GLN D 2 54  ? 11.092  77.867  116.261 1.00 46.42  ? 228 GLN D CA  1 
ATOM   7305 C C   . GLN D 2 54  ? 10.732  79.062  115.395 1.00 46.03  ? 228 GLN D C   1 
ATOM   7306 O O   . GLN D 2 54  ? 9.556   79.423  115.276 1.00 46.23  ? 228 GLN D O   1 
ATOM   7307 C CB  . GLN D 2 54  ? 11.059  76.590  115.415 1.00 46.77  ? 228 GLN D CB  1 
ATOM   7308 C CG  . GLN D 2 54  ? 11.583  75.351  116.130 1.00 47.68  ? 228 GLN D CG  1 
ATOM   7309 C CD  . GLN D 2 54  ? 13.006  75.525  116.632 1.00 49.59  ? 228 GLN D CD  1 
ATOM   7310 O OE1 . GLN D 2 54  ? 13.898  75.897  115.862 1.00 52.58  ? 228 GLN D OE1 1 
ATOM   7311 N NE2 . GLN D 2 54  ? 13.222  75.269  117.916 1.00 47.80  ? 228 GLN D NE2 1 
ATOM   7312 N N   . ASN D 2 55  ? 11.752  79.684  114.811 1.00 45.47  ? 229 ASN D N   1 
ATOM   7313 C CA  . ASN D 2 55  ? 11.560  80.829  113.935 1.00 44.97  ? 229 ASN D CA  1 
ATOM   7314 C C   . ASN D 2 55  ? 10.738  80.423  112.722 1.00 43.88  ? 229 ASN D C   1 
ATOM   7315 O O   . ASN D 2 55  ? 9.892   81.177  112.245 1.00 43.62  ? 229 ASN D O   1 
ATOM   7316 C CB  . ASN D 2 55  ? 12.912  81.403  113.500 1.00 45.42  ? 229 ASN D CB  1 
ATOM   7317 C CG  . ASN D 2 55  ? 13.587  82.228  114.598 1.00 47.29  ? 229 ASN D CG  1 
ATOM   7318 O OD1 . ASN D 2 55  ? 12.930  82.784  115.486 1.00 47.94  ? 229 ASN D OD1 1 
ATOM   7319 N ND2 . ASN D 2 55  ? 14.914  82.308  114.533 1.00 49.26  ? 229 ASN D ND2 1 
ATOM   7320 N N   . GLU D 2 56  ? 10.997  79.213  112.248 1.00 42.65  ? 230 GLU D N   1 
ATOM   7321 C CA  . GLU D 2 56  ? 10.289  78.642  111.118 1.00 41.99  ? 230 GLU D CA  1 
ATOM   7322 C C   . GLU D 2 56  ? 8.771   78.553  111.362 1.00 40.95  ? 230 GLU D C   1 
ATOM   7323 O O   . GLU D 2 56  ? 7.980   78.741  110.437 1.00 40.91  ? 230 GLU D O   1 
ATOM   7324 C CB  . GLU D 2 56  ? 10.903  77.281  110.782 1.00 42.30  ? 230 GLU D CB  1 
ATOM   7325 C CG  . GLU D 2 56  ? 10.145  76.449  109.763 1.00 44.07  ? 230 GLU D CG  1 
ATOM   7326 C CD  . GLU D 2 56  ? 10.233  76.985  108.350 1.00 46.02  ? 230 GLU D CD  1 
ATOM   7327 O OE1 . GLU D 2 56  ? 10.609  78.166  108.153 1.00 46.93  ? 230 GLU D OE1 1 
ATOM   7328 O OE2 . GLU D 2 56  ? 9.909   76.206  107.432 1.00 46.91  ? 230 GLU D OE2 1 
ATOM   7329 N N   . THR D 2 57  ? 8.377   78.297  112.612 1.00 39.67  ? 231 THR D N   1 
ATOM   7330 C CA  . THR D 2 57  ? 6.963   78.267  113.015 1.00 38.12  ? 231 THR D CA  1 
ATOM   7331 C C   . THR D 2 57  ? 6.271   79.586  112.717 1.00 37.13  ? 231 THR D C   1 
ATOM   7332 O O   . THR D 2 57  ? 5.152   79.618  112.207 1.00 36.67  ? 231 THR D O   1 
ATOM   7333 C CB  . THR D 2 57  ? 6.837   77.932  114.518 1.00 37.99  ? 231 THR D CB  1 
ATOM   7334 O OG1 . THR D 2 57  ? 7.209   76.565  114.729 1.00 37.27  ? 231 THR D OG1 1 
ATOM   7335 C CG2 . THR D 2 57  ? 5.390   77.981  114.962 1.00 37.55  ? 231 THR D CG2 1 
ATOM   7336 N N   . LEU D 2 58  ? 6.963   80.663  113.046 1.00 36.22  ? 232 LEU D N   1 
ATOM   7337 C CA  . LEU D 2 58  ? 6.506   82.021  112.814 1.00 35.61  ? 232 LEU D CA  1 
ATOM   7338 C C   . LEU D 2 58  ? 6.312   82.303  111.331 1.00 34.79  ? 232 LEU D C   1 
ATOM   7339 O O   . LEU D 2 58  ? 5.335   82.939  110.938 1.00 34.33  ? 232 LEU D O   1 
ATOM   7340 C CB  . LEU D 2 58  ? 7.548   82.980  113.383 1.00 35.91  ? 232 LEU D CB  1 
ATOM   7341 C CG  . LEU D 2 58  ? 7.244   84.404  113.836 1.00 37.12  ? 232 LEU D CG  1 
ATOM   7342 C CD1 . LEU D 2 58  ? 8.139   85.323  113.026 1.00 38.14  ? 232 LEU D CD1 1 
ATOM   7343 C CD2 . LEU D 2 58  ? 5.774   84.813  113.738 1.00 36.46  ? 232 LEU D CD2 1 
ATOM   7344 N N   . HIS D 2 59  ? 7.254   81.838  110.514 1.00 33.97  ? 233 HIS D N   1 
ATOM   7345 C CA  . HIS D 2 59  ? 7.224   82.119  109.080 1.00 33.52  ? 233 HIS D CA  1 
ATOM   7346 C C   . HIS D 2 59  ? 6.027   81.400  108.462 1.00 32.47  ? 233 HIS D C   1 
ATOM   7347 O O   . HIS D 2 59  ? 5.246   81.998  107.709 1.00 32.24  ? 233 HIS D O   1 
ATOM   7348 C CB  . HIS D 2 59  ? 8.538   81.698  108.421 1.00 33.73  ? 233 HIS D CB  1 
ATOM   7349 C CG  . HIS D 2 59  ? 9.644   82.701  108.570 1.00 36.69  ? 233 HIS D CG  1 
ATOM   7350 N ND1 . HIS D 2 59  ? 10.262  82.962  109.779 1.00 38.80  ? 233 HIS D ND1 1 
ATOM   7351 C CD2 . HIS D 2 59  ? 10.247  83.504  107.659 1.00 38.15  ? 233 HIS D CD2 1 
ATOM   7352 C CE1 . HIS D 2 59  ? 11.200  83.877  109.603 1.00 39.27  ? 233 HIS D CE1 1 
ATOM   7353 N NE2 . HIS D 2 59  ? 11.212  84.221  108.325 1.00 40.14  ? 233 HIS D NE2 1 
ATOM   7354 N N   . LEU D 2 60  ? 5.849   80.136  108.842 1.00 30.94  ? 234 LEU D N   1 
ATOM   7355 C CA  . LEU D 2 60  ? 4.688   79.368  108.410 1.00 29.94  ? 234 LEU D CA  1 
ATOM   7356 C C   . LEU D 2 60  ? 3.391   80.077  108.776 1.00 29.11  ? 234 LEU D C   1 
ATOM   7357 O O   . LEU D 2 60  ? 2.494   80.227  107.937 1.00 29.32  ? 234 LEU D O   1 
ATOM   7358 C CB  . LEU D 2 60  ? 4.724   77.960  109.004 1.00 29.64  ? 234 LEU D CB  1 
ATOM   7359 C CG  . LEU D 2 60  ? 5.775   77.054  108.380 1.00 29.76  ? 234 LEU D CG  1 
ATOM   7360 C CD1 . LEU D 2 60  ? 5.904   75.786  109.191 1.00 29.99  ? 234 LEU D CD1 1 
ATOM   7361 C CD2 . LEU D 2 60  ? 5.444   76.755  106.912 1.00 29.07  ? 234 LEU D CD2 1 
ATOM   7362 N N   . ALA D 2 61  ? 3.305   80.526  110.024 1.00 28.53  ? 235 ALA D N   1 
ATOM   7363 C CA  . ALA D 2 61  ? 2.084   81.124  110.545 1.00 28.21  ? 235 ALA D CA  1 
ATOM   7364 C C   . ALA D 2 61  ? 1.706   82.354  109.727 1.00 28.21  ? 235 ALA D C   1 
ATOM   7365 O O   . ALA D 2 61  ? 0.557   82.513  109.334 1.00 27.95  ? 235 ALA D O   1 
ATOM   7366 C CB  . ALA D 2 61  ? 2.230   81.463  112.017 1.00 27.66  ? 235 ALA D CB  1 
ATOM   7367 N N   . VAL D 2 62  ? 2.690   83.197  109.439 1.00 28.50  ? 236 VAL D N   1 
ATOM   7368 C CA  . VAL D 2 62  ? 2.475   84.359  108.579 1.00 29.00  ? 236 VAL D CA  1 
ATOM   7369 C C   . VAL D 2 62  ? 2.043   83.960  107.148 1.00 29.18  ? 236 VAL D C   1 
ATOM   7370 O O   . VAL D 2 62  ? 1.114   84.557  106.587 1.00 28.98  ? 236 VAL D O   1 
ATOM   7371 C CB  . VAL D 2 62  ? 3.710   85.261  108.582 1.00 29.18  ? 236 VAL D CB  1 
ATOM   7372 C CG1 . VAL D 2 62  ? 3.527   86.433  107.630 1.00 29.52  ? 236 VAL D CG1 1 
ATOM   7373 C CG2 . VAL D 2 62  ? 3.999   85.730  110.025 1.00 28.66  ? 236 VAL D CG2 1 
ATOM   7374 N N   . ASN D 2 63  ? 2.696   82.941  106.580 1.00 29.31  ? 237 ASN D N   1 
ATOM   7375 C CA  . ASN D 2 63  ? 2.267   82.371  105.301 1.00 29.83  ? 237 ASN D CA  1 
ATOM   7376 C C   . ASN D 2 63  ? 0.774   81.960  105.286 1.00 29.44  ? 237 ASN D C   1 
ATOM   7377 O O   . ASN D 2 63  ? 0.055   82.274  104.343 1.00 29.11  ? 237 ASN D O   1 
ATOM   7378 C CB  . ASN D 2 63  ? 3.162   81.187  104.901 1.00 30.02  ? 237 ASN D CB  1 
ATOM   7379 C CG  . ASN D 2 63  ? 2.770   80.577  103.547 1.00 32.48  ? 237 ASN D CG  1 
ATOM   7380 O OD1 . ASN D 2 63  ? 2.038   79.573  103.482 1.00 34.79  ? 237 ASN D OD1 1 
ATOM   7381 N ND2 . ASN D 2 63  ? 3.254   81.179  102.464 1.00 34.63  ? 237 ASN D ND2 1 
ATOM   7382 N N   . TYR D 2 64  ? 0.319   81.269  106.334 1.00 29.18  ? 238 TYR D N   1 
ATOM   7383 C CA  . TYR D 2 64  ? -1.078  80.811  106.409 1.00 28.58  ? 238 TYR D CA  1 
ATOM   7384 C C   . TYR D 2 64  ? -2.041  81.982  106.499 1.00 28.90  ? 238 TYR D C   1 
ATOM   7385 O O   . TYR D 2 64  ? -3.080  81.990  105.840 1.00 29.28  ? 238 TYR D O   1 
ATOM   7386 C CB  . TYR D 2 64  ? -1.314  79.872  107.598 1.00 27.82  ? 238 TYR D CB  1 
ATOM   7387 C CG  . TYR D 2 64  ? -0.413  78.664  107.650 1.00 26.16  ? 238 TYR D CG  1 
ATOM   7388 C CD1 . TYR D 2 64  ? 0.185   78.146  106.496 1.00 24.96  ? 238 TYR D CD1 1 
ATOM   7389 C CD2 . TYR D 2 64  ? -0.161  78.027  108.863 1.00 25.47  ? 238 TYR D CD2 1 
ATOM   7390 C CE1 . TYR D 2 64  ? 1.026   77.026  106.553 1.00 24.20  ? 238 TYR D CE1 1 
ATOM   7391 C CE2 . TYR D 2 64  ? 0.669   76.911  108.936 1.00 25.32  ? 238 TYR D CE2 1 
ATOM   7392 C CZ  . TYR D 2 64  ? 1.260   76.419  107.786 1.00 25.24  ? 238 TYR D CZ  1 
ATOM   7393 O OH  . TYR D 2 64  ? 2.079   75.315  107.879 1.00 26.05  ? 238 TYR D OH  1 
ATOM   7394 N N   . ILE D 2 65  ? -1.702  82.970  107.318 1.00 29.14  ? 239 ILE D N   1 
ATOM   7395 C CA  . ILE D 2 65  ? -2.553  84.148  107.466 1.00 29.47  ? 239 ILE D CA  1 
ATOM   7396 C C   . ILE D 2 65  ? -2.753  84.842  106.122 1.00 29.77  ? 239 ILE D C   1 
ATOM   7397 O O   . ILE D 2 65  ? -3.884  85.090  105.704 1.00 30.27  ? 239 ILE D O   1 
ATOM   7398 C CB  . ILE D 2 65  ? -1.968  85.116  108.520 1.00 29.31  ? 239 ILE D CB  1 
ATOM   7399 C CG1 . ILE D 2 65  ? -1.829  84.378  109.855 1.00 29.67  ? 239 ILE D CG1 1 
ATOM   7400 C CG2 . ILE D 2 65  ? -2.858  86.362  108.654 1.00 27.93  ? 239 ILE D CG2 1 
ATOM   7401 C CD1 . ILE D 2 65  ? -0.944  85.053  110.885 1.00 30.25  ? 239 ILE D CD1 1 
ATOM   7402 N N   . ASP D 2 66  ? -1.648  85.136  105.445 1.00 30.18  ? 240 ASP D N   1 
ATOM   7403 C CA  . ASP D 2 66  ? -1.683  85.801  104.139 1.00 30.51  ? 240 ASP D CA  1 
ATOM   7404 C C   . ASP D 2 66  ? -2.482  85.030  103.098 1.00 29.96  ? 240 ASP D C   1 
ATOM   7405 O O   . ASP D 2 66  ? -3.215  85.616  102.328 1.00 30.06  ? 240 ASP D O   1 
ATOM   7406 C CB  . ASP D 2 66  ? -0.263  86.063  103.630 1.00 30.32  ? 240 ASP D CB  1 
ATOM   7407 C CG  . ASP D 2 66  ? 0.425   87.202  104.371 1.00 32.30  ? 240 ASP D CG  1 
ATOM   7408 O OD1 . ASP D 2 66  ? -0.285  88.026  105.003 1.00 32.40  ? 240 ASP D OD1 1 
ATOM   7409 O OD2 . ASP D 2 66  ? 1.675   87.351  104.367 1.00 33.62  ? 240 ASP D OD2 1 
ATOM   7410 N N   . ARG D 2 67  ? -2.339  83.714  103.069 1.00 30.03  ? 241 ARG D N   1 
ATOM   7411 C CA  . ARG D 2 67  ? -3.118  82.919  102.120 1.00 29.91  ? 241 ARG D CA  1 
ATOM   7412 C C   . ARG D 2 67  ? -4.592  82.894  102.521 1.00 29.65  ? 241 ARG D C   1 
ATOM   7413 O O   . ARG D 2 67  ? -5.466  82.984  101.668 1.00 29.69  ? 241 ARG D O   1 
ATOM   7414 C CB  . ARG D 2 67  ? -2.571  81.503  102.014 1.00 29.54  ? 241 ARG D CB  1 
ATOM   7415 C CG  . ARG D 2 67  ? -1.373  81.364  101.118 1.00 29.85  ? 241 ARG D CG  1 
ATOM   7416 C CD  . ARG D 2 67  ? -0.490  80.197  101.498 1.00 30.10  ? 241 ARG D CD  1 
ATOM   7417 N NE  . ARG D 2 67  ? -1.077  78.950  101.037 1.00 31.66  ? 241 ARG D NE  1 
ATOM   7418 C CZ  . ARG D 2 67  ? -0.881  77.754  101.597 1.00 31.51  ? 241 ARG D CZ  1 
ATOM   7419 N NH1 . ARG D 2 67  ? -0.091  77.610  102.654 1.00 31.57  ? 241 ARG D NH1 1 
ATOM   7420 N NH2 . ARG D 2 67  ? -1.474  76.688  101.079 1.00 31.88  ? 241 ARG D NH2 1 
ATOM   7421 N N   . PHE D 2 68  ? -4.863  82.803  103.821 1.00 29.45  ? 242 PHE D N   1 
ATOM   7422 C CA  . PHE D 2 68  ? -6.236  82.813  104.298 1.00 29.57  ? 242 PHE D CA  1 
ATOM   7423 C C   . PHE D 2 68  ? -6.953  84.116  103.951 1.00 30.26  ? 242 PHE D C   1 
ATOM   7424 O O   . PHE D 2 68  ? -8.101  84.106  103.477 1.00 30.16  ? 242 PHE D O   1 
ATOM   7425 C CB  . PHE D 2 68  ? -6.308  82.567  105.810 1.00 29.30  ? 242 PHE D CB  1 
ATOM   7426 C CG  . PHE D 2 68  ? -7.709  82.448  106.323 1.00 27.34  ? 242 PHE D CG  1 
ATOM   7427 C CD1 . PHE D 2 68  ? -8.338  81.209  106.393 1.00 27.24  ? 242 PHE D CD1 1 
ATOM   7428 C CD2 . PHE D 2 68  ? -8.414  83.568  106.703 1.00 25.36  ? 242 PHE D CD2 1 
ATOM   7429 C CE1 . PHE D 2 68  ? -9.649  81.097  106.853 1.00 24.81  ? 242 PHE D CE1 1 
ATOM   7430 C CE2 . PHE D 2 68  ? -9.723  83.463  107.167 1.00 25.05  ? 242 PHE D CE2 1 
ATOM   7431 C CZ  . PHE D 2 68  ? -10.336 82.229  107.242 1.00 25.12  ? 242 PHE D CZ  1 
ATOM   7432 N N   . LEU D 2 69  ? -6.281  85.234  104.208 1.00 30.80  ? 243 LEU D N   1 
ATOM   7433 C CA  . LEU D 2 69  ? -6.844  86.549  103.923 1.00 31.50  ? 243 LEU D CA  1 
ATOM   7434 C C   . LEU D 2 69  ? -6.881  86.865  102.409 1.00 31.76  ? 243 LEU D C   1 
ATOM   7435 O O   . LEU D 2 69  ? -7.548  87.811  101.989 1.00 31.37  ? 243 LEU D O   1 
ATOM   7436 C CB  . LEU D 2 69  ? -6.105  87.640  104.720 1.00 31.59  ? 243 LEU D CB  1 
ATOM   7437 C CG  . LEU D 2 69  ? -6.046  87.560  106.261 1.00 32.31  ? 243 LEU D CG  1 
ATOM   7438 C CD1 . LEU D 2 69  ? -5.162  88.662  106.801 1.00 32.43  ? 243 LEU D CD1 1 
ATOM   7439 C CD2 . LEU D 2 69  ? -7.424  87.636  106.924 1.00 30.77  ? 243 LEU D CD2 1 
ATOM   7440 N N   . SER D 2 70  ? -6.181  86.062  101.606 1.00 32.10  ? 244 SER D N   1 
ATOM   7441 C CA  . SER D 2 70  ? -6.288  86.116  100.141 1.00 33.00  ? 244 SER D CA  1 
ATOM   7442 C C   . SER D 2 70  ? -7.551  85.432  99.612  1.00 33.57  ? 244 SER D C   1 
ATOM   7443 O O   . SER D 2 70  ? -7.932  85.642  98.457  1.00 33.96  ? 244 SER D O   1 
ATOM   7444 C CB  . SER D 2 70  ? -5.081  85.443  99.466  1.00 32.87  ? 244 SER D CB  1 
ATOM   7445 O OG  . SER D 2 70  ? -3.864  86.099  99.761  1.00 33.46  ? 244 SER D OG  1 
ATOM   7446 N N   . SER D 2 71  ? -8.173  84.582  100.425 1.00 34.10  ? 245 SER D N   1 
ATOM   7447 C CA  . SER D 2 71  ? -9.394  83.896  100.001 1.00 34.82  ? 245 SER D CA  1 
ATOM   7448 C C   . SER D 2 71  ? -10.638 84.353  100.748 1.00 34.98  ? 245 SER D C   1 
ATOM   7449 O O   . SER D 2 71  ? -11.732 84.296  100.214 1.00 35.71  ? 245 SER D O   1 
ATOM   7450 C CB  . SER D 2 71  ? -9.270  82.377  100.128 1.00 34.84  ? 245 SER D CB  1 
ATOM   7451 O OG  . SER D 2 71  ? -7.924  81.946  100.220 1.00 36.20  ? 245 SER D OG  1 
ATOM   7452 N N   . MET D 2 72  ? -10.485 84.780  101.989 1.00 35.44  ? 246 MET D N   1 
ATOM   7453 C CA  . MET D 2 72  ? -11.651 85.056  102.819 1.00 35.76  ? 246 MET D CA  1 
ATOM   7454 C C   . MET D 2 72  ? -11.597 86.456  103.342 1.00 35.80  ? 246 MET D C   1 
ATOM   7455 O O   . MET D 2 72  ? -10.560 86.903  103.837 1.00 35.99  ? 246 MET D O   1 
ATOM   7456 C CB  . MET D 2 72  ? -11.711 84.110  104.015 1.00 35.91  ? 246 MET D CB  1 
ATOM   7457 C CG  . MET D 2 72  ? -11.567 82.651  103.675 1.00 37.54  ? 246 MET D CG  1 
ATOM   7458 S SD  . MET D 2 72  ? -13.121 81.979  103.060 1.00 41.92  ? 246 MET D SD  1 
ATOM   7459 C CE  . MET D 2 72  ? -13.954 81.669  104.673 1.00 37.82  ? 246 MET D CE  1 
ATOM   7460 N N   . SER D 2 73  ? -12.721 87.147  103.244 1.00 35.73  ? 247 SER D N   1 
ATOM   7461 C CA  . SER D 2 73  ? -12.846 88.446  103.863 1.00 35.81  ? 247 SER D CA  1 
ATOM   7462 C C   . SER D 2 73  ? -13.052 88.220  105.364 1.00 35.42  ? 247 SER D C   1 
ATOM   7463 O O   . SER D 2 73  ? -13.792 87.323  105.757 1.00 35.62  ? 247 SER D O   1 
ATOM   7464 C CB  . SER D 2 73  ? -13.994 89.233  103.211 1.00 35.84  ? 247 SER D CB  1 
ATOM   7465 O OG  . SER D 2 73  ? -15.075 89.396  104.111 1.00 37.46  ? 247 SER D OG  1 
ATOM   7466 N N   . VAL D 2 74  ? -12.372 89.013  106.191 1.00 35.36  ? 248 VAL D N   1 
ATOM   7467 C CA  . VAL D 2 74  ? -12.447 88.892  107.649 1.00 35.02  ? 248 VAL D CA  1 
ATOM   7468 C C   . VAL D 2 74  ? -12.606 90.252  108.305 1.00 35.46  ? 248 VAL D C   1 
ATOM   7469 O O   . VAL D 2 74  ? -11.902 91.197  107.955 1.00 35.49  ? 248 VAL D O   1 
ATOM   7470 C CB  . VAL D 2 74  ? -11.177 88.233  108.262 1.00 34.84  ? 248 VAL D CB  1 
ATOM   7471 C CG1 . VAL D 2 74  ? -11.258 88.220  109.803 1.00 33.59  ? 248 VAL D CG1 1 
ATOM   7472 C CG2 . VAL D 2 74  ? -10.972 86.827  107.737 1.00 33.91  ? 248 VAL D CG2 1 
ATOM   7473 N N   . LEU D 2 75  ? -13.513 90.325  109.281 1.00 35.98  ? 249 LEU D N   1 
ATOM   7474 C CA  . LEU D 2 75  ? -13.726 91.526  110.079 1.00 36.62  ? 249 LEU D CA  1 
ATOM   7475 C C   . LEU D 2 75  ? -12.585 91.786  111.065 1.00 36.70  ? 249 LEU D C   1 
ATOM   7476 O O   . LEU D 2 75  ? -11.912 90.860  111.500 1.00 36.18  ? 249 LEU D O   1 
ATOM   7477 C CB  . LEU D 2 75  ? -15.046 91.428  110.847 1.00 36.74  ? 249 LEU D CB  1 
ATOM   7478 C CG  . LEU D 2 75  ? -16.348 91.623  110.065 1.00 37.78  ? 249 LEU D CG  1 
ATOM   7479 C CD1 . LEU D 2 75  ? -17.518 91.926  111.021 1.00 38.62  ? 249 LEU D CD1 1 
ATOM   7480 C CD2 . LEU D 2 75  ? -16.212 92.715  109.025 1.00 37.25  ? 249 LEU D CD2 1 
ATOM   7481 N N   . ARG D 2 76  ? -12.390 93.063  111.393 1.00 37.28  ? 250 ARG D N   1 
ATOM   7482 C CA  . ARG D 2 76  ? -11.392 93.539  112.359 1.00 37.99  ? 250 ARG D CA  1 
ATOM   7483 C C   . ARG D 2 76  ? -11.292 92.698  113.648 1.00 37.51  ? 250 ARG D C   1 
ATOM   7484 O O   . ARG D 2 76  ? -10.208 92.225  114.009 1.00 37.75  ? 250 ARG D O   1 
ATOM   7485 C CB  . ARG D 2 76  ? -11.728 94.985  112.722 1.00 38.86  ? 250 ARG D CB  1 
ATOM   7486 C CG  . ARG D 2 76  ? -10.601 95.971  112.619 1.00 40.97  ? 250 ARG D CG  1 
ATOM   7487 C CD  . ARG D 2 76  ? -10.492 96.849  113.847 1.00 45.16  ? 250 ARG D CD  1 
ATOM   7488 N NE  . ARG D 2 76  ? -10.936 98.251  113.745 1.00 49.55  ? 250 ARG D NE  1 
ATOM   7489 C CZ  . ARG D 2 76  ? -11.334 98.912  112.648 1.00 52.55  ? 250 ARG D CZ  1 
ATOM   7490 N NH1 . ARG D 2 76  ? -11.690 100.183 112.768 1.00 52.75  ? 250 ARG D NH1 1 
ATOM   7491 N NH2 . ARG D 2 76  ? -11.399 98.336  111.448 1.00 54.48  ? 250 ARG D NH2 1 
ATOM   7492 N N   . GLY D 2 77  ? -12.422 92.500  114.323 1.00 36.93  ? 251 GLY D N   1 
ATOM   7493 C CA  . GLY D 2 77  ? -12.455 91.773  115.583 1.00 36.17  ? 251 GLY D CA  1 
ATOM   7494 C C   . GLY D 2 77  ? -12.122 90.291  115.499 1.00 36.04  ? 251 GLY D C   1 
ATOM   7495 O O   . GLY D 2 77  ? -11.925 89.647  116.535 1.00 36.33  ? 251 GLY D O   1 
ATOM   7496 N N   . LYS D 2 78  ? -12.065 89.747  114.280 1.00 35.15  ? 252 LYS D N   1 
ATOM   7497 C CA  . LYS D 2 78  ? -11.797 88.321  114.071 1.00 34.07  ? 252 LYS D CA  1 
ATOM   7498 C C   . LYS D 2 78  ? -10.401 88.075  113.524 1.00 33.56  ? 252 LYS D C   1 
ATOM   7499 O O   . LYS D 2 78  ? -9.985  86.921  113.370 1.00 33.37  ? 252 LYS D O   1 
ATOM   7500 C CB  . LYS D 2 78  ? -12.824 87.684  113.125 1.00 34.16  ? 252 LYS D CB  1 
ATOM   7501 C CG  . LYS D 2 78  ? -14.297 87.967  113.425 1.00 34.83  ? 252 LYS D CG  1 
ATOM   7502 C CD  . LYS D 2 78  ? -14.634 87.795  114.888 1.00 35.63  ? 252 LYS D CD  1 
ATOM   7503 C CE  . LYS D 2 78  ? -15.025 86.387  115.193 1.00 37.24  ? 252 LYS D CE  1 
ATOM   7504 N NZ  . LYS D 2 78  ? -16.375 86.391  115.798 1.00 39.07  ? 252 LYS D NZ  1 
ATOM   7505 N N   . LEU D 2 79  ? -9.683  89.159  113.231 1.00 32.96  ? 253 LEU D N   1 
ATOM   7506 C CA  . LEU D 2 79  ? -8.332  89.080  112.683 1.00 32.63  ? 253 LEU D CA  1 
ATOM   7507 C C   . LEU D 2 79  ? -7.387  88.303  113.604 1.00 32.29  ? 253 LEU D C   1 
ATOM   7508 O O   . LEU D 2 79  ? -6.628  87.441  113.151 1.00 32.12  ? 253 LEU D O   1 
ATOM   7509 C CB  . LEU D 2 79  ? -7.782  90.482  112.394 1.00 32.70  ? 253 LEU D CB  1 
ATOM   7510 C CG  . LEU D 2 79  ? -6.430  90.559  111.676 1.00 34.29  ? 253 LEU D CG  1 
ATOM   7511 C CD1 . LEU D 2 79  ? -6.464  89.919  110.272 1.00 33.09  ? 253 LEU D CD1 1 
ATOM   7512 C CD2 . LEU D 2 79  ? -5.933  92.009  111.593 1.00 35.97  ? 253 LEU D CD2 1 
ATOM   7513 N N   . GLN D 2 80  ? -7.460  88.585  114.900 1.00 31.56  ? 254 GLN D N   1 
ATOM   7514 C CA  . GLN D 2 80  ? -6.606  87.906  115.849 1.00 31.31  ? 254 GLN D CA  1 
ATOM   7515 C C   . GLN D 2 80  ? -6.942  86.422  115.943 1.00 30.49  ? 254 GLN D C   1 
ATOM   7516 O O   . GLN D 2 80  ? -6.065  85.599  116.203 1.00 30.68  ? 254 GLN D O   1 
ATOM   7517 C CB  . GLN D 2 80  ? -6.723  88.553  117.218 1.00 31.67  ? 254 GLN D CB  1 
ATOM   7518 C CG  . GLN D 2 80  ? -5.685  88.021  118.205 1.00 33.53  ? 254 GLN D CG  1 
ATOM   7519 C CD  . GLN D 2 80  ? -5.594  88.836  119.468 1.00 34.84  ? 254 GLN D CD  1 
ATOM   7520 O OE1 . GLN D 2 80  ? -4.652  88.664  120.240 1.00 37.79  ? 254 GLN D OE1 1 
ATOM   7521 N NE2 . GLN D 2 80  ? -6.556  89.730  119.682 1.00 34.20  ? 254 GLN D NE2 1 
ATOM   7522 N N   . LEU D 2 81  ? -8.210  86.092  115.721 1.00 29.56  ? 255 LEU D N   1 
ATOM   7523 C CA  . LEU D 2 81  ? -8.657  84.713  115.746 1.00 29.16  ? 255 LEU D CA  1 
ATOM   7524 C C   . LEU D 2 81  ? -7.997  83.907  114.624 1.00 28.86  ? 255 LEU D C   1 
ATOM   7525 O O   . LEU D 2 81  ? -7.566  82.785  114.847 1.00 28.92  ? 255 LEU D O   1 
ATOM   7526 C CB  . LEU D 2 81  ? -10.196 84.624  115.703 1.00 29.01  ? 255 LEU D CB  1 
ATOM   7527 C CG  . LEU D 2 81  ? -10.819 83.213  115.782 1.00 28.63  ? 255 LEU D CG  1 
ATOM   7528 C CD1 . LEU D 2 81  ? -10.354 82.437  117.023 1.00 29.89  ? 255 LEU D CD1 1 
ATOM   7529 C CD2 . LEU D 2 81  ? -12.333 83.266  115.729 1.00 26.98  ? 255 LEU D CD2 1 
ATOM   7530 N N   . VAL D 2 82  ? -7.901  84.497  113.434 1.00 28.91  ? 256 VAL D N   1 
ATOM   7531 C CA  . VAL D 2 82  ? -7.201  83.883  112.293 1.00 28.31  ? 256 VAL D CA  1 
ATOM   7532 C C   . VAL D 2 82  ? -5.720  83.671  112.597 1.00 28.18  ? 256 VAL D C   1 
ATOM   7533 O O   . VAL D 2 82  ? -5.184  82.594  112.328 1.00 28.32  ? 256 VAL D O   1 
ATOM   7534 C CB  . VAL D 2 82  ? -7.325  84.736  110.995 1.00 28.51  ? 256 VAL D CB  1 
ATOM   7535 C CG1 . VAL D 2 82  ? -6.566  84.078  109.839 1.00 28.15  ? 256 VAL D CG1 1 
ATOM   7536 C CG2 . VAL D 2 82  ? -8.803  85.004  110.628 1.00 27.71  ? 256 VAL D CG2 1 
ATOM   7537 N N   . GLY D 2 83  ? -5.068  84.693  113.157 1.00 27.75  ? 257 GLY D N   1 
ATOM   7538 C CA  . GLY D 2 83  ? -3.662  84.608  113.543 1.00 27.26  ? 257 GLY D CA  1 
ATOM   7539 C C   . GLY D 2 83  ? -3.353  83.550  114.597 1.00 27.24  ? 257 GLY D C   1 
ATOM   7540 O O   . GLY D 2 83  ? -2.351  82.820  114.494 1.00 27.49  ? 257 GLY D O   1 
ATOM   7541 N N   . THR D 2 84  ? -4.209  83.469  115.613 1.00 26.72  ? 258 THR D N   1 
ATOM   7542 C CA  . THR D 2 84  ? -4.089  82.462  116.670 1.00 26.50  ? 258 THR D CA  1 
ATOM   7543 C C   . THR D 2 84  ? -4.200  81.033  116.136 1.00 26.17  ? 258 THR D C   1 
ATOM   7544 O O   . THR D 2 84  ? -3.355  80.165  116.437 1.00 26.17  ? 258 THR D O   1 
ATOM   7545 C CB  . THR D 2 84  ? -5.167  82.722  117.750 1.00 26.79  ? 258 THR D CB  1 
ATOM   7546 O OG1 . THR D 2 84  ? -4.957  84.024  118.301 1.00 27.11  ? 258 THR D OG1 1 
ATOM   7547 C CG2 . THR D 2 84  ? -4.982  81.802  118.939 1.00 25.74  ? 258 THR D CG2 1 
ATOM   7548 N N   . ALA D 2 85  ? -5.239  80.789  115.346 1.00 25.80  ? 259 ALA D N   1 
ATOM   7549 C CA  . ALA D 2 85  ? -5.395  79.494  114.691 1.00 26.24  ? 259 ALA D CA  1 
ATOM   7550 C C   . ALA D 2 85  ? -4.244  79.173  113.735 1.00 25.92  ? 259 ALA D C   1 
ATOM   7551 O O   . ALA D 2 85  ? -3.829  78.025  113.639 1.00 26.33  ? 259 ALA D O   1 
ATOM   7552 C CB  . ALA D 2 85  ? -6.753  79.399  113.987 1.00 26.25  ? 259 ALA D CB  1 
ATOM   7553 N N   . ALA D 2 86  ? -3.703  80.189  113.064 1.00 26.24  ? 260 ALA D N   1 
ATOM   7554 C CA  . ALA D 2 86  ? -2.557  80.005  112.163 1.00 26.56  ? 260 ALA D CA  1 
ATOM   7555 C C   . ALA D 2 86  ? -1.316  79.549  112.936 1.00 27.10  ? 260 ALA D C   1 
ATOM   7556 O O   . ALA D 2 86  ? -0.592  78.632  112.514 1.00 26.71  ? 260 ALA D O   1 
ATOM   7557 C CB  . ALA D 2 86  ? -2.272  81.274  111.429 1.00 26.19  ? 260 ALA D CB  1 
ATOM   7558 N N   . MET D 2 87  ? -1.095  80.192  114.083 1.00 27.94  ? 261 MET D N   1 
ATOM   7559 C CA  . MET D 2 87  ? 0.020   79.877  114.983 1.00 28.62  ? 261 MET D CA  1 
ATOM   7560 C C   . MET D 2 87  ? -0.130  78.454  115.536 1.00 28.79  ? 261 MET D C   1 
ATOM   7561 O O   . MET D 2 87  ? 0.826   77.674  115.530 1.00 29.07  ? 261 MET D O   1 
ATOM   7562 C CB  . MET D 2 87  ? 0.056   80.907  116.113 1.00 28.82  ? 261 MET D CB  1 
ATOM   7563 C CG  . MET D 2 87  ? 1.424   81.155  116.740 1.00 32.45  ? 261 MET D CG  1 
ATOM   7564 S SD  . MET D 2 87  ? 2.793   81.424  115.578 1.00 40.06  ? 261 MET D SD  1 
ATOM   7565 C CE  . MET D 2 87  ? 3.959   82.409  116.571 1.00 35.11  ? 261 MET D CE  1 
ATOM   7566 N N   . LEU D 2 88  ? -1.339  78.125  115.993 1.00 28.51  ? 262 LEU D N   1 
ATOM   7567 C CA  . LEU D 2 88  ? -1.682  76.783  116.428 1.00 28.73  ? 262 LEU D CA  1 
ATOM   7568 C C   . LEU D 2 88  ? -1.328  75.729  115.371 1.00 28.31  ? 262 LEU D C   1 
ATOM   7569 O O   . LEU D 2 88  ? -0.607  74.762  115.659 1.00 28.09  ? 262 LEU D O   1 
ATOM   7570 C CB  . LEU D 2 88  ? -3.181  76.727  116.763 1.00 29.43  ? 262 LEU D CB  1 
ATOM   7571 C CG  . LEU D 2 88  ? -3.801  75.422  117.274 1.00 30.70  ? 262 LEU D CG  1 
ATOM   7572 C CD1 . LEU D 2 88  ? -3.022  74.844  118.448 1.00 30.85  ? 262 LEU D CD1 1 
ATOM   7573 C CD2 . LEU D 2 88  ? -5.257  75.670  117.669 1.00 31.63  ? 262 LEU D CD2 1 
ATOM   7574 N N   . LEU D 2 89  ? -1.820  75.931  114.147 1.00 27.69  ? 263 LEU D N   1 
ATOM   7575 C CA  . LEU D 2 89  ? -1.536  75.022  113.039 1.00 27.00  ? 263 LEU D CA  1 
ATOM   7576 C C   . LEU D 2 89  ? -0.056  74.937  112.720 1.00 26.90  ? 263 LEU D C   1 
ATOM   7577 O O   . LEU D 2 89  ? 0.471   73.842  112.491 1.00 26.96  ? 263 LEU D O   1 
ATOM   7578 C CB  . LEU D 2 89  ? -2.318  75.441  111.782 1.00 27.42  ? 263 LEU D CB  1 
ATOM   7579 C CG  . LEU D 2 89  ? -3.797  75.048  111.762 1.00 26.86  ? 263 LEU D CG  1 
ATOM   7580 C CD1 . LEU D 2 89  ? -4.488  75.732  110.618 1.00 27.60  ? 263 LEU D CD1 1 
ATOM   7581 C CD2 . LEU D 2 89  ? -3.950  73.552  111.661 1.00 23.84  ? 263 LEU D CD2 1 
ATOM   7582 N N   . ALA D 2 90  ? 0.617   76.087  112.703 1.00 26.61  ? 264 ALA D N   1 
ATOM   7583 C CA  . ALA D 2 90  ? 2.064   76.122  112.465 1.00 26.88  ? 264 ALA D CA  1 
ATOM   7584 C C   . ALA D 2 90  ? 2.829   75.351  113.527 1.00 27.18  ? 264 ALA D C   1 
ATOM   7585 O O   . ALA D 2 90  ? 3.763   74.620  113.199 1.00 27.76  ? 264 ALA D O   1 
ATOM   7586 C CB  . ALA D 2 90  ? 2.574   77.554  112.399 1.00 27.00  ? 264 ALA D CB  1 
ATOM   7587 N N   . SER D 2 91  ? 2.431   75.521  114.791 1.00 27.20  ? 265 SER D N   1 
ATOM   7588 C CA  . SER D 2 91  ? 3.050   74.831  115.911 1.00 27.31  ? 265 SER D CA  1 
ATOM   7589 C C   . SER D 2 91  ? 2.875   73.333  115.774 1.00 27.94  ? 265 SER D C   1 
ATOM   7590 O O   . SER D 2 91  ? 3.840   72.575  115.926 1.00 28.25  ? 265 SER D O   1 
ATOM   7591 C CB  . SER D 2 91  ? 2.469   75.328  117.235 1.00 26.99  ? 265 SER D CB  1 
ATOM   7592 O OG  . SER D 2 91  ? 2.666   76.731  117.348 1.00 27.84  ? 265 SER D OG  1 
ATOM   7593 N N   . LYS D 2 92  ? 1.651   72.903  115.468 1.00 28.30  ? 266 LYS D N   1 
ATOM   7594 C CA  . LYS D 2 92  ? 1.377   71.489  115.210 1.00 28.81  ? 266 LYS D CA  1 
ATOM   7595 C C   . LYS D 2 92  ? 2.187   70.916  114.041 1.00 29.33  ? 266 LYS D C   1 
ATOM   7596 O O   . LYS D 2 92  ? 2.570   69.761  114.062 1.00 29.67  ? 266 LYS D O   1 
ATOM   7597 C CB  . LYS D 2 92  ? -0.120  71.260  114.967 1.00 28.75  ? 266 LYS D CB  1 
ATOM   7598 C CG  . LYS D 2 92  ? -1.008  71.473  116.203 1.00 28.50  ? 266 LYS D CG  1 
ATOM   7599 C CD  . LYS D 2 92  ? -2.376  70.882  115.978 1.00 27.92  ? 266 LYS D CD  1 
ATOM   7600 C CE  . LYS D 2 92  ? -3.191  70.888  117.250 1.00 28.33  ? 266 LYS D CE  1 
ATOM   7601 N NZ  . LYS D 2 92  ? -4.633  71.075  116.931 1.00 26.72  ? 266 LYS D NZ  1 
ATOM   7602 N N   . PHE D 2 93  ? 2.437   71.711  113.014 1.00 30.41  ? 267 PHE D N   1 
ATOM   7603 C CA  . PHE D 2 93  ? 3.186   71.206  111.877 1.00 31.13  ? 267 PHE D CA  1 
ATOM   7604 C C   . PHE D 2 93  ? 4.661   71.041  112.242 1.00 31.84  ? 267 PHE D C   1 
ATOM   7605 O O   . PHE D 2 93  ? 5.251   69.976  112.035 1.00 30.51  ? 267 PHE D O   1 
ATOM   7606 C CB  . PHE D 2 93  ? 3.033   72.142  110.668 1.00 31.17  ? 267 PHE D CB  1 
ATOM   7607 C CG  . PHE D 2 93  ? 3.606   71.581  109.392 1.00 31.29  ? 267 PHE D CG  1 
ATOM   7608 C CD1 . PHE D 2 93  ? 2.959   70.528  108.722 1.00 31.50  ? 267 PHE D CD1 1 
ATOM   7609 C CD2 . PHE D 2 93  ? 4.801   72.081  108.868 1.00 30.76  ? 267 PHE D CD2 1 
ATOM   7610 C CE1 . PHE D 2 93  ? 3.496   69.987  107.531 1.00 31.11  ? 267 PHE D CE1 1 
ATOM   7611 C CE2 . PHE D 2 93  ? 5.343   71.559  107.671 1.00 31.04  ? 267 PHE D CE2 1 
ATOM   7612 C CZ  . PHE D 2 93  ? 4.690   70.509  107.004 1.00 30.48  ? 267 PHE D CZ  1 
ATOM   7613 N N   . GLU D 2 94  ? 5.216   72.100  112.827 1.00 33.20  ? 268 GLU D N   1 
ATOM   7614 C CA  . GLU D 2 94  ? 6.658   72.314  112.884 1.00 34.94  ? 268 GLU D CA  1 
ATOM   7615 C C   . GLU D 2 94  ? 7.330   71.846  114.189 1.00 35.62  ? 268 GLU D C   1 
ATOM   7616 O O   . GLU D 2 94  ? 8.422   71.266  114.157 1.00 35.60  ? 268 GLU D O   1 
ATOM   7617 C CB  . GLU D 2 94  ? 6.944   73.805  112.631 1.00 34.99  ? 268 GLU D CB  1 
ATOM   7618 C CG  . GLU D 2 94  ? 8.342   74.157  112.113 1.00 37.76  ? 268 GLU D CG  1 
ATOM   7619 C CD  . GLU D 2 94  ? 8.906   73.174  111.092 1.00 41.06  ? 268 GLU D CD  1 
ATOM   7620 O OE1 . GLU D 2 94  ? 8.158   72.729  110.184 1.00 42.29  ? 268 GLU D OE1 1 
ATOM   7621 O OE2 . GLU D 2 94  ? 10.116  72.851  111.191 1.00 42.09  ? 268 GLU D OE2 1 
ATOM   7622 N N   . GLU D 2 95  ? 6.669   72.099  115.318 1.00 36.80  ? 269 GLU D N   1 
ATOM   7623 C CA  . GLU D 2 95  ? 7.259   71.914  116.652 1.00 37.72  ? 269 GLU D CA  1 
ATOM   7624 C C   . GLU D 2 95  ? 7.207   70.484  117.142 1.00 38.33  ? 269 GLU D C   1 
ATOM   7625 O O   . GLU D 2 95  ? 6.232   69.767  116.912 1.00 38.53  ? 269 GLU D O   1 
ATOM   7626 C CB  . GLU D 2 95  ? 6.552   72.794  117.689 1.00 37.77  ? 269 GLU D CB  1 
ATOM   7627 C CG  . GLU D 2 95  ? 6.588   74.289  117.418 1.00 39.31  ? 269 GLU D CG  1 
ATOM   7628 C CD  . GLU D 2 95  ? 7.932   74.921  117.731 1.00 41.99  ? 269 GLU D CD  1 
ATOM   7629 O OE1 . GLU D 2 95  ? 8.668   74.395  118.599 1.00 44.25  ? 269 GLU D OE1 1 
ATOM   7630 O OE2 . GLU D 2 95  ? 8.253   75.960  117.115 1.00 42.69  ? 269 GLU D OE2 1 
ATOM   7631 N N   . ILE D 2 96  ? 8.264   70.093  117.846 1.00 39.39  ? 270 ILE D N   1 
ATOM   7632 C CA  . ILE D 2 96  ? 8.298   68.855  118.618 1.00 40.08  ? 270 ILE D CA  1 
ATOM   7633 C C   . ILE D 2 96  ? 7.243   68.887  119.737 1.00 40.23  ? 270 ILE D C   1 
ATOM   7634 O O   . ILE D 2 96  ? 6.438   67.963  119.851 1.00 40.51  ? 270 ILE D O   1 
ATOM   7635 C CB  . ILE D 2 96  ? 9.732   68.603  119.183 1.00 40.27  ? 270 ILE D CB  1 
ATOM   7636 C CG1 . ILE D 2 96  ? 10.749  68.473  118.036 1.00 41.09  ? 270 ILE D CG1 1 
ATOM   7637 C CG2 . ILE D 2 96  ? 9.754   67.351  120.069 1.00 40.26  ? 270 ILE D CG2 1 
ATOM   7638 C CD1 . ILE D 2 96  ? 12.204  68.694  118.442 1.00 42.92  ? 270 ILE D CD1 1 
ATOM   7639 N N   . TYR D 2 97  ? 7.247   69.948  120.547 1.00 40.62  ? 271 TYR D N   1 
ATOM   7640 C CA  . TYR D 2 97  ? 6.238   70.138  121.602 1.00 41.19  ? 271 TYR D CA  1 
ATOM   7641 C C   . TYR D 2 97  ? 5.469   71.445  121.411 1.00 40.86  ? 271 TYR D C   1 
ATOM   7642 O O   . TYR D 2 97  ? 5.808   72.456  122.026 1.00 40.99  ? 271 TYR D O   1 
ATOM   7643 C CB  . TYR D 2 97  ? 6.852   70.132  123.018 1.00 41.43  ? 271 TYR D CB  1 
ATOM   7644 C CG  . TYR D 2 97  ? 7.969   69.144  123.249 1.00 42.99  ? 271 TYR D CG  1 
ATOM   7645 C CD1 . TYR D 2 97  ? 7.698   67.818  123.596 1.00 44.10  ? 271 TYR D CD1 1 
ATOM   7646 C CD2 . TYR D 2 97  ? 9.302   69.543  123.145 1.00 45.00  ? 271 TYR D CD2 1 
ATOM   7647 C CE1 . TYR D 2 97  ? 8.727   66.912  123.810 1.00 45.28  ? 271 TYR D CE1 1 
ATOM   7648 C CE2 . TYR D 2 97  ? 10.341  68.644  123.357 1.00 45.75  ? 271 TYR D CE2 1 
ATOM   7649 C CZ  . TYR D 2 97  ? 10.047  67.333  123.687 1.00 46.60  ? 271 TYR D CZ  1 
ATOM   7650 O OH  . TYR D 2 97  ? 11.077  66.441  123.893 1.00 49.06  ? 271 TYR D OH  1 
ATOM   7651 N N   . PRO D 2 98  ? 4.423   71.438  120.587 1.00 40.78  ? 272 PRO D N   1 
ATOM   7652 C CA  . PRO D 2 98  ? 3.624   72.657  120.404 1.00 40.68  ? 272 PRO D CA  1 
ATOM   7653 C C   . PRO D 2 98  ? 2.951   72.996  121.734 1.00 40.79  ? 272 PRO D C   1 
ATOM   7654 O O   . PRO D 2 98  ? 2.692   72.082  122.525 1.00 40.40  ? 272 PRO D O   1 
ATOM   7655 C CB  . PRO D 2 98  ? 2.571   72.251  119.364 1.00 40.38  ? 272 PRO D CB  1 
ATOM   7656 C CG  . PRO D 2 98  ? 2.529   70.756  119.394 1.00 40.68  ? 272 PRO D CG  1 
ATOM   7657 C CD  . PRO D 2 98  ? 3.888   70.294  119.827 1.00 40.64  ? 272 PRO D CD  1 
ATOM   7658 N N   . PRO D 2 99  ? 2.681   74.270  121.991 1.00 40.87  ? 273 PRO D N   1 
ATOM   7659 C CA  . PRO D 2 99  ? 1.860   74.631  123.140 1.00 41.24  ? 273 PRO D CA  1 
ATOM   7660 C C   . PRO D 2 99  ? 0.493   74.007  122.906 1.00 41.92  ? 273 PRO D C   1 
ATOM   7661 O O   . PRO D 2 99  ? 0.107   73.854  121.740 1.00 42.36  ? 273 PRO D O   1 
ATOM   7662 C CB  . PRO D 2 99  ? 1.775   76.150  123.032 1.00 41.17  ? 273 PRO D CB  1 
ATOM   7663 C CG  . PRO D 2 99  ? 2.961   76.530  122.235 1.00 41.29  ? 273 PRO D CG  1 
ATOM   7664 C CD  . PRO D 2 99  ? 3.090   75.451  121.214 1.00 40.81  ? 273 PRO D CD  1 
ATOM   7665 N N   . GLU D 2 100 ? -0.219  73.630  123.962 1.00 42.31  ? 274 GLU D N   1 
ATOM   7666 C CA  . GLU D 2 100 ? -1.598  73.194  123.791 1.00 43.01  ? 274 GLU D CA  1 
ATOM   7667 C C   . GLU D 2 100 ? -2.517  74.364  123.473 1.00 42.16  ? 274 GLU D C   1 
ATOM   7668 O O   . GLU D 2 100 ? -2.137  75.529  123.635 1.00 41.84  ? 274 GLU D O   1 
ATOM   7669 C CB  . GLU D 2 100 ? -2.128  72.442  125.016 1.00 43.99  ? 274 GLU D CB  1 
ATOM   7670 C CG  . GLU D 2 100 ? -1.220  72.407  126.228 1.00 47.71  ? 274 GLU D CG  1 
ATOM   7671 C CD  . GLU D 2 100 ? -1.652  71.334  127.202 1.00 52.47  ? 274 GLU D CD  1 
ATOM   7672 O OE1 . GLU D 2 100 ? -1.419  70.144  126.898 1.00 54.66  ? 274 GLU D OE1 1 
ATOM   7673 O OE2 . GLU D 2 100 ? -2.243  71.681  128.253 1.00 55.27  ? 274 GLU D OE2 1 
ATOM   7674 N N   . VAL D 2 101 ? -3.729  74.029  123.031 1.00 41.55  ? 275 VAL D N   1 
ATOM   7675 C CA  . VAL D 2 101 ? -4.758  75.002  122.649 1.00 40.80  ? 275 VAL D CA  1 
ATOM   7676 C C   . VAL D 2 101 ? -5.104  75.977  123.775 1.00 40.72  ? 275 VAL D C   1 
ATOM   7677 O O   . VAL D 2 101 ? -5.314  77.175  123.531 1.00 39.83  ? 275 VAL D O   1 
ATOM   7678 C CB  . VAL D 2 101 ? -6.054  74.291  122.190 1.00 40.90  ? 275 VAL D CB  1 
ATOM   7679 C CG1 . VAL D 2 101 ? -7.095  75.298  121.741 1.00 40.67  ? 275 VAL D CG1 1 
ATOM   7680 C CG2 . VAL D 2 101 ? -5.763  73.299  121.076 1.00 40.81  ? 275 VAL D CG2 1 
ATOM   7681 N N   . ALA D 2 102 ? -5.172  75.458  125.005 1.00 40.61  ? 276 ALA D N   1 
ATOM   7682 C CA  . ALA D 2 102 ? -5.450  76.298  126.162 1.00 40.70  ? 276 ALA D CA  1 
ATOM   7683 C C   . ALA D 2 102 ? -4.405  77.401  126.259 1.00 40.72  ? 276 ALA D C   1 
ATOM   7684 O O   . ALA D 2 102 ? -4.753  78.543  126.525 1.00 40.45  ? 276 ALA D O   1 
ATOM   7685 C CB  . ALA D 2 102 ? -5.512  75.477  127.443 1.00 40.86  ? 276 ALA D CB  1 
ATOM   7686 N N   . GLU D 2 103 ? -3.141  77.063  125.997 1.00 41.07  ? 277 GLU D N   1 
ATOM   7687 C CA  . GLU D 2 103 ? -2.065  78.057  125.931 1.00 42.12  ? 277 GLU D CA  1 
ATOM   7688 C C   . GLU D 2 103 ? -2.390  79.133  124.880 1.00 42.05  ? 277 GLU D C   1 
ATOM   7689 O O   . GLU D 2 103 ? -2.193  80.317  125.134 1.00 42.26  ? 277 GLU D O   1 
ATOM   7690 C CB  . GLU D 2 103 ? -0.680  77.398  125.681 1.00 42.60  ? 277 GLU D CB  1 
ATOM   7691 C CG  . GLU D 2 103 ? -0.063  76.682  126.893 1.00 45.54  ? 277 GLU D CG  1 
ATOM   7692 C CD  . GLU D 2 103 ? 1.171   75.812  126.567 1.00 49.96  ? 277 GLU D CD  1 
ATOM   7693 O OE1 . GLU D 2 103 ? 2.245   76.364  126.224 1.00 52.72  ? 277 GLU D OE1 1 
ATOM   7694 O OE2 . GLU D 2 103 ? 1.100   74.560  126.677 1.00 51.22  ? 277 GLU D OE2 1 
ATOM   7695 N N   . PHE D 2 104 ? -2.922  78.723  123.722 1.00 41.92  ? 278 PHE D N   1 
ATOM   7696 C CA  . PHE D 2 104 ? -3.332  79.663  122.663 1.00 41.48  ? 278 PHE D CA  1 
ATOM   7697 C C   . PHE D 2 104 ? -4.545  80.520  123.012 1.00 42.46  ? 278 PHE D C   1 
ATOM   7698 O O   . PHE D 2 104 ? -4.576  81.707  122.683 1.00 42.17  ? 278 PHE D O   1 
ATOM   7699 C CB  . PHE D 2 104 ? -3.555  78.948  121.323 1.00 40.34  ? 278 PHE D CB  1 
ATOM   7700 C CG  . PHE D 2 104 ? -2.292  78.490  120.688 1.00 37.38  ? 278 PHE D CG  1 
ATOM   7701 C CD1 . PHE D 2 104 ? -1.522  79.368  119.940 1.00 34.10  ? 278 PHE D CD1 1 
ATOM   7702 C CD2 . PHE D 2 104 ? -1.842  77.191  120.872 1.00 35.53  ? 278 PHE D CD2 1 
ATOM   7703 C CE1 . PHE D 2 104 ? -0.330  78.964  119.371 1.00 33.29  ? 278 PHE D CE1 1 
ATOM   7704 C CE2 . PHE D 2 104 ? -0.638  76.770  120.302 1.00 35.33  ? 278 PHE D CE2 1 
ATOM   7705 C CZ  . PHE D 2 104 ? 0.117   77.659  119.547 1.00 33.53  ? 278 PHE D CZ  1 
ATOM   7706 N N   . VAL D 2 105 ? -5.540  79.923  123.668 1.00 43.82  ? 279 VAL D N   1 
ATOM   7707 C CA  . VAL D 2 105 ? -6.716  80.677  124.115 1.00 45.57  ? 279 VAL D CA  1 
ATOM   7708 C C   . VAL D 2 105 ? -6.290  81.716  125.145 1.00 47.25  ? 279 VAL D C   1 
ATOM   7709 O O   . VAL D 2 105 ? -6.854  82.808  125.211 1.00 47.04  ? 279 VAL D O   1 
ATOM   7710 C CB  . VAL D 2 105 ? -7.828  79.770  124.705 1.00 45.32  ? 279 VAL D CB  1 
ATOM   7711 C CG1 . VAL D 2 105 ? -9.090  80.575  124.990 1.00 44.99  ? 279 VAL D CG1 1 
ATOM   7712 C CG2 . VAL D 2 105 ? -8.157  78.627  123.751 1.00 45.52  ? 279 VAL D CG2 1 
ATOM   7713 N N   . TYR D 2 106 ? -5.267  81.367  125.920 1.00 49.62  ? 280 TYR D N   1 
ATOM   7714 C CA  . TYR D 2 106 ? -4.752  82.230  126.963 1.00 52.24  ? 280 TYR D CA  1 
ATOM   7715 C C   . TYR D 2 106 ? -4.169  83.533  126.410 1.00 53.39  ? 280 TYR D C   1 
ATOM   7716 O O   . TYR D 2 106 ? -4.612  84.605  126.808 1.00 53.68  ? 280 TYR D O   1 
ATOM   7717 C CB  . TYR D 2 106 ? -3.743  81.477  127.841 1.00 52.47  ? 280 TYR D CB  1 
ATOM   7718 C CG  . TYR D 2 106 ? -3.267  82.286  129.026 1.00 55.30  ? 280 TYR D CG  1 
ATOM   7719 C CD1 . TYR D 2 106 ? -4.063  82.432  130.163 1.00 57.48  ? 280 TYR D CD1 1 
ATOM   7720 C CD2 . TYR D 2 106 ? -2.023  82.926  129.001 1.00 57.82  ? 280 TYR D CD2 1 
ATOM   7721 C CE1 . TYR D 2 106 ? -3.630  83.191  131.252 1.00 59.84  ? 280 TYR D CE1 1 
ATOM   7722 C CE2 . TYR D 2 106 ? -1.577  83.681  130.083 1.00 59.68  ? 280 TYR D CE2 1 
ATOM   7723 C CZ  . TYR D 2 106 ? -2.384  83.808  131.205 1.00 60.87  ? 280 TYR D CZ  1 
ATOM   7724 O OH  . TYR D 2 106 ? -1.948  84.557  132.278 1.00 63.40  ? 280 TYR D OH  1 
ATOM   7725 N N   . ILE D 2 107 ? -3.211  83.441  125.487 1.00 55.22  ? 281 ILE D N   1 
ATOM   7726 C CA  . ILE D 2 107 ? -2.532  84.623  124.930 1.00 57.32  ? 281 ILE D CA  1 
ATOM   7727 C C   . ILE D 2 107 ? -3.416  85.633  124.166 1.00 58.91  ? 281 ILE D C   1 
ATOM   7728 O O   . ILE D 2 107 ? -2.930  86.694  123.765 1.00 59.10  ? 281 ILE D O   1 
ATOM   7729 C CB  . ILE D 2 107 ? -1.321  84.221  124.032 1.00 57.26  ? 281 ILE D CB  1 
ATOM   7730 C CG1 . ILE D 2 107 ? -1.590  82.921  123.281 1.00 57.23  ? 281 ILE D CG1 1 
ATOM   7731 C CG2 . ILE D 2 107 ? -0.031  84.129  124.839 1.00 57.60  ? 281 ILE D CG2 1 
ATOM   7732 C CD1 . ILE D 2 107 ? -1.768  83.109  121.798 1.00 57.52  ? 281 ILE D CD1 1 
ATOM   7733 N N   . THR D 2 108 ? -4.693  85.311  123.962 1.00 60.86  ? 282 THR D N   1 
ATOM   7734 C CA  . THR D 2 108 ? -5.609  86.217  123.260 1.00 62.88  ? 282 THR D CA  1 
ATOM   7735 C C   . THR D 2 108 ? -6.481  87.073  124.196 1.00 64.32  ? 282 THR D C   1 
ATOM   7736 O O   . THR D 2 108 ? -7.532  87.581  123.778 1.00 64.59  ? 282 THR D O   1 
ATOM   7737 C CB  . THR D 2 108 ? -6.492  85.450  122.235 1.00 62.92  ? 282 THR D CB  1 
ATOM   7738 O OG1 . THR D 2 108 ? -7.138  84.339  122.869 1.00 63.08  ? 282 THR D OG1 1 
ATOM   7739 C CG2 . THR D 2 108 ? -5.636  84.796  121.170 1.00 62.73  ? 282 THR D CG2 1 
ATOM   7740 N N   . ASP D 2 109 ? -6.028  87.235  125.446 1.00 66.01  ? 283 ASP D N   1 
ATOM   7741 C CA  . ASP D 2 109 ? -6.719  88.028  126.486 1.00 67.51  ? 283 ASP D CA  1 
ATOM   7742 C C   . ASP D 2 109 ? -8.104  87.468  126.844 1.00 67.24  ? 283 ASP D C   1 
ATOM   7743 O O   . ASP D 2 109 ? -8.914  88.131  127.506 1.00 67.30  ? 283 ASP D O   1 
ATOM   7744 C CB  . ASP D 2 109 ? -6.814  89.515  126.086 1.00 68.35  ? 283 ASP D CB  1 
ATOM   7745 C CG  . ASP D 2 109 ? -7.122  90.431  127.272 1.00 71.49  ? 283 ASP D CG  1 
ATOM   7746 O OD1 . ASP D 2 109 ? -8.291  90.878  127.403 1.00 75.21  ? 283 ASP D OD1 1 
ATOM   7747 O OD2 . ASP D 2 109 ? -6.260  90.766  128.119 1.00 74.22  ? 283 ASP D OD2 1 
ATOM   7748 N N   . ASP D 2 110 ? -8.357  86.235  126.409 1.00 66.87  ? 284 ASP D N   1 
ATOM   7749 C CA  . ASP D 2 110 ? -9.672  85.601  126.534 1.00 66.17  ? 284 ASP D CA  1 
ATOM   7750 C C   . ASP D 2 110 ? -10.791 86.403  125.831 1.00 64.65  ? 284 ASP D C   1 
ATOM   7751 O O   . ASP D 2 110 ? -11.954 86.385  126.252 1.00 64.57  ? 284 ASP D O   1 
ATOM   7752 C CB  . ASP D 2 110 ? -9.988  85.284  128.003 1.00 66.94  ? 284 ASP D CB  1 
ATOM   7753 C CG  . ASP D 2 110 ? -8.852  84.533  128.689 1.00 69.02  ? 284 ASP D CG  1 
ATOM   7754 O OD1 . ASP D 2 110 ? -9.030  83.332  128.991 1.00 70.74  ? 284 ASP D OD1 1 
ATOM   7755 O OD2 . ASP D 2 110 ? -7.741  85.059  128.948 1.00 71.45  ? 284 ASP D OD2 1 
ATOM   7756 N N   . THR D 2 111 ? -10.405 87.091  124.751 1.00 62.44  ? 285 THR D N   1 
ATOM   7757 C CA  . THR D 2 111 ? -11.332 87.670  123.777 1.00 60.13  ? 285 THR D CA  1 
ATOM   7758 C C   . THR D 2 111 ? -12.176 86.561  123.136 1.00 57.69  ? 285 THR D C   1 
ATOM   7759 O O   . THR D 2 111 ? -13.371 86.737  122.883 1.00 57.80  ? 285 THR D O   1 
ATOM   7760 C CB  . THR D 2 111 ? -10.542 88.417  122.666 1.00 60.60  ? 285 THR D CB  1 
ATOM   7761 O OG1 . THR D 2 111 ? -9.587  89.313  123.253 1.00 61.23  ? 285 THR D OG1 1 
ATOM   7762 C CG2 . THR D 2 111 ? -11.455 89.340  121.855 1.00 61.11  ? 285 THR D CG2 1 
ATOM   7763 N N   . TYR D 2 112 ? -11.541 85.417  122.892 1.00 54.25  ? 286 TYR D N   1 
ATOM   7764 C CA  . TYR D 2 112 ? -12.177 84.307  122.197 1.00 50.99  ? 286 TYR D CA  1 
ATOM   7765 C C   . TYR D 2 112 ? -12.302 83.068  123.077 1.00 49.35  ? 286 TYR D C   1 
ATOM   7766 O O   . TYR D 2 112 ? -11.527 82.883  124.012 1.00 49.42  ? 286 TYR D O   1 
ATOM   7767 C CB  . TYR D 2 112 ? -11.385 83.960  120.936 1.00 50.37  ? 286 TYR D CB  1 
ATOM   7768 C CG  . TYR D 2 112 ? -11.093 85.131  120.024 1.00 47.51  ? 286 TYR D CG  1 
ATOM   7769 C CD1 . TYR D 2 112 ? -12.115 85.785  119.336 1.00 44.85  ? 286 TYR D CD1 1 
ATOM   7770 C CD2 . TYR D 2 112 ? -9.789  85.568  119.832 1.00 44.90  ? 286 TYR D CD2 1 
ATOM   7771 C CE1 . TYR D 2 112 ? -11.844 86.851  118.490 1.00 43.53  ? 286 TYR D CE1 1 
ATOM   7772 C CE2 . TYR D 2 112 ? -9.506  86.625  118.990 1.00 43.67  ? 286 TYR D CE2 1 
ATOM   7773 C CZ  . TYR D 2 112 ? -10.534 87.263  118.323 1.00 43.53  ? 286 TYR D CZ  1 
ATOM   7774 O OH  . TYR D 2 112 ? -10.235 88.311  117.485 1.00 44.08  ? 286 TYR D OH  1 
ATOM   7775 N N   . THR D 2 113 ? -13.277 82.222  122.764 1.00 47.11  ? 287 THR D N   1 
ATOM   7776 C CA  . THR D 2 113 ? -13.478 80.975  123.493 1.00 45.17  ? 287 THR D CA  1 
ATOM   7777 C C   . THR D 2 113 ? -12.654 79.871  122.850 1.00 44.00  ? 287 THR D C   1 
ATOM   7778 O O   . THR D 2 113 ? -12.380 79.916  121.648 1.00 43.41  ? 287 THR D O   1 
ATOM   7779 C CB  . THR D 2 113 ? -14.973 80.574  123.515 1.00 45.37  ? 287 THR D CB  1 
ATOM   7780 O OG1 . THR D 2 113 ? -15.408 80.260  122.186 1.00 45.13  ? 287 THR D OG1 1 
ATOM   7781 C CG2 . THR D 2 113 ? -15.859 81.761  123.901 1.00 44.70  ? 287 THR D CG2 1 
ATOM   7782 N N   . LYS D 2 114 ? -12.259 78.880  123.650 1.00 42.34  ? 288 LYS D N   1 
ATOM   7783 C CA  . LYS D 2 114 ? -11.586 77.702  123.121 1.00 41.15  ? 288 LYS D CA  1 
ATOM   7784 C C   . LYS D 2 114 ? -12.291 77.162  121.870 1.00 40.31  ? 288 LYS D C   1 
ATOM   7785 O O   . LYS D 2 114 ? -11.630 76.745  120.916 1.00 40.28  ? 288 LYS D O   1 
ATOM   7786 C CB  . LYS D 2 114 ? -11.464 76.614  124.185 1.00 40.97  ? 288 LYS D CB  1 
ATOM   7787 C CG  . LYS D 2 114 ? -10.581 75.456  123.768 1.00 41.61  ? 288 LYS D CG  1 
ATOM   7788 C CD  . LYS D 2 114 ? -9.587  75.082  124.848 1.00 43.02  ? 288 LYS D CD  1 
ATOM   7789 C CE  . LYS D 2 114 ? -9.954  73.757  125.491 1.00 44.96  ? 288 LYS D CE  1 
ATOM   7790 N NZ  . LYS D 2 114 ? -8.744  72.891  125.706 1.00 47.70  ? 288 LYS D NZ  1 
ATOM   7791 N N   . LYS D 2 115 ? -13.622 77.190  121.872 1.00 39.13  ? 289 LYS D N   1 
ATOM   7792 C CA  . LYS D 2 115 ? -14.399 76.655  120.756 1.00 38.89  ? 289 LYS D CA  1 
ATOM   7793 C C   . LYS D 2 115 ? -14.206 77.473  119.481 1.00 37.51  ? 289 LYS D C   1 
ATOM   7794 O O   . LYS D 2 115 ? -14.148 76.910  118.400 1.00 37.57  ? 289 LYS D O   1 
ATOM   7795 C CB  . LYS D 2 115 ? -15.886 76.529  121.116 1.00 39.17  ? 289 LYS D CB  1 
ATOM   7796 C CG  . LYS D 2 115 ? -16.791 75.994  119.999 1.00 41.94  ? 289 LYS D CG  1 
ATOM   7797 C CD  . LYS D 2 115 ? -16.372 74.601  119.518 1.00 46.03  ? 289 LYS D CD  1 
ATOM   7798 C CE  . LYS D 2 115 ? -17.540 73.618  119.519 1.00 47.92  ? 289 LYS D CE  1 
ATOM   7799 N NZ  . LYS D 2 115 ? -17.519 72.741  118.297 1.00 49.08  ? 289 LYS D NZ  1 
ATOM   7800 N N   . GLN D 2 116 ? -14.095 78.792  119.615 1.00 36.10  ? 290 GLN D N   1 
ATOM   7801 C CA  . GLN D 2 116 ? -13.848 79.652  118.464 1.00 34.70  ? 290 GLN D CA  1 
ATOM   7802 C C   . GLN D 2 116 ? -12.498 79.318  117.843 1.00 33.17  ? 290 GLN D C   1 
ATOM   7803 O O   . GLN D 2 116 ? -12.392 79.156  116.625 1.00 32.97  ? 290 GLN D O   1 
ATOM   7804 C CB  . GLN D 2 116 ? -13.923 81.128  118.855 1.00 35.00  ? 290 GLN D CB  1 
ATOM   7805 C CG  . GLN D 2 116 ? -15.332 81.689  118.774 1.00 37.12  ? 290 GLN D CG  1 
ATOM   7806 C CD  . GLN D 2 116 ? -15.480 83.037  119.452 1.00 40.59  ? 290 GLN D CD  1 
ATOM   7807 O OE1 . GLN D 2 116 ? -15.002 83.234  120.568 1.00 43.99  ? 290 GLN D OE1 1 
ATOM   7808 N NE2 . GLN D 2 116 ? -16.154 83.962  118.787 1.00 41.62  ? 290 GLN D NE2 1 
ATOM   7809 N N   . VAL D 2 117 ? -11.480 79.190  118.691 1.00 31.17  ? 291 VAL D N   1 
ATOM   7810 C CA  . VAL D 2 117 ? -10.129 78.873  118.234 1.00 29.64  ? 291 VAL D CA  1 
ATOM   7811 C C   . VAL D 2 117 ? -10.119 77.563  117.447 1.00 28.89  ? 291 VAL D C   1 
ATOM   7812 O O   . VAL D 2 117 ? -9.595  77.508  116.331 1.00 28.57  ? 291 VAL D O   1 
ATOM   7813 C CB  . VAL D 2 117 ? -9.114  78.859  119.403 1.00 29.19  ? 291 VAL D CB  1 
ATOM   7814 C CG1 . VAL D 2 117 ? -7.869  78.082  119.044 1.00 28.47  ? 291 VAL D CG1 1 
ATOM   7815 C CG2 . VAL D 2 117 ? -8.749  80.287  119.806 1.00 28.36  ? 291 VAL D CG2 1 
ATOM   7816 N N   . LEU D 2 118 ? -10.747 76.538  118.014 1.00 28.29  ? 292 LEU D N   1 
ATOM   7817 C CA  . LEU D 2 118 ? -10.790 75.217  117.406 1.00 28.44  ? 292 LEU D CA  1 
ATOM   7818 C C   . LEU D 2 118 ? -11.541 75.194  116.083 1.00 27.91  ? 292 LEU D C   1 
ATOM   7819 O O   . LEU D 2 118 ? -11.131 74.522  115.130 1.00 27.69  ? 292 LEU D O   1 
ATOM   7820 C CB  . LEU D 2 118 ? -11.406 74.207  118.371 1.00 28.39  ? 292 LEU D CB  1 
ATOM   7821 C CG  . LEU D 2 118 ? -10.488 73.341  119.246 1.00 29.79  ? 292 LEU D CG  1 
ATOM   7822 C CD1 . LEU D 2 118 ? -9.017  73.740  119.207 1.00 31.31  ? 292 LEU D CD1 1 
ATOM   7823 C CD2 . LEU D 2 118 ? -11.003 73.323  120.682 1.00 30.11  ? 292 LEU D CD2 1 
ATOM   7824 N N   . ARG D 2 119 ? -12.649 75.912  116.032 1.00 27.77  ? 293 ARG D N   1 
ATOM   7825 C CA  . ARG D 2 119 ? -13.413 75.992  114.806 1.00 28.59  ? 293 ARG D CA  1 
ATOM   7826 C C   . ARG D 2 119 ? -12.637 76.757  113.722 1.00 27.72  ? 293 ARG D C   1 
ATOM   7827 O O   . ARG D 2 119 ? -12.664 76.374  112.553 1.00 27.10  ? 293 ARG D O   1 
ATOM   7828 C CB  . ARG D 2 119 ? -14.813 76.561  115.086 1.00 29.32  ? 293 ARG D CB  1 
ATOM   7829 C CG  . ARG D 2 119 ? -15.778 75.486  115.613 1.00 33.41  ? 293 ARG D CG  1 
ATOM   7830 C CD  . ARG D 2 119 ? -17.225 75.945  115.875 1.00 42.54  ? 293 ARG D CD  1 
ATOM   7831 N NE  . ARG D 2 119 ? -18.108 74.789  116.094 1.00 49.34  ? 293 ARG D NE  1 
ATOM   7832 C CZ  . ARG D 2 119 ? -19.343 74.827  116.618 1.00 52.73  ? 293 ARG D CZ  1 
ATOM   7833 N NH1 . ARG D 2 119 ? -19.903 75.978  116.991 1.00 54.15  ? 293 ARG D NH1 1 
ATOM   7834 N NH2 . ARG D 2 119 ? -20.025 73.694  116.768 1.00 53.81  ? 293 ARG D NH2 1 
ATOM   7835 N N   . MET D 2 120 ? -11.903 77.797  114.124 1.00 27.57  ? 294 MET D N   1 
ATOM   7836 C CA  . MET D 2 120 ? -11.065 78.552  113.187 1.00 27.54  ? 294 MET D CA  1 
ATOM   7837 C C   . MET D 2 120 ? -9.876  77.730  112.710 1.00 27.39  ? 294 MET D C   1 
ATOM   7838 O O   . MET D 2 120 ? -9.517  77.817  111.544 1.00 27.92  ? 294 MET D O   1 
ATOM   7839 C CB  . MET D 2 120 ? -10.627 79.904  113.757 1.00 27.89  ? 294 MET D CB  1 
ATOM   7840 C CG  . MET D 2 120 ? -9.774  80.768  112.798 1.00 28.71  ? 294 MET D CG  1 
ATOM   7841 S SD  . MET D 2 120 ? -10.702 81.381  111.377 1.00 33.12  ? 294 MET D SD  1 
ATOM   7842 C CE  . MET D 2 120 ? -11.630 82.660  112.165 1.00 28.72  ? 294 MET D CE  1 
ATOM   7843 N N   . GLU D 2 121 ? -9.283  76.915  113.579 1.00 27.08  ? 295 GLU D N   1 
ATOM   7844 C CA  . GLU D 2 121 ? -8.273  75.960  113.125 1.00 27.22  ? 295 GLU D CA  1 
ATOM   7845 C C   . GLU D 2 121 ? -8.828  75.175  111.936 1.00 27.14  ? 295 GLU D C   1 
ATOM   7846 O O   . GLU D 2 121 ? -8.201  75.125  110.882 1.00 27.48  ? 295 GLU D O   1 
ATOM   7847 C CB  . GLU D 2 121 ? -7.843  74.995  114.244 1.00 27.76  ? 295 GLU D CB  1 
ATOM   7848 C CG  . GLU D 2 121 ? -6.744  74.024  113.823 1.00 29.15  ? 295 GLU D CG  1 
ATOM   7849 C CD  . GLU D 2 121 ? -6.494  72.902  114.819 1.00 31.56  ? 295 GLU D CD  1 
ATOM   7850 O OE1 . GLU D 2 121 ? -7.437  72.120  115.098 1.00 33.37  ? 295 GLU D OE1 1 
ATOM   7851 O OE2 . GLU D 2 121 ? -5.342  72.779  115.303 1.00 31.54  ? 295 GLU D OE2 1 
ATOM   7852 N N   . HIS D 2 122 ? -10.020 74.599  112.102 1.00 26.55  ? 296 HIS D N   1 
ATOM   7853 C CA  . HIS D 2 122 ? -10.651 73.802  111.057 1.00 26.36  ? 296 HIS D CA  1 
ATOM   7854 C C   . HIS D 2 122 ? -10.969 74.596  109.783 1.00 25.86  ? 296 HIS D C   1 
ATOM   7855 O O   . HIS D 2 122 ? -10.730 74.109  108.688 1.00 25.99  ? 296 HIS D O   1 
ATOM   7856 C CB  . HIS D 2 122 ? -11.921 73.120  111.593 1.00 26.82  ? 296 HIS D CB  1 
ATOM   7857 C CG  . HIS D 2 122 ? -12.300 71.872  110.854 1.00 28.26  ? 296 HIS D CG  1 
ATOM   7858 N ND1 . HIS D 2 122 ? -11.624 71.428  109.737 1.00 31.51  ? 296 HIS D ND1 1 
ATOM   7859 C CD2 . HIS D 2 122 ? -13.289 70.975  111.073 1.00 31.19  ? 296 HIS D CD2 1 
ATOM   7860 C CE1 . HIS D 2 122 ? -12.181 70.314  109.298 1.00 32.49  ? 296 HIS D CE1 1 
ATOM   7861 N NE2 . HIS D 2 122 ? -13.199 70.021  110.087 1.00 33.35  ? 296 HIS D NE2 1 
ATOM   7862 N N   . LEU D 2 123 ? -11.518 75.801  109.926 1.00 25.53  ? 297 LEU D N   1 
ATOM   7863 C CA  . LEU D 2 123 ? -11.798 76.646  108.767 1.00 25.34  ? 297 LEU D CA  1 
ATOM   7864 C C   . LEU D 2 123 ? -10.525 77.000  108.001 1.00 25.25  ? 297 LEU D C   1 
ATOM   7865 O O   . LEU D 2 123 ? -10.509 76.937  106.789 1.00 24.60  ? 297 LEU D O   1 
ATOM   7866 C CB  . LEU D 2 123 ? -12.590 77.899  109.151 1.00 25.16  ? 297 LEU D CB  1 
ATOM   7867 C CG  . LEU D 2 123 ? -12.913 78.886  108.017 1.00 24.94  ? 297 LEU D CG  1 
ATOM   7868 C CD1 . LEU D 2 123 ? -13.777 78.244  106.929 1.00 22.83  ? 297 LEU D CD1 1 
ATOM   7869 C CD2 . LEU D 2 123 ? -13.589 80.130  108.587 1.00 24.90  ? 297 LEU D CD2 1 
ATOM   7870 N N   . VAL D 2 124 ? -9.449  77.330  108.714 1.00 25.94  ? 298 VAL D N   1 
ATOM   7871 C CA  . VAL D 2 124 ? -8.156  77.601  108.076 1.00 25.52  ? 298 VAL D CA  1 
ATOM   7872 C C   . VAL D 2 124 ? -7.609  76.420  107.247 1.00 26.45  ? 298 VAL D C   1 
ATOM   7873 O O   . VAL D 2 124 ? -7.147  76.604  106.113 1.00 26.68  ? 298 VAL D O   1 
ATOM   7874 C CB  . VAL D 2 124 ? -7.106  78.089  109.108 1.00 25.45  ? 298 VAL D CB  1 
ATOM   7875 C CG1 . VAL D 2 124 ? -5.720  78.072  108.521 1.00 23.73  ? 298 VAL D CG1 1 
ATOM   7876 C CG2 . VAL D 2 124 ? -7.447  79.493  109.594 1.00 22.68  ? 298 VAL D CG2 1 
ATOM   7877 N N   . LEU D 2 125 ? -7.664  75.212  107.801 1.00 27.22  ? 299 LEU D N   1 
ATOM   7878 C CA  . LEU D 2 125 ? -7.254  74.013  107.064 1.00 27.95  ? 299 LEU D CA  1 
ATOM   7879 C C   . LEU D 2 125 ? -8.051  73.821  105.768 1.00 28.25  ? 299 LEU D C   1 
ATOM   7880 O O   . LEU D 2 125 ? -7.485  73.420  104.753 1.00 28.55  ? 299 LEU D O   1 
ATOM   7881 C CB  . LEU D 2 125 ? -7.382  72.755  107.939 1.00 28.06  ? 299 LEU D CB  1 
ATOM   7882 C CG  . LEU D 2 125 ? -6.347  72.597  109.058 1.00 29.03  ? 299 LEU D CG  1 
ATOM   7883 C CD1 . LEU D 2 125 ? -6.743  71.474  110.038 1.00 28.75  ? 299 LEU D CD1 1 
ATOM   7884 C CD2 . LEU D 2 125 ? -4.969  72.336  108.457 1.00 27.98  ? 299 LEU D CD2 1 
ATOM   7885 N N   . LYS D 2 126 ? -9.357  74.090  105.816 1.00 28.25  ? 300 LYS D N   1 
ATOM   7886 C CA  . LYS D 2 126 ? -10.229 73.952  104.644 1.00 28.74  ? 300 LYS D CA  1 
ATOM   7887 C C   . LYS D 2 126 ? -9.964  75.017  103.585 1.00 28.38  ? 300 LYS D C   1 
ATOM   7888 O O   . LYS D 2 126 ? -9.990  74.731  102.387 1.00 28.64  ? 300 LYS D O   1 
ATOM   7889 C CB  . LYS D 2 126 ? -11.704 73.998  105.056 1.00 28.93  ? 300 LYS D CB  1 
ATOM   7890 C CG  . LYS D 2 126 ? -12.232 72.691  105.637 1.00 30.48  ? 300 LYS D CG  1 
ATOM   7891 C CD  . LYS D 2 126 ? -13.742 72.757  105.897 1.00 33.62  ? 300 LYS D CD  1 
ATOM   7892 C CE  . LYS D 2 126 ? -14.059 73.379  107.250 1.00 35.84  ? 300 LYS D CE  1 
ATOM   7893 N NZ  . LYS D 2 126 ? -15.413 74.030  107.288 1.00 38.56  ? 300 LYS D NZ  1 
ATOM   7894 N N   . VAL D 2 127 ? -9.720  76.246  104.031 1.00 27.93  ? 301 VAL D N   1 
ATOM   7895 C CA  . VAL D 2 127 ? -9.384  77.347  103.128 1.00 27.70  ? 301 VAL D CA  1 
ATOM   7896 C C   . VAL D 2 127 ? -8.041  77.111  102.437 1.00 28.12  ? 301 VAL D C   1 
ATOM   7897 O O   . VAL D 2 127 ? -7.901  77.411  101.257 1.00 28.48  ? 301 VAL D O   1 
ATOM   7898 C CB  . VAL D 2 127 ? -9.415  78.705  103.862 1.00 27.73  ? 301 VAL D CB  1 
ATOM   7899 C CG1 . VAL D 2 127 ? -8.698  79.792  103.069 1.00 27.43  ? 301 VAL D CG1 1 
ATOM   7900 C CG2 . VAL D 2 127 ? -10.856 79.104  104.137 1.00 26.47  ? 301 VAL D CG2 1 
ATOM   7901 N N   . LEU D 2 128 ? -7.079  76.547  103.164 1.00 28.32  ? 302 LEU D N   1 
ATOM   7902 C CA  . LEU D 2 128 ? -5.756  76.244  102.624 1.00 28.99  ? 302 LEU D CA  1 
ATOM   7903 C C   . LEU D 2 128 ? -5.711  74.866  101.980 1.00 29.00  ? 302 LEU D C   1 
ATOM   7904 O O   . LEU D 2 128 ? -4.659  74.423  101.532 1.00 28.96  ? 302 LEU D O   1 
ATOM   7905 C CB  . LEU D 2 128 ? -4.692  76.318  103.732 1.00 29.13  ? 302 LEU D CB  1 
ATOM   7906 C CG  . LEU D 2 128 ? -4.595  77.601  104.553 1.00 30.34  ? 302 LEU D CG  1 
ATOM   7907 C CD1 . LEU D 2 128 ? -3.530  77.460  105.609 1.00 32.25  ? 302 LEU D CD1 1 
ATOM   7908 C CD2 . LEU D 2 128 ? -4.300  78.791  103.667 1.00 31.62  ? 302 LEU D CD2 1 
ATOM   7909 N N   . THR D 2 129 ? -6.861  74.199  101.938 1.00 29.45  ? 303 THR D N   1 
ATOM   7910 C CA  . THR D 2 129 ? -6.969  72.809  101.479 1.00 29.90  ? 303 THR D CA  1 
ATOM   7911 C C   . THR D 2 129 ? -5.821  71.953  102.009 1.00 30.37  ? 303 THR D C   1 
ATOM   7912 O O   . THR D 2 129 ? -5.249  71.142  101.281 1.00 29.64  ? 303 THR D O   1 
ATOM   7913 C CB  . THR D 2 129 ? -7.074  72.714  99.919  1.00 30.25  ? 303 THR D CB  1 
ATOM   7914 O OG1 . THR D 2 129 ? -5.937  73.338  99.315  1.00 30.04  ? 303 THR D OG1 1 
ATOM   7915 C CG2 . THR D 2 129 ? -8.243  73.520  99.385  1.00 29.08  ? 303 THR D CG2 1 
ATOM   7916 N N   . PHE D 2 130 ? -5.484  72.158  103.287 1.00 31.33  ? 304 PHE D N   1 
ATOM   7917 C CA  . PHE D 2 130 ? -4.462  71.372  103.985 1.00 32.17  ? 304 PHE D CA  1 
ATOM   7918 C C   . PHE D 2 130 ? -3.042  71.512  103.415 1.00 32.68  ? 304 PHE D C   1 
ATOM   7919 O O   . PHE D 2 130 ? -2.182  70.688  103.715 1.00 32.37  ? 304 PHE D O   1 
ATOM   7920 C CB  . PHE D 2 130 ? -4.847  69.890  103.990 1.00 32.47  ? 304 PHE D CB  1 
ATOM   7921 C CG  . PHE D 2 130 ? -5.464  69.410  105.271 1.00 33.65  ? 304 PHE D CG  1 
ATOM   7922 C CD1 . PHE D 2 130 ? -4.663  69.041  106.358 1.00 34.78  ? 304 PHE D CD1 1 
ATOM   7923 C CD2 . PHE D 2 130 ? -6.845  69.273  105.376 1.00 33.50  ? 304 PHE D CD2 1 
ATOM   7924 C CE1 . PHE D 2 130 ? -5.245  68.566  107.540 1.00 35.33  ? 304 PHE D CE1 1 
ATOM   7925 C CE2 . PHE D 2 130 ? -7.437  68.801  106.542 1.00 33.56  ? 304 PHE D CE2 1 
ATOM   7926 C CZ  . PHE D 2 130 ? -6.642  68.442  107.626 1.00 34.94  ? 304 PHE D CZ  1 
ATOM   7927 N N   . ASP D 2 131 ? -2.796  72.526  102.585 1.00 33.72  ? 305 ASP D N   1 
ATOM   7928 C CA  . ASP D 2 131 ? -1.450  72.734  102.036 1.00 34.94  ? 305 ASP D CA  1 
ATOM   7929 C C   . ASP D 2 131 ? -0.612  73.544  103.015 1.00 35.14  ? 305 ASP D C   1 
ATOM   7930 O O   . ASP D 2 131 ? -0.594  74.772  102.980 1.00 34.91  ? 305 ASP D O   1 
ATOM   7931 C CB  . ASP D 2 131 ? -1.487  73.367  100.638 1.00 35.17  ? 305 ASP D CB  1 
ATOM   7932 C CG  . ASP D 2 131 ? -2.059  72.413  99.579  1.00 37.59  ? 305 ASP D CG  1 
ATOM   7933 O OD1 . ASP D 2 131 ? -1.501  71.304  99.369  1.00 38.98  ? 305 ASP D OD1 1 
ATOM   7934 O OD2 . ASP D 2 131 ? -3.084  72.685  98.920  1.00 39.83  ? 305 ASP D OD2 1 
ATOM   7935 N N   . LEU D 2 132 ? 0.076   72.838  103.905 1.00 35.64  ? 306 LEU D N   1 
ATOM   7936 C CA  . LEU D 2 132 ? 0.729   73.501  105.025 1.00 36.32  ? 306 LEU D CA  1 
ATOM   7937 C C   . LEU D 2 132 ? 2.247   73.543  104.886 1.00 36.58  ? 306 LEU D C   1 
ATOM   7938 O O   . LEU D 2 132 ? 2.903   74.362  105.526 1.00 36.38  ? 306 LEU D O   1 
ATOM   7939 C CB  . LEU D 2 132 ? 0.304   72.856  106.354 1.00 36.35  ? 306 LEU D CB  1 
ATOM   7940 C CG  . LEU D 2 132 ? -1.162  72.989  106.809 1.00 36.52  ? 306 LEU D CG  1 
ATOM   7941 C CD1 . LEU D 2 132 ? -1.270  72.805  108.309 1.00 36.27  ? 306 LEU D CD1 1 
ATOM   7942 C CD2 . LEU D 2 132 ? -1.789  74.319  106.413 1.00 36.61  ? 306 LEU D CD2 1 
ATOM   7943 N N   . ALA D 2 133 ? 2.786   72.677  104.032 1.00 37.15  ? 307 ALA D N   1 
ATOM   7944 C CA  . ALA D 2 133 ? 4.230   72.538  103.864 1.00 37.95  ? 307 ALA D CA  1 
ATOM   7945 C C   . ALA D 2 133 ? 4.831   73.669  103.020 1.00 38.33  ? 307 ALA D C   1 
ATOM   7946 O O   . ALA D 2 133 ? 5.578   73.421  102.070 1.00 38.59  ? 307 ALA D O   1 
ATOM   7947 C CB  . ALA D 2 133 ? 4.564   71.168  103.262 1.00 37.98  ? 307 ALA D CB  1 
ATOM   7948 N N   . ALA D 2 134 ? 4.526   74.907  103.398 1.00 38.76  ? 308 ALA D N   1 
ATOM   7949 C CA  . ALA D 2 134 ? 4.920   76.082  102.629 1.00 39.40  ? 308 ALA D CA  1 
ATOM   7950 C C   . ALA D 2 134 ? 6.405   76.404  102.786 1.00 39.96  ? 308 ALA D C   1 
ATOM   7951 O O   . ALA D 2 134 ? 6.932   76.399  103.910 1.00 40.21  ? 308 ALA D O   1 
ATOM   7952 C CB  . ALA D 2 134 ? 4.080   77.271  103.037 1.00 39.04  ? 308 ALA D CB  1 
ATOM   7953 N N   . PRO D 2 135 ? 7.087   76.686  101.673 1.00 40.42  ? 309 PRO D N   1 
ATOM   7954 C CA  . PRO D 2 135 ? 8.476   77.152  101.744 1.00 40.60  ? 309 PRO D CA  1 
ATOM   7955 C C   . PRO D 2 135 ? 8.483   78.554  102.324 1.00 40.77  ? 309 PRO D C   1 
ATOM   7956 O O   . PRO D 2 135 ? 7.586   79.350  102.057 1.00 40.54  ? 309 PRO D O   1 
ATOM   7957 C CB  . PRO D 2 135 ? 8.932   77.176  100.277 1.00 40.75  ? 309 PRO D CB  1 
ATOM   7958 C CG  . PRO D 2 135 ? 7.899   76.421  99.533  1.00 40.47  ? 309 PRO D CG  1 
ATOM   7959 C CD  . PRO D 2 135 ? 6.606   76.608  100.283 1.00 40.25  ? 309 PRO D CD  1 
ATOM   7960 N N   . THR D 2 136 ? 9.493   78.833  103.131 1.00 41.29  ? 310 THR D N   1 
ATOM   7961 C CA  . THR D 2 136 ? 9.615   80.107  103.814 1.00 41.54  ? 310 THR D CA  1 
ATOM   7962 C C   . THR D 2 136 ? 10.984  80.689  103.515 1.00 41.84  ? 310 THR D C   1 
ATOM   7963 O O   . THR D 2 136 ? 11.908  79.957  103.121 1.00 41.45  ? 310 THR D O   1 
ATOM   7964 C CB  . THR D 2 136 ? 9.504   79.887  105.336 1.00 41.66  ? 310 THR D CB  1 
ATOM   7965 O OG1 . THR D 2 136 ? 10.403  78.835  105.726 1.00 41.35  ? 310 THR D OG1 1 
ATOM   7966 C CG2 . THR D 2 136 ? 8.116   79.338  105.716 1.00 42.34  ? 310 THR D CG2 1 
ATOM   7967 N N   . VAL D 2 137 ? 11.102  81.998  103.731 1.00 42.27  ? 311 VAL D N   1 
ATOM   7968 C CA  . VAL D 2 137 ? 12.373  82.713  103.722 1.00 43.09  ? 311 VAL D CA  1 
ATOM   7969 C C   . VAL D 2 137 ? 13.428  81.969  104.535 1.00 43.90  ? 311 VAL D C   1 
ATOM   7970 O O   . VAL D 2 137 ? 14.580  81.822  104.100 1.00 44.29  ? 311 VAL D O   1 
ATOM   7971 C CB  . VAL D 2 137 ? 12.193  84.134  104.301 1.00 43.21  ? 311 VAL D CB  1 
ATOM   7972 C CG1 . VAL D 2 137 ? 13.545  84.760  104.686 1.00 42.22  ? 311 VAL D CG1 1 
ATOM   7973 C CG2 . VAL D 2 137 ? 11.432  85.012  103.311 1.00 42.22  ? 311 VAL D CG2 1 
ATOM   7974 N N   . ASN D 2 138 ? 13.013  81.498  105.708 1.00 44.63  ? 312 ASN D N   1 
ATOM   7975 C CA  . ASN D 2 138 ? 13.862  80.782  106.650 1.00 45.27  ? 312 ASN D CA  1 
ATOM   7976 C C   . ASN D 2 138 ? 14.408  79.483  106.062 1.00 45.60  ? 312 ASN D C   1 
ATOM   7977 O O   . ASN D 2 138 ? 15.578  79.141  106.275 1.00 45.96  ? 312 ASN D O   1 
ATOM   7978 C CB  . ASN D 2 138 ? 13.057  80.512  107.922 1.00 45.48  ? 312 ASN D CB  1 
ATOM   7979 C CG  . ASN D 2 138 ? 13.917  80.101  109.094 1.00 46.61  ? 312 ASN D CG  1 
ATOM   7980 O OD1 . ASN D 2 138 ? 14.482  80.944  109.785 1.00 48.34  ? 312 ASN D OD1 1 
ATOM   7981 N ND2 . ASN D 2 138 ? 13.989  78.798  109.351 1.00 46.89  ? 312 ASN D ND2 1 
ATOM   7982 N N   . GLN D 2 139 ? 13.570  78.769  105.310 1.00 45.84  ? 313 GLN D N   1 
ATOM   7983 C CA  . GLN D 2 139 ? 13.973  77.506  104.684 1.00 46.18  ? 313 GLN D CA  1 
ATOM   7984 C C   . GLN D 2 139 ? 15.013  77.744  103.601 1.00 45.88  ? 313 GLN D C   1 
ATOM   7985 O O   . GLN D 2 139 ? 15.895  76.913  103.376 1.00 45.88  ? 313 GLN D O   1 
ATOM   7986 C CB  . GLN D 2 139 ? 12.771  76.791  104.075 1.00 46.32  ? 313 GLN D CB  1 
ATOM   7987 C CG  . GLN D 2 139 ? 11.995  75.944  105.047 1.00 48.01  ? 313 GLN D CG  1 
ATOM   7988 C CD  . GLN D 2 139 ? 10.829  75.243  104.387 1.00 49.65  ? 313 GLN D CD  1 
ATOM   7989 O OE1 . GLN D 2 139 ? 11.023  74.304  103.611 1.00 51.02  ? 313 GLN D OE1 1 
ATOM   7990 N NE2 . GLN D 2 139 ? 9.615   75.692  104.688 1.00 49.78  ? 313 GLN D NE2 1 
ATOM   7991 N N   . PHE D 2 140 ? 14.885  78.880  102.926 1.00 45.74  ? 314 PHE D N   1 
ATOM   7992 C CA  . PHE D 2 140 ? 15.835  79.278  101.900 1.00 45.69  ? 314 PHE D CA  1 
ATOM   7993 C C   . PHE D 2 140 ? 17.149  79.781  102.518 1.00 46.11  ? 314 PHE D C   1 
ATOM   7994 O O   . PHE D 2 140 ? 18.227  79.337  102.103 1.00 45.94  ? 314 PHE D O   1 
ATOM   7995 C CB  . PHE D 2 140 ? 15.203  80.289  100.935 1.00 45.06  ? 314 PHE D CB  1 
ATOM   7996 C CG  . PHE D 2 140 ? 14.315  79.652  99.900  1.00 44.11  ? 314 PHE D CG  1 
ATOM   7997 C CD1 . PHE D 2 140 ? 14.860  78.854  98.894  1.00 43.10  ? 314 PHE D CD1 1 
ATOM   7998 C CD2 . PHE D 2 140 ? 12.933  79.834  99.935  1.00 42.44  ? 314 PHE D CD2 1 
ATOM   7999 C CE1 . PHE D 2 140 ? 14.048  78.248  97.935  1.00 41.99  ? 314 PHE D CE1 1 
ATOM   8000 C CE2 . PHE D 2 140 ? 12.112  79.240  98.982  1.00 41.36  ? 314 PHE D CE2 1 
ATOM   8001 C CZ  . PHE D 2 140 ? 12.676  78.443  97.975  1.00 41.79  ? 314 PHE D CZ  1 
ATOM   8002 N N   . LEU D 2 141 ? 17.052  80.664  103.522 1.00 46.59  ? 315 LEU D N   1 
ATOM   8003 C CA  . LEU D 2 141 ? 18.226  81.209  104.222 1.00 47.52  ? 315 LEU D CA  1 
ATOM   8004 C C   . LEU D 2 141 ? 19.124  80.098  104.734 1.00 48.53  ? 315 LEU D C   1 
ATOM   8005 O O   . LEU D 2 141 ? 20.342  80.147  104.594 1.00 48.66  ? 315 LEU D O   1 
ATOM   8006 C CB  . LEU D 2 141 ? 17.815  82.093  105.407 1.00 47.03  ? 315 LEU D CB  1 
ATOM   8007 C CG  . LEU D 2 141 ? 17.379  83.553  105.230 1.00 46.00  ? 315 LEU D CG  1 
ATOM   8008 C CD1 . LEU D 2 141 ? 16.889  84.120  106.559 1.00 43.72  ? 315 LEU D CD1 1 
ATOM   8009 C CD2 . LEU D 2 141 ? 18.497  84.418  104.679 1.00 46.17  ? 315 LEU D CD2 1 
ATOM   8010 N N   . THR D 2 142 ? 18.495  79.094  105.330 1.00 50.11  ? 316 THR D N   1 
ATOM   8011 C CA  . THR D 2 142 ? 19.174  77.950  105.917 1.00 51.59  ? 316 THR D CA  1 
ATOM   8012 C C   . THR D 2 142 ? 19.998  77.193  104.866 1.00 52.70  ? 316 THR D C   1 
ATOM   8013 O O   . THR D 2 142 ? 21.094  76.707  105.153 1.00 52.95  ? 316 THR D O   1 
ATOM   8014 C CB  . THR D 2 142 ? 18.111  77.062  106.623 1.00 51.48  ? 316 THR D CB  1 
ATOM   8015 O OG1 . THR D 2 142 ? 18.205  77.253  108.036 1.00 51.51  ? 316 THR D OG1 1 
ATOM   8016 C CG2 . THR D 2 142 ? 18.381  75.593  106.459 1.00 51.56  ? 316 THR D CG2 1 
ATOM   8017 N N   . GLN D 2 143 ? 19.469  77.126  103.647 1.00 54.26  ? 317 GLN D N   1 
ATOM   8018 C CA  . GLN D 2 143 ? 20.160  76.531  102.509 1.00 55.76  ? 317 GLN D CA  1 
ATOM   8019 C C   . GLN D 2 143 ? 21.323  77.402  102.048 1.00 56.71  ? 317 GLN D C   1 
ATOM   8020 O O   . GLN D 2 143 ? 22.301  76.896  101.490 1.00 56.62  ? 317 GLN D O   1 
ATOM   8021 C CB  . GLN D 2 143 ? 19.200  76.378  101.337 1.00 55.97  ? 317 GLN D CB  1 
ATOM   8022 C CG  . GLN D 2 143 ? 18.280  75.202  101.414 1.00 57.25  ? 317 GLN D CG  1 
ATOM   8023 C CD  . GLN D 2 143 ? 17.790  74.784  100.049 1.00 59.67  ? 317 GLN D CD  1 
ATOM   8024 O OE1 . GLN D 2 143 ? 16.844  75.370  99.516  1.00 60.88  ? 317 GLN D OE1 1 
ATOM   8025 N NE2 . GLN D 2 143 ? 18.433  73.774  99.470  1.00 60.65  ? 317 GLN D NE2 1 
ATOM   8026 N N   . TYR D 2 144 ? 21.199  78.713  102.259 1.00 57.91  ? 318 TYR D N   1 
ATOM   8027 C CA  . TYR D 2 144 ? 22.210  79.655  101.796 1.00 59.09  ? 318 TYR D CA  1 
ATOM   8028 C C   . TYR D 2 144 ? 23.416  79.665  102.727 1.00 61.25  ? 318 TYR D C   1 
ATOM   8029 O O   . TYR D 2 144 ? 24.550  79.722  102.258 1.00 61.52  ? 318 TYR D O   1 
ATOM   8030 C CB  . TYR D 2 144 ? 21.636  81.069  101.657 1.00 57.98  ? 318 TYR D CB  1 
ATOM   8031 C CG  . TYR D 2 144 ? 20.556  81.244  100.607 1.00 54.39  ? 318 TYR D CG  1 
ATOM   8032 C CD1 . TYR D 2 144 ? 20.300  80.263  99.641  1.00 50.69  ? 318 TYR D CD1 1 
ATOM   8033 C CD2 . TYR D 2 144 ? 19.784  82.409  100.580 1.00 50.76  ? 318 TYR D CD2 1 
ATOM   8034 C CE1 . TYR D 2 144 ? 19.296  80.446  98.681  1.00 48.47  ? 318 TYR D CE1 1 
ATOM   8035 C CE2 . TYR D 2 144 ? 18.795  82.596  99.628  1.00 47.69  ? 318 TYR D CE2 1 
ATOM   8036 C CZ  . TYR D 2 144 ? 18.549  81.618  98.693  1.00 46.86  ? 318 TYR D CZ  1 
ATOM   8037 O OH  . TYR D 2 144 ? 17.558  81.830  97.775  1.00 46.16  ? 318 TYR D OH  1 
ATOM   8038 N N   . PHE D 2 145 ? 23.163  79.603  104.038 1.00 63.91  ? 319 PHE D N   1 
ATOM   8039 C CA  . PHE D 2 145 ? 24.220  79.595  105.057 1.00 66.55  ? 319 PHE D CA  1 
ATOM   8040 C C   . PHE D 2 145 ? 25.276  78.526  104.794 1.00 68.91  ? 319 PHE D C   1 
ATOM   8041 O O   . PHE D 2 145 ? 26.439  78.705  105.156 1.00 69.34  ? 319 PHE D O   1 
ATOM   8042 C CB  . PHE D 2 145 ? 23.642  79.388  106.461 1.00 66.03  ? 319 PHE D CB  1 
ATOM   8043 C CG  . PHE D 2 145 ? 22.672  80.459  106.900 1.00 66.07  ? 319 PHE D CG  1 
ATOM   8044 C CD1 . PHE D 2 145 ? 22.686  81.734  106.323 1.00 65.28  ? 319 PHE D CD1 1 
ATOM   8045 C CD2 . PHE D 2 145 ? 21.745  80.190  107.908 1.00 65.18  ? 319 PHE D CD2 1 
ATOM   8046 C CE1 . PHE D 2 145 ? 21.790  82.713  106.733 1.00 64.81  ? 319 PHE D CE1 1 
ATOM   8047 C CE2 . PHE D 2 145 ? 20.846  81.164  108.329 1.00 64.74  ? 319 PHE D CE2 1 
ATOM   8048 C CZ  . PHE D 2 145 ? 20.866  82.429  107.739 1.00 65.00  ? 319 PHE D CZ  1 
ATOM   8049 N N   . LEU D 2 146 ? 24.868  77.423  104.166 1.00 71.77  ? 320 LEU D N   1 
ATOM   8050 C CA  . LEU D 2 146 ? 25.786  76.348  103.781 1.00 74.68  ? 320 LEU D CA  1 
ATOM   8051 C C   . LEU D 2 146 ? 26.806  76.780  102.716 1.00 76.90  ? 320 LEU D C   1 
ATOM   8052 O O   . LEU D 2 146 ? 27.797  76.084  102.480 1.00 77.14  ? 320 LEU D O   1 
ATOM   8053 C CB  . LEU D 2 146 ? 25.008  75.118  103.291 1.00 74.46  ? 320 LEU D CB  1 
ATOM   8054 C CG  . LEU D 2 146 ? 24.287  74.224  104.308 1.00 74.66  ? 320 LEU D CG  1 
ATOM   8055 C CD1 . LEU D 2 146 ? 23.532  73.116  103.587 1.00 74.59  ? 320 LEU D CD1 1 
ATOM   8056 C CD2 . LEU D 2 146 ? 25.238  73.633  105.349 1.00 74.40  ? 320 LEU D CD2 1 
ATOM   8057 N N   . HIS D 2 147 ? 26.560  77.922  102.077 1.00 79.68  ? 321 HIS D N   1 
ATOM   8058 C CA  . HIS D 2 147 ? 27.472  78.461  101.072 1.00 82.43  ? 321 HIS D CA  1 
ATOM   8059 C C   . HIS D 2 147 ? 28.421  79.509  101.664 1.00 84.18  ? 321 HIS D C   1 
ATOM   8060 O O   . HIS D 2 147 ? 29.113  80.217  100.931 1.00 84.51  ? 321 HIS D O   1 
ATOM   8061 C CB  . HIS D 2 147 ? 26.687  79.025  99.883  1.00 82.55  ? 321 HIS D CB  1 
ATOM   8062 C CG  . HIS D 2 147 ? 26.103  77.974  98.989  1.00 83.53  ? 321 HIS D CG  1 
ATOM   8063 N ND1 . HIS D 2 147 ? 26.233  78.008  97.617  1.00 84.29  ? 321 HIS D ND1 1 
ATOM   8064 C CD2 . HIS D 2 147 ? 25.386  76.859  99.269  1.00 84.43  ? 321 HIS D CD2 1 
ATOM   8065 C CE1 . HIS D 2 147 ? 25.626  76.959  97.091  1.00 84.61  ? 321 HIS D CE1 1 
ATOM   8066 N NE2 . HIS D 2 147 ? 25.104  76.246  98.072  1.00 84.69  ? 321 HIS D NE2 1 
ATOM   8067 N N   . GLN D 2 148 ? 28.439  79.606  102.993 1.00 86.36  ? 322 GLN D N   1 
ATOM   8068 C CA  . GLN D 2 148 ? 29.435  80.400  103.705 1.00 88.41  ? 322 GLN D CA  1 
ATOM   8069 C C   . GLN D 2 148 ? 30.717  79.595  103.764 1.00 89.61  ? 322 GLN D C   1 
ATOM   8070 O O   . GLN D 2 148 ? 30.689  78.402  104.069 1.00 89.85  ? 322 GLN D O   1 
ATOM   8071 C CB  . GLN D 2 148 ? 28.981  80.697  105.132 1.00 88.49  ? 322 GLN D CB  1 
ATOM   8072 C CG  . GLN D 2 148 ? 27.955  81.799  105.261 1.00 89.48  ? 322 GLN D CG  1 
ATOM   8073 C CD  . GLN D 2 148 ? 27.914  82.383  106.659 1.00 90.59  ? 322 GLN D CD  1 
ATOM   8074 O OE1 . GLN D 2 148 ? 28.336  83.520  106.871 1.00 91.06  ? 322 GLN D OE1 1 
ATOM   8075 N NE2 . GLN D 2 148 ? 27.407  81.610  107.617 1.00 90.71  ? 322 GLN D NE2 1 
ATOM   8076 N N   . GLN D 2 149 ? 31.839  80.245  103.474 1.00 91.14  ? 323 GLN D N   1 
ATOM   8077 C CA  . GLN D 2 149 ? 33.138  79.573  103.508 1.00 92.52  ? 323 GLN D CA  1 
ATOM   8078 C C   . GLN D 2 149 ? 33.604  79.381  104.961 1.00 92.66  ? 323 GLN D C   1 
ATOM   8079 O O   . GLN D 2 149 ? 33.730  78.238  105.411 1.00 92.80  ? 323 GLN D O   1 
ATOM   8080 C CB  . GLN D 2 149 ? 34.168  80.297  102.631 1.00 92.96  ? 323 GLN D CB  1 
ATOM   8081 C CG  . GLN D 2 149 ? 33.560  81.058  101.438 1.00 95.32  ? 323 GLN D CG  1 
ATOM   8082 C CD  . GLN D 2 149 ? 33.019  80.150  100.332 1.00 97.95  ? 323 GLN D CD  1 
ATOM   8083 O OE1 . GLN D 2 149 ? 33.485  79.021  100.150 1.00 99.06  ? 323 GLN D OE1 1 
ATOM   8084 N NE2 . GLN D 2 149 ? 32.036  80.651  99.589  1.00 98.93  ? 323 GLN D NE2 1 
ATOM   8085 N N   . PRO D 2 150 ? 33.852  80.471  105.696 1.00 92.76  ? 324 PRO D N   1 
ATOM   8086 C CA  . PRO D 2 150 ? 33.827  80.399  107.160 1.00 92.54  ? 324 PRO D CA  1 
ATOM   8087 C C   . PRO D 2 150 ? 32.405  80.676  107.662 1.00 92.01  ? 324 PRO D C   1 
ATOM   8088 O O   . PRO D 2 150 ? 31.828  81.719  107.329 1.00 92.10  ? 324 PRO D O   1 
ATOM   8089 C CB  . PRO D 2 150 ? 34.800  81.505  107.590 1.00 92.65  ? 324 PRO D CB  1 
ATOM   8090 C CG  . PRO D 2 150 ? 34.856  82.475  106.429 1.00 92.97  ? 324 PRO D CG  1 
ATOM   8091 C CD  . PRO D 2 150 ? 34.213  81.825  105.226 1.00 92.88  ? 324 PRO D CD  1 
ATOM   8092 N N   . ALA D 2 151 ? 31.842  79.741  108.425 1.00 91.15  ? 325 ALA D N   1 
ATOM   8093 C CA  . ALA D 2 151 ? 30.482  79.882  108.942 1.00 90.20  ? 325 ALA D CA  1 
ATOM   8094 C C   . ALA D 2 151 ? 30.424  80.928  110.051 1.00 89.38  ? 325 ALA D C   1 
ATOM   8095 O O   . ALA D 2 151 ? 30.830  80.669  111.186 1.00 89.41  ? 325 ALA D O   1 
ATOM   8096 C CB  . ALA D 2 151 ? 29.945  78.536  109.431 1.00 90.37  ? 325 ALA D CB  1 
ATOM   8097 N N   . ASN D 2 152 ? 29.930  82.115  109.707 1.00 88.23  ? 326 ASN D N   1 
ATOM   8098 C CA  . ASN D 2 152 ? 29.810  83.210  110.666 1.00 87.06  ? 326 ASN D CA  1 
ATOM   8099 C C   . ASN D 2 152 ? 28.429  83.234  111.301 1.00 86.13  ? 326 ASN D C   1 
ATOM   8100 O O   . ASN D 2 152 ? 27.418  83.352  110.604 1.00 86.14  ? 326 ASN D O   1 
ATOM   8101 C CB  . ASN D 2 152 ? 30.114  84.557  110.000 1.00 87.18  ? 326 ASN D CB  1 
ATOM   8102 C CG  . ASN D 2 152 ? 30.492  85.636  111.002 1.00 86.95  ? 326 ASN D CG  1 
ATOM   8103 O OD1 . ASN D 2 152 ? 29.718  85.975  111.898 1.00 86.22  ? 326 ASN D OD1 1 
ATOM   8104 N ND2 . ASN D 2 152 ? 31.689  86.187  110.845 1.00 87.38  ? 326 ASN D ND2 1 
ATOM   8105 N N   . CYS D 2 153 ? 28.399  83.126  112.627 1.00 84.81  ? 327 CYS D N   1 
ATOM   8106 C CA  . CYS D 2 153 ? 27.150  83.051  113.383 1.00 83.55  ? 327 CYS D CA  1 
ATOM   8107 C C   . CYS D 2 153 ? 26.416  84.394  113.495 1.00 82.30  ? 327 CYS D C   1 
ATOM   8108 O O   . CYS D 2 153 ? 25.199  84.424  113.692 1.00 82.21  ? 327 CYS D O   1 
ATOM   8109 C CB  . CYS D 2 153 ? 27.403  82.454  114.772 1.00 83.78  ? 327 CYS D CB  1 
ATOM   8110 S SG  . CYS D 2 153 ? 28.677  83.303  115.741 1.00 84.56  ? 327 CYS D SG  1 
ATOM   8111 N N   . LYS D 2 154 ? 27.155  85.494  113.369 1.00 80.72  ? 328 LYS D N   1 
ATOM   8112 C CA  . LYS D 2 154 ? 26.573  86.836  113.430 1.00 79.18  ? 328 LYS D CA  1 
ATOM   8113 C C   . LYS D 2 154 ? 25.909  87.227  112.112 1.00 77.75  ? 328 LYS D C   1 
ATOM   8114 O O   . LYS D 2 154 ? 24.915  87.958  112.104 1.00 77.62  ? 328 LYS D O   1 
ATOM   8115 C CB  . LYS D 2 154 ? 27.636  87.869  113.810 1.00 79.46  ? 328 LYS D CB  1 
ATOM   8116 C CG  . LYS D 2 154 ? 27.275  88.704  115.032 1.00 80.02  ? 328 LYS D CG  1 
ATOM   8117 C CD  . LYS D 2 154 ? 28.518  89.197  115.751 1.00 81.37  ? 328 LYS D CD  1 
ATOM   8118 C CE  . LYS D 2 154 ? 28.951  90.563  115.231 1.00 82.21  ? 328 LYS D CE  1 
ATOM   8119 N NZ  . LYS D 2 154 ? 28.767  91.629  116.254 1.00 82.78  ? 328 LYS D NZ  1 
ATOM   8120 N N   . VAL D 2 155 ? 26.478  86.751  111.006 1.00 75.84  ? 329 VAL D N   1 
ATOM   8121 C CA  . VAL D 2 155 ? 25.888  86.930  109.685 1.00 74.06  ? 329 VAL D CA  1 
ATOM   8122 C C   . VAL D 2 155 ? 24.548  86.189  109.632 1.00 72.81  ? 329 VAL D C   1 
ATOM   8123 O O   . VAL D 2 155 ? 23.521  86.782  109.274 1.00 72.77  ? 329 VAL D O   1 
ATOM   8124 C CB  . VAL D 2 155 ? 26.835  86.430  108.559 1.00 74.16  ? 329 VAL D CB  1 
ATOM   8125 C CG1 . VAL D 2 155 ? 26.097  86.312  107.219 1.00 73.77  ? 329 VAL D CG1 1 
ATOM   8126 C CG2 . VAL D 2 155 ? 28.049  87.349  108.424 1.00 74.19  ? 329 VAL D CG2 1 
ATOM   8127 N N   . GLU D 2 156 ? 24.572  84.907  110.009 1.00 70.88  ? 330 GLU D N   1 
ATOM   8128 C CA  . GLU D 2 156 ? 23.376  84.063  110.051 1.00 69.00  ? 330 GLU D CA  1 
ATOM   8129 C C   . GLU D 2 156 ? 22.261  84.715  110.850 1.00 67.32  ? 330 GLU D C   1 
ATOM   8130 O O   . GLU D 2 156 ? 21.138  84.830  110.366 1.00 67.28  ? 330 GLU D O   1 
ATOM   8131 C CB  . GLU D 2 156 ? 23.692  82.699  110.657 1.00 69.17  ? 330 GLU D CB  1 
ATOM   8132 C CG  . GLU D 2 156 ? 24.391  81.738  109.715 1.00 70.01  ? 330 GLU D CG  1 
ATOM   8133 C CD  . GLU D 2 156 ? 24.838  80.460  110.407 1.00 71.56  ? 330 GLU D CD  1 
ATOM   8134 O OE1 . GLU D 2 156 ? 24.546  80.288  111.613 1.00 71.70  ? 330 GLU D OE1 1 
ATOM   8135 O OE2 . GLU D 2 156 ? 25.489  79.624  109.741 1.00 72.36  ? 330 GLU D OE2 1 
ATOM   8136 N N   . SER D 2 157 ? 22.581  85.151  112.065 1.00 65.22  ? 331 SER D N   1 
ATOM   8137 C CA  . SER D 2 157 ? 21.607  85.796  112.937 1.00 63.34  ? 331 SER D CA  1 
ATOM   8138 C C   . SER D 2 157 ? 20.989  87.031  112.290 1.00 61.99  ? 331 SER D C   1 
ATOM   8139 O O   . SER D 2 157 ? 19.770  87.183  112.284 1.00 61.76  ? 331 SER D O   1 
ATOM   8140 C CB  . SER D 2 157 ? 22.232  86.155  114.285 1.00 63.26  ? 331 SER D CB  1 
ATOM   8141 O OG  . SER D 2 157 ? 22.483  84.989  115.045 1.00 63.21  ? 331 SER D OG  1 
ATOM   8142 N N   . LEU D 2 158 ? 21.829  87.900  111.736 1.00 60.32  ? 332 LEU D N   1 
ATOM   8143 C CA  . LEU D 2 158 ? 21.351  89.143  111.147 1.00 58.69  ? 332 LEU D CA  1 
ATOM   8144 C C   . LEU D 2 158 ? 20.448  88.878  109.948 1.00 57.93  ? 332 LEU D C   1 
ATOM   8145 O O   . LEU D 2 158 ? 19.389  89.503  109.817 1.00 57.59  ? 332 LEU D O   1 
ATOM   8146 C CB  . LEU D 2 158 ? 22.520  90.063  110.772 1.00 58.61  ? 332 LEU D CB  1 
ATOM   8147 C CG  . LEU D 2 158 ? 22.198  91.406  110.104 1.00 57.57  ? 332 LEU D CG  1 
ATOM   8148 C CD1 . LEU D 2 158 ? 21.260  92.285  110.944 1.00 55.50  ? 332 LEU D CD1 1 
ATOM   8149 C CD2 . LEU D 2 158 ? 23.484  92.136  109.786 1.00 57.44  ? 332 LEU D CD2 1 
ATOM   8150 N N   . ALA D 2 159 ? 20.865  87.948  109.090 1.00 56.82  ? 333 ALA D N   1 
ATOM   8151 C CA  . ALA D 2 159 ? 20.037  87.494  107.977 1.00 56.23  ? 333 ALA D CA  1 
ATOM   8152 C C   . ALA D 2 159 ? 18.653  87.047  108.463 1.00 55.75  ? 333 ALA D C   1 
ATOM   8153 O O   . ALA D 2 159 ? 17.633  87.432  107.878 1.00 55.44  ? 333 ALA D O   1 
ATOM   8154 C CB  . ALA D 2 159 ? 20.734  86.375  107.210 1.00 56.23  ? 333 ALA D CB  1 
ATOM   8155 N N   . MET D 2 160 ? 18.633  86.260  109.544 1.00 55.21  ? 334 MET D N   1 
ATOM   8156 C CA  . MET D 2 160 ? 17.392  85.843  110.197 1.00 54.86  ? 334 MET D CA  1 
ATOM   8157 C C   . MET D 2 160 ? 16.559  87.049  110.640 1.00 53.88  ? 334 MET D C   1 
ATOM   8158 O O   . MET D 2 160 ? 15.359  87.093  110.370 1.00 53.90  ? 334 MET D O   1 
ATOM   8159 C CB  . MET D 2 160 ? 17.664  84.897  111.382 1.00 55.31  ? 334 MET D CB  1 
ATOM   8160 C CG  . MET D 2 160 ? 17.768  83.404  111.015 1.00 57.51  ? 334 MET D CG  1 
ATOM   8161 S SD  . MET D 2 160 ? 18.728  82.424  112.239 1.00 63.26  ? 334 MET D SD  1 
ATOM   8162 C CE  . MET D 2 160 ? 18.415  80.738  111.673 1.00 62.05  ? 334 MET D CE  1 
ATOM   8163 N N   . PHE D 2 161 ? 17.197  88.024  111.297 1.00 52.69  ? 335 PHE D N   1 
ATOM   8164 C CA  . PHE D 2 161 ? 16.530  89.263  111.734 1.00 51.39  ? 335 PHE D CA  1 
ATOM   8165 C C   . PHE D 2 161 ? 15.910  90.060  110.581 1.00 50.50  ? 335 PHE D C   1 
ATOM   8166 O O   . PHE D 2 161 ? 14.824  90.617  110.729 1.00 50.30  ? 335 PHE D O   1 
ATOM   8167 C CB  . PHE D 2 161 ? 17.498  90.150  112.532 1.00 51.74  ? 335 PHE D CB  1 
ATOM   8168 C CG  . PHE D 2 161 ? 17.000  91.564  112.767 1.00 52.14  ? 335 PHE D CG  1 
ATOM   8169 C CD1 . PHE D 2 161 ? 15.900  91.811  113.590 1.00 52.06  ? 335 PHE D CD1 1 
ATOM   8170 C CD2 . PHE D 2 161 ? 17.643  92.651  112.170 1.00 52.34  ? 335 PHE D CD2 1 
ATOM   8171 C CE1 . PHE D 2 161 ? 15.440  93.115  113.808 1.00 51.99  ? 335 PHE D CE1 1 
ATOM   8172 C CE2 . PHE D 2 161 ? 17.192  93.962  112.384 1.00 52.66  ? 335 PHE D CE2 1 
ATOM   8173 C CZ  . PHE D 2 161 ? 16.089  94.193  113.205 1.00 52.06  ? 335 PHE D CZ  1 
ATOM   8174 N N   . LEU D 2 162 ? 16.600  90.110  109.443 1.00 49.45  ? 336 LEU D N   1 
ATOM   8175 C CA  . LEU D 2 162 ? 16.120  90.856  108.279 1.00 48.70  ? 336 LEU D CA  1 
ATOM   8176 C C   . LEU D 2 162 ? 14.939  90.157  107.603 1.00 48.36  ? 336 LEU D C   1 
ATOM   8177 O O   . LEU D 2 162 ? 13.921  90.791  107.321 1.00 48.20  ? 336 LEU D O   1 
ATOM   8178 C CB  . LEU D 2 162 ? 17.246  91.096  107.262 1.00 48.36  ? 336 LEU D CB  1 
ATOM   8179 C CG  . LEU D 2 162 ? 18.449  91.978  107.634 1.00 48.21  ? 336 LEU D CG  1 
ATOM   8180 C CD1 . LEU D 2 162 ? 19.568  91.799  106.603 1.00 46.47  ? 336 LEU D CD1 1 
ATOM   8181 C CD2 . LEU D 2 162 ? 18.076  93.457  107.783 1.00 46.30  ? 336 LEU D CD2 1 
ATOM   8182 N N   . GLY D 2 163 ? 15.086  88.857  107.338 1.00 47.98  ? 337 GLY D N   1 
ATOM   8183 C CA  . GLY D 2 163 ? 14.017  88.050  106.768 1.00 47.52  ? 337 GLY D CA  1 
ATOM   8184 C C   . GLY D 2 163 ? 12.765  88.102  107.623 1.00 47.35  ? 337 GLY D C   1 
ATOM   8185 O O   . GLY D 2 163 ? 11.642  88.208  107.103 1.00 47.42  ? 337 GLY D O   1 
ATOM   8186 N N   . GLU D 2 164 ? 12.975  88.057  108.939 1.00 46.76  ? 338 GLU D N   1 
ATOM   8187 C CA  . GLU D 2 164 ? 11.915  88.182  109.929 1.00 46.59  ? 338 GLU D CA  1 
ATOM   8188 C C   . GLU D 2 164 ? 11.308  89.596  109.961 1.00 46.70  ? 338 GLU D C   1 
ATOM   8189 O O   . GLU D 2 164 ? 10.136  89.773  110.308 1.00 46.63  ? 338 GLU D O   1 
ATOM   8190 C CB  . GLU D 2 164 ? 12.458  87.779  111.302 1.00 46.43  ? 338 GLU D CB  1 
ATOM   8191 C CG  . GLU D 2 164 ? 11.434  87.724  112.419 1.00 46.69  ? 338 GLU D CG  1 
ATOM   8192 C CD  . GLU D 2 164 ? 11.834  86.794  113.552 1.00 47.58  ? 338 GLU D CD  1 
ATOM   8193 O OE1 . GLU D 2 164 ? 11.288  86.957  114.661 1.00 48.43  ? 338 GLU D OE1 1 
ATOM   8194 O OE2 . GLU D 2 164 ? 12.674  85.890  113.342 1.00 48.18  ? 338 GLU D OE2 1 
ATOM   8195 N N   . LEU D 2 165 ? 12.100  90.601  109.597 1.00 46.76  ? 339 LEU D N   1 
ATOM   8196 C CA  . LEU D 2 165 ? 11.603  91.971  109.543 1.00 46.88  ? 339 LEU D CA  1 
ATOM   8197 C C   . LEU D 2 165 ? 10.675  92.150  108.349 1.00 46.87  ? 339 LEU D C   1 
ATOM   8198 O O   . LEU D 2 165 ? 9.759   92.976  108.391 1.00 46.97  ? 339 LEU D O   1 
ATOM   8199 C CB  . LEU D 2 165 ? 12.759  92.980  109.455 1.00 47.07  ? 339 LEU D CB  1 
ATOM   8200 C CG  . LEU D 2 165 ? 13.352  93.634  110.715 1.00 47.64  ? 339 LEU D CG  1 
ATOM   8201 C CD1 . LEU D 2 165 ? 13.903  94.989  110.355 1.00 47.88  ? 339 LEU D CD1 1 
ATOM   8202 C CD2 . LEU D 2 165 ? 12.365  93.771  111.863 1.00 47.52  ? 339 LEU D CD2 1 
ATOM   8203 N N   . SER D 2 166 ? 10.916  91.379  107.287 1.00 46.63  ? 340 SER D N   1 
ATOM   8204 C CA  . SER D 2 166 ? 10.091  91.465  106.086 1.00 46.80  ? 340 SER D CA  1 
ATOM   8205 C C   . SER D 2 166 ? 8.658   90.954  106.277 1.00 46.83  ? 340 SER D C   1 
ATOM   8206 O O   . SER D 2 166 ? 7.777   91.275  105.480 1.00 47.13  ? 340 SER D O   1 
ATOM   8207 C CB  . SER D 2 166 ? 10.776  90.806  104.878 1.00 46.84  ? 340 SER D CB  1 
ATOM   8208 O OG  . SER D 2 166 ? 10.765  89.392  104.935 1.00 46.94  ? 340 SER D OG  1 
ATOM   8209 N N   . LEU D 2 167 ? 8.431   90.177  107.339 1.00 46.85  ? 341 LEU D N   1 
ATOM   8210 C CA  . LEU D 2 167 ? 7.104   89.623  107.641 1.00 46.69  ? 341 LEU D CA  1 
ATOM   8211 C C   . LEU D 2 167 ? 6.100   90.669  108.103 1.00 46.89  ? 341 LEU D C   1 
ATOM   8212 O O   . LEU D 2 167 ? 4.899   90.520  107.866 1.00 46.88  ? 341 LEU D O   1 
ATOM   8213 C CB  . LEU D 2 167 ? 7.194   88.520  108.698 1.00 46.40  ? 341 LEU D CB  1 
ATOM   8214 C CG  . LEU D 2 167 ? 8.003   87.256  108.401 1.00 45.94  ? 341 LEU D CG  1 
ATOM   8215 C CD1 . LEU D 2 167 ? 8.022   86.402  109.634 1.00 45.47  ? 341 LEU D CD1 1 
ATOM   8216 C CD2 . LEU D 2 167 ? 7.466   86.471  107.208 1.00 45.12  ? 341 LEU D CD2 1 
ATOM   8217 N N   . ILE D 2 168 ? 6.591   91.712  108.770 1.00 47.13  ? 342 ILE D N   1 
ATOM   8218 C CA  . ILE D 2 168 ? 5.734   92.741  109.359 1.00 47.60  ? 342 ILE D CA  1 
ATOM   8219 C C   . ILE D 2 168 ? 5.032   93.591  108.296 1.00 48.17  ? 342 ILE D C   1 
ATOM   8220 O O   . ILE D 2 168 ? 3.862   93.943  108.459 1.00 48.61  ? 342 ILE D O   1 
ATOM   8221 C CB  . ILE D 2 168 ? 6.542   93.651  110.338 1.00 47.41  ? 342 ILE D CB  1 
ATOM   8222 C CG1 . ILE D 2 168 ? 7.251   92.817  111.416 1.00 46.99  ? 342 ILE D CG1 1 
ATOM   8223 C CG2 . ILE D 2 168 ? 5.650   94.740  110.951 1.00 46.81  ? 342 ILE D CG2 1 
ATOM   8224 C CD1 . ILE D 2 168 ? 6.418   92.506  112.648 1.00 45.87  ? 342 ILE D CD1 1 
ATOM   8225 N N   . ASP D 2 169 ? 5.741   93.912  107.218 1.00 48.76  ? 343 ASP D N   1 
ATOM   8226 C CA  . ASP D 2 169 ? 5.242   94.871  106.236 1.00 49.81  ? 343 ASP D CA  1 
ATOM   8227 C C   . ASP D 2 169 ? 4.867   94.225  104.910 1.00 50.31  ? 343 ASP D C   1 
ATOM   8228 O O   . ASP D 2 169 ? 5.732   93.914  104.081 1.00 50.35  ? 343 ASP D O   1 
ATOM   8229 C CB  . ASP D 2 169 ? 6.252   96.000  106.004 1.00 49.89  ? 343 ASP D CB  1 
ATOM   8230 C CG  . ASP D 2 169 ? 6.559   96.777  107.267 1.00 50.25  ? 343 ASP D CG  1 
ATOM   8231 O OD1 . ASP D 2 169 ? 5.708   97.588  107.697 1.00 50.14  ? 343 ASP D OD1 1 
ATOM   8232 O OD2 . ASP D 2 169 ? 7.628   96.633  107.896 1.00 51.43  ? 343 ASP D OD2 1 
ATOM   8233 N N   . ALA D 2 170 ? 3.563   94.049  104.717 1.00 50.79  ? 344 ALA D N   1 
ATOM   8234 C CA  . ALA D 2 170 ? 3.029   93.467  103.497 1.00 51.41  ? 344 ALA D CA  1 
ATOM   8235 C C   . ALA D 2 170 ? 3.371   94.328  102.282 1.00 51.92  ? 344 ALA D C   1 
ATOM   8236 O O   . ALA D 2 170 ? 3.544   93.807  101.169 1.00 51.80  ? 344 ALA D O   1 
ATOM   8237 C CB  . ALA D 2 170 ? 1.526   93.296  103.621 1.00 51.29  ? 344 ALA D CB  1 
ATOM   8238 N N   . ASP D 2 171 ? 3.486   95.637  102.521 1.00 52.48  ? 345 ASP D N   1 
ATOM   8239 C CA  . ASP D 2 171 ? 3.640   96.632  101.465 1.00 53.16  ? 345 ASP D CA  1 
ATOM   8240 C C   . ASP D 2 171 ? 4.657   96.204  100.406 1.00 53.05  ? 345 ASP D C   1 
ATOM   8241 O O   . ASP D 2 171 ? 4.258   95.818  99.303  1.00 53.61  ? 345 ASP D O   1 
ATOM   8242 C CB  . ASP D 2 171 ? 3.978   98.014  102.043 1.00 53.69  ? 345 ASP D CB  1 
ATOM   8243 C CG  . ASP D 2 171 ? 3.849   99.132  101.011 1.00 54.95  ? 345 ASP D CG  1 
ATOM   8244 O OD1 . ASP D 2 171 ? 4.248   98.937  99.837  1.00 55.10  ? 345 ASP D OD1 1 
ATOM   8245 O OD2 . ASP D 2 171 ? 3.359   100.249 101.296 1.00 57.01  ? 345 ASP D OD2 1 
ATOM   8246 N N   . PRO D 2 172 ? 5.954   96.253  100.704 1.00 52.68  ? 346 PRO D N   1 
ATOM   8247 C CA  . PRO D 2 172 ? 6.929   95.794  99.711  1.00 52.21  ? 346 PRO D CA  1 
ATOM   8248 C C   . PRO D 2 172 ? 6.906   94.261  99.581  1.00 51.62  ? 346 PRO D C   1 
ATOM   8249 O O   . PRO D 2 172 ? 6.875   93.735  98.465  1.00 51.49  ? 346 PRO D O   1 
ATOM   8250 C CB  . PRO D 2 172 ? 8.274   96.287  100.267 1.00 52.17  ? 346 PRO D CB  1 
ATOM   8251 C CG  . PRO D 2 172 ? 7.927   97.178  101.440 1.00 52.66  ? 346 PRO D CG  1 
ATOM   8252 C CD  . PRO D 2 172 ? 6.602   96.720  101.946 1.00 52.50  ? 346 PRO D CD  1 
ATOM   8253 N N   . TYR D 2 173 ? 6.853   93.566  100.711 1.00 50.91  ? 347 TYR D N   1 
ATOM   8254 C CA  . TYR D 2 173 ? 7.329   92.186  100.772 1.00 50.60  ? 347 TYR D CA  1 
ATOM   8255 C C   . TYR D 2 173 ? 6.407   91.094  100.250 1.00 50.02  ? 347 TYR D C   1 
ATOM   8256 O O   . TYR D 2 173 ? 6.879   90.037  99.846  1.00 50.00  ? 347 TYR D O   1 
ATOM   8257 C CB  . TYR D 2 173 ? 7.892   91.886  102.165 1.00 50.69  ? 347 TYR D CB  1 
ATOM   8258 C CG  . TYR D 2 173 ? 9.022   92.829  102.462 1.00 51.74  ? 347 TYR D CG  1 
ATOM   8259 C CD1 . TYR D 2 173 ? 10.260  92.669  101.839 1.00 52.71  ? 347 TYR D CD1 1 
ATOM   8260 C CD2 . TYR D 2 173 ? 8.841   93.925  103.299 1.00 52.99  ? 347 TYR D CD2 1 
ATOM   8261 C CE1 . TYR D 2 173 ? 11.301  93.550  102.077 1.00 53.67  ? 347 TYR D CE1 1 
ATOM   8262 C CE2 . TYR D 2 173 ? 9.879   94.816  103.542 1.00 53.72  ? 347 TYR D CE2 1 
ATOM   8263 C CZ  . TYR D 2 173 ? 11.104  94.617  102.924 1.00 53.75  ? 347 TYR D CZ  1 
ATOM   8264 O OH  . TYR D 2 173 ? 12.138  95.481  103.151 1.00 54.74  ? 347 TYR D OH  1 
ATOM   8265 N N   . LEU D 2 174 ? 5.106   91.357  100.221 1.00 49.84  ? 348 LEU D N   1 
ATOM   8266 C CA  . LEU D 2 174 ? 4.178   90.438  99.567  1.00 49.83  ? 348 LEU D CA  1 
ATOM   8267 C C   . LEU D 2 174 ? 4.525   90.231  98.077  1.00 49.85  ? 348 LEU D C   1 
ATOM   8268 O O   . LEU D 2 174 ? 4.237   89.173  97.510  1.00 49.82  ? 348 LEU D O   1 
ATOM   8269 C CB  . LEU D 2 174 ? 2.724   90.901  99.751  1.00 49.52  ? 348 LEU D CB  1 
ATOM   8270 C CG  . LEU D 2 174 ? 1.732   89.958  100.454 1.00 48.99  ? 348 LEU D CG  1 
ATOM   8271 C CD1 . LEU D 2 174 ? 2.390   89.031  101.473 1.00 47.38  ? 348 LEU D CD1 1 
ATOM   8272 C CD2 . LEU D 2 174 ? 0.622   90.762  101.112 1.00 48.63  ? 348 LEU D CD2 1 
ATOM   8273 N N   . LYS D 2 175 ? 5.171   91.230  97.469  1.00 49.85  ? 349 LYS D N   1 
ATOM   8274 C CA  . LYS D 2 175 ? 5.567   91.170  96.062  1.00 50.16  ? 349 LYS D CA  1 
ATOM   8275 C C   . LYS D 2 175 ? 6.711   90.184  95.794  1.00 50.00  ? 349 LYS D C   1 
ATOM   8276 O O   . LYS D 2 175 ? 6.841   89.663  94.680  1.00 49.99  ? 349 LYS D O   1 
ATOM   8277 C CB  . LYS D 2 175 ? 5.956   92.561  95.564  1.00 50.45  ? 349 LYS D CB  1 
ATOM   8278 C CG  . LYS D 2 175 ? 5.865   92.742  94.057  1.00 52.14  ? 349 LYS D CG  1 
ATOM   8279 C CD  . LYS D 2 175 ? 6.414   94.110  93.616  1.00 54.62  ? 349 LYS D CD  1 
ATOM   8280 C CE  . LYS D 2 175 ? 6.438   94.221  92.089  1.00 55.53  ? 349 LYS D CE  1 
ATOM   8281 N NZ  . LYS D 2 175 ? 6.696   95.616  91.625  1.00 55.79  ? 349 LYS D NZ  1 
ATOM   8282 N N   . TYR D 2 176 ? 7.532   89.922  96.808  1.00 49.47  ? 350 TYR D N   1 
ATOM   8283 C CA  . TYR D 2 176 ? 8.721   89.094  96.612  1.00 49.30  ? 350 TYR D CA  1 
ATOM   8284 C C   . TYR D 2 176 ? 8.546   87.664  97.098  1.00 48.47  ? 350 TYR D C   1 
ATOM   8285 O O   . TYR D 2 176 ? 7.935   87.422  98.140  1.00 48.46  ? 350 TYR D O   1 
ATOM   8286 C CB  . TYR D 2 176 ? 9.937   89.729  97.289  1.00 49.55  ? 350 TYR D CB  1 
ATOM   8287 C CG  . TYR D 2 176 ? 10.184  91.163  96.875  1.00 51.25  ? 350 TYR D CG  1 
ATOM   8288 C CD1 . TYR D 2 176 ? 10.557  91.476  95.564  1.00 52.19  ? 350 TYR D CD1 1 
ATOM   8289 C CD2 . TYR D 2 176 ? 10.033  92.209  97.789  1.00 51.76  ? 350 TYR D CD2 1 
ATOM   8290 C CE1 . TYR D 2 176 ? 10.781  92.794  95.176  1.00 53.04  ? 350 TYR D CE1 1 
ATOM   8291 C CE2 . TYR D 2 176 ? 10.258  93.528  97.413  1.00 52.66  ? 350 TYR D CE2 1 
ATOM   8292 C CZ  . TYR D 2 176 ? 10.630  93.813  96.103  1.00 53.38  ? 350 TYR D CZ  1 
ATOM   8293 O OH  . TYR D 2 176 ? 10.856  95.116  95.718  1.00 54.17  ? 350 TYR D OH  1 
ATOM   8294 N N   . LEU D 2 177 ? 9.087   86.732  96.324  1.00 47.56  ? 351 LEU D N   1 
ATOM   8295 C CA  . LEU D 2 177 ? 9.153   85.331  96.707  1.00 47.22  ? 351 LEU D CA  1 
ATOM   8296 C C   . LEU D 2 177 ? 10.119  85.135  97.880  1.00 46.92  ? 351 LEU D C   1 
ATOM   8297 O O   . LEU D 2 177 ? 11.142  85.814  97.957  1.00 46.97  ? 351 LEU D O   1 
ATOM   8298 C CB  . LEU D 2 177 ? 9.579   84.457  95.519  1.00 47.11  ? 351 LEU D CB  1 
ATOM   8299 C CG  . LEU D 2 177 ? 8.687   84.425  94.269  1.00 47.09  ? 351 LEU D CG  1 
ATOM   8300 C CD1 . LEU D 2 177 ? 9.314   83.572  93.168  1.00 46.08  ? 351 LEU D CD1 1 
ATOM   8301 C CD2 . LEU D 2 177 ? 7.275   83.948  94.589  1.00 47.72  ? 351 LEU D CD2 1 
ATOM   8302 N N   . PRO D 2 178 ? 9.773   84.238  98.808  1.00 46.59  ? 352 PRO D N   1 
ATOM   8303 C CA  . PRO D 2 178 ? 10.650  83.898  99.937  1.00 46.29  ? 352 PRO D CA  1 
ATOM   8304 C C   . PRO D 2 178 ? 12.132  83.728  99.578  1.00 45.90  ? 352 PRO D C   1 
ATOM   8305 O O   . PRO D 2 178 ? 12.973  84.218  100.329 1.00 45.88  ? 352 PRO D O   1 
ATOM   8306 C CB  . PRO D 2 178 ? 10.068  82.566  100.431 1.00 46.12  ? 352 PRO D CB  1 
ATOM   8307 C CG  . PRO D 2 178 ? 8.611   82.687  100.160 1.00 46.48  ? 352 PRO D CG  1 
ATOM   8308 C CD  . PRO D 2 178 ? 8.490   83.514  98.887  1.00 46.57  ? 352 PRO D CD  1 
ATOM   8309 N N   . SER D 2 179 ? 12.429  83.058  98.463  1.00 45.45  ? 353 SER D N   1 
ATOM   8310 C CA  . SER D 2 179 ? 13.804  82.766  98.048  1.00 45.27  ? 353 SER D CA  1 
ATOM   8311 C C   . SER D 2 179 ? 14.579  84.008  97.626  1.00 45.26  ? 353 SER D C   1 
ATOM   8312 O O   . SER D 2 179 ? 15.806  84.052  97.758  1.00 45.49  ? 353 SER D O   1 
ATOM   8313 C CB  . SER D 2 179 ? 13.804  81.781  96.893  1.00 44.97  ? 353 SER D CB  1 
ATOM   8314 O OG  . SER D 2 179 ? 13.287  82.400  95.732  1.00 44.58  ? 353 SER D OG  1 
ATOM   8315 N N   . VAL D 2 180 ? 13.855  84.990  97.095  1.00 45.21  ? 354 VAL D N   1 
ATOM   8316 C CA  . VAL D 2 180 ? 14.413  86.292  96.749  1.00 45.26  ? 354 VAL D CA  1 
ATOM   8317 C C   . VAL D 2 180 ? 14.740  87.065  98.022  1.00 45.47  ? 354 VAL D C   1 
ATOM   8318 O O   . VAL D 2 180 ? 15.866  87.524  98.187  1.00 45.67  ? 354 VAL D O   1 
ATOM   8319 C CB  . VAL D 2 180 ? 13.462  87.102  95.816  1.00 45.15  ? 354 VAL D CB  1 
ATOM   8320 C CG1 . VAL D 2 180 ? 13.864  88.563  95.744  1.00 45.35  ? 354 VAL D CG1 1 
ATOM   8321 C CG2 . VAL D 2 180 ? 13.430  86.493  94.414  1.00 44.77  ? 354 VAL D CG2 1 
ATOM   8322 N N   . ILE D 2 181 ? 13.777  87.187  98.939  1.00 45.80  ? 355 ILE D N   1 
ATOM   8323 C CA  . ILE D 2 181 ? 14.040  87.886  100.203 1.00 45.81  ? 355 ILE D CA  1 
ATOM   8324 C C   . ILE D 2 181 ? 15.184  87.229  100.977 1.00 46.01  ? 355 ILE D C   1 
ATOM   8325 O O   . ILE D 2 181 ? 16.016  87.916  101.570 1.00 45.66  ? 355 ILE D O   1 
ATOM   8326 C CB  . ILE D 2 181 ? 12.786  87.983  101.084 1.00 45.72  ? 355 ILE D CB  1 
ATOM   8327 C CG1 . ILE D 2 181 ? 11.624  88.596  100.300 1.00 45.38  ? 355 ILE D CG1 1 
ATOM   8328 C CG2 . ILE D 2 181 ? 13.098  88.808  102.334 1.00 46.07  ? 355 ILE D CG2 1 
ATOM   8329 C CD1 . ILE D 2 181 ? 10.332  88.749  101.095 1.00 44.63  ? 355 ILE D CD1 1 
ATOM   8330 N N   . ALA D 2 182 ? 15.219  85.898  100.959 1.00 46.32  ? 356 ALA D N   1 
ATOM   8331 C CA  . ALA D 2 182 ? 16.309  85.144  101.571 1.00 46.73  ? 356 ALA D CA  1 
ATOM   8332 C C   . ALA D 2 182 ? 17.642  85.530  100.942 1.00 47.31  ? 356 ALA D C   1 
ATOM   8333 O O   . ALA D 2 182 ? 18.637  85.683  101.640 1.00 46.90  ? 356 ALA D O   1 
ATOM   8334 C CB  . ALA D 2 182 ? 16.073  83.671  101.432 1.00 46.22  ? 356 ALA D CB  1 
ATOM   8335 N N   . GLY D 2 183 ? 17.644  85.688  99.620  1.00 48.32  ? 357 GLY D N   1 
ATOM   8336 C CA  . GLY D 2 183 ? 18.810  86.156  98.893  1.00 49.59  ? 357 GLY D CA  1 
ATOM   8337 C C   . GLY D 2 183 ? 19.209  87.564  99.300  1.00 50.61  ? 357 GLY D C   1 
ATOM   8338 O O   . GLY D 2 183 ? 20.373  87.807  99.620  1.00 50.80  ? 357 GLY D O   1 
ATOM   8339 N N   . ALA D 2 184 ? 18.245  88.484  99.300  1.00 51.42  ? 358 ALA D N   1 
ATOM   8340 C CA  . ALA D 2 184 ? 18.507  89.874  99.665  1.00 52.43  ? 358 ALA D CA  1 
ATOM   8341 C C   . ALA D 2 184 ? 18.983  90.020  101.109 1.00 53.25  ? 358 ALA D C   1 
ATOM   8342 O O   . ALA D 2 184 ? 19.903  90.786  101.381 1.00 53.73  ? 358 ALA D O   1 
ATOM   8343 C CB  . ALA D 2 184 ? 17.285  90.739  99.405  1.00 52.14  ? 358 ALA D CB  1 
ATOM   8344 N N   . ALA D 2 185 ? 18.370  89.273  102.025 1.00 54.51  ? 359 ALA D N   1 
ATOM   8345 C CA  . ALA D 2 185 ? 18.749  89.304  103.440 1.00 55.48  ? 359 ALA D CA  1 
ATOM   8346 C C   . ALA D 2 185 ? 20.063  88.580  103.732 1.00 56.49  ? 359 ALA D C   1 
ATOM   8347 O O   . ALA D 2 185 ? 20.710  88.851  104.745 1.00 56.56  ? 359 ALA D O   1 
ATOM   8348 C CB  . ALA D 2 185 ? 17.632  88.734  104.301 1.00 55.41  ? 359 ALA D CB  1 
ATOM   8349 N N   . PHE D 2 186 ? 20.446  87.646  102.867 1.00 57.76  ? 360 PHE D N   1 
ATOM   8350 C CA  . PHE D 2 186 ? 21.737  86.977  103.010 1.00 59.22  ? 360 PHE D CA  1 
ATOM   8351 C C   . PHE D 2 186 ? 22.869  87.858  102.496 1.00 60.52  ? 360 PHE D C   1 
ATOM   8352 O O   . PHE D 2 186 ? 23.972  87.845  103.045 1.00 60.73  ? 360 PHE D O   1 
ATOM   8353 C CB  . PHE D 2 186 ? 21.762  85.628  102.295 1.00 58.81  ? 360 PHE D CB  1 
ATOM   8354 C CG  . PHE D 2 186 ? 22.976  84.802  102.609 1.00 58.82  ? 360 PHE D CG  1 
ATOM   8355 C CD1 . PHE D 2 186 ? 23.426  84.666  103.922 1.00 58.98  ? 360 PHE D CD1 1 
ATOM   8356 C CD2 . PHE D 2 186 ? 23.676  84.162  101.599 1.00 59.15  ? 360 PHE D CD2 1 
ATOM   8357 C CE1 . PHE D 2 186 ? 24.553  83.896  104.219 1.00 58.38  ? 360 PHE D CE1 1 
ATOM   8358 C CE2 . PHE D 2 186 ? 24.806  83.391  101.889 1.00 58.97  ? 360 PHE D CE2 1 
ATOM   8359 C CZ  . PHE D 2 186 ? 25.241  83.259  103.201 1.00 58.71  ? 360 PHE D CZ  1 
ATOM   8360 N N   . HIS D 2 187 ? 22.595  88.612  101.436 1.00 62.11  ? 361 HIS D N   1 
ATOM   8361 C CA  . HIS D 2 187 ? 23.565  89.562  100.920 1.00 63.81  ? 361 HIS D CA  1 
ATOM   8362 C C   . HIS D 2 187 ? 23.746  90.688  101.925 1.00 64.47  ? 361 HIS D C   1 
ATOM   8363 O O   . HIS D 2 187 ? 24.870  91.044  102.262 1.00 64.80  ? 361 HIS D O   1 
ATOM   8364 C CB  . HIS D 2 187 ? 23.134  90.122  99.560  1.00 64.09  ? 361 HIS D CB  1 
ATOM   8365 C CG  . HIS D 2 187 ? 23.943  91.302  99.119  1.00 65.66  ? 361 HIS D CG  1 
ATOM   8366 N ND1 . HIS D 2 187 ? 25.116  91.175  98.406  1.00 66.83  ? 361 HIS D ND1 1 
ATOM   8367 C CD2 . HIS D 2 187 ? 23.762  92.631  99.313  1.00 66.78  ? 361 HIS D CD2 1 
ATOM   8368 C CE1 . HIS D 2 187 ? 25.616  92.375  98.169  1.00 67.50  ? 361 HIS D CE1 1 
ATOM   8369 N NE2 . HIS D 2 187 ? 24.813  93.275  98.709  1.00 67.79  ? 361 HIS D NE2 1 
ATOM   8370 N N   . LEU D 2 188 ? 22.631  91.220  102.418 1.00 65.34  ? 362 LEU D N   1 
ATOM   8371 C CA  . LEU D 2 188 ? 22.648  92.379  103.298 1.00 66.16  ? 362 LEU D CA  1 
ATOM   8372 C C   . LEU D 2 188 ? 23.307  92.108  104.647 1.00 67.18  ? 362 LEU D C   1 
ATOM   8373 O O   . LEU D 2 188 ? 23.810  93.026  105.284 1.00 67.24  ? 362 LEU D O   1 
ATOM   8374 C CB  . LEU D 2 188 ? 21.231  92.928  103.488 1.00 65.93  ? 362 LEU D CB  1 
ATOM   8375 C CG  . LEU D 2 188 ? 21.033  94.317  104.110 1.00 65.44  ? 362 LEU D CG  1 
ATOM   8376 C CD1 . LEU D 2 188 ? 21.977  95.359  103.509 1.00 65.02  ? 362 LEU D CD1 1 
ATOM   8377 C CD2 . LEU D 2 188 ? 19.587  94.759  103.960 1.00 64.19  ? 362 LEU D CD2 1 
ATOM   8378 N N   . ALA D 2 189 ? 23.307  90.851  105.079 1.00 68.55  ? 363 ALA D N   1 
ATOM   8379 C CA  . ALA D 2 189 ? 23.927  90.488  106.352 1.00 69.90  ? 363 ALA D CA  1 
ATOM   8380 C C   . ALA D 2 189 ? 25.390  90.102  106.166 1.00 70.93  ? 363 ALA D C   1 
ATOM   8381 O O   . ALA D 2 189 ? 26.190  90.200  107.100 1.00 71.06  ? 363 ALA D O   1 
ATOM   8382 C CB  . ALA D 2 189 ? 23.160  89.367  107.025 1.00 69.81  ? 363 ALA D CB  1 
ATOM   8383 N N   . LEU D 2 190 ? 25.726  89.649  104.960 1.00 72.29  ? 364 LEU D N   1 
ATOM   8384 C CA  . LEU D 2 190 ? 27.111  89.399  104.586 1.00 73.67  ? 364 LEU D CA  1 
ATOM   8385 C C   . LEU D 2 190 ? 27.846  90.735  104.517 1.00 74.62  ? 364 LEU D C   1 
ATOM   8386 O O   . LEU D 2 190 ? 28.878  90.916  105.169 1.00 74.88  ? 364 LEU D O   1 
ATOM   8387 C CB  . LEU D 2 190 ? 27.187  88.675  103.238 1.00 73.59  ? 364 LEU D CB  1 
ATOM   8388 C CG  . LEU D 2 190 ? 28.000  87.382  103.163 1.00 73.86  ? 364 LEU D CG  1 
ATOM   8389 C CD1 . LEU D 2 190 ? 27.170  86.220  103.647 1.00 74.29  ? 364 LEU D CD1 1 
ATOM   8390 C CD2 . LEU D 2 190 ? 28.472  87.125  101.739 1.00 74.31  ? 364 LEU D CD2 1 
ATOM   8391 N N   . TYR D 2 191 ? 27.285  91.671  103.751 1.00 75.64  ? 365 TYR D N   1 
ATOM   8392 C CA  . TYR D 2 191 ? 27.882  92.987  103.545 1.00 76.77  ? 365 TYR D CA  1 
ATOM   8393 C C   . TYR D 2 191 ? 27.968  93.814  104.826 1.00 77.17  ? 365 TYR D C   1 
ATOM   8394 O O   . TYR D 2 191 ? 29.002  94.425  105.093 1.00 77.44  ? 365 TYR D O   1 
ATOM   8395 C CB  . TYR D 2 191 ? 27.129  93.753  102.456 1.00 77.01  ? 365 TYR D CB  1 
ATOM   8396 C CG  . TYR D 2 191 ? 27.796  95.039  102.024 1.00 78.52  ? 365 TYR D CG  1 
ATOM   8397 C CD1 . TYR D 2 191 ? 28.800  95.039  101.052 1.00 79.68  ? 365 TYR D CD1 1 
ATOM   8398 C CD2 . TYR D 2 191 ? 27.414  96.262  102.579 1.00 79.97  ? 365 TYR D CD2 1 
ATOM   8399 C CE1 . TYR D 2 191 ? 29.411  96.225  100.650 1.00 80.39  ? 365 TYR D CE1 1 
ATOM   8400 C CE2 . TYR D 2 191 ? 28.017  97.452  102.185 1.00 81.07  ? 365 TYR D CE2 1 
ATOM   8401 C CZ  . TYR D 2 191 ? 29.014  97.428  101.221 1.00 81.06  ? 365 TYR D CZ  1 
ATOM   8402 O OH  . TYR D 2 191 ? 29.607  98.610  100.837 1.00 81.50  ? 365 TYR D OH  1 
ATOM   8403 N N   . THR D 2 192 ? 26.893  93.837  105.613 1.00 77.69  ? 366 THR D N   1 
ATOM   8404 C CA  . THR D 2 192 ? 26.883  94.605  106.859 1.00 78.25  ? 366 THR D CA  1 
ATOM   8405 C C   . THR D 2 192 ? 28.057  94.241  107.774 1.00 78.65  ? 366 THR D C   1 
ATOM   8406 O O   . THR D 2 192 ? 28.851  95.107  108.146 1.00 78.66  ? 366 THR D O   1 
ATOM   8407 C CB  . THR D 2 192 ? 25.539  94.435  107.602 1.00 78.18  ? 366 THR D CB  1 
ATOM   8408 O OG1 . THR D 2 192 ? 24.505  95.089  106.860 1.00 78.25  ? 366 THR D OG1 1 
ATOM   8409 C CG2 . THR D 2 192 ? 25.543  95.190  108.931 1.00 78.07  ? 366 THR D CG2 1 
ATOM   8410 N N   . VAL D 2 193 ? 28.169  92.955  108.105 1.00 79.20  ? 367 VAL D N   1 
ATOM   8411 C CA  . VAL D 2 193 ? 29.151  92.485  109.084 1.00 79.77  ? 367 VAL D CA  1 
ATOM   8412 C C   . VAL D 2 193 ? 30.544  92.257  108.480 1.00 80.14  ? 367 VAL D C   1 
ATOM   8413 O O   . VAL D 2 193 ? 31.547  92.677  109.061 1.00 80.17  ? 367 VAL D O   1 
ATOM   8414 C CB  . VAL D 2 193 ? 28.662  91.203  109.833 1.00 79.75  ? 367 VAL D CB  1 
ATOM   8415 C CG1 . VAL D 2 193 ? 29.551  90.894  111.037 1.00 79.73  ? 367 VAL D CG1 1 
ATOM   8416 C CG2 . VAL D 2 193 ? 27.212  91.344  110.278 1.00 79.69  ? 367 VAL D CG2 1 
ATOM   8417 N N   . THR D 2 194 ? 30.604  91.609  107.317 1.00 80.60  ? 368 THR D N   1 
ATOM   8418 C CA  . THR D 2 194 ? 31.886  91.180  106.748 1.00 81.09  ? 368 THR D CA  1 
ATOM   8419 C C   . THR D 2 194 ? 32.340  91.949  105.492 1.00 81.35  ? 368 THR D C   1 
ATOM   8420 O O   . THR D 2 194 ? 33.416  91.675  104.954 1.00 81.48  ? 368 THR D O   1 
ATOM   8421 C CB  . THR D 2 194 ? 31.883  89.650  106.478 1.00 81.09  ? 368 THR D CB  1 
ATOM   8422 O OG1 . THR D 2 194 ? 30.815  89.313  105.584 1.00 81.29  ? 368 THR D OG1 1 
ATOM   8423 C CG2 . THR D 2 194 ? 31.543  88.868  107.743 1.00 81.11  ? 368 THR D CG2 1 
ATOM   8424 N N   . GLY D 2 195 ? 31.529  92.905  105.037 1.00 81.57  ? 369 GLY D N   1 
ATOM   8425 C CA  . GLY D 2 195 ? 31.823  93.670  103.831 1.00 81.83  ? 369 GLY D CA  1 
ATOM   8426 C C   . GLY D 2 195 ? 31.811  92.829  102.565 1.00 82.03  ? 369 GLY D C   1 
ATOM   8427 O O   . GLY D 2 195 ? 32.448  93.178  101.571 1.00 82.08  ? 369 GLY D O   1 
ATOM   8428 N N   . GLN D 2 196 ? 31.061  91.732  102.601 1.00 82.24  ? 370 GLN D N   1 
ATOM   8429 C CA  . GLN D 2 196 ? 31.110  90.708  101.560 1.00 82.43  ? 370 GLN D CA  1 
ATOM   8430 C C   . GLN D 2 196 ? 29.854  90.682  100.690 1.00 82.07  ? 370 GLN D C   1 
ATOM   8431 O O   . GLN D 2 196 ? 28.845  91.300  101.031 1.00 82.22  ? 370 GLN D O   1 
ATOM   8432 C CB  . GLN D 2 196 ? 31.332  89.345  102.206 1.00 82.71  ? 370 GLN D CB  1 
ATOM   8433 C CG  . GLN D 2 196 ? 32.688  89.206  102.855 1.00 83.99  ? 370 GLN D CG  1 
ATOM   8434 C CD  . GLN D 2 196 ? 33.302  87.863  102.583 1.00 85.73  ? 370 GLN D CD  1 
ATOM   8435 O OE1 . GLN D 2 196 ? 33.693  87.571  101.445 1.00 86.28  ? 370 GLN D OE1 1 
ATOM   8436 N NE2 . GLN D 2 196 ? 33.380  87.029  103.620 1.00 86.52  ? 370 GLN D NE2 1 
ATOM   8437 N N   . SER D 2 197 ? 29.917  89.960  99.573  1.00 81.51  ? 371 SER D N   1 
ATOM   8438 C CA  . SER D 2 197 ? 28.829  89.975  98.596  1.00 81.01  ? 371 SER D CA  1 
ATOM   8439 C C   . SER D 2 197 ? 28.325  88.589  98.190  1.00 80.46  ? 371 SER D C   1 
ATOM   8440 O O   . SER D 2 197 ? 29.087  87.621  98.175  1.00 80.68  ? 371 SER D O   1 
ATOM   8441 C CB  . SER D 2 197 ? 29.256  90.760  97.353  1.00 81.11  ? 371 SER D CB  1 
ATOM   8442 O OG  . SER D 2 197 ? 28.130  91.192  96.611  1.00 81.44  ? 371 SER D OG  1 
ATOM   8443 N N   . TRP D 2 198 ? 27.030  88.525  97.880  1.00 79.54  ? 372 TRP D N   1 
ATOM   8444 C CA  . TRP D 2 198 ? 26.358  87.376  97.261  1.00 78.68  ? 372 TRP D CA  1 
ATOM   8445 C C   . TRP D 2 198 ? 27.302  86.455  96.459  1.00 78.45  ? 372 TRP D C   1 
ATOM   8446 O O   . TRP D 2 198 ? 27.615  86.739  95.301  1.00 78.63  ? 372 TRP D O   1 
ATOM   8447 C CB  . TRP D 2 198 ? 25.230  87.921  96.373  1.00 78.43  ? 372 TRP D CB  1 
ATOM   8448 C CG  . TRP D 2 198 ? 24.278  86.919  95.788  1.00 77.25  ? 372 TRP D CG  1 
ATOM   8449 C CD1 . TRP D 2 198 ? 24.064  86.680  94.459  1.00 76.52  ? 372 TRP D CD1 1 
ATOM   8450 C CD2 . TRP D 2 198 ? 23.380  86.055  96.497  1.00 76.11  ? 372 TRP D CD2 1 
ATOM   8451 N NE1 . TRP D 2 198 ? 23.106  85.707  94.297  1.00 75.70  ? 372 TRP D NE1 1 
ATOM   8452 C CE2 . TRP D 2 198 ? 22.668  85.306  95.532  1.00 75.86  ? 372 TRP D CE2 1 
ATOM   8453 C CE3 . TRP D 2 198 ? 23.112  85.824  97.854  1.00 75.78  ? 372 TRP D CE3 1 
ATOM   8454 C CZ2 . TRP D 2 198 ? 21.709  84.349  95.879  1.00 75.57  ? 372 TRP D CZ2 1 
ATOM   8455 C CZ3 . TRP D 2 198 ? 22.157  84.874  98.198  1.00 75.29  ? 372 TRP D CZ3 1 
ATOM   8456 C CH2 . TRP D 2 198 ? 21.469  84.148  97.213  1.00 75.28  ? 372 TRP D CH2 1 
ATOM   8457 N N   . PRO D 2 199 ? 27.757  85.363  97.080  1.00 78.09  ? 373 PRO D N   1 
ATOM   8458 C CA  . PRO D 2 199 ? 28.776  84.481  96.488  1.00 77.74  ? 373 PRO D CA  1 
ATOM   8459 C C   . PRO D 2 199 ? 28.412  83.872  95.136  1.00 77.29  ? 373 PRO D C   1 
ATOM   8460 O O   . PRO D 2 199 ? 27.232  83.703  94.814  1.00 77.36  ? 373 PRO D O   1 
ATOM   8461 C CB  . PRO D 2 199 ? 28.928  83.373  97.536  1.00 77.80  ? 373 PRO D CB  1 
ATOM   8462 C CG  . PRO D 2 199 ? 28.499  84.011  98.808  1.00 78.03  ? 373 PRO D CG  1 
ATOM   8463 C CD  . PRO D 2 199 ? 27.350  84.894  98.418  1.00 78.19  ? 373 PRO D CD  1 
ATOM   8464 N N   . GLU D 2 200 ? 29.447  83.541  94.367  1.00 76.57  ? 374 GLU D N   1 
ATOM   8465 C CA  . GLU D 2 200 ? 29.304  82.956  93.037  1.00 75.89  ? 374 GLU D CA  1 
ATOM   8466 C C   . GLU D 2 200 ? 28.584  81.605  93.088  1.00 74.69  ? 374 GLU D C   1 
ATOM   8467 O O   . GLU D 2 200 ? 27.734  81.315  92.239  1.00 74.60  ? 374 GLU D O   1 
ATOM   8468 C CB  . GLU D 2 200 ? 30.683  82.844  92.359  1.00 76.24  ? 374 GLU D CB  1 
ATOM   8469 C CG  . GLU D 2 200 ? 30.772  81.896  91.164  1.00 77.88  ? 374 GLU D CG  1 
ATOM   8470 C CD  . GLU D 2 200 ? 30.093  82.426  89.908  1.00 80.03  ? 374 GLU D CD  1 
ATOM   8471 O OE1 . GLU D 2 200 ? 29.945  83.663  89.765  1.00 81.18  ? 374 GLU D OE1 1 
ATOM   8472 O OE2 . GLU D 2 200 ? 29.709  81.596  89.054  1.00 80.85  ? 374 GLU D OE2 1 
ATOM   8473 N N   . SER D 2 201 ? 28.925  80.798  94.093  1.00 73.32  ? 375 SER D N   1 
ATOM   8474 C CA  . SER D 2 201 ? 28.290  79.496  94.329  1.00 71.93  ? 375 SER D CA  1 
ATOM   8475 C C   . SER D 2 201 ? 26.762  79.578  94.414  1.00 70.92  ? 375 SER D C   1 
ATOM   8476 O O   . SER D 2 201 ? 26.057  78.721  93.874  1.00 70.81  ? 375 SER D O   1 
ATOM   8477 C CB  . SER D 2 201 ? 28.842  78.860  95.605  1.00 71.90  ? 375 SER D CB  1 
ATOM   8478 O OG  . SER D 2 201 ? 28.809  79.779  96.686  1.00 71.85  ? 375 SER D OG  1 
ATOM   8479 N N   . LEU D 2 202 ? 26.264  80.618  95.082  1.00 69.60  ? 376 LEU D N   1 
ATOM   8480 C CA  . LEU D 2 202 ? 24.826  80.845  95.217  1.00 68.34  ? 376 LEU D CA  1 
ATOM   8481 C C   . LEU D 2 202 ? 24.159  81.269  93.914  1.00 67.62  ? 376 LEU D C   1 
ATOM   8482 O O   . LEU D 2 202 ? 23.038  80.841  93.619  1.00 67.44  ? 376 LEU D O   1 
ATOM   8483 C CB  . LEU D 2 202 ? 24.543  81.868  96.315  1.00 68.16  ? 376 LEU D CB  1 
ATOM   8484 C CG  . LEU D 2 202 ? 24.665  81.305  97.731  1.00 67.76  ? 376 LEU D CG  1 
ATOM   8485 C CD1 . LEU D 2 202 ? 24.763  82.429  98.726  1.00 67.33  ? 376 LEU D CD1 1 
ATOM   8486 C CD2 . LEU D 2 202 ? 23.503  80.383  98.071  1.00 67.12  ? 376 LEU D CD2 1 
ATOM   8487 N N   . ILE D 2 203 ? 24.853  82.106  93.143  1.00 66.79  ? 377 ILE D N   1 
ATOM   8488 C CA  . ILE D 2 203 ? 24.381  82.545  91.833  1.00 65.80  ? 377 ILE D CA  1 
ATOM   8489 C C   . ILE D 2 203 ? 24.151  81.336  90.930  1.00 65.69  ? 377 ILE D C   1 
ATOM   8490 O O   . ILE D 2 203 ? 23.193  81.300  90.160  1.00 65.56  ? 377 ILE D O   1 
ATOM   8491 C CB  . ILE D 2 203 ? 25.387  83.542  91.198  1.00 65.64  ? 377 ILE D CB  1 
ATOM   8492 C CG1 . ILE D 2 203 ? 25.585  84.752  92.113  1.00 65.14  ? 377 ILE D CG1 1 
ATOM   8493 C CG2 . ILE D 2 203 ? 24.915  83.999  89.820  1.00 65.07  ? 377 ILE D CG2 1 
ATOM   8494 C CD1 . ILE D 2 203 ? 26.895  85.487  91.918  1.00 64.82  ? 377 ILE D CD1 1 
ATOM   8495 N N   . ARG D 2 204 ? 25.029  80.342  91.048  1.00 65.61  ? 378 ARG D N   1 
ATOM   8496 C CA  . ARG D 2 204 ? 24.928  79.109  90.268  1.00 65.57  ? 378 ARG D CA  1 
ATOM   8497 C C   . ARG D 2 204 ? 23.752  78.237  90.725  1.00 65.12  ? 378 ARG D C   1 
ATOM   8498 O O   . ARG D 2 204 ? 23.098  77.588  89.905  1.00 65.05  ? 378 ARG D O   1 
ATOM   8499 C CB  . ARG D 2 204 ? 26.241  78.317  90.345  1.00 65.81  ? 378 ARG D CB  1 
ATOM   8500 C CG  . ARG D 2 204 ? 27.388  78.936  89.547  1.00 67.04  ? 378 ARG D CG  1 
ATOM   8501 C CD  . ARG D 2 204 ? 28.609  78.037  89.400  1.00 68.88  ? 378 ARG D CD  1 
ATOM   8502 N NE  . ARG D 2 204 ? 29.563  78.235  90.491  1.00 69.92  ? 378 ARG D NE  1 
ATOM   8503 C CZ  . ARG D 2 204 ? 29.867  77.317  91.401  1.00 70.43  ? 378 ARG D CZ  1 
ATOM   8504 N NH1 . ARG D 2 204 ? 30.748  77.598  92.356  1.00 70.80  ? 378 ARG D NH1 1 
ATOM   8505 N NH2 . ARG D 2 204 ? 29.299  76.117  91.360  1.00 70.25  ? 378 ARG D NH2 1 
ATOM   8506 N N   . LYS D 2 205 ? 23.498  78.232  92.033  1.00 64.66  ? 379 LYS D N   1 
ATOM   8507 C CA  . LYS D 2 205 ? 22.423  77.440  92.634  1.00 64.24  ? 379 LYS D CA  1 
ATOM   8508 C C   . LYS D 2 205 ? 21.050  78.048  92.342  1.00 64.08  ? 379 LYS D C   1 
ATOM   8509 O O   . LYS D 2 205 ? 20.167  77.375  91.800  1.00 64.07  ? 379 LYS D O   1 
ATOM   8510 C CB  . LYS D 2 205 ? 22.636  77.321  94.150  1.00 64.13  ? 379 LYS D CB  1 
ATOM   8511 C CG  . LYS D 2 205 ? 22.023  76.085  94.799  1.00 63.48  ? 379 LYS D CG  1 
ATOM   8512 C CD  . LYS D 2 205 ? 20.945  76.479  95.802  1.00 63.02  ? 379 LYS D CD  1 
ATOM   8513 C CE  . LYS D 2 205 ? 21.385  76.254  97.238  1.00 62.78  ? 379 LYS D CE  1 
ATOM   8514 N NZ  . LYS D 2 205 ? 20.832  74.988  97.794  1.00 62.57  ? 379 LYS D NZ  1 
ATOM   8515 N N   . THR D 2 206 ? 20.896  79.324  92.689  1.00 63.84  ? 380 THR D N   1 
ATOM   8516 C CA  . THR D 2 206 ? 19.613  80.017  92.615  1.00 63.78  ? 380 THR D CA  1 
ATOM   8517 C C   . THR D 2 206 ? 19.327  80.606  91.239  1.00 63.98  ? 380 THR D C   1 
ATOM   8518 O O   . THR D 2 206 ? 18.169  80.724  90.834  1.00 63.86  ? 380 THR D O   1 
ATOM   8519 C CB  . THR D 2 206 ? 19.543  81.136  93.679  1.00 63.85  ? 380 THR D CB  1 
ATOM   8520 O OG1 . THR D 2 206 ? 20.549  82.124  93.409  1.00 63.54  ? 380 THR D OG1 1 
ATOM   8521 C CG2 . THR D 2 206 ? 19.915  80.598  95.067  1.00 63.50  ? 380 THR D CG2 1 
ATOM   8522 N N   . GLY D 2 207 ? 20.385  80.983  90.526  1.00 64.33  ? 381 GLY D N   1 
ATOM   8523 C CA  . GLY D 2 207 ? 20.240  81.684  89.262  1.00 64.52  ? 381 GLY D CA  1 
ATOM   8524 C C   . GLY D 2 207 ? 19.934  83.156  89.469  1.00 64.70  ? 381 GLY D C   1 
ATOM   8525 O O   . GLY D 2 207 ? 19.648  83.875  88.509  1.00 64.73  ? 381 GLY D O   1 
ATOM   8526 N N   . TYR D 2 208 ? 19.978  83.598  90.725  1.00 64.99  ? 382 TYR D N   1 
ATOM   8527 C CA  . TYR D 2 208 ? 19.801  85.007  91.061  1.00 65.52  ? 382 TYR D CA  1 
ATOM   8528 C C   . TYR D 2 208 ? 21.157  85.702  91.070  1.00 65.73  ? 382 TYR D C   1 
ATOM   8529 O O   . TYR D 2 208 ? 22.051  85.318  91.825  1.00 65.75  ? 382 TYR D O   1 
ATOM   8530 C CB  . TYR D 2 208 ? 19.142  85.188  92.444  1.00 65.58  ? 382 TYR D CB  1 
ATOM   8531 C CG  . TYR D 2 208 ? 17.777  84.551  92.637  1.00 65.78  ? 382 TYR D CG  1 
ATOM   8532 C CD1 . TYR D 2 208 ? 16.878  84.410  91.574  1.00 66.07  ? 382 TYR D CD1 1 
ATOM   8533 C CD2 . TYR D 2 208 ? 17.380  84.102  93.897  1.00 66.17  ? 382 TYR D CD2 1 
ATOM   8534 C CE1 . TYR D 2 208 ? 15.627  83.825  91.761  1.00 65.98  ? 382 TYR D CE1 1 
ATOM   8535 C CE2 . TYR D 2 208 ? 16.129  83.518  94.095  1.00 66.06  ? 382 TYR D CE2 1 
ATOM   8536 C CZ  . TYR D 2 208 ? 15.262  83.384  93.025  1.00 65.75  ? 382 TYR D CZ  1 
ATOM   8537 O OH  . TYR D 2 208 ? 14.032  82.812  93.218  1.00 65.38  ? 382 TYR D OH  1 
ATOM   8538 N N   . THR D 2 209 ? 21.312  86.717  90.226  1.00 66.11  ? 383 THR D N   1 
ATOM   8539 C CA  . THR D 2 209 ? 22.487  87.582  90.292  1.00 66.36  ? 383 THR D CA  1 
ATOM   8540 C C   . THR D 2 209 ? 22.127  88.786  91.150  1.00 66.65  ? 383 THR D C   1 
ATOM   8541 O O   . THR D 2 209 ? 20.965  88.946  91.541  1.00 66.44  ? 383 THR D O   1 
ATOM   8542 C CB  . THR D 2 209 ? 22.959  88.024  88.883  1.00 66.33  ? 383 THR D CB  1 
ATOM   8543 O OG1 . THR D 2 209 ? 21.905  88.725  88.217  1.00 66.12  ? 383 THR D OG1 1 
ATOM   8544 C CG2 . THR D 2 209 ? 23.217  86.814  87.976  1.00 66.37  ? 383 THR D CG2 1 
ATOM   8545 N N   . LEU D 2 210 ? 23.121  89.627  91.436  1.00 67.03  ? 384 LEU D N   1 
ATOM   8546 C CA  . LEU D 2 210 ? 22.936  90.782  92.317  1.00 67.33  ? 384 LEU D CA  1 
ATOM   8547 C C   . LEU D 2 210 ? 22.061  91.891  91.721  1.00 67.42  ? 384 LEU D C   1 
ATOM   8548 O O   . LEU D 2 210 ? 21.466  92.677  92.460  1.00 67.47  ? 384 LEU D O   1 
ATOM   8549 C CB  . LEU D 2 210 ? 24.289  91.332  92.775  1.00 67.39  ? 384 LEU D CB  1 
ATOM   8550 C CG  . LEU D 2 210 ? 24.341  91.991  94.157  1.00 67.66  ? 384 LEU D CG  1 
ATOM   8551 C CD1 . LEU D 2 210 ? 23.692  91.134  95.236  1.00 68.07  ? 384 LEU D CD1 1 
ATOM   8552 C CD2 . LEU D 2 210 ? 25.776  92.304  94.530  1.00 68.45  ? 384 LEU D CD2 1 
ATOM   8553 N N   . GLU D 2 211 ? 21.988  91.950  90.394  1.00 67.55  ? 385 GLU D N   1 
ATOM   8554 C CA  . GLU D 2 211 ? 21.065  92.854  89.709  1.00 67.65  ? 385 GLU D CA  1 
ATOM   8555 C C   . GLU D 2 211 ? 19.623  92.392  89.948  1.00 67.06  ? 385 GLU D C   1 
ATOM   8556 O O   . GLU D 2 211 ? 18.754  93.195  90.308  1.00 66.99  ? 385 GLU D O   1 
ATOM   8557 C CB  . GLU D 2 211 ? 21.387  92.920  88.205  1.00 68.07  ? 385 GLU D CB  1 
ATOM   8558 C CG  . GLU D 2 211 ? 20.386  93.700  87.353  1.00 70.04  ? 385 GLU D CG  1 
ATOM   8559 C CD  . GLU D 2 211 ? 20.825  95.130  87.046  1.00 72.73  ? 385 GLU D CD  1 
ATOM   8560 O OE1 . GLU D 2 211 ? 20.154  96.078  87.523  1.00 73.65  ? 385 GLU D OE1 1 
ATOM   8561 O OE2 . GLU D 2 211 ? 21.831  95.313  86.321  1.00 73.18  ? 385 GLU D OE2 1 
ATOM   8562 N N   . SER D 2 212 ? 19.392  91.091  89.759  1.00 66.32  ? 386 SER D N   1 
ATOM   8563 C CA  . SER D 2 212 ? 18.076  90.473  89.964  1.00 65.40  ? 386 SER D CA  1 
ATOM   8564 C C   . SER D 2 212 ? 17.580  90.552  91.417  1.00 64.61  ? 386 SER D C   1 
ATOM   8565 O O   . SER D 2 212 ? 16.369  90.553  91.662  1.00 64.56  ? 386 SER D O   1 
ATOM   8566 C CB  . SER D 2 212 ? 18.078  89.017  89.473  1.00 65.51  ? 386 SER D CB  1 
ATOM   8567 O OG  . SER D 2 212 ? 18.927  88.207  90.266  1.00 65.57  ? 386 SER D OG  1 
ATOM   8568 N N   . LEU D 2 213 ? 18.514  90.625  92.366  1.00 63.41  ? 387 LEU D N   1 
ATOM   8569 C CA  . LEU D 2 213 ? 18.175  90.759  93.785  1.00 62.31  ? 387 LEU D CA  1 
ATOM   8570 C C   . LEU D 2 213 ? 17.970  92.209  94.199  1.00 61.61  ? 387 LEU D C   1 
ATOM   8571 O O   . LEU D 2 213 ? 17.432  92.481  95.280  1.00 61.45  ? 387 LEU D O   1 
ATOM   8572 C CB  . LEU D 2 213 ? 19.265  90.150  94.673  1.00 62.27  ? 387 LEU D CB  1 
ATOM   8573 C CG  . LEU D 2 213 ? 19.456  88.637  94.752  1.00 62.28  ? 387 LEU D CG  1 
ATOM   8574 C CD1 . LEU D 2 213 ? 20.406  88.315  95.893  1.00 62.52  ? 387 LEU D CD1 1 
ATOM   8575 C CD2 . LEU D 2 213 ? 18.134  87.899  94.921  1.00 62.74  ? 387 LEU D CD2 1 
ATOM   8576 N N   . LYS D 2 214 ? 18.406  93.131  93.341  1.00 60.66  ? 388 LYS D N   1 
ATOM   8577 C CA  . LYS D 2 214 ? 18.410  94.562  93.665  1.00 59.84  ? 388 LYS D CA  1 
ATOM   8578 C C   . LYS D 2 214 ? 17.053  95.167  94.090  1.00 58.82  ? 388 LYS D C   1 
ATOM   8579 O O   . LYS D 2 214 ? 17.006  95.850  95.109  1.00 58.85  ? 388 LYS D O   1 
ATOM   8580 C CB  . LYS D 2 214 ? 19.065  95.383  92.543  1.00 59.93  ? 388 LYS D CB  1 
ATOM   8581 C CG  . LYS D 2 214 ? 19.425  96.802  92.939  1.00 60.30  ? 388 LYS D CG  1 
ATOM   8582 C CD  . LYS D 2 214 ? 19.838  97.621  91.721  1.00 62.02  ? 388 LYS D CD  1 
ATOM   8583 C CE  . LYS D 2 214 ? 20.205  99.047  92.115  1.00 62.85  ? 388 LYS D CE  1 
ATOM   8584 N NZ  . LYS D 2 214 ? 19.001  99.862  92.487  1.00 63.55  ? 388 LYS D NZ  1 
ATOM   8585 N N   . PRO D 2 215 ? 15.964  94.935  93.349  1.00 58.02  ? 389 PRO D N   1 
ATOM   8586 C CA  . PRO D 2 215 ? 14.672  95.530  93.724  1.00 57.65  ? 389 PRO D CA  1 
ATOM   8587 C C   . PRO D 2 215 ? 14.253  95.188  95.163  1.00 57.43  ? 389 PRO D C   1 
ATOM   8588 O O   . PRO D 2 215 ? 13.811  96.087  95.888  1.00 57.49  ? 389 PRO D O   1 
ATOM   8589 C CB  . PRO D 2 215 ? 13.698  94.928  92.708  1.00 57.53  ? 389 PRO D CB  1 
ATOM   8590 C CG  . PRO D 2 215 ? 14.543  94.581  91.545  1.00 57.51  ? 389 PRO D CG  1 
ATOM   8591 C CD  . PRO D 2 215 ? 15.844  94.119  92.125  1.00 57.74  ? 389 PRO D CD  1 
ATOM   8592 N N   . CYS D 2 216 ? 14.399  93.926  95.571  1.00 57.04  ? 390 CYS D N   1 
ATOM   8593 C CA  . CYS D 2 216 ? 14.128  93.539  96.960  1.00 56.69  ? 390 CYS D CA  1 
ATOM   8594 C C   . CYS D 2 216 ? 15.210  94.078  97.896  1.00 56.52  ? 390 CYS D C   1 
ATOM   8595 O O   . CYS D 2 216 ? 14.923  94.450  99.037  1.00 56.18  ? 390 CYS D O   1 
ATOM   8596 C CB  . CYS D 2 216 ? 13.989  92.015  97.103  1.00 56.72  ? 390 CYS D CB  1 
ATOM   8597 S SG  . CYS D 2 216 ? 13.681  91.415  98.791  1.00 56.24  ? 390 CYS D SG  1 
ATOM   8598 N N   . LEU D 2 217 ? 16.447  94.141  97.401  1.00 56.58  ? 391 LEU D N   1 
ATOM   8599 C CA  . LEU D 2 217 ? 17.561  94.668  98.189  1.00 56.68  ? 391 LEU D CA  1 
ATOM   8600 C C   . LEU D 2 217 ? 17.382  96.155  98.489  1.00 56.79  ? 391 LEU D C   1 
ATOM   8601 O O   . LEU D 2 217 ? 17.640  96.599  99.613  1.00 56.76  ? 391 LEU D O   1 
ATOM   8602 C CB  . LEU D 2 217 ? 18.904  94.414  97.497  1.00 56.64  ? 391 LEU D CB  1 
ATOM   8603 C CG  . LEU D 2 217 ? 20.138  94.032  98.330  1.00 56.42  ? 391 LEU D CG  1 
ATOM   8604 C CD1 . LEU D 2 217 ? 19.936  94.155  99.842  1.00 56.77  ? 391 LEU D CD1 1 
ATOM   8605 C CD2 . LEU D 2 217 ? 20.572  92.627  97.977  1.00 56.79  ? 391 LEU D CD2 1 
ATOM   8606 N N   . MET D 2 218 ? 16.931  96.912  97.489  1.00 56.81  ? 392 MET D N   1 
ATOM   8607 C CA  . MET D 2 218 ? 16.637  98.329  97.673  1.00 57.17  ? 392 MET D CA  1 
ATOM   8608 C C   . MET D 2 218 ? 15.667  98.461  98.838  1.00 56.74  ? 392 MET D C   1 
ATOM   8609 O O   . MET D 2 218 ? 15.932  99.174  99.806  1.00 56.78  ? 392 MET D O   1 
ATOM   8610 C CB  . MET D 2 218 ? 16.056  98.950  96.387  1.00 57.71  ? 392 MET D CB  1 
ATOM   8611 C CG  . MET D 2 218 ? 15.162  100.193 96.619  1.00 59.46  ? 392 MET D CG  1 
ATOM   8612 S SD  . MET D 2 218 ? 15.136  101.428 95.282  1.00 63.37  ? 392 MET D SD  1 
ATOM   8613 C CE  . MET D 2 218 ? 16.006  102.839 96.072  1.00 61.25  ? 392 MET D CE  1 
ATOM   8614 N N   . ASP D 2 219 ? 14.561  97.728  98.745  1.00 56.35  ? 393 ASP D N   1 
ATOM   8615 C CA  . ASP D 2 219 ? 13.517  97.737  99.764  1.00 55.77  ? 393 ASP D CA  1 
ATOM   8616 C C   . ASP D 2 219 ? 13.995  97.328  101.156 1.00 55.07  ? 393 ASP D C   1 
ATOM   8617 O O   . ASP D 2 219 ? 13.723  98.014  102.139 1.00 54.93  ? 393 ASP D O   1 
ATOM   8618 C CB  . ASP D 2 219 ? 12.364  96.836  99.321  1.00 55.88  ? 393 ASP D CB  1 
ATOM   8619 C CG  . ASP D 2 219 ? 11.393  97.552  98.420  1.00 56.17  ? 393 ASP D CG  1 
ATOM   8620 O OD1 . ASP D 2 219 ? 11.016  98.698  98.755  1.00 56.70  ? 393 ASP D OD1 1 
ATOM   8621 O OD2 . ASP D 2 219 ? 10.957  97.051  97.358  1.00 56.83  ? 393 ASP D OD2 1 
ATOM   8622 N N   . LEU D 2 220 ? 14.707  96.209  101.224 1.00 54.66  ? 394 LEU D N   1 
ATOM   8623 C CA  . LEU D 2 220 ? 15.167  95.653  102.488 1.00 54.34  ? 394 LEU D CA  1 
ATOM   8624 C C   . LEU D 2 220 ? 16.180  96.557  103.170 1.00 54.58  ? 394 LEU D C   1 
ATOM   8625 O O   . LEU D 2 220 ? 16.205  96.657  104.403 1.00 54.40  ? 394 LEU D O   1 
ATOM   8626 C CB  . LEU D 2 220 ? 15.746  94.255  102.273 1.00 54.15  ? 394 LEU D CB  1 
ATOM   8627 C CG  . LEU D 2 220 ? 15.966  93.364  103.494 1.00 53.66  ? 394 LEU D CG  1 
ATOM   8628 C CD1 . LEU D 2 220 ? 14.676  93.110  104.269 1.00 53.15  ? 394 LEU D CD1 1 
ATOM   8629 C CD2 . LEU D 2 220 ? 16.586  92.067  103.037 1.00 53.18  ? 394 LEU D CD2 1 
ATOM   8630 N N   . HIS D 2 221 ? 17.012  97.217  102.362 1.00 54.93  ? 395 HIS D N   1 
ATOM   8631 C CA  . HIS D 2 221 ? 17.947  98.215  102.871 1.00 54.99  ? 395 HIS D CA  1 
ATOM   8632 C C   . HIS D 2 221 ? 17.185  99.283  103.641 1.00 54.61  ? 395 HIS D C   1 
ATOM   8633 O O   . HIS D 2 221 ? 17.510  99.562  104.789 1.00 54.24  ? 395 HIS D O   1 
ATOM   8634 C CB  . HIS D 2 221 ? 18.767  98.839  101.733 1.00 55.34  ? 395 HIS D CB  1 
ATOM   8635 C CG  . HIS D 2 221 ? 19.947  99.643  102.197 1.00 56.03  ? 395 HIS D CG  1 
ATOM   8636 N ND1 . HIS D 2 221 ? 20.513  99.490  103.445 1.00 57.03  ? 395 HIS D ND1 1 
ATOM   8637 C CD2 . HIS D 2 221 ? 20.668  100.605 101.574 1.00 57.11  ? 395 HIS D CD2 1 
ATOM   8638 C CE1 . HIS D 2 221 ? 21.528  100.326 103.574 1.00 57.63  ? 395 HIS D CE1 1 
ATOM   8639 N NE2 . HIS D 2 221 ? 21.643  101.015 102.453 1.00 57.63  ? 395 HIS D NE2 1 
ATOM   8640 N N   . GLN D 2 222 ? 16.150  99.841  103.018 1.00 54.77  ? 396 GLN D N   1 
ATOM   8641 C CA  . GLN D 2 222 ? 15.338  100.889 103.641 1.00 55.28  ? 396 GLN D CA  1 
ATOM   8642 C C   . GLN D 2 222 ? 14.679  100.443 104.950 1.00 55.22  ? 396 GLN D C   1 
ATOM   8643 O O   . GLN D 2 222 ? 14.669  101.194 105.930 1.00 55.19  ? 396 GLN D O   1 
ATOM   8644 C CB  . GLN D 2 222 ? 14.280  101.412 102.663 1.00 55.59  ? 396 GLN D CB  1 
ATOM   8645 C CG  . GLN D 2 222 ? 14.825  102.243 101.506 1.00 57.38  ? 396 GLN D CG  1 
ATOM   8646 C CD  . GLN D 2 222 ? 15.411  103.574 101.954 1.00 60.54  ? 396 GLN D CD  1 
ATOM   8647 O OE1 . GLN D 2 222 ? 16.629  103.774 101.889 1.00 61.66  ? 396 GLN D OE1 1 
ATOM   8648 N NE2 . GLN D 2 222 ? 14.549  104.486 102.411 1.00 61.32  ? 396 GLN D NE2 1 
ATOM   8649 N N   . THR D 2 223 ? 14.142  99.221  104.963 1.00 55.21  ? 397 THR D N   1 
ATOM   8650 C CA  . THR D 2 223 ? 13.513  98.658  106.162 1.00 55.25  ? 397 THR D CA  1 
ATOM   8651 C C   . THR D 2 223 ? 14.523  98.497  107.306 1.00 55.49  ? 397 THR D C   1 
ATOM   8652 O O   . THR D 2 223 ? 14.210  98.788  108.468 1.00 55.30  ? 397 THR D O   1 
ATOM   8653 C CB  . THR D 2 223 ? 12.796  97.312  105.837 1.00 55.08  ? 397 THR D CB  1 
ATOM   8654 O OG1 . THR D 2 223 ? 11.561  97.577  105.161 1.00 54.77  ? 397 THR D OG1 1 
ATOM   8655 C CG2 . THR D 2 223 ? 12.331  96.605  107.104 1.00 54.80  ? 397 THR D CG2 1 
ATOM   8656 N N   . TYR D 2 224 ? 15.724  98.029  106.968 1.00 55.83  ? 398 TYR D N   1 
ATOM   8657 C CA  . TYR D 2 224 ? 16.832  97.940  107.919 1.00 56.35  ? 398 TYR D CA  1 
ATOM   8658 C C   . TYR D 2 224 ? 17.106  99.321  108.518 1.00 57.03  ? 398 TYR D C   1 
ATOM   8659 O O   . TYR D 2 224 ? 17.151  99.476  109.742 1.00 56.97  ? 398 TYR D O   1 
ATOM   8660 C CB  . TYR D 2 224 ? 18.090  97.402  107.223 1.00 56.07  ? 398 TYR D CB  1 
ATOM   8661 C CG  . TYR D 2 224 ? 19.185  96.867  108.133 1.00 55.11  ? 398 TYR D CG  1 
ATOM   8662 C CD1 . TYR D 2 224 ? 19.043  96.858  109.523 1.00 54.13  ? 398 TYR D CD1 1 
ATOM   8663 C CD2 . TYR D 2 224 ? 20.367  96.360  107.591 1.00 54.06  ? 398 TYR D CD2 1 
ATOM   8664 C CE1 . TYR D 2 224 ? 20.047  96.363  110.347 1.00 53.89  ? 398 TYR D CE1 1 
ATOM   8665 C CE2 . TYR D 2 224 ? 21.377  95.865  108.402 1.00 53.61  ? 398 TYR D CE2 1 
ATOM   8666 C CZ  . TYR D 2 224 ? 21.211  95.866  109.780 1.00 54.00  ? 398 TYR D CZ  1 
ATOM   8667 O OH  . TYR D 2 224 ? 22.214  95.375  110.592 1.00 53.90  ? 398 TYR D OH  1 
ATOM   8668 N N   . LEU D 2 225 ? 17.269  100.314 107.643 1.00 57.91  ? 399 LEU D N   1 
ATOM   8669 C CA  . LEU D 2 225 ? 17.518  101.696 108.054 1.00 58.74  ? 399 LEU D CA  1 
ATOM   8670 C C   . LEU D 2 225 ? 16.468  102.209 109.034 1.00 59.01  ? 399 LEU D C   1 
ATOM   8671 O O   . LEU D 2 225 ? 16.817  102.740 110.089 1.00 59.28  ? 399 LEU D O   1 
ATOM   8672 C CB  . LEU D 2 225 ? 17.596  102.629 106.836 1.00 58.92  ? 399 LEU D CB  1 
ATOM   8673 C CG  . LEU D 2 225 ? 18.833  102.571 105.934 1.00 59.38  ? 399 LEU D CG  1 
ATOM   8674 C CD1 . LEU D 2 225 ? 18.652  103.523 104.754 1.00 59.82  ? 399 LEU D CD1 1 
ATOM   8675 C CD2 . LEU D 2 225 ? 20.125  102.883 106.701 1.00 59.82  ? 399 LEU D CD2 1 
ATOM   8676 N N   . LYS D 2 226 ? 15.191  102.021 108.697 1.00 59.21  ? 400 LYS D N   1 
ATOM   8677 C CA  . LYS D 2 226 ? 14.091  102.603 109.475 1.00 59.37  ? 400 LYS D CA  1 
ATOM   8678 C C   . LYS D 2 226 ? 13.597  101.735 110.638 1.00 59.25  ? 400 LYS D C   1 
ATOM   8679 O O   . LYS D 2 226 ? 12.771  102.185 111.441 1.00 59.21  ? 400 LYS D O   1 
ATOM   8680 C CB  . LYS D 2 226 ? 12.922  102.976 108.558 1.00 59.55  ? 400 LYS D CB  1 
ATOM   8681 C CG  . LYS D 2 226 ? 13.175  104.207 107.705 1.00 60.29  ? 400 LYS D CG  1 
ATOM   8682 C CD  . LYS D 2 226 ? 12.917  103.914 106.236 1.00 61.60  ? 400 LYS D CD  1 
ATOM   8683 C CE  . LYS D 2 226 ? 11.959  104.936 105.637 1.00 62.69  ? 400 LYS D CE  1 
ATOM   8684 N NZ  . LYS D 2 226 ? 12.087  105.043 104.153 1.00 63.10  ? 400 LYS D NZ  1 
ATOM   8685 N N   . ALA D 2 227 ? 14.118  100.508 110.737 1.00 58.89  ? 401 ALA D N   1 
ATOM   8686 C CA  . ALA D 2 227 ? 13.712  99.559  111.782 1.00 58.60  ? 401 ALA D CA  1 
ATOM   8687 C C   . ALA D 2 227 ? 13.576  100.133 113.205 1.00 58.41  ? 401 ALA D C   1 
ATOM   8688 O O   . ALA D 2 227 ? 12.604  99.814  113.886 1.00 58.29  ? 401 ALA D O   1 
ATOM   8689 C CB  . ALA D 2 227 ? 14.620  98.317  111.781 1.00 58.59  ? 401 ALA D CB  1 
ATOM   8690 N N   . PRO D 2 228 ? 14.529  100.956 113.666 1.00 58.32  ? 402 PRO D N   1 
ATOM   8691 C CA  . PRO D 2 228 ? 14.415  101.589 114.993 1.00 58.10  ? 402 PRO D CA  1 
ATOM   8692 C C   . PRO D 2 228 ? 13.197  102.508 115.177 1.00 57.74  ? 402 PRO D C   1 
ATOM   8693 O O   . PRO D 2 228 ? 12.752  102.692 116.316 1.00 57.46  ? 402 PRO D O   1 
ATOM   8694 C CB  . PRO D 2 228 ? 15.714  102.395 115.104 1.00 58.22  ? 402 PRO D CB  1 
ATOM   8695 C CG  . PRO D 2 228 ? 16.662  101.701 114.187 1.00 58.31  ? 402 PRO D CG  1 
ATOM   8696 C CD  . PRO D 2 228 ? 15.810  101.311 113.018 1.00 58.35  ? 402 PRO D CD  1 
ATOM   8697 N N   . GLN D 2 229 ? 12.666  103.061 114.086 1.00 57.34  ? 403 GLN D N   1 
ATOM   8698 C CA  . GLN D 2 229 ? 11.543  104.000 114.169 1.00 57.05  ? 403 GLN D CA  1 
ATOM   8699 C C   . GLN D 2 229 ? 10.182  103.393 113.808 1.00 56.27  ? 403 GLN D C   1 
ATOM   8700 O O   . GLN D 2 229 ? 9.146   104.038 114.009 1.00 56.13  ? 403 GLN D O   1 
ATOM   8701 C CB  . GLN D 2 229 ? 11.809  105.249 113.317 1.00 57.44  ? 403 GLN D CB  1 
ATOM   8702 C CG  . GLN D 2 229 ? 12.905  106.169 113.858 1.00 59.17  ? 403 GLN D CG  1 
ATOM   8703 C CD  . GLN D 2 229 ? 14.223  105.994 113.110 1.00 62.34  ? 403 GLN D CD  1 
ATOM   8704 O OE1 . GLN D 2 229 ? 15.189  105.452 113.659 1.00 63.65  ? 403 GLN D OE1 1 
ATOM   8705 N NE2 . GLN D 2 229 ? 14.261  106.439 111.853 1.00 63.04  ? 403 GLN D NE2 1 
ATOM   8706 N N   . HIS D 2 230 ? 10.186  102.165 113.280 1.00 55.40  ? 404 HIS D N   1 
ATOM   8707 C CA  . HIS D 2 230 ? 8.951   101.431 112.954 1.00 54.34  ? 404 HIS D CA  1 
ATOM   8708 C C   . HIS D 2 230 ? 8.054   101.308 114.189 1.00 53.57  ? 404 HIS D C   1 
ATOM   8709 O O   . HIS D 2 230 ? 8.548   101.130 115.295 1.00 53.07  ? 404 HIS D O   1 
ATOM   8710 C CB  . HIS D 2 230 ? 9.296   100.037 112.396 1.00 54.43  ? 404 HIS D CB  1 
ATOM   8711 C CG  . HIS D 2 230 ? 8.178   99.377  111.640 1.00 54.06  ? 404 HIS D CG  1 
ATOM   8712 N ND1 . HIS D 2 230 ? 7.045   98.889  112.254 1.00 53.46  ? 404 HIS D ND1 1 
ATOM   8713 C CD2 . HIS D 2 230 ? 8.031   99.111  110.319 1.00 53.67  ? 404 HIS D CD2 1 
ATOM   8714 C CE1 . HIS D 2 230 ? 6.243   98.362  111.346 1.00 53.14  ? 404 HIS D CE1 1 
ATOM   8715 N NE2 . HIS D 2 230 ? 6.819   98.483  110.163 1.00 53.10  ? 404 HIS D NE2 1 
ATOM   8716 N N   . ALA D 2 231 ? 6.740   101.415 113.997 1.00 53.13  ? 405 ALA D N   1 
ATOM   8717 C CA  . ALA D 2 231 ? 5.768   101.239 115.090 1.00 52.79  ? 405 ALA D CA  1 
ATOM   8718 C C   . ALA D 2 231 ? 5.879   99.890  115.818 1.00 52.65  ? 405 ALA D C   1 
ATOM   8719 O O   . ALA D 2 231 ? 5.461   99.769  116.967 1.00 52.25  ? 405 ALA D O   1 
ATOM   8720 C CB  . ALA D 2 231 ? 4.347   101.442 114.573 1.00 52.62  ? 405 ALA D CB  1 
ATOM   8721 N N   . GLN D 2 232 ? 6.445   98.890  115.138 1.00 52.68  ? 406 GLN D N   1 
ATOM   8722 C CA  . GLN D 2 232 ? 6.596   97.539  115.676 1.00 52.91  ? 406 GLN D CA  1 
ATOM   8723 C C   . GLN D 2 232 ? 8.034   97.246  116.084 1.00 52.93  ? 406 GLN D C   1 
ATOM   8724 O O   . GLN D 2 232 ? 8.941   97.251  115.249 1.00 53.11  ? 406 GLN D O   1 
ATOM   8725 C CB  . GLN D 2 232 ? 6.123   96.504  114.650 1.00 52.98  ? 406 GLN D CB  1 
ATOM   8726 C CG  . GLN D 2 232 ? 4.641   96.148  114.749 1.00 53.11  ? 406 GLN D CG  1 
ATOM   8727 C CD  . GLN D 2 232 ? 3.720   97.296  114.429 1.00 53.45  ? 406 GLN D CD  1 
ATOM   8728 O OE1 . GLN D 2 232 ? 3.883   97.964  113.409 1.00 55.37  ? 406 GLN D OE1 1 
ATOM   8729 N NE2 . GLN D 2 232 ? 2.745   97.530  115.292 1.00 53.63  ? 406 GLN D NE2 1 
ATOM   8730 N N   . GLN D 2 233 ? 8.224   96.955  117.367 1.00 53.07  ? 407 GLN D N   1 
ATOM   8731 C CA  . GLN D 2 233 ? 9.554   96.825  117.956 1.00 53.37  ? 407 GLN D CA  1 
ATOM   8732 C C   . GLN D 2 233 ? 9.944   95.393  118.379 1.00 53.69  ? 407 GLN D C   1 
ATOM   8733 O O   . GLN D 2 233 ? 11.138  95.099  118.537 1.00 53.69  ? 407 GLN D O   1 
ATOM   8734 C CB  . GLN D 2 233 ? 9.675   97.783  119.154 1.00 53.28  ? 407 GLN D CB  1 
ATOM   8735 C CG  . GLN D 2 233 ? 10.780  98.866  119.071 1.00 53.35  ? 407 GLN D CG  1 
ATOM   8736 C CD  . GLN D 2 233 ? 11.025  99.407  117.666 1.00 53.07  ? 407 GLN D CD  1 
ATOM   8737 O OE1 . GLN D 2 233 ? 12.090  99.186  117.083 1.00 52.96  ? 407 GLN D OE1 1 
ATOM   8738 N NE2 . GLN D 2 233 ? 10.052  100.126 117.131 1.00 52.68  ? 407 GLN D NE2 1 
ATOM   8739 N N   . SER D 2 234 ? 8.955   94.510  118.550 1.00 53.75  ? 408 SER D N   1 
ATOM   8740 C CA  . SER D 2 234 ? 9.186   93.165  119.117 1.00 53.93  ? 408 SER D CA  1 
ATOM   8741 C C   . SER D 2 234 ? 10.307  92.350  118.458 1.00 54.23  ? 408 SER D C   1 
ATOM   8742 O O   . SER D 2 234 ? 11.030  91.623  119.149 1.00 54.04  ? 408 SER D O   1 
ATOM   8743 C CB  . SER D 2 234 ? 7.892   92.340  119.157 1.00 53.83  ? 408 SER D CB  1 
ATOM   8744 O OG  . SER D 2 234 ? 6.790   93.131  119.563 1.00 53.42  ? 408 SER D OG  1 
ATOM   8745 N N   . ILE D 2 235 ? 10.443  92.463  117.138 1.00 54.74  ? 409 ILE D N   1 
ATOM   8746 C CA  . ILE D 2 235 ? 11.528  91.783  116.422 1.00 55.53  ? 409 ILE D CA  1 
ATOM   8747 C C   . ILE D 2 235 ? 12.883  92.368  116.804 1.00 56.33  ? 409 ILE D C   1 
ATOM   8748 O O   . ILE D 2 235 ? 13.843  91.627  117.000 1.00 56.29  ? 409 ILE D O   1 
ATOM   8749 C CB  . ILE D 2 235 ? 11.346  91.840  114.883 1.00 55.27  ? 409 ILE D CB  1 
ATOM   8750 C CG1 . ILE D 2 235 ? 9.882   91.580  114.490 1.00 54.87  ? 409 ILE D CG1 1 
ATOM   8751 C CG2 . ILE D 2 235 ? 12.337  90.881  114.200 1.00 54.88  ? 409 ILE D CG2 1 
ATOM   8752 C CD1 . ILE D 2 235 ? 9.689   90.991  113.107 1.00 53.37  ? 409 ILE D CD1 1 
ATOM   8753 N N   . ARG D 2 236 ? 12.950  93.696  116.902 1.00 57.60  ? 410 ARG D N   1 
ATOM   8754 C CA  . ARG D 2 236 ? 14.160  94.380  117.353 1.00 58.89  ? 410 ARG D CA  1 
ATOM   8755 C C   . ARG D 2 236 ? 14.521  93.945  118.775 1.00 59.55  ? 410 ARG D C   1 
ATOM   8756 O O   . ARG D 2 236 ? 15.669  93.583  119.034 1.00 59.62  ? 410 ARG D O   1 
ATOM   8757 C CB  . ARG D 2 236 ? 14.004  95.903  117.251 1.00 58.98  ? 410 ARG D CB  1 
ATOM   8758 C CG  . ARG D 2 236 ? 13.955  96.420  115.808 1.00 60.08  ? 410 ARG D CG  1 
ATOM   8759 C CD  . ARG D 2 236 ? 14.712  97.723  115.536 1.00 62.27  ? 410 ARG D CD  1 
ATOM   8760 N NE  . ARG D 2 236 ? 15.986  97.824  116.253 1.00 64.24  ? 410 ARG D NE  1 
ATOM   8761 C CZ  . ARG D 2 236 ? 16.235  98.703  117.221 1.00 64.74  ? 410 ARG D CZ  1 
ATOM   8762 N NH1 . ARG D 2 236 ? 17.423  98.720  117.815 1.00 65.11  ? 410 ARG D NH1 1 
ATOM   8763 N NH2 . ARG D 2 236 ? 15.299  99.565  117.600 1.00 64.72  ? 410 ARG D NH2 1 
ATOM   8764 N N   . GLU D 2 237 ? 13.534  93.954  119.675 1.00 60.68  ? 411 GLU D N   1 
ATOM   8765 C CA  . GLU D 2 237 ? 13.709  93.467  121.052 1.00 61.92  ? 411 GLU D CA  1 
ATOM   8766 C C   . GLU D 2 237 ? 14.126  91.995  121.130 1.00 62.50  ? 411 GLU D C   1 
ATOM   8767 O O   . GLU D 2 237 ? 14.899  91.617  122.012 1.00 62.73  ? 411 GLU D O   1 
ATOM   8768 C CB  . GLU D 2 237 ? 12.444  93.687  121.891 1.00 61.90  ? 411 GLU D CB  1 
ATOM   8769 C CG  . GLU D 2 237 ? 12.114  95.146  122.196 1.00 63.70  ? 411 GLU D CG  1 
ATOM   8770 C CD  . GLU D 2 237 ? 12.840  95.721  123.417 1.00 65.99  ? 411 GLU D CD  1 
ATOM   8771 O OE1 . GLU D 2 237 ? 13.658  95.014  124.060 1.00 66.70  ? 411 GLU D OE1 1 
ATOM   8772 O OE2 . GLU D 2 237 ? 12.592  96.909  123.738 1.00 66.37  ? 411 GLU D OE2 1 
ATOM   8773 N N   . LYS D 2 238 ? 13.610  91.177  120.212 1.00 63.37  ? 412 LYS D N   1 
ATOM   8774 C CA  . LYS D 2 238 ? 13.906  89.742  120.164 1.00 64.21  ? 412 LYS D CA  1 
ATOM   8775 C C   . LYS D 2 238 ? 15.379  89.475  119.851 1.00 65.37  ? 412 LYS D C   1 
ATOM   8776 O O   . LYS D 2 238 ? 16.022  88.639  120.498 1.00 65.44  ? 412 LYS D O   1 
ATOM   8777 C CB  . LYS D 2 238 ? 13.005  89.045  119.129 1.00 63.81  ? 412 LYS D CB  1 
ATOM   8778 C CG  . LYS D 2 238 ? 13.359  87.586  118.816 1.00 62.61  ? 412 LYS D CG  1 
ATOM   8779 C CD  . LYS D 2 238 ? 12.326  86.935  117.891 1.00 59.82  ? 412 LYS D CD  1 
ATOM   8780 C CE  . LYS D 2 238 ? 12.715  85.500  117.553 1.00 58.27  ? 412 LYS D CE  1 
ATOM   8781 N NZ  . LYS D 2 238 ? 12.239  85.061  116.205 1.00 56.36  ? 412 LYS D NZ  1 
ATOM   8782 N N   . TYR D 2 239 ? 15.902  90.195  118.860 1.00 66.57  ? 413 TYR D N   1 
ATOM   8783 C CA  . TYR D 2 239 ? 17.250  89.962  118.355 1.00 67.89  ? 413 TYR D CA  1 
ATOM   8784 C C   . TYR D 2 239 ? 18.308  90.802  119.086 1.00 68.92  ? 413 TYR D C   1 
ATOM   8785 O O   . TYR D 2 239 ? 19.414  91.011  118.577 1.00 68.93  ? 413 TYR D O   1 
ATOM   8786 C CB  . TYR D 2 239 ? 17.290  90.203  116.843 1.00 67.82  ? 413 TYR D CB  1 
ATOM   8787 C CG  . TYR D 2 239 ? 16.776  89.036  116.025 1.00 67.75  ? 413 TYR D CG  1 
ATOM   8788 C CD1 . TYR D 2 239 ? 15.411  88.880  115.768 1.00 67.63  ? 413 TYR D CD1 1 
ATOM   8789 C CD2 . TYR D 2 239 ? 17.654  88.088  115.501 1.00 67.44  ? 413 TYR D CD2 1 
ATOM   8790 C CE1 . TYR D 2 239 ? 14.937  87.802  115.012 1.00 66.85  ? 413 TYR D CE1 1 
ATOM   8791 C CE2 . TYR D 2 239 ? 17.189  87.011  114.746 1.00 66.86  ? 413 TYR D CE2 1 
ATOM   8792 C CZ  . TYR D 2 239 ? 15.834  86.876  114.508 1.00 66.57  ? 413 TYR D CZ  1 
ATOM   8793 O OH  . TYR D 2 239 ? 15.384  85.813  113.762 1.00 66.68  ? 413 TYR D OH  1 
ATOM   8794 N N   . LYS D 2 240 ? 17.951  91.272  120.281 1.00 70.16  ? 414 LYS D N   1 
ATOM   8795 C CA  . LYS D 2 240 ? 18.877  91.965  121.172 1.00 71.39  ? 414 LYS D CA  1 
ATOM   8796 C C   . LYS D 2 240 ? 19.664  90.963  122.001 1.00 72.10  ? 414 LYS D C   1 
ATOM   8797 O O   . LYS D 2 240 ? 20.846  91.169  122.259 1.00 72.42  ? 414 LYS D O   1 
ATOM   8798 C CB  . LYS D 2 240 ? 18.129  92.932  122.094 1.00 71.38  ? 414 LYS D CB  1 
ATOM   8799 C CG  . LYS D 2 240 ? 18.437  94.397  121.831 1.00 71.85  ? 414 LYS D CG  1 
ATOM   8800 C CD  . LYS D 2 240 ? 17.196  95.264  121.962 1.00 72.59  ? 414 LYS D CD  1 
ATOM   8801 C CE  . LYS D 2 240 ? 17.228  96.419  120.974 1.00 72.71  ? 414 LYS D CE  1 
ATOM   8802 N NZ  . LYS D 2 240 ? 16.289  97.503  121.367 1.00 73.05  ? 414 LYS D NZ  1 
ATOM   8803 N N   . ASN D 2 241 ? 19.002  89.877  122.400 1.00 73.00  ? 415 ASN D N   1 
ATOM   8804 C CA  . ASN D 2 241 ? 19.584  88.854  123.271 1.00 73.89  ? 415 ASN D CA  1 
ATOM   8805 C C   . ASN D 2 241 ? 20.857  88.190  122.734 1.00 74.10  ? 415 ASN D C   1 
ATOM   8806 O O   . ASN D 2 241 ? 21.175  88.287  121.545 1.00 74.14  ? 415 ASN D O   1 
ATOM   8807 C CB  . ASN D 2 241 ? 18.534  87.787  123.614 1.00 74.07  ? 415 ASN D CB  1 
ATOM   8808 C CG  . ASN D 2 241 ? 18.837  87.066  124.924 1.00 75.41  ? 415 ASN D CG  1 
ATOM   8809 O OD1 . ASN D 2 241 ? 19.625  86.114  124.961 1.00 76.36  ? 415 ASN D OD1 1 
ATOM   8810 N ND2 . ASN D 2 241 ? 18.217  87.525  126.007 1.00 76.61  ? 415 ASN D ND2 1 
ATOM   8811 N N   . SER D 2 242 ? 21.580  87.530  123.639 1.00 74.51  ? 416 SER D N   1 
ATOM   8812 C CA  . SER D 2 242 ? 22.768  86.742  123.318 1.00 74.92  ? 416 SER D CA  1 
ATOM   8813 C C   . SER D 2 242 ? 22.457  85.614  122.339 1.00 74.93  ? 416 SER D C   1 
ATOM   8814 O O   . SER D 2 242 ? 23.280  85.282  121.483 1.00 74.82  ? 416 SER D O   1 
ATOM   8815 C CB  . SER D 2 242 ? 23.356  86.145  124.600 1.00 75.13  ? 416 SER D CB  1 
ATOM   8816 O OG  . SER D 2 242 ? 22.673  84.952  124.970 1.00 75.34  ? 416 SER D OG  1 
ATOM   8817 N N   . LYS D 2 243 ? 21.272  85.024  122.498 1.00 75.05  ? 417 LYS D N   1 
ATOM   8818 C CA  . LYS D 2 243 ? 20.766  83.968  121.623 1.00 75.19  ? 417 LYS D CA  1 
ATOM   8819 C C   . LYS D 2 243 ? 21.008  84.305  120.157 1.00 75.05  ? 417 LYS D C   1 
ATOM   8820 O O   . LYS D 2 243 ? 21.471  83.465  119.384 1.00 75.12  ? 417 LYS D O   1 
ATOM   8821 C CB  . LYS D 2 243 ? 19.268  83.761  121.868 1.00 75.31  ? 417 LYS D CB  1 
ATOM   8822 C CG  . LYS D 2 243 ? 18.827  82.311  121.895 1.00 75.92  ? 417 LYS D CG  1 
ATOM   8823 C CD  . LYS D 2 243 ? 17.353  82.189  121.558 1.00 77.13  ? 417 LYS D CD  1 
ATOM   8824 C CE  . LYS D 2 243 ? 17.073  80.928  120.754 1.00 77.98  ? 417 LYS D CE  1 
ATOM   8825 N NZ  . LYS D 2 243 ? 15.637  80.543  120.837 1.00 78.74  ? 417 LYS D NZ  1 
ATOM   8826 N N   . TYR D 2 244 ? 20.707  85.549  119.794 1.00 74.88  ? 418 TYR D N   1 
ATOM   8827 C CA  . TYR D 2 244 ? 20.867  86.028  118.428 1.00 74.67  ? 418 TYR D CA  1 
ATOM   8828 C C   . TYR D 2 244 ? 22.044  87.006  118.280 1.00 74.47  ? 418 TYR D C   1 
ATOM   8829 O O   . TYR D 2 244 ? 22.021  87.898  117.425 1.00 74.42  ? 418 TYR D O   1 
ATOM   8830 C CB  . TYR D 2 244 ? 19.547  86.633  117.931 1.00 74.73  ? 418 TYR D CB  1 
ATOM   8831 C CG  . TYR D 2 244 ? 18.368  85.688  118.050 1.00 74.83  ? 418 TYR D CG  1 
ATOM   8832 C CD1 . TYR D 2 244 ? 18.261  84.573  117.218 1.00 75.47  ? 418 TYR D CD1 1 
ATOM   8833 C CD2 . TYR D 2 244 ? 17.369  85.898  119.002 1.00 75.36  ? 418 TYR D CD2 1 
ATOM   8834 C CE1 . TYR D 2 244 ? 17.185  83.691  117.323 1.00 75.97  ? 418 TYR D CE1 1 
ATOM   8835 C CE2 . TYR D 2 244 ? 16.284  85.024  119.117 1.00 75.92  ? 418 TYR D CE2 1 
ATOM   8836 C CZ  . TYR D 2 244 ? 16.200  83.922  118.271 1.00 76.15  ? 418 TYR D CZ  1 
ATOM   8837 O OH  . TYR D 2 244 ? 15.141  83.046  118.363 1.00 76.25  ? 418 TYR D OH  1 
ATOM   8838 N N   . HIS D 2 245 ? 23.065  86.824  119.123 1.00 74.12  ? 419 HIS D N   1 
ATOM   8839 C CA  . HIS D 2 245 ? 24.340  87.554  119.045 1.00 73.76  ? 419 HIS D CA  1 
ATOM   8840 C C   . HIS D 2 245 ? 24.201  89.082  118.915 1.00 73.35  ? 419 HIS D C   1 
ATOM   8841 O O   . HIS D 2 245 ? 25.046  89.741  118.302 1.00 73.32  ? 419 HIS D O   1 
ATOM   8842 C CB  . HIS D 2 245 ? 25.216  86.987  117.913 1.00 73.92  ? 419 HIS D CB  1 
ATOM   8843 C CG  . HIS D 2 245 ? 25.486  85.518  118.030 1.00 74.59  ? 419 HIS D CG  1 
ATOM   8844 N ND1 . HIS D 2 245 ? 24.588  84.560  117.607 1.00 75.01  ? 419 HIS D ND1 1 
ATOM   8845 C CD2 . HIS D 2 245 ? 26.552  84.843  118.525 1.00 75.23  ? 419 HIS D CD2 1 
ATOM   8846 C CE1 . HIS D 2 245 ? 25.088  83.358  117.838 1.00 75.55  ? 419 HIS D CE1 1 
ATOM   8847 N NE2 . HIS D 2 245 ? 26.279  83.502  118.394 1.00 75.41  ? 419 HIS D NE2 1 
ATOM   8848 N N   . GLY D 2 246 ? 23.130  89.629  119.491 1.00 72.86  ? 420 GLY D N   1 
ATOM   8849 C CA  . GLY D 2 246 ? 22.858  91.059  119.472 1.00 72.21  ? 420 GLY D CA  1 
ATOM   8850 C C   . GLY D 2 246 ? 22.961  91.752  118.121 1.00 71.93  ? 420 GLY D C   1 
ATOM   8851 O O   . GLY D 2 246 ? 23.477  92.871  118.042 1.00 71.97  ? 420 GLY D O   1 
ATOM   8852 N N   . VAL D 2 247 ? 22.451  91.109  117.068 1.00 71.59  ? 421 VAL D N   1 
ATOM   8853 C CA  . VAL D 2 247 ? 22.601  91.620  115.700 1.00 71.26  ? 421 VAL D CA  1 
ATOM   8854 C C   . VAL D 2 247 ? 21.754  92.856  115.369 1.00 71.24  ? 421 VAL D C   1 
ATOM   8855 O O   . VAL D 2 247 ? 22.064  93.573  114.415 1.00 71.30  ? 421 VAL D O   1 
ATOM   8856 C CB  . VAL D 2 247 ? 22.383  90.523  114.616 1.00 71.26  ? 421 VAL D CB  1 
ATOM   8857 C CG1 . VAL D 2 247 ? 23.575  89.570  114.563 1.00 71.10  ? 421 VAL D CG1 1 
ATOM   8858 C CG2 . VAL D 2 247 ? 21.075  89.769  114.838 1.00 71.09  ? 421 VAL D CG2 1 
ATOM   8859 N N   . SER D 2 248 ? 20.700  93.107  116.145 1.00 71.32  ? 422 SER D N   1 
ATOM   8860 C CA  . SER D 2 248 ? 19.820  94.258  115.894 1.00 71.49  ? 422 SER D CA  1 
ATOM   8861 C C   . SER D 2 248 ? 20.355  95.567  116.483 1.00 71.89  ? 422 SER D C   1 
ATOM   8862 O O   . SER D 2 248 ? 19.846  96.646  116.176 1.00 71.71  ? 422 SER D O   1 
ATOM   8863 C CB  . SER D 2 248 ? 18.393  93.980  116.382 1.00 71.26  ? 422 SER D CB  1 
ATOM   8864 O OG  . SER D 2 248 ? 18.282  94.073  117.792 1.00 70.88  ? 422 SER D OG  1 
ATOM   8865 N N   . LEU D 2 249 ? 21.373  95.460  117.334 1.00 72.71  ? 423 LEU D N   1 
ATOM   8866 C CA  . LEU D 2 249 ? 22.060  96.628  117.884 1.00 73.66  ? 423 LEU D CA  1 
ATOM   8867 C C   . LEU D 2 249 ? 23.194  97.086  116.961 1.00 74.47  ? 423 LEU D C   1 
ATOM   8868 O O   . LEU D 2 249 ? 23.767  98.155  117.160 1.00 74.42  ? 423 LEU D O   1 
ATOM   8869 C CB  . LEU D 2 249 ? 22.599  96.333  119.291 1.00 73.46  ? 423 LEU D CB  1 
ATOM   8870 C CG  . LEU D 2 249 ? 21.612  95.926  120.395 1.00 73.11  ? 423 LEU D CG  1 
ATOM   8871 C CD1 . LEU D 2 249 ? 22.274  94.957  121.377 1.00 72.06  ? 423 LEU D CD1 1 
ATOM   8872 C CD2 . LEU D 2 249 ? 21.020  97.132  121.127 1.00 72.59  ? 423 LEU D CD2 1 
ATOM   8873 N N   . LEU D 2 250 ? 23.510  96.265  115.958 1.00 75.73  ? 424 LEU D N   1 
ATOM   8874 C CA  . LEU D 2 250 ? 24.515  96.593  114.950 1.00 77.07  ? 424 LEU D CA  1 
ATOM   8875 C C   . LEU D 2 250 ? 24.023  97.724  114.050 1.00 78.43  ? 424 LEU D C   1 
ATOM   8876 O O   . LEU D 2 250 ? 22.837  98.066  114.053 1.00 78.60  ? 424 LEU D O   1 
ATOM   8877 C CB  . LEU D 2 250 ? 24.862  95.364  114.094 1.00 76.78  ? 424 LEU D CB  1 
ATOM   8878 C CG  . LEU D 2 250 ? 25.498  94.088  114.672 1.00 76.30  ? 424 LEU D CG  1 
ATOM   8879 C CD1 . LEU D 2 250 ? 26.262  93.350  113.576 1.00 75.85  ? 424 LEU D CD1 1 
ATOM   8880 C CD2 . LEU D 2 250 ? 26.407  94.336  115.885 1.00 76.03  ? 424 LEU D CD2 1 
ATOM   8881 N N   . ASN D 2 251 ? 24.940  98.301  113.279 1.00 80.15  ? 425 ASN D N   1 
ATOM   8882 C CA  . ASN D 2 251 ? 24.603  99.412  112.399 1.00 81.81  ? 425 ASN D CA  1 
ATOM   8883 C C   . ASN D 2 251 ? 24.519  99.005  110.932 1.00 83.25  ? 425 ASN D C   1 
ATOM   8884 O O   . ASN D 2 251 ? 25.417  98.334  110.416 1.00 83.31  ? 425 ASN D O   1 
ATOM   8885 C CB  . ASN D 2 251 ? 25.592  100.566 112.585 1.00 81.76  ? 425 ASN D CB  1 
ATOM   8886 C CG  . ASN D 2 251 ? 25.400  101.295 113.904 1.00 81.40  ? 425 ASN D CG  1 
ATOM   8887 O OD1 . ASN D 2 251 ? 26.368  101.758 114.508 1.00 81.11  ? 425 ASN D OD1 1 
ATOM   8888 N ND2 . ASN D 2 251 ? 24.149  101.405 114.354 1.00 81.16  ? 425 ASN D ND2 1 
ATOM   8889 N N   . PRO D 2 252 ? 23.431  99.400  110.268 1.00 84.74  ? 426 PRO D N   1 
ATOM   8890 C CA  . PRO D 2 252 ? 23.275  99.157  108.831 1.00 86.07  ? 426 PRO D CA  1 
ATOM   8891 C C   . PRO D 2 252 ? 24.228  100.050 108.041 1.00 87.80  ? 426 PRO D C   1 
ATOM   8892 O O   . PRO D 2 252 ? 24.559  101.133 108.529 1.00 87.81  ? 426 PRO D O   1 
ATOM   8893 C CB  . PRO D 2 252 ? 21.823  99.568  108.564 1.00 85.93  ? 426 PRO D CB  1 
ATOM   8894 C CG  . PRO D 2 252 ? 21.490  100.552 109.644 1.00 85.30  ? 426 PRO D CG  1 
ATOM   8895 C CD  . PRO D 2 252 ? 22.269  100.107 110.844 1.00 84.81  ? 426 PRO D CD  1 
ATOM   8896 N N   . PRO D 2 253 ? 24.676  99.610  106.866 1.00 89.53  ? 427 PRO D N   1 
ATOM   8897 C CA  . PRO D 2 253 ? 25.499  100.454 105.993 1.00 91.19  ? 427 PRO D CA  1 
ATOM   8898 C C   . PRO D 2 253 ? 24.768  101.734 105.577 1.00 93.05  ? 427 PRO D C   1 
ATOM   8899 O O   . PRO D 2 253 ? 23.534  101.761 105.556 1.00 93.03  ? 427 PRO D O   1 
ATOM   8900 C CB  . PRO D 2 253 ? 25.742  99.560  104.773 1.00 91.00  ? 427 PRO D CB  1 
ATOM   8901 C CG  . PRO D 2 253 ? 25.559  98.177  105.280 1.00 90.20  ? 427 PRO D CG  1 
ATOM   8902 C CD  . PRO D 2 253 ? 24.451  98.277  106.281 1.00 89.60  ? 427 PRO D CD  1 
ATOM   8903 N N   . GLU D 2 254 ? 25.528  102.783 105.271 1.00 95.44  ? 428 GLU D N   1 
ATOM   8904 C CA  . GLU D 2 254 ? 24.953  104.032 104.778 1.00 97.88  ? 428 GLU D CA  1 
ATOM   8905 C C   . GLU D 2 254 ? 24.390  103.829 103.368 1.00 99.62  ? 428 GLU D C   1 
ATOM   8906 O O   . GLU D 2 254 ? 23.267  104.247 103.075 1.00 99.81  ? 428 GLU D O   1 
ATOM   8907 C CB  . GLU D 2 254 ? 25.982  105.178 104.825 1.00 97.80  ? 428 GLU D CB  1 
ATOM   8908 C CG  . GLU D 2 254 ? 27.247  104.962 103.994 1.00 98.10  ? 428 GLU D CG  1 
ATOM   8909 C CD  . GLU D 2 254 ? 28.362  105.940 104.327 1.00 98.08  ? 428 GLU D CD  1 
ATOM   8910 O OE1 . GLU D 2 254 ? 29.434  105.478 104.777 1.00 97.68  ? 428 GLU D OE1 1 
ATOM   8911 O OE2 . GLU D 2 254 ? 28.175  107.165 104.131 1.00 97.77  ? 428 GLU D OE2 1 
ATOM   8912 N N   . THR D 2 255 ? 25.183  103.178 102.514 1.00 101.98 ? 429 THR D N   1 
ATOM   8913 C CA  . THR D 2 255 ? 24.770  102.761 101.172 1.00 104.36 ? 429 THR D CA  1 
ATOM   8914 C C   . THR D 2 255 ? 25.277  101.341 100.912 1.00 106.04 ? 429 THR D C   1 
ATOM   8915 O O   . THR D 2 255 ? 26.138  100.837 101.639 1.00 106.07 ? 429 THR D O   1 
ATOM   8916 C CB  . THR D 2 255 ? 25.308  103.723 100.075 1.00 104.33 ? 429 THR D CB  1 
ATOM   8917 O OG1 . THR D 2 255 ? 26.731  103.854 100.196 1.00 104.55 ? 429 THR D OG1 1 
ATOM   8918 C CG2 . THR D 2 255 ? 24.787  105.155 100.260 1.00 104.46 ? 429 THR D CG2 1 
ATOM   8919 N N   . LEU D 2 256 ? 24.746  100.706 99.870  1.00 108.38 ? 430 LEU D N   1 
ATOM   8920 C CA  . LEU D 2 256 ? 25.098  99.325  99.541  1.00 110.73 ? 430 LEU D CA  1 
ATOM   8921 C C   . LEU D 2 256 ? 26.152  99.223  98.444  1.00 112.26 ? 430 LEU D C   1 
ATOM   8922 O O   . LEU D 2 256 ? 26.703  98.144  98.211  1.00 112.46 ? 430 LEU D O   1 
ATOM   8923 C CB  . LEU D 2 256 ? 23.851  98.534  99.128  1.00 110.75 ? 430 LEU D CB  1 
ATOM   8924 C CG  . LEU D 2 256 ? 23.199  97.635  100.184 1.00 111.22 ? 430 LEU D CG  1 
ATOM   8925 C CD1 . LEU D 2 256 ? 21.717  97.487  99.892  1.00 111.55 ? 430 LEU D CD1 1 
ATOM   8926 C CD2 . LEU D 2 256 ? 23.871  96.267  100.249 1.00 111.55 ? 430 LEU D CD2 1 
ATOM   8927 N N   . ASN D 2 257 ? 26.428  100.349 97.785  1.00 114.26 ? 431 ASN D N   1 
ATOM   8928 C CA  . ASN D 2 257 ? 27.311  100.404 96.613  1.00 116.16 ? 431 ASN D CA  1 
ATOM   8929 C C   . ASN D 2 257 ? 26.781  99.541  95.461  1.00 117.09 ? 431 ASN D C   1 
ATOM   8930 O O   . ASN D 2 257 ? 27.529  98.794  94.818  1.00 117.29 ? 431 ASN D O   1 
ATOM   8931 C CB  . ASN D 2 257 ? 28.769  100.051 96.972  1.00 116.41 ? 431 ASN D CB  1 
ATOM   8932 C CG  . ASN D 2 257 ? 29.334  100.918 98.099  1.00 117.39 ? 431 ASN D CG  1 
ATOM   8933 O OD1 . ASN D 2 257 ? 30.130  100.450 98.914  1.00 118.20 ? 431 ASN D OD1 1 
ATOM   8934 N ND2 . ASN D 2 257 ? 28.928  102.184 98.142  1.00 118.50 ? 431 ASN D ND2 1 
ATOM   8935 N N   . LEU D 2 258 ? 25.475  99.660  95.220  1.00 118.22 ? 432 LEU D N   1 
ATOM   8936 C CA  . LEU D 2 258 ? 24.774  98.873  94.209  1.00 119.11 ? 432 LEU D CA  1 
ATOM   8937 C C   . LEU D 2 258 ? 23.627  99.671  93.590  1.00 119.26 ? 432 LEU D C   1 
ATOM   8938 O O   . LEU D 2 258 ? 22.968  100.465 94.268  1.00 119.39 ? 432 LEU D O   1 
ATOM   8939 C CB  . LEU D 2 258 ? 24.239  97.571  94.825  1.00 119.49 ? 432 LEU D CB  1 
ATOM   8940 C CG  . LEU D 2 258 ? 24.459  96.214  94.134  1.00 120.52 ? 432 LEU D CG  1 
ATOM   8941 C CD1 . LEU D 2 258 ? 23.409  95.966  93.051  1.00 121.71 ? 432 LEU D CD1 1 
ATOM   8942 C CD2 . LEU D 2 258 ? 25.876  96.042  93.572  1.00 121.49 ? 432 LEU D CD2 1 
HETATM 8943 O O37 . UCN E 3 .   ? 10.550  113.830 52.802  1.00 44.85  ? 410 UCN A O37 1 
HETATM 8944 C C9  . UCN E 3 .   ? 9.907   113.714 51.527  1.00 26.78  ? 410 UCN A C9  1 
HETATM 8945 N N1  . UCN E 3 .   ? 10.493  112.732 50.607  1.00 27.50  ? 410 UCN A N1  1 
HETATM 8946 C C8  . UCN E 3 .   ? 9.594   112.012 49.925  1.00 27.51  ? 410 UCN A C8  1 
HETATM 8947 O O5  . UCN E 3 .   ? 9.783   111.219 49.026  1.00 29.68  ? 410 UCN A O5  1 
HETATM 8948 C C7  . UCN E 3 .   ? 8.260   112.379 50.415  1.00 27.71  ? 410 UCN A C7  1 
HETATM 8949 C C6  . UCN E 3 .   ? 6.913   111.897 50.091  1.00 28.93  ? 410 UCN A C6  1 
HETATM 8950 C C5  . UCN E 3 .   ? 6.399   110.874 49.175  1.00 30.00  ? 410 UCN A C5  1 
HETATM 8951 C C20 . UCN E 3 .   ? 4.938   110.897 49.347  1.00 31.97  ? 410 UCN A C20 1 
HETATM 8952 C C1  . UCN E 3 .   ? 4.135   110.022 48.604  1.00 33.33  ? 410 UCN A C1  1 
HETATM 8953 C C2  . UCN E 3 .   ? 4.785   109.142 47.727  1.00 32.93  ? 410 UCN A C2  1 
HETATM 8954 C C3  . UCN E 3 .   ? 6.187   109.126 47.586  1.00 32.74  ? 410 UCN A C3  1 
HETATM 8955 C C4  . UCN E 3 .   ? 7.024   109.988 48.315  1.00 31.51  ? 410 UCN A C4  1 
HETATM 8956 N N3  . UCN E 3 .   ? 4.585   111.891 50.291  1.00 30.27  ? 410 UCN A N3  1 
HETATM 8957 C C19 . UCN E 3 .   ? 5.762   112.496 50.775  1.00 28.23  ? 410 UCN A C19 1 
HETATM 8958 C C18 . UCN E 3 .   ? 5.910   113.529 51.713  1.00 27.59  ? 410 UCN A C18 1 
HETATM 8959 N N2  . UCN E 3 .   ? 5.066   114.237 52.502  1.00 26.78  ? 410 UCN A N2  1 
HETATM 8960 C C17 . UCN E 3 .   ? 5.666   115.134 53.319  1.00 25.30  ? 410 UCN A C17 1 
HETATM 8961 C C12 . UCN E 3 .   ? 7.123   115.030 53.064  1.00 25.29  ? 410 UCN A C12 1 
HETATM 8962 C C13 . UCN E 3 .   ? 8.083   115.820 53.776  1.00 24.69  ? 410 UCN A C13 1 
HETATM 8963 C C14 . UCN E 3 .   ? 7.609   116.734 54.715  1.00 23.90  ? 410 UCN A C14 1 
HETATM 8964 C C15 . UCN E 3 .   ? 6.242   116.871 54.979  1.00 25.68  ? 410 UCN A C15 1 
HETATM 8965 C C16 . UCN E 3 .   ? 5.277   116.096 54.323  1.00 25.62  ? 410 UCN A C16 1 
HETATM 8966 C C11 . UCN E 3 .   ? 7.295   113.984 52.031  1.00 26.35  ? 410 UCN A C11 1 
HETATM 8967 C C10 . UCN E 3 .   ? 8.423   113.434 51.408  1.00 27.74  ? 410 UCN A C10 1 
HETATM 8968 C C21 . UCN E 3 .   ? 3.607   113.915 52.487  1.00 28.35  ? 410 UCN A C21 1 
HETATM 8969 O O4  . UCN E 3 .   ? 3.214   113.629 51.132  1.00 29.01  ? 410 UCN A O4  1 
HETATM 8970 C C25 . UCN E 3 .   ? 3.210   112.282 50.630  1.00 29.64  ? 410 UCN A C25 1 
HETATM 8971 C C24 . UCN E 3 .   ? 2.580   111.273 51.610  1.00 29.02  ? 410 UCN A C24 1 
HETATM 8972 C C23 . UCN E 3 .   ? 2.194   111.957 52.930  1.00 29.99  ? 410 UCN A C23 1 
HETATM 8973 N N4  . UCN E 3 .   ? 1.681   111.062 53.950  1.00 30.27  ? 410 UCN A N4  1 
HETATM 8974 C C28 . UCN E 3 .   ? 1.776   109.640 53.693  1.00 33.77  ? 410 UCN A C28 1 
HETATM 8975 C C22 . UCN E 3 .   ? 3.393   112.748 53.454  1.00 28.59  ? 410 UCN A C22 1 
HETATM 8976 O O6  . UCN E 3 .   ? 4.565   111.906 53.535  1.00 28.48  ? 410 UCN A O6  1 
HETATM 8977 C C27 . UCN E 3 .   ? 5.214   111.872 54.807  1.00 27.06  ? 410 UCN A C27 1 
HETATM 8978 C C26 . UCN E 3 .   ? 2.719   115.094 52.889  1.00 28.94  ? 410 UCN A C26 1 
HETATM 8979 O O37 . UCN F 3 .   ? -2.817  53.421  102.688 1.00 44.66  ? 411 UCN C O37 1 
HETATM 8980 C C9  . UCN F 3 .   ? -4.186  52.831  102.736 1.00 33.09  ? 411 UCN C C9  1 
HETATM 8981 N N1  . UCN F 3 .   ? -4.535  51.997  101.584 1.00 34.33  ? 411 UCN C N1  1 
HETATM 8982 C C8  . UCN F 3 .   ? -4.695  50.694  101.849 1.00 33.72  ? 411 UCN C C8  1 
HETATM 8983 O O5  . UCN F 3 .   ? -5.041  49.795  101.102 1.00 34.86  ? 411 UCN C O5  1 
HETATM 8984 C C7  . UCN F 3 .   ? -4.412  50.502  103.272 1.00 33.90  ? 411 UCN C C7  1 
HETATM 8985 C C6  . UCN F 3 .   ? -4.415  49.315  104.138 1.00 34.20  ? 411 UCN C C6  1 
HETATM 8986 C C5  . UCN F 3 .   ? -4.608  47.883  103.894 1.00 33.57  ? 411 UCN C C5  1 
HETATM 8987 C C20 . UCN F 3 .   ? -4.356  47.224  105.193 1.00 34.40  ? 411 UCN C C20 1 
HETATM 8988 C C1  . UCN F 3 .   ? -4.422  45.836  105.294 1.00 34.20  ? 411 UCN C C1  1 
HETATM 8989 C C2  . UCN F 3 .   ? -4.683  45.122  104.112 1.00 34.81  ? 411 UCN C C2  1 
HETATM 8990 C C3  . UCN F 3 .   ? -4.871  45.761  102.868 1.00 34.94  ? 411 UCN C C3  1 
HETATM 8991 C C4  . UCN F 3 .   ? -4.815  47.159  102.732 1.00 33.66  ? 411 UCN C C4  1 
HETATM 8992 N N3  . UCN F 3 .   ? -4.129  48.209  106.178 1.00 34.87  ? 411 UCN C N3  1 
HETATM 8993 C C19 . UCN F 3 .   ? -4.058  49.472  105.555 1.00 34.72  ? 411 UCN C C19 1 
HETATM 8994 C C18 . UCN F 3 .   ? -3.772  50.727  106.112 1.00 34.52  ? 411 UCN C C18 1 
HETATM 8995 N N2  . UCN F 3 .   ? -3.423  51.178  107.335 1.00 35.17  ? 411 UCN C N2  1 
HETATM 8996 C C17 . UCN F 3 .   ? -3.151  52.519  107.376 1.00 35.54  ? 411 UCN C C17 1 
HETATM 8997 C C12 . UCN F 3 .   ? -3.408  53.058  106.018 1.00 34.77  ? 411 UCN C C12 1 
HETATM 8998 C C13 . UCN F 3 .   ? -3.174  54.425  105.652 1.00 34.88  ? 411 UCN C C13 1 
HETATM 8999 C C14 . UCN F 3 .   ? -2.745  55.291  106.651 1.00 36.14  ? 411 UCN C C14 1 
HETATM 9000 C C15 . UCN F 3 .   ? -2.508  54.842  107.955 1.00 36.03  ? 411 UCN C C15 1 
HETATM 9001 C C16 . UCN F 3 .   ? -2.690  53.506  108.328 1.00 36.02  ? 411 UCN C C16 1 
HETATM 9002 C C11 . UCN F 3 .   ? -3.805  51.907  105.196 1.00 34.33  ? 411 UCN C C11 1 
HETATM 9003 C C10 . UCN F 3 .   ? -4.095  51.804  103.836 1.00 33.97  ? 411 UCN C C10 1 
HETATM 9004 C C21 . UCN F 3 .   ? -3.266  50.196  108.461 1.00 35.95  ? 411 UCN C C21 1 
HETATM 9005 O O4  . UCN F 3 .   ? -4.325  49.237  108.335 1.00 35.42  ? 411 UCN C O4  1 
HETATM 9006 C C25 . UCN F 3 .   ? -4.110  47.997  107.626 1.00 35.97  ? 411 UCN C C25 1 
HETATM 9007 C C24 . UCN F 3 .   ? -2.800  47.290  107.966 1.00 36.48  ? 411 UCN C C24 1 
HETATM 9008 C C23 . UCN F 3 .   ? -1.989  48.113  108.948 1.00 38.11  ? 411 UCN C C23 1 
HETATM 9009 N N4  . UCN F 3 .   ? -0.695  47.486  109.146 1.00 40.13  ? 411 UCN C N4  1 
HETATM 9010 C C28 . UCN F 3 .   ? -0.627  46.296  109.983 1.00 41.62  ? 411 UCN C C28 1 
HETATM 9011 C C22 . UCN F 3 .   ? -1.877  49.540  108.415 1.00 36.98  ? 411 UCN C C22 1 
HETATM 9012 O O6  . UCN F 3 .   ? -1.336  49.474  107.084 1.00 36.68  ? 411 UCN C O6  1 
HETATM 9013 C C27 . UCN F 3 .   ? -0.287  50.421  106.849 1.00 36.83  ? 411 UCN C C27 1 
HETATM 9014 C C26 . UCN F 3 .   ? -3.469  50.849  109.829 1.00 35.77  ? 411 UCN C C26 1 
HETATM 9015 O O   . HOH G 4 .   ? 4.262   98.457  82.002  1.00 25.22  ? 411 HOH A O   1 
HETATM 9016 O O   . HOH G 4 .   ? 14.052  107.458 75.366  1.00 17.36  ? 412 HOH A O   1 
HETATM 9017 O O   . HOH G 4 .   ? 5.636   110.146 68.001  1.00 15.70  ? 413 HOH A O   1 
HETATM 9018 O O   . HOH G 4 .   ? 12.072  123.745 68.955  1.00 25.04  ? 414 HOH A O   1 
HETATM 9019 O O   . HOH G 4 .   ? -1.454  104.839 71.831  1.00 19.07  ? 415 HOH A O   1 
HETATM 9020 O O   . HOH G 4 .   ? 19.121  121.824 77.927  1.00 28.95  ? 416 HOH A O   1 
HETATM 9021 O O   . HOH G 4 .   ? 2.904   98.019  79.807  1.00 24.06  ? 417 HOH A O   1 
HETATM 9022 O O   . HOH G 4 .   ? 12.642  105.813 78.668  1.00 39.00  ? 418 HOH A O   1 
HETATM 9023 O O   . HOH G 4 .   ? 7.421   118.108 78.045  1.00 21.80  ? 419 HOH A O   1 
HETATM 9024 O O   . HOH G 4 .   ? 18.887  109.995 54.329  1.00 21.07  ? 420 HOH A O   1 
HETATM 9025 O O   . HOH G 4 .   ? -13.184 103.402 69.261  1.00 38.16  ? 421 HOH A O   1 
HETATM 9026 O O   . HOH G 4 .   ? -7.494  98.440  70.994  1.00 33.71  ? 422 HOH A O   1 
HETATM 9027 O O   . HOH G 4 .   ? 24.006  112.364 50.633  1.00 41.00  ? 423 HOH A O   1 
HETATM 9028 O O   . HOH G 4 .   ? 18.610  120.053 80.828  1.00 18.59  ? 424 HOH A O   1 
HETATM 9029 O O   . HOH G 4 .   ? 22.753  104.817 63.135  1.00 44.43  ? 425 HOH A O   1 
HETATM 9030 O O   . HOH G 4 .   ? -0.045  96.986  84.131  1.00 36.39  ? 426 HOH A O   1 
HETATM 9031 O O   . HOH G 4 .   ? 21.682  105.704 65.829  1.00 25.05  ? 427 HOH A O   1 
HETATM 9032 O O   . HOH G 4 .   ? 7.479   110.961 78.220  1.00 19.96  ? 428 HOH A O   1 
HETATM 9033 O O   . HOH G 4 .   ? 21.289  99.118  59.912  1.00 31.37  ? 429 HOH A O   1 
HETATM 9034 O O   . HOH G 4 .   ? 10.613  115.029 55.862  1.00 33.63  ? 430 HOH A O   1 
HETATM 9035 O O   . HOH G 4 .   ? 12.025  99.801  51.761  1.00 35.72  ? 431 HOH A O   1 
HETATM 9036 O O   . HOH G 4 .   ? -2.160  102.061 67.788  1.00 18.84  ? 432 HOH A O   1 
HETATM 9037 O O   . HOH G 4 .   ? 2.486   114.568 79.376  1.00 49.98  ? 433 HOH A O   1 
HETATM 9038 O O   . HOH G 4 .   ? 14.094  115.410 81.320  1.00 30.60  ? 434 HOH A O   1 
HETATM 9039 O O   . HOH G 4 .   ? 2.755   113.914 56.958  1.00 35.30  ? 435 HOH A O   1 
HETATM 9040 O O   . HOH G 4 .   ? 3.480   108.747 71.449  1.00 19.45  ? 436 HOH A O   1 
HETATM 9041 O O   . HOH G 4 .   ? -0.689  100.918 65.955  1.00 19.91  ? 437 HOH A O   1 
HETATM 9042 O O   . HOH G 4 .   ? 0.579   118.842 80.122  1.00 60.21  ? 438 HOH A O   1 
HETATM 9043 O O   . HOH G 4 .   ? 21.259  116.520 42.814  1.00 36.66  ? 439 HOH A O   1 
HETATM 9044 O O   . HOH G 4 .   ? -5.522  95.573  71.407  1.00 42.24  ? 440 HOH A O   1 
HETATM 9045 O O   . HOH G 4 .   ? 5.504   100.716 84.050  1.00 43.26  ? 441 HOH A O   1 
HETATM 9046 O O   . HOH G 4 .   ? 21.587  91.564  73.477  1.00 46.03  ? 442 HOH A O   1 
HETATM 9047 O O   . HOH G 4 .   ? 18.952  113.157 56.935  1.00 25.16  ? 443 HOH A O   1 
HETATM 9048 O O   . HOH G 4 .   ? 21.659  115.696 46.121  1.00 37.96  ? 444 HOH A O   1 
HETATM 9049 O O   . HOH G 4 .   ? -5.862  113.295 89.057  1.00 35.67  ? 445 HOH A O   1 
HETATM 9050 O O   . HOH G 4 .   ? 14.782  104.784 79.799  1.00 41.66  ? 446 HOH A O   1 
HETATM 9051 O O   . HOH G 4 .   ? 17.085  130.444 47.734  1.00 35.89  ? 447 HOH A O   1 
HETATM 9052 O O   . HOH G 4 .   ? 24.188  109.718 67.732  1.00 27.05  ? 448 HOH A O   1 
HETATM 9053 O O   . HOH G 4 .   ? 12.921  113.968 57.240  1.00 30.64  ? 449 HOH A O   1 
HETATM 9054 O O   . HOH G 4 .   ? 20.333  125.780 44.655  1.00 40.53  ? 450 HOH A O   1 
HETATM 9055 O O   . HOH G 4 .   ? 3.445   89.060  59.794  1.00 46.86  ? 451 HOH A O   1 
HETATM 9056 O O   . HOH G 4 .   ? 21.943  94.462  55.946  1.00 44.80  ? 452 HOH A O   1 
HETATM 9057 O O   . HOH G 4 .   ? -5.044  112.748 66.444  1.00 38.77  ? 453 HOH A O   1 
HETATM 9058 O O   . HOH G 4 .   ? 18.317  126.885 43.859  1.00 50.66  ? 454 HOH A O   1 
HETATM 9059 O O   . HOH G 4 .   ? 6.149   126.071 40.341  1.00 54.53  ? 455 HOH A O   1 
HETATM 9060 O O   . HOH G 4 .   ? 20.869  97.724  75.888  1.00 47.37  ? 456 HOH A O   1 
HETATM 9061 O O   . HOH G 4 .   ? 10.485  138.727 52.290  1.00 59.31  ? 457 HOH A O   1 
HETATM 9062 O O   . HOH G 4 .   ? 4.876   118.533 78.716  1.00 30.78  ? 458 HOH A O   1 
HETATM 9063 O O   . HOH G 4 .   ? 2.435   112.049 88.766  1.00 48.36  ? 459 HOH A O   1 
HETATM 9064 O O   . HOH G 4 .   ? 16.491  88.356  59.940  1.00 45.53  ? 460 HOH A O   1 
HETATM 9065 O O   . HOH G 4 .   ? -4.861  89.505  69.541  1.00 36.39  ? 461 HOH A O   1 
HETATM 9066 O O   . HOH G 4 .   ? 18.892  121.209 74.716  1.00 53.97  ? 462 HOH A O   1 
HETATM 9067 O O   . HOH G 4 .   ? 20.696  93.418  68.630  1.00 54.18  ? 463 HOH A O   1 
HETATM 9068 O O   . HOH G 4 .   ? 22.810  123.850 66.460  1.00 39.63  ? 464 HOH A O   1 
HETATM 9069 O O   . HOH G 4 .   ? -5.490  96.284  87.312  1.00 37.92  ? 465 HOH A O   1 
HETATM 9070 O O   . HOH G 4 .   ? 0.826   116.575 77.852  1.00 39.78  ? 466 HOH A O   1 
HETATM 9071 O O   . HOH G 4 .   ? 10.134  123.278 84.218  1.00 44.80  ? 467 HOH A O   1 
HETATM 9072 O O   . HOH G 4 .   ? 21.876  93.273  65.462  1.00 31.08  ? 468 HOH A O   1 
HETATM 9073 O O   . HOH G 4 .   ? -1.408  83.570  71.156  1.00 41.54  ? 469 HOH A O   1 
HETATM 9074 O O   . HOH G 4 .   ? -4.979  99.077  88.253  1.00 38.90  ? 470 HOH A O   1 
HETATM 9075 O O   . HOH G 4 .   ? 18.901  103.365 50.400  1.00 47.74  ? 471 HOH A O   1 
HETATM 9076 O O   . HOH G 4 .   ? 7.315   125.780 78.845  1.00 56.95  ? 472 HOH A O   1 
HETATM 9077 O O   . HOH G 4 .   ? 7.200   139.387 51.085  1.00 51.25  ? 473 HOH A O   1 
HETATM 9078 O O   . HOH G 4 .   ? 1.934   115.899 86.165  1.00 40.49  ? 474 HOH A O   1 
HETATM 9079 O O   . HOH G 4 .   ? 3.896   126.079 69.147  1.00 27.60  ? 475 HOH A O   1 
HETATM 9080 O O   . HOH G 4 .   ? -6.946  117.358 76.987  1.00 54.54  ? 476 HOH A O   1 
HETATM 9081 O O   . HOH G 4 .   ? -4.266  113.825 74.842  1.00 36.42  ? 477 HOH A O   1 
HETATM 9082 O O   . HOH G 4 .   ? 2.904   129.758 62.833  1.00 46.85  ? 478 HOH A O   1 
HETATM 9083 O O   . HOH G 4 .   ? -0.424  134.625 51.114  1.00 78.83  ? 479 HOH A O   1 
HETATM 9084 O O   . HOH G 4 .   ? 17.392  123.444 78.775  1.00 41.42  ? 480 HOH A O   1 
HETATM 9085 O O   . HOH G 4 .   ? 3.576   94.012  49.117  1.00 49.42  ? 481 HOH A O   1 
HETATM 9086 O O   . HOH G 4 .   ? 24.419  112.517 52.956  1.00 56.36  ? 482 HOH A O   1 
HETATM 9087 O O   . HOH G 4 .   ? 16.106  91.086  59.120  1.00 41.86  ? 483 HOH A O   1 
HETATM 9088 O O   . HOH G 4 .   ? 1.904   114.646 60.001  1.00 42.46  ? 484 HOH A O   1 
HETATM 9089 O O   . HOH G 4 .   ? -13.908 101.748 76.499  1.00 27.76  ? 485 HOH A O   1 
HETATM 9090 O O   . HOH G 4 .   ? 8.025   120.330 88.727  1.00 45.51  ? 486 HOH A O   1 
HETATM 9091 O O   . HOH G 4 .   ? 7.189   139.400 53.922  1.00 49.72  ? 487 HOH A O   1 
HETATM 9092 O O   . HOH G 4 .   ? 25.307  104.762 75.869  1.00 48.57  ? 488 HOH A O   1 
HETATM 9093 O O   . HOH G 4 .   ? -0.523  123.104 75.094  1.00 35.73  ? 489 HOH A O   1 
HETATM 9094 O O   . HOH G 4 .   ? 15.009  89.922  76.571  1.00 37.18  ? 490 HOH A O   1 
HETATM 9095 O O   . HOH G 4 .   ? 6.224   122.059 58.059  1.00 41.51  ? 491 HOH A O   1 
HETATM 9096 O O   . HOH G 4 .   ? -1.821  80.333  74.666  1.00 35.08  ? 492 HOH A O   1 
HETATM 9097 O O   . HOH G 4 .   ? -12.140 102.310 74.512  1.00 49.50  ? 493 HOH A O   1 
HETATM 9098 O O   . HOH G 4 .   ? 13.236  122.822 77.181  1.00 31.08  ? 494 HOH A O   1 
HETATM 9099 O O   . HOH G 4 .   ? 11.139  124.480 35.223  1.00 55.16  ? 495 HOH A O   1 
HETATM 9100 O O   . HOH G 4 .   ? 2.989   121.724 67.789  1.00 48.01  ? 496 HOH A O   1 
HETATM 9101 O O   . HOH G 4 .   ? 12.316  105.747 76.136  1.00 28.91  ? 497 HOH A O   1 
HETATM 9102 O O   . HOH G 4 .   ? 22.941  110.338 51.485  1.00 42.20  ? 498 HOH A O   1 
HETATM 9103 O O   . HOH G 4 .   ? 22.814  91.252  64.491  1.00 50.14  ? 499 HOH A O   1 
HETATM 9104 O O   . HOH G 4 .   ? -3.062  122.080 75.972  1.00 59.74  ? 500 HOH A O   1 
HETATM 9105 O O   . HOH G 4 .   ? 2.263   118.888 77.701  1.00 28.84  ? 501 HOH A O   1 
HETATM 9106 O O   . HOH G 4 .   ? 18.962  96.796  58.139  1.00 46.67  ? 502 HOH A O   1 
HETATM 9107 O O   . HOH G 4 .   ? 14.878  103.301 45.797  1.00 70.50  ? 503 HOH A O   1 
HETATM 9108 O O   . HOH G 4 .   ? -12.677 101.477 89.372  1.00 46.08  ? 504 HOH A O   1 
HETATM 9109 O O   . HOH G 4 .   ? 12.311  114.885 83.828  1.00 64.97  ? 505 HOH A O   1 
HETATM 9110 O O   . HOH G 4 .   ? -10.378 92.650  82.842  1.00 74.65  ? 506 HOH A O   1 
HETATM 9111 O O   . HOH G 4 .   ? 20.362  102.346 58.848  1.00 38.19  ? 507 HOH A O   1 
HETATM 9112 O O   . HOH G 4 .   ? 12.184  121.706 83.640  1.00 33.11  ? 508 HOH A O   1 
HETATM 9113 O O   . HOH G 4 .   ? 5.708   87.916  62.221  1.00 57.81  ? 509 HOH A O   1 
HETATM 9114 O O   . HOH G 4 .   ? 2.465   111.204 36.608  1.00 51.03  ? 510 HOH A O   1 
HETATM 9115 O O   . HOH G 4 .   ? 6.667   121.568 65.934  1.00 36.32  ? 511 HOH A O   1 
HETATM 9116 O O   . HOH G 4 .   ? 16.909  110.186 42.478  1.00 48.62  ? 512 HOH A O   1 
HETATM 9117 O O   . HOH G 4 .   ? -1.128  113.449 51.504  1.00 45.37  ? 513 HOH A O   1 
HETATM 9118 O O   . HOH G 4 .   ? 10.063  123.829 32.843  1.00 61.79  ? 514 HOH A O   1 
HETATM 9119 O O   . HOH G 4 .   ? -7.139  88.953  64.747  1.00 63.21  ? 515 HOH A O   1 
HETATM 9120 O O   . HOH G 4 .   ? -2.309  118.846 82.360  1.00 35.05  ? 516 HOH A O   1 
HETATM 9121 O O   . HOH G 4 .   ? 20.183  118.847 45.865  1.00 50.57  ? 517 HOH A O   1 
HETATM 9122 O O   . HOH G 4 .   ? 24.251  118.960 62.620  1.00 47.93  ? 518 HOH A O   1 
HETATM 9123 O O   . HOH G 4 .   ? 5.812   109.247 85.238  1.00 32.95  ? 519 HOH A O   1 
HETATM 9124 O O   . HOH G 4 .   ? 14.553  102.180 80.635  1.00 38.51  ? 520 HOH A O   1 
HETATM 9125 O O   . HOH G 4 .   ? -0.450  89.185  81.802  1.00 45.66  ? 521 HOH A O   1 
HETATM 9126 O O   . HOH G 4 .   ? 7.139   115.939 63.370  1.00 24.04  ? 522 HOH A O   1 
HETATM 9127 O O   . HOH G 4 .   ? 10.465  110.618 78.187  1.00 51.21  ? 523 HOH A O   1 
HETATM 9128 O O   . HOH G 4 .   ? -13.076 102.625 91.527  1.00 42.24  ? 524 HOH A O   1 
HETATM 9129 O O   . HOH G 4 .   ? 14.659  115.515 85.882  1.00 45.11  ? 525 HOH A O   1 
HETATM 9130 O O   . HOH G 4 .   ? 20.160  121.586 54.006  1.00 49.23  ? 526 HOH A O   1 
HETATM 9131 O O   . HOH G 4 .   ? 19.681  123.878 53.520  1.00 57.99  ? 527 HOH A O   1 
HETATM 9132 O O   . HOH G 4 .   ? 8.773   96.043  80.299  1.00 61.77  ? 528 HOH A O   1 
HETATM 9133 O O   . HOH G 4 .   ? 13.225  86.895  65.799  1.00 43.82  ? 529 HOH A O   1 
HETATM 9134 O O   . HOH G 4 .   ? 18.455  118.239 43.521  1.00 33.23  ? 530 HOH A O   1 
HETATM 9135 O O   . HOH G 4 .   ? 3.910   127.824 40.151  1.00 64.30  ? 531 HOH A O   1 
HETATM 9136 O O   . HOH G 4 .   ? 3.330   86.431  70.881  1.00 46.17  ? 532 HOH A O   1 
HETATM 9137 O O   . HOH G 4 .   ? 23.114  94.770  53.681  1.00 48.49  ? 533 HOH A O   1 
HETATM 9138 O O   . HOH G 4 .   ? 12.521  113.329 81.328  1.00 44.34  ? 534 HOH A O   1 
HETATM 9139 O O   . HOH G 4 .   ? -0.843  92.401  78.181  1.00 38.13  ? 535 HOH A O   1 
HETATM 9140 O O   . HOH G 4 .   ? 16.287  111.530 46.165  1.00 44.83  ? 536 HOH A O   1 
HETATM 9141 O O   . HOH G 4 .   ? 7.381   85.796  58.787  1.00 54.29  ? 537 HOH A O   1 
HETATM 9142 O O   . HOH G 4 .   ? 9.113   87.631  75.928  1.00 40.48  ? 538 HOH A O   1 
HETATM 9143 O O   . HOH G 4 .   ? 17.675  128.888 39.871  1.00 48.97  ? 539 HOH A O   1 
HETATM 9144 O O   . HOH G 4 .   ? -5.717  114.429 79.015  1.00 50.50  ? 540 HOH A O   1 
HETATM 9145 O O   . HOH G 4 .   ? 15.010  96.607  54.722  1.00 34.08  ? 541 HOH A O   1 
HETATM 9146 O O   . HOH G 4 .   ? -14.061 94.160  80.854  1.00 32.97  ? 542 HOH A O   1 
HETATM 9147 O O   . HOH G 4 .   ? -9.340  117.529 75.000  1.00 56.35  ? 543 HOH A O   1 
HETATM 9148 O O   . HOH G 4 .   ? 13.440  84.199  66.366  1.00 59.20  ? 544 HOH A O   1 
HETATM 9149 O O   . HOH G 4 .   ? 3.277   118.345 56.792  1.00 44.10  ? 545 HOH A O   1 
HETATM 9150 O O   . HOH G 4 .   ? 2.480   131.986 59.341  1.00 64.93  ? 546 HOH A O   1 
HETATM 9151 O O   . HOH G 4 .   ? 11.736  82.815  79.337  1.00 56.06  ? 547 HOH A O   1 
HETATM 9152 O O   . HOH G 4 .   ? 15.332  117.510 87.258  1.00 53.25  ? 548 HOH A O   1 
HETATM 9153 O O   . HOH G 4 .   ? 15.725  92.137  77.047  1.00 28.16  ? 549 HOH A O   1 
HETATM 9154 O O   . HOH G 4 .   ? 12.688  98.542  41.847  1.00 68.31  ? 550 HOH A O   1 
HETATM 9155 O O   . HOH G 4 .   ? 18.273  116.169 56.739  1.00 28.60  ? 551 HOH A O   1 
HETATM 9156 O O   . HOH G 4 .   ? -0.645  132.455 57.946  1.00 56.17  ? 552 HOH A O   1 
HETATM 9157 O O   . HOH G 4 .   ? 7.425   111.770 80.679  1.00 43.26  ? 553 HOH A O   1 
HETATM 9158 O O   . HOH G 4 .   ? -2.238  123.432 51.395  1.00 68.17  ? 554 HOH A O   1 
HETATM 9159 O O   . HOH G 4 .   ? -5.590  93.359  72.955  1.00 49.22  ? 555 HOH A O   1 
HETATM 9160 O O   . HOH G 4 .   ? -7.217  102.041 56.977  1.00 75.81  ? 556 HOH A O   1 
HETATM 9161 O O   . HOH H 4 .   ? 14.941  106.852 72.887  1.00 20.30  ? 433 HOH B O   1 
HETATM 9162 O O   . HOH H 4 .   ? 27.527  130.128 70.868  1.00 28.56  ? 434 HOH B O   1 
HETATM 9163 O O   . HOH H 4 .   ? 15.861  123.016 84.702  1.00 39.21  ? 435 HOH B O   1 
HETATM 9164 O O   . HOH H 4 .   ? 32.326  151.100 65.592  1.00 43.10  ? 436 HOH B O   1 
HETATM 9165 O O   . HOH H 4 .   ? 23.170  132.286 75.914  1.00 28.05  ? 437 HOH B O   1 
HETATM 9166 O O   . HOH H 4 .   ? 19.398  144.505 85.462  1.00 28.10  ? 438 HOH B O   1 
HETATM 9167 O O   . HOH H 4 .   ? 29.027  134.977 74.918  1.00 27.56  ? 439 HOH B O   1 
HETATM 9168 O O   . HOH H 4 .   ? 17.550  121.650 85.806  1.00 30.84  ? 440 HOH B O   1 
HETATM 9169 O O   . HOH H 4 .   ? 12.595  124.291 71.308  1.00 27.04  ? 441 HOH B O   1 
HETATM 9170 O O   . HOH H 4 .   ? 6.248   127.786 76.505  1.00 38.03  ? 442 HOH B O   1 
HETATM 9171 O O   . HOH H 4 .   ? 13.307  128.810 79.655  1.00 22.95  ? 443 HOH B O   1 
HETATM 9172 O O   . HOH H 4 .   ? 29.274  144.009 82.820  1.00 39.18  ? 444 HOH B O   1 
HETATM 9173 O O   . HOH H 4 .   ? 30.307  122.068 79.206  1.00 25.20  ? 445 HOH B O   1 
HETATM 9174 O O   . HOH H 4 .   ? 26.019  145.422 74.780  1.00 32.44  ? 446 HOH B O   1 
HETATM 9175 O O   . HOH H 4 .   ? 28.049  149.843 56.269  1.00 33.45  ? 447 HOH B O   1 
HETATM 9176 O O   . HOH H 4 .   ? 5.813   128.153 68.466  1.00 30.70  ? 448 HOH B O   1 
HETATM 9177 O O   . HOH H 4 .   ? 2.835   134.591 76.033  1.00 56.22  ? 449 HOH B O   1 
HETATM 9178 O O   . HOH H 4 .   ? 37.008  131.354 81.164  1.00 35.48  ? 450 HOH B O   1 
HETATM 9179 O O   . HOH H 4 .   ? 21.433  142.568 91.884  1.00 35.36  ? 451 HOH B O   1 
HETATM 9180 O O   . HOH H 4 .   ? 25.360  129.246 70.296  1.00 37.16  ? 452 HOH B O   1 
HETATM 9181 O O   . HOH H 4 .   ? 26.289  150.022 62.053  1.00 27.60  ? 453 HOH B O   1 
HETATM 9182 O O   . HOH H 4 .   ? 24.648  131.942 58.417  1.00 35.91  ? 454 HOH B O   1 
HETATM 9183 O O   . HOH H 4 .   ? 33.697  136.172 99.861  1.00 51.99  ? 455 HOH B O   1 
HETATM 9184 O O   . HOH H 4 .   ? 22.531  136.538 52.447  1.00 58.27  ? 456 HOH B O   1 
HETATM 9185 O O   . HOH H 4 .   ? 32.388  154.233 63.954  1.00 52.69  ? 457 HOH B O   1 
HETATM 9186 O O   . HOH H 4 .   ? 32.325  142.967 68.944  1.00 60.79  ? 458 HOH B O   1 
HETATM 9187 O O   . HOH H 4 .   ? 8.311   136.648 57.132  1.00 34.47  ? 459 HOH B O   1 
HETATM 9188 O O   . HOH H 4 .   ? 38.027  137.385 94.705  1.00 57.28  ? 460 HOH B O   1 
HETATM 9189 O O   . HOH H 4 .   ? 24.664  144.260 85.082  1.00 32.30  ? 461 HOH B O   1 
HETATM 9190 O O   . HOH H 4 .   ? 13.322  123.604 74.365  1.00 26.05  ? 462 HOH B O   1 
HETATM 9191 O O   . HOH H 4 .   ? 35.997  141.490 73.879  1.00 73.81  ? 463 HOH B O   1 
HETATM 9192 O O   . HOH H 4 .   ? 22.410  133.709 73.474  1.00 29.15  ? 464 HOH B O   1 
HETATM 9193 O O   . HOH H 4 .   ? 34.946  130.623 75.840  1.00 33.18  ? 465 HOH B O   1 
HETATM 9194 O O   . HOH H 4 .   ? 40.350  129.740 80.310  1.00 48.10  ? 466 HOH B O   1 
HETATM 9195 O O   . HOH H 4 .   ? 19.169  144.754 82.361  1.00 28.72  ? 467 HOH B O   1 
HETATM 9196 O O   . HOH H 4 .   ? 22.231  145.249 82.823  1.00 35.56  ? 468 HOH B O   1 
HETATM 9197 O O   . HOH H 4 .   ? 19.331  126.751 54.456  1.00 42.23  ? 469 HOH B O   1 
HETATM 9198 O O   . HOH H 4 .   ? 38.175  114.843 87.538  1.00 60.13  ? 470 HOH B O   1 
HETATM 9199 O O   . HOH H 4 .   ? 30.172  115.601 76.521  1.00 38.97  ? 471 HOH B O   1 
HETATM 9200 O O   . HOH H 4 .   ? 31.703  117.875 71.139  1.00 39.02  ? 472 HOH B O   1 
HETATM 9201 O O   . HOH H 4 .   ? 12.096  143.983 83.781  1.00 36.26  ? 473 HOH B O   1 
HETATM 9202 O O   . HOH H 4 .   ? 29.114  147.466 80.417  1.00 45.68  ? 474 HOH B O   1 
HETATM 9203 O O   . HOH H 4 .   ? 32.290  123.828 73.335  1.00 21.88  ? 475 HOH B O   1 
HETATM 9204 O O   . HOH H 4 .   ? 18.040  125.441 70.549  1.00 25.41  ? 476 HOH B O   1 
HETATM 9205 O O   . HOH H 4 .   ? 20.112  144.164 95.116  1.00 47.45  ? 477 HOH B O   1 
HETATM 9206 O O   . HOH H 4 .   ? 32.329  119.913 64.545  1.00 54.94  ? 478 HOH B O   1 
HETATM 9207 O O   . HOH H 4 .   ? 34.719  130.879 94.834  1.00 42.72  ? 479 HOH B O   1 
HETATM 9208 O O   . HOH H 4 .   ? 32.617  118.167 94.431  1.00 46.13  ? 480 HOH B O   1 
HETATM 9209 O O   . HOH H 4 .   ? 17.337  133.237 81.658  1.00 43.52  ? 481 HOH B O   1 
HETATM 9210 O O   . HOH H 4 .   ? 21.896  145.525 85.845  1.00 31.60  ? 482 HOH B O   1 
HETATM 9211 O O   . HOH H 4 .   ? 16.033  125.908 72.523  1.00 19.78  ? 483 HOH B O   1 
HETATM 9212 O O   . HOH H 4 .   ? 37.221  141.346 86.044  1.00 48.30  ? 484 HOH B O   1 
HETATM 9213 O O   . HOH H 4 .   ? 10.132  136.236 80.479  1.00 46.62  ? 485 HOH B O   1 
HETATM 9214 O O   . HOH H 4 .   ? 38.378  123.380 89.845  1.00 33.47  ? 486 HOH B O   1 
HETATM 9215 O O   . HOH H 4 .   ? 36.768  111.443 89.710  1.00 58.79  ? 487 HOH B O   1 
HETATM 9216 O O   . HOH H 4 .   ? 23.944  109.611 76.988  1.00 36.79  ? 488 HOH B O   1 
HETATM 9217 O O   . HOH H 4 .   ? 27.083  145.203 86.111  1.00 41.04  ? 489 HOH B O   1 
HETATM 9218 O O   . HOH H 4 .   ? 24.833  143.337 82.553  1.00 38.68  ? 490 HOH B O   1 
HETATM 9219 O O   . HOH H 4 .   ? 25.387  114.324 94.065  1.00 62.52  ? 491 HOH B O   1 
HETATM 9220 O O   . HOH H 4 .   ? 30.201  114.420 78.904  1.00 33.87  ? 492 HOH B O   1 
HETATM 9221 O O   . HOH H 4 .   ? 32.665  141.931 72.435  1.00 52.35  ? 493 HOH B O   1 
HETATM 9222 O O   . HOH H 4 .   ? 12.298  138.517 79.990  1.00 23.42  ? 494 HOH B O   1 
HETATM 9223 O O   . HOH H 4 .   ? 25.757  135.993 77.135  1.00 31.66  ? 495 HOH B O   1 
HETATM 9224 O O   . HOH H 4 .   ? -0.257  148.236 67.147  1.00 87.11  ? 496 HOH B O   1 
HETATM 9225 O O   . HOH H 4 .   ? 25.183  133.997 75.794  1.00 41.88  ? 497 HOH B O   1 
HETATM 9226 O O   . HOH H 4 .   ? 24.243  116.589 83.493  1.00 42.50  ? 498 HOH B O   1 
HETATM 9227 O O   . HOH H 4 .   ? 8.193   136.572 54.137  1.00 62.73  ? 499 HOH B O   1 
HETATM 9228 O O   . HOH H 4 .   ? 20.075  123.368 71.077  1.00 39.94  ? 500 HOH B O   1 
HETATM 9229 O O   . HOH H 4 .   ? 27.372  133.235 74.790  1.00 29.54  ? 501 HOH B O   1 
HETATM 9230 O O   . HOH H 4 .   ? 16.630  150.981 66.547  1.00 28.17  ? 502 HOH B O   1 
HETATM 9231 O O   . HOH H 4 .   ? 40.629  119.200 89.424  1.00 41.03  ? 503 HOH B O   1 
HETATM 9232 O O   . HOH H 4 .   ? 9.844   139.051 86.473  1.00 39.67  ? 504 HOH B O   1 
HETATM 9233 O O   . HOH H 4 .   ? 16.492  149.095 82.167  1.00 35.92  ? 505 HOH B O   1 
HETATM 9234 O O   . HOH H 4 .   ? 29.904  113.599 86.057  1.00 33.29  ? 506 HOH B O   1 
HETATM 9235 O O   . HOH H 4 .   ? 30.896  116.211 92.567  1.00 43.45  ? 507 HOH B O   1 
HETATM 9236 O O   . HOH H 4 .   ? 26.758  155.397 59.636  1.00 53.59  ? 508 HOH B O   1 
HETATM 9237 O O   . HOH H 4 .   ? 24.149  129.818 59.660  1.00 41.72  ? 509 HOH B O   1 
HETATM 9238 O O   . HOH H 4 .   ? 31.800  137.506 101.003 1.00 51.46  ? 510 HOH B O   1 
HETATM 9239 O O   . HOH H 4 .   ? 27.000  132.580 72.001  1.00 39.16  ? 511 HOH B O   1 
HETATM 9240 O O   . HOH H 4 .   ? 18.108  150.793 78.762  1.00 45.84  ? 512 HOH B O   1 
HETATM 9241 O O   . HOH H 4 .   ? 13.974  150.408 80.395  1.00 45.00  ? 513 HOH B O   1 
HETATM 9242 O O   . HOH H 4 .   ? 1.116   145.044 80.998  1.00 54.02  ? 514 HOH B O   1 
HETATM 9243 O O   . HOH H 4 .   ? 32.014  122.878 97.484  1.00 48.14  ? 515 HOH B O   1 
HETATM 9244 O O   . HOH H 4 .   ? 32.611  117.580 77.864  1.00 32.32  ? 516 HOH B O   1 
HETATM 9245 O O   . HOH H 4 .   ? 31.754  110.549 84.353  1.00 59.69  ? 517 HOH B O   1 
HETATM 9246 O O   . HOH H 4 .   ? 0.094   132.861 75.908  1.00 62.61  ? 518 HOH B O   1 
HETATM 9247 O O   . HOH H 4 .   ? 31.039  148.171 81.967  1.00 51.48  ? 519 HOH B O   1 
HETATM 9248 O O   . HOH H 4 .   ? 27.235  136.452 74.901  1.00 36.59  ? 520 HOH B O   1 
HETATM 9249 O O   . HOH H 4 .   ? 21.653  134.169 50.075  1.00 47.31  ? 521 HOH B O   1 
HETATM 9250 O O   . HOH H 4 .   ? 29.187  146.063 84.709  1.00 38.47  ? 522 HOH B O   1 
HETATM 9251 O O   . HOH H 4 .   ? 16.241  123.599 73.892  1.00 51.90  ? 523 HOH B O   1 
HETATM 9252 O O   . HOH H 4 .   ? 2.439   146.958 57.396  1.00 44.12  ? 524 HOH B O   1 
HETATM 9253 O O   . HOH H 4 .   ? 29.575  146.125 76.570  1.00 36.41  ? 525 HOH B O   1 
HETATM 9254 O O   . HOH H 4 .   ? 23.608  143.518 95.233  1.00 58.78  ? 526 HOH B O   1 
HETATM 9255 O O   . HOH H 4 .   ? 15.042  122.994 87.858  1.00 51.17  ? 527 HOH B O   1 
HETATM 9256 O O   . HOH H 4 .   ? 36.551  120.782 78.079  1.00 36.01  ? 528 HOH B O   1 
HETATM 9257 O O   . HOH H 4 .   ? 29.485  111.880 74.243  1.00 49.16  ? 529 HOH B O   1 
HETATM 9258 O O   . HOH H 4 .   ? 26.498  139.104 75.609  1.00 37.56  ? 530 HOH B O   1 
HETATM 9259 O O   . HOH H 4 .   ? 22.498  123.859 94.676  1.00 46.36  ? 531 HOH B O   1 
HETATM 9260 O O   . HOH H 4 .   ? 27.359  110.151 81.647  1.00 65.78  ? 532 HOH B O   1 
HETATM 9261 O O   . HOH H 4 .   ? 15.135  149.065 77.765  1.00 51.76  ? 533 HOH B O   1 
HETATM 9262 O O   . HOH H 4 .   ? 29.381  143.877 60.751  1.00 52.56  ? 534 HOH B O   1 
HETATM 9263 O O   . HOH H 4 .   ? 1.657   148.124 60.177  1.00 44.26  ? 535 HOH B O   1 
HETATM 9264 O O   . HOH H 4 .   ? 38.839  131.765 78.984  1.00 53.36  ? 536 HOH B O   1 
HETATM 9265 O O   . HOH H 4 .   ? 36.351  139.721 90.141  1.00 50.16  ? 537 HOH B O   1 
HETATM 9266 O O   . HOH H 4 .   ? 15.809  125.193 77.685  1.00 48.07  ? 538 HOH B O   1 
HETATM 9267 O O   . HOH H 4 .   ? 27.207  157.383 63.095  1.00 55.36  ? 539 HOH B O   1 
HETATM 9268 O O   . HOH H 4 .   ? 23.460  113.667 88.311  1.00 51.04  ? 540 HOH B O   1 
HETATM 9269 O O   . HOH H 4 .   ? 9.251   152.952 56.134  1.00 63.94  ? 541 HOH B O   1 
HETATM 9270 O O   . HOH H 4 .   ? 39.433  121.417 90.412  1.00 45.50  ? 542 HOH B O   1 
HETATM 9271 O O   . HOH I 4 .   ? 17.277  48.170  113.701 1.00 29.70  ? 412 HOH C O   1 
HETATM 9272 O O   . HOH I 4 .   ? 2.958   42.995  94.678  1.00 26.56  ? 413 HOH C O   1 
HETATM 9273 O O   . HOH I 4 .   ? 5.065   57.753  109.181 1.00 29.73  ? 414 HOH C O   1 
HETATM 9274 O O   . HOH I 4 .   ? 1.503   70.839  102.033 1.00 27.91  ? 415 HOH C O   1 
HETATM 9275 O O   . HOH I 4 .   ? -3.495  47.745  112.244 1.00 51.75  ? 416 HOH C O   1 
HETATM 9276 O O   . HOH I 4 .   ? -0.651  63.936  117.579 1.00 44.80  ? 417 HOH C O   1 
HETATM 9277 O O   . HOH I 4 .   ? -23.176 61.853  94.703  1.00 32.58  ? 418 HOH C O   1 
HETATM 9278 O O   . HOH I 4 .   ? -0.916  60.762  97.857  1.00 40.91  ? 419 HOH C O   1 
HETATM 9279 O O   . HOH I 4 .   ? -5.530  72.599  125.780 1.00 46.10  ? 420 HOH C O   1 
HETATM 9280 O O   . HOH I 4 .   ? 15.216  44.117  112.474 1.00 38.47  ? 421 HOH C O   1 
HETATM 9281 O O   . HOH I 4 .   ? 29.045  49.220  120.445 1.00 66.48  ? 422 HOH C O   1 
HETATM 9282 O O   . HOH I 4 .   ? -13.729 56.486  92.030  1.00 27.67  ? 423 HOH C O   1 
HETATM 9283 O O   . HOH I 4 .   ? 11.850  54.677  108.831 1.00 42.40  ? 424 HOH C O   1 
HETATM 9284 O O   . HOH I 4 .   ? 0.487   55.333  93.932  1.00 31.03  ? 425 HOH C O   1 
HETATM 9285 O O   . HOH I 4 .   ? 4.258   62.945  112.000 1.00 37.08  ? 426 HOH C O   1 
HETATM 9286 O O   . HOH I 4 .   ? 12.879  65.047  120.919 1.00 45.67  ? 427 HOH C O   1 
HETATM 9287 O O   . HOH I 4 .   ? -15.770 63.710  97.772  1.00 51.03  ? 428 HOH C O   1 
HETATM 9288 O O   . HOH I 4 .   ? 34.093  47.983  121.977 1.00 65.02  ? 429 HOH C O   1 
HETATM 9289 O O   . HOH I 4 .   ? -17.703 47.252  92.741  1.00 64.80  ? 430 HOH C O   1 
HETATM 9290 O O   . HOH I 4 .   ? -14.627 64.740  120.558 1.00 49.64  ? 431 HOH C O   1 
HETATM 9291 O O   . HOH I 4 .   ? -1.547  50.595  113.383 1.00 64.43  ? 432 HOH C O   1 
HETATM 9292 O O   . HOH I 4 .   ? -23.464 59.891  104.804 1.00 52.74  ? 433 HOH C O   1 
HETATM 9293 O O   . HOH I 4 .   ? 24.714  38.365  114.215 1.00 76.81  ? 434 HOH C O   1 
HETATM 9294 O O   . HOH I 4 .   ? -23.508 48.718  92.407  1.00 51.09  ? 435 HOH C O   1 
HETATM 9295 O O   . HOH I 4 .   ? 17.294  65.778  113.042 1.00 45.92  ? 436 HOH C O   1 
HETATM 9296 O O   . HOH I 4 .   ? -18.543 60.269  96.987  1.00 50.86  ? 437 HOH C O   1 
HETATM 9297 O O   . HOH I 4 .   ? 34.276  50.413  130.484 1.00 68.96  ? 438 HOH C O   1 
HETATM 9298 O O   . HOH I 4 .   ? 27.965  46.281  86.588  1.00 53.06  ? 439 HOH C O   1 
HETATM 9299 O O   . HOH I 4 .   ? 7.012   42.845  91.466  1.00 41.85  ? 440 HOH C O   1 
HETATM 9300 O O   . HOH I 4 .   ? -9.560  54.303  118.088 1.00 49.46  ? 441 HOH C O   1 
HETATM 9301 O O   . HOH I 4 .   ? -22.653 54.917  102.886 1.00 60.74  ? 442 HOH C O   1 
HETATM 9302 O O   . HOH I 4 .   ? 4.981   34.679  95.639  1.00 43.18  ? 443 HOH C O   1 
HETATM 9303 O O   . HOH I 4 .   ? 25.520  64.160  118.568 1.00 59.54  ? 444 HOH C O   1 
HETATM 9304 O O   . HOH I 4 .   ? -17.624 70.281  107.304 1.00 57.34  ? 445 HOH C O   1 
HETATM 9305 O O   . HOH I 4 .   ? -13.360 56.931  95.232  1.00 31.75  ? 446 HOH C O   1 
HETATM 9306 O O   . HOH I 4 .   ? 19.983  33.925  114.687 1.00 67.81  ? 447 HOH C O   1 
HETATM 9307 O O   . HOH I 4 .   ? 21.391  57.147  103.594 1.00 39.79  ? 448 HOH C O   1 
HETATM 9308 O O   . HOH I 4 .   ? 25.878  50.049  130.887 1.00 58.78  ? 449 HOH C O   1 
HETATM 9309 O O   . HOH I 4 .   ? 23.617  38.702  103.424 1.00 61.66  ? 450 HOH C O   1 
HETATM 9310 O O   . HOH I 4 .   ? 1.541   59.016  95.877  1.00 33.59  ? 451 HOH C O   1 
HETATM 9311 O O   . HOH I 4 .   ? -4.064  59.975  112.082 1.00 49.33  ? 452 HOH C O   1 
HETATM 9312 O O   . HOH I 4 .   ? 14.539  71.475  116.868 1.00 55.46  ? 453 HOH C O   1 
HETATM 9313 O O   . HOH I 4 .   ? 21.483  67.905  107.483 1.00 42.53  ? 454 HOH C O   1 
HETATM 9314 O O   . HOH I 4 .   ? -15.491 67.664  102.811 1.00 32.17  ? 455 HOH C O   1 
HETATM 9315 O O   . HOH I 4 .   ? -16.210 60.170  95.764  1.00 35.52  ? 456 HOH C O   1 
HETATM 9316 O O   . HOH I 4 .   ? 9.147   72.863  102.741 1.00 45.13  ? 457 HOH C O   1 
HETATM 9317 O O   . HOH I 4 .   ? 26.480  49.072  128.624 1.00 56.48  ? 458 HOH C O   1 
HETATM 9318 O O   . HOH I 4 .   ? 15.574  74.355  105.882 1.00 76.35  ? 459 HOH C O   1 
HETATM 9319 O O   . HOH I 4 .   ? 27.582  48.119  84.324  1.00 65.29  ? 460 HOH C O   1 
HETATM 9320 O O   . HOH I 4 .   ? -12.219 59.328  96.138  1.00 39.15  ? 461 HOH C O   1 
HETATM 9321 O O   . HOH I 4 .   ? -8.586  52.035  95.164  1.00 35.53  ? 462 HOH C O   1 
HETATM 9322 O O   . HOH I 4 .   ? 20.653  61.060  96.970  1.00 75.27  ? 463 HOH C O   1 
HETATM 9323 O O   . HOH I 4 .   ? -7.147  42.681  100.358 1.00 41.84  ? 464 HOH C O   1 
HETATM 9324 O O   . HOH I 4 .   ? 22.857  32.018  96.810  1.00 41.81  ? 465 HOH C O   1 
HETATM 9325 O O   . HOH I 4 .   ? 5.172   61.223  90.002  1.00 52.35  ? 466 HOH C O   1 
HETATM 9326 O O   . HOH I 4 .   ? 23.868  32.085  107.287 1.00 66.41  ? 467 HOH C O   1 
HETATM 9327 O O   . HOH I 4 .   ? -18.854 67.001  119.949 1.00 53.60  ? 468 HOH C O   1 
HETATM 9328 O O   . HOH I 4 .   ? 16.527  63.393  118.827 1.00 40.19  ? 469 HOH C O   1 
HETATM 9329 O O   . HOH I 4 .   ? 16.584  64.915  121.071 1.00 50.40  ? 470 HOH C O   1 
HETATM 9330 O O   . HOH I 4 .   ? 17.386  61.215  118.061 1.00 53.16  ? 471 HOH C O   1 
HETATM 9331 O O   . HOH I 4 .   ? 23.881  59.107  102.997 1.00 56.97  ? 472 HOH C O   1 
HETATM 9332 O O   . HOH I 4 .   ? -2.053  59.962  110.333 1.00 61.65  ? 473 HOH C O   1 
HETATM 9333 O O   . HOH I 4 .   ? -10.464 49.674  92.807  1.00 45.75  ? 474 HOH C O   1 
HETATM 9334 O O   . HOH I 4 .   ? 23.601  66.165  121.159 1.00 54.92  ? 475 HOH C O   1 
HETATM 9335 O O   . HOH I 4 .   ? 14.702  71.804  110.030 1.00 52.31  ? 476 HOH C O   1 
HETATM 9336 O O   . HOH I 4 .   ? 14.155  67.330  121.419 1.00 58.18  ? 477 HOH C O   1 
HETATM 9337 O O   . HOH I 4 .   ? 31.361  57.254  126.885 1.00 100.57 ? 478 HOH C O   1 
HETATM 9338 O O   . HOH I 4 .   ? 19.759  65.545  121.472 1.00 61.07  ? 479 HOH C O   1 
HETATM 9339 O O   . HOH I 4 .   ? 30.181  38.071  114.992 1.00 50.15  ? 480 HOH C O   1 
HETATM 9340 O O   . HOH I 4 .   ? 20.125  60.520  116.664 1.00 58.28  ? 481 HOH C O   1 
HETATM 9341 O O   . HOH I 4 .   ? 13.582  69.982  121.447 1.00 58.76  ? 482 HOH C O   1 
HETATM 9342 O O   . HOH I 4 .   ? -24.289 52.986  92.251  1.00 45.34  ? 483 HOH C O   1 
HETATM 9343 O O   . HOH I 4 .   ? 34.155  55.543  118.001 1.00 64.22  ? 484 HOH C O   1 
HETATM 9344 O O   . HOH I 4 .   ? 31.636  50.675  119.975 1.00 68.78  ? 485 HOH C O   1 
HETATM 9345 O O   . HOH I 4 .   ? -4.591  54.767  111.407 1.00 56.86  ? 486 HOH C O   1 
HETATM 9346 O O   . HOH I 4 .   ? -3.529  70.859  120.464 1.00 55.15  ? 487 HOH C O   1 
HETATM 9347 O O   . HOH I 4 .   ? -1.243  57.586  110.349 1.00 58.33  ? 488 HOH C O   1 
HETATM 9348 O O   . HOH I 4 .   ? 16.630  38.615  108.340 1.00 56.39  ? 489 HOH C O   1 
HETATM 9349 O O   . HOH I 4 .   ? 15.027  33.573  99.749  1.00 73.93  ? 490 HOH C O   1 
HETATM 9350 O O   . HOH I 4 .   ? -1.806  48.502  85.246  1.00 52.88  ? 491 HOH C O   1 
HETATM 9351 O O   . HOH I 4 .   ? -0.745  48.185  82.562  1.00 66.29  ? 492 HOH C O   1 
HETATM 9352 O O   . HOH I 4 .   ? 16.503  35.115  98.046  1.00 72.75  ? 493 HOH C O   1 
HETATM 9353 O O   . HOH I 4 .   ? 6.759   56.730  117.879 1.00 42.12  ? 494 HOH C O   1 
HETATM 9354 O O   . HOH I 4 .   ? 5.531   66.710  117.181 1.00 52.44  ? 495 HOH C O   1 
HETATM 9355 O O   . HOH I 4 .   ? -11.190 56.651  119.195 1.00 72.59  ? 496 HOH C O   1 
HETATM 9356 O O   . HOH I 4 .   ? 22.121  38.601  118.767 1.00 54.32  ? 497 HOH C O   1 
HETATM 9357 O O   . HOH I 4 .   ? -0.846  56.022  103.845 1.00 34.23  ? 498 HOH C O   1 
HETATM 9358 O O   . HOH J 4 .   ? 11.528  99.547  101.335 1.00 61.25  ? 433 HOH D O   1 
HETATM 9359 O O   . HOH J 4 .   ? -12.241 92.756  105.626 1.00 30.37  ? 434 HOH D O   1 
HETATM 9360 O O   . HOH J 4 .   ? -4.326  100.007 112.368 1.00 49.86  ? 435 HOH D O   1 
HETATM 9361 O O   . HOH J 4 .   ? -6.693  78.916  128.520 1.00 40.99  ? 436 HOH D O   1 
HETATM 9362 O O   . HOH J 4 .   ? 20.541  93.375  118.891 1.00 73.64  ? 437 HOH D O   1 
HETATM 9363 O O   . HOH J 4 .   ? -15.619 71.052  109.165 1.00 90.95  ? 438 HOH D O   1 
HETATM 9364 O O   . HOH J 4 .   ? -13.050 98.572  114.928 1.00 38.78  ? 439 HOH D O   1 
HETATM 9365 O O   . HOH J 4 .   ? 10.243  77.298  89.999  1.00 39.55  ? 440 HOH D O   1 
HETATM 9366 O O   . HOH J 4 .   ? 16.534  80.238  95.395  1.00 36.84  ? 441 HOH D O   1 
HETATM 9367 O O   . HOH J 4 .   ? 8.457   98.797  104.287 1.00 63.79  ? 442 HOH D O   1 
HETATM 9368 O O   . HOH J 4 .   ? -9.298  98.036  104.327 1.00 65.68  ? 443 HOH D O   1 
HETATM 9369 O O   . HOH J 4 .   ? -8.771  90.862  115.729 1.00 27.40  ? 444 HOH D O   1 
HETATM 9370 O O   . HOH J 4 .   ? 24.943  73.401  94.902  1.00 63.45  ? 445 HOH D O   1 
HETATM 9371 O O   . HOH J 4 .   ? -13.417 78.887  126.216 1.00 40.36  ? 446 HOH D O   1 
HETATM 9372 O O   . HOH J 4 .   ? 11.767  102.959 119.560 1.00 51.45  ? 447 HOH D O   1 
HETATM 9373 O O   . HOH J 4 .   ? -10.227 72.078  114.573 1.00 38.00  ? 448 HOH D O   1 
HETATM 9374 O O   . HOH J 4 .   ? 11.957  71.007  109.747 1.00 56.03  ? 449 HOH D O   1 
HETATM 9375 O O   . HOH J 4 .   ? 10.617  94.890  115.067 1.00 53.48  ? 450 HOH D O   1 
HETATM 9376 O O   . HOH J 4 .   ? 30.630  96.429  106.689 1.00 66.72  ? 451 HOH D O   1 
HETATM 9377 O O   . HOH J 4 .   ? -7.994  80.997  128.627 1.00 64.39  ? 452 HOH D O   1 
HETATM 9378 O O   . HOH J 4 .   ? 5.189   96.526  119.111 1.00 55.26  ? 453 HOH D O   1 
HETATM 9379 O O   . HOH J 4 .   ? 3.046   97.156  104.935 1.00 41.09  ? 454 HOH D O   1 
HETATM 9380 O O   . HOH J 4 .   ? 8.849   83.430  104.901 1.00 48.30  ? 455 HOH D O   1 
HETATM 9381 O O   . HOH J 4 .   ? -9.851  88.996  99.678  1.00 70.21  ? 456 HOH D O   1 
HETATM 9382 O O   . HOH J 4 .   ? 30.834  78.765  98.063  1.00 57.78  ? 457 HOH D O   1 
HETATM 9383 O O   . HOH J 4 .   ? 2.524   96.581  117.862 1.00 38.42  ? 458 HOH D O   1 
HETATM 9384 O O   . HOH J 4 .   ? 18.169  58.548  100.823 1.00 46.75  ? 459 HOH D O   1 
HETATM 9385 O O   . HOH J 4 .   ? 13.585  69.152  92.373  1.00 60.79  ? 460 HOH D O   1 
HETATM 9386 O O   . HOH J 4 .   ? 14.855  87.397  90.886  1.00 48.23  ? 461 HOH D O   1 
HETATM 9387 O O   . HOH J 4 .   ? -18.023 80.329  121.594 1.00 47.44  ? 462 HOH D O   1 
HETATM 9388 O O   . HOH J 4 .   ? 4.253   69.267  92.052  1.00 43.23  ? 463 HOH D O   1 
HETATM 9389 O O   . HOH J 4 .   ? 6.188   87.669  100.587 1.00 38.53  ? 464 HOH D O   1 
HETATM 9390 O O   . HOH J 4 .   ? 10.838  71.829  117.578 1.00 45.92  ? 465 HOH D O   1 
HETATM 9391 O O   . HOH J 4 .   ? 3.561   66.540  120.497 1.00 61.90  ? 466 HOH D O   1 
HETATM 9392 O O   . HOH J 4 .   ? 0.995   87.210  124.226 1.00 53.10  ? 467 HOH D O   1 
HETATM 9393 O O   . HOH J 4 .   ? 10.995  75.279  119.692 1.00 43.51  ? 468 HOH D O   1 
HETATM 9394 O O   . HOH J 4 .   ? 15.203  74.087  103.260 1.00 57.46  ? 469 HOH D O   1 
HETATM 9395 O O   . HOH J 4 .   ? -3.024  90.491  119.080 1.00 60.26  ? 470 HOH D O   1 
HETATM 9396 O O   . HOH J 4 .   ? 27.614  74.902  89.340  1.00 62.04  ? 471 HOH D O   1 
HETATM 9397 O O   . HOH J 4 .   ? 12.726  107.644 103.985 1.00 52.49  ? 472 HOH D O   1 
HETATM 9398 O O   . HOH J 4 .   ? 4.918   80.781  129.146 1.00 56.58  ? 473 HOH D O   1 
HETATM 9399 O O   . HOH J 4 .   ? -20.962 80.088  120.004 1.00 72.23  ? 474 HOH D O   1 
HETATM 9400 O O   . HOH J 4 .   ? -4.294  89.536  123.163 1.00 36.08  ? 475 HOH D O   1 
HETATM 9401 O O   . HOH J 4 .   ? 9.845   95.074  90.753  1.00 62.56  ? 476 HOH D O   1 
HETATM 9402 O O   . HOH J 4 .   ? 0.293   89.127  125.942 1.00 48.65  ? 477 HOH D O   1 
HETATM 9403 O O   . HOH J 4 .   ? 10.127  92.831  92.056  1.00 70.52  ? 478 HOH D O   1 
HETATM 9404 O O   . HOH J 4 .   ? -14.121 83.429  126.611 1.00 59.32  ? 479 HOH D O   1 
HETATM 9405 O O   . HOH J 4 .   ? -18.006 79.401  116.485 1.00 54.45  ? 480 HOH D O   1 
HETATM 9406 O O   . HOH J 4 .   ? -9.080  90.931  118.843 1.00 45.61  ? 481 HOH D O   1 
HETATM 9407 O O   . HOH J 4 .   ? 1.074   71.053  98.276  1.00 62.78  ? 482 HOH D O   1 
HETATM 9408 O O   . HOH J 4 .   ? -1.918  87.720  126.586 1.00 62.23  ? 483 HOH D O   1 
HETATM 9409 O O   . HOH J 4 .   ? 1.374   69.974  95.539  1.00 48.63  ? 484 HOH D O   1 
HETATM 9410 O O   . HOH J 4 .   ? 11.828  99.689  108.870 1.00 75.76  ? 485 HOH D O   1 
HETATM 9411 O O   . HOH J 4 .   ? 23.802  71.553  97.227  1.00 66.61  ? 486 HOH D O   1 
HETATM 9412 O O   . HOH J 4 .   ? -3.213  99.507  104.241 1.00 59.24  ? 487 HOH D O   1 
HETATM 9413 O O   . HOH J 4 .   ? 8.563   81.842  117.107 1.00 53.95  ? 488 HOH D O   1 
HETATM 9414 O O   . HOH J 4 .   ? 7.667   82.275  129.157 1.00 58.18  ? 489 HOH D O   1 
HETATM 9415 O O   . HOH J 4 .   ? 1.441   95.264  98.309  1.00 68.64  ? 490 HOH D O   1 
HETATM 9416 O O   . HOH J 4 .   ? 3.807   68.584  116.601 1.00 36.19  ? 491 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   0   0   SER SER A . n 
A 1 2   MET 2   1   1   MET MET A . n 
A 1 3   GLU 3   2   2   GLU GLU A . n 
A 1 4   ASN 4   3   3   ASN ASN A . n 
A 1 5   PHE 5   4   4   PHE PHE A . n 
A 1 6   GLN 6   5   5   GLN GLN A . n 
A 1 7   LYS 7   6   6   LYS LYS A . n 
A 1 8   VAL 8   7   7   VAL VAL A . n 
A 1 9   GLU 9   8   8   GLU GLU A . n 
A 1 10  LYS 10  9   9   LYS LYS A . n 
A 1 11  ILE 11  10  10  ILE ILE A . n 
A 1 12  GLY 12  11  11  GLY GLY A . n 
A 1 13  GLU 13  12  12  GLU GLU A . n 
A 1 14  GLY 14  13  13  GLY GLY A . n 
A 1 15  THR 15  14  14  THR THR A . n 
A 1 16  TYR 16  15  15  TYR TYR A . n 
A 1 17  GLY 17  16  16  GLY GLY A . n 
A 1 18  VAL 18  17  17  VAL VAL A . n 
A 1 19  VAL 19  18  18  VAL VAL A . n 
A 1 20  TYR 20  19  19  TYR TYR A . n 
A 1 21  LYS 21  20  20  LYS LYS A . n 
A 1 22  ALA 22  21  21  ALA ALA A . n 
A 1 23  ARG 23  22  22  ARG ARG A . n 
A 1 24  ASN 24  23  23  ASN ASN A . n 
A 1 25  LYS 25  24  24  LYS LYS A . n 
A 1 26  LEU 26  25  25  LEU LEU A . n 
A 1 27  THR 27  26  26  THR THR A . n 
A 1 28  GLY 28  27  27  GLY GLY A . n 
A 1 29  GLU 29  28  28  GLU GLU A . n 
A 1 30  VAL 30  29  29  VAL VAL A . n 
A 1 31  VAL 31  30  30  VAL VAL A . n 
A 1 32  ALA 32  31  31  ALA ALA A . n 
A 1 33  LEU 33  32  32  LEU LEU A . n 
A 1 34  LYS 34  33  33  LYS LYS A . n 
A 1 35  LYS 35  34  34  LYS LYS A . n 
A 1 36  ILE 36  35  35  ILE ILE A . n 
A 1 37  ARG 37  36  36  ARG ARG A . n 
A 1 38  LEU 38  37  37  LEU LEU A . n 
A 1 39  ASP 39  38  38  ASP ASP A . n 
A 1 40  THR 40  39  39  THR THR A . n 
A 1 41  GLU 41  40  40  GLU GLU A . n 
A 1 42  THR 42  41  41  THR THR A . n 
A 1 43  GLU 43  42  42  GLU GLU A . n 
A 1 44  GLY 44  43  43  GLY GLY A . n 
A 1 45  VAL 45  44  44  VAL VAL A . n 
A 1 46  PRO 46  45  45  PRO PRO A . n 
A 1 47  SER 47  46  46  SER SER A . n 
A 1 48  THR 48  47  47  THR THR A . n 
A 1 49  ALA 49  48  48  ALA ALA A . n 
A 1 50  ILE 50  49  49  ILE ILE A . n 
A 1 51  ARG 51  50  50  ARG ARG A . n 
A 1 52  GLU 52  51  51  GLU GLU A . n 
A 1 53  ILE 53  52  52  ILE ILE A . n 
A 1 54  SER 54  53  53  SER SER A . n 
A 1 55  LEU 55  54  54  LEU LEU A . n 
A 1 56  LEU 56  55  55  LEU LEU A . n 
A 1 57  LYS 57  56  56  LYS LYS A . n 
A 1 58  GLU 58  57  57  GLU GLU A . n 
A 1 59  LEU 59  58  58  LEU LEU A . n 
A 1 60  ASN 60  59  59  ASN ASN A . n 
A 1 61  HIS 61  60  60  HIS HIS A . n 
A 1 62  PRO 62  61  61  PRO PRO A . n 
A 1 63  ASN 63  62  62  ASN ASN A . n 
A 1 64  ILE 64  63  63  ILE ILE A . n 
A 1 65  VAL 65  64  64  VAL VAL A . n 
A 1 66  LYS 66  65  65  LYS LYS A . n 
A 1 67  LEU 67  66  66  LEU LEU A . n 
A 1 68  LEU 68  67  67  LEU LEU A . n 
A 1 69  ASP 69  68  68  ASP ASP A . n 
A 1 70  VAL 70  69  69  VAL VAL A . n 
A 1 71  ILE 71  70  70  ILE ILE A . n 
A 1 72  HIS 72  71  71  HIS HIS A . n 
A 1 73  THR 73  72  72  THR THR A . n 
A 1 74  GLU 74  73  73  GLU GLU A . n 
A 1 75  ASN 75  74  74  ASN ASN A . n 
A 1 76  LYS 76  75  75  LYS LYS A . n 
A 1 77  LEU 77  76  76  LEU LEU A . n 
A 1 78  TYR 78  77  77  TYR TYR A . n 
A 1 79  LEU 79  78  78  LEU LEU A . n 
A 1 80  VAL 80  79  79  VAL VAL A . n 
A 1 81  PHE 81  80  80  PHE PHE A . n 
A 1 82  GLU 82  81  81  GLU GLU A . n 
A 1 83  PHE 83  82  82  PHE PHE A . n 
A 1 84  LEU 84  83  83  LEU LEU A . n 
A 1 85  HIS 85  84  84  HIS HIS A . n 
A 1 86  GLN 86  85  85  GLN GLN A . n 
A 1 87  ASP 87  86  86  ASP ASP A . n 
A 1 88  LEU 88  87  87  LEU LEU A . n 
A 1 89  LYS 89  88  88  LYS LYS A . n 
A 1 90  LYS 90  89  89  LYS LYS A . n 
A 1 91  PHE 91  90  90  PHE PHE A . n 
A 1 92  MET 92  91  91  MET MET A . n 
A 1 93  ASP 93  92  92  ASP ASP A . n 
A 1 94  ALA 94  93  93  ALA ALA A . n 
A 1 95  SER 95  94  94  SER SER A . n 
A 1 96  ALA 96  95  95  ALA ALA A . n 
A 1 97  LEU 97  96  96  LEU LEU A . n 
A 1 98  THR 98  97  97  THR THR A . n 
A 1 99  GLY 99  98  98  GLY GLY A . n 
A 1 100 ILE 100 99  99  ILE ILE A . n 
A 1 101 PRO 101 100 100 PRO PRO A . n 
A 1 102 LEU 102 101 101 LEU LEU A . n 
A 1 103 PRO 103 102 102 PRO PRO A . n 
A 1 104 LEU 104 103 103 LEU LEU A . n 
A 1 105 ILE 105 104 104 ILE ILE A . n 
A 1 106 LYS 106 105 105 LYS LYS A . n 
A 1 107 SER 107 106 106 SER SER A . n 
A 1 108 TYR 108 107 107 TYR TYR A . n 
A 1 109 LEU 109 108 108 LEU LEU A . n 
A 1 110 PHE 110 109 109 PHE PHE A . n 
A 1 111 GLN 111 110 110 GLN GLN A . n 
A 1 112 LEU 112 111 111 LEU LEU A . n 
A 1 113 LEU 113 112 112 LEU LEU A . n 
A 1 114 GLN 114 113 113 GLN GLN A . n 
A 1 115 GLY 115 114 114 GLY GLY A . n 
A 1 116 LEU 116 115 115 LEU LEU A . n 
A 1 117 ALA 117 116 116 ALA ALA A . n 
A 1 118 PHE 118 117 117 PHE PHE A . n 
A 1 119 CYS 119 118 118 CYS CYS A . n 
A 1 120 HIS 120 119 119 HIS HIS A . n 
A 1 121 SER 121 120 120 SER SER A . n 
A 1 122 HIS 122 121 121 HIS HIS A . n 
A 1 123 ARG 123 122 122 ARG ARG A . n 
A 1 124 VAL 124 123 123 VAL VAL A . n 
A 1 125 LEU 125 124 124 LEU LEU A . n 
A 1 126 HIS 126 125 125 HIS HIS A . n 
A 1 127 ARG 127 126 126 ARG ARG A . n 
A 1 128 ASP 128 127 127 ASP ASP A . n 
A 1 129 LEU 129 128 128 LEU LEU A . n 
A 1 130 LYS 130 129 129 LYS LYS A . n 
A 1 131 PRO 131 130 130 PRO PRO A . n 
A 1 132 GLN 132 131 131 GLN GLN A . n 
A 1 133 ASN 133 132 132 ASN ASN A . n 
A 1 134 LEU 134 133 133 LEU LEU A . n 
A 1 135 LEU 135 134 134 LEU LEU A . n 
A 1 136 ILE 136 135 135 ILE ILE A . n 
A 1 137 ASN 137 136 136 ASN ASN A . n 
A 1 138 THR 138 137 137 THR THR A . n 
A 1 139 GLU 139 138 138 GLU GLU A . n 
A 1 140 GLY 140 139 139 GLY GLY A . n 
A 1 141 ALA 141 140 140 ALA ALA A . n 
A 1 142 ILE 142 141 141 ILE ILE A . n 
A 1 143 LYS 143 142 142 LYS LYS A . n 
A 1 144 LEU 144 143 143 LEU LEU A . n 
A 1 145 ALA 145 144 144 ALA ALA A . n 
A 1 146 ASP 146 145 145 ASP ASP A . n 
A 1 147 PHE 147 146 146 PHE PHE A . n 
A 1 148 GLY 148 147 147 GLY GLY A . n 
A 1 149 LEU 149 148 148 LEU LEU A . n 
A 1 150 ALA 150 149 149 ALA ALA A . n 
A 1 151 ARG 151 150 150 ARG ARG A . n 
A 1 152 ALA 152 151 151 ALA ALA A . n 
A 1 153 PHE 153 152 152 PHE PHE A . n 
A 1 154 GLY 154 153 153 GLY GLY A . n 
A 1 155 VAL 155 154 154 VAL VAL A . n 
A 1 156 PRO 156 155 155 PRO PRO A . n 
A 1 157 VAL 157 156 156 VAL VAL A . n 
A 1 158 ARG 158 157 157 ARG ARG A . n 
A 1 159 THR 159 158 158 THR THR A . n 
A 1 160 TYR 160 159 159 TYR TYR A . n 
A 1 161 TPO 161 160 160 TPO TPO A . n 
A 1 162 HIS 162 161 161 HIS HIS A . n 
A 1 163 GLU 163 162 162 GLU GLU A . n 
A 1 164 VAL 164 163 163 VAL VAL A . n 
A 1 165 VAL 165 164 164 VAL VAL A . n 
A 1 166 THR 166 165 165 THR THR A . n 
A 1 167 LEU 167 166 166 LEU LEU A . n 
A 1 168 TRP 168 167 167 TRP TRP A . n 
A 1 169 TYR 169 168 168 TYR TYR A . n 
A 1 170 ARG 170 169 169 ARG ARG A . n 
A 1 171 ALA 171 170 170 ALA ALA A . n 
A 1 172 PRO 172 171 171 PRO PRO A . n 
A 1 173 GLU 173 172 172 GLU GLU A . n 
A 1 174 ILE 174 173 173 ILE ILE A . n 
A 1 175 LEU 175 174 174 LEU LEU A . n 
A 1 176 LEU 176 175 175 LEU LEU A . n 
A 1 177 GLY 177 176 176 GLY GLY A . n 
A 1 178 CYS 178 177 177 CYS CYS A . n 
A 1 179 LYS 179 178 178 LYS LYS A . n 
A 1 180 TYR 180 179 179 TYR TYR A . n 
A 1 181 TYR 181 180 180 TYR TYR A . n 
A 1 182 SER 182 181 181 SER SER A . n 
A 1 183 THR 183 182 182 THR THR A . n 
A 1 184 ALA 184 183 183 ALA ALA A . n 
A 1 185 VAL 185 184 184 VAL VAL A . n 
A 1 186 ASP 186 185 185 ASP ASP A . n 
A 1 187 ILE 187 186 186 ILE ILE A . n 
A 1 188 TRP 188 187 187 TRP TRP A . n 
A 1 189 SER 189 188 188 SER SER A . n 
A 1 190 LEU 190 189 189 LEU LEU A . n 
A 1 191 GLY 191 190 190 GLY GLY A . n 
A 1 192 CYS 192 191 191 CYS CYS A . n 
A 1 193 ILE 193 192 192 ILE ILE A . n 
A 1 194 PHE 194 193 193 PHE PHE A . n 
A 1 195 ALA 195 194 194 ALA ALA A . n 
A 1 196 GLU 196 195 195 GLU GLU A . n 
A 1 197 MET 197 196 196 MET MET A . n 
A 1 198 VAL 198 197 197 VAL VAL A . n 
A 1 199 THR 199 198 198 THR THR A . n 
A 1 200 ARG 200 199 199 ARG ARG A . n 
A 1 201 ARG 201 200 200 ARG ARG A . n 
A 1 202 ALA 202 201 201 ALA ALA A . n 
A 1 203 LEU 203 202 202 LEU LEU A . n 
A 1 204 PHE 204 203 203 PHE PHE A . n 
A 1 205 PRO 205 204 204 PRO PRO A . n 
A 1 206 GLY 206 205 205 GLY GLY A . n 
A 1 207 ASP 207 206 206 ASP ASP A . n 
A 1 208 SER 208 207 207 SER SER A . n 
A 1 209 GLU 209 208 208 GLU GLU A . n 
A 1 210 ILE 210 209 209 ILE ILE A . n 
A 1 211 ASP 211 210 210 ASP ASP A . n 
A 1 212 GLN 212 211 211 GLN GLN A . n 
A 1 213 LEU 213 212 212 LEU LEU A . n 
A 1 214 PHE 214 213 213 PHE PHE A . n 
A 1 215 ARG 215 214 214 ARG ARG A . n 
A 1 216 ILE 216 215 215 ILE ILE A . n 
A 1 217 PHE 217 216 216 PHE PHE A . n 
A 1 218 ARG 218 217 217 ARG ARG A . n 
A 1 219 THR 219 218 218 THR THR A . n 
A 1 220 LEU 220 219 219 LEU LEU A . n 
A 1 221 GLY 221 220 220 GLY GLY A . n 
A 1 222 THR 222 221 221 THR THR A . n 
A 1 223 PRO 223 222 222 PRO PRO A . n 
A 1 224 ASP 224 223 223 ASP ASP A . n 
A 1 225 GLU 225 224 224 GLU GLU A . n 
A 1 226 VAL 226 225 225 VAL VAL A . n 
A 1 227 VAL 227 226 226 VAL VAL A . n 
A 1 228 TRP 228 227 227 TRP TRP A . n 
A 1 229 PRO 229 228 228 PRO PRO A . n 
A 1 230 GLY 230 229 229 GLY GLY A . n 
A 1 231 VAL 231 230 230 VAL VAL A . n 
A 1 232 THR 232 231 231 THR THR A . n 
A 1 233 SER 233 232 232 SER SER A . n 
A 1 234 MET 234 233 233 MET MET A . n 
A 1 235 PRO 235 234 234 PRO PRO A . n 
A 1 236 ASP 236 235 235 ASP ASP A . n 
A 1 237 TYR 237 236 236 TYR TYR A . n 
A 1 238 LYS 238 237 237 LYS LYS A . n 
A 1 239 PRO 239 238 238 PRO PRO A . n 
A 1 240 SER 240 239 239 SER SER A . n 
A 1 241 PHE 241 240 240 PHE PHE A . n 
A 1 242 PRO 242 241 241 PRO PRO A . n 
A 1 243 LYS 243 242 242 LYS LYS A . n 
A 1 244 TRP 244 243 243 TRP TRP A . n 
A 1 245 ALA 245 244 244 ALA ALA A . n 
A 1 246 ARG 246 245 245 ARG ARG A . n 
A 1 247 GLN 247 246 246 GLN GLN A . n 
A 1 248 ASP 248 247 247 ASP ASP A . n 
A 1 249 PHE 249 248 248 PHE PHE A . n 
A 1 250 SER 250 249 249 SER SER A . n 
A 1 251 LYS 251 250 250 LYS LYS A . n 
A 1 252 VAL 252 251 251 VAL VAL A . n 
A 1 253 VAL 253 252 252 VAL VAL A . n 
A 1 254 PRO 254 253 253 PRO PRO A . n 
A 1 255 PRO 255 254 254 PRO PRO A . n 
A 1 256 LEU 256 255 255 LEU LEU A . n 
A 1 257 ASP 257 256 256 ASP ASP A . n 
A 1 258 GLU 258 257 257 GLU GLU A . n 
A 1 259 ASP 259 258 258 ASP ASP A . n 
A 1 260 GLY 260 259 259 GLY GLY A . n 
A 1 261 ARG 261 260 260 ARG ARG A . n 
A 1 262 SER 262 261 261 SER SER A . n 
A 1 263 LEU 263 262 262 LEU LEU A . n 
A 1 264 LEU 264 263 263 LEU LEU A . n 
A 1 265 SER 265 264 264 SER SER A . n 
A 1 266 GLN 266 265 265 GLN GLN A . n 
A 1 267 MET 267 266 266 MET MET A . n 
A 1 268 LEU 268 267 267 LEU LEU A . n 
A 1 269 HIS 269 268 268 HIS HIS A . n 
A 1 270 TYR 270 269 269 TYR TYR A . n 
A 1 271 ASP 271 270 270 ASP ASP A . n 
A 1 272 PRO 272 271 271 PRO PRO A . n 
A 1 273 ASN 273 272 272 ASN ASN A . n 
A 1 274 LYS 274 273 273 LYS LYS A . n 
A 1 275 ARG 275 274 274 ARG ARG A . n 
A 1 276 ILE 276 275 275 ILE ILE A . n 
A 1 277 SER 277 276 276 SER SER A . n 
A 1 278 ALA 278 277 277 ALA ALA A . n 
A 1 279 LYS 279 278 278 LYS LYS A . n 
A 1 280 ALA 280 279 279 ALA ALA A . n 
A 1 281 ALA 281 280 280 ALA ALA A . n 
A 1 282 LEU 282 281 281 LEU LEU A . n 
A 1 283 ALA 283 282 282 ALA ALA A . n 
A 1 284 HIS 284 283 283 HIS HIS A . n 
A 1 285 PRO 285 284 284 PRO PRO A . n 
A 1 286 PHE 286 285 285 PHE PHE A . n 
A 1 287 PHE 287 286 286 PHE PHE A . n 
A 1 288 GLN 288 287 287 GLN GLN A . n 
A 1 289 ASP 289 288 288 ASP ASP A . n 
A 1 290 VAL 290 289 289 VAL VAL A . n 
A 1 291 THR 291 290 290 THR THR A . n 
A 1 292 LYS 292 291 291 LYS LYS A . n 
A 1 293 PRO 293 292 292 PRO PRO A . n 
A 1 294 VAL 294 293 293 VAL VAL A . n 
A 1 295 PRO 295 294 294 PRO PRO A . n 
A 1 296 HIS 296 295 295 HIS HIS A . n 
A 1 297 LEU 297 296 296 LEU LEU A . n 
B 2 1   VAL 1   175 175 VAL VAL B . n 
B 2 2   PRO 2   176 176 PRO PRO B . n 
B 2 3   ASP 3   177 177 ASP ASP B . n 
B 2 4   TYR 4   178 178 TYR TYR B . n 
B 2 5   HIS 5   179 179 HIS HIS B . n 
B 2 6   GLU 6   180 180 GLU GLU B . n 
B 2 7   ASP 7   181 181 ASP ASP B . n 
B 2 8   ILE 8   182 182 ILE ILE B . n 
B 2 9   HIS 9   183 183 HIS HIS B . n 
B 2 10  THR 10  184 184 THR THR B . n 
B 2 11  TYR 11  185 185 TYR TYR B . n 
B 2 12  LEU 12  186 186 LEU LEU B . n 
B 2 13  ARG 13  187 187 ARG ARG B . n 
B 2 14  GLU 14  188 188 GLU GLU B . n 
B 2 15  MET 15  189 189 MET MET B . n 
B 2 16  GLU 16  190 190 GLU GLU B . n 
B 2 17  VAL 17  191 191 VAL VAL B . n 
B 2 18  LYS 18  192 192 LYS LYS B . n 
B 2 19  CYS 19  193 193 CYS CYS B . n 
B 2 20  LYS 20  194 194 LYS LYS B . n 
B 2 21  PRO 21  195 195 PRO PRO B . n 
B 2 22  LYS 22  196 196 LYS LYS B . n 
B 2 23  VAL 23  197 197 VAL VAL B . n 
B 2 24  GLY 24  198 198 GLY GLY B . n 
B 2 25  TYR 25  199 199 TYR TYR B . n 
B 2 26  MET 26  200 200 MET MET B . n 
B 2 27  LYS 27  201 201 LYS LYS B . n 
B 2 28  LYS 28  202 202 LYS LYS B . n 
B 2 29  GLN 29  203 203 GLN GLN B . n 
B 2 30  PRO 30  204 204 PRO PRO B . n 
B 2 31  ASP 31  205 205 ASP ASP B . n 
B 2 32  ILE 32  206 206 ILE ILE B . n 
B 2 33  THR 33  207 207 THR THR B . n 
B 2 34  ASN 34  208 208 ASN ASN B . n 
B 2 35  SER 35  209 209 SER SER B . n 
B 2 36  MET 36  210 210 MET MET B . n 
B 2 37  ARG 37  211 211 ARG ARG B . n 
B 2 38  ALA 38  212 212 ALA ALA B . n 
B 2 39  ILE 39  213 213 ILE ILE B . n 
B 2 40  LEU 40  214 214 LEU LEU B . n 
B 2 41  VAL 41  215 215 VAL VAL B . n 
B 2 42  ASP 42  216 216 ASP ASP B . n 
B 2 43  TRP 43  217 217 TRP TRP B . n 
B 2 44  LEU 44  218 218 LEU LEU B . n 
B 2 45  VAL 45  219 219 VAL VAL B . n 
B 2 46  GLU 46  220 220 GLU GLU B . n 
B 2 47  VAL 47  221 221 VAL VAL B . n 
B 2 48  GLY 48  222 222 GLY GLY B . n 
B 2 49  GLU 49  223 223 GLU GLU B . n 
B 2 50  GLU 50  224 224 GLU GLU B . n 
B 2 51  TYR 51  225 225 TYR TYR B . n 
B 2 52  LYS 52  226 226 LYS LYS B . n 
B 2 53  LEU 53  227 227 LEU LEU B . n 
B 2 54  GLN 54  228 228 GLN GLN B . n 
B 2 55  ASN 55  229 229 ASN ASN B . n 
B 2 56  GLU 56  230 230 GLU GLU B . n 
B 2 57  THR 57  231 231 THR THR B . n 
B 2 58  LEU 58  232 232 LEU LEU B . n 
B 2 59  HIS 59  233 233 HIS HIS B . n 
B 2 60  LEU 60  234 234 LEU LEU B . n 
B 2 61  ALA 61  235 235 ALA ALA B . n 
B 2 62  VAL 62  236 236 VAL VAL B . n 
B 2 63  ASN 63  237 237 ASN ASN B . n 
B 2 64  TYR 64  238 238 TYR TYR B . n 
B 2 65  ILE 65  239 239 ILE ILE B . n 
B 2 66  ASP 66  240 240 ASP ASP B . n 
B 2 67  ARG 67  241 241 ARG ARG B . n 
B 2 68  PHE 68  242 242 PHE PHE B . n 
B 2 69  LEU 69  243 243 LEU LEU B . n 
B 2 70  SER 70  244 244 SER SER B . n 
B 2 71  SER 71  245 245 SER SER B . n 
B 2 72  MET 72  246 246 MET MET B . n 
B 2 73  SER 73  247 247 SER SER B . n 
B 2 74  VAL 74  248 248 VAL VAL B . n 
B 2 75  LEU 75  249 249 LEU LEU B . n 
B 2 76  ARG 76  250 250 ARG ARG B . n 
B 2 77  GLY 77  251 251 GLY GLY B . n 
B 2 78  LYS 78  252 252 LYS LYS B . n 
B 2 79  LEU 79  253 253 LEU LEU B . n 
B 2 80  GLN 80  254 254 GLN GLN B . n 
B 2 81  LEU 81  255 255 LEU LEU B . n 
B 2 82  VAL 82  256 256 VAL VAL B . n 
B 2 83  GLY 83  257 257 GLY GLY B . n 
B 2 84  THR 84  258 258 THR THR B . n 
B 2 85  ALA 85  259 259 ALA ALA B . n 
B 2 86  ALA 86  260 260 ALA ALA B . n 
B 2 87  MET 87  261 261 MET MET B . n 
B 2 88  LEU 88  262 262 LEU LEU B . n 
B 2 89  LEU 89  263 263 LEU LEU B . n 
B 2 90  ALA 90  264 264 ALA ALA B . n 
B 2 91  SER 91  265 265 SER SER B . n 
B 2 92  LYS 92  266 266 LYS LYS B . n 
B 2 93  PHE 93  267 267 PHE PHE B . n 
B 2 94  GLU 94  268 268 GLU GLU B . n 
B 2 95  GLU 95  269 269 GLU GLU B . n 
B 2 96  ILE 96  270 270 ILE ILE B . n 
B 2 97  TYR 97  271 271 TYR TYR B . n 
B 2 98  PRO 98  272 272 PRO PRO B . n 
B 2 99  PRO 99  273 273 PRO PRO B . n 
B 2 100 GLU 100 274 274 GLU GLU B . n 
B 2 101 VAL 101 275 275 VAL VAL B . n 
B 2 102 ALA 102 276 276 ALA ALA B . n 
B 2 103 GLU 103 277 277 GLU GLU B . n 
B 2 104 PHE 104 278 278 PHE PHE B . n 
B 2 105 VAL 105 279 279 VAL VAL B . n 
B 2 106 TYR 106 280 280 TYR TYR B . n 
B 2 107 ILE 107 281 281 ILE ILE B . n 
B 2 108 THR 108 282 282 THR THR B . n 
B 2 109 ASP 109 283 283 ASP ASP B . n 
B 2 110 ASP 110 284 284 ASP ASP B . n 
B 2 111 THR 111 285 285 THR THR B . n 
B 2 112 TYR 112 286 286 TYR TYR B . n 
B 2 113 THR 113 287 287 THR THR B . n 
B 2 114 LYS 114 288 288 LYS LYS B . n 
B 2 115 LYS 115 289 289 LYS LYS B . n 
B 2 116 GLN 116 290 290 GLN GLN B . n 
B 2 117 VAL 117 291 291 VAL VAL B . n 
B 2 118 LEU 118 292 292 LEU LEU B . n 
B 2 119 ARG 119 293 293 ARG ARG B . n 
B 2 120 MET 120 294 294 MET MET B . n 
B 2 121 GLU 121 295 295 GLU GLU B . n 
B 2 122 HIS 122 296 296 HIS HIS B . n 
B 2 123 LEU 123 297 297 LEU LEU B . n 
B 2 124 VAL 124 298 298 VAL VAL B . n 
B 2 125 LEU 125 299 299 LEU LEU B . n 
B 2 126 LYS 126 300 300 LYS LYS B . n 
B 2 127 VAL 127 301 301 VAL VAL B . n 
B 2 128 LEU 128 302 302 LEU LEU B . n 
B 2 129 THR 129 303 303 THR THR B . n 
B 2 130 PHE 130 304 304 PHE PHE B . n 
B 2 131 ASP 131 305 305 ASP ASP B . n 
B 2 132 LEU 132 306 306 LEU LEU B . n 
B 2 133 ALA 133 307 307 ALA ALA B . n 
B 2 134 ALA 134 308 308 ALA ALA B . n 
B 2 135 PRO 135 309 309 PRO PRO B . n 
B 2 136 THR 136 310 310 THR THR B . n 
B 2 137 VAL 137 311 311 VAL VAL B . n 
B 2 138 ASN 138 312 312 ASN ASN B . n 
B 2 139 GLN 139 313 313 GLN GLN B . n 
B 2 140 PHE 140 314 314 PHE PHE B . n 
B 2 141 LEU 141 315 315 LEU LEU B . n 
B 2 142 THR 142 316 316 THR THR B . n 
B 2 143 GLN 143 317 317 GLN GLN B . n 
B 2 144 TYR 144 318 318 TYR TYR B . n 
B 2 145 PHE 145 319 319 PHE PHE B . n 
B 2 146 LEU 146 320 320 LEU LEU B . n 
B 2 147 HIS 147 321 321 HIS HIS B . n 
B 2 148 GLN 148 322 322 GLN GLN B . n 
B 2 149 GLN 149 323 323 GLN GLN B . n 
B 2 150 PRO 150 324 324 PRO PRO B . n 
B 2 151 ALA 151 325 325 ALA ALA B . n 
B 2 152 ASN 152 326 326 ASN ASN B . n 
B 2 153 CYS 153 327 327 CYS CYS B . n 
B 2 154 LYS 154 328 328 LYS LYS B . n 
B 2 155 VAL 155 329 329 VAL VAL B . n 
B 2 156 GLU 156 330 330 GLU GLU B . n 
B 2 157 SER 157 331 331 SER SER B . n 
B 2 158 LEU 158 332 332 LEU LEU B . n 
B 2 159 ALA 159 333 333 ALA ALA B . n 
B 2 160 MET 160 334 334 MET MET B . n 
B 2 161 PHE 161 335 335 PHE PHE B . n 
B 2 162 LEU 162 336 336 LEU LEU B . n 
B 2 163 GLY 163 337 337 GLY GLY B . n 
B 2 164 GLU 164 338 338 GLU GLU B . n 
B 2 165 LEU 165 339 339 LEU LEU B . n 
B 2 166 SER 166 340 340 SER SER B . n 
B 2 167 LEU 167 341 341 LEU LEU B . n 
B 2 168 ILE 168 342 342 ILE ILE B . n 
B 2 169 ASP 169 343 343 ASP ASP B . n 
B 2 170 ALA 170 344 344 ALA ALA B . n 
B 2 171 ASP 171 345 345 ASP ASP B . n 
B 2 172 PRO 172 346 346 PRO PRO B . n 
B 2 173 TYR 173 347 347 TYR TYR B . n 
B 2 174 LEU 174 348 348 LEU LEU B . n 
B 2 175 LYS 175 349 349 LYS LYS B . n 
B 2 176 TYR 176 350 350 TYR TYR B . n 
B 2 177 LEU 177 351 351 LEU LEU B . n 
B 2 178 PRO 178 352 352 PRO PRO B . n 
B 2 179 SER 179 353 353 SER SER B . n 
B 2 180 VAL 180 354 354 VAL VAL B . n 
B 2 181 ILE 181 355 355 ILE ILE B . n 
B 2 182 ALA 182 356 356 ALA ALA B . n 
B 2 183 GLY 183 357 357 GLY GLY B . n 
B 2 184 ALA 184 358 358 ALA ALA B . n 
B 2 185 ALA 185 359 359 ALA ALA B . n 
B 2 186 PHE 186 360 360 PHE PHE B . n 
B 2 187 HIS 187 361 361 HIS HIS B . n 
B 2 188 LEU 188 362 362 LEU LEU B . n 
B 2 189 ALA 189 363 363 ALA ALA B . n 
B 2 190 LEU 190 364 364 LEU LEU B . n 
B 2 191 TYR 191 365 365 TYR TYR B . n 
B 2 192 THR 192 366 366 THR THR B . n 
B 2 193 VAL 193 367 367 VAL VAL B . n 
B 2 194 THR 194 368 368 THR THR B . n 
B 2 195 GLY 195 369 369 GLY GLY B . n 
B 2 196 GLN 196 370 370 GLN GLN B . n 
B 2 197 SER 197 371 371 SER SER B . n 
B 2 198 TRP 198 372 372 TRP TRP B . n 
B 2 199 PRO 199 373 373 PRO PRO B . n 
B 2 200 GLU 200 374 374 GLU GLU B . n 
B 2 201 SER 201 375 375 SER SER B . n 
B 2 202 LEU 202 376 376 LEU LEU B . n 
B 2 203 ILE 203 377 377 ILE ILE B . n 
B 2 204 ARG 204 378 378 ARG ARG B . n 
B 2 205 LYS 205 379 379 LYS LYS B . n 
B 2 206 THR 206 380 380 THR THR B . n 
B 2 207 GLY 207 381 381 GLY GLY B . n 
B 2 208 TYR 208 382 382 TYR TYR B . n 
B 2 209 THR 209 383 383 THR THR B . n 
B 2 210 LEU 210 384 384 LEU LEU B . n 
B 2 211 GLU 211 385 385 GLU GLU B . n 
B 2 212 SER 212 386 386 SER SER B . n 
B 2 213 LEU 213 387 387 LEU LEU B . n 
B 2 214 LYS 214 388 388 LYS LYS B . n 
B 2 215 PRO 215 389 389 PRO PRO B . n 
B 2 216 CYS 216 390 390 CYS CYS B . n 
B 2 217 LEU 217 391 391 LEU LEU B . n 
B 2 218 MET 218 392 392 MET MET B . n 
B 2 219 ASP 219 393 393 ASP ASP B . n 
B 2 220 LEU 220 394 394 LEU LEU B . n 
B 2 221 HIS 221 395 395 HIS HIS B . n 
B 2 222 GLN 222 396 396 GLN GLN B . n 
B 2 223 THR 223 397 397 THR THR B . n 
B 2 224 TYR 224 398 398 TYR TYR B . n 
B 2 225 LEU 225 399 399 LEU LEU B . n 
B 2 226 LYS 226 400 400 LYS LYS B . n 
B 2 227 ALA 227 401 401 ALA ALA B . n 
B 2 228 PRO 228 402 402 PRO PRO B . n 
B 2 229 GLN 229 403 403 GLN GLN B . n 
B 2 230 HIS 230 404 404 HIS HIS B . n 
B 2 231 ALA 231 405 405 ALA ALA B . n 
B 2 232 GLN 232 406 406 GLN GLN B . n 
B 2 233 GLN 233 407 407 GLN GLN B . n 
B 2 234 SER 234 408 408 SER SER B . n 
B 2 235 ILE 235 409 409 ILE ILE B . n 
B 2 236 ARG 236 410 410 ARG ARG B . n 
B 2 237 GLU 237 411 411 GLU GLU B . n 
B 2 238 LYS 238 412 412 LYS LYS B . n 
B 2 239 TYR 239 413 413 TYR TYR B . n 
B 2 240 LYS 240 414 414 LYS LYS B . n 
B 2 241 ASN 241 415 415 ASN ASN B . n 
B 2 242 SER 242 416 416 SER SER B . n 
B 2 243 LYS 243 417 417 LYS LYS B . n 
B 2 244 TYR 244 418 418 TYR TYR B . n 
B 2 245 HIS 245 419 419 HIS HIS B . n 
B 2 246 GLY 246 420 420 GLY GLY B . n 
B 2 247 VAL 247 421 421 VAL VAL B . n 
B 2 248 SER 248 422 422 SER SER B . n 
B 2 249 LEU 249 423 423 LEU LEU B . n 
B 2 250 LEU 250 424 424 LEU LEU B . n 
B 2 251 ASN 251 425 425 ASN ASN B . n 
B 2 252 PRO 252 426 426 PRO PRO B . n 
B 2 253 PRO 253 427 427 PRO PRO B . n 
B 2 254 GLU 254 428 428 GLU GLU B . n 
B 2 255 THR 255 429 429 THR THR B . n 
B 2 256 LEU 256 430 430 LEU LEU B . n 
B 2 257 ASN 257 431 431 ASN ASN B . n 
B 2 258 LEU 258 432 432 LEU LEU B . n 
C 1 1   SER 1   0   0   SER SER C . n 
C 1 2   MET 2   1   1   MET MET C . n 
C 1 3   GLU 3   2   2   GLU GLU C . n 
C 1 4   ASN 4   3   3   ASN ASN C . n 
C 1 5   PHE 5   4   4   PHE PHE C . n 
C 1 6   GLN 6   5   5   GLN GLN C . n 
C 1 7   LYS 7   6   6   LYS LYS C . n 
C 1 8   VAL 8   7   7   VAL VAL C . n 
C 1 9   GLU 9   8   8   GLU GLU C . n 
C 1 10  LYS 10  9   9   LYS LYS C . n 
C 1 11  ILE 11  10  10  ILE ILE C . n 
C 1 12  GLY 12  11  11  GLY GLY C . n 
C 1 13  GLU 13  12  12  GLU GLU C . n 
C 1 14  GLY 14  13  13  GLY GLY C . n 
C 1 15  THR 15  14  14  THR THR C . n 
C 1 16  TYR 16  15  15  TYR TYR C . n 
C 1 17  GLY 17  16  16  GLY GLY C . n 
C 1 18  VAL 18  17  17  VAL VAL C . n 
C 1 19  VAL 19  18  18  VAL VAL C . n 
C 1 20  TYR 20  19  19  TYR TYR C . n 
C 1 21  LYS 21  20  20  LYS LYS C . n 
C 1 22  ALA 22  21  21  ALA ALA C . n 
C 1 23  ARG 23  22  22  ARG ARG C . n 
C 1 24  ASN 24  23  23  ASN ASN C . n 
C 1 25  LYS 25  24  24  LYS LYS C . n 
C 1 26  LEU 26  25  25  LEU LEU C . n 
C 1 27  THR 27  26  26  THR THR C . n 
C 1 28  GLY 28  27  27  GLY GLY C . n 
C 1 29  GLU 29  28  28  GLU GLU C . n 
C 1 30  VAL 30  29  29  VAL VAL C . n 
C 1 31  VAL 31  30  30  VAL VAL C . n 
C 1 32  ALA 32  31  31  ALA ALA C . n 
C 1 33  LEU 33  32  32  LEU LEU C . n 
C 1 34  LYS 34  33  33  LYS LYS C . n 
C 1 35  LYS 35  34  34  LYS LYS C . n 
C 1 36  ILE 36  35  35  ILE ILE C . n 
C 1 37  ARG 37  36  36  ARG ARG C . n 
C 1 38  LEU 38  37  37  LEU LEU C . n 
C 1 39  ASP 39  38  38  ASP ASP C . n 
C 1 40  THR 40  39  39  THR THR C . n 
C 1 41  GLU 41  40  40  GLU GLU C . n 
C 1 42  THR 42  41  41  THR THR C . n 
C 1 43  GLU 43  42  42  GLU GLU C . n 
C 1 44  GLY 44  43  43  GLY GLY C . n 
C 1 45  VAL 45  44  44  VAL VAL C . n 
C 1 46  PRO 46  45  45  PRO PRO C . n 
C 1 47  SER 47  46  46  SER SER C . n 
C 1 48  THR 48  47  47  THR THR C . n 
C 1 49  ALA 49  48  48  ALA ALA C . n 
C 1 50  ILE 50  49  49  ILE ILE C . n 
C 1 51  ARG 51  50  50  ARG ARG C . n 
C 1 52  GLU 52  51  51  GLU GLU C . n 
C 1 53  ILE 53  52  52  ILE ILE C . n 
C 1 54  SER 54  53  53  SER SER C . n 
C 1 55  LEU 55  54  54  LEU LEU C . n 
C 1 56  LEU 56  55  55  LEU LEU C . n 
C 1 57  LYS 57  56  56  LYS LYS C . n 
C 1 58  GLU 58  57  57  GLU GLU C . n 
C 1 59  LEU 59  58  58  LEU LEU C . n 
C 1 60  ASN 60  59  59  ASN ASN C . n 
C 1 61  HIS 61  60  60  HIS HIS C . n 
C 1 62  PRO 62  61  61  PRO PRO C . n 
C 1 63  ASN 63  62  62  ASN ASN C . n 
C 1 64  ILE 64  63  63  ILE ILE C . n 
C 1 65  VAL 65  64  64  VAL VAL C . n 
C 1 66  LYS 66  65  65  LYS LYS C . n 
C 1 67  LEU 67  66  66  LEU LEU C . n 
C 1 68  LEU 68  67  67  LEU LEU C . n 
C 1 69  ASP 69  68  68  ASP ASP C . n 
C 1 70  VAL 70  69  69  VAL VAL C . n 
C 1 71  ILE 71  70  70  ILE ILE C . n 
C 1 72  HIS 72  71  71  HIS HIS C . n 
C 1 73  THR 73  72  72  THR THR C . n 
C 1 74  GLU 74  73  73  GLU GLU C . n 
C 1 75  ASN 75  74  74  ASN ASN C . n 
C 1 76  LYS 76  75  75  LYS LYS C . n 
C 1 77  LEU 77  76  76  LEU LEU C . n 
C 1 78  TYR 78  77  77  TYR TYR C . n 
C 1 79  LEU 79  78  78  LEU LEU C . n 
C 1 80  VAL 80  79  79  VAL VAL C . n 
C 1 81  PHE 81  80  80  PHE PHE C . n 
C 1 82  GLU 82  81  81  GLU GLU C . n 
C 1 83  PHE 83  82  82  PHE PHE C . n 
C 1 84  LEU 84  83  83  LEU LEU C . n 
C 1 85  HIS 85  84  84  HIS HIS C . n 
C 1 86  GLN 86  85  85  GLN GLN C . n 
C 1 87  ASP 87  86  86  ASP ASP C . n 
C 1 88  LEU 88  87  87  LEU LEU C . n 
C 1 89  LYS 89  88  88  LYS LYS C . n 
C 1 90  LYS 90  89  89  LYS LYS C . n 
C 1 91  PHE 91  90  90  PHE PHE C . n 
C 1 92  MET 92  91  91  MET MET C . n 
C 1 93  ASP 93  92  92  ASP ASP C . n 
C 1 94  ALA 94  93  93  ALA ALA C . n 
C 1 95  SER 95  94  94  SER SER C . n 
C 1 96  ALA 96  95  95  ALA ALA C . n 
C 1 97  LEU 97  96  96  LEU LEU C . n 
C 1 98  THR 98  97  97  THR THR C . n 
C 1 99  GLY 99  98  98  GLY GLY C . n 
C 1 100 ILE 100 99  99  ILE ILE C . n 
C 1 101 PRO 101 100 100 PRO PRO C . n 
C 1 102 LEU 102 101 101 LEU LEU C . n 
C 1 103 PRO 103 102 102 PRO PRO C . n 
C 1 104 LEU 104 103 103 LEU LEU C . n 
C 1 105 ILE 105 104 104 ILE ILE C . n 
C 1 106 LYS 106 105 105 LYS LYS C . n 
C 1 107 SER 107 106 106 SER SER C . n 
C 1 108 TYR 108 107 107 TYR TYR C . n 
C 1 109 LEU 109 108 108 LEU LEU C . n 
C 1 110 PHE 110 109 109 PHE PHE C . n 
C 1 111 GLN 111 110 110 GLN GLN C . n 
C 1 112 LEU 112 111 111 LEU LEU C . n 
C 1 113 LEU 113 112 112 LEU LEU C . n 
C 1 114 GLN 114 113 113 GLN GLN C . n 
C 1 115 GLY 115 114 114 GLY GLY C . n 
C 1 116 LEU 116 115 115 LEU LEU C . n 
C 1 117 ALA 117 116 116 ALA ALA C . n 
C 1 118 PHE 118 117 117 PHE PHE C . n 
C 1 119 CYS 119 118 118 CYS CYS C . n 
C 1 120 HIS 120 119 119 HIS HIS C . n 
C 1 121 SER 121 120 120 SER SER C . n 
C 1 122 HIS 122 121 121 HIS HIS C . n 
C 1 123 ARG 123 122 122 ARG ARG C . n 
C 1 124 VAL 124 123 123 VAL VAL C . n 
C 1 125 LEU 125 124 124 LEU LEU C . n 
C 1 126 HIS 126 125 125 HIS HIS C . n 
C 1 127 ARG 127 126 126 ARG ARG C . n 
C 1 128 ASP 128 127 127 ASP ASP C . n 
C 1 129 LEU 129 128 128 LEU LEU C . n 
C 1 130 LYS 130 129 129 LYS LYS C . n 
C 1 131 PRO 131 130 130 PRO PRO C . n 
C 1 132 GLN 132 131 131 GLN GLN C . n 
C 1 133 ASN 133 132 132 ASN ASN C . n 
C 1 134 LEU 134 133 133 LEU LEU C . n 
C 1 135 LEU 135 134 134 LEU LEU C . n 
C 1 136 ILE 136 135 135 ILE ILE C . n 
C 1 137 ASN 137 136 136 ASN ASN C . n 
C 1 138 THR 138 137 137 THR THR C . n 
C 1 139 GLU 139 138 138 GLU GLU C . n 
C 1 140 GLY 140 139 139 GLY GLY C . n 
C 1 141 ALA 141 140 140 ALA ALA C . n 
C 1 142 ILE 142 141 141 ILE ILE C . n 
C 1 143 LYS 143 142 142 LYS LYS C . n 
C 1 144 LEU 144 143 143 LEU LEU C . n 
C 1 145 ALA 145 144 144 ALA ALA C . n 
C 1 146 ASP 146 145 145 ASP ASP C . n 
C 1 147 PHE 147 146 146 PHE PHE C . n 
C 1 148 GLY 148 147 147 GLY GLY C . n 
C 1 149 LEU 149 148 148 LEU LEU C . n 
C 1 150 ALA 150 149 149 ALA ALA C . n 
C 1 151 ARG 151 150 150 ARG ARG C . n 
C 1 152 ALA 152 151 151 ALA ALA C . n 
C 1 153 PHE 153 152 152 PHE PHE C . n 
C 1 154 GLY 154 153 153 GLY GLY C . n 
C 1 155 VAL 155 154 154 VAL VAL C . n 
C 1 156 PRO 156 155 155 PRO PRO C . n 
C 1 157 VAL 157 156 156 VAL VAL C . n 
C 1 158 ARG 158 157 157 ARG ARG C . n 
C 1 159 THR 159 158 158 THR THR C . n 
C 1 160 TYR 160 159 159 TYR TYR C . n 
C 1 161 TPO 161 160 160 TPO TPO C . n 
C 1 162 HIS 162 161 161 HIS HIS C . n 
C 1 163 GLU 163 162 162 GLU GLU C . n 
C 1 164 VAL 164 163 163 VAL VAL C . n 
C 1 165 VAL 165 164 164 VAL VAL C . n 
C 1 166 THR 166 165 165 THR THR C . n 
C 1 167 LEU 167 166 166 LEU LEU C . n 
C 1 168 TRP 168 167 167 TRP TRP C . n 
C 1 169 TYR 169 168 168 TYR TYR C . n 
C 1 170 ARG 170 169 169 ARG ARG C . n 
C 1 171 ALA 171 170 170 ALA ALA C . n 
C 1 172 PRO 172 171 171 PRO PRO C . n 
C 1 173 GLU 173 172 172 GLU GLU C . n 
C 1 174 ILE 174 173 173 ILE ILE C . n 
C 1 175 LEU 175 174 174 LEU LEU C . n 
C 1 176 LEU 176 175 175 LEU LEU C . n 
C 1 177 GLY 177 176 176 GLY GLY C . n 
C 1 178 CYS 178 177 177 CYS CYS C . n 
C 1 179 LYS 179 178 178 LYS LYS C . n 
C 1 180 TYR 180 179 179 TYR TYR C . n 
C 1 181 TYR 181 180 180 TYR TYR C . n 
C 1 182 SER 182 181 181 SER SER C . n 
C 1 183 THR 183 182 182 THR THR C . n 
C 1 184 ALA 184 183 183 ALA ALA C . n 
C 1 185 VAL 185 184 184 VAL VAL C . n 
C 1 186 ASP 186 185 185 ASP ASP C . n 
C 1 187 ILE 187 186 186 ILE ILE C . n 
C 1 188 TRP 188 187 187 TRP TRP C . n 
C 1 189 SER 189 188 188 SER SER C . n 
C 1 190 LEU 190 189 189 LEU LEU C . n 
C 1 191 GLY 191 190 190 GLY GLY C . n 
C 1 192 CYS 192 191 191 CYS CYS C . n 
C 1 193 ILE 193 192 192 ILE ILE C . n 
C 1 194 PHE 194 193 193 PHE PHE C . n 
C 1 195 ALA 195 194 194 ALA ALA C . n 
C 1 196 GLU 196 195 195 GLU GLU C . n 
C 1 197 MET 197 196 196 MET MET C . n 
C 1 198 VAL 198 197 197 VAL VAL C . n 
C 1 199 THR 199 198 198 THR THR C . n 
C 1 200 ARG 200 199 199 ARG ARG C . n 
C 1 201 ARG 201 200 200 ARG ARG C . n 
C 1 202 ALA 202 201 201 ALA ALA C . n 
C 1 203 LEU 203 202 202 LEU LEU C . n 
C 1 204 PHE 204 203 203 PHE PHE C . n 
C 1 205 PRO 205 204 204 PRO PRO C . n 
C 1 206 GLY 206 205 205 GLY GLY C . n 
C 1 207 ASP 207 206 206 ASP ASP C . n 
C 1 208 SER 208 207 207 SER SER C . n 
C 1 209 GLU 209 208 208 GLU GLU C . n 
C 1 210 ILE 210 209 209 ILE ILE C . n 
C 1 211 ASP 211 210 210 ASP ASP C . n 
C 1 212 GLN 212 211 211 GLN GLN C . n 
C 1 213 LEU 213 212 212 LEU LEU C . n 
C 1 214 PHE 214 213 213 PHE PHE C . n 
C 1 215 ARG 215 214 214 ARG ARG C . n 
C 1 216 ILE 216 215 215 ILE ILE C . n 
C 1 217 PHE 217 216 216 PHE PHE C . n 
C 1 218 ARG 218 217 217 ARG ARG C . n 
C 1 219 THR 219 218 218 THR THR C . n 
C 1 220 LEU 220 219 219 LEU LEU C . n 
C 1 221 GLY 221 220 220 GLY GLY C . n 
C 1 222 THR 222 221 221 THR THR C . n 
C 1 223 PRO 223 222 222 PRO PRO C . n 
C 1 224 ASP 224 223 223 ASP ASP C . n 
C 1 225 GLU 225 224 224 GLU GLU C . n 
C 1 226 VAL 226 225 225 VAL VAL C . n 
C 1 227 VAL 227 226 226 VAL VAL C . n 
C 1 228 TRP 228 227 227 TRP TRP C . n 
C 1 229 PRO 229 228 228 PRO PRO C . n 
C 1 230 GLY 230 229 229 GLY GLY C . n 
C 1 231 VAL 231 230 230 VAL VAL C . n 
C 1 232 THR 232 231 231 THR THR C . n 
C 1 233 SER 233 232 232 SER SER C . n 
C 1 234 MET 234 233 233 MET MET C . n 
C 1 235 PRO 235 234 234 PRO PRO C . n 
C 1 236 ASP 236 235 235 ASP ASP C . n 
C 1 237 TYR 237 236 236 TYR TYR C . n 
C 1 238 LYS 238 237 237 LYS LYS C . n 
C 1 239 PRO 239 238 238 PRO PRO C . n 
C 1 240 SER 240 239 239 SER SER C . n 
C 1 241 PHE 241 240 240 PHE PHE C . n 
C 1 242 PRO 242 241 241 PRO PRO C . n 
C 1 243 LYS 243 242 242 LYS LYS C . n 
C 1 244 TRP 244 243 243 TRP TRP C . n 
C 1 245 ALA 245 244 244 ALA ALA C . n 
C 1 246 ARG 246 245 245 ARG ARG C . n 
C 1 247 GLN 247 246 246 GLN GLN C . n 
C 1 248 ASP 248 247 247 ASP ASP C . n 
C 1 249 PHE 249 248 248 PHE PHE C . n 
C 1 250 SER 250 249 249 SER SER C . n 
C 1 251 LYS 251 250 250 LYS LYS C . n 
C 1 252 VAL 252 251 251 VAL VAL C . n 
C 1 253 VAL 253 252 252 VAL VAL C . n 
C 1 254 PRO 254 253 253 PRO PRO C . n 
C 1 255 PRO 255 254 254 PRO PRO C . n 
C 1 256 LEU 256 255 255 LEU LEU C . n 
C 1 257 ASP 257 256 256 ASP ASP C . n 
C 1 258 GLU 258 257 257 GLU GLU C . n 
C 1 259 ASP 259 258 258 ASP ASP C . n 
C 1 260 GLY 260 259 259 GLY GLY C . n 
C 1 261 ARG 261 260 260 ARG ARG C . n 
C 1 262 SER 262 261 261 SER SER C . n 
C 1 263 LEU 263 262 262 LEU LEU C . n 
C 1 264 LEU 264 263 263 LEU LEU C . n 
C 1 265 SER 265 264 264 SER SER C . n 
C 1 266 GLN 266 265 265 GLN GLN C . n 
C 1 267 MET 267 266 266 MET MET C . n 
C 1 268 LEU 268 267 267 LEU LEU C . n 
C 1 269 HIS 269 268 268 HIS HIS C . n 
C 1 270 TYR 270 269 269 TYR TYR C . n 
C 1 271 ASP 271 270 270 ASP ASP C . n 
C 1 272 PRO 272 271 271 PRO PRO C . n 
C 1 273 ASN 273 272 272 ASN ASN C . n 
C 1 274 LYS 274 273 273 LYS LYS C . n 
C 1 275 ARG 275 274 274 ARG ARG C . n 
C 1 276 ILE 276 275 275 ILE ILE C . n 
C 1 277 SER 277 276 276 SER SER C . n 
C 1 278 ALA 278 277 277 ALA ALA C . n 
C 1 279 LYS 279 278 278 LYS LYS C . n 
C 1 280 ALA 280 279 279 ALA ALA C . n 
C 1 281 ALA 281 280 280 ALA ALA C . n 
C 1 282 LEU 282 281 281 LEU LEU C . n 
C 1 283 ALA 283 282 282 ALA ALA C . n 
C 1 284 HIS 284 283 283 HIS HIS C . n 
C 1 285 PRO 285 284 284 PRO PRO C . n 
C 1 286 PHE 286 285 285 PHE PHE C . n 
C 1 287 PHE 287 286 286 PHE PHE C . n 
C 1 288 GLN 288 287 287 GLN GLN C . n 
C 1 289 ASP 289 288 288 ASP ASP C . n 
C 1 290 VAL 290 289 289 VAL VAL C . n 
C 1 291 THR 291 290 290 THR THR C . n 
C 1 292 LYS 292 291 291 LYS LYS C . n 
C 1 293 PRO 293 292 292 PRO PRO C . n 
C 1 294 VAL 294 293 293 VAL VAL C . n 
C 1 295 PRO 295 294 294 PRO PRO C . n 
C 1 296 HIS 296 295 295 HIS HIS C . n 
C 1 297 LEU 297 296 296 LEU LEU C . n 
D 2 1   VAL 1   175 175 VAL VAL D . n 
D 2 2   PRO 2   176 176 PRO PRO D . n 
D 2 3   ASP 3   177 177 ASP ASP D . n 
D 2 4   TYR 4   178 178 TYR TYR D . n 
D 2 5   HIS 5   179 179 HIS HIS D . n 
D 2 6   GLU 6   180 180 GLU GLU D . n 
D 2 7   ASP 7   181 181 ASP ASP D . n 
D 2 8   ILE 8   182 182 ILE ILE D . n 
D 2 9   HIS 9   183 183 HIS HIS D . n 
D 2 10  THR 10  184 184 THR THR D . n 
D 2 11  TYR 11  185 185 TYR TYR D . n 
D 2 12  LEU 12  186 186 LEU LEU D . n 
D 2 13  ARG 13  187 187 ARG ARG D . n 
D 2 14  GLU 14  188 188 GLU GLU D . n 
D 2 15  MET 15  189 189 MET MET D . n 
D 2 16  GLU 16  190 190 GLU GLU D . n 
D 2 17  VAL 17  191 191 VAL VAL D . n 
D 2 18  LYS 18  192 192 LYS LYS D . n 
D 2 19  CYS 19  193 193 CYS CYS D . n 
D 2 20  LYS 20  194 194 LYS LYS D . n 
D 2 21  PRO 21  195 195 PRO PRO D . n 
D 2 22  LYS 22  196 196 LYS LYS D . n 
D 2 23  VAL 23  197 197 VAL VAL D . n 
D 2 24  GLY 24  198 198 GLY GLY D . n 
D 2 25  TYR 25  199 199 TYR TYR D . n 
D 2 26  MET 26  200 200 MET MET D . n 
D 2 27  LYS 27  201 201 LYS LYS D . n 
D 2 28  LYS 28  202 202 LYS LYS D . n 
D 2 29  GLN 29  203 203 GLN GLN D . n 
D 2 30  PRO 30  204 204 PRO PRO D . n 
D 2 31  ASP 31  205 205 ASP ASP D . n 
D 2 32  ILE 32  206 206 ILE ILE D . n 
D 2 33  THR 33  207 207 THR THR D . n 
D 2 34  ASN 34  208 208 ASN ASN D . n 
D 2 35  SER 35  209 209 SER SER D . n 
D 2 36  MET 36  210 210 MET MET D . n 
D 2 37  ARG 37  211 211 ARG ARG D . n 
D 2 38  ALA 38  212 212 ALA ALA D . n 
D 2 39  ILE 39  213 213 ILE ILE D . n 
D 2 40  LEU 40  214 214 LEU LEU D . n 
D 2 41  VAL 41  215 215 VAL VAL D . n 
D 2 42  ASP 42  216 216 ASP ASP D . n 
D 2 43  TRP 43  217 217 TRP TRP D . n 
D 2 44  LEU 44  218 218 LEU LEU D . n 
D 2 45  VAL 45  219 219 VAL VAL D . n 
D 2 46  GLU 46  220 220 GLU GLU D . n 
D 2 47  VAL 47  221 221 VAL VAL D . n 
D 2 48  GLY 48  222 222 GLY GLY D . n 
D 2 49  GLU 49  223 223 GLU GLU D . n 
D 2 50  GLU 50  224 224 GLU GLU D . n 
D 2 51  TYR 51  225 225 TYR TYR D . n 
D 2 52  LYS 52  226 226 LYS LYS D . n 
D 2 53  LEU 53  227 227 LEU LEU D . n 
D 2 54  GLN 54  228 228 GLN GLN D . n 
D 2 55  ASN 55  229 229 ASN ASN D . n 
D 2 56  GLU 56  230 230 GLU GLU D . n 
D 2 57  THR 57  231 231 THR THR D . n 
D 2 58  LEU 58  232 232 LEU LEU D . n 
D 2 59  HIS 59  233 233 HIS HIS D . n 
D 2 60  LEU 60  234 234 LEU LEU D . n 
D 2 61  ALA 61  235 235 ALA ALA D . n 
D 2 62  VAL 62  236 236 VAL VAL D . n 
D 2 63  ASN 63  237 237 ASN ASN D . n 
D 2 64  TYR 64  238 238 TYR TYR D . n 
D 2 65  ILE 65  239 239 ILE ILE D . n 
D 2 66  ASP 66  240 240 ASP ASP D . n 
D 2 67  ARG 67  241 241 ARG ARG D . n 
D 2 68  PHE 68  242 242 PHE PHE D . n 
D 2 69  LEU 69  243 243 LEU LEU D . n 
D 2 70  SER 70  244 244 SER SER D . n 
D 2 71  SER 71  245 245 SER SER D . n 
D 2 72  MET 72  246 246 MET MET D . n 
D 2 73  SER 73  247 247 SER SER D . n 
D 2 74  VAL 74  248 248 VAL VAL D . n 
D 2 75  LEU 75  249 249 LEU LEU D . n 
D 2 76  ARG 76  250 250 ARG ARG D . n 
D 2 77  GLY 77  251 251 GLY GLY D . n 
D 2 78  LYS 78  252 252 LYS LYS D . n 
D 2 79  LEU 79  253 253 LEU LEU D . n 
D 2 80  GLN 80  254 254 GLN GLN D . n 
D 2 81  LEU 81  255 255 LEU LEU D . n 
D 2 82  VAL 82  256 256 VAL VAL D . n 
D 2 83  GLY 83  257 257 GLY GLY D . n 
D 2 84  THR 84  258 258 THR THR D . n 
D 2 85  ALA 85  259 259 ALA ALA D . n 
D 2 86  ALA 86  260 260 ALA ALA D . n 
D 2 87  MET 87  261 261 MET MET D . n 
D 2 88  LEU 88  262 262 LEU LEU D . n 
D 2 89  LEU 89  263 263 LEU LEU D . n 
D 2 90  ALA 90  264 264 ALA ALA D . n 
D 2 91  SER 91  265 265 SER SER D . n 
D 2 92  LYS 92  266 266 LYS LYS D . n 
D 2 93  PHE 93  267 267 PHE PHE D . n 
D 2 94  GLU 94  268 268 GLU GLU D . n 
D 2 95  GLU 95  269 269 GLU GLU D . n 
D 2 96  ILE 96  270 270 ILE ILE D . n 
D 2 97  TYR 97  271 271 TYR TYR D . n 
D 2 98  PRO 98  272 272 PRO PRO D . n 
D 2 99  PRO 99  273 273 PRO PRO D . n 
D 2 100 GLU 100 274 274 GLU GLU D . n 
D 2 101 VAL 101 275 275 VAL VAL D . n 
D 2 102 ALA 102 276 276 ALA ALA D . n 
D 2 103 GLU 103 277 277 GLU GLU D . n 
D 2 104 PHE 104 278 278 PHE PHE D . n 
D 2 105 VAL 105 279 279 VAL VAL D . n 
D 2 106 TYR 106 280 280 TYR TYR D . n 
D 2 107 ILE 107 281 281 ILE ILE D . n 
D 2 108 THR 108 282 282 THR THR D . n 
D 2 109 ASP 109 283 283 ASP ASP D . n 
D 2 110 ASP 110 284 284 ASP ASP D . n 
D 2 111 THR 111 285 285 THR THR D . n 
D 2 112 TYR 112 286 286 TYR TYR D . n 
D 2 113 THR 113 287 287 THR THR D . n 
D 2 114 LYS 114 288 288 LYS LYS D . n 
D 2 115 LYS 115 289 289 LYS LYS D . n 
D 2 116 GLN 116 290 290 GLN GLN D . n 
D 2 117 VAL 117 291 291 VAL VAL D . n 
D 2 118 LEU 118 292 292 LEU LEU D . n 
D 2 119 ARG 119 293 293 ARG ARG D . n 
D 2 120 MET 120 294 294 MET MET D . n 
D 2 121 GLU 121 295 295 GLU GLU D . n 
D 2 122 HIS 122 296 296 HIS HIS D . n 
D 2 123 LEU 123 297 297 LEU LEU D . n 
D 2 124 VAL 124 298 298 VAL VAL D . n 
D 2 125 LEU 125 299 299 LEU LEU D . n 
D 2 126 LYS 126 300 300 LYS LYS D . n 
D 2 127 VAL 127 301 301 VAL VAL D . n 
D 2 128 LEU 128 302 302 LEU LEU D . n 
D 2 129 THR 129 303 303 THR THR D . n 
D 2 130 PHE 130 304 304 PHE PHE D . n 
D 2 131 ASP 131 305 305 ASP ASP D . n 
D 2 132 LEU 132 306 306 LEU LEU D . n 
D 2 133 ALA 133 307 307 ALA ALA D . n 
D 2 134 ALA 134 308 308 ALA ALA D . n 
D 2 135 PRO 135 309 309 PRO PRO D . n 
D 2 136 THR 136 310 310 THR THR D . n 
D 2 137 VAL 137 311 311 VAL VAL D . n 
D 2 138 ASN 138 312 312 ASN ASN D . n 
D 2 139 GLN 139 313 313 GLN GLN D . n 
D 2 140 PHE 140 314 314 PHE PHE D . n 
D 2 141 LEU 141 315 315 LEU LEU D . n 
D 2 142 THR 142 316 316 THR THR D . n 
D 2 143 GLN 143 317 317 GLN GLN D . n 
D 2 144 TYR 144 318 318 TYR TYR D . n 
D 2 145 PHE 145 319 319 PHE PHE D . n 
D 2 146 LEU 146 320 320 LEU LEU D . n 
D 2 147 HIS 147 321 321 HIS HIS D . n 
D 2 148 GLN 148 322 322 GLN GLN D . n 
D 2 149 GLN 149 323 323 GLN GLN D . n 
D 2 150 PRO 150 324 324 PRO PRO D . n 
D 2 151 ALA 151 325 325 ALA ALA D . n 
D 2 152 ASN 152 326 326 ASN ASN D . n 
D 2 153 CYS 153 327 327 CYS CYS D . n 
D 2 154 LYS 154 328 328 LYS LYS D . n 
D 2 155 VAL 155 329 329 VAL VAL D . n 
D 2 156 GLU 156 330 330 GLU GLU D . n 
D 2 157 SER 157 331 331 SER SER D . n 
D 2 158 LEU 158 332 332 LEU LEU D . n 
D 2 159 ALA 159 333 333 ALA ALA D . n 
D 2 160 MET 160 334 334 MET MET D . n 
D 2 161 PHE 161 335 335 PHE PHE D . n 
D 2 162 LEU 162 336 336 LEU LEU D . n 
D 2 163 GLY 163 337 337 GLY GLY D . n 
D 2 164 GLU 164 338 338 GLU GLU D . n 
D 2 165 LEU 165 339 339 LEU LEU D . n 
D 2 166 SER 166 340 340 SER SER D . n 
D 2 167 LEU 167 341 341 LEU LEU D . n 
D 2 168 ILE 168 342 342 ILE ILE D . n 
D 2 169 ASP 169 343 343 ASP ASP D . n 
D 2 170 ALA 170 344 344 ALA ALA D . n 
D 2 171 ASP 171 345 345 ASP ASP D . n 
D 2 172 PRO 172 346 346 PRO PRO D . n 
D 2 173 TYR 173 347 347 TYR TYR D . n 
D 2 174 LEU 174 348 348 LEU LEU D . n 
D 2 175 LYS 175 349 349 LYS LYS D . n 
D 2 176 TYR 176 350 350 TYR TYR D . n 
D 2 177 LEU 177 351 351 LEU LEU D . n 
D 2 178 PRO 178 352 352 PRO PRO D . n 
D 2 179 SER 179 353 353 SER SER D . n 
D 2 180 VAL 180 354 354 VAL VAL D . n 
D 2 181 ILE 181 355 355 ILE ILE D . n 
D 2 182 ALA 182 356 356 ALA ALA D . n 
D 2 183 GLY 183 357 357 GLY GLY D . n 
D 2 184 ALA 184 358 358 ALA ALA D . n 
D 2 185 ALA 185 359 359 ALA ALA D . n 
D 2 186 PHE 186 360 360 PHE PHE D . n 
D 2 187 HIS 187 361 361 HIS HIS D . n 
D 2 188 LEU 188 362 362 LEU LEU D . n 
D 2 189 ALA 189 363 363 ALA ALA D . n 
D 2 190 LEU 190 364 364 LEU LEU D . n 
D 2 191 TYR 191 365 365 TYR TYR D . n 
D 2 192 THR 192 366 366 THR THR D . n 
D 2 193 VAL 193 367 367 VAL VAL D . n 
D 2 194 THR 194 368 368 THR THR D . n 
D 2 195 GLY 195 369 369 GLY GLY D . n 
D 2 196 GLN 196 370 370 GLN GLN D . n 
D 2 197 SER 197 371 371 SER SER D . n 
D 2 198 TRP 198 372 372 TRP TRP D . n 
D 2 199 PRO 199 373 373 PRO PRO D . n 
D 2 200 GLU 200 374 374 GLU GLU D . n 
D 2 201 SER 201 375 375 SER SER D . n 
D 2 202 LEU 202 376 376 LEU LEU D . n 
D 2 203 ILE 203 377 377 ILE ILE D . n 
D 2 204 ARG 204 378 378 ARG ARG D . n 
D 2 205 LYS 205 379 379 LYS LYS D . n 
D 2 206 THR 206 380 380 THR THR D . n 
D 2 207 GLY 207 381 381 GLY GLY D . n 
D 2 208 TYR 208 382 382 TYR TYR D . n 
D 2 209 THR 209 383 383 THR THR D . n 
D 2 210 LEU 210 384 384 LEU LEU D . n 
D 2 211 GLU 211 385 385 GLU GLU D . n 
D 2 212 SER 212 386 386 SER SER D . n 
D 2 213 LEU 213 387 387 LEU LEU D . n 
D 2 214 LYS 214 388 388 LYS LYS D . n 
D 2 215 PRO 215 389 389 PRO PRO D . n 
D 2 216 CYS 216 390 390 CYS CYS D . n 
D 2 217 LEU 217 391 391 LEU LEU D . n 
D 2 218 MET 218 392 392 MET MET D . n 
D 2 219 ASP 219 393 393 ASP ASP D . n 
D 2 220 LEU 220 394 394 LEU LEU D . n 
D 2 221 HIS 221 395 395 HIS HIS D . n 
D 2 222 GLN 222 396 396 GLN GLN D . n 
D 2 223 THR 223 397 397 THR THR D . n 
D 2 224 TYR 224 398 398 TYR TYR D . n 
D 2 225 LEU 225 399 399 LEU LEU D . n 
D 2 226 LYS 226 400 400 LYS LYS D . n 
D 2 227 ALA 227 401 401 ALA ALA D . n 
D 2 228 PRO 228 402 402 PRO PRO D . n 
D 2 229 GLN 229 403 403 GLN GLN D . n 
D 2 230 HIS 230 404 404 HIS HIS D . n 
D 2 231 ALA 231 405 405 ALA ALA D . n 
D 2 232 GLN 232 406 406 GLN GLN D . n 
D 2 233 GLN 233 407 407 GLN GLN D . n 
D 2 234 SER 234 408 408 SER SER D . n 
D 2 235 ILE 235 409 409 ILE ILE D . n 
D 2 236 ARG 236 410 410 ARG ARG D . n 
D 2 237 GLU 237 411 411 GLU GLU D . n 
D 2 238 LYS 238 412 412 LYS LYS D . n 
D 2 239 TYR 239 413 413 TYR TYR D . n 
D 2 240 LYS 240 414 414 LYS LYS D . n 
D 2 241 ASN 241 415 415 ASN ASN D . n 
D 2 242 SER 242 416 416 SER SER D . n 
D 2 243 LYS 243 417 417 LYS LYS D . n 
D 2 244 TYR 244 418 418 TYR TYR D . n 
D 2 245 HIS 245 419 419 HIS HIS D . n 
D 2 246 GLY 246 420 420 GLY GLY D . n 
D 2 247 VAL 247 421 421 VAL VAL D . n 
D 2 248 SER 248 422 422 SER SER D . n 
D 2 249 LEU 249 423 423 LEU LEU D . n 
D 2 250 LEU 250 424 424 LEU LEU D . n 
D 2 251 ASN 251 425 425 ASN ASN D . n 
D 2 252 PRO 252 426 426 PRO PRO D . n 
D 2 253 PRO 253 427 427 PRO PRO D . n 
D 2 254 GLU 254 428 428 GLU GLU D . n 
D 2 255 THR 255 429 429 THR THR D . n 
D 2 256 LEU 256 430 430 LEU LEU D . n 
D 2 257 ASN 257 431 431 ASN ASN D . n 
D 2 258 LEU 258 432 432 LEU LEU D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 UCN 1   410 410 UCN STH A . 
F 3 UCN 1   411 410 UCN STH C . 
G 4 HOH 1   411 1   HOH HOH A . 
G 4 HOH 2   412 2   HOH HOH A . 
G 4 HOH 3   413 4   HOH HOH A . 
G 4 HOH 4   414 5   HOH HOH A . 
G 4 HOH 5   415 7   HOH HOH A . 
G 4 HOH 6   416 9   HOH HOH A . 
G 4 HOH 7   417 10  HOH HOH A . 
G 4 HOH 8   418 13  HOH HOH A . 
G 4 HOH 9   419 15  HOH HOH A . 
G 4 HOH 10  420 19  HOH HOH A . 
G 4 HOH 11  421 20  HOH HOH A . 
G 4 HOH 12  422 21  HOH HOH A . 
G 4 HOH 13  423 24  HOH HOH A . 
G 4 HOH 14  424 25  HOH HOH A . 
G 4 HOH 15  425 28  HOH HOH A . 
G 4 HOH 16  426 31  HOH HOH A . 
G 4 HOH 17  427 32  HOH HOH A . 
G 4 HOH 18  428 34  HOH HOH A . 
G 4 HOH 19  429 35  HOH HOH A . 
G 4 HOH 20  430 37  HOH HOH A . 
G 4 HOH 21  431 40  HOH HOH A . 
G 4 HOH 22  432 41  HOH HOH A . 
G 4 HOH 23  433 45  HOH HOH A . 
G 4 HOH 24  434 46  HOH HOH A . 
G 4 HOH 25  435 48  HOH HOH A . 
G 4 HOH 26  436 49  HOH HOH A . 
G 4 HOH 27  437 54  HOH HOH A . 
G 4 HOH 28  438 60  HOH HOH A . 
G 4 HOH 29  439 63  HOH HOH A . 
G 4 HOH 30  440 64  HOH HOH A . 
G 4 HOH 31  441 69  HOH HOH A . 
G 4 HOH 32  442 70  HOH HOH A . 
G 4 HOH 33  443 72  HOH HOH A . 
G 4 HOH 34  444 75  HOH HOH A . 
G 4 HOH 35  445 76  HOH HOH A . 
G 4 HOH 36  446 77  HOH HOH A . 
G 4 HOH 37  447 78  HOH HOH A . 
G 4 HOH 38  448 80  HOH HOH A . 
G 4 HOH 39  449 85  HOH HOH A . 
G 4 HOH 40  450 88  HOH HOH A . 
G 4 HOH 41  451 90  HOH HOH A . 
G 4 HOH 42  452 92  HOH HOH A . 
G 4 HOH 43  453 94  HOH HOH A . 
G 4 HOH 44  454 96  HOH HOH A . 
G 4 HOH 45  455 98  HOH HOH A . 
G 4 HOH 46  456 99  HOH HOH A . 
G 4 HOH 47  457 100 HOH HOH A . 
G 4 HOH 48  458 101 HOH HOH A . 
G 4 HOH 49  459 106 HOH HOH A . 
G 4 HOH 50  460 109 HOH HOH A . 
G 4 HOH 51  461 110 HOH HOH A . 
G 4 HOH 52  462 111 HOH HOH A . 
G 4 HOH 53  463 113 HOH HOH A . 
G 4 HOH 54  464 116 HOH HOH A . 
G 4 HOH 55  465 117 HOH HOH A . 
G 4 HOH 56  466 118 HOH HOH A . 
G 4 HOH 57  467 122 HOH HOH A . 
G 4 HOH 58  468 136 HOH HOH A . 
G 4 HOH 59  469 137 HOH HOH A . 
G 4 HOH 60  470 139 HOH HOH A . 
G 4 HOH 61  471 142 HOH HOH A . 
G 4 HOH 62  472 143 HOH HOH A . 
G 4 HOH 63  473 146 HOH HOH A . 
G 4 HOH 64  474 150 HOH HOH A . 
G 4 HOH 65  475 153 HOH HOH A . 
G 4 HOH 66  476 154 HOH HOH A . 
G 4 HOH 67  477 156 HOH HOH A . 
G 4 HOH 68  478 160 HOH HOH A . 
G 4 HOH 69  479 162 HOH HOH A . 
G 4 HOH 70  480 165 HOH HOH A . 
G 4 HOH 71  481 166 HOH HOH A . 
G 4 HOH 72  482 167 HOH HOH A . 
G 4 HOH 73  483 169 HOH HOH A . 
G 4 HOH 74  484 171 HOH HOH A . 
G 4 HOH 75  485 177 HOH HOH A . 
G 4 HOH 76  486 180 HOH HOH A . 
G 4 HOH 77  487 183 HOH HOH A . 
G 4 HOH 78  488 188 HOH HOH A . 
G 4 HOH 79  489 195 HOH HOH A . 
G 4 HOH 80  490 204 HOH HOH A . 
G 4 HOH 81  491 206 HOH HOH A . 
G 4 HOH 82  492 211 HOH HOH A . 
G 4 HOH 83  493 212 HOH HOH A . 
G 4 HOH 84  494 215 HOH HOH A . 
G 4 HOH 85  495 216 HOH HOH A . 
G 4 HOH 86  496 218 HOH HOH A . 
G 4 HOH 87  497 219 HOH HOH A . 
G 4 HOH 88  498 225 HOH HOH A . 
G 4 HOH 89  499 227 HOH HOH A . 
G 4 HOH 90  500 228 HOH HOH A . 
G 4 HOH 91  501 239 HOH HOH A . 
G 4 HOH 92  502 245 HOH HOH A . 
G 4 HOH 93  503 246 HOH HOH A . 
G 4 HOH 94  504 248 HOH HOH A . 
G 4 HOH 95  505 250 HOH HOH A . 
G 4 HOH 96  506 251 HOH HOH A . 
G 4 HOH 97  507 254 HOH HOH A . 
G 4 HOH 98  508 256 HOH HOH A . 
G 4 HOH 99  509 259 HOH HOH A . 
G 4 HOH 100 510 261 HOH HOH A . 
G 4 HOH 101 511 265 HOH HOH A . 
G 4 HOH 102 512 274 HOH HOH A . 
G 4 HOH 103 513 276 HOH HOH A . 
G 4 HOH 104 514 283 HOH HOH A . 
G 4 HOH 105 515 286 HOH HOH A . 
G 4 HOH 106 516 287 HOH HOH A . 
G 4 HOH 107 517 288 HOH HOH A . 
G 4 HOH 108 518 290 HOH HOH A . 
G 4 HOH 109 519 291 HOH HOH A . 
G 4 HOH 110 520 292 HOH HOH A . 
G 4 HOH 111 521 294 HOH HOH A . 
G 4 HOH 112 522 300 HOH HOH A . 
G 4 HOH 113 523 301 HOH HOH A . 
G 4 HOH 114 524 303 HOH HOH A . 
G 4 HOH 115 525 305 HOH HOH A . 
G 4 HOH 116 526 308 HOH HOH A . 
G 4 HOH 117 527 311 HOH HOH A . 
G 4 HOH 118 528 312 HOH HOH A . 
G 4 HOH 119 529 317 HOH HOH A . 
G 4 HOH 120 530 318 HOH HOH A . 
G 4 HOH 121 531 319 HOH HOH A . 
G 4 HOH 122 532 320 HOH HOH A . 
G 4 HOH 123 533 323 HOH HOH A . 
G 4 HOH 124 534 326 HOH HOH A . 
G 4 HOH 125 535 331 HOH HOH A . 
G 4 HOH 126 536 335 HOH HOH A . 
G 4 HOH 127 537 338 HOH HOH A . 
G 4 HOH 128 538 341 HOH HOH A . 
G 4 HOH 129 539 343 HOH HOH A . 
G 4 HOH 130 540 346 HOH HOH A . 
G 4 HOH 131 541 348 HOH HOH A . 
G 4 HOH 132 542 358 HOH HOH A . 
G 4 HOH 133 543 361 HOH HOH A . 
G 4 HOH 134 544 364 HOH HOH A . 
G 4 HOH 135 545 369 HOH HOH A . 
G 4 HOH 136 546 370 HOH HOH A . 
G 4 HOH 137 547 371 HOH HOH A . 
G 4 HOH 138 548 372 HOH HOH A . 
G 4 HOH 139 549 373 HOH HOH A . 
G 4 HOH 140 550 378 HOH HOH A . 
G 4 HOH 141 551 381 HOH HOH A . 
G 4 HOH 142 552 386 HOH HOH A . 
G 4 HOH 143 553 389 HOH HOH A . 
G 4 HOH 144 554 395 HOH HOH A . 
G 4 HOH 145 555 396 HOH HOH A . 
G 4 HOH 146 556 403 HOH HOH A . 
H 4 HOH 1   433 3   HOH HOH B . 
H 4 HOH 2   434 8   HOH HOH B . 
H 4 HOH 3   435 11  HOH HOH B . 
H 4 HOH 4   436 12  HOH HOH B . 
H 4 HOH 5   437 22  HOH HOH B . 
H 4 HOH 6   438 26  HOH HOH B . 
H 4 HOH 7   439 29  HOH HOH B . 
H 4 HOH 8   440 30  HOH HOH B . 
H 4 HOH 9   441 36  HOH HOH B . 
H 4 HOH 10  442 39  HOH HOH B . 
H 4 HOH 11  443 42  HOH HOH B . 
H 4 HOH 12  444 50  HOH HOH B . 
H 4 HOH 13  445 51  HOH HOH B . 
H 4 HOH 14  446 52  HOH HOH B . 
H 4 HOH 15  447 53  HOH HOH B . 
H 4 HOH 16  448 56  HOH HOH B . 
H 4 HOH 17  449 57  HOH HOH B . 
H 4 HOH 18  450 58  HOH HOH B . 
H 4 HOH 19  451 62  HOH HOH B . 
H 4 HOH 20  452 68  HOH HOH B . 
H 4 HOH 21  453 71  HOH HOH B . 
H 4 HOH 22  454 73  HOH HOH B . 
H 4 HOH 23  455 79  HOH HOH B . 
H 4 HOH 24  456 89  HOH HOH B . 
H 4 HOH 25  457 91  HOH HOH B . 
H 4 HOH 26  458 95  HOH HOH B . 
H 4 HOH 27  459 97  HOH HOH B . 
H 4 HOH 28  460 105 HOH HOH B . 
H 4 HOH 29  461 112 HOH HOH B . 
H 4 HOH 30  462 115 HOH HOH B . 
H 4 HOH 31  463 120 HOH HOH B . 
H 4 HOH 32  464 121 HOH HOH B . 
H 4 HOH 33  465 123 HOH HOH B . 
H 4 HOH 34  466 124 HOH HOH B . 
H 4 HOH 35  467 125 HOH HOH B . 
H 4 HOH 36  468 126 HOH HOH B . 
H 4 HOH 37  469 127 HOH HOH B . 
H 4 HOH 38  470 128 HOH HOH B . 
H 4 HOH 39  471 130 HOH HOH B . 
H 4 HOH 40  472 131 HOH HOH B . 
H 4 HOH 41  473 132 HOH HOH B . 
H 4 HOH 42  474 134 HOH HOH B . 
H 4 HOH 43  475 135 HOH HOH B . 
H 4 HOH 44  476 140 HOH HOH B . 
H 4 HOH 45  477 145 HOH HOH B . 
H 4 HOH 46  478 147 HOH HOH B . 
H 4 HOH 47  479 158 HOH HOH B . 
H 4 HOH 48  480 159 HOH HOH B . 
H 4 HOH 49  481 168 HOH HOH B . 
H 4 HOH 50  482 173 HOH HOH B . 
H 4 HOH 51  483 175 HOH HOH B . 
H 4 HOH 52  484 176 HOH HOH B . 
H 4 HOH 53  485 181 HOH HOH B . 
H 4 HOH 54  486 184 HOH HOH B . 
H 4 HOH 55  487 186 HOH HOH B . 
H 4 HOH 56  488 187 HOH HOH B . 
H 4 HOH 57  489 190 HOH HOH B . 
H 4 HOH 58  490 192 HOH HOH B . 
H 4 HOH 59  491 194 HOH HOH B . 
H 4 HOH 60  492 197 HOH HOH B . 
H 4 HOH 61  493 201 HOH HOH B . 
H 4 HOH 62  494 210 HOH HOH B . 
H 4 HOH 63  495 213 HOH HOH B . 
H 4 HOH 64  496 224 HOH HOH B . 
H 4 HOH 65  497 232 HOH HOH B . 
H 4 HOH 66  498 233 HOH HOH B . 
H 4 HOH 67  499 237 HOH HOH B . 
H 4 HOH 68  500 238 HOH HOH B . 
H 4 HOH 69  501 241 HOH HOH B . 
H 4 HOH 70  502 249 HOH HOH B . 
H 4 HOH 71  503 252 HOH HOH B . 
H 4 HOH 72  504 257 HOH HOH B . 
H 4 HOH 73  505 263 HOH HOH B . 
H 4 HOH 74  506 264 HOH HOH B . 
H 4 HOH 75  507 266 HOH HOH B . 
H 4 HOH 76  508 267 HOH HOH B . 
H 4 HOH 77  509 268 HOH HOH B . 
H 4 HOH 78  510 269 HOH HOH B . 
H 4 HOH 79  511 271 HOH HOH B . 
H 4 HOH 80  512 272 HOH HOH B . 
H 4 HOH 81  513 279 HOH HOH B . 
H 4 HOH 82  514 284 HOH HOH B . 
H 4 HOH 83  515 289 HOH HOH B . 
H 4 HOH 84  516 296 HOH HOH B . 
H 4 HOH 85  517 297 HOH HOH B . 
H 4 HOH 86  518 310 HOH HOH B . 
H 4 HOH 87  519 313 HOH HOH B . 
H 4 HOH 88  520 315 HOH HOH B . 
H 4 HOH 89  521 316 HOH HOH B . 
H 4 HOH 90  522 322 HOH HOH B . 
H 4 HOH 91  523 325 HOH HOH B . 
H 4 HOH 92  524 330 HOH HOH B . 
H 4 HOH 93  525 334 HOH HOH B . 
H 4 HOH 94  526 337 HOH HOH B . 
H 4 HOH 95  527 340 HOH HOH B . 
H 4 HOH 96  528 342 HOH HOH B . 
H 4 HOH 97  529 345 HOH HOH B . 
H 4 HOH 98  530 347 HOH HOH B . 
H 4 HOH 99  531 349 HOH HOH B . 
H 4 HOH 100 532 350 HOH HOH B . 
H 4 HOH 101 533 351 HOH HOH B . 
H 4 HOH 102 534 356 HOH HOH B . 
H 4 HOH 103 535 359 HOH HOH B . 
H 4 HOH 104 536 365 HOH HOH B . 
H 4 HOH 105 537 368 HOH HOH B . 
H 4 HOH 106 538 374 HOH HOH B . 
H 4 HOH 107 539 375 HOH HOH B . 
H 4 HOH 108 540 394 HOH HOH B . 
H 4 HOH 109 541 397 HOH HOH B . 
H 4 HOH 110 542 399 HOH HOH B . 
I 4 HOH 1   412 6   HOH HOH C . 
I 4 HOH 2   413 14  HOH HOH C . 
I 4 HOH 3   414 27  HOH HOH C . 
I 4 HOH 4   415 33  HOH HOH C . 
I 4 HOH 5   416 38  HOH HOH C . 
I 4 HOH 6   417 44  HOH HOH C . 
I 4 HOH 7   418 47  HOH HOH C . 
I 4 HOH 8   419 55  HOH HOH C . 
I 4 HOH 9   420 65  HOH HOH C . 
I 4 HOH 10  421 66  HOH HOH C . 
I 4 HOH 11  422 74  HOH HOH C . 
I 4 HOH 12  423 82  HOH HOH C . 
I 4 HOH 13  424 83  HOH HOH C . 
I 4 HOH 14  425 84  HOH HOH C . 
I 4 HOH 15  426 86  HOH HOH C . 
I 4 HOH 16  427 87  HOH HOH C . 
I 4 HOH 17  428 107 HOH HOH C . 
I 4 HOH 18  429 108 HOH HOH C . 
I 4 HOH 19  430 129 HOH HOH C . 
I 4 HOH 20  431 138 HOH HOH C . 
I 4 HOH 21  432 144 HOH HOH C . 
I 4 HOH 22  433 148 HOH HOH C . 
I 4 HOH 23  434 149 HOH HOH C . 
I 4 HOH 24  435 152 HOH HOH C . 
I 4 HOH 25  436 155 HOH HOH C . 
I 4 HOH 26  437 157 HOH HOH C . 
I 4 HOH 27  438 161 HOH HOH C . 
I 4 HOH 28  439 163 HOH HOH C . 
I 4 HOH 29  440 164 HOH HOH C . 
I 4 HOH 30  441 170 HOH HOH C . 
I 4 HOH 31  442 174 HOH HOH C . 
I 4 HOH 32  443 185 HOH HOH C . 
I 4 HOH 33  444 199 HOH HOH C . 
I 4 HOH 34  445 200 HOH HOH C . 
I 4 HOH 35  446 203 HOH HOH C . 
I 4 HOH 36  447 207 HOH HOH C . 
I 4 HOH 37  448 209 HOH HOH C . 
I 4 HOH 38  449 214 HOH HOH C . 
I 4 HOH 39  450 217 HOH HOH C . 
I 4 HOH 40  451 220 HOH HOH C . 
I 4 HOH 41  452 221 HOH HOH C . 
I 4 HOH 42  453 229 HOH HOH C . 
I 4 HOH 43  454 230 HOH HOH C . 
I 4 HOH 44  455 231 HOH HOH C . 
I 4 HOH 45  456 234 HOH HOH C . 
I 4 HOH 46  457 235 HOH HOH C . 
I 4 HOH 47  458 240 HOH HOH C . 
I 4 HOH 48  459 242 HOH HOH C . 
I 4 HOH 49  460 243 HOH HOH C . 
I 4 HOH 50  461 253 HOH HOH C . 
I 4 HOH 51  462 255 HOH HOH C . 
I 4 HOH 52  463 258 HOH HOH C . 
I 4 HOH 53  464 280 HOH HOH C . 
I 4 HOH 54  465 282 HOH HOH C . 
I 4 HOH 55  466 285 HOH HOH C . 
I 4 HOH 56  467 293 HOH HOH C . 
I 4 HOH 57  468 298 HOH HOH C . 
I 4 HOH 58  469 299 HOH HOH C . 
I 4 HOH 59  470 307 HOH HOH C . 
I 4 HOH 60  471 309 HOH HOH C . 
I 4 HOH 61  472 314 HOH HOH C . 
I 4 HOH 62  473 321 HOH HOH C . 
I 4 HOH 63  474 328 HOH HOH C . 
I 4 HOH 64  475 329 HOH HOH C . 
I 4 HOH 65  476 333 HOH HOH C . 
I 4 HOH 66  477 344 HOH HOH C . 
I 4 HOH 67  478 353 HOH HOH C . 
I 4 HOH 68  479 355 HOH HOH C . 
I 4 HOH 69  480 360 HOH HOH C . 
I 4 HOH 70  481 362 HOH HOH C . 
I 4 HOH 71  482 363 HOH HOH C . 
I 4 HOH 72  483 366 HOH HOH C . 
I 4 HOH 73  484 367 HOH HOH C . 
I 4 HOH 74  485 376 HOH HOH C . 
I 4 HOH 75  486 379 HOH HOH C . 
I 4 HOH 76  487 385 HOH HOH C . 
I 4 HOH 77  488 387 HOH HOH C . 
I 4 HOH 78  489 388 HOH HOH C . 
I 4 HOH 79  490 390 HOH HOH C . 
I 4 HOH 80  491 391 HOH HOH C . 
I 4 HOH 81  492 398 HOH HOH C . 
I 4 HOH 82  493 400 HOH HOH C . 
I 4 HOH 83  494 401 HOH HOH C . 
I 4 HOH 84  495 402 HOH HOH C . 
I 4 HOH 85  496 404 HOH HOH C . 
I 4 HOH 86  497 405 HOH HOH C . 
I 4 HOH 87  498 406 HOH HOH C . 
J 4 HOH 1   433 16  HOH HOH D . 
J 4 HOH 2   434 17  HOH HOH D . 
J 4 HOH 3   435 18  HOH HOH D . 
J 4 HOH 4   436 23  HOH HOH D . 
J 4 HOH 5   437 43  HOH HOH D . 
J 4 HOH 6   438 59  HOH HOH D . 
J 4 HOH 7   439 61  HOH HOH D . 
J 4 HOH 8   440 67  HOH HOH D . 
J 4 HOH 9   441 81  HOH HOH D . 
J 4 HOH 10  442 93  HOH HOH D . 
J 4 HOH 11  443 102 HOH HOH D . 
J 4 HOH 12  444 103 HOH HOH D . 
J 4 HOH 13  445 104 HOH HOH D . 
J 4 HOH 14  446 114 HOH HOH D . 
J 4 HOH 15  447 119 HOH HOH D . 
J 4 HOH 16  448 133 HOH HOH D . 
J 4 HOH 17  449 141 HOH HOH D . 
J 4 HOH 18  450 151 HOH HOH D . 
J 4 HOH 19  451 172 HOH HOH D . 
J 4 HOH 20  452 178 HOH HOH D . 
J 4 HOH 21  453 179 HOH HOH D . 
J 4 HOH 22  454 182 HOH HOH D . 
J 4 HOH 23  455 191 HOH HOH D . 
J 4 HOH 24  456 193 HOH HOH D . 
J 4 HOH 25  457 196 HOH HOH D . 
J 4 HOH 26  458 198 HOH HOH D . 
J 4 HOH 27  459 202 HOH HOH D . 
J 4 HOH 28  460 205 HOH HOH D . 
J 4 HOH 29  461 208 HOH HOH D . 
J 4 HOH 30  462 222 HOH HOH D . 
J 4 HOH 31  463 223 HOH HOH D . 
J 4 HOH 32  464 226 HOH HOH D . 
J 4 HOH 33  465 236 HOH HOH D . 
J 4 HOH 34  466 244 HOH HOH D . 
J 4 HOH 35  467 247 HOH HOH D . 
J 4 HOH 36  468 260 HOH HOH D . 
J 4 HOH 37  469 262 HOH HOH D . 
J 4 HOH 38  470 270 HOH HOH D . 
J 4 HOH 39  471 273 HOH HOH D . 
J 4 HOH 40  472 275 HOH HOH D . 
J 4 HOH 41  473 278 HOH HOH D . 
J 4 HOH 42  474 281 HOH HOH D . 
J 4 HOH 43  475 295 HOH HOH D . 
J 4 HOH 44  476 302 HOH HOH D . 
J 4 HOH 45  477 304 HOH HOH D . 
J 4 HOH 46  478 306 HOH HOH D . 
J 4 HOH 47  479 324 HOH HOH D . 
J 4 HOH 48  480 327 HOH HOH D . 
J 4 HOH 49  481 336 HOH HOH D . 
J 4 HOH 50  482 339 HOH HOH D . 
J 4 HOH 51  483 352 HOH HOH D . 
J 4 HOH 52  484 354 HOH HOH D . 
J 4 HOH 53  485 357 HOH HOH D . 
J 4 HOH 54  486 377 HOH HOH D . 
J 4 HOH 55  487 380 HOH HOH D . 
J 4 HOH 56  488 382 HOH HOH D . 
J 4 HOH 57  489 383 HOH HOH D . 
J 4 HOH 58  490 392 HOH HOH D . 
J 4 HOH 59  491 393 HOH HOH D . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A TPO 161 A TPO 160 ? THR PHOSPHOTHREONINE 
2 C TPO 161 C TPO 160 ? THR PHOSPHOTHREONINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,G,H 
2 1 C,D,F,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4200  ? 
1 MORE         -19   ? 
1 'SSA (A^2)'  23180 ? 
2 'ABSA (A^2)' 4340  ? 
2 MORE         -19   ? 
2 'SSA (A^2)'  23240 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-06-24 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-01-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            citation_author 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_citation_author.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.1.19    ? 1 
MOSFLM 'data reduction' .         ? 2 
CCP4   'data scaling'   '(SCALA)' ? 3 
MOLREP phasing          .         ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 CD A PRO 155 ? ? O A HOH 424 ? ? 1.90 
2 1 O  C HIS 71  ? ? O C LYS 75  ? ? 2.05 
3 1 O  B VAL 175 ? ? N B TYR 178 ? ? 2.10 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 256 ? ? CG A ASP 256 ? ? OD2 A ASP 256 ? ? 123.78 118.30 5.48 0.90 N 
2 1 CB B ASP 177 ? ? CG B ASP 177 ? ? OD2 B ASP 177 ? ? 124.10 118.30 5.80 0.90 N 
3 1 CB C ASP 256 ? ? CG C ASP 256 ? ? OD2 C ASP 256 ? ? 124.68 118.30 6.38 0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 40  ? ? -88.99  44.28   
2  1 THR A 41  ? ? -152.40 -99.86  
3  1 LEU A 58  ? ? -101.93 75.24   
4  1 THR A 72  ? ? 164.58  144.13  
5  1 ASP A 127 ? ? -161.93 43.29   
6  1 ASP A 145 ? ? 54.30   84.10   
7  1 VAL A 164 ? ? 78.94   132.36  
8  1 SER A 181 ? ? -144.92 -150.43 
9  1 TRP A 227 ? ? -150.43 84.91   
10 1 LYS A 291 ? ? -106.98 76.35   
11 1 PRO A 294 ? ? -43.33  -151.24 
12 1 PRO B 176 ? ? -51.16  -7.18   
13 1 ASP B 283 ? ? 21.41   64.87   
14 1 ASP B 284 ? ? 54.66   16.08   
15 1 ASP B 345 ? ? -45.83  -72.22  
16 1 TRP B 372 ? ? -23.97  111.14  
17 1 GLU C 8   ? ? 178.71  150.18  
18 1 ASP C 38  ? ? -106.04 -88.95  
19 1 THR C 39  ? ? 79.97   -11.83  
20 1 THR C 41  ? ? -124.14 -93.37  
21 1 LEU C 58  ? ? -108.99 70.82   
22 1 HIS C 71  ? ? -81.40  -78.54  
23 1 THR C 72  ? ? 65.43   145.45  
24 1 ILE C 99  ? ? 68.06   105.05  
25 1 ASP C 127 ? ? -157.36 43.17   
26 1 ASP C 145 ? ? 57.28   84.68   
27 1 VAL C 154 ? ? -63.27  -74.61  
28 1 ARG C 157 ? ? -114.98 -169.52 
29 1 GLU C 162 ? ? -69.26  73.74   
30 1 VAL C 164 ? ? 67.64   128.70  
31 1 SER C 181 ? ? -140.83 -139.90 
32 1 THR C 221 ? ? -28.81  121.49  
33 1 PRO C 228 ? ? -56.73  103.69  
34 1 THR C 290 ? ? -113.90 -169.32 
35 1 PRO D 176 ? ? -56.56  -2.21   
36 1 ASP D 345 ? ? -44.75  -74.42  
37 1 TRP D 372 ? ? -23.91  97.29   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 7-HYDROXYSTAUROSPORINE UCN 
4 water                  HOH 
#