data_1POZ
# 
_entry.id   1POZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1POZ         
RCSB  RCSB019467   
WWPDB D_1000019467 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1o7b 'Link module of the human TSG-6'                                                         unspecified 
PDB 1o7c 'Conformation of the bound Link module of the human TSG-6 to a hyaluronic acid octamer.' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1POZ 
_pdbx_database_status.recvd_initial_deposition_date   2003-06-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Teriete, P.'    1 
'Banerji, S.'    2 
'Blundell, C.D.' 3 
'Kahmann, J.D.'  4 
'Pickford, A.R.' 5 
'Wright, A.J.'   6 
'Campbell, I.D.' 7 
'Jackson, D.G.'  8 
'Day, A.J.'      9 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure of the Regulatory Hyaluronan Binding Domain in the Inflammatory Leukocyte Homing Receptor CD44.' Mol.Cell 13  
483  496  2004 MOCEFL US 1097-2765 2168 ? 14992719 '10.1016/S1097-2765(04)00080-2' 
1       'A lymphocyte molecule implicated in lymph node homing is a member of the cartilage link protein family.' 
'Cell(Cambridge,Mass.)' 56  1057 1062 1989 CELLB5 US 0092-8674 0998 ? ?        '10.1016/0092-8674(89)90638-7'  
2       'A human lymphocyte homing receptor, the hermes antigen, is related to cartilage proteoglycan core and link proteins.' 
'Cell(Cambridge,Mass.)' 56  1063 1072 1989 CELLB5 US 0092-8674 0998 ? ?        '10.1016/0092-8674(89)90639-9'  
3       'CD44 is the principal cell surface receptor for hyaluronate.' 'Cell(Cambridge,Mass.)' 61  1303 1313 1990 CELLB5 US 
0092-8674 0998 ? ?        '10.1016/0092-8674(90)90694-A'  
4       'Identification of hyaluronic acid binding sites in the extracellular domain of CD44.' 'J.Cell Biol.'          122 257  
264  1993 JCLBA3 US 0021-9525 2019 ? ?        10.1083/jcb.122.1.257           
5       
;Solution Structure of the Link Module: A Hyaluronan-Binding Domain Involved in Extracellular Matrix 
Stability and Cell Migration
;
'Cell(Cambridge,Mass.)' 86  767  775  1996 CELLB5 US 0092-8674 0998 ? ?        '10.1016/S0092-8674(00)80151-8' 
6       'Identification of CD44 residues important for hyaluronan binding and delineation of the binding site' J.Biol.Chem. 273 
338  343  1998 JBCHA3 US 0021-9258 0071 ? ?        10.1074/jbc.273.1.338           
7       
;Site-specific de-N-glycosylation of CD44 can activate hyaluronan binding, and CD44 activation states show distinct threshold densities for hyaluronan binding
;
'Cancer Res.'           58  3736 3742 1998 CNREA8 US 0008-5472 0400 ? ?        ?                               
8       'Characterization of a functional hyaluronan-binding domain from the human CD44 molecule expressed in Escherichia coli' 
'Protein Expr.Purif.'   14  371  381  1998 PEXPEJ US 1046-5928 0757 ? ?        10.1006/prep.1998.0971          
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Teriete, P.'     1  
primary 'Banerji, S.'     2  
primary 'Noble, M.'       3  
primary 'Blundell, C.D.'  4  
primary 'Wright, A.J.'    5  
primary 'Pickford, A.R.'  6  
primary 'Lowe, E.'        7  
primary 'Mahoney, D.J.'   8  
primary 'Tammi, M.I.'     9  
primary 'Kahmann, J.D.'   10 
primary 'Campbell, I.D.'  11 
primary 'Day, A.J.'       12 
primary 'Jackson, D.G.'   13 
1       'Stamenkovic, I.' 14 
1       'Amiot, M.'       15 
1       'Pesando, J.M.'   16 
1       'Seed, B.'        17 
2       'A Goldstien, L.' 18 
2       'Zhou, D.F.H.'    19 
2       'Picker, L.J.'    20 
2       'Minty, C.N.'     21 
2       'Bargatze, R.F.'  22 
2       'Din, J.F.'       23 
2       'Butcher, E.C.'   24 
3       'Aruffo, A.'      25 
3       'Stamenkovic, I.' 26 
3       'Melnick, M.'     27 
3       'Underhill, C.B.' 28 
3       'Seed, B.'        29 
4       'Peach, R.J.'     30 
4       'Hollenbaugh, D.' 31 
4       'Stamenkovic, I.' 32 
4       'Aruffo, A.'      33 
5       'Kohda, D.'       34 
5       'Morton, C.J.'    35 
5       'Parkar, A.A.'    36 
5       'Hatanaka, H.'    37 
5       'Inagaki, F.M.'   38 
5       'Campbell, I.D.'  39 
5       'Day, A.J.'       40 
6       'Bajorath, J.'    41 
6       'Greenfield, B.'  42 
6       'Munro, S.B.'     43 
6       'Day, A.J.'       44 
6       'Aruffo, A.'      45 
7       'English, N.M.'   46 
7       'Lesley, J.F.'    47 
7       'Hyman, R.'       48 
8       'Banerji, S.'     49 
8       'Day, A.J.'       50 
8       'Kahmann, J.D.'   51 
8       'Jackson, D.G.'   52 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'CD44 antigen' 
_entity.formula_weight             17601.486 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'HYALURONAN BINDING DOMAIN' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Phagocytic glycoprotein I, PGP-1, HUTCH-I, Extracellular matrix receptor-III, ECMR-III, GP90 lymphocyte homing/adhesion receptor, Hermes antigen, Hyaluronate receptor, Heparan sulfate proteoglycan, Epican, CDw44
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAA
NNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAA
NNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   GLN n 
1 3   ILE n 
1 4   ASP n 
1 5   LEU n 
1 6   ASN n 
1 7   ILE n 
1 8   THR n 
1 9   CYS n 
1 10  ARG n 
1 11  PHE n 
1 12  ALA n 
1 13  GLY n 
1 14  VAL n 
1 15  PHE n 
1 16  HIS n 
1 17  VAL n 
1 18  GLU n 
1 19  LYS n 
1 20  ASN n 
1 21  GLY n 
1 22  ARG n 
1 23  TYR n 
1 24  SER n 
1 25  ILE n 
1 26  SER n 
1 27  ARG n 
1 28  THR n 
1 29  GLU n 
1 30  ALA n 
1 31  ALA n 
1 32  ASP n 
1 33  LEU n 
1 34  CYS n 
1 35  LYS n 
1 36  ALA n 
1 37  PHE n 
1 38  ASN n 
1 39  SER n 
1 40  THR n 
1 41  LEU n 
1 42  PRO n 
1 43  THR n 
1 44  MET n 
1 45  ALA n 
1 46  GLN n 
1 47  MET n 
1 48  GLU n 
1 49  LYS n 
1 50  ALA n 
1 51  LEU n 
1 52  SER n 
1 53  ILE n 
1 54  GLY n 
1 55  PHE n 
1 56  GLU n 
1 57  THR n 
1 58  CYS n 
1 59  ARG n 
1 60  TYR n 
1 61  GLY n 
1 62  PHE n 
1 63  ILE n 
1 64  GLU n 
1 65  GLY n 
1 66  HIS n 
1 67  VAL n 
1 68  VAL n 
1 69  ILE n 
1 70  PRO n 
1 71  ARG n 
1 72  ILE n 
1 73  HIS n 
1 74  PRO n 
1 75  ASN n 
1 76  SER n 
1 77  ILE n 
1 78  CYS n 
1 79  ALA n 
1 80  ALA n 
1 81  ASN n 
1 82  ASN n 
1 83  THR n 
1 84  GLY n 
1 85  VAL n 
1 86  TYR n 
1 87  ILE n 
1 88  LEU n 
1 89  THR n 
1 90  SER n 
1 91  ASN n 
1 92  THR n 
1 93  SER n 
1 94  GLN n 
1 95  TYR n 
1 96  ASP n 
1 97  THR n 
1 98  TYR n 
1 99  CYS n 
1 100 PHE n 
1 101 ASN n 
1 102 ALA n 
1 103 SER n 
1 104 ALA n 
1 105 PRO n 
1 106 PRO n 
1 107 GLU n 
1 108 GLU n 
1 109 ASP n 
1 110 CYS n 
1 111 THR n 
1 112 SER n 
1 113 VAL n 
1 114 THR n 
1 115 ASP n 
1 116 LEU n 
1 117 PRO n 
1 118 ASN n 
1 119 ALA n 
1 120 PHE n 
1 121 ASP n 
1 122 GLY n 
1 123 PRO n 
1 124 ILE n 
1 125 THR n 
1 126 ILE n 
1 127 THR n 
1 128 ILE n 
1 129 VAL n 
1 130 ASN n 
1 131 ARG n 
1 132 ASP n 
1 133 GLY n 
1 134 THR n 
1 135 ARG n 
1 136 TYR n 
1 137 VAL n 
1 138 GLN n 
1 139 LYS n 
1 140 GLY n 
1 141 GLU n 
1 142 TYR n 
1 143 ARG n 
1 144 THR n 
1 145 ASN n 
1 146 PRO n 
1 147 GLU n 
1 148 ASP n 
1 149 ILE n 
1 150 TYR n 
1 151 PRO n 
1 152 SER n 
1 153 ASN n 
1 154 PRO n 
1 155 THR n 
1 156 ASP n 
1 157 ASP n 
1 158 ASP n 
1 159 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 CD44 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          'pET Vector' 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET19b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CD44_HUMAN 
_struct_ref.pdbx_db_accession          Q16208 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAA
NNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV
;
_struct_ref.pdbx_align_begin           20 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1POZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 159 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q16208 
_struct_ref_seq.db_align_beg                  20 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  178 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       20 
_struct_ref_seq.pdbx_auth_seq_align_end       178 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 '2D NOESY'             4 
3 1 '2D NOESY'             5 
4 1 '2D TOCSY'             4 
5 1 HMQC-J                 2 
6 1 'CBCA(CO)NH'           1 
7 1 'NH-Exchange HSQC'     3 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      <5mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '13C,15N-labelled, pH 6.5, 1mM' '5% D2O and 95% H2O' 
2 '15N-labelled, pH 6.5, 1mM'     '5% D2O and 95% H2O' 
3 '15N-labelled, pH 6.5, 1mM'     '100% D2O'           
4 'unlabelled, pH 6.5, 1mM'       '5% D2O and 95% H2O' 
5 'unlabelled, pH 6.5, 1mM'       '100% D2O'           
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 'Omega 750' Omega 750 ? 
2 'Omega 600' Omega 600 ? 
3 'Omega 500' Omega 500 ? 
# 
_pdbx_nmr_refine.entry_id           1POZ 
_pdbx_nmr_refine.method             
;torsion angle dynamics  
simulated annealing   
refinement by molecular dynamics
;
_pdbx_nmr_refine.details            
;The structures are calculated from 2271 restraints, 2168 are NOE based, 47 dihedral constraints and 56 distance restraints from hydrogen bonds
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1POZ 
_pdbx_nmr_ensemble.conformers_calculated_total_number            500 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations,structures with the lowest energy,target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1POZ 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
'structure solution' CNS    1.1  'Brunger, A.T.'  1 
processing           FELIX  2.3  'MSI, San Diego' 2 
'structure solution' SOPHIE 1.0  'Pickford, A.R.' 3 
'data analysis'      Sparky 2.0  'Goddard, T.D.'  4 
'data analysis'      XEasy  3.13 'Xia, T'         5 
refinement           SOPHIE 1.0  'Pickford, A.R.' 6 
# 
_exptl.entry_id          1POZ 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1POZ 
_struct.title                     'SOLUTION STRUCTURE OF THE HYALURONAN BINDING DOMAIN OF HUMAN CD44' 
_struct.pdbx_descriptor           'CD44 antigen' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1POZ 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            'HYALURONAN-BINDING DOMAIN, CARBOHYDRATE-BINDING DOMAIN, LINK MODULE, CELL ADHESION, GLYCOPROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 26  ? PHE A 37  ? SER A 45  PHE A 56  1 ? 12 
HELX_P HELX_P2 2 THR A 43  ? ILE A 53  ? THR A 62  ILE A 72  1 ? 11 
HELX_P HELX_P3 3 ASN A 145 ? ILE A 149 ? ASN A 164 ILE A 168 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 9  SG ? ? ? 1_555 A CYS 110 SG ? ? A CYS 28 A CYS 129 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf2 disulf ? ? A CYS 34 SG ? ? ? 1_555 A CYS 99  SG ? ? A CYS 53 A CYS 118 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf3 disulf ? ? A CYS 58 SG ? ? ? 1_555 A CYS 78  SG ? ? A CYS 77 A CYS 97  1_555 ? ? ? ? ? ? ? 2.030 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
E ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 2   ? ASP A 4   ? GLN A 21  ASP A 23  
A 2 PHE A 120 ? ASN A 130 ? PHE A 139 ASN A 149 
A 3 THR A 134 ? TYR A 136 ? THR A 153 TYR A 155 
B 1 GLN A 2   ? ASP A 4   ? GLN A 21  ASP A 23  
B 2 PHE A 120 ? ASN A 130 ? PHE A 139 ASN A 149 
B 3 LYS A 139 ? GLU A 141 ? LYS A 158 GLU A 160 
C 1 ARG A 10  ? PHE A 11  ? ARG A 29  PHE A 30  
C 2 VAL A 14  ? PHE A 15  ? VAL A 33  PHE A 34  
D 1 SER A 39  ? THR A 40  ? SER A 58  THR A 59  
D 2 PHE A 100 ? ASN A 101 ? PHE A 119 ASN A 120 
E 1 VAL A 67  ? VAL A 68  ? VAL A 86  VAL A 87  
E 2 GLY A 61  ? PHE A 62  ? GLY A 80  PHE A 81  
E 3 ASP A 96  ? THR A 97  ? ASP A 115 THR A 116 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 3   ? N ILE A 22  O THR A 125 ? O THR A 144 
A 2 3 N ILE A 128 ? N ILE A 147 O TYR A 136 ? O TYR A 155 
B 1 2 N ILE A 3   ? N ILE A 22  O THR A 125 ? O THR A 144 
B 2 3 N ILE A 124 ? N ILE A 143 O GLY A 140 ? O GLY A 159 
C 1 2 N PHE A 11  ? N PHE A 30  O VAL A 14  ? O VAL A 33  
D 1 2 N THR A 40  ? N THR A 59  O PHE A 100 ? O PHE A 119 
E 1 2 O VAL A 68  ? O VAL A 87  N GLY A 61  ? N GLY A 80  
E 2 3 N PHE A 62  ? N PHE A 81  O ASP A 96  ? O ASP A 115 
# 
_database_PDB_matrix.entry_id          1POZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1POZ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ALA A 1 1   ? -3.062  -16.076 -13.214 1.00 0.00 ? 20  ALA A N    1  
ATOM 2     C CA   . ALA A 1 1   ? -2.575  -14.696 -12.957 1.00 0.00 ? 20  ALA A CA   1  
ATOM 3     C C    . ALA A 1 1   ? -1.841  -14.613 -11.623 1.00 0.00 ? 20  ALA A C    1  
ATOM 4     O O    . ALA A 1 1   ? -1.904  -15.537 -10.811 1.00 0.00 ? 20  ALA A O    1  
ATOM 5     C CB   . ALA A 1 1   ? -3.737  -13.715 -12.983 1.00 0.00 ? 20  ALA A CB   1  
ATOM 6     H H1   . ALA A 1 1   ? -2.262  -16.702 -13.436 1.00 0.00 ? 20  ALA A H1   1  
ATOM 7     H H2   . ALA A 1 1   ? -3.723  -16.079 -14.017 1.00 0.00 ? 20  ALA A H2   1  
ATOM 8     H H3   . ALA A 1 1   ? -3.553  -16.444 -12.374 1.00 0.00 ? 20  ALA A H3   1  
ATOM 9     H HA   . ALA A 1 1   ? -1.890  -14.425 -13.748 1.00 0.00 ? 20  ALA A HA   1  
ATOM 10    H HB1  . ALA A 1 1   ? -4.431  -13.999 -13.760 1.00 0.00 ? 20  ALA A HB1  1  
ATOM 11    H HB2  . ALA A 1 1   ? -3.364  -12.720 -13.180 1.00 0.00 ? 20  ALA A HB2  1  
ATOM 12    H HB3  . ALA A 1 1   ? -4.240  -13.727 -12.028 1.00 0.00 ? 20  ALA A HB3  1  
ATOM 13    N N    . GLN A 1 2   ? -1.145  -13.502 -11.403 1.00 0.00 ? 21  GLN A N    1  
ATOM 14    C CA   . GLN A 1 2   ? -0.398  -13.300 -10.166 1.00 0.00 ? 21  GLN A CA   1  
ATOM 15    C C    . GLN A 1 2   ? -0.106  -11.820 -9.941  1.00 0.00 ? 21  GLN A C    1  
ATOM 16    O O    . GLN A 1 2   ? -0.088  -11.030 -10.884 1.00 0.00 ? 21  GLN A O    1  
ATOM 17    C CB   . GLN A 1 2   ? 0.911   -14.090 -10.202 1.00 0.00 ? 21  GLN A CB   1  
ATOM 18    C CG   . GLN A 1 2   ? 1.712   -13.956 -11.487 1.00 0.00 ? 21  GLN A CG   1  
ATOM 19    C CD   . GLN A 1 2   ? 2.805   -12.909 -11.389 1.00 0.00 ? 21  GLN A CD   1  
ATOM 20    O OE1  . GLN A 1 2   ? 3.673   -12.981 -10.519 1.00 0.00 ? 21  GLN A OE1  1  
ATOM 21    N NE2  . GLN A 1 2   ? 2.766   -11.928 -12.282 4.00 0.00 ? 21  GLN A NE2  1  
ATOM 22    H H    . GLN A 1 2   ? -1.134  -12.802 -12.088 1.00 0.00 ? 21  GLN A H    1  
ATOM 23    H HA   . GLN A 1 2   ? -1.005  -13.663 -9.350  1.00 0.00 ? 21  GLN A HA   1  
ATOM 24    H HB2  . GLN A 1 2   ? 1.534   -13.758 -9.385  2.00 0.00 ? 21  GLN A HB2  1  
ATOM 25    H HB3  . GLN A 1 2   ? 0.685   -15.136 -10.057 2.00 0.00 ? 21  GLN A HB3  1  
ATOM 26    H HG2  . GLN A 1 2   ? 2.167   -14.909 -11.714 2.00 0.00 ? 21  GLN A HG2  1  
ATOM 27    H HG3  . GLN A 1 2   ? 1.041   -13.679 -12.287 2.00 0.00 ? 21  GLN A HG3  1  
ATOM 28    H HE21 . GLN A 1 2   ? 2.043   -11.933 -12.948 5.00 0.00 ? 21  GLN A HE21 1  
ATOM 29    H HE22 . GLN A 1 2   ? 3.463   -11.235 -12.242 5.00 0.00 ? 21  GLN A HE22 1  
ATOM 30    N N    . ILE A 1 3   ? 0.125   -11.454 -8.684  1.00 0.00 ? 22  ILE A N    1  
ATOM 31    C CA   . ILE A 1 3   ? 0.418   -10.071 -8.331  1.00 0.00 ? 22  ILE A CA   1  
ATOM 32    C C    . ILE A 1 3   ? 1.240   -9.998  -7.047  1.00 0.00 ? 22  ILE A C    1  
ATOM 33    O O    . ILE A 1 3   ? 1.008   -10.758 -6.106  1.00 0.00 ? 22  ILE A O    1  
ATOM 34    C CB   . ILE A 1 3   ? -0.877  -9.253  -8.151  1.00 0.00 ? 22  ILE A CB   1  
ATOM 35    C CG1  . ILE A 1 3   ? -1.373  -8.738  -9.503  1.00 0.00 ? 22  ILE A CG1  1  
ATOM 36    C CG2  . ILE A 1 3   ? -0.650  -8.096  -7.190  1.00 0.00 ? 22  ILE A CG2  1  
ATOM 37    C CD1  . ILE A 1 3   ? -2.649  -9.399  -9.976  1.00 0.00 ? 22  ILE A CD1  1  
ATOM 38    H H    . ILE A 1 3   ? 0.097   -12.131 -7.977  1.00 0.00 ? 22  ILE A H    1  
ATOM 39    H HA   . ILE A 1 3   ? 0.987   -9.633  -9.138  1.00 0.00 ? 22  ILE A HA   1  
ATOM 40    H HB   . ILE A 1 3   ? -1.628  -9.900  -7.724  1.00 0.00 ? 22  ILE A HB   1  
ATOM 41    H HG12 . ILE A 1 3   ? -1.557  -7.676  -9.431  2.00 0.00 ? 22  ILE A HG12 1  
ATOM 42    H HG13 . ILE A 1 3   ? -0.612  -8.915  -10.249 2.00 0.00 ? 22  ILE A HG13 1  
ATOM 43    H HG21 . ILE A 1 3   ? 0.136   -7.461  -7.571  1.00 0.00 ? 22  ILE A HG21 1  
ATOM 44    H HG22 . ILE A 1 3   ? -0.364  -8.483  -6.223  1.00 0.00 ? 22  ILE A HG22 1  
ATOM 45    H HG23 . ILE A 1 3   ? -1.561  -7.524  -7.095  1.00 0.00 ? 22  ILE A HG23 1  
ATOM 46    H HD11 . ILE A 1 3   ? -3.407  -9.307  -9.212  1.00 0.00 ? 22  ILE A HD11 1  
ATOM 47    H HD12 . ILE A 1 3   ? -2.461  -10.445 -10.172 1.00 0.00 ? 22  ILE A HD12 1  
ATOM 48    H HD13 . ILE A 1 3   ? -2.990  -8.919  -10.881 1.00 0.00 ? 22  ILE A HD13 1  
ATOM 49    N N    . ASP A 1 4   ? 2.200   -9.078  -7.013  1.00 0.00 ? 23  ASP A N    1  
ATOM 50    C CA   . ASP A 1 4   ? 3.053   -8.910  -5.844  1.00 0.00 ? 23  ASP A CA   1  
ATOM 51    C C    . ASP A 1 4   ? 2.580   -7.734  -4.997  1.00 0.00 ? 23  ASP A C    1  
ATOM 52    O O    . ASP A 1 4   ? 2.593   -6.587  -5.446  1.00 0.00 ? 23  ASP A O    1  
ATOM 53    C CB   . ASP A 1 4   ? 4.506   -8.699  -6.270  1.00 0.00 ? 23  ASP A CB   1  
ATOM 54    C CG   . ASP A 1 4   ? 5.171   -9.982  -6.728  1.00 0.00 ? 23  ASP A CG   1  
ATOM 55    O OD1  . ASP A 1 4   ? 4.603   -10.664 -7.607  1.00 0.00 ? 23  ASP A OD1  1  
ATOM 56    O OD2  . ASP A 1 4   ? 6.260   -10.304 -6.209  1.00 0.00 ? 23  ASP A OD2  1  
ATOM 57    H H    . ASP A 1 4   ? 2.338   -8.498  -7.791  1.00 0.00 ? 23  ASP A H    1  
ATOM 58    H HA   . ASP A 1 4   ? 2.987   -9.812  -5.253  1.00 0.00 ? 23  ASP A HA   1  
ATOM 59    H HB2  . ASP A 1 4   ? 4.536   -7.989  -7.086  2.00 0.00 ? 23  ASP A HB2  1  
ATOM 60    H HB3  . ASP A 1 4   ? 5.066   -8.304  -5.433  2.00 0.00 ? 23  ASP A HB3  1  
ATOM 61    N N    . LEU A 1 5   ? 2.163   -8.026  -3.772  1.00 0.00 ? 24  LEU A N    1  
ATOM 62    C CA   . LEU A 1 5   ? 1.684   -6.996  -2.862  1.00 0.00 ? 24  LEU A CA   1  
ATOM 63    C C    . LEU A 1 5   ? 2.800   -6.541  -1.931  1.00 0.00 ? 24  LEU A C    1  
ATOM 64    O O    . LEU A 1 5   ? 3.846   -7.185  -1.842  1.00 0.00 ? 24  LEU A O    1  
ATOM 65    C CB   . LEU A 1 5   ? 0.500   -7.517  -2.047  1.00 0.00 ? 24  LEU A CB   1  
ATOM 66    C CG   . LEU A 1 5   ? -0.727  -7.970  -2.841  1.00 0.00 ? 24  LEU A CG   1  
ATOM 67    C CD1  . LEU A 1 5   ? -0.380  -9.141  -3.748  2.00 0.00 ? 24  LEU A CD1  1  
ATOM 68    C CD2  . LEU A 1 5   ? -1.859  -8.352  -1.902  2.00 0.00 ? 24  LEU A CD2  1  
ATOM 69    H H    . LEU A 1 5   ? 2.177   -8.959  -3.471  1.00 0.00 ? 24  LEU A H    1  
ATOM 70    H HA   . LEU A 1 5   ? 1.358   -6.155  -3.455  1.00 0.00 ? 24  LEU A HA   1  
ATOM 71    H HB2  . LEU A 1 5   ? 0.844   -8.353  -1.455  2.00 0.00 ? 24  LEU A HB2  1  
ATOM 72    H HB3  . LEU A 1 5   ? 0.191   -6.735  -1.369  2.00 0.00 ? 24  LEU A HB3  1  
ATOM 73    H HG   . LEU A 1 5   ? -1.066  -7.154  -3.461  1.00 0.00 ? 24  LEU A HG   1  
ATOM 74    H HD11 . LEU A 1 5   ? 0.063   -9.931  -3.161  1.00 0.00 ? 24  LEU A HD11 1  
ATOM 75    H HD12 . LEU A 1 5   ? 0.321   -8.816  -4.502  1.00 0.00 ? 24  LEU A HD12 1  
ATOM 76    H HD13 . LEU A 1 5   ? -1.279  -9.506  -4.223  1.00 0.00 ? 24  LEU A HD13 1  
ATOM 77    H HD21 . LEU A 1 5   ? -1.764  -7.799  -0.979  1.00 0.00 ? 24  LEU A HD21 1  
ATOM 78    H HD22 . LEU A 1 5   ? -1.813  -9.411  -1.694  1.00 0.00 ? 24  LEU A HD22 1  
ATOM 79    H HD23 . LEU A 1 5   ? -2.806  -8.117  -2.366  1.00 0.00 ? 24  LEU A HD23 1  
ATOM 80    N N    . ASN A 1 6   ? 2.576   -5.431  -1.240  1.00 0.00 ? 25  ASN A N    1  
ATOM 81    C CA   . ASN A 1 6   ? 3.571   -4.898  -0.319  1.00 0.00 ? 25  ASN A CA   1  
ATOM 82    C C    . ASN A 1 6   ? 2.934   -3.948  0.688   1.00 0.00 ? 25  ASN A C    1  
ATOM 83    O O    . ASN A 1 6   ? 2.580   -2.819  0.354   1.00 0.00 ? 25  ASN A O    1  
ATOM 84    C CB   . ASN A 1 6   ? 4.674   -4.175  -1.092  1.00 0.00 ? 25  ASN A CB   1  
ATOM 85    C CG   . ASN A 1 6   ? 6.056   -4.708  -0.767  1.00 0.00 ? 25  ASN A CG   1  
ATOM 86    O OD1  . ASN A 1 6   ? 6.706   -5.332  -1.605  1.00 0.00 ? 25  ASN A OD1  1  
ATOM 87    N ND2  . ASN A 1 6   ? 6.512   -4.464  0.457   4.00 0.00 ? 25  ASN A ND2  1  
ATOM 88    H H    . ASN A 1 6   ? 1.724   -4.959  -1.352  1.00 0.00 ? 25  ASN A H    1  
ATOM 89    H HA   . ASN A 1 6   ? 4.005   -5.730  0.215   1.00 0.00 ? 25  ASN A HA   1  
ATOM 90    H HB2  . ASN A 1 6   ? 4.503   -4.297  -2.151  2.00 0.00 ? 25  ASN A HB2  1  
ATOM 91    H HB3  . ASN A 1 6   ? 4.648   -3.124  -0.846  2.00 0.00 ? 25  ASN A HB3  1  
ATOM 92    H HD21 . ASN A 1 6   ? 5.938   -3.959  1.074   5.00 0.00 ? 25  ASN A HD21 1  
ATOM 93    H HD22 . ASN A 1 6   ? 7.405   -4.798  0.694   5.00 0.00 ? 25  ASN A HD22 1  
ATOM 94    N N    . ILE A 1 7   ? 2.792   -4.412  1.922   1.00 0.00 ? 26  ILE A N    1  
ATOM 95    C CA   . ILE A 1 7   ? 2.204   -3.601  2.975   1.00 0.00 ? 26  ILE A CA   1  
ATOM 96    C C    . ILE A 1 7   ? 3.144   -3.502  4.171   1.00 0.00 ? 26  ILE A C    1  
ATOM 97    O O    . ILE A 1 7   ? 3.962   -4.389  4.401   1.00 0.00 ? 26  ILE A O    1  
ATOM 98    C CB   . ILE A 1 7   ? 0.850   -4.172  3.434   1.00 0.00 ? 26  ILE A CB   1  
ATOM 99    C CG1  . ILE A 1 7   ? 1.010   -4.984  4.719   1.00 0.00 ? 26  ILE A CG1  1  
ATOM 100   C CG2  . ILE A 1 7   ? 0.235   -5.025  2.336   1.00 0.00 ? 26  ILE A CG2  1  
ATOM 101   C CD1  . ILE A 1 7   ? -0.158  -4.851  5.674   1.00 0.00 ? 26  ILE A CD1  1  
ATOM 102   H H    . ILE A 1 7   ? 3.090   -5.321  2.130   1.00 0.00 ? 26  ILE A H    1  
ATOM 103   H HA   . ILE A 1 7   ? 2.036   -2.610  2.578   1.00 0.00 ? 26  ILE A HA   1  
ATOM 104   H HB   . ILE A 1 7   ? 0.186   -3.344  3.622   1.00 0.00 ? 26  ILE A HB   1  
ATOM 105   H HG12 . ILE A 1 7   ? 1.116   -6.028  4.465   2.00 0.00 ? 26  ILE A HG12 1  
ATOM 106   H HG13 . ILE A 1 7   ? 1.899   -4.656  5.237   2.00 0.00 ? 26  ILE A HG13 1  
ATOM 107   H HG21 . ILE A 1 7   ? 0.841   -4.958  1.445   1.00 0.00 ? 26  ILE A HG21 1  
ATOM 108   H HG22 . ILE A 1 7   ? -0.762  -4.668  2.120   1.00 0.00 ? 26  ILE A HG22 1  
ATOM 109   H HG23 . ILE A 1 7   ? 0.186   -6.053  2.663   1.00 0.00 ? 26  ILE A HG23 1  
ATOM 110   H HD11 . ILE A 1 7   ? -0.998  -4.407  5.156   1.00 0.00 ? 26  ILE A HD11 1  
ATOM 111   H HD12 . ILE A 1 7   ? 0.126   -4.220  6.505   1.00 0.00 ? 26  ILE A HD12 1  
ATOM 112   H HD13 . ILE A 1 7   ? -0.438  -5.827  6.041   1.00 0.00 ? 26  ILE A HD13 1  
ATOM 113   N N    . THR A 1 8   ? 3.019   -2.422  4.932   1.00 0.00 ? 27  THR A N    1  
ATOM 114   C CA   . THR A 1 8   ? 3.861   -2.217  6.104   1.00 0.00 ? 27  THR A CA   1  
ATOM 115   C C    . THR A 1 8   ? 3.307   -2.979  7.297   1.00 0.00 ? 27  THR A C    1  
ATOM 116   O O    . THR A 1 8   ? 4.040   -3.666  8.009   1.00 0.00 ? 27  THR A O    1  
ATOM 117   C CB   . THR A 1 8   ? 3.971   -0.721  6.459   1.00 0.00 ? 27  THR A CB   1  
ATOM 118   O OG1  . THR A 1 8   ? 5.329   -0.284  6.325   1.00 0.00 ? 27  THR A OG1  1  
ATOM 119   C CG2  . THR A 1 8   ? 3.485   -0.448  7.876   1.00 0.00 ? 27  THR A CG2  1  
ATOM 120   H H    . THR A 1 8   ? 2.343   -1.749  4.704   1.00 0.00 ? 27  THR A H    1  
ATOM 121   H HA   . THR A 1 8   ? 4.850   -2.589  5.877   1.00 0.00 ? 27  THR A HA   1  
ATOM 122   H HB   . THR A 1 8   ? 3.353   -0.161  5.773   1.00 0.00 ? 27  THR A HB   1  
ATOM 123   H HG1  . THR A 1 8   ? 5.463   0.080   5.448   1.00 0.00 ? 27  THR A HG1  1  
ATOM 124   H HG21 . THR A 1 8   ? 4.291   -0.624  8.574   1.00 0.00 ? 27  THR A HG21 1  
ATOM 125   H HG22 . THR A 1 8   ? 2.659   -1.104  8.107   1.00 0.00 ? 27  THR A HG22 1  
ATOM 126   H HG23 . THR A 1 8   ? 3.160   0.580   7.953   1.00 0.00 ? 27  THR A HG23 1  
ATOM 127   N N    . CYS A 1 9   ? 2.002   -2.846  7.497   1.00 0.00 ? 28  CYS A N    1  
ATOM 128   C CA   . CYS A 1 9   ? 1.305   -3.509  8.596   1.00 0.00 ? 28  CYS A CA   1  
ATOM 129   C C    . CYS A 1 9   ? 0.044   -2.736  8.959   1.00 0.00 ? 28  CYS A C    1  
ATOM 130   O O    . CYS A 1 9   ? -0.150  -1.609  8.506   1.00 0.00 ? 28  CYS A O    1  
ATOM 131   C CB   . CYS A 1 9   ? 2.214   -3.638  9.820   1.00 0.00 ? 28  CYS A CB   1  
ATOM 132   S SG   . CYS A 1 9   ? 1.442   -4.479  11.240  1.00 0.00 ? 28  CYS A SG   1  
ATOM 133   H H    . CYS A 1 9   ? 1.488   -2.279  6.879   1.00 0.00 ? 28  CYS A H    1  
ATOM 134   H HA   . CYS A 1 9   ? 1.022   -4.496  8.260   1.00 0.00 ? 28  CYS A HA   1  
ATOM 135   H HB2  . CYS A 1 9   ? 3.095   -4.201  9.546   2.00 0.00 ? 28  CYS A HB2  1  
ATOM 136   H HB3  . CYS A 1 9   ? 2.508   -2.651  10.144  2.00 0.00 ? 28  CYS A HB3  1  
ATOM 137   N N    . ARG A 1 10  ? -0.817  -3.346  9.765   1.00 0.00 ? 29  ARG A N    1  
ATOM 138   C CA   . ARG A 1 10  ? -2.065  -2.708  10.165  1.00 0.00 ? 29  ARG A CA   1  
ATOM 139   C C    . ARG A 1 10  ? -1.998  -2.195  11.603  1.00 0.00 ? 29  ARG A C    1  
ATOM 140   O O    . ARG A 1 10  ? -2.441  -2.867  12.533  1.00 0.00 ? 29  ARG A O    1  
ATOM 141   C CB   . ARG A 1 10  ? -3.218  -3.697  10.004  1.00 0.00 ? 29  ARG A CB   1  
ATOM 142   C CG   . ARG A 1 10  ? -4.502  -3.074  9.488   1.00 0.00 ? 29  ARG A CG   1  
ATOM 143   C CD   . ARG A 1 10  ? -5.705  -3.511  10.304  1.00 0.00 ? 29  ARG A CD   1  
ATOM 144   N NE   . ARG A 1 10  ? -5.720  -4.954  10.533  1.00 0.00 ? 29  ARG A NE   1  
ATOM 145   C CZ   . ARG A 1 10  ? -5.650  -5.860  9.560   4.00 0.00 ? 29  ARG A CZ   1  
ATOM 146   N NH1  . ARG A 1 10  ? -5.556  -5.482  8.292   5.00 0.00 ? 29  ARG A NH1  1  
ATOM 147   N NH2  . ARG A 1 10  ? -5.672  -7.154  9.849   5.00 0.00 ? 29  ARG A NH2  1  
ATOM 148   H H    . ARG A 1 10  ? -0.616  -4.249  10.091  1.00 0.00 ? 29  ARG A H    1  
ATOM 149   H HA   . ARG A 1 10  ? -2.231  -1.869  9.506   1.00 0.00 ? 29  ARG A HA   1  
ATOM 150   H HB2  . ARG A 1 10  ? -2.919  -4.466  9.307   2.00 0.00 ? 29  ARG A HB2  1  
ATOM 151   H HB3  . ARG A 1 10  ? -3.424  -4.152  10.962  2.00 0.00 ? 29  ARG A HB3  1  
ATOM 152   H HG2  . ARG A 1 10  ? -4.416  -1.998  9.531   2.00 0.00 ? 29  ARG A HG2  1  
ATOM 153   H HG3  . ARG A 1 10  ? -4.649  -3.381  8.463   2.00 0.00 ? 29  ARG A HG3  1  
ATOM 154   H HD2  . ARG A 1 10  ? -5.679  -3.005  11.258  2.00 0.00 ? 29  ARG A HD2  1  
ATOM 155   H HD3  . ARG A 1 10  ? -6.604  -3.230  9.775   2.00 0.00 ? 29  ARG A HD3  1  
ATOM 156   H HE   . ARG A 1 10  ? -5.787  -5.265  11.459  1.00 0.00 ? 29  ARG A HE   1  
ATOM 157   H HH11 . ARG A 1 10  ? -5.539  -4.510  8.060   5.00 0.00 ? 29  ARG A HH11 1  
ATOM 158   H HH12 . ARG A 1 10  ? -5.504  -6.170  7.568   5.00 0.00 ? 29  ARG A HH12 1  
ATOM 159   H HH21 . ARG A 1 10  ? -5.743  -7.453  10.801  5.00 0.00 ? 29  ARG A HH21 1  
ATOM 160   H HH22 . ARG A 1 10  ? -5.620  -7.831  9.115   5.00 0.00 ? 29  ARG A HH22 1  
ATOM 161   N N    . PHE A 1 11  ? -1.446  -0.994  11.774  1.00 0.00 ? 30  PHE A N    1  
ATOM 162   C CA   . PHE A 1 11  ? -1.324  -0.382  13.096  1.00 0.00 ? 30  PHE A CA   1  
ATOM 163   C C    . PHE A 1 11  ? -2.588  0.389   13.462  1.00 0.00 ? 30  PHE A C    1  
ATOM 164   O O    . PHE A 1 11  ? -3.111  1.159   12.657  1.00 0.00 ? 30  PHE A O    1  
ATOM 165   C CB   . PHE A 1 11  ? -0.133  0.576   13.138  1.00 0.00 ? 30  PHE A CB   1  
ATOM 166   C CG   . PHE A 1 11  ? 1.208   -0.033  12.851  1.00 0.00 ? 30  PHE A CG   1  
ATOM 167   C CD1  . PHE A 1 11  ? 1.545   -0.420  11.566  1.00 0.00 ? 30  PHE A CD1  1  
ATOM 168   C CD2  . PHE A 1 11  ? 2.137   -0.200  13.864  1.00 0.00 ? 30  PHE A CD2  1  
ATOM 169   C CE1  . PHE A 1 11  ? 2.785   -0.964  11.296  1.00 0.00 ? 30  PHE A CE1  1  
ATOM 170   C CE2  . PHE A 1 11  ? 3.378   -0.746  13.601  1.00 0.00 ? 30  PHE A CE2  1  
ATOM 171   C CZ   . PHE A 1 11  ? 3.703   -1.129  12.314  1.00 0.00 ? 30  PHE A CZ   1  
ATOM 172   H H    . PHE A 1 11  ? -1.115  -0.506  10.992  1.00 0.00 ? 30  PHE A H    1  
ATOM 173   H HA   . PHE A 1 11  ? -1.170  -1.170  13.817  1.00 0.00 ? 30  PHE A HA   1  
ATOM 174   H HB2  . PHE A 1 11  ? -0.295  1.360   12.414  2.00 0.00 ? 30  PHE A HB2  1  
ATOM 175   H HB3  . PHE A 1 11  ? -0.083  1.020   14.121  2.00 0.00 ? 30  PHE A HB3  1  
ATOM 176   H HD1  . PHE A 1 11  ? 0.826   -0.293  10.769  1.00 0.00 ? 30  PHE A HD1  1  
ATOM 177   H HD2  . PHE A 1 11  ? 1.883   0.101   14.871  1.00 0.00 ? 30  PHE A HD2  1  
ATOM 178   H HE1  . PHE A 1 11  ? 3.036   -1.263  10.289  1.00 0.00 ? 30  PHE A HE1  1  
ATOM 179   H HE2  . PHE A 1 11  ? 4.094   -0.874  14.400  1.00 0.00 ? 30  PHE A HE2  1  
ATOM 180   H HZ   . PHE A 1 11  ? 4.673   -1.554  12.104  1.00 0.00 ? 30  PHE A HZ   1  
ATOM 181   N N    . ALA A 1 12  ? -3.064  0.193   14.687  1.00 0.00 ? 31  ALA A N    1  
ATOM 182   C CA   . ALA A 1 12  ? -4.258  0.882   15.165  1.00 0.00 ? 31  ALA A CA   1  
ATOM 183   C C    . ALA A 1 12  ? -5.402  0.781   14.160  1.00 0.00 ? 31  ALA A C    1  
ATOM 184   O O    . ALA A 1 12  ? -6.262  1.655   14.103  1.00 0.00 ? 31  ALA A O    1  
ATOM 185   C CB   . ALA A 1 12  ? -3.941  2.341   15.456  1.00 0.00 ? 31  ALA A CB   1  
ATOM 186   H H    . ALA A 1 12  ? -2.595  -0.423  15.288  1.00 0.00 ? 31  ALA A H    1  
ATOM 187   H HA   . ALA A 1 12  ? -4.560  0.417   16.090  1.00 0.00 ? 31  ALA A HA   1  
ATOM 188   H HB1  . ALA A 1 12  ? -3.251  2.401   16.284  1.00 0.00 ? 31  ALA A HB1  1  
ATOM 189   H HB2  . ALA A 1 12  ? -4.852  2.864   15.707  1.00 0.00 ? 31  ALA A HB2  1  
ATOM 190   H HB3  . ALA A 1 12  ? -3.496  2.793   14.582  1.00 0.00 ? 31  ALA A HB3  1  
ATOM 191   N N    . GLY A 1 13  ? -5.408  -0.289  13.373  1.00 0.00 ? 32  GLY A N    1  
ATOM 192   C CA   . GLY A 1 13  ? -6.449  -0.477  12.378  1.00 0.00 ? 32  GLY A CA   1  
ATOM 193   C C    . GLY A 1 13  ? -6.089  0.109   11.023  1.00 0.00 ? 32  GLY A C    1  
ATOM 194   O O    . GLY A 1 13  ? -6.933  0.189   10.131  1.00 0.00 ? 32  GLY A O    1  
ATOM 195   H H    . GLY A 1 13  ? -4.704  -0.959  13.471  1.00 0.00 ? 32  GLY A H    1  
ATOM 196   H HA2  . GLY A 1 13  ? -6.632  -1.537  12.261  2.00 0.00 ? 32  GLY A HA2  1  
ATOM 197   H HA3  . GLY A 1 13  ? -7.357  -0.005  12.729  2.00 0.00 ? 32  GLY A HA3  1  
ATOM 198   N N    . VAL A 1 14  ? -4.832  0.522   10.872  1.00 0.00 ? 33  VAL A N    1  
ATOM 199   C CA   . VAL A 1 14  ? -4.358  1.107   9.621   1.00 0.00 ? 33  VAL A CA   1  
ATOM 200   C C    . VAL A 1 14  ? -3.233  0.275   9.014   1.00 0.00 ? 33  VAL A C    1  
ATOM 201   O O    . VAL A 1 14  ? -2.206  0.053   9.653   1.00 0.00 ? 33  VAL A O    1  
ATOM 202   C CB   . VAL A 1 14  ? -3.831  2.541   9.834   1.00 0.00 ? 33  VAL A CB   1  
ATOM 203   C CG1  . VAL A 1 14  ? -2.522  2.750   9.094   2.00 0.00 ? 33  VAL A CG1  1  
ATOM 204   C CG2  . VAL A 1 14  ? -4.846  3.574   9.385   2.00 0.00 ? 33  VAL A CG2  1  
ATOM 205   H H    . VAL A 1 14  ? -4.208  0.433   11.621  1.00 0.00 ? 33  VAL A H    1  
ATOM 206   H HA   . VAL A 1 14  ? -5.186  1.145   8.929   1.00 0.00 ? 33  VAL A HA   1  
ATOM 207   H HB   . VAL A 1 14  ? -3.652  2.676   10.891  1.00 0.00 ? 33  VAL A HB   1  
ATOM 208   H HG11 . VAL A 1 14  ? -2.681  2.594   8.037   1.00 0.00 ? 33  VAL A HG11 1  
ATOM 209   H HG12 . VAL A 1 14  ? -1.787  2.046   9.456   1.00 0.00 ? 33  VAL A HG12 1  
ATOM 210   H HG13 . VAL A 1 14  ? -2.170  3.757   9.260   1.00 0.00 ? 33  VAL A HG13 1  
ATOM 211   H HG21 . VAL A 1 14  ? -5.675  3.078   8.904   1.00 0.00 ? 33  VAL A HG21 1  
ATOM 212   H HG22 . VAL A 1 14  ? -4.375  4.253   8.686   1.00 0.00 ? 33  VAL A HG22 1  
ATOM 213   H HG23 . VAL A 1 14  ? -5.200  4.126   10.242  1.00 0.00 ? 33  VAL A HG23 1  
ATOM 214   N N    . PHE A 1 15  ? -3.413  -0.161  7.772   1.00 0.00 ? 34  PHE A N    1  
ATOM 215   C CA   . PHE A 1 15  ? -2.383  -0.938  7.097   1.00 0.00 ? 34  PHE A CA   1  
ATOM 216   C C    . PHE A 1 15  ? -2.032  -0.296  5.763   1.00 0.00 ? 34  PHE A C    1  
ATOM 217   O O    . PHE A 1 15  ? -2.894  -0.063  4.912   1.00 0.00 ? 34  PHE A O    1  
ATOM 218   C CB   . PHE A 1 15  ? -2.805  -2.426  6.984   1.00 0.00 ? 34  PHE A CB   1  
ATOM 219   C CG   . PHE A 1 15  ? -2.777  -3.068  5.611   1.00 0.00 ? 34  PHE A CG   1  
ATOM 220   C CD1  . PHE A 1 15  ? -2.069  -2.526  4.551   1.00 0.00 ? 34  PHE A CD1  1  
ATOM 221   C CD2  . PHE A 1 15  ? -3.481  -4.250  5.396   1.00 0.00 ? 34  PHE A CD2  1  
ATOM 222   C CE1  . PHE A 1 15  ? -2.066  -3.140  3.315   1.00 0.00 ? 34  PHE A CE1  1  
ATOM 223   C CE2  . PHE A 1 15  ? -3.481  -4.867  4.161   1.00 0.00 ? 34  PHE A CE2  1  
ATOM 224   C CZ   . PHE A 1 15  ? -2.773  -4.310  3.120   1.00 0.00 ? 34  PHE A CZ   1  
ATOM 225   H H    . PHE A 1 15  ? -4.242  0.060   7.296   1.00 0.00 ? 34  PHE A H    1  
ATOM 226   H HA   . PHE A 1 15  ? -1.503  -0.886  7.721   1.00 0.00 ? 34  PHE A HA   1  
ATOM 227   H HB2  . PHE A 1 15  ? -2.147  -3.007  7.614   2.00 0.00 ? 34  PHE A HB2  1  
ATOM 228   H HB3  . PHE A 1 15  ? -3.813  -2.521  7.358   2.00 0.00 ? 34  PHE A HB3  1  
ATOM 229   H HD1  . PHE A 1 15  ? -1.513  -1.616  4.694   1.00 0.00 ? 34  PHE A HD1  1  
ATOM 230   H HD2  . PHE A 1 15  ? -4.039  -4.687  6.207   1.00 0.00 ? 34  PHE A HD2  1  
ATOM 231   H HE1  . PHE A 1 15  ? -1.511  -2.705  2.498   1.00 0.00 ? 34  PHE A HE1  1  
ATOM 232   H HE2  . PHE A 1 15  ? -4.042  -5.783  4.010   1.00 0.00 ? 34  PHE A HE2  1  
ATOM 233   H HZ   . PHE A 1 15  ? -2.769  -4.787  2.156   1.00 0.00 ? 34  PHE A HZ   1  
ATOM 234   N N    . HIS A 1 16  ? -0.748  0.010   5.611   1.00 0.00 ? 35  HIS A N    1  
ATOM 235   C CA   . HIS A 1 16  ? -0.232  0.644   4.408   1.00 0.00 ? 35  HIS A CA   1  
ATOM 236   C C    . HIS A 1 16  ? -0.041  -0.401  3.314   1.00 0.00 ? 35  HIS A C    1  
ATOM 237   O O    . HIS A 1 16  ? 0.647   -1.398  3.516   1.00 0.00 ? 35  HIS A O    1  
ATOM 238   C CB   . HIS A 1 16  ? 1.089   1.353   4.742   1.00 0.00 ? 35  HIS A CB   1  
ATOM 239   C CG   . HIS A 1 16  ? 1.961   1.660   3.567   1.00 0.00 ? 35  HIS A CG   1  
ATOM 240   N ND1  . HIS A 1 16  ? 2.943   2.626   3.597   1.00 0.00 ? 35  HIS A ND1  1  
ATOM 241   C CD2  . HIS A 1 16  ? 2.005   1.123   2.329   1.00 0.00 ? 35  HIS A CD2  1  
ATOM 242   C CE1  . HIS A 1 16  ? 3.551   2.670   2.428   1.00 0.00 ? 35  HIS A CE1  1  
ATOM 243   N NE2  . HIS A 1 16  ? 3.001   1.768   1.639   1.00 0.00 ? 35  HIS A NE2  1  
ATOM 244   H H    . HIS A 1 16  ? -0.127  -0.189  6.342   1.00 0.00 ? 35  HIS A H    1  
ATOM 245   H HA   . HIS A 1 16  ? -0.954  1.375   4.076   1.00 0.00 ? 35  HIS A HA   1  
ATOM 246   H HB2  . HIS A 1 16  ? 0.865   2.288   5.234   2.00 0.00 ? 35  HIS A HB2  1  
ATOM 247   H HB3  . HIS A 1 16  ? 1.656   0.731   5.418   2.00 0.00 ? 35  HIS A HB3  1  
ATOM 248   H HD1  . HIS A 1 16  ? 3.161   3.195   4.363   1.00 0.00 ? 35  HIS A HD1  1  
ATOM 249   H HD2  . HIS A 1 16  ? 1.374   0.331   1.958   1.00 0.00 ? 35  HIS A HD2  1  
ATOM 250   H HE1  . HIS A 1 16  ? 4.362   3.332   2.162   1.00 0.00 ? 35  HIS A HE1  1  
ATOM 251   H HE2  . HIS A 1 16  ? 3.156   1.698   0.675   1.00 0.00 ? 35  HIS A HE2  1  
ATOM 252   N N    . VAL A 1 17  ? -0.683  -0.185  2.169   1.00 0.00 ? 36  VAL A N    1  
ATOM 253   C CA   . VAL A 1 17  ? -0.606  -1.136  1.064   1.00 0.00 ? 36  VAL A CA   1  
ATOM 254   C C    . VAL A 1 17  ? 0.243   -0.630  -0.102  1.00 0.00 ? 36  VAL A C    1  
ATOM 255   O O    . VAL A 1 17  ? 0.428   0.575   -0.287  1.00 0.00 ? 36  VAL A O    1  
ATOM 256   C CB   . VAL A 1 17  ? -2.014  -1.475  0.536   1.00 0.00 ? 36  VAL A CB   1  
ATOM 257   C CG1  . VAL A 1 17  ? -2.993  -0.363  0.871   2.00 0.00 ? 36  VAL A CG1  1  
ATOM 258   C CG2  . VAL A 1 17  ? -1.990  -1.724  -0.965  2.00 0.00 ? 36  VAL A CG2  1  
ATOM 259   H H    . VAL A 1 17  ? -1.238  0.617   2.074   1.00 0.00 ? 36  VAL A H    1  
ATOM 260   H HA   . VAL A 1 17  ? -0.169  -2.046  1.445   1.00 0.00 ? 36  VAL A HA   1  
ATOM 261   H HB   . VAL A 1 17  ? -2.345  -2.379  1.025   1.00 0.00 ? 36  VAL A HB   1  
ATOM 262   H HG11 . VAL A 1 17  ? -2.657  0.558   0.418   1.00 0.00 ? 36  VAL A HG11 1  
ATOM 263   H HG12 . VAL A 1 17  ? -3.044  -0.240  1.942   1.00 0.00 ? 36  VAL A HG12 1  
ATOM 264   H HG13 . VAL A 1 17  ? -3.970  -0.616  0.489   1.00 0.00 ? 36  VAL A HG13 1  
ATOM 265   H HG21 . VAL A 1 17  ? -1.410  -2.612  -1.173  1.00 0.00 ? 36  VAL A HG21 1  
ATOM 266   H HG22 . VAL A 1 17  ? -1.542  -0.877  -1.463  1.00 0.00 ? 36  VAL A HG22 1  
ATOM 267   H HG23 . VAL A 1 17  ? -2.999  -1.861  -1.323  1.00 0.00 ? 36  VAL A HG23 1  
ATOM 268   N N    . GLU A 1 18  ? 0.730   -1.580  -0.898  1.00 0.00 ? 37  GLU A N    1  
ATOM 269   C CA   . GLU A 1 18  ? 1.538   -1.284  -2.076  1.00 0.00 ? 37  GLU A CA   1  
ATOM 270   C C    . GLU A 1 18  ? 1.346   -2.385  -3.118  1.00 0.00 ? 37  GLU A C    1  
ATOM 271   O O    . GLU A 1 18  ? 0.798   -3.444  -2.812  1.00 0.00 ? 37  GLU A O    1  
ATOM 272   C CB   . GLU A 1 18  ? 3.019   -1.165  -1.708  1.00 0.00 ? 37  GLU A CB   1  
ATOM 273   C CG   . GLU A 1 18  ? 3.307   -0.103  -0.660  1.00 0.00 ? 37  GLU A CG   1  
ATOM 274   C CD   . GLU A 1 18  ? 4.734   -0.152  -0.149  1.00 0.00 ? 37  GLU A CD   1  
ATOM 275   O OE1  . GLU A 1 18  ? 5.665   -0.060  -0.976  1.00 0.00 ? 37  GLU A OE1  1  
ATOM 276   O OE2  . GLU A 1 18  ? 4.920   -0.279  1.080   1.00 0.00 ? 37  GLU A OE2  1  
ATOM 277   H H    . GLU A 1 18  ? 0.524   -2.516  -0.693  1.00 0.00 ? 37  GLU A H    1  
ATOM 278   H HA   . GLU A 1 18  ? 1.194   -0.346  -2.488  1.00 0.00 ? 37  GLU A HA   1  
ATOM 279   H HB2  . GLU A 1 18  ? 3.361   -2.116  -1.329  2.00 0.00 ? 37  GLU A HB2  1  
ATOM 280   H HB3  . GLU A 1 18  ? 3.579   -0.921  -2.599  2.00 0.00 ? 37  GLU A HB3  1  
ATOM 281   H HG2  . GLU A 1 18  ? 3.130   0.869   -1.094  2.00 0.00 ? 37  GLU A HG2  1  
ATOM 282   H HG3  . GLU A 1 18  ? 2.638   -0.249  0.174   2.00 0.00 ? 37  GLU A HG3  1  
ATOM 283   N N    . LYS A 1 19  ? 1.791   -2.138  -4.345  1.00 0.00 ? 38  LYS A N    1  
ATOM 284   C CA   . LYS A 1 19  ? 1.650   -3.126  -5.412  1.00 0.00 ? 38  LYS A CA   1  
ATOM 285   C C    . LYS A 1 19  ? 2.949   -3.287  -6.195  1.00 0.00 ? 38  LYS A C    1  
ATOM 286   O O    . LYS A 1 19  ? 3.134   -2.662  -7.239  1.00 0.00 ? 38  LYS A O    1  
ATOM 287   C CB   . LYS A 1 19  ? 0.516   -2.727  -6.358  1.00 0.00 ? 38  LYS A CB   1  
ATOM 288   C CG   . LYS A 1 19  ? -0.545  -3.801  -6.536  1.00 0.00 ? 38  LYS A CG   1  
ATOM 289   C CD   . LYS A 1 19  ? -1.527  -3.823  -5.376  1.00 0.00 ? 38  LYS A CD   1  
ATOM 290   C CE   . LYS A 1 19  ? -2.857  -4.444  -5.770  1.00 0.00 ? 38  LYS A CE   1  
ATOM 291   N NZ   . LYS A 1 19  ? -2.675  -5.711  -6.530  1.00 0.00 ? 38  LYS A NZ   1  
ATOM 292   H H    . LYS A 1 19  ? 2.218   -1.277  -4.539  1.00 0.00 ? 38  LYS A H    1  
ATOM 293   H HA   . LYS A 1 19  ? 1.403   -4.072  -4.953  1.00 0.00 ? 38  LYS A HA   1  
ATOM 294   H HB2  . LYS A 1 19  ? 0.037   -1.840  -5.971  2.00 0.00 ? 38  LYS A HB2  1  
ATOM 295   H HB3  . LYS A 1 19  ? 0.935   -2.501  -7.328  2.00 0.00 ? 38  LYS A HB3  1  
ATOM 296   H HG2  . LYS A 1 19  ? -1.087  -3.608  -7.450  2.00 0.00 ? 38  LYS A HG2  1  
ATOM 297   H HG3  . LYS A 1 19  ? -0.060  -4.763  -6.602  2.00 0.00 ? 38  LYS A HG3  1  
ATOM 298   H HD2  . LYS A 1 19  ? -1.099  -4.398  -4.568  2.00 0.00 ? 38  LYS A HD2  1  
ATOM 299   H HD3  . LYS A 1 19  ? -1.698  -2.810  -5.044  2.00 0.00 ? 38  LYS A HD3  1  
ATOM 300   H HE2  . LYS A 1 19  ? -3.423  -4.650  -4.874  2.00 0.00 ? 38  LYS A HE2  1  
ATOM 301   H HE3  . LYS A 1 19  ? -3.400  -3.741  -6.384  2.00 0.00 ? 38  LYS A HE3  1  
ATOM 302   H HZ1  . LYS A 1 19  ? -2.233  -5.515  -7.451  1.00 0.00 ? 38  LYS A HZ1  1  
ATOM 303   H HZ2  . LYS A 1 19  ? -3.595  -6.168  -6.690  1.00 0.00 ? 38  LYS A HZ2  1  
ATOM 304   H HZ3  . LYS A 1 19  ? -2.065  -6.363  -5.996  1.00 0.00 ? 38  LYS A HZ3  1  
ATOM 305   N N    . ASN A 1 20  ? 3.839   -4.136  -5.684  1.00 0.00 ? 39  ASN A N    1  
ATOM 306   C CA   . ASN A 1 20  ? 5.125   -4.393  -6.327  1.00 0.00 ? 39  ASN A CA   1  
ATOM 307   C C    . ASN A 1 20  ? 5.602   -3.181  -7.115  1.00 0.00 ? 39  ASN A C    1  
ATOM 308   O O    . ASN A 1 20  ? 6.225   -3.317  -8.168  1.00 0.00 ? 39  ASN A O    1  
ATOM 309   C CB   . ASN A 1 20  ? 5.024   -5.608  -7.250  1.00 0.00 ? 39  ASN A CB   1  
ATOM 310   C CG   . ASN A 1 20  ? 6.378   -6.186  -7.611  1.00 0.00 ? 39  ASN A CG   1  
ATOM 311   O OD1  . ASN A 1 20  ? 7.254   -6.327  -6.757  1.00 0.00 ? 39  ASN A OD1  1  
ATOM 312   N ND2  . ASN A 1 20  ? 6.558   -6.523  -8.883  4.00 0.00 ? 39  ASN A ND2  1  
ATOM 313   H H    . ASN A 1 20  ? 3.625   -4.607  -4.852  1.00 0.00 ? 39  ASN A H    1  
ATOM 314   H HA   . ASN A 1 20  ? 5.844   -4.601  -5.550  1.00 0.00 ? 39  ASN A HA   1  
ATOM 315   H HB2  . ASN A 1 20  ? 4.446   -6.377  -6.759  2.00 0.00 ? 39  ASN A HB2  1  
ATOM 316   H HB3  . ASN A 1 20  ? 4.524   -5.318  -8.162  2.00 0.00 ? 39  ASN A HB3  1  
ATOM 317   H HD21 . ASN A 1 20  ? 5.814   -6.382  -9.510  5.00 0.00 ? 39  ASN A HD21 1  
ATOM 318   H HD22 . ASN A 1 20  ? 7.427   -6.900  -9.145  5.00 0.00 ? 39  ASN A HD22 1  
ATOM 319   N N    . GLY A 1 21  ? 5.309   -1.997  -6.596  1.00 0.00 ? 40  GLY A N    1  
ATOM 320   C CA   . GLY A 1 21  ? 5.719   -0.779  -7.260  1.00 0.00 ? 40  GLY A CA   1  
ATOM 321   C C    . GLY A 1 21  ? 6.772   -0.034  -6.470  1.00 0.00 ? 40  GLY A C    1  
ATOM 322   O O    . GLY A 1 21  ? 7.653   0.599   -7.049  1.00 0.00 ? 40  GLY A O    1  
ATOM 323   H H    . GLY A 1 21  ? 4.813   -1.950  -5.753  1.00 0.00 ? 40  GLY A H    1  
ATOM 324   H HA2  . GLY A 1 21  ? 6.118   -1.025  -8.232  2.00 0.00 ? 40  GLY A HA2  1  
ATOM 325   H HA3  . GLY A 1 21  ? 4.857   -0.140  -7.385  2.00 0.00 ? 40  GLY A HA3  1  
ATOM 326   N N    . ARG A 1 22  ? 6.687   -0.121  -5.143  1.00 0.00 ? 41  ARG A N    1  
ATOM 327   C CA   . ARG A 1 22  ? 7.649   0.547   -4.271  1.00 0.00 ? 41  ARG A CA   1  
ATOM 328   C C    . ARG A 1 22  ? 8.196   1.799   -4.945  1.00 0.00 ? 41  ARG A C    1  
ATOM 329   O O    . ARG A 1 22  ? 9.217   1.747   -5.631  1.00 0.00 ? 41  ARG A O    1  
ATOM 330   C CB   . ARG A 1 22  ? 8.791   -0.409  -3.937  1.00 0.00 ? 41  ARG A CB   1  
ATOM 331   C CG   . ARG A 1 22  ? 9.041   -1.453  -5.010  1.00 0.00 ? 41  ARG A CG   1  
ATOM 332   C CD   . ARG A 1 22  ? 10.484  -1.931  -5.012  1.00 0.00 ? 41  ARG A CD   1  
ATOM 333   N NE   . ARG A 1 22  ? 11.374  -1.002  -5.702  1.00 0.00 ? 41  ARG A NE   1  
ATOM 334   C CZ   . ARG A 1 22  ? 12.681  -1.197  -5.837  4.00 0.00 ? 41  ARG A CZ   1  
ATOM 335   N NH1  . ARG A 1 22  ? 13.253  -2.282  -5.334  5.00 0.00 ? 41  ARG A NH1  1  
ATOM 336   N NH2  . ARG A 1 22  ? 13.429  -0.308  -6.478  5.00 0.00 ? 41  ARG A NH2  1  
ATOM 337   H H    . ARG A 1 22  ? 5.965   -0.653  -4.744  1.00 0.00 ? 41  ARG A H    1  
ATOM 338   H HA   . ARG A 1 22  ? 7.141   0.828   -3.360  1.00 0.00 ? 41  ARG A HA   1  
ATOM 339   H HB2  . ARG A 1 22  ? 9.697   0.163   -3.803  2.00 0.00 ? 41  ARG A HB2  1  
ATOM 340   H HB3  . ARG A 1 22  ? 8.561   -0.919  -3.014  2.00 0.00 ? 41  ARG A HB3  1  
ATOM 341   H HG2  . ARG A 1 22  ? 8.390   -2.299  -4.832  2.00 0.00 ? 41  ARG A HG2  1  
ATOM 342   H HG3  . ARG A 1 22  ? 8.812   -1.018  -5.974  2.00 0.00 ? 41  ARG A HG3  1  
ATOM 343   H HD2  . ARG A 1 22  ? 10.815  -2.038  -3.989  2.00 0.00 ? 41  ARG A HD2  1  
ATOM 344   H HD3  . ARG A 1 22  ? 10.531  -2.891  -5.503  2.00 0.00 ? 41  ARG A HD3  1  
ATOM 345   H HE   . ARG A 1 22  ? 10.976  -0.192  -6.085  1.00 0.00 ? 41  ARG A HE   1  
ATOM 346   H HH11 . ARG A 1 22  ? 12.700  -2.960  -4.849  5.00 0.00 ? 41  ARG A HH11 1  
ATOM 347   H HH12 . ARG A 1 22  ? 14.238  -2.423  -5.439  5.00 0.00 ? 41  ARG A HH12 1  
ATOM 348   H HH21 . ARG A 1 22  ? 13.008  0.513   -6.863  5.00 0.00 ? 41  ARG A HH21 1  
ATOM 349   H HH22 . ARG A 1 22  ? 14.412  -0.460  -6.577  5.00 0.00 ? 41  ARG A HH22 1  
ATOM 350   N N    . TYR A 1 23  ? 7.495   2.915   -4.769  1.00 0.00 ? 42  TYR A N    1  
ATOM 351   C CA   . TYR A 1 23  ? 7.891   4.173   -5.384  1.00 0.00 ? 42  TYR A CA   1  
ATOM 352   C C    . TYR A 1 23  ? 7.432   4.196   -6.834  1.00 0.00 ? 42  TYR A C    1  
ATOM 353   O O    . TYR A 1 23  ? 7.546   5.210   -7.522  1.00 0.00 ? 42  TYR A O    1  
ATOM 354   C CB   . TYR A 1 23  ? 9.407   4.374   -5.301  1.00 0.00 ? 42  TYR A CB   1  
ATOM 355   C CG   . TYR A 1 23  ? 9.931   4.851   -3.965  1.00 0.00 ? 42  TYR A CG   1  
ATOM 356   C CD1  . TYR A 1 23  ? 9.066   5.330   -2.986  1.00 0.00 ? 42  TYR A CD1  1  
ATOM 357   C CD2  . TYR A 1 23  ? 11.290  4.824   -3.682  1.00 0.00 ? 42  TYR A CD2  1  
ATOM 358   C CE1  . TYR A 1 23  ? 9.544   5.768   -1.765  1.00 0.00 ? 42  TYR A CE1  1  
ATOM 359   C CE2  . TYR A 1 23  ? 11.775  5.259   -2.463  1.00 0.00 ? 42  TYR A CE2  1  
ATOM 360   C CZ   . TYR A 1 23  ? 10.898  5.730   -1.509  1.00 0.00 ? 42  TYR A CZ   1  
ATOM 361   O OH   . TYR A 1 23  ? 11.377  6.164   -0.294  1.00 0.00 ? 42  TYR A OH   1  
ATOM 362   H H    . TYR A 1 23  ? 6.679   2.886   -4.230  1.00 0.00 ? 42  TYR A H    1  
ATOM 363   H HA   . TYR A 1 23  ? 7.398   4.972   -4.849  1.00 0.00 ? 42  TYR A HA   1  
ATOM 364   H HB2  . TYR A 1 23  ? 9.895   3.438   -5.527  2.00 0.00 ? 42  TYR A HB2  1  
ATOM 365   H HB3  . TYR A 1 23  ? 9.700   5.102   -6.044  2.00 0.00 ? 42  TYR A HB3  1  
ATOM 366   H HD1  . TYR A 1 23  ? 8.005   5.359   -3.190  1.00 0.00 ? 42  TYR A HD1  1  
ATOM 367   H HD2  . TYR A 1 23  ? 11.975  4.455   -4.432  1.00 0.00 ? 42  TYR A HD2  1  
ATOM 368   H HE1  . TYR A 1 23  ? 8.857   6.137   -1.018  1.00 0.00 ? 42  TYR A HE1  1  
ATOM 369   H HE2  . TYR A 1 23  ? 12.836  5.229   -2.262  1.00 0.00 ? 42  TYR A HE2  1  
ATOM 370   H HH   . TYR A 1 23  ? 11.693  5.412   0.213   1.00 0.00 ? 42  TYR A HH   1  
ATOM 371   N N    . SER A 1 24  ? 6.903   3.061   -7.286  1.00 0.00 ? 43  SER A N    1  
ATOM 372   C CA   . SER A 1 24  ? 6.409   2.935   -8.650  1.00 0.00 ? 43  SER A CA   1  
ATOM 373   C C    . SER A 1 24  ? 4.992   2.366   -8.661  1.00 0.00 ? 43  SER A C    1  
ATOM 374   O O    . SER A 1 24  ? 4.583   1.715   -9.624  1.00 0.00 ? 43  SER A O    1  
ATOM 375   C CB   . SER A 1 24  ? 7.339   2.041   -9.474  1.00 0.00 ? 43  SER A CB   1  
ATOM 376   O OG   . SER A 1 24  ? 8.082   2.801   -10.411 1.00 0.00 ? 43  SER A OG   1  
ATOM 377   H H    . SER A 1 24  ? 6.841   2.288   -6.682  1.00 0.00 ? 43  SER A H    1  
ATOM 378   H HA   . SER A 1 24  ? 6.391   3.922   -9.089  1.00 0.00 ? 43  SER A HA   1  
ATOM 379   H HB2  . SER A 1 24  ? 8.027   1.535   -8.812  2.00 0.00 ? 43  SER A HB2  1  
ATOM 380   H HB3  . SER A 1 24  ? 6.751   1.309   -10.008 2.00 0.00 ? 43  SER A HB3  1  
ATOM 381   H HG   . SER A 1 24  ? 8.647   2.216   -10.921 1.00 0.00 ? 43  SER A HG   1  
ATOM 382   N N    . ILE A 1 25  ? 4.243   2.614   -7.586  1.00 0.00 ? 44  ILE A N    1  
ATOM 383   C CA   . ILE A 1 25  ? 2.873   2.124   -7.480  1.00 0.00 ? 44  ILE A CA   1  
ATOM 384   C C    . ILE A 1 25  ? 1.869   3.216   -7.831  1.00 0.00 ? 44  ILE A C    1  
ATOM 385   O O    . ILE A 1 25  ? 2.050   4.379   -7.468  1.00 0.00 ? 44  ILE A O    1  
ATOM 386   C CB   . ILE A 1 25  ? 2.564   1.602   -6.067  1.00 0.00 ? 44  ILE A CB   1  
ATOM 387   C CG1  . ILE A 1 25  ? 3.761   0.834   -5.505  1.00 0.00 ? 44  ILE A CG1  1  
ATOM 388   C CG2  . ILE A 1 25  ? 1.324   0.720   -6.086  1.00 0.00 ? 44  ILE A CG2  1  
ATOM 389   C CD1  . ILE A 1 25  ? 4.065   1.135   -4.054  1.00 0.00 ? 44  ILE A CD1  1  
ATOM 390   H H    . ILE A 1 25  ? 4.621   3.140   -6.848  1.00 0.00 ? 44  ILE A H    1  
ATOM 391   H HA   . ILE A 1 25  ? 2.757   1.308   -8.173  1.00 0.00 ? 44  ILE A HA   1  
ATOM 392   H HB   . ILE A 1 25  ? 2.361   2.449   -5.437  1.00 0.00 ? 44  ILE A HB   1  
ATOM 393   H HG12 . ILE A 1 25  ? 3.571   -0.226  -5.589  2.00 0.00 ? 44  ILE A HG12 1  
ATOM 394   H HG13 . ILE A 1 25  ? 4.640   1.079   -6.083  2.00 0.00 ? 44  ILE A HG13 1  
ATOM 395   H HG21 . ILE A 1 25  ? 1.509   -0.174  -5.510  1.00 0.00 ? 44  ILE A HG21 1  
ATOM 396   H HG22 . ILE A 1 25  ? 1.090   0.450   -7.105  1.00 0.00 ? 44  ILE A HG22 1  
ATOM 397   H HG23 . ILE A 1 25  ? 0.493   1.259   -5.657  1.00 0.00 ? 44  ILE A HG23 1  
ATOM 398   H HD11 . ILE A 1 25  ? 4.864   0.493   -3.713  1.00 0.00 ? 44  ILE A HD11 1  
ATOM 399   H HD12 . ILE A 1 25  ? 3.182   0.959   -3.457  1.00 0.00 ? 44  ILE A HD12 1  
ATOM 400   H HD13 . ILE A 1 25  ? 4.367   2.167   -3.956  1.00 0.00 ? 44  ILE A HD13 1  
ATOM 401   N N    . SER A 1 26  ? 0.811   2.833   -8.538  1.00 0.00 ? 45  SER A N    1  
ATOM 402   C CA   . SER A 1 26  ? -0.225  3.778   -8.937  1.00 0.00 ? 45  SER A CA   1  
ATOM 403   C C    . SER A 1 26  ? -1.465  3.627   -8.061  1.00 0.00 ? 45  SER A C    1  
ATOM 404   O O    . SER A 1 26  ? -1.590  2.663   -7.308  1.00 0.00 ? 45  SER A O    1  
ATOM 405   C CB   . SER A 1 26  ? -0.596  3.569   -10.407 1.00 0.00 ? 45  SER A CB   1  
ATOM 406   O OG   . SER A 1 26  ? -1.098  4.763   -10.981 1.00 0.00 ? 45  SER A OG   1  
ATOM 407   H H    . SER A 1 26  ? 0.723   1.891   -8.795  1.00 0.00 ? 45  SER A H    1  
ATOM 408   H HA   . SER A 1 26  ? 0.170   4.775   -8.813  1.00 0.00 ? 45  SER A HA   1  
ATOM 409   H HB2  . SER A 1 26  ? 0.281   3.261   -10.957 2.00 0.00 ? 45  SER A HB2  1  
ATOM 410   H HB3  . SER A 1 26  ? -1.354  2.803   -10.479 2.00 0.00 ? 45  SER A HB3  1  
ATOM 411   H HG   . SER A 1 26  ? -1.823  4.554   -11.574 1.00 0.00 ? 45  SER A HG   1  
ATOM 412   N N    . ARG A 1 27  ? -2.376  4.588   -8.165  1.00 0.00 ? 46  ARG A N    1  
ATOM 413   C CA   . ARG A 1 27  ? -3.606  4.565   -7.380  1.00 0.00 ? 46  ARG A CA   1  
ATOM 414   C C    . ARG A 1 27  ? -4.487  3.383   -7.775  1.00 0.00 ? 46  ARG A C    1  
ATOM 415   O O    . ARG A 1 27  ? -5.153  2.786   -6.931  1.00 0.00 ? 46  ARG A O    1  
ATOM 416   C CB   . ARG A 1 27  ? -4.377  5.873   -7.565  1.00 0.00 ? 46  ARG A CB   1  
ATOM 417   C CG   . ARG A 1 27  ? -4.765  6.543   -6.257  1.00 0.00 ? 46  ARG A CG   1  
ATOM 418   C CD   . ARG A 1 27  ? -5.708  7.715   -6.479  1.00 0.00 ? 46  ARG A CD   1  
ATOM 419   N NE   . ARG A 1 27  ? -7.074  7.276   -6.746  1.00 0.00 ? 46  ARG A NE   1  
ATOM 420   C CZ   . ARG A 1 27  ? -8.104  8.108   -6.871  4.00 0.00 ? 46  ARG A CZ   1  
ATOM 421   N NH1  . ARG A 1 27  ? -7.927  9.417   -6.754  5.00 0.00 ? 46  ARG A NH1  1  
ATOM 422   N NH2  . ARG A 1 27  ? -9.320  7.638   -7.114  5.00 0.00 ? 46  ARG A NH2  1  
ATOM 423   H H    . ARG A 1 27  ? -2.218  5.332   -8.783  1.00 0.00 ? 46  ARG A H    1  
ATOM 424   H HA   . ARG A 1 27  ? -3.333  4.462   -6.341  1.00 0.00 ? 46  ARG A HA   1  
ATOM 425   H HB2  . ARG A 1 27  ? -3.765  6.561   -8.129  2.00 0.00 ? 46  ARG A HB2  1  
ATOM 426   H HB3  . ARG A 1 27  ? -5.280  5.669   -8.122  2.00 0.00 ? 46  ARG A HB3  1  
ATOM 427   H HG2  . ARG A 1 27  ? -5.254  5.817   -5.624  2.00 0.00 ? 46  ARG A HG2  1  
ATOM 428   H HG3  . ARG A 1 27  ? -3.871  6.901   -5.769  2.00 0.00 ? 46  ARG A HG3  1  
ATOM 429   H HD2  . ARG A 1 27  ? -5.705  8.335   -5.595  2.00 0.00 ? 46  ARG A HD2  1  
ATOM 430   H HD3  . ARG A 1 27  ? -5.354  8.292   -7.321  2.00 0.00 ? 46  ARG A HD3  1  
ATOM 431   H HE   . ARG A 1 27  ? -7.233  6.313   -6.837  1.00 0.00 ? 46  ARG A HE   1  
ATOM 432   H HH11 . ARG A 1 27  ? -7.015  9.784   -6.570  5.00 0.00 ? 46  ARG A HH11 1  
ATOM 433   H HH12 . ARG A 1 27  ? -8.706  10.037  -6.849  5.00 0.00 ? 46  ARG A HH12 1  
ATOM 434   H HH21 . ARG A 1 27  ? -9.466  6.652   -7.204  5.00 0.00 ? 46  ARG A HH21 1  
ATOM 435   H HH22 . ARG A 1 27  ? -10.090 8.268   -7.206  5.00 0.00 ? 46  ARG A HH22 1  
ATOM 436   N N    . THR A 1 28  ? -4.489  3.055   -9.062  1.00 0.00 ? 47  THR A N    1  
ATOM 437   C CA   . THR A 1 28  ? -5.292  1.947   -9.568  1.00 0.00 ? 47  THR A CA   1  
ATOM 438   C C    . THR A 1 28  ? -5.053  0.673   -8.764  1.00 0.00 ? 47  THR A C    1  
ATOM 439   O O    . THR A 1 28  ? -5.942  0.197   -8.057  1.00 0.00 ? 47  THR A O    1  
ATOM 440   C CB   . THR A 1 28  ? -4.990  1.666   -11.051 1.00 0.00 ? 47  THR A CB   1  
ATOM 441   O OG1  . THR A 1 28  ? -3.797  2.352   -11.448 1.00 0.00 ? 47  THR A OG1  1  
ATOM 442   C CG2  . THR A 1 28  ? -6.149  2.104   -11.933 1.00 0.00 ? 47  THR A CG2  1  
ATOM 443   H H    . THR A 1 28  ? -3.939  3.570   -9.688  1.00 0.00 ? 47  THR A H    1  
ATOM 444   H HA   . THR A 1 28  ? -6.333  2.225   -9.481  1.00 0.00 ? 47  THR A HA   1  
ATOM 445   H HB   . THR A 1 28  ? -4.843  0.603   -11.178 1.00 0.00 ? 47  THR A HB   1  
ATOM 446   H HG1  . THR A 1 28  ? -3.997  3.278   -11.604 1.00 0.00 ? 47  THR A HG1  1  
ATOM 447   H HG21 . THR A 1 28  ? -6.005  1.723   -12.933 1.00 0.00 ? 47  THR A HG21 1  
ATOM 448   H HG22 . THR A 1 28  ? -6.191  3.183   -11.962 1.00 0.00 ? 47  THR A HG22 1  
ATOM 449   H HG23 . THR A 1 28  ? -7.074  1.719   -11.530 1.00 0.00 ? 47  THR A HG23 1  
ATOM 450   N N    . GLU A 1 29  ? -3.849  0.123   -8.880  1.00 0.00 ? 48  GLU A N    1  
ATOM 451   C CA   . GLU A 1 29  ? -3.494  -1.100  -8.168  1.00 0.00 ? 48  GLU A CA   1  
ATOM 452   C C    . GLU A 1 29  ? -3.560  -0.896  -6.658  1.00 0.00 ? 48  GLU A C    1  
ATOM 453   O O    . GLU A 1 29  ? -4.244  -1.637  -5.951  1.00 0.00 ? 48  GLU A O    1  
ATOM 454   C CB   . GLU A 1 29  ? -2.091  -1.558  -8.572  1.00 0.00 ? 48  GLU A CB   1  
ATOM 455   C CG   . GLU A 1 29  ? -1.928  -1.941  -10.034 1.00 0.00 ? 48  GLU A CG   1  
ATOM 456   C CD   . GLU A 1 29  ? -0.548  -1.618  -10.574 1.00 0.00 ? 48  GLU A CD   1  
ATOM 457   O OE1  . GLU A 1 29  ? -0.289  -0.432  -10.869 1.00 0.00 ? 48  GLU A OE1  1  
ATOM 458   O OE2  . GLU A 1 29  ? 0.272   -2.550  -10.702 1.00 0.00 ? 48  GLU A OE2  1  
ATOM 459   H H    . GLU A 1 29  ? -3.184  0.548   -9.461  1.00 0.00 ? 48  GLU A H    1  
ATOM 460   H HA   . GLU A 1 29  ? -4.205  -1.863  -8.447  1.00 0.00 ? 48  GLU A HA   1  
ATOM 461   H HB2  . GLU A 1 29  ? -1.395  -0.762  -8.356  2.00 0.00 ? 48  GLU A HB2  1  
ATOM 462   H HB3  . GLU A 1 29  ? -1.825  -2.415  -7.972  2.00 0.00 ? 48  GLU A HB3  1  
ATOM 463   H HG2  . GLU A 1 29  ? -2.097  -3.002  -10.135 2.00 0.00 ? 48  GLU A HG2  1  
ATOM 464   H HG3  . GLU A 1 29  ? -2.661  -1.404  -10.617 2.00 0.00 ? 48  GLU A HG3  1  
ATOM 465   N N    . ALA A 1 30  ? -2.845  0.112   -6.170  1.00 0.00 ? 49  ALA A N    1  
ATOM 466   C CA   . ALA A 1 30  ? -2.822  0.413   -4.743  1.00 0.00 ? 49  ALA A CA   1  
ATOM 467   C C    . ALA A 1 30  ? -4.229  0.462   -4.166  1.00 0.00 ? 49  ALA A C    1  
ATOM 468   O O    . ALA A 1 30  ? -4.632  -0.419  -3.407  1.00 0.00 ? 49  ALA A O    1  
ATOM 469   C CB   . ALA A 1 30  ? -2.121  1.738   -4.493  1.00 0.00 ? 49  ALA A CB   1  
ATOM 470   H H    . ALA A 1 30  ? -2.319  0.667   -6.784  1.00 0.00 ? 49  ALA A H    1  
ATOM 471   H HA   . ALA A 1 30  ? -2.262  -0.365  -4.244  1.00 0.00 ? 49  ALA A HA   1  
ATOM 472   H HB1  . ALA A 1 30  ? -1.779  2.148   -5.431  1.00 0.00 ? 49  ALA A HB1  1  
ATOM 473   H HB2  . ALA A 1 30  ? -1.277  1.581   -3.838  1.00 0.00 ? 49  ALA A HB2  1  
ATOM 474   H HB3  . ALA A 1 30  ? -2.815  2.426   -4.029  1.00 0.00 ? 49  ALA A HB3  1  
ATOM 475   N N    . ALA A 1 31  ? -4.965  1.506   -4.527  1.00 0.00 ? 50  ALA A N    1  
ATOM 476   C CA   . ALA A 1 31  ? -6.326  1.690   -4.043  1.00 0.00 ? 50  ALA A CA   1  
ATOM 477   C C    . ALA A 1 31  ? -7.108  0.380   -4.070  1.00 0.00 ? 50  ALA A C    1  
ATOM 478   O O    . ALA A 1 31  ? -7.898  0.099   -3.168  1.00 0.00 ? 50  ALA A O    1  
ATOM 479   C CB   . ALA A 1 31  ? -7.039  2.750   -4.868  1.00 0.00 ? 50  ALA A CB   1  
ATOM 480   H H    . ALA A 1 31  ? -4.580  2.177   -5.129  1.00 0.00 ? 50  ALA A H    1  
ATOM 481   H HA   . ALA A 1 31  ? -6.265  2.042   -3.024  1.00 0.00 ? 50  ALA A HA   1  
ATOM 482   H HB1  . ALA A 1 31  ? -6.510  3.688   -4.783  1.00 0.00 ? 50  ALA A HB1  1  
ATOM 483   H HB2  . ALA A 1 31  ? -8.049  2.872   -4.503  1.00 0.00 ? 50  ALA A HB2  1  
ATOM 484   H HB3  . ALA A 1 31  ? -7.065  2.444   -5.903  1.00 0.00 ? 50  ALA A HB3  1  
ATOM 485   N N    . ASP A 1 32  ? -6.884  -0.419  -5.110  1.00 0.00 ? 51  ASP A N    1  
ATOM 486   C CA   . ASP A 1 32  ? -7.570  -1.699  -5.254  1.00 0.00 ? 51  ASP A CA   1  
ATOM 487   C C    . ASP A 1 32  ? -7.359  -2.573  -4.021  1.00 0.00 ? 51  ASP A C    1  
ATOM 488   O O    . ASP A 1 32  ? -8.305  -3.160  -3.496  1.00 0.00 ? 51  ASP A O    1  
ATOM 489   C CB   . ASP A 1 32  ? -7.075  -2.429  -6.504  1.00 0.00 ? 51  ASP A CB   1  
ATOM 490   C CG   . ASP A 1 32  ? -8.066  -2.361  -7.649  1.00 0.00 ? 51  ASP A CG   1  
ATOM 491   O OD1  . ASP A 1 32  ? -9.265  -2.622  -7.413  1.00 0.00 ? 51  ASP A OD1  1  
ATOM 492   O OD2  . ASP A 1 32  ? -7.644  -2.048  -8.782  1.00 0.00 ? 51  ASP A OD2  1  
ATOM 493   H H    . ASP A 1 32  ? -6.244  -0.140  -5.797  1.00 0.00 ? 51  ASP A H    1  
ATOM 494   H HA   . ASP A 1 32  ? -8.625  -1.498  -5.360  1.00 0.00 ? 51  ASP A HA   1  
ATOM 495   H HB2  . ASP A 1 32  ? -6.147  -1.982  -6.830  2.00 0.00 ? 51  ASP A HB2  1  
ATOM 496   H HB3  . ASP A 1 32  ? -6.903  -3.467  -6.262  2.00 0.00 ? 51  ASP A HB3  1  
ATOM 497   N N    . LEU A 1 33  ? -6.114  -2.655  -3.565  1.00 0.00 ? 52  LEU A N    1  
ATOM 498   C CA   . LEU A 1 33  ? -5.782  -3.458  -2.393  1.00 0.00 ? 52  LEU A CA   1  
ATOM 499   C C    . LEU A 1 33  ? -6.279  -2.790  -1.118  1.00 0.00 ? 52  LEU A C    1  
ATOM 500   O O    . LEU A 1 33  ? -6.963  -3.412  -0.296  1.00 0.00 ? 52  LEU A O    1  
ATOM 501   C CB   . LEU A 1 33  ? -4.275  -3.672  -2.307  1.00 0.00 ? 52  LEU A CB   1  
ATOM 502   C CG   . LEU A 1 33  ? -3.786  -4.813  -1.420  1.00 0.00 ? 52  LEU A CG   1  
ATOM 503   C CD1  . LEU A 1 33  ? -2.440  -5.328  -1.902  2.00 0.00 ? 52  LEU A CD1  1  
ATOM 504   C CD2  . LEU A 1 33  ? -3.699  -4.374  0.032   2.00 0.00 ? 52  LEU A CD2  1  
ATOM 505   H H    . LEU A 1 33  ? -5.402  -2.164  -4.026  1.00 0.00 ? 52  LEU A H    1  
ATOM 506   H HA   . LEU A 1 33  ? -6.268  -4.416  -2.498  1.00 0.00 ? 52  LEU A HA   1  
ATOM 507   H HB2  . LEU A 1 33  ? -3.906  -3.848  -3.307  2.00 0.00 ? 52  LEU A HB2  1  
ATOM 508   H HB3  . LEU A 1 33  ? -3.829  -2.757  -1.948  2.00 0.00 ? 52  LEU A HB3  1  
ATOM 509   H HG   . LEU A 1 33  ? -4.504  -5.616  -1.486  1.00 0.00 ? 52  LEU A HG   1  
ATOM 510   H HD11 . LEU A 1 33  ? -2.572  -5.866  -2.830  1.00 0.00 ? 52  LEU A HD11 1  
ATOM 511   H HD12 . LEU A 1 33  ? -2.021  -5.990  -1.159  1.00 0.00 ? 52  LEU A HD12 1  
ATOM 512   H HD13 . LEU A 1 33  ? -1.772  -4.495  -2.061  1.00 0.00 ? 52  LEU A HD13 1  
ATOM 513   H HD21 . LEU A 1 33  ? -3.026  -5.029  0.567   1.00 0.00 ? 52  LEU A HD21 1  
ATOM 514   H HD22 . LEU A 1 33  ? -4.680  -4.421  0.482   1.00 0.00 ? 52  LEU A HD22 1  
ATOM 515   H HD23 . LEU A 1 33  ? -3.330  -3.361  0.081   1.00 0.00 ? 52  LEU A HD23 1  
ATOM 516   N N    . CYS A 1 34  ? -5.937  -1.515  -0.961  1.00 0.00 ? 53  CYS A N    1  
ATOM 517   C CA   . CYS A 1 34  ? -6.359  -0.760  0.205   1.00 0.00 ? 53  CYS A CA   1  
ATOM 518   C C    . CYS A 1 34  ? -7.827  -1.045  0.483   1.00 0.00 ? 53  CYS A C    1  
ATOM 519   O O    . CYS A 1 34  ? -8.275  -1.026  1.628   1.00 0.00 ? 53  CYS A O    1  
ATOM 520   C CB   . CYS A 1 34  ? -6.135  0.736   -0.023  1.00 0.00 ? 53  CYS A CB   1  
ATOM 521   S SG   . CYS A 1 34  ? -7.608  1.790   0.171   1.00 0.00 ? 53  CYS A SG   1  
ATOM 522   H H    . CYS A 1 34  ? -5.397  -1.074  -1.649  1.00 0.00 ? 53  CYS A H    1  
ATOM 523   H HA   . CYS A 1 34  ? -5.769  -1.086  1.050   1.00 0.00 ? 53  CYS A HA   1  
ATOM 524   H HB2  . CYS A 1 34  ? -5.391  1.087   0.676   2.00 0.00 ? 53  CYS A HB2  1  
ATOM 525   H HB3  . CYS A 1 34  ? -5.763  0.883   -1.026  2.00 0.00 ? 53  CYS A HB3  1  
ATOM 526   N N    . LYS A 1 35  ? -8.560  -1.338  -0.585  1.00 0.00 ? 54  LYS A N    1  
ATOM 527   C CA   . LYS A 1 35  ? -9.975  -1.665  -0.483  1.00 0.00 ? 54  LYS A CA   1  
ATOM 528   C C    . LYS A 1 35  ? -10.144 -3.167  -0.296  1.00 0.00 ? 54  LYS A C    1  
ATOM 529   O O    . LYS A 1 35  ? -11.091 -3.628  0.341   1.00 0.00 ? 54  LYS A O    1  
ATOM 530   C CB   . LYS A 1 35  ? -10.724 -1.200  -1.735  1.00 0.00 ? 54  LYS A CB   1  
ATOM 531   C CG   . LYS A 1 35  ? -11.014 -2.290  -2.755  1.00 0.00 ? 54  LYS A CG   1  
ATOM 532   C CD   . LYS A 1 35  ? -12.264 -2.000  -3.568  1.00 0.00 ? 54  LYS A CD   1  
ATOM 533   C CE   . LYS A 1 35  ? -13.249 -3.158  -3.538  1.00 0.00 ? 54  LYS A CE   1  
ATOM 534   N NZ   . LYS A 1 35  ? -14.650 -2.693  -3.343  1.00 0.00 ? 54  LYS A NZ   1  
ATOM 535   H H    . LYS A 1 35  ? -8.127  -1.361  -1.465  1.00 0.00 ? 54  LYS A H    1  
ATOM 536   H HA   . LYS A 1 35  ? -10.375 -1.156  0.382   1.00 0.00 ? 54  LYS A HA   1  
ATOM 537   H HB2  . LYS A 1 35  ? -11.665 -0.767  -1.431  2.00 0.00 ? 54  LYS A HB2  1  
ATOM 538   H HB3  . LYS A 1 35  ? -10.137 -0.435  -2.221  2.00 0.00 ? 54  LYS A HB3  1  
ATOM 539   H HG2  . LYS A 1 35  ? -10.172 -2.371  -3.426  2.00 0.00 ? 54  LYS A HG2  1  
ATOM 540   H HG3  . LYS A 1 35  ? -11.146 -3.227  -2.235  2.00 0.00 ? 54  LYS A HG3  1  
ATOM 541   H HD2  . LYS A 1 35  ? -12.747 -1.122  -3.166  2.00 0.00 ? 54  LYS A HD2  1  
ATOM 542   H HD3  . LYS A 1 35  ? -11.978 -1.813  -4.593  2.00 0.00 ? 54  LYS A HD3  1  
ATOM 543   H HE2  . LYS A 1 35  ? -13.184 -3.694  -4.473  2.00 0.00 ? 54  LYS A HE2  1  
ATOM 544   H HE3  . LYS A 1 35  ? -12.983 -3.819  -2.726  2.00 0.00 ? 54  LYS A HE3  1  
ATOM 545   H HZ1  . LYS A 1 35  ? -14.858 -2.602  -2.328  1.00 0.00 ? 54  LYS A HZ1  1  
ATOM 546   H HZ2  . LYS A 1 35  ? -15.314 -3.374  -3.762  1.00 0.00 ? 54  LYS A HZ2  1  
ATOM 547   H HZ3  . LYS A 1 35  ? -14.786 -1.768  -3.799  1.00 0.00 ? 54  LYS A HZ3  1  
ATOM 548   N N    . ALA A 1 36  ? -9.206  -3.921  -0.864  1.00 0.00 ? 55  ALA A N    1  
ATOM 549   C CA   . ALA A 1 36  ? -9.222  -5.375  -0.780  1.00 0.00 ? 55  ALA A CA   1  
ATOM 550   C C    . ALA A 1 36  ? -9.546  -5.846  0.631   1.00 0.00 ? 55  ALA A C    1  
ATOM 551   O O    . ALA A 1 36  ? -10.297 -6.801  0.811   1.00 0.00 ? 55  ALA A O    1  
ATOM 552   C CB   . ALA A 1 36  ? -7.888  -5.944  -1.237  1.00 0.00 ? 55  ALA A CB   1  
ATOM 553   H H    . ALA A 1 36  ? -8.481  -3.484  -1.358  1.00 0.00 ? 55  ALA A H    1  
ATOM 554   H HA   . ALA A 1 36  ? -9.988  -5.737  -1.451  1.00 0.00 ? 55  ALA A HA   1  
ATOM 555   H HB1  . ALA A 1 36  ? -7.934  -7.023  -1.226  1.00 0.00 ? 55  ALA A HB1  1  
ATOM 556   H HB2  . ALA A 1 36  ? -7.106  -5.610  -0.571  1.00 0.00 ? 55  ALA A HB2  1  
ATOM 557   H HB3  . ALA A 1 36  ? -7.676  -5.604  -2.240  1.00 0.00 ? 55  ALA A HB3  1  
ATOM 558   N N    . PHE A 1 37  ? -8.980  -5.179  1.633   1.00 0.00 ? 56  PHE A N    1  
ATOM 559   C CA   . PHE A 1 37  ? -9.241  -5.563  3.018   1.00 0.00 ? 56  PHE A CA   1  
ATOM 560   C C    . PHE A 1 37  ? -10.149 -4.559  3.722   1.00 0.00 ? 56  PHE A C    1  
ATOM 561   O O    . PHE A 1 37  ? -9.794  -4.010  4.765   1.00 0.00 ? 56  PHE A O    1  
ATOM 562   C CB   . PHE A 1 37  ? -7.943  -5.746  3.804   1.00 0.00 ? 56  PHE A CB   1  
ATOM 563   C CG   . PHE A 1 37  ? -7.046  -4.547  3.874   1.00 0.00 ? 56  PHE A CG   1  
ATOM 564   C CD1  . PHE A 1 37  ? -6.457  -4.024  2.734   1.00 0.00 ? 56  PHE A CD1  1  
ATOM 565   C CD2  . PHE A 1 37  ? -6.769  -3.961  5.096   1.00 0.00 ? 56  PHE A CD2  1  
ATOM 566   C CE1  . PHE A 1 37  ? -5.610  -2.933  2.815   1.00 0.00 ? 56  PHE A CE1  1  
ATOM 567   C CE2  . PHE A 1 37  ? -5.921  -2.878  5.185   1.00 0.00 ? 56  PHE A CE2  1  
ATOM 568   C CZ   . PHE A 1 37  ? -5.340  -2.361  4.045   1.00 0.00 ? 56  PHE A CZ   1  
ATOM 569   H H    . PHE A 1 37  ? -8.381  -4.421  1.438   1.00 0.00 ? 56  PHE A H    1  
ATOM 570   H HA   . PHE A 1 37  ? -9.752  -6.512  2.989   1.00 0.00 ? 56  PHE A HA   1  
ATOM 571   H HB2  . PHE A 1 37  ? -8.195  -6.020  4.819   2.00 0.00 ? 56  PHE A HB2  1  
ATOM 572   H HB3  . PHE A 1 37  ? -7.379  -6.552  3.358   2.00 0.00 ? 56  PHE A HB3  1  
ATOM 573   H HD1  . PHE A 1 37  ? -6.668  -4.471  1.774   1.00 0.00 ? 56  PHE A HD1  1  
ATOM 574   H HD2  . PHE A 1 37  ? -7.223  -4.362  5.989   1.00 0.00 ? 56  PHE A HD2  1  
ATOM 575   H HE1  . PHE A 1 37  ? -5.157  -2.532  1.921   1.00 0.00 ? 56  PHE A HE1  1  
ATOM 576   H HE2  . PHE A 1 37  ? -5.712  -2.435  6.147   1.00 0.00 ? 56  PHE A HE2  1  
ATOM 577   H HZ   . PHE A 1 37  ? -4.660  -1.524  4.120   1.00 0.00 ? 56  PHE A HZ   1  
ATOM 578   N N    . ASN A 1 38  ? -11.330 -4.339  3.149   1.00 0.00 ? 57  ASN A N    1  
ATOM 579   C CA   . ASN A 1 38  ? -12.311 -3.417  3.716   1.00 0.00 ? 57  ASN A CA   1  
ATOM 580   C C    . ASN A 1 38  ? -11.639 -2.228  4.389   1.00 0.00 ? 57  ASN A C    1  
ATOM 581   O O    . ASN A 1 38  ? -11.454 -2.214  5.606   1.00 0.00 ? 57  ASN A O    1  
ATOM 582   C CB   . ASN A 1 38  ? -13.204 -4.146  4.723   1.00 0.00 ? 57  ASN A CB   1  
ATOM 583   C CG   . ASN A 1 38  ? -12.425 -5.105  5.602   1.00 0.00 ? 57  ASN A CG   1  
ATOM 584   O OD1  . ASN A 1 38  ? -11.980 -4.744  6.692   1.00 0.00 ? 57  ASN A OD1  1  
ATOM 585   N ND2  . ASN A 1 38  ? -12.256 -6.336  5.132   4.00 0.00 ? 57  ASN A ND2  1  
ATOM 586   H H    . ASN A 1 38  ? -11.553 -4.818  2.324   1.00 0.00 ? 57  ASN A H    1  
ATOM 587   H HA   . ASN A 1 38  ? -12.926 -3.054  2.906   1.00 0.00 ? 57  ASN A HA   1  
ATOM 588   H HB2  . ASN A 1 38  ? -13.688 -3.417  5.358   2.00 0.00 ? 57  ASN A HB2  1  
ATOM 589   H HB3  . ASN A 1 38  ? -13.956 -4.708  4.187   2.00 0.00 ? 57  ASN A HB3  1  
ATOM 590   H HD21 . ASN A 1 38  ? -12.639 -6.554  4.254   5.00 0.00 ? 57  ASN A HD21 1  
ATOM 591   H HD22 . ASN A 1 38  ? -11.755 -6.978  5.683   5.00 0.00 ? 57  ASN A HD22 1  
ATOM 592   N N    . SER A 1 39  ? -11.284 -1.228  3.592   1.00 0.00 ? 58  SER A N    1  
ATOM 593   C CA   . SER A 1 39  ? -10.639 -0.030  4.116   1.00 0.00 ? 58  SER A CA   1  
ATOM 594   C C    . SER A 1 39  ? -11.022 1.199   3.301   1.00 0.00 ? 58  SER A C    1  
ATOM 595   O O    . SER A 1 39  ? -11.631 1.086   2.237   1.00 0.00 ? 58  SER A O    1  
ATOM 596   C CB   . SER A 1 39  ? -9.120  -0.202  4.121   1.00 0.00 ? 58  SER A CB   1  
ATOM 597   O OG   . SER A 1 39  ? -8.759  -1.565  3.982   1.00 0.00 ? 58  SER A OG   1  
ATOM 598   H H    . SER A 1 39  ? -11.463 -1.296  2.631   1.00 0.00 ? 58  SER A H    1  
ATOM 599   H HA   . SER A 1 39  ? -10.980 0.110   5.130   1.00 0.00 ? 58  SER A HA   1  
ATOM 600   H HB2  . SER A 1 39  ? -8.694  0.355   3.300   2.00 0.00 ? 58  SER A HB2  1  
ATOM 601   H HB3  . SER A 1 39  ? -8.721  0.169   5.053   2.00 0.00 ? 58  SER A HB3  1  
ATOM 602   H HG   . SER A 1 39  ? -9.372  -2.111  4.480   1.00 0.00 ? 58  SER A HG   1  
ATOM 603   N N    . THR A 1 40  ? -10.662 2.373   3.809   1.00 0.00 ? 59  THR A N    1  
ATOM 604   C CA   . THR A 1 40  ? -10.970 3.624   3.130   1.00 0.00 ? 59  THR A CA   1  
ATOM 605   C C    . THR A 1 40  ? -9.702  4.422   2.852   1.00 0.00 ? 59  THR A C    1  
ATOM 606   O O    . THR A 1 40  ? -8.709  4.301   3.572   1.00 0.00 ? 59  THR A O    1  
ATOM 607   C CB   . THR A 1 40  ? -11.936 4.490   3.959   1.00 0.00 ? 59  THR A CB   1  
ATOM 608   O OG1  . THR A 1 40  ? -11.425 4.663   5.286   1.00 0.00 ? 59  THR A OG1  1  
ATOM 609   C CG2  . THR A 1 40  ? -13.315 3.850   4.021   1.00 0.00 ? 59  THR A CG2  1  
ATOM 610   H H    . THR A 1 40  ? -10.179 2.398   4.663   1.00 0.00 ? 59  THR A H    1  
ATOM 611   H HA   . THR A 1 40  ? -11.447 3.386   2.191   1.00 0.00 ? 59  THR A HA   1  
ATOM 612   H HB   . THR A 1 40  ? -12.026 5.457   3.486   1.00 0.00 ? 59  THR A HB   1  
ATOM 613   H HG1  . THR A 1 40  ? -11.955 5.315   5.750   1.00 0.00 ? 59  THR A HG1  1  
ATOM 614   H HG21 . THR A 1 40  ? -13.401 3.102   3.247   1.00 0.00 ? 59  THR A HG21 1  
ATOM 615   H HG22 . THR A 1 40  ? -14.071 4.608   3.875   1.00 0.00 ? 59  THR A HG22 1  
ATOM 616   H HG23 . THR A 1 40  ? -13.453 3.386   4.987   1.00 0.00 ? 59  THR A HG23 1  
ATOM 617   N N    . LEU A 1 41  ? -9.745  5.238   1.801   1.00 0.00 ? 60  LEU A N    1  
ATOM 618   C CA   . LEU A 1 41  ? -8.601  6.060   1.420   1.00 0.00 ? 60  LEU A CA   1  
ATOM 619   C C    . LEU A 1 41  ? -7.863  6.570   2.653   1.00 0.00 ? 60  LEU A C    1  
ATOM 620   O O    . LEU A 1 41  ? -8.471  6.821   3.693   1.00 0.00 ? 60  LEU A O    1  
ATOM 621   C CB   . LEU A 1 41  ? -9.057  7.241   0.560   1.00 0.00 ? 60  LEU A CB   1  
ATOM 622   C CG   . LEU A 1 41  ? -9.110  7.034   -0.955  1.00 0.00 ? 60  LEU A CG   1  
ATOM 623   C CD1  . LEU A 1 41  ? -10.548 6.906   -1.431  2.00 0.00 ? 60  LEU A CD1  1  
ATOM 624   C CD2  . LEU A 1 41  ? -8.405  8.171   -1.680  2.00 0.00 ? 60  LEU A CD2  1  
ATOM 625   H H    . LEU A 1 41  ? -10.566 5.287   1.269   1.00 0.00 ? 60  LEU A H    1  
ATOM 626   H HA   . LEU A 1 41  ? -7.929  5.444   0.842   1.00 0.00 ? 60  LEU A HA   1  
ATOM 627   H HB2  . LEU A 1 41  ? -10.045 7.528   0.889   2.00 0.00 ? 60  LEU A HB2  1  
ATOM 628   H HB3  . LEU A 1 41  ? -8.393  8.070   0.758   2.00 0.00 ? 60  LEU A HB3  1  
ATOM 629   H HG   . LEU A 1 41  ? -8.594  6.115   -1.187  1.00 0.00 ? 60  LEU A HG   1  
ATOM 630   H HD11 . LEU A 1 41  ? -11.218 7.057   -0.597  1.00 0.00 ? 60  LEU A HD11 1  
ATOM 631   H HD12 . LEU A 1 41  ? -10.704 5.920   -1.844  1.00 0.00 ? 60  LEU A HD12 1  
ATOM 632   H HD13 . LEU A 1 41  ? -10.744 7.649   -2.189  1.00 0.00 ? 60  LEU A HD13 1  
ATOM 633   H HD21 . LEU A 1 41  ? -9.118  8.704   -2.292  1.00 0.00 ? 60  LEU A HD21 1  
ATOM 634   H HD22 . LEU A 1 41  ? -7.623  7.769   -2.306  1.00 0.00 ? 60  LEU A HD22 1  
ATOM 635   H HD23 . LEU A 1 41  ? -7.975  8.848   -0.957  1.00 0.00 ? 60  LEU A HD23 1  
ATOM 636   N N    . PRO A 1 42  ? -6.537  6.730   2.547   1.00 0.00 ? 61  PRO A N    1  
ATOM 637   C CA   . PRO A 1 42  ? -5.708  7.214   3.654   1.00 0.00 ? 61  PRO A CA   1  
ATOM 638   C C    . PRO A 1 42  ? -6.132  8.600   4.125   1.00 0.00 ? 61  PRO A C    1  
ATOM 639   O O    . PRO A 1 42  ? -5.560  9.609   3.713   1.00 0.00 ? 61  PRO A O    1  
ATOM 640   C CB   . PRO A 1 42  ? -4.293  7.255   3.064   1.00 0.00 ? 61  PRO A CB   1  
ATOM 641   C CG   . PRO A 1 42  ? -4.483  7.235   1.586   1.00 0.00 ? 61  PRO A CG   1  
ATOM 642   C CD   . PRO A 1 42  ? -5.743  6.458   1.341   1.00 0.00 ? 61  PRO A CD   1  
ATOM 643   H HA   . PRO A 1 42  ? -5.732  6.531   4.491   1.00 0.00 ? 61  PRO A HA   1  
ATOM 644   H HB2  . PRO A 1 42  ? -3.795  8.158   3.385   1.00 0.00 ? 61  PRO A HB2  1  
ATOM 645   H HB3  . PRO A 1 42  ? -3.736  6.393   3.401   1.00 0.00 ? 61  PRO A HB3  1  
ATOM 646   H HG2  . PRO A 1 42  ? -4.588  8.244   1.215   1.00 0.00 ? 61  PRO A HG2  1  
ATOM 647   H HG3  . PRO A 1 42  ? -3.644  6.746   1.114   1.00 0.00 ? 61  PRO A HG3  1  
ATOM 648   H HD2  . PRO A 1 42  ? -6.246  6.820   0.456   1.00 0.00 ? 61  PRO A HD2  1  
ATOM 649   H HD3  . PRO A 1 42  ? -5.528  5.404   1.251   1.00 0.00 ? 61  PRO A HD3  1  
ATOM 650   N N    . THR A 1 43  ? -7.140  8.641   4.990   1.00 0.00 ? 62  THR A N    1  
ATOM 651   C CA   . THR A 1 43  ? -7.640  9.903   5.516   1.00 0.00 ? 62  THR A CA   1  
ATOM 652   C C    . THR A 1 43  ? -6.668  10.496  6.528   1.00 0.00 ? 62  THR A C    1  
ATOM 653   O O    . THR A 1 43  ? -5.767  9.811   7.013   1.00 0.00 ? 62  THR A O    1  
ATOM 654   C CB   . THR A 1 43  ? -9.017  9.730   6.183   1.00 0.00 ? 62  THR A CB   1  
ATOM 655   O OG1  . THR A 1 43  ? -9.739  8.667   5.551   1.00 0.00 ? 62  THR A OG1  1  
ATOM 656   C CG2  . THR A 1 43  ? -9.824  11.017  6.099   1.00 0.00 ? 62  THR A CG2  1  
ATOM 657   H H    . THR A 1 43  ? -7.556  7.803   5.281   1.00 0.00 ? 62  THR A H    1  
ATOM 658   H HA   . THR A 1 43  ? -7.748  10.590  4.689   1.00 0.00 ? 62  THR A HA   1  
ATOM 659   H HB   . THR A 1 43  ? -8.868  9.485   7.225   1.00 0.00 ? 62  THR A HB   1  
ATOM 660   H HG1  . THR A 1 43  ? -10.286 9.024   4.848   1.00 0.00 ? 62  THR A HG1  1  
ATOM 661   H HG21 . THR A 1 43  ? -10.768 10.819  5.613   1.00 0.00 ? 62  THR A HG21 1  
ATOM 662   H HG22 . THR A 1 43  ? -9.274  11.751  5.529   1.00 0.00 ? 62  THR A HG22 1  
ATOM 663   H HG23 . THR A 1 43  ? -10.004 11.395  7.094   1.00 0.00 ? 62  THR A HG23 1  
ATOM 664   N N    . MET A 1 44  ? -6.857  11.771  6.843   1.00 0.00 ? 63  MET A N    1  
ATOM 665   C CA   . MET A 1 44  ? -5.995  12.456  7.797   1.00 0.00 ? 63  MET A CA   1  
ATOM 666   C C    . MET A 1 44  ? -6.246  11.952  9.214   1.00 0.00 ? 63  MET A C    1  
ATOM 667   O O    . MET A 1 44  ? -5.351  11.977  10.057  1.00 0.00 ? 63  MET A O    1  
ATOM 668   C CB   . MET A 1 44  ? -6.226  13.966  7.732   1.00 0.00 ? 63  MET A CB   1  
ATOM 669   C CG   . MET A 1 44  ? -4.944  14.782  7.693   1.00 0.00 ? 63  MET A CG   1  
ATOM 670   S SD   . MET A 1 44  ? -4.513  15.323  6.029   1.00 0.00 ? 63  MET A SD   1  
ATOM 671   C CE   . MET A 1 44  ? -3.070  14.312  5.708   1.00 0.00 ? 63  MET A CE   1  
ATOM 672   H H    . MET A 1 44  ? -7.592  12.264  6.423   1.00 0.00 ? 63  MET A H    1  
ATOM 673   H HA   . MET A 1 44  ? -4.971  12.245  7.529   1.00 0.00 ? 63  MET A HA   1  
ATOM 674   H HB2  . MET A 1 44  ? -6.797  14.193  6.844   2.00 0.00 ? 63  MET A HB2  1  
ATOM 675   H HB3  . MET A 1 44  ? -6.793  14.269  8.599   2.00 0.00 ? 63  MET A HB3  1  
ATOM 676   H HG2  . MET A 1 44  ? -5.069  15.653  8.319   2.00 0.00 ? 63  MET A HG2  1  
ATOM 677   H HG3  . MET A 1 44  ? -4.137  14.177  8.079   2.00 0.00 ? 63  MET A HG3  1  
ATOM 678   H HE1  . MET A 1 44  ? -2.514  14.177  6.624   1.00 0.00 ? 63  MET A HE1  1  
ATOM 679   H HE2  . MET A 1 44  ? -2.444  14.800  4.975   1.00 0.00 ? 63  MET A HE2  1  
ATOM 680   H HE3  . MET A 1 44  ? -3.381  13.349  5.331   1.00 0.00 ? 63  MET A HE3  1  
ATOM 681   N N    . ALA A 1 45  ? -7.470  11.499  9.469   1.00 0.00 ? 64  ALA A N    1  
ATOM 682   C CA   . ALA A 1 45  ? -7.843  10.992  10.786  1.00 0.00 ? 64  ALA A CA   1  
ATOM 683   C C    . ALA A 1 45  ? -7.243  9.613   11.044  1.00 0.00 ? 64  ALA A C    1  
ATOM 684   O O    . ALA A 1 45  ? -6.620  9.381   12.080  1.00 0.00 ? 64  ALA A O    1  
ATOM 685   C CB   . ALA A 1 45  ? -9.357  10.941  10.918  1.00 0.00 ? 64  ALA A CB   1  
ATOM 686   H H    . ALA A 1 45  ? -8.140  11.507  8.754   1.00 0.00 ? 64  ALA A H    1  
ATOM 687   H HA   . ALA A 1 45  ? -7.465  11.682  11.526  1.00 0.00 ? 64  ALA A HA   1  
ATOM 688   H HB1  . ALA A 1 45  ? -9.803  11.634  10.220  1.00 0.00 ? 64  ALA A HB1  1  
ATOM 689   H HB2  . ALA A 1 45  ? -9.640  11.213  11.925  1.00 0.00 ? 64  ALA A HB2  1  
ATOM 690   H HB3  . ALA A 1 45  ? -9.703  9.941   10.704  1.00 0.00 ? 64  ALA A HB3  1  
ATOM 691   N N    . GLN A 1 46  ? -7.439  8.700   10.100  1.00 0.00 ? 65  GLN A N    1  
ATOM 692   C CA   . GLN A 1 46  ? -6.922  7.344   10.230  1.00 0.00 ? 65  GLN A CA   1  
ATOM 693   C C    . GLN A 1 46  ? -5.398  7.343   10.315  1.00 0.00 ? 65  GLN A C    1  
ATOM 694   O O    . GLN A 1 46  ? -4.803  6.506   10.994  1.00 0.00 ? 65  GLN A O    1  
ATOM 695   C CB   . GLN A 1 46  ? -7.380  6.492   9.043   1.00 0.00 ? 65  GLN A CB   1  
ATOM 696   C CG   . GLN A 1 46  ? -8.474  7.116   8.188   1.00 0.00 ? 65  GLN A CG   1  
ATOM 697   C CD   . GLN A 1 46  ? -9.171  6.115   7.290   1.00 0.00 ? 65  GLN A CD   1  
ATOM 698   O OE1  . GLN A 1 46  ? -8.750  5.881   6.157   1.00 0.00 ? 65  GLN A OE1  1  
ATOM 699   N NE2  . GLN A 1 46  ? -10.245 5.517   7.793   4.00 0.00 ? 65  GLN A NE2  1  
ATOM 700   H H    . GLN A 1 46  ? -7.947  8.941   9.298   1.00 0.00 ? 65  GLN A H    1  
ATOM 701   H HA   . GLN A 1 46  ? -7.322  6.922   11.139  1.00 0.00 ? 65  GLN A HA   1  
ATOM 702   H HB2  . GLN A 1 46  ? -6.527  6.302   8.407   2.00 0.00 ? 65  GLN A HB2  1  
ATOM 703   H HB3  . GLN A 1 46  ? -7.746  5.548   9.418   2.00 0.00 ? 65  GLN A HB3  1  
ATOM 704   H HG2  . GLN A 1 46  ? -9.210  7.563   8.840   2.00 0.00 ? 65  GLN A HG2  1  
ATOM 705   H HG3  . GLN A 1 46  ? -8.033  7.883   7.568   2.00 0.00 ? 65  GLN A HG3  1  
ATOM 706   H HE21 . GLN A 1 46  ? -10.523 5.753   8.706   5.00 0.00 ? 65  GLN A HE21 1  
ATOM 707   H HE22 . GLN A 1 46  ? -10.716 4.860   7.234   5.00 0.00 ? 65  GLN A HE22 1  
ATOM 708   N N    . MET A 1 47  ? -4.773  8.282   9.613   1.00 0.00 ? 66  MET A N    1  
ATOM 709   C CA   . MET A 1 47  ? -3.318  8.386   9.597   1.00 0.00 ? 66  MET A CA   1  
ATOM 710   C C    . MET A 1 47  ? -2.773  8.918   10.921  1.00 0.00 ? 66  MET A C    1  
ATOM 711   O O    . MET A 1 47  ? -1.863  8.329   11.505  1.00 0.00 ? 66  MET A O    1  
ATOM 712   C CB   . MET A 1 47  ? -2.868  9.292   8.450   1.00 0.00 ? 66  MET A CB   1  
ATOM 713   C CG   . MET A 1 47  ? -2.573  8.552   7.156   1.00 0.00 ? 66  MET A CG   1  
ATOM 714   S SD   . MET A 1 47  ? -0.817  8.205   6.941   1.00 0.00 ? 66  MET A SD   1  
ATOM 715   C CE   . MET A 1 47  ? -0.150  9.866   6.876   1.00 0.00 ? 66  MET A CE   1  
ATOM 716   H H    . MET A 1 47  ? -5.303  8.916   9.086   1.00 0.00 ? 66  MET A H    1  
ATOM 717   H HA   . MET A 1 47  ? -2.920  7.397   9.433   1.00 0.00 ? 66  MET A HA   1  
ATOM 718   H HB2  . MET A 1 47  ? -3.645  10.016  8.254   2.00 0.00 ? 66  MET A HB2  1  
ATOM 719   H HB3  . MET A 1 47  ? -1.973  9.815   8.752   2.00 0.00 ? 66  MET A HB3  1  
ATOM 720   H HG2  . MET A 1 47  ? -3.112  7.616   7.162   2.00 0.00 ? 66  MET A HG2  1  
ATOM 721   H HG3  . MET A 1 47  ? -2.911  9.155   6.327   2.00 0.00 ? 66  MET A HG3  1  
ATOM 722   H HE1  . MET A 1 47  ? -0.932  10.557  6.601   1.00 0.00 ? 66  MET A HE1  1  
ATOM 723   H HE2  . MET A 1 47  ? 0.641   9.907   6.142   1.00 0.00 ? 66  MET A HE2  1  
ATOM 724   H HE3  . MET A 1 47  ? 0.244   10.134  7.845   1.00 0.00 ? 66  MET A HE3  1  
ATOM 725   N N    . GLU A 1 48  ? -3.321  10.037  11.386  1.00 0.00 ? 67  GLU A N    1  
ATOM 726   C CA   . GLU A 1 48  ? -2.872  10.644  12.632  1.00 0.00 ? 67  GLU A CA   1  
ATOM 727   C C    . GLU A 1 48  ? -3.003  9.678   13.803  1.00 0.00 ? 67  GLU A C    1  
ATOM 728   O O    . GLU A 1 48  ? -2.109  9.587   14.645  1.00 0.00 ? 67  GLU A O    1  
ATOM 729   C CB   . GLU A 1 48  ? -3.667  11.911  12.921  1.00 0.00 ? 67  GLU A CB   1  
ATOM 730   C CG   . GLU A 1 48  ? -5.163  11.741  12.755  1.00 0.00 ? 67  GLU A CG   1  
ATOM 731   C CD   . GLU A 1 48  ? -5.898  13.061  12.628  1.00 0.00 ? 67  GLU A CD   1  
ATOM 732   O OE1  . GLU A 1 48  ? -5.392  13.957  11.920  1.00 0.00 ? 67  GLU A OE1  1  
ATOM 733   O OE2  . GLU A 1 48  ? -6.980  13.199  13.238  1.00 0.00 ? 67  GLU A OE2  1  
ATOM 734   H H    . GLU A 1 48  ? -4.037  10.470  10.877  1.00 0.00 ? 67  GLU A H    1  
ATOM 735   H HA   . GLU A 1 48  ? -1.835  10.905  12.513  1.00 0.00 ? 67  GLU A HA   1  
ATOM 736   H HB2  . GLU A 1 48  ? -3.472  12.215  13.935  2.00 0.00 ? 67  GLU A HB2  1  
ATOM 737   H HB3  . GLU A 1 48  ? -3.337  12.692  12.252  2.00 0.00 ? 67  GLU A HB3  1  
ATOM 738   H HG2  . GLU A 1 48  ? -5.342  11.158  11.864  2.00 0.00 ? 67  GLU A HG2  1  
ATOM 739   H HG3  . GLU A 1 48  ? -5.550  11.211  13.615  2.00 0.00 ? 67  GLU A HG3  1  
ATOM 740   N N    . LYS A 1 49  ? -4.119  8.958   13.856  1.00 0.00 ? 68  LYS A N    1  
ATOM 741   C CA   . LYS A 1 49  ? -4.353  8.004   14.929  1.00 0.00 ? 68  LYS A CA   1  
ATOM 742   C C    . LYS A 1 49  ? -3.268  6.940   14.925  1.00 0.00 ? 68  LYS A C    1  
ATOM 743   O O    . LYS A 1 49  ? -2.605  6.707   15.933  1.00 0.00 ? 68  LYS A O    1  
ATOM 744   C CB   . LYS A 1 49  ? -5.729  7.353   14.776  1.00 0.00 ? 68  LYS A CB   1  
ATOM 745   C CG   . LYS A 1 49  ? -6.819  7.940   15.658  1.00 0.00 ? 68  LYS A CG   1  
ATOM 746   C CD   . LYS A 1 49  ? -7.429  6.899   16.582  1.00 0.00 ? 68  LYS A CD   1  
ATOM 747   C CE   . LYS A 1 49  ? -7.605  7.419   18.000  1.00 0.00 ? 68  LYS A CE   1  
ATOM 748   N NZ   . LYS A 1 49  ? -8.509  6.548   18.801  1.00 0.00 ? 68  LYS A NZ   1  
ATOM 749   H H    . LYS A 1 49  ? -4.796  9.067   13.157  1.00 0.00 ? 68  LYS A H    1  
ATOM 750   H HA   . LYS A 1 49  ? -4.316  8.539   15.866  1.00 0.00 ? 68  LYS A HA   1  
ATOM 751   H HB2  . LYS A 1 49  ? -6.043  7.449   13.747  2.00 0.00 ? 68  LYS A HB2  1  
ATOM 752   H HB3  . LYS A 1 49  ? -5.640  6.303   15.010  2.00 0.00 ? 68  LYS A HB3  1  
ATOM 753   H HG2  . LYS A 1 49  ? -6.394  8.732   16.257  2.00 0.00 ? 68  LYS A HG2  1  
ATOM 754   H HG3  . LYS A 1 49  ? -7.596  8.347   15.029  2.00 0.00 ? 68  LYS A HG3  1  
ATOM 755   H HD2  . LYS A 1 49  ? -8.395  6.612   16.194  2.00 0.00 ? 68  LYS A HD2  1  
ATOM 756   H HD3  . LYS A 1 49  ? -6.783  6.033   16.606  2.00 0.00 ? 68  LYS A HD3  1  
ATOM 757   H HE2  . LYS A 1 49  ? -6.638  7.456   18.479  2.00 0.00 ? 68  LYS A HE2  1  
ATOM 758   H HE3  . LYS A 1 49  ? -8.022  8.414   17.957  2.00 0.00 ? 68  LYS A HE3  1  
ATOM 759   H HZ1  . LYS A 1 49  ? -8.011  6.195   19.643  1.00 0.00 ? 68  LYS A HZ1  1  
ATOM 760   H HZ2  . LYS A 1 49  ? -8.821  5.737   18.231  1.00 0.00 ? 68  LYS A HZ2  1  
ATOM 761   H HZ3  . LYS A 1 49  ? -9.346  7.086   19.106  1.00 0.00 ? 68  LYS A HZ3  1  
ATOM 762   N N    . ALA A 1 50  ? -3.089  6.307   13.774  1.00 0.00 ? 69  ALA A N    1  
ATOM 763   C CA   . ALA A 1 50  ? -2.079  5.272   13.621  1.00 0.00 ? 69  ALA A CA   1  
ATOM 764   C C    . ALA A 1 50  ? -0.680  5.846   13.820  1.00 0.00 ? 69  ALA A C    1  
ATOM 765   O O    . ALA A 1 50  ? 0.258   5.119   14.140  1.00 0.00 ? 69  ALA A O    1  
ATOM 766   C CB   . ALA A 1 50  ? -2.198  4.616   12.253  1.00 0.00 ? 69  ALA A CB   1  
ATOM 767   H H    . ALA A 1 50  ? -3.647  6.549   13.007  1.00 0.00 ? 69  ALA A H    1  
ATOM 768   H HA   . ALA A 1 50  ? -2.259  4.517   14.374  1.00 0.00 ? 69  ALA A HA   1  
ATOM 769   H HB1  . ALA A 1 50  ? -2.502  5.353   11.525  1.00 0.00 ? 69  ALA A HB1  1  
ATOM 770   H HB2  . ALA A 1 50  ? -2.934  3.826   12.295  1.00 0.00 ? 69  ALA A HB2  1  
ATOM 771   H HB3  . ALA A 1 50  ? -1.242  4.201   11.968  1.00 0.00 ? 69  ALA A HB3  1  
ATOM 772   N N    . LEU A 1 51  ? -0.545  7.156   13.634  1.00 0.00 ? 70  LEU A N    1  
ATOM 773   C CA   . LEU A 1 51  ? 0.743   7.816   13.798  1.00 0.00 ? 70  LEU A CA   1  
ATOM 774   C C    . LEU A 1 51  ? 1.048   8.049   15.274  1.00 0.00 ? 70  LEU A C    1  
ATOM 775   O O    . LEU A 1 51  ? 2.199   7.955   15.702  1.00 0.00 ? 70  LEU A O    1  
ATOM 776   C CB   . LEU A 1 51  ? 0.759   9.145   13.041  1.00 0.00 ? 70  LEU A CB   1  
ATOM 777   C CG   . LEU A 1 51  ? 1.328   9.142   11.622  1.00 0.00 ? 70  LEU A CG   1  
ATOM 778   C CD1  . LEU A 1 51  ? 0.496   10.021  10.701  2.00 0.00 ? 70  LEU A CD1  1  
ATOM 779   C CD2  . LEU A 1 51  ? 2.780   9.595   11.620  2.00 0.00 ? 70  LEU A CD2  1  
ATOM 780   H H    . LEU A 1 51  ? -1.328  7.691   13.383  1.00 0.00 ? 70  LEU A H    1  
ATOM 781   H HA   . LEU A 1 51  ? 1.501   7.168   13.384  1.00 0.00 ? 70  LEU A HA   1  
ATOM 782   H HB2  . LEU A 1 51  ? -0.257  9.510   12.990  2.00 0.00 ? 70  LEU A HB2  1  
ATOM 783   H HB3  . LEU A 1 51  ? 1.332   9.850   13.624  2.00 0.00 ? 70  LEU A HB3  1  
ATOM 784   H HG   . LEU A 1 51  ? 1.290   8.129   11.248  1.00 0.00 ? 70  LEU A HG   1  
ATOM 785   H HD11 . LEU A 1 51  ? 0.557   11.048  11.032  1.00 0.00 ? 70  LEU A HD11 1  
ATOM 786   H HD12 . LEU A 1 51  ? -0.533  9.696   10.725  1.00 0.00 ? 70  LEU A HD12 1  
ATOM 787   H HD13 . LEU A 1 51  ? 0.874   9.945   9.692   1.00 0.00 ? 70  LEU A HD13 1  
ATOM 788   H HD21 . LEU A 1 51  ? 3.373   8.907   12.205  1.00 0.00 ? 70  LEU A HD21 1  
ATOM 789   H HD22 . LEU A 1 51  ? 2.849   10.583  12.050  1.00 0.00 ? 70  LEU A HD22 1  
ATOM 790   H HD23 . LEU A 1 51  ? 3.150   9.617   10.606  1.00 0.00 ? 70  LEU A HD23 1  
ATOM 791   N N    . SER A 1 52  ? 0.010   8.349   16.050  1.00 0.00 ? 71  SER A N    1  
ATOM 792   C CA   . SER A 1 52  ? 0.168   8.591   17.480  1.00 0.00 ? 71  SER A CA   1  
ATOM 793   C C    . SER A 1 52  ? 0.243   7.274   18.241  1.00 0.00 ? 71  SER A C    1  
ATOM 794   O O    . SER A 1 52  ? 0.568   7.246   19.428  1.00 0.00 ? 71  SER A O    1  
ATOM 795   C CB   . SER A 1 52  ? -0.990  9.438   18.010  1.00 0.00 ? 71  SER A CB   1  
ATOM 796   O OG   . SER A 1 52  ? -2.080  8.624   18.409  1.00 0.00 ? 71  SER A OG   1  
ATOM 797   H H    . SER A 1 52  ? -0.883  8.406   15.651  1.00 0.00 ? 71  SER A H    1  
ATOM 798   H HA   . SER A 1 52  ? 1.092   9.128   17.625  1.00 0.00 ? 71  SER A HA   1  
ATOM 799   H HB2  . SER A 1 52  ? -0.654  10.010  18.862  2.00 0.00 ? 71  SER A HB2  1  
ATOM 800   H HB3  . SER A 1 52  ? -1.325  10.111  17.235  2.00 0.00 ? 71  SER A HB3  1  
ATOM 801   H HG   . SER A 1 52  ? -2.900  9.013   18.097  1.00 0.00 ? 71  SER A HG   1  
ATOM 802   N N    . ILE A 1 53  ? -0.058  6.185   17.545  1.00 0.00 ? 72  ILE A N    1  
ATOM 803   C CA   . ILE A 1 53  ? -0.023  4.860   18.145  1.00 0.00 ? 72  ILE A CA   1  
ATOM 804   C C    . ILE A 1 53  ? 1.307   4.173   17.856  1.00 0.00 ? 72  ILE A C    1  
ATOM 805   O O    . ILE A 1 53  ? 1.518   3.019   18.231  1.00 0.00 ? 72  ILE A O    1  
ATOM 806   C CB   . ILE A 1 53  ? -1.175  3.983   17.621  1.00 0.00 ? 72  ILE A CB   1  
ATOM 807   C CG1  . ILE A 1 53  ? -0.918  3.581   16.169  1.00 0.00 ? 72  ILE A CG1  1  
ATOM 808   C CG2  . ILE A 1 53  ? -2.498  4.720   17.748  1.00 0.00 ? 72  ILE A CG2  1  
ATOM 809   C CD1  . ILE A 1 53  ? -0.642  2.106   15.985  1.00 0.00 ? 72  ILE A CD1  1  
ATOM 810   H H    . ILE A 1 53  ? -0.306  6.276   16.602  1.00 0.00 ? 72  ILE A H    1  
ATOM 811   H HA   . ILE A 1 53  ? -0.137  4.972   19.213  1.00 0.00 ? 72  ILE A HA   1  
ATOM 812   H HB   . ILE A 1 53  ? -1.229  3.095   18.228  1.00 0.00 ? 72  ILE A HB   1  
ATOM 813   H HG12 . ILE A 1 53  ? -1.783  3.832   15.574  2.00 0.00 ? 72  ILE A HG12 1  
ATOM 814   H HG13 . ILE A 1 53  ? -0.064  4.126   15.798  2.00 0.00 ? 72  ILE A HG13 1  
ATOM 815   H HG21 . ILE A 1 53  ? -2.311  5.782   17.829  1.00 0.00 ? 72  ILE A HG21 1  
ATOM 816   H HG22 . ILE A 1 53  ? -3.018  4.378   18.631  1.00 0.00 ? 72  ILE A HG22 1  
ATOM 817   H HG23 . ILE A 1 53  ? -3.104  4.527   16.875  1.00 0.00 ? 72  ILE A HG23 1  
ATOM 818   H HD11 . ILE A 1 53  ? -0.920  1.573   16.882  1.00 0.00 ? 72  ILE A HD11 1  
ATOM 819   H HD12 . ILE A 1 53  ? 0.410   1.958   15.790  1.00 0.00 ? 72  ILE A HD12 1  
ATOM 820   H HD13 . ILE A 1 53  ? -1.219  1.733   15.152  1.00 0.00 ? 72  ILE A HD13 1  
ATOM 821   N N    . GLY A 1 54  ? 2.201   4.895   17.187  1.00 0.00 ? 73  GLY A N    1  
ATOM 822   C CA   . GLY A 1 54  ? 3.503   4.348   16.856  1.00 0.00 ? 73  GLY A CA   1  
ATOM 823   C C    . GLY A 1 54  ? 3.506   3.554   15.565  1.00 0.00 ? 73  GLY A C    1  
ATOM 824   O O    . GLY A 1 54  ? 3.844   2.370   15.560  1.00 0.00 ? 73  GLY A O    1  
ATOM 825   H H    . GLY A 1 54  ? 1.974   5.810   16.917  1.00 0.00 ? 73  GLY A H    1  
ATOM 826   H HA2  . GLY A 1 54  ? 4.208   5.163   16.764  2.00 0.00 ? 73  GLY A HA2  1  
ATOM 827   H HA3  . GLY A 1 54  ? 3.822   3.702   17.663  2.00 0.00 ? 73  GLY A HA3  1  
ATOM 828   N N    . PHE A 1 55  ? 3.128   4.203   14.467  1.00 0.00 ? 74  PHE A N    1  
ATOM 829   C CA   . PHE A 1 55  ? 3.092   3.538   13.168  1.00 0.00 ? 74  PHE A CA   1  
ATOM 830   C C    . PHE A 1 55  ? 3.708   4.416   12.083  1.00 0.00 ? 74  PHE A C    1  
ATOM 831   O O    . PHE A 1 55  ? 3.505   5.630   12.060  1.00 0.00 ? 74  PHE A O    1  
ATOM 832   C CB   . PHE A 1 55  ? 1.651   3.165   12.804  1.00 0.00 ? 74  PHE A CB   1  
ATOM 833   C CG   . PHE A 1 55  ? 1.196   3.609   11.442  1.00 0.00 ? 74  PHE A CG   1  
ATOM 834   C CD1  . PHE A 1 55  ? 0.843   4.929   11.210  1.00 0.00 ? 74  PHE A CD1  1  
ATOM 835   C CD2  . PHE A 1 55  ? 1.115   2.704   10.393  1.00 0.00 ? 74  PHE A CD2  1  
ATOM 836   C CE1  . PHE A 1 55  ? 0.419   5.339   9.961   1.00 0.00 ? 74  PHE A CE1  1  
ATOM 837   C CE2  . PHE A 1 55  ? 0.692   3.109   9.144   1.00 0.00 ? 74  PHE A CE2  1  
ATOM 838   C CZ   . PHE A 1 55  ? 0.344   4.428   8.928   1.00 0.00 ? 74  PHE A CZ   1  
ATOM 839   H H    . PHE A 1 55  ? 2.868   5.148   14.532  1.00 0.00 ? 74  PHE A H    1  
ATOM 840   H HA   . PHE A 1 55  ? 3.675   2.633   13.249  1.00 0.00 ? 74  PHE A HA   1  
ATOM 841   H HB2  . PHE A 1 55  ? 1.551   2.092   12.847  2.00 0.00 ? 74  PHE A HB2  1  
ATOM 842   H HB3  . PHE A 1 55  ? 0.985   3.604   13.531  2.00 0.00 ? 74  PHE A HB3  1  
ATOM 843   H HD1  . PHE A 1 55  ? 0.900   5.642   12.018  1.00 0.00 ? 74  PHE A HD1  1  
ATOM 844   H HD2  . PHE A 1 55  ? 1.384   1.671   10.559  1.00 0.00 ? 74  PHE A HD2  1  
ATOM 845   H HE1  . PHE A 1 55  ? 0.148   6.371   9.793   1.00 0.00 ? 74  PHE A HE1  1  
ATOM 846   H HE2  . PHE A 1 55  ? 0.633   2.396   8.335   1.00 0.00 ? 74  PHE A HE2  1  
ATOM 847   H HZ   . PHE A 1 55  ? 0.013   4.745   7.951   1.00 0.00 ? 74  PHE A HZ   1  
ATOM 848   N N    . GLU A 1 56  ? 4.462   3.789   11.186  1.00 0.00 ? 75  GLU A N    1  
ATOM 849   C CA   . GLU A 1 56  ? 5.113   4.502   10.094  1.00 0.00 ? 75  GLU A CA   1  
ATOM 850   C C    . GLU A 1 56  ? 5.787   3.524   9.137   1.00 0.00 ? 75  GLU A C    1  
ATOM 851   O O    . GLU A 1 56  ? 6.043   2.373   9.491   1.00 0.00 ? 75  GLU A O    1  
ATOM 852   C CB   . GLU A 1 56  ? 6.146   5.490   10.641  1.00 0.00 ? 75  GLU A CB   1  
ATOM 853   C CG   . GLU A 1 56  ? 6.851   5.013   11.900  1.00 0.00 ? 75  GLU A CG   1  
ATOM 854   C CD   . GLU A 1 56  ? 8.252   4.499   11.632  1.00 0.00 ? 75  GLU A CD   1  
ATOM 855   O OE1  . GLU A 1 56  ? 9.053   5.244   11.030  1.00 0.00 ? 75  GLU A OE1  1  
ATOM 856   O OE2  . GLU A 1 56  ? 8.548   3.350   12.023  1.00 0.00 ? 75  GLU A OE2  1  
ATOM 857   H H    . GLU A 1 56  ? 4.584   2.819   11.261  1.00 0.00 ? 75  GLU A H    1  
ATOM 858   H HA   . GLU A 1 56  ? 4.353   5.049   9.556   1.00 0.00 ? 75  GLU A HA   1  
ATOM 859   H HB2  . GLU A 1 56  ? 6.895   5.667   9.881   2.00 0.00 ? 75  GLU A HB2  1  
ATOM 860   H HB3  . GLU A 1 56  ? 5.648   6.424   10.866  2.00 0.00 ? 75  GLU A HB3  1  
ATOM 861   H HG2  . GLU A 1 56  ? 6.915   5.836   12.596  2.00 0.00 ? 75  GLU A HG2  1  
ATOM 862   H HG3  . GLU A 1 56  ? 6.271   4.216   12.342  2.00 0.00 ? 75  GLU A HG3  1  
ATOM 863   N N    . THR A 1 57  ? 6.071   3.989   7.926   1.00 0.00 ? 76  THR A N    1  
ATOM 864   C CA   . THR A 1 57  ? 6.714   3.153   6.920   1.00 0.00 ? 76  THR A CA   1  
ATOM 865   C C    . THR A 1 57  ? 8.033   3.763   6.461   1.00 0.00 ? 76  THR A C    1  
ATOM 866   O O    . THR A 1 57  ? 8.781   3.149   5.701   1.00 0.00 ? 76  THR A O    1  
ATOM 867   C CB   . THR A 1 57  ? 5.805   2.945   5.696   1.00 0.00 ? 76  THR A CB   1  
ATOM 868   O OG1  . THR A 1 57  ? 5.701   4.163   4.949   1.00 0.00 ? 76  THR A OG1  1  
ATOM 869   C CG2  . THR A 1 57  ? 4.419   2.484   6.122   1.00 0.00 ? 76  THR A CG2  1  
ATOM 870   H H    . THR A 1 57  ? 5.842   4.915   7.702   1.00 0.00 ? 76  THR A H    1  
ATOM 871   H HA   . THR A 1 57  ? 6.911   2.188   7.365   1.00 0.00 ? 76  THR A HA   1  
ATOM 872   H HB   . THR A 1 57  ? 6.243   2.185   5.067   1.00 0.00 ? 76  THR A HB   1  
ATOM 873   H HG1  . THR A 1 57  ? 5.518   3.961   4.029   1.00 0.00 ? 76  THR A HG1  1  
ATOM 874   H HG21 . THR A 1 57  ? 4.302   2.628   7.186   1.00 0.00 ? 76  THR A HG21 1  
ATOM 875   H HG22 . THR A 1 57  ? 4.301   1.436   5.886   1.00 0.00 ? 76  THR A HG22 1  
ATOM 876   H HG23 . THR A 1 57  ? 3.668   3.058   5.597   1.00 0.00 ? 76  THR A HG23 1  
ATOM 877   N N    . CYS A 1 58  ? 8.311   4.977   6.926   1.00 0.00 ? 77  CYS A N    1  
ATOM 878   C CA   . CYS A 1 58  ? 9.540   5.673   6.562   1.00 0.00 ? 77  CYS A CA   1  
ATOM 879   C C    . CYS A 1 58  ? 9.664   5.798   5.047   1.00 0.00 ? 77  CYS A C    1  
ATOM 880   O O    . CYS A 1 58  ? 10.740  6.088   4.524   1.00 0.00 ? 77  CYS A O    1  
ATOM 881   C CB   . CYS A 1 58  ? 10.756  4.937   7.127   1.00 0.00 ? 77  CYS A CB   1  
ATOM 882   S SG   . CYS A 1 58  ? 12.060  6.007   7.815   1.00 0.00 ? 77  CYS A SG   1  
ATOM 883   H H    . CYS A 1 58  ? 7.674   5.415   7.528   1.00 0.00 ? 77  CYS A H    1  
ATOM 884   H HA   . CYS A 1 58  ? 9.498   6.664   6.990   1.00 0.00 ? 77  CYS A HA   1  
ATOM 885   H HB2  . CYS A 1 58  ? 10.429  4.276   7.916   2.00 0.00 ? 77  CYS A HB2  1  
ATOM 886   H HB3  . CYS A 1 58  ? 11.202  4.346   6.341   2.00 0.00 ? 77  CYS A HB3  1  
ATOM 887   N N    . ARG A 1 59  ? 8.555   5.576   4.348   1.00 0.00 ? 78  ARG A N    1  
ATOM 888   C CA   . ARG A 1 59  ? 8.539   5.662   2.893   1.00 0.00 ? 78  ARG A CA   1  
ATOM 889   C C    . ARG A 1 59  ? 7.472   6.643   2.416   1.00 0.00 ? 78  ARG A C    1  
ATOM 890   O O    . ARG A 1 59  ? 6.782   7.265   3.223   1.00 0.00 ? 78  ARG A O    1  
ATOM 891   C CB   . ARG A 1 59  ? 8.288   4.281   2.284   1.00 0.00 ? 78  ARG A CB   1  
ATOM 892   C CG   . ARG A 1 59  ? 9.431   3.302   2.492   1.00 0.00 ? 78  ARG A CG   1  
ATOM 893   C CD   . ARG A 1 59  ? 9.614   2.380   1.298   1.00 0.00 ? 78  ARG A CD   1  
ATOM 894   N NE   . ARG A 1 59  ? 11.023  2.142   0.999   1.00 0.00 ? 78  ARG A NE   1  
ATOM 895   C CZ   . ARG A 1 59  ? 11.551  0.931   0.851   4.00 0.00 ? 78  ARG A CZ   1  
ATOM 896   N NH1  . ARG A 1 59  ? 10.792  -0.150  0.971   5.00 0.00 ? 78  ARG A NH1  1  
ATOM 897   N NH2  . ARG A 1 59  ? 12.842  0.790   0.585   5.00 0.00 ? 78  ARG A NH2  1  
ATOM 898   H H    . ARG A 1 59  ? 7.729   5.348   4.823   1.00 0.00 ? 78  ARG A H    1  
ATOM 899   H HA   . ARG A 1 59  ? 9.506   6.016   2.571   1.00 0.00 ? 78  ARG A HA   1  
ATOM 900   H HB2  . ARG A 1 59  ? 7.398   3.861   2.729   2.00 0.00 ? 78  ARG A HB2  1  
ATOM 901   H HB3  . ARG A 1 59  ? 8.127   4.393   1.222   2.00 0.00 ? 78  ARG A HB3  1  
ATOM 902   H HG2  . ARG A 1 59  ? 10.344  3.858   2.646   2.00 0.00 ? 78  ARG A HG2  1  
ATOM 903   H HG3  . ARG A 1 59  ? 9.224   2.703   3.367   2.00 0.00 ? 78  ARG A HG3  1  
ATOM 904   H HD2  . ARG A 1 59  ? 9.138   1.435   1.513   2.00 0.00 ? 78  ARG A HD2  1  
ATOM 905   H HD3  . ARG A 1 59  ? 9.144   2.831   0.436   2.00 0.00 ? 78  ARG A HD3  1  
ATOM 906   H HE   . ARG A 1 59  ? 11.605  2.925   0.906   1.00 0.00 ? 78  ARG A HE   1  
ATOM 907   H HH11 . ARG A 1 59  ? 9.817   -0.057  1.175   5.00 0.00 ? 78  ARG A HH11 1  
ATOM 908   H HH12 . ARG A 1 59  ? 11.195  -1.058  0.858   5.00 0.00 ? 78  ARG A HH12 1  
ATOM 909   H HH21 . ARG A 1 59  ? 13.425  1.598   0.495   5.00 0.00 ? 78  ARG A HH21 1  
ATOM 910   H HH22 . ARG A 1 59  ? 13.233  -0.123  0.474   5.00 0.00 ? 78  ARG A HH22 1  
ATOM 911   N N    . TYR A 1 60  ? 7.346   6.776   1.100   1.00 0.00 ? 79  TYR A N    1  
ATOM 912   C CA   . TYR A 1 60  ? 6.365   7.683   0.513   1.00 0.00 ? 79  TYR A CA   1  
ATOM 913   C C    . TYR A 1 60  ? 5.045   6.966   0.251   1.00 0.00 ? 79  TYR A C    1  
ATOM 914   O O    . TYR A 1 60  ? 4.892   6.279   -0.757  1.00 0.00 ? 79  TYR A O    1  
ATOM 915   C CB   . TYR A 1 60  ? 6.901   8.268   -0.795  1.00 0.00 ? 79  TYR A CB   1  
ATOM 916   C CG   . TYR A 1 60  ? 7.926   9.368   -0.645  1.00 0.00 ? 79  TYR A CG   1  
ATOM 917   C CD1  . TYR A 1 60  ? 7.564   10.622  -0.171  1.00 0.00 ? 79  TYR A CD1  1  
ATOM 918   C CD2  . TYR A 1 60  ? 9.255   9.152   -0.982  1.00 0.00 ? 79  TYR A CD2  1  
ATOM 919   C CE1  . TYR A 1 60  ? 8.499   11.630  -0.036  1.00 0.00 ? 79  TYR A CE1  1  
ATOM 920   C CE2  . TYR A 1 60  ? 10.197  10.155  -0.849  1.00 0.00 ? 79  TYR A CE2  1  
ATOM 921   C CZ   . TYR A 1 60  ? 9.814   11.392  -0.376  1.00 0.00 ? 79  TYR A CZ   1  
ATOM 922   O OH   . TYR A 1 60  ? 10.748  12.393  -0.243  1.00 0.00 ? 79  TYR A OH   1  
ATOM 923   H H    . TYR A 1 60  ? 7.927   6.253   0.509   1.00 0.00 ? 79  TYR A H    1  
ATOM 924   H HA   . TYR A 1 60  ? 6.194   8.486   1.213   1.00 0.00 ? 79  TYR A HA   1  
ATOM 925   H HB2  . TYR A 1 60  ? 7.355   7.475   -1.369  2.00 0.00 ? 79  TYR A HB2  1  
ATOM 926   H HB3  . TYR A 1 60  ? 6.072   8.670   -1.359  2.00 0.00 ? 79  TYR A HB3  1  
ATOM 927   H HD1  . TYR A 1 60  ? 6.533   10.804  0.095   1.00 0.00 ? 79  TYR A HD1  1  
ATOM 928   H HD2  . TYR A 1 60  ? 9.552   8.182   -1.353  1.00 0.00 ? 79  TYR A HD2  1  
ATOM 929   H HE1  . TYR A 1 60  ? 8.197   12.599  0.334   1.00 0.00 ? 79  TYR A HE1  1  
ATOM 930   H HE2  . TYR A 1 60  ? 11.226  9.967   -1.116  1.00 0.00 ? 79  TYR A HE2  1  
ATOM 931   H HH   . TYR A 1 60  ? 11.626  12.006  -0.188  1.00 0.00 ? 79  TYR A HH   1  
ATOM 932   N N    . GLY A 1 61  ? 4.094   7.132   1.163   1.00 0.00 ? 80  GLY A N    1  
ATOM 933   C CA   . GLY A 1 61  ? 2.800   6.497   1.006   1.00 0.00 ? 80  GLY A CA   1  
ATOM 934   C C    . GLY A 1 61  ? 1.708   7.468   0.604   1.00 0.00 ? 80  GLY A C    1  
ATOM 935   O O    . GLY A 1 61  ? 1.606   8.563   1.158   1.00 0.00 ? 80  GLY A O    1  
ATOM 936   H H    . GLY A 1 61  ? 4.271   7.692   1.947   1.00 0.00 ? 80  GLY A H    1  
ATOM 937   H HA2  . GLY A 1 61  ? 2.880   5.730   0.246   2.00 0.00 ? 80  GLY A HA2  1  
ATOM 938   H HA3  . GLY A 1 61  ? 2.525   6.032   1.942   2.00 0.00 ? 80  GLY A HA3  1  
ATOM 939   N N    . PHE A 1 62  ? 0.892   7.067   -0.364  1.00 0.00 ? 81  PHE A N    1  
ATOM 940   C CA   . PHE A 1 62  ? -0.197  7.904   -0.847  1.00 0.00 ? 81  PHE A CA   1  
ATOM 941   C C    . PHE A 1 62  ? -1.164  8.262   0.276   1.00 0.00 ? 81  PHE A C    1  
ATOM 942   O O    . PHE A 1 62  ? -1.621  7.389   1.016   1.00 0.00 ? 81  PHE A O    1  
ATOM 943   C CB   . PHE A 1 62  ? -0.952  7.186   -1.965  1.00 0.00 ? 81  PHE A CB   1  
ATOM 944   C CG   . PHE A 1 62  ? -0.827  7.834   -3.312  1.00 0.00 ? 81  PHE A CG   1  
ATOM 945   C CD1  . PHE A 1 62  ? -0.775  9.213   -3.431  1.00 0.00 ? 81  PHE A CD1  1  
ATOM 946   C CD2  . PHE A 1 62  ? -0.762  7.062   -4.459  1.00 0.00 ? 81  PHE A CD2  1  
ATOM 947   C CE1  . PHE A 1 62  ? -0.662  9.811   -4.671  1.00 0.00 ? 81  PHE A CE1  1  
ATOM 948   C CE2  . PHE A 1 62  ? -0.650  7.653   -5.703  1.00 0.00 ? 81  PHE A CE2  1  
ATOM 949   C CZ   . PHE A 1 62  ? -0.600  9.031   -5.809  1.00 0.00 ? 81  PHE A CZ   1  
ATOM 950   H H    . PHE A 1 62  ? 1.027   6.185   -0.768  1.00 0.00 ? 81  PHE A H    1  
ATOM 951   H HA   . PHE A 1 62  ? 0.232   8.813   -1.241  1.00 0.00 ? 81  PHE A HA   1  
ATOM 952   H HB2  . PHE A 1 62  ? -0.576  6.177   -2.048  2.00 0.00 ? 81  PHE A HB2  1  
ATOM 953   H HB3  . PHE A 1 62  ? -2.001  7.150   -1.712  2.00 0.00 ? 81  PHE A HB3  1  
ATOM 954   H HD1  . PHE A 1 62  ? -0.823  9.822   -2.541  1.00 0.00 ? 81  PHE A HD1  1  
ATOM 955   H HD2  . PHE A 1 62  ? -0.800  5.986   -4.375  1.00 0.00 ? 81  PHE A HD2  1  
ATOM 956   H HE1  . PHE A 1 62  ? -0.624  10.887  -4.751  1.00 0.00 ? 81  PHE A HE1  1  
ATOM 957   H HE2  . PHE A 1 62  ? -0.602  7.040   -6.591  1.00 0.00 ? 81  PHE A HE2  1  
ATOM 958   H HZ   . PHE A 1 62  ? -0.510  9.496   -6.779  1.00 0.00 ? 81  PHE A HZ   1  
ATOM 959   N N    . ILE A 1 63  ? -1.479  9.549   0.386   1.00 0.00 ? 82  ILE A N    1  
ATOM 960   C CA   . ILE A 1 63  ? -2.403  10.028  1.409   1.00 0.00 ? 82  ILE A CA   1  
ATOM 961   C C    . ILE A 1 63  ? -3.797  10.233  0.821   1.00 0.00 ? 82  ILE A C    1  
ATOM 962   O O    . ILE A 1 63  ? -4.103  9.721   -0.256  1.00 0.00 ? 82  ILE A O    1  
ATOM 963   C CB   . ILE A 1 63  ? -1.907  11.347  2.044   1.00 0.00 ? 82  ILE A CB   1  
ATOM 964   C CG1  . ILE A 1 63  ? -2.331  11.442  3.514   1.00 0.00 ? 82  ILE A CG1  1  
ATOM 965   C CG2  . ILE A 1 63  ? -2.421  12.549  1.265   1.00 0.00 ? 82  ILE A CG2  1  
ATOM 966   C CD1  . ILE A 1 63  ? -2.618  10.107  4.167   1.00 0.00 ? 82  ILE A CD1  1  
ATOM 967   H H    . ILE A 1 63  ? -1.085  10.193  -0.242  1.00 0.00 ? 82  ILE A H    1  
ATOM 968   H HA   . ILE A 1 63  ? -2.458  9.276   2.183   1.00 0.00 ? 82  ILE A HA   1  
ATOM 969   H HB   . ILE A 1 63  ? -0.830  11.357  1.991   1.00 0.00 ? 82  ILE A HB   1  
ATOM 970   H HG12 . ILE A 1 63  ? -1.542  11.919  4.076   2.00 0.00 ? 82  ILE A HG12 1  
ATOM 971   H HG13 . ILE A 1 63  ? -3.225  12.043  3.586   2.00 0.00 ? 82  ILE A HG13 1  
ATOM 972   H HG21 . ILE A 1 63  ? -1.908  13.439  1.598   1.00 0.00 ? 82  ILE A HG21 1  
ATOM 973   H HG22 . ILE A 1 63  ? -3.482  12.661  1.434   1.00 0.00 ? 82  ILE A HG22 1  
ATOM 974   H HG23 . ILE A 1 63  ? -2.238  12.400  0.212   1.00 0.00 ? 82  ILE A HG23 1  
ATOM 975   H HD11 . ILE A 1 63  ? -1.917  9.371   3.805   1.00 0.00 ? 82  ILE A HD11 1  
ATOM 976   H HD12 . ILE A 1 63  ? -3.624  9.797   3.925   1.00 0.00 ? 82  ILE A HD12 1  
ATOM 977   H HD13 . ILE A 1 63  ? -2.519  10.202  5.238   1.00 0.00 ? 82  ILE A HD13 1  
ATOM 978   N N    . GLU A 1 64  ? -4.637  10.982  1.529   1.00 0.00 ? 83  GLU A N    1  
ATOM 979   C CA   . GLU A 1 64  ? -5.997  11.251  1.071   1.00 0.00 ? 83  GLU A CA   1  
ATOM 980   C C    . GLU A 1 64  ? -6.028  11.488  -0.436  1.00 0.00 ? 83  GLU A C    1  
ATOM 981   O O    . GLU A 1 64  ? -6.994  11.132  -1.111  1.00 0.00 ? 83  GLU A O    1  
ATOM 982   C CB   . GLU A 1 64  ? -6.573  12.466  1.802   1.00 0.00 ? 83  GLU A CB   1  
ATOM 983   C CG   . GLU A 1 64  ? -5.758  13.736  1.620   1.00 0.00 ? 83  GLU A CG   1  
ATOM 984   C CD   . GLU A 1 64  ? -6.474  14.784  0.791   1.00 0.00 ? 83  GLU A CD   1  
ATOM 985   O OE1  . GLU A 1 64  ? -7.638  15.103  1.114   1.00 0.00 ? 83  GLU A OE1  1  
ATOM 986   O OE2  . GLU A 1 64  ? -5.872  15.286  -0.181  1.00 0.00 ? 83  GLU A OE2  1  
ATOM 987   H H    . GLU A 1 64  ? -4.335  11.363  2.379   1.00 0.00 ? 83  GLU A H    1  
ATOM 988   H HA   . GLU A 1 64  ? -6.600  10.385  1.300   1.00 0.00 ? 83  GLU A HA   1  
ATOM 989   H HB2  . GLU A 1 64  ? -7.572  12.650  1.435   2.00 0.00 ? 83  GLU A HB2  1  
ATOM 990   H HB3  . GLU A 1 64  ? -6.624  12.244  2.858   2.00 0.00 ? 83  GLU A HB3  1  
ATOM 991   H HG2  . GLU A 1 64  ? -5.546  14.153  2.594   2.00 0.00 ? 83  GLU A HG2  1  
ATOM 992   H HG3  . GLU A 1 64  ? -4.830  13.484  1.129   2.00 0.00 ? 83  GLU A HG3  1  
ATOM 993   N N    . GLY A 1 65  ? -4.964  12.090  -0.955  1.00 0.00 ? 84  GLY A N    1  
ATOM 994   C CA   . GLY A 1 65  ? -4.884  12.365  -2.377  1.00 0.00 ? 84  GLY A CA   1  
ATOM 995   C C    . GLY A 1 65  ? -3.558  12.979  -2.779  1.00 0.00 ? 84  GLY A C    1  
ATOM 996   O O    . GLY A 1 65  ? -3.508  13.852  -3.646  1.00 0.00 ? 84  GLY A O    1  
ATOM 997   H H    . GLY A 1 65  ? -4.224  12.350  -0.367  1.00 0.00 ? 84  GLY A H    1  
ATOM 998   H HA2  . GLY A 1 65  ? -5.019  11.439  -2.920  2.00 0.00 ? 84  GLY A HA2  1  
ATOM 999   H HA3  . GLY A 1 65  ? -5.680  13.046  -2.646  2.00 0.00 ? 84  GLY A HA3  1  
ATOM 1000  N N    . HIS A 1 66  ? -2.480  12.522  -2.147  1.00 0.00 ? 85  HIS A N    1  
ATOM 1001  C CA   . HIS A 1 66  ? -1.146  13.034  -2.443  1.00 0.00 ? 85  HIS A CA   1  
ATOM 1002  C C    . HIS A 1 66  ? -0.076  12.256  -1.680  1.00 0.00 ? 85  HIS A C    1  
ATOM 1003  O O    . HIS A 1 66  ? -0.286  11.845  -0.540  1.00 0.00 ? 85  HIS A O    1  
ATOM 1004  C CB   . HIS A 1 66  ? -1.059  14.520  -2.092  1.00 0.00 ? 85  HIS A CB   1  
ATOM 1005  C CG   . HIS A 1 66  ? -0.890  15.426  -3.272  1.00 0.00 ? 85  HIS A CG   1  
ATOM 1006  N ND1  . HIS A 1 66  ? 0.077   15.234  -4.237  1.00 0.00 ? 85  HIS A ND1  1  
ATOM 1007  C CD2  . HIS A 1 66  ? -1.572  16.536  -3.641  1.00 0.00 ? 85  HIS A CD2  1  
ATOM 1008  C CE1  . HIS A 1 66  ? -0.017  16.187  -5.147  1.00 0.00 ? 85  HIS A CE1  1  
ATOM 1009  N NE2  . HIS A 1 66  ? -1.010  16.989  -4.809  1.00 0.00 ? 85  HIS A NE2  1  
ATOM 1010  H H    . HIS A 1 66  ? -2.584  11.826  -1.466  1.00 0.00 ? 85  HIS A H    1  
ATOM 1011  H HA   . HIS A 1 66  ? -0.974  12.914  -3.502  1.00 0.00 ? 85  HIS A HA   1  
ATOM 1012  H HB2  . HIS A 1 66  ? -1.963  14.813  -1.579  2.00 0.00 ? 85  HIS A HB2  1  
ATOM 1013  H HB3  . HIS A 1 66  ? -0.216  14.676  -1.434  2.00 0.00 ? 85  HIS A HB3  1  
ATOM 1014  H HD1  . HIS A 1 66  ? 0.734   14.508  -4.252  1.00 0.00 ? 85  HIS A HD1  1  
ATOM 1015  H HD2  . HIS A 1 66  ? -2.404  16.982  -3.115  1.00 0.00 ? 85  HIS A HD2  1  
ATOM 1016  H HE1  . HIS A 1 66  ? 0.610   16.292  -6.020  1.00 0.00 ? 85  HIS A HE1  1  
ATOM 1017  H HE2  . HIS A 1 66  ? -1.236  17.829  -5.262  1.00 0.00 ? 85  HIS A HE2  1  
ATOM 1018  N N    . VAL A 1 67  ? 1.071   12.063  -2.321  1.00 0.00 ? 86  VAL A N    1  
ATOM 1019  C CA   . VAL A 1 67  ? 2.184   11.339  -1.713  1.00 0.00 ? 86  VAL A CA   1  
ATOM 1020  C C    . VAL A 1 67  ? 2.685   12.048  -0.459  1.00 0.00 ? 86  VAL A C    1  
ATOM 1021  O O    . VAL A 1 67  ? 3.189   13.168  -0.529  1.00 0.00 ? 86  VAL A O    1  
ATOM 1022  C CB   . VAL A 1 67  ? 3.350   11.196  -2.706  1.00 0.00 ? 86  VAL A CB   1  
ATOM 1023  C CG1  . VAL A 1 67  ? 3.631   12.522  -3.393  2.00 0.00 ? 86  VAL A CG1  1  
ATOM 1024  C CG2  . VAL A 1 67  ? 4.606   10.693  -2.012  2.00 0.00 ? 86  VAL A CG2  1  
ATOM 1025  H H    . VAL A 1 67  ? 1.175   12.419  -3.228  1.00 0.00 ? 86  VAL A H    1  
ATOM 1026  H HA   . VAL A 1 67  ? 1.839   10.351  -1.448  1.00 0.00 ? 86  VAL A HA   1  
ATOM 1027  H HB   . VAL A 1 67  ? 3.065   10.476  -3.459  1.00 0.00 ? 86  VAL A HB   1  
ATOM 1028  H HG11 . VAL A 1 67  ? 4.546   12.447  -3.960  1.00 0.00 ? 86  VAL A HG11 1  
ATOM 1029  H HG12 . VAL A 1 67  ? 3.729   13.300  -2.649  1.00 0.00 ? 86  VAL A HG12 1  
ATOM 1030  H HG13 . VAL A 1 67  ? 2.813   12.761  -4.058  1.00 0.00 ? 86  VAL A HG13 1  
ATOM 1031  H HG21 . VAL A 1 67  ? 5.214   11.534  -1.712  1.00 0.00 ? 86  VAL A HG21 1  
ATOM 1032  H HG22 . VAL A 1 67  ? 5.167   10.067  -2.693  1.00 0.00 ? 86  VAL A HG22 1  
ATOM 1033  H HG23 . VAL A 1 67  ? 4.331   10.118  -1.140  1.00 0.00 ? 86  VAL A HG23 1  
ATOM 1034  N N    . VAL A 1 68  ? 2.546   11.390  0.688   1.00 0.00 ? 87  VAL A N    1  
ATOM 1035  C CA   . VAL A 1 68  ? 2.989   11.966  1.954   1.00 0.00 ? 87  VAL A CA   1  
ATOM 1036  C C    . VAL A 1 68  ? 3.798   10.965  2.770   1.00 0.00 ? 87  VAL A C    1  
ATOM 1037  O O    . VAL A 1 68  ? 3.835   9.775   2.454   1.00 0.00 ? 87  VAL A O    1  
ATOM 1038  C CB   . VAL A 1 68  ? 1.796   12.449  2.800   1.00 0.00 ? 87  VAL A CB   1  
ATOM 1039  C CG1  . VAL A 1 68  ? 0.808   13.232  1.950   2.00 0.00 ? 87  VAL A CG1  1  
ATOM 1040  C CG2  . VAL A 1 68  ? 1.085   11.276  3.460   2.00 0.00 ? 87  VAL A CG2  1  
ATOM 1041  H H    . VAL A 1 68  ? 2.138   10.499  0.684   1.00 0.00 ? 87  VAL A H    1  
ATOM 1042  H HA   . VAL A 1 68  ? 3.612   12.820  1.730   1.00 0.00 ? 87  VAL A HA   1  
ATOM 1043  H HB   . VAL A 1 68  ? 2.172   13.101  3.575   1.00 0.00 ? 87  VAL A HB   1  
ATOM 1044  H HG11 . VAL A 1 68  ? 1.078   14.277  1.955   1.00 0.00 ? 87  VAL A HG11 1  
ATOM 1045  H HG12 . VAL A 1 68  ? -0.187  13.115  2.355   1.00 0.00 ? 87  VAL A HG12 1  
ATOM 1046  H HG13 . VAL A 1 68  ? 0.830   12.859  0.937   1.00 0.00 ? 87  VAL A HG13 1  
ATOM 1047  H HG21 . VAL A 1 68  ? 0.868   10.523  2.718   1.00 0.00 ? 87  VAL A HG21 1  
ATOM 1048  H HG22 . VAL A 1 68  ? 0.163   11.619  3.906   1.00 0.00 ? 87  VAL A HG22 1  
ATOM 1049  H HG23 . VAL A 1 68  ? 1.720   10.855  4.226   1.00 0.00 ? 87  VAL A HG23 1  
ATOM 1050  N N    . ILE A 1 69  ? 4.442   11.457  3.823   1.00 0.00 ? 88  ILE A N    1  
ATOM 1051  C CA   . ILE A 1 69  ? 5.249   10.611  4.693   1.00 0.00 ? 88  ILE A CA   1  
ATOM 1052  C C    . ILE A 1 69  ? 4.907   10.851  6.160   1.00 0.00 ? 88  ILE A C    1  
ATOM 1053  O O    . ILE A 1 69  ? 4.854   11.994  6.616   1.00 0.00 ? 88  ILE A O    1  
ATOM 1054  C CB   . ILE A 1 69  ? 6.756   10.858  4.482   1.00 0.00 ? 88  ILE A CB   1  
ATOM 1055  C CG1  . ILE A 1 69  ? 7.210   10.258  3.150   1.00 0.00 ? 88  ILE A CG1  1  
ATOM 1056  C CG2  . ILE A 1 69  ? 7.558   10.273  5.636   1.00 0.00 ? 88  ILE A CG2  1  
ATOM 1057  C CD1  . ILE A 1 69  ? 8.714   10.199  2.984   1.00 0.00 ? 88  ILE A CD1  1  
ATOM 1058  H H    . ILE A 1 69  ? 4.370   12.414  4.022   1.00 0.00 ? 88  ILE A H    1  
ATOM 1059  H HA   . ILE A 1 69  ? 5.036   9.580   4.447   1.00 0.00 ? 88  ILE A HA   1  
ATOM 1060  H HB   . ILE A 1 69  ? 6.923   11.925  4.464   1.00 0.00 ? 88  ILE A HB   1  
ATOM 1061  H HG12 . ILE A 1 69  ? 6.828   9.252   3.067   2.00 0.00 ? 88  ILE A HG12 1  
ATOM 1062  H HG13 . ILE A 1 69  ? 6.812   10.853  2.341   2.00 0.00 ? 88  ILE A HG13 1  
ATOM 1063  H HG21 . ILE A 1 69  ? 7.188   10.672  6.569   1.00 0.00 ? 88  ILE A HG21 1  
ATOM 1064  H HG22 . ILE A 1 69  ? 8.599   10.535  5.520   1.00 0.00 ? 88  ILE A HG22 1  
ATOM 1065  H HG23 . ILE A 1 69  ? 7.455   9.198   5.637   1.00 0.00 ? 88  ILE A HG23 1  
ATOM 1066  H HD11 . ILE A 1 69  ? 9.128   11.189  3.100   1.00 0.00 ? 88  ILE A HD11 1  
ATOM 1067  H HD12 . ILE A 1 69  ? 8.952   9.821   2.001   1.00 0.00 ? 88  ILE A HD12 1  
ATOM 1068  H HD13 . ILE A 1 69  ? 9.133   9.543   3.733   1.00 0.00 ? 88  ILE A HD13 1  
ATOM 1069  N N    . PRO A 1 70  ? 4.669   9.769   6.919   1.00 0.00 ? 89  PRO A N    1  
ATOM 1070  C CA   . PRO A 1 70  ? 4.329   9.858   8.343   1.00 0.00 ? 89  PRO A CA   1  
ATOM 1071  C C    . PRO A 1 70  ? 5.464   10.453  9.170   1.00 0.00 ? 89  PRO A C    1  
ATOM 1072  O O    . PRO A 1 70  ? 6.637   10.166  8.929   1.00 0.00 ? 89  PRO A O    1  
ATOM 1073  C CB   . PRO A 1 70  ? 4.083   8.400   8.747   1.00 0.00 ? 89  PRO A CB   1  
ATOM 1074  C CG   . PRO A 1 70  ? 3.867   7.668   7.467   1.00 0.00 ? 89  PRO A CG   1  
ATOM 1075  C CD   . PRO A 1 70  ? 4.711   8.376   6.447   1.00 0.00 ? 89  PRO A CD   1  
ATOM 1076  H HA   . PRO A 1 70  ? 3.430   10.435  8.500   1.00 0.00 ? 89  PRO A HA   1  
ATOM 1077  H HB2  . PRO A 1 70  ? 4.945   8.021   9.277   2.00 0.00 ? 89  PRO A HB2  1  
ATOM 1078  H HB3  . PRO A 1 70  ? 3.212   8.344   9.384   2.00 0.00 ? 89  PRO A HB3  1  
ATOM 1079  H HG2  . PRO A 1 70  ? 4.187   6.641   7.572   2.00 0.00 ? 89  PRO A HG2  1  
ATOM 1080  H HG3  . PRO A 1 70  ? 2.824   7.713   7.189   2.00 0.00 ? 89  PRO A HG3  1  
ATOM 1081  H HD2  . PRO A 1 70  ? 5.721   7.993   6.456   2.00 0.00 ? 89  PRO A HD2  1  
ATOM 1082  H HD3  . PRO A 1 70  ? 4.274   8.286   5.463   2.00 0.00 ? 89  PRO A HD3  1  
ATOM 1083  N N    . ARG A 1 71  ? 5.108   11.282  10.146  1.00 0.00 ? 90  ARG A N    1  
ATOM 1084  C CA   . ARG A 1 71  ? 6.098   11.917  11.008  1.00 0.00 ? 90  ARG A CA   1  
ATOM 1085  C C    . ARG A 1 71  ? 5.427   12.637  12.173  1.00 0.00 ? 90  ARG A C    1  
ATOM 1086  O O    . ARG A 1 71  ? 5.588   13.846  12.344  1.00 0.00 ? 90  ARG A O    1  
ATOM 1087  C CB   . ARG A 1 71  ? 6.947   12.904  10.204  1.00 0.00 ? 90  ARG A CB   1  
ATOM 1088  C CG   . ARG A 1 71  ? 8.375   13.072  10.696  1.00 0.00 ? 90  ARG A CG   1  
ATOM 1089  C CD   . ARG A 1 71  ? 9.252   11.897  10.294  1.00 0.00 ? 90  ARG A CD   1  
ATOM 1090  N NE   . ARG A 1 71  ? 10.106  11.455  11.392  1.00 0.00 ? 90  ARG A NE   1  
ATOM 1091  C CZ   . ARG A 1 71  ? 10.050  10.238  11.926  4.00 0.00 ? 90  ARG A CZ   1  
ATOM 1092  N NH1  . ARG A 1 71  ? 9.187   9.342   11.467  5.00 0.00 ? 90  ARG A NH1  1  
ATOM 1093  N NH2  . ARG A 1 71  ? 10.860  9.907   12.923  5.00 0.00 ? 90  ARG A NH2  1  
ATOM 1094  H H    . ARG A 1 71  ? 4.157   11.472  10.289  1.00 0.00 ? 90  ARG A H    1  
ATOM 1095  H HA   . ARG A 1 71  ? 6.740   11.142  11.401  1.00 0.00 ? 90  ARG A HA   1  
ATOM 1096  H HB2  . ARG A 1 71  ? 6.985   12.569  9.178   2.00 0.00 ? 90  ARG A HB2  1  
ATOM 1097  H HB3  . ARG A 1 71  ? 6.468   13.871  10.231  2.00 0.00 ? 90  ARG A HB3  1  
ATOM 1098  H HG2  . ARG A 1 71  ? 8.787   13.976  10.273  2.00 0.00 ? 90  ARG A HG2  1  
ATOM 1099  H HG3  . ARG A 1 71  ? 8.367   13.150  11.774  2.00 0.00 ? 90  ARG A HG3  1  
ATOM 1100  H HD2  . ARG A 1 71  ? 8.617   11.077  9.992   2.00 0.00 ? 90  ARG A HD2  1  
ATOM 1101  H HD3  . ARG A 1 71  ? 9.874   12.196  9.464   2.00 0.00 ? 90  ARG A HD3  1  
ATOM 1102  H HE   . ARG A 1 71  ? 10.754  12.097  11.750  1.00 0.00 ? 90  ARG A HE   1  
ATOM 1103  H HH11 . ARG A 1 71  ? 8.573   9.580   10.714  5.00 0.00 ? 90  ARG A HH11 1  
ATOM 1104  H HH12 . ARG A 1 71  ? 9.151   8.429   11.873  5.00 0.00 ? 90  ARG A HH12 1  
ATOM 1105  H HH21 . ARG A 1 71  ? 11.516  10.573  13.277  5.00 0.00 ? 90  ARG A HH21 1  
ATOM 1106  H HH22 . ARG A 1 71  ? 10.813  8.990   13.321  5.00 0.00 ? 90  ARG A HH22 1  
ATOM 1107  N N    . ILE A 1 72  ? 4.675   11.888  12.972  1.00 0.00 ? 91  ILE A N    1  
ATOM 1108  C CA   . ILE A 1 72  ? 3.981   12.457  14.121  1.00 0.00 ? 91  ILE A CA   1  
ATOM 1109  C C    . ILE A 1 72  ? 4.964   13.054  15.123  1.00 0.00 ? 91  ILE A C    1  
ATOM 1110  O O    . ILE A 1 72  ? 4.581   13.839  15.990  1.00 0.00 ? 91  ILE A O    1  
ATOM 1111  C CB   . ILE A 1 72  ? 3.117   11.399  14.833  1.00 0.00 ? 91  ILE A CB   1  
ATOM 1112  C CG1  . ILE A 1 72  ? 1.899   12.056  15.481  1.00 0.00 ? 91  ILE A CG1  1  
ATOM 1113  C CG2  . ILE A 1 72  ? 3.939   10.650  15.872  1.00 0.00 ? 91  ILE A CG2  1  
ATOM 1114  C CD1  . ILE A 1 72  ? 0.693   11.149  15.567  1.00 0.00 ? 91  ILE A CD1  1  
ATOM 1115  H H    . ILE A 1 72  ? 4.584   10.929  12.785  1.00 0.00 ? 91  ILE A H    1  
ATOM 1116  H HA   . ILE A 1 72  ? 3.329   13.239  13.761  1.00 0.00 ? 91  ILE A HA   1  
ATOM 1117  H HB   . ILE A 1 72  ? 2.781   10.686  14.095  1.00 0.00 ? 91  ILE A HB   1  
ATOM 1118  H HG12 . ILE A 1 72  ? 2.154   12.364  16.485  2.00 0.00 ? 91  ILE A HG12 1  
ATOM 1119  H HG13 . ILE A 1 72  ? 1.618   12.926  14.906  2.00 0.00 ? 91  ILE A HG13 1  
ATOM 1120  H HG21 . ILE A 1 72  ? 3.382   9.794   16.223  1.00 0.00 ? 91  ILE A HG21 1  
ATOM 1121  H HG22 . ILE A 1 72  ? 4.153   11.306  16.703  1.00 0.00 ? 91  ILE A HG22 1  
ATOM 1122  H HG23 . ILE A 1 72  ? 4.866   10.319  15.427  1.00 0.00 ? 91  ILE A HG23 1  
ATOM 1123  H HD11 . ILE A 1 72  ? 0.997   10.128  15.380  1.00 0.00 ? 91  ILE A HD11 1  
ATOM 1124  H HD12 . ILE A 1 72  ? -0.037  11.448  14.829  1.00 0.00 ? 91  ILE A HD12 1  
ATOM 1125  H HD13 . ILE A 1 72  ? 0.258   11.220  16.553  1.00 0.00 ? 91  ILE A HD13 1  
ATOM 1126  N N    . HIS A 1 73  ? 6.232   12.675  15.001  1.00 0.00 ? 92  HIS A N    1  
ATOM 1127  C CA   . HIS A 1 73  ? 7.268   13.172  15.900  1.00 0.00 ? 92  HIS A CA   1  
ATOM 1128  C C    . HIS A 1 73  ? 8.126   14.231  15.214  1.00 0.00 ? 92  HIS A C    1  
ATOM 1129  O O    . HIS A 1 73  ? 8.436   14.122  14.027  1.00 0.00 ? 92  HIS A O    1  
ATOM 1130  C CB   . HIS A 1 73  ? 8.150   12.020  16.383  1.00 0.00 ? 92  HIS A CB   1  
ATOM 1131  C CG   . HIS A 1 73  ? 7.664   11.356  17.634  1.00 0.00 ? 92  HIS A CG   1  
ATOM 1132  N ND1  . HIS A 1 73  ? 6.669   10.402  17.642  1.00 0.00 ? 92  HIS A ND1  1  
ATOM 1133  C CD2  . HIS A 1 73  ? 8.042   11.514  18.925  1.00 0.00 ? 92  HIS A CD2  1  
ATOM 1134  C CE1  . HIS A 1 73  ? 6.454   10.002  18.883  1.00 0.00 ? 92  HIS A CE1  1  
ATOM 1135  N NE2  . HIS A 1 73  ? 7.275   10.661  19.680  1.00 0.00 ? 92  HIS A NE2  1  
ATOM 1136  H H    . HIS A 1 73  ? 6.477   12.044  14.291  1.00 0.00 ? 92  HIS A H    1  
ATOM 1137  H HA   . HIS A 1 73  ? 6.779   13.620  16.751  1.00 0.00 ? 92  HIS A HA   1  
ATOM 1138  H HB2  . HIS A 1 73  ? 8.202   11.269  15.609  2.00 0.00 ? 92  HIS A HB2  1  
ATOM 1139  H HB3  . HIS A 1 73  ? 9.145   12.396  16.574  2.00 0.00 ? 92  HIS A HB3  1  
ATOM 1140  H HD1  . HIS A 1 73  ? 6.190   10.068  16.855  1.00 0.00 ? 92  HIS A HD1  1  
ATOM 1141  H HD2  . HIS A 1 73  ? 8.804   12.186  19.292  1.00 0.00 ? 92  HIS A HD2  1  
ATOM 1142  H HE1  . HIS A 1 73  ? 5.731   9.262   19.192  1.00 0.00 ? 92  HIS A HE1  1  
ATOM 1143  H HE2  . HIS A 1 73  ? 7.381   10.499  20.640  1.00 0.00 ? 92  HIS A HE2  1  
ATOM 1144  N N    . PRO A 1 74  ? 8.522   15.275  15.961  1.00 0.00 ? 93  PRO A N    1  
ATOM 1145  C CA   . PRO A 1 74  ? 9.349   16.362  15.429  1.00 0.00 ? 93  PRO A CA   1  
ATOM 1146  C C    . PRO A 1 74  ? 10.783  15.921  15.159  1.00 0.00 ? 93  PRO A C    1  
ATOM 1147  O O    . PRO A 1 74  ? 11.601  16.701  14.669  1.00 0.00 ? 93  PRO A O    1  
ATOM 1148  C CB   . PRO A 1 74  ? 9.313   17.407  16.543  1.00 0.00 ? 93  PRO A CB   1  
ATOM 1149  C CG   . PRO A 1 74  ? 9.071   16.626  17.787  1.00 0.00 ? 93  PRO A CG   1  
ATOM 1150  C CD   . PRO A 1 74  ? 8.191   15.473  17.386  1.00 0.00 ? 93  PRO A CD   1  
ATOM 1151  H HA   . PRO A 1 74  ? 8.925   16.778  14.527  1.00 0.00 ? 93  PRO A HA   1  
ATOM 1152  H HB2  . PRO A 1 74  ? 10.258  17.928  16.582  2.00 0.00 ? 93  PRO A HB2  1  
ATOM 1153  H HB3  . PRO A 1 74  ? 8.515   18.110  16.356  2.00 0.00 ? 93  PRO A HB3  1  
ATOM 1154  H HG2  . PRO A 1 74  ? 10.008  16.263  18.181  2.00 0.00 ? 93  PRO A HG2  1  
ATOM 1155  H HG3  . PRO A 1 74  ? 8.569   17.244  18.517  2.00 0.00 ? 93  PRO A HG3  1  
ATOM 1156  H HD2  . PRO A 1 74  ? 8.434   14.593  17.964  2.00 0.00 ? 93  PRO A HD2  1  
ATOM 1157  H HD3  . PRO A 1 74  ? 7.149   15.732  17.507  2.00 0.00 ? 93  PRO A HD3  1  
ATOM 1158  N N    . ASN A 1 75  ? 11.083  14.667  15.482  1.00 0.00 ? 94  ASN A N    1  
ATOM 1159  C CA   . ASN A 1 75  ? 12.419  14.123  15.275  1.00 0.00 ? 94  ASN A CA   1  
ATOM 1160  C C    . ASN A 1 75  ? 12.620  13.717  13.818  1.00 0.00 ? 94  ASN A C    1  
ATOM 1161  O O    . ASN A 1 75  ? 12.565  12.535  13.479  1.00 0.00 ? 94  ASN A O    1  
ATOM 1162  C CB   . ASN A 1 75  ? 12.649  12.919  16.189  1.00 0.00 ? 94  ASN A CB   1  
ATOM 1163  C CG   . ASN A 1 75  ? 14.011  12.945  16.855  1.00 0.00 ? 94  ASN A CG   1  
ATOM 1164  O OD1  . ASN A 1 75  ? 14.265  13.760  17.742  1.00 0.00 ? 94  ASN A OD1  1  
ATOM 1165  N ND2  . ASN A 1 75  ? 14.895  12.049  16.430  4.00 0.00 ? 94  ASN A ND2  1  
ATOM 1166  H H    . ASN A 1 75  ? 10.388  14.095  15.869  1.00 0.00 ? 94  ASN A H    1  
ATOM 1167  H HA   . ASN A 1 75  ? 13.133  14.894  15.523  1.00 0.00 ? 94  ASN A HA   1  
ATOM 1168  H HB2  . ASN A 1 75  ? 11.893  12.911  16.959  2.00 0.00 ? 94  ASN A HB2  1  
ATOM 1169  H HB3  . ASN A 1 75  ? 12.572  12.013  15.606  2.00 0.00 ? 94  ASN A HB3  1  
ATOM 1170  H HD21 . ASN A 1 75  ? 14.622  11.429  15.719  5.00 0.00 ? 94  ASN A HD21 1  
ATOM 1171  H HD22 . ASN A 1 75  ? 15.786  12.044  16.846  5.00 0.00 ? 94  ASN A HD22 1  
ATOM 1172  N N    . SER A 1 76  ? 12.853  14.707  12.962  1.00 0.00 ? 95  SER A N    1  
ATOM 1173  C CA   . SER A 1 76  ? 13.062  14.455  11.541  1.00 0.00 ? 95  SER A CA   1  
ATOM 1174  C C    . SER A 1 76  ? 14.232  13.502  11.322  1.00 0.00 ? 95  SER A C    1  
ATOM 1175  O O    . SER A 1 76  ? 15.356  13.776  11.742  1.00 0.00 ? 95  SER A O    1  
ATOM 1176  C CB   . SER A 1 76  ? 13.315  15.770  10.800  1.00 0.00 ? 95  SER A CB   1  
ATOM 1177  O OG   . SER A 1 76  ? 14.265  16.568  11.486  1.00 0.00 ? 95  SER A OG   1  
ATOM 1178  H H    . SER A 1 76  ? 12.885  15.628  13.294  1.00 0.00 ? 95  SER A H    1  
ATOM 1179  H HA   . SER A 1 76  ? 12.165  14.000  11.150  1.00 0.00 ? 95  SER A HA   1  
ATOM 1180  H HB2  . SER A 1 76  ? 13.690  15.557  9.810   2.00 0.00 ? 95  SER A HB2  1  
ATOM 1181  H HB3  . SER A 1 76  ? 12.390  16.322  10.724  2.00 0.00 ? 95  SER A HB3  1  
ATOM 1182  H HG   . SER A 1 76  ? 14.219  17.470  11.162  1.00 0.00 ? 95  SER A HG   1  
ATOM 1183  N N    . ILE A 1 77  ? 13.959  12.381  10.663  1.00 0.00 ? 96  ILE A N    1  
ATOM 1184  C CA   . ILE A 1 77  ? 14.987  11.385  10.388  1.00 0.00 ? 96  ILE A CA   1  
ATOM 1185  C C    . ILE A 1 77  ? 14.535  10.415  9.301   1.00 0.00 ? 96  ILE A C    1  
ATOM 1186  O O    . ILE A 1 77  ? 15.342  9.948   8.497   1.00 0.00 ? 96  ILE A O    1  
ATOM 1187  C CB   . ILE A 1 77  ? 15.351  10.588  11.656  1.00 0.00 ? 96  ILE A CB   1  
ATOM 1188  C CG1  . ILE A 1 77  ? 16.453  9.572   11.349  1.00 0.00 ? 96  ILE A CG1  1  
ATOM 1189  C CG2  . ILE A 1 77  ? 14.120  9.890   12.215  1.00 0.00 ? 96  ILE A CG2  1  
ATOM 1190  C CD1  . ILE A 1 77  ? 17.395  9.321   12.506  1.00 0.00 ? 96  ILE A CD1  1  
ATOM 1191  H H    . ILE A 1 77  ? 13.043  12.220  10.354  1.00 0.00 ? 96  ILE A H    1  
ATOM 1192  H HA   . ILE A 1 77  ? 15.872  11.904  10.048  1.00 0.00 ? 96  ILE A HA   1  
ATOM 1193  H HB   . ILE A 1 77  ? 15.709  11.283  12.400  1.00 0.00 ? 96  ILE A HB   1  
ATOM 1194  H HG12 . ILE A 1 77  ? 15.998  8.627   11.082  2.00 0.00 ? 96  ILE A HG12 1  
ATOM 1195  H HG13 . ILE A 1 77  ? 17.040  9.929   10.515  2.00 0.00 ? 96  ILE A HG13 1  
ATOM 1196  H HG21 . ILE A 1 77  ? 14.174  9.875   13.294  1.00 0.00 ? 96  ILE A HG21 1  
ATOM 1197  H HG22 . ILE A 1 77  ? 14.080  8.877   11.843  1.00 0.00 ? 96  ILE A HG22 1  
ATOM 1198  H HG23 . ILE A 1 77  ? 13.233  10.423  11.907  1.00 0.00 ? 96  ILE A HG23 1  
ATOM 1199  H HD11 . ILE A 1 77  ? 18.373  9.712   12.265  1.00 0.00 ? 96  ILE A HD11 1  
ATOM 1200  H HD12 . ILE A 1 77  ? 17.467  8.259   12.688  1.00 0.00 ? 96  ILE A HD12 1  
ATOM 1201  H HD13 . ILE A 1 77  ? 17.019  9.813   13.390  1.00 0.00 ? 96  ILE A HD13 1  
ATOM 1202  N N    . CYS A 1 78  ? 13.240  10.115  9.284   1.00 0.00 ? 97  CYS A N    1  
ATOM 1203  C CA   . CYS A 1 78  ? 12.680  9.200   8.296   1.00 0.00 ? 97  CYS A CA   1  
ATOM 1204  C C    . CYS A 1 78  ? 12.673  9.833   6.908   1.00 0.00 ? 97  CYS A C    1  
ATOM 1205  O O    . CYS A 1 78  ? 13.494  9.493   6.057   1.00 0.00 ? 97  CYS A O    1  
ATOM 1206  C CB   . CYS A 1 78  ? 11.258  8.798   8.693   1.00 0.00 ? 97  CYS A CB   1  
ATOM 1207  S SG   . CYS A 1 78  ? 11.104  7.072   9.255   1.00 0.00 ? 97  CYS A SG   1  
ATOM 1208  H H    . CYS A 1 78  ? 12.647  10.518  9.952   1.00 0.00 ? 97  CYS A H    1  
ATOM 1209  H HA   . CYS A 1 78  ? 13.301  8.317   8.273   1.00 0.00 ? 97  CYS A HA   1  
ATOM 1210  H HB2  . CYS A 1 78  ? 10.923  9.436   9.497   2.00 0.00 ? 97  CYS A HB2  1  
ATOM 1211  H HB3  . CYS A 1 78  ? 10.605  8.926   7.843   2.00 0.00 ? 97  CYS A HB3  1  
ATOM 1212  N N    . ALA A 1 79  ? 11.741  10.755  6.688   1.00 0.00 ? 98  ALA A N    1  
ATOM 1213  C CA   . ALA A 1 79  ? 11.627  11.434  5.403   1.00 0.00 ? 98  ALA A CA   1  
ATOM 1214  C C    . ALA A 1 79  ? 12.840  12.319  5.138   1.00 0.00 ? 98  ALA A C    1  
ATOM 1215  O O    . ALA A 1 79  ? 13.760  11.929  4.419   1.00 0.00 ? 98  ALA A O    1  
ATOM 1216  C CB   . ALA A 1 79  ? 10.349  12.258  5.353   1.00 0.00 ? 98  ALA A CB   1  
ATOM 1217  H H    . ALA A 1 79  ? 11.114  10.983  7.406   1.00 0.00 ? 98  ALA A H    1  
ATOM 1218  H HA   . ALA A 1 79  ? 11.570  10.680  4.632   1.00 0.00 ? 98  ALA A HA   1  
ATOM 1219  H HB1  . ALA A 1 79  ? 9.804   12.134  6.277   1.00 0.00 ? 98  ALA A HB1  1  
ATOM 1220  H HB2  . ALA A 1 79  ? 9.738   11.925  4.527   1.00 0.00 ? 98  ALA A HB2  1  
ATOM 1221  H HB3  . ALA A 1 79  ? 10.598  13.301  5.219   1.00 0.00 ? 98  ALA A HB3  1  
ATOM 1222  N N    . ALA A 1 80  ? 12.836  13.513  5.723   1.00 0.00 ? 99  ALA A N    1  
ATOM 1223  C CA   . ALA A 1 80  ? 13.937  14.452  5.547   1.00 0.00 ? 99  ALA A CA   1  
ATOM 1224  C C    . ALA A 1 80  ? 13.970  15.479  6.675   1.00 0.00 ? 99  ALA A C    1  
ATOM 1225  O O    . ALA A 1 80  ? 14.792  15.387  7.586   1.00 0.00 ? 99  ALA A O    1  
ATOM 1226  C CB   . ALA A 1 80  ? 13.825  15.149  4.200   1.00 0.00 ? 99  ALA A CB   1  
ATOM 1227  H H    . ALA A 1 80  ? 12.074  13.768  6.284   1.00 0.00 ? 99  ALA A H    1  
ATOM 1228  H HA   . ALA A 1 80  ? 14.859  13.890  5.559   1.00 0.00 ? 99  ALA A HA   1  
ATOM 1229  H HB1  . ALA A 1 80  ? 12.873  14.911  3.749   1.00 0.00 ? 99  ALA A HB1  1  
ATOM 1230  H HB2  . ALA A 1 80  ? 14.623  14.815  3.554   1.00 0.00 ? 99  ALA A HB2  1  
ATOM 1231  H HB3  . ALA A 1 80  ? 13.899  16.218  4.340   1.00 0.00 ? 99  ALA A HB3  1  
ATOM 1232  N N    . ASN A 1 81  ? 13.073  16.457  6.605   1.00 0.00 ? 100 ASN A N    1  
ATOM 1233  C CA   . ASN A 1 81  ? 13.002  17.502  7.620   1.00 0.00 ? 100 ASN A CA   1  
ATOM 1234  C C    . ASN A 1 81  ? 11.558  17.763  8.036   1.00 0.00 ? 100 ASN A C    1  
ATOM 1235  O O    . ASN A 1 81  ? 11.195  17.583  9.198   1.00 0.00 ? 100 ASN A O    1  
ATOM 1236  C CB   . ASN A 1 81  ? 13.635  18.793  7.096   1.00 0.00 ? 100 ASN A CB   1  
ATOM 1237  C CG   . ASN A 1 81  ? 14.802  19.256  7.947   1.00 0.00 ? 100 ASN A CG   1  
ATOM 1238  O OD1  . ASN A 1 81  ? 14.840  19.014  9.153   1.00 0.00 ? 100 ASN A OD1  1  
ATOM 1239  N ND2  . ASN A 1 81  ? 15.762  19.926  7.320   4.00 0.00 ? 100 ASN A ND2  1  
ATOM 1240  H H    . ASN A 1 81  ? 12.445  16.478  5.853   1.00 0.00 ? 100 ASN A H    1  
ATOM 1241  H HA   . ASN A 1 81  ? 13.557  17.165  8.482   1.00 0.00 ? 100 ASN A HA   1  
ATOM 1242  H HB2  . ASN A 1 81  ? 13.990  18.630  6.089   2.00 0.00 ? 100 ASN A HB2  1  
ATOM 1243  H HB3  . ASN A 1 81  ? 12.889  19.574  7.087   2.00 0.00 ? 100 ASN A HB3  1  
ATOM 1244  H HD21 . ASN A 1 81  ? 15.665  20.082  6.355   5.00 0.00 ? 100 ASN A HD21 1  
ATOM 1245  H HD22 . ASN A 1 81  ? 16.531  20.237  7.848   5.00 0.00 ? 100 ASN A HD22 1  
ATOM 1246  N N    . ASN A 1 82  ? 10.740  18.190  7.079   1.00 0.00 ? 101 ASN A N    1  
ATOM 1247  C CA   . ASN A 1 82  ? 9.335   18.478  7.346   1.00 0.00 ? 101 ASN A CA   1  
ATOM 1248  C C    . ASN A 1 82  ? 8.649   17.285  8.004   1.00 0.00 ? 101 ASN A C    1  
ATOM 1249  O O    . ASN A 1 82  ? 8.917   16.134  7.658   1.00 0.00 ? 101 ASN A O    1  
ATOM 1250  C CB   . ASN A 1 82  ? 8.612   18.845  6.048   1.00 0.00 ? 101 ASN A CB   1  
ATOM 1251  C CG   . ASN A 1 82  ? 8.093   20.270  6.052   1.00 0.00 ? 101 ASN A CG   1  
ATOM 1252  O OD1  . ASN A 1 82  ? 8.858   21.221  6.210   1.00 0.00 ? 101 ASN A OD1  1  
ATOM 1253  N ND2  . ASN A 1 82  ? 6.785   20.424  5.877   4.00 0.00 ? 101 ASN A ND2  1  
ATOM 1254  H H    . ASN A 1 82  ? 11.089  18.316  6.172   1.00 0.00 ? 101 ASN A H    1  
ATOM 1255  H HA   . ASN A 1 82  ? 9.292   19.320  8.021   1.00 0.00 ? 101 ASN A HA   1  
ATOM 1256  H HB2  . ASN A 1 82  ? 9.296   18.734  5.220   2.00 0.00 ? 101 ASN A HB2  1  
ATOM 1257  H HB3  . ASN A 1 82  ? 7.774   18.178  5.910   2.00 0.00 ? 101 ASN A HB3  1  
ATOM 1258  H HD21 . ASN A 1 82  ? 6.235   19.619  5.758   5.00 0.00 ? 101 ASN A HD21 1  
ATOM 1259  H HD22 . ASN A 1 82  ? 6.422   21.337  5.875   5.00 0.00 ? 101 ASN A HD22 1  
ATOM 1260  N N    . THR A 1 83  ? 7.764   17.568  8.954   1.00 0.00 ? 102 THR A N    1  
ATOM 1261  C CA   . THR A 1 83  ? 7.041   16.521  9.660   1.00 0.00 ? 102 THR A CA   1  
ATOM 1262  C C    . THR A 1 83  ? 5.550   16.574  9.349   1.00 0.00 ? 102 THR A C    1  
ATOM 1263  O O    . THR A 1 83  ? 4.989   17.647  9.127   1.00 0.00 ? 102 THR A O    1  
ATOM 1264  C CB   . THR A 1 83  ? 7.239   16.630  11.184  1.00 0.00 ? 102 THR A CB   1  
ATOM 1265  O OG1  . THR A 1 83  ? 6.599   17.813  11.678  1.00 0.00 ? 102 THR A OG1  1  
ATOM 1266  C CG2  . THR A 1 83  ? 8.719   16.664  11.537  1.00 0.00 ? 102 THR A CG2  1  
ATOM 1267  H H    . THR A 1 83  ? 7.594   18.502  9.185   1.00 0.00 ? 102 THR A H    1  
ATOM 1268  H HA   . THR A 1 83  ? 7.434   15.571  9.335   1.00 0.00 ? 102 THR A HA   1  
ATOM 1269  H HB   . THR A 1 83  ? 6.792   15.766  11.653  1.00 0.00 ? 102 THR A HB   1  
ATOM 1270  H HG1  . THR A 1 83  ? 5.911   17.569  12.301  1.00 0.00 ? 102 THR A HG1  1  
ATOM 1271  H HG21 . THR A 1 83  ? 9.035   17.689  11.663  1.00 0.00 ? 102 THR A HG21 1  
ATOM 1272  H HG22 . THR A 1 83  ? 9.289   16.207  10.742  1.00 0.00 ? 102 THR A HG22 1  
ATOM 1273  H HG23 . THR A 1 83  ? 8.882   16.121  12.456  1.00 0.00 ? 102 THR A HG23 1  
ATOM 1274  N N    . GLY A 1 84  ? 4.912   15.407  9.335   1.00 0.00 ? 103 GLY A N    1  
ATOM 1275  C CA   . GLY A 1 84  ? 3.491   15.341  9.051   1.00 0.00 ? 103 GLY A CA   1  
ATOM 1276  C C    . GLY A 1 84  ? 3.168   15.593  7.592   1.00 0.00 ? 103 GLY A C    1  
ATOM 1277  O O    . GLY A 1 84  ? 3.675   16.541  6.992   1.00 0.00 ? 103 GLY A O    1  
ATOM 1278  H H    . GLY A 1 84  ? 5.412   14.585  9.520   1.00 0.00 ? 103 GLY A H    1  
ATOM 1279  H HA2  . GLY A 1 84  ? 3.127   14.360  9.324   2.00 0.00 ? 103 GLY A HA2  1  
ATOM 1280  H HA3  . GLY A 1 84  ? 2.982   16.082  9.653   2.00 0.00 ? 103 GLY A HA3  1  
ATOM 1281  N N    . VAL A 1 85  ? 2.321   14.740  7.021   1.00 0.00 ? 104 VAL A N    1  
ATOM 1282  C CA   . VAL A 1 85  ? 1.923   14.867  5.622   1.00 0.00 ? 104 VAL A CA   1  
ATOM 1283  C C    . VAL A 1 85  ? 3.084   15.355  4.757   1.00 0.00 ? 104 VAL A C    1  
ATOM 1284  O O    . VAL A 1 85  ? 2.939   16.296  3.976   1.00 0.00 ? 104 VAL A O    1  
ATOM 1285  C CB   . VAL A 1 85  ? 0.724   15.826  5.464   1.00 0.00 ? 104 VAL A CB   1  
ATOM 1286  C CG1  . VAL A 1 85  ? 1.102   17.248  5.851   2.00 0.00 ? 104 VAL A CG1  1  
ATOM 1287  C CG2  . VAL A 1 85  ? 0.187   15.796  4.041   2.00 0.00 ? 104 VAL A CG2  1  
ATOM 1288  H H    . VAL A 1 85  ? 1.952   14.006  7.556   1.00 0.00 ? 104 VAL A H    1  
ATOM 1289  H HA   . VAL A 1 85  ? 1.620   13.889  5.276   1.00 0.00 ? 104 VAL A HA   1  
ATOM 1290  H HB   . VAL A 1 85  ? -0.059  15.490  6.128   1.00 0.00 ? 104 VAL A HB   1  
ATOM 1291  H HG11 . VAL A 1 85  ? 0.383   17.937  5.435   1.00 0.00 ? 104 VAL A HG11 1  
ATOM 1292  H HG12 . VAL A 1 85  ? 2.085   17.477  5.466   1.00 0.00 ? 104 VAL A HG12 1  
ATOM 1293  H HG13 . VAL A 1 85  ? 1.107   17.338  6.927   1.00 0.00 ? 104 VAL A HG13 1  
ATOM 1294  H HG21 . VAL A 1 85  ? -0.772  16.291  4.007   1.00 0.00 ? 104 VAL A HG21 1  
ATOM 1295  H HG22 . VAL A 1 85  ? 0.075   14.771  3.720   1.00 0.00 ? 104 VAL A HG22 1  
ATOM 1296  H HG23 . VAL A 1 85  ? 0.878   16.305  3.385   1.00 0.00 ? 104 VAL A HG23 1  
ATOM 1297  N N    . TYR A 1 86  ? 4.236   14.707  4.901   1.00 0.00 ? 105 TYR A N    1  
ATOM 1298  C CA   . TYR A 1 86  ? 5.420   15.074  4.133   1.00 0.00 ? 105 TYR A CA   1  
ATOM 1299  C C    . TYR A 1 86  ? 5.252   14.699  2.664   1.00 0.00 ? 105 TYR A C    1  
ATOM 1300  O O    . TYR A 1 86  ? 5.406   13.536  2.290   1.00 0.00 ? 105 TYR A O    1  
ATOM 1301  C CB   . TYR A 1 86  ? 6.661   14.386  4.707   1.00 0.00 ? 105 TYR A CB   1  
ATOM 1302  C CG   . TYR A 1 86  ? 7.935   14.644  3.933   1.00 0.00 ? 105 TYR A CG   1  
ATOM 1303  C CD1  . TYR A 1 86  ? 8.749   15.727  4.241   1.00 0.00 ? 105 TYR A CD1  1  
ATOM 1304  C CD2  . TYR A 1 86  ? 8.323   13.804  2.896   1.00 0.00 ? 105 TYR A CD2  1  
ATOM 1305  C CE1  . TYR A 1 86  ? 9.914   15.966  3.537   1.00 0.00 ? 105 TYR A CE1  1  
ATOM 1306  C CE2  . TYR A 1 86  ? 9.487   14.037  2.188   1.00 0.00 ? 105 TYR A CE2  1  
ATOM 1307  C CZ   . TYR A 1 86  ? 10.278  15.119  2.512   1.00 0.00 ? 105 TYR A CZ   1  
ATOM 1308  O OH   . TYR A 1 86  ? 11.438  15.354  1.809   1.00 0.00 ? 105 TYR A OH   1  
ATOM 1309  H H    . TYR A 1 86  ? 4.290   13.964  5.539   1.00 0.00 ? 105 TYR A H    1  
ATOM 1310  H HA   . TYR A 1 86  ? 5.545   16.144  4.207   1.00 0.00 ? 105 TYR A HA   1  
ATOM 1311  H HB2  . TYR A 1 86  ? 6.815   14.729  5.719   2.00 0.00 ? 105 TYR A HB2  1  
ATOM 1312  H HB3  . TYR A 1 86  ? 6.494   13.319  4.720   2.00 0.00 ? 105 TYR A HB3  1  
ATOM 1313  H HD1  . TYR A 1 86  ? 8.462   16.388  5.045   1.00 0.00 ? 105 TYR A HD1  1  
ATOM 1314  H HD2  . TYR A 1 86  ? 7.701   12.958  2.644   1.00 0.00 ? 105 TYR A HD2  1  
ATOM 1315  H HE1  . TYR A 1 86  ? 10.534  16.813  3.791   1.00 0.00 ? 105 TYR A HE1  1  
ATOM 1316  H HE2  . TYR A 1 86  ? 9.772   13.373  1.385   1.00 0.00 ? 105 TYR A HE2  1  
ATOM 1317  H HH   . TYR A 1 86  ? 11.543  16.298  1.672   1.00 0.00 ? 105 TYR A HH   1  
ATOM 1318  N N    . ILE A 1 87  ? 4.939   15.690  1.835   1.00 0.00 ? 106 ILE A N    1  
ATOM 1319  C CA   . ILE A 1 87  ? 4.752   15.460  0.407   1.00 0.00 ? 106 ILE A CA   1  
ATOM 1320  C C    . ILE A 1 87  ? 6.094   15.300  -0.302  1.00 0.00 ? 106 ILE A C    1  
ATOM 1321  O O    . ILE A 1 87  ? 7.091   15.904  0.092   1.00 0.00 ? 106 ILE A O    1  
ATOM 1322  C CB   . ILE A 1 87  ? 3.961   16.609  -0.251  1.00 0.00 ? 106 ILE A CB   1  
ATOM 1323  C CG1  . ILE A 1 87  ? 2.484   16.231  -0.382  1.00 0.00 ? 106 ILE A CG1  1  
ATOM 1324  C CG2  . ILE A 1 87  ? 4.549   16.952  -1.613  1.00 0.00 ? 106 ILE A CG2  1  
ATOM 1325  C CD1  . ILE A 1 87  ? 2.145   15.530  -1.681  1.00 0.00 ? 106 ILE A CD1  1  
ATOM 1326  H H    . ILE A 1 87  ? 4.831   16.596  2.192   1.00 0.00 ? 106 ILE A H    1  
ATOM 1327  H HA   . ILE A 1 87  ? 4.185   14.548  0.290   1.00 0.00 ? 106 ILE A HA   1  
ATOM 1328  H HB   . ILE A 1 87  ? 4.047   17.482  0.379   1.00 0.00 ? 106 ILE A HB   1  
ATOM 1329  H HG12 . ILE A 1 87  ? 2.214   15.572  0.430   2.00 0.00 ? 106 ILE A HG12 1  
ATOM 1330  H HG13 . ILE A 1 87  ? 1.883   17.127  -0.323  2.00 0.00 ? 106 ILE A HG13 1  
ATOM 1331  H HG21 . ILE A 1 87  ? 5.576   17.264  -1.495  1.00 0.00 ? 106 ILE A HG21 1  
ATOM 1332  H HG22 . ILE A 1 87  ? 3.978   17.752  -2.061  1.00 0.00 ? 106 ILE A HG22 1  
ATOM 1333  H HG23 . ILE A 1 87  ? 4.508   16.080  -2.251  1.00 0.00 ? 106 ILE A HG23 1  
ATOM 1334  H HD11 . ILE A 1 87  ? 1.297   14.879  -1.528  1.00 0.00 ? 106 ILE A HD11 1  
ATOM 1335  H HD12 . ILE A 1 87  ? 2.993   14.946  -2.007  1.00 0.00 ? 106 ILE A HD12 1  
ATOM 1336  H HD13 . ILE A 1 87  ? 1.903   16.265  -2.434  1.00 0.00 ? 106 ILE A HD13 1  
ATOM 1337  N N    . LEU A 1 88  ? 6.109   14.482  -1.349  1.00 0.00 ? 107 LEU A N    1  
ATOM 1338  C CA   . LEU A 1 88  ? 7.327   14.240  -2.114  1.00 0.00 ? 107 LEU A CA   1  
ATOM 1339  C C    . LEU A 1 88  ? 7.780   15.504  -2.838  1.00 0.00 ? 107 LEU A C    1  
ATOM 1340  O O    . LEU A 1 88  ? 7.003   16.442  -3.016  1.00 0.00 ? 107 LEU A O    1  
ATOM 1341  C CB   . LEU A 1 88  ? 7.104   13.114  -3.124  1.00 0.00 ? 107 LEU A CB   1  
ATOM 1342  C CG   . LEU A 1 88  ? 8.309   12.204  -3.367  1.00 0.00 ? 107 LEU A CG   1  
ATOM 1343  C CD1  . LEU A 1 88  ? 7.854   10.783  -3.659  2.00 0.00 ? 107 LEU A CD1  1  
ATOM 1344  C CD2  . LEU A 1 88  ? 9.160   12.734  -4.510  2.00 0.00 ? 107 LEU A CD2  1  
ATOM 1345  H H    . LEU A 1 88  ? 5.281   14.028  -1.613  1.00 0.00 ? 107 LEU A H    1  
ATOM 1346  H HA   . LEU A 1 88  ? 8.099   13.941  -1.421  1.00 0.00 ? 107 LEU A HA   1  
ATOM 1347  H HB2  . LEU A 1 88  ? 6.283   12.505  -2.776  2.00 0.00 ? 107 LEU A HB2  1  
ATOM 1348  H HB3  . LEU A 1 88  ? 6.819   13.557  -4.067  2.00 0.00 ? 107 LEU A HB3  1  
ATOM 1349  H HG   . LEU A 1 88  ? 8.918   12.184  -2.476  1.00 0.00 ? 107 LEU A HG   1  
ATOM 1350  H HD11 . LEU A 1 88  ? 7.889   10.605  -4.723  1.00 0.00 ? 107 LEU A HD11 1  
ATOM 1351  H HD12 . LEU A 1 88  ? 6.841   10.649  -3.305  1.00 0.00 ? 107 LEU A HD12 1  
ATOM 1352  H HD13 . LEU A 1 88  ? 8.506   10.085  -3.155  1.00 0.00 ? 107 LEU A HD13 1  
ATOM 1353  H HD21 . LEU A 1 88  ? 8.591   13.453  -5.079  1.00 0.00 ? 107 LEU A HD21 1  
ATOM 1354  H HD22 . LEU A 1 88  ? 9.451   11.915  -5.152  1.00 0.00 ? 107 LEU A HD22 1  
ATOM 1355  H HD23 . LEU A 1 88  ? 10.044  13.209  -4.110  1.00 0.00 ? 107 LEU A HD23 1  
ATOM 1356  N N    . THR A 1 89  ? 9.042   15.520  -3.254  1.00 0.00 ? 108 THR A N    1  
ATOM 1357  C CA   . THR A 1 89  ? 9.600   16.666  -3.960  1.00 0.00 ? 108 THR A CA   1  
ATOM 1358  C C    . THR A 1 89  ? 10.847  16.272  -4.745  1.00 0.00 ? 108 THR A C    1  
ATOM 1359  O O    . THR A 1 89  ? 11.914  16.862  -4.574  1.00 0.00 ? 108 THR A O    1  
ATOM 1360  C CB   . THR A 1 89  ? 9.958   17.806  -2.988  1.00 0.00 ? 108 THR A CB   1  
ATOM 1361  O OG1  . THR A 1 89  ? 9.869   17.343  -1.635  1.00 0.00 ? 108 THR A OG1  1  
ATOM 1362  C CG2  . THR A 1 89  ? 9.030   18.995  -3.183  1.00 0.00 ? 108 THR A CG2  1  
ATOM 1363  H H    . THR A 1 89  ? 9.611   14.741  -3.082  1.00 0.00 ? 108 THR A H    1  
ATOM 1364  H HA   . THR A 1 89  ? 8.852   17.030  -4.650  1.00 0.00 ? 108 THR A HA   1  
ATOM 1365  H HB   . THR A 1 89  ? 10.972  18.124  -3.186  1.00 0.00 ? 108 THR A HB   1  
ATOM 1366  H HG1  . THR A 1 89  ? 9.269   17.908  -1.142  1.00 0.00 ? 108 THR A HG1  1  
ATOM 1367  H HG21 . THR A 1 89  ? 9.390   19.833  -2.604  1.00 0.00 ? 108 THR A HG21 1  
ATOM 1368  H HG22 . THR A 1 89  ? 8.034   18.733  -2.856  1.00 0.00 ? 108 THR A HG22 1  
ATOM 1369  H HG23 . THR A 1 89  ? 9.005   19.265  -4.229  1.00 0.00 ? 108 THR A HG23 1  
ATOM 1370  N N    . SER A 1 90  ? 10.704  15.269  -5.606  1.00 0.00 ? 109 SER A N    1  
ATOM 1371  C CA   . SER A 1 90  ? 11.819  14.794  -6.418  1.00 0.00 ? 109 SER A CA   1  
ATOM 1372  C C    . SER A 1 90  ? 11.349  14.413  -7.819  1.00 0.00 ? 109 SER A C    1  
ATOM 1373  O O    . SER A 1 90  ? 10.327  14.906  -8.297  1.00 0.00 ? 109 SER A O    1  
ATOM 1374  C CB   . SER A 1 90  ? 12.488  13.593  -5.747  1.00 0.00 ? 109 SER A CB   1  
ATOM 1375  O OG   . SER A 1 90  ? 13.753  13.945  -5.214  1.00 0.00 ? 109 SER A OG   1  
ATOM 1376  H H    . SER A 1 90  ? 9.829   14.838  -5.698  1.00 0.00 ? 109 SER A H    1  
ATOM 1377  H HA   . SER A 1 90  ? 12.537  15.596  -6.498  1.00 0.00 ? 109 SER A HA   1  
ATOM 1378  H HB2  . SER A 1 90  ? 11.860  13.235  -4.943  2.00 0.00 ? 109 SER A HB2  1  
ATOM 1379  H HB3  . SER A 1 90  ? 12.625  12.806  -6.476  2.00 0.00 ? 109 SER A HB3  1  
ATOM 1380  H HG   . SER A 1 90  ? 14.371  13.223  -5.351  1.00 0.00 ? 109 SER A HG   1  
ATOM 1381  N N    . ASN A 1 91  ? 12.102  13.533  -8.472  1.00 0.00 ? 110 ASN A N    1  
ATOM 1382  C CA   . ASN A 1 91  ? 11.763  13.085  -9.818  1.00 0.00 ? 110 ASN A CA   1  
ATOM 1383  C C    . ASN A 1 91  ? 10.347  12.520  -9.863  1.00 0.00 ? 110 ASN A C    1  
ATOM 1384  O O    . ASN A 1 91  ? 9.836   12.018  -8.862  1.00 0.00 ? 110 ASN A O    1  
ATOM 1385  C CB   . ASN A 1 91  ? 12.761  12.027  -10.293 1.00 0.00 ? 110 ASN A CB   1  
ATOM 1386  C CG   . ASN A 1 91  ? 12.718  11.784  -11.788 1.00 0.00 ? 110 ASN A CG   1  
ATOM 1387  O OD1  . ASN A 1 91  ? 12.870  12.710  -12.585 1.00 0.00 ? 110 ASN A OD1  1  
ATOM 1388  N ND2  . ASN A 1 91  ? 12.509  10.531  -12.178 4.00 0.00 ? 110 ASN A ND2  1  
ATOM 1389  H H    . ASN A 1 91  ? 12.905  13.176  -8.038  1.00 0.00 ? 110 ASN A H    1  
ATOM 1390  H HA   . ASN A 1 91  ? 11.818  13.940  -10.476 1.00 0.00 ? 110 ASN A HA   1  
ATOM 1391  H HB2  . ASN A 1 91  ? 13.759  12.345  -10.030 2.00 0.00 ? 110 ASN A HB2  1  
ATOM 1392  H HB3  . ASN A 1 91  ? 12.548  11.095  -9.792  2.00 0.00 ? 110 ASN A HB3  1  
ATOM 1393  H HD21 . ASN A 1 91  ? 12.395  9.843   -11.486 5.00 0.00 ? 110 ASN A HD21 1  
ATOM 1394  H HD22 . ASN A 1 91  ? 12.476  10.345  -13.143 5.00 0.00 ? 110 ASN A HD22 1  
ATOM 1395  N N    . THR A 1 92  ? 9.718   12.607  -11.031 1.00 0.00 ? 111 THR A N    1  
ATOM 1396  C CA   . THR A 1 92  ? 8.360   12.105  -11.205 1.00 0.00 ? 111 THR A CA   1  
ATOM 1397  C C    . THR A 1 92  ? 8.352   10.593  -11.405 1.00 0.00 ? 111 THR A C    1  
ATOM 1398  O O    . THR A 1 92  ? 9.176   10.049  -12.140 1.00 0.00 ? 111 THR A O    1  
ATOM 1399  C CB   . THR A 1 92  ? 7.663   12.772  -12.405 1.00 0.00 ? 111 THR A CB   1  
ATOM 1400  O OG1  . THR A 1 92  ? 7.585   14.188  -12.203 1.00 0.00 ? 111 THR A OG1  1  
ATOM 1401  C CG2  . THR A 1 92  ? 6.264   12.206  -12.599 1.00 0.00 ? 111 THR A CG2  1  
ATOM 1402  H H    . THR A 1 92  ? 10.177  13.019  -11.792 1.00 0.00 ? 111 THR A H    1  
ATOM 1403  H HA   . THR A 1 92  ? 7.800   12.343  -10.312 1.00 0.00 ? 111 THR A HA   1  
ATOM 1404  H HB   . THR A 1 92  ? 8.242   12.573  -13.295 1.00 0.00 ? 111 THR A HB   1  
ATOM 1405  H HG1  . THR A 1 92  ? 7.578   14.377  -11.262 1.00 0.00 ? 111 THR A HG1  1  
ATOM 1406  H HG21 . THR A 1 92  ? 5.532   12.954  -12.334 1.00 0.00 ? 111 THR A HG21 1  
ATOM 1407  H HG22 . THR A 1 92  ? 6.136   11.338  -11.969 1.00 0.00 ? 111 THR A HG22 1  
ATOM 1408  H HG23 . THR A 1 92  ? 6.131   11.922  -13.633 1.00 0.00 ? 111 THR A HG23 1  
ATOM 1409  N N    . SER A 1 93  ? 7.413   9.923   -10.746 1.00 0.00 ? 112 SER A N    1  
ATOM 1410  C CA   . SER A 1 93  ? 7.289   8.473   -10.849 1.00 0.00 ? 112 SER A CA   1  
ATOM 1411  C C    . SER A 1 93  ? 6.030   7.989   -10.139 1.00 0.00 ? 112 SER A C    1  
ATOM 1412  O O    . SER A 1 93  ? 4.925   8.110   -10.667 1.00 0.00 ? 112 SER A O    1  
ATOM 1413  C CB   . SER A 1 93  ? 8.523   7.789   -10.257 1.00 0.00 ? 112 SER A CB   1  
ATOM 1414  O OG   . SER A 1 93  ? 8.962   8.453   -9.085  1.00 0.00 ? 112 SER A OG   1  
ATOM 1415  H H    . SER A 1 93  ? 6.785   10.415  -10.178 1.00 0.00 ? 112 SER A H    1  
ATOM 1416  H HA   . SER A 1 93  ? 7.216   8.221   -11.897 1.00 0.00 ? 112 SER A HA   1  
ATOM 1417  H HB2  . SER A 1 93  ? 8.280   6.767   -10.008 2.00 0.00 ? 112 SER A HB2  1  
ATOM 1418  H HB3  . SER A 1 93  ? 9.323   7.802   -10.983 2.00 0.00 ? 112 SER A HB3  1  
ATOM 1419  H HG   . SER A 1 93  ? 8.917   9.402   -9.218  1.00 0.00 ? 112 SER A HG   1  
ATOM 1420  N N    . GLN A 1 94  ? 6.202   7.446   -8.937  1.00 0.00 ? 113 GLN A N    1  
ATOM 1421  C CA   . GLN A 1 94  ? 5.082   6.950   -8.153  1.00 0.00 ? 113 GLN A CA   1  
ATOM 1422  C C    . GLN A 1 94  ? 5.503   6.736   -6.706  1.00 0.00 ? 113 GLN A C    1  
ATOM 1423  O O    . GLN A 1 94  ? 6.586   7.156   -6.298  1.00 0.00 ? 113 GLN A O    1  
ATOM 1424  C CB   . GLN A 1 94  ? 4.554   5.641   -8.742  1.00 0.00 ? 113 GLN A CB   1  
ATOM 1425  C CG   . GLN A 1 94  ? 3.493   5.831   -9.815  1.00 0.00 ? 113 GLN A CG   1  
ATOM 1426  C CD   . GLN A 1 94  ? 2.481   6.903   -9.461  1.00 0.00 ? 113 GLN A CD   1  
ATOM 1427  O OE1  . GLN A 1 94  ? 2.066   7.687   -10.315 1.00 0.00 ? 113 GLN A OE1  1  
ATOM 1428  N NE2  . GLN A 1 94  ? 2.077   6.943   -8.197  4.00 0.00 ? 113 GLN A NE2  1  
ATOM 1429  H H    . GLN A 1 94  ? 7.106   7.381   -8.564  1.00 0.00 ? 113 GLN A H    1  
ATOM 1430  H HA   . GLN A 1 94  ? 4.299   7.693   -8.183  1.00 0.00 ? 113 GLN A HA   1  
ATOM 1431  H HB2  . GLN A 1 94  ? 5.379   5.098   -9.177  2.00 0.00 ? 113 GLN A HB2  1  
ATOM 1432  H HB3  . GLN A 1 94  ? 4.126   5.049   -7.946  2.00 0.00 ? 113 GLN A HB3  1  
ATOM 1433  H HG2  . GLN A 1 94  ? 3.981   6.109   -10.738 2.00 0.00 ? 113 GLN A HG2  1  
ATOM 1434  H HG3  . GLN A 1 94  ? 2.971   4.897   -9.953  2.00 0.00 ? 113 GLN A HG3  1  
ATOM 1435  H HE21 . GLN A 1 94  ? 2.450   6.286   -7.569  5.00 0.00 ? 113 GLN A HE21 1  
ATOM 1436  H HE22 . GLN A 1 94  ? 1.420   7.629   -7.941  5.00 0.00 ? 113 GLN A HE22 1  
ATOM 1437  N N    . TYR A 1 95  ? 4.646   6.082   -5.934  1.00 0.00 ? 114 TYR A N    1  
ATOM 1438  C CA   . TYR A 1 95  ? 4.939   5.817   -4.532  1.00 0.00 ? 114 TYR A CA   1  
ATOM 1439  C C    . TYR A 1 95  ? 4.024   4.729   -3.984  1.00 0.00 ? 114 TYR A C    1  
ATOM 1440  O O    . TYR A 1 95  ? 3.428   3.966   -4.745  1.00 0.00 ? 114 TYR A O    1  
ATOM 1441  C CB   . TYR A 1 95  ? 4.790   7.100   -3.707  1.00 0.00 ? 114 TYR A CB   1  
ATOM 1442  C CG   . TYR A 1 95  ? 4.365   8.314   -4.505  1.00 0.00 ? 114 TYR A CG   1  
ATOM 1443  C CD1  . TYR A 1 95  ? 3.043   8.487   -4.895  1.00 0.00 ? 114 TYR A CD1  1  
ATOM 1444  C CD2  . TYR A 1 95  ? 5.289   9.284   -4.873  1.00 0.00 ? 114 TYR A CD2  1  
ATOM 1445  C CE1  . TYR A 1 95  ? 2.655   9.592   -5.629  1.00 0.00 ? 114 TYR A CE1  1  
ATOM 1446  C CE2  . TYR A 1 95  ? 4.909   10.392  -5.605  1.00 0.00 ? 114 TYR A CE2  1  
ATOM 1447  C CZ   . TYR A 1 95  ? 3.591   10.541  -5.981  1.00 0.00 ? 114 TYR A CZ   1  
ATOM 1448  O OH   . TYR A 1 95  ? 3.208   11.642  -6.712  1.00 0.00 ? 114 TYR A OH   1  
ATOM 1449  H H    . TYR A 1 95  ? 3.798   5.769   -6.314  1.00 0.00 ? 114 TYR A H    1  
ATOM 1450  H HA   . TYR A 1 95  ? 5.961   5.476   -4.467  1.00 0.00 ? 114 TYR A HA   1  
ATOM 1451  H HB2  . TYR A 1 95  ? 4.055   6.939   -2.934  2.00 0.00 ? 114 TYR A HB2  1  
ATOM 1452  H HB3  . TYR A 1 95  ? 5.739   7.329   -3.243  2.00 0.00 ? 114 TYR A HB3  1  
ATOM 1453  H HD1  . TYR A 1 95  ? 2.312   7.742   -4.617  1.00 0.00 ? 114 TYR A HD1  1  
ATOM 1454  H HD2  . TYR A 1 95  ? 6.321   9.163   -4.578  1.00 0.00 ? 114 TYR A HD2  1  
ATOM 1455  H HE1  . TYR A 1 95  ? 1.623   9.710   -5.923  1.00 0.00 ? 114 TYR A HE1  1  
ATOM 1456  H HE2  . TYR A 1 95  ? 5.643   11.135  -5.880  1.00 0.00 ? 114 TYR A HE2  1  
ATOM 1457  H HH   . TYR A 1 95  ? 2.384   11.454  -7.168  1.00 0.00 ? 114 TYR A HH   1  
ATOM 1458  N N    . ASP A 1 96  ? 3.924   4.663   -2.662  1.00 0.00 ? 115 ASP A N    1  
ATOM 1459  C CA   . ASP A 1 96  ? 3.086   3.668   -2.002  1.00 0.00 ? 115 ASP A CA   1  
ATOM 1460  C C    . ASP A 1 96  ? 1.694   4.227   -1.720  1.00 0.00 ? 115 ASP A C    1  
ATOM 1461  O O    . ASP A 1 96  ? 1.301   5.247   -2.287  1.00 0.00 ? 115 ASP A O    1  
ATOM 1462  C CB   . ASP A 1 96  ? 3.741   3.217   -0.698  1.00 0.00 ? 115 ASP A CB   1  
ATOM 1463  C CG   . ASP A 1 96  ? 5.255   3.209   -0.777  1.00 0.00 ? 115 ASP A CG   1  
ATOM 1464  O OD1  . ASP A 1 96  ? 5.795   2.685   -1.774  1.00 0.00 ? 115 ASP A OD1  1  
ATOM 1465  O OD2  . ASP A 1 96  ? 5.900   3.728   0.158   1.00 0.00 ? 115 ASP A OD2  1  
ATOM 1466  H H    . ASP A 1 96  ? 4.430   5.298   -2.114  1.00 0.00 ? 115 ASP A H    1  
ATOM 1467  H HA   . ASP A 1 96  ? 2.994   2.820   -2.662  1.00 0.00 ? 115 ASP A HA   1  
ATOM 1468  H HB2  . ASP A 1 96  ? 3.444   3.885   0.096   2.00 0.00 ? 115 ASP A HB2  1  
ATOM 1469  H HB3  . ASP A 1 96  ? 3.407   2.217   -0.463  2.00 0.00 ? 115 ASP A HB3  1  
ATOM 1470  N N    . THR A 1 97  ? 0.949   3.554   -0.843  1.00 0.00 ? 116 THR A N    1  
ATOM 1471  C CA   . THR A 1 97  ? -0.398  3.994   -0.496  1.00 0.00 ? 116 THR A CA   1  
ATOM 1472  C C    . THR A 1 97  ? -0.845  3.424   0.848   1.00 0.00 ? 116 THR A C    1  
ATOM 1473  O O    . THR A 1 97  ? -0.480  2.307   1.213   1.00 0.00 ? 116 THR A O    1  
ATOM 1474  C CB   . THR A 1 97  ? -1.416  3.585   -1.578  1.00 0.00 ? 116 THR A CB   1  
ATOM 1475  O OG1  . THR A 1 97  ? -2.402  4.612   -1.737  1.00 0.00 ? 116 THR A OG1  1  
ATOM 1476  C CG2  . THR A 1 97  ? -2.099  2.273   -1.218  1.00 0.00 ? 116 THR A CG2  1  
ATOM 1477  H H    . THR A 1 97  ? 1.313   2.744   -0.424  1.00 0.00 ? 116 THR A H    1  
ATOM 1478  H HA   . THR A 1 97  ? -0.389  5.072   -0.432  1.00 0.00 ? 116 THR A HA   1  
ATOM 1479  H HB   . THR A 1 97  ? -0.891  3.454   -2.514  1.00 0.00 ? 116 THR A HB   1  
ATOM 1480  H HG1  . THR A 1 97  ? -2.704  4.628   -2.648  1.00 0.00 ? 116 THR A HG1  1  
ATOM 1481  H HG21 . THR A 1 97  ? -1.364  1.483   -1.177  1.00 0.00 ? 116 THR A HG21 1  
ATOM 1482  H HG22 . THR A 1 97  ? -2.842  2.035   -1.966  1.00 0.00 ? 116 THR A HG22 1  
ATOM 1483  H HG23 . THR A 1 97  ? -2.577  2.370   -0.254  1.00 0.00 ? 116 THR A HG23 1  
ATOM 1484  N N    . TYR A 1 98  ? -1.644  4.198   1.577   1.00 0.00 ? 117 TYR A N    1  
ATOM 1485  C CA   . TYR A 1 98  ? -2.151  3.770   2.879   1.00 0.00 ? 117 TYR A CA   1  
ATOM 1486  C C    . TYR A 1 98  ? -3.661  3.571   2.828   1.00 0.00 ? 117 TYR A C    1  
ATOM 1487  O O    . TYR A 1 98  ? -4.322  4.018   1.891   1.00 0.00 ? 117 TYR A O    1  
ATOM 1488  C CB   . TYR A 1 98  ? -1.825  4.810   3.950   1.00 0.00 ? 117 TYR A CB   1  
ATOM 1489  C CG   . TYR A 1 98  ? -0.380  4.864   4.380   1.00 0.00 ? 117 TYR A CG   1  
ATOM 1490  C CD1  . TYR A 1 98  ? 0.610   5.301   3.512   1.00 0.00 ? 117 TYR A CD1  1  
ATOM 1491  C CD2  . TYR A 1 98  ? -0.010  4.503   5.667   1.00 0.00 ? 117 TYR A CD2  1  
ATOM 1492  C CE1  . TYR A 1 98  ? 1.928   5.378   3.917   1.00 0.00 ? 117 TYR A CE1  1  
ATOM 1493  C CE2  . TYR A 1 98  ? 1.303   4.572   6.077   1.00 0.00 ? 117 TYR A CE2  1  
ATOM 1494  C CZ   . TYR A 1 98  ? 2.269   5.013   5.201   1.00 0.00 ? 117 TYR A CZ   1  
ATOM 1495  O OH   . TYR A 1 98  ? 3.580   5.093   5.609   1.00 0.00 ? 117 TYR A OH   1  
ATOM 1496  H H    . TYR A 1 98  ? -1.903  5.079   1.230   1.00 0.00 ? 117 TYR A H    1  
ATOM 1497  H HA   . TYR A 1 98  ? -1.678  2.834   3.134   1.00 0.00 ? 117 TYR A HA   1  
ATOM 1498  H HB2  . TYR A 1 98  ? -2.091  5.788   3.578   2.00 0.00 ? 117 TYR A HB2  1  
ATOM 1499  H HB3  . TYR A 1 98  ? -2.418  4.600   4.828   2.00 0.00 ? 117 TYR A HB3  1  
ATOM 1500  H HD1  . TYR A 1 98  ? 0.340   5.581   2.506   1.00 0.00 ? 117 TYR A HD1  1  
ATOM 1501  H HD2  . TYR A 1 98  ? -0.766  4.153   6.353   1.00 0.00 ? 117 TYR A HD2  1  
ATOM 1502  H HE1  . TYR A 1 98  ? 2.683   5.721   3.227   1.00 0.00 ? 117 TYR A HE1  1  
ATOM 1503  H HE2  . TYR A 1 98  ? 1.565   4.286   7.085   1.00 0.00 ? 117 TYR A HE2  1  
ATOM 1504  H HH   . TYR A 1 98  ? 3.939   5.950   5.367   1.00 0.00 ? 117 TYR A HH   1  
ATOM 1505  N N    . CYS A 1 99  ? -4.206  2.913   3.847   1.00 0.00 ? 118 CYS A N    1  
ATOM 1506  C CA   . CYS A 1 99  ? -5.644  2.679   3.914   1.00 0.00 ? 118 CYS A CA   1  
ATOM 1507  C C    . CYS A 1 99  ? -6.049  2.111   5.269   1.00 0.00 ? 118 CYS A C    1  
ATOM 1508  O O    . CYS A 1 99  ? -5.572  1.052   5.679   1.00 0.00 ? 118 CYS A O    1  
ATOM 1509  C CB   . CYS A 1 99  ? -6.087  1.732   2.798   1.00 0.00 ? 118 CYS A CB   1  
ATOM 1510  S SG   . CYS A 1 99  ? -7.779  2.009   2.181   1.00 0.00 ? 118 CYS A SG   1  
ATOM 1511  H H    . CYS A 1 99  ? -3.631  2.585   4.572   1.00 0.00 ? 118 CYS A H    1  
ATOM 1512  H HA   . CYS A 1 99  ? -6.136  3.630   3.778   1.00 0.00 ? 118 CYS A HA   1  
ATOM 1513  H HB2  . CYS A 1 99  ? -5.413  1.839   1.961   2.00 0.00 ? 118 CYS A HB2  1  
ATOM 1514  H HB3  . CYS A 1 99  ? -6.035  0.716   3.160   2.00 0.00 ? 118 CYS A HB3  1  
ATOM 1515  N N    . PHE A 1 100 ? -6.944  2.818   5.955   1.00 0.00 ? 119 PHE A N    1  
ATOM 1516  C CA   . PHE A 1 100 ? -7.428  2.378   7.255   1.00 0.00 ? 119 PHE A CA   1  
ATOM 1517  C C    . PHE A 1 100 ? -8.584  1.406   7.068   1.00 0.00 ? 119 PHE A C    1  
ATOM 1518  O O    . PHE A 1 100 ? -9.668  1.792   6.633   1.00 0.00 ? 119 PHE A O    1  
ATOM 1519  C CB   . PHE A 1 100 ? -7.872  3.575   8.102   1.00 0.00 ? 119 PHE A CB   1  
ATOM 1520  C CG   . PHE A 1 100 ? -8.644  3.242   9.351   1.00 0.00 ? 119 PHE A CG   1  
ATOM 1521  C CD1  . PHE A 1 100 ? -9.939  2.753   9.276   1.00 0.00 ? 119 PHE A CD1  1  
ATOM 1522  C CD2  . PHE A 1 100 ? -8.073  3.422   10.601  1.00 0.00 ? 119 PHE A CD2  1  
ATOM 1523  C CE1  . PHE A 1 100 ? -10.648 2.450   10.421  1.00 0.00 ? 119 PHE A CE1  1  
ATOM 1524  C CE2  . PHE A 1 100 ? -8.778  3.120   11.749  1.00 0.00 ? 119 PHE A CE2  1  
ATOM 1525  C CZ   . PHE A 1 100 ? -10.066 2.634   11.658  1.00 0.00 ? 119 PHE A CZ   1  
ATOM 1526  H H    . PHE A 1 100 ? -7.296  3.646   5.569   1.00 0.00 ? 119 PHE A H    1  
ATOM 1527  H HA   . PHE A 1 100 ? -6.615  1.869   7.758   1.00 0.00 ? 119 PHE A HA   1  
ATOM 1528  H HB2  . PHE A 1 100 ? -6.993  4.127   8.403   2.00 0.00 ? 119 PHE A HB2  1  
ATOM 1529  H HB3  . PHE A 1 100 ? -8.494  4.222   7.497   2.00 0.00 ? 119 PHE A HB3  1  
ATOM 1530  H HD1  . PHE A 1 100 ? -10.396 2.605   8.310   1.00 0.00 ? 119 PHE A HD1  1  
ATOM 1531  H HD2  . PHE A 1 100 ? -7.067  3.802   10.674  1.00 0.00 ? 119 PHE A HD2  1  
ATOM 1532  H HE1  . PHE A 1 100 ? -11.656 2.071   10.348  1.00 0.00 ? 119 PHE A HE1  1  
ATOM 1533  H HE2  . PHE A 1 100 ? -8.322  3.265   12.717  1.00 0.00 ? 119 PHE A HE2  1  
ATOM 1534  H HZ   . PHE A 1 100 ? -10.618 2.399   12.552  1.00 0.00 ? 119 PHE A HZ   1  
ATOM 1535  N N    . ASN A 1 101 ? -8.340  0.142   7.376   1.00 0.00 ? 120 ASN A N    1  
ATOM 1536  C CA   . ASN A 1 101 ? -9.351  -0.887  7.219   1.00 0.00 ? 120 ASN A CA   1  
ATOM 1537  C C    . ASN A 1 101 ? -10.156 -1.088  8.493   1.00 0.00 ? 120 ASN A C    1  
ATOM 1538  O O    . ASN A 1 101 ? -9.598  -1.201  9.585   1.00 0.00 ? 120 ASN A O    1  
ATOM 1539  C CB   . ASN A 1 101 ? -8.692  -2.199  6.816   1.00 0.00 ? 120 ASN A CB   1  
ATOM 1540  C CG   . ASN A 1 101 ? -7.675  -2.673  7.831   1.00 0.00 ? 120 ASN A CG   1  
ATOM 1541  O OD1  . ASN A 1 101 ? -6.899  -1.882  8.365   1.00 0.00 ? 120 ASN A OD1  1  
ATOM 1542  N ND2  . ASN A 1 101 ? -7.674  -3.973  8.102   4.00 0.00 ? 120 ASN A ND2  1  
ATOM 1543  H H    . ASN A 1 101 ? -7.453  -0.110  7.700   1.00 0.00 ? 120 ASN A H    1  
ATOM 1544  H HA   . ASN A 1 101 ? -10.018 -0.577  6.432   1.00 0.00 ? 120 ASN A HA   1  
ATOM 1545  H HB2  . ASN A 1 101 ? -9.449  -2.954  6.717   2.00 0.00 ? 120 ASN A HB2  1  
ATOM 1546  H HB3  . ASN A 1 101 ? -8.193  -2.068  5.868   2.00 0.00 ? 120 ASN A HB3  1  
ATOM 1547  H HD21 . ASN A 1 101 ? -8.323  -4.544  7.634   5.00 0.00 ? 120 ASN A HD21 1  
ATOM 1548  H HD22 . ASN A 1 101 ? -7.025  -4.310  8.757   5.00 0.00 ? 120 ASN A HD22 1  
ATOM 1549  N N    . ALA A 1 102 ? -11.474 -1.149  8.342   1.00 0.00 ? 121 ALA A N    1  
ATOM 1550  C CA   . ALA A 1 102 ? -12.360 -1.356  9.475   1.00 0.00 ? 121 ALA A CA   1  
ATOM 1551  C C    . ALA A 1 102 ? -12.137 -2.738  10.075  1.00 0.00 ? 121 ALA A C    1  
ATOM 1552  O O    . ALA A 1 102 ? -12.606 -3.031  11.175  1.00 0.00 ? 121 ALA A O    1  
ATOM 1553  C CB   . ALA A 1 102 ? -13.811 -1.183  9.053   1.00 0.00 ? 121 ALA A CB   1  
ATOM 1554  H H    . ALA A 1 102 ? -11.856 -1.062  7.444   1.00 0.00 ? 121 ALA A H    1  
ATOM 1555  H HA   . ALA A 1 102 ? -12.131 -0.608  10.220  1.00 0.00 ? 121 ALA A HA   1  
ATOM 1556  H HB1  . ALA A 1 102 ? -13.867 -1.101  7.978   1.00 0.00 ? 121 ALA A HB1  1  
ATOM 1557  H HB2  . ALA A 1 102 ? -14.211 -0.286  9.504   1.00 0.00 ? 121 ALA A HB2  1  
ATOM 1558  H HB3  . ALA A 1 102 ? -14.386 -2.037  9.380   1.00 0.00 ? 121 ALA A HB3  1  
ATOM 1559  N N    . SER A 1 103 ? -11.406 -3.583  9.347   1.00 0.00 ? 122 SER A N    1  
ATOM 1560  C CA   . SER A 1 103 ? -11.109 -4.930  9.815   1.00 0.00 ? 122 SER A CA   1  
ATOM 1561  C C    . SER A 1 103 ? -10.669 -4.883  11.272  1.00 0.00 ? 122 SER A C    1  
ATOM 1562  O O    . SER A 1 103 ? -11.444 -5.194  12.177  1.00 0.00 ? 122 SER A O    1  
ATOM 1563  C CB   . SER A 1 103 ? -10.014 -5.569  8.954   1.00 0.00 ? 122 SER A CB   1  
ATOM 1564  O OG   . SER A 1 103 ? -9.847  -6.939  9.275   1.00 0.00 ? 122 SER A OG   1  
ATOM 1565  H H    . SER A 1 103 ? -11.052 -3.288  8.482   1.00 0.00 ? 122 SER A H    1  
ATOM 1566  H HA   . SER A 1 103 ? -12.011 -5.519  9.738   1.00 0.00 ? 122 SER A HA   1  
ATOM 1567  H HB2  . SER A 1 103 ? -10.280 -5.488  7.909   2.00 0.00 ? 122 SER A HB2  1  
ATOM 1568  H HB3  . SER A 1 103 ? -9.079  -5.057  9.126   2.00 0.00 ? 122 SER A HB3  1  
ATOM 1569  H HG   . SER A 1 103 ? -10.474 -7.465  8.774   1.00 0.00 ? 122 SER A HG   1  
ATOM 1570  N N    . ALA A 1 104 ? -9.427  -4.470  11.492  1.00 0.00 ? 123 ALA A N    1  
ATOM 1571  C CA   . ALA A 1 104 ? -8.890  -4.353  12.838  1.00 0.00 ? 123 ALA A CA   1  
ATOM 1572  C C    . ALA A 1 104 ? -9.158  -2.959  13.393  1.00 0.00 ? 123 ALA A C    1  
ATOM 1573  O O    . ALA A 1 104 ? -8.900  -1.956  12.727  1.00 0.00 ? 123 ALA A O    1  
ATOM 1574  C CB   . ALA A 1 104 ? -7.401  -4.654  12.848  1.00 0.00 ? 123 ALA A CB   1  
ATOM 1575  H H    . ALA A 1 104 ? -8.864  -4.219  10.729  1.00 0.00 ? 123 ALA A H    1  
ATOM 1576  H HA   . ALA A 1 104 ? -9.388  -5.082  13.461  1.00 0.00 ? 123 ALA A HA   1  
ATOM 1577  H HB1  . ALA A 1 104 ? -6.846  -3.729  12.797  1.00 0.00 ? 123 ALA A HB1  1  
ATOM 1578  H HB2  . ALA A 1 104 ? -7.153  -5.269  11.996  1.00 0.00 ? 123 ALA A HB2  1  
ATOM 1579  H HB3  . ALA A 1 104 ? -7.145  -5.178  13.757  1.00 0.00 ? 123 ALA A HB3  1  
ATOM 1580  N N    . PRO A 1 105 ? -9.685  -2.876  14.621  1.00 0.00 ? 124 PRO A N    1  
ATOM 1581  C CA   . PRO A 1 105 ? -9.995  -1.595  15.264  1.00 0.00 ? 124 PRO A CA   1  
ATOM 1582  C C    . PRO A 1 105 ? -8.738  -0.793  15.599  1.00 0.00 ? 124 PRO A C    1  
ATOM 1583  O O    . PRO A 1 105 ? -7.621  -1.195  15.254  1.00 0.00 ? 124 PRO A O    1  
ATOM 1584  C CB   . PRO A 1 105 ? -10.725 -2.012  16.545  1.00 0.00 ? 124 PRO A CB   1  
ATOM 1585  C CG   . PRO A 1 105 ? -10.249 -3.395  16.822  1.00 0.00 ? 124 PRO A CG   1  
ATOM 1586  C CD   . PRO A 1 105 ? -10.026 -4.026  15.477  1.00 0.00 ? 124 PRO A CD   1  
ATOM 1587  H HA   . PRO A 1 105 ? -10.651 -0.994  14.651  1.00 0.00 ? 124 PRO A HA   1  
ATOM 1588  H HB2  . PRO A 1 105 ? -10.465 -1.337  17.347  2.00 0.00 ? 124 PRO A HB2  1  
ATOM 1589  H HB3  . PRO A 1 105 ? -11.792 -1.987  16.378  2.00 0.00 ? 124 PRO A HB3  1  
ATOM 1590  H HG2  . PRO A 1 105 ? -9.324  -3.361  17.378  2.00 0.00 ? 124 PRO A HG2  1  
ATOM 1591  H HG3  . PRO A 1 105 ? -11.001 -3.940  17.372  2.00 0.00 ? 124 PRO A HG3  1  
ATOM 1592  H HD2  . PRO A 1 105 ? -9.208  -4.730  15.520  2.00 0.00 ? 124 PRO A HD2  1  
ATOM 1593  H HD3  . PRO A 1 105 ? -10.927 -4.511  15.132  2.00 0.00 ? 124 PRO A HD3  1  
ATOM 1594  N N    . PRO A 1 106 ? -8.905  0.356   16.280  1.00 0.00 ? 125 PRO A N    1  
ATOM 1595  C CA   . PRO A 1 106 ? -7.782  1.210   16.672  1.00 0.00 ? 125 PRO A CA   1  
ATOM 1596  C C    . PRO A 1 106 ? -6.795  0.453   17.546  1.00 0.00 ? 125 PRO A C    1  
ATOM 1597  O O    . PRO A 1 106 ? -6.766  0.622   18.765  1.00 0.00 ? 125 PRO A O    1  
ATOM 1598  C CB   . PRO A 1 106 ? -8.445  2.341   17.460  1.00 0.00 ? 125 PRO A CB   1  
ATOM 1599  C CG   . PRO A 1 106 ? -9.867  2.339   17.023  1.00 0.00 ? 125 PRO A CG   1  
ATOM 1600  C CD   . PRO A 1 106 ? -10.199 0.903   16.724  1.00 0.00 ? 125 PRO A CD   1  
ATOM 1601  H HA   . PRO A 1 106 ? -7.269  1.612   15.811  1.00 0.00 ? 125 PRO A HA   1  
ATOM 1602  H HB2  . PRO A 1 106 ? -8.357  2.144   18.519  2.00 0.00 ? 125 PRO A HB2  1  
ATOM 1603  H HB3  . PRO A 1 106 ? -7.962  3.277   17.225  2.00 0.00 ? 125 PRO A HB3  1  
ATOM 1604  H HG2  . PRO A 1 106 ? -10.497 2.713   17.817  2.00 0.00 ? 125 PRO A HG2  1  
ATOM 1605  H HG3  . PRO A 1 106 ? -9.980  2.943   16.135  2.00 0.00 ? 125 PRO A HG3  1  
ATOM 1606  H HD2  . PRO A 1 106 ? -10.548 0.401   17.615  2.00 0.00 ? 125 PRO A HD2  1  
ATOM 1607  H HD3  . PRO A 1 106 ? -10.934 0.840   15.936  2.00 0.00 ? 125 PRO A HD3  1  
ATOM 1608  N N    . GLU A 1 107 ? -5.994  -0.390  16.910  1.00 0.00 ? 126 GLU A N    1  
ATOM 1609  C CA   . GLU A 1 107 ? -5.004  -1.191  17.615  1.00 0.00 ? 126 GLU A CA   1  
ATOM 1610  C C    . GLU A 1 107 ? -3.955  -1.717  16.646  1.00 0.00 ? 126 GLU A C    1  
ATOM 1611  O O    . GLU A 1 107 ? -4.245  -1.978  15.479  1.00 0.00 ? 126 GLU A O    1  
ATOM 1612  C CB   . GLU A 1 107 ? -5.677  -2.358  18.341  1.00 0.00 ? 126 GLU A CB   1  
ATOM 1613  C CG   . GLU A 1 107 ? -6.827  -2.986  17.570  1.00 0.00 ? 126 GLU A CG   1  
ATOM 1614  C CD   . GLU A 1 107 ? -6.821  -4.501  17.639  1.00 0.00 ? 126 GLU A CD   1  
ATOM 1615  O OE1  . GLU A 1 107 ? -6.757  -5.044  18.762  1.00 0.00 ? 126 GLU A OE1  1  
ATOM 1616  O OE2  . GLU A 1 107 ? -6.878  -5.143  16.570  1.00 0.00 ? 126 GLU A OE2  1  
ATOM 1617  H H    . GLU A 1 107 ? -6.073  -0.475  15.935  1.00 0.00 ? 126 GLU A H    1  
ATOM 1618  H HA   . GLU A 1 107 ? -4.521  -0.556  18.342  1.00 0.00 ? 126 GLU A HA   1  
ATOM 1619  H HB2  . GLU A 1 107 ? -4.938  -3.124  18.527  2.00 0.00 ? 126 GLU A HB2  1  
ATOM 1620  H HB3  . GLU A 1 107 ? -6.057  -2.005  19.287  2.00 0.00 ? 126 GLU A HB3  1  
ATOM 1621  H HG2  . GLU A 1 107 ? -7.758  -2.626  17.982  2.00 0.00 ? 126 GLU A HG2  1  
ATOM 1622  H HG3  . GLU A 1 107 ? -6.754  -2.688  16.535  2.00 0.00 ? 126 GLU A HG3  1  
ATOM 1623  N N    . GLU A 1 108 ? -2.734  -1.859  17.137  1.00 0.00 ? 127 GLU A N    1  
ATOM 1624  C CA   . GLU A 1 108 ? -1.631  -2.341  16.318  1.00 0.00 ? 127 GLU A CA   1  
ATOM 1625  C C    . GLU A 1 108 ? -1.742  -3.839  16.065  1.00 0.00 ? 127 GLU A C    1  
ATOM 1626  O O    . GLU A 1 108 ? -1.778  -4.638  17.001  1.00 0.00 ? 127 GLU A O    1  
ATOM 1627  C CB   . GLU A 1 108 ? -0.306  -2.011  16.997  1.00 0.00 ? 127 GLU A CB   1  
ATOM 1628  C CG   . GLU A 1 108 ? -0.270  -0.659  17.688  1.00 0.00 ? 127 GLU A CG   1  
ATOM 1629  C CD   . GLU A 1 108 ? 0.658   -0.628  18.887  1.00 0.00 ? 127 GLU A CD   1  
ATOM 1630  O OE1  . GLU A 1 108 ? 0.382   -1.347  19.870  1.00 0.00 ? 127 GLU A OE1  1  
ATOM 1631  O OE2  . GLU A 1 108 ? 1.660   0.116   18.844  1.00 0.00 ? 127 GLU A OE2  1  
ATOM 1632  H H    . GLU A 1 108 ? -2.568  -1.628  18.074  1.00 0.00 ? 127 GLU A H    1  
ATOM 1633  H HA   . GLU A 1 108 ? -1.675  -1.826  15.370  1.00 0.00 ? 127 GLU A HA   1  
ATOM 1634  H HB2  . GLU A 1 108 ? -0.097  -2.771  17.734  2.00 0.00 ? 127 GLU A HB2  1  
ATOM 1635  H HB3  . GLU A 1 108 ? 0.478   -2.029  16.253  2.00 0.00 ? 127 GLU A HB3  1  
ATOM 1636  H HG2  . GLU A 1 108 ? 0.061   0.085   16.977  2.00 0.00 ? 127 GLU A HG2  1  
ATOM 1637  H HG3  . GLU A 1 108 ? -1.271  -0.414  18.020  2.00 0.00 ? 127 GLU A HG3  1  
ATOM 1638  N N    . ASP A 1 109 ? -1.799  -4.210  14.790  1.00 0.00 ? 128 ASP A N    1  
ATOM 1639  C CA   . ASP A 1 109 ? -1.909  -5.610  14.403  1.00 0.00 ? 128 ASP A CA   1  
ATOM 1640  C C    . ASP A 1 109 ? -1.122  -5.888  13.127  1.00 0.00 ? 128 ASP A C    1  
ATOM 1641  O O    . ASP A 1 109 ? -1.332  -5.242  12.098  1.00 0.00 ? 128 ASP A O    1  
ATOM 1642  C CB   . ASP A 1 109 ? -3.378  -5.990  14.201  1.00 0.00 ? 128 ASP A CB   1  
ATOM 1643  C CG   . ASP A 1 109 ? -3.843  -7.105  15.117  1.00 0.00 ? 128 ASP A CG   1  
ATOM 1644  O OD1  . ASP A 1 109 ? -3.034  -8.013  15.404  1.00 0.00 ? 128 ASP A OD1  1  
ATOM 1645  O OD2  . ASP A 1 109 ? -5.015  -7.071  15.546  1.00 0.00 ? 128 ASP A OD2  1  
ATOM 1646  H H    . ASP A 1 109 ? -1.768  -3.523  14.092  1.00 0.00 ? 128 ASP A H    1  
ATOM 1647  H HA   . ASP A 1 109 ? -1.499  -6.208  15.203  1.00 0.00 ? 128 ASP A HA   1  
ATOM 1648  H HB2  . ASP A 1 109 ? -3.993  -5.122  14.385  2.00 0.00 ? 128 ASP A HB2  1  
ATOM 1649  H HB3  . ASP A 1 109 ? -3.520  -6.309  13.179  2.00 0.00 ? 128 ASP A HB3  1  
ATOM 1650  N N    . CYS A 1 110 ? -0.217  -6.857  13.201  1.00 0.00 ? 129 CYS A N    1  
ATOM 1651  C CA   . CYS A 1 110 ? 0.599   -7.230  12.053  1.00 0.00 ? 129 CYS A CA   1  
ATOM 1652  C C    . CYS A 1 110 ? 0.212   -8.616  11.554  1.00 0.00 ? 129 CYS A C    1  
ATOM 1653  O O    . CYS A 1 110 ? 0.914   -9.213  10.737  1.00 0.00 ? 129 CYS A O    1  
ATOM 1654  C CB   . CYS A 1 110 ? 2.083   -7.201  12.421  1.00 0.00 ? 129 CYS A CB   1  
ATOM 1655  S SG   . CYS A 1 110 ? 2.929   -5.650  11.976  1.00 0.00 ? 129 CYS A SG   1  
ATOM 1656  H H    . CYS A 1 110 ? -0.099  -7.337  14.047  1.00 0.00 ? 129 CYS A H    1  
ATOM 1657  H HA   . CYS A 1 110 ? 0.416   -6.513  11.268  1.00 0.00 ? 129 CYS A HA   1  
ATOM 1658  H HB2  . CYS A 1 110 ? 2.185   -7.336  13.488  2.00 0.00 ? 129 CYS A HB2  1  
ATOM 1659  H HB3  . CYS A 1 110 ? 2.589   -8.009  11.912  2.00 0.00 ? 129 CYS A HB3  1  
ATOM 1660  N N    . THR A 1 111 ? -0.913  -9.122  12.052  1.00 0.00 ? 130 THR A N    1  
ATOM 1661  C CA   . THR A 1 111 ? -1.402  -10.437 11.661  1.00 0.00 ? 130 THR A CA   1  
ATOM 1662  C C    . THR A 1 111 ? -1.278  -10.640 10.157  1.00 0.00 ? 130 THR A C    1  
ATOM 1663  O O    . THR A 1 111 ? -1.554  -9.732  9.374   1.00 0.00 ? 130 THR A O    1  
ATOM 1664  C CB   . THR A 1 111 ? -2.871  -10.638 12.076  1.00 0.00 ? 130 THR A CB   1  
ATOM 1665  O OG1  . THR A 1 111 ? -3.114  -10.013 13.342  1.00 0.00 ? 130 THR A OG1  1  
ATOM 1666  C CG2  . THR A 1 111 ? -3.211  -12.119 12.163  1.00 0.00 ? 130 THR A CG2  1  
ATOM 1667  H H    . THR A 1 111 ? -1.427  -8.596  12.699  1.00 0.00 ? 130 THR A H    1  
ATOM 1668  H HA   . THR A 1 111 ? -0.802  -11.180 12.167  1.00 0.00 ? 130 THR A HA   1  
ATOM 1669  H HB   . THR A 1 111 ? -3.506  -10.182 11.330  1.00 0.00 ? 130 THR A HB   1  
ATOM 1670  H HG1  . THR A 1 111 ? -3.983  -10.266 13.663  1.00 0.00 ? 130 THR A HG1  1  
ATOM 1671  H HG21 . THR A 1 111 ? -4.018  -12.344 11.482  1.00 0.00 ? 130 THR A HG21 1  
ATOM 1672  H HG22 . THR A 1 111 ? -3.512  -12.360 13.171  1.00 0.00 ? 130 THR A HG22 1  
ATOM 1673  H HG23 . THR A 1 111 ? -2.342  -12.703 11.898  1.00 0.00 ? 130 THR A HG23 1  
ATOM 1674  N N    . SER A 1 112 ? -0.857  -11.836 9.761   1.00 0.00 ? 131 SER A N    1  
ATOM 1675  C CA   . SER A 1 112 ? -0.692  -12.159 8.350   1.00 0.00 ? 131 SER A CA   1  
ATOM 1676  C C    . SER A 1 112 ? -1.981  -11.903 7.576   1.00 0.00 ? 131 SER A C    1  
ATOM 1677  O O    . SER A 1 112 ? -2.815  -12.797 7.434   1.00 0.00 ? 131 SER A O    1  
ATOM 1678  C CB   . SER A 1 112 ? -0.268  -13.620 8.187   1.00 0.00 ? 131 SER A CB   1  
ATOM 1679  O OG   . SER A 1 112 ? -0.801  -14.422 9.227   1.00 0.00 ? 131 SER A OG   1  
ATOM 1680  H H    . SER A 1 112 ? -0.650  -12.517 10.435  1.00 0.00 ? 131 SER A H    1  
ATOM 1681  H HA   . SER A 1 112 ? 0.084   -11.522 7.953   1.00 0.00 ? 131 SER A HA   1  
ATOM 1682  H HB2  . SER A 1 112 ? -0.629  -13.994 7.240   2.00 0.00 ? 131 SER A HB2  1  
ATOM 1683  H HB3  . SER A 1 112 ? 0.811   -13.686 8.216   2.00 0.00 ? 131 SER A HB3  1  
ATOM 1684  H HG   . SER A 1 112 ? -0.263  -15.209 9.333   1.00 0.00 ? 131 SER A HG   1  
ATOM 1685  N N    . VAL A 1 113 ? -2.134  -10.680 7.074   1.00 0.00 ? 132 VAL A N    1  
ATOM 1686  C CA   . VAL A 1 113 ? -3.320  -10.314 6.308   1.00 0.00 ? 132 VAL A CA   1  
ATOM 1687  C C    . VAL A 1 113 ? -3.679  -11.414 5.314   1.00 0.00 ? 132 VAL A C    1  
ATOM 1688  O O    . VAL A 1 113 ? -4.461  -12.311 5.627   1.00 0.00 ? 132 VAL A O    1  
ATOM 1689  C CB   . VAL A 1 113 ? -3.122  -8.982  5.552   1.00 0.00 ? 132 VAL A CB   1  
ATOM 1690  C CG1  . VAL A 1 113 ? -4.245  -8.754  4.553   2.00 0.00 ? 132 VAL A CG1  1  
ATOM 1691  C CG2  . VAL A 1 113 ? -3.034  -7.811  6.521   2.00 0.00 ? 132 VAL A CG2  1  
ATOM 1692  H H    . VAL A 1 113 ? -1.432  -10.011 7.218   1.00 0.00 ? 132 VAL A H    1  
ATOM 1693  H HA   . VAL A 1 113 ? -4.137  -10.192 6.999   1.00 0.00 ? 132 VAL A HA   1  
ATOM 1694  H HB   . VAL A 1 113 ? -2.190  -9.044  5.008   1.00 0.00 ? 132 VAL A HB   1  
ATOM 1695  H HG11 . VAL A 1 113 ? -5.193  -8.761  5.070   1.00 0.00 ? 132 VAL A HG11 1  
ATOM 1696  H HG12 . VAL A 1 113 ? -4.233  -9.541  3.813   1.00 0.00 ? 132 VAL A HG12 1  
ATOM 1697  H HG13 . VAL A 1 113 ? -4.106  -7.800  4.067   1.00 0.00 ? 132 VAL A HG13 1  
ATOM 1698  H HG21 . VAL A 1 113 ? -3.504  -6.942  6.081   1.00 0.00 ? 132 VAL A HG21 1  
ATOM 1699  H HG22 . VAL A 1 113 ? -1.997  -7.593  6.728   1.00 0.00 ? 132 VAL A HG22 1  
ATOM 1700  H HG23 . VAL A 1 113 ? -3.538  -8.066  7.441   1.00 0.00 ? 132 VAL A HG23 1  
ATOM 1701  N N    . THR A 1 114 ? -3.099  -11.340 4.120   1.00 0.00 ? 133 THR A N    1  
ATOM 1702  C CA   . THR A 1 114 ? -3.354  -12.334 3.078   1.00 0.00 ? 133 THR A CA   1  
ATOM 1703  C C    . THR A 1 114 ? -4.845  -12.588 2.916   1.00 0.00 ? 133 THR A C    1  
ATOM 1704  O O    . THR A 1 114 ? -5.260  -13.511 2.215   1.00 0.00 ? 133 THR A O    1  
ATOM 1705  C CB   . THR A 1 114 ? -2.669  -13.674 3.402   1.00 0.00 ? 133 THR A CB   1  
ATOM 1706  O OG1  . THR A 1 114 ? -2.297  -14.342 2.190   1.00 0.00 ? 133 THR A OG1  1  
ATOM 1707  C CG2  . THR A 1 114 ? -3.598  -14.564 4.215   1.00 0.00 ? 133 THR A CG2  1  
ATOM 1708  H H    . THR A 1 114 ? -2.484  -10.602 3.938   1.00 0.00 ? 133 THR A H    1  
ATOM 1709  H HA   . THR A 1 114 ? -2.954  -11.961 2.148   1.00 0.00 ? 133 THR A HA   1  
ATOM 1710  H HB   . THR A 1 114 ? -1.781  -13.478 3.985   1.00 0.00 ? 133 THR A HB   1  
ATOM 1711  H HG1  . THR A 1 114 ? -1.644  -15.017 2.384   1.00 0.00 ? 133 THR A HG1  1  
ATOM 1712  H HG21 . THR A 1 114 ? -4.547  -14.061 4.354   1.00 0.00 ? 133 THR A HG21 1  
ATOM 1713  H HG22 . THR A 1 114 ? -3.153  -14.765 5.177   1.00 0.00 ? 133 THR A HG22 1  
ATOM 1714  H HG23 . THR A 1 114 ? -3.758  -15.493 3.689   1.00 0.00 ? 133 THR A HG23 1  
ATOM 1715  N N    . ASP A 1 115 ? -5.643  -11.777 3.588   1.00 0.00 ? 134 ASP A N    1  
ATOM 1716  C CA   . ASP A 1 115 ? -7.089  -11.923 3.545   1.00 0.00 ? 134 ASP A CA   1  
ATOM 1717  C C    . ASP A 1 115 ? -7.700  -11.147 2.385   1.00 0.00 ? 134 ASP A C    1  
ATOM 1718  O O    . ASP A 1 115 ? -8.044  -11.724 1.353   1.00 0.00 ? 134 ASP A O    1  
ATOM 1719  C CB   . ASP A 1 115 ? -7.700  -11.457 4.868   1.00 0.00 ? 134 ASP A CB   1  
ATOM 1720  C CG   . ASP A 1 115 ? -8.582  -12.510 5.509   1.00 0.00 ? 134 ASP A CG   1  
ATOM 1721  O OD1  . ASP A 1 115 ? -8.471  -13.693 5.124   1.00 0.00 ? 134 ASP A OD1  1  
ATOM 1722  O OD2  . ASP A 1 115 ? -9.385  -12.152 6.396   1.00 0.00 ? 134 ASP A OD2  1  
ATOM 1723  H H    . ASP A 1 115 ? -5.248  -11.070 4.141   1.00 0.00 ? 134 ASP A H    1  
ATOM 1724  H HA   . ASP A 1 115 ? -7.309  -12.969 3.413   1.00 0.00 ? 134 ASP A HA   1  
ATOM 1725  H HB2  . ASP A 1 115 ? -6.903  -11.213 5.558   2.00 0.00 ? 134 ASP A HB2  1  
ATOM 1726  H HB3  . ASP A 1 115 ? -8.298  -10.573 4.689   2.00 0.00 ? 134 ASP A HB3  1  
ATOM 1727  N N    . LEU A 1 116 ? -7.849  -9.842  2.569   1.00 0.00 ? 135 LEU A N    1  
ATOM 1728  C CA   . LEU A 1 116 ? -8.441  -8.988  1.547   1.00 0.00 ? 135 LEU A CA   1  
ATOM 1729  C C    . LEU A 1 116 ? -9.803  -9.537  1.113   1.00 0.00 ? 135 LEU A C    1  
ATOM 1730  O O    . LEU A 1 116 ? -10.144 -9.506  -0.069  1.00 0.00 ? 135 LEU A O    1  
ATOM 1731  C CB   . LEU A 1 116 ? -7.517  -8.883  0.331   1.00 0.00 ? 135 LEU A CB   1  
ATOM 1732  C CG   . LEU A 1 116 ? -6.024  -8.769  0.652   1.00 0.00 ? 135 LEU A CG   1  
ATOM 1733  C CD1  . LEU A 1 116 ? -5.266  -8.165  -0.518  2.00 0.00 ? 135 LEU A CD1  1  
ATOM 1734  C CD2  . LEU A 1 116 ? -5.809  -7.931  1.898   2.00 0.00 ? 135 LEU A CD2  1  
ATOM 1735  H H    . LEU A 1 116 ? -7.567  -9.446  3.419   1.00 0.00 ? 135 LEU A H    1  
ATOM 1736  H HA   . LEU A 1 116 ? -8.575  -8.004  1.974   1.00 0.00 ? 135 LEU A HA   1  
ATOM 1737  H HB2  . LEU A 1 116 ? -7.668  -9.757  -0.283  2.00 0.00 ? 135 LEU A HB2  1  
ATOM 1738  H HB3  . LEU A 1 116 ? -7.808  -8.014  -0.240  2.00 0.00 ? 135 LEU A HB3  1  
ATOM 1739  H HG   . LEU A 1 116 ? -5.626  -9.756  0.838   1.00 0.00 ? 135 LEU A HG   1  
ATOM 1740  H HD11 . LEU A 1 116 ? -4.691  -7.318  -0.173  1.00 0.00 ? 135 LEU A HD11 1  
ATOM 1741  H HD12 . LEU A 1 116 ? -5.967  -7.841  -1.273  1.00 0.00 ? 135 LEU A HD12 1  
ATOM 1742  H HD13 . LEU A 1 116 ? -4.601  -8.905  -0.937  1.00 0.00 ? 135 LEU A HD13 1  
ATOM 1743  H HD21 . LEU A 1 116 ? -6.548  -7.145  1.934   1.00 0.00 ? 135 LEU A HD21 1  
ATOM 1744  H HD22 . LEU A 1 116 ? -4.821  -7.496  1.870   1.00 0.00 ? 135 LEU A HD22 1  
ATOM 1745  H HD23 . LEU A 1 116 ? -5.903  -8.556  2.773   1.00 0.00 ? 135 LEU A HD23 1  
ATOM 1746  N N    . PRO A 1 117 ? -10.594 -10.062 2.068   1.00 0.00 ? 136 PRO A N    1  
ATOM 1747  C CA   . PRO A 1 117 ? -11.918 -10.636 1.782   1.00 0.00 ? 136 PRO A CA   1  
ATOM 1748  C C    . PRO A 1 117 ? -12.866 -9.650  1.104   1.00 0.00 ? 136 PRO A C    1  
ATOM 1749  O O    . PRO A 1 117 ? -14.023 -9.977  0.841   1.00 0.00 ? 136 PRO A O    1  
ATOM 1750  C CB   . PRO A 1 117 ? -12.458 -11.016 3.164   1.00 0.00 ? 136 PRO A CB   1  
ATOM 1751  C CG   . PRO A 1 117 ? -11.247 -11.155 4.016   1.00 0.00 ? 136 PRO A CG   1  
ATOM 1752  C CD   . PRO A 1 117 ? -10.255 -10.154 3.500   1.00 0.00 ? 136 PRO A CD   1  
ATOM 1753  H HA   . PRO A 1 117 ? -11.836 -11.524 1.172   1.00 0.00 ? 136 PRO A HA   1  
ATOM 1754  H HB2  . PRO A 1 117 ? -13.110 -10.235 3.526   2.00 0.00 ? 136 PRO A HB2  1  
ATOM 1755  H HB3  . PRO A 1 117 ? -13.003 -11.947 3.097   2.00 0.00 ? 136 PRO A HB3  1  
ATOM 1756  H HG2  . PRO A 1 117 ? -11.495 -10.939 5.045   2.00 0.00 ? 136 PRO A HG2  1  
ATOM 1757  H HG3  . PRO A 1 117 ? -10.849 -12.155 3.929   2.00 0.00 ? 136 PRO A HG3  1  
ATOM 1758  H HD2  . PRO A 1 117 ? -10.386 -9.201  3.991   2.00 0.00 ? 136 PRO A HD2  1  
ATOM 1759  H HD3  . PRO A 1 117 ? -9.245  -10.519 3.636   2.00 0.00 ? 136 PRO A HD3  1  
ATOM 1760  N N    . ASN A 1 118 ? -12.378 -8.448  0.820   1.00 0.00 ? 137 ASN A N    1  
ATOM 1761  C CA   . ASN A 1 118 ? -13.202 -7.435  0.170   1.00 0.00 ? 137 ASN A CA   1  
ATOM 1762  C C    . ASN A 1 118 ? -12.995 -7.457  -1.339  1.00 0.00 ? 137 ASN A C    1  
ATOM 1763  O O    . ASN A 1 118 ? -13.366 -6.517  -2.043  1.00 0.00 ? 137 ASN A O    1  
ATOM 1764  C CB   . ASN A 1 118 ? -12.890 -6.045  0.727   1.00 0.00 ? 137 ASN A CB   1  
ATOM 1765  C CG   . ASN A 1 118 ? -13.856 -5.626  1.818   1.00 0.00 ? 137 ASN A CG   1  
ATOM 1766  O OD1  . ASN A 1 118 ? -14.447 -4.548  1.761   1.00 0.00 ? 137 ASN A OD1  1  
ATOM 1767  N ND2  . ASN A 1 118 ? -14.019 -6.481  2.821   4.00 0.00 ? 137 ASN A ND2  1  
ATOM 1768  H H    . ASN A 1 118 ? -11.447 -8.240  1.048   1.00 0.00 ? 137 ASN A H    1  
ATOM 1769  H HA   . ASN A 1 118 ? -14.235 -7.670  0.379   1.00 0.00 ? 137 ASN A HA   1  
ATOM 1770  H HB2  . ASN A 1 118 ? -11.891 -6.044  1.139   2.00 0.00 ? 137 ASN A HB2  1  
ATOM 1771  H HB3  . ASN A 1 118 ? -12.946 -5.321  -0.074  2.00 0.00 ? 137 ASN A HB3  1  
ATOM 1772  H HD21 . ASN A 1 118 ? -13.513 -7.323  2.800   5.00 0.00 ? 137 ASN A HD21 1  
ATOM 1773  H HD22 . ASN A 1 118 ? -14.641 -6.237  3.543   5.00 0.00 ? 137 ASN A HD22 1  
ATOM 1774  N N    . ALA A 1 119 ? -12.407 -8.543  -1.828  1.00 0.00 ? 138 ALA A N    1  
ATOM 1775  C CA   . ALA A 1 119 ? -12.154 -8.701  -3.254  1.00 0.00 ? 138 ALA A CA   1  
ATOM 1776  C C    . ALA A 1 119 ? -13.068 -9.767  -3.849  1.00 0.00 ? 138 ALA A C    1  
ATOM 1777  O O    . ALA A 1 119 ? -14.152 -10.028 -3.326  1.00 0.00 ? 138 ALA A O    1  
ATOM 1778  C CB   . ALA A 1 119 ? -10.693 -9.055  -3.495  1.00 0.00 ? 138 ALA A CB   1  
ATOM 1779  H H    . ALA A 1 119 ? -12.140 -9.259  -1.214  1.00 0.00 ? 138 ALA A H    1  
ATOM 1780  H HA   . ALA A 1 119 ? -12.356 -7.757  -3.737  1.00 0.00 ? 138 ALA A HA   1  
ATOM 1781  H HB1  . ALA A 1 119 ? -10.368 -8.624  -4.431  1.00 0.00 ? 138 ALA A HB1  1  
ATOM 1782  H HB2  . ALA A 1 119 ? -10.585 -10.129 -3.535  1.00 0.00 ? 138 ALA A HB2  1  
ATOM 1783  H HB3  . ALA A 1 119 ? -10.090 -8.662  -2.689  1.00 0.00 ? 138 ALA A HB3  1  
ATOM 1784  N N    . PHE A 1 120 ? -12.629 -10.381 -4.943  1.00 0.00 ? 139 PHE A N    1  
ATOM 1785  C CA   . PHE A 1 120 ? -13.416 -11.418 -5.601  1.00 0.00 ? 139 PHE A CA   1  
ATOM 1786  C C    . PHE A 1 120 ? -12.555 -12.637 -5.920  1.00 0.00 ? 139 PHE A C    1  
ATOM 1787  O O    . PHE A 1 120 ? -11.329 -12.546 -5.978  1.00 0.00 ? 139 PHE A O    1  
ATOM 1788  C CB   . PHE A 1 120 ? -14.058 -10.877 -6.882  1.00 0.00 ? 139 PHE A CB   1  
ATOM 1789  C CG   . PHE A 1 120 ? -13.242 -9.851  -7.617  1.00 0.00 ? 139 PHE A CG   1  
ATOM 1790  C CD1  . PHE A 1 120 ? -12.906 -8.649  -7.014  1.00 0.00 ? 139 PHE A CD1  1  
ATOM 1791  C CD2  . PHE A 1 120 ? -12.813 -10.088 -8.913  1.00 0.00 ? 139 PHE A CD2  1  
ATOM 1792  C CE1  . PHE A 1 120 ? -12.157 -7.704  -7.689  1.00 0.00 ? 139 PHE A CE1  1  
ATOM 1793  C CE2  . PHE A 1 120 ? -12.064 -9.147  -9.593  1.00 0.00 ? 139 PHE A CE2  1  
ATOM 1794  C CZ   . PHE A 1 120 ? -11.735 -7.953  -8.980  1.00 0.00 ? 139 PHE A CZ   1  
ATOM 1795  H H    . PHE A 1 120 ? -11.758 -10.131 -5.314  1.00 0.00 ? 139 PHE A H    1  
ATOM 1796  H HA   . PHE A 1 120 ? -14.198 -11.718 -4.919  1.00 0.00 ? 139 PHE A HA   1  
ATOM 1797  H HB2  . PHE A 1 120 ? -14.232 -11.703 -7.559  2.00 0.00 ? 139 PHE A HB2  1  
ATOM 1798  H HB3  . PHE A 1 120 ? -15.007 -10.424 -6.631  2.00 0.00 ? 139 PHE A HB3  1  
ATOM 1799  H HD1  . PHE A 1 120 ? -13.234 -8.453  -6.004  1.00 0.00 ? 139 PHE A HD1  1  
ATOM 1800  H HD2  . PHE A 1 120 ? -13.069 -11.021 -9.393  1.00 0.00 ? 139 PHE A HD2  1  
ATOM 1801  H HE1  . PHE A 1 120 ? -11.901 -6.772  -7.207  1.00 0.00 ? 139 PHE A HE1  1  
ATOM 1802  H HE2  . PHE A 1 120 ? -11.736 -9.344  -10.603 1.00 0.00 ? 139 PHE A HE2  1  
ATOM 1803  H HZ   . PHE A 1 120 ? -11.149 -7.217  -9.510  1.00 0.00 ? 139 PHE A HZ   1  
ATOM 1804  N N    . ASP A 1 121 ? -13.208 -13.777 -6.120  1.00 0.00 ? 140 ASP A N    1  
ATOM 1805  C CA   . ASP A 1 121 ? -12.507 -15.019 -6.429  1.00 0.00 ? 140 ASP A CA   1  
ATOM 1806  C C    . ASP A 1 121 ? -11.694 -14.887 -7.713  1.00 0.00 ? 140 ASP A C    1  
ATOM 1807  O O    . ASP A 1 121 ? -12.007 -14.067 -8.577  1.00 0.00 ? 140 ASP A O    1  
ATOM 1808  C CB   . ASP A 1 121 ? -13.505 -16.171 -6.560  1.00 0.00 ? 140 ASP A CB   1  
ATOM 1809  C CG   . ASP A 1 121 ? -13.209 -17.312 -5.606  1.00 0.00 ? 140 ASP A CG   1  
ATOM 1810  O OD1  . ASP A 1 121 ? -12.410 -18.200 -5.972  1.00 0.00 ? 140 ASP A OD1  1  
ATOM 1811  O OD2  . ASP A 1 121 ? -13.778 -17.319 -4.494  1.00 0.00 ? 140 ASP A OD2  1  
ATOM 1812  H H    . ASP A 1 121 ? -14.186 -13.784 -6.057  1.00 0.00 ? 140 ASP A H    1  
ATOM 1813  H HA   . ASP A 1 121 ? -11.834 -15.230 -5.612  1.00 0.00 ? 140 ASP A HA   1  
ATOM 1814  H HB2  . ASP A 1 121 ? -14.498 -15.803 -6.353  2.00 0.00 ? 140 ASP A HB2  1  
ATOM 1815  H HB3  . ASP A 1 121 ? -13.472 -16.554 -7.569  2.00 0.00 ? 140 ASP A HB3  1  
ATOM 1816  N N    . GLY A 1 122 ? -10.648 -15.701 -7.831  1.00 0.00 ? 141 GLY A N    1  
ATOM 1817  C CA   . GLY A 1 122 ? -9.805  -15.661 -9.012  1.00 0.00 ? 141 GLY A CA   1  
ATOM 1818  C C    . GLY A 1 122 ? -8.436  -16.268 -8.771  1.00 0.00 ? 141 GLY A C    1  
ATOM 1819  O O    . GLY A 1 122 ? -7.935  -16.253 -7.647  1.00 0.00 ? 141 GLY A O    1  
ATOM 1820  H H    . GLY A 1 122 ? -10.448 -16.334 -7.110  1.00 0.00 ? 141 GLY A H    1  
ATOM 1821  H HA2  . GLY A 1 122 ? -10.294 -16.207 -9.808  2.00 0.00 ? 141 GLY A HA2  1  
ATOM 1822  H HA3  . GLY A 1 122 ? -9.682  -14.631 -9.318  2.00 0.00 ? 141 GLY A HA3  1  
ATOM 1823  N N    . PRO A 1 123 ? -7.805  -16.823 -9.818  1.00 0.00 ? 142 PRO A N    1  
ATOM 1824  C CA   . PRO A 1 123 ? -6.484  -17.447 -9.717  1.00 0.00 ? 142 PRO A CA   1  
ATOM 1825  C C    . PRO A 1 123 ? -5.366  -16.425 -9.518  1.00 0.00 ? 142 PRO A C    1  
ATOM 1826  O O    . PRO A 1 123 ? -4.187  -16.750 -9.664  1.00 0.00 ? 142 PRO A O    1  
ATOM 1827  C CB   . PRO A 1 123 ? -6.308  -18.166 -11.067 1.00 0.00 ? 142 PRO A CB   1  
ATOM 1828  C CG   . PRO A 1 123 ? -7.653  -18.123 -11.722 1.00 0.00 ? 142 PRO A CG   1  
ATOM 1829  C CD   . PRO A 1 123 ? -8.330  -16.899 -11.182 1.00 0.00 ? 142 PRO A CD   1  
ATOM 1830  H HA   . PRO A 1 123 ? -6.451  -18.171 -8.916  1.00 0.00 ? 142 PRO A HA   1  
ATOM 1831  H HB2  . PRO A 1 123 ? -5.567  -17.647 -11.658 2.00 0.00 ? 142 PRO A HB2  1  
ATOM 1832  H HB3  . PRO A 1 123 ? -5.988  -19.183 -10.894 2.00 0.00 ? 142 PRO A HB3  1  
ATOM 1833  H HG2  . PRO A 1 123 ? -7.538  -18.047 -12.793 2.00 0.00 ? 142 PRO A HG2  1  
ATOM 1834  H HG3  . PRO A 1 123 ? -8.216  -19.007 -11.464 2.00 0.00 ? 142 PRO A HG3  1  
ATOM 1835  H HD2  . PRO A 1 123 ? -8.052  -16.026 -11.755 2.00 0.00 ? 142 PRO A HD2  1  
ATOM 1836  H HD3  . PRO A 1 123 ? -9.402  -17.028 -11.179 2.00 0.00 ? 142 PRO A HD3  1  
ATOM 1837  N N    . ILE A 1 124 ? -5.737  -15.192 -9.186  1.00 0.00 ? 143 ILE A N    1  
ATOM 1838  C CA   . ILE A 1 124 ? -4.754  -14.134 -8.972  1.00 0.00 ? 143 ILE A CA   1  
ATOM 1839  C C    . ILE A 1 124 ? -3.929  -14.397 -7.717  1.00 0.00 ? 143 ILE A C    1  
ATOM 1840  O O    . ILE A 1 124 ? -4.468  -14.485 -6.614  1.00 0.00 ? 143 ILE A O    1  
ATOM 1841  C CB   . ILE A 1 124 ? -5.425  -12.751 -8.854  1.00 0.00 ? 143 ILE A CB   1  
ATOM 1842  C CG1  . ILE A 1 124 ? -5.878  -12.263 -10.233 1.00 0.00 ? 143 ILE A CG1  1  
ATOM 1843  C CG2  . ILE A 1 124 ? -4.471  -11.750 -8.218  1.00 0.00 ? 143 ILE A CG2  1  
ATOM 1844  C CD1  . ILE A 1 124 ? -6.412  -10.847 -10.243 1.00 0.00 ? 143 ILE A CD1  1  
ATOM 1845  H H    . ILE A 1 124 ? -6.690  -14.988 -9.083  1.00 0.00 ? 143 ILE A H    1  
ATOM 1846  H HA   . ILE A 1 124 ? -4.094  -14.116 -9.826  1.00 0.00 ? 143 ILE A HA   1  
ATOM 1847  H HB   . ILE A 1 124 ? -6.287  -12.847 -8.213  1.00 0.00 ? 143 ILE A HB   1  
ATOM 1848  H HG12 . ILE A 1 124 ? -5.040  -12.304 -10.914 2.00 0.00 ? 143 ILE A HG12 1  
ATOM 1849  H HG13 . ILE A 1 124 ? -6.658  -12.914 -10.598 2.00 0.00 ? 143 ILE A HG13 1  
ATOM 1850  H HG21 . ILE A 1 124 ? -3.461  -12.126 -8.279  1.00 0.00 ? 143 ILE A HG21 1  
ATOM 1851  H HG22 . ILE A 1 124 ? -4.739  -11.606 -7.182  1.00 0.00 ? 143 ILE A HG22 1  
ATOM 1852  H HG23 . ILE A 1 124 ? -4.536  -10.807 -8.741  1.00 0.00 ? 143 ILE A HG23 1  
ATOM 1853  H HD11 . ILE A 1 124 ? -7.211  -10.770 -10.966 1.00 0.00 ? 143 ILE A HD11 1  
ATOM 1854  H HD12 . ILE A 1 124 ? -5.619  -10.165 -10.509 1.00 0.00 ? 143 ILE A HD12 1  
ATOM 1855  H HD13 . ILE A 1 124 ? -6.789  -10.597 -9.262  1.00 0.00 ? 143 ILE A HD13 1  
ATOM 1856  N N    . THR A 1 125 ? -2.617  -14.520 -7.893  1.00 0.00 ? 144 THR A N    1  
ATOM 1857  C CA   . THR A 1 125 ? -1.716  -14.772 -6.776  1.00 0.00 ? 144 THR A CA   1  
ATOM 1858  C C    . THR A 1 125 ? -1.564  -13.532 -5.902  1.00 0.00 ? 144 THR A C    1  
ATOM 1859  O O    . THR A 1 125 ? -0.638  -12.742 -6.083  1.00 0.00 ? 144 THR A O    1  
ATOM 1860  C CB   . THR A 1 125 ? -0.324  -15.215 -7.264  1.00 0.00 ? 144 THR A CB   1  
ATOM 1861  O OG1  . THR A 1 125 ? -0.456  -16.228 -8.269  1.00 0.00 ? 144 THR A OG1  1  
ATOM 1862  C CG2  . THR A 1 125 ? 0.511   -15.746 -6.109  1.00 0.00 ? 144 THR A CG2  1  
ATOM 1863  H H    . THR A 1 125 ? -2.247  -14.439 -8.797  1.00 0.00 ? 144 THR A H    1  
ATOM 1864  H HA   . THR A 1 125 ? -2.137  -15.570 -6.181  1.00 0.00 ? 144 THR A HA   1  
ATOM 1865  H HB   . THR A 1 125 ? 0.181   -14.360 -7.690  1.00 0.00 ? 144 THR A HB   1  
ATOM 1866  H HG1  . THR A 1 125 ? -1.238  -16.756 -8.092  1.00 0.00 ? 144 THR A HG1  1  
ATOM 1867  H HG21 . THR A 1 125 ? 0.048   -15.471 -5.173  1.00 0.00 ? 144 THR A HG21 1  
ATOM 1868  H HG22 . THR A 1 125 ? 1.503   -15.322 -6.158  1.00 0.00 ? 144 THR A HG22 1  
ATOM 1869  H HG23 . THR A 1 125 ? 0.576   -16.822 -6.176  1.00 0.00 ? 144 THR A HG23 1  
ATOM 1870  N N    . ILE A 1 126 ? -2.481  -13.368 -4.954  1.00 0.00 ? 145 ILE A N    1  
ATOM 1871  C CA   . ILE A 1 126 ? -2.451  -12.225 -4.050  1.00 0.00 ? 145 ILE A CA   1  
ATOM 1872  C C    . ILE A 1 126 ? -1.477  -12.458 -2.899  1.00 0.00 ? 145 ILE A C    1  
ATOM 1873  O O    . ILE A 1 126 ? -1.864  -12.934 -1.832  1.00 0.00 ? 145 ILE A O    1  
ATOM 1874  C CB   . ILE A 1 126 ? -3.851  -11.930 -3.474  1.00 0.00 ? 145 ILE A CB   1  
ATOM 1875  C CG1  . ILE A 1 126 ? -4.847  -11.670 -4.603  1.00 0.00 ? 145 ILE A CG1  1  
ATOM 1876  C CG2  . ILE A 1 126 ? -3.799  -10.740 -2.531  1.00 0.00 ? 145 ILE A CG2  1  
ATOM 1877  C CD1  . ILE A 1 126 ? -6.288  -11.590 -4.148  1.00 0.00 ? 145 ILE A CD1  1  
ATOM 1878  H H    . ILE A 1 126 ? -3.195  -14.033 -4.860  1.00 0.00 ? 145 ILE A H    1  
ATOM 1879  H HA   . ILE A 1 126 ? -2.128  -11.362 -4.614  1.00 0.00 ? 145 ILE A HA   1  
ATOM 1880  H HB   . ILE A 1 126 ? -4.175  -12.793 -2.911  1.00 0.00 ? 145 ILE A HB   1  
ATOM 1881  H HG12 . ILE A 1 126 ? -4.599  -10.734 -5.083  2.00 0.00 ? 145 ILE A HG12 1  
ATOM 1882  H HG13 . ILE A 1 126 ? -4.773  -12.464 -5.327  2.00 0.00 ? 145 ILE A HG13 1  
ATOM 1883  H HG21 . ILE A 1 126 ? -2.851  -10.233 -2.644  1.00 0.00 ? 145 ILE A HG21 1  
ATOM 1884  H HG22 . ILE A 1 126 ? -3.907  -11.081 -1.513  1.00 0.00 ? 145 ILE A HG22 1  
ATOM 1885  H HG23 . ILE A 1 126 ? -4.601  -10.059 -2.771  1.00 0.00 ? 145 ILE A HG23 1  
ATOM 1886  H HD11 . ILE A 1 126 ? -6.321  -11.307 -3.106  1.00 0.00 ? 145 ILE A HD11 1  
ATOM 1887  H HD12 . ILE A 1 126 ? -6.759  -12.553 -4.275  1.00 0.00 ? 145 ILE A HD12 1  
ATOM 1888  H HD13 . ILE A 1 126 ? -6.811  -10.852 -4.738  1.00 0.00 ? 145 ILE A HD13 1  
ATOM 1889  N N    . THR A 1 127 ? -0.210  -12.120 -3.122  1.00 0.00 ? 146 THR A N    1  
ATOM 1890  C CA   . THR A 1 127 ? 0.818   -12.292 -2.103  1.00 0.00 ? 146 THR A CA   1  
ATOM 1891  C C    . THR A 1 127 ? 1.139   -10.968 -1.417  1.00 0.00 ? 146 THR A C    1  
ATOM 1892  O O    . THR A 1 127 ? 1.757   -10.085 -2.012  1.00 0.00 ? 146 THR A O    1  
ATOM 1893  C CB   . THR A 1 127 ? 2.111   -12.871 -2.704  1.00 0.00 ? 146 THR A CB   1  
ATOM 1894  O OG1  . THR A 1 127 ? 1.925   -14.253 -3.032  1.00 0.00 ? 146 THR A OG1  1  
ATOM 1895  C CG2  . THR A 1 127 ? 3.268   -12.728 -1.729  1.00 0.00 ? 146 THR A CG2  1  
ATOM 1896  H H    . THR A 1 127 ? 0.040   -11.745 -3.993  1.00 0.00 ? 146 THR A H    1  
ATOM 1897  H HA   . THR A 1 127 ? 0.444   -12.988 -1.366  1.00 0.00 ? 146 THR A HA   1  
ATOM 1898  H HB   . THR A 1 127 ? 2.348   -12.324 -3.604  1.00 0.00 ? 146 THR A HB   1  
ATOM 1899  H HG1  . THR A 1 127 ? 2.172   -14.401 -3.948  1.00 0.00 ? 146 THR A HG1  1  
ATOM 1900  H HG21 . THR A 1 127 ? 3.741   -13.688 -1.587  1.00 0.00 ? 146 THR A HG21 1  
ATOM 1901  H HG22 . THR A 1 127 ? 2.896   -12.366 -0.782  1.00 0.00 ? 146 THR A HG22 1  
ATOM 1902  H HG23 . THR A 1 127 ? 3.987   -12.027 -2.125  1.00 0.00 ? 146 THR A HG23 1  
ATOM 1903  N N    . ILE A 1 128 ? 0.716   -10.836 -0.164  1.00 0.00 ? 147 ILE A N    1  
ATOM 1904  C CA   . ILE A 1 128 ? 0.959   -9.614  0.598   1.00 0.00 ? 147 ILE A CA   1  
ATOM 1905  C C    . ILE A 1 128 ? 2.309   -9.652  1.304   1.00 0.00 ? 147 ILE A C    1  
ATOM 1906  O O    . ILE A 1 128 ? 2.504   -10.413 2.252   1.00 0.00 ? 147 ILE A O    1  
ATOM 1907  C CB   . ILE A 1 128 ? -0.138  -9.356  1.653   1.00 0.00 ? 147 ILE A CB   1  
ATOM 1908  C CG1  . ILE A 1 128 ? -1.144  -10.509 1.703   1.00 0.00 ? 147 ILE A CG1  1  
ATOM 1909  C CG2  . ILE A 1 128 ? -0.846  -8.043  1.366   1.00 0.00 ? 147 ILE A CG2  1  
ATOM 1910  C CD1  . ILE A 1 128 ? -2.047  -10.593 0.492   1.00 0.00 ? 147 ILE A CD1  1  
ATOM 1911  H H    . ILE A 1 128 ? 0.230   -11.574 0.255   1.00 0.00 ? 147 ILE A H    1  
ATOM 1912  H HA   . ILE A 1 128 ? 0.956   -8.787  -0.097  1.00 0.00 ? 147 ILE A HA   1  
ATOM 1913  H HB   . ILE A 1 128 ? 0.342   -9.268  2.617   1.00 0.00 ? 147 ILE A HB   1  
ATOM 1914  H HG12 . ILE A 1 128 ? -0.609  -11.443 1.786   2.00 0.00 ? 147 ILE A HG12 1  
ATOM 1915  H HG13 . ILE A 1 128 ? -1.772  -10.388 2.573   2.00 0.00 ? 147 ILE A HG13 1  
ATOM 1916  H HG21 . ILE A 1 128 ? -1.902  -8.154  1.557   1.00 0.00 ? 147 ILE A HG21 1  
ATOM 1917  H HG22 . ILE A 1 128 ? -0.693  -7.770  0.332   1.00 0.00 ? 147 ILE A HG22 1  
ATOM 1918  H HG23 . ILE A 1 128 ? -0.443  -7.271  2.005   1.00 0.00 ? 147 ILE A HG23 1  
ATOM 1919  H HD11 . ILE A 1 128 ? -1.760  -11.441 -0.113  1.00 0.00 ? 147 ILE A HD11 1  
ATOM 1920  H HD12 . ILE A 1 128 ? -1.954  -9.688  -0.089  1.00 0.00 ? 147 ILE A HD12 1  
ATOM 1921  H HD13 . ILE A 1 128 ? -3.072  -10.710 0.815   1.00 0.00 ? 147 ILE A HD13 1  
ATOM 1922  N N    . VAL A 1 129 ? 3.234   -8.817  0.843   1.00 0.00 ? 148 VAL A N    1  
ATOM 1923  C CA   . VAL A 1 129 ? 4.563   -8.743  1.439   1.00 0.00 ? 148 VAL A CA   1  
ATOM 1924  C C    . VAL A 1 129 ? 4.589   -7.722  2.571   1.00 0.00 ? 148 VAL A C    1  
ATOM 1925  O O    . VAL A 1 129 ? 4.380   -6.531  2.347   1.00 0.00 ? 148 VAL A O    1  
ATOM 1926  C CB   . VAL A 1 129 ? 5.626   -8.356  0.395   1.00 0.00 ? 148 VAL A CB   1  
ATOM 1927  C CG1  . VAL A 1 129 ? 7.007   -8.286  1.029   2.00 0.00 ? 148 VAL A CG1  1  
ATOM 1928  C CG2  . VAL A 1 129 ? 5.626   -9.338  -0.767  2.00 0.00 ? 148 VAL A CG2  1  
ATOM 1929  H H    . VAL A 1 129 ? 3.014   -8.229  0.090   1.00 0.00 ? 148 VAL A H    1  
ATOM 1930  H HA   . VAL A 1 129 ? 4.809   -9.717  1.835   1.00 0.00 ? 148 VAL A HA   1  
ATOM 1931  H HB   . VAL A 1 129 ? 5.376   -7.376  0.015   1.00 0.00 ? 148 VAL A HB   1  
ATOM 1932  H HG11 . VAL A 1 129 ? 7.110   -9.079  1.756   1.00 0.00 ? 148 VAL A HG11 1  
ATOM 1933  H HG12 . VAL A 1 129 ? 7.131   -7.332  1.519   1.00 0.00 ? 148 VAL A HG12 1  
ATOM 1934  H HG13 . VAL A 1 129 ? 7.761   -8.399  0.264   1.00 0.00 ? 148 VAL A HG13 1  
ATOM 1935  H HG21 . VAL A 1 129 ? 6.307   -8.992  -1.530  1.00 0.00 ? 148 VAL A HG21 1  
ATOM 1936  H HG22 . VAL A 1 129 ? 4.629   -9.408  -1.178  1.00 0.00 ? 148 VAL A HG22 1  
ATOM 1937  H HG23 . VAL A 1 129 ? 5.940   -10.310 -0.417  1.00 0.00 ? 148 VAL A HG23 1  
ATOM 1938  N N    . ASN A 1 130 ? 4.841   -8.192  3.788   1.00 0.00 ? 149 ASN A N    1  
ATOM 1939  C CA   . ASN A 1 130 ? 4.883   -7.309  4.949   1.00 0.00 ? 149 ASN A CA   1  
ATOM 1940  C C    . ASN A 1 130 ? 6.213   -6.577  5.041   1.00 0.00 ? 149 ASN A C    1  
ATOM 1941  O O    . ASN A 1 130 ? 7.161   -7.077  5.647   1.00 0.00 ? 149 ASN A O    1  
ATOM 1942  C CB   . ASN A 1 130 ? 4.649   -8.097  6.236   1.00 0.00 ? 149 ASN A CB   1  
ATOM 1943  C CG   . ASN A 1 130 ? 3.276   -7.853  6.832   1.00 0.00 ? 149 ASN A CG   1  
ATOM 1944  O OD1  . ASN A 1 130 ? 3.012   -8.214  7.979   1.00 0.00 ? 149 ASN A OD1  1  
ATOM 1945  N ND2  . ASN A 1 130 ? 2.394   -7.234  6.056   4.00 0.00 ? 149 ASN A ND2  1  
ATOM 1946  H H    . ASN A 1 130 ? 4.995   -9.151  3.909   1.00 0.00 ? 149 ASN A H    1  
ATOM 1947  H HA   . ASN A 1 130 ? 4.093   -6.581  4.838   1.00 0.00 ? 149 ASN A HA   1  
ATOM 1948  H HB2  . ASN A 1 130 ? 4.751   -9.151  6.028   2.00 0.00 ? 149 ASN A HB2  1  
ATOM 1949  H HB3  . ASN A 1 130 ? 5.392   -7.806  6.966   2.00 0.00 ? 149 ASN A HB3  1  
ATOM 1950  H HD21 . ASN A 1 130 ? 2.675   -6.972  5.151   5.00 0.00 ? 149 ASN A HD21 1  
ATOM 1951  H HD22 . ASN A 1 130 ? 1.497   -7.063  6.418   5.00 0.00 ? 149 ASN A HD22 1  
ATOM 1952  N N    . ARG A 1 131 ? 6.258   -5.386  4.444   1.00 0.00 ? 150 ARG A N    1  
ATOM 1953  C CA   . ARG A 1 131 ? 7.452   -4.545  4.451   1.00 0.00 ? 150 ARG A CA   1  
ATOM 1954  C C    . ARG A 1 131 ? 8.728   -5.374  4.560   1.00 0.00 ? 150 ARG A C    1  
ATOM 1955  O O    . ARG A 1 131 ? 9.441   -5.565  3.574   1.00 0.00 ? 150 ARG A O    1  
ATOM 1956  C CB   . ARG A 1 131 ? 7.376   -3.541  5.604   1.00 0.00 ? 150 ARG A CB   1  
ATOM 1957  C CG   . ARG A 1 131 ? 7.521   -2.091  5.166   1.00 0.00 ? 150 ARG A CG   1  
ATOM 1958  C CD   . ARG A 1 131 ? 8.849   -1.493  5.600   1.00 0.00 ? 150 ARG A CD   1  
ATOM 1959  N NE   . ARG A 1 131 ? 9.094   -1.685  7.026   1.00 0.00 ? 150 ARG A NE   1  
ATOM 1960  C CZ   . ARG A 1 131 ? 9.705   -0.790  7.796   4.00 0.00 ? 150 ARG A CZ   1  
ATOM 1961  N NH1  . ARG A 1 131 ? 10.133  0.354   7.282   5.00 0.00 ? 150 ARG A NH1  1  
ATOM 1962  N NH2  . ARG A 1 131 ? 9.895   -1.033  9.086   5.00 0.00 ? 150 ARG A NH2  1  
ATOM 1963  H H    . ARG A 1 131 ? 5.455   -5.057  3.991   1.00 0.00 ? 150 ARG A H    1  
ATOM 1964  H HA   . ARG A 1 131 ? 7.474   -4.000  3.519   1.00 0.00 ? 150 ARG A HA   1  
ATOM 1965  H HB2  . ARG A 1 131 ? 6.420   -3.650  6.098   2.00 0.00 ? 150 ARG A HB2  1  
ATOM 1966  H HB3  . ARG A 1 131 ? 8.162   -3.761  6.310   2.00 0.00 ? 150 ARG A HB3  1  
ATOM 1967  H HG2  . ARG A 1 131 ? 7.452   -2.044  4.089   2.00 0.00 ? 150 ARG A HG2  1  
ATOM 1968  H HG3  . ARG A 1 131 ? 6.718   -1.512  5.602   2.00 0.00 ? 150 ARG A HG3  1  
ATOM 1969  H HD2  . ARG A 1 131 ? 9.642   -1.967  5.041   2.00 0.00 ? 150 ARG A HD2  1  
ATOM 1970  H HD3  . ARG A 1 131 ? 8.840   -0.435  5.385   2.00 0.00 ? 150 ARG A HD3  1  
ATOM 1971  H HE   . ARG A 1 131 ? 8.789   -2.525  7.431   1.00 0.00 ? 150 ARG A HE   1  
ATOM 1972  H HH11 . ARG A 1 131 ? 9.997   0.548   6.311   5.00 0.00 ? 150 ARG A HH11 1  
ATOM 1973  H HH12 . ARG A 1 131 ? 10.592  1.024   7.866   5.00 0.00 ? 150 ARG A HH12 1  
ATOM 1974  H HH21 . ARG A 1 131 ? 9.578   -1.893  9.485   5.00 0.00 ? 150 ARG A HH21 1  
ATOM 1975  H HH22 . ARG A 1 131 ? 10.356  -0.355  9.659   5.00 0.00 ? 150 ARG A HH22 1  
ATOM 1976  N N    . ASP A 1 132 ? 9.012   -5.860  5.762   1.00 0.00 ? 151 ASP A N    1  
ATOM 1977  C CA   . ASP A 1 132 ? 10.205  -6.666  5.998   1.00 0.00 ? 151 ASP A CA   1  
ATOM 1978  C C    . ASP A 1 132 ? 10.033  -7.548  7.229   1.00 0.00 ? 151 ASP A C    1  
ATOM 1979  O O    . ASP A 1 132 ? 11.007  -8.070  7.771   1.00 0.00 ? 151 ASP A O    1  
ATOM 1980  C CB   . ASP A 1 132 ? 11.428  -5.764  6.170   1.00 0.00 ? 151 ASP A CB   1  
ATOM 1981  C CG   . ASP A 1 132 ? 12.635  -6.217  5.372   1.00 0.00 ? 151 ASP A CG   1  
ATOM 1982  O OD1  . ASP A 1 132 ? 12.699  -5.905  4.164   1.00 0.00 ? 151 ASP A OD1  1  
ATOM 1983  O OD2  . ASP A 1 132 ? 13.516  -6.882  5.955   1.00 0.00 ? 151 ASP A OD2  1  
ATOM 1984  H H    . ASP A 1 132 ? 8.404   -5.674  6.508   1.00 0.00 ? 151 ASP A H    1  
ATOM 1985  H HA   . ASP A 1 132 ? 10.353  -7.297  5.135   1.00 0.00 ? 151 ASP A HA   1  
ATOM 1986  H HB2  . ASP A 1 132 ? 11.171  -4.762  5.854   2.00 0.00 ? 151 ASP A HB2  1  
ATOM 1987  H HB3  . ASP A 1 132 ? 11.703  -5.742  7.216   2.00 0.00 ? 151 ASP A HB3  1  
ATOM 1988  N N    . GLY A 1 133 ? 8.789   -7.712  7.665   1.00 0.00 ? 152 GLY A N    1  
ATOM 1989  C CA   . GLY A 1 133 ? 8.514   -8.532  8.827   1.00 0.00 ? 152 GLY A CA   1  
ATOM 1990  C C    . GLY A 1 133 ? 7.932   -9.885  8.468   1.00 0.00 ? 152 GLY A C    1  
ATOM 1991  O O    . GLY A 1 133 ? 8.098   -10.853 9.210   1.00 0.00 ? 152 GLY A O    1  
ATOM 1992  H H    . GLY A 1 133 ? 8.052   -7.273  7.193   1.00 0.00 ? 152 GLY A H    1  
ATOM 1993  H HA2  . GLY A 1 133 ? 9.436   -8.684  9.372   2.00 0.00 ? 152 GLY A HA2  1  
ATOM 1994  H HA3  . GLY A 1 133 ? 7.814   -8.010  9.464   2.00 0.00 ? 152 GLY A HA3  1  
ATOM 1995  N N    . THR A 1 134 ? 7.248   -9.953  7.329   1.00 0.00 ? 153 THR A N    1  
ATOM 1996  C CA   . THR A 1 134 ? 6.642   -11.205 6.883   1.00 0.00 ? 153 THR A CA   1  
ATOM 1997  C C    . THR A 1 134 ? 6.159   -11.107 5.440   1.00 0.00 ? 153 THR A C    1  
ATOM 1998  O O    . THR A 1 134 ? 6.259   -10.055 4.810   1.00 0.00 ? 153 THR A O    1  
ATOM 1999  C CB   . THR A 1 134 ? 5.462   -11.614 7.787   1.00 0.00 ? 153 THR A CB   1  
ATOM 2000  O OG1  . THR A 1 134 ? 4.452   -12.271 7.013   1.00 0.00 ? 153 THR A OG1  1  
ATOM 2001  C CG2  . THR A 1 134 ? 4.862   -10.403 8.484   1.00 0.00 ? 153 THR A CG2  1  
ATOM 2002  H H    . THR A 1 134 ? 7.149   -9.146  6.777   1.00 0.00 ? 153 THR A H    1  
ATOM 2003  H HA   . THR A 1 134 ? 7.393   -11.977 6.943   1.00 0.00 ? 153 THR A HA   1  
ATOM 2004  H HB   . THR A 1 134 ? 5.826   -12.298 8.540   1.00 0.00 ? 153 THR A HB   1  
ATOM 2005  H HG1  . THR A 1 134 ? 4.458   -13.211 7.209   1.00 0.00 ? 153 THR A HG1  1  
ATOM 2006  H HG21 . THR A 1 134 ? 4.050   -10.010 7.889   1.00 0.00 ? 153 THR A HG21 1  
ATOM 2007  H HG22 . THR A 1 134 ? 5.621   -9.643  8.603   1.00 0.00 ? 153 THR A HG22 1  
ATOM 2008  H HG23 . THR A 1 134 ? 4.488   -10.694 9.454   1.00 0.00 ? 153 THR A HG23 1  
ATOM 2009  N N    . ARG A 1 135 ? 5.639   -12.216 4.925   1.00 0.00 ? 154 ARG A N    1  
ATOM 2010  C CA   . ARG A 1 135 ? 5.136   -12.271 3.557   1.00 0.00 ? 154 ARG A CA   1  
ATOM 2011  C C    . ARG A 1 135 ? 4.170   -13.440 3.397   1.00 0.00 ? 154 ARG A C    1  
ATOM 2012  O O    . ARG A 1 135 ? 4.556   -14.599 3.552   1.00 0.00 ? 154 ARG A O    1  
ATOM 2013  C CB   . ARG A 1 135 ? 6.295   -12.411 2.568   1.00 0.00 ? 154 ARG A CB   1  
ATOM 2014  C CG   . ARG A 1 135 ? 7.345   -13.428 2.988   1.00 0.00 ? 154 ARG A CG   1  
ATOM 2015  C CD   . ARG A 1 135 ? 8.469   -13.543 1.971   1.00 0.00 ? 154 ARG A CD   1  
ATOM 2016  N NE   . ARG A 1 135 ? 9.703   -14.036 2.573   1.00 0.00 ? 154 ARG A NE   1  
ATOM 2017  C CZ   . ARG A 1 135 ? 10.893  -13.955 1.986   4.00 0.00 ? 154 ARG A CZ   1  
ATOM 2018  N NH1  . ARG A 1 135 ? 11.014  -13.402 0.787   5.00 0.00 ? 154 ARG A NH1  1  
ATOM 2019  N NH2  . ARG A 1 135 ? 11.974  -14.424 2.595   5.00 0.00 ? 154 ARG A NH2  1  
ATOM 2020  H H    . ARG A 1 135 ? 5.592   -13.021 5.481   1.00 0.00 ? 154 ARG A H    1  
ATOM 2021  H HA   . ARG A 1 135 ? 4.609   -11.350 3.357   1.00 0.00 ? 154 ARG A HA   1  
ATOM 2022  H HB2  . ARG A 1 135 ? 5.900   -12.710 1.608   2.00 0.00 ? 154 ARG A HB2  1  
ATOM 2023  H HB3  . ARG A 1 135 ? 6.779   -11.451 2.460   2.00 0.00 ? 154 ARG A HB3  1  
ATOM 2024  H HG2  . ARG A 1 135 ? 7.763   -13.126 3.938   2.00 0.00 ? 154 ARG A HG2  1  
ATOM 2025  H HG3  . ARG A 1 135 ? 6.871   -14.394 3.094   2.00 0.00 ? 154 ARG A HG3  1  
ATOM 2026  H HD2  . ARG A 1 135 ? 8.163   -14.224 1.191   2.00 0.00 ? 154 ARG A HD2  1  
ATOM 2027  H HD3  . ARG A 1 135 ? 8.652   -12.567 1.544   2.00 0.00 ? 154 ARG A HD3  1  
ATOM 2028  H HE   . ARG A 1 135 ? 9.643   -14.448 3.460   1.00 0.00 ? 154 ARG A HE   1  
ATOM 2029  H HH11 . ARG A 1 135 ? 10.207  -13.042 0.319   5.00 0.00 ? 154 ARG A HH11 1  
ATOM 2030  H HH12 . ARG A 1 135 ? 11.913  -13.343 0.352   5.00 0.00 ? 154 ARG A HH12 1  
ATOM 2031  H HH21 . ARG A 1 135 ? 11.896  -14.842 3.500   5.00 0.00 ? 154 ARG A HH21 1  
ATOM 2032  H HH22 . ARG A 1 135 ? 12.867  -14.360 2.149   5.00 0.00 ? 154 ARG A HH22 1  
ATOM 2033  N N    . TYR A 1 136 ? 2.911   -13.133 3.101   1.00 0.00 ? 155 TYR A N    1  
ATOM 2034  C CA   . TYR A 1 136 ? 1.899   -14.169 2.939   1.00 0.00 ? 155 TYR A CA   1  
ATOM 2035  C C    . TYR A 1 136 ? 1.392   -14.230 1.502   1.00 0.00 ? 155 TYR A C    1  
ATOM 2036  O O    . TYR A 1 136 ? 1.382   -13.225 0.792   1.00 0.00 ? 155 TYR A O    1  
ATOM 2037  C CB   . TYR A 1 136 ? 0.732   -13.920 3.897   1.00 0.00 ? 155 TYR A CB   1  
ATOM 2038  C CG   . TYR A 1 136 ? 0.775   -12.616 4.662   1.00 0.00 ? 155 TYR A CG   1  
ATOM 2039  C CD1  . TYR A 1 136 ? 1.811   -12.338 5.549   1.00 0.00 ? 155 TYR A CD1  1  
ATOM 2040  C CD2  . TYR A 1 136 ? -0.221  -11.661 4.499   1.00 0.00 ? 155 TYR A CD2  1  
ATOM 2041  C CE1  . TYR A 1 136 ? 1.849   -11.148 6.250   1.00 0.00 ? 155 TYR A CE1  1  
ATOM 2042  C CE2  . TYR A 1 136 ? -0.186  -10.469 5.195   1.00 0.00 ? 155 TYR A CE2  1  
ATOM 2043  C CZ   . TYR A 1 136 ? 0.849   -10.218 6.068   1.00 0.00 ? 155 TYR A CZ   1  
ATOM 2044  O OH   . TYR A 1 136 ? 0.880   -9.033  6.765   1.00 0.00 ? 155 TYR A OH   1  
ATOM 2045  H H    . TYR A 1 136 ? 2.655   -12.190 2.998   1.00 0.00 ? 155 TYR A H    1  
ATOM 2046  H HA   . TYR A 1 136 ? 2.355   -15.116 3.185   1.00 0.00 ? 155 TYR A HA   1  
ATOM 2047  H HB2  . TYR A 1 136 ? -0.190  -13.935 3.331   2.00 0.00 ? 155 TYR A HB2  1  
ATOM 2048  H HB3  . TYR A 1 136 ? 0.703   -14.722 4.622   2.00 0.00 ? 155 TYR A HB3  1  
ATOM 2049  H HD1  . TYR A 1 136 ? 2.596   -13.068 5.688   1.00 0.00 ? 155 TYR A HD1  1  
ATOM 2050  H HD2  . TYR A 1 136 ? -1.035  -11.859 3.815   1.00 0.00 ? 155 TYR A HD2  1  
ATOM 2051  H HE1  . TYR A 1 136 ? 2.660   -10.950 6.934   1.00 0.00 ? 155 TYR A HE1  1  
ATOM 2052  H HE2  . TYR A 1 136 ? -0.969  -9.739  5.053   1.00 0.00 ? 155 TYR A HE2  1  
ATOM 2053  H HH   . TYR A 1 136 ? 0.787   -9.211  7.704   1.00 0.00 ? 155 TYR A HH   1  
ATOM 2054  N N    . VAL A 1 137 ? 0.971   -15.420 1.083   1.00 0.00 ? 156 VAL A N    1  
ATOM 2055  C CA   . VAL A 1 137 ? 0.461   -15.622 -0.267  1.00 0.00 ? 156 VAL A CA   1  
ATOM 2056  C C    . VAL A 1 137 ? -1.012  -16.017 -0.242  1.00 0.00 ? 156 VAL A C    1  
ATOM 2057  O O    . VAL A 1 137 ? -1.477  -16.659 0.700   1.00 0.00 ? 156 VAL A O    1  
ATOM 2058  C CB   . VAL A 1 137 ? 1.260   -16.709 -1.012  1.00 0.00 ? 156 VAL A CB   1  
ATOM 2059  C CG1  . VAL A 1 137 ? 1.170   -18.042 -0.286  2.00 0.00 ? 156 VAL A CG1  1  
ATOM 2060  C CG2  . VAL A 1 137 ? 0.766   -16.862 -2.443  2.00 0.00 ? 156 VAL A CG2  1  
ATOM 2061  H H    . VAL A 1 137 ? 1.005   -16.182 1.699   1.00 0.00 ? 156 VAL A H    1  
ATOM 2062  H HA   . VAL A 1 137 ? 0.566   -14.692 -0.807  1.00 0.00 ? 156 VAL A HA   1  
ATOM 2063  H HB   . VAL A 1 137 ? 2.296   -16.404 -1.040  1.00 0.00 ? 156 VAL A HB   1  
ATOM 2064  H HG11 . VAL A 1 137 ? 0.137   -18.350 -0.224  1.00 0.00 ? 156 VAL A HG11 1  
ATOM 2065  H HG12 . VAL A 1 137 ? 1.576   -17.938 0.710   1.00 0.00 ? 156 VAL A HG12 1  
ATOM 2066  H HG13 . VAL A 1 137 ? 1.735   -18.786 -0.828  1.00 0.00 ? 156 VAL A HG13 1  
ATOM 2067  H HG21 . VAL A 1 137 ? 1.578   -17.196 -3.071  1.00 0.00 ? 156 VAL A HG21 1  
ATOM 2068  H HG22 . VAL A 1 137 ? 0.400   -15.912 -2.801  1.00 0.00 ? 156 VAL A HG22 1  
ATOM 2069  H HG23 . VAL A 1 137 ? -0.033  -17.589 -2.472  1.00 0.00 ? 156 VAL A HG23 1  
ATOM 2070  N N    . GLN A 1 138 ? -1.741  -15.630 -1.284  1.00 0.00 ? 157 GLN A N    1  
ATOM 2071  C CA   . GLN A 1 138 ? -3.161  -15.944 -1.383  1.00 0.00 ? 157 GLN A CA   1  
ATOM 2072  C C    . GLN A 1 138 ? -3.597  -16.026 -2.843  1.00 0.00 ? 157 GLN A C    1  
ATOM 2073  O O    . GLN A 1 138 ? -2.833  -15.691 -3.747  1.00 0.00 ? 157 GLN A O    1  
ATOM 2074  C CB   . GLN A 1 138 ? -3.991  -14.890 -0.649  1.00 0.00 ? 157 GLN A CB   1  
ATOM 2075  C CG   . GLN A 1 138 ? -5.373  -15.375 -0.244  1.00 0.00 ? 157 GLN A CG   1  
ATOM 2076  C CD   . GLN A 1 138 ? -6.465  -14.365 -0.539  1.00 0.00 ? 157 GLN A CD   1  
ATOM 2077  O OE1  . GLN A 1 138 ? -7.576  -14.730 -0.923  1.00 0.00 ? 157 GLN A OE1  1  
ATOM 2078  N NE2  . GLN A 1 138 ? -6.153  -13.087 -0.361  4.00 0.00 ? 157 GLN A NE2  1  
ATOM 2079  H H    . GLN A 1 138 ? -1.313  -15.121 -2.004  1.00 0.00 ? 157 GLN A H    1  
ATOM 2080  H HA   . GLN A 1 138 ? -3.322  -16.905 -0.917  1.00 0.00 ? 157 GLN A HA   1  
ATOM 2081  H HB2  . GLN A 1 138 ? -3.462  -14.590 0.244   2.00 0.00 ? 157 GLN A HB2  1  
ATOM 2082  H HB3  . GLN A 1 138 ? -4.109  -14.030 -1.292  2.00 0.00 ? 157 GLN A HB3  1  
ATOM 2083  H HG2  . GLN A 1 138 ? -5.592  -16.285 -0.782  2.00 0.00 ? 157 GLN A HG2  1  
ATOM 2084  H HG3  . GLN A 1 138 ? -5.371  -15.579 0.817   2.00 0.00 ? 157 GLN A HG3  1  
ATOM 2085  H HE21 . GLN A 1 138 ? -5.245  -12.869 -0.053  5.00 0.00 ? 157 GLN A HE21 1  
ATOM 2086  H HE22 . GLN A 1 138 ? -6.842  -12.411 -0.546  5.00 0.00 ? 157 GLN A HE22 1  
ATOM 2087  N N    . LYS A 1 139 ? -4.829  -16.474 -3.065  1.00 0.00 ? 158 LYS A N    1  
ATOM 2088  C CA   . LYS A 1 139 ? -5.362  -16.598 -4.416  1.00 0.00 ? 158 LYS A CA   1  
ATOM 2089  C C    . LYS A 1 139 ? -6.762  -16.002 -4.507  1.00 0.00 ? 158 LYS A C    1  
ATOM 2090  O O    . LYS A 1 139 ? -7.708  -16.517 -3.912  1.00 0.00 ? 158 LYS A O    1  
ATOM 2091  C CB   . LYS A 1 139 ? -5.395  -18.066 -4.842  1.00 0.00 ? 158 LYS A CB   1  
ATOM 2092  C CG   . LYS A 1 139 ? -4.464  -18.387 -6.000  1.00 0.00 ? 158 LYS A CG   1  
ATOM 2093  C CD   . LYS A 1 139 ? -4.089  -19.860 -6.030  1.00 0.00 ? 158 LYS A CD   1  
ATOM 2094  C CE   . LYS A 1 139 ? -3.222  -20.197 -7.232  1.00 0.00 ? 158 LYS A CE   1  
ATOM 2095  N NZ   . LYS A 1 139 ? -3.949  -20.005 -8.517  1.00 0.00 ? 158 LYS A NZ   1  
ATOM 2096  H H    . LYS A 1 139 ? -5.391  -16.727 -2.304  1.00 0.00 ? 158 LYS A H    1  
ATOM 2097  H HA   . LYS A 1 139 ? -4.708  -16.054 -5.081  1.00 0.00 ? 158 LYS A HA   1  
ATOM 2098  H HB2  . LYS A 1 139 ? -5.113  -18.680 -4.000  2.00 0.00 ? 158 LYS A HB2  1  
ATOM 2099  H HB3  . LYS A 1 139 ? -6.402  -18.317 -5.138  2.00 0.00 ? 158 LYS A HB3  1  
ATOM 2100  H HG2  . LYS A 1 139 ? -4.957  -18.133 -6.926  2.00 0.00 ? 158 LYS A HG2  1  
ATOM 2101  H HG3  . LYS A 1 139 ? -3.563  -17.800 -5.898  2.00 0.00 ? 158 LYS A HG3  1  
ATOM 2102  H HD2  . LYS A 1 139 ? -3.546  -20.101 -5.128  2.00 0.00 ? 158 LYS A HD2  1  
ATOM 2103  H HD3  . LYS A 1 139 ? -4.993  -20.450 -6.075  2.00 0.00 ? 158 LYS A HD3  1  
ATOM 2104  H HE2  . LYS A 1 139 ? -2.351  -19.558 -7.222  2.00 0.00 ? 158 LYS A HE2  1  
ATOM 2105  H HE3  . LYS A 1 139 ? -2.909  -21.228 -7.156  2.00 0.00 ? 158 LYS A HE3  1  
ATOM 2106  H HZ1  . LYS A 1 139 ? -3.771  -20.810 -9.152  1.00 0.00 ? 158 LYS A HZ1  1  
ATOM 2107  H HZ2  . LYS A 1 139 ? -3.627  -19.133 -8.983  1.00 0.00 ? 158 LYS A HZ2  1  
ATOM 2108  H HZ3  . LYS A 1 139 ? -4.972  -19.934 -8.342  1.00 0.00 ? 158 LYS A HZ3  1  
ATOM 2109  N N    . GLY A 1 140 ? -6.886  -14.913 -5.258  1.00 0.00 ? 159 GLY A N    1  
ATOM 2110  C CA   . GLY A 1 140 ? -8.172  -14.263 -5.417  1.00 0.00 ? 159 GLY A CA   1  
ATOM 2111  C C    . GLY A 1 140 ? -8.234  -13.401 -6.663  1.00 0.00 ? 159 GLY A C    1  
ATOM 2112  O O    . GLY A 1 140 ? -7.809  -13.820 -7.738  1.00 0.00 ? 159 GLY A O    1  
ATOM 2113  H H    . GLY A 1 140 ? -6.096  -14.549 -5.708  1.00 0.00 ? 159 GLY A H    1  
ATOM 2114  H HA2  . GLY A 1 140 ? -8.942  -15.021 -5.478  2.00 0.00 ? 159 GLY A HA2  1  
ATOM 2115  H HA3  . GLY A 1 140 ? -8.359  -13.641 -4.553  2.00 0.00 ? 159 GLY A HA3  1  
ATOM 2116  N N    . GLU A 1 141 ? -8.765  -12.193 -6.517  1.00 0.00 ? 160 GLU A N    1  
ATOM 2117  C CA   . GLU A 1 141 ? -8.883  -11.267 -7.637  1.00 0.00 ? 160 GLU A CA   1  
ATOM 2118  C C    . GLU A 1 141 ? -9.185  -9.858  -7.139  1.00 0.00 ? 160 GLU A C    1  
ATOM 2119  O O    . GLU A 1 141 ? -9.990  -9.675  -6.226  1.00 0.00 ? 160 GLU A O    1  
ATOM 2120  C CB   . GLU A 1 141 ? -9.981  -11.730 -8.597  1.00 0.00 ? 160 GLU A CB   1  
ATOM 2121  C CG   . GLU A 1 141 ? -9.457  -12.286 -9.911  1.00 0.00 ? 160 GLU A CG   1  
ATOM 2122  C CD   . GLU A 1 141 ? -10.551 -12.504 -10.937 1.00 0.00 ? 160 GLU A CD   1  
ATOM 2123  O OE1  . GLU A 1 141 ? -10.986 -11.513 -11.561 1.00 0.00 ? 160 GLU A OE1  1  
ATOM 2124  O OE2  . GLU A 1 141 ? -10.974 -13.665 -11.117 1.00 0.00 ? 160 GLU A OE2  1  
ATOM 2125  H H    . GLU A 1 141 ? -9.087  -11.917 -5.634  1.00 0.00 ? 160 GLU A H    1  
ATOM 2126  H HA   . GLU A 1 141 ? -7.939  -11.257 -8.161  1.00 0.00 ? 160 GLU A HA   1  
ATOM 2127  H HB2  . GLU A 1 141 ? -10.564 -12.500 -8.113  2.00 0.00 ? 160 GLU A HB2  1  
ATOM 2128  H HB3  . GLU A 1 141 ? -10.625 -10.891 -8.818  2.00 0.00 ? 160 GLU A HB3  1  
ATOM 2129  H HG2  . GLU A 1 141 ? -8.736  -11.591 -10.318 2.00 0.00 ? 160 GLU A HG2  1  
ATOM 2130  H HG3  . GLU A 1 141 ? -8.972  -13.231 -9.718  2.00 0.00 ? 160 GLU A HG3  1  
ATOM 2131  N N    . TYR A 1 142 ? -8.535  -8.867  -7.738  1.00 0.00 ? 161 TYR A N    1  
ATOM 2132  C CA   . TYR A 1 142 ? -8.736  -7.479  -7.345  1.00 0.00 ? 161 TYR A CA   1  
ATOM 2133  C C    . TYR A 1 142 ? -8.003  -6.523  -8.284  1.00 0.00 ? 161 TYR A C    1  
ATOM 2134  O O    . TYR A 1 142 ? -8.443  -5.393  -8.498  1.00 0.00 ? 161 TYR A O    1  
ATOM 2135  C CB   . TYR A 1 142 ? -8.268  -7.264  -5.902  1.00 0.00 ? 161 TYR A CB   1  
ATOM 2136  C CG   . TYR A 1 142 ? -6.803  -7.561  -5.653  1.00 0.00 ? 161 TYR A CG   1  
ATOM 2137  C CD1  . TYR A 1 142 ? -6.111  -8.482  -6.432  1.00 0.00 ? 161 TYR A CD1  1  
ATOM 2138  C CD2  . TYR A 1 142 ? -6.111  -6.917  -4.633  1.00 0.00 ? 161 TYR A CD2  1  
ATOM 2139  C CE1  . TYR A 1 142 ? -4.776  -8.751  -6.204  1.00 0.00 ? 161 TYR A CE1  1  
ATOM 2140  C CE2  . TYR A 1 142 ? -4.775  -7.181  -4.400  1.00 0.00 ? 161 TYR A CE2  1  
ATOM 2141  C CZ   . TYR A 1 142 ? -4.113  -8.098  -5.188  1.00 0.00 ? 161 TYR A CZ   1  
ATOM 2142  O OH   . TYR A 1 142 ? -2.784  -8.363  -4.959  1.00 0.00 ? 161 TYR A OH   1  
ATOM 2143  H H    . TYR A 1 142 ? -7.905  -9.073  -8.457  1.00 0.00 ? 161 TYR A H    1  
ATOM 2144  H HA   . TYR A 1 142 ? -9.794  -7.273  -7.401  1.00 0.00 ? 161 TYR A HA   1  
ATOM 2145  H HB2  . TYR A 1 142 ? -8.442  -6.233  -5.633  2.00 0.00 ? 161 TYR A HB2  1  
ATOM 2146  H HB3  . TYR A 1 142 ? -8.849  -7.900  -5.248  2.00 0.00 ? 161 TYR A HB3  1  
ATOM 2147  H HD1  . TYR A 1 142 ? -6.631  -8.994  -7.227  1.00 0.00 ? 161 TYR A HD1  1  
ATOM 2148  H HD2  . TYR A 1 142 ? -6.632  -6.200  -4.015  1.00 0.00 ? 161 TYR A HD2  1  
ATOM 2149  H HE1  . TYR A 1 142 ? -4.257  -9.469  -6.822  1.00 0.00 ? 161 TYR A HE1  1  
ATOM 2150  H HE2  . TYR A 1 142 ? -4.255  -6.671  -3.603  1.00 0.00 ? 161 TYR A HE2  1  
ATOM 2151  H HH   . TYR A 1 142 ? -2.248  -7.658  -5.330  1.00 0.00 ? 161 TYR A HH   1  
ATOM 2152  N N    . ARG A 1 143 ? -6.887  -6.980  -8.842  1.00 0.00 ? 162 ARG A N    1  
ATOM 2153  C CA   . ARG A 1 143 ? -6.100  -6.160  -9.757  1.00 0.00 ? 162 ARG A CA   1  
ATOM 2154  C C    . ARG A 1 143 ? -6.567  -6.350  -11.196 1.00 0.00 ? 162 ARG A C    1  
ATOM 2155  O O    . ARG A 1 143 ? -6.412  -5.459  -12.031 1.00 0.00 ? 162 ARG A O    1  
ATOM 2156  C CB   . ARG A 1 143 ? -4.615  -6.509  -9.641  1.00 0.00 ? 162 ARG A CB   1  
ATOM 2157  C CG   . ARG A 1 143 ? -3.690  -5.303  -9.670  1.00 0.00 ? 162 ARG A CG   1  
ATOM 2158  C CD   . ARG A 1 143 ? -2.458  -5.548  -10.525 1.00 0.00 ? 162 ARG A CD   1  
ATOM 2159  N NE   . ARG A 1 143 ? -1.237  -5.580  -9.725  1.00 0.00 ? 162 ARG A NE   1  
ATOM 2160  C CZ   . ARG A 1 143 ? -0.014  -5.565  -10.246 4.00 0.00 ? 162 ARG A CZ   1  
ATOM 2161  N NH1  . ARG A 1 143 ? 0.155   -5.516  -11.561 5.00 0.00 ? 162 ARG A NH1  1  
ATOM 2162  N NH2  . ARG A 1 143 ? 1.051   -5.596  -9.457  5.00 0.00 ? 162 ARG A NH2  1  
ATOM 2163  H H    . ARG A 1 143 ? -6.584  -7.888  -8.635  1.00 0.00 ? 162 ARG A H    1  
ATOM 2164  H HA   . ARG A 1 143 ? -6.240  -5.126  -9.479  1.00 0.00 ? 162 ARG A HA   1  
ATOM 2165  H HB2  . ARG A 1 143 ? -4.454  -7.036  -8.712  2.00 0.00 ? 162 ARG A HB2  1  
ATOM 2166  H HB3  . ARG A 1 143 ? -4.346  -7.160  -10.460 2.00 0.00 ? 162 ARG A HB3  1  
ATOM 2167  H HG2  . ARG A 1 143 ? -4.231  -4.458  -10.071 2.00 0.00 ? 162 ARG A HG2  1  
ATOM 2168  H HG3  . ARG A 1 143 ? -3.376  -5.080  -8.661  2.00 0.00 ? 162 ARG A HG3  1  
ATOM 2169  H HD2  . ARG A 1 143 ? -2.569  -6.494  -11.034 2.00 0.00 ? 162 ARG A HD2  1  
ATOM 2170  H HD3  . ARG A 1 143 ? -2.378  -4.755  -11.255 2.00 0.00 ? 162 ARG A HD3  1  
ATOM 2171  H HE   . ARG A 1 143 ? -1.334  -5.615  -8.751  1.00 0.00 ? 162 ARG A HE   1  
ATOM 2172  H HH11 . ARG A 1 143 ? -0.640  -5.491  -12.166 5.00 0.00 ? 162 ARG A HH11 1  
ATOM 2173  H HH12 . ARG A 1 143 ? 1.077   -5.505  -11.946 5.00 0.00 ? 162 ARG A HH12 1  
ATOM 2174  H HH21 . ARG A 1 143 ? 0.937   -5.632  -8.464  5.00 0.00 ? 162 ARG A HH21 1  
ATOM 2175  H HH22 . ARG A 1 143 ? 1.968   -5.585  -9.855  5.00 0.00 ? 162 ARG A HH22 1  
ATOM 2176  N N    . THR A 1 144 ? -7.138  -7.517  -11.477 1.00 0.00 ? 163 THR A N    1  
ATOM 2177  C CA   . THR A 1 144 ? -7.629  -7.828  -12.815 1.00 0.00 ? 163 THR A CA   1  
ATOM 2178  C C    . THR A 1 144 ? -6.595  -7.472  -13.879 1.00 0.00 ? 163 THR A C    1  
ATOM 2179  O O    . THR A 1 144 ? -6.899  -6.770  -14.844 1.00 0.00 ? 163 THR A O    1  
ATOM 2180  C CB   . THR A 1 144 ? -8.942  -7.082  -13.120 1.00 0.00 ? 163 THR A CB   1  
ATOM 2181  O OG1  . THR A 1 144 ? -8.725  -5.667  -13.083 1.00 0.00 ? 163 THR A OG1  1  
ATOM 2182  C CG2  . THR A 1 144 ? -10.023 -7.460  -12.118 1.00 0.00 ? 163 THR A CG2  1  
ATOM 2183  H H    . THR A 1 144 ? -7.232  -8.186  -10.767 1.00 0.00 ? 163 THR A H    1  
ATOM 2184  H HA   . THR A 1 144 ? -7.824  -8.889  -12.859 1.00 0.00 ? 163 THR A HA   1  
ATOM 2185  H HB   . THR A 1 144 ? -9.276  -7.362  -14.109 1.00 0.00 ? 163 THR A HB   1  
ATOM 2186  H HG1  . THR A 1 144 ? -9.540  -5.224  -12.835 1.00 0.00 ? 163 THR A HG1  1  
ATOM 2187  H HG21 . THR A 1 144 ? -10.734 -8.123  -12.589 1.00 0.00 ? 163 THR A HG21 1  
ATOM 2188  H HG22 . THR A 1 144 ? -10.530 -6.568  -11.782 1.00 0.00 ? 163 THR A HG22 1  
ATOM 2189  H HG23 . THR A 1 144 ? -9.572  -7.959  -11.273 1.00 0.00 ? 163 THR A HG23 1  
ATOM 2190  N N    . ASN A 1 145 ? -5.372  -7.960  -13.696 1.00 0.00 ? 164 ASN A N    1  
ATOM 2191  C CA   . ASN A 1 145 ? -4.293  -7.692  -14.641 1.00 0.00 ? 164 ASN A CA   1  
ATOM 2192  C C    . ASN A 1 145 ? -3.714  -8.993  -15.190 1.00 0.00 ? 164 ASN A C    1  
ATOM 2193  O O    . ASN A 1 145 ? -2.597  -9.380  -14.848 1.00 0.00 ? 164 ASN A O    1  
ATOM 2194  C CB   . ASN A 1 145 ? -3.190  -6.873  -13.969 1.00 0.00 ? 164 ASN A CB   1  
ATOM 2195  C CG   . ASN A 1 145 ? -2.837  -5.601  -14.714 1.00 0.00 ? 164 ASN A CG   1  
ATOM 2196  O OD1  . ASN A 1 145 ? -1.828  -5.540  -15.418 1.00 0.00 ? 164 ASN A OD1  1  
ATOM 2197  N ND2  . ASN A 1 145 ? -3.668  -4.576  -14.563 4.00 0.00 ? 164 ASN A ND2  1  
ATOM 2198  H H    . ASN A 1 145 ? -5.190  -8.512  -12.907 1.00 0.00 ? 164 ASN A H    1  
ATOM 2199  H HA   . ASN A 1 145 ? -4.704  -7.122  -15.460 1.00 0.00 ? 164 ASN A HA   1  
ATOM 2200  H HB2  . ASN A 1 145 ? -3.512  -6.603  -12.973 2.00 0.00 ? 164 ASN A HB2  1  
ATOM 2201  H HB3  . ASN A 1 145 ? -2.298  -7.480  -13.896 2.00 0.00 ? 164 ASN A HB3  1  
ATOM 2202  H HD21 . ASN A 1 145 ? -4.454  -4.697  -13.985 5.00 0.00 ? 164 ASN A HD21 1  
ATOM 2203  H HD22 . ASN A 1 145 ? -3.463  -3.739  -15.035 5.00 0.00 ? 164 ASN A HD22 1  
ATOM 2204  N N    . PRO A 1 146 ? -4.473  -9.685  -16.054 1.00 0.00 ? 165 PRO A N    1  
ATOM 2205  C CA   . PRO A 1 146 ? -4.039  -10.948 -16.656 1.00 0.00 ? 165 PRO A CA   1  
ATOM 2206  C C    . PRO A 1 146 ? -2.989  -10.742 -17.743 1.00 0.00 ? 165 PRO A C    1  
ATOM 2207  O O    . PRO A 1 146 ? -2.207  -11.644 -18.043 1.00 0.00 ? 165 PRO A O    1  
ATOM 2208  C CB   . PRO A 1 146 ? -5.329  -11.510 -17.258 1.00 0.00 ? 165 PRO A CB   1  
ATOM 2209  C CG   . PRO A 1 146 ? -6.150  -10.306 -17.570 1.00 0.00 ? 165 PRO A CG   1  
ATOM 2210  C CD   . PRO A 1 146 ? -5.816  -9.290  -16.511 1.00 0.00 ? 165 PRO A CD   1  
ATOM 2211  H HA   . PRO A 1 146 ? -3.658  -11.632 -15.912 1.00 0.00 ? 165 PRO A HA   1  
ATOM 2212  H HB2  . PRO A 1 146 ? -5.098  -12.073 -18.151 2.00 0.00 ? 165 PRO A HB2  1  
ATOM 2213  H HB3  . PRO A 1 146 ? -5.819  -12.148 -16.538 2.00 0.00 ? 165 PRO A HB3  1  
ATOM 2214  H HG2  . PRO A 1 146 ? -5.891  -9.927  -18.547 2.00 0.00 ? 165 PRO A HG2  1  
ATOM 2215  H HG3  . PRO A 1 146 ? -7.200  -10.556 -17.530 2.00 0.00 ? 165 PRO A HG3  1  
ATOM 2216  H HD2  . PRO A 1 146 ? -5.801  -8.297  -16.935 2.00 0.00 ? 165 PRO A HD2  1  
ATOM 2217  H HD3  . PRO A 1 146 ? -6.528  -9.343  -15.702 2.00 0.00 ? 165 PRO A HD3  1  
ATOM 2218  N N    . GLU A 1 147 ? -2.979  -9.550  -18.330 1.00 0.00 ? 166 GLU A N    1  
ATOM 2219  C CA   . GLU A 1 147 ? -2.026  -9.225  -19.385 1.00 0.00 ? 166 GLU A CA   1  
ATOM 2220  C C    . GLU A 1 147 ? -0.601  -9.193  -18.842 1.00 0.00 ? 166 GLU A C    1  
ATOM 2221  O O    . GLU A 1 147 ? 0.364   -9.331  -19.594 1.00 0.00 ? 166 GLU A O    1  
ATOM 2222  C CB   . GLU A 1 147 ? -2.373  -7.876  -20.018 1.00 0.00 ? 166 GLU A CB   1  
ATOM 2223  C CG   . GLU A 1 147 ? -2.565  -7.929  -21.524 1.00 0.00 ? 166 GLU A CG   1  
ATOM 2224  C CD   . GLU A 1 147 ? -3.468  -6.827  -22.041 1.00 0.00 ? 166 GLU A CD   1  
ATOM 2225  O OE1  . GLU A 1 147 ? -2.952  -5.733  -22.351 1.00 0.00 ? 166 GLU A OE1  1  
ATOM 2226  O OE2  . GLU A 1 147 ? -4.692  -7.057  -22.135 1.00 0.00 ? 166 GLU A OE2  1  
ATOM 2227  H H    . GLU A 1 147 ? -3.628  -8.872  -18.048 1.00 0.00 ? 166 GLU A H    1  
ATOM 2228  H HA   . GLU A 1 147 ? -2.093  -9.994  -20.139 1.00 0.00 ? 166 GLU A HA   1  
ATOM 2229  H HB2  . GLU A 1 147 ? -3.288  -7.511  -19.574 2.00 0.00 ? 166 GLU A HB2  1  
ATOM 2230  H HB3  . GLU A 1 147 ? -1.579  -7.177  -19.803 2.00 0.00 ? 166 GLU A HB3  1  
ATOM 2231  H HG2  . GLU A 1 147 ? -1.599  -7.834  -22.001 2.00 0.00 ? 166 GLU A HG2  1  
ATOM 2232  H HG3  . GLU A 1 147 ? -3.002  -8.883  -21.785 2.00 0.00 ? 166 GLU A HG3  1  
ATOM 2233  N N    . ASP A 1 148 ? -0.476  -9.010  -17.531 1.00 0.00 ? 167 ASP A N    1  
ATOM 2234  C CA   . ASP A 1 148 ? 0.832   -8.961  -16.888 1.00 0.00 ? 167 ASP A CA   1  
ATOM 2235  C C    . ASP A 1 148 ? 1.452   -10.352 -16.806 1.00 0.00 ? 167 ASP A C    1  
ATOM 2236  O O    . ASP A 1 148 ? 2.642   -10.496 -16.527 1.00 0.00 ? 167 ASP A O    1  
ATOM 2237  C CB   . ASP A 1 148 ? 0.711   -8.361  -15.486 1.00 0.00 ? 167 ASP A CB   1  
ATOM 2238  C CG   . ASP A 1 148 ? 1.633   -7.175  -15.276 1.00 0.00 ? 167 ASP A CG   1  
ATOM 2239  O OD1  . ASP A 1 148 ? 1.251   -6.051  -15.664 1.00 0.00 ? 167 ASP A OD1  1  
ATOM 2240  O OD2  . ASP A 1 148 ? 2.735   -7.371  -14.723 1.00 0.00 ? 167 ASP A OD2  1  
ATOM 2241  H H    . ASP A 1 148 ? -1.282  -8.907  -16.984 1.00 0.00 ? 167 ASP A H    1  
ATOM 2242  H HA   . ASP A 1 148 ? 1.472   -8.329  -17.486 1.00 0.00 ? 167 ASP A HA   1  
ATOM 2243  H HB2  . ASP A 1 148 ? -0.307  -8.033  -15.328 2.00 0.00 ? 167 ASP A HB2  1  
ATOM 2244  H HB3  . ASP A 1 148 ? 0.960   -9.119  -14.755 2.00 0.00 ? 167 ASP A HB3  1  
ATOM 2245  N N    . ILE A 1 149 ? 0.637   -11.373 -17.049 1.00 0.00 ? 168 ILE A N    1  
ATOM 2246  C CA   . ILE A 1 149 ? 1.105   -12.753 -17.001 1.00 0.00 ? 168 ILE A CA   1  
ATOM 2247  C C    . ILE A 1 149 ? 1.322   -13.311 -18.403 1.00 0.00 ? 168 ILE A C    1  
ATOM 2248  O O    . ILE A 1 149 ? 2.458   -13.465 -18.851 1.00 0.00 ? 168 ILE A O    1  
ATOM 2249  C CB   . ILE A 1 149 ? 0.111   -13.660 -16.251 1.00 0.00 ? 168 ILE A CB   1  
ATOM 2250  C CG1  . ILE A 1 149 ? -0.780  -12.827 -15.326 1.00 0.00 ? 168 ILE A CG1  1  
ATOM 2251  C CG2  . ILE A 1 149 ? 0.858   -14.724 -15.460 1.00 0.00 ? 168 ILE A CG2  1  
ATOM 2252  C CD1  . ILE A 1 149 ? -0.038  -12.187 -14.172 1.00 0.00 ? 168 ILE A CD1  1  
ATOM 2253  H H    . ILE A 1 149 ? -0.302  -11.194 -17.265 1.00 0.00 ? 168 ILE A H    1  
ATOM 2254  H HA   . ILE A 1 149 ? 2.045   -12.767 -16.469 1.00 0.00 ? 168 ILE A HA   1  
ATOM 2255  H HB   . ILE A 1 149 ? -0.508  -14.159 -16.981 1.00 0.00 ? 168 ILE A HB   1  
ATOM 2256  H HG12 . ILE A 1 149 ? -1.243  -12.038 -15.899 2.00 0.00 ? 168 ILE A HG12 1  
ATOM 2257  H HG13 . ILE A 1 149 ? -1.550  -13.461 -14.913 2.00 0.00 ? 168 ILE A HG13 1  
ATOM 2258  H HG21 . ILE A 1 149 ? 0.737   -15.682 -15.943 1.00 0.00 ? 168 ILE A HG21 1  
ATOM 2259  H HG22 . ILE A 1 149 ? 0.460   -14.773 -14.458 1.00 0.00 ? 168 ILE A HG22 1  
ATOM 2260  H HG23 . ILE A 1 149 ? 1.907   -14.471 -15.419 1.00 0.00 ? 168 ILE A HG23 1  
ATOM 2261  H HD11 . ILE A 1 149 ? 0.147   -12.928 -13.408 1.00 0.00 ? 168 ILE A HD11 1  
ATOM 2262  H HD12 . ILE A 1 149 ? -0.635  -11.387 -13.760 1.00 0.00 ? 168 ILE A HD12 1  
ATOM 2263  H HD13 . ILE A 1 149 ? 0.903   -11.791 -14.525 1.00 0.00 ? 168 ILE A HD13 1  
ATOM 2264  N N    . TYR A 1 150 ? 0.226   -13.612 -19.091 1.00 0.00 ? 169 TYR A N    1  
ATOM 2265  C CA   . TYR A 1 150 ? 0.297   -14.155 -20.443 1.00 0.00 ? 169 TYR A CA   1  
ATOM 2266  C C    . TYR A 1 150 ? -0.226  -13.147 -21.463 1.00 0.00 ? 169 TYR A C    1  
ATOM 2267  O O    . TYR A 1 150 ? -1.383  -13.214 -21.880 1.00 0.00 ? 169 TYR A O    1  
ATOM 2268  C CB   . TYR A 1 150 ? -0.504  -15.455 -20.539 1.00 0.00 ? 169 TYR A CB   1  
ATOM 2269  C CG   . TYR A 1 150 ? -1.498  -15.679 -19.423 1.00 0.00 ? 169 TYR A CG   1  
ATOM 2270  C CD1  . TYR A 1 150 ? -2.671  -14.938 -19.353 1.00 0.00 ? 169 TYR A CD1  1  
ATOM 2271  C CD2  . TYR A 1 150 ? -1.263  -16.630 -18.439 1.00 0.00 ? 169 TYR A CD2  1  
ATOM 2272  C CE1  . TYR A 1 150 ? -3.583  -15.140 -18.334 1.00 0.00 ? 169 TYR A CE1  1  
ATOM 2273  C CE2  . TYR A 1 150 ? -2.170  -16.838 -17.417 1.00 0.00 ? 169 TYR A CE2  1  
ATOM 2274  C CZ   . TYR A 1 150 ? -3.327  -16.091 -17.369 1.00 0.00 ? 169 TYR A CZ   1  
ATOM 2275  O OH   . TYR A 1 150 ? -4.233  -16.295 -16.353 1.00 0.00 ? 169 TYR A OH   1  
ATOM 2276  H H    . TYR A 1 150 ? -0.652  -13.468 -18.680 1.00 0.00 ? 169 TYR A H    1  
ATOM 2277  H HA   . TYR A 1 150 ? 1.333   -14.364 -20.661 1.00 0.00 ? 169 TYR A HA   1  
ATOM 2278  H HB2  . TYR A 1 150 ? -1.051  -15.459 -21.470 2.00 0.00 ? 169 TYR A HB2  1  
ATOM 2279  H HB3  . TYR A 1 150 ? 0.184   -16.288 -20.537 2.00 0.00 ? 169 TYR A HB3  1  
ATOM 2280  H HD1  . TYR A 1 150 ? -2.869  -14.195 -20.111 1.00 0.00 ? 169 TYR A HD1  1  
ATOM 2281  H HD2  . TYR A 1 150 ? -0.356  -17.214 -18.479 1.00 0.00 ? 169 TYR A HD2  1  
ATOM 2282  H HE1  . TYR A 1 150 ? -4.489  -14.554 -18.297 1.00 0.00 ? 169 TYR A HE1  1  
ATOM 2283  H HE2  . TYR A 1 150 ? -1.969  -17.582 -16.661 1.00 0.00 ? 169 TYR A HE2  1  
ATOM 2284  H HH   . TYR A 1 150 ? -3.998  -17.090 -15.869 1.00 0.00 ? 169 TYR A HH   1  
ATOM 2285  N N    . PRO A 1 151 ? 0.626   -12.197 -21.879 1.00 0.00 ? 170 PRO A N    1  
ATOM 2286  C CA   . PRO A 1 151 ? 0.255   -11.169 -22.855 1.00 0.00 ? 170 PRO A CA   1  
ATOM 2287  C C    . PRO A 1 151 ? -0.385  -11.764 -24.105 1.00 0.00 ? 170 PRO A C    1  
ATOM 2288  O O    . PRO A 1 151 ? -0.055  -12.877 -24.514 1.00 0.00 ? 170 PRO A O    1  
ATOM 2289  C CB   . PRO A 1 151 ? 1.592   -10.507 -23.203 1.00 0.00 ? 170 PRO A CB   1  
ATOM 2290  C CG   . PRO A 1 151 ? 2.444   -10.726 -21.999 1.00 0.00 ? 170 PRO A CG   1  
ATOM 2291  C CD   . PRO A 1 151 ? 2.020   -12.051 -21.430 1.00 0.00 ? 170 PRO A CD   1  
ATOM 2292  H HA   . PRO A 1 151 ? -0.412  -10.437 -22.424 1.00 0.00 ? 170 PRO A HA   1  
ATOM 2293  H HB2  . PRO A 1 151 ? 2.014   -10.980 -24.077 2.00 0.00 ? 170 PRO A HB2  1  
ATOM 2294  H HB3  . PRO A 1 151 ? 1.437   -9.455  -23.392 2.00 0.00 ? 170 PRO A HB3  1  
ATOM 2295  H HG2  . PRO A 1 151 ? 3.485   -10.756 -22.286 2.00 0.00 ? 170 PRO A HG2  1  
ATOM 2296  H HG3  . PRO A 1 151 ? 2.274   -9.937  -21.280 2.00 0.00 ? 170 PRO A HG3  1  
ATOM 2297  H HD2  . PRO A 1 151 ? 2.637   -12.845 -21.824 2.00 0.00 ? 170 PRO A HD2  1  
ATOM 2298  H HD3  . PRO A 1 151 ? 2.077   -12.032 -20.351 2.00 0.00 ? 170 PRO A HD3  1  
ATOM 2299  N N    . SER A 1 152 ? -1.302  -11.014 -24.708 1.00 0.00 ? 171 SER A N    1  
ATOM 2300  C CA   . SER A 1 152 ? -1.989  -11.468 -25.912 1.00 0.00 ? 171 SER A CA   1  
ATOM 2301  C C    . SER A 1 152 ? -1.296  -10.942 -27.165 1.00 0.00 ? 171 SER A C    1  
ATOM 2302  O O    . SER A 1 152 ? -0.565  -11.671 -27.835 1.00 0.00 ? 171 SER A O    1  
ATOM 2303  C CB   . SER A 1 152 ? -3.450  -11.013 -25.894 1.00 0.00 ? 171 SER A CB   1  
ATOM 2304  O OG   . SER A 1 152 ? -4.104  -11.443 -24.712 1.00 0.00 ? 171 SER A OG   1  
ATOM 2305  H H    . SER A 1 152 ? -1.523  -10.135 -24.335 1.00 0.00 ? 171 SER A H    1  
ATOM 2306  H HA   . SER A 1 152 ? -1.958  -12.547 -25.925 1.00 0.00 ? 171 SER A HA   1  
ATOM 2307  H HB2  . SER A 1 152 ? -3.490  -9.935  -25.940 2.00 0.00 ? 171 SER A HB2  1  
ATOM 2308  H HB3  . SER A 1 152 ? -3.965  -11.429 -26.747 2.00 0.00 ? 171 SER A HB3  1  
ATOM 2309  H HG   . SER A 1 152 ? -4.932  -10.968 -24.614 1.00 0.00 ? 171 SER A HG   1  
ATOM 2310  N N    . ASN A 1 153 ? -1.530  -9.670  -27.475 1.00 0.00 ? 172 ASN A N    1  
ATOM 2311  C CA   . ASN A 1 153 ? -0.928  -9.047  -28.648 1.00 0.00 ? 172 ASN A CA   1  
ATOM 2312  C C    . ASN A 1 153 ? 0.143   -8.039  -28.239 1.00 0.00 ? 172 ASN A C    1  
ATOM 2313  O O    . ASN A 1 153 ? -0.165  -6.978  -27.695 1.00 0.00 ? 172 ASN A O    1  
ATOM 2314  C CB   . ASN A 1 153 ? -2.000  -8.354  -29.490 1.00 0.00 ? 172 ASN A CB   1  
ATOM 2315  C CG   . ASN A 1 153 ? -3.069  -7.689  -28.645 1.00 0.00 ? 172 ASN A CG   1  
ATOM 2316  O OD1  . ASN A 1 153 ? -4.035  -8.329  -28.230 1.00 0.00 ? 172 ASN A OD1  1  
ATOM 2317  N ND2  . ASN A 1 153 ? -2.901  -6.398  -28.387 4.00 0.00 ? 172 ASN A ND2  1  
ATOM 2318  H H    . ASN A 1 153 ? -2.121  -9.139  -26.902 1.00 0.00 ? 172 ASN A H    1  
ATOM 2319  H HA   . ASN A 1 153 ? -0.467  -9.825  -29.237 1.00 0.00 ? 172 ASN A HA   1  
ATOM 2320  H HB2  . ASN A 1 153 ? -1.533  -7.599  -30.105 2.00 0.00 ? 172 ASN A HB2  1  
ATOM 2321  H HB3  . ASN A 1 153 ? -2.475  -9.085  -30.127 2.00 0.00 ? 172 ASN A HB3  1  
ATOM 2322  H HD21 . ASN A 1 153 ? -2.105  -5.951  -28.752 5.00 0.00 ? 172 ASN A HD21 1  
ATOM 2323  H HD22 . ASN A 1 153 ? -3.579  -5.942  -27.841 5.00 0.00 ? 172 ASN A HD22 1  
ATOM 2324  N N    . PRO A 1 154 ? 1.420   -8.361  -28.499 1.00 0.00 ? 173 PRO A N    1  
ATOM 2325  C CA   . PRO A 1 154 ? 2.542   -7.482  -28.158 1.00 0.00 ? 173 PRO A CA   1  
ATOM 2326  C C    . PRO A 1 154 ? 2.525   -6.185  -28.959 1.00 0.00 ? 173 PRO A C    1  
ATOM 2327  O O    . PRO A 1 154 ? 2.263   -6.190  -30.162 1.00 0.00 ? 173 PRO A O    1  
ATOM 2328  C CB   . PRO A 1 154 ? 3.773   -8.317  -28.518 1.00 0.00 ? 173 PRO A CB   1  
ATOM 2329  C CG   . PRO A 1 154 ? 3.292   -9.307  -29.521 1.00 0.00 ? 173 PRO A CG   1  
ATOM 2330  C CD   . PRO A 1 154 ? 1.867   -9.607  -29.146 1.00 0.00 ? 173 PRO A CD   1  
ATOM 2331  H HA   . PRO A 1 154 ? 2.556   -7.250  -27.103 1.00 0.00 ? 173 PRO A HA   1  
ATOM 2332  H HB2  . PRO A 1 154 ? 4.537   -7.675  -28.932 2.00 0.00 ? 173 PRO A HB2  1  
ATOM 2333  H HB3  . PRO A 1 154 ? 4.151   -8.805  -27.632 2.00 0.00 ? 173 PRO A HB3  1  
ATOM 2334  H HG2  . PRO A 1 154 ? 3.337   -8.879  -30.511 2.00 0.00 ? 173 PRO A HG2  1  
ATOM 2335  H HG3  . PRO A 1 154 ? 3.891   -10.204 -29.469 2.00 0.00 ? 173 PRO A HG3  1  
ATOM 2336  H HD2  . PRO A 1 154 ? 1.280   -9.816  -30.028 2.00 0.00 ? 173 PRO A HD2  1  
ATOM 2337  H HD3  . PRO A 1 154 ? 1.825   -10.437 -28.456 2.00 0.00 ? 173 PRO A HD3  1  
ATOM 2338  N N    . THR A 1 155 ? 2.804   -5.074  -28.285 1.00 0.00 ? 174 THR A N    1  
ATOM 2339  C CA   . THR A 1 155 ? 2.819   -3.769  -28.933 1.00 0.00 ? 174 THR A CA   1  
ATOM 2340  C C    . THR A 1 155 ? 4.128   -3.540  -29.680 1.00 0.00 ? 174 THR A C    1  
ATOM 2341  O O    . THR A 1 155 ? 5.186   -4.006  -29.256 1.00 0.00 ? 174 THR A O    1  
ATOM 2342  C CB   . THR A 1 155 ? 2.620   -2.633  -27.913 1.00 0.00 ? 174 THR A CB   1  
ATOM 2343  O OG1  . THR A 1 155 ? 3.167   -3.011  -26.645 1.00 0.00 ? 174 THR A OG1  1  
ATOM 2344  C CG2  . THR A 1 155 ? 1.143   -2.301  -27.755 1.00 0.00 ? 174 THR A CG2  1  
ATOM 2345  H H    . THR A 1 155 ? 3.003   -5.134  -27.327 1.00 0.00 ? 174 THR A H    1  
ATOM 2346  H HA   . THR A 1 155 ? 2.002   -3.738  -29.640 1.00 0.00 ? 174 THR A HA   1  
ATOM 2347  H HB   . THR A 1 155 ? 3.135   -1.753  -28.272 1.00 0.00 ? 174 THR A HB   1  
ATOM 2348  H HG1  . THR A 1 155 ? 2.841   -2.417  -25.965 1.00 0.00 ? 174 THR A HG1  1  
ATOM 2349  H HG21 . THR A 1 155 ? 0.591   -2.712  -28.587 1.00 0.00 ? 174 THR A HG21 1  
ATOM 2350  H HG22 . THR A 1 155 ? 1.016   -1.229  -27.733 1.00 0.00 ? 174 THR A HG22 1  
ATOM 2351  H HG23 . THR A 1 155 ? 0.776   -2.726  -26.833 1.00 0.00 ? 174 THR A HG23 1  
ATOM 2352  N N    . ASP A 1 156 ? 4.049   -2.820  -30.795 1.00 0.00 ? 175 ASP A N    1  
ATOM 2353  C CA   . ASP A 1 156 ? 5.228   -2.528  -31.602 1.00 0.00 ? 175 ASP A CA   1  
ATOM 2354  C C    . ASP A 1 156 ? 4.945   -1.397  -32.587 1.00 0.00 ? 175 ASP A C    1  
ATOM 2355  O O    . ASP A 1 156 ? 4.370   -1.618  -33.652 1.00 0.00 ? 175 ASP A O    1  
ATOM 2356  C CB   . ASP A 1 156 ? 5.677   -3.779  -32.359 1.00 0.00 ? 175 ASP A CB   1  
ATOM 2357  C CG   . ASP A 1 156 ? 7.152   -3.755  -32.708 1.00 0.00 ? 175 ASP A CG   1  
ATOM 2358  O OD1  . ASP A 1 156 ? 7.970   -4.175  -31.863 1.00 0.00 ? 175 ASP A OD1  1  
ATOM 2359  O OD2  . ASP A 1 156 ? 7.490   -3.316  -33.828 1.00 0.00 ? 175 ASP A OD2  1  
ATOM 2360  H H    . ASP A 1 156 ? 3.177   -2.476  -31.081 1.00 0.00 ? 175 ASP A H    1  
ATOM 2361  H HA   . ASP A 1 156 ? 6.018   -2.218  -30.935 1.00 0.00 ? 175 ASP A HA   1  
ATOM 2362  H HB2  . ASP A 1 156 ? 5.487   -4.649  -31.747 2.00 0.00 ? 175 ASP A HB2  1  
ATOM 2363  H HB3  . ASP A 1 156 ? 5.111   -3.860  -33.275 2.00 0.00 ? 175 ASP A HB3  1  
ATOM 2364  N N    . ASP A 1 157 ? 5.353   -0.186  -32.222 1.00 0.00 ? 176 ASP A N    1  
ATOM 2365  C CA   . ASP A 1 157 ? 5.143   0.980   -33.074 1.00 0.00 ? 176 ASP A CA   1  
ATOM 2366  C C    . ASP A 1 157 ? 6.474   1.542   -33.564 1.00 0.00 ? 176 ASP A C    1  
ATOM 2367  O O    . ASP A 1 157 ? 6.746   1.561   -34.765 1.00 0.00 ? 176 ASP A O    1  
ATOM 2368  C CB   . ASP A 1 157 ? 4.369   2.059   -32.316 1.00 0.00 ? 176 ASP A CB   1  
ATOM 2369  C CG   . ASP A 1 157 ? 2.882   1.779   -32.213 1.00 0.00 ? 176 ASP A CG   1  
ATOM 2370  O OD1  . ASP A 1 157 ? 2.480   1.041   -31.289 1.00 0.00 ? 176 ASP A OD1  1  
ATOM 2371  O OD2  . ASP A 1 157 ? 2.121   2.299   -33.056 1.00 0.00 ? 176 ASP A OD2  1  
ATOM 2372  H H    . ASP A 1 157 ? 5.806   -0.073  -31.360 1.00 0.00 ? 176 ASP A H    1  
ATOM 2373  H HA   . ASP A 1 157 ? 4.562   0.665   -33.928 1.00 0.00 ? 176 ASP A HA   1  
ATOM 2374  H HB2  . ASP A 1 157 ? 4.767   2.139   -31.315 2.00 0.00 ? 176 ASP A HB2  1  
ATOM 2375  H HB3  . ASP A 1 157 ? 4.501   3.005   -32.820 2.00 0.00 ? 176 ASP A HB3  1  
ATOM 2376  N N    . ASP A 1 158 ? 7.299   1.998   -32.627 1.00 0.00 ? 177 ASP A N    1  
ATOM 2377  C CA   . ASP A 1 158 ? 8.601   2.561   -32.964 1.00 0.00 ? 177 ASP A CA   1  
ATOM 2378  C C    . ASP A 1 158 ? 9.455   1.545   -33.716 1.00 0.00 ? 177 ASP A C    1  
ATOM 2379  O O    . ASP A 1 158 ? 9.613   0.406   -33.278 1.00 0.00 ? 177 ASP A O    1  
ATOM 2380  C CB   . ASP A 1 158 ? 9.327   3.014   -31.696 1.00 0.00 ? 177 ASP A CB   1  
ATOM 2381  C CG   . ASP A 1 158 ? 9.811   4.449   -31.779 1.00 0.00 ? 177 ASP A CG   1  
ATOM 2382  O OD1  . ASP A 1 158 ? 10.938  4.667   -32.269 1.00 0.00 ? 177 ASP A OD1  1  
ATOM 2383  O OD2  . ASP A 1 158 ? 9.062   5.353   -31.354 1.00 0.00 ? 177 ASP A OD2  1  
ATOM 2384  H H    . ASP A 1 158 ? 7.025   1.955   -31.687 1.00 0.00 ? 177 ASP A H    1  
ATOM 2385  H HA   . ASP A 1 158 ? 8.438   3.418   -33.600 1.00 0.00 ? 177 ASP A HA   1  
ATOM 2386  H HB2  . ASP A 1 158 ? 8.654   2.930   -30.855 2.00 0.00 ? 177 ASP A HB2  1  
ATOM 2387  H HB3  . ASP A 1 158 ? 10.182  2.376   -31.530 2.00 0.00 ? 177 ASP A HB3  1  
ATOM 2388  N N    . VAL A 1 159 ? 10.003  1.967   -34.851 1.00 0.00 ? 178 VAL A N    1  
ATOM 2389  C CA   . VAL A 1 159 ? 10.841  1.095   -35.665 1.00 0.00 ? 178 VAL A CA   1  
ATOM 2390  C C    . VAL A 1 159 ? 12.298  1.161   -35.222 1.00 0.00 ? 178 VAL A C    1  
ATOM 2391  O O    . VAL A 1 159 ? 12.717  2.226   -34.720 1.00 0.00 ? 178 VAL A O    1  
ATOM 2392  C CB   . VAL A 1 159 ? 10.754  1.465   -37.158 1.00 0.00 ? 178 VAL A CB   1  
ATOM 2393  C CG1  . VAL A 1 159 ? 9.420   1.030   -37.746 2.00 0.00 ? 178 VAL A CG1  1  
ATOM 2394  C CG2  . VAL A 1 159 ? 10.957  2.959   -37.358 2.00 0.00 ? 178 VAL A CG2  1  
ATOM 2395  H H    . VAL A 1 159 ? 9.840   2.886   -35.148 1.00 0.00 ? 178 VAL A H    1  
ATOM 2396  H HA   . VAL A 1 159 ? 10.484  0.082   -35.545 1.00 0.00 ? 178 VAL A HA   1  
ATOM 2397  H HB   . VAL A 1 159 ? 11.542  0.941   -37.679 1.00 0.00 ? 178 VAL A HB   1  
ATOM 2398  H HG11 . VAL A 1 159 ? 8.644   1.704   -37.414 1.00 0.00 ? 178 VAL A HG11 1  
ATOM 2399  H HG12 . VAL A 1 159 ? 9.191   0.027   -37.417 1.00 0.00 ? 178 VAL A HG12 1  
ATOM 2400  H HG13 . VAL A 1 159 ? 9.478   1.051   -38.824 1.00 0.00 ? 178 VAL A HG13 1  
ATOM 2401  H HG21 . VAL A 1 159 ? 10.010  3.424   -37.584 1.00 0.00 ? 178 VAL A HG21 1  
ATOM 2402  H HG22 . VAL A 1 159 ? 11.644  3.123   -38.175 1.00 0.00 ? 178 VAL A HG22 1  
ATOM 2403  H HG23 . VAL A 1 159 ? 11.364  3.391   -36.455 1.00 0.00 ? 178 VAL A HG23 1  
ATOM 2404  N N    . ALA A 1 1   ? -0.552  -16.064 -13.632 1.00 0.00 ? 20  ALA A N    2  
ATOM 2405  C CA   . ALA A 1 1   ? -1.361  -15.138 -12.797 1.00 0.00 ? 20  ALA A CA   2  
ATOM 2406  C C    . ALA A 1 1   ? -0.806  -15.053 -11.379 1.00 0.00 ? 20  ALA A C    2  
ATOM 2407  O O    . ALA A 1 1   ? -1.075  -15.916 -10.544 1.00 0.00 ? 20  ALA A O    2  
ATOM 2408  C CB   . ALA A 1 1   ? -2.814  -15.587 -12.768 1.00 0.00 ? 20  ALA A CB   2  
ATOM 2409  H H1   . ALA A 1 1   ? -0.412  -16.965 -13.132 1.00 0.00 ? 20  ALA A H1   2  
ATOM 2410  H H2   . ALA A 1 1   ? 0.377   -15.644 -13.833 1.00 0.00 ? 20  ALA A H2   2  
ATOM 2411  H H3   . ALA A 1 1   ? -1.039  -16.251 -14.531 1.00 0.00 ? 20  ALA A H3   2  
ATOM 2412  H HA   . ALA A 1 1   ? -1.323  -14.156 -13.245 1.00 0.00 ? 20  ALA A HA   2  
ATOM 2413  H HB1  . ALA A 1 1   ? -2.865  -16.653 -12.936 1.00 0.00 ? 20  ALA A HB1  2  
ATOM 2414  H HB2  . ALA A 1 1   ? -3.364  -15.075 -13.543 1.00 0.00 ? 20  ALA A HB2  2  
ATOM 2415  H HB3  . ALA A 1 1   ? -3.244  -15.352 -11.806 1.00 0.00 ? 20  ALA A HB3  2  
ATOM 2416  N N    . GLN A 1 2   ? -0.030  -14.006 -11.116 1.00 0.00 ? 21  GLN A N    2  
ATOM 2417  C CA   . GLN A 1 2   ? 0.563   -13.805 -9.798  1.00 0.00 ? 21  GLN A CA   2  
ATOM 2418  C C    . GLN A 1 2   ? 1.066   -12.373 -9.643  1.00 0.00 ? 21  GLN A C    2  
ATOM 2419  O O    . GLN A 1 2   ? 1.644   -11.804 -10.569 1.00 0.00 ? 21  GLN A O    2  
ATOM 2420  C CB   . GLN A 1 2   ? 1.715   -14.789 -9.579  1.00 0.00 ? 21  GLN A CB   2  
ATOM 2421  C CG   . GLN A 1 2   ? 2.582   -15.051 -10.799 1.00 0.00 ? 21  GLN A CG   2  
ATOM 2422  C CD   . GLN A 1 2   ? 3.955   -15.583 -10.437 1.00 0.00 ? 21  GLN A CD   2  
ATOM 2423  O OE1  . GLN A 1 2   ? 4.252   -16.760 -10.641 1.00 0.00 ? 21  GLN A OE1  2  
ATOM 2424  N NE2  . GLN A 1 2   ? 4.802   -14.715 -9.897  4.00 0.00 ? 21  GLN A NE2  2  
ATOM 2425  H H    . GLN A 1 2   ? 0.146   -13.352 -11.824 1.00 0.00 ? 21  GLN A H    2  
ATOM 2426  H HA   . GLN A 1 2   ? -0.201  -13.988 -9.058  1.00 0.00 ? 21  GLN A HA   2  
ATOM 2427  H HB2  . GLN A 1 2   ? 2.350   -14.405 -8.794  2.00 0.00 ? 21  GLN A HB2  2  
ATOM 2428  H HB3  . GLN A 1 2   ? 1.302   -15.732 -9.253  2.00 0.00 ? 21  GLN A HB3  2  
ATOM 2429  H HG2  . GLN A 1 2   ? 2.087   -15.777 -11.428 2.00 0.00 ? 21  GLN A HG2  2  
ATOM 2430  H HG3  . GLN A 1 2   ? 2.703   -14.127 -11.344 2.00 0.00 ? 21  GLN A HG3  2  
ATOM 2431  H HE21 . GLN A 1 2   ? 4.497   -13.790 -9.763  5.00 0.00 ? 21  GLN A HE21 2  
ATOM 2432  H HE22 . GLN A 1 2   ? 5.700   -15.032 -9.654  5.00 0.00 ? 21  GLN A HE22 2  
ATOM 2433  N N    . ILE A 1 3   ? 0.841   -11.796 -8.466  1.00 0.00 ? 22  ILE A N    2  
ATOM 2434  C CA   . ILE A 1 3   ? 1.270   -10.430 -8.192  1.00 0.00 ? 22  ILE A CA   2  
ATOM 2435  C C    . ILE A 1 3   ? 1.940   -10.330 -6.825  1.00 0.00 ? 22  ILE A C    2  
ATOM 2436  O O    . ILE A 1 3   ? 1.489   -10.938 -5.854  1.00 0.00 ? 22  ILE A O    2  
ATOM 2437  C CB   . ILE A 1 3   ? 0.082   -9.450  -8.249  1.00 0.00 ? 22  ILE A CB   2  
ATOM 2438  C CG1  . ILE A 1 3   ? -0.284  -9.146  -9.703  1.00 0.00 ? 22  ILE A CG1  2  
ATOM 2439  C CG2  . ILE A 1 3   ? 0.413   -8.170  -7.500  1.00 0.00 ? 22  ILE A CG2  2  
ATOM 2440  C CD1  . ILE A 1 3   ? -1.533  -9.857  -10.178 1.00 0.00 ? 22  ILE A CD1  2  
ATOM 2441  H H    . ILE A 1 3   ? 0.375   -12.299 -7.766  1.00 0.00 ? 22  ILE A H    2  
ATOM 2442  H HA   . ILE A 1 3   ? 1.981   -10.145 -8.953  1.00 0.00 ? 22  ILE A HA   2  
ATOM 2443  H HB   . ILE A 1 3   ? -0.762  -9.915  -7.762  1.00 0.00 ? 22  ILE A HB   2  
ATOM 2444  H HG12 . ILE A 1 3   ? -0.448  -8.083  -9.810  2.00 0.00 ? 22  ILE A HG12 2  
ATOM 2445  H HG13 . ILE A 1 3   ? 0.532   -9.443  -10.344 2.00 0.00 ? 22  ILE A HG13 2  
ATOM 2446  H HG21 . ILE A 1 3   ? 0.592   -8.399  -6.459  1.00 0.00 ? 22  ILE A HG21 2  
ATOM 2447  H HG22 . ILE A 1 3   ? -0.416  -7.481  -7.579  1.00 0.00 ? 22  ILE A HG22 2  
ATOM 2448  H HG23 . ILE A 1 3   ? 1.297   -7.720  -7.927  1.00 0.00 ? 22  ILE A HG23 2  
ATOM 2449  H HD11 . ILE A 1 3   ? -1.449  -10.912 -9.963  1.00 0.00 ? 22  ILE A HD11 2  
ATOM 2450  H HD12 . ILE A 1 3   ? -1.643  -9.716  -11.243 1.00 0.00 ? 22  ILE A HD12 2  
ATOM 2451  H HD13 . ILE A 1 3   ? -2.393  -9.453  -9.669  1.00 0.00 ? 22  ILE A HD13 2  
ATOM 2452  N N    . ASP A 1 4   ? 3.021   -9.559  -6.759  1.00 0.00 ? 23  ASP A N    2  
ATOM 2453  C CA   . ASP A 1 4   ? 3.758   -9.377  -5.513  1.00 0.00 ? 23  ASP A CA   2  
ATOM 2454  C C    . ASP A 1 4   ? 3.295   -8.123  -4.780  1.00 0.00 ? 23  ASP A C    2  
ATOM 2455  O O    . ASP A 1 4   ? 3.482   -7.005  -5.261  1.00 0.00 ? 23  ASP A O    2  
ATOM 2456  C CB   . ASP A 1 4   ? 5.259   -9.294  -5.794  1.00 0.00 ? 23  ASP A CB   2  
ATOM 2457  C CG   . ASP A 1 4   ? 5.872   -10.647 -6.095  1.00 0.00 ? 23  ASP A CG   2  
ATOM 2458  O OD1  . ASP A 1 4   ? 6.246   -11.355 -5.137  1.00 0.00 ? 23  ASP A OD1  2  
ATOM 2459  O OD2  . ASP A 1 4   ? 5.978   -10.998 -7.289  1.00 0.00 ? 23  ASP A OD2  2  
ATOM 2460  H H    . ASP A 1 4   ? 3.332   -9.101  -7.568  1.00 0.00 ? 23  ASP A H    2  
ATOM 2461  H HA   . ASP A 1 4   ? 3.566   -10.237 -4.887  1.00 0.00 ? 23  ASP A HA   2  
ATOM 2462  H HB2  . ASP A 1 4   ? 5.423   -8.648  -6.645  2.00 0.00 ? 23  ASP A HB2  2  
ATOM 2463  H HB3  . ASP A 1 4   ? 5.758   -8.878  -4.928  2.00 0.00 ? 23  ASP A HB3  2  
ATOM 2464  N N    . LEU A 1 5   ? 2.694   -8.316  -3.610  1.00 0.00 ? 24  LEU A N    2  
ATOM 2465  C CA   . LEU A 1 5   ? 2.208   -7.204  -2.805  1.00 0.00 ? 24  LEU A CA   2  
ATOM 2466  C C    . LEU A 1 5   ? 3.251   -6.798  -1.772  1.00 0.00 ? 24  LEU A C    2  
ATOM 2467  O O    . LEU A 1 5   ? 4.188   -7.547  -1.497  1.00 0.00 ? 24  LEU A O    2  
ATOM 2468  C CB   . LEU A 1 5   ? 0.902   -7.586  -2.109  1.00 0.00 ? 24  LEU A CB   2  
ATOM 2469  C CG   . LEU A 1 5   ? -0.363  -6.861  -2.577  1.00 0.00 ? 24  LEU A CG   2  
ATOM 2470  C CD1  . LEU A 1 5   ? -0.288  -6.552  -4.065  2.00 0.00 ? 24  LEU A CD1  2  
ATOM 2471  C CD2  . LEU A 1 5   ? -1.598  -7.695  -2.275  2.00 0.00 ? 24  LEU A CD2  2  
ATOM 2472  H H    . LEU A 1 5   ? 2.579   -9.230  -3.276  1.00 0.00 ? 24  LEU A H    2  
ATOM 2473  H HA   . LEU A 1 5   ? 2.023   -6.369  -3.466  1.00 0.00 ? 24  LEU A HA   2  
ATOM 2474  H HB2  . LEU A 1 5   ? 0.749   -8.647  -2.244  2.00 0.00 ? 24  LEU A HB2  2  
ATOM 2475  H HB3  . LEU A 1 5   ? 1.020   -7.401  -1.051  2.00 0.00 ? 24  LEU A HB3  2  
ATOM 2476  H HG   . LEU A 1 5   ? -0.451  -5.926  -2.043  1.00 0.00 ? 24  LEU A HG   2  
ATOM 2477  H HD11 . LEU A 1 5   ? 0.206   -7.364  -4.577  1.00 0.00 ? 24  LEU A HD11 2  
ATOM 2478  H HD12 . LEU A 1 5   ? 0.270   -5.639  -4.215  1.00 0.00 ? 24  LEU A HD12 2  
ATOM 2479  H HD13 . LEU A 1 5   ? -1.286  -6.431  -4.457  1.00 0.00 ? 24  LEU A HD13 2  
ATOM 2480  H HD21 . LEU A 1 5   ? -1.618  -7.942  -1.224  1.00 0.00 ? 24  LEU A HD21 2  
ATOM 2481  H HD22 . LEU A 1 5   ? -1.570  -8.603  -2.859  1.00 0.00 ? 24  LEU A HD22 2  
ATOM 2482  H HD23 . LEU A 1 5   ? -2.483  -7.131  -2.529  1.00 0.00 ? 24  LEU A HD23 2  
ATOM 2483  N N    . ASN A 1 6   ? 3.084   -5.612  -1.202  1.00 0.00 ? 25  ASN A N    2  
ATOM 2484  C CA   . ASN A 1 6   ? 4.014   -5.113  -0.196  1.00 0.00 ? 25  ASN A CA   2  
ATOM 2485  C C    . ASN A 1 6   ? 3.372   -4.012  0.636   1.00 0.00 ? 25  ASN A C    2  
ATOM 2486  O O    . ASN A 1 6   ? 3.261   -2.871  0.194   1.00 0.00 ? 25  ASN A O    2  
ATOM 2487  C CB   . ASN A 1 6   ? 5.288   -4.590  -0.861  1.00 0.00 ? 25  ASN A CB   2  
ATOM 2488  C CG   . ASN A 1 6   ? 6.538   -5.266  -0.331  1.00 0.00 ? 25  ASN A CG   2  
ATOM 2489  O OD1  . ASN A 1 6   ? 7.137   -4.813  0.644   1.00 0.00 ? 25  ASN A OD1  2  
ATOM 2490  N ND2  . ASN A 1 6   ? 6.939   -6.356  -0.975  4.00 0.00 ? 25  ASN A ND2  2  
ATOM 2491  H H    . ASN A 1 6   ? 2.318   -5.060  -1.461  1.00 0.00 ? 25  ASN A H    2  
ATOM 2492  H HA   . ASN A 1 6   ? 4.270   -5.936  0.453   1.00 0.00 ? 25  ASN A HA   2  
ATOM 2493  H HB2  . ASN A 1 6   ? 5.230   -4.765  -1.925  2.00 0.00 ? 25  ASN A HB2  2  
ATOM 2494  H HB3  . ASN A 1 6   ? 5.372   -3.528  -0.680  2.00 0.00 ? 25  ASN A HB3  2  
ATOM 2495  H HD21 . ASN A 1 6   ? 6.411   -6.660  -1.746  5.00 0.00 ? 25  ASN A HD21 2  
ATOM 2496  H HD22 . ASN A 1 6   ? 7.747   -6.814  -0.653  5.00 0.00 ? 25  ASN A HD22 2  
ATOM 2497  N N    . ILE A 1 7   ? 2.948   -4.361  1.842   1.00 0.00 ? 26  ILE A N    2  
ATOM 2498  C CA   . ILE A 1 7   ? 2.315   -3.399  2.735   1.00 0.00 ? 26  ILE A CA   2  
ATOM 2499  C C    . ILE A 1 7   ? 3.168   -3.160  3.977   1.00 0.00 ? 26  ILE A C    2  
ATOM 2500  O O    . ILE A 1 7   ? 4.226   -3.771  4.141   1.00 0.00 ? 26  ILE A O    2  
ATOM 2501  C CB   . ILE A 1 7   ? 0.909   -3.866  3.157   1.00 0.00 ? 26  ILE A CB   2  
ATOM 2502  C CG1  . ILE A 1 7   ? 0.965   -4.676  4.453   1.00 0.00 ? 26  ILE A CG1  2  
ATOM 2503  C CG2  . ILE A 1 7   ? 0.271   -4.681  2.045   1.00 0.00 ? 26  ILE A CG2  2  
ATOM 2504  C CD1  . ILE A 1 7   ? -0.283  -4.554  5.301   1.00 0.00 ? 26  ILE A CD1  2  
ATOM 2505  H H    . ILE A 1 7   ? 3.062   -5.289  2.139   1.00 0.00 ? 26  ILE A H    2  
ATOM 2506  H HA   . ILE A 1 7   ? 2.209   -2.464  2.196   1.00 0.00 ? 26  ILE A HA   2  
ATOM 2507  H HB   . ILE A 1 7   ? 0.300   -2.990  3.317   1.00 0.00 ? 26  ILE A HB   2  
ATOM 2508  H HG12 . ILE A 1 7   ? 1.102   -5.720  4.213   2.00 0.00 ? 26  ILE A HG12 2  
ATOM 2509  H HG13 . ILE A 1 7   ? 1.802   -4.338  5.046   2.00 0.00 ? 26  ILE A HG13 2  
ATOM 2510  H HG21 . ILE A 1 7   ? 0.978   -4.811  1.240   1.00 0.00 ? 26  ILE A HG21 2  
ATOM 2511  H HG22 . ILE A 1 7   ? -0.604  -4.163  1.677   1.00 0.00 ? 26  ILE A HG22 2  
ATOM 2512  H HG23 . ILE A 1 7   ? -0.021  -5.647  2.430   1.00 0.00 ? 26  ILE A HG23 2  
ATOM 2513  H HD11 . ILE A 1 7   ? -0.576  -5.531  5.655   1.00 0.00 ? 26  ILE A HD11 2  
ATOM 2514  H HD12 . ILE A 1 7   ? -1.084  -4.131  4.708   1.00 0.00 ? 26  ILE A HD12 2  
ATOM 2515  H HD13 . ILE A 1 7   ? -0.085  -3.910  6.145   1.00 0.00 ? 26  ILE A HD13 2  
ATOM 2516  N N    . THR A 1 8   ? 2.704   -2.273  4.849   1.00 0.00 ? 27  THR A N    2  
ATOM 2517  C CA   . THR A 1 8   ? 3.425   -1.956  6.076   1.00 0.00 ? 27  THR A CA   2  
ATOM 2518  C C    . THR A 1 8   ? 2.775   -2.639  7.272   1.00 0.00 ? 27  THR A C    2  
ATOM 2519  O O    . THR A 1 8   ? 3.453   -3.026  8.224   1.00 0.00 ? 27  THR A O    2  
ATOM 2520  C CB   . THR A 1 8   ? 3.466   -0.434  6.317   1.00 0.00 ? 27  THR A CB   2  
ATOM 2521  O OG1  . THR A 1 8   ? 4.489   0.160   5.510   1.00 0.00 ? 27  THR A OG1  2  
ATOM 2522  C CG2  . THR A 1 8   ? 3.719   -0.113  7.782   1.00 0.00 ? 27  THR A CG2  2  
ATOM 2523  H H    . THR A 1 8   ? 1.854   -1.820  4.665   1.00 0.00 ? 27  THR A H    2  
ATOM 2524  H HA   . THR A 1 8   ? 4.439   -2.313  5.972   1.00 0.00 ? 27  THR A HA   2  
ATOM 2525  H HB   . THR A 1 8   ? 2.510   -0.017  6.036   1.00 0.00 ? 27  THR A HB   2  
ATOM 2526  H HG1  . THR A 1 8   ? 4.084   0.679   4.811   1.00 0.00 ? 27  THR A HG1  2  
ATOM 2527  H HG21 . THR A 1 8   ? 3.364   0.885   7.996   1.00 0.00 ? 27  THR A HG21 2  
ATOM 2528  H HG22 . THR A 1 8   ? 4.778   -0.169  7.986   1.00 0.00 ? 27  THR A HG22 2  
ATOM 2529  H HG23 . THR A 1 8   ? 3.193   -0.822  8.404   1.00 0.00 ? 27  THR A HG23 2  
ATOM 2530  N N    . CYS A 1 9   ? 1.454   -2.779  7.198   1.00 0.00 ? 28  CYS A N    2  
ATOM 2531  C CA   . CYS A 1 9   ? 0.656   -3.411  8.252   1.00 0.00 ? 28  CYS A CA   2  
ATOM 2532  C C    . CYS A 1 9   ? -0.483  -2.495  8.663   1.00 0.00 ? 28  CYS A C    2  
ATOM 2533  O O    . CYS A 1 9   ? -0.582  -1.367  8.189   1.00 0.00 ? 28  CYS A O    2  
ATOM 2534  C CB   . CYS A 1 9   ? 1.493   -3.750  9.485   1.00 0.00 ? 28  CYS A CB   2  
ATOM 2535  S SG   . CYS A 1 9   ? 2.238   -5.412  9.456   1.00 0.00 ? 28  CYS A SG   2  
ATOM 2536  H H    . CYS A 1 9   ? 0.993   -2.439  6.397   1.00 0.00 ? 28  CYS A H    2  
ATOM 2537  H HA   . CYS A 1 9   ? 0.238   -4.322  7.848   1.00 0.00 ? 28  CYS A HA   2  
ATOM 2538  H HB2  . CYS A 1 9   ? 2.291   -3.032  9.575   2.00 0.00 ? 28  CYS A HB2  2  
ATOM 2539  H HB3  . CYS A 1 9   ? 0.863   -3.690  10.362  2.00 0.00 ? 28  CYS A HB3  2  
ATOM 2540  N N    . ARG A 1 10  ? -1.334  -2.984  9.552   1.00 0.00 ? 29  ARG A N    2  
ATOM 2541  C CA   . ARG A 1 10  ? -2.467  -2.203  10.026  1.00 0.00 ? 29  ARG A CA   2  
ATOM 2542  C C    . ARG A 1 10  ? -2.273  -1.765  11.472  1.00 0.00 ? 29  ARG A C    2  
ATOM 2543  O O    . ARG A 1 10  ? -2.836  -2.354  12.395  1.00 0.00 ? 29  ARG A O    2  
ATOM 2544  C CB   . ARG A 1 10  ? -3.764  -3.001  9.887   1.00 0.00 ? 29  ARG A CB   2  
ATOM 2545  C CG   . ARG A 1 10  ? -3.721  -4.049  8.788   1.00 0.00 ? 29  ARG A CG   2  
ATOM 2546  C CD   . ARG A 1 10  ? -3.372  -5.421  9.336   1.00 0.00 ? 29  ARG A CD   2  
ATOM 2547  N NE   . ARG A 1 10  ? -4.489  -6.358  9.233   1.00 0.00 ? 29  ARG A NE   2  
ATOM 2548  C CZ   . ARG A 1 10  ? -5.136  -6.851  10.284  4.00 0.00 ? 29  ARG A CZ   2  
ATOM 2549  N NH1  . ARG A 1 10  ? -4.784  -6.504  11.514  5.00 0.00 ? 29  ARG A NH1  2  
ATOM 2550  N NH2  . ARG A 1 10  ? -6.145  -7.695  10.112  5.00 0.00 ? 29  ARG A NH2  2  
ATOM 2551  H H    . ARG A 1 10  ? -1.192  -3.889  9.898   1.00 0.00 ? 29  ARG A H    2  
ATOM 2552  H HA   . ARG A 1 10  ? -2.536  -1.321  9.408   1.00 0.00 ? 29  ARG A HA   2  
ATOM 2553  H HB2  . ARG A 1 10  ? -3.969  -3.498  10.823  2.00 0.00 ? 29  ARG A HB2  2  
ATOM 2554  H HB3  . ARG A 1 10  ? -4.572  -2.317  9.670   2.00 0.00 ? 29  ARG A HB3  2  
ATOM 2555  H HG2  . ARG A 1 10  ? -4.689  -4.095  8.307   2.00 0.00 ? 29  ARG A HG2  2  
ATOM 2556  H HG3  . ARG A 1 10  ? -2.974  -3.762  8.062   2.00 0.00 ? 29  ARG A HG3  2  
ATOM 2557  H HD2  . ARG A 1 10  ? -2.532  -5.812  8.782   2.00 0.00 ? 29  ARG A HD2  2  
ATOM 2558  H HD3  . ARG A 1 10  ? -3.096  -5.315  10.376  2.00 0.00 ? 29  ARG A HD3  2  
ATOM 2559  H HE   . ARG A 1 10  ? -4.770  -6.631  8.335   1.00 0.00 ? 29  ARG A HE   2  
ATOM 2560  H HH11 . ARG A 1 10  ? -4.026  -5.867  11.656  5.00 0.00 ? 29  ARG A HH11 2  
ATOM 2561  H HH12 . ARG A 1 10  ? -5.276  -6.879  12.300  5.00 0.00 ? 29  ARG A HH12 2  
ATOM 2562  H HH21 . ARG A 1 10  ? -6.421  -7.963  9.189   5.00 0.00 ? 29  ARG A HH21 2  
ATOM 2563  H HH22 . ARG A 1 10  ? -6.629  -8.063  10.906  5.00 0.00 ? 29  ARG A HH22 2  
ATOM 2564  N N    . PHE A 1 11  ? -1.478  -0.722  11.657  1.00 0.00 ? 30  PHE A N    2  
ATOM 2565  C CA   . PHE A 1 11  ? -1.212  -0.189  12.987  1.00 0.00 ? 30  PHE A CA   2  
ATOM 2566  C C    . PHE A 1 11  ? -2.368  0.691   13.441  1.00 0.00 ? 30  PHE A C    2  
ATOM 2567  O O    . PHE A 1 11  ? -2.692  1.684   12.788  1.00 0.00 ? 30  PHE A O    2  
ATOM 2568  C CB   . PHE A 1 11  ? 0.081   0.627   12.991  1.00 0.00 ? 30  PHE A CB   2  
ATOM 2569  C CG   . PHE A 1 11  ? 1.336   -0.147  12.712  1.00 0.00 ? 30  PHE A CG   2  
ATOM 2570  C CD1  . PHE A 1 11  ? 1.513   -0.794  11.502  1.00 0.00 ? 30  PHE A CD1  2  
ATOM 2571  C CD2  . PHE A 1 11  ? 2.345   -0.216  13.660  1.00 0.00 ? 30  PHE A CD2  2  
ATOM 2572  C CE1  . PHE A 1 11  ? 2.673   -1.496  11.239  1.00 0.00 ? 30  PHE A CE1  2  
ATOM 2573  C CE2  . PHE A 1 11  ? 3.507   -0.920  13.404  1.00 0.00 ? 30  PHE A CE2  2  
ATOM 2574  C CZ   . PHE A 1 11  ? 3.670   -1.560  12.190  1.00 0.00 ? 30  PHE A CZ   2  
ATOM 2575  H H    . PHE A 1 11  ? -1.065  -0.295  10.879  1.00 0.00 ? 30  PHE A H    2  
ATOM 2576  H HA   . PHE A 1 11  ? -1.111  -1.020  13.670  1.00 0.00 ? 30  PHE A HA   2  
ATOM 2577  H HB2  . PHE A 1 11  ? 0.004   1.402   12.243  2.00 0.00 ? 30  PHE A HB2  2  
ATOM 2578  H HB3  . PHE A 1 11  ? 0.194   1.092   13.958  2.00 0.00 ? 30  PHE A HB3  2  
ATOM 2579  H HD1  . PHE A 1 11  ? 0.733   -0.746  10.756  1.00 0.00 ? 30  PHE A HD1  2  
ATOM 2580  H HD2  . PHE A 1 11  ? 2.215   0.285   14.608  1.00 0.00 ? 30  PHE A HD2  2  
ATOM 2581  H HE1  . PHE A 1 11  ? 2.799   -1.996  10.291  1.00 0.00 ? 30  PHE A HE1  2  
ATOM 2582  H HE2  . PHE A 1 11  ? 4.285   -0.968  14.150  1.00 0.00 ? 30  PHE A HE2  2  
ATOM 2583  H HZ   . PHE A 1 11  ? 4.577   -2.108  11.984  1.00 0.00 ? 30  PHE A HZ   2  
ATOM 2584  N N    . ALA A 1 12  ? -2.992  0.324   14.555  1.00 0.00 ? 31  ALA A N    2  
ATOM 2585  C CA   . ALA A 1 12  ? -4.117  1.088   15.076  1.00 0.00 ? 31  ALA A CA   2  
ATOM 2586  C C    . ALA A 1 12  ? -5.349  0.904   14.201  1.00 0.00 ? 31  ALA A C    2  
ATOM 2587  O O    . ALA A 1 12  ? -6.459  1.254   14.596  1.00 0.00 ? 31  ALA A O    2  
ATOM 2588  C CB   . ALA A 1 12  ? -3.756  2.563   15.181  1.00 0.00 ? 31  ALA A CB   2  
ATOM 2589  H H    . ALA A 1 12  ? -2.695  -0.482  15.033  1.00 0.00 ? 31  ALA A H    2  
ATOM 2590  H HA   . ALA A 1 12  ? -4.335  0.725   16.068  1.00 0.00 ? 31  ALA A HA   2  
ATOM 2591  H HB1  . ALA A 1 12  ? -2.837  2.747   14.645  1.00 0.00 ? 31  ALA A HB1  2  
ATOM 2592  H HB2  . ALA A 1 12  ? -3.628  2.830   16.220  1.00 0.00 ? 31  ALA A HB2  2  
ATOM 2593  H HB3  . ALA A 1 12  ? -4.548  3.158   14.751  1.00 0.00 ? 31  ALA A HB3  2  
ATOM 2594  N N    . GLY A 1 13  ? -5.141  0.347   13.012  1.00 0.00 ? 32  GLY A N    2  
ATOM 2595  C CA   . GLY A 1 13  ? -6.234  0.124   12.086  1.00 0.00 ? 32  GLY A CA   2  
ATOM 2596  C C    . GLY A 1 13  ? -5.929  0.619   10.684  1.00 0.00 ? 32  GLY A C    2  
ATOM 2597  O O    . GLY A 1 13  ? -6.802  0.630   9.816   1.00 0.00 ? 32  GLY A O    2  
ATOM 2598  H H    . GLY A 1 13  ? -4.234  0.086   12.761  1.00 0.00 ? 32  GLY A H    2  
ATOM 2599  H HA2  . GLY A 1 13  ? -6.444  -0.937  12.043  2.00 0.00 ? 32  GLY A HA2  2  
ATOM 2600  H HA3  . GLY A 1 13  ? -7.112  0.638   12.454  2.00 0.00 ? 32  GLY A HA3  2  
ATOM 2601  N N    . VAL A 1 14  ? -4.683  1.035   10.466  1.00 0.00 ? 33  VAL A N    2  
ATOM 2602  C CA   . VAL A 1 14  ? -4.254  1.540   9.165   1.00 0.00 ? 33  VAL A CA   2  
ATOM 2603  C C    . VAL A 1 14  ? -3.226  0.613   8.522   1.00 0.00 ? 33  VAL A C    2  
ATOM 2604  O O    . VAL A 1 14  ? -2.139  0.412   9.064   1.00 0.00 ? 33  VAL A O    2  
ATOM 2605  C CB   . VAL A 1 14  ? -3.629  2.946   9.285   1.00 0.00 ? 33  VAL A CB   2  
ATOM 2606  C CG1  . VAL A 1 14  ? -2.426  3.082   8.366   2.00 0.00 ? 33  VAL A CG1  2  
ATOM 2607  C CG2  . VAL A 1 14  ? -4.647  4.028   8.970   2.00 0.00 ? 33  VAL A CG2  2  
ATOM 2608  H H    . VAL A 1 14  ? -4.035  1.003   11.201  1.00 0.00 ? 33  VAL A H    2  
ATOM 2609  H HA   . VAL A 1 14  ? -5.122  1.604   8.525   1.00 0.00 ? 33  VAL A HA   2  
ATOM 2610  H HB   . VAL A 1 14  ? -3.297  3.077   10.303  1.00 0.00 ? 33  VAL A HB   2  
ATOM 2611  H HG11 . VAL A 1 14  ? -1.638  2.428   8.705   1.00 0.00 ? 33  VAL A HG11 2  
ATOM 2612  H HG12 . VAL A 1 14  ? -2.077  4.104   8.378   1.00 0.00 ? 33  VAL A HG12 2  
ATOM 2613  H HG13 . VAL A 1 14  ? -2.712  2.811   7.360   1.00 0.00 ? 33  VAL A HG13 2  
ATOM 2614  H HG21 . VAL A 1 14  ? -4.155  4.845   8.461   1.00 0.00 ? 33  VAL A HG21 2  
ATOM 2615  H HG22 . VAL A 1 14  ? -5.085  4.388   9.889   1.00 0.00 ? 33  VAL A HG22 2  
ATOM 2616  H HG23 . VAL A 1 14  ? -5.420  3.622   8.335   1.00 0.00 ? 33  VAL A HG23 2  
ATOM 2617  N N    . PHE A 1 15  ? -3.563  0.066   7.357   1.00 0.00 ? 34  PHE A N    2  
ATOM 2618  C CA   . PHE A 1 15  ? -2.649  -0.816  6.647   1.00 0.00 ? 34  PHE A CA   2  
ATOM 2619  C C    . PHE A 1 15  ? -2.185  -0.150  5.362   1.00 0.00 ? 34  PHE A C    2  
ATOM 2620  O O    . PHE A 1 15  ? -2.974  0.117   4.453   1.00 0.00 ? 34  PHE A O    2  
ATOM 2621  C CB   . PHE A 1 15  ? -3.307  -2.197  6.422   1.00 0.00 ? 34  PHE A CB   2  
ATOM 2622  C CG   . PHE A 1 15  ? -3.069  -2.891  5.094   1.00 0.00 ? 34  PHE A CG   2  
ATOM 2623  C CD1  . PHE A 1 15  ? -2.259  -2.353  4.106   1.00 0.00 ? 34  PHE A CD1  2  
ATOM 2624  C CD2  . PHE A 1 15  ? -3.698  -4.107  4.839   1.00 0.00 ? 34  PHE A CD2  2  
ATOM 2625  C CE1  . PHE A 1 15  ? -2.087  -3.005  2.901   1.00 0.00 ? 34  PHE A CE1  2  
ATOM 2626  C CE2  . PHE A 1 15  ? -3.527  -4.761  3.637   1.00 0.00 ? 34  PHE A CE2  2  
ATOM 2627  C CZ   . PHE A 1 15  ? -2.722  -4.208  2.668   1.00 0.00 ? 34  PHE A CZ   2  
ATOM 2628  H H    . PHE A 1 15  ? -4.436  0.272   6.961   1.00 0.00 ? 34  PHE A H    2  
ATOM 2629  H HA   . PHE A 1 15  ? -1.785  -0.949  7.279   1.00 0.00 ? 34  PHE A HA   2  
ATOM 2630  H HB2  . PHE A 1 15  ? -2.947  -2.863  7.191   2.00 0.00 ? 34  PHE A HB2  2  
ATOM 2631  H HB3  . PHE A 1 15  ? -4.375  -2.086  6.536   2.00 0.00 ? 34  PHE A HB3  2  
ATOM 2632  H HD1  . PHE A 1 15  ? -1.759  -1.418  4.279   1.00 0.00 ? 34  PHE A HD1  2  
ATOM 2633  H HD2  . PHE A 1 15  ? -4.329  -4.544  5.594   1.00 0.00 ? 34  PHE A HD2  2  
ATOM 2634  H HE1  . PHE A 1 15  ? -1.454  -2.575  2.142   1.00 0.00 ? 34  PHE A HE1  2  
ATOM 2635  H HE2  . PHE A 1 15  ? -4.037  -5.701  3.453   1.00 0.00 ? 34  PHE A HE2  2  
ATOM 2636  H HZ   . PHE A 1 15  ? -2.586  -4.715  1.726   1.00 0.00 ? 34  PHE A HZ   2  
ATOM 2637  N N    . HIS A 1 16  ? -0.887  0.136   5.316   1.00 0.00 ? 35  HIS A N    2  
ATOM 2638  C CA   . HIS A 1 16  ? -0.275  0.787   4.168   1.00 0.00 ? 35  HIS A CA   2  
ATOM 2639  C C    . HIS A 1 16  ? 0.003   -0.232  3.072   1.00 0.00 ? 35  HIS A C    2  
ATOM 2640  O O    . HIS A 1 16  ? 0.810   -1.141  3.250   1.00 0.00 ? 35  HIS A O    2  
ATOM 2641  C CB   . HIS A 1 16  ? 1.023   1.482   4.598   1.00 0.00 ? 35  HIS A CB   2  
ATOM 2642  C CG   . HIS A 1 16  ? 1.919   1.886   3.468   1.00 0.00 ? 35  HIS A CG   2  
ATOM 2643  N ND1  . HIS A 1 16  ? 2.878   2.868   3.581   1.00 0.00 ? 35  HIS A ND1  2  
ATOM 2644  C CD2  . HIS A 1 16  ? 2.000   1.430   2.200   1.00 0.00 ? 35  HIS A CD2  2  
ATOM 2645  C CE1  . HIS A 1 16  ? 3.508   3.000   2.429   1.00 0.00 ? 35  HIS A CE1  2  
ATOM 2646  N NE2  . HIS A 1 16  ? 2.995   2.139   1.572   1.00 0.00 ? 35  HIS A NE2  2  
ATOM 2647  H H    . HIS A 1 16  ? -0.327  -0.092  6.086   1.00 0.00 ? 35  HIS A H    2  
ATOM 2648  H HA   . HIS A 1 16  ? -0.966  1.527   3.793   1.00 0.00 ? 35  HIS A HA   2  
ATOM 2649  H HB2  . HIS A 1 16  ? 0.775   2.373   5.155   2.00 0.00 ? 35  HIS A HB2  2  
ATOM 2650  H HB3  . HIS A 1 16  ? 1.581   0.815   5.238   2.00 0.00 ? 35  HIS A HB3  2  
ATOM 2651  H HD1  . HIS A 1 16  ? 3.067   3.392   4.386   1.00 0.00 ? 35  HIS A HD1  2  
ATOM 2652  H HD2  . HIS A 1 16  ? 1.394   0.649   1.766   1.00 0.00 ? 35  HIS A HD2  2  
ATOM 2653  H HE1  . HIS A 1 16  ? 4.310   3.694   2.223   1.00 0.00 ? 35  HIS A HE1  2  
ATOM 2654  H HE2  . HIS A 1 16  ? 3.174   2.130   0.610   1.00 0.00 ? 35  HIS A HE2  2  
ATOM 2655  N N    . VAL A 1 17  ? -0.678  -0.081  1.943   1.00 0.00 ? 36  VAL A N    2  
ATOM 2656  C CA   . VAL A 1 17  ? -0.511  -0.999  0.822   1.00 0.00 ? 36  VAL A CA   2  
ATOM 2657  C C    . VAL A 1 17  ? 0.519   -0.491  -0.180  1.00 0.00 ? 36  VAL A C    2  
ATOM 2658  O O    . VAL A 1 17  ? 0.624   0.710   -0.431  1.00 0.00 ? 36  VAL A O    2  
ATOM 2659  C CB   . VAL A 1 17  ? -1.843  -1.226  0.086   1.00 0.00 ? 36  VAL A CB   2  
ATOM 2660  C CG1  . VAL A 1 17  ? -2.766  -0.040  0.288   2.00 0.00 ? 36  VAL A CG1  2  
ATOM 2661  C CG2  . VAL A 1 17  ? -1.610  -1.470  -1.397  2.00 0.00 ? 36  VAL A CG2  2  
ATOM 2662  H H    . VAL A 1 17  ? -1.313  0.660   1.865   1.00 0.00 ? 36  VAL A H    2  
ATOM 2663  H HA   . VAL A 1 17  ? -0.182  -1.948  1.218   1.00 0.00 ? 36  VAL A HA   2  
ATOM 2664  H HB   . VAL A 1 17  ? -2.314  -2.102  0.507   1.00 0.00 ? 36  VAL A HB   2  
ATOM 2665  H HG11 . VAL A 1 17  ? -2.209  0.872   0.138   1.00 0.00 ? 36  VAL A HG11 2  
ATOM 2666  H HG12 . VAL A 1 17  ? -3.161  -0.062  1.292   1.00 0.00 ? 36  VAL A HG12 2  
ATOM 2667  H HG13 . VAL A 1 17  ? -3.577  -0.089  -0.422  1.00 0.00 ? 36  VAL A HG13 2  
ATOM 2668  H HG21 . VAL A 1 17  ? -0.938  -2.306  -1.525  1.00 0.00 ? 36  VAL A HG21 2  
ATOM 2669  H HG22 . VAL A 1 17  ? -1.175  -0.587  -1.843  1.00 0.00 ? 36  VAL A HG22 2  
ATOM 2670  H HG23 . VAL A 1 17  ? -2.553  -1.688  -1.877  1.00 0.00 ? 36  VAL A HG23 2  
ATOM 2671  N N    . GLU A 1 18  ? 1.267   -1.422  -0.760  1.00 0.00 ? 37  GLU A N    2  
ATOM 2672  C CA   . GLU A 1 18  ? 2.283   -1.092  -1.751  1.00 0.00 ? 37  GLU A CA   2  
ATOM 2673  C C    . GLU A 1 18  ? 2.621   -2.325  -2.585  1.00 0.00 ? 37  GLU A C    2  
ATOM 2674  O O    . GLU A 1 18  ? 2.064   -3.400  -2.364  1.00 0.00 ? 37  GLU A O    2  
ATOM 2675  C CB   . GLU A 1 18  ? 3.544   -0.553  -1.071  1.00 0.00 ? 37  GLU A CB   2  
ATOM 2676  C CG   . GLU A 1 18  ? 4.436   0.267   -1.990  1.00 0.00 ? 37  GLU A CG   2  
ATOM 2677  C CD   . GLU A 1 18  ? 5.804   -0.354  -2.191  1.00 0.00 ? 37  GLU A CD   2  
ATOM 2678  O OE1  . GLU A 1 18  ? 6.171   -1.250  -1.403  1.00 0.00 ? 37  GLU A OE1  2  
ATOM 2679  O OE2  . GLU A 1 18  ? 6.509   0.057   -3.138  1.00 0.00 ? 37  GLU A OE2  2  
ATOM 2680  H H    . GLU A 1 18  ? 1.125   -2.362  -0.522  1.00 0.00 ? 37  GLU A H    2  
ATOM 2681  H HA   . GLU A 1 18  ? 1.875   -0.330  -2.401  1.00 0.00 ? 37  GLU A HA   2  
ATOM 2682  H HB2  . GLU A 1 18  ? 3.252   0.071   -0.240  2.00 0.00 ? 37  GLU A HB2  2  
ATOM 2683  H HB3  . GLU A 1 18  ? 4.122   -1.387  -0.698  2.00 0.00 ? 37  GLU A HB3  2  
ATOM 2684  H HG2  . GLU A 1 18  ? 3.954   0.358   -2.952  2.00 0.00 ? 37  GLU A HG2  2  
ATOM 2685  H HG3  . GLU A 1 18  ? 4.564   1.250   -1.561  2.00 0.00 ? 37  GLU A HG3  2  
ATOM 2686  N N    . LYS A 1 19  ? 3.536   -2.171  -3.533  1.00 0.00 ? 38  LYS A N    2  
ATOM 2687  C CA   . LYS A 1 19  ? 3.942   -3.283  -4.383  1.00 0.00 ? 38  LYS A CA   2  
ATOM 2688  C C    . LYS A 1 19  ? 5.373   -3.702  -4.072  1.00 0.00 ? 38  LYS A C    2  
ATOM 2689  O O    . LYS A 1 19  ? 6.101   -2.991  -3.380  1.00 0.00 ? 38  LYS A O    2  
ATOM 2690  C CB   . LYS A 1 19  ? 3.812   -2.906  -5.859  1.00 0.00 ? 38  LYS A CB   2  
ATOM 2691  C CG   . LYS A 1 19  ? 3.198   -3.996  -6.724  1.00 0.00 ? 38  LYS A CG   2  
ATOM 2692  C CD   . LYS A 1 19  ? 4.257   -4.773  -7.489  1.00 0.00 ? 38  LYS A CD   2  
ATOM 2693  C CE   . LYS A 1 19  ? 4.025   -4.718  -8.991  1.00 0.00 ? 38  LYS A CE   2  
ATOM 2694  N NZ   . LYS A 1 19  ? 4.084   -6.071  -9.611  1.00 0.00 ? 38  LYS A NZ   2  
ATOM 2695  H H    . LYS A 1 19  ? 3.951   -1.293  -3.663  1.00 0.00 ? 38  LYS A H    2  
ATOM 2696  H HA   . LYS A 1 19  ? 3.284   -4.114  -4.173  1.00 0.00 ? 38  LYS A HA   2  
ATOM 2697  H HB2  . LYS A 1 19  ? 3.194   -2.024  -5.939  2.00 0.00 ? 38  LYS A HB2  2  
ATOM 2698  H HB3  . LYS A 1 19  ? 4.794   -2.680  -6.247  2.00 0.00 ? 38  LYS A HB3  2  
ATOM 2699  H HG2  . LYS A 1 19  ? 2.653   -4.679  -6.090  2.00 0.00 ? 38  LYS A HG2  2  
ATOM 2700  H HG3  . LYS A 1 19  ? 2.519   -3.541  -7.430  2.00 0.00 ? 38  LYS A HG3  2  
ATOM 2701  H HD2  . LYS A 1 19  ? 5.227   -4.351  -7.270  2.00 0.00 ? 38  LYS A HD2  2  
ATOM 2702  H HD3  . LYS A 1 19  ? 4.233   -5.804  -7.170  2.00 0.00 ? 38  LYS A HD3  2  
ATOM 2703  H HE2  . LYS A 1 19  ? 3.053   -4.288  -9.177  2.00 0.00 ? 38  LYS A HE2  2  
ATOM 2704  H HE3  . LYS A 1 19  ? 4.786   -4.095  -9.437  2.00 0.00 ? 38  LYS A HE3  2  
ATOM 2705  H HZ1  . LYS A 1 19  ? 3.134   -6.492  -9.638  1.00 0.00 ? 38  LYS A HZ1  2  
ATOM 2706  H HZ2  . LYS A 1 19  ? 4.710   -6.691  -9.059  1.00 0.00 ? 38  LYS A HZ2  2  
ATOM 2707  H HZ3  . LYS A 1 19  ? 4.449   -6.003  -10.582 1.00 0.00 ? 38  LYS A HZ3  2  
ATOM 2708  N N    . ASN A 1 20  ? 5.770   -4.863  -4.583  1.00 0.00 ? 39  ASN A N    2  
ATOM 2709  C CA   . ASN A 1 20  ? 7.115   -5.380  -4.353  1.00 0.00 ? 39  ASN A CA   2  
ATOM 2710  C C    . ASN A 1 20  ? 8.168   -4.300  -4.585  1.00 0.00 ? 39  ASN A C    2  
ATOM 2711  O O    . ASN A 1 20  ? 8.592   -4.066  -5.717  1.00 0.00 ? 39  ASN A O    2  
ATOM 2712  C CB   . ASN A 1 20  ? 7.385   -6.578  -5.264  1.00 0.00 ? 39  ASN A CB   2  
ATOM 2713  C CG   . ASN A 1 20  ? 8.710   -7.253  -4.969  1.00 0.00 ? 39  ASN A CG   2  
ATOM 2714  O OD1  . ASN A 1 20  ? 8.944   -7.728  -3.858  1.00 0.00 ? 39  ASN A OD1  2  
ATOM 2715  N ND2  . ASN A 1 20  ? 9.584   -7.300  -5.967  4.00 0.00 ? 39  ASN A ND2  2  
ATOM 2716  H H    . ASN A 1 20  ? 5.141   -5.389  -5.123  1.00 0.00 ? 39  ASN A H    2  
ATOM 2717  H HA   . ASN A 1 20  ? 7.172   -5.701  -3.325  1.00 0.00 ? 39  ASN A HA   2  
ATOM 2718  H HB2  . ASN A 1 20  ? 6.597   -7.305  -5.134  2.00 0.00 ? 39  ASN A HB2  2  
ATOM 2719  H HB3  . ASN A 1 20  ? 7.394   -6.245  -6.292  2.00 0.00 ? 39  ASN A HB3  2  
ATOM 2720  H HD21 . ASN A 1 20  ? 9.329   -6.900  -6.829  5.00 0.00 ? 39  ASN A HD21 2  
ATOM 2721  H HD22 . ASN A 1 20  ? 10.452  -7.733  -5.804  5.00 0.00 ? 39  ASN A HD22 2  
ATOM 2722  N N    . GLY A 1 21  ? 8.586   -3.649  -3.503  1.00 0.00 ? 40  GLY A N    2  
ATOM 2723  C CA   . GLY A 1 21  ? 9.589   -2.603  -3.605  1.00 0.00 ? 40  GLY A CA   2  
ATOM 2724  C C    . GLY A 1 21  ? 9.274   -1.615  -4.710  1.00 0.00 ? 40  GLY A C    2  
ATOM 2725  O O    . GLY A 1 21  ? 10.179  -1.083  -5.352  1.00 0.00 ? 40  GLY A O    2  
ATOM 2726  H H    . GLY A 1 21  ? 8.212   -3.881  -2.627  1.00 0.00 ? 40  GLY A H    2  
ATOM 2727  H HA2  . GLY A 1 21  ? 9.638   -2.073  -2.665  2.00 0.00 ? 40  GLY A HA2  2  
ATOM 2728  H HA3  . GLY A 1 21  ? 10.549  -3.056  -3.803  2.00 0.00 ? 40  GLY A HA3  2  
ATOM 2729  N N    . ARG A 1 22  ? 7.988   -1.377  -4.937  1.00 0.00 ? 41  ARG A N    2  
ATOM 2730  C CA   . ARG A 1 22  ? 7.556   -0.451  -5.978  1.00 0.00 ? 41  ARG A CA   2  
ATOM 2731  C C    . ARG A 1 22  ? 7.921   0.989   -5.629  1.00 0.00 ? 41  ARG A C    2  
ATOM 2732  O O    . ARG A 1 22  ? 8.865   1.236   -4.879  1.00 0.00 ? 41  ARG A O    2  
ATOM 2733  C CB   . ARG A 1 22  ? 6.048   -0.567  -6.203  1.00 0.00 ? 41  ARG A CB   2  
ATOM 2734  C CG   . ARG A 1 22  ? 5.662   -0.957  -7.621  1.00 0.00 ? 41  ARG A CG   2  
ATOM 2735  C CD   . ARG A 1 22  ? 5.993   0.141   -8.619  1.00 0.00 ? 41  ARG A CD   2  
ATOM 2736  N NE   . ARG A 1 22  ? 6.522   -0.391  -9.872  1.00 0.00 ? 41  ARG A NE   2  
ATOM 2737  C CZ   . ARG A 1 22  ? 7.812   -0.372  -10.193 4.00 0.00 ? 41  ARG A CZ   2  
ATOM 2738  N NH1  . ARG A 1 22  ? 8.703   0.147   -9.360  5.00 0.00 ? 41  ARG A NH1  2  
ATOM 2739  N NH2  . ARG A 1 22  ? 8.220   -0.873  -11.351 5.00 0.00 ? 41  ARG A NH2  2  
ATOM 2740  H H    . ARG A 1 22  ? 7.312   -1.838  -4.395  1.00 0.00 ? 41  ARG A H    2  
ATOM 2741  H HA   . ARG A 1 22  ? 8.065   -0.723  -6.891  1.00 0.00 ? 41  ARG A HA   2  
ATOM 2742  H HB2  . ARG A 1 22  ? 5.653   -1.313  -5.529  2.00 0.00 ? 41  ARG A HB2  2  
ATOM 2743  H HB3  . ARG A 1 22  ? 5.589   0.384   -5.977  2.00 0.00 ? 41  ARG A HB3  2  
ATOM 2744  H HG2  . ARG A 1 22  ? 6.200   -1.853  -7.896  2.00 0.00 ? 41  ARG A HG2  2  
ATOM 2745  H HG3  . ARG A 1 22  ? 4.600   -1.150  -7.653  2.00 0.00 ? 41  ARG A HG3  2  
ATOM 2746  H HD2  . ARG A 1 22  ? 5.093   0.700   -8.828  2.00 0.00 ? 41  ARG A HD2  2  
ATOM 2747  H HD3  . ARG A 1 22  ? 6.728   0.798   -8.180  2.00 0.00 ? 41  ARG A HD3  2  
ATOM 2748  H HE   . ARG A 1 22  ? 5.884   -0.781  -10.506 1.00 0.00 ? 41  ARG A HE   2  
ATOM 2749  H HH11 . ARG A 1 22  ? 8.406   0.528   -8.484  5.00 0.00 ? 41  ARG A HH11 2  
ATOM 2750  H HH12 . ARG A 1 22  ? 9.672   0.158   -9.608  5.00 0.00 ? 41  ARG A HH12 2  
ATOM 2751  H HH21 . ARG A 1 22  ? 7.557   -1.267  -11.988 5.00 0.00 ? 41  ARG A HH21 2  
ATOM 2752  H HH22 . ARG A 1 22  ? 9.192   -0.857  -11.588 5.00 0.00 ? 41  ARG A HH22 2  
ATOM 2753  N N    . TYR A 1 23  ? 7.164   1.933   -6.189  1.00 0.00 ? 42  TYR A N    2  
ATOM 2754  C CA   . TYR A 1 23  ? 7.391   3.355   -5.965  1.00 0.00 ? 42  TYR A CA   2  
ATOM 2755  C C    . TYR A 1 23  ? 6.731   4.148   -7.082  1.00 0.00 ? 42  TYR A C    2  
ATOM 2756  O O    . TYR A 1 23  ? 6.703   5.378   -7.062  1.00 0.00 ? 42  TYR A O    2  
ATOM 2757  C CB   . TYR A 1 23  ? 8.889   3.666   -5.916  1.00 0.00 ? 42  TYR A CB   2  
ATOM 2758  C CG   . TYR A 1 23  ? 9.259   5.019   -5.350  1.00 0.00 ? 42  TYR A CG   2  
ATOM 2759  C CD1  . TYR A 1 23  ? 8.411   5.689   -4.475  1.00 0.00 ? 42  TYR A CD1  2  
ATOM 2760  C CD2  . TYR A 1 23  ? 10.463  5.625   -5.688  1.00 0.00 ? 42  TYR A CD2  2  
ATOM 2761  C CE1  . TYR A 1 23  ? 8.753   6.924   -3.956  1.00 0.00 ? 42  TYR A CE1  2  
ATOM 2762  C CE2  . TYR A 1 23  ? 10.811  6.858   -5.173  1.00 0.00 ? 42  TYR A CE2  2  
ATOM 2763  C CZ   . TYR A 1 23  ? 9.954   7.503   -4.309  1.00 0.00 ? 42  TYR A CZ   2  
ATOM 2764  O OH   . TYR A 1 23  ? 10.299  8.732   -3.794  1.00 0.00 ? 42  TYR A OH   2  
ATOM 2765  H H    . TYR A 1 23  ? 6.429   1.665   -6.780  1.00 0.00 ? 42  TYR A H    2  
ATOM 2766  H HA   . TYR A 1 23  ? 6.937   3.624   -5.023  1.00 0.00 ? 42  TYR A HA   2  
ATOM 2767  H HB2  . TYR A 1 23  ? 9.378   2.917   -5.312  2.00 0.00 ? 42  TYR A HB2  2  
ATOM 2768  H HB3  . TYR A 1 23  ? 9.287   3.613   -6.919  2.00 0.00 ? 42  TYR A HB3  2  
ATOM 2769  H HD1  . TYR A 1 23  ? 7.470   5.232   -4.199  1.00 0.00 ? 42  TYR A HD1  2  
ATOM 2770  H HD2  . TYR A 1 23  ? 11.132  5.118   -6.366  1.00 0.00 ? 42  TYR A HD2  2  
ATOM 2771  H HE1  . TYR A 1 23  ? 8.081   7.429   -3.278  1.00 0.00 ? 42  TYR A HE1  2  
ATOM 2772  H HE2  . TYR A 1 23  ? 11.751  7.312   -5.450  1.00 0.00 ? 42  TYR A HE2  2  
ATOM 2773  H HH   . TYR A 1 23  ? 10.297  9.386   -4.497  1.00 0.00 ? 42  TYR A HH   2  
ATOM 2774  N N    . SER A 1 24  ? 6.198   3.418   -8.057  1.00 0.00 ? 43  SER A N    2  
ATOM 2775  C CA   . SER A 1 24  ? 5.525   4.021   -9.196  1.00 0.00 ? 43  SER A CA   2  
ATOM 2776  C C    . SER A 1 24  ? 4.082   3.534   -9.280  1.00 0.00 ? 43  SER A C    2  
ATOM 2777  O O    . SER A 1 24  ? 3.506   3.448   -10.365 1.00 0.00 ? 43  SER A O    2  
ATOM 2778  C CB   . SER A 1 24  ? 6.267   3.684   -10.492 1.00 0.00 ? 43  SER A CB   2  
ATOM 2779  O OG   . SER A 1 24  ? 5.849   4.524   -11.554 1.00 0.00 ? 43  SER A OG   2  
ATOM 2780  H H    . SER A 1 24  ? 6.257   2.441   -8.003  1.00 0.00 ? 43  SER A H    2  
ATOM 2781  H HA   . SER A 1 24  ? 5.526   5.092   -9.056  1.00 0.00 ? 43  SER A HA   2  
ATOM 2782  H HB2  . SER A 1 24  ? 7.328   3.817   -10.341 2.00 0.00 ? 43  SER A HB2  2  
ATOM 2783  H HB3  . SER A 1 24  ? 6.068   2.658   -10.761 2.00 0.00 ? 43  SER A HB3  2  
ATOM 2784  H HG   . SER A 1 24  ? 6.038   4.098   -12.393 1.00 0.00 ? 43  SER A HG   2  
ATOM 2785  N N    . ILE A 1 25  ? 3.504   3.219   -8.124  1.00 0.00 ? 44  ILE A N    2  
ATOM 2786  C CA   . ILE A 1 25  ? 2.129   2.742   -8.061  1.00 0.00 ? 44  ILE A CA   2  
ATOM 2787  C C    . ILE A 1 25  ? 1.142   3.899   -8.147  1.00 0.00 ? 44  ILE A C    2  
ATOM 2788  O O    . ILE A 1 25  ? 1.456   5.024   -7.757  1.00 0.00 ? 44  ILE A O    2  
ATOM 2789  C CB   . ILE A 1 25  ? 1.862   1.957   -6.766  1.00 0.00 ? 44  ILE A CB   2  
ATOM 2790  C CG1  . ILE A 1 25  ? 2.909   0.859   -6.581  1.00 0.00 ? 44  ILE A CG1  2  
ATOM 2791  C CG2  . ILE A 1 25  ? 0.459   1.365   -6.782  1.00 0.00 ? 44  ILE A CG2  2  
ATOM 2792  C CD1  . ILE A 1 25  ? 2.977   0.302   -5.176  1.00 0.00 ? 44  ILE A CD1  2  
ATOM 2793  H H    . ILE A 1 25  ? 4.016   3.310   -7.293  1.00 0.00 ? 44  ILE A H    2  
ATOM 2794  H HA   . ILE A 1 25  ? 1.966   2.080   -8.895  1.00 0.00 ? 44  ILE A HA   2  
ATOM 2795  H HB   . ILE A 1 25  ? 1.925   2.645   -5.943  1.00 0.00 ? 44  ILE A HB   2  
ATOM 2796  H HG12 . ILE A 1 25  ? 2.684   0.041   -7.250  2.00 0.00 ? 44  ILE A HG12 2  
ATOM 2797  H HG13 . ILE A 1 25  ? 3.882   1.255   -6.828  2.00 0.00 ? 44  ILE A HG13 2  
ATOM 2798  H HG21 . ILE A 1 25  ? 0.182   1.122   -7.796  1.00 0.00 ? 44  ILE A HG21 2  
ATOM 2799  H HG22 . ILE A 1 25  ? -0.239  2.087   -6.380  1.00 0.00 ? 44  ILE A HG22 2  
ATOM 2800  H HG23 . ILE A 1 25  ? 0.439   0.471   -6.177  1.00 0.00 ? 44  ILE A HG23 2  
ATOM 2801  H HD11 . ILE A 1 25  ? 3.861   -0.309  -5.073  1.00 0.00 ? 44  ILE A HD11 2  
ATOM 2802  H HD12 . ILE A 1 25  ? 2.100   -0.297  -4.984  1.00 0.00 ? 44  ILE A HD12 2  
ATOM 2803  H HD13 . ILE A 1 25  ? 3.019   1.117   -4.468  1.00 0.00 ? 44  ILE A HD13 2  
ATOM 2804  N N    . SER A 1 26  ? -0.052  3.610   -8.654  1.00 0.00 ? 45  SER A N    2  
ATOM 2805  C CA   . SER A 1 26  ? -1.094  4.619   -8.790  1.00 0.00 ? 45  SER A CA   2  
ATOM 2806  C C    . SER A 1 26  ? -2.284  4.292   -7.892  1.00 0.00 ? 45  SER A C    2  
ATOM 2807  O O    . SER A 1 26  ? -2.183  3.458   -6.991  1.00 0.00 ? 45  SER A O    2  
ATOM 2808  C CB   . SER A 1 26  ? -1.551  4.719   -10.246 1.00 0.00 ? 45  SER A CB   2  
ATOM 2809  O OG   . SER A 1 26  ? -0.985  5.852   -10.882 1.00 0.00 ? 45  SER A OG   2  
ATOM 2810  H H    . SER A 1 26  ? -0.238  2.691   -8.943  1.00 0.00 ? 45  SER A H    2  
ATOM 2811  H HA   . SER A 1 26  ? -0.678  5.568   -8.485  1.00 0.00 ? 45  SER A HA   2  
ATOM 2812  H HB2  . SER A 1 26  ? -1.244  3.832   -10.780 2.00 0.00 ? 45  SER A HB2  2  
ATOM 2813  H HB3  . SER A 1 26  ? -2.627  4.805   -10.279 2.00 0.00 ? 45  SER A HB3  2  
ATOM 2814  H HG   . SER A 1 26  ? -1.453  6.026   -11.703 1.00 0.00 ? 45  SER A HG   2  
ATOM 2815  N N    . ARG A 1 27  ? -3.408  4.954   -8.142  1.00 0.00 ? 46  ARG A N    2  
ATOM 2816  C CA   . ARG A 1 27  ? -4.615  4.736   -7.353  1.00 0.00 ? 46  ARG A CA   2  
ATOM 2817  C C    . ARG A 1 27  ? -5.328  3.454   -7.775  1.00 0.00 ? 46  ARG A C    2  
ATOM 2818  O O    . ARG A 1 27  ? -6.093  2.878   -7.004  1.00 0.00 ? 46  ARG A O    2  
ATOM 2819  C CB   . ARG A 1 27  ? -5.563  5.930   -7.494  1.00 0.00 ? 46  ARG A CB   2  
ATOM 2820  C CG   . ARG A 1 27  ? -6.285  6.289   -6.206  1.00 0.00 ? 46  ARG A CG   2  
ATOM 2821  C CD   . ARG A 1 27  ? -6.833  7.707   -6.240  1.00 0.00 ? 46  ARG A CD   2  
ATOM 2822  N NE   . ARG A 1 27  ? -8.027  7.814   -7.075  1.00 0.00 ? 46  ARG A NE   2  
ATOM 2823  C CZ   . ARG A 1 27  ? -9.135  8.444   -6.698  4.00 0.00 ? 46  ARG A CZ   2  
ATOM 2824  N NH1  . ARG A 1 27  ? -9.206  9.024   -5.508  5.00 0.00 ? 46  ARG A NH1  2  
ATOM 2825  N NH2  . ARG A 1 27  ? -10.182 8.499   -7.509  5.00 0.00 ? 46  ARG A NH2  2  
ATOM 2826  H H    . ARG A 1 27  ? -3.426  5.607   -8.873  1.00 0.00 ? 46  ARG A H    2  
ATOM 2827  H HA   . ARG A 1 27  ? -4.321  4.643   -6.319  1.00 0.00 ? 46  ARG A HA   2  
ATOM 2828  H HB2  . ARG A 1 27  ? -4.992  6.790   -7.813  2.00 0.00 ? 46  ARG A HB2  2  
ATOM 2829  H HB3  . ARG A 1 27  ? -6.304  5.700   -8.245  2.00 0.00 ? 46  ARG A HB3  2  
ATOM 2830  H HG2  . ARG A 1 27  ? -7.106  5.601   -6.063  2.00 0.00 ? 46  ARG A HG2  2  
ATOM 2831  H HG3  . ARG A 1 27  ? -5.594  6.201   -5.382  2.00 0.00 ? 46  ARG A HG3  2  
ATOM 2832  H HD2  . ARG A 1 27  ? -7.082  8.007   -5.233  2.00 0.00 ? 46  ARG A HD2  2  
ATOM 2833  H HD3  . ARG A 1 27  ? -6.072  8.365   -6.631  2.00 0.00 ? 46  ARG A HD3  2  
ATOM 2834  H HE   . ARG A 1 27  ? -8.001  7.393   -7.959  1.00 0.00 ? 46  ARG A HE   2  
ATOM 2835  H HH11 . ARG A 1 27  ? -8.423  8.988   -4.887  5.00 0.00 ? 46  ARG A HH11 2  
ATOM 2836  H HH12 . ARG A 1 27  ? -10.043 9.497   -5.232  5.00 0.00 ? 46  ARG A HH12 2  
ATOM 2837  H HH21 . ARG A 1 27  ? -10.141 8.064   -8.410  5.00 0.00 ? 46  ARG A HH21 2  
ATOM 2838  H HH22 . ARG A 1 27  ? -11.013 8.975   -7.222  5.00 0.00 ? 46  ARG A HH22 2  
ATOM 2839  N N    . THR A 1 28  ? -5.075  3.014   -9.002  1.00 0.00 ? 47  THR A N    2  
ATOM 2840  C CA   . THR A 1 28  ? -5.699  1.801   -9.519  1.00 0.00 ? 47  THR A CA   2  
ATOM 2841  C C    . THR A 1 28  ? -5.338  0.588   -8.668  1.00 0.00 ? 47  THR A C    2  
ATOM 2842  O O    . THR A 1 28  ? -6.190  0.021   -7.984  1.00 0.00 ? 47  THR A O    2  
ATOM 2843  C CB   . THR A 1 28  ? -5.285  1.531   -10.978 1.00 0.00 ? 47  THR A CB   2  
ATOM 2844  O OG1  . THR A 1 28  ? -4.496  2.620   -11.473 1.00 0.00 ? 47  THR A OG1  2  
ATOM 2845  C CG2  . THR A 1 28  ? -6.509  1.343   -11.861 1.00 0.00 ? 47  THR A CG2  2  
ATOM 2846  H H    . THR A 1 28  ? -4.458  3.516   -9.575  1.00 0.00 ? 47  THR A H    2  
ATOM 2847  H HA   . THR A 1 28  ? -6.770  1.941   -9.490  1.00 0.00 ? 47  THR A HA   2  
ATOM 2848  H HB   . THR A 1 28  ? -4.695  0.625   -11.008 1.00 0.00 ? 47  THR A HB   2  
ATOM 2849  H HG1  . THR A 1 28  ? -5.071  3.276   -11.873 1.00 0.00 ? 47  THR A HG1  2  
ATOM 2850  H HG21 . THR A 1 28  ? -6.237  1.507   -12.893 1.00 0.00 ? 47  THR A HG21 2  
ATOM 2851  H HG22 . THR A 1 28  ? -7.273  2.050   -11.573 1.00 0.00 ? 47  THR A HG22 2  
ATOM 2852  H HG23 . THR A 1 28  ? -6.886  0.338   -11.744 1.00 0.00 ? 47  THR A HG23 2  
ATOM 2853  N N    . GLU A 1 29  ? -4.070  0.195   -8.716  1.00 0.00 ? 48  GLU A N    2  
ATOM 2854  C CA   . GLU A 1 29  ? -3.595  -0.952  -7.950  1.00 0.00 ? 48  GLU A CA   2  
ATOM 2855  C C    . GLU A 1 29  ? -3.791  -0.725  -6.455  1.00 0.00 ? 48  GLU A C    2  
ATOM 2856  O O    . GLU A 1 29  ? -4.280  -1.603  -5.741  1.00 0.00 ? 48  GLU A O    2  
ATOM 2857  C CB   . GLU A 1 29  ? -2.119  -1.216  -8.252  1.00 0.00 ? 48  GLU A CB   2  
ATOM 2858  C CG   . GLU A 1 29  ? -1.833  -1.844  -9.607  1.00 0.00 ? 48  GLU A CG   2  
ATOM 2859  C CD   . GLU A 1 29  ? -1.108  -0.902  -10.548 1.00 0.00 ? 48  GLU A CD   2  
ATOM 2860  O OE1  . GLU A 1 29  ? -1.788  -0.120  -11.246 1.00 0.00 ? 48  GLU A OE1  2  
ATOM 2861  O OE2  . GLU A 1 29  ? 0.140   -0.946  -10.589 1.00 0.00 ? 48  GLU A OE2  2  
ATOM 2862  H H    . GLU A 1 29  ? -3.437  0.688   -9.279  1.00 0.00 ? 48  GLU A H    2  
ATOM 2863  H HA   . GLU A 1 29  ? -4.174  -1.813  -8.251  1.00 0.00 ? 48  GLU A HA   2  
ATOM 2864  H HB2  . GLU A 1 29  ? -1.585  -0.278  -8.200  2.00 0.00 ? 48  GLU A HB2  2  
ATOM 2865  H HB3  . GLU A 1 29  ? -1.725  -1.873  -7.490  2.00 0.00 ? 48  GLU A HB3  2  
ATOM 2866  H HG2  . GLU A 1 29  ? -1.222  -2.722  -9.461  2.00 0.00 ? 48  GLU A HG2  2  
ATOM 2867  H HG3  . GLU A 1 29  ? -2.769  -2.131  -10.060 2.00 0.00 ? 48  GLU A HG3  2  
ATOM 2868  N N    . ALA A 1 30  ? -3.410  0.460   -5.988  1.00 0.00 ? 49  ALA A N    2  
ATOM 2869  C CA   . ALA A 1 30  ? -3.547  0.804   -4.579  1.00 0.00 ? 49  ALA A CA   2  
ATOM 2870  C C    . ALA A 1 30  ? -4.984  0.637   -4.115  1.00 0.00 ? 49  ALA A C    2  
ATOM 2871  O O    . ALA A 1 30  ? -5.309  -0.296  -3.382  1.00 0.00 ? 49  ALA A O    2  
ATOM 2872  C CB   . ALA A 1 30  ? -3.096  2.235   -4.340  1.00 0.00 ? 49  ALA A CB   2  
ATOM 2873  H H    . ALA A 1 30  ? -3.029  1.118   -6.608  1.00 0.00 ? 49  ALA A H    2  
ATOM 2874  H HA   . ALA A 1 30  ? -2.909  0.147   -4.006  1.00 0.00 ? 49  ALA A HA   2  
ATOM 2875  H HB1  . ALA A 1 30  ? -2.270  2.241   -3.645  1.00 0.00 ? 49  ALA A HB1  2  
ATOM 2876  H HB2  . ALA A 1 30  ? -3.919  2.802   -3.926  1.00 0.00 ? 49  ALA A HB2  2  
ATOM 2877  H HB3  . ALA A 1 30  ? -2.786  2.678   -5.274  1.00 0.00 ? 49  ALA A HB3  2  
ATOM 2878  N N    . ALA A 1 31  ? -5.839  1.558   -4.544  1.00 0.00 ? 50  ALA A N    2  
ATOM 2879  C CA   . ALA A 1 31  ? -7.245  1.528   -4.175  1.00 0.00 ? 50  ALA A CA   2  
ATOM 2880  C C    . ALA A 1 31  ? -7.838  0.136   -4.369  1.00 0.00 ? 50  ALA A C    2  
ATOM 2881  O O    . ALA A 1 31  ? -8.838  -0.217  -3.744  1.00 0.00 ? 50  ALA A O    2  
ATOM 2882  C CB   . ALA A 1 31  ? -8.023  2.556   -4.982  1.00 0.00 ? 50  ALA A CB   2  
ATOM 2883  H H    . ALA A 1 31  ? -5.514  2.278   -5.123  1.00 0.00 ? 50  ALA A H    2  
ATOM 2884  H HA   . ALA A 1 31  ? -7.313  1.798   -3.131  1.00 0.00 ? 50  ALA A HA   2  
ATOM 2885  H HB1  . ALA A 1 31  ? -9.073  2.481   -4.744  1.00 0.00 ? 50  ALA A HB1  2  
ATOM 2886  H HB2  . ALA A 1 31  ? -7.879  2.369   -6.037  1.00 0.00 ? 50  ALA A HB2  2  
ATOM 2887  H HB3  . ALA A 1 31  ? -7.668  3.547   -4.740  1.00 0.00 ? 50  ALA A HB3  2  
ATOM 2888  N N    . ASP A 1 32  ? -7.216  -0.650  -5.243  1.00 0.00 ? 51  ASP A N    2  
ATOM 2889  C CA   . ASP A 1 32  ? -7.682  -2.004  -5.524  1.00 0.00 ? 51  ASP A CA   2  
ATOM 2890  C C    . ASP A 1 32  ? -7.603  -2.882  -4.279  1.00 0.00 ? 51  ASP A C    2  
ATOM 2891  O O    . ASP A 1 32  ? -8.620  -3.180  -3.653  1.00 0.00 ? 51  ASP A O    2  
ATOM 2892  C CB   . ASP A 1 32  ? -6.861  -2.626  -6.654  1.00 0.00 ? 51  ASP A CB   2  
ATOM 2893  C CG   . ASP A 1 32  ? -7.625  -2.686  -7.962  1.00 0.00 ? 51  ASP A CG   2  
ATOM 2894  O OD1  . ASP A 1 32  ? -8.806  -3.090  -7.942  1.00 0.00 ? 51  ASP A OD1  2  
ATOM 2895  O OD2  . ASP A 1 32  ? -7.041  -2.329  -9.007  1.00 0.00 ? 51  ASP A OD2  2  
ATOM 2896  H H    . ASP A 1 32  ? -6.424  -0.311  -5.712  1.00 0.00 ? 51  ASP A H    2  
ATOM 2897  H HA   . ASP A 1 32  ? -8.714  -1.938  -5.837  1.00 0.00 ? 51  ASP A HA   2  
ATOM 2898  H HB2  . ASP A 1 32  ? -5.969  -2.038  -6.807  2.00 0.00 ? 51  ASP A HB2  2  
ATOM 2899  H HB3  . ASP A 1 32  ? -6.580  -3.630  -6.376  2.00 0.00 ? 51  ASP A HB3  2  
ATOM 2900  N N    . LEU A 1 33  ? -6.390  -3.298  -3.925  1.00 0.00 ? 52  LEU A N    2  
ATOM 2901  C CA   . LEU A 1 33  ? -6.190  -4.145  -2.753  1.00 0.00 ? 52  LEU A CA   2  
ATOM 2902  C C    . LEU A 1 33  ? -6.538  -3.389  -1.475  1.00 0.00 ? 52  LEU A C    2  
ATOM 2903  O O    . LEU A 1 33  ? -7.131  -3.949  -0.548  1.00 0.00 ? 52  LEU A O    2  
ATOM 2904  C CB   . LEU A 1 33  ? -4.747  -4.659  -2.706  1.00 0.00 ? 52  LEU A CB   2  
ATOM 2905  C CG   . LEU A 1 33  ? -3.760  -3.943  -1.782  1.00 0.00 ? 52  LEU A CG   2  
ATOM 2906  C CD1  . LEU A 1 33  ? -4.101  -4.186  -0.321  2.00 0.00 ? 52  LEU A CD1  2  
ATOM 2907  C CD2  . LEU A 1 33  ? -2.338  -4.394  -2.073  2.00 0.00 ? 52  LEU A CD2  2  
ATOM 2908  H H    . LEU A 1 33  ? -5.614  -3.030  -4.463  1.00 0.00 ? 52  LEU A H    2  
ATOM 2909  H HA   . LEU A 1 33  ? -6.857  -4.989  -2.845  1.00 0.00 ? 52  LEU A HA   2  
ATOM 2910  H HB2  . LEU A 1 33  ? -4.776  -5.699  -2.415  2.00 0.00 ? 52  LEU A HB2  2  
ATOM 2911  H HB3  . LEU A 1 33  ? -4.350  -4.610  -3.708  2.00 0.00 ? 52  LEU A HB3  2  
ATOM 2912  H HG   . LEU A 1 33  ? -3.826  -2.882  -1.975  1.00 0.00 ? 52  LEU A HG   2  
ATOM 2913  H HD11 . LEU A 1 33  ? -3.294  -4.722  0.154   1.00 0.00 ? 52  LEU A HD11 2  
ATOM 2914  H HD12 . LEU A 1 33  ? -5.008  -4.770  -0.256  1.00 0.00 ? 52  LEU A HD12 2  
ATOM 2915  H HD13 . LEU A 1 33  ? -4.247  -3.238  0.177   1.00 0.00 ? 52  LEU A HD13 2  
ATOM 2916  H HD21 . LEU A 1 33  ? -1.910  -4.835  -1.185  1.00 0.00 ? 52  LEU A HD21 2  
ATOM 2917  H HD22 . LEU A 1 33  ? -1.745  -3.543  -2.376  1.00 0.00 ? 52  LEU A HD22 2  
ATOM 2918  H HD23 . LEU A 1 33  ? -2.348  -5.125  -2.868  1.00 0.00 ? 52  LEU A HD23 2  
ATOM 2919  N N    . CYS A 1 34  ? -6.179  -2.112  -1.433  1.00 0.00 ? 53  CYS A N    2  
ATOM 2920  C CA   . CYS A 1 34  ? -6.474  -1.287  -0.270  1.00 0.00 ? 53  CYS A CA   2  
ATOM 2921  C C    . CYS A 1 34  ? -7.907  -1.529  0.182   1.00 0.00 ? 53  CYS A C    2  
ATOM 2922  O O    . CYS A 1 34  ? -8.159  -1.879  1.334   1.00 0.00 ? 53  CYS A O    2  
ATOM 2923  C CB   . CYS A 1 34  ? -6.273  0.193   -0.594  1.00 0.00 ? 53  CYS A CB   2  
ATOM 2924  S SG   . CYS A 1 34  ? -7.556  1.314   0.051   1.00 0.00 ? 53  CYS A SG   2  
ATOM 2925  H H    . CYS A 1 34  ? -5.717  -1.717  -2.201  1.00 0.00 ? 53  CYS A H    2  
ATOM 2926  H HA   . CYS A 1 34  ? -5.800  -1.573  0.524   1.00 0.00 ? 53  CYS A HA   2  
ATOM 2927  H HB2  . CYS A 1 34  ? -5.326  0.515   -0.185  2.00 0.00 ? 53  CYS A HB2  2  
ATOM 2928  H HB3  . CYS A 1 34  ? -6.244  0.316   -1.667  2.00 0.00 ? 53  CYS A HB3  2  
ATOM 2929  N N    . LYS A 1 35  ? -8.842  -1.357  -0.745  1.00 0.00 ? 54  LYS A N    2  
ATOM 2930  C CA   . LYS A 1 35  ? -10.251 -1.572  -0.458  1.00 0.00 ? 54  LYS A CA   2  
ATOM 2931  C C    . LYS A 1 35  ? -10.524 -3.056  -0.256  1.00 0.00 ? 54  LYS A C    2  
ATOM 2932  O O    . LYS A 1 35  ? -11.471 -3.438  0.433   1.00 0.00 ? 54  LYS A O    2  
ATOM 2933  C CB   . LYS A 1 35  ? -11.112 -1.035  -1.603  1.00 0.00 ? 54  LYS A CB   2  
ATOM 2934  C CG   . LYS A 1 35  ? -11.324 -2.002  -2.756  1.00 0.00 ? 54  LYS A CG   2  
ATOM 2935  C CD   . LYS A 1 35  ? -12.374 -1.507  -3.738  1.00 0.00 ? 54  LYS A CD   2  
ATOM 2936  C CE   . LYS A 1 35  ? -12.755 -2.572  -4.753  1.00 0.00 ? 54  LYS A CE   2  
ATOM 2937  N NZ   . LYS A 1 35  ? -14.139 -2.379  -5.269  1.00 0.00 ? 54  LYS A NZ   2  
ATOM 2938  H H    . LYS A 1 35  ? -8.574  -1.092  -1.650  1.00 0.00 ? 54  LYS A H    2  
ATOM 2939  H HA   . LYS A 1 35  ? -10.495 -1.041  0.450   1.00 0.00 ? 54  LYS A HA   2  
ATOM 2940  H HB2  . LYS A 1 35  ? -12.080 -0.766  -1.209  2.00 0.00 ? 54  LYS A HB2  2  
ATOM 2941  H HB3  . LYS A 1 35  ? -10.644 -0.145  -1.995  2.00 0.00 ? 54  LYS A HB3  2  
ATOM 2942  H HG2  . LYS A 1 35  ? -10.388 -2.128  -3.281  2.00 0.00 ? 54  LYS A HG2  2  
ATOM 2943  H HG3  . LYS A 1 35  ? -11.641 -2.955  -2.359  2.00 0.00 ? 54  LYS A HG3  2  
ATOM 2944  H HD2  . LYS A 1 35  ? -13.256 -1.218  -3.188  2.00 0.00 ? 54  LYS A HD2  2  
ATOM 2945  H HD3  . LYS A 1 35  ? -11.982 -0.649  -4.263  2.00 0.00 ? 54  LYS A HD3  2  
ATOM 2946  H HE2  . LYS A 1 35  ? -12.064 -2.528  -5.581  2.00 0.00 ? 54  LYS A HE2  2  
ATOM 2947  H HE3  . LYS A 1 35  ? -12.689 -3.541  -4.282  2.00 0.00 ? 54  LYS A HE3  2  
ATOM 2948  H HZ1  . LYS A 1 35  ? -14.371 -1.365  -5.299  1.00 0.00 ? 54  LYS A HZ1  2  
ATOM 2949  H HZ2  . LYS A 1 35  ? -14.822 -2.861  -4.650  1.00 0.00 ? 54  LYS A HZ2  2  
ATOM 2950  H HZ3  . LYS A 1 35  ? -14.221 -2.772  -6.229  1.00 0.00 ? 54  LYS A HZ3  2  
ATOM 2951  N N    . ALA A 1 36  ? -9.683  -3.886  -0.863  1.00 0.00 ? 55  ALA A N    2  
ATOM 2952  C CA   . ALA A 1 36  ? -9.822  -5.332  -0.755  1.00 0.00 ? 55  ALA A CA   2  
ATOM 2953  C C    . ALA A 1 36  ? -10.021 -5.752  0.696   1.00 0.00 ? 55  ALA A C    2  
ATOM 2954  O O    . ALA A 1 36  ? -10.901 -6.556  1.002   1.00 0.00 ? 55  ALA A O    2  
ATOM 2955  C CB   . ALA A 1 36  ? -8.615  -6.032  -1.355  1.00 0.00 ? 55  ALA A CB   2  
ATOM 2956  H H    . ALA A 1 36  ? -8.949  -3.516  -1.397  1.00 0.00 ? 55  ALA A H    2  
ATOM 2957  H HA   . ALA A 1 36  ? -10.694 -5.622  -1.322  1.00 0.00 ? 55  ALA A HA   2  
ATOM 2958  H HB1  . ALA A 1 36  ? -8.749  -7.102  -1.288  1.00 0.00 ? 55  ALA A HB1  2  
ATOM 2959  H HB2  . ALA A 1 36  ? -7.725  -5.747  -0.812  1.00 0.00 ? 55  ALA A HB2  2  
ATOM 2960  H HB3  . ALA A 1 36  ? -8.511  -5.747  -2.391  1.00 0.00 ? 55  ALA A HB3  2  
ATOM 2961  N N    . PHE A 1 37  ? -9.209  -5.203  1.594   1.00 0.00 ? 56  PHE A N    2  
ATOM 2962  C CA   . PHE A 1 37  ? -9.331  -5.539  3.008   1.00 0.00 ? 56  PHE A CA   2  
ATOM 2963  C C    . PHE A 1 37  ? -10.188 -4.514  3.745   1.00 0.00 ? 56  PHE A C    2  
ATOM 2964  O O    . PHE A 1 37  ? -9.889  -4.136  4.877   1.00 0.00 ? 56  PHE A O    2  
ATOM 2965  C CB   . PHE A 1 37  ? -7.962  -5.663  3.674   1.00 0.00 ? 56  PHE A CB   2  
ATOM 2966  C CG   . PHE A 1 37  ? -7.110  -4.430  3.637   1.00 0.00 ? 56  PHE A CG   2  
ATOM 2967  C CD1  . PHE A 1 37  ? -6.470  -4.041  2.471   1.00 0.00 ? 56  PHE A CD1  2  
ATOM 2968  C CD2  . PHE A 1 37  ? -6.923  -3.679  4.783   1.00 0.00 ? 56  PHE A CD2  2  
ATOM 2969  C CE1  . PHE A 1 37  ? -5.654  -2.926  2.455   1.00 0.00 ? 56  PHE A CE1  2  
ATOM 2970  C CE2  . PHE A 1 37  ? -6.119  -2.560  4.771   1.00 0.00 ? 56  PHE A CE2  2  
ATOM 2971  C CZ   . PHE A 1 37  ? -5.479  -2.183  3.606   1.00 0.00 ? 56  PHE A CZ   2  
ATOM 2972  H H    . PHE A 1 37  ? -8.524  -4.563  1.300   1.00 0.00 ? 56  PHE A H    2  
ATOM 2973  H HA   . PHE A 1 37  ? -9.824  -6.497  3.067   1.00 0.00 ? 56  PHE A HA   2  
ATOM 2974  H HB2  . PHE A 1 37  ? -8.108  -5.927  4.712   2.00 0.00 ? 56  PHE A HB2  2  
ATOM 2975  H HB3  . PHE A 1 37  ? -7.412  -6.455  3.188   2.00 0.00 ? 56  PHE A HB3  2  
ATOM 2976  H HD1  . PHE A 1 37  ? -6.609  -4.620  1.571   1.00 0.00 ? 56  PHE A HD1  2  
ATOM 2977  H HD2  . PHE A 1 37  ? -7.424  -3.972  5.695   1.00 0.00 ? 56  PHE A HD2  2  
ATOM 2978  H HE1  . PHE A 1 37  ? -5.158  -2.632  1.542   1.00 0.00 ? 56  PHE A HE1  2  
ATOM 2979  H HE2  . PHE A 1 37  ? -5.982  -1.982  5.673   1.00 0.00 ? 56  PHE A HE2  2  
ATOM 2980  H HZ   . PHE A 1 37  ? -4.823  -1.324  3.604   1.00 0.00 ? 56  PHE A HZ   2  
ATOM 2981  N N    . ASN A 1 38  ? -11.263 -4.078  3.094   1.00 0.00 ? 57  ASN A N    2  
ATOM 2982  C CA   . ASN A 1 38  ? -12.181 -3.105  3.680   1.00 0.00 ? 57  ASN A CA   2  
ATOM 2983  C C    . ASN A 1 38  ? -11.439 -1.873  4.189   1.00 0.00 ? 57  ASN A C    2  
ATOM 2984  O O    . ASN A 1 38  ? -11.628 -1.451  5.329   1.00 0.00 ? 57  ASN A O    2  
ATOM 2985  C CB   . ASN A 1 38  ? -12.969 -3.743  4.826   1.00 0.00 ? 57  ASN A CB   2  
ATOM 2986  C CG   . ASN A 1 38  ? -13.396 -5.164  4.516   1.00 0.00 ? 57  ASN A CG   2  
ATOM 2987  O OD1  . ASN A 1 38  ? -12.574 -6.079  4.487   1.00 0.00 ? 57  ASN A OD1  2  
ATOM 2988  N ND2  . ASN A 1 38  ? -14.689 -5.355  4.280   4.00 0.00 ? 57  ASN A ND2  2  
ATOM 2989  H H    . ASN A 1 38  ? -11.449 -4.426  2.197   1.00 0.00 ? 57  ASN A H    2  
ATOM 2990  H HA   . ASN A 1 38  ? -12.872 -2.799  2.910   1.00 0.00 ? 57  ASN A HA   2  
ATOM 2991  H HB2  . ASN A 1 38  ? -12.353 -3.758  5.714   2.00 0.00 ? 57  ASN A HB2  2  
ATOM 2992  H HB3  . ASN A 1 38  ? -13.856 -3.154  5.016   2.00 0.00 ? 57  ASN A HB3  2  
ATOM 2993  H HD21 . ASN A 1 38  ? -15.287 -4.576  4.319   5.00 0.00 ? 57  ASN A HD21 2  
ATOM 2994  H HD22 . ASN A 1 38  ? -14.994 -6.267  4.076   5.00 0.00 ? 57  ASN A HD22 2  
ATOM 2995  N N    . SER A 1 39  ? -10.599 -1.295  3.336   1.00 0.00 ? 58  SER A N    2  
ATOM 2996  C CA   . SER A 1 39  ? -9.838  -0.107  3.705   1.00 0.00 ? 58  SER A CA   2  
ATOM 2997  C C    . SER A 1 39  ? -10.255 1.090   2.859   1.00 0.00 ? 58  SER A C    2  
ATOM 2998  O O    . SER A 1 39  ? -10.796 0.931   1.765   1.00 0.00 ? 58  SER A O    2  
ATOM 2999  C CB   . SER A 1 39  ? -8.339  -0.361  3.543   1.00 0.00 ? 58  SER A CB   2  
ATOM 3000  O OG   . SER A 1 39  ? -7.628  0.010   4.710   1.00 0.00 ? 58  SER A OG   2  
ATOM 3001  H H    . SER A 1 39  ? -10.493 -1.673  2.438   1.00 0.00 ? 58  SER A H    2  
ATOM 3002  H HA   . SER A 1 39  ? -10.047 0.111   4.741   1.00 0.00 ? 58  SER A HA   2  
ATOM 3003  H HB2  . SER A 1 39  ? -8.173  -1.413  3.354   2.00 0.00 ? 58  SER A HB2  2  
ATOM 3004  H HB3  . SER A 1 39  ? -7.966  0.217   2.711   2.00 0.00 ? 58  SER A HB3  2  
ATOM 3005  H HG   . SER A 1 39  ? -6.685  -0.033  4.537   1.00 0.00 ? 58  SER A HG   2  
ATOM 3006  N N    . THR A 1 40  ? -9.999  2.289   3.372   1.00 0.00 ? 59  THR A N    2  
ATOM 3007  C CA   . THR A 1 40  ? -10.349 3.511   2.660   1.00 0.00 ? 59  THR A CA   2  
ATOM 3008  C C    . THR A 1 40  ? -9.202  4.512   2.696   1.00 0.00 ? 59  THR A C    2  
ATOM 3009  O O    . THR A 1 40  ? -8.284  4.390   3.507   1.00 0.00 ? 59  THR A O    2  
ATOM 3010  C CB   . THR A 1 40  ? -11.608 4.168   3.255   1.00 0.00 ? 59  THR A CB   2  
ATOM 3011  O OG1  . THR A 1 40  ? -11.408 4.441   4.647   1.00 0.00 ? 59  THR A OG1  2  
ATOM 3012  C CG2  . THR A 1 40  ? -12.822 3.266   3.081   1.00 0.00 ? 59  THR A CG2  2  
ATOM 3013  H H    . THR A 1 40  ? -9.564  2.353   4.251   1.00 0.00 ? 59  THR A H    2  
ATOM 3014  H HA   . THR A 1 40  ? -10.556 3.252   1.632   1.00 0.00 ? 59  THR A HA   2  
ATOM 3015  H HB   . THR A 1 40  ? -11.792 5.097   2.736   1.00 0.00 ? 59  THR A HB   2  
ATOM 3016  H HG1  . THR A 1 40  ? -10.519 4.775   4.783   1.00 0.00 ? 59  THR A HG1  2  
ATOM 3017  H HG21 . THR A 1 40  ? -12.961 2.674   3.973   1.00 0.00 ? 59  THR A HG21 2  
ATOM 3018  H HG22 . THR A 1 40  ? -12.665 2.611   2.236   1.00 0.00 ? 59  THR A HG22 2  
ATOM 3019  H HG23 . THR A 1 40  ? -13.699 3.871   2.909   1.00 0.00 ? 59  THR A HG23 2  
ATOM 3020  N N    . LEU A 1 41  ? -9.259  5.504   1.810   1.00 0.00 ? 60  LEU A N    2  
ATOM 3021  C CA   . LEU A 1 41  ? -8.222  6.527   1.741   1.00 0.00 ? 60  LEU A CA   2  
ATOM 3022  C C    . LEU A 1 41  ? -7.784  6.947   3.140   1.00 0.00 ? 60  LEU A C    2  
ATOM 3023  O O    . LEU A 1 41  ? -8.615  7.199   4.013   1.00 0.00 ? 60  LEU A O    2  
ATOM 3024  C CB   . LEU A 1 41  ? -8.723  7.744   0.962   1.00 0.00 ? 60  LEU A CB   2  
ATOM 3025  C CG   . LEU A 1 41  ? -8.574  7.721   -0.560  1.00 0.00 ? 60  LEU A CG   2  
ATOM 3026  C CD1  . LEU A 1 41  ? -9.335  8.874   -1.196  2.00 0.00 ? 60  LEU A CD1  2  
ATOM 3027  C CD2  . LEU A 1 41  ? -7.107  7.764   -0.959  2.00 0.00 ? 60  LEU A CD2  2  
ATOM 3028  H H    . LEU A 1 41  ? -10.015 5.547   1.189   1.00 0.00 ? 60  LEU A H    2  
ATOM 3029  H HA   . LEU A 1 41  ? -7.373  6.104   1.224   1.00 0.00 ? 60  LEU A HA   2  
ATOM 3030  H HB2  . LEU A 1 41  ? -9.771  7.873   1.190   2.00 0.00 ? 60  LEU A HB2  2  
ATOM 3031  H HB3  . LEU A 1 41  ? -8.198  8.612   1.332   2.00 0.00 ? 60  LEU A HB3  2  
ATOM 3032  H HG   . LEU A 1 41  ? -8.996  6.796   -0.925  1.00 0.00 ? 60  LEU A HG   2  
ATOM 3033  H HD11 . LEU A 1 41  ? -10.396 8.684   -1.131  1.00 0.00 ? 60  LEU A HD11 2  
ATOM 3034  H HD12 . LEU A 1 41  ? -9.048  8.966   -2.233  1.00 0.00 ? 60  LEU A HD12 2  
ATOM 3035  H HD13 . LEU A 1 41  ? -9.101  9.791   -0.674  1.00 0.00 ? 60  LEU A HD13 2  
ATOM 3036  H HD21 . LEU A 1 41  ? -6.996  8.349   -1.861  1.00 0.00 ? 60  LEU A HD21 2  
ATOM 3037  H HD22 . LEU A 1 41  ? -6.753  6.759   -1.137  1.00 0.00 ? 60  LEU A HD22 2  
ATOM 3038  H HD23 . LEU A 1 41  ? -6.530  8.213   -0.165  1.00 0.00 ? 60  LEU A HD23 2  
ATOM 3039  N N    . PRO A 1 42  ? -6.465  7.027   3.372   1.00 0.00 ? 61  PRO A N    2  
ATOM 3040  C CA   . PRO A 1 42  ? -5.914  7.417   4.672   1.00 0.00 ? 61  PRO A CA   2  
ATOM 3041  C C    . PRO A 1 42  ? -6.219  8.870   5.015   1.00 0.00 ? 61  PRO A C    2  
ATOM 3042  O O    . PRO A 1 42  ? -5.651  9.790   4.430   1.00 0.00 ? 61  PRO A O    2  
ATOM 3043  C CB   . PRO A 1 42  ? -4.406  7.210   4.502   1.00 0.00 ? 61  PRO A CB   2  
ATOM 3044  C CG   . PRO A 1 42  ? -4.172  7.291   3.032   1.00 0.00 ? 61  PRO A CG   2  
ATOM 3045  C CD   . PRO A 1 42  ? -5.411  6.744   2.383   1.00 0.00 ? 61  PRO A CD   2  
ATOM 3046  H HA   . PRO A 1 42  ? -6.280  6.779   5.463   1.00 0.00 ? 61  PRO A HA   2  
ATOM 3047  H HB2  . PRO A 1 42  ? -3.872  7.986   5.031   1.00 0.00 ? 61  PRO A HB2  2  
ATOM 3048  H HB3  . PRO A 1 42  ? -4.127  6.243   4.892   1.00 0.00 ? 61  PRO A HB3  2  
ATOM 3049  H HG2  . PRO A 1 42  ? -4.020  8.320   2.741   1.00 0.00 ? 61  PRO A HG2  2  
ATOM 3050  H HG3  . PRO A 1 42  ? -3.313  6.693   2.765   1.00 0.00 ? 61  PRO A HG3  2  
ATOM 3051  H HD2  . PRO A 1 42  ? -5.607  7.255   1.452   1.00 0.00 ? 61  PRO A HD2  2  
ATOM 3052  H HD3  . PRO A 1 42  ? -5.313  5.681   2.218   1.00 0.00 ? 61  PRO A HD3  2  
ATOM 3053  N N    . THR A 1 43  ? -7.121  9.065   5.969   1.00 0.00 ? 62  THR A N    2  
ATOM 3054  C CA   . THR A 1 43  ? -7.505  10.403  6.394   1.00 0.00 ? 62  THR A CA   2  
ATOM 3055  C C    . THR A 1 43  ? -6.521  10.951  7.421   1.00 0.00 ? 62  THR A C    2  
ATOM 3056  O O    . THR A 1 43  ? -5.499  10.328  7.709   1.00 0.00 ? 62  THR A O    2  
ATOM 3057  C CB   . THR A 1 43  ? -8.921  10.415  7.001   1.00 0.00 ? 62  THR A CB   2  
ATOM 3058  O OG1  . THR A 1 43  ? -8.972  9.549   8.141   1.00 0.00 ? 62  THR A OG1  2  
ATOM 3059  C CG2  . THR A 1 43  ? -9.951  9.971   5.974   1.00 0.00 ? 62  THR A CG2  2  
ATOM 3060  H H    . THR A 1 43  ? -7.539  8.290   6.398   1.00 0.00 ? 62  THR A H    2  
ATOM 3061  H HA   . THR A 1 43  ? -7.501  11.046  5.526   1.00 0.00 ? 62  THR A HA   2  
ATOM 3062  H HB   . THR A 1 43  ? -9.155  11.423  7.312   1.00 0.00 ? 62  THR A HB   2  
ATOM 3063  H HG1  . THR A 1 43  ? -9.855  9.568   8.518   1.00 0.00 ? 62  THR A HG1  2  
ATOM 3064  H HG21 . THR A 1 43  ? -10.945 10.127  6.369   1.00 0.00 ? 62  THR A HG21 2  
ATOM 3065  H HG22 . THR A 1 43  ? -9.812  8.921   5.755   1.00 0.00 ? 62  THR A HG22 2  
ATOM 3066  H HG23 . THR A 1 43  ? -9.830  10.545  5.068   1.00 0.00 ? 62  THR A HG23 2  
ATOM 3067  N N    . MET A 1 44  ? -6.837  12.117  7.970   1.00 0.00 ? 63  MET A N    2  
ATOM 3068  C CA   . MET A 1 44  ? -5.982  12.746  8.967   1.00 0.00 ? 63  MET A CA   2  
ATOM 3069  C C    . MET A 1 44  ? -6.114  12.042  10.311  1.00 0.00 ? 63  MET A C    2  
ATOM 3070  O O    . MET A 1 44  ? -5.228  12.134  11.160  1.00 0.00 ? 63  MET A O    2  
ATOM 3071  C CB   . MET A 1 44  ? -6.339  14.226  9.115   1.00 0.00 ? 63  MET A CB   2  
ATOM 3072  C CG   . MET A 1 44  ? -5.474  15.152  8.276   1.00 0.00 ? 63  MET A CG   2  
ATOM 3073  S SD   . MET A 1 44  ? -4.078  15.825  9.197   1.00 0.00 ? 63  MET A SD   2  
ATOM 3074  C CE   . MET A 1 44  ? -3.933  17.448  8.452   1.00 0.00 ? 63  MET A CE   2  
ATOM 3075  H H    . MET A 1 44  ? -7.665  12.563  7.700   1.00 0.00 ? 63  MET A H    2  
ATOM 3076  H HA   . MET A 1 44  ? -4.961  12.661  8.628   1.00 0.00 ? 63  MET A HA   2  
ATOM 3077  H HB2  . MET A 1 44  ? -7.368  14.367  8.822   2.00 0.00 ? 63  MET A HB2  2  
ATOM 3078  H HB3  . MET A 1 44  ? -6.229  14.508  10.152  2.00 0.00 ? 63  MET A HB3  2  
ATOM 3079  H HG2  . MET A 1 44  ? -5.095  14.599  7.429   2.00 0.00 ? 63  MET A HG2  2  
ATOM 3080  H HG3  . MET A 1 44  ? -6.083  15.971  7.925   2.00 0.00 ? 63  MET A HG3  2  
ATOM 3081  H HE1  . MET A 1 44  ? -4.445  17.455  7.502   1.00 0.00 ? 63  MET A HE1  2  
ATOM 3082  H HE2  . MET A 1 44  ? -2.890  17.682  8.301   1.00 0.00 ? 63  MET A HE2  2  
ATOM 3083  H HE3  . MET A 1 44  ? -4.377  18.184  9.106   1.00 0.00 ? 63  MET A HE3  2  
ATOM 3084  N N    . ALA A 1 45  ? -7.223  11.337  10.500  1.00 0.00 ? 64  ALA A N    2  
ATOM 3085  C CA   . ALA A 1 45  ? -7.467  10.619  11.744  1.00 0.00 ? 64  ALA A CA   2  
ATOM 3086  C C    . ALA A 1 45  ? -6.787  9.255   11.735  1.00 0.00 ? 64  ALA A C    2  
ATOM 3087  O O    . ALA A 1 45  ? -6.043  8.918   12.656  1.00 0.00 ? 64  ALA A O    2  
ATOM 3088  C CB   . ALA A 1 45  ? -8.961  10.466  11.983  1.00 0.00 ? 64  ALA A CB   2  
ATOM 3089  H H    . ALA A 1 45  ? -7.894  11.300  9.786   1.00 0.00 ? 64  ALA A H    2  
ATOM 3090  H HA   . ALA A 1 45  ? -7.054  11.207  12.550  1.00 0.00 ? 64  ALA A HA   2  
ATOM 3091  H HB1  . ALA A 1 45  ? -9.501  10.781  11.102  1.00 0.00 ? 64  ALA A HB1  2  
ATOM 3092  H HB2  . ALA A 1 45  ? -9.256  11.079  12.823  1.00 0.00 ? 64  ALA A HB2  2  
ATOM 3093  H HB3  . ALA A 1 45  ? -9.189  9.432   12.194  1.00 0.00 ? 64  ALA A HB3  2  
ATOM 3094  N N    . GLN A 1 46  ? -7.046  8.472   10.694  1.00 0.00 ? 65  GLN A N    2  
ATOM 3095  C CA   . GLN A 1 46  ? -6.459  7.147   10.574  1.00 0.00 ? 65  GLN A CA   2  
ATOM 3096  C C    . GLN A 1 46  ? -4.934  7.225   10.548  1.00 0.00 ? 65  GLN A C    2  
ATOM 3097  O O    . GLN A 1 46  ? -4.250  6.385   11.133  1.00 0.00 ? 65  GLN A O    2  
ATOM 3098  C CB   . GLN A 1 46  ? -6.971  6.464   9.306   1.00 0.00 ? 65  GLN A CB   2  
ATOM 3099  C CG   . GLN A 1 46  ? -8.474  6.569   9.089   1.00 0.00 ? 65  GLN A CG   2  
ATOM 3100  C CD   . GLN A 1 46  ? -8.872  6.448   7.631   1.00 0.00 ? 65  GLN A CD   2  
ATOM 3101  O OE1  . GLN A 1 46  ? -8.043  6.597   6.734   1.00 0.00 ? 65  GLN A OE1  2  
ATOM 3102  N NE2  . GLN A 1 46  ? -10.147 6.171   7.387   4.00 0.00 ? 65  GLN A NE2  2  
ATOM 3103  H H    . GLN A 1 46  ? -7.649  8.790   9.989   1.00 0.00 ? 65  GLN A H    2  
ATOM 3104  H HA   . GLN A 1 46  ? -6.764  6.569   11.432  1.00 0.00 ? 65  GLN A HA   2  
ATOM 3105  H HB2  . GLN A 1 46  ? -6.479  6.907   8.453   2.00 0.00 ? 65  GLN A HB2  2  
ATOM 3106  H HB3  . GLN A 1 46  ? -6.710  5.417   9.349   2.00 0.00 ? 65  GLN A HB3  2  
ATOM 3107  H HG2  . GLN A 1 46  ? -8.958  5.779   9.644   2.00 0.00 ? 65  GLN A HG2  2  
ATOM 3108  H HG3  . GLN A 1 46  ? -8.812  7.525   9.459   2.00 0.00 ? 65  GLN A HG3  2  
ATOM 3109  H HE21 . GLN A 1 46  ? -10.753 6.056   8.154   5.00 0.00 ? 65  GLN A HE21 2  
ATOM 3110  H HE22 . GLN A 1 46  ? -10.434 6.086   6.451   5.00 0.00 ? 65  GLN A HE22 2  
ATOM 3111  N N    . MET A 1 47  ? -4.409  8.235   9.862   1.00 0.00 ? 66  MET A N    2  
ATOM 3112  C CA   . MET A 1 47  ? -2.966  8.420   9.751   1.00 0.00 ? 66  MET A CA   2  
ATOM 3113  C C    . MET A 1 47  ? -2.360  8.922   11.059  1.00 0.00 ? 66  MET A C    2  
ATOM 3114  O O    . MET A 1 47  ? -1.450  8.302   11.606  1.00 0.00 ? 66  MET A O    2  
ATOM 3115  C CB   . MET A 1 47  ? -2.645  9.399   8.622   1.00 0.00 ? 66  MET A CB   2  
ATOM 3116  C CG   . MET A 1 47  ? -2.087  8.740   7.373   1.00 0.00 ? 66  MET A CG   2  
ATOM 3117  S SD   . MET A 1 47  ? -0.462  9.377   6.921   1.00 0.00 ? 66  MET A SD   2  
ATOM 3118  C CE   . MET A 1 47  ? -0.033  8.285   5.568   1.00 0.00 ? 66  MET A CE   2  
ATOM 3119  H H    . MET A 1 47  ? -5.006  8.870   9.412   1.00 0.00 ? 66  MET A H    2  
ATOM 3120  H HA   . MET A 1 47  ? -2.530  7.461   9.515   1.00 0.00 ? 66  MET A HA   2  
ATOM 3121  H HB2  . MET A 1 47  ? -3.549  9.924   8.352   2.00 0.00 ? 66  MET A HB2  2  
ATOM 3122  H HB3  . MET A 1 47  ? -1.919  10.114  8.979   2.00 0.00 ? 66  MET A HB3  2  
ATOM 3123  H HG2  . MET A 1 47  ? -2.008  7.678   7.548   2.00 0.00 ? 66  MET A HG2  2  
ATOM 3124  H HG3  . MET A 1 47  ? -2.769  8.919   6.554   2.00 0.00 ? 66  MET A HG3  2  
ATOM 3125  H HE1  . MET A 1 47  ? 0.957   7.885   5.728   1.00 0.00 ? 66  MET A HE1  2  
ATOM 3126  H HE2  . MET A 1 47  ? -0.055  8.836   4.640   1.00 0.00 ? 66  MET A HE2  2  
ATOM 3127  H HE3  . MET A 1 47  ? -0.745  7.474   5.521   1.00 0.00 ? 66  MET A HE3  2  
ATOM 3128  N N    . GLU A 1 48  ? -2.862  10.051  11.552  1.00 0.00 ? 67  GLU A N    2  
ATOM 3129  C CA   . GLU A 1 48  ? -2.355  10.633  12.788  1.00 0.00 ? 67  GLU A CA   2  
ATOM 3130  C C    . GLU A 1 48  ? -2.392  9.626   13.929  1.00 0.00 ? 67  GLU A C    2  
ATOM 3131  O O    . GLU A 1 48  ? -1.380  9.385   14.586  1.00 0.00 ? 67  GLU A O    2  
ATOM 3132  C CB   . GLU A 1 48  ? -3.173  11.862  13.160  1.00 0.00 ? 67  GLU A CB   2  
ATOM 3133  C CG   . GLU A 1 48  ? -2.860  13.088  12.319  1.00 0.00 ? 67  GLU A CG   2  
ATOM 3134  C CD   . GLU A 1 48  ? -3.182  14.388  13.028  1.00 0.00 ? 67  GLU A CD   2  
ATOM 3135  O OE1  . GLU A 1 48  ? -4.357  14.583  13.407  1.00 0.00 ? 67  GLU A OE1  2  
ATOM 3136  O OE2  . GLU A 1 48  ? -2.262  15.213  13.205  1.00 0.00 ? 67  GLU A OE2  2  
ATOM 3137  H H    . GLU A 1 48  ? -3.585  10.507  11.073  1.00 0.00 ? 67  GLU A H    2  
ATOM 3138  H HA   . GLU A 1 48  ? -1.331  10.931  12.619  1.00 0.00 ? 67  GLU A HA   2  
ATOM 3139  H HB2  . GLU A 1 48  ? -4.216  11.622  13.041  2.00 0.00 ? 67  GLU A HB2  2  
ATOM 3140  H HB3  . GLU A 1 48  ? -2.986  12.102  14.193  2.00 0.00 ? 67  GLU A HB3  2  
ATOM 3141  H HG2  . GLU A 1 48  ? -1.807  13.082  12.075  2.00 0.00 ? 67  GLU A HG2  2  
ATOM 3142  H HG3  . GLU A 1 48  ? -3.440  13.041  11.407  2.00 0.00 ? 67  GLU A HG3  2  
ATOM 3143  N N    . LYS A 1 49  ? -3.561  9.036   14.161  1.00 0.00 ? 68  LYS A N    2  
ATOM 3144  C CA   . LYS A 1 49  ? -3.711  8.054   15.222  1.00 0.00 ? 68  LYS A CA   2  
ATOM 3145  C C    . LYS A 1 49  ? -2.673  6.959   15.055  1.00 0.00 ? 68  LYS A C    2  
ATOM 3146  O O    . LYS A 1 49  ? -1.981  6.590   16.000  1.00 0.00 ? 68  LYS A O    2  
ATOM 3147  C CB   . LYS A 1 49  ? -5.119  7.456   15.204  1.00 0.00 ? 68  LYS A CB   2  
ATOM 3148  C CG   . LYS A 1 49  ? -5.847  7.486   16.539  1.00 0.00 ? 68  LYS A CG   2  
ATOM 3149  C CD   . LYS A 1 49  ? -7.138  6.687   16.505  1.00 0.00 ? 68  LYS A CD   2  
ATOM 3150  C CE   . LYS A 1 49  ? -8.074  7.059   17.645  1.00 0.00 ? 68  LYS A CE   2  
ATOM 3151  N NZ   . LYS A 1 49  ? -9.462  6.578   17.401  1.00 0.00 ? 68  LYS A NZ   2  
ATOM 3152  H H    . LYS A 1 49  ? -4.332  9.260   13.602  1.00 0.00 ? 68  LYS A H    2  
ATOM 3153  H HA   . LYS A 1 49  ? -3.548  8.553   16.166  1.00 0.00 ? 68  LYS A HA   2  
ATOM 3154  H HB2  . LYS A 1 49  ? -5.716  8.001   14.487  2.00 0.00 ? 68  LYS A HB2  2  
ATOM 3155  H HB3  . LYS A 1 49  ? -5.053  6.428   14.883  2.00 0.00 ? 68  LYS A HB3  2  
ATOM 3156  H HG2  . LYS A 1 49  ? -5.199  7.074   17.298  2.00 0.00 ? 68  LYS A HG2  2  
ATOM 3157  H HG3  . LYS A 1 49  ? -6.077  8.513   16.786  2.00 0.00 ? 68  LYS A HG3  2  
ATOM 3158  H HD2  . LYS A 1 49  ? -7.640  6.873   15.567  2.00 0.00 ? 68  LYS A HD2  2  
ATOM 3159  H HD3  . LYS A 1 49  ? -6.899  5.636   16.578  2.00 0.00 ? 68  LYS A HD3  2  
ATOM 3160  H HE2  . LYS A 1 49  ? -7.703  6.615   18.557  2.00 0.00 ? 68  LYS A HE2  2  
ATOM 3161  H HE3  . LYS A 1 49  ? -8.087  8.133   17.747  2.00 0.00 ? 68  LYS A HE3  2  
ATOM 3162  H HZ1  . LYS A 1 49  ? -9.963  7.237   16.771  1.00 0.00 ? 68  LYS A HZ1  2  
ATOM 3163  H HZ2  . LYS A 1 49  ? -9.981  6.512   18.299  1.00 0.00 ? 68  LYS A HZ2  2  
ATOM 3164  H HZ3  . LYS A 1 49  ? -9.441  5.638   16.956  1.00 0.00 ? 68  LYS A HZ3  2  
ATOM 3165  N N    . ALA A 1 50  ? -2.561  6.460   13.831  1.00 0.00 ? 69  ALA A N    2  
ATOM 3166  C CA   . ALA A 1 50  ? -1.596  5.419   13.517  1.00 0.00 ? 69  ALA A CA   2  
ATOM 3167  C C    . ALA A 1 50  ? -0.174  5.945   13.671  1.00 0.00 ? 69  ALA A C    2  
ATOM 3168  O O    . ALA A 1 50  ? 0.756   5.179   13.916  1.00 0.00 ? 69  ALA A O    2  
ATOM 3169  C CB   . ALA A 1 50  ? -1.818  4.897   12.105  1.00 0.00 ? 69  ALA A CB   2  
ATOM 3170  H H    . ALA A 1 50  ? -3.136  6.811   13.121  1.00 0.00 ? 69  ALA A H    2  
ATOM 3171  H HA   . ALA A 1 50  ? -1.748  4.602   14.208  1.00 0.00 ? 69  ALA A HA   2  
ATOM 3172  H HB1  . ALA A 1 50  ? -1.015  5.234   11.465  1.00 0.00 ? 69  ALA A HB1  2  
ATOM 3173  H HB2  . ALA A 1 50  ? -2.759  5.269   11.727  1.00 0.00 ? 69  ALA A HB2  2  
ATOM 3174  H HB3  . ALA A 1 50  ? -1.838  3.818   12.118  1.00 0.00 ? 69  ALA A HB3  2  
ATOM 3175  N N    . LEU A 1 51  ? -0.009  7.258   13.530  1.00 0.00 ? 70  LEU A N    2  
ATOM 3176  C CA   . LEU A 1 51  ? 1.307   7.871   13.658  1.00 0.00 ? 70  LEU A CA   2  
ATOM 3177  C C    . LEU A 1 51  ? 1.656   8.101   15.124  1.00 0.00 ? 70  LEU A C    2  
ATOM 3178  O O    . LEU A 1 51  ? 2.826   8.064   15.508  1.00 0.00 ? 70  LEU A O    2  
ATOM 3179  C CB   . LEU A 1 51  ? 1.352   9.193   12.892  1.00 0.00 ? 70  LEU A CB   2  
ATOM 3180  C CG   . LEU A 1 51  ? 1.848   9.155   11.445  1.00 0.00 ? 70  LEU A CG   2  
ATOM 3181  C CD1  . LEU A 1 51  ? 1.212   8.002   10.682  2.00 0.00 ? 70  LEU A CD1  2  
ATOM 3182  C CD2  . LEU A 1 51  ? 1.568   10.475  10.743  2.00 0.00 ? 70  LEU A CD2  2  
ATOM 3183  H H    . LEU A 1 51  ? -0.788  7.829   13.338  1.00 0.00 ? 70  LEU A H    2  
ATOM 3184  H HA   . LEU A 1 51  ? 2.030   7.193   13.231  1.00 0.00 ? 70  LEU A HA   2  
ATOM 3185  H HB2  . LEU A 1 51  ? 0.356   9.609   12.890  2.00 0.00 ? 70  LEU A HB2  2  
ATOM 3186  H HB3  . LEU A 1 51  ? 1.989   9.869   13.441  2.00 0.00 ? 70  LEU A HB3  2  
ATOM 3187  H HG   . LEU A 1 51  ? 2.917   9.001   11.460  1.00 0.00 ? 70  LEU A HG   2  
ATOM 3188  H HD11 . LEU A 1 51  ? 0.199   8.262   10.415  1.00 0.00 ? 70  LEU A HD11 2  
ATOM 3189  H HD12 . LEU A 1 51  ? 1.205   7.119   11.303  1.00 0.00 ? 70  LEU A HD12 2  
ATOM 3190  H HD13 . LEU A 1 51  ? 1.781   7.807   9.785   1.00 0.00 ? 70  LEU A HD13 2  
ATOM 3191  H HD21 . LEU A 1 51  ? 1.771   10.373  9.687   1.00 0.00 ? 70  LEU A HD21 2  
ATOM 3192  H HD22 . LEU A 1 51  ? 2.201   11.245  11.159  1.00 0.00 ? 70  LEU A HD22 2  
ATOM 3193  H HD23 . LEU A 1 51  ? 0.532   10.745  10.886  1.00 0.00 ? 70  LEU A HD23 2  
ATOM 3194  N N    . SER A 1 52  ? 0.635   8.341   15.940  1.00 0.00 ? 71  SER A N    2  
ATOM 3195  C CA   . SER A 1 52  ? 0.831   8.578   17.365  1.00 0.00 ? 71  SER A CA   2  
ATOM 3196  C C    . SER A 1 52  ? 0.829   7.266   18.141  1.00 0.00 ? 71  SER A C    2  
ATOM 3197  O O    . SER A 1 52  ? 0.992   7.254   19.360  1.00 0.00 ? 71  SER A O    2  
ATOM 3198  C CB   . SER A 1 52  ? -0.262  9.504   17.903  1.00 0.00 ? 71  SER A CB   2  
ATOM 3199  O OG   . SER A 1 52  ? -1.486  8.810   18.068  1.00 0.00 ? 71  SER A OG   2  
ATOM 3200  H H    . SER A 1 52  ? -0.274  8.357   15.574  1.00 0.00 ? 71  SER A H    2  
ATOM 3201  H HA   . SER A 1 52  ? 1.789   9.056   17.492  1.00 0.00 ? 71  SER A HA   2  
ATOM 3202  H HB2  . SER A 1 52  ? 0.045   9.900   18.861  2.00 0.00 ? 71  SER A HB2  2  
ATOM 3203  H HB3  . SER A 1 52  ? -0.415  10.318  17.210  2.00 0.00 ? 71  SER A HB3  2  
ATOM 3204  H HG   . SER A 1 52  ? -1.991  9.216   18.776  1.00 0.00 ? 71  SER A HG   2  
ATOM 3205  N N    . ILE A 1 53  ? 0.643   6.163   17.424  1.00 0.00 ? 72  ILE A N    2  
ATOM 3206  C CA   . ILE A 1 53  ? 0.620   4.844   18.043  1.00 0.00 ? 72  ILE A CA   2  
ATOM 3207  C C    . ILE A 1 53  ? 1.888   4.065   17.716  1.00 0.00 ? 72  ILE A C    2  
ATOM 3208  O O    . ILE A 1 53  ? 2.083   2.948   18.193  1.00 0.00 ? 72  ILE A O    2  
ATOM 3209  C CB   . ILE A 1 53  ? -0.606  4.032   17.584  1.00 0.00 ? 72  ILE A CB   2  
ATOM 3210  C CG1  . ILE A 1 53  ? -0.528  3.750   16.082  1.00 0.00 ? 72  ILE A CG1  2  
ATOM 3211  C CG2  . ILE A 1 53  ? -1.888  4.772   17.927  1.00 0.00 ? 72  ILE A CG2  2  
ATOM 3212  C CD1  . ILE A 1 53  ? 0.222   2.483   15.735  1.00 0.00 ? 72  ILE A CD1  2  
ATOM 3213  H H    . ILE A 1 53  ? 0.518   6.238   16.455  1.00 0.00 ? 72  ILE A H    2  
ATOM 3214  H HA   . ILE A 1 53  ? 0.556   4.978   19.113  1.00 0.00 ? 72  ILE A HA   2  
ATOM 3215  H HB   . ILE A 1 53  ? -0.610  3.095   18.115  1.00 0.00 ? 72  ILE A HB   2  
ATOM 3216  H HG12 . ILE A 1 53  ? -1.529  3.658   15.687  2.00 0.00 ? 72  ILE A HG12 2  
ATOM 3217  H HG13 . ILE A 1 53  ? -0.030  4.574   15.593  2.00 0.00 ? 72  ILE A HG13 2  
ATOM 3218  H HG21 . ILE A 1 53  ? -1.667  5.816   18.095  1.00 0.00 ? 72  ILE A HG21 2  
ATOM 3219  H HG22 . ILE A 1 53  ? -2.321  4.347   18.820  1.00 0.00 ? 72  ILE A HG22 2  
ATOM 3220  H HG23 . ILE A 1 53  ? -2.588  4.680   17.109  1.00 0.00 ? 72  ILE A HG23 2  
ATOM 3221  H HD11 . ILE A 1 53  ? 1.012   2.714   15.036  1.00 0.00 ? 72  ILE A HD11 2  
ATOM 3222  H HD12 . ILE A 1 53  ? -0.458  1.773   15.289  1.00 0.00 ? 72  ILE A HD12 2  
ATOM 3223  H HD13 . ILE A 1 53  ? 0.647   2.060   16.633  1.00 0.00 ? 72  ILE A HD13 2  
ATOM 3224  N N    . GLY A 1 54  ? 2.745   4.663   16.895  1.00 0.00 ? 73  GLY A N    2  
ATOM 3225  C CA   . GLY A 1 54  ? 3.984   4.012   16.513  1.00 0.00 ? 73  GLY A CA   2  
ATOM 3226  C C    . GLY A 1 54  ? 3.902   3.340   15.157  1.00 0.00 ? 73  GLY A C    2  
ATOM 3227  O O    . GLY A 1 54  ? 4.096   2.130   15.043  1.00 0.00 ? 73  GLY A O    2  
ATOM 3228  H H    . GLY A 1 54  ? 2.535   5.553   16.545  1.00 0.00 ? 73  GLY A H    2  
ATOM 3229  H HA2  . GLY A 1 54  ? 4.773   4.751   16.489  2.00 0.00 ? 73  GLY A HA2  2  
ATOM 3230  H HA3  . GLY A 1 54  ? 4.228   3.265   17.257  2.00 0.00 ? 73  GLY A HA3  2  
ATOM 3231  N N    . PHE A 1 55  ? 3.611   4.127   14.125  1.00 0.00 ? 74  PHE A N    2  
ATOM 3232  C CA   . PHE A 1 55  ? 3.500   3.599   12.770  1.00 0.00 ? 74  PHE A CA   2  
ATOM 3233  C C    . PHE A 1 55  ? 3.967   4.626   11.744  1.00 0.00 ? 74  PHE A C    2  
ATOM 3234  O O    . PHE A 1 55  ? 3.498   5.764   11.731  1.00 0.00 ? 74  PHE A O    2  
ATOM 3235  C CB   . PHE A 1 55  ? 2.056   3.183   12.485  1.00 0.00 ? 74  PHE A CB   2  
ATOM 3236  C CG   . PHE A 1 55  ? 1.653   3.219   11.038  1.00 0.00 ? 74  PHE A CG   2  
ATOM 3237  C CD1  . PHE A 1 55  ? 1.828   2.107   10.230  1.00 0.00 ? 74  PHE A CD1  2  
ATOM 3238  C CD2  . PHE A 1 55  ? 1.091   4.360   10.488  1.00 0.00 ? 74  PHE A CD2  2  
ATOM 3239  C CE1  . PHE A 1 55  ? 1.450   2.132   8.903   1.00 0.00 ? 74  PHE A CE1  2  
ATOM 3240  C CE2  . PHE A 1 55  ? 0.710   4.391   9.160   1.00 0.00 ? 74  PHE A CE2  2  
ATOM 3241  C CZ   . PHE A 1 55  ? 0.891   3.273   8.368   1.00 0.00 ? 74  PHE A CZ   2  
ATOM 3242  H H    . PHE A 1 55  ? 3.465   5.085   14.279  1.00 0.00 ? 74  PHE A H    2  
ATOM 3243  H HA   . PHE A 1 55  ? 4.136   2.728   12.702  1.00 0.00 ? 74  PHE A HA   2  
ATOM 3244  H HB2  . PHE A 1 55  ? 1.908   2.174   12.840  2.00 0.00 ? 74  PHE A HB2  2  
ATOM 3245  H HB3  . PHE A 1 55  ? 1.392   3.840   13.025  2.00 0.00 ? 74  PHE A HB3  2  
ATOM 3246  H HD1  . PHE A 1 55  ? 2.267   1.213   10.648  1.00 0.00 ? 74  PHE A HD1  2  
ATOM 3247  H HD2  . PHE A 1 55  ? 0.951   5.234   11.107  1.00 0.00 ? 74  PHE A HD2  2  
ATOM 3248  H HE1  . PHE A 1 55  ? 1.591   1.258   8.285   1.00 0.00 ? 74  PHE A HE1  2  
ATOM 3249  H HE2  . PHE A 1 55  ? 0.273   5.287   8.742   1.00 0.00 ? 74  PHE A HE2  2  
ATOM 3250  H HZ   . PHE A 1 55  ? 0.592   3.293   7.330   1.00 0.00 ? 74  PHE A HZ   2  
ATOM 3251  N N    . GLU A 1 56  ? 4.894   4.215   10.888  1.00 0.00 ? 75  GLU A N    2  
ATOM 3252  C CA   . GLU A 1 56  ? 5.431   5.094   9.858   1.00 0.00 ? 75  GLU A CA   2  
ATOM 3253  C C    . GLU A 1 56  ? 6.254   4.301   8.847   1.00 0.00 ? 75  GLU A C    2  
ATOM 3254  O O    . GLU A 1 56  ? 6.945   3.347   9.207   1.00 0.00 ? 75  GLU A O    2  
ATOM 3255  C CB   . GLU A 1 56  ? 6.294   6.187   10.491  1.00 0.00 ? 75  GLU A CB   2  
ATOM 3256  C CG   . GLU A 1 56  ? 6.942   5.780   11.805  1.00 0.00 ? 75  GLU A CG   2  
ATOM 3257  C CD   . GLU A 1 56  ? 6.677   6.770   12.922  1.00 0.00 ? 75  GLU A CD   2  
ATOM 3258  O OE1  . GLU A 1 56  ? 5.515   6.864   13.369  1.00 0.00 ? 75  GLU A OE1  2  
ATOM 3259  O OE2  . GLU A 1 56  ? 7.633   7.451   13.350  1.00 0.00 ? 75  GLU A OE2  2  
ATOM 3260  H H    . GLU A 1 56  ? 5.228   3.297   10.952  1.00 0.00 ? 75  GLU A H    2  
ATOM 3261  H HA   . GLU A 1 56  ? 4.599   5.554   9.347   1.00 0.00 ? 75  GLU A HA   2  
ATOM 3262  H HB2  . GLU A 1 56  ? 7.079   6.451   9.797   2.00 0.00 ? 75  GLU A HB2  2  
ATOM 3263  H HB3  . GLU A 1 56  ? 5.677   7.055   10.672  2.00 0.00 ? 75  GLU A HB3  2  
ATOM 3264  H HG2  . GLU A 1 56  ? 6.553   4.817   12.100  2.00 0.00 ? 75  GLU A HG2  2  
ATOM 3265  H HG3  . GLU A 1 56  ? 8.008   5.705   11.657  2.00 0.00 ? 75  GLU A HG3  2  
ATOM 3266  N N    . THR A 1 57  ? 6.175   4.698   7.582   1.00 0.00 ? 76  THR A N    2  
ATOM 3267  C CA   . THR A 1 57  ? 6.913   4.021   6.522   1.00 0.00 ? 76  THR A CA   2  
ATOM 3268  C C    . THR A 1 57  ? 7.998   4.922   5.943   1.00 0.00 ? 76  THR A C    2  
ATOM 3269  O O    . THR A 1 57  ? 7.912   6.147   6.026   1.00 0.00 ? 76  THR A O    2  
ATOM 3270  C CB   . THR A 1 57  ? 5.975   3.566   5.389   1.00 0.00 ? 76  THR A CB   2  
ATOM 3271  O OG1  . THR A 1 57  ? 5.732   4.652   4.486   1.00 0.00 ? 76  THR A OG1  2  
ATOM 3272  C CG2  . THR A 1 57  ? 4.654   3.059   5.953   1.00 0.00 ? 76  THR A CG2  2  
ATOM 3273  H H    . THR A 1 57  ? 5.607   5.464   7.355   1.00 0.00 ? 76  THR A H    2  
ATOM 3274  H HA   . THR A 1 57  ? 7.378   3.145   6.949   1.00 0.00 ? 76  THR A HA   2  
ATOM 3275  H HB   . THR A 1 57  ? 6.452   2.760   4.849   1.00 0.00 ? 76  THR A HB   2  
ATOM 3276  H HG1  . THR A 1 57  ? 5.723   4.323   3.585   1.00 0.00 ? 76  THR A HG1  2  
ATOM 3277  H HG21 . THR A 1 57  ? 4.600   1.987   5.832   1.00 0.00 ? 76  THR A HG21 2  
ATOM 3278  H HG22 . THR A 1 57  ? 3.834   3.522   5.424   1.00 0.00 ? 76  THR A HG22 2  
ATOM 3279  H HG23 . THR A 1 57  ? 4.591   3.307   7.001   1.00 0.00 ? 76  THR A HG23 2  
ATOM 3280  N N    . CYS A 1 58  ? 9.020   4.306   5.356   1.00 0.00 ? 77  CYS A N    2  
ATOM 3281  C CA   . CYS A 1 58  ? 10.126  5.051   4.766   1.00 0.00 ? 77  CYS A CA   2  
ATOM 3282  C C    . CYS A 1 58  ? 9.954   5.182   3.255   1.00 0.00 ? 77  CYS A C    2  
ATOM 3283  O O    . CYS A 1 58  ? 10.910  5.022   2.496   1.00 0.00 ? 77  CYS A O    2  
ATOM 3284  C CB   . CYS A 1 58  ? 11.455  4.361   5.079   1.00 0.00 ? 77  CYS A CB   2  
ATOM 3285  S SG   . CYS A 1 58  ? 12.487  5.194   6.328   1.00 0.00 ? 77  CYS A SG   2  
ATOM 3286  H H    . CYS A 1 58  ? 9.031   3.327   5.324   1.00 0.00 ? 77  CYS A H    2  
ATOM 3287  H HA   . CYS A 1 58  ? 10.132  6.038   5.202   1.00 0.00 ? 77  CYS A HA   2  
ATOM 3288  H HB2  . CYS A 1 58  ? 11.253  3.362   5.439   2.00 0.00 ? 77  CYS A HB2  2  
ATOM 3289  H HB3  . CYS A 1 58  ? 12.035  4.293   4.171   2.00 0.00 ? 77  CYS A HB3  2  
ATOM 3290  N N    . ARG A 1 59  ? 8.731   5.473   2.824   1.00 0.00 ? 78  ARG A N    2  
ATOM 3291  C CA   . ARG A 1 59  ? 8.439   5.624   1.404   1.00 0.00 ? 78  ARG A CA   2  
ATOM 3292  C C    . ARG A 1 59  ? 7.222   6.517   1.184   1.00 0.00 ? 78  ARG A C    2  
ATOM 3293  O O    . ARG A 1 59  ? 6.396   6.689   2.082   1.00 0.00 ? 78  ARG A O    2  
ATOM 3294  C CB   . ARG A 1 59  ? 8.203   4.256   0.761   1.00 0.00 ? 78  ARG A CB   2  
ATOM 3295  C CG   . ARG A 1 59  ? 8.805   4.116   -0.626  1.00 0.00 ? 78  ARG A CG   2  
ATOM 3296  C CD   . ARG A 1 59  ? 8.899   2.662   -1.060  1.00 0.00 ? 78  ARG A CD   2  
ATOM 3297  N NE   . ARG A 1 59  ? 10.206  2.344   -1.629  1.00 0.00 ? 78  ARG A NE   2  
ATOM 3298  C CZ   . ARG A 1 59  ? 11.103  1.570   -1.026  4.00 0.00 ? 78  ARG A CZ   2  
ATOM 3299  N NH1  . ARG A 1 59  ? 10.839  1.034   0.157   5.00 0.00 ? 78  ARG A NH1  2  
ATOM 3300  N NH2  . ARG A 1 59  ? 12.271  1.324   -1.603  5.00 0.00 ? 78  ARG A NH2  2  
ATOM 3301  H H    . ARG A 1 59  ? 8.007   5.588   3.476   1.00 0.00 ? 78  ARG A H    2  
ATOM 3302  H HA   . ARG A 1 59  ? 9.297   6.085   0.937   1.00 0.00 ? 78  ARG A HA   2  
ATOM 3303  H HB2  . ARG A 1 59  ? 8.633   3.495   1.395   2.00 0.00 ? 78  ARG A HB2  2  
ATOM 3304  H HB3  . ARG A 1 59  ? 7.138   4.086   0.688   2.00 0.00 ? 78  ARG A HB3  2  
ATOM 3305  H HG2  . ARG A 1 59  ? 8.186   4.650   -1.332  2.00 0.00 ? 78  ARG A HG2  2  
ATOM 3306  H HG3  . ARG A 1 59  ? 9.796   4.544   -0.623  2.00 0.00 ? 78  ARG A HG3  2  
ATOM 3307  H HD2  . ARG A 1 59  ? 8.729   2.032   -0.200  2.00 0.00 ? 78  ARG A HD2  2  
ATOM 3308  H HD3  . ARG A 1 59  ? 8.138   2.470   -1.802  2.00 0.00 ? 78  ARG A HD3  2  
ATOM 3309  H HE   . ARG A 1 59  ? 10.425  2.728   -2.503  1.00 0.00 ? 78  ARG A HE   2  
ATOM 3310  H HH11 . ARG A 1 59  ? 9.961   1.211   0.602   5.00 0.00 ? 78  ARG A HH11 2  
ATOM 3311  H HH12 . ARG A 1 59  ? 11.517  0.451   0.604   5.00 0.00 ? 78  ARG A HH12 2  
ATOM 3312  H HH21 . ARG A 1 59  ? 12.482  1.721   -2.496  5.00 0.00 ? 78  ARG A HH21 2  
ATOM 3313  H HH22 . ARG A 1 59  ? 12.942  0.740   -1.146  5.00 0.00 ? 78  ARG A HH22 2  
ATOM 3314  N N    . TYR A 1 60  ? 7.117   7.080   -0.015  1.00 0.00 ? 79  TYR A N    2  
ATOM 3315  C CA   . TYR A 1 60  ? 6.000   7.953   -0.356  1.00 0.00 ? 79  TYR A CA   2  
ATOM 3316  C C    . TYR A 1 60  ? 4.688   7.177   -0.361  1.00 0.00 ? 79  TYR A C    2  
ATOM 3317  O O    . TYR A 1 60  ? 4.497   6.270   -1.170  1.00 0.00 ? 79  TYR A O    2  
ATOM 3318  C CB   . TYR A 1 60  ? 6.226   8.596   -1.725  1.00 0.00 ? 79  TYR A CB   2  
ATOM 3319  C CG   . TYR A 1 60  ? 7.050   9.863   -1.723  1.00 0.00 ? 79  TYR A CG   2  
ATOM 3320  C CD1  . TYR A 1 60  ? 6.911   10.805  -0.712  1.00 0.00 ? 79  TYR A CD1  2  
ATOM 3321  C CD2  . TYR A 1 60  ? 7.969   10.117  -2.733  1.00 0.00 ? 79  TYR A CD2  2  
ATOM 3322  C CE1  . TYR A 1 60  ? 7.664   11.964  -0.707  1.00 0.00 ? 79  TYR A CE1  2  
ATOM 3323  C CE2  . TYR A 1 60  ? 8.727   11.272  -2.735  1.00 0.00 ? 79  TYR A CE2  2  
ATOM 3324  C CZ   . TYR A 1 60  ? 8.570   12.192  -1.721  1.00 0.00 ? 79  TYR A CZ   2  
ATOM 3325  O OH   . TYR A 1 60  ? 9.322   13.346  -1.719  1.00 0.00 ? 79  TYR A OH   2  
ATOM 3326  H H    . TYR A 1 60  ? 7.807   6.902   -0.689  1.00 0.00 ? 79  TYR A H    2  
ATOM 3327  H HA   . TYR A 1 60  ? 5.944   8.729   0.392   1.00 0.00 ? 79  TYR A HA   2  
ATOM 3328  H HB2  . TYR A 1 60  ? 6.728   7.884   -2.363  2.00 0.00 ? 79  TYR A HB2  2  
ATOM 3329  H HB3  . TYR A 1 60  ? 5.267   8.833   -2.161  2.00 0.00 ? 79  TYR A HB3  2  
ATOM 3330  H HD1  . TYR A 1 60  ? 6.199   10.623  0.081   1.00 0.00 ? 79  TYR A HD1  2  
ATOM 3331  H HD2  . TYR A 1 60  ? 8.090   9.394   -3.526  1.00 0.00 ? 79  TYR A HD2  2  
ATOM 3332  H HE1  . TYR A 1 60  ? 7.539   12.685  0.088   1.00 0.00 ? 79  TYR A HE1  2  
ATOM 3333  H HE2  . TYR A 1 60  ? 9.434   11.452  -3.530  1.00 0.00 ? 79  TYR A HE2  2  
ATOM 3334  H HH   . TYR A 1 60  ? 10.016  13.274  -1.060  1.00 0.00 ? 79  TYR A HH   2  
ATOM 3335  N N    . GLY A 1 61  ? 3.787   7.536   0.547   1.00 0.00 ? 80  GLY A N    2  
ATOM 3336  C CA   . GLY A 1 61  ? 2.506   6.858   0.625   1.00 0.00 ? 80  GLY A CA   2  
ATOM 3337  C C    . GLY A 1 61  ? 1.325   7.795   0.465   1.00 0.00 ? 80  GLY A C    2  
ATOM 3338  O O    . GLY A 1 61  ? 1.188   8.766   1.208   1.00 0.00 ? 80  GLY A O    2  
ATOM 3339  H H    . GLY A 1 61  ? 3.992   8.265   1.167   1.00 0.00 ? 80  GLY A H    2  
ATOM 3340  H HA2  . GLY A 1 61  ? 2.463   6.108   -0.153  2.00 0.00 ? 80  GLY A HA2  2  
ATOM 3341  H HA3  . GLY A 1 61  ? 2.433   6.368   1.585   2.00 0.00 ? 80  GLY A HA3  2  
ATOM 3342  N N    . PHE A 1 62  ? 0.473   7.502   -0.512  1.00 0.00 ? 81  PHE A N    2  
ATOM 3343  C CA   . PHE A 1 62  ? -0.703  8.319   -0.777  1.00 0.00 ? 81  PHE A CA   2  
ATOM 3344  C C    . PHE A 1 62  ? -1.503  8.574   0.496   1.00 0.00 ? 81  PHE A C    2  
ATOM 3345  O O    . PHE A 1 62  ? -1.680  7.679   1.323   1.00 0.00 ? 81  PHE A O    2  
ATOM 3346  C CB   . PHE A 1 62  ? -1.593  7.630   -1.811  1.00 0.00 ? 81  PHE A CB   2  
ATOM 3347  C CG   . PHE A 1 62  ? -1.731  8.370   -3.109  1.00 0.00 ? 81  PHE A CG   2  
ATOM 3348  C CD1  . PHE A 1 62  ? -1.574  9.745   -3.159  1.00 0.00 ? 81  PHE A CD1  2  
ATOM 3349  C CD2  . PHE A 1 62  ? -2.021  7.688   -4.278  1.00 0.00 ? 81  PHE A CD2  2  
ATOM 3350  C CE1  . PHE A 1 62  ? -1.704  10.427  -4.354  1.00 0.00 ? 81  PHE A CE1  2  
ATOM 3351  C CE2  . PHE A 1 62  ? -2.153  8.363   -5.476  1.00 0.00 ? 81  PHE A CE2  2  
ATOM 3352  C CZ   . PHE A 1 62  ? -1.995  9.736   -5.514  1.00 0.00 ? 81  PHE A CZ   2  
ATOM 3353  H H    . PHE A 1 62  ? 0.639   6.716   -1.072  1.00 0.00 ? 81  PHE A H    2  
ATOM 3354  H HA   . PHE A 1 62  ? -0.368  9.262   -1.176  1.00 0.00 ? 81  PHE A HA   2  
ATOM 3355  H HB2  . PHE A 1 62  ? -1.184  6.655   -2.030  2.00 0.00 ? 81  PHE A HB2  2  
ATOM 3356  H HB3  . PHE A 1 62  ? -2.582  7.508   -1.395  2.00 0.00 ? 81  PHE A HB3  2  
ATOM 3357  H HD1  . PHE A 1 62  ? -1.346  10.285  -2.254  1.00 0.00 ? 81  PHE A HD1  2  
ATOM 3358  H HD2  . PHE A 1 62  ? -2.144  6.614   -4.247  1.00 0.00 ? 81  PHE A HD2  2  
ATOM 3359  H HE1  . PHE A 1 62  ? -1.579  11.500  -4.380  1.00 0.00 ? 81  PHE A HE1  2  
ATOM 3360  H HE2  . PHE A 1 62  ? -2.381  7.819   -6.382  1.00 0.00 ? 81  PHE A HE2  2  
ATOM 3361  H HZ   . PHE A 1 62  ? -2.095  10.268  -6.449  1.00 0.00 ? 81  PHE A HZ   2  
ATOM 3362  N N    . ILE A 1 63  ? -1.993  9.802   0.635   1.00 0.00 ? 82  ILE A N    2  
ATOM 3363  C CA   . ILE A 1 63  ? -2.788  10.188  1.795   1.00 0.00 ? 82  ILE A CA   2  
ATOM 3364  C C    . ILE A 1 63  ? -4.258  10.338  1.403   1.00 0.00 ? 82  ILE A C    2  
ATOM 3365  O O    . ILE A 1 63  ? -4.692  9.785   0.392   1.00 0.00 ? 82  ILE A O    2  
ATOM 3366  C CB   . ILE A 1 63  ? -2.267  11.508  2.413   1.00 0.00 ? 82  ILE A CB   2  
ATOM 3367  C CG1  . ILE A 1 63  ? -2.560  11.568  3.918   1.00 0.00 ? 82  ILE A CG1  2  
ATOM 3368  C CG2  . ILE A 1 63  ? -2.868  12.713  1.706   1.00 0.00 ? 82  ILE A CG2  2  
ATOM 3369  C CD1  . ILE A 1 63  ? -2.823  10.223  4.557   1.00 0.00 ? 82  ILE A CD1  2  
ATOM 3370  H H    . ILE A 1 63  ? -1.822  10.465  -0.066  1.00 0.00 ? 82  ILE A H    2  
ATOM 3371  H HA   . ILE A 1 63  ? -2.700  9.405   2.535   1.00 0.00 ? 82  ILE A HA   2  
ATOM 3372  H HB   . ILE A 1 63  ? -1.198  11.541  2.266   1.00 0.00 ? 82  ILE A HB   2  
ATOM 3373  H HG12 . ILE A 1 63  ? -1.712  12.010  4.420   2.00 0.00 ? 82  ILE A HG12 2  
ATOM 3374  H HG13 . ILE A 1 63  ? -3.427  12.190  4.084   2.00 0.00 ? 82  ILE A HG13 2  
ATOM 3375  H HG21 . ILE A 1 63  ? -2.437  13.618  2.109   1.00 0.00 ? 82  ILE A HG21 2  
ATOM 3376  H HG22 . ILE A 1 63  ? -3.936  12.726  1.858   1.00 0.00 ? 82  ILE A HG22 2  
ATOM 3377  H HG23 . ILE A 1 63  ? -2.655  12.654  0.649   1.00 0.00 ? 82  ILE A HG23 2  
ATOM 3378  H HD11 . ILE A 1 63  ? -3.079  10.363  5.598   1.00 0.00 ? 82  ILE A HD11 2  
ATOM 3379  H HD12 . ILE A 1 63  ? -1.937  9.610   4.485   1.00 0.00 ? 82  ILE A HD12 2  
ATOM 3380  H HD13 . ILE A 1 63  ? -3.641  9.736   4.049   1.00 0.00 ? 82  ILE A HD13 2  
ATOM 3381  N N    . GLU A 1 64  ? -5.021  11.082  2.198   1.00 0.00 ? 83  GLU A N    2  
ATOM 3382  C CA   . GLU A 1 64  ? -6.437  11.294  1.917   1.00 0.00 ? 83  GLU A CA   2  
ATOM 3383  C C    . GLU A 1 64  ? -6.648  11.670  0.452   1.00 0.00 ? 83  GLU A C    2  
ATOM 3384  O O    . GLU A 1 64  ? -7.768  11.617  -0.059  1.00 0.00 ? 83  GLU A O    2  
ATOM 3385  C CB   . GLU A 1 64  ? -6.999  12.392  2.822   1.00 0.00 ? 83  GLU A CB   2  
ATOM 3386  C CG   . GLU A 1 64  ? -6.292  13.729  2.677   1.00 0.00 ? 83  GLU A CG   2  
ATOM 3387  C CD   . GLU A 1 64  ? -6.971  14.842  3.451   1.00 0.00 ? 83  GLU A CD   2  
ATOM 3388  O OE1  . GLU A 1 64  ? -8.083  15.248  3.054   1.00 0.00 ? 83  GLU A OE1  2  
ATOM 3389  O OE2  . GLU A 1 64  ? -6.390  15.308  4.454   1.00 0.00 ? 83  GLU A OE2  2  
ATOM 3390  H H    . GLU A 1 64  ? -4.625  11.498  2.990   1.00 0.00 ? 83  GLU A H    2  
ATOM 3391  H HA   . GLU A 1 64  ? -6.958  10.370  2.118   1.00 0.00 ? 83  GLU A HA   2  
ATOM 3392  H HB2  . GLU A 1 64  ? -8.044  12.535  2.586   2.00 0.00 ? 83  GLU A HB2  2  
ATOM 3393  H HB3  . GLU A 1 64  ? -6.914  12.073  3.849   2.00 0.00 ? 83  GLU A HB3  2  
ATOM 3394  H HG2  . GLU A 1 64  ? -5.280  13.627  3.040   2.00 0.00 ? 83  GLU A HG2  2  
ATOM 3395  H HG3  . GLU A 1 64  ? -6.272  14.000  1.632   2.00 0.00 ? 83  GLU A HG3  2  
ATOM 3396  N N    . GLY A 1 65  ? -5.564  12.046  -0.218  1.00 0.00 ? 84  GLY A N    2  
ATOM 3397  C CA   . GLY A 1 65  ? -5.641  12.424  -1.616  1.00 0.00 ? 84  GLY A CA   2  
ATOM 3398  C C    . GLY A 1 65  ? -4.370  13.084  -2.111  1.00 0.00 ? 84  GLY A C    2  
ATOM 3399  O O    . GLY A 1 65  ? -4.415  13.973  -2.962  1.00 0.00 ? 84  GLY A O    2  
ATOM 3400  H H    . GLY A 1 65  ? -4.700  12.067  0.243   1.00 0.00 ? 84  GLY A H    2  
ATOM 3401  H HA2  . GLY A 1 65  ? -5.828  11.537  -2.207  2.00 0.00 ? 84  GLY A HA2  2  
ATOM 3402  H HA3  . GLY A 1 65  ? -6.466  13.111  -1.747  2.00 0.00 ? 84  GLY A HA3  2  
ATOM 3403  N N    . HIS A 1 66  ? -3.232  12.650  -1.575  1.00 0.00 ? 85  HIS A N    2  
ATOM 3404  C CA   . HIS A 1 66  ? -1.942  13.208  -1.965  1.00 0.00 ? 85  HIS A CA   2  
ATOM 3405  C C    . HIS A 1 66  ? -0.789  12.413  -1.357  1.00 0.00 ? 85  HIS A C    2  
ATOM 3406  O O    . HIS A 1 66  ? -0.850  11.992  -0.203  1.00 0.00 ? 85  HIS A O    2  
ATOM 3407  C CB   . HIS A 1 66  ? -1.846  14.673  -1.536  1.00 0.00 ? 85  HIS A CB   2  
ATOM 3408  C CG   . HIS A 1 66  ? -1.868  15.653  -2.667  1.00 0.00 ? 85  HIS A CG   2  
ATOM 3409  N ND1  . HIS A 1 66  ? -2.633  16.800  -2.655  1.00 0.00 ? 85  HIS A ND1  2  
ATOM 3410  C CD2  . HIS A 1 66  ? -1.209  15.655  -3.850  1.00 0.00 ? 85  HIS A CD2  2  
ATOM 3411  C CE1  . HIS A 1 66  ? -2.446  17.464  -3.781  1.00 0.00 ? 85  HIS A CE1  2  
ATOM 3412  N NE2  . HIS A 1 66  ? -1.586  16.791  -4.523  1.00 0.00 ? 85  HIS A NE2  2  
ATOM 3413  H H    . HIS A 1 66  ? -3.261  11.940  -0.900  1.00 0.00 ? 85  HIS A H    2  
ATOM 3414  H HA   . HIS A 1 66  ? -1.871  13.154  -3.042  1.00 0.00 ? 85  HIS A HA   2  
ATOM 3415  H HB2  . HIS A 1 66  ? -2.676  14.902  -0.885  2.00 0.00 ? 85  HIS A HB2  2  
ATOM 3416  H HB3  . HIS A 1 66  ? -0.924  14.818  -0.991  2.00 0.00 ? 85  HIS A HB3  2  
ATOM 3417  H HD1  . HIS A 1 66  ? -3.226  17.083  -1.928  1.00 0.00 ? 85  HIS A HD1  2  
ATOM 3418  H HD2  . HIS A 1 66  ? -0.517  14.902  -4.201  1.00 0.00 ? 85  HIS A HD2  2  
ATOM 3419  H HE1  . HIS A 1 66  ? -2.914  18.400  -4.048  1.00 0.00 ? 85  HIS A HE1  2  
ATOM 3420  H HE2  . HIS A 1 66  ? -1.327  17.024  -5.439  1.00 0.00 ? 85  HIS A HE2  2  
ATOM 3421  N N    . VAL A 1 67  ? 0.261   12.215  -2.146  1.00 0.00 ? 86  VAL A N    2  
ATOM 3422  C CA   . VAL A 1 67  ? 1.437   11.474  -1.700  1.00 0.00 ? 86  VAL A CA   2  
ATOM 3423  C C    . VAL A 1 67  ? 2.087   12.139  -0.490  1.00 0.00 ? 86  VAL A C    2  
ATOM 3424  O O    . VAL A 1 67  ? 2.662   13.221  -0.600  1.00 0.00 ? 86  VAL A O    2  
ATOM 3425  C CB   . VAL A 1 67  ? 2.473   11.365  -2.831  1.00 0.00 ? 86  VAL A CB   2  
ATOM 3426  C CG1  . VAL A 1 67  ? 2.725   12.727  -3.461  2.00 0.00 ? 86  VAL A CG1  2  
ATOM 3427  C CG2  . VAL A 1 67  ? 3.783   10.772  -2.334  2.00 0.00 ? 86  VAL A CG2  2  
ATOM 3428  H H    . VAL A 1 67  ? 0.248   12.579  -3.056  1.00 0.00 ? 86  VAL A H    2  
ATOM 3429  H HA   . VAL A 1 67  ? 1.124   10.477  -1.428  1.00 0.00 ? 86  VAL A HA   2  
ATOM 3430  H HB   . VAL A 1 67  ? 2.072   10.711  -3.591  1.00 0.00 ? 86  VAL A HB   2  
ATOM 3431  H HG11 . VAL A 1 67  ? 3.630   12.690  -4.049  1.00 0.00 ? 86  VAL A HG11 2  
ATOM 3432  H HG12 . VAL A 1 67  ? 2.829   13.470  -2.684  1.00 0.00 ? 86  VAL A HG12 2  
ATOM 3433  H HG13 . VAL A 1 67  ? 1.892   12.987  -4.097  1.00 0.00 ? 86  VAL A HG13 2  
ATOM 3434  H HG21 . VAL A 1 67  ? 4.278   10.257  -3.149  1.00 0.00 ? 86  VAL A HG21 2  
ATOM 3435  H HG22 . VAL A 1 67  ? 3.582   10.071  -1.538  1.00 0.00 ? 86  VAL A HG22 2  
ATOM 3436  H HG23 . VAL A 1 67  ? 4.421   11.562  -1.967  1.00 0.00 ? 86  VAL A HG23 2  
ATOM 3437  N N    . VAL A 1 68  ? 1.997   11.484  0.665   1.00 0.00 ? 87  VAL A N    2  
ATOM 3438  C CA   . VAL A 1 68  ? 2.578   12.019  1.893   1.00 0.00 ? 87  VAL A CA   2  
ATOM 3439  C C    . VAL A 1 68  ? 3.449   10.983  2.596   1.00 0.00 ? 87  VAL A C    2  
ATOM 3440  O O    . VAL A 1 68  ? 3.531   9.831   2.171   1.00 0.00 ? 87  VAL A O    2  
ATOM 3441  C CB   . VAL A 1 68  ? 1.490   12.497  2.872   1.00 0.00 ? 87  VAL A CB   2  
ATOM 3442  C CG1  . VAL A 1 68  ? 0.438   13.326  2.153   2.00 0.00 ? 87  VAL A CG1  2  
ATOM 3443  C CG2  . VAL A 1 68  ? 0.825   11.318  3.569   2.00 0.00 ? 87  VAL A CG2  2  
ATOM 3444  H H    . VAL A 1 68  ? 1.528   10.625  0.693   1.00 0.00 ? 87  VAL A H    2  
ATOM 3445  H HA   . VAL A 1 68  ? 3.191   12.868  1.628   1.00 0.00 ? 87  VAL A HA   2  
ATOM 3446  H HB   . VAL A 1 68  ? 1.958   13.116  3.622   1.00 0.00 ? 87  VAL A HB   2  
ATOM 3447  H HG11 . VAL A 1 68  ? -0.125  13.899  2.875   1.00 0.00 ? 87  VAL A HG11 2  
ATOM 3448  H HG12 . VAL A 1 68  ? -0.230  12.671  1.614   1.00 0.00 ? 87  VAL A HG12 2  
ATOM 3449  H HG13 . VAL A 1 68  ? 0.921   13.998  1.459   1.00 0.00 ? 87  VAL A HG13 2  
ATOM 3450  H HG21 . VAL A 1 68  ? 0.399   10.656  2.829   1.00 0.00 ? 87  VAL A HG21 2  
ATOM 3451  H HG22 . VAL A 1 68  ? 0.043   11.679  4.222   1.00 0.00 ? 87  VAL A HG22 2  
ATOM 3452  H HG23 . VAL A 1 68  ? 1.560   10.781  4.150   1.00 0.00 ? 87  VAL A HG23 2  
ATOM 3453  N N    . ILE A 1 69  ? 4.090   11.405  3.682   1.00 0.00 ? 88  ILE A N    2  
ATOM 3454  C CA   . ILE A 1 69  ? 4.951   10.522  4.459   1.00 0.00 ? 88  ILE A CA   2  
ATOM 3455  C C    . ILE A 1 69  ? 4.756   10.752  5.954   1.00 0.00 ? 88  ILE A C    2  
ATOM 3456  O O    . ILE A 1 69  ? 4.857   11.881  6.436   1.00 0.00 ? 88  ILE A O    2  
ATOM 3457  C CB   . ILE A 1 69  ? 6.438   10.731  4.112   1.00 0.00 ? 88  ILE A CB   2  
ATOM 3458  C CG1  . ILE A 1 69  ? 6.731   10.229  2.697   1.00 0.00 ? 88  ILE A CG1  2  
ATOM 3459  C CG2  . ILE A 1 69  ? 7.324   10.021  5.126   1.00 0.00 ? 88  ILE A CG2  2  
ATOM 3460  C CD1  . ILE A 1 69  ? 8.198   10.260  2.326   1.00 0.00 ? 88  ILE A CD1  2  
ATOM 3461  H H    . ILE A 1 69  ? 3.977   12.335  3.971   1.00 0.00 ? 88  ILE A H    2  
ATOM 3462  H HA   . ILE A 1 69  ? 4.686   9.502   4.222   1.00 0.00 ? 88  ILE A HA   2  
ATOM 3463  H HB   . ILE A 1 69  ? 6.651   11.788  4.162   1.00 0.00 ? 88  ILE A HB   2  
ATOM 3464  H HG12 . ILE A 1 69  ? 6.389   9.208   2.606   2.00 0.00 ? 88  ILE A HG12 2  
ATOM 3465  H HG13 . ILE A 1 69  ? 6.198   10.843  1.986   2.00 0.00 ? 88  ILE A HG13 2  
ATOM 3466  H HG21 . ILE A 1 69  ? 7.185   8.953   5.040   1.00 0.00 ? 88  ILE A HG21 2  
ATOM 3467  H HG22 . ILE A 1 69  ? 7.056   10.339  6.122   1.00 0.00 ? 88  ILE A HG22 2  
ATOM 3468  H HG23 . ILE A 1 69  ? 8.358   10.266  4.935   1.00 0.00 ? 88  ILE A HG23 2  
ATOM 3469  H HD11 . ILE A 1 69  ? 8.309   10.655  1.327   1.00 0.00 ? 88  ILE A HD11 2  
ATOM 3470  H HD12 . ILE A 1 69  ? 8.601   9.259   2.364   1.00 0.00 ? 88  ILE A HD12 2  
ATOM 3471  H HD13 . ILE A 1 69  ? 8.733   10.889  3.024   1.00 0.00 ? 88  ILE A HD13 2  
ATOM 3472  N N    . PRO A 1 70  ? 4.468   9.679   6.706   1.00 0.00 ? 89  PRO A N    2  
ATOM 3473  C CA   . PRO A 1 70  ? 4.252   9.757   8.156   1.00 0.00 ? 89  PRO A CA   2  
ATOM 3474  C C    . PRO A 1 70  ? 5.516   10.159  8.909   1.00 0.00 ? 89  PRO A C    2  
ATOM 3475  O O    . PRO A 1 70  ? 6.192   11.119  8.538   1.00 0.00 ? 89  PRO A O    2  
ATOM 3476  C CB   . PRO A 1 70  ? 3.833   8.332   8.537   1.00 0.00 ? 89  PRO A CB   2  
ATOM 3477  C CG   . PRO A 1 70  ? 3.458   7.672   7.254   1.00 0.00 ? 89  PRO A CG   2  
ATOM 3478  C CD   . PRO A 1 70  ? 4.324   8.304   6.203   1.00 0.00 ? 89  PRO A CD   2  
ATOM 3479  H HA   . PRO A 1 70  ? 3.457   10.446  8.399   1.00 0.00 ? 89  PRO A HA   2  
ATOM 3480  H HB2  . PRO A 1 70  ? 4.662   7.827   9.011   2.00 0.00 ? 89  PRO A HB2  2  
ATOM 3481  H HB3  . PRO A 1 70  ? 2.996   8.372   9.218   2.00 0.00 ? 89  PRO A HB3  2  
ATOM 3482  H HG2  . PRO A 1 70  ? 3.655   6.611   7.315   2.00 0.00 ? 89  PRO A HG2  2  
ATOM 3483  H HG3  . PRO A 1 70  ? 2.415   7.851   7.039   2.00 0.00 ? 89  PRO A HG3  2  
ATOM 3484  H HD2  . PRO A 1 70  ? 5.282   7.808   6.150   2.00 0.00 ? 89  PRO A HD2  2  
ATOM 3485  H HD3  . PRO A 1 70  ? 3.829   8.291   5.244   2.00 0.00 ? 89  PRO A HD3  2  
ATOM 3486  N N    . ARG A 1 71  ? 5.829   9.417   9.969   1.00 0.00 ? 90  ARG A N    2  
ATOM 3487  C CA   . ARG A 1 71  ? 7.011   9.692   10.778  1.00 0.00 ? 90  ARG A CA   2  
ATOM 3488  C C    . ARG A 1 71  ? 6.855   11.002  11.545  1.00 0.00 ? 90  ARG A C    2  
ATOM 3489  O O    . ARG A 1 71  ? 7.540   11.984  11.260  1.00 0.00 ? 90  ARG A O    2  
ATOM 3490  C CB   . ARG A 1 71  ? 8.261   9.752   9.896   1.00 0.00 ? 90  ARG A CB   2  
ATOM 3491  C CG   . ARG A 1 71  ? 8.561   8.479   9.121   1.00 0.00 ? 90  ARG A CG   2  
ATOM 3492  C CD   . ARG A 1 71  ? 10.054  8.286   8.910   1.00 0.00 ? 90  ARG A CD   2  
ATOM 3493  N NE   . ARG A 1 71  ? 10.442  6.883   9.012   1.00 0.00 ? 90  ARG A NE   2  
ATOM 3494  C CZ   . ARG A 1 71  ? 11.647  6.478   9.398   4.00 0.00 ? 90  ARG A CZ   2  
ATOM 3495  N NH1  . ARG A 1 71  ? 12.581  7.363   9.718   5.00 0.00 ? 90  ARG A NH1  2  
ATOM 3496  N NH2  . ARG A 1 71  ? 11.929  5.184   9.467   5.00 0.00 ? 90  ARG A NH2  2  
ATOM 3497  H H    . ARG A 1 71  ? 5.250   8.666   10.213  1.00 0.00 ? 90  ARG A H    2  
ATOM 3498  H HA   . ARG A 1 71  ? 7.121   8.886   11.487  1.00 0.00 ? 90  ARG A HA   2  
ATOM 3499  H HB2  . ARG A 1 71  ? 8.143   10.556  9.185   2.00 0.00 ? 90  ARG A HB2  2  
ATOM 3500  H HB3  . ARG A 1 71  ? 9.114   9.970   10.521  2.00 0.00 ? 90  ARG A HB3  2  
ATOM 3501  H HG2  . ARG A 1 71  ? 8.174   7.635   9.672   2.00 0.00 ? 90  ARG A HG2  2  
ATOM 3502  H HG3  . ARG A 1 71  ? 8.076   8.534   8.158   2.00 0.00 ? 90  ARG A HG3  2  
ATOM 3503  H HD2  . ARG A 1 71  ? 10.317  8.652   7.928   2.00 0.00 ? 90  ARG A HD2  2  
ATOM 3504  H HD3  . ARG A 1 71  ? 10.587  8.853   9.659   2.00 0.00 ? 90  ARG A HD3  2  
ATOM 3505  H HE   . ARG A 1 71  ? 9.769   6.208   8.782   1.00 0.00 ? 90  ARG A HE   2  
ATOM 3506  H HH11 . ARG A 1 71  ? 12.381  8.341   9.672   5.00 0.00 ? 90  ARG A HH11 2  
ATOM 3507  H HH12 . ARG A 1 71  ? 13.487  7.051   10.007  5.00 0.00 ? 90  ARG A HH12 2  
ATOM 3508  H HH21 . ARG A 1 71  ? 11.234  4.507   9.229   5.00 0.00 ? 90  ARG A HH21 2  
ATOM 3509  H HH22 . ARG A 1 71  ? 12.838  4.885   9.758   5.00 0.00 ? 90  ARG A HH22 2  
ATOM 3510  N N    . ILE A 1 72  ? 5.949   11.008  12.520  1.00 0.00 ? 91  ILE A N    2  
ATOM 3511  C CA   . ILE A 1 72  ? 5.703   12.196  13.330  1.00 0.00 ? 91  ILE A CA   2  
ATOM 3512  C C    . ILE A 1 72  ? 6.998   12.945  13.625  1.00 0.00 ? 91  ILE A C    2  
ATOM 3513  O O    . ILE A 1 72  ? 7.271   13.989  13.032  1.00 0.00 ? 91  ILE A O    2  
ATOM 3514  C CB   . ILE A 1 72  ? 5.023   11.836  14.664  1.00 0.00 ? 91  ILE A CB   2  
ATOM 3515  C CG1  . ILE A 1 72  ? 3.834   10.905  14.415  1.00 0.00 ? 91  ILE A CG1  2  
ATOM 3516  C CG2  . ILE A 1 72  ? 4.579   13.099  15.387  1.00 0.00 ? 91  ILE A CG2  2  
ATOM 3517  C CD1  . ILE A 1 72  ? 2.716   11.058  15.422  1.00 0.00 ? 91  ILE A CD1  2  
ATOM 3518  H H    . ILE A 1 72  ? 5.433   10.192  12.699  1.00 0.00 ? 91  ILE A H    2  
ATOM 3519  H HA   . ILE A 1 72  ? 5.040   12.845  12.778  1.00 0.00 ? 91  ILE A HA   2  
ATOM 3520  H HB   . ILE A 1 72  ? 5.745   11.329  15.285  1.00 0.00 ? 91  ILE A HB   2  
ATOM 3521  H HG12 . ILE A 1 72  ? 3.427   11.107  13.435  2.00 0.00 ? 91  ILE A HG12 2  
ATOM 3522  H HG13 . ILE A 1 72  ? 4.175   9.880   14.452  2.00 0.00 ? 91  ILE A HG13 2  
ATOM 3523  H HG21 . ILE A 1 72  ? 4.407   12.874  16.429  1.00 0.00 ? 91  ILE A HG21 2  
ATOM 3524  H HG22 . ILE A 1 72  ? 3.666   13.467  14.943  1.00 0.00 ? 91  ILE A HG22 2  
ATOM 3525  H HG23 . ILE A 1 72  ? 5.349   13.851  15.303  1.00 0.00 ? 91  ILE A HG23 2  
ATOM 3526  H HD11 . ILE A 1 72  ? 3.135   11.154  16.412  1.00 0.00 ? 91  ILE A HD11 2  
ATOM 3527  H HD12 . ILE A 1 72  ? 2.076   10.189  15.382  1.00 0.00 ? 91  ILE A HD12 2  
ATOM 3528  H HD13 . ILE A 1 72  ? 2.140   11.940  15.186  1.00 0.00 ? 91  ILE A HD13 2  
ATOM 3529  N N    . HIS A 1 73  ? 7.794   12.404  14.542  1.00 0.00 ? 92  HIS A N    2  
ATOM 3530  C CA   . HIS A 1 73  ? 9.062   13.022  14.914  1.00 0.00 ? 92  HIS A CA   2  
ATOM 3531  C C    . HIS A 1 73  ? 10.084  11.965  15.324  1.00 0.00 ? 92  HIS A C    2  
ATOM 3532  O O    . HIS A 1 73  ? 10.493  11.899  16.484  1.00 0.00 ? 92  HIS A O    2  
ATOM 3533  C CB   . HIS A 1 73  ? 8.853   14.016  16.059  1.00 0.00 ? 92  HIS A CB   2  
ATOM 3534  C CG   . HIS A 1 73  ? 7.877   13.562  17.099  1.00 0.00 ? 92  HIS A CG   2  
ATOM 3535  N ND1  . HIS A 1 73  ? 6.860   14.361  17.578  1.00 0.00 ? 92  HIS A ND1  2  
ATOM 3536  C CD2  . HIS A 1 73  ? 7.767   12.383  17.756  1.00 0.00 ? 92  HIS A CD2  2  
ATOM 3537  C CE1  . HIS A 1 73  ? 6.167   13.694  18.483  1.00 0.00 ? 92  HIS A CE1  2  
ATOM 3538  N NE2  . HIS A 1 73  ? 6.696   12.490  18.609  1.00 0.00 ? 92  HIS A NE2  2  
ATOM 3539  H H    . HIS A 1 73  ? 7.522   11.570  14.979  1.00 0.00 ? 92  HIS A H    2  
ATOM 3540  H HA   . HIS A 1 73  ? 9.437   13.553  14.052  1.00 0.00 ? 92  HIS A HA   2  
ATOM 3541  H HB2  . HIS A 1 73  ? 9.799   14.192  16.548  2.00 0.00 ? 92  HIS A HB2  2  
ATOM 3542  H HB3  . HIS A 1 73  ? 8.490   14.948  15.650  2.00 0.00 ? 92  HIS A HB3  2  
ATOM 3543  H HD1  . HIS A 1 73  ? 6.674   15.281  17.296  1.00 0.00 ? 92  HIS A HD1  2  
ATOM 3544  H HD2  . HIS A 1 73  ? 8.403   11.518  17.632  1.00 0.00 ? 92  HIS A HD2  2  
ATOM 3545  H HE1  . HIS A 1 73  ? 5.313   14.067  19.027  1.00 0.00 ? 92  HIS A HE1  2  
ATOM 3546  H HE2  . HIS A 1 73  ? 6.311   11.757  19.133  1.00 0.00 ? 92  HIS A HE2  2  
ATOM 3547  N N    . PRO A 1 74  ? 10.513  11.123  14.370  1.00 0.00 ? 93  PRO A N    2  
ATOM 3548  C CA   . PRO A 1 74  ? 11.494  10.066  14.633  1.00 0.00 ? 93  PRO A CA   2  
ATOM 3549  C C    . PRO A 1 74  ? 12.876  10.624  14.957  1.00 0.00 ? 93  PRO A C    2  
ATOM 3550  O O    . PRO A 1 74  ? 13.210  10.838  16.122  1.00 0.00 ? 93  PRO A O    2  
ATOM 3551  C CB   . PRO A 1 74  ? 11.528  9.278   13.322  1.00 0.00 ? 93  PRO A CB   2  
ATOM 3552  C CG   . PRO A 1 74  ? 11.071  10.243  12.283  1.00 0.00 ? 93  PRO A CG   2  
ATOM 3553  C CD   . PRO A 1 74  ? 10.074  11.140  12.963  1.00 0.00 ? 93  PRO A CD   2  
ATOM 3554  H HA   . PRO A 1 74  ? 11.171  9.419   15.436  1.00 0.00 ? 93  PRO A HA   2  
ATOM 3555  H HB2  . PRO A 1 74  ? 12.534  8.938   13.129  2.00 0.00 ? 93  PRO A HB2  2  
ATOM 3556  H HB3  . PRO A 1 74  ? 10.863  8.430   13.391  2.00 0.00 ? 93  PRO A HB3  2  
ATOM 3557  H HG2  . PRO A 1 74  ? 11.910  10.819  11.923  2.00 0.00 ? 93  PRO A HG2  2  
ATOM 3558  H HG3  . PRO A 1 74  ? 10.602  9.711   11.468  2.00 0.00 ? 93  PRO A HG3  2  
ATOM 3559  H HD2  . PRO A 1 74  ? 10.124  12.139  12.554  2.00 0.00 ? 93  PRO A HD2  2  
ATOM 3560  H HD3  . PRO A 1 74  ? 9.076   10.739  12.865  2.00 0.00 ? 93  PRO A HD3  2  
ATOM 3561  N N    . ASN A 1 75  ? 13.674  10.860  13.920  1.00 0.00 ? 94  ASN A N    2  
ATOM 3562  C CA   . ASN A 1 75  ? 15.019  11.395  14.097  1.00 0.00 ? 94  ASN A CA   2  
ATOM 3563  C C    . ASN A 1 75  ? 15.445  12.211  12.880  1.00 0.00 ? 94  ASN A C    2  
ATOM 3564  O O    . ASN A 1 75  ? 16.635  12.425  12.649  1.00 0.00 ? 94  ASN A O    2  
ATOM 3565  C CB   . ASN A 1 75  ? 16.016  10.259  14.337  1.00 0.00 ? 94  ASN A CB   2  
ATOM 3566  C CG   . ASN A 1 75  ? 15.881  9.646   15.717  1.00 0.00 ? 94  ASN A CG   2  
ATOM 3567  O OD1  . ASN A 1 75  ? 16.405  10.175  16.697  1.00 0.00 ? 94  ASN A OD1  2  
ATOM 3568  N ND2  . ASN A 1 75  ? 15.176  8.524   15.799  4.00 0.00 ? 94  ASN A ND2  2  
ATOM 3569  H H    . ASN A 1 75  ? 13.350  10.670  13.014  1.00 0.00 ? 94  ASN A H    2  
ATOM 3570  H HA   . ASN A 1 75  ? 15.008  12.041  14.962  1.00 0.00 ? 94  ASN A HA   2  
ATOM 3571  H HB2  . ASN A 1 75  ? 15.852  9.485   13.602  2.00 0.00 ? 94  ASN A HB2  2  
ATOM 3572  H HB3  . ASN A 1 75  ? 17.020  10.642  14.231  2.00 0.00 ? 94  ASN A HB3  2  
ATOM 3573  H HD21 . ASN A 1 75  ? 14.787  8.158   14.974  5.00 0.00 ? 94  ASN A HD21 2  
ATOM 3574  H HD22 . ASN A 1 75  ? 15.073  8.105   16.682  5.00 0.00 ? 94  ASN A HD22 2  
ATOM 3575  N N    . SER A 1 76  ? 14.464  12.662  12.104  1.00 0.00 ? 95  SER A N    2  
ATOM 3576  C CA   . SER A 1 76  ? 14.735  13.454  10.910  1.00 0.00 ? 95  SER A CA   2  
ATOM 3577  C C    . SER A 1 76  ? 15.578  12.664  9.913   1.00 0.00 ? 95  SER A C    2  
ATOM 3578  O O    . SER A 1 76  ? 16.307  13.241  9.107   1.00 0.00 ? 95  SER A O    2  
ATOM 3579  C CB   . SER A 1 76  ? 15.449  14.754  11.284  1.00 0.00 ? 95  SER A CB   2  
ATOM 3580  O OG   . SER A 1 76  ? 14.757  15.438  12.314  1.00 0.00 ? 95  SER A OG   2  
ATOM 3581  H H    . SER A 1 76  ? 13.535  12.457  12.341  1.00 0.00 ? 95  SER A H    2  
ATOM 3582  H HA   . SER A 1 76  ? 13.788  13.694  10.450  1.00 0.00 ? 95  SER A HA   2  
ATOM 3583  H HB2  . SER A 1 76  ? 16.447  14.527  11.628  2.00 0.00 ? 95  SER A HB2  2  
ATOM 3584  H HB3  . SER A 1 76  ? 15.503  15.395  10.416  2.00 0.00 ? 95  SER A HB3  2  
ATOM 3585  H HG   . SER A 1 76  ? 15.387  15.759  12.964  1.00 0.00 ? 95  SER A HG   2  
ATOM 3586  N N    . ILE A 1 77  ? 15.472  11.341  9.975   1.00 0.00 ? 96  ILE A N    2  
ATOM 3587  C CA   . ILE A 1 77  ? 16.222  10.470  9.078   1.00 0.00 ? 96  ILE A CA   2  
ATOM 3588  C C    . ILE A 1 77  ? 15.528  10.347  7.726   1.00 0.00 ? 96  ILE A C    2  
ATOM 3589  O O    . ILE A 1 77  ? 15.994  10.893  6.726   1.00 0.00 ? 96  ILE A O    2  
ATOM 3590  C CB   . ILE A 1 77  ? 16.402  9.063   9.680   1.00 0.00 ? 96  ILE A CB   2  
ATOM 3591  C CG1  . ILE A 1 77  ? 17.003  9.156   11.084  1.00 0.00 ? 96  ILE A CG1  2  
ATOM 3592  C CG2  . ILE A 1 77  ? 17.278  8.207   8.777   1.00 0.00 ? 96  ILE A CG2  2  
ATOM 3593  C CD1  . ILE A 1 77  ? 18.388  9.765   11.122  1.00 0.00 ? 96  ILE A CD1  2  
ATOM 3594  H H    . ILE A 1 77  ? 14.872  10.939  10.639  1.00 0.00 ? 96  ILE A H    2  
ATOM 3595  H HA   . ILE A 1 77  ? 17.201  10.905  8.933   1.00 0.00 ? 96  ILE A HA   2  
ATOM 3596  H HB   . ILE A 1 77  ? 15.430  8.596   9.743   1.00 0.00 ? 96  ILE A HB   2  
ATOM 3597  H HG12 . ILE A 1 77  ? 16.358  9.762   11.705  2.00 0.00 ? 96  ILE A HG12 2  
ATOM 3598  H HG13 . ILE A 1 77  ? 17.068  8.162   11.506  2.00 0.00 ? 96  ILE A HG13 2  
ATOM 3599  H HG21 . ILE A 1 77  ? 16.906  7.193   8.770   1.00 0.00 ? 96  ILE A HG21 2  
ATOM 3600  H HG22 . ILE A 1 77  ? 18.292  8.216   9.145   1.00 0.00 ? 96  ILE A HG22 2  
ATOM 3601  H HG23 . ILE A 1 77  ? 17.256  8.605   7.772   1.00 0.00 ? 96  ILE A HG23 2  
ATOM 3602  H HD11 . ILE A 1 77  ? 19.098  9.025   11.460  1.00 0.00 ? 96  ILE A HD11 2  
ATOM 3603  H HD12 . ILE A 1 77  ? 18.393  10.605  11.801  1.00 0.00 ? 96  ILE A HD12 2  
ATOM 3604  H HD13 . ILE A 1 77  ? 18.661  10.102  10.133  1.00 0.00 ? 96  ILE A HD13 2  
ATOM 3605  N N    . CYS A 1 78  ? 14.412  9.626   7.705   1.00 0.00 ? 97  CYS A N    2  
ATOM 3606  C CA   . CYS A 1 78  ? 13.652  9.430   6.476   1.00 0.00 ? 97  CYS A CA   2  
ATOM 3607  C C    . CYS A 1 78  ? 12.814  10.662  6.155   1.00 0.00 ? 97  CYS A C    2  
ATOM 3608  O O    . CYS A 1 78  ? 12.484  11.450  7.042   1.00 0.00 ? 97  CYS A O    2  
ATOM 3609  C CB   . CYS A 1 78  ? 12.747  8.203   6.603   1.00 0.00 ? 97  CYS A CB   2  
ATOM 3610  S SG   . CYS A 1 78  ? 13.104  6.888   5.394   1.00 0.00 ? 97  CYS A SG   2  
ATOM 3611  H H    . CYS A 1 78  ? 14.093  9.216   8.535   1.00 0.00 ? 97  CYS A H    2  
ATOM 3612  H HA   . CYS A 1 78  ? 14.355  9.267   5.674   1.00 0.00 ? 97  CYS A HA   2  
ATOM 3613  H HB2  . CYS A 1 78  ? 12.861  7.781   7.591   2.00 0.00 ? 97  CYS A HB2  2  
ATOM 3614  H HB3  . CYS A 1 78  ? 11.720  8.508   6.464   2.00 0.00 ? 97  CYS A HB3  2  
ATOM 3615  N N    . ALA A 1 79  ? 12.474  10.825  4.881   1.00 0.00 ? 98  ALA A N    2  
ATOM 3616  C CA   . ALA A 1 79  ? 11.675  11.962  4.442   1.00 0.00 ? 98  ALA A CA   2  
ATOM 3617  C C    . ALA A 1 79  ? 12.307  13.278  4.881   1.00 0.00 ? 98  ALA A C    2  
ATOM 3618  O O    . ALA A 1 79  ? 11.607  14.258  5.142   1.00 0.00 ? 98  ALA A O    2  
ATOM 3619  C CB   . ALA A 1 79  ? 10.257  11.849  4.979   1.00 0.00 ? 98  ALA A CB   2  
ATOM 3620  H H    . ALA A 1 79  ? 12.768  10.164  4.220   1.00 0.00 ? 98  ALA A H    2  
ATOM 3621  H HA   . ALA A 1 79  ? 11.629  11.940  3.363   1.00 0.00 ? 98  ALA A HA   2  
ATOM 3622  H HB1  . ALA A 1 79  ? 9.604   11.483  4.200   1.00 0.00 ? 98  ALA A HB1  2  
ATOM 3623  H HB2  . ALA A 1 79  ? 9.917   12.821  5.306   1.00 0.00 ? 98  ALA A HB2  2  
ATOM 3624  H HB3  . ALA A 1 79  ? 10.242  11.163  5.813   1.00 0.00 ? 98  ALA A HB3  2  
ATOM 3625  N N    . ALA A 1 80  ? 13.634  13.293  4.962   1.00 0.00 ? 99  ALA A N    2  
ATOM 3626  C CA   . ALA A 1 80  ? 14.364  14.488  5.370   1.00 0.00 ? 99  ALA A CA   2  
ATOM 3627  C C    . ALA A 1 80  ? 14.048  14.857  6.816   1.00 0.00 ? 99  ALA A C    2  
ATOM 3628  O O    . ALA A 1 80  ? 13.572  14.027  7.589   1.00 0.00 ? 99  ALA A O    2  
ATOM 3629  C CB   . ALA A 1 80  ? 14.038  15.649  4.443   1.00 0.00 ? 99  ALA A CB   2  
ATOM 3630  H H    . ALA A 1 80  ? 14.135  12.481  4.742   1.00 0.00 ? 99  ALA A H    2  
ATOM 3631  H HA   . ALA A 1 80  ? 15.420  14.277  5.287   1.00 0.00 ? 99  ALA A HA   2  
ATOM 3632  H HB1  . ALA A 1 80  ? 13.801  16.524  5.030   1.00 0.00 ? 99  ALA A HB1  2  
ATOM 3633  H HB2  . ALA A 1 80  ? 13.192  15.389  3.824   1.00 0.00 ? 99  ALA A HB2  2  
ATOM 3634  H HB3  . ALA A 1 80  ? 14.892  15.859  3.816   1.00 0.00 ? 99  ALA A HB3  2  
ATOM 3635  N N    . ASN A 1 81  ? 14.320  16.108  7.175   1.00 0.00 ? 100 ASN A N    2  
ATOM 3636  C CA   . ASN A 1 81  ? 14.067  16.588  8.528   1.00 0.00 ? 100 ASN A CA   2  
ATOM 3637  C C    . ASN A 1 81  ? 12.606  16.990  8.702   1.00 0.00 ? 100 ASN A C    2  
ATOM 3638  O O    . ASN A 1 81  ? 12.111  17.100  9.824   1.00 0.00 ? 100 ASN A O    2  
ATOM 3639  C CB   . ASN A 1 81  ? 14.975  17.777  8.848   1.00 0.00 ? 100 ASN A CB   2  
ATOM 3640  C CG   . ASN A 1 81  ? 16.337  17.661  8.191   1.00 0.00 ? 100 ASN A CG   2  
ATOM 3641  O OD1  . ASN A 1 81  ? 16.528  18.090  7.053   1.00 0.00 ? 100 ASN A OD1  2  
ATOM 3642  N ND2  . ASN A 1 81  ? 17.292  17.077  8.906   4.00 0.00 ? 100 ASN A ND2  2  
ATOM 3643  H H    . ASN A 1 81  ? 14.700  16.724  6.513   1.00 0.00 ? 100 ASN A H    2  
ATOM 3644  H HA   . ASN A 1 81  ? 14.289  15.782  9.212   1.00 0.00 ? 100 ASN A HA   2  
ATOM 3645  H HB2  . ASN A 1 81  ? 14.505  18.684  8.502   2.00 0.00 ? 100 ASN A HB2  2  
ATOM 3646  H HB3  . ASN A 1 81  ? 15.117  17.836  9.918   2.00 0.00 ? 100 ASN A HB3  2  
ATOM 3647  H HD21 . ASN A 1 81  ? 17.066  16.758  9.808   5.00 0.00 ? 100 ASN A HD21 2  
ATOM 3648  H HD22 . ASN A 1 81  ? 18.184  16.988  8.504   5.00 0.00 ? 100 ASN A HD22 2  
ATOM 3649  N N    . ASN A 1 82  ? 11.920  17.209  7.584   1.00 0.00 ? 101 ASN A N    2  
ATOM 3650  C CA   . ASN A 1 82  ? 10.515  17.599  7.613   1.00 0.00 ? 101 ASN A CA   2  
ATOM 3651  C C    . ASN A 1 82  ? 9.685   16.587  8.395   1.00 0.00 ? 101 ASN A C    2  
ATOM 3652  O O    . ASN A 1 82  ? 9.806   15.379  8.191   1.00 0.00 ? 101 ASN A O    2  
ATOM 3653  C CB   . ASN A 1 82  ? 9.971   17.730  6.189   1.00 0.00 ? 101 ASN A CB   2  
ATOM 3654  C CG   . ASN A 1 82  ? 9.473   19.129  5.881   1.00 0.00 ? 101 ASN A CG   2  
ATOM 3655  O OD1  . ASN A 1 82  ? 9.345   19.966  6.773   1.00 0.00 ? 101 ASN A OD1  2  
ATOM 3656  N ND2  . ASN A 1 82  ? 9.187   19.387  4.610   4.00 0.00 ? 101 ASN A ND2  2  
ATOM 3657  H H    . ASN A 1 82  ? 12.370  17.105  6.719   1.00 0.00 ? 101 ASN A H    2  
ATOM 3658  H HA   . ASN A 1 82  ? 10.447  18.558  8.104   1.00 0.00 ? 101 ASN A HA   2  
ATOM 3659  H HB2  . ASN A 1 82  ? 10.755  17.485  5.488   2.00 0.00 ? 101 ASN A HB2  2  
ATOM 3660  H HB3  . ASN A 1 82  ? 9.151   17.040  6.060   2.00 0.00 ? 101 ASN A HB3  2  
ATOM 3661  H HD21 . ASN A 1 82  ? 9.313   18.670  3.950   5.00 0.00 ? 101 ASN A HD21 2  
ATOM 3662  H HD22 . ASN A 1 82  ? 8.861   20.287  4.381   5.00 0.00 ? 101 ASN A HD22 2  
ATOM 3663  N N    . THR A 1 83  ? 8.843   17.088  9.293   1.00 0.00 ? 102 THR A N    2  
ATOM 3664  C CA   . THR A 1 83  ? 7.994   16.230  10.107  1.00 0.00 ? 102 THR A CA   2  
ATOM 3665  C C    . THR A 1 83  ? 6.525   16.393  9.733   1.00 0.00 ? 102 THR A C    2  
ATOM 3666  O O    . THR A 1 83  ? 6.139   17.382  9.109   1.00 0.00 ? 102 THR A O    2  
ATOM 3667  C CB   . THR A 1 83  ? 8.166   16.527  11.607  1.00 0.00 ? 102 THR A CB   2  
ATOM 3668  O OG1  . THR A 1 83  ? 7.952   17.920  11.860  1.00 0.00 ? 102 THR A OG1  2  
ATOM 3669  C CG2  . THR A 1 83  ? 9.557   16.129  12.081  1.00 0.00 ? 102 THR A CG2  2  
ATOM 3670  H H    . THR A 1 83  ? 8.791   18.057  9.411   1.00 0.00 ? 102 THR A H    2  
ATOM 3671  H HA   . THR A 1 83  ? 8.289   15.208  9.927   1.00 0.00 ? 102 THR A HA   2  
ATOM 3672  H HB   . THR A 1 83  ? 7.437   15.952  12.159  1.00 0.00 ? 102 THR A HB   2  
ATOM 3673  H HG1  . THR A 1 83  ? 8.708   18.423  11.548  1.00 0.00 ? 102 THR A HG1  2  
ATOM 3674  H HG21 . THR A 1 83  ? 9.802   16.677  12.978  1.00 0.00 ? 102 THR A HG21 2  
ATOM 3675  H HG22 . THR A 1 83  ? 10.278  16.359  11.311  1.00 0.00 ? 102 THR A HG22 2  
ATOM 3676  H HG23 . THR A 1 83  ? 9.578   15.069  12.288  1.00 0.00 ? 102 THR A HG23 2  
ATOM 3677  N N    . GLY A 1 84  ? 5.709   15.418  10.120  1.00 0.00 ? 103 GLY A N    2  
ATOM 3678  C CA   . GLY A 1 84  ? 4.292   15.472  9.817   1.00 0.00 ? 103 GLY A CA   2  
ATOM 3679  C C    . GLY A 1 84  ? 3.972   15.001  8.413   1.00 0.00 ? 103 GLY A C    2  
ATOM 3680  O O    . GLY A 1 84  ? 4.629   14.103  7.887   1.00 0.00 ? 103 GLY A O    2  
ATOM 3681  H H    . GLY A 1 84  ? 6.074   14.654  10.613  1.00 0.00 ? 103 GLY A H    2  
ATOM 3682  H HA2  . GLY A 1 84  ? 3.761   14.848  10.523  2.00 0.00 ? 103 GLY A HA2  2  
ATOM 3683  H HA3  . GLY A 1 84  ? 3.951   16.493  9.928   2.00 0.00 ? 103 GLY A HA3  2  
ATOM 3684  N N    . VAL A 1 85  ? 2.958   15.607  7.804   1.00 0.00 ? 104 VAL A N    2  
ATOM 3685  C CA   . VAL A 1 85  ? 2.551   15.245  6.451   1.00 0.00 ? 104 VAL A CA   2  
ATOM 3686  C C    . VAL A 1 85  ? 3.573   15.721  5.423   1.00 0.00 ? 104 VAL A C    2  
ATOM 3687  O O    . VAL A 1 85  ? 3.555   16.878  5.003   1.00 0.00 ? 104 VAL A O    2  
ATOM 3688  C CB   . VAL A 1 85  ? 1.170   15.836  6.103   1.00 0.00 ? 104 VAL A CB   2  
ATOM 3689  C CG1  . VAL A 1 85  ? 1.119   17.322  6.423   2.00 0.00 ? 104 VAL A CG1  2  
ATOM 3690  C CG2  . VAL A 1 85  ? 0.831   15.602  4.639   2.00 0.00 ? 104 VAL A CG2  2  
ATOM 3691  H H    . VAL A 1 85  ? 2.472   16.315  8.276   1.00 0.00 ? 104 VAL A H    2  
ATOM 3692  H HA   . VAL A 1 85  ? 2.481   14.168  6.402   1.00 0.00 ? 104 VAL A HA   2  
ATOM 3693  H HB   . VAL A 1 85  ? 0.430   15.333  6.708   1.00 0.00 ? 104 VAL A HB   2  
ATOM 3694  H HG11 . VAL A 1 85  ? 2.104   17.665  6.701   1.00 0.00 ? 104 VAL A HG11 2  
ATOM 3695  H HG12 . VAL A 1 85  ? 0.433   17.492  7.239   1.00 0.00 ? 104 VAL A HG12 2  
ATOM 3696  H HG13 . VAL A 1 85  ? 0.783   17.866  5.552   1.00 0.00 ? 104 VAL A HG13 2  
ATOM 3697  H HG21 . VAL A 1 85  ? 0.190   14.738  4.552   1.00 0.00 ? 104 VAL A HG21 2  
ATOM 3698  H HG22 . VAL A 1 85  ? 1.740   15.433  4.081   1.00 0.00 ? 104 VAL A HG22 2  
ATOM 3699  H HG23 . VAL A 1 85  ? 0.322   16.469  4.245   1.00 0.00 ? 104 VAL A HG23 2  
ATOM 3700  N N    . TYR A 1 86  ? 4.465   14.821  5.021   1.00 0.00 ? 105 TYR A N    2  
ATOM 3701  C CA   . TYR A 1 86  ? 5.494   15.152  4.041   1.00 0.00 ? 105 TYR A CA   2  
ATOM 3702  C C    . TYR A 1 86  ? 5.070   14.722  2.641   1.00 0.00 ? 105 TYR A C    2  
ATOM 3703  O O    . TYR A 1 86  ? 5.057   13.533  2.323   1.00 0.00 ? 105 TYR A O    2  
ATOM 3704  C CB   . TYR A 1 86  ? 6.818   14.482  4.413   1.00 0.00 ? 105 TYR A CB   2  
ATOM 3705  C CG   . TYR A 1 86  ? 7.943   14.731  3.434   1.00 0.00 ? 105 TYR A CG   2  
ATOM 3706  C CD1  . TYR A 1 86  ? 8.730   15.872  3.525   1.00 0.00 ? 105 TYR A CD1  2  
ATOM 3707  C CD2  . TYR A 1 86  ? 8.215   13.825  2.416   1.00 0.00 ? 105 TYR A CD2  2  
ATOM 3708  C CE1  . TYR A 1 86  ? 9.758   16.103  2.631   1.00 0.00 ? 105 TYR A CE1  2  
ATOM 3709  C CE2  . TYR A 1 86  ? 9.242   14.050  1.518   1.00 0.00 ? 105 TYR A CE2  2  
ATOM 3710  C CZ   . TYR A 1 86  ? 10.010  15.189  1.630   1.00 0.00 ? 105 TYR A CZ   2  
ATOM 3711  O OH   . TYR A 1 86  ? 11.032  15.417  0.738   1.00 0.00 ? 105 TYR A OH   2  
ATOM 3712  H H    . TYR A 1 86  ? 4.430   13.913  5.391   1.00 0.00 ? 105 TYR A H    2  
ATOM 3713  H HA   . TYR A 1 86  ? 5.628   16.223  4.050   1.00 0.00 ? 105 TYR A HA   2  
ATOM 3714  H HB2  . TYR A 1 86  ? 7.136   14.848  5.379   2.00 0.00 ? 105 TYR A HB2  2  
ATOM 3715  H HB3  . TYR A 1 86  ? 6.666   13.414  4.476   2.00 0.00 ? 105 TYR A HB3  2  
ATOM 3716  H HD1  . TYR A 1 86  ? 8.531   16.584  4.312   1.00 0.00 ? 105 TYR A HD1  2  
ATOM 3717  H HD2  . TYR A 1 86  ? 7.613   12.933  2.330   1.00 0.00 ? 105 TYR A HD2  2  
ATOM 3718  H HE1  . TYR A 1 86  ? 10.359  16.996  2.720   1.00 0.00 ? 105 TYR A HE1  2  
ATOM 3719  H HE2  . TYR A 1 86  ? 9.439   13.334  0.733   1.00 0.00 ? 105 TYR A HE2  2  
ATOM 3720  H HH   . TYR A 1 86  ? 10.730  15.223  -0.152  1.00 0.00 ? 105 TYR A HH   2  
ATOM 3721  N N    . ILE A 1 87  ? 4.725   15.697  1.805   1.00 0.00 ? 106 ILE A N    2  
ATOM 3722  C CA   . ILE A 1 87  ? 4.301   15.416  0.438   1.00 0.00 ? 106 ILE A CA   2  
ATOM 3723  C C    . ILE A 1 87  ? 5.497   15.336  -0.507  1.00 0.00 ? 106 ILE A C    2  
ATOM 3724  O O    . ILE A 1 87  ? 6.575   15.846  -0.206  1.00 0.00 ? 106 ILE A O    2  
ATOM 3725  C CB   . ILE A 1 87  ? 3.316   16.487  -0.077  1.00 0.00 ? 106 ILE A CB   2  
ATOM 3726  C CG1  . ILE A 1 87  ? 1.900   15.909  -0.154  1.00 0.00 ? 106 ILE A CG1  2  
ATOM 3727  C CG2  . ILE A 1 87  ? 3.752   17.004  -1.438  1.00 0.00 ? 106 ILE A CG2  2  
ATOM 3728  C CD1  . ILE A 1 87  ? 1.293   15.952  -1.539  1.00 0.00 ? 106 ILE A CD1  2  
ATOM 3729  H H    . ILE A 1 87  ? 4.755   16.626  2.115   1.00 0.00 ? 106 ILE A H    2  
ATOM 3730  H HA   . ILE A 1 87  ? 3.793   14.463  0.439   1.00 0.00 ? 106 ILE A HA   2  
ATOM 3731  H HB   . ILE A 1 87  ? 3.321   17.314  0.615   1.00 0.00 ? 106 ILE A HB   2  
ATOM 3732  H HG12 . ILE A 1 87  ? 1.927   14.878  0.161   2.00 0.00 ? 106 ILE A HG12 2  
ATOM 3733  H HG13 . ILE A 1 87  ? 1.254   16.465  0.510   2.00 0.00 ? 106 ILE A HG13 2  
ATOM 3734  H HG21 . ILE A 1 87  ? 3.162   17.870  -1.701  1.00 0.00 ? 106 ILE A HG21 2  
ATOM 3735  H HG22 . ILE A 1 87  ? 3.607   16.231  -2.178  1.00 0.00 ? 106 ILE A HG22 2  
ATOM 3736  H HG23 . ILE A 1 87  ? 4.797   17.277  -1.402  1.00 0.00 ? 106 ILE A HG23 2  
ATOM 3737  H HD11 . ILE A 1 87  ? 1.757   15.200  -2.160  1.00 0.00 ? 106 ILE A HD11 2  
ATOM 3738  H HD12 . ILE A 1 87  ? 1.456   16.927  -1.974  1.00 0.00 ? 106 ILE A HD12 2  
ATOM 3739  H HD13 . ILE A 1 87  ? 0.233   15.760  -1.475  1.00 0.00 ? 106 ILE A HD13 2  
ATOM 3740  N N    . LEU A 1 88  ? 5.293   14.693  -1.654  1.00 0.00 ? 107 LEU A N    2  
ATOM 3741  C CA   . LEU A 1 88  ? 6.349   14.544  -2.648  1.00 0.00 ? 107 LEU A CA   2  
ATOM 3742  C C    . LEU A 1 88  ? 6.437   15.779  -3.539  1.00 0.00 ? 107 LEU A C    2  
ATOM 3743  O O    . LEU A 1 88  ? 5.436   16.449  -3.789  1.00 0.00 ? 107 LEU A O    2  
ATOM 3744  C CB   . LEU A 1 88  ? 6.095   13.299  -3.502  1.00 0.00 ? 107 LEU A CB   2  
ATOM 3745  C CG   . LEU A 1 88  ? 6.283   13.483  -5.009  1.00 0.00 ? 107 LEU A CG   2  
ATOM 3746  C CD1  . LEU A 1 88  ? 7.718   13.179  -5.411  2.00 0.00 ? 107 LEU A CD1  2  
ATOM 3747  C CD2  . LEU A 1 88  ? 5.317   12.598  -5.780  2.00 0.00 ? 107 LEU A CD2  2  
ATOM 3748  H H    . LEU A 1 88  ? 4.409   14.310  -1.835  1.00 0.00 ? 107 LEU A H    2  
ATOM 3749  H HA   . LEU A 1 88  ? 7.285   14.425  -2.123  1.00 0.00 ? 107 LEU A HA   2  
ATOM 3750  H HB2  . LEU A 1 88  ? 6.766   12.519  -3.171  2.00 0.00 ? 107 LEU A HB2  2  
ATOM 3751  H HB3  . LEU A 1 88  ? 5.082   12.968  -3.326  2.00 0.00 ? 107 LEU A HB3  2  
ATOM 3752  H HG   . LEU A 1 88  ? 6.073   14.511  -5.266  1.00 0.00 ? 107 LEU A HG   2  
ATOM 3753  H HD11 . LEU A 1 88  ? 8.360   13.270  -4.548  1.00 0.00 ? 107 LEU A HD11 2  
ATOM 3754  H HD12 . LEU A 1 88  ? 8.035   13.876  -6.171  1.00 0.00 ? 107 LEU A HD12 2  
ATOM 3755  H HD13 . LEU A 1 88  ? 7.777   12.172  -5.799  1.00 0.00 ? 107 LEU A HD13 2  
ATOM 3756  H HD21 . LEU A 1 88  ? 5.868   11.819  -6.286  1.00 0.00 ? 107 LEU A HD21 2  
ATOM 3757  H HD22 . LEU A 1 88  ? 4.784   13.194  -6.507  1.00 0.00 ? 107 LEU A HD22 2  
ATOM 3758  H HD23 . LEU A 1 88  ? 4.611   12.152  -5.094  1.00 0.00 ? 107 LEU A HD23 2  
ATOM 3759  N N    . THR A 1 89  ? 7.643   16.075  -4.015  1.00 0.00 ? 108 THR A N    2  
ATOM 3760  C CA   . THR A 1 89  ? 7.860   17.229  -4.879  1.00 0.00 ? 108 THR A CA   2  
ATOM 3761  C C    . THR A 1 89  ? 8.859   16.906  -5.987  1.00 0.00 ? 108 THR A C    2  
ATOM 3762  O O    . THR A 1 89  ? 9.903   17.548  -6.100  1.00 0.00 ? 108 THR A O    2  
ATOM 3763  C CB   . THR A 1 89  ? 8.373   18.441  -4.078  1.00 0.00 ? 108 THR A CB   2  
ATOM 3764  O OG1  . THR A 1 89  ? 8.565   18.075  -2.706  1.00 0.00 ? 108 THR A OG1  2  
ATOM 3765  C CG2  . THR A 1 89  ? 7.393   19.601  -4.166  1.00 0.00 ? 108 THR A CG2  2  
ATOM 3766  H H    . THR A 1 89  ? 8.403   15.502  -3.781  1.00 0.00 ? 108 THR A H    2  
ATOM 3767  H HA   . THR A 1 89  ? 6.914   17.494  -5.327  1.00 0.00 ? 108 THR A HA   2  
ATOM 3768  H HB   . THR A 1 89  ? 9.319   18.754  -4.495  1.00 0.00 ? 108 THR A HB   2  
ATOM 3769  H HG1  . THR A 1 89  ? 9.471   18.261  -2.449  1.00 0.00 ? 108 THR A HG1  2  
ATOM 3770  H HG21 . THR A 1 89  ? 6.751   19.596  -3.298  1.00 0.00 ? 108 THR A HG21 2  
ATOM 3771  H HG22 . THR A 1 89  ? 6.794   19.500  -5.059  1.00 0.00 ? 108 THR A HG22 2  
ATOM 3772  H HG23 . THR A 1 89  ? 7.940   20.531  -4.204  1.00 0.00 ? 108 THR A HG23 2  
ATOM 3773  N N    . SER A 1 90  ? 8.529   15.909  -6.802  1.00 0.00 ? 109 SER A N    2  
ATOM 3774  C CA   . SER A 1 90  ? 9.399   15.504  -7.902  1.00 0.00 ? 109 SER A CA   2  
ATOM 3775  C C    . SER A 1 90  ? 8.647   14.622  -8.894  1.00 0.00 ? 109 SER A C    2  
ATOM 3776  O O    . SER A 1 90  ? 9.051   14.486  -10.049 1.00 0.00 ? 109 SER A O    2  
ATOM 3777  C CB   . SER A 1 90  ? 10.621  14.758  -7.365  1.00 0.00 ? 109 SER A CB   2  
ATOM 3778  O OG   . SER A 1 90  ? 11.818  15.447  -7.679  1.00 0.00 ? 109 SER A OG   2  
ATOM 3779  H H    . SER A 1 90  ? 7.684   15.436  -6.662  1.00 0.00 ? 109 SER A H    2  
ATOM 3780  H HA   . SER A 1 90  ? 9.728   16.397  -8.411  1.00 0.00 ? 109 SER A HA   2  
ATOM 3781  H HB2  . SER A 1 90  ? 10.543  14.670  -6.289  2.00 0.00 ? 109 SER A HB2  2  
ATOM 3782  H HB3  . SER A 1 90  ? 10.661  13.771  -7.806  2.00 0.00 ? 109 SER A HB3  2  
ATOM 3783  H HG   . SER A 1 90  ? 12.447  15.342  -6.962  1.00 0.00 ? 109 SER A HG   2  
ATOM 3784  N N    . ASN A 1 91  ? 7.551   14.025  -8.436  1.00 0.00 ? 110 ASN A N    2  
ATOM 3785  C CA   . ASN A 1 91  ? 6.740   13.154  -9.282  1.00 0.00 ? 110 ASN A CA   2  
ATOM 3786  C C    . ASN A 1 91  ? 7.556   11.968  -9.787  1.00 0.00 ? 110 ASN A C    2  
ATOM 3787  O O    . ASN A 1 91  ? 7.594   10.914  -9.151  1.00 0.00 ? 110 ASN A O    2  
ATOM 3788  C CB   . ASN A 1 91  ? 6.173   13.941  -10.465 1.00 0.00 ? 110 ASN A CB   2  
ATOM 3789  C CG   . ASN A 1 91  ? 5.563   15.271  -10.070 1.00 0.00 ? 110 ASN A CG   2  
ATOM 3790  O OD1  . ASN A 1 91  ? 4.562   15.319  -9.354  1.00 0.00 ? 110 ASN A OD1  2  
ATOM 3791  N ND2  . ASN A 1 91  ? 6.163   16.360  -10.536 4.00 0.00 ? 110 ASN A ND2  2  
ATOM 3792  H H    . ASN A 1 91  ? 7.280   14.173  -7.506  1.00 0.00 ? 110 ASN A H    2  
ATOM 3793  H HA   . ASN A 1 91  ? 5.922   12.784  -8.684  1.00 0.00 ? 110 ASN A HA   2  
ATOM 3794  H HB2  . ASN A 1 91  ? 6.967   14.130  -11.173 2.00 0.00 ? 110 ASN A HB2  2  
ATOM 3795  H HB3  . ASN A 1 91  ? 5.410   13.348  -10.947 2.00 0.00 ? 110 ASN A HB3  2  
ATOM 3796  H HD21 . ASN A 1 91  ? 6.957   16.245  -11.103 5.00 0.00 ? 110 ASN A HD21 2  
ATOM 3797  H HD22 . ASN A 1 91  ? 5.787   17.236  -10.295 5.00 0.00 ? 110 ASN A HD22 2  
ATOM 3798  N N    . THR A 1 92  ? 8.205   12.146  -10.934 1.00 0.00 ? 111 THR A N    2  
ATOM 3799  C CA   . THR A 1 92  ? 9.017   11.089  -11.525 1.00 0.00 ? 111 THR A CA   2  
ATOM 3800  C C    . THR A 1 92  ? 8.171   9.859   -11.839 1.00 0.00 ? 111 THR A C    2  
ATOM 3801  O O    . THR A 1 92  ? 7.543   9.779   -12.896 1.00 0.00 ? 111 THR A O    2  
ATOM 3802  C CB   . THR A 1 92  ? 10.173  10.680  -10.595 1.00 0.00 ? 111 THR A CB   2  
ATOM 3803  O OG1  . THR A 1 92  ? 10.769  11.845  -10.009 1.00 0.00 ? 111 THR A OG1  2  
ATOM 3804  C CG2  . THR A 1 92  ? 11.230  9.895   -11.357 1.00 0.00 ? 111 THR A CG2  2  
ATOM 3805  H H    . THR A 1 92  ? 8.134   13.008  -11.395 1.00 0.00 ? 111 THR A H    2  
ATOM 3806  H HA   . THR A 1 92  ? 9.439   11.467  -12.446 1.00 0.00 ? 111 THR A HA   2  
ATOM 3807  H HB   . THR A 1 92  ? 9.779   10.053  -9.808  1.00 0.00 ? 111 THR A HB   2  
ATOM 3808  H HG1  . THR A 1 92  ? 10.342  12.035  -9.170  1.00 0.00 ? 111 THR A HG1  2  
ATOM 3809  H HG21 . THR A 1 92  ? 12.204  10.101  -10.938 1.00 0.00 ? 111 THR A HG21 2  
ATOM 3810  H HG22 . THR A 1 92  ? 11.216  10.187  -12.396 1.00 0.00 ? 111 THR A HG22 2  
ATOM 3811  H HG23 . THR A 1 92  ? 11.020  8.838   -11.277 1.00 0.00 ? 111 THR A HG23 2  
ATOM 3812  N N    . SER A 1 93  ? 8.153   8.905   -10.914 1.00 0.00 ? 112 SER A N    2  
ATOM 3813  C CA   . SER A 1 93  ? 7.378   7.683   -11.092 1.00 0.00 ? 112 SER A CA   2  
ATOM 3814  C C    . SER A 1 93  ? 5.991   7.833   -10.474 1.00 0.00 ? 112 SER A C    2  
ATOM 3815  O O    . SER A 1 93  ? 5.057   8.293   -11.130 1.00 0.00 ? 112 SER A O    2  
ATOM 3816  C CB   . SER A 1 93  ? 8.106   6.493   -10.466 1.00 0.00 ? 112 SER A CB   2  
ATOM 3817  O OG   . SER A 1 93  ? 8.682   5.665   -11.461 1.00 0.00 ? 112 SER A OG   2  
ATOM 3818  H H    . SER A 1 93  ? 8.670   9.027   -10.091 1.00 0.00 ? 112 SER A H    2  
ATOM 3819  H HA   . SER A 1 93  ? 7.269   7.511   -12.152 1.00 0.00 ? 112 SER A HA   2  
ATOM 3820  H HB2  . SER A 1 93  ? 8.891   6.854   -9.817  2.00 0.00 ? 112 SER A HB2  2  
ATOM 3821  H HB3  . SER A 1 93  ? 7.405   5.907   -9.889  2.00 0.00 ? 112 SER A HB3  2  
ATOM 3822  H HG   . SER A 1 93  ? 9.488   6.070   -11.788 1.00 0.00 ? 112 SER A HG   2  
ATOM 3823  N N    . GLN A 1 94  ? 5.869   7.457   -9.203  1.00 0.00 ? 113 GLN A N    2  
ATOM 3824  C CA   . GLN A 1 94  ? 4.608   7.559   -8.484  1.00 0.00 ? 113 GLN A CA   2  
ATOM 3825  C C    . GLN A 1 94  ? 4.846   7.376   -6.990  1.00 0.00 ? 113 GLN A C    2  
ATOM 3826  O O    . GLN A 1 94  ? 5.508   8.206   -6.367  1.00 0.00 ? 113 GLN A O    2  
ATOM 3827  C CB   . GLN A 1 94  ? 3.594   6.532   -8.997  1.00 0.00 ? 113 GLN A CB   2  
ATOM 3828  C CG   . GLN A 1 94  ? 2.873   6.956   -10.267 1.00 0.00 ? 113 GLN A CG   2  
ATOM 3829  C CD   . GLN A 1 94  ? 1.973   8.159   -10.059 1.00 0.00 ? 113 GLN A CD   2  
ATOM 3830  O OE1  . GLN A 1 94  ? 0.967   8.082   -9.354  1.00 0.00 ? 113 GLN A OE1  2  
ATOM 3831  N NE2  . GLN A 1 94  ? 2.331   9.279   -10.675 4.00 0.00 ? 113 GLN A NE2  2  
ATOM 3832  H H    . GLN A 1 94  ? 6.655   7.114   -8.729  1.00 0.00 ? 113 GLN A H    2  
ATOM 3833  H HA   . GLN A 1 94  ? 4.217   8.551   -8.651  1.00 0.00 ? 113 GLN A HA   2  
ATOM 3834  H HB2  . GLN A 1 94  ? 4.107   5.605   -9.195  2.00 0.00 ? 113 GLN A HB2  2  
ATOM 3835  H HB3  . GLN A 1 94  ? 2.851   6.366   -8.232  2.00 0.00 ? 113 GLN A HB3  2  
ATOM 3836  H HG2  . GLN A 1 94  ? 3.607   7.201   -11.018 2.00 0.00 ? 113 GLN A HG2  2  
ATOM 3837  H HG3  . GLN A 1 94  ? 2.268   6.131   -10.613 2.00 0.00 ? 113 GLN A HG3  2  
ATOM 3838  H HE21 . GLN A 1 94  ? 3.147   9.268   -11.223 5.00 0.00 ? 113 GLN A HE21 2  
ATOM 3839  H HE22 . GLN A 1 94  ? 1.766   10.075  -10.558 5.00 0.00 ? 113 GLN A HE22 2  
ATOM 3840  N N    . TYR A 1 95  ? 4.320   6.293   -6.411  1.00 0.00 ? 114 TYR A N    2  
ATOM 3841  C CA   . TYR A 1 95  ? 4.498   6.042   -4.982  1.00 0.00 ? 114 TYR A CA   2  
ATOM 3842  C C    . TYR A 1 95  ? 3.558   4.949   -4.486  1.00 0.00 ? 114 TYR A C    2  
ATOM 3843  O O    . TYR A 1 95  ? 2.876   4.291   -5.272  1.00 0.00 ? 114 TYR A O    2  
ATOM 3844  C CB   . TYR A 1 95  ? 4.244   7.325   -4.186  1.00 0.00 ? 114 TYR A CB   2  
ATOM 3845  C CG   . TYR A 1 95  ? 3.276   8.289   -4.840  1.00 0.00 ? 114 TYR A CG   2  
ATOM 3846  C CD1  . TYR A 1 95  ? 1.976   7.902   -5.142  1.00 0.00 ? 114 TYR A CD1  2  
ATOM 3847  C CD2  . TYR A 1 95  ? 3.665   9.583   -5.162  1.00 0.00 ? 114 TYR A CD2  2  
ATOM 3848  C CE1  . TYR A 1 95  ? 1.095   8.779   -5.747  1.00 0.00 ? 114 TYR A CE1  2  
ATOM 3849  C CE2  . TYR A 1 95  ? 2.791   10.464  -5.766  1.00 0.00 ? 114 TYR A CE2  2  
ATOM 3850  C CZ   . TYR A 1 95  ? 1.507   10.058  -6.056  1.00 0.00 ? 114 TYR A CZ   2  
ATOM 3851  O OH   . TYR A 1 95  ? 0.632   10.931  -6.659  1.00 0.00 ? 114 TYR A OH   2  
ATOM 3852  H H    . TYR A 1 95  ? 3.809   5.649   -6.951  1.00 0.00 ? 114 TYR A H    2  
ATOM 3853  H HA   . TYR A 1 95  ? 5.518   5.725   -4.823  1.00 0.00 ? 114 TYR A HA   2  
ATOM 3854  H HB2  . TYR A 1 95  ? 3.844   7.063   -3.217  2.00 0.00 ? 114 TYR A HB2  2  
ATOM 3855  H HB3  . TYR A 1 95  ? 5.181   7.844   -4.048  2.00 0.00 ? 114 TYR A HB3  2  
ATOM 3856  H HD1  . TYR A 1 95  ? 1.657   6.900   -4.898  1.00 0.00 ? 114 TYR A HD1  2  
ATOM 3857  H HD2  . TYR A 1 95  ? 4.673   9.899   -4.932  1.00 0.00 ? 114 TYR A HD2  2  
ATOM 3858  H HE1  . TYR A 1 95  ? 0.089   8.460   -5.974  1.00 0.00 ? 114 TYR A HE1  2  
ATOM 3859  H HE2  . TYR A 1 95  ? 3.115   11.467  -6.005  1.00 0.00 ? 114 TYR A HE2  2  
ATOM 3860  H HH   . TYR A 1 95  ? 1.046   11.793  -6.744  1.00 0.00 ? 114 TYR A HH   2  
ATOM 3861  N N    . ASP A 1 96  ? 3.525   4.775   -3.168  1.00 0.00 ? 115 ASP A N    2  
ATOM 3862  C CA   . ASP A 1 96  ? 2.667   3.776   -2.539  1.00 0.00 ? 115 ASP A CA   2  
ATOM 3863  C C    . ASP A 1 96  ? 1.323   4.386   -2.158  1.00 0.00 ? 115 ASP A C    2  
ATOM 3864  O O    . ASP A 1 96  ? 0.944   5.441   -2.669  1.00 0.00 ? 115 ASP A O    2  
ATOM 3865  C CB   . ASP A 1 96  ? 3.347   3.201   -1.296  1.00 0.00 ? 115 ASP A CB   2  
ATOM 3866  C CG   . ASP A 1 96  ? 4.839   3.466   -1.270  1.00 0.00 ? 115 ASP A CG   2  
ATOM 3867  O OD1  . ASP A 1 96  ? 5.514   3.163   -2.276  1.00 0.00 ? 115 ASP A OD1  2  
ATOM 3868  O OD2  . ASP A 1 96  ? 5.334   3.976   -0.242  1.00 0.00 ? 115 ASP A OD2  2  
ATOM 3869  H H    . ASP A 1 96  ? 4.091   5.339   -2.602  1.00 0.00 ? 115 ASP A H    2  
ATOM 3870  H HA   . ASP A 1 96  ? 2.500   2.981   -3.251  1.00 0.00 ? 115 ASP A HA   2  
ATOM 3871  H HB2  . ASP A 1 96  ? 2.906   3.645   -0.416  2.00 0.00 ? 115 ASP A HB2  2  
ATOM 3872  H HB3  . ASP A 1 96  ? 3.189   2.133   -1.271  2.00 0.00 ? 115 ASP A HB3  2  
ATOM 3873  N N    . THR A 1 97  ? 0.603   3.720   -1.261  1.00 0.00 ? 116 THR A N    2  
ATOM 3874  C CA   . THR A 1 97  ? -0.699  4.207   -0.823  1.00 0.00 ? 116 THR A CA   2  
ATOM 3875  C C    . THR A 1 97  ? -1.111  3.591   0.512   1.00 0.00 ? 116 THR A C    2  
ATOM 3876  O O    . THR A 1 97  ? -0.958  2.389   0.727   1.00 0.00 ? 116 THR A O    2  
ATOM 3877  C CB   . THR A 1 97  ? -1.788  3.901   -1.873  1.00 0.00 ? 116 THR A CB   2  
ATOM 3878  O OG1  . THR A 1 97  ? -2.323  5.121   -2.398  1.00 0.00 ? 116 THR A OG1  2  
ATOM 3879  C CG2  . THR A 1 97  ? -2.912  3.070   -1.272  1.00 0.00 ? 116 THR A CG2  2  
ATOM 3880  H H    . THR A 1 97  ? 0.954   2.884   -0.889  1.00 0.00 ? 116 THR A H    2  
ATOM 3881  H HA   . THR A 1 97  ? -0.633  5.279   -0.708  1.00 0.00 ? 116 THR A HA   2  
ATOM 3882  H HB   . THR A 1 97  ? -1.338  3.339   -2.679  1.00 0.00 ? 116 THR A HB   2  
ATOM 3883  H HG1  . THR A 1 97  ? -3.166  5.307   -1.977  1.00 0.00 ? 116 THR A HG1  2  
ATOM 3884  H HG21 . THR A 1 97  ? -3.820  3.236   -1.831  1.00 0.00 ? 116 THR A HG21 2  
ATOM 3885  H HG22 . THR A 1 97  ? -3.064  3.359   -0.243  1.00 0.00 ? 116 THR A HG22 2  
ATOM 3886  H HG23 . THR A 1 97  ? -2.648  2.024   -1.317  1.00 0.00 ? 116 THR A HG23 2  
ATOM 3887  N N    . TYR A 1 98  ? -1.659  4.420   1.396   1.00 0.00 ? 117 TYR A N    2  
ATOM 3888  C CA   . TYR A 1 98  ? -2.124  3.955   2.698   1.00 0.00 ? 117 TYR A CA   2  
ATOM 3889  C C    . TYR A 1 98  ? -3.629  3.729   2.654   1.00 0.00 ? 117 TYR A C    2  
ATOM 3890  O O    . TYR A 1 98  ? -4.293  4.141   1.703   1.00 0.00 ? 117 TYR A O    2  
ATOM 3891  C CB   . TYR A 1 98  ? -1.808  4.976   3.791   1.00 0.00 ? 117 TYR A CB   2  
ATOM 3892  C CG   . TYR A 1 98  ? -0.349  5.104   4.161   1.00 0.00 ? 117 TYR A CG   2  
ATOM 3893  C CD1  . TYR A 1 98  ? 0.563   5.670   3.282   1.00 0.00 ? 117 TYR A CD1  2  
ATOM 3894  C CD2  . TYR A 1 98  ? 0.109   4.688   5.404   1.00 0.00 ? 117 TYR A CD2  2  
ATOM 3895  C CE1  . TYR A 1 98  ? 1.891   5.817   3.633   1.00 0.00 ? 117 TYR A CE1  2  
ATOM 3896  C CE2  . TYR A 1 98  ? 1.434   4.827   5.758   1.00 0.00 ? 117 TYR A CE2  2  
ATOM 3897  C CZ   . TYR A 1 98  ? 2.320   5.395   4.871   1.00 0.00 ? 117 TYR A CZ   2  
ATOM 3898  O OH   . TYR A 1 98  ? 3.641   5.545   5.224   1.00 0.00 ? 117 TYR A OH   2  
ATOM 3899  H H    . TYR A 1 98  ? -1.771  5.365   1.158   1.00 0.00 ? 117 TYR A H    2  
ATOM 3900  H HA   . TYR A 1 98  ? -1.629  3.021   2.922   1.00 0.00 ? 117 TYR A HA   2  
ATOM 3901  H HB2  . TYR A 1 98  ? -2.145  5.948   3.465   2.00 0.00 ? 117 TYR A HB2  2  
ATOM 3902  H HB3  . TYR A 1 98  ? -2.347  4.704   4.686   2.00 0.00 ? 117 TYR A HB3  2  
ATOM 3903  H HD1  . TYR A 1 98  ? 0.225   5.995   2.312   1.00 0.00 ? 117 TYR A HD1  2  
ATOM 3904  H HD2  . TYR A 1 98  ? -0.583  4.236   6.097   1.00 0.00 ? 117 TYR A HD2  2  
ATOM 3905  H HE1  . TYR A 1 98  ? 2.586   6.260   2.936   1.00 0.00 ? 117 TYR A HE1  2  
ATOM 3906  H HE2  . TYR A 1 98  ? 1.766   4.496   6.731   1.00 0.00 ? 117 TYR A HE2  2  
ATOM 3907  H HH   . TYR A 1 98  ? 4.036   6.245   4.698   1.00 0.00 ? 117 TYR A HH   2  
ATOM 3908  N N    . CYS A 1 99  ? -4.169  3.091   3.684   1.00 0.00 ? 118 CYS A N    2  
ATOM 3909  C CA   . CYS A 1 99  ? -5.604  2.837   3.745   1.00 0.00 ? 118 CYS A CA   2  
ATOM 3910  C C    . CYS A 1 99  ? -6.001  2.254   5.096   1.00 0.00 ? 118 CYS A C    2  
ATOM 3911  O O    . CYS A 1 99  ? -5.511  1.198   5.498   1.00 0.00 ? 118 CYS A O    2  
ATOM 3912  C CB   . CYS A 1 99  ? -6.030  1.897   2.615   1.00 0.00 ? 118 CYS A CB   2  
ATOM 3913  S SG   . CYS A 1 99  ? -6.506  2.726   1.063   1.00 0.00 ? 118 CYS A SG   2  
ATOM 3914  H H    . CYS A 1 99  ? -3.594  2.790   4.420   1.00 0.00 ? 118 CYS A H    2  
ATOM 3915  H HA   . CYS A 1 99  ? -6.108  3.784   3.618   1.00 0.00 ? 118 CYS A HA   2  
ATOM 3916  H HB2  . CYS A 1 99  ? -5.213  1.228   2.389   2.00 0.00 ? 118 CYS A HB2  2  
ATOM 3917  H HB3  . CYS A 1 99  ? -6.876  1.314   2.945   2.00 0.00 ? 118 CYS A HB3  2  
ATOM 3918  N N    . PHE A 1 100 ? -6.898  2.948   5.792   1.00 0.00 ? 119 PHE A N    2  
ATOM 3919  C CA   . PHE A 1 100 ? -7.369  2.498   7.095   1.00 0.00 ? 119 PHE A CA   2  
ATOM 3920  C C    . PHE A 1 100 ? -8.601  1.619   6.940   1.00 0.00 ? 119 PHE A C    2  
ATOM 3921  O O    . PHE A 1 100 ? -9.668  2.087   6.545   1.00 0.00 ? 119 PHE A O    2  
ATOM 3922  C CB   . PHE A 1 100 ? -7.687  3.692   7.999   1.00 0.00 ? 119 PHE A CB   2  
ATOM 3923  C CG   . PHE A 1 100 ? -8.394  3.361   9.284   1.00 0.00 ? 119 PHE A CG   2  
ATOM 3924  C CD1  . PHE A 1 100 ? -9.741  3.034   9.288   1.00 0.00 ? 119 PHE A CD1  2  
ATOM 3925  C CD2  . PHE A 1 100 ? -7.712  3.383   10.490  1.00 0.00 ? 119 PHE A CD2  2  
ATOM 3926  C CE1  . PHE A 1 100 ? -10.391 2.735   10.468  1.00 0.00 ? 119 PHE A CE1  2  
ATOM 3927  C CE2  . PHE A 1 100 ? -8.357  3.084   11.672  1.00 0.00 ? 119 PHE A CE2  2  
ATOM 3928  C CZ   . PHE A 1 100 ? -9.698  2.759   11.661  1.00 0.00 ? 119 PHE A CZ   2  
ATOM 3929  H H    . PHE A 1 100 ? -7.255  3.778   5.417   1.00 0.00 ? 119 PHE A H    2  
ATOM 3930  H HA   . PHE A 1 100 ? -6.578  1.916   7.547   1.00 0.00 ? 119 PHE A HA   2  
ATOM 3931  H HB2  . PHE A 1 100 ? -6.760  4.181   8.257   2.00 0.00 ? 119 PHE A HB2  2  
ATOM 3932  H HB3  . PHE A 1 100 ? -8.306  4.395   7.457   2.00 0.00 ? 119 PHE A HB3  2  
ATOM 3933  H HD1  . PHE A 1 100 ? -10.284 3.010   8.357   1.00 0.00 ? 119 PHE A HD1  2  
ATOM 3934  H HD2  . PHE A 1 100 ? -6.663  3.636   10.501  1.00 0.00 ? 119 PHE A HD2  2  
ATOM 3935  H HE1  . PHE A 1 100 ? -11.441 2.483   10.457  1.00 0.00 ? 119 PHE A HE1  2  
ATOM 3936  H HE2  . PHE A 1 100 ? -7.814  3.103   12.605  1.00 0.00 ? 119 PHE A HE2  2  
ATOM 3937  H HZ   . PHE A 1 100 ? -10.204 2.526   12.582  1.00 0.00 ? 119 PHE A HZ   2  
ATOM 3938  N N    . ASN A 1 101 ? -8.438  0.339   7.242   1.00 0.00 ? 120 ASN A N    2  
ATOM 3939  C CA   . ASN A 1 101 ? -9.522  -0.618  7.129   1.00 0.00 ? 120 ASN A CA   2  
ATOM 3940  C C    . ASN A 1 101 ? -10.150 -0.912  8.485   1.00 0.00 ? 120 ASN A C    2  
ATOM 3941  O O    . ASN A 1 101 ? -9.450  -1.210  9.453   1.00 0.00 ? 120 ASN A O    2  
ATOM 3942  C CB   . ASN A 1 101 ? -8.995  -1.910  6.522   1.00 0.00 ? 120 ASN A CB   2  
ATOM 3943  C CG   . ASN A 1 101 ? -8.000  -2.613  7.425   1.00 0.00 ? 120 ASN A CG   2  
ATOM 3944  O OD1  . ASN A 1 101 ? -8.242  -3.730  7.884   1.00 0.00 ? 120 ASN A OD1  2  
ATOM 3945  N ND2  . ASN A 1 101 ? -6.874  -1.961  7.687   4.00 0.00 ? 120 ASN A ND2  2  
ATOM 3946  H H    . ASN A 1 101 ? -7.562  0.025   7.537   1.00 0.00 ? 120 ASN A H    2  
ATOM 3947  H HA   . ASN A 1 101 ? -10.273 -0.201  6.477   1.00 0.00 ? 120 ASN A HA   2  
ATOM 3948  H HB2  . ASN A 1 101 ? -9.820  -2.574  6.345   2.00 0.00 ? 120 ASN A HB2  2  
ATOM 3949  H HB3  . ASN A 1 101 ? -8.508  -1.689  5.584   2.00 0.00 ? 120 ASN A HB3  2  
ATOM 3950  H HD21 . ASN A 1 101 ? -6.748  -1.073  7.285   5.00 0.00 ? 120 ASN A HD21 2  
ATOM 3951  H HD22 . ASN A 1 101 ? -6.210  -2.394  8.269   5.00 0.00 ? 120 ASN A HD22 2  
ATOM 3952  N N    . ALA A 1 102 ? -11.476 -0.847  8.545   1.00 0.00 ? 121 ALA A N    2  
ATOM 3953  C CA   . ALA A 1 102 ? -12.193 -1.130  9.778   1.00 0.00 ? 121 ALA A CA   2  
ATOM 3954  C C    . ALA A 1 102 ? -11.910 -2.558  10.229  1.00 0.00 ? 121 ALA A C    2  
ATOM 3955  O O    . ALA A 1 102 ? -12.076 -2.899  11.401  1.00 0.00 ? 121 ALA A O    2  
ATOM 3956  C CB   . ALA A 1 102 ? -13.687 -0.916  9.587   1.00 0.00 ? 121 ALA A CB   2  
ATOM 3957  H H    . ALA A 1 102 ? -11.981 -0.617  7.737   1.00 0.00 ? 121 ALA A H    2  
ATOM 3958  H HA   . ALA A 1 102 ? -11.843 -0.444  10.537  1.00 0.00 ? 121 ALA A HA   2  
ATOM 3959  H HB1  . ALA A 1 102 ? -14.232 -1.691  10.106  1.00 0.00 ? 121 ALA A HB1  2  
ATOM 3960  H HB2  . ALA A 1 102 ? -13.924 -0.954  8.533   1.00 0.00 ? 121 ALA A HB2  2  
ATOM 3961  H HB3  . ALA A 1 102 ? -13.967 0.048   9.983   1.00 0.00 ? 121 ALA A HB3  2  
ATOM 3962  N N    . SER A 1 103 ? -11.470 -3.386  9.284   1.00 0.00 ? 122 SER A N    2  
ATOM 3963  C CA   . SER A 1 103 ? -11.147 -4.779  9.568   1.00 0.00 ? 122 SER A CA   2  
ATOM 3964  C C    . SER A 1 103 ? -9.903  -4.869  10.444  1.00 0.00 ? 122 SER A C    2  
ATOM 3965  O O    . SER A 1 103 ? -9.646  -5.893  11.076  1.00 0.00 ? 122 SER A O    2  
ATOM 3966  C CB   . SER A 1 103 ? -10.925 -5.550  8.263   1.00 0.00 ? 122 SER A CB   2  
ATOM 3967  O OG   . SER A 1 103 ? -12.093 -5.544  7.462   1.00 0.00 ? 122 SER A OG   2  
ATOM 3968  H H    . SER A 1 103 ? -11.352 -3.046  8.372   1.00 0.00 ? 122 SER A H    2  
ATOM 3969  H HA   . SER A 1 103 ? -11.981 -5.213  10.097  1.00 0.00 ? 122 SER A HA   2  
ATOM 3970  H HB2  . SER A 1 103 ? -10.118 -5.093  7.706   2.00 0.00 ? 122 SER A HB2  2  
ATOM 3971  H HB3  . SER A 1 103 ? -10.667 -6.574  8.493   2.00 0.00 ? 122 SER A HB3  2  
ATOM 3972  H HG   . SER A 1 103 ? -12.866 -5.460  8.024   1.00 0.00 ? 122 SER A HG   2  
ATOM 3973  N N    . ALA A 1 104 ? -9.137  -3.784  10.477  1.00 0.00 ? 123 ALA A N    2  
ATOM 3974  C CA   . ALA A 1 104 ? -7.918  -3.729  11.274  1.00 0.00 ? 123 ALA A CA   2  
ATOM 3975  C C    . ALA A 1 104 ? -8.209  -3.215  12.679  1.00 0.00 ? 123 ALA A C    2  
ATOM 3976  O O    . ALA A 1 104 ? -8.977  -2.270  12.859  1.00 0.00 ? 123 ALA A O    2  
ATOM 3977  C CB   . ALA A 1 104 ? -6.882  -2.849  10.593  1.00 0.00 ? 123 ALA A CB   2  
ATOM 3978  H H    . ALA A 1 104 ? -9.397  -2.999  9.952   1.00 0.00 ? 123 ALA A H    2  
ATOM 3979  H HA   . ALA A 1 104 ? -7.518  -4.731  11.342  1.00 0.00 ? 123 ALA A HA   2  
ATOM 3980  H HB1  . ALA A 1 104 ? -7.319  -1.888  10.367  1.00 0.00 ? 123 ALA A HB1  2  
ATOM 3981  H HB2  . ALA A 1 104 ? -6.556  -3.320  9.677   1.00 0.00 ? 123 ALA A HB2  2  
ATOM 3982  H HB3  . ALA A 1 104 ? -6.036  -2.716  11.249  1.00 0.00 ? 123 ALA A HB3  2  
ATOM 3983  N N    . PRO A 1 105 ? -7.597  -3.839  13.697  1.00 0.00 ? 124 PRO A N    2  
ATOM 3984  C CA   . PRO A 1 105 ? -7.792  -3.449  15.099  1.00 0.00 ? 124 PRO A CA   2  
ATOM 3985  C C    . PRO A 1 105 ? -7.424  -1.990  15.358  1.00 0.00 ? 124 PRO A C    2  
ATOM 3986  O O    . PRO A 1 105 ? -6.527  -1.438  14.716  1.00 0.00 ? 124 PRO A O    2  
ATOM 3987  C CB   . PRO A 1 105 ? -6.849  -4.383  15.865  1.00 0.00 ? 124 PRO A CB   2  
ATOM 3988  C CG   . PRO A 1 105 ? -6.635  -5.542  14.953  1.00 0.00 ? 124 PRO A CG   2  
ATOM 3989  C CD   . PRO A 1 105 ? -6.674  -4.977  13.564  1.00 0.00 ? 124 PRO A CD   2  
ATOM 3990  H HA   . PRO A 1 105 ? -8.809  -3.623  15.417  1.00 0.00 ? 124 PRO A HA   2  
ATOM 3991  H HB2  . PRO A 1 105 ? -5.923  -3.869  16.075  2.00 0.00 ? 124 PRO A HB2  2  
ATOM 3992  H HB3  . PRO A 1 105 ? -7.315  -4.689  16.791  2.00 0.00 ? 124 PRO A HB3  2  
ATOM 3993  H HG2  . PRO A 1 105 ? -5.673  -5.993  15.150  2.00 0.00 ? 124 PRO A HG2  2  
ATOM 3994  H HG3  . PRO A 1 105 ? -7.425  -6.266  15.087  2.00 0.00 ? 124 PRO A HG3  2  
ATOM 3995  H HD2  . PRO A 1 105 ? -5.692  -4.644  13.262  2.00 0.00 ? 124 PRO A HD2  2  
ATOM 3996  H HD3  . PRO A 1 105 ? -7.059  -5.708  12.868  2.00 0.00 ? 124 PRO A HD3  2  
ATOM 3997  N N    . PRO A 1 106 ? -8.124  -1.349  16.311  1.00 0.00 ? 125 PRO A N    2  
ATOM 3998  C CA   . PRO A 1 106 ? -7.883  0.051   16.671  1.00 0.00 ? 125 PRO A CA   2  
ATOM 3999  C C    . PRO A 1 106 ? -6.647  0.219   17.548  1.00 0.00 ? 125 PRO A C    2  
ATOM 4000  O O    . PRO A 1 106 ? -6.705  0.845   18.607  1.00 0.00 ? 125 PRO A O    2  
ATOM 4001  C CB   . PRO A 1 106 ? -9.141  0.415   17.448  1.00 0.00 ? 125 PRO A CB   2  
ATOM 4002  C CG   . PRO A 1 106 ? -9.573  -0.857  18.086  1.00 0.00 ? 125 PRO A CG   2  
ATOM 4003  C CD   . PRO A 1 106 ? -9.211  -1.952  17.114  1.00 0.00 ? 125 PRO A CD   2  
ATOM 4004  H HA   . PRO A 1 106 ? -7.798  0.678   15.797  1.00 0.00 ? 125 PRO A HA   2  
ATOM 4005  H HB2  . PRO A 1 106 ? -8.905  1.168   18.186  2.00 0.00 ? 125 PRO A HB2  2  
ATOM 4006  H HB3  . PRO A 1 106 ? -9.891  0.793   16.769  2.00 0.00 ? 125 PRO A HB3  2  
ATOM 4007  H HG2  . PRO A 1 106 ? -9.049  -0.996  19.020  2.00 0.00 ? 125 PRO A HG2  2  
ATOM 4008  H HG3  . PRO A 1 106 ? -10.640 -0.841  18.251  2.00 0.00 ? 125 PRO A HG3  2  
ATOM 4009  H HD2  . PRO A 1 106 ? -8.858  -2.826  17.644  2.00 0.00 ? 125 PRO A HD2  2  
ATOM 4010  H HD3  . PRO A 1 106 ? -10.057 -2.199  16.490  2.00 0.00 ? 125 PRO A HD3  2  
ATOM 4011  N N    . GLU A 1 107 ? -5.529  -0.342  17.097  1.00 0.00 ? 126 GLU A N    2  
ATOM 4012  C CA   . GLU A 1 107 ? -4.274  -0.263  17.825  1.00 0.00 ? 126 GLU A CA   2  
ATOM 4013  C C    . GLU A 1 107 ? -3.185  -1.018  17.080  1.00 0.00 ? 126 GLU A C    2  
ATOM 4014  O O    . GLU A 1 107 ? -3.404  -2.123  16.588  1.00 0.00 ? 126 GLU A O    2  
ATOM 4015  C CB   . GLU A 1 107 ? -4.415  -0.830  19.240  1.00 0.00 ? 126 GLU A CB   2  
ATOM 4016  C CG   . GLU A 1 107 ? -5.676  -1.651  19.464  1.00 0.00 ? 126 GLU A CG   2  
ATOM 4017  C CD   . GLU A 1 107 ? -5.401  -2.972  20.155  1.00 0.00 ? 126 GLU A CD   2  
ATOM 4018  O OE1  . GLU A 1 107 ? -4.402  -3.631  19.801  1.00 0.00 ? 126 GLU A OE1  2  
ATOM 4019  O OE2  . GLU A 1 107 ? -6.187  -3.348  21.050  1.00 0.00 ? 126 GLU A OE2  2  
ATOM 4020  H H    . GLU A 1 107 ? -5.544  -0.818  16.245  1.00 0.00 ? 126 GLU A H    2  
ATOM 4021  H HA   . GLU A 1 107 ? -3.994  0.779   17.890  1.00 0.00 ? 126 GLU A HA   2  
ATOM 4022  H HB2  . GLU A 1 107 ? -3.564  -1.462  19.444  2.00 0.00 ? 126 GLU A HB2  2  
ATOM 4023  H HB3  . GLU A 1 107 ? -4.414  -0.010  19.940  2.00 0.00 ? 126 GLU A HB3  2  
ATOM 4024  H HG2  . GLU A 1 107 ? -6.359  -1.078  20.074  2.00 0.00 ? 126 GLU A HG2  2  
ATOM 4025  H HG3  . GLU A 1 107 ? -6.134  -1.852  18.507  2.00 0.00 ? 126 GLU A HG3  2  
ATOM 4026  N N    . GLU A 1 108 ? -2.015  -0.409  17.010  1.00 0.00 ? 127 GLU A N    2  
ATOM 4027  C CA   . GLU A 1 108 ? -0.863  -1.008  16.342  1.00 0.00 ? 127 GLU A CA   2  
ATOM 4028  C C    . GLU A 1 108 ? -1.075  -2.501  16.100  1.00 0.00 ? 127 GLU A C    2  
ATOM 4029  O O    . GLU A 1 108 ? -1.048  -3.297  17.039  1.00 0.00 ? 127 GLU A O    2  
ATOM 4030  C CB   . GLU A 1 108 ? 0.360   -0.804  17.221  1.00 0.00 ? 127 GLU A CB   2  
ATOM 4031  C CG   . GLU A 1 108 ? 0.037   -0.607  18.691  1.00 0.00 ? 127 GLU A CG   2  
ATOM 4032  C CD   . GLU A 1 108 ? 1.089   0.194   19.431  1.00 0.00 ? 127 GLU A CD   2  
ATOM 4033  O OE1  . GLU A 1 108 ? 2.275   -0.192  19.378  1.00 0.00 ? 127 GLU A OE1  2  
ATOM 4034  O OE2  . GLU A 1 108 ? 0.726   1.208   20.066  1.00 0.00 ? 127 GLU A OE2  2  
ATOM 4035  H H    . GLU A 1 108 ? -1.916  0.471   17.430  1.00 0.00 ? 127 GLU A H    2  
ATOM 4036  H HA   . GLU A 1 108 ? -0.713  -0.508  15.399  1.00 0.00 ? 127 GLU A HA   2  
ATOM 4037  H HB2  . GLU A 1 108 ? 1.004   -1.667  17.130  2.00 0.00 ? 127 GLU A HB2  2  
ATOM 4038  H HB3  . GLU A 1 108 ? 0.899   0.066   16.873  2.00 0.00 ? 127 GLU A HB3  2  
ATOM 4039  H HG2  . GLU A 1 108 ? -0.914  -0.089  18.766  2.00 0.00 ? 127 GLU A HG2  2  
ATOM 4040  H HG3  . GLU A 1 108 ? -0.051  -1.578  19.156  2.00 0.00 ? 127 GLU A HG3  2  
ATOM 4041  N N    . ASP A 1 109 ? -1.288  -2.881  14.844  1.00 0.00 ? 128 ASP A N    2  
ATOM 4042  C CA   . ASP A 1 109 ? -1.504  -4.282  14.505  1.00 0.00 ? 128 ASP A CA   2  
ATOM 4043  C C    . ASP A 1 109 ? -0.786  -4.661  13.211  1.00 0.00 ? 128 ASP A C    2  
ATOM 4044  O O    . ASP A 1 109 ? -1.199  -4.267  12.121  1.00 0.00 ? 128 ASP A O    2  
ATOM 4045  C CB   . ASP A 1 109 ? -2.999  -4.572  14.376  1.00 0.00 ? 128 ASP A CB   2  
ATOM 4046  C CG   . ASP A 1 109 ? -3.545  -5.432  15.500  1.00 0.00 ? 128 ASP A CG   2  
ATOM 4047  O OD1  . ASP A 1 109 ? -3.836  -4.879  16.581  1.00 0.00 ? 128 ASP A OD1  2  
ATOM 4048  O OD2  . ASP A 1 109 ? -3.680  -6.657  15.298  1.00 0.00 ? 128 ASP A OD2  2  
ATOM 4049  H H    . ASP A 1 109 ? -1.302  -2.207  14.131  1.00 0.00 ? 128 ASP A H    2  
ATOM 4050  H HA   . ASP A 1 109 ? -1.102  -4.880  15.309  1.00 0.00 ? 128 ASP A HA   2  
ATOM 4051  H HB2  . ASP A 1 109 ? -3.539  -3.637  14.373  2.00 0.00 ? 128 ASP A HB2  2  
ATOM 4052  H HB3  . ASP A 1 109 ? -3.179  -5.083  13.442  2.00 0.00 ? 128 ASP A HB3  2  
ATOM 4053  N N    . CYS A 1 110 ? 0.285   -5.437  13.343  1.00 0.00 ? 129 CYS A N    2  
ATOM 4054  C CA   . CYS A 1 110 ? 1.057   -5.883  12.188  1.00 0.00 ? 129 CYS A CA   2  
ATOM 4055  C C    . CYS A 1 110 ? 0.720   -7.331  11.849  1.00 0.00 ? 129 CYS A C    2  
ATOM 4056  O O    . CYS A 1 110 ? 1.465   -8.005  11.139  1.00 0.00 ? 129 CYS A O    2  
ATOM 4057  C CB   . CYS A 1 110 ? 2.556   -5.747  12.467  1.00 0.00 ? 129 CYS A CB   2  
ATOM 4058  S SG   . CYS A 1 110 ? 3.564   -5.368  10.993  1.00 0.00 ? 129 CYS A SG   2  
ATOM 4059  H H    . CYS A 1 110 ? 0.560   -5.724  14.239  1.00 0.00 ? 129 CYS A H    2  
ATOM 4060  H HA   . CYS A 1 110 ? 0.795   -5.256  11.348  1.00 0.00 ? 129 CYS A HA   2  
ATOM 4061  H HB2  . CYS A 1 110 ? 2.711   -4.952  13.181  2.00 0.00 ? 129 CYS A HB2  2  
ATOM 4062  H HB3  . CYS A 1 110 ? 2.921   -6.674  12.884  2.00 0.00 ? 129 CYS A HB3  2  
ATOM 4063  N N    . THR A 1 111 ? -0.409  -7.801  12.372  1.00 0.00 ? 130 THR A N    2  
ATOM 4064  C CA   . THR A 1 111 ? -0.856  -9.169  12.140  1.00 0.00 ? 130 THR A CA   2  
ATOM 4065  C C    . THR A 1 111 ? -0.809  -9.528  10.660  1.00 0.00 ? 130 THR A C    2  
ATOM 4066  O O    . THR A 1 111 ? -0.642  -8.660  9.803   1.00 0.00 ? 130 THR A O    2  
ATOM 4067  C CB   . THR A 1 111 ? -2.286  -9.390  12.665  1.00 0.00 ? 130 THR A CB   2  
ATOM 4068  O OG1  . THR A 1 111 ? -3.006  -8.152  12.661  1.00 0.00 ? 130 THR A OG1  2  
ATOM 4069  C CG2  . THR A 1 111 ? -2.264  -9.966  14.072  1.00 0.00 ? 130 THR A CG2  2  
ATOM 4070  H H    . THR A 1 111 ? -0.955  -7.214  12.934  1.00 0.00 ? 130 THR A H    2  
ATOM 4071  H HA   . THR A 1 111 ? -0.193  -9.828  12.681  1.00 0.00 ? 130 THR A HA   2  
ATOM 4072  H HB   . THR A 1 111 ? -2.787  -10.092 12.013  1.00 0.00 ? 130 THR A HB   2  
ATOM 4073  H HG1  . THR A 1 111 ? -3.892  -8.295  13.003  1.00 0.00 ? 130 THR A HG1  2  
ATOM 4074  H HG21 . THR A 1 111 ? -1.462  -10.685 14.154  1.00 0.00 ? 130 THR A HG21 2  
ATOM 4075  H HG22 . THR A 1 111 ? -3.207  -10.452 14.278  1.00 0.00 ? 130 THR A HG22 2  
ATOM 4076  H HG23 . THR A 1 111 ? -2.107  -9.170  14.785  1.00 0.00 ? 130 THR A HG23 2  
ATOM 4077  N N    . SER A 1 112 ? -0.955  -10.816 10.368  1.00 0.00 ? 131 SER A N    2  
ATOM 4078  C CA   . SER A 1 112 ? -0.927  -11.297 8.992   1.00 0.00 ? 131 SER A CA   2  
ATOM 4079  C C    . SER A 1 112 ? -2.185  -10.880 8.236   1.00 0.00 ? 131 SER A C    2  
ATOM 4080  O O    . SER A 1 112 ? -3.259  -11.447 8.437   1.00 0.00 ? 131 SER A O    2  
ATOM 4081  C CB   . SER A 1 112 ? -0.788  -12.820 8.967   1.00 0.00 ? 131 SER A CB   2  
ATOM 4082  O OG   . SER A 1 112 ? -1.627  -13.423 9.936   1.00 0.00 ? 131 SER A OG   2  
ATOM 4083  H H    . SER A 1 112 ? -1.083  -11.460 11.096  1.00 0.00 ? 131 SER A H    2  
ATOM 4084  H HA   . SER A 1 112 ? -0.069  -10.859 8.507   1.00 0.00 ? 131 SER A HA   2  
ATOM 4085  H HB2  . SER A 1 112 ? -1.065  -13.189 7.988   2.00 0.00 ? 131 SER A HB2  2  
ATOM 4086  H HB3  . SER A 1 112 ? 0.238   -13.090 9.178   2.00 0.00 ? 131 SER A HB3  2  
ATOM 4087  H HG   . SER A 1 112 ? -2.499  -13.565 9.562   1.00 0.00 ? 131 SER A HG   2  
ATOM 4088  N N    . VAL A 1 113 ? -2.043  -9.888  7.361   1.00 0.00 ? 132 VAL A N    2  
ATOM 4089  C CA   . VAL A 1 113 ? -3.165  -9.402  6.569   1.00 0.00 ? 132 VAL A CA   2  
ATOM 4090  C C    . VAL A 1 113 ? -3.853  -10.552 5.842   1.00 0.00 ? 132 VAL A C    2  
ATOM 4091  O O    . VAL A 1 113 ? -4.873  -11.066 6.301   1.00 0.00 ? 132 VAL A O    2  
ATOM 4092  C CB   . VAL A 1 113 ? -2.711  -8.336  5.548   1.00 0.00 ? 132 VAL A CB   2  
ATOM 4093  C CG1  . VAL A 1 113 ? -3.685  -8.235  4.384   2.00 0.00 ? 132 VAL A CG1  2  
ATOM 4094  C CG2  . VAL A 1 113 ? -2.553  -6.979  6.219   2.00 0.00 ? 132 VAL A CG2  2  
ATOM 4095  H H    . VAL A 1 113 ? -1.160  -9.479  7.242   1.00 0.00 ? 132 VAL A H    2  
ATOM 4096  H HA   . VAL A 1 113 ? -3.872  -8.946  7.241   1.00 0.00 ? 132 VAL A HA   2  
ATOM 4097  H HB   . VAL A 1 113 ? -1.749  -8.637  5.159   1.00 0.00 ? 132 VAL A HB   2  
ATOM 4098  H HG11 . VAL A 1 113 ? -3.433  -7.378  3.778   1.00 0.00 ? 132 VAL A HG11 2  
ATOM 4099  H HG12 . VAL A 1 113 ? -4.690  -8.124  4.764   1.00 0.00 ? 132 VAL A HG12 2  
ATOM 4100  H HG13 . VAL A 1 113 ? -3.623  -9.130  3.784   1.00 0.00 ? 132 VAL A HG13 2  
ATOM 4101  H HG21 . VAL A 1 113 ? -3.266  -6.284  5.801   1.00 0.00 ? 132 VAL A HG21 2  
ATOM 4102  H HG22 . VAL A 1 113 ? -1.551  -6.611  6.053   1.00 0.00 ? 132 VAL A HG22 2  
ATOM 4103  H HG23 . VAL A 1 113 ? -2.727  -7.080  7.280   1.00 0.00 ? 132 VAL A HG23 2  
ATOM 4104  N N    . THR A 1 114 ? -3.282  -10.953 4.712   1.00 0.00 ? 133 THR A N    2  
ATOM 4105  C CA   . THR A 1 114 ? -3.829  -12.049 3.915   1.00 0.00 ? 133 THR A CA   2  
ATOM 4106  C C    . THR A 1 114 ? -5.340  -11.920 3.759   1.00 0.00 ? 133 THR A C    2  
ATOM 4107  O O    . THR A 1 114 ? -6.022  -12.872 3.379   1.00 0.00 ? 133 THR A O    2  
ATOM 4108  C CB   . THR A 1 114 ? -3.512  -13.415 4.552   1.00 0.00 ? 133 THR A CB   2  
ATOM 4109  O OG1  . THR A 1 114 ? -3.477  -14.431 3.543   1.00 0.00 ? 133 THR A OG1  2  
ATOM 4110  C CG2  . THR A 1 114 ? -4.551  -13.774 5.604   1.00 0.00 ? 133 THR A CG2  2  
ATOM 4111  H H    . THR A 1 114 ? -2.469  -10.501 4.409   1.00 0.00 ? 133 THR A H    2  
ATOM 4112  H HA   . THR A 1 114 ? -3.371  -12.016 2.939   1.00 0.00 ? 133 THR A HA   2  
ATOM 4113  H HB   . THR A 1 114 ? -2.543  -13.358 5.029   1.00 0.00 ? 133 THR A HB   2  
ATOM 4114  H HG1  . THR A 1 114 ? -3.306  -14.029 2.688   1.00 0.00 ? 133 THR A HG1  2  
ATOM 4115  H HG21 . THR A 1 114 ? -5.316  -13.012 5.627   1.00 0.00 ? 133 THR A HG21 2  
ATOM 4116  H HG22 . THR A 1 114 ? -4.076  -13.838 6.572   1.00 0.00 ? 133 THR A HG22 2  
ATOM 4117  H HG23 . THR A 1 114 ? -4.997  -14.726 5.359   1.00 0.00 ? 133 THR A HG23 2  
ATOM 4118  N N    . ASP A 1 115 ? -5.856  -10.738 4.065   1.00 0.00 ? 134 ASP A N    2  
ATOM 4119  C CA   . ASP A 1 115 ? -7.286  -10.482 3.975   1.00 0.00 ? 134 ASP A CA   2  
ATOM 4120  C C    . ASP A 1 115 ? -7.715  -10.181 2.541   1.00 0.00 ? 134 ASP A C    2  
ATOM 4121  O O    . ASP A 1 115 ? -7.883  -11.090 1.728   1.00 0.00 ? 134 ASP A O    2  
ATOM 4122  C CB   . ASP A 1 115 ? -7.672  -9.319  4.890   1.00 0.00 ? 134 ASP A CB   2  
ATOM 4123  C CG   . ASP A 1 115 ? -7.926  -9.757  6.319   1.00 0.00 ? 134 ASP A CG   2  
ATOM 4124  O OD1  . ASP A 1 115 ? -8.950  -10.429 6.560   1.00 0.00 ? 134 ASP A OD1  2  
ATOM 4125  O OD2  . ASP A 1 115 ? -7.099  -9.429  7.197   1.00 0.00 ? 134 ASP A OD2  2  
ATOM 4126  H H    . ASP A 1 115 ? -5.260  -10.023 4.370   1.00 0.00 ? 134 ASP A H    2  
ATOM 4127  H HA   . ASP A 1 115 ? -7.800  -11.371 4.309   1.00 0.00 ? 134 ASP A HA   2  
ATOM 4128  H HB2  . ASP A 1 115 ? -6.870  -8.591  4.894   2.00 0.00 ? 134 ASP A HB2  2  
ATOM 4129  H HB3  . ASP A 1 115 ? -8.572  -8.854  4.511   2.00 0.00 ? 134 ASP A HB3  2  
ATOM 4130  N N    . LEU A 1 116 ? -7.905  -8.898  2.247   1.00 0.00 ? 135 LEU A N    2  
ATOM 4131  C CA   . LEU A 1 116 ? -8.335  -8.464  0.921   1.00 0.00 ? 135 LEU A CA   2  
ATOM 4132  C C    . LEU A 1 116 ? -9.557  -9.257  0.455   1.00 0.00 ? 135 LEU A C    2  
ATOM 4133  O O    . LEU A 1 116 ? -9.669  -9.603  -0.722  1.00 0.00 ? 135 LEU A O    2  
ATOM 4134  C CB   . LEU A 1 116 ? -7.208  -8.626  -0.099  1.00 0.00 ? 135 LEU A CB   2  
ATOM 4135  C CG   . LEU A 1 116 ? -5.806  -8.783  0.493   1.00 0.00 ? 135 LEU A CG   2  
ATOM 4136  C CD1  . LEU A 1 116 ? -4.756  -8.771  -0.603  2.00 0.00 ? 135 LEU A CD1  2  
ATOM 4137  C CD2  . LEU A 1 116 ? -5.523  -7.676  1.490   2.00 0.00 ? 135 LEU A CD2  2  
ATOM 4138  H H    . LEU A 1 116 ? -7.764  -8.226  2.944   1.00 0.00 ? 135 LEU A H    2  
ATOM 4139  H HA   . LEU A 1 116 ? -8.597  -7.419  0.989   1.00 0.00 ? 135 LEU A HA   2  
ATOM 4140  H HB2  . LEU A 1 116 ? -7.427  -9.495  -0.701  2.00 0.00 ? 135 LEU A HB2  2  
ATOM 4141  H HB3  . LEU A 1 116 ? -7.207  -7.760  -0.743  2.00 0.00 ? 135 LEU A HB3  2  
ATOM 4142  H HG   . LEU A 1 116 ? -5.743  -9.728  1.012   1.00 0.00 ? 135 LEU A HG   2  
ATOM 4143  H HD11 . LEU A 1 116 ? -5.224  -8.544  -1.550  1.00 0.00 ? 135 LEU A HD11 2  
ATOM 4144  H HD12 . LEU A 1 116 ? -4.283  -9.741  -0.659  1.00 0.00 ? 135 LEU A HD12 2  
ATOM 4145  H HD13 . LEU A 1 116 ? -4.013  -8.019  -0.379  1.00 0.00 ? 135 LEU A HD13 2  
ATOM 4146  H HD21 . LEU A 1 116 ? -6.298  -6.926  1.421   1.00 0.00 ? 135 LEU A HD21 2  
ATOM 4147  H HD22 . LEU A 1 116 ? -4.567  -7.228  1.264   1.00 0.00 ? 135 LEU A HD22 2  
ATOM 4148  H HD23 . LEU A 1 116 ? -5.504  -8.086  2.488   1.00 0.00 ? 135 LEU A HD23 2  
ATOM 4149  N N    . PRO A 1 117 ? -10.489 -9.563  1.373   1.00 0.00 ? 136 PRO A N    2  
ATOM 4150  C CA   . PRO A 1 117 ? -11.701 -10.328 1.048   1.00 0.00 ? 136 PRO A CA   2  
ATOM 4151  C C    . PRO A 1 117 ? -12.645 -9.583  0.113   1.00 0.00 ? 136 PRO A C    2  
ATOM 4152  O O    . PRO A 1 117 ? -13.695 -10.102 -0.266  1.00 0.00 ? 136 PRO A O    2  
ATOM 4153  C CB   . PRO A 1 117 ? -12.382 -10.524 2.402   1.00 0.00 ? 136 PRO A CB   2  
ATOM 4154  C CG   . PRO A 1 117 ? -11.836 -9.439  3.265   1.00 0.00 ? 136 PRO A CG   2  
ATOM 4155  C CD   . PRO A 1 117 ? -10.431 -9.197  2.799   1.00 0.00 ? 136 PRO A CD   2  
ATOM 4156  H HA   . PRO A 1 117 ? -11.460 -11.290 0.624   1.00 0.00 ? 136 PRO A HA   2  
ATOM 4157  H HB2  . PRO A 1 117 ? -13.447 -10.423 2.278   2.00 0.00 ? 136 PRO A HB2  2  
ATOM 4158  H HB3  . PRO A 1 117 ? -12.146 -11.502 2.794   2.00 0.00 ? 136 PRO A HB3  2  
ATOM 4159  H HG2  . PRO A 1 117 ? -12.429 -8.545  3.149   2.00 0.00 ? 136 PRO A HG2  2  
ATOM 4160  H HG3  . PRO A 1 117 ? -11.837 -9.758  4.297   2.00 0.00 ? 136 PRO A HG3  2  
ATOM 4161  H HD2  . PRO A 1 117 ? -10.166 -8.157  2.920   2.00 0.00 ? 136 PRO A HD2  2  
ATOM 4162  H HD3  . PRO A 1 117 ? -9.740  -9.832  3.334   2.00 0.00 ? 136 PRO A HD3  2  
ATOM 4163  N N    . ASN A 1 118 ? -12.275 -8.363  -0.245  1.00 0.00 ? 137 ASN A N    2  
ATOM 4164  C CA   . ASN A 1 118 ? -13.106 -7.545  -1.124  1.00 0.00 ? 137 ASN A CA   2  
ATOM 4165  C C    . ASN A 1 118 ? -12.767 -7.772  -2.594  1.00 0.00 ? 137 ASN A C    2  
ATOM 4166  O O    . ASN A 1 118 ? -13.524 -7.373  -3.479  1.00 0.00 ? 137 ASN A O    2  
ATOM 4167  C CB   . ASN A 1 118 ? -12.956 -6.062  -0.780  1.00 0.00 ? 137 ASN A CB   2  
ATOM 4168  C CG   . ASN A 1 118 ? -14.133 -5.524  0.010   1.00 0.00 ? 137 ASN A CG   2  
ATOM 4169  O OD1  . ASN A 1 118 ? -15.087 -4.994  -0.560  1.00 0.00 ? 137 ASN A OD1  2  
ATOM 4170  N ND2  . ASN A 1 118 ? -14.071 -5.658  1.329   4.00 0.00 ? 137 ASN A ND2  2  
ATOM 4171  H H    . ASN A 1 118 ? -11.432 -8.004  0.100   1.00 0.00 ? 137 ASN A H    2  
ATOM 4172  H HA   . ASN A 1 118 ? -14.133 -7.833  -0.962  1.00 0.00 ? 137 ASN A HA   2  
ATOM 4173  H HB2  . ASN A 1 118 ? -12.062 -5.926  -0.192  2.00 0.00 ? 137 ASN A HB2  2  
ATOM 4174  H HB3  . ASN A 1 118 ? -12.871 -5.494  -1.696  2.00 0.00 ? 137 ASN A HB3  2  
ATOM 4175  H HD21 . ASN A 1 118 ? -13.277 -6.091  1.715   5.00 0.00 ? 137 ASN A HD21 2  
ATOM 4176  H HD22 . ASN A 1 118 ? -14.821 -5.317  1.866   5.00 0.00 ? 137 ASN A HD22 2  
ATOM 4177  N N    . ALA A 1 119 ? -11.632 -8.413  -2.852  1.00 0.00 ? 138 ALA A N    2  
ATOM 4178  C CA   . ALA A 1 119 ? -11.217 -8.685  -4.222  1.00 0.00 ? 138 ALA A CA   2  
ATOM 4179  C C    . ALA A 1 119 ? -12.230 -9.582  -4.927  1.00 0.00 ? 138 ALA A C    2  
ATOM 4180  O O    . ALA A 1 119 ? -13.385 -9.674  -4.511  1.00 0.00 ? 138 ALA A O    2  
ATOM 4181  C CB   . ALA A 1 119 ? -9.832  -9.313  -4.248  1.00 0.00 ? 138 ALA A CB   2  
ATOM 4182  H H    . ALA A 1 119 ? -11.067 -8.711  -2.109  1.00 0.00 ? 138 ALA A H    2  
ATOM 4183  H HA   . ALA A 1 119 ? -11.167 -7.740  -4.745  1.00 0.00 ? 138 ALA A HA   2  
ATOM 4184  H HB1  . ALA A 1 119 ? -9.311  -8.993  -5.141  1.00 0.00 ? 138 ALA A HB1  2  
ATOM 4185  H HB2  . ALA A 1 119 ? -9.924  -10.388 -4.251  1.00 0.00 ? 138 ALA A HB2  2  
ATOM 4186  H HB3  . ALA A 1 119 ? -9.278  -9.000  -3.376  1.00 0.00 ? 138 ALA A HB3  2  
ATOM 4187  N N    . PHE A 1 120 ? -11.797 -10.236 -5.998  1.00 0.00 ? 139 PHE A N    2  
ATOM 4188  C CA   . PHE A 1 120 ? -12.678 -11.117 -6.758  1.00 0.00 ? 139 PHE A CA   2  
ATOM 4189  C C    . PHE A 1 120 ? -11.981 -12.431 -7.097  1.00 0.00 ? 139 PHE A C    2  
ATOM 4190  O O    . PHE A 1 120 ? -10.753 -12.517 -7.082  1.00 0.00 ? 139 PHE A O    2  
ATOM 4191  C CB   . PHE A 1 120 ? -13.145 -10.424 -8.042  1.00 0.00 ? 139 PHE A CB   2  
ATOM 4192  C CG   . PHE A 1 120 ? -12.189 -9.402  -8.593  1.00 0.00 ? 139 PHE A CG   2  
ATOM 4193  C CD1  . PHE A 1 120 ? -11.753 -8.346  -7.808  1.00 0.00 ? 139 PHE A CD1  2  
ATOM 4194  C CD2  . PHE A 1 120 ? -11.725 -9.499  -9.894  1.00 0.00 ? 139 PHE A CD2  2  
ATOM 4195  C CE1  . PHE A 1 120 ? -10.872 -7.409  -8.309  1.00 0.00 ? 139 PHE A CE1  2  
ATOM 4196  C CE2  . PHE A 1 120 ? -10.843 -8.564  -10.402 1.00 0.00 ? 139 PHE A CE2  2  
ATOM 4197  C CZ   . PHE A 1 120 ? -10.415 -7.517  -9.608  1.00 0.00 ? 139 PHE A CZ   2  
ATOM 4198  H H    . PHE A 1 120 ? -10.868 -10.121 -6.288  1.00 0.00 ? 139 PHE A H    2  
ATOM 4199  H HA   . PHE A 1 120 ? -13.539 -11.330 -6.144  1.00 0.00 ? 139 PHE A HA   2  
ATOM 4200  H HB2  . PHE A 1 120 ? -13.300 -11.174 -8.807  2.00 0.00 ? 139 PHE A HB2  2  
ATOM 4201  H HB3  . PHE A 1 120 ? -14.084 -9.924  -7.848  2.00 0.00 ? 139 PHE A HB3  2  
ATOM 4202  H HD1  . PHE A 1 120 ? -12.109 -8.259  -6.792  1.00 0.00 ? 139 PHE A HD1  2  
ATOM 4203  H HD2  . PHE A 1 120 ? -12.058 -10.317 -10.516 1.00 0.00 ? 139 PHE A HD2  2  
ATOM 4204  H HE1  . PHE A 1 120 ? -10.539 -6.592  -7.685  1.00 0.00 ? 139 PHE A HE1  2  
ATOM 4205  H HE2  . PHE A 1 120 ? -10.488 -8.652  -11.418 1.00 0.00 ? 139 PHE A HE2  2  
ATOM 4206  H HZ   . PHE A 1 120 ? -9.725  -6.787  -10.000 1.00 0.00 ? 139 PHE A HZ   2  
ATOM 4207  N N    . ASP A 1 121 ? -12.776 -13.451 -7.401  1.00 0.00 ? 140 ASP A N    2  
ATOM 4208  C CA   . ASP A 1 121 ? -12.244 -14.766 -7.743  1.00 0.00 ? 140 ASP A CA   2  
ATOM 4209  C C    . ASP A 1 121 ? -11.242 -14.668 -8.890  1.00 0.00 ? 140 ASP A C    2  
ATOM 4210  O O    . ASP A 1 121 ? -11.370 -13.817 -9.769  1.00 0.00 ? 140 ASP A O    2  
ATOM 4211  C CB   . ASP A 1 121 ? -13.380 -15.716 -8.122  1.00 0.00 ? 140 ASP A CB   2  
ATOM 4212  C CG   . ASP A 1 121 ? -14.060 -15.325 -9.421  1.00 0.00 ? 140 ASP A CG   2  
ATOM 4213  O OD1  . ASP A 1 121 ? -15.003 -14.508 -9.375  1.00 0.00 ? 140 ASP A OD1  2  
ATOM 4214  O OD2  . ASP A 1 121 ? -13.648 -15.836 -10.483 1.00 0.00 ? 140 ASP A OD2  2  
ATOM 4215  H H    . ASP A 1 121 ? -13.747 -13.318 -7.394  1.00 0.00 ? 140 ASP A H    2  
ATOM 4216  H HA   . ASP A 1 121 ? -11.738 -15.154 -6.872  1.00 0.00 ? 140 ASP A HA   2  
ATOM 4217  H HB2  . ASP A 1 121 ? -12.985 -16.714 -8.232  2.00 0.00 ? 140 ASP A HB2  2  
ATOM 4218  H HB3  . ASP A 1 121 ? -14.121 -15.712 -7.337  2.00 0.00 ? 140 ASP A HB3  2  
ATOM 4219  N N    . GLY A 1 122 ? -10.246 -15.547 -8.872  1.00 0.00 ? 141 GLY A N    2  
ATOM 4220  C CA   . GLY A 1 122 ? -9.236  -15.545 -9.915  1.00 0.00 ? 141 GLY A CA   2  
ATOM 4221  C C    . GLY A 1 122 ? -7.940  -16.195 -9.470  1.00 0.00 ? 141 GLY A C    2  
ATOM 4222  O O    . GLY A 1 122 ? -7.559  -16.092 -8.305  1.00 0.00 ? 141 GLY A O    2  
ATOM 4223  H H    . GLY A 1 122 ? -10.195 -16.203 -8.146  1.00 0.00 ? 141 GLY A H    2  
ATOM 4224  H HA2  . GLY A 1 122 ? -9.620  -16.082 -10.772 2.00 0.00 ? 141 GLY A HA2  2  
ATOM 4225  H HA3  . GLY A 1 122 ? -9.034  -14.523 -10.203 2.00 0.00 ? 141 GLY A HA3  2  
ATOM 4226  N N    . PRO A 1 123 ? -7.238  -16.880 -10.386 1.00 0.00 ? 142 PRO A N    2  
ATOM 4227  C CA   . PRO A 1 123 ? -5.973  -17.555 -10.080 1.00 0.00 ? 142 PRO A CA   2  
ATOM 4228  C C    . PRO A 1 123 ? -4.856  -16.573 -9.740  1.00 0.00 ? 142 PRO A C    2  
ATOM 4229  O O    . PRO A 1 123 ? -3.689  -16.957 -9.647  1.00 0.00 ? 142 PRO A O    2  
ATOM 4230  C CB   . PRO A 1 123 ? -5.636  -18.313 -11.374 1.00 0.00 ? 142 PRO A CB   2  
ATOM 4231  C CG   . PRO A 1 123 ? -6.899  -18.316 -12.172 1.00 0.00 ? 142 PRO A CG   2  
ATOM 4232  C CD   . PRO A 1 123 ? -7.623  -17.059 -11.790 1.00 0.00 ? 142 PRO A CD   2  
ATOM 4233  H HA   . PRO A 1 123 ? -6.089  -18.259 -9.269  1.00 0.00 ? 142 PRO A HA   2  
ATOM 4234  H HB2  . PRO A 1 123 ? -4.842  -17.799 -11.896 2.00 0.00 ? 142 PRO A HB2  2  
ATOM 4235  H HB3  . PRO A 1 123 ? -5.321  -19.318 -11.133 2.00 0.00 ? 142 PRO A HB3  2  
ATOM 4236  H HG2  . PRO A 1 123 ? -6.669  -18.310 -13.227 2.00 0.00 ? 142 PRO A HG2  2  
ATOM 4237  H HG3  . PRO A 1 123 ? -7.492  -19.181 -11.919 2.00 0.00 ? 142 PRO A HG3  2  
ATOM 4238  H HD2  . PRO A 1 123 ? -7.287  -16.228 -12.393 2.00 0.00 ? 142 PRO A HD2  2  
ATOM 4239  H HD3  . PRO A 1 123 ? -8.691  -17.192 -11.885 2.00 0.00 ? 142 PRO A HD3  2  
ATOM 4240  N N    . ILE A 1 124 ? -5.213  -15.305 -9.556  1.00 0.00 ? 143 ILE A N    2  
ATOM 4241  C CA   . ILE A 1 124 ? -4.231  -14.278 -9.231  1.00 0.00 ? 143 ILE A CA   2  
ATOM 4242  C C    . ILE A 1 124 ? -3.581  -14.543 -7.877  1.00 0.00 ? 143 ILE A C    2  
ATOM 4243  O O    . ILE A 1 124 ? -4.201  -14.350 -6.832  1.00 0.00 ? 143 ILE A O    2  
ATOM 4244  C CB   . ILE A 1 124 ? -4.864  -12.874 -9.210  1.00 0.00 ? 143 ILE A CB   2  
ATOM 4245  C CG1  . ILE A 1 124 ? -5.188  -12.415 -10.634 1.00 0.00 ? 143 ILE A CG1  2  
ATOM 4246  C CG2  . ILE A 1 124 ? -3.932  -11.883 -8.524  1.00 0.00 ? 143 ILE A CG2  2  
ATOM 4247  C CD1  . ILE A 1 124 ? -5.146  -10.914 -10.825 1.00 0.00 ? 143 ILE A CD1  2  
ATOM 4248  H H    . ILE A 1 124 ? -6.157  -15.054 -9.644  1.00 0.00 ? 143 ILE A H    2  
ATOM 4249  H HA   . ILE A 1 124 ? -3.467  -14.291 -9.993  1.00 0.00 ? 143 ILE A HA   2  
ATOM 4250  H HB   . ILE A 1 124 ? -5.778  -12.924 -8.639  1.00 0.00 ? 143 ILE A HB   2  
ATOM 4251  H HG12 . ILE A 1 124 ? -4.476  -12.853 -11.317 2.00 0.00 ? 143 ILE A HG12 2  
ATOM 4252  H HG13 . ILE A 1 124 ? -6.179  -12.753 -10.896 2.00 0.00 ? 143 ILE A HG13 2  
ATOM 4253  H HG21 . ILE A 1 124 ? -3.008  -11.817 -9.078  1.00 0.00 ? 143 ILE A HG21 2  
ATOM 4254  H HG22 . ILE A 1 124 ? -3.727  -12.221 -7.519  1.00 0.00 ? 143 ILE A HG22 2  
ATOM 4255  H HG23 . ILE A 1 124 ? -4.403  -10.913 -8.488  1.00 0.00 ? 143 ILE A HG23 2  
ATOM 4256  H HD11 . ILE A 1 124 ? -5.828  -10.632 -11.613 1.00 0.00 ? 143 ILE A HD11 2  
ATOM 4257  H HD12 . ILE A 1 124 ? -4.144  -10.613 -11.090 1.00 0.00 ? 143 ILE A HD12 2  
ATOM 4258  H HD13 . ILE A 1 124 ? -5.438  -10.427 -9.906  1.00 0.00 ? 143 ILE A HD13 2  
ATOM 4259  N N    . THR A 1 125 ? -2.327  -14.979 -7.903  1.00 0.00 ? 144 THR A N    2  
ATOM 4260  C CA   . THR A 1 125 ? -1.594  -15.260 -6.676  1.00 0.00 ? 144 THR A CA   2  
ATOM 4261  C C    . THR A 1 125 ? -1.354  -13.976 -5.891  1.00 0.00 ? 144 THR A C    2  
ATOM 4262  O O    . THR A 1 125 ? -0.300  -13.352 -6.011  1.00 0.00 ? 144 THR A O    2  
ATOM 4263  C CB   . THR A 1 125 ? -0.240  -15.932 -6.968  1.00 0.00 ? 144 THR A CB   2  
ATOM 4264  O OG1  . THR A 1 125 ? -0.357  -16.801 -8.102  1.00 0.00 ? 144 THR A OG1  2  
ATOM 4265  C CG2  . THR A 1 125 ? 0.242   -16.724 -5.763  1.00 0.00 ? 144 THR A CG2  2  
ATOM 4266  H H    . THR A 1 125 ? -1.883  -15.109 -8.767  1.00 0.00 ? 144 THR A H    2  
ATOM 4267  H HA   . THR A 1 125 ? -2.188  -15.935 -6.076  1.00 0.00 ? 144 THR A HA   2  
ATOM 4268  H HB   . THR A 1 125 ? 0.487   -15.163 -7.189  1.00 0.00 ? 144 THR A HB   2  
ATOM 4269  H HG1  . THR A 1 125 ? -1.283  -17.000 -8.258  1.00 0.00 ? 144 THR A HG1  2  
ATOM 4270  H HG21 . THR A 1 125 ? 1.214   -17.146 -5.974  1.00 0.00 ? 144 THR A HG21 2  
ATOM 4271  H HG22 . THR A 1 125 ? -0.456  -17.521 -5.553  1.00 0.00 ? 144 THR A HG22 2  
ATOM 4272  H HG23 . THR A 1 125 ? 0.311   -16.071 -4.906  1.00 0.00 ? 144 THR A HG23 2  
ATOM 4273  N N    . ILE A 1 126 ? -2.343  -13.581 -5.097  1.00 0.00 ? 145 ILE A N    2  
ATOM 4274  C CA   . ILE A 1 126 ? -2.241  -12.365 -4.302  1.00 0.00 ? 145 ILE A CA   2  
ATOM 4275  C C    . ILE A 1 126 ? -1.423  -12.595 -3.037  1.00 0.00 ? 145 ILE A C    2  
ATOM 4276  O O    . ILE A 1 126 ? -1.966  -12.943 -1.988  1.00 0.00 ? 145 ILE A O    2  
ATOM 4277  C CB   . ILE A 1 126 ? -3.631  -11.832 -3.906  1.00 0.00 ? 145 ILE A CB   2  
ATOM 4278  C CG1  . ILE A 1 126 ? -4.446  -11.487 -5.154  1.00 0.00 ? 145 ILE A CG1  2  
ATOM 4279  C CG2  . ILE A 1 126 ? -3.494  -10.613 -3.001  1.00 0.00 ? 145 ILE A CG2  2  
ATOM 4280  C CD1  . ILE A 1 126 ? -5.820  -10.926 -4.857  1.00 0.00 ? 145 ILE A CD1  2  
ATOM 4281  H H    . ILE A 1 126 ? -3.162  -14.117 -5.050  1.00 0.00 ? 145 ILE A H    2  
ATOM 4282  H HA   . ILE A 1 126 ? -1.750  -11.614 -4.903  1.00 0.00 ? 145 ILE A HA   2  
ATOM 4283  H HB   . ILE A 1 126 ? -4.144  -12.605 -3.354  1.00 0.00 ? 145 ILE A HB   2  
ATOM 4284  H HG12 . ILE A 1 126 ? -3.907  -10.752 -5.733  2.00 0.00 ? 145 ILE A HG12 2  
ATOM 4285  H HG13 . ILE A 1 126 ? -4.573  -12.378 -5.750  2.00 0.00 ? 145 ILE A HG13 2  
ATOM 4286  H HG21 . ILE A 1 126 ? -2.649  -10.018 -3.321  1.00 0.00 ? 145 ILE A HG21 2  
ATOM 4287  H HG22 . ILE A 1 126 ? -3.339  -10.936 -1.981  1.00 0.00 ? 145 ILE A HG22 2  
ATOM 4288  H HG23 . ILE A 1 126 ? -4.393  -10.018 -3.056  1.00 0.00 ? 145 ILE A HG23 2  
ATOM 4289  H HD11 . ILE A 1 126 ? -5.721  -9.987  -4.332  1.00 0.00 ? 145 ILE A HD11 2  
ATOM 4290  H HD12 . ILE A 1 126 ? -6.369  -11.626 -4.242  1.00 0.00 ? 145 ILE A HD12 2  
ATOM 4291  H HD13 . ILE A 1 126 ? -6.352  -10.767 -5.783  1.00 0.00 ? 145 ILE A HD13 2  
ATOM 4292  N N    . THR A 1 127 ? -0.116  -12.383 -3.139  1.00 0.00 ? 146 THR A N    2  
ATOM 4293  C CA   . THR A 1 127 ? 0.774   -12.549 -2.003  1.00 0.00 ? 146 THR A CA   2  
ATOM 4294  C C    . THR A 1 127 ? 1.142   -11.192 -1.415  1.00 0.00 ? 146 THR A C    2  
ATOM 4295  O O    . THR A 1 127 ? 1.875   -10.419 -2.028  1.00 0.00 ? 146 THR A O    2  
ATOM 4296  C CB   . THR A 1 127 ? 2.060   -13.294 -2.396  1.00 0.00 ? 146 THR A CB   2  
ATOM 4297  O OG1  . THR A 1 127 ? 1.759   -14.654 -2.729  1.00 0.00 ? 146 THR A OG1  2  
ATOM 4298  C CG2  . THR A 1 127 ? 3.064   -13.252 -1.257  1.00 0.00 ? 146 THR A CG2  2  
ATOM 4299  H H    . THR A 1 127 ? 0.257   -12.097 -3.998  1.00 0.00 ? 146 THR A H    2  
ATOM 4300  H HA   . THR A 1 127 ? 0.258   -13.132 -1.253  1.00 0.00 ? 146 THR A HA   2  
ATOM 4301  H HB   . THR A 1 127 ? 2.493   -12.806 -3.256  1.00 0.00 ? 146 THR A HB   2  
ATOM 4302  H HG1  . THR A 1 127 ? 1.480   -14.705 -3.645  1.00 0.00 ? 146 THR A HG1  2  
ATOM 4303  H HG21 . THR A 1 127 ? 3.853   -12.556 -1.498  1.00 0.00 ? 146 THR A HG21 2  
ATOM 4304  H HG22 . THR A 1 127 ? 3.482   -14.237 -1.110  1.00 0.00 ? 146 THR A HG22 2  
ATOM 4305  H HG23 . THR A 1 127 ? 2.565   -12.934 -0.353  1.00 0.00 ? 146 THR A HG23 2  
ATOM 4306  N N    . ILE A 1 128 ? 0.613   -10.902 -0.233  1.00 0.00 ? 147 ILE A N    2  
ATOM 4307  C CA   . ILE A 1 128 ? 0.870   -9.627  0.426   1.00 0.00 ? 147 ILE A CA   2  
ATOM 4308  C C    . ILE A 1 128 ? 2.060   -9.703  1.376   1.00 0.00 ? 147 ILE A C    2  
ATOM 4309  O O    . ILE A 1 128 ? 2.060   -10.481 2.331   1.00 0.00 ? 147 ILE A O    2  
ATOM 4310  C CB   . ILE A 1 128 ? -0.367  -9.150  1.206   1.00 0.00 ? 147 ILE A CB   2  
ATOM 4311  C CG1  . ILE A 1 128 ? -1.643  -9.619  0.510   1.00 0.00 ? 147 ILE A CG1  2  
ATOM 4312  C CG2  . ILE A 1 128 ? -0.362  -7.639  1.343   1.00 0.00 ? 147 ILE A CG2  2  
ATOM 4313  C CD1  . ILE A 1 128 ? -2.316  -10.779 1.200   1.00 0.00 ? 147 ILE A CD1  2  
ATOM 4314  H H    . ILE A 1 128 ? 0.025   -11.554 0.202   1.00 0.00 ? 147 ILE A H    2  
ATOM 4315  H HA   . ILE A 1 128 ? 1.085   -8.897  -0.341  1.00 0.00 ? 147 ILE A HA   2  
ATOM 4316  H HB   . ILE A 1 128 ? -0.328  -9.578  2.196   1.00 0.00 ? 147 ILE A HB   2  
ATOM 4317  H HG12 . ILE A 1 128 ? -2.346  -8.801  0.473   2.00 0.00 ? 147 ILE A HG12 2  
ATOM 4318  H HG13 . ILE A 1 128 ? -1.404  -9.925  -0.498  2.00 0.00 ? 147 ILE A HG13 2  
ATOM 4319  H HG21 . ILE A 1 128 ? -1.077  -7.348  2.098   1.00 0.00 ? 147 ILE A HG21 2  
ATOM 4320  H HG22 . ILE A 1 128 ? -0.632  -7.191  0.399   1.00 0.00 ? 147 ILE A HG22 2  
ATOM 4321  H HG23 . ILE A 1 128 ? 0.623   -7.307  1.633   1.00 0.00 ? 147 ILE A HG23 2  
ATOM 4322  H HD11 . ILE A 1 128 ? -3.292  -10.940 0.765   1.00 0.00 ? 147 ILE A HD11 2  
ATOM 4323  H HD12 . ILE A 1 128 ? -2.422  -10.556 2.251   1.00 0.00 ? 147 ILE A HD12 2  
ATOM 4324  H HD13 . ILE A 1 128 ? -1.713  -11.669 1.077   1.00 0.00 ? 147 ILE A HD13 2  
ATOM 4325  N N    . VAL A 1 129 ? 3.071   -8.882  1.108   1.00 0.00 ? 148 VAL A N    2  
ATOM 4326  C CA   . VAL A 1 129 ? 4.269   -8.840  1.937   1.00 0.00 ? 148 VAL A CA   2  
ATOM 4327  C C    . VAL A 1 129 ? 4.205   -7.686  2.935   1.00 0.00 ? 148 VAL A C    2  
ATOM 4328  O O    . VAL A 1 129 ? 4.298   -6.521  2.554   1.00 0.00 ? 148 VAL A O    2  
ATOM 4329  C CB   . VAL A 1 129 ? 5.537   -8.679  1.079   1.00 0.00 ? 148 VAL A CB   2  
ATOM 4330  C CG1  . VAL A 1 129 ? 6.788   -8.800  1.936   2.00 0.00 ? 148 VAL A CG1  2  
ATOM 4331  C CG2  . VAL A 1 129 ? 5.562   -9.703  -0.045  2.00 0.00 ? 148 VAL A CG2  2  
ATOM 4332  H H    . VAL A 1 129 ? 3.006   -8.285  0.333   1.00 0.00 ? 148 VAL A H    2  
ATOM 4333  H HA   . VAL A 1 129 ? 4.337   -9.771  2.477   1.00 0.00 ? 148 VAL A HA   2  
ATOM 4334  H HB   . VAL A 1 129 ? 5.517   -7.691  0.642   1.00 0.00 ? 148 VAL A HB   2  
ATOM 4335  H HG11 . VAL A 1 129 ? 7.633   -9.038  1.307   1.00 0.00 ? 148 VAL A HG11 2  
ATOM 4336  H HG12 . VAL A 1 129 ? 6.651   -9.584  2.665   1.00 0.00 ? 148 VAL A HG12 2  
ATOM 4337  H HG13 . VAL A 1 129 ? 6.970   -7.863  2.442   1.00 0.00 ? 148 VAL A HG13 2  
ATOM 4338  H HG21 . VAL A 1 129 ? 5.607   -9.193  -0.996  1.00 0.00 ? 148 VAL A HG21 2  
ATOM 4339  H HG22 . VAL A 1 129 ? 4.667   -10.307 -0.002  1.00 0.00 ? 148 VAL A HG22 2  
ATOM 4340  H HG23 . VAL A 1 129 ? 6.429   -10.338 0.065   1.00 0.00 ? 148 VAL A HG23 2  
ATOM 4341  N N    . ASN A 1 130 ? 4.048   -8.017  4.213   1.00 0.00 ? 149 ASN A N    2  
ATOM 4342  C CA   . ASN A 1 130 ? 3.973   -7.001  5.258   1.00 0.00 ? 149 ASN A CA   2  
ATOM 4343  C C    . ASN A 1 130 ? 5.365   -6.542  5.683   1.00 0.00 ? 149 ASN A C    2  
ATOM 4344  O O    . ASN A 1 130 ? 6.318   -7.324  5.673   1.00 0.00 ? 149 ASN A O    2  
ATOM 4345  C CB   . ASN A 1 130 ? 3.206   -7.538  6.468   1.00 0.00 ? 149 ASN A CB   2  
ATOM 4346  C CG   . ASN A 1 130 ? 1.711   -7.314  6.360   1.00 0.00 ? 149 ASN A CG   2  
ATOM 4347  O OD1  . ASN A 1 130 ? 1.074   -6.834  7.297   1.00 0.00 ? 149 ASN A OD1  2  
ATOM 4348  N ND2  . ASN A 1 130 ? 1.141   -7.663  5.213   4.00 0.00 ? 149 ASN A ND2  2  
ATOM 4349  H H    . ASN A 1 130 ? 3.981   -8.963  4.459   1.00 0.00 ? 149 ASN A H    2  
ATOM 4350  H HA   . ASN A 1 130 ? 3.438   -6.154  4.855   1.00 0.00 ? 149 ASN A HA   2  
ATOM 4351  H HB2  . ASN A 1 130 ? 3.386   -8.602  6.557   2.00 0.00 ? 149 ASN A HB2  2  
ATOM 4352  H HB3  . ASN A 1 130 ? 3.562   -7.042  7.361   2.00 0.00 ? 149 ASN A HB3  2  
ATOM 4353  H HD21 . ASN A 1 130 ? 1.712   -8.042  4.507   5.00 0.00 ? 149 ASN A HD21 2  
ATOM 4354  H HD22 . ASN A 1 130 ? 0.173   -7.529  5.115   5.00 0.00 ? 149 ASN A HD22 2  
ATOM 4355  N N    . ARG A 1 131 ? 5.472   -5.268  6.051   1.00 0.00 ? 150 ARG A N    2  
ATOM 4356  C CA   . ARG A 1 131 ? 6.742   -4.690  6.479   1.00 0.00 ? 150 ARG A CA   2  
ATOM 4357  C C    . ARG A 1 131 ? 7.376   -5.510  7.598   1.00 0.00 ? 150 ARG A C    2  
ATOM 4358  O O    . ARG A 1 131 ? 8.574   -5.396  7.861   1.00 0.00 ? 150 ARG A O    2  
ATOM 4359  C CB   . ARG A 1 131 ? 6.535   -3.248  6.948   1.00 0.00 ? 150 ARG A CB   2  
ATOM 4360  C CG   . ARG A 1 131 ? 6.990   -2.203  5.942   1.00 0.00 ? 150 ARG A CG   2  
ATOM 4361  C CD   . ARG A 1 131 ? 8.474   -1.896  6.065   1.00 0.00 ? 150 ARG A CD   2  
ATOM 4362  N NE   . ARG A 1 131 ? 8.864   -0.746  5.254   1.00 0.00 ? 150 ARG A NE   2  
ATOM 4363  C CZ   . ARG A 1 131 ? 10.091  -0.236  5.240   4.00 0.00 ? 150 ARG A CZ   2  
ATOM 4364  N NH1  . ARG A 1 131 ? 11.048  -0.770  5.989   5.00 0.00 ? 150 ARG A NH1  2  
ATOM 4365  N NH2  . ARG A 1 131 ? 10.374  0.811   4.478   5.00 0.00 ? 150 ARG A NH2  2  
ATOM 4366  H H    . ARG A 1 131 ? 4.673   -4.700  6.035   1.00 0.00 ? 150 ARG A H    2  
ATOM 4367  H HA   . ARG A 1 131 ? 7.408   -4.689  5.629   1.00 0.00 ? 150 ARG A HA   2  
ATOM 4368  H HB2  . ARG A 1 131 ? 5.485   -3.094  7.145   2.00 0.00 ? 150 ARG A HB2  2  
ATOM 4369  H HB3  . ARG A 1 131 ? 7.089   -3.097  7.863   2.00 0.00 ? 150 ARG A HB3  2  
ATOM 4370  H HG2  . ARG A 1 131 ? 6.791   -2.568  4.945   2.00 0.00 ? 150 ARG A HG2  2  
ATOM 4371  H HG3  . ARG A 1 131 ? 6.431   -1.293  6.107   2.00 0.00 ? 150 ARG A HG3  2  
ATOM 4372  H HD2  . ARG A 1 131 ? 8.700   -1.688  7.100   2.00 0.00 ? 150 ARG A HD2  2  
ATOM 4373  H HD3  . ARG A 1 131 ? 9.035   -2.760  5.741   2.00 0.00 ? 150 ARG A HD3  2  
ATOM 4374  H HE   . ARG A 1 131 ? 8.176   -0.332  4.693   1.00 0.00 ? 150 ARG A HE   2  
ATOM 4375  H HH11 . ARG A 1 131 ? 10.848  -1.559  6.568   5.00 0.00 ? 150 ARG A HH11 2  
ATOM 4376  H HH12 . ARG A 1 131 ? 11.969  -0.381  5.973   5.00 0.00 ? 150 ARG A HH12 2  
ATOM 4377  H HH21 . ARG A 1 131 ? 9.662   1.224   3.910   5.00 0.00 ? 150 ARG A HH21 2  
ATOM 4378  H HH22 . ARG A 1 131 ? 11.300  1.190   4.472   5.00 0.00 ? 150 ARG A HH22 2  
ATOM 4379  N N    . ASP A 1 132 ? 6.569   -6.337  8.255   1.00 0.00 ? 151 ASP A N    2  
ATOM 4380  C CA   . ASP A 1 132 ? 7.056   -7.174  9.346   1.00 0.00 ? 151 ASP A CA   2  
ATOM 4381  C C    . ASP A 1 132 ? 7.743   -8.422  8.803   1.00 0.00 ? 151 ASP A C    2  
ATOM 4382  O O    . ASP A 1 132 ? 7.753   -9.469  9.451   1.00 0.00 ? 151 ASP A O    2  
ATOM 4383  C CB   . ASP A 1 132 ? 5.902   -7.573  10.267  1.00 0.00 ? 151 ASP A CB   2  
ATOM 4384  C CG   . ASP A 1 132 ? 6.324   -7.809  11.704  1.00 0.00 ? 151 ASP A CG   2  
ATOM 4385  O OD1  . ASP A 1 132 ? 7.453   -8.300  11.919  1.00 0.00 ? 151 ASP A OD1  2  
ATOM 4386  O OD2  . ASP A 1 132 ? 5.527   -7.502  12.616  1.00 0.00 ? 151 ASP A OD2  2  
ATOM 4387  H H    . ASP A 1 132 ? 5.625   -6.386  8.000   1.00 0.00 ? 151 ASP A H    2  
ATOM 4388  H HA   . ASP A 1 132 ? 7.775   -6.598  9.910   1.00 0.00 ? 151 ASP A HA   2  
ATOM 4389  H HB2  . ASP A 1 132 ? 5.160   -6.787  10.259  2.00 0.00 ? 151 ASP A HB2  2  
ATOM 4390  H HB3  . ASP A 1 132 ? 5.452   -8.483  9.893   2.00 0.00 ? 151 ASP A HB3  2  
ATOM 4391  N N    . GLY A 1 133 ? 8.315   -8.303  7.610   1.00 0.00 ? 152 GLY A N    2  
ATOM 4392  C CA   . GLY A 1 133 ? 8.994   -9.426  6.997   1.00 0.00 ? 152 GLY A CA   2  
ATOM 4393  C C    . GLY A 1 133 ? 8.111   -10.653 6.879   1.00 0.00 ? 152 GLY A C    2  
ATOM 4394  O O    . GLY A 1 133 ? 8.572   -11.779 7.063   1.00 0.00 ? 152 GLY A O    2  
ATOM 4395  H H    . GLY A 1 133 ? 8.273   -7.444  7.141   1.00 0.00 ? 152 GLY A H    2  
ATOM 4396  H HA2  . GLY A 1 133 ? 9.322   -9.136  6.008   2.00 0.00 ? 152 GLY A HA2  2  
ATOM 4397  H HA3  . GLY A 1 133 ? 9.861   -9.677  7.593   2.00 0.00 ? 152 GLY A HA3  2  
ATOM 4398  N N    . THR A 1 134 ? 6.837   -10.431 6.571   1.00 0.00 ? 153 THR A N    2  
ATOM 4399  C CA   . THR A 1 134 ? 5.884   -11.525 6.429   1.00 0.00 ? 153 THR A CA   2  
ATOM 4400  C C    . THR A 1 134 ? 5.379   -11.628 4.995   1.00 0.00 ? 153 THR A C    2  
ATOM 4401  O O    . THR A 1 134 ? 5.378   -10.644 4.254   1.00 0.00 ? 153 THR A O    2  
ATOM 4402  C CB   . THR A 1 134 ? 4.684   -11.349 7.377   1.00 0.00 ? 153 THR A CB   2  
ATOM 4403  O OG1  . THR A 1 134 ? 4.503   -9.962  7.687   1.00 0.00 ? 153 THR A OG1  2  
ATOM 4404  C CG2  . THR A 1 134 ? 4.890   -12.137 8.660   1.00 0.00 ? 153 THR A CG2  2  
ATOM 4405  H H    . THR A 1 134 ? 6.532   -9.508  6.437   1.00 0.00 ? 153 THR A H    2  
ATOM 4406  H HA   . THR A 1 134 ? 6.389   -12.444 6.689   1.00 0.00 ? 153 THR A HA   2  
ATOM 4407  H HB   . THR A 1 134 ? 3.797   -11.719 6.883   1.00 0.00 ? 153 THR A HB   2  
ATOM 4408  H HG1  . THR A 1 134 ? 4.983   -9.426  7.052   1.00 0.00 ? 153 THR A HG1  2  
ATOM 4409  H HG21 . THR A 1 134 ? 4.059   -11.963 9.327   1.00 0.00 ? 153 THR A HG21 2  
ATOM 4410  H HG22 . THR A 1 134 ? 5.806   -11.818 9.135   1.00 0.00 ? 153 THR A HG22 2  
ATOM 4411  H HG23 . THR A 1 134 ? 4.952   -13.191 8.430   1.00 0.00 ? 153 THR A HG23 2  
ATOM 4412  N N    . ARG A 1 135 ? 4.953   -12.825 4.606   1.00 0.00 ? 154 ARG A N    2  
ATOM 4413  C CA   . ARG A 1 135 ? 4.450   -13.054 3.257   1.00 0.00 ? 154 ARG A CA   2  
ATOM 4414  C C    . ARG A 1 135 ? 3.301   -14.057 3.259   1.00 0.00 ? 154 ARG A C    2  
ATOM 4415  O O    . ARG A 1 135 ? 3.474   -15.215 3.636   1.00 0.00 ? 154 ARG A O    2  
ATOM 4416  C CB   . ARG A 1 135 ? 5.576   -13.557 2.352   1.00 0.00 ? 154 ARG A CB   2  
ATOM 4417  C CG   . ARG A 1 135 ? 6.699   -14.259 3.097   1.00 0.00 ? 154 ARG A CG   2  
ATOM 4418  C CD   . ARG A 1 135 ? 7.668   -14.951 2.151   1.00 0.00 ? 154 ARG A CD   2  
ATOM 4419  N NE   . ARG A 1 135 ? 8.736   -14.058 1.711   1.00 0.00 ? 154 ARG A NE   2  
ATOM 4420  C CZ   . ARG A 1 135 ? 8.689   -13.351 0.586   4.00 0.00 ? 154 ARG A CZ   2  
ATOM 4421  N NH1  . ARG A 1 135 ? 7.633   -13.430 -0.211  5.00 0.00 ? 154 ARG A NH1  2  
ATOM 4422  N NH2  . ARG A 1 135 ? 9.699   -12.561 0.250   5.00 0.00 ? 154 ARG A NH2  2  
ATOM 4423  H H    . ARG A 1 135 ? 4.980   -13.573 5.240   1.00 0.00 ? 154 ARG A H    2  
ATOM 4424  H HA   . ARG A 1 135 ? 4.088   -12.111 2.874   1.00 0.00 ? 154 ARG A HA   2  
ATOM 4425  H HB2  . ARG A 1 135 ? 5.163   -14.249 1.634   2.00 0.00 ? 154 ARG A HB2  2  
ATOM 4426  H HB3  . ARG A 1 135 ? 5.997   -12.717 1.820   2.00 0.00 ? 154 ARG A HB3  2  
ATOM 4427  H HG2  . ARG A 1 135 ? 7.243   -13.528 3.679   2.00 0.00 ? 154 ARG A HG2  2  
ATOM 4428  H HG3  . ARG A 1 135 ? 6.270   -14.999 3.759   2.00 0.00 ? 154 ARG A HG3  2  
ATOM 4429  H HD2  . ARG A 1 135 ? 8.105   -15.797 2.659   2.00 0.00 ? 154 ARG A HD2  2  
ATOM 4430  H HD3  . ARG A 1 135 ? 7.121   -15.296 1.285   2.00 0.00 ? 154 ARG A HD3  2  
ATOM 4431  H HE   . ARG A 1 135 ? 9.527   -13.982 2.283   1.00 0.00 ? 154 ARG A HE   2  
ATOM 4432  H HH11 . ARG A 1 135 ? 6.866   -14.024 0.031   5.00 0.00 ? 154 ARG A HH11 2  
ATOM 4433  H HH12 . ARG A 1 135 ? 7.604   -12.895 -1.057  5.00 0.00 ? 154 ARG A HH12 2  
ATOM 4434  H HH21 . ARG A 1 135 ? 10.502  -12.494 0.842   5.00 0.00 ? 154 ARG A HH21 2  
ATOM 4435  H HH22 . ARG A 1 135 ? 9.658   -12.032 -0.599  5.00 0.00 ? 154 ARG A HH22 2  
ATOM 4436  N N    . TYR A 1 136 ? 2.126   -13.603 2.831   1.00 0.00 ? 155 TYR A N    2  
ATOM 4437  C CA   . TYR A 1 136 ? 0.947   -14.461 2.777   1.00 0.00 ? 155 TYR A CA   2  
ATOM 4438  C C    . TYR A 1 136 ? 0.506   -14.675 1.333   1.00 0.00 ? 155 TYR A C    2  
ATOM 4439  O O    . TYR A 1 136 ? 0.361   -13.719 0.572   1.00 0.00 ? 155 TYR A O    2  
ATOM 4440  C CB   . TYR A 1 136 ? -0.197  -13.848 3.587   1.00 0.00 ? 155 TYR A CB   2  
ATOM 4441  C CG   . TYR A 1 136 ? 0.197   -12.766 4.566   1.00 0.00 ? 155 TYR A CG   2  
ATOM 4442  C CD1  . TYR A 1 136 ? 1.202   -12.981 5.502   1.00 0.00 ? 155 TYR A CD1  2  
ATOM 4443  C CD2  . TYR A 1 136 ? -0.433  -11.527 4.554   1.00 0.00 ? 155 TYR A CD2  2  
ATOM 4444  C CE1  . TYR A 1 136 ? 1.566   -11.996 6.397   1.00 0.00 ? 155 TYR A CE1  2  
ATOM 4445  C CE2  . TYR A 1 136 ? -0.072  -10.537 5.447   1.00 0.00 ? 155 TYR A CE2  2  
ATOM 4446  C CZ   . TYR A 1 136 ? 0.927   -10.775 6.366   1.00 0.00 ? 155 TYR A CZ   2  
ATOM 4447  O OH   . TYR A 1 136 ? 1.288   -9.792  7.257   1.00 0.00 ? 155 TYR A OH   2  
ATOM 4448  H H    . TYR A 1 136 ? 2.051   -12.669 2.540   1.00 0.00 ? 155 TYR A H    2  
ATOM 4449  H HA   . TYR A 1 136 ? 1.211   -15.416 3.206   1.00 0.00 ? 155 TYR A HA   2  
ATOM 4450  H HB2  . TYR A 1 136 ? -0.917  -13.420 2.902   2.00 0.00 ? 155 TYR A HB2  2  
ATOM 4451  H HB3  . TYR A 1 136 ? -0.683  -14.633 4.149   2.00 0.00 ? 155 TYR A HB3  2  
ATOM 4452  H HD1  . TYR A 1 136 ? 1.702   -13.938 5.524   1.00 0.00 ? 155 TYR A HD1  2  
ATOM 4453  H HD2  . TYR A 1 136 ? -1.219  -11.343 3.834   1.00 0.00 ? 155 TYR A HD2  2  
ATOM 4454  H HE1  . TYR A 1 136 ? 2.349   -12.183 7.117   1.00 0.00 ? 155 TYR A HE1  2  
ATOM 4455  H HE2  . TYR A 1 136 ? -0.573  -9.580  5.422   1.00 0.00 ? 155 TYR A HE2  2  
ATOM 4456  H HH   . TYR A 1 136 ? 1.671   -10.194 8.039   1.00 0.00 ? 155 TYR A HH   2  
ATOM 4457  N N    . VAL A 1 137 ? 0.301   -15.932 0.960   1.00 0.00 ? 156 VAL A N    2  
ATOM 4458  C CA   . VAL A 1 137 ? -0.115  -16.268 -0.396  1.00 0.00 ? 156 VAL A CA   2  
ATOM 4459  C C    . VAL A 1 137 ? -1.621  -16.491 -0.480  1.00 0.00 ? 156 VAL A C    2  
ATOM 4460  O O    . VAL A 1 137 ? -2.194  -17.250 0.301   1.00 0.00 ? 156 VAL A O    2  
ATOM 4461  C CB   . VAL A 1 137 ? 0.608   -17.526 -0.909  1.00 0.00 ? 156 VAL A CB   2  
ATOM 4462  C CG1  . VAL A 1 137 ? 0.515   -18.656 0.106   2.00 0.00 ? 156 VAL A CG1  2  
ATOM 4463  C CG2  . VAL A 1 137 ? 0.035   -17.978 -2.243  2.00 0.00 ? 156 VAL A CG2  2  
ATOM 4464  H H    . VAL A 1 137 ? 0.437   -16.654 1.611   1.00 0.00 ? 156 VAL A H    2  
ATOM 4465  H HA   . VAL A 1 137 ? 0.151   -15.440 -1.038  1.00 0.00 ? 156 VAL A HA   2  
ATOM 4466  H HB   . VAL A 1 137 ? 1.650   -17.281 -1.051  1.00 0.00 ? 156 VAL A HB   2  
ATOM 4467  H HG11 . VAL A 1 137 ? -0.520  -18.932 0.242   1.00 0.00 ? 156 VAL A HG11 2  
ATOM 4468  H HG12 . VAL A 1 137 ? 0.927   -18.326 1.048   1.00 0.00 ? 156 VAL A HG12 2  
ATOM 4469  H HG13 . VAL A 1 137 ? 1.072   -19.508 -0.253  1.00 0.00 ? 156 VAL A HG13 2  
ATOM 4470  H HG21 . VAL A 1 137 ? -0.272  -17.115 -2.814  1.00 0.00 ? 156 VAL A HG21 2  
ATOM 4471  H HG22 . VAL A 1 137 ? -0.818  -18.618 -2.071  1.00 0.00 ? 156 VAL A HG22 2  
ATOM 4472  H HG23 . VAL A 1 137 ? 0.788   -18.523 -2.793  1.00 0.00 ? 156 VAL A HG23 2  
ATOM 4473  N N    . GLN A 1 138 ? -2.253  -15.826 -1.442  1.00 0.00 ? 157 GLN A N    2  
ATOM 4474  C CA   . GLN A 1 138 ? -3.692  -15.949 -1.645  1.00 0.00 ? 157 GLN A CA   2  
ATOM 4475  C C    . GLN A 1 138 ? -4.013  -16.022 -3.134  1.00 0.00 ? 157 GLN A C    2  
ATOM 4476  O O    . GLN A 1 138 ? -3.170  -15.705 -3.974  1.00 0.00 ? 157 GLN A O    2  
ATOM 4477  C CB   . GLN A 1 138 ? -4.421  -14.764 -1.010  1.00 0.00 ? 157 GLN A CB   2  
ATOM 4478  C CG   . GLN A 1 138 ? -5.853  -15.075 -0.606  1.00 0.00 ? 157 GLN A CG   2  
ATOM 4479  C CD   . GLN A 1 138 ? -6.664  -13.832 -0.293  1.00 0.00 ? 157 GLN A CD   2  
ATOM 4480  O OE1  . GLN A 1 138 ? -7.862  -13.774 -0.567  1.00 0.00 ? 157 GLN A OE1  2  
ATOM 4481  N NE2  . GLN A 1 138 ? -6.012  -12.830 0.284   4.00 0.00 ? 157 GLN A NE2  2  
ATOM 4482  H H    . GLN A 1 138 ? -1.737  -15.240 -2.034  1.00 0.00 ? 157 GLN A H    2  
ATOM 4483  H HA   . GLN A 1 138 ? -4.019  -16.861 -1.171  1.00 0.00 ? 157 GLN A HA   2  
ATOM 4484  H HB2  . GLN A 1 138 ? -3.881  -14.454 -0.127  2.00 0.00 ? 157 GLN A HB2  2  
ATOM 4485  H HB3  . GLN A 1 138 ? -4.439  -13.946 -1.715  2.00 0.00 ? 157 GLN A HB3  2  
ATOM 4486  H HG2  . GLN A 1 138 ? -6.335  -15.604 -1.415  2.00 0.00 ? 157 GLN A HG2  2  
ATOM 4487  H HG3  . GLN A 1 138 ? -5.837  -15.704 0.272   2.00 0.00 ? 157 GLN A HG3  2  
ATOM 4488  H HE21 . GLN A 1 138 ? -5.055  -12.947 0.474   5.00 0.00 ? 157 GLN A HE21 2  
ATOM 4489  H HE22 . GLN A 1 138 ? -6.513  -12.012 0.499   5.00 0.00 ? 157 GLN A HE22 2  
ATOM 4490  N N    . LYS A 1 139 ? -5.229  -16.443 -3.460  1.00 0.00 ? 158 LYS A N    2  
ATOM 4491  C CA   . LYS A 1 139 ? -5.646  -16.555 -4.851  1.00 0.00 ? 158 LYS A CA   2  
ATOM 4492  C C    . LYS A 1 139 ? -6.941  -15.790 -5.100  1.00 0.00 ? 158 LYS A C    2  
ATOM 4493  O O    . LYS A 1 139 ? -8.007  -16.185 -4.629  1.00 0.00 ? 158 LYS A O    2  
ATOM 4494  C CB   . LYS A 1 139 ? -5.830  -18.022 -5.237  1.00 0.00 ? 158 LYS A CB   2  
ATOM 4495  C CG   . LYS A 1 139 ? -4.783  -18.532 -6.214  1.00 0.00 ? 158 LYS A CG   2  
ATOM 4496  C CD   . LYS A 1 139 ? -4.885  -20.035 -6.416  1.00 0.00 ? 158 LYS A CD   2  
ATOM 4497  C CE   . LYS A 1 139 ? -3.623  -20.608 -7.041  1.00 0.00 ? 158 LYS A CE   2  
ATOM 4498  N NZ   . LYS A 1 139 ? -2.569  -20.874 -6.025  1.00 0.00 ? 158 LYS A NZ   2  
ATOM 4499  H H    . LYS A 1 139 ? -5.860  -16.686 -2.750  1.00 0.00 ? 158 LYS A H    2  
ATOM 4500  H HA   . LYS A 1 139 ? -4.867  -16.127 -5.464  1.00 0.00 ? 158 LYS A HA   2  
ATOM 4501  H HB2  . LYS A 1 139 ? -5.783  -18.627 -4.343  2.00 0.00 ? 158 LYS A HB2  2  
ATOM 4502  H HB3  . LYS A 1 139 ? -6.802  -18.140 -5.689  2.00 0.00 ? 158 LYS A HB3  2  
ATOM 4503  H HG2  . LYS A 1 139 ? -4.923  -18.042 -7.165  2.00 0.00 ? 158 LYS A HG2  2  
ATOM 4504  H HG3  . LYS A 1 139 ? -3.802  -18.298 -5.828  2.00 0.00 ? 158 LYS A HG3  2  
ATOM 4505  H HD2  . LYS A 1 139 ? -5.046  -20.508 -5.458  2.00 0.00 ? 158 LYS A HD2  2  
ATOM 4506  H HD3  . LYS A 1 139 ? -5.722  -20.245 -7.065  2.00 0.00 ? 158 LYS A HD3  2  
ATOM 4507  H HE2  . LYS A 1 139 ? -3.872  -21.532 -7.540  2.00 0.00 ? 158 LYS A HE2  2  
ATOM 4508  H HE3  . LYS A 1 139 ? -3.243  -19.901 -7.764  2.00 0.00 ? 158 LYS A HE3  2  
ATOM 4509  H HZ1  . LYS A 1 139 ? -2.616  -20.164 -5.265  1.00 0.00 ? 158 LYS A HZ1  2  
ATOM 4510  H HZ2  . LYS A 1 139 ? -1.628  -20.831 -6.465  1.00 0.00 ? 158 LYS A HZ2  2  
ATOM 4511  H HZ3  . LYS A 1 139 ? -2.703  -21.819 -5.610  1.00 0.00 ? 158 LYS A HZ3  2  
ATOM 4512  N N    . GLY A 1 140 ? -6.838  -14.698 -5.847  1.00 0.00 ? 159 GLY A N    2  
ATOM 4513  C CA   . GLY A 1 140 ? -8.007  -13.895 -6.151  1.00 0.00 ? 159 GLY A CA   2  
ATOM 4514  C C    . GLY A 1 140 ? -7.828  -13.066 -7.407  1.00 0.00 ? 159 GLY A C    2  
ATOM 4515  O O    . GLY A 1 140 ? -7.539  -13.601 -8.477  1.00 0.00 ? 159 GLY A O    2  
ATOM 4516  H H    . GLY A 1 140 ? -5.961  -14.434 -6.196  1.00 0.00 ? 159 GLY A H    2  
ATOM 4517  H HA2  . GLY A 1 140 ? -8.858  -14.551 -6.284  2.00 0.00 ? 159 GLY A HA2  2  
ATOM 4518  H HA3  . GLY A 1 140 ? -8.203  -13.232 -5.319  2.00 0.00 ? 159 GLY A HA3  2  
ATOM 4519  N N    . GLU A 1 141 ? -8.000  -11.756 -7.273  1.00 0.00 ? 160 GLU A N    2  
ATOM 4520  C CA   . GLU A 1 141 ? -7.858  -10.842 -8.400  1.00 0.00 ? 160 GLU A CA   2  
ATOM 4521  C C    . GLU A 1 141 ? -8.065  -9.403  -7.944  1.00 0.00 ? 160 GLU A C    2  
ATOM 4522  O O    . GLU A 1 141 ? -8.865  -9.139  -7.047  1.00 0.00 ? 160 GLU A O    2  
ATOM 4523  C CB   . GLU A 1 141 ? -8.861  -11.192 -9.501  1.00 0.00 ? 160 GLU A CB   2  
ATOM 4524  C CG   . GLU A 1 141 ? -8.380  -10.854 -10.902 1.00 0.00 ? 160 GLU A CG   2  
ATOM 4525  C CD   . GLU A 1 141 ? -9.409  -11.168 -11.971 1.00 0.00 ? 160 GLU A CD   2  
ATOM 4526  O OE1  . GLU A 1 141 ? -9.963  -12.287 -11.951 1.00 0.00 ? 160 GLU A OE1  2  
ATOM 4527  O OE2  . GLU A 1 141 ? -9.661  -10.294 -12.827 1.00 0.00 ? 160 GLU A OE2  2  
ATOM 4528  H H    . GLU A 1 141 ? -8.229  -11.393 -6.393  1.00 0.00 ? 160 GLU A H    2  
ATOM 4529  H HA   . GLU A 1 141 ? -6.855  -10.944 -8.788  1.00 0.00 ? 160 GLU A HA   2  
ATOM 4530  H HB2  . GLU A 1 141 ? -9.064  -12.253 -9.461  2.00 0.00 ? 160 GLU A HB2  2  
ATOM 4531  H HB3  . GLU A 1 141 ? -9.778  -10.654 -9.319  2.00 0.00 ? 160 GLU A HB3  2  
ATOM 4532  H HG2  . GLU A 1 141 ? -8.150  -9.799  -10.945 2.00 0.00 ? 160 GLU A HG2  2  
ATOM 4533  H HG3  . GLU A 1 141 ? -7.486  -11.423 -11.109 2.00 0.00 ? 160 GLU A HG3  2  
ATOM 4534  N N    . TYR A 1 142 ? -7.341  -8.473  -8.559  1.00 0.00 ? 161 TYR A N    2  
ATOM 4535  C CA   . TYR A 1 142 ? -7.454  -7.064  -8.200  1.00 0.00 ? 161 TYR A CA   2  
ATOM 4536  C C    . TYR A 1 142 ? -6.560  -6.189  -9.075  1.00 0.00 ? 161 TYR A C    2  
ATOM 4537  O O    . TYR A 1 142 ? -6.860  -5.017  -9.304  1.00 0.00 ? 161 TYR A O    2  
ATOM 4538  C CB   . TYR A 1 142 ? -7.106  -6.862  -6.722  1.00 0.00 ? 161 TYR A CB   2  
ATOM 4539  C CG   . TYR A 1 142 ? -5.726  -7.339  -6.317  1.00 0.00 ? 161 TYR A CG   2  
ATOM 4540  C CD1  . TYR A 1 142 ? -5.049  -8.303  -7.058  1.00 0.00 ? 161 TYR A CD1  2  
ATOM 4541  C CD2  . TYR A 1 142 ? -5.098  -6.822  -5.190  1.00 0.00 ? 161 TYR A CD2  2  
ATOM 4542  C CE1  . TYR A 1 142 ? -3.790  -8.733  -6.688  1.00 0.00 ? 161 TYR A CE1  2  
ATOM 4543  C CE2  . TYR A 1 142 ? -3.840  -7.250  -4.813  1.00 0.00 ? 161 TYR A CE2  2  
ATOM 4544  C CZ   . TYR A 1 142 ? -3.190  -8.205  -5.565  1.00 0.00 ? 161 TYR A CZ   2  
ATOM 4545  O OH   . TYR A 1 142 ? -1.937  -8.634  -5.194  1.00 0.00 ? 161 TYR A OH   2  
ATOM 4546  H H    . TYR A 1 142 ? -6.717  -8.741  -9.266  1.00 0.00 ? 161 TYR A H    2  
ATOM 4547  H HA   . TYR A 1 142 ? -8.481  -6.770  -8.357  1.00 0.00 ? 161 TYR A HA   2  
ATOM 4548  H HB2  . TYR A 1 142 ? -7.168  -5.807  -6.490  2.00 0.00 ? 161 TYR A HB2  2  
ATOM 4549  H HB3  . TYR A 1 142 ? -7.827  -7.397  -6.118  2.00 0.00 ? 161 TYR A HB3  2  
ATOM 4550  H HD1  . TYR A 1 142 ? -5.520  -8.719  -7.935  1.00 0.00 ? 161 TYR A HD1  2  
ATOM 4551  H HD2  . TYR A 1 142 ? -5.610  -6.075  -4.600  1.00 0.00 ? 161 TYR A HD2  2  
ATOM 4552  H HE1  . TYR A 1 142 ? -3.282  -9.482  -7.277  1.00 0.00 ? 161 TYR A HE1  2  
ATOM 4553  H HE2  . TYR A 1 142 ? -3.370  -6.835  -3.933  1.00 0.00 ? 161 TYR A HE2  2  
ATOM 4554  H HH   . TYR A 1 142 ? -1.935  -9.590  -5.116  1.00 0.00 ? 161 TYR A HH   2  
ATOM 4555  N N    . ARG A 1 143 ? -5.465  -6.759  -9.567  1.00 0.00 ? 162 ARG A N    2  
ATOM 4556  C CA   . ARG A 1 143 ? -4.539  -6.020  -10.417 1.00 0.00 ? 162 ARG A CA   2  
ATOM 4557  C C    . ARG A 1 143 ? -5.033  -5.993  -11.859 1.00 0.00 ? 162 ARG A C    2  
ATOM 4558  O O    . ARG A 1 143 ? -4.736  -5.065  -12.610 1.00 0.00 ? 162 ARG A O    2  
ATOM 4559  C CB   . ARG A 1 143 ? -3.145  -6.645  -10.354 1.00 0.00 ? 162 ARG A CB   2  
ATOM 4560  C CG   . ARG A 1 143 ? -2.022  -5.696  -10.738 1.00 0.00 ? 162 ARG A CG   2  
ATOM 4561  C CD   . ARG A 1 143 ? -0.897  -5.696  -9.715  1.00 0.00 ? 162 ARG A CD   2  
ATOM 4562  N NE   . ARG A 1 143 ? -0.019  -4.538  -9.868  1.00 0.00 ? 162 ARG A NE   2  
ATOM 4563  C CZ   . ARG A 1 143 ? 0.917   -4.444  -10.805 4.00 0.00 ? 162 ARG A CZ   2  
ATOM 4564  N NH1  . ARG A 1 143 ? 1.099   -5.430  -11.675 5.00 0.00 ? 162 ARG A NH1  2  
ATOM 4565  N NH2  . ARG A 1 143 ? 1.680   -3.363  -10.885 5.00 0.00 ? 162 ARG A NH2  2  
ATOM 4566  H H    . ARG A 1 143 ? -5.275  -7.694  -9.356  1.00 0.00 ? 162 ARG A H    2  
ATOM 4567  H HA   . ARG A 1 143 ? -4.487  -5.007  -10.047 1.00 0.00 ? 162 ARG A HA   2  
ATOM 4568  H HB2  . ARG A 1 143 ? -2.964  -6.991  -9.347  2.00 0.00 ? 162 ARG A HB2  2  
ATOM 4569  H HB3  . ARG A 1 143 ? -3.113  -7.493  -11.023 2.00 0.00 ? 162 ARG A HB3  2  
ATOM 4570  H HG2  . ARG A 1 143 ? -1.621  -5.997  -11.695 2.00 0.00 ? 162 ARG A HG2  2  
ATOM 4571  H HG3  . ARG A 1 143 ? -2.421  -4.696  -10.817 2.00 0.00 ? 162 ARG A HG3  2  
ATOM 4572  H HD2  . ARG A 1 143 ? -1.328  -5.681  -8.725  2.00 0.00 ? 162 ARG A HD2  2  
ATOM 4573  H HD3  . ARG A 1 143 ? -0.314  -6.596  -9.838  2.00 0.00 ? 162 ARG A HD3  2  
ATOM 4574  H HE   . ARG A 1 143 ? -0.135  -3.796  -9.240  1.00 0.00 ? 162 ARG A HE   2  
ATOM 4575  H HH11 . ARG A 1 143 ? 0.530   -6.250  -11.627 5.00 0.00 ? 162 ARG A HH11 2  
ATOM 4576  H HH12 . ARG A 1 143 ? 1.806   -5.353  -12.377 5.00 0.00 ? 162 ARG A HH12 2  
ATOM 4577  H HH21 . ARG A 1 143 ? 1.551   -2.612  -10.238 5.00 0.00 ? 162 ARG A HH21 2  
ATOM 4578  H HH22 . ARG A 1 143 ? 2.383   -3.296  -11.593 5.00 0.00 ? 162 ARG A HH22 2  
ATOM 4579  N N    . THR A 1 144 ? -5.791  -7.019  -12.236 1.00 0.00 ? 163 THR A N    2  
ATOM 4580  C CA   . THR A 1 144 ? -6.330  -7.117  -13.587 1.00 0.00 ? 163 THR A CA   2  
ATOM 4581  C C    . THR A 1 144 ? -5.268  -6.782  -14.630 1.00 0.00 ? 163 THR A C    2  
ATOM 4582  O O    . THR A 1 144 ? -5.563  -6.171  -15.656 1.00 0.00 ? 163 THR A O    2  
ATOM 4583  C CB   . THR A 1 144 ? -7.538  -6.180  -13.780 1.00 0.00 ? 163 THR A CB   2  
ATOM 4584  O OG1  . THR A 1 144 ? -7.184  -4.841  -13.415 1.00 0.00 ? 163 THR A OG1  2  
ATOM 4585  C CG2  . THR A 1 144 ? -8.721  -6.643  -12.942 1.00 0.00 ? 163 THR A CG2  2  
ATOM 4586  H H    . THR A 1 144 ? -5.993  -7.726  -11.589 1.00 0.00 ? 163 THR A H    2  
ATOM 4587  H HA   . THR A 1 144 ? -6.663  -8.134  -13.739 1.00 0.00 ? 163 THR A HA   2  
ATOM 4588  H HB   . THR A 1 144 ? -7.825  -6.198  -14.822 1.00 0.00 ? 163 THR A HB   2  
ATOM 4589  H HG1  . THR A 1 144 ? -7.747  -4.222  -13.884 1.00 0.00 ? 163 THR A HG1  2  
ATOM 4590  H HG21 . THR A 1 144 ? -9.599  -6.712  -13.568 1.00 0.00 ? 163 THR A HG21 2  
ATOM 4591  H HG22 . THR A 1 144 ? -8.899  -5.934  -12.149 1.00 0.00 ? 163 THR A HG22 2  
ATOM 4592  H HG23 . THR A 1 144 ? -8.504  -7.612  -12.518 1.00 0.00 ? 163 THR A HG23 2  
ATOM 4593  N N    . ASN A 1 145 ? -4.031  -7.184  -14.356 1.00 0.00 ? 164 ASN A N    2  
ATOM 4594  C CA   . ASN A 1 145 ? -2.924  -6.924  -15.270 1.00 0.00 ? 164 ASN A CA   2  
ATOM 4595  C C    . ASN A 1 145 ? -2.200  -8.218  -15.632 1.00 0.00 ? 164 ASN A C    2  
ATOM 4596  O O    . ASN A 1 145 ? -1.082  -8.464  -15.178 1.00 0.00 ? 164 ASN A O    2  
ATOM 4597  C CB   . ASN A 1 145 ? -1.939  -5.934  -14.642 1.00 0.00 ? 164 ASN A CB   2  
ATOM 4598  C CG   . ASN A 1 145 ? -1.851  -4.614  -15.380 1.00 0.00 ? 164 ASN A CG   2  
ATOM 4599  O OD1  . ASN A 1 145 ? -0.847  -4.317  -16.028 1.00 0.00 ? 164 ASN A OD1  2  
ATOM 4600  N ND2  . ASN A 1 145 ? -2.904  -3.810  -15.287 4.00 0.00 ? 164 ASN A ND2  2  
ATOM 4601  H H    . ASN A 1 145 ? -3.859  -7.666  -13.521 1.00 0.00 ? 164 ASN A H    2  
ATOM 4602  H HA   . ASN A 1 145 ? -3.332  -6.490  -16.170 1.00 0.00 ? 164 ASN A HA   2  
ATOM 4603  H HB2  . ASN A 1 145 ? -2.246  -5.733  -13.625 2.00 0.00 ? 164 ASN A HB2  2  
ATOM 4604  H HB3  . ASN A 1 145 ? -0.955  -6.381  -14.629 2.00 0.00 ? 164 ASN A HB3  2  
ATOM 4605  H HD21 . ASN A 1 145 ? -3.671  -4.111  -14.751 5.00 0.00 ? 164 ASN A HD21 2  
ATOM 4606  H HD22 . ASN A 1 145 ? -2.873  -2.947  -15.755 5.00 0.00 ? 164 ASN A HD22 2  
ATOM 4607  N N    . PRO A 1 146 ? -2.832  -9.061  -16.461 1.00 0.00 ? 165 PRO A N    2  
ATOM 4608  C CA   . PRO A 1 146 ? -2.251  -10.335 -16.892 1.00 0.00 ? 165 PRO A CA   2  
ATOM 4609  C C    . PRO A 1 146 ? -1.113  -10.142 -17.888 1.00 0.00 ? 165 PRO A C    2  
ATOM 4610  O O    . PRO A 1 146 ? -0.299  -11.041 -18.099 1.00 0.00 ? 165 PRO A O    2  
ATOM 4611  C CB   . PRO A 1 146 ? -3.428  -11.056 -17.555 1.00 0.00 ? 165 PRO A CB   2  
ATOM 4612  C CG   . PRO A 1 146 ? -4.317  -9.960  -18.034 1.00 0.00 ? 165 PRO A CG   2  
ATOM 4613  C CD   . PRO A 1 146 ? -4.165  -8.838  -17.045 1.00 0.00 ? 165 PRO A CD   2  
ATOM 4614  H HA   . PRO A 1 146 ? -1.898  -10.913 -16.051 1.00 0.00 ? 165 PRO A HA   2  
ATOM 4615  H HB2  . PRO A 1 146 ? -3.068  -11.660 -18.374 2.00 0.00 ? 165 PRO A HB2  2  
ATOM 4616  H HB3  . PRO A 1 146 ? -3.927  -11.680 -16.828 2.00 0.00 ? 165 PRO A HB3  2  
ATOM 4617  H HG2  . PRO A 1 146 ? -4.007  -9.638  -19.018 2.00 0.00 ? 165 PRO A HG2  2  
ATOM 4618  H HG3  . PRO A 1 146 ? -5.342  -10.301 -18.057 2.00 0.00 ? 165 PRO A HG3  2  
ATOM 4619  H HD2  . PRO A 1 146 ? -4.208  -7.883  -17.550 2.00 0.00 ? 165 PRO A HD2  2  
ATOM 4620  H HD3  . PRO A 1 146 ? -4.931  -8.897  -16.288 2.00 0.00 ? 165 PRO A HD3  2  
ATOM 4621  N N    . GLU A 1 147 ? -1.063  -8.961  -18.498 1.00 0.00 ? 166 GLU A N    2  
ATOM 4622  C CA   . GLU A 1 147 ? -0.028  -8.643  -19.470 1.00 0.00 ? 166 GLU A CA   2  
ATOM 4623  C C    . GLU A 1 147 ? 1.339   -8.549  -18.802 1.00 0.00 ? 166 GLU A C    2  
ATOM 4624  O O    . GLU A 1 147 ? 2.373   -8.610  -19.469 1.00 0.00 ? 166 GLU A O    2  
ATOM 4625  C CB   . GLU A 1 147 ? -0.361  -7.326  -20.169 1.00 0.00 ? 166 GLU A CB   2  
ATOM 4626  C CG   . GLU A 1 147 ? 0.011   -7.295  -21.641 1.00 0.00 ? 166 GLU A CG   2  
ATOM 4627  C CD   . GLU A 1 147 ? 1.039   -6.230  -21.965 1.00 0.00 ? 166 GLU A CD   2  
ATOM 4628  O OE1  . GLU A 1 147 ? 2.108   -6.220  -21.318 1.00 0.00 ? 166 GLU A OE1  2  
ATOM 4629  O OE2  . GLU A 1 147 ? 0.777   -5.406  -22.866 1.00 0.00 ? 166 GLU A OE2  2  
ATOM 4630  H H    . GLU A 1 147 ? -1.739  -8.285  -18.288 1.00 0.00 ? 166 GLU A H    2  
ATOM 4631  H HA   . GLU A 1 147 ? -0.006  -9.435  -20.203 1.00 0.00 ? 166 GLU A HA   2  
ATOM 4632  H HB2  . GLU A 1 147 ? -1.423  -7.148  -20.086 2.00 0.00 ? 166 GLU A HB2  2  
ATOM 4633  H HB3  . GLU A 1 147 ? 0.165   -6.528  -19.670 2.00 0.00 ? 166 GLU A HB3  2  
ATOM 4634  H HG2  . GLU A 1 147 ? 0.414   -8.260  -21.916 2.00 0.00 ? 166 GLU A HG2  2  
ATOM 4635  H HG3  . GLU A 1 147 ? -0.882  -7.100  -22.218 2.00 0.00 ? 166 GLU A HG3  2  
ATOM 4636  N N    . ASP A 1 148 ? 1.338   -8.398  -17.481 1.00 0.00 ? 167 ASP A N    2  
ATOM 4637  C CA   . ASP A 1 148 ? 2.579   -8.294  -16.722 1.00 0.00 ? 167 ASP A CA   2  
ATOM 4638  C C    . ASP A 1 148 ? 3.224   -9.663  -16.542 1.00 0.00 ? 167 ASP A C    2  
ATOM 4639  O O    . ASP A 1 148 ? 4.359   -9.771  -16.076 1.00 0.00 ? 167 ASP A O    2  
ATOM 4640  C CB   . ASP A 1 148 ? 2.315   -7.657  -15.356 1.00 0.00 ? 167 ASP A CB   2  
ATOM 4641  C CG   . ASP A 1 148 ? 2.716   -6.197  -15.305 1.00 0.00 ? 167 ASP A CG   2  
ATOM 4642  O OD1  . ASP A 1 148 ? 3.816   -5.866  -15.795 1.00 0.00 ? 167 ASP A OD1  2  
ATOM 4643  O OD2  . ASP A 1 148 ? 1.931   -5.384  -14.772 1.00 0.00 ? 167 ASP A OD2  2  
ATOM 4644  H H    . ASP A 1 148 ? 0.482   -8.356  -17.006 1.00 0.00 ? 167 ASP A H    2  
ATOM 4645  H HA   . ASP A 1 148 ? 3.255   -7.662  -17.278 1.00 0.00 ? 167 ASP A HA   2  
ATOM 4646  H HB2  . ASP A 1 148 ? 1.259   -7.729  -15.132 2.00 0.00 ? 167 ASP A HB2  2  
ATOM 4647  H HB3  . ASP A 1 148 ? 2.876   -8.193  -14.603 2.00 0.00 ? 167 ASP A HB3  2  
ATOM 4648  N N    . ILE A 1 149 ? 2.493   -10.710 -16.912 1.00 0.00 ? 168 ILE A N    2  
ATOM 4649  C CA   . ILE A 1 149 ? 2.994   -12.074 -16.790 1.00 0.00 ? 168 ILE A CA   2  
ATOM 4650  C C    . ILE A 1 149 ? 3.324   -12.663 -18.157 1.00 0.00 ? 168 ILE A C    2  
ATOM 4651  O O    . ILE A 1 149 ? 4.270   -13.439 -18.297 1.00 0.00 ? 168 ILE A O    2  
ATOM 4652  C CB   . ILE A 1 149 ? 1.973   -12.986 -16.084 1.00 0.00 ? 168 ILE A CB   2  
ATOM 4653  C CG1  . ILE A 1 149 ? 1.389   -12.283 -14.857 1.00 0.00 ? 168 ILE A CG1  2  
ATOM 4654  C CG2  . ILE A 1 149 ? 2.624   -14.302 -15.686 1.00 0.00 ? 168 ILE A CG2  2  
ATOM 4655  C CD1  . ILE A 1 149 ? -0.113  -12.411 -14.734 1.00 0.00 ? 168 ILE A CD1  2  
ATOM 4656  H H    . ILE A 1 149 ? 1.595   -10.561 -17.276 1.00 0.00 ? 168 ILE A H    2  
ATOM 4657  H HA   . ILE A 1 149 ? 3.894   -12.046 -16.193 1.00 0.00 ? 168 ILE A HA   2  
ATOM 4658  H HB   . ILE A 1 149 ? 1.176   -13.203 -16.779 1.00 0.00 ? 168 ILE A HB   2  
ATOM 4659  H HG12 . ILE A 1 149 ? 1.831   -12.702 -13.966 2.00 0.00 ? 168 ILE A HG12 2  
ATOM 4660  H HG13 . ILE A 1 149 ? 1.628   -11.231 -14.907 2.00 0.00 ? 168 ILE A HG13 2  
ATOM 4661  H HG21 . ILE A 1 149 ? 3.341   -14.591 -16.440 1.00 0.00 ? 168 ILE A HG21 2  
ATOM 4662  H HG22 . ILE A 1 149 ? 1.867   -15.067 -15.599 1.00 0.00 ? 168 ILE A HG22 2  
ATOM 4663  H HG23 . ILE A 1 149 ? 3.126   -14.184 -14.737 1.00 0.00 ? 168 ILE A HG23 2  
ATOM 4664  H HD11 . ILE A 1 149 ? -0.556  -12.419 -15.719 1.00 0.00 ? 168 ILE A HD11 2  
ATOM 4665  H HD12 . ILE A 1 149 ? -0.502  -11.575 -14.172 1.00 0.00 ? 168 ILE A HD12 2  
ATOM 4666  H HD13 . ILE A 1 149 ? -0.355  -13.332 -14.224 1.00 0.00 ? 168 ILE A HD13 2  
ATOM 4667  N N    . TYR A 1 150 ? 2.541   -12.287 -19.163 1.00 0.00 ? 169 TYR A N    2  
ATOM 4668  C CA   . TYR A 1 150 ? 2.751   -12.779 -20.520 1.00 0.00 ? 169 TYR A CA   2  
ATOM 4669  C C    . TYR A 1 150 ? 2.771   -11.625 -21.519 1.00 0.00 ? 169 TYR A C    2  
ATOM 4670  O O    . TYR A 1 150 ? 1.803   -11.402 -22.245 1.00 0.00 ? 169 TYR A O    2  
ATOM 4671  C CB   . TYR A 1 150 ? 1.655   -13.777 -20.899 1.00 0.00 ? 169 TYR A CB   2  
ATOM 4672  C CG   . TYR A 1 150 ? 1.215   -14.697 -19.781 1.00 0.00 ? 169 TYR A CG   2  
ATOM 4673  C CD1  . TYR A 1 150 ? 1.989   -15.788 -19.409 1.00 0.00 ? 169 TYR A CD1  2  
ATOM 4674  C CD2  . TYR A 1 150 ? 0.025   -14.472 -19.101 1.00 0.00 ? 169 TYR A CD2  2  
ATOM 4675  C CE1  . TYR A 1 150 ? 1.591   -16.630 -18.389 1.00 0.00 ? 169 TYR A CE1  2  
ATOM 4676  C CE2  . TYR A 1 150 ? -0.380  -15.310 -18.079 1.00 0.00 ? 169 TYR A CE2  2  
ATOM 4677  C CZ   . TYR A 1 150 ? 0.405   -16.388 -17.727 1.00 0.00 ? 169 TYR A CZ   2  
ATOM 4678  O OH   . TYR A 1 150 ? 0.005   -17.224 -16.710 1.00 0.00 ? 169 TYR A OH   2  
ATOM 4679  H H    . TYR A 1 150 ? 1.804   -11.665 -18.989 1.00 0.00 ? 169 TYR A H    2  
ATOM 4680  H HA   . TYR A 1 150 ? 3.707   -13.279 -20.547 1.00 0.00 ? 169 TYR A HA   2  
ATOM 4681  H HB2  . TYR A 1 150 ? 0.787   -13.232 -21.236 2.00 0.00 ? 169 TYR A HB2  2  
ATOM 4682  H HB3  . TYR A 1 150 ? 2.012   -14.395 -21.710 2.00 0.00 ? 169 TYR A HB3  2  
ATOM 4683  H HD1  . TYR A 1 150 ? 2.917   -15.976 -19.929 1.00 0.00 ? 169 TYR A HD1  2  
ATOM 4684  H HD2  . TYR A 1 150 ? -0.588  -13.628 -19.378 1.00 0.00 ? 169 TYR A HD2  2  
ATOM 4685  H HE1  . TYR A 1 150 ? 2.207   -17.474 -18.113 1.00 0.00 ? 169 TYR A HE1  2  
ATOM 4686  H HE2  . TYR A 1 150 ? -1.308  -15.119 -17.560 1.00 0.00 ? 169 TYR A HE2  2  
ATOM 4687  H HH   . TYR A 1 150 ? 0.187   -16.809 -15.864 1.00 0.00 ? 169 TYR A HH   2  
ATOM 4688  N N    . PRO A 1 151 ? 3.883   -10.873 -21.563 1.00 0.00 ? 170 PRO A N    2  
ATOM 4689  C CA   . PRO A 1 151 ? 4.037   -9.735  -22.473 1.00 0.00 ? 170 PRO A CA   2  
ATOM 4690  C C    . PRO A 1 151 ? 3.683   -10.090 -23.913 1.00 0.00 ? 170 PRO A C    2  
ATOM 4691  O O    . PRO A 1 151 ? 4.334   -10.933 -24.531 1.00 0.00 ? 170 PRO A O    2  
ATOM 4692  C CB   . PRO A 1 151 ? 5.523   -9.385  -22.358 1.00 0.00 ? 170 PRO A CB   2  
ATOM 4693  C CG   . PRO A 1 151 ? 5.917   -9.858  -21.000 1.00 0.00 ? 170 PRO A CG   2  
ATOM 4694  C CD   . PRO A 1 151 ? 5.077   -11.074 -20.726 1.00 0.00 ? 170 PRO A CD   2  
ATOM 4695  H HA   . PRO A 1 151 ? 3.440   -8.891  -22.155 1.00 0.00 ? 170 PRO A HA   2  
ATOM 4696  H HB2  . PRO A 1 151 ? 6.077   -9.896  -23.131 2.00 0.00 ? 170 PRO A HB2  2  
ATOM 4697  H HB3  . PRO A 1 151 ? 5.654   -8.317  -22.459 2.00 0.00 ? 170 PRO A HB3  2  
ATOM 4698  H HG2  . PRO A 1 151 ? 6.966   -10.118 -20.991 2.00 0.00 ? 170 PRO A HG2  2  
ATOM 4699  H HG3  . PRO A 1 151 ? 5.714   -9.090  -20.270 2.00 0.00 ? 170 PRO A HG3  2  
ATOM 4700  H HD2  . PRO A 1 151 ? 5.604   -11.970 -21.019 2.00 0.00 ? 170 PRO A HD2  2  
ATOM 4701  H HD3  . PRO A 1 151 ? 4.810   -11.120 -19.681 2.00 0.00 ? 170 PRO A HD3  2  
ATOM 4702  N N    . SER A 1 152 ? 2.649   -9.441  -24.441 1.00 0.00 ? 171 SER A N    2  
ATOM 4703  C CA   . SER A 1 152 ? 2.209   -9.688  -25.810 1.00 0.00 ? 171 SER A CA   2  
ATOM 4704  C C    . SER A 1 152 ? 1.821   -11.150 -26.004 1.00 0.00 ? 171 SER A C    2  
ATOM 4705  O O    . SER A 1 152 ? 2.674   -12.001 -26.259 1.00 0.00 ? 171 SER A O    2  
ATOM 4706  C CB   . SER A 1 152 ? 3.311   -9.304  -26.800 1.00 0.00 ? 171 SER A CB   2  
ATOM 4707  O OG   . SER A 1 152 ? 2.927   -9.599  -28.131 1.00 0.00 ? 171 SER A OG   2  
ATOM 4708  H H    . SER A 1 152 ? 2.172   -8.780  -23.897 1.00 0.00 ? 171 SER A H    2  
ATOM 4709  H HA   . SER A 1 152 ? 1.343   -9.070  -25.994 1.00 0.00 ? 171 SER A HA   2  
ATOM 4710  H HB2  . SER A 1 152 ? 3.509   -8.246  -26.722 2.00 0.00 ? 171 SER A HB2  2  
ATOM 4711  H HB3  . SER A 1 152 ? 4.209   -9.857  -26.567 2.00 0.00 ? 171 SER A HB3  2  
ATOM 4712  H HG   . SER A 1 152 ? 3.630   -10.087 -28.567 1.00 0.00 ? 171 SER A HG   2  
ATOM 4713  N N    . ASN A 1 153 ? 0.529   -11.435 -25.884 1.00 0.00 ? 172 ASN A N    2  
ATOM 4714  C CA   . ASN A 1 153 ? 0.027   -12.794 -26.046 1.00 0.00 ? 172 ASN A CA   2  
ATOM 4715  C C    . ASN A 1 153 ? -0.607  -12.978 -27.423 1.00 0.00 ? 172 ASN A C    2  
ATOM 4716  O O    . ASN A 1 153 ? -1.461  -12.192 -27.834 1.00 0.00 ? 172 ASN A O    2  
ATOM 4717  C CB   . ASN A 1 153 ? -0.995  -13.118 -24.955 1.00 0.00 ? 172 ASN A CB   2  
ATOM 4718  C CG   . ASN A 1 153 ? -0.467  -14.104 -23.932 1.00 0.00 ? 172 ASN A CG   2  
ATOM 4719  O OD1  . ASN A 1 153 ? 0.573   -14.731 -24.136 1.00 0.00 ? 172 ASN A OD1  2  
ATOM 4720  N ND2  . ASN A 1 153 ? -1.184  -14.248 -22.824 4.00 0.00 ? 172 ASN A ND2  2  
ATOM 4721  H H    . ASN A 1 153 ? -0.103  -10.713 -25.680 1.00 0.00 ? 172 ASN A H    2  
ATOM 4722  H HA   . ASN A 1 153 ? 0.863   -13.469 -25.956 1.00 0.00 ? 172 ASN A HA   2  
ATOM 4723  H HB2  . ASN A 1 153 ? -1.265  -12.206 -24.441 2.00 0.00 ? 172 ASN A HB2  2  
ATOM 4724  H HB3  . ASN A 1 153 ? -1.878  -13.540 -25.412 2.00 0.00 ? 172 ASN A HB3  2  
ATOM 4725  H HD21 . ASN A 1 153 ? -2.005  -13.716 -22.729 5.00 0.00 ? 172 ASN A HD21 2  
ATOM 4726  H HD22 . ASN A 1 153 ? -0.865  -14.883 -22.143 5.00 0.00 ? 172 ASN A HD22 2  
ATOM 4727  N N    . PRO A 1 154 ? -0.192  -14.025 -28.154 1.00 0.00 ? 173 PRO A N    2  
ATOM 4728  C CA   . PRO A 1 154 ? -0.719  -14.316 -29.491 1.00 0.00 ? 173 PRO A CA   2  
ATOM 4729  C C    . PRO A 1 154 ? -2.240  -14.434 -29.500 1.00 0.00 ? 173 PRO A C    2  
ATOM 4730  O O    . PRO A 1 154 ? -2.824  -15.126 -28.666 1.00 0.00 ? 173 PRO A O    2  
ATOM 4731  C CB   . PRO A 1 154 ? -0.077  -15.658 -29.843 1.00 0.00 ? 173 PRO A CB   2  
ATOM 4732  C CG   . PRO A 1 154 ? 1.154   -15.730 -29.007 1.00 0.00 ? 173 PRO A CG   2  
ATOM 4733  C CD   . PRO A 1 154 ? 0.823   -15.007 -27.732 1.00 0.00 ? 173 PRO A CD   2  
ATOM 4734  H HA   . PRO A 1 154 ? -0.414  -13.567 -30.207 1.00 0.00 ? 173 PRO A HA   2  
ATOM 4735  H HB2  . PRO A 1 154 ? -0.760  -16.460 -29.610 2.00 0.00 ? 173 PRO A HB2  2  
ATOM 4736  H HB3  . PRO A 1 154 ? 0.162   -15.679 -30.897 2.00 0.00 ? 173 PRO A HB3  2  
ATOM 4737  H HG2  . PRO A 1 154 ? 1.398   -16.762 -28.801 2.00 0.00 ? 173 PRO A HG2  2  
ATOM 4738  H HG3  . PRO A 1 154 ? 1.972   -15.242 -29.514 2.00 0.00 ? 173 PRO A HG3  2  
ATOM 4739  H HD2  . PRO A 1 154 ? 0.417   -15.693 -27.002 2.00 0.00 ? 173 PRO A HD2  2  
ATOM 4740  H HD3  . PRO A 1 154 ? 1.699   -14.511 -27.340 2.00 0.00 ? 173 PRO A HD3  2  
ATOM 4741  N N    . THR A 1 155 ? -2.876  -13.754 -30.449 1.00 0.00 ? 174 THR A N    2  
ATOM 4742  C CA   . THR A 1 155 ? -4.329  -13.784 -30.566 1.00 0.00 ? 174 THR A CA   2  
ATOM 4743  C C    . THR A 1 155 ? -4.773  -14.760 -31.650 1.00 0.00 ? 174 THR A C    2  
ATOM 4744  O O    . THR A 1 155 ? -4.648  -14.479 -32.842 1.00 0.00 ? 174 THR A O    2  
ATOM 4745  C CB   . THR A 1 155 ? -4.895  -12.388 -30.887 1.00 0.00 ? 174 THR A CB   2  
ATOM 4746  O OG1  . THR A 1 155 ? -4.160  -11.385 -30.174 1.00 0.00 ? 174 THR A OG1  2  
ATOM 4747  C CG2  . THR A 1 155 ? -6.368  -12.304 -30.516 1.00 0.00 ? 174 THR A CG2  2  
ATOM 4748  H H    . THR A 1 155 ? -2.356  -13.221 -31.084 1.00 0.00 ? 174 THR A H    2  
ATOM 4749  H HA   . THR A 1 155 ? -4.734  -14.105 -29.618 1.00 0.00 ? 174 THR A HA   2  
ATOM 4750  H HB   . THR A 1 155 ? -4.796  -12.210 -31.948 1.00 0.00 ? 174 THR A HB   2  
ATOM 4751  H HG1  . THR A 1 155 ? -3.673  -10.842 -30.796 1.00 0.00 ? 174 THR A HG1  2  
ATOM 4752  H HG21 . THR A 1 155 ? -6.855  -11.571 -31.142 1.00 0.00 ? 174 THR A HG21 2  
ATOM 4753  H HG22 . THR A 1 155 ? -6.463  -12.013 -29.480 1.00 0.00 ? 174 THR A HG22 2  
ATOM 4754  H HG23 . THR A 1 155 ? -6.831  -13.268 -30.663 1.00 0.00 ? 174 THR A HG23 2  
ATOM 4755  N N    . ASP A 1 156 ? -5.294  -15.908 -31.227 1.00 0.00 ? 175 ASP A N    2  
ATOM 4756  C CA   . ASP A 1 156 ? -5.759  -16.928 -32.160 1.00 0.00 ? 175 ASP A CA   2  
ATOM 4757  C C    . ASP A 1 156 ? -4.643  -17.350 -33.110 1.00 0.00 ? 175 ASP A C    2  
ATOM 4758  O O    . ASP A 1 156 ? -4.902  -17.875 -34.193 1.00 0.00 ? 175 ASP A O    2  
ATOM 4759  C CB   . ASP A 1 156 ? -6.956  -16.411 -32.960 1.00 0.00 ? 175 ASP A CB   2  
ATOM 4760  C CG   . ASP A 1 156 ? -8.148  -17.347 -32.905 1.00 0.00 ? 175 ASP A CG   2  
ATOM 4761  O OD1  . ASP A 1 156 ? -8.794  -17.423 -31.839 1.00 0.00 ? 175 ASP A OD1  2  
ATOM 4762  O OD2  . ASP A 1 156 ? -8.434  -18.004 -33.928 1.00 0.00 ? 175 ASP A OD2  2  
ATOM 4763  H H    . ASP A 1 156 ? -5.368  -16.073 -30.264 1.00 0.00 ? 175 ASP A H    2  
ATOM 4764  H HA   . ASP A 1 156 ? -6.069  -17.788 -31.584 1.00 0.00 ? 175 ASP A HA   2  
ATOM 4765  H HB2  . ASP A 1 156 ? -7.258  -15.453 -32.563 2.00 0.00 ? 175 ASP A HB2  2  
ATOM 4766  H HB3  . ASP A 1 156 ? -6.666  -16.290 -33.992 2.00 0.00 ? 175 ASP A HB3  2  
ATOM 4767  N N    . ASP A 1 157 ? -3.401  -17.119 -32.697 1.00 0.00 ? 176 ASP A N    2  
ATOM 4768  C CA   . ASP A 1 157 ? -2.246  -17.477 -33.511 1.00 0.00 ? 176 ASP A CA   2  
ATOM 4769  C C    . ASP A 1 157 ? -2.101  -18.991 -33.612 1.00 0.00 ? 176 ASP A C    2  
ATOM 4770  O O    . ASP A 1 157 ? -2.449  -19.721 -32.684 1.00 0.00 ? 176 ASP A O    2  
ATOM 4771  C CB   . ASP A 1 157 ? -0.971  -16.869 -32.922 1.00 0.00 ? 176 ASP A CB   2  
ATOM 4772  C CG   . ASP A 1 157 ? 0.207   -16.894 -33.874 1.00 0.00 ? 176 ASP A CG   2  
ATOM 4773  O OD1  . ASP A 1 157 ? 0.253   -16.040 -34.786 1.00 0.00 ? 176 ASP A OD1  2  
ATOM 4774  O OD2  . ASP A 1 157 ? 1.087   -17.766 -33.708 1.00 0.00 ? 176 ASP A OD2  2  
ATOM 4775  H H    . ASP A 1 157 ? -3.259  -16.698 -31.823 1.00 0.00 ? 176 ASP A H    2  
ATOM 4776  H HA   . ASP A 1 157 ? -2.401  -17.074 -34.501 1.00 0.00 ? 176 ASP A HA   2  
ATOM 4777  H HB2  . ASP A 1 157 ? -1.166  -15.842 -32.651 2.00 0.00 ? 176 ASP A HB2  2  
ATOM 4778  H HB3  . ASP A 1 157 ? -0.700  -17.418 -32.034 2.00 0.00 ? 176 ASP A HB3  2  
ATOM 4779  N N    . ASP A 1 158 ? -1.587  -19.457 -34.747 1.00 0.00 ? 177 ASP A N    2  
ATOM 4780  C CA   . ASP A 1 158 ? -1.397  -20.885 -34.970 1.00 0.00 ? 177 ASP A CA   2  
ATOM 4781  C C    . ASP A 1 158 ? -2.721  -21.635 -34.851 1.00 0.00 ? 177 ASP A C    2  
ATOM 4782  O O    . ASP A 1 158 ? -3.792  -21.028 -34.852 1.00 0.00 ? 177 ASP A O    2  
ATOM 4783  C CB   . ASP A 1 158 ? -0.386  -21.450 -33.971 1.00 0.00 ? 177 ASP A CB   2  
ATOM 4784  C CG   . ASP A 1 158 ? 1.027   -21.479 -34.519 1.00 0.00 ? 177 ASP A CG   2  
ATOM 4785  O OD1  . ASP A 1 158 ? 1.214   -21.973 -35.651 1.00 0.00 ? 177 ASP A OD1  2  
ATOM 4786  O OD2  . ASP A 1 158 ? 1.947   -21.006 -33.819 1.00 0.00 ? 177 ASP A OD2  2  
ATOM 4787  H H    . ASP A 1 158 ? -1.331  -18.824 -35.450 1.00 0.00 ? 177 ASP A H    2  
ATOM 4788  H HA   . ASP A 1 158 ? -1.012  -21.016 -35.970 1.00 0.00 ? 177 ASP A HA   2  
ATOM 4789  H HB2  . ASP A 1 158 ? -0.392  -20.840 -33.079 2.00 0.00 ? 177 ASP A HB2  2  
ATOM 4790  H HB3  . ASP A 1 158 ? -0.671  -22.459 -33.712 2.00 0.00 ? 177 ASP A HB3  2  
ATOM 4791  N N    . VAL A 1 159 ? -2.639  -22.957 -34.748 1.00 0.00 ? 178 VAL A N    2  
ATOM 4792  C CA   . VAL A 1 159 ? -3.830  -23.790 -34.629 1.00 0.00 ? 178 VAL A CA   2  
ATOM 4793  C C    . VAL A 1 159 ? -3.902  -24.453 -33.257 1.00 0.00 ? 178 VAL A C    2  
ATOM 4794  O O    . VAL A 1 159 ? -3.062  -25.336 -32.982 1.00 0.00 ? 178 VAL A O    2  
ATOM 4795  C CB   . VAL A 1 159 ? -3.865  -24.881 -35.715 1.00 0.00 ? 178 VAL A CB   2  
ATOM 4796  C CG1  . VAL A 1 159 ? -5.253  -25.493 -35.822 2.00 0.00 ? 178 VAL A CG1  2  
ATOM 4797  C CG2  . VAL A 1 159 ? -3.430  -24.319 -37.060 2.00 0.00 ? 178 VAL A CG2  2  
ATOM 4798  H H    . VAL A 1 159 ? -1.756  -23.384 -34.754 1.00 0.00 ? 178 VAL A H    2  
ATOM 4799  H HA   . VAL A 1 159 ? -4.695  -23.155 -34.757 1.00 0.00 ? 178 VAL A HA   2  
ATOM 4800  H HB   . VAL A 1 159 ? -3.172  -25.658 -35.431 1.00 0.00 ? 178 VAL A HB   2  
ATOM 4801  H HG11 . VAL A 1 159 ? -5.683  -25.585 -34.836 1.00 0.00 ? 178 VAL A HG11 2  
ATOM 4802  H HG12 . VAL A 1 159 ? -5.183  -26.469 -36.277 1.00 0.00 ? 178 VAL A HG12 2  
ATOM 4803  H HG13 . VAL A 1 159 ? -5.881  -24.858 -36.430 1.00 0.00 ? 178 VAL A HG13 2  
ATOM 4804  H HG21 . VAL A 1 159 ? -2.355  -24.375 -37.143 1.00 0.00 ? 178 VAL A HG21 2  
ATOM 4805  H HG22 . VAL A 1 159 ? -3.745  -23.289 -37.138 1.00 0.00 ? 178 VAL A HG22 2  
ATOM 4806  H HG23 . VAL A 1 159 ? -3.883  -24.895 -37.854 1.00 0.00 ? 178 VAL A HG23 2  
ATOM 4807  N N    . ALA A 1 1   ? -0.413  -16.793 -12.593 1.00 0.00 ? 20  ALA A N    3  
ATOM 4808  C CA   . ALA A 1 1   ? -0.911  -15.428 -12.282 1.00 0.00 ? 20  ALA A CA   3  
ATOM 4809  C C    . ALA A 1 1   ? -0.718  -15.098 -10.806 1.00 0.00 ? 20  ALA A C    3  
ATOM 4810  O O    . ALA A 1 1   ? -1.605  -15.336 -9.986  1.00 0.00 ? 20  ALA A O    3  
ATOM 4811  C CB   . ALA A 1 1   ? -2.378  -15.304 -12.663 1.00 0.00 ? 20  ALA A CB   3  
ATOM 4812  H H1   . ALA A 1 1   ? -1.213  -17.443 -12.732 1.00 0.00 ? 20  ALA A H1   3  
ATOM 4813  H H2   . ALA A 1 1   ? 0.174   -17.147 -11.810 1.00 0.00 ? 20  ALA A H2   3  
ATOM 4814  H H3   . ALA A 1 1   ? 0.162   -16.776 -13.460 1.00 0.00 ? 20  ALA A H3   3  
ATOM 4815  H HA   . ALA A 1 1   ? -0.350  -14.720 -12.874 1.00 0.00 ? 20  ALA A HA   3  
ATOM 4816  H HB1  . ALA A 1 1   ? -2.986  -15.342 -11.772 1.00 0.00 ? 20  ALA A HB1  3  
ATOM 4817  H HB2  . ALA A 1 1   ? -2.650  -16.117 -13.319 1.00 0.00 ? 20  ALA A HB2  3  
ATOM 4818  H HB3  . ALA A 1 1   ? -2.540  -14.363 -13.170 1.00 0.00 ? 20  ALA A HB3  3  
ATOM 4819  N N    . GLN A 1 2   ? 0.446   -14.549 -10.473 1.00 0.00 ? 21  GLN A N    3  
ATOM 4820  C CA   . GLN A 1 2   ? 0.755   -14.185 -9.095  1.00 0.00 ? 21  GLN A CA   3  
ATOM 4821  C C    . GLN A 1 2   ? 1.498   -12.855 -9.038  1.00 0.00 ? 21  GLN A C    3  
ATOM 4822  O O    . GLN A 1 2   ? 2.418   -12.613 -9.819  1.00 0.00 ? 21  GLN A O    3  
ATOM 4823  C CB   . GLN A 1 2   ? 1.595   -15.281 -8.433  1.00 0.00 ? 21  GLN A CB   3  
ATOM 4824  C CG   . GLN A 1 2   ? 2.678   -15.884 -9.313  1.00 0.00 ? 21  GLN A CG   3  
ATOM 4825  C CD   . GLN A 1 2   ? 3.888   -16.339 -8.521  1.00 0.00 ? 21  GLN A CD   3  
ATOM 4826  O OE1  . GLN A 1 2   ? 4.139   -17.537 -8.384  1.00 0.00 ? 21  GLN A OE1  3  
ATOM 4827  N NE2  . GLN A 1 2   ? 4.646   -15.384 -7.997  4.00 0.00 ? 21  GLN A NE2  3  
ATOM 4828  H H    . GLN A 1 2   ? 1.113   -14.384 -11.172 1.00 0.00 ? 21  GLN A H    3  
ATOM 4829  H HA   . GLN A 1 2   ? -0.178  -14.088 -8.561  1.00 0.00 ? 21  GLN A HA   3  
ATOM 4830  H HB2  . GLN A 1 2   ? 2.069   -14.866 -7.557  2.00 0.00 ? 21  GLN A HB2  3  
ATOM 4831  H HB3  . GLN A 1 2   ? 0.936   -16.077 -8.121  2.00 0.00 ? 21  GLN A HB3  3  
ATOM 4832  H HG2  . GLN A 1 2   ? 2.267   -16.736 -9.835  2.00 0.00 ? 21  GLN A HG2  3  
ATOM 4833  H HG3  . GLN A 1 2   ? 2.995   -15.142 -10.031 2.00 0.00 ? 21  GLN A HG3  3  
ATOM 4834  H HE21 . GLN A 1 2   ? 4.385   -14.449 -8.148  5.00 0.00 ? 21  GLN A HE21 3  
ATOM 4835  H HE22 . GLN A 1 2   ? 5.438   -15.651 -7.479  5.00 0.00 ? 21  GLN A HE22 3  
ATOM 4836  N N    . ILE A 1 3   ? 1.089   -11.992 -8.113  1.00 0.00 ? 22  ILE A N    3  
ATOM 4837  C CA   . ILE A 1 3   ? 1.711   -10.685 -7.959  1.00 0.00 ? 22  ILE A CA   3  
ATOM 4838  C C    . ILE A 1 3   ? 2.386   -10.547 -6.600  1.00 0.00 ? 22  ILE A C    3  
ATOM 4839  O O    . ILE A 1 3   ? 1.972   -11.171 -5.623  1.00 0.00 ? 22  ILE A O    3  
ATOM 4840  C CB   . ILE A 1 3   ? 0.683   -9.551  -8.119  1.00 0.00 ? 22  ILE A CB   3  
ATOM 4841  C CG1  . ILE A 1 3   ? -0.654  -10.107 -8.618  1.00 0.00 ? 22  ILE A CG1  3  
ATOM 4842  C CG2  . ILE A 1 3   ? 1.212   -8.494  -9.071  1.00 0.00 ? 22  ILE A CG2  3  
ATOM 4843  C CD1  . ILE A 1 3   ? -1.751  -9.068  -8.705  1.00 0.00 ? 22  ILE A CD1  3  
ATOM 4844  H H    . ILE A 1 3   ? 0.348   -12.237 -7.522  1.00 0.00 ? 22  ILE A H    3  
ATOM 4845  H HA   . ILE A 1 3   ? 2.458   -10.577 -8.733  1.00 0.00 ? 22  ILE A HA   3  
ATOM 4846  H HB   . ILE A 1 3   ? 0.535   -9.091  -7.154  1.00 0.00 ? 22  ILE A HB   3  
ATOM 4847  H HG12 . ILE A 1 3   ? -0.515  -10.526 -9.604  2.00 0.00 ? 22  ILE A HG12 3  
ATOM 4848  H HG13 . ILE A 1 3   ? -0.986  -10.885 -7.947  2.00 0.00 ? 22  ILE A HG13 3  
ATOM 4849  H HG21 . ILE A 1 3   ? 1.719   -8.976  -9.893  1.00 0.00 ? 22  ILE A HG21 3  
ATOM 4850  H HG22 . ILE A 1 3   ? 1.904   -7.852  -8.546  1.00 0.00 ? 22  ILE A HG22 3  
ATOM 4851  H HG23 . ILE A 1 3   ? 0.389   -7.907  -9.450  1.00 0.00 ? 22  ILE A HG23 3  
ATOM 4852  H HD11 . ILE A 1 3   ? -2.119  -8.850  -7.713  1.00 0.00 ? 22  ILE A HD11 3  
ATOM 4853  H HD12 . ILE A 1 3   ? -2.559  -9.449  -9.313  1.00 0.00 ? 22  ILE A HD12 3  
ATOM 4854  H HD13 . ILE A 1 3   ? -1.358  -8.166  -9.150  1.00 0.00 ? 22  ILE A HD13 3  
ATOM 4855  N N    . ASP A 1 4   ? 3.422   -9.717  -6.546  1.00 0.00 ? 23  ASP A N    3  
ATOM 4856  C CA   . ASP A 1 4   ? 4.151   -9.484  -5.306  1.00 0.00 ? 23  ASP A CA   3  
ATOM 4857  C C    . ASP A 1 4   ? 3.672   -8.198  -4.642  1.00 0.00 ? 23  ASP A C    3  
ATOM 4858  O O    . ASP A 1 4   ? 3.853   -7.106  -5.179  1.00 0.00 ? 23  ASP A O    3  
ATOM 4859  C CB   . ASP A 1 4   ? 5.654   -9.404  -5.579  1.00 0.00 ? 23  ASP A CB   3  
ATOM 4860  C CG   . ASP A 1 4   ? 6.274   -10.765 -5.826  1.00 0.00 ? 23  ASP A CG   3  
ATOM 4861  O OD1  . ASP A 1 4   ? 5.860   -11.439 -6.792  1.00 0.00 ? 23  ASP A OD1  3  
ATOM 4862  O OD2  . ASP A 1 4   ? 7.175   -11.156 -5.055  1.00 0.00 ? 23  ASP A OD2  3  
ATOM 4863  H H    . ASP A 1 4   ? 3.698   -9.244  -7.358  1.00 0.00 ? 23  ASP A H    3  
ATOM 4864  H HA   . ASP A 1 4   ? 3.955   -10.314 -4.643  1.00 0.00 ? 23  ASP A HA   3  
ATOM 4865  H HB2  . ASP A 1 4   ? 5.822   -8.788  -6.451  2.00 0.00 ? 23  ASP A HB2  3  
ATOM 4866  H HB3  . ASP A 1 4   ? 6.144   -8.955  -4.726  2.00 0.00 ? 23  ASP A HB3  3  
ATOM 4867  N N    . LEU A 1 5   ? 3.054   -8.334  -3.475  1.00 0.00 ? 24  LEU A N    3  
ATOM 4868  C CA   . LEU A 1 5   ? 2.544   -7.182  -2.745  1.00 0.00 ? 24  LEU A CA   3  
ATOM 4869  C C    . LEU A 1 5   ? 3.463   -6.827  -1.583  1.00 0.00 ? 24  LEU A C    3  
ATOM 4870  O O    . LEU A 1 5   ? 4.071   -7.702  -0.969  1.00 0.00 ? 24  LEU A O    3  
ATOM 4871  C CB   . LEU A 1 5   ? 1.131   -7.463  -2.231  1.00 0.00 ? 24  LEU A CB   3  
ATOM 4872  C CG   . LEU A 1 5   ? 0.031   -7.570  -3.292  1.00 0.00 ? 24  LEU A CG   3  
ATOM 4873  C CD1  . LEU A 1 5   ? -0.015  -6.312  -4.146  2.00 0.00 ? 24  LEU A CD1  3  
ATOM 4874  C CD2  . LEU A 1 5   ? 0.250   -8.792  -4.169  2.00 0.00 ? 24  LEU A CD2  3  
ATOM 4875  H H    . LEU A 1 5   ? 2.935   -9.230  -3.095  1.00 0.00 ? 24  LEU A H    3  
ATOM 4876  H HA   . LEU A 1 5   ? 2.508   -6.346  -3.427  1.00 0.00 ? 24  LEU A HA   3  
ATOM 4877  H HB2  . LEU A 1 5   ? 1.154   -8.390  -1.678  2.00 0.00 ? 24  LEU A HB2  3  
ATOM 4878  H HB3  . LEU A 1 5   ? 0.859   -6.673  -1.546  2.00 0.00 ? 24  LEU A HB3  3  
ATOM 4879  H HG   . LEU A 1 5   ? -0.925  -7.676  -2.800  1.00 0.00 ? 24  LEU A HG   3  
ATOM 4880  H HD11 . LEU A 1 5   ? 0.392   -5.482  -3.587  1.00 0.00 ? 24  LEU A HD11 3  
ATOM 4881  H HD12 . LEU A 1 5   ? -1.038  -6.098  -4.416  1.00 0.00 ? 24  LEU A HD12 3  
ATOM 4882  H HD13 . LEU A 1 5   ? 0.570   -6.464  -5.041  1.00 0.00 ? 24  LEU A HD13 3  
ATOM 4883  H HD21 . LEU A 1 5   ? -0.491  -8.809  -4.955  1.00 0.00 ? 24  LEU A HD21 3  
ATOM 4884  H HD22 . LEU A 1 5   ? 0.160   -9.687  -3.570  1.00 0.00 ? 24  LEU A HD22 3  
ATOM 4885  H HD23 . LEU A 1 5   ? 1.237   -8.750  -4.606  1.00 0.00 ? 24  LEU A HD23 3  
ATOM 4886  N N    . ASN A 1 6   ? 3.558   -5.538  -1.290  1.00 0.00 ? 25  ASN A N    3  
ATOM 4887  C CA   . ASN A 1 6   ? 4.398   -5.058  -0.203  1.00 0.00 ? 25  ASN A CA   3  
ATOM 4888  C C    . ASN A 1 6   ? 3.683   -3.968  0.581   1.00 0.00 ? 25  ASN A C    3  
ATOM 4889  O O    . ASN A 1 6   ? 3.520   -2.849  0.100   1.00 0.00 ? 25  ASN A O    3  
ATOM 4890  C CB   . ASN A 1 6   ? 5.724   -4.525  -0.746  1.00 0.00 ? 25  ASN A CB   3  
ATOM 4891  C CG   . ASN A 1 6   ? 6.902   -5.403  -0.373  1.00 0.00 ? 25  ASN A CG   3  
ATOM 4892  O OD1  . ASN A 1 6   ? 7.673   -5.076  0.529   1.00 0.00 ? 25  ASN A OD1  3  
ATOM 4893  N ND2  . ASN A 1 6   ? 7.047   -6.527  -1.066  4.00 0.00 ? 25  ASN A ND2  3  
ATOM 4894  H H    . ASN A 1 6   ? 3.048   -4.890  -1.820  1.00 0.00 ? 25  ASN A H    3  
ATOM 4895  H HA   . ASN A 1 6   ? 4.596   -5.890  0.456   1.00 0.00 ? 25  ASN A HA   3  
ATOM 4896  H HB2  . ASN A 1 6   ? 5.667   -4.469  -1.823  2.00 0.00 ? 25  ASN A HB2  3  
ATOM 4897  H HB3  . ASN A 1 6   ? 5.897   -3.537  -0.348  2.00 0.00 ? 25  ASN A HB3  3  
ATOM 4898  H HD21 . ASN A 1 6   ? 6.392   -6.725  -1.772  5.00 0.00 ? 25  ASN A HD21 3  
ATOM 4899  H HD22 . ASN A 1 6   ? 7.803   -7.115  -0.843  5.00 0.00 ? 25  ASN A HD22 3  
ATOM 4900  N N    . ILE A 1 7   ? 3.251   -4.300  1.789   1.00 0.00 ? 26  ILE A N    3  
ATOM 4901  C CA   . ILE A 1 7   ? 2.550   -3.345  2.633   1.00 0.00 ? 26  ILE A CA   3  
ATOM 4902  C C    . ILE A 1 7   ? 3.326   -3.084  3.919   1.00 0.00 ? 26  ILE A C    3  
ATOM 4903  O O    . ILE A 1 7   ? 4.446   -3.567  4.087   1.00 0.00 ? 26  ILE A O    3  
ATOM 4904  C CB   . ILE A 1 7   ? 1.132   -3.840  2.975   1.00 0.00 ? 26  ILE A CB   3  
ATOM 4905  C CG1  . ILE A 1 7   ? 1.157   -4.792  4.172   1.00 0.00 ? 26  ILE A CG1  3  
ATOM 4906  C CG2  . ILE A 1 7   ? 0.511   -4.518  1.764   1.00 0.00 ? 26  ILE A CG2  3  
ATOM 4907  C CD1  . ILE A 1 7   ? -0.124  -4.789  4.980   1.00 0.00 ? 26  ILE A CD1  3  
ATOM 4908  H H    . ILE A 1 7   ? 3.405   -5.209  2.121   1.00 0.00 ? 26  ILE A H    3  
ATOM 4909  H HA   . ILE A 1 7   ? 2.460   -2.417  2.084   1.00 0.00 ? 26  ILE A HA   3  
ATOM 4910  H HB   . ILE A 1 7   ? 0.528   -2.981  3.220   1.00 0.00 ? 26  ILE A HB   3  
ATOM 4911  H HG12 . ILE A 1 7   ? 1.324   -5.799  3.820   2.00 0.00 ? 26  ILE A HG12 3  
ATOM 4912  H HG13 . ILE A 1 7   ? 1.965   -4.510  4.832   2.00 0.00 ? 26  ILE A HG13 3  
ATOM 4913  H HG21 . ILE A 1 7   ? -0.464  -4.094  1.574   1.00 0.00 ? 26  ILE A HG21 3  
ATOM 4914  H HG22 . ILE A 1 7   ? 0.413   -5.575  1.957   1.00 0.00 ? 26  ILE A HG22 3  
ATOM 4915  H HG23 . ILE A 1 7   ? 1.144   -4.366  0.902   1.00 0.00 ? 26  ILE A HG23 3  
ATOM 4916  H HD11 . ILE A 1 7   ? 0.082   -4.439  5.981   1.00 0.00 ? 26  ILE A HD11 3  
ATOM 4917  H HD12 . ILE A 1 7   ? -0.524  -5.791  5.025   1.00 0.00 ? 26  ILE A HD12 3  
ATOM 4918  H HD13 . ILE A 1 7   ? -0.847  -4.134  4.512   1.00 0.00 ? 26  ILE A HD13 3  
ATOM 4919  N N    . THR A 1 8   ? 2.727   -2.321  4.824   1.00 0.00 ? 27  THR A N    3  
ATOM 4920  C CA   . THR A 1 8   ? 3.366   -1.999  6.091   1.00 0.00 ? 27  THR A CA   3  
ATOM 4921  C C    . THR A 1 8   ? 2.673   -2.723  7.233   1.00 0.00 ? 27  THR A C    3  
ATOM 4922  O O    . THR A 1 8   ? 3.287   -3.020  8.256   1.00 0.00 ? 27  THR A O    3  
ATOM 4923  C CB   . THR A 1 8   ? 3.338   -0.486  6.358   1.00 0.00 ? 27  THR A CB   3  
ATOM 4924  O OG1  . THR A 1 8   ? 4.486   0.134   5.766   1.00 0.00 ? 27  THR A OG1  3  
ATOM 4925  C CG2  . THR A 1 8   ? 3.307   -0.187  7.850   1.00 0.00 ? 27  THR A CG2  3  
ATOM 4926  H H    . THR A 1 8   ? 1.832   -1.966  4.636   1.00 0.00 ? 27  THR A H    3  
ATOM 4927  H HA   . THR A 1 8   ? 4.395   -2.322  6.041   1.00 0.00 ? 27  THR A HA   3  
ATOM 4928  H HB   . THR A 1 8   ? 2.446   -0.076  5.907   1.00 0.00 ? 27  THR A HB   3  
ATOM 4929  H HG1  . THR A 1 8   ? 4.224   0.608   4.975   1.00 0.00 ? 27  THR A HG1  3  
ATOM 4930  H HG21 . THR A 1 8   ? 2.805   0.756   8.015   1.00 0.00 ? 27  THR A HG21 3  
ATOM 4931  H HG22 . THR A 1 8   ? 4.317   -0.129  8.226   1.00 0.00 ? 27  THR A HG22 3  
ATOM 4932  H HG23 . THR A 1 8   ? 2.773   -0.974  8.364   1.00 0.00 ? 27  THR A HG23 3  
ATOM 4933  N N    . CYS A 1 9   ? 1.386   -2.994  7.032   1.00 0.00 ? 28  CYS A N    3  
ATOM 4934  C CA   . CYS A 1 9   ? 0.559   -3.686  8.024   1.00 0.00 ? 28  CYS A CA   3  
ATOM 4935  C C    . CYS A 1 9   ? -0.546  -2.769  8.525   1.00 0.00 ? 28  CYS A C    3  
ATOM 4936  O O    . CYS A 1 9   ? -0.549  -1.574  8.233   1.00 0.00 ? 28  CYS A O    3  
ATOM 4937  C CB   . CYS A 1 9   ? 1.397   -4.178  9.205   1.00 0.00 ? 28  CYS A CB   3  
ATOM 4938  S SG   . CYS A 1 9   ? 2.548   -5.531  8.796   1.00 0.00 ? 28  CYS A SG   3  
ATOM 4939  H H    . CYS A 1 9   ? 0.974   -2.713  6.182   1.00 0.00 ? 28  CYS A H    3  
ATOM 4940  H HA   . CYS A 1 9   ? 0.106   -4.537  7.537   1.00 0.00 ? 28  CYS A HA   3  
ATOM 4941  H HB2  . CYS A 1 9   ? 1.982   -3.354  9.587   2.00 0.00 ? 28  CYS A HB2  3  
ATOM 4942  H HB3  . CYS A 1 9   ? 0.736   -4.536  9.981   2.00 0.00 ? 28  CYS A HB3  3  
ATOM 4943  N N    . ARG A 1 10  ? -1.488  -3.331  9.275   1.00 0.00 ? 29  ARG A N    3  
ATOM 4944  C CA   . ARG A 1 10  ? -2.601  -2.551  9.801   1.00 0.00 ? 29  ARG A CA   3  
ATOM 4945  C C    . ARG A 1 10  ? -2.411  -2.221  11.277  1.00 0.00 ? 29  ARG A C    3  
ATOM 4946  O O    . ARG A 1 10  ? -2.674  -3.047  12.158  1.00 0.00 ? 29  ARG A O    3  
ATOM 4947  C CB   . ARG A 1 10  ? -3.924  -3.290  9.594   1.00 0.00 ? 29  ARG A CB   3  
ATOM 4948  C CG   . ARG A 1 10  ? -3.849  -4.399  8.562   1.00 0.00 ? 29  ARG A CG   3  
ATOM 4949  C CD   . ARG A 1 10  ? -3.544  -5.739  9.205   1.00 0.00 ? 29  ARG A CD   3  
ATOM 4950  N NE   . ARG A 1 10  ? -4.757  -6.475  9.549   1.00 0.00 ? 29  ARG A NE   3  
ATOM 4951  C CZ   . ARG A 1 10  ? -4.868  -7.796  9.460   4.00 0.00 ? 29  ARG A CZ   3  
ATOM 4952  N NH1  . ARG A 1 10  ? -3.845  -8.529  9.040   5.00 0.00 ? 29  ARG A NH1  3  
ATOM 4953  N NH2  . ARG A 1 10  ? -6.003  -8.398  9.787   5.00 0.00 ? 29  ARG A NH2  3  
ATOM 4954  H H    . ARG A 1 10  ? -1.433  -4.288  9.474   1.00 0.00 ? 29  ARG A H    3  
ATOM 4955  H HA   . ARG A 1 10  ? -2.635  -1.625  9.248   1.00 0.00 ? 29  ARG A HA   3  
ATOM 4956  H HB2  . ARG A 1 10  ? -4.230  -3.723  10.535  2.00 0.00 ? 29  ARG A HB2  3  
ATOM 4957  H HB3  . ARG A 1 10  ? -4.672  -2.580  9.275   2.00 0.00 ? 29  ARG A HB3  3  
ATOM 4958  H HG2  . ARG A 1 10  ? -4.796  -4.462  8.043   2.00 0.00 ? 29  ARG A HG2  3  
ATOM 4959  H HG3  . ARG A 1 10  ? -3.067  -4.165  7.854   2.00 0.00 ? 29  ARG A HG3  3  
ATOM 4960  H HD2  . ARG A 1 10  ? -2.955  -6.328  8.519   2.00 0.00 ? 29  ARG A HD2  3  
ATOM 4961  H HD3  . ARG A 1 10  ? -2.971  -5.562  10.106  2.00 0.00 ? 29  ARG A HD3  3  
ATOM 4962  H HE   . ARG A 1 10  ? -5.528  -5.958  9.863   1.00 0.00 ? 29  ARG A HE   3  
ATOM 4963  H HH11 . ARG A 1 10  ? -2.983  -8.087  8.789   5.00 0.00 ? 29  ARG A HH11 3  
ATOM 4964  H HH12 . ARG A 1 10  ? -3.934  -9.522  8.975   5.00 0.00 ? 29  ARG A HH12 3  
ATOM 4965  H HH21 . ARG A 1 10  ? -6.782  -7.856  10.105  5.00 0.00 ? 29  ARG A HH21 3  
ATOM 4966  H HH22 . ARG A 1 10  ? -6.080  -9.392  9.718   5.00 0.00 ? 29  ARG A HH22 3  
ATOM 4967  N N    . PHE A 1 11  ? -1.972  -0.996  11.532  1.00 0.00 ? 30  PHE A N    3  
ATOM 4968  C CA   . PHE A 1 11  ? -1.759  -0.513  12.890  1.00 0.00 ? 30  PHE A CA   3  
ATOM 4969  C C    . PHE A 1 11  ? -2.891  0.428   13.287  1.00 0.00 ? 30  PHE A C    3  
ATOM 4970  O O    . PHE A 1 11  ? -3.256  1.327   12.528  1.00 0.00 ? 30  PHE A O    3  
ATOM 4971  C CB   . PHE A 1 11  ? -0.421  0.221   13.003  1.00 0.00 ? 30  PHE A CB   3  
ATOM 4972  C CG   . PHE A 1 11  ? 0.798   -0.593  12.675  1.00 0.00 ? 30  PHE A CG   3  
ATOM 4973  C CD1  . PHE A 1 11  ? 1.008   -1.062  11.390  1.00 0.00 ? 30  PHE A CD1  3  
ATOM 4974  C CD2  . PHE A 1 11  ? 1.739   -0.879  13.651  1.00 0.00 ? 30  PHE A CD2  3  
ATOM 4975  C CE1  . PHE A 1 11  ? 2.134   -1.799  11.082  1.00 0.00 ? 30  PHE A CE1  3  
ATOM 4976  C CE2  . PHE A 1 11  ? 2.866   -1.619  13.350  1.00 0.00 ? 30  PHE A CE2  3  
ATOM 4977  C CZ   . PHE A 1 11  ? 3.064   -2.079  12.062  1.00 0.00 ? 30  PHE A CZ   3  
ATOM 4978  H H    . PHE A 1 11  ? -1.800  -0.394  10.781  1.00 0.00 ? 30  PHE A H    3  
ATOM 4979  H HA   . PHE A 1 11  ? -1.758  -1.363  13.555  1.00 0.00 ? 30  PHE A HA   3  
ATOM 4980  H HB2  . PHE A 1 11  ? -0.435  1.070   12.335  2.00 0.00 ? 30  PHE A HB2  3  
ATOM 4981  H HB3  . PHE A 1 11  ? -0.309  0.582   14.015  2.00 0.00 ? 30  PHE A HB3  3  
ATOM 4982  H HD1  . PHE A 1 11  ? 0.281   -0.845  10.620  1.00 0.00 ? 30  PHE A HD1  3  
ATOM 4983  H HD2  . PHE A 1 11  ? 1.584   -0.519  14.657  1.00 0.00 ? 30  PHE A HD2  3  
ATOM 4984  H HE1  . PHE A 1 11  ? 2.287   -2.159  10.075  1.00 0.00 ? 30  PHE A HE1  3  
ATOM 4985  H HE2  . PHE A 1 11  ? 3.592   -1.836  14.119  1.00 0.00 ? 30  PHE A HE2  3  
ATOM 4986  H HZ   . PHE A 1 11  ? 3.945   -2.655  11.822  1.00 0.00 ? 30  PHE A HZ   3  
ATOM 4987  N N    . ALA A 1 12  ? -3.448  0.217   14.472  1.00 0.00 ? 31  ALA A N    3  
ATOM 4988  C CA   . ALA A 1 12  ? -4.544  1.047   14.958  1.00 0.00 ? 31  ALA A CA   3  
ATOM 4989  C C    . ALA A 1 12  ? -5.739  0.994   14.008  1.00 0.00 ? 31  ALA A C    3  
ATOM 4990  O O    . ALA A 1 12  ? -6.728  1.696   14.206  1.00 0.00 ? 31  ALA A O    3  
ATOM 4991  C CB   . ALA A 1 12  ? -4.078  2.484   15.141  1.00 0.00 ? 31  ALA A CB   3  
ATOM 4992  H H    . ALA A 1 12  ? -3.118  -0.514  15.032  1.00 0.00 ? 31  ALA A H    3  
ATOM 4993  H HA   . ALA A 1 12  ? -4.847  0.668   15.922  1.00 0.00 ? 31  ALA A HA   3  
ATOM 4994  H HB1  . ALA A 1 12  ? -3.531  2.800   14.266  1.00 0.00 ? 31  ALA A HB1  3  
ATOM 4995  H HB2  . ALA A 1 12  ? -3.438  2.548   16.008  1.00 0.00 ? 31  ALA A HB2  3  
ATOM 4996  H HB3  . ALA A 1 12  ? -4.936  3.126   15.279  1.00 0.00 ? 31  ALA A HB3  3  
ATOM 4997  N N    . GLY A 1 13  ? -5.643  0.152   12.983  1.00 0.00 ? 32  GLY A N    3  
ATOM 4998  C CA   . GLY A 1 13  ? -6.723  0.019   12.021  1.00 0.00 ? 32  GLY A CA   3  
ATOM 4999  C C    . GLY A 1 13  ? -6.352  0.488   10.623  1.00 0.00 ? 32  GLY A C    3  
ATOM 5000  O O    . GLY A 1 13  ? -7.193  0.496   9.724   1.00 0.00 ? 32  GLY A O    3  
ATOM 5001  H H    . GLY A 1 13  ? -4.837  -0.391  12.884  1.00 0.00 ? 32  GLY A H    3  
ATOM 5002  H HA2  . GLY A 1 13  ? -7.016  -1.021  11.970  2.00 0.00 ? 32  GLY A HA2  3  
ATOM 5003  H HA3  . GLY A 1 13  ? -7.568  0.601   12.365  2.00 0.00 ? 32  GLY A HA3  3  
ATOM 5004  N N    . VAL A 1 14  ? -5.094  0.885   10.435  1.00 0.00 ? 33  VAL A N    3  
ATOM 5005  C CA   . VAL A 1 14  ? -4.629  1.357   9.132   1.00 0.00 ? 33  VAL A CA   3  
ATOM 5006  C C    . VAL A 1 14  ? -3.537  0.455   8.566   1.00 0.00 ? 33  VAL A C    3  
ATOM 5007  O O    . VAL A 1 14  ? -2.513  0.231   9.212   1.00 0.00 ? 33  VAL A O    3  
ATOM 5008  C CB   . VAL A 1 14  ? -4.079  2.798   9.221   1.00 0.00 ? 33  VAL A CB   3  
ATOM 5009  C CG1  . VAL A 1 14  ? -2.775  2.929   8.451   2.00 0.00 ? 33  VAL A CG1  3  
ATOM 5010  C CG2  . VAL A 1 14  ? -5.090  3.804   8.703   2.00 0.00 ? 33  VAL A CG2  3  
ATOM 5011  H H    . VAL A 1 14  ? -4.467  0.861   11.187  1.00 0.00 ? 33  VAL A H    3  
ATOM 5012  H HA   . VAL A 1 14  ? -5.471  1.358   8.455   1.00 0.00 ? 33  VAL A HA   3  
ATOM 5013  H HB   . VAL A 1 14  ? -3.883  3.015   10.262  1.00 0.00 ? 33  VAL A HB   3  
ATOM 5014  H HG11 . VAL A 1 14  ? -2.077  2.178   8.792   1.00 0.00 ? 33  VAL A HG11 3  
ATOM 5015  H HG12 . VAL A 1 14  ? -2.357  3.910   8.614   1.00 0.00 ? 33  VAL A HG12 3  
ATOM 5016  H HG13 . VAL A 1 14  ? -2.966  2.789   7.397   1.00 0.00 ? 33  VAL A HG13 3  
ATOM 5017  H HG21 . VAL A 1 14  ? -6.042  3.315   8.560   1.00 0.00 ? 33  VAL A HG21 3  
ATOM 5018  H HG22 . VAL A 1 14  ? -4.745  4.206   7.762   1.00 0.00 ? 33  VAL A HG22 3  
ATOM 5019  H HG23 . VAL A 1 14  ? -5.199  4.604   9.419   1.00 0.00 ? 33  VAL A HG23 3  
ATOM 5020  N N    . PHE A 1 15  ? -3.742  -0.040  7.347   1.00 0.00 ? 34  PHE A N    3  
ATOM 5021  C CA   . PHE A 1 15  ? -2.751  -0.891  6.702   1.00 0.00 ? 34  PHE A CA   3  
ATOM 5022  C C    . PHE A 1 15  ? -2.253  -0.220  5.431   1.00 0.00 ? 34  PHE A C    3  
ATOM 5023  O O    . PHE A 1 15  ? -3.021  0.065   4.508   1.00 0.00 ? 34  PHE A O    3  
ATOM 5024  C CB   . PHE A 1 15  ? -3.332  -2.306  6.464   1.00 0.00 ? 34  PHE A CB   3  
ATOM 5025  C CG   . PHE A 1 15  ? -3.033  -2.977  5.136   1.00 0.00 ? 34  PHE A CG   3  
ATOM 5026  C CD1  . PHE A 1 15  ? -2.153  -2.437  4.212   1.00 0.00 ? 34  PHE A CD1  3  
ATOM 5027  C CD2  . PHE A 1 15  ? -3.669  -4.175  4.816   1.00 0.00 ? 34  PHE A CD2  3  
ATOM 5028  C CE1  . PHE A 1 15  ? -1.919  -3.067  3.007   1.00 0.00 ? 34  PHE A CE1  3  
ATOM 5029  C CE2  . PHE A 1 15  ? -3.436  -4.807  3.612   1.00 0.00 ? 34  PHE A CE2  3  
ATOM 5030  C CZ   . PHE A 1 15  ? -2.562  -4.251  2.707   1.00 0.00 ? 34  PHE A CZ   3  
ATOM 5031  H H    . PHE A 1 15  ? -4.568  0.185   6.864   1.00 0.00 ? 34  PHE A H    3  
ATOM 5032  H HA   . PHE A 1 15  ? -1.917  -0.973  7.382   1.00 0.00 ? 34  PHE A HA   3  
ATOM 5033  H HB2  . PHE A 1 15  ? -2.951  -2.956  7.236   2.00 0.00 ? 34  PHE A HB2  3  
ATOM 5034  H HB3  . PHE A 1 15  ? -4.406  -2.252  6.559   2.00 0.00 ? 34  PHE A HB3  3  
ATOM 5035  H HD1  . PHE A 1 15  ? -1.647  -1.515  4.437   1.00 0.00 ? 34  PHE A HD1  3  
ATOM 5036  H HD2  . PHE A 1 15  ? -4.355  -4.615  5.520   1.00 0.00 ? 34  PHE A HD2  3  
ATOM 5037  H HE1  . PHE A 1 15  ? -1.232  -2.632  2.298   1.00 0.00 ? 34  PHE A HE1  3  
ATOM 5038  H HE2  . PHE A 1 15  ? -3.956  -5.731  3.375   1.00 0.00 ? 34  PHE A HE2  3  
ATOM 5039  H HZ   . PHE A 1 15  ? -2.378  -4.740  1.766   1.00 0.00 ? 34  PHE A HZ   3  
ATOM 5040  N N    . HIS A 1 16  ? -0.952  0.054   5.413   1.00 0.00 ? 35  HIS A N    3  
ATOM 5041  C CA   . HIS A 1 16  ? -0.312  0.709   4.284   1.00 0.00 ? 35  HIS A CA   3  
ATOM 5042  C C    . HIS A 1 16  ? 0.031   -0.312  3.206   1.00 0.00 ? 35  HIS A C    3  
ATOM 5043  O O    . HIS A 1 16  ? 0.817   -1.226  3.438   1.00 0.00 ? 35  HIS A O    3  
ATOM 5044  C CB   . HIS A 1 16  ? 0.953   1.433   4.759   1.00 0.00 ? 35  HIS A CB   3  
ATOM 5045  C CG   . HIS A 1 16  ? 1.803   1.978   3.659   1.00 0.00 ? 35  HIS A CG   3  
ATOM 5046  N ND1  . HIS A 1 16  ? 2.708   2.999   3.840   1.00 0.00 ? 35  HIS A ND1  3  
ATOM 5047  C CD2  . HIS A 1 16  ? 1.877   1.639   2.357   1.00 0.00 ? 35  HIS A CD2  3  
ATOM 5048  C CE1  . HIS A 1 16  ? 3.302   3.267   2.693   1.00 0.00 ? 35  HIS A CE1  3  
ATOM 5049  N NE2  . HIS A 1 16  ? 2.815   2.455   1.772   1.00 0.00 ? 35  HIS A NE2  3  
ATOM 5050  H H    . HIS A 1 16  ? -0.408  -0.184  6.192   1.00 0.00 ? 35  HIS A H    3  
ATOM 5051  H HA   . HIS A 1 16  ? -1.003  1.432   3.878   1.00 0.00 ? 35  HIS A HA   3  
ATOM 5052  H HB2  . HIS A 1 16  ? 0.666   2.258   5.394   2.00 0.00 ? 35  HIS A HB2  3  
ATOM 5053  H HB3  . HIS A 1 16  ? 1.556   0.744   5.331   2.00 0.00 ? 35  HIS A HB3  3  
ATOM 5054  H HD1  . HIS A 1 16  ? 2.891   3.459   4.685   1.00 0.00 ? 35  HIS A HD1  3  
ATOM 5055  H HD2  . HIS A 1 16  ? 1.307   0.862   1.872   1.00 0.00 ? 35  HIS A HD2  3  
ATOM 5056  H HE1  . HIS A 1 16  ? 4.058   4.021   2.533   1.00 0.00 ? 35  HIS A HE1  3  
ATOM 5057  H HE2  . HIS A 1 16  ? 2.936   2.571   0.809   1.00 0.00 ? 35  HIS A HE2  3  
ATOM 5058  N N    . VAL A 1 17  ? -0.573  -0.161  2.032   1.00 0.00 ? 36  VAL A N    3  
ATOM 5059  C CA   . VAL A 1 17  ? -0.337  -1.089  0.929   1.00 0.00 ? 36  VAL A CA   3  
ATOM 5060  C C    . VAL A 1 17  ? 0.639   -0.526  -0.101  1.00 0.00 ? 36  VAL A C    3  
ATOM 5061  O O    . VAL A 1 17  ? 0.679   0.678   -0.347  1.00 0.00 ? 36  VAL A O    3  
ATOM 5062  C CB   . VAL A 1 17  ? -1.651  -1.445  0.210   1.00 0.00 ? 36  VAL A CB   3  
ATOM 5063  C CG1  . VAL A 1 17  ? -2.671  -0.335  0.386   2.00 0.00 ? 36  VAL A CG1  3  
ATOM 5064  C CG2  . VAL A 1 17  ? -1.407  -1.711  -1.268  2.00 0.00 ? 36  VAL A CG2  3  
ATOM 5065  H H    . VAL A 1 17  ? -1.198  0.583   1.909   1.00 0.00 ? 36  VAL A H    3  
ATOM 5066  H HA   . VAL A 1 17  ? 0.071   -1.996  1.345   1.00 0.00 ? 36  VAL A HA   3  
ATOM 5067  H HB   . VAL A 1 17  ? -2.046  -2.344  0.659   1.00 0.00 ? 36  VAL A HB   3  
ATOM 5068  H HG11 . VAL A 1 17  ? -3.426  -0.414  -0.382  1.00 0.00 ? 36  VAL A HG11 3  
ATOM 5069  H HG12 . VAL A 1 17  ? -2.174  0.620   0.307   1.00 0.00 ? 36  VAL A HG12 3  
ATOM 5070  H HG13 . VAL A 1 17  ? -3.134  -0.423  1.358   1.00 0.00 ? 36  VAL A HG13 3  
ATOM 5071  H HG21 . VAL A 1 17  ? -2.342  -1.965  -1.747  1.00 0.00 ? 36  VAL A HG21 3  
ATOM 5072  H HG22 . VAL A 1 17  ? -0.713  -2.533  -1.376  1.00 0.00 ? 36  VAL A HG22 3  
ATOM 5073  H HG23 . VAL A 1 17  ? -0.995  -0.827  -1.729  1.00 0.00 ? 36  VAL A HG23 3  
ATOM 5074  N N    . GLU A 1 18  ? 1.407   -1.422  -0.715  1.00 0.00 ? 37  GLU A N    3  
ATOM 5075  C CA   . GLU A 1 18  ? 2.371   -1.046  -1.741  1.00 0.00 ? 37  GLU A CA   3  
ATOM 5076  C C    . GLU A 1 18  ? 2.729   -2.264  -2.588  1.00 0.00 ? 37  GLU A C    3  
ATOM 5077  O O    . GLU A 1 18  ? 2.246   -3.367  -2.330  1.00 0.00 ? 37  GLU A O    3  
ATOM 5078  C CB   . GLU A 1 18  ? 3.632   -0.454  -1.107  1.00 0.00 ? 37  GLU A CB   3  
ATOM 5079  C CG   . GLU A 1 18  ? 4.455   0.398   -2.059  1.00 0.00 ? 37  GLU A CG   3  
ATOM 5080  C CD   . GLU A 1 18  ? 5.840   -0.166  -2.308  1.00 0.00 ? 37  GLU A CD   3  
ATOM 5081  O OE1  . GLU A 1 18  ? 6.216   -1.142  -1.626  1.00 0.00 ? 37  GLU A OE1  3  
ATOM 5082  O OE2  . GLU A 1 18  ? 6.550   0.371   -3.185  1.00 0.00 ? 37  GLU A OE2  3  
ATOM 5083  H H    . GLU A 1 18  ? 1.313   -2.369  -0.480  1.00 0.00 ? 37  GLU A H    3  
ATOM 5084  H HA   . GLU A 1 18  ? 1.909   -0.302  -2.373  1.00 0.00 ? 37  GLU A HA   3  
ATOM 5085  H HB2  . GLU A 1 18  ? 3.345   0.160   -0.266  2.00 0.00 ? 37  GLU A HB2  3  
ATOM 5086  H HB3  . GLU A 1 18  ? 4.256   -1.262  -0.753  2.00 0.00 ? 37  GLU A HB3  3  
ATOM 5087  H HG2  . GLU A 1 18  ? 3.934   0.463   -3.003  2.00 0.00 ? 37  GLU A HG2  3  
ATOM 5088  H HG3  . GLU A 1 18  ? 4.557   1.386   -1.638  2.00 0.00 ? 37  GLU A HG3  3  
ATOM 5089  N N    . LYS A 1 19  ? 3.574   -2.069  -3.593  1.00 0.00 ? 38  LYS A N    3  
ATOM 5090  C CA   . LYS A 1 19  ? 3.984   -3.168  -4.461  1.00 0.00 ? 38  LYS A CA   3  
ATOM 5091  C C    . LYS A 1 19  ? 5.412   -3.598  -4.148  1.00 0.00 ? 38  LYS A C    3  
ATOM 5092  O O    . LYS A 1 19  ? 6.129   -2.913  -3.418  1.00 0.00 ? 38  LYS A O    3  
ATOM 5093  C CB   . LYS A 1 19  ? 3.868   -2.762  -5.932  1.00 0.00 ? 38  LYS A CB   3  
ATOM 5094  C CG   . LYS A 1 19  ? 3.009   -3.699  -6.764  1.00 0.00 ? 38  LYS A CG   3  
ATOM 5095  C CD   . LYS A 1 19  ? 3.801   -4.342  -7.891  1.00 0.00 ? 38  LYS A CD   3  
ATOM 5096  C CE   . LYS A 1 19  ? 3.084   -5.549  -8.472  1.00 0.00 ? 38  LYS A CE   3  
ATOM 5097  N NZ   . LYS A 1 19  ? 4.020   -6.460  -9.187  1.00 0.00 ? 38  LYS A NZ   3  
ATOM 5098  H H    . LYS A 1 19  ? 3.930   -1.171  -3.755  1.00 0.00 ? 38  LYS A H    3  
ATOM 5099  H HA   . LYS A 1 19  ? 3.323   -4.000  -4.274  1.00 0.00 ? 38  LYS A HA   3  
ATOM 5100  H HB2  . LYS A 1 19  ? 3.441   -1.773  -5.987  2.00 0.00 ? 38  LYS A HB2  3  
ATOM 5101  H HB3  . LYS A 1 19  ? 4.858   -2.739  -6.364  2.00 0.00 ? 38  LYS A HB3  3  
ATOM 5102  H HG2  . LYS A 1 19  ? 2.618   -4.477  -6.124  2.00 0.00 ? 38  LYS A HG2  3  
ATOM 5103  H HG3  . LYS A 1 19  ? 2.190   -3.138  -7.189  2.00 0.00 ? 38  LYS A HG3  3  
ATOM 5104  H HD2  . LYS A 1 19  ? 3.949   -3.612  -8.674  2.00 0.00 ? 38  LYS A HD2  3  
ATOM 5105  H HD3  . LYS A 1 19  ? 4.761   -4.657  -7.508  2.00 0.00 ? 38  LYS A HD3  3  
ATOM 5106  H HE2  . LYS A 1 19  ? 2.610   -6.092  -7.668  2.00 0.00 ? 38  LYS A HE2  3  
ATOM 5107  H HE3  . LYS A 1 19  ? 2.331   -5.204  -9.167  2.00 0.00 ? 38  LYS A HE3  3  
ATOM 5108  H HZ1  . LYS A 1 19  ? 4.373   -6.003  -10.052 1.00 0.00 ? 38  LYS A HZ1  3  
ATOM 5109  H HZ2  . LYS A 1 19  ? 3.533   -7.340  -9.448  1.00 0.00 ? 38  LYS A HZ2  3  
ATOM 5110  H HZ3  . LYS A 1 19  ? 4.829   -6.693  -8.575  1.00 0.00 ? 38  LYS A HZ3  3  
ATOM 5111  N N    . ASN A 1 20  ? 5.818   -4.737  -4.698  1.00 0.00 ? 39  ASN A N    3  
ATOM 5112  C CA   . ASN A 1 20  ? 7.162   -5.258  -4.471  1.00 0.00 ? 39  ASN A CA   3  
ATOM 5113  C C    . ASN A 1 20  ? 8.216   -4.185  -4.725  1.00 0.00 ? 39  ASN A C    3  
ATOM 5114  O O    . ASN A 1 20  ? 8.620   -3.955  -5.864  1.00 0.00 ? 39  ASN A O    3  
ATOM 5115  C CB   . ASN A 1 20  ? 7.422   -6.468  -5.370  1.00 0.00 ? 39  ASN A CB   3  
ATOM 5116  C CG   . ASN A 1 20  ? 8.626   -7.278  -4.930  1.00 0.00 ? 39  ASN A CG   3  
ATOM 5117  O OD1  . ASN A 1 20  ? 9.757   -6.997  -5.327  1.00 0.00 ? 39  ASN A OD1  3  
ATOM 5118  N ND2  . ASN A 1 20  ? 8.387   -8.292  -4.106  4.00 0.00 ? 39  ASN A ND2  3  
ATOM 5119  H H    . ASN A 1 20  ? 5.198   -5.241  -5.269  1.00 0.00 ? 39  ASN A H    3  
ATOM 5120  H HA   . ASN A 1 20  ? 7.225   -5.568  -3.439  1.00 0.00 ? 39  ASN A HA   3  
ATOM 5121  H HB2  . ASN A 1 20  ? 6.555   -7.111  -5.356  2.00 0.00 ? 39  ASN A HB2  3  
ATOM 5122  H HB3  . ASN A 1 20  ? 7.593   -6.126  -6.381  2.00 0.00 ? 39  ASN A HB3  3  
ATOM 5123  H HD21 . ASN A 1 20  ? 7.458   -8.458  -3.831  5.00 0.00 ? 39  ASN A HD21 3  
ATOM 5124  H HD22 . ASN A 1 20  ? 9.149   -8.834  -3.804  5.00 0.00 ? 39  ASN A HD22 3  
ATOM 5125  N N    . GLY A 1 21  ? 8.657   -3.530  -3.653  1.00 0.00 ? 40  GLY A N    3  
ATOM 5126  C CA   . GLY A 1 21  ? 9.660   -2.488  -3.780  1.00 0.00 ? 40  GLY A CA   3  
ATOM 5127  C C    . GLY A 1 21  ? 9.302   -1.481  -4.853  1.00 0.00 ? 40  GLY A C    3  
ATOM 5128  O O    . GLY A 1 21  ? 10.180  -0.935  -5.521  1.00 0.00 ? 40  GLY A O    3  
ATOM 5129  H H    . GLY A 1 21  ? 8.298   -3.756  -2.769  1.00 0.00 ? 40  GLY A H    3  
ATOM 5130  H HA2  . GLY A 1 21  ? 9.753   -1.975  -2.835  2.00 0.00 ? 40  GLY A HA2  3  
ATOM 5131  H HA3  . GLY A 1 21  ? 10.608  -2.943  -4.027  2.00 0.00 ? 40  GLY A HA3  3  
ATOM 5132  N N    . ARG A 1 22  ? 8.006   -1.241  -5.023  1.00 0.00 ? 41  ARG A N    3  
ATOM 5133  C CA   . ARG A 1 22  ? 7.525   -0.299  -6.026  1.00 0.00 ? 41  ARG A CA   3  
ATOM 5134  C C    . ARG A 1 22  ? 7.917   1.133   -5.676  1.00 0.00 ? 41  ARG A C    3  
ATOM 5135  O O    . ARG A 1 22  ? 8.807   1.365   -4.857  1.00 0.00 ? 41  ARG A O    3  
ATOM 5136  C CB   . ARG A 1 22  ? 6.006   -0.403  -6.164  1.00 0.00 ? 41  ARG A CB   3  
ATOM 5137  C CG   . ARG A 1 22  ? 5.516   -0.478  -7.602  1.00 0.00 ? 41  ARG A CG   3  
ATOM 5138  C CD   . ARG A 1 22  ? 6.154   -1.633  -8.357  1.00 0.00 ? 41  ARG A CD   3  
ATOM 5139  N NE   . ARG A 1 22  ? 7.118   -1.178  -9.354  1.00 0.00 ? 41  ARG A NE   3  
ATOM 5140  C CZ   . ARG A 1 22  ? 6.794   -0.874  -10.607 4.00 0.00 ? 41  ARG A CZ   3  
ATOM 5141  N NH1  . ARG A 1 22  ? 5.538   -0.974  -11.017 5.00 0.00 ? 41  ARG A NH1  3  
ATOM 5142  N NH2  . ARG A 1 22  ? 7.725   -0.466  -11.459 5.00 0.00 ? 41  ARG A NH2  3  
ATOM 5143  H H    . ARG A 1 22  ? 7.357   -1.714  -4.461  1.00 0.00 ? 41  ARG A H    3  
ATOM 5144  H HA   . ARG A 1 22  ? 7.980   -0.561  -6.970  1.00 0.00 ? 41  ARG A HA   3  
ATOM 5145  H HB2  . ARG A 1 22  ? 5.672   -1.289  -5.647  2.00 0.00 ? 41  ARG A HB2  3  
ATOM 5146  H HB3  . ARG A 1 22  ? 5.556   0.462   -5.700  2.00 0.00 ? 41  ARG A HB3  3  
ATOM 5147  H HG2  . ARG A 1 22  ? 4.445   -0.613  -7.598  2.00 0.00 ? 41  ARG A HG2  3  
ATOM 5148  H HG3  . ARG A 1 22  ? 5.762   0.446   -8.104  2.00 0.00 ? 41  ARG A HG3  3  
ATOM 5149  H HD2  . ARG A 1 22  ? 6.658   -2.274  -7.649  2.00 0.00 ? 41  ARG A HD2  3  
ATOM 5150  H HD3  . ARG A 1 22  ? 5.376   -2.194  -8.853  2.00 0.00 ? 41  ARG A HD3  3  
ATOM 5151  H HE   . ARG A 1 22  ? 8.054   -1.095  -9.075  1.00 0.00 ? 41  ARG A HE   3  
ATOM 5152  H HH11 . ARG A 1 22  ? 4.827   -1.280  -10.383 5.00 0.00 ? 41  ARG A HH11 3  
ATOM 5153  H HH12 . ARG A 1 22  ? 5.301   -0.744  -11.961 5.00 0.00 ? 41  ARG A HH12 3  
ATOM 5154  H HH21 . ARG A 1 22  ? 8.676   -0.386  -11.159 5.00 0.00 ? 41  ARG A HH21 3  
ATOM 5155  H HH22 . ARG A 1 22  ? 7.476   -0.239  -12.400 5.00 0.00 ? 41  ARG A HH22 3  
ATOM 5156  N N    . TYR A 1 23  ? 7.240   2.088   -6.307  1.00 0.00 ? 42  TYR A N    3  
ATOM 5157  C CA   . TYR A 1 23  ? 7.497   3.504   -6.082  1.00 0.00 ? 42  TYR A CA   3  
ATOM 5158  C C    . TYR A 1 23  ? 6.761   4.336   -7.122  1.00 0.00 ? 42  TYR A C    3  
ATOM 5159  O O    . TYR A 1 23  ? 6.827   5.565   -7.118  1.00 0.00 ? 42  TYR A O    3  
ATOM 5160  C CB   . TYR A 1 23  ? 8.998   3.798   -6.142  1.00 0.00 ? 42  TYR A CB   3  
ATOM 5161  C CG   . TYR A 1 23  ? 9.552   4.612   -4.994  1.00 0.00 ? 42  TYR A CG   3  
ATOM 5162  C CD1  . TYR A 1 23  ? 8.718   5.105   -3.996  1.00 0.00 ? 42  TYR A CD1  3  
ATOM 5163  C CD2  . TYR A 1 23  ? 10.911  4.888   -4.906  1.00 0.00 ? 42  TYR A CD2  3  
ATOM 5164  C CE1  . TYR A 1 23  ? 9.223   5.849   -2.946  1.00 0.00 ? 42  TYR A CE1  3  
ATOM 5165  C CE2  . TYR A 1 23  ? 11.423  5.631   -3.859  1.00 0.00 ? 42  TYR A CE2  3  
ATOM 5166  C CZ   . TYR A 1 23  ? 10.576  6.108   -2.882  1.00 0.00 ? 42  TYR A CZ   3  
ATOM 5167  O OH   . TYR A 1 23  ? 11.081  6.849   -1.838  1.00 0.00 ? 42  TYR A OH   3  
ATOM 5168  H H    . TYR A 1 23  ? 6.542   1.832   -6.946  1.00 0.00 ? 42  TYR A H    3  
ATOM 5169  H HA   . TYR A 1 23  ? 7.124   3.760   -5.101  1.00 0.00 ? 42  TYR A HA   3  
ATOM 5170  H HB2  . TYR A 1 23  ? 9.534   2.860   -6.164  2.00 0.00 ? 42  TYR A HB2  3  
ATOM 5171  H HB3  . TYR A 1 23  ? 9.209   4.335   -7.054  2.00 0.00 ? 42  TYR A HB3  3  
ATOM 5172  H HD1  . TYR A 1 23  ? 7.658   4.899   -4.048  1.00 0.00 ? 42  TYR A HD1  3  
ATOM 5173  H HD2  . TYR A 1 23  ? 11.573  4.514   -5.673  1.00 0.00 ? 42  TYR A HD2  3  
ATOM 5174  H HE1  . TYR A 1 23  ? 8.559   6.223   -2.181  1.00 0.00 ? 42  TYR A HE1  3  
ATOM 5175  H HE2  . TYR A 1 23  ? 12.482  5.835   -3.810  1.00 0.00 ? 42  TYR A HE2  3  
ATOM 5176  H HH   . TYR A 1 23  ? 11.069  7.780   -2.070  1.00 0.00 ? 42  TYR A HH   3  
ATOM 5177  N N    . SER A 1 24  ? 6.057   3.646   -8.014  1.00 0.00 ? 43  SER A N    3  
ATOM 5178  C CA   . SER A 1 24  ? 5.296   4.300   -9.069  1.00 0.00 ? 43  SER A CA   3  
ATOM 5179  C C    . SER A 1 24  ? 3.847   3.825   -9.058  1.00 0.00 ? 43  SER A C    3  
ATOM 5180  O O    . SER A 1 24  ? 3.104   4.043   -10.015 1.00 0.00 ? 43  SER A O    3  
ATOM 5181  C CB   . SER A 1 24  ? 5.929   4.020   -10.434 1.00 0.00 ? 43  SER A CB   3  
ATOM 5182  O OG   . SER A 1 24  ? 7.344   4.059   -10.359 1.00 0.00 ? 43  SER A OG   3  
ATOM 5183  H H    . SER A 1 24  ? 6.047   2.668   -7.959  1.00 0.00 ? 43  SER A H    3  
ATOM 5184  H HA   . SER A 1 24  ? 5.316   5.364   -8.883  1.00 0.00 ? 43  SER A HA   3  
ATOM 5185  H HB2  . SER A 1 24  ? 5.626   3.042   -10.775 2.00 0.00 ? 43  SER A HB2  3  
ATOM 5186  H HB3  . SER A 1 24  ? 5.599   4.766   -11.142 2.00 0.00 ? 43  SER A HB3  3  
ATOM 5187  H HG   . SER A 1 24  ? 7.620   4.876   -9.937  1.00 0.00 ? 43  SER A HG   3  
ATOM 5188  N N    . ILE A 1 25  ? 3.452   3.176   -7.967  1.00 0.00 ? 44  ILE A N    3  
ATOM 5189  C CA   . ILE A 1 25  ? 2.092   2.673   -7.827  1.00 0.00 ? 44  ILE A CA   3  
ATOM 5190  C C    . ILE A 1 25  ? 1.087   3.818   -7.823  1.00 0.00 ? 44  ILE A C    3  
ATOM 5191  O O    . ILE A 1 25  ? 1.339   4.874   -7.239  1.00 0.00 ? 44  ILE A O    3  
ATOM 5192  C CB   . ILE A 1 25  ? 1.923   1.848   -6.533  1.00 0.00 ? 44  ILE A CB   3  
ATOM 5193  C CG1  . ILE A 1 25  ? 1.836   0.357   -6.860  1.00 0.00 ? 44  ILE A CG1  3  
ATOM 5194  C CG2  . ILE A 1 25  ? 0.687   2.300   -5.765  1.00 0.00 ? 44  ILE A CG2  3  
ATOM 5195  C CD1  . ILE A 1 25  ? 1.473   -0.515  -5.678  1.00 0.00 ? 44  ILE A CD1  3  
ATOM 5196  H H    . ILE A 1 25  ? 4.092   3.036   -7.236  1.00 0.00 ? 44  ILE A H    3  
ATOM 5197  H HA   . ILE A 1 25  ? 1.886   2.028   -8.669  1.00 0.00 ? 44  ILE A HA   3  
ATOM 5198  H HB   . ILE A 1 25  ? 2.786   2.021   -5.908  1.00 0.00 ? 44  ILE A HB   3  
ATOM 5199  H HG12 . ILE A 1 25  ? 1.086   0.207   -7.623  2.00 0.00 ? 44  ILE A HG12 3  
ATOM 5200  H HG13 . ILE A 1 25  ? 2.790   0.022   -7.237  2.00 0.00 ? 44  ILE A HG13 3  
ATOM 5201  H HG21 . ILE A 1 25  ? 0.400   1.534   -5.060  1.00 0.00 ? 44  ILE A HG21 3  
ATOM 5202  H HG22 . ILE A 1 25  ? -0.123  2.473   -6.457  1.00 0.00 ? 44  ILE A HG22 3  
ATOM 5203  H HG23 . ILE A 1 25  ? 0.908   3.214   -5.234  1.00 0.00 ? 44  ILE A HG23 3  
ATOM 5204  H HD11 . ILE A 1 25  ? 1.825   -1.522  -5.851  1.00 0.00 ? 44  ILE A HD11 3  
ATOM 5205  H HD12 . ILE A 1 25  ? 0.401   -0.526  -5.553  1.00 0.00 ? 44  ILE A HD12 3  
ATOM 5206  H HD13 . ILE A 1 25  ? 1.937   -0.121  -4.785  1.00 0.00 ? 44  ILE A HD13 3  
ATOM 5207  N N    . SER A 1 26  ? -0.050  3.601   -8.475  1.00 0.00 ? 45  SER A N    3  
ATOM 5208  C CA   . SER A 1 26  ? -1.098  4.612   -8.549  1.00 0.00 ? 45  SER A CA   3  
ATOM 5209  C C    . SER A 1 26  ? -2.293  4.215   -7.689  1.00 0.00 ? 45  SER A C    3  
ATOM 5210  O O    . SER A 1 26  ? -2.181  3.364   -6.807  1.00 0.00 ? 45  SER A O    3  
ATOM 5211  C CB   . SER A 1 26  ? -1.540  4.814   -9.999  1.00 0.00 ? 45  SER A CB   3  
ATOM 5212  O OG   . SER A 1 26  ? -0.427  5.035   -10.847 1.00 0.00 ? 45  SER A OG   3  
ATOM 5213  H H    . SER A 1 26  ? -0.188  2.737   -8.918  1.00 0.00 ? 45  SER A H    3  
ATOM 5214  H HA   . SER A 1 26  ? -0.691  5.539   -8.173  1.00 0.00 ? 45  SER A HA   3  
ATOM 5215  H HB2  . SER A 1 26  ? -2.067  3.935   -10.338 2.00 0.00 ? 45  SER A HB2  3  
ATOM 5216  H HB3  . SER A 1 26  ? -2.196  5.670   -10.056 2.00 0.00 ? 45  SER A HB3  3  
ATOM 5217  H HG   . SER A 1 26  ? -0.697  4.934   -11.763 1.00 0.00 ? 45  SER A HG   3  
ATOM 5218  N N    . ARG A 1 27  ? -3.437  4.838   -7.951  1.00 0.00 ? 46  ARG A N    3  
ATOM 5219  C CA   . ARG A 1 27  ? -4.654  4.552   -7.199  1.00 0.00 ? 46  ARG A CA   3  
ATOM 5220  C C    . ARG A 1 27  ? -5.303  3.255   -7.674  1.00 0.00 ? 46  ARG A C    3  
ATOM 5221  O O    . ARG A 1 27  ? -6.060  2.626   -6.937  1.00 0.00 ? 46  ARG A O    3  
ATOM 5222  C CB   . ARG A 1 27  ? -5.644  5.711   -7.331  1.00 0.00 ? 46  ARG A CB   3  
ATOM 5223  C CG   . ARG A 1 27  ? -6.839  5.603   -6.400  1.00 0.00 ? 46  ARG A CG   3  
ATOM 5224  C CD   . ARG A 1 27  ? -7.702  6.854   -6.435  1.00 0.00 ? 46  ARG A CD   3  
ATOM 5225  N NE   . ARG A 1 27  ? -9.010  6.602   -7.032  1.00 0.00 ? 46  ARG A NE   3  
ATOM 5226  C CZ   . ARG A 1 27  ? -9.449  7.209   -8.130  4.00 0.00 ? 46  ARG A CZ   3  
ATOM 5227  N NH1  . ARG A 1 27  ? -8.690  8.101   -8.751  5.00 0.00 ? 46  ARG A NH1  3  
ATOM 5228  N NH2  . ARG A 1 27  ? -10.651 6.929   -8.616  5.00 0.00 ? 46  ARG A NH2  3  
ATOM 5229  H H    . ARG A 1 27  ? -3.464  5.509   -8.666  1.00 0.00 ? 46  ARG A H    3  
ATOM 5230  H HA   . ARG A 1 27  ? -4.380  4.442   -6.161  1.00 0.00 ? 46  ARG A HA   3  
ATOM 5231  H HB2  . ARG A 1 27  ? -5.128  6.636   -7.115  2.00 0.00 ? 46  ARG A HB2  3  
ATOM 5232  H HB3  . ARG A 1 27  ? -6.008  5.743   -8.347  2.00 0.00 ? 46  ARG A HB3  3  
ATOM 5233  H HG2  . ARG A 1 27  ? -7.439  4.757   -6.699  2.00 0.00 ? 46  ARG A HG2  3  
ATOM 5234  H HG3  . ARG A 1 27  ? -6.484  5.452   -5.392  2.00 0.00 ? 46  ARG A HG3  3  
ATOM 5235  H HD2  . ARG A 1 27  ? -7.840  7.210   -5.425  2.00 0.00 ? 46  ARG A HD2  3  
ATOM 5236  H HD3  . ARG A 1 27  ? -7.192  7.611   -7.014  2.00 0.00 ? 46  ARG A HD3  3  
ATOM 5237  H HE   . ARG A 1 27  ? -9.591  5.946   -6.592  1.00 0.00 ? 46  ARG A HE   3  
ATOM 5238  H HH11 . ARG A 1 27  ? -7.782  8.321   -8.395  5.00 0.00 ? 46  ARG A HH11 3  
ATOM 5239  H HH12 . ARG A 1 27  ? -9.026  8.555   -9.577  5.00 0.00 ? 46  ARG A HH12 3  
ATOM 5240  H HH21 . ARG A 1 27  ? -11.233 6.258   -8.156  5.00 0.00 ? 46  ARG A HH21 3  
ATOM 5241  H HH22 . ARG A 1 27  ? -10.975 7.389   -9.442  5.00 0.00 ? 46  ARG A HH22 3  
ATOM 5242  N N    . THR A 1 28  ? -5.005  2.862   -8.907  1.00 0.00 ? 47  THR A N    3  
ATOM 5243  C CA   . THR A 1 28  ? -5.565  1.641   -9.472  1.00 0.00 ? 47  THR A CA   3  
ATOM 5244  C C    . THR A 1 28  ? -5.192  0.423   -8.633  1.00 0.00 ? 47  THR A C    3  
ATOM 5245  O O    . THR A 1 28  ? -6.045  -0.181  -7.983  1.00 0.00 ? 47  THR A O    3  
ATOM 5246  C CB   . THR A 1 28  ? -5.090  1.420   -10.920 1.00 0.00 ? 47  THR A CB   3  
ATOM 5247  O OG1  . THR A 1 28  ? -4.322  2.545   -11.362 1.00 0.00 ? 47  THR A OG1  3  
ATOM 5248  C CG2  . THR A 1 28  ? -6.274  1.211   -11.851 1.00 0.00 ? 47  THR A CG2  3  
ATOM 5249  H H    . THR A 1 28  ? -4.395  3.405   -9.449  1.00 0.00 ? 47  THR A H    3  
ATOM 5250  H HA   . THR A 1 28  ? -6.642  1.741   -9.479  1.00 0.00 ? 47  THR A HA   3  
ATOM 5251  H HB   . THR A 1 28  ? -4.469  0.536   -10.948 1.00 0.00 ? 47  THR A HB   3  
ATOM 5252  H HG1  . THR A 1 28  ? -4.115  2.447   -12.294 1.00 0.00 ? 47  THR A HG1  3  
ATOM 5253  H HG21 . THR A 1 28  ? -6.512  0.158   -11.901 1.00 0.00 ? 47  THR A HG21 3  
ATOM 5254  H HG22 . THR A 1 28  ? -6.023  1.570   -12.838 1.00 0.00 ? 47  THR A HG22 3  
ATOM 5255  H HG23 . THR A 1 28  ? -7.128  1.755   -11.476 1.00 0.00 ? 47  THR A HG23 3  
ATOM 5256  N N    . GLU A 1 29  ? -3.910  0.068   -8.649  1.00 0.00 ? 48  GLU A N    3  
ATOM 5257  C CA   . GLU A 1 29  ? -3.425  -1.078  -7.887  1.00 0.00 ? 48  GLU A CA   3  
ATOM 5258  C C    . GLU A 1 29  ? -3.671  -0.873  -6.397  1.00 0.00 ? 48  GLU A C    3  
ATOM 5259  O O    . GLU A 1 29  ? -4.162  -1.769  -5.704  1.00 0.00 ? 48  GLU A O    3  
ATOM 5260  C CB   . GLU A 1 29  ? -1.934  -1.297  -8.147  1.00 0.00 ? 48  GLU A CB   3  
ATOM 5261  C CG   . GLU A 1 29  ? -1.603  -2.136  -9.371  1.00 0.00 ? 48  GLU A CG   3  
ATOM 5262  C CD   . GLU A 1 29  ? -1.081  -3.513  -9.014  1.00 0.00 ? 48  GLU A CD   3  
ATOM 5263  O OE1  . GLU A 1 29  ? 0.057   -3.605  -8.508  1.00 0.00 ? 48  GLU A OE1  3  
ATOM 5264  O OE2  . GLU A 1 29  ? -1.811  -4.502  -9.239  1.00 0.00 ? 48  GLU A OE2  3  
ATOM 5265  H H    . GLU A 1 29  ? -3.276  0.590   -9.184  1.00 0.00 ? 48  GLU A H    3  
ATOM 5266  H HA   . GLU A 1 29  ? -3.972  -1.950  -8.214  1.00 0.00 ? 48  GLU A HA   3  
ATOM 5267  H HB2  . GLU A 1 29  ? -1.462  -0.333  -8.266  2.00 0.00 ? 48  GLU A HB2  3  
ATOM 5268  H HB3  . GLU A 1 29  ? -1.503  -1.782  -7.284  2.00 0.00 ? 48  GLU A HB3  3  
ATOM 5269  H HG2  . GLU A 1 29  ? -2.497  -2.249  -9.966  2.00 0.00 ? 48  GLU A HG2  3  
ATOM 5270  H HG3  . GLU A 1 29  ? -0.849  -1.622  -9.949  2.00 0.00 ? 48  GLU A HG3  3  
ATOM 5271  N N    . ALA A 1 30  ? -3.332  0.317   -5.911  1.00 0.00 ? 49  ALA A N    3  
ATOM 5272  C CA   . ALA A 1 30  ? -3.519  0.649   -4.507  1.00 0.00 ? 49  ALA A CA   3  
ATOM 5273  C C    . ALA A 1 30  ? -4.961  0.415   -4.081  1.00 0.00 ? 49  ALA A C    3  
ATOM 5274  O O    . ALA A 1 30  ? -5.269  -0.564  -3.403  1.00 0.00 ? 49  ALA A O    3  
ATOM 5275  C CB   . ALA A 1 30  ? -3.138  2.098   -4.250  1.00 0.00 ? 49  ALA A CB   3  
ATOM 5276  H H    . ALA A 1 30  ? -2.951  0.990   -6.514  1.00 0.00 ? 49  ALA A H    3  
ATOM 5277  H HA   . ALA A 1 30  ? -2.867  0.018   -3.919  1.00 0.00 ? 49  ALA A HA   3  
ATOM 5278  H HB1  . ALA A 1 30  ? -2.316  2.136   -3.551  1.00 0.00 ? 49  ALA A HB1  3  
ATOM 5279  H HB2  . ALA A 1 30  ? -3.988  2.623   -3.838  1.00 0.00 ? 49  ALA A HB2  3  
ATOM 5280  H HB3  . ALA A 1 30  ? -2.844  2.562   -5.180  1.00 0.00 ? 49  ALA A HB3  3  
ATOM 5281  N N    . ALA A 1 31  ? -5.836  1.329   -4.486  1.00 0.00 ? 50  ALA A N    3  
ATOM 5282  C CA   . ALA A 1 31  ? -7.249  1.238   -4.151  1.00 0.00 ? 50  ALA A CA   3  
ATOM 5283  C C    . ALA A 1 31  ? -7.771  -0.185  -4.322  1.00 0.00 ? 50  ALA A C    3  
ATOM 5284  O O    . ALA A 1 31  ? -8.716  -0.595  -3.647  1.00 0.00 ? 50  ALA A O    3  
ATOM 5285  C CB   . ALA A 1 31  ? -8.055  2.206   -5.003  1.00 0.00 ? 50  ALA A CB   3  
ATOM 5286  H H    . ALA A 1 31  ? -5.521  2.086   -5.022  1.00 0.00 ? 50  ALA A H    3  
ATOM 5287  H HA   . ALA A 1 31  ? -7.358  1.529   -3.117  1.00 0.00 ? 50  ALA A HA   3  
ATOM 5288  H HB1  . ALA A 1 31  ? -7.851  2.022   -6.048  1.00 0.00 ? 50  ALA A HB1  3  
ATOM 5289  H HB2  . ALA A 1 31  ? -7.779  3.220   -4.754  1.00 0.00 ? 50  ALA A HB2  3  
ATOM 5290  H HB3  . ALA A 1 31  ? -9.109  2.063   -4.811  1.00 0.00 ? 50  ALA A HB3  3  
ATOM 5291  N N    . ASP A 1 32  ? -7.153  -0.936  -5.229  1.00 0.00 ? 51  ASP A N    3  
ATOM 5292  C CA   . ASP A 1 32  ? -7.559  -2.313  -5.487  1.00 0.00 ? 51  ASP A CA   3  
ATOM 5293  C C    . ASP A 1 32  ? -7.461  -3.158  -4.221  1.00 0.00 ? 51  ASP A C    3  
ATOM 5294  O O    . ASP A 1 32  ? -8.475  -3.482  -3.601  1.00 0.00 ? 51  ASP A O    3  
ATOM 5295  C CB   . ASP A 1 32  ? -6.696  -2.929  -6.589  1.00 0.00 ? 51  ASP A CB   3  
ATOM 5296  C CG   . ASP A 1 32  ? -7.406  -2.976  -7.928  1.00 0.00 ? 51  ASP A CG   3  
ATOM 5297  O OD1  . ASP A 1 32  ? -7.995  -1.948  -8.324  1.00 0.00 ? 51  ASP A OD1  3  
ATOM 5298  O OD2  . ASP A 1 32  ? -7.375  -4.040  -8.580  1.00 0.00 ? 51  ASP A OD2  3  
ATOM 5299  H H    . ASP A 1 32  ? -6.406  -0.555  -5.737  1.00 0.00 ? 51  ASP A H    3  
ATOM 5300  H HA   . ASP A 1 32  ? -8.588  -2.297  -5.815  1.00 0.00 ? 51  ASP A HA   3  
ATOM 5301  H HB2  . ASP A 1 32  ? -5.795  -2.345  -6.701  2.00 0.00 ? 51  ASP A HB2  3  
ATOM 5302  H HB3  . ASP A 1 32  ? -6.432  -3.939  -6.307  2.00 0.00 ? 51  ASP A HB3  3  
ATOM 5303  N N    . LEU A 1 33  ? -6.238  -3.513  -3.843  1.00 0.00 ? 52  LEU A N    3  
ATOM 5304  C CA   . LEU A 1 33  ? -6.019  -4.324  -2.649  1.00 0.00 ? 52  LEU A CA   3  
ATOM 5305  C C    . LEU A 1 33  ? -6.294  -3.513  -1.385  1.00 0.00 ? 52  LEU A C    3  
ATOM 5306  O O    . LEU A 1 33  ? -6.886  -4.017  -0.426  1.00 0.00 ? 52  LEU A O    3  
ATOM 5307  C CB   . LEU A 1 33  ? -4.591  -4.882  -2.636  1.00 0.00 ? 52  LEU A CB   3  
ATOM 5308  C CG   . LEU A 1 33  ? -3.552  -4.169  -1.771  1.00 0.00 ? 52  LEU A CG   3  
ATOM 5309  C CD1  . LEU A 1 33  ? -3.804  -4.426  -0.294  2.00 0.00 ? 52  LEU A CD1  3  
ATOM 5310  C CD2  . LEU A 1 33  ? -2.146  -4.606  -2.154  2.00 0.00 ? 52  LEU A CD2  3  
ATOM 5311  H H    . LEU A 1 33  ? -5.466  -3.224  -4.379  1.00 0.00 ? 52  LEU A H    3  
ATOM 5312  H HA   . LEU A 1 33  ? -6.714  -5.149  -2.686  1.00 0.00 ? 52  LEU A HA   3  
ATOM 5313  H HB2  . LEU A 1 33  ? -4.643  -5.910  -2.310  2.00 0.00 ? 52  LEU A HB2  3  
ATOM 5314  H HB3  . LEU A 1 33  ? -4.229  -4.879  -3.654  2.00 0.00 ? 52  LEU A HB3  3  
ATOM 5315  H HG   . LEU A 1 33  ? -3.636  -3.106  -1.950  1.00 0.00 ? 52  LEU A HG   3  
ATOM 5316  H HD11 . LEU A 1 33  ? -3.934  -3.483  0.217   1.00 0.00 ? 52  LEU A HD11 3  
ATOM 5317  H HD12 . LEU A 1 33  ? -2.960  -4.950  0.129   1.00 0.00 ? 52  LEU A HD12 3  
ATOM 5318  H HD13 . LEU A 1 33  ? -4.695  -5.023  -0.179  1.00 0.00 ? 52  LEU A HD13 3  
ATOM 5319  H HD21 . LEU A 1 33  ? -1.698  -5.142  -1.328  1.00 0.00 ? 52  LEU A HD21 3  
ATOM 5320  H HD22 . LEU A 1 33  ? -1.549  -3.738  -2.386  1.00 0.00 ? 52  LEU A HD22 3  
ATOM 5321  H HD23 . LEU A 1 33  ? -2.193  -5.253  -3.018  1.00 0.00 ? 52  LEU A HD23 3  
ATOM 5322  N N    . CYS A 1 34  ? -5.870  -2.254  -1.392  1.00 0.00 ? 53  CYS A N    3  
ATOM 5323  C CA   . CYS A 1 34  ? -6.080  -1.373  -0.249  1.00 0.00 ? 53  CYS A CA   3  
ATOM 5324  C C    . CYS A 1 34  ? -7.507  -1.507  0.266   1.00 0.00 ? 53  CYS A C    3  
ATOM 5325  O O    . CYS A 1 34  ? -7.731  -1.777  1.446   1.00 0.00 ? 53  CYS A O    3  
ATOM 5326  C CB   . CYS A 1 34  ? -5.802  0.080   -0.635  1.00 0.00 ? 53  CYS A CB   3  
ATOM 5327  S SG   . CYS A 1 34  ? -7.204  1.226   -0.431  1.00 0.00 ? 53  CYS A SG   3  
ATOM 5328  H H    . CYS A 1 34  ? -5.411  -1.908  -2.187  1.00 0.00 ? 53  CYS A H    3  
ATOM 5329  H HA   . CYS A 1 34  ? -5.396  -1.670  0.530   1.00 0.00 ? 53  CYS A HA   3  
ATOM 5330  H HB2  . CYS A 1 34  ? -4.989  0.452   -0.029  2.00 0.00 ? 53  CYS A HB2  3  
ATOM 5331  H HB3  . CYS A 1 34  ? -5.504  0.115   -1.672  2.00 0.00 ? 53  CYS A HB3  3  
ATOM 5332  N N    . LYS A 1 35  ? -8.470  -1.327  -0.630  1.00 0.00 ? 54  LYS A N    3  
ATOM 5333  C CA   . LYS A 1 35  ? -9.876  -1.439  -0.272  1.00 0.00 ? 54  LYS A CA   3  
ATOM 5334  C C    . LYS A 1 35  ? -10.268 -2.904  -0.139  1.00 0.00 ? 54  LYS A C    3  
ATOM 5335  O O    . LYS A 1 35  ? -11.241 -3.241  0.536   1.00 0.00 ? 54  LYS A O    3  
ATOM 5336  C CB   . LYS A 1 35  ? -10.748 -0.753  -1.325  1.00 0.00 ? 54  LYS A CB   3  
ATOM 5337  C CG   . LYS A 1 35  ? -11.278 -1.666  -2.419  1.00 0.00 ? 54  LYS A CG   3  
ATOM 5338  C CD   . LYS A 1 35  ? -12.163 -0.926  -3.408  1.00 0.00 ? 54  LYS A CD   3  
ATOM 5339  C CE   . LYS A 1 35  ? -12.134 -1.559  -4.790  1.00 0.00 ? 54  LYS A CE   3  
ATOM 5340  N NZ   . LYS A 1 35  ? -12.271 -3.041  -4.725  1.00 0.00 ? 54  LYS A NZ   3  
ATOM 5341  H H    . LYS A 1 35  ? -8.228  -1.122  -1.557  1.00 0.00 ? 54  LYS A H    3  
ATOM 5342  H HA   . LYS A 1 35  ? -10.018 -0.950  0.680   1.00 0.00 ? 54  LYS A HA   3  
ATOM 5343  H HB2  . LYS A 1 35  ? -11.594 -0.300  -0.830  2.00 0.00 ? 54  LYS A HB2  3  
ATOM 5344  H HB3  . LYS A 1 35  ? -10.169 0.027   -1.794  2.00 0.00 ? 54  LYS A HB3  3  
ATOM 5345  H HG2  . LYS A 1 35  ? -10.440 -2.093  -2.952  2.00 0.00 ? 54  LYS A HG2  3  
ATOM 5346  H HG3  . LYS A 1 35  ? -11.852 -2.460  -1.964  2.00 0.00 ? 54  LYS A HG3  3  
ATOM 5347  H HD2  . LYS A 1 35  ? -13.179 -0.935  -3.042  2.00 0.00 ? 54  LYS A HD2  3  
ATOM 5348  H HD3  . LYS A 1 35  ? -11.820 0.096   -3.486  2.00 0.00 ? 54  LYS A HD3  3  
ATOM 5349  H HE2  . LYS A 1 35  ? -12.948 -1.157  -5.374  2.00 0.00 ? 54  LYS A HE2  3  
ATOM 5350  H HE3  . LYS A 1 35  ? -11.196 -1.314  -5.265  2.00 0.00 ? 54  LYS A HE3  3  
ATOM 5351  H HZ1  . LYS A 1 35  ? -11.337 -3.481  -4.601  1.00 0.00 ? 54  LYS A HZ1  3  
ATOM 5352  H HZ2  . LYS A 1 35  ? -12.697 -3.399  -5.604  1.00 0.00 ? 54  LYS A HZ2  3  
ATOM 5353  H HZ3  . LYS A 1 35  ? -12.878 -3.309  -3.925  1.00 0.00 ? 54  LYS A HZ3  3  
ATOM 5354  N N    . ALA A 1 36  ? -9.496  -3.769  -0.789  1.00 0.00 ? 55  ALA A N    3  
ATOM 5355  C CA   . ALA A 1 36  ? -9.749  -5.203  -0.749  1.00 0.00 ? 55  ALA A CA   3  
ATOM 5356  C C    . ALA A 1 36  ? -9.977  -5.681  0.681   1.00 0.00 ? 55  ALA A C    3  
ATOM 5357  O O    . ALA A 1 36  ? -10.931 -6.406  0.956   1.00 0.00 ? 55  ALA A O    3  
ATOM 5358  C CB   . ALA A 1 36  ? -8.601  -5.964  -1.389  1.00 0.00 ? 55  ALA A CB   3  
ATOM 5359  H H    . ALA A 1 36  ? -8.735  -3.432  -1.308  1.00 0.00 ? 55  ALA A H    3  
ATOM 5360  H HA   . ALA A 1 36  ? -10.640 -5.396  -1.327  1.00 0.00 ? 55  ALA A HA   3  
ATOM 5361  H HB1  . ALA A 1 36  ? -8.752  -7.024  -1.253  1.00 0.00 ? 55  ALA A HB1  3  
ATOM 5362  H HB2  . ALA A 1 36  ? -7.671  -5.671  -0.924  1.00 0.00 ? 55  ALA A HB2  3  
ATOM 5363  H HB3  . ALA A 1 36  ? -8.563  -5.738  -2.444  1.00 0.00 ? 55  ALA A HB3  3  
ATOM 5364  N N    . PHE A 1 37  ? -9.105  -5.274  1.596   1.00 0.00 ? 56  PHE A N    3  
ATOM 5365  C CA   . PHE A 1 37  ? -9.250  -5.680  2.989   1.00 0.00 ? 56  PHE A CA   3  
ATOM 5366  C C    . PHE A 1 37  ? -10.157 -4.716  3.748   1.00 0.00 ? 56  PHE A C    3  
ATOM 5367  O O    . PHE A 1 37  ? -9.835  -4.284  4.855   1.00 0.00 ? 56  PHE A O    3  
ATOM 5368  C CB   . PHE A 1 37  ? -7.895  -5.784  3.682   1.00 0.00 ? 56  PHE A CB   3  
ATOM 5369  C CG   . PHE A 1 37  ? -7.032  -4.559  3.607   1.00 0.00 ? 56  PHE A CG   3  
ATOM 5370  C CD1  . PHE A 1 37  ? -6.312  -4.268  2.459   1.00 0.00 ? 56  PHE A CD1  3  
ATOM 5371  C CD2  . PHE A 1 37  ? -6.919  -3.716  4.696   1.00 0.00 ? 56  PHE A CD2  3  
ATOM 5372  C CE1  . PHE A 1 37  ? -5.497  -3.153  2.404   1.00 0.00 ? 56  PHE A CE1  3  
ATOM 5373  C CE2  . PHE A 1 37  ? -6.100  -2.605  4.650   1.00 0.00 ? 56  PHE A CE2  3  
ATOM 5374  C CZ   . PHE A 1 37  ? -5.388  -2.322  3.503   1.00 0.00 ? 56  PHE A CZ   3  
ATOM 5375  H H    . PHE A 1 37  ? -8.357  -4.694  1.330   1.00 0.00 ? 56  PHE A H    3  
ATOM 5376  H HA   . PHE A 1 37  ? -9.710  -6.654  2.993   1.00 0.00 ? 56  PHE A HA   3  
ATOM 5377  H HB2  . PHE A 1 37  ? -8.058  -6.001  4.729   2.00 0.00 ? 56  PHE A HB2  3  
ATOM 5378  H HB3  . PHE A 1 37  ? -7.343  -6.601  3.241   2.00 0.00 ? 56  PHE A HB3  3  
ATOM 5379  H HD1  . PHE A 1 37  ? -6.398  -4.917  1.601   1.00 0.00 ? 56  PHE A HD1  3  
ATOM 5380  H HD2  . PHE A 1 37  ? -7.476  -3.935  5.595   1.00 0.00 ? 56  PHE A HD2  3  
ATOM 5381  H HE1  . PHE A 1 37  ? -4.940  -2.937  1.505   1.00 0.00 ? 56  PHE A HE1  3  
ATOM 5382  H HE2  . PHE A 1 37  ? -6.022  -1.957  5.509   1.00 0.00 ? 56  PHE A HE2  3  
ATOM 5383  H HZ   . PHE A 1 37  ? -4.728  -1.465  3.475   1.00 0.00 ? 56  PHE A HZ   3  
ATOM 5384  N N    . ASN A 1 38  ? -11.295 -4.387  3.144   1.00 0.00 ? 57  ASN A N    3  
ATOM 5385  C CA   . ASN A 1 38  ? -12.257 -3.478  3.758   1.00 0.00 ? 57  ASN A CA   3  
ATOM 5386  C C    . ASN A 1 38  ? -11.574 -2.198  4.229   1.00 0.00 ? 57  ASN A C    3  
ATOM 5387  O O    . ASN A 1 38  ? -11.400 -1.981  5.427   1.00 0.00 ? 57  ASN A O    3  
ATOM 5388  C CB   . ASN A 1 38  ? -12.955 -4.159  4.936   1.00 0.00 ? 57  ASN A CB   3  
ATOM 5389  C CG   . ASN A 1 38  ? -14.338 -4.665  4.575   1.00 0.00 ? 57  ASN A CG   3  
ATOM 5390  O OD1  . ASN A 1 38  ? -15.248 -3.881  4.306   1.00 0.00 ? 57  ASN A OD1  3  
ATOM 5391  N ND2  . ASN A 1 38  ? -14.503 -5.983  4.566   4.00 0.00 ? 57  ASN A ND2  3  
ATOM 5392  H H    . ASN A 1 38  ? -11.494 -4.767  2.262   1.00 0.00 ? 57  ASN A H    3  
ATOM 5393  H HA   . ASN A 1 38  ? -12.994 -3.224  3.012   1.00 0.00 ? 57  ASN A HA   3  
ATOM 5394  H HB2  . ASN A 1 38  ? -12.359 -5.000  5.263   2.00 0.00 ? 57  ASN A HB2  3  
ATOM 5395  H HB3  . ASN A 1 38  ? -13.052 -3.452  5.748   2.00 0.00 ? 57  ASN A HB3  3  
ATOM 5396  H HD21 . ASN A 1 38  ? -13.731 -6.549  4.791   5.00 0.00 ? 57  ASN A HD21 3  
ATOM 5397  H HD22 . ASN A 1 38  ? -15.390 -6.339  4.335   5.00 0.00 ? 57  ASN A HD22 3  
ATOM 5398  N N    . SER A 1 39  ? -11.189 -1.356  3.275   1.00 0.00 ? 58  SER A N    3  
ATOM 5399  C CA   . SER A 1 39  ? -10.525 -0.097  3.589   1.00 0.00 ? 58  SER A CA   3  
ATOM 5400  C C    . SER A 1 39  ? -10.936 0.993   2.606   1.00 0.00 ? 58  SER A C    3  
ATOM 5401  O O    . SER A 1 39  ? -11.562 0.714   1.583   1.00 0.00 ? 58  SER A O    3  
ATOM 5402  C CB   . SER A 1 39  ? -9.007  -0.280  3.558   1.00 0.00 ? 58  SER A CB   3  
ATOM 5403  O OG   . SER A 1 39  ? -8.343  0.893   3.990   1.00 0.00 ? 58  SER A OG   3  
ATOM 5404  H H    . SER A 1 39  ? -11.356 -1.588  2.338   1.00 0.00 ? 58  SER A H    3  
ATOM 5405  H HA   . SER A 1 39  ? -10.823 0.199   4.583   1.00 0.00 ? 58  SER A HA   3  
ATOM 5406  H HB2  . SER A 1 39  ? -8.732  -1.096  4.210   2.00 0.00 ? 58  SER A HB2  3  
ATOM 5407  H HB3  . SER A 1 39  ? -8.694  -0.504  2.549   2.00 0.00 ? 58  SER A HB3  3  
ATOM 5408  H HG   . SER A 1 39  ? -7.547  0.651   4.471   1.00 0.00 ? 58  SER A HG   3  
ATOM 5409  N N    . THR A 1 40  ? -10.580 2.235   2.918   1.00 0.00 ? 59  THR A N    3  
ATOM 5410  C CA   . THR A 1 40  ? -10.915 3.360   2.054   1.00 0.00 ? 59  THR A CA   3  
ATOM 5411  C C    . THR A 1 40  ? -10.015 4.555   2.337   1.00 0.00 ? 59  THR A C    3  
ATOM 5412  O O    . THR A 1 40  ? -9.370  4.622   3.382   1.00 0.00 ? 59  THR A O    3  
ATOM 5413  C CB   . THR A 1 40  ? -12.386 3.785   2.227   1.00 0.00 ? 59  THR A CB   3  
ATOM 5414  O OG1  . THR A 1 40  ? -12.557 5.143   1.807   1.00 0.00 ? 59  THR A OG1  3  
ATOM 5415  C CG2  . THR A 1 40  ? -12.824 3.639   3.676   1.00 0.00 ? 59  THR A CG2  3  
ATOM 5416  H H    . THR A 1 40  ? -10.078 2.399   3.748   1.00 0.00 ? 59  THR A H    3  
ATOM 5417  H HA   . THR A 1 40  ? -10.771 3.048   1.029   1.00 0.00 ? 59  THR A HA   3  
ATOM 5418  H HB   . THR A 1 40  ? -13.004 3.145   1.614   1.00 0.00 ? 59  THR A HB   3  
ATOM 5419  H HG1  . THR A 1 40  ? -12.927 5.160   0.921   1.00 0.00 ? 59  THR A HG1  3  
ATOM 5420  H HG21 . THR A 1 40  ? -11.966 3.411   4.291   1.00 0.00 ? 59  THR A HG21 3  
ATOM 5421  H HG22 . THR A 1 40  ? -13.546 2.840   3.755   1.00 0.00 ? 59  THR A HG22 3  
ATOM 5422  H HG23 . THR A 1 40  ? -13.272 4.563   4.011   1.00 0.00 ? 59  THR A HG23 3  
ATOM 5423  N N    . LEU A 1 41  ? -9.978  5.498   1.398   1.00 0.00 ? 60  LEU A N    3  
ATOM 5424  C CA   . LEU A 1 41  ? -9.157  6.694   1.547   1.00 0.00 ? 60  LEU A CA   3  
ATOM 5425  C C    . LEU A 1 41  ? -9.160  7.173   2.994   1.00 0.00 ? 60  LEU A C    3  
ATOM 5426  O O    . LEU A 1 41  ? -10.120 7.791   3.453   1.00 0.00 ? 60  LEU A O    3  
ATOM 5427  C CB   . LEU A 1 41  ? -9.666  7.806   0.627   1.00 0.00 ? 60  LEU A CB   3  
ATOM 5428  C CG   . LEU A 1 41  ? -9.251  7.752   -0.845  1.00 0.00 ? 60  LEU A CG   3  
ATOM 5429  C CD1  . LEU A 1 41  ? -10.416 8.126   -1.749  2.00 0.00 ? 60  LEU A CD1  3  
ATOM 5430  C CD2  . LEU A 1 41  ? -8.059  8.661   -1.103  2.00 0.00 ? 60  LEU A CD2  3  
ATOM 5431  H H    . LEU A 1 41  ? -10.518 5.385   0.587   1.00 0.00 ? 60  LEU A H    3  
ATOM 5432  H HA   . LEU A 1 41  ? -8.148  6.439   1.265   1.00 0.00 ? 60  LEU A HA   3  
ATOM 5433  H HB2  . LEU A 1 41  ? -10.745 7.800   0.666   2.00 0.00 ? 60  LEU A HB2  3  
ATOM 5434  H HB3  . LEU A 1 41  ? -9.329  8.749   1.031   2.00 0.00 ? 60  LEU A HB3  3  
ATOM 5435  H HG   . LEU A 1 41  ? -8.958  6.737   -1.075  1.00 0.00 ? 60  LEU A HG   3  
ATOM 5436  H HD11 . LEU A 1 41  ? -10.154 8.997   -2.332  1.00 0.00 ? 60  LEU A HD11 3  
ATOM 5437  H HD12 . LEU A 1 41  ? -11.285 8.345   -1.145  1.00 0.00 ? 60  LEU A HD12 3  
ATOM 5438  H HD13 . LEU A 1 41  ? -10.637 7.302   -2.412  1.00 0.00 ? 60  LEU A HD13 3  
ATOM 5439  H HD21 . LEU A 1 41  ? -7.988  8.869   -2.161  1.00 0.00 ? 60  LEU A HD21 3  
ATOM 5440  H HD22 . LEU A 1 41  ? -7.156  8.172   -0.771  1.00 0.00 ? 60  LEU A HD22 3  
ATOM 5441  H HD23 . LEU A 1 41  ? -8.188  9.585   -0.562  1.00 0.00 ? 60  LEU A HD23 3  
ATOM 5442  N N    . PRO A 1 42  ? -8.077  6.889   3.734   1.00 0.00 ? 61  PRO A N    3  
ATOM 5443  C CA   . PRO A 1 42  ? -7.952  7.289   5.138   1.00 0.00 ? 61  PRO A CA   3  
ATOM 5444  C C    . PRO A 1 42  ? -7.786  8.794   5.294   1.00 0.00 ? 61  PRO A C    3  
ATOM 5445  O O    . PRO A 1 42  ? -7.417  9.487   4.348   1.00 0.00 ? 61  PRO A O    3  
ATOM 5446  C CB   . PRO A 1 42  ? -6.689  6.561   5.604   1.00 0.00 ? 61  PRO A CB   3  
ATOM 5447  C CG   . PRO A 1 42  ? -5.891  6.356   4.363   1.00 0.00 ? 61  PRO A CG   3  
ATOM 5448  C CD   . PRO A 1 42  ? -6.890  6.156   3.258   1.00 0.00 ? 61  PRO A CD   3  
ATOM 5449  H HA   . PRO A 1 42  ? -8.799  6.957   5.721   1.00 0.00 ? 61  PRO A HA   3  
ATOM 5450  H HB2  . PRO A 1 42  ? -6.160  7.175   6.319   1.00 0.00 ? 61  PRO A HB2  3  
ATOM 5451  H HB3  . PRO A 1 42  ? -6.959  5.620   6.060   1.00 0.00 ? 61  PRO A HB3  3  
ATOM 5452  H HG2  . PRO A 1 42  ? -5.285  7.229   4.168   1.00 0.00 ? 61  PRO A HG2  3  
ATOM 5453  H HG3  . PRO A 1 42  ? -5.267  5.481   4.469   1.00 0.00 ? 61  PRO A HG3  3  
ATOM 5454  H HD2  . PRO A 1 42  ? -6.521  6.577   2.335   1.00 0.00 ? 61  PRO A HD2  3  
ATOM 5455  H HD3  . PRO A 1 42  ? -7.110  5.106   3.133   1.00 0.00 ? 61  PRO A HD3  3  
ATOM 5456  N N    . THR A 1 43  ? -8.063  9.295   6.491   1.00 0.00 ? 62  THR A N    3  
ATOM 5457  C CA   . THR A 1 43  ? -7.942  10.719  6.765   1.00 0.00 ? 62  THR A CA   3  
ATOM 5458  C C    . THR A 1 43  ? -6.690  11.013  7.584   1.00 0.00 ? 62  THR A C    3  
ATOM 5459  O O    . THR A 1 43  ? -5.986  10.098  8.014   1.00 0.00 ? 62  THR A O    3  
ATOM 5460  C CB   . THR A 1 43  ? -9.173  11.254  7.520   1.00 0.00 ? 62  THR A CB   3  
ATOM 5461  O OG1  . THR A 1 43  ? -10.281 10.364  7.344   1.00 0.00 ? 62  THR A OG1  3  
ATOM 5462  C CG2  . THR A 1 43  ? -9.549  12.643  7.026   1.00 0.00 ? 62  THR A CG2  3  
ATOM 5463  H H    . THR A 1 43  ? -8.354  8.693   7.207   1.00 0.00 ? 62  THR A H    3  
ATOM 5464  H HA   . THR A 1 43  ? -7.872  11.237  5.819   1.00 0.00 ? 62  THR A HA   3  
ATOM 5465  H HB   . THR A 1 43  ? -8.933  11.317  8.572   1.00 0.00 ? 62  THR A HB   3  
ATOM 5466  H HG1  . THR A 1 43  ? -10.856 10.413  8.111   1.00 0.00 ? 62  THR A HG1  3  
ATOM 5467  H HG21 . THR A 1 43  ? -8.816  12.980  6.307   1.00 0.00 ? 62  THR A HG21 3  
ATOM 5468  H HG22 . THR A 1 43  ? -9.576  13.327  7.860   1.00 0.00 ? 62  THR A HG22 3  
ATOM 5469  H HG23 . THR A 1 43  ? -10.521 12.607  6.556   1.00 0.00 ? 62  THR A HG23 3  
ATOM 5470  N N    . MET A 1 44  ? -6.420  12.295  7.798   1.00 0.00 ? 63  MET A N    3  
ATOM 5471  C CA   . MET A 1 44  ? -5.257  12.711  8.569   1.00 0.00 ? 63  MET A CA   3  
ATOM 5472  C C    . MET A 1 44  ? -5.283  12.082  9.955   1.00 0.00 ? 63  MET A C    3  
ATOM 5473  O O    . MET A 1 44  ? -4.270  12.045  10.652  1.00 0.00 ? 63  MET A O    3  
ATOM 5474  C CB   . MET A 1 44  ? -5.212  14.236  8.687   1.00 0.00 ? 63  MET A CB   3  
ATOM 5475  C CG   . MET A 1 44  ? -3.809  14.816  8.635   1.00 0.00 ? 63  MET A CG   3  
ATOM 5476  S SD   . MET A 1 44  ? -3.726  16.358  7.704   1.00 0.00 ? 63  MET A SD   3  
ATOM 5477  C CE   . MET A 1 44  ? -4.624  17.459  8.794   1.00 0.00 ? 63  MET A CE   3  
ATOM 5478  H H    . MET A 1 44  ? -7.020  12.977  7.433   1.00 0.00 ? 63  MET A H    3  
ATOM 5479  H HA   . MET A 1 44  ? -4.374  12.371  8.048   1.00 0.00 ? 63  MET A HA   3  
ATOM 5480  H HB2  . MET A 1 44  ? -5.785  14.664  7.877   2.00 0.00 ? 63  MET A HB2  3  
ATOM 5481  H HB3  . MET A 1 44  ? -5.664  14.525  9.624   2.00 0.00 ? 63  MET A HB3  3  
ATOM 5482  H HG2  . MET A 1 44  ? -3.474  15.004  9.646   2.00 0.00 ? 63  MET A HG2  3  
ATOM 5483  H HG3  . MET A 1 44  ? -3.153  14.095  8.170   2.00 0.00 ? 63  MET A HG3  3  
ATOM 5484  H HE1  . MET A 1 44  ? -4.066  17.596  9.708   1.00 0.00 ? 63  MET A HE1  3  
ATOM 5485  H HE2  . MET A 1 44  ? -5.589  17.031  9.022   1.00 0.00 ? 63  MET A HE2  3  
ATOM 5486  H HE3  . MET A 1 44  ? -4.760  18.414  8.308   1.00 0.00 ? 63  MET A HE3  3  
ATOM 5487  N N    . ALA A 1 45  ? -6.453  11.588  10.347  1.00 0.00 ? 64  ALA A N    3  
ATOM 5488  C CA   . ALA A 1 45  ? -6.619  10.959  11.649  1.00 0.00 ? 64  ALA A CA   3  
ATOM 5489  C C    . ALA A 1 45  ? -6.191  9.496   11.612  1.00 0.00 ? 64  ALA A C    3  
ATOM 5490  O O    . ALA A 1 45  ? -5.558  9.004   12.544  1.00 0.00 ? 64  ALA A O    3  
ATOM 5491  C CB   . ALA A 1 45  ? -8.064  11.076  12.110  1.00 0.00 ? 64  ALA A CB   3  
ATOM 5492  H H    . ALA A 1 45  ? -7.223  11.649  9.744   1.00 0.00 ? 64  ALA A H    3  
ATOM 5493  H HA   . ALA A 1 45  ? -5.997  11.487  12.356  1.00 0.00 ? 64  ALA A HA   3  
ATOM 5494  H HB1  . ALA A 1 45  ? -8.554  11.867  11.562  1.00 0.00 ? 64  ALA A HB1  3  
ATOM 5495  H HB2  . ALA A 1 45  ? -8.088  11.302  13.166  1.00 0.00 ? 64  ALA A HB2  3  
ATOM 5496  H HB3  . ALA A 1 45  ? -8.577  10.142  11.930  1.00 0.00 ? 64  ALA A HB3  3  
ATOM 5497  N N    . GLN A 1 46  ? -6.541  8.804   10.533  1.00 0.00 ? 65  GLN A N    3  
ATOM 5498  C CA   . GLN A 1 46  ? -6.190  7.399   10.386  1.00 0.00 ? 65  GLN A CA   3  
ATOM 5499  C C    . GLN A 1 46  ? -4.676  7.212   10.395  1.00 0.00 ? 65  GLN A C    3  
ATOM 5500  O O    . GLN A 1 46  ? -4.150  6.341   11.090  1.00 0.00 ? 65  GLN A O    3  
ATOM 5501  C CB   . GLN A 1 46  ? -6.778  6.840   9.088   1.00 0.00 ? 65  GLN A CB   3  
ATOM 5502  C CG   . GLN A 1 46  ? -8.298  6.875   9.003   1.00 0.00 ? 65  GLN A CG   3  
ATOM 5503  C CD   . GLN A 1 46  ? -8.925  7.907   9.919   1.00 0.00 ? 65  GLN A CD   3  
ATOM 5504  O OE1  . GLN A 1 46  ? -9.108  9.063   9.537   1.00 0.00 ? 65  GLN A OE1  3  
ATOM 5505  N NE2  . GLN A 1 46  ? -9.258  7.495   11.137  4.00 0.00 ? 65  GLN A NE2  3  
ATOM 5506  H H    . GLN A 1 46  ? -7.047  9.245   9.819   1.00 0.00 ? 65  GLN A H    3  
ATOM 5507  H HA   . GLN A 1 46  ? -6.612  6.861   11.223  1.00 0.00 ? 65  GLN A HA   3  
ATOM 5508  H HB2  . GLN A 1 46  ? -6.385  7.410   8.259   2.00 0.00 ? 65  GLN A HB2  3  
ATOM 5509  H HB3  . GLN A 1 46  ? -6.461  5.814   8.980   2.00 0.00 ? 65  GLN A HB3  3  
ATOM 5510  H HG2  . GLN A 1 46  ? -8.583  7.099   7.987   2.00 0.00 ? 65  GLN A HG2  3  
ATOM 5511  H HG3  . GLN A 1 46  ? -8.680  5.902   9.274   2.00 0.00 ? 65  GLN A HG3  3  
ATOM 5512  H HE21 . GLN A 1 46  ? -9.081  6.557   11.373  5.00 0.00 ? 65  GLN A HE21 3  
ATOM 5513  H HE22 . GLN A 1 46  ? -9.666  8.144   11.751  5.00 0.00 ? 65  GLN A HE22 3  
ATOM 5514  N N    . MET A 1 47  ? -3.980  8.033   9.614   1.00 0.00 ? 66  MET A N    3  
ATOM 5515  C CA   . MET A 1 47  ? -2.527  7.955   9.527   1.00 0.00 ? 66  MET A CA   3  
ATOM 5516  C C    . MET A 1 47  ? -1.860  8.497   10.788  1.00 0.00 ? 66  MET A C    3  
ATOM 5517  O O    . MET A 1 47  ? -1.044  7.816   11.409  1.00 0.00 ? 66  MET A O    3  
ATOM 5518  C CB   . MET A 1 47  ? -2.028  8.726   8.305   1.00 0.00 ? 66  MET A CB   3  
ATOM 5519  C CG   . MET A 1 47  ? -1.581  7.842   7.153   1.00 0.00 ? 66  MET A CG   3  
ATOM 5520  S SD   . MET A 1 47  ? 0.190   7.959   6.835   1.00 0.00 ? 66  MET A SD   3  
ATOM 5521  C CE   . MET A 1 47  ? 0.393   9.733   6.690   1.00 0.00 ? 66  MET A CE   3  
ATOM 5522  H H    . MET A 1 47  ? -4.455  8.705   9.082   1.00 0.00 ? 66  MET A H    3  
ATOM 5523  H HA   . MET A 1 47  ? -2.259  6.915   9.414   1.00 0.00 ? 66  MET A HA   3  
ATOM 5524  H HB2  . MET A 1 47  ? -2.824  9.366   7.951   2.00 0.00 ? 66  MET A HB2  3  
ATOM 5525  H HB3  . MET A 1 47  ? -1.192  9.344   8.601   2.00 0.00 ? 66  MET A HB3  3  
ATOM 5526  H HG2  . MET A 1 47  ? -1.823  6.816   7.389   2.00 0.00 ? 66  MET A HG2  3  
ATOM 5527  H HG3  . MET A 1 47  ? -2.113  8.140   6.261   2.00 0.00 ? 66  MET A HG3  3  
ATOM 5528  H HE1  . MET A 1 47  ? 0.618   9.987   5.666   1.00 0.00 ? 66  MET A HE1  3  
ATOM 5529  H HE2  . MET A 1 47  ? 1.204   10.055  7.328   1.00 0.00 ? 66  MET A HE2  3  
ATOM 5530  H HE3  . MET A 1 47  ? -0.518  10.226  6.993   1.00 0.00 ? 66  MET A HE3  3  
ATOM 5531  N N    . GLU A 1 48  ? -2.201  9.727   11.158  1.00 0.00 ? 67  GLU A N    3  
ATOM 5532  C CA   . GLU A 1 48  ? -1.620  10.358  12.339  1.00 0.00 ? 67  GLU A CA   3  
ATOM 5533  C C    . GLU A 1 48  ? -1.816  9.500   13.585  1.00 0.00 ? 67  GLU A C    3  
ATOM 5534  O O    . GLU A 1 48  ? -0.860  9.212   14.304  1.00 0.00 ? 67  GLU A O    3  
ATOM 5535  C CB   . GLU A 1 48  ? -2.230  11.739  12.563  1.00 0.00 ? 67  GLU A CB   3  
ATOM 5536  C CG   . GLU A 1 48  ? -1.468  12.864  11.883  1.00 0.00 ? 67  GLU A CG   3  
ATOM 5537  C CD   . GLU A 1 48  ? -0.839  13.832  12.866  1.00 0.00 ? 67  GLU A CD   3  
ATOM 5538  O OE1  . GLU A 1 48  ? -1.530  14.233  13.826  1.00 0.00 ? 67  GLU A OE1  3  
ATOM 5539  O OE2  . GLU A 1 48  ? 0.342   14.187  12.677  1.00 0.00 ? 67  GLU A OE2  3  
ATOM 5540  H H    . GLU A 1 48  ? -2.852  10.226  10.620  1.00 0.00 ? 67  GLU A H    3  
ATOM 5541  H HA   . GLU A 1 48  ? -0.561  10.470  12.163  1.00 0.00 ? 67  GLU A HA   3  
ATOM 5542  H HB2  . GLU A 1 48  ? -3.242  11.738  12.187  2.00 0.00 ? 67  GLU A HB2  3  
ATOM 5543  H HB3  . GLU A 1 48  ? -2.251  11.937  13.623  2.00 0.00 ? 67  GLU A HB3  3  
ATOM 5544  H HG2  . GLU A 1 48  ? -0.683  12.434  11.274  2.00 0.00 ? 67  GLU A HG2  3  
ATOM 5545  H HG3  . GLU A 1 48  ? -2.152  13.414  11.249  2.00 0.00 ? 67  GLU A HG3  3  
ATOM 5546  N N    . LYS A 1 49  ? -3.056  9.089   13.838  1.00 0.00 ? 68  LYS A N    3  
ATOM 5547  C CA   . LYS A 1 49  ? -3.351  8.262   14.999  1.00 0.00 ? 68  LYS A CA   3  
ATOM 5548  C C    . LYS A 1 49  ? -2.476  7.022   14.978  1.00 0.00 ? 68  LYS A C    3  
ATOM 5549  O O    . LYS A 1 49  ? -1.817  6.693   15.962  1.00 0.00 ? 68  LYS A O    3  
ATOM 5550  C CB   . LYS A 1 49  ? -4.828  7.864   15.022  1.00 0.00 ? 68  LYS A CB   3  
ATOM 5551  C CG   . LYS A 1 49  ? -5.570  8.219   16.300  1.00 0.00 ? 68  LYS A CG   3  
ATOM 5552  C CD   . LYS A 1 49  ? -5.129  7.361   17.475  1.00 0.00 ? 68  LYS A CD   3  
ATOM 5553  C CE   . LYS A 1 49  ? -5.998  6.125   17.643  1.00 0.00 ? 68  LYS A CE   3  
ATOM 5554  N NZ   . LYS A 1 49  ? -7.356  6.466   18.146  1.00 0.00 ? 68  LYS A NZ   3  
ATOM 5555  H H    . LYS A 1 49  ? -3.781  9.340   13.230  1.00 0.00 ? 68  LYS A H    3  
ATOM 5556  H HA   . LYS A 1 49  ? -3.124  8.836   15.886  1.00 0.00 ? 68  LYS A HA   3  
ATOM 5557  H HB2  . LYS A 1 49  ? -5.329  8.350   14.199  2.00 0.00 ? 68  LYS A HB2  3  
ATOM 5558  H HB3  . LYS A 1 49  ? -4.898  6.794   14.881  2.00 0.00 ? 68  LYS A HB3  3  
ATOM 5559  H HG2  . LYS A 1 49  ? -5.385  9.256   16.535  2.00 0.00 ? 68  LYS A HG2  3  
ATOM 5560  H HG3  . LYS A 1 49  ? -6.629  8.074   16.140  2.00 0.00 ? 68  LYS A HG3  3  
ATOM 5561  H HD2  . LYS A 1 49  ? -4.108  7.050   17.315  2.00 0.00 ? 68  LYS A HD2  3  
ATOM 5562  H HD3  . LYS A 1 49  ? -5.185  7.951   18.378  2.00 0.00 ? 68  LYS A HD3  3  
ATOM 5563  H HE2  . LYS A 1 49  ? -6.091  5.632   16.686  2.00 0.00 ? 68  LYS A HE2  3  
ATOM 5564  H HE3  . LYS A 1 49  ? -5.520  5.456   18.345  2.00 0.00 ? 68  LYS A HE3  3  
ATOM 5565  H HZ1  . LYS A 1 49  ? -7.993  5.650   18.038  1.00 0.00 ? 68  LYS A HZ1  3  
ATOM 5566  H HZ2  . LYS A 1 49  ? -7.745  7.268   17.612  1.00 0.00 ? 68  LYS A HZ2  3  
ATOM 5567  H HZ3  . LYS A 1 49  ? -7.310  6.724   19.153  1.00 0.00 ? 68  LYS A HZ3  3  
ATOM 5568  N N    . ALA A 1 50  ? -2.466  6.349   13.836  1.00 0.00 ? 69  ALA A N    3  
ATOM 5569  C CA   . ALA A 1 50  ? -1.662  5.151   13.663  1.00 0.00 ? 69  ALA A CA   3  
ATOM 5570  C C    . ALA A 1 50  ? -0.186  5.460   13.891  1.00 0.00 ? 69  ALA A C    3  
ATOM 5571  O O    . ALA A 1 50  ? 0.552   4.642   14.437  1.00 0.00 ? 69  ALA A O    3  
ATOM 5572  C CB   . ALA A 1 50  ? -1.880  4.561   12.274  1.00 0.00 ? 69  ALA A CB   3  
ATOM 5573  H H    . ALA A 1 50  ? -3.007  6.676   13.086  1.00 0.00 ? 69  ALA A H    3  
ATOM 5574  H HA   . ALA A 1 50  ? -1.984  4.424   14.394  1.00 0.00 ? 69  ALA A HA   3  
ATOM 5575  H HB1  . ALA A 1 50  ? -1.837  5.349   11.537  1.00 0.00 ? 69  ALA A HB1  3  
ATOM 5576  H HB2  . ALA A 1 50  ? -2.850  4.082   12.234  1.00 0.00 ? 69  ALA A HB2  3  
ATOM 5577  H HB3  . ALA A 1 50  ? -1.110  3.832   12.067  1.00 0.00 ? 69  ALA A HB3  3  
ATOM 5578  N N    . LEU A 1 51  ? 0.239   6.653   13.478  1.00 0.00 ? 70  LEU A N    3  
ATOM 5579  C CA   . LEU A 1 51  ? 1.629   7.066   13.646  1.00 0.00 ? 70  LEU A CA   3  
ATOM 5580  C C    . LEU A 1 51  ? 1.958   7.257   15.123  1.00 0.00 ? 70  LEU A C    3  
ATOM 5581  O O    . LEU A 1 51  ? 3.115   7.158   15.529  1.00 0.00 ? 70  LEU A O    3  
ATOM 5582  C CB   . LEU A 1 51  ? 1.900   8.361   12.874  1.00 0.00 ? 70  LEU A CB   3  
ATOM 5583  C CG   . LEU A 1 51  ? 2.590   8.238   11.513  1.00 0.00 ? 70  LEU A CG   3  
ATOM 5584  C CD1  . LEU A 1 51  ? 1.678   7.564   10.500  2.00 0.00 ? 70  LEU A CD1  3  
ATOM 5585  C CD2  . LEU A 1 51  ? 3.030   9.603   11.006  2.00 0.00 ? 70  LEU A CD2  3  
ATOM 5586  H H    . LEU A 1 51  ? -0.396  7.271   13.057  1.00 0.00 ? 70  LEU A H    3  
ATOM 5587  H HA   . LEU A 1 51  ? 2.256   6.283   13.249  1.00 0.00 ? 70  LEU A HA   3  
ATOM 5588  H HB2  . LEU A 1 51  ? 0.955   8.861   12.723  2.00 0.00 ? 70  LEU A HB2  3  
ATOM 5589  H HB3  . LEU A 1 51  ? 2.513   8.997   13.497  2.00 0.00 ? 70  LEU A HB3  3  
ATOM 5590  H HG   . LEU A 1 51  ? 3.469   7.624   11.638  1.00 0.00 ? 70  LEU A HG   3  
ATOM 5591  H HD11 . LEU A 1 51  ? 1.403   6.583   10.860  1.00 0.00 ? 70  LEU A HD11 3  
ATOM 5592  H HD12 . LEU A 1 51  ? 2.195   7.469   9.557   1.00 0.00 ? 70  LEU A HD12 3  
ATOM 5593  H HD13 . LEU A 1 51  ? 0.787   8.160   10.364  1.00 0.00 ? 70  LEU A HD13 3  
ATOM 5594  H HD21 . LEU A 1 51  ? 2.974   10.322  11.811  1.00 0.00 ? 70  LEU A HD21 3  
ATOM 5595  H HD22 . LEU A 1 51  ? 2.383   9.913   10.199  1.00 0.00 ? 70  LEU A HD22 3  
ATOM 5596  H HD23 . LEU A 1 51  ? 4.048   9.543   10.649  1.00 0.00 ? 70  LEU A HD23 3  
ATOM 5597  N N    . SER A 1 52  ? 0.930   7.527   15.922  1.00 0.00 ? 71  SER A N    3  
ATOM 5598  C CA   . SER A 1 52  ? 1.105   7.727   17.355  1.00 0.00 ? 71  SER A CA   3  
ATOM 5599  C C    . SER A 1 52  ? 0.950   6.410   18.106  1.00 0.00 ? 71  SER A C    3  
ATOM 5600  O O    . SER A 1 52  ? 1.313   6.304   19.278  1.00 0.00 ? 71  SER A O    3  
ATOM 5601  C CB   . SER A 1 52  ? 0.090   8.746   17.876  1.00 0.00 ? 71  SER A CB   3  
ATOM 5602  O OG   . SER A 1 52  ? -0.188  9.737   16.902  1.00 0.00 ? 71  SER A OG   3  
ATOM 5603  H H    . SER A 1 52  ? 0.031   7.590   15.537  1.00 0.00 ? 71  SER A H    3  
ATOM 5604  H HA   . SER A 1 52  ? 2.101   8.108   17.518  1.00 0.00 ? 71  SER A HA   3  
ATOM 5605  H HB2  . SER A 1 52  ? -0.830  8.238   18.126  2.00 0.00 ? 71  SER A HB2  3  
ATOM 5606  H HB3  . SER A 1 52  ? 0.486   9.228   18.758  2.00 0.00 ? 71  SER A HB3  3  
ATOM 5607  H HG   . SER A 1 52  ? -0.984  9.497   16.419  1.00 0.00 ? 71  SER A HG   3  
ATOM 5608  N N    . ILE A 1 53  ? 0.408   5.409   17.422  1.00 0.00 ? 72  ILE A N    3  
ATOM 5609  C CA   . ILE A 1 53  ? 0.202   4.095   18.019  1.00 0.00 ? 72  ILE A CA   3  
ATOM 5610  C C    . ILE A 1 53  ? 1.354   3.155   17.684  1.00 0.00 ? 72  ILE A C    3  
ATOM 5611  O O    . ILE A 1 53  ? 1.387   2.009   18.135  1.00 0.00 ? 72  ILE A O    3  
ATOM 5612  C CB   . ILE A 1 53  ? -1.121  3.466   17.537  1.00 0.00 ? 72  ILE A CB   3  
ATOM 5613  C CG1  . ILE A 1 53  ? -0.939  2.823   16.161  1.00 0.00 ? 72  ILE A CG1  3  
ATOM 5614  C CG2  . ILE A 1 53  ? -2.218  4.515   17.490  1.00 0.00 ? 72  ILE A CG2  3  
ATOM 5615  C CD1  . ILE A 1 53  ? -0.739  1.323   16.207  1.00 0.00 ? 72  ILE A CD1  3  
ATOM 5616  H H    . ILE A 1 53  ? 0.139   5.557   16.492  1.00 0.00 ? 72  ILE A H    3  
ATOM 5617  H HA   . ILE A 1 53  ? 0.148   4.219   19.091  1.00 0.00 ? 72  ILE A HA   3  
ATOM 5618  H HB   . ILE A 1 53  ? -1.414  2.707   18.244  1.00 0.00 ? 72  ILE A HB   3  
ATOM 5619  H HG12 . ILE A 1 53  ? -1.814  3.021   15.561  2.00 0.00 ? 72  ILE A HG12 3  
ATOM 5620  H HG13 . ILE A 1 53  ? -0.077  3.259   15.680  2.00 0.00 ? 72  ILE A HG13 3  
ATOM 5621  H HG21 . ILE A 1 53  ? -2.450  4.744   16.461  1.00 0.00 ? 72  ILE A HG21 3  
ATOM 5622  H HG22 . ILE A 1 53  ? -1.882  5.409   17.993  1.00 0.00 ? 72  ILE A HG22 3  
ATOM 5623  H HG23 . ILE A 1 53  ? -3.102  4.134   17.982  1.00 0.00 ? 72  ILE A HG23 3  
ATOM 5624  H HD11 . ILE A 1 53  ? -1.202  0.926   17.098  1.00 0.00 ? 72  ILE A HD11 3  
ATOM 5625  H HD12 . ILE A 1 53  ? 0.318   1.102   16.221  1.00 0.00 ? 72  ILE A HD12 3  
ATOM 5626  H HD13 . ILE A 1 53  ? -1.190  0.873   15.335  1.00 0.00 ? 72  ILE A HD13 3  
ATOM 5627  N N    . GLY A 1 54  ? 2.298   3.647   16.887  1.00 0.00 ? 73  GLY A N    3  
ATOM 5628  C CA   . GLY A 1 54  ? 3.437   2.839   16.497  1.00 0.00 ? 73  GLY A CA   3  
ATOM 5629  C C    . GLY A 1 54  ? 3.362   2.374   15.057  1.00 0.00 ? 73  GLY A C    3  
ATOM 5630  O O    . GLY A 1 54  ? 3.780   1.263   14.730  1.00 0.00 ? 73  GLY A O    3  
ATOM 5631  H H    . GLY A 1 54  ? 2.216   4.565   16.556  1.00 0.00 ? 73  GLY A H    3  
ATOM 5632  H HA2  . GLY A 1 54  ? 4.339   3.421   16.628  2.00 0.00 ? 73  GLY A HA2  3  
ATOM 5633  H HA3  . GLY A 1 54  ? 3.486   1.971   17.142  2.00 0.00 ? 73  GLY A HA3  3  
ATOM 5634  N N    . PHE A 1 55  ? 2.820   3.228   14.195  1.00 0.00 ? 74  PHE A N    3  
ATOM 5635  C CA   . PHE A 1 55  ? 2.679   2.908   12.780  1.00 0.00 ? 74  PHE A CA   3  
ATOM 5636  C C    . PHE A 1 55  ? 3.598   3.783   11.936  1.00 0.00 ? 74  PHE A C    3  
ATOM 5637  O O    . PHE A 1 55  ? 3.408   4.997   11.847  1.00 0.00 ? 74  PHE A O    3  
ATOM 5638  C CB   . PHE A 1 55  ? 1.224   3.094   12.346  1.00 0.00 ? 74  PHE A CB   3  
ATOM 5639  C CG   . PHE A 1 55  ? 0.985   3.024   10.866  1.00 0.00 ? 74  PHE A CG   3  
ATOM 5640  C CD1  . PHE A 1 55  ? 1.120   1.828   10.183  1.00 0.00 ? 74  PHE A CD1  3  
ATOM 5641  C CD2  . PHE A 1 55  ? 0.610   4.157   10.161  1.00 0.00 ? 74  PHE A CD2  3  
ATOM 5642  C CE1  . PHE A 1 55  ? 0.886   1.759   8.825   1.00 0.00 ? 74  PHE A CE1  3  
ATOM 5643  C CE2  . PHE A 1 55  ? 0.377   4.095   8.801   1.00 0.00 ? 74  PHE A CE2  3  
ATOM 5644  C CZ   . PHE A 1 55  ? 0.515   2.893   8.133   1.00 0.00 ? 74  PHE A CZ   3  
ATOM 5645  H H    . PHE A 1 55  ? 2.502   4.098   14.521  1.00 0.00 ? 74  PHE A H    3  
ATOM 5646  H HA   . PHE A 1 55  ? 2.959   1.874   12.643  1.00 0.00 ? 74  PHE A HA   3  
ATOM 5647  H HB2  . PHE A 1 55  ? 0.623   2.328   12.811  2.00 0.00 ? 74  PHE A HB2  3  
ATOM 5648  H HB3  . PHE A 1 55  ? 0.882   4.059   12.687  2.00 0.00 ? 74  PHE A HB3  3  
ATOM 5649  H HD1  . PHE A 1 55  ? 1.412   0.941   10.724  1.00 0.00 ? 74  PHE A HD1  3  
ATOM 5650  H HD2  . PHE A 1 55  ? 0.503   5.095   10.683  1.00 0.00 ? 74  PHE A HD2  3  
ATOM 5651  H HE1  . PHE A 1 55  ? 0.995   0.820   8.304   1.00 0.00 ? 74  PHE A HE1  3  
ATOM 5652  H HE2  . PHE A 1 55  ? 0.088   4.985   8.261   1.00 0.00 ? 74  PHE A HE2  3  
ATOM 5653  H HZ   . PHE A 1 55  ? 0.331   2.843   7.070   1.00 0.00 ? 74  PHE A HZ   3  
ATOM 5654  N N    . GLU A 1 56  ? 4.596   3.160   11.320  1.00 0.00 ? 75  GLU A N    3  
ATOM 5655  C CA   . GLU A 1 56  ? 5.548   3.883   10.485  1.00 0.00 ? 75  GLU A CA   3  
ATOM 5656  C C    . GLU A 1 56  ? 5.967   3.044   9.284   1.00 0.00 ? 75  GLU A C    3  
ATOM 5657  O O    . GLU A 1 56  ? 6.114   1.825   9.384   1.00 0.00 ? 75  GLU A O    3  
ATOM 5658  C CB   . GLU A 1 56  ? 6.780   4.277   11.304  1.00 0.00 ? 75  GLU A CB   3  
ATOM 5659  C CG   . GLU A 1 56  ? 6.882   3.571   12.645  1.00 0.00 ? 75  GLU A CG   3  
ATOM 5660  C CD   . GLU A 1 56  ? 8.310   3.458   13.144  1.00 0.00 ? 75  GLU A CD   3  
ATOM 5661  O OE1  . GLU A 1 56  ? 9.154   2.908   12.406  1.00 0.00 ? 75  GLU A OE1  3  
ATOM 5662  O OE2  . GLU A 1 56  ? 8.583   3.920   14.272  1.00 0.00 ? 75  GLU A OE2  3  
ATOM 5663  H H    . GLU A 1 56  ? 4.696   2.191   11.431  1.00 0.00 ? 75  GLU A H    3  
ATOM 5664  H HA   . GLU A 1 56  ? 5.062   4.779   10.131  1.00 0.00 ? 75  GLU A HA   3  
ATOM 5665  H HB2  . GLU A 1 56  ? 7.667   4.043   10.730  2.00 0.00 ? 75  GLU A HB2  3  
ATOM 5666  H HB3  . GLU A 1 56  ? 6.750   5.343   11.484  2.00 0.00 ? 75  GLU A HB3  3  
ATOM 5667  H HG2  . GLU A 1 56  ? 6.307   4.124   13.373  2.00 0.00 ? 75  GLU A HG2  3  
ATOM 5668  H HG3  . GLU A 1 56  ? 6.473   2.576   12.547  2.00 0.00 ? 75  GLU A HG3  3  
ATOM 5669  N N    . THR A 1 57  ? 6.155   3.706   8.148   1.00 0.00 ? 76  THR A N    3  
ATOM 5670  C CA   . THR A 1 57  ? 6.554   3.029   6.922   1.00 0.00 ? 76  THR A CA   3  
ATOM 5671  C C    . THR A 1 57  ? 7.808   3.659   6.333   1.00 0.00 ? 76  THR A C    3  
ATOM 5672  O O    . THR A 1 57  ? 8.397   4.563   6.925   1.00 0.00 ? 76  THR A O    3  
ATOM 5673  C CB   . THR A 1 57  ? 5.435   3.083   5.871   1.00 0.00 ? 76  THR A CB   3  
ATOM 5674  O OG1  . THR A 1 57  ? 5.400   4.380   5.262   1.00 0.00 ? 76  THR A OG1  3  
ATOM 5675  C CG2  . THR A 1 57  ? 4.086   2.776   6.504   1.00 0.00 ? 76  THR A CG2  3  
ATOM 5676  H H    . THR A 1 57  ? 6.020   4.675   8.133   1.00 0.00 ? 76  THR A H    3  
ATOM 5677  H HA   . THR A 1 57  ? 6.754   1.993   7.157   1.00 0.00 ? 76  THR A HA   3  
ATOM 5678  H HB   . THR A 1 57  ? 5.638   2.346   5.111   1.00 0.00 ? 76  THR A HB   3  
ATOM 5679  H HG1  . THR A 1 57  ? 5.207   4.289   4.326   1.00 0.00 ? 76  THR A HG1  3  
ATOM 5680  H HG21 . THR A 1 57  ? 3.297   3.010   5.804   1.00 0.00 ? 76  THR A HG21 3  
ATOM 5681  H HG22 . THR A 1 57  ? 3.964   3.371   7.397   1.00 0.00 ? 76  THR A HG22 3  
ATOM 5682  H HG23 . THR A 1 57  ? 4.041   1.728   6.760   1.00 0.00 ? 76  THR A HG23 3  
ATOM 5683  N N    . CYS A 1 58  ? 8.205   3.186   5.156   1.00 0.00 ? 77  CYS A N    3  
ATOM 5684  C CA   . CYS A 1 58  ? 9.382   3.718   4.485   1.00 0.00 ? 77  CYS A CA   3  
ATOM 5685  C C    . CYS A 1 58  ? 9.280   5.232   4.373   1.00 0.00 ? 77  CYS A C    3  
ATOM 5686  O O    . CYS A 1 58  ? 10.226  5.952   4.690   1.00 0.00 ? 77  CYS A O    3  
ATOM 5687  C CB   . CYS A 1 58  ? 9.536   3.098   3.095   1.00 0.00 ? 77  CYS A CB   3  
ATOM 5688  S SG   . CYS A 1 58  ? 10.453  4.110   1.889   1.00 0.00 ? 77  CYS A SG   3  
ATOM 5689  H H    . CYS A 1 58  ? 7.690   2.470   4.728   1.00 0.00 ? 77  CYS A H    3  
ATOM 5690  H HA   . CYS A 1 58  ? 10.247  3.469   5.082   1.00 0.00 ? 77  CYS A HA   3  
ATOM 5691  H HB2  . CYS A 1 58  ? 10.055  2.155   3.190   2.00 0.00 ? 77  CYS A HB2  3  
ATOM 5692  H HB3  . CYS A 1 58  ? 8.553   2.914   2.686   2.00 0.00 ? 77  CYS A HB3  3  
ATOM 5693  N N    . ARG A 1 59  ? 8.115   5.706   3.932   1.00 0.00 ? 78  ARG A N    3  
ATOM 5694  C CA   . ARG A 1 59  ? 7.870   7.139   3.783   1.00 0.00 ? 78  ARG A CA   3  
ATOM 5695  C C    . ARG A 1 59  ? 6.714   7.407   2.822   1.00 0.00 ? 78  ARG A C    3  
ATOM 5696  O O    . ARG A 1 59  ? 5.549   7.214   3.170   1.00 0.00 ? 78  ARG A O    3  
ATOM 5697  C CB   . ARG A 1 59  ? 9.133   7.852   3.294   1.00 0.00 ? 78  ARG A CB   3  
ATOM 5698  C CG   . ARG A 1 59  ? 9.702   8.853   4.287   1.00 0.00 ? 78  ARG A CG   3  
ATOM 5699  C CD   . ARG A 1 59  ? 9.363   8.491   5.725   1.00 0.00 ? 78  ARG A CD   3  
ATOM 5700  N NE   . ARG A 1 59  ? 10.329  9.038   6.672   1.00 0.00 ? 78  ARG A NE   3  
ATOM 5701  C CZ   . ARG A 1 59  ? 10.284  8.814   7.981   4.00 0.00 ? 78  ARG A CZ   3  
ATOM 5702  N NH1  . ARG A 1 59  ? 9.328   8.055   8.500   5.00 0.00 ? 78  ARG A NH1  3  
ATOM 5703  N NH2  . ARG A 1 59  ? 11.195  9.347   8.783   5.00 0.00 ? 78  ARG A NH2  3  
ATOM 5704  H H    . ARG A 1 59  ? 7.398   5.076   3.707   1.00 0.00 ? 78  ARG A H    3  
ATOM 5705  H HA   . ARG A 1 59  ? 7.606   7.527   4.756   1.00 0.00 ? 78  ARG A HA   3  
ATOM 5706  H HB2  . ARG A 1 59  ? 9.891   7.112   3.087   2.00 0.00 ? 78  ARG A HB2  3  
ATOM 5707  H HB3  . ARG A 1 59  ? 8.902   8.378   2.378   2.00 0.00 ? 78  ARG A HB3  3  
ATOM 5708  H HG2  . ARG A 1 59  ? 10.776  8.879   4.179   2.00 0.00 ? 78  ARG A HG2  3  
ATOM 5709  H HG3  . ARG A 1 59  ? 9.296   9.830   4.070   2.00 0.00 ? 78  ARG A HG3  3  
ATOM 5710  H HD2  . ARG A 1 59  ? 8.383   8.881   5.959   2.00 0.00 ? 78  ARG A HD2  3  
ATOM 5711  H HD3  . ARG A 1 59  ? 9.352   7.414   5.818   2.00 0.00 ? 78  ARG A HD3  3  
ATOM 5712  H HE   . ARG A 1 59  ? 11.046  9.602   6.314   1.00 0.00 ? 78  ARG A HE   3  
ATOM 5713  H HH11 . ARG A 1 59  ? 8.635   7.648   7.905   5.00 0.00 ? 78  ARG A HH11 3  
ATOM 5714  H HH12 . ARG A 1 59  ? 9.300   7.890   9.485   5.00 0.00 ? 78  ARG A HH12 3  
ATOM 5715  H HH21 . ARG A 1 59  ? 11.920  9.921   8.404   5.00 0.00 ? 78  ARG A HH21 3  
ATOM 5716  H HH22 . ARG A 1 59  ? 11.155  9.176   9.767   5.00 0.00 ? 78  ARG A HH22 3  
ATOM 5717  N N    . TYR A 1 60  ? 7.047   7.864   1.617   1.00 0.00 ? 79  TYR A N    3  
ATOM 5718  C CA   . TYR A 1 60  ? 6.044   8.175   0.603   1.00 0.00 ? 79  TYR A CA   3  
ATOM 5719  C C    . TYR A 1 60  ? 4.850   7.227   0.680   1.00 0.00 ? 79  TYR A C    3  
ATOM 5720  O O    . TYR A 1 60  ? 5.009   6.006   0.713   1.00 0.00 ? 79  TYR A O    3  
ATOM 5721  C CB   . TYR A 1 60  ? 6.667   8.118   -0.793  1.00 0.00 ? 79  TYR A CB   3  
ATOM 5722  C CG   . TYR A 1 60  ? 7.375   9.378   -1.242  1.00 0.00 ? 79  TYR A CG   3  
ATOM 5723  C CD1  . TYR A 1 60  ? 6.897   10.635  -0.882  1.00 0.00 ? 79  TYR A CD1  3  
ATOM 5724  C CD2  . TYR A 1 60  ? 8.518   9.312   -2.028  1.00 0.00 ? 79  TYR A CD2  3  
ATOM 5725  C CE1  . TYR A 1 60  ? 7.540   11.787  -1.293  1.00 0.00 ? 79  TYR A CE1  3  
ATOM 5726  C CE2  . TYR A 1 60  ? 9.166   10.460  -2.442  1.00 0.00 ? 79  TYR A CE2  3  
ATOM 5727  C CZ   . TYR A 1 60  ? 8.674   11.694  -2.072  1.00 0.00 ? 79  TYR A CZ   3  
ATOM 5728  O OH   . TYR A 1 60  ? 9.318   12.839  -2.482  1.00 0.00 ? 79  TYR A OH   3  
ATOM 5729  H H    . TYR A 1 60  ? 7.993   8.003   1.406   1.00 0.00 ? 79  TYR A H    3  
ATOM 5730  H HA   . TYR A 1 60  ? 5.695   9.180   0.785   1.00 0.00 ? 79  TYR A HA   3  
ATOM 5731  H HB2  . TYR A 1 60  ? 7.387   7.314   -0.818  2.00 0.00 ? 79  TYR A HB2  3  
ATOM 5732  H HB3  . TYR A 1 60  ? 5.889   7.907   -1.512  2.00 0.00 ? 79  TYR A HB3  3  
ATOM 5733  H HD1  . TYR A 1 60  ? 6.011   10.705  -0.270  1.00 0.00 ? 79  TYR A HD1  3  
ATOM 5734  H HD2  . TYR A 1 60  ? 8.902   8.346   -2.316  1.00 0.00 ? 79  TYR A HD2  3  
ATOM 5735  H HE1  . TYR A 1 60  ? 7.154   12.752  -1.002  1.00 0.00 ? 79  TYR A HE1  3  
ATOM 5736  H HE2  . TYR A 1 60  ? 10.055  10.388  -3.052  1.00 0.00 ? 79  TYR A HE2  3  
ATOM 5737  H HH   . TYR A 1 60  ? 9.714   13.273  -1.723  1.00 0.00 ? 79  TYR A HH   3  
ATOM 5738  N N    . GLY A 1 61  ? 3.652   7.805   0.706   1.00 0.00 ? 80  GLY A N    3  
ATOM 5739  C CA   . GLY A 1 61  ? 2.437   7.016   0.776   1.00 0.00 ? 80  GLY A CA   3  
ATOM 5740  C C    . GLY A 1 61  ? 1.180   7.854   0.620   1.00 0.00 ? 80  GLY A C    3  
ATOM 5741  O O    . GLY A 1 61  ? 1.003   8.852   1.319   1.00 0.00 ? 80  GLY A O    3  
ATOM 5742  H H    . GLY A 1 61  ? 3.593   8.780   0.676   1.00 0.00 ? 80  GLY A H    3  
ATOM 5743  H HA2  . GLY A 1 61  ? 2.459   6.272   -0.010  2.00 0.00 ? 80  GLY A HA2  3  
ATOM 5744  H HA3  . GLY A 1 61  ? 2.404   6.510   1.731   2.00 0.00 ? 80  GLY A HA3  3  
ATOM 5745  N N    . PHE A 1 62  ? 0.312   7.454   -0.304  1.00 0.00 ? 81  PHE A N    3  
ATOM 5746  C CA   . PHE A 1 62  ? -0.930  8.178   -0.557  1.00 0.00 ? 81  PHE A CA   3  
ATOM 5747  C C    . PHE A 1 62  ? -1.674  8.481   0.738   1.00 0.00 ? 81  PHE A C    3  
ATOM 5748  O O    . PHE A 1 62  ? -2.015  7.574   1.497   1.00 0.00 ? 81  PHE A O    3  
ATOM 5749  C CB   . PHE A 1 62  ? -1.836  7.377   -1.494  1.00 0.00 ? 81  PHE A CB   3  
ATOM 5750  C CG   . PHE A 1 62  ? -2.155  8.067   -2.789  1.00 0.00 ? 81  PHE A CG   3  
ATOM 5751  C CD1  . PHE A 1 62  ? -2.552  9.395   -2.800  1.00 0.00 ? 81  PHE A CD1  3  
ATOM 5752  C CD2  . PHE A 1 62  ? -2.053  7.392   -3.994  1.00 0.00 ? 81  PHE A CD2  3  
ATOM 5753  C CE1  . PHE A 1 62  ? -2.842  10.036  -3.990  1.00 0.00 ? 81  PHE A CE1  3  
ATOM 5754  C CE2  . PHE A 1 62  ? -2.340  8.028   -5.188  1.00 0.00 ? 81  PHE A CE2  3  
ATOM 5755  C CZ   . PHE A 1 62  ? -2.734  9.352   -5.184  1.00 0.00 ? 81  PHE A CZ   3  
ATOM 5756  H H    . PHE A 1 62  ? 0.516   6.655   -0.836  1.00 0.00 ? 81  PHE A H    3  
ATOM 5757  H HA   . PHE A 1 62  ? -0.676  9.112   -1.034  1.00 0.00 ? 81  PHE A HA   3  
ATOM 5758  H HB2  . PHE A 1 62  ? -1.353  6.441   -1.732  2.00 0.00 ? 81  PHE A HB2  3  
ATOM 5759  H HB3  . PHE A 1 62  ? -2.768  7.170   -0.990  2.00 0.00 ? 81  PHE A HB3  3  
ATOM 5760  H HD1  . PHE A 1 62  ? -2.636  9.931   -1.866  1.00 0.00 ? 81  PHE A HD1  3  
ATOM 5761  H HD2  . PHE A 1 62  ? -1.745  6.355   -3.996  1.00 0.00 ? 81  PHE A HD2  3  
ATOM 5762  H HE1  . PHE A 1 62  ? -3.149  11.071  -3.986  1.00 0.00 ? 81  PHE A HE1  3  
ATOM 5763  H HE2  . PHE A 1 62  ? -2.257  7.490   -6.120  1.00 0.00 ? 81  PHE A HE2  3  
ATOM 5764  H HZ   . PHE A 1 62  ? -2.956  9.853   -6.115  1.00 0.00 ? 81  PHE A HZ   3  
ATOM 5765  N N    . ILE A 1 63  ? -1.932  9.764   0.977   1.00 0.00 ? 82  ILE A N    3  
ATOM 5766  C CA   . ILE A 1 63  ? -2.646  10.189  2.174   1.00 0.00 ? 82  ILE A CA   3  
ATOM 5767  C C    . ILE A 1 63  ? -4.141  10.326  1.888   1.00 0.00 ? 82  ILE A C    3  
ATOM 5768  O O    . ILE A 1 63  ? -4.642  9.771   0.910   1.00 0.00 ? 82  ILE A O    3  
ATOM 5769  C CB   . ILE A 1 63  ? -2.089  11.527  2.716   1.00 0.00 ? 82  ILE A CB   3  
ATOM 5770  C CG1  . ILE A 1 63  ? -2.275  11.625  4.233   1.00 0.00 ? 82  ILE A CG1  3  
ATOM 5771  C CG2  . ILE A 1 63  ? -2.749  12.709  2.025   1.00 0.00 ? 82  ILE A CG2  3  
ATOM 5772  C CD1  . ILE A 1 63  ? -2.520  10.298  4.920   1.00 0.00 ? 82  ILE A CD1  3  
ATOM 5773  H H    . ILE A 1 63  ? -1.639  10.440  0.327   1.00 0.00 ? 82  ILE A H    3  
ATOM 5774  H HA   . ILE A 1 63  ? -2.504  9.431   2.931   1.00 0.00 ? 82  ILE A HA   3  
ATOM 5775  H HB   . ILE A 1 63  ? -1.034  11.562  2.492   1.00 0.00 ? 82  ILE A HB   3  
ATOM 5776  H HG12 . ILE A 1 63  ? -1.387  12.061  4.666   2.00 0.00 ? 82  ILE A HG12 3  
ATOM 5777  H HG13 . ILE A 1 63  ? -3.118  12.266  4.445   2.00 0.00 ? 82  ILE A HG13 3  
ATOM 5778  H HG21 . ILE A 1 63  ? -2.676  12.588  0.955   1.00 0.00 ? 82  ILE A HG21 3  
ATOM 5779  H HG22 . ILE A 1 63  ? -2.249  13.620  2.319   1.00 0.00 ? 82  ILE A HG22 3  
ATOM 5780  H HG23 . ILE A 1 63  ? -3.788  12.761  2.313   1.00 0.00 ? 82  ILE A HG23 3  
ATOM 5781  H HD11 . ILE A 1 63  ? -2.428  10.424  5.989   1.00 0.00 ? 82  ILE A HD11 3  
ATOM 5782  H HD12 . ILE A 1 63  ? -1.793  9.576   4.578   1.00 0.00 ? 82  ILE A HD12 3  
ATOM 5783  H HD13 . ILE A 1 63  ? -3.514  9.949   4.684   1.00 0.00 ? 82  ILE A HD13 3  
ATOM 5784  N N    . GLU A 1 64  ? -4.848  11.059  2.742   1.00 0.00 ? 83  GLU A N    3  
ATOM 5785  C CA   . GLU A 1 64  ? -6.284  11.259  2.574   1.00 0.00 ? 83  GLU A CA   3  
ATOM 5786  C C    . GLU A 1 64  ? -6.636  11.541  1.116   1.00 0.00 ? 83  GLU A C    3  
ATOM 5787  O O    . GLU A 1 64  ? -7.751  11.265  0.673   1.00 0.00 ? 83  GLU A O    3  
ATOM 5788  C CB   . GLU A 1 64  ? -6.766  12.410  3.459   1.00 0.00 ? 83  GLU A CB   3  
ATOM 5789  C CG   . GLU A 1 64  ? -6.008  13.709  3.242   1.00 0.00 ? 83  GLU A CG   3  
ATOM 5790  C CD   . GLU A 1 64  ? -6.916  14.923  3.206   1.00 0.00 ? 83  GLU A CD   3  
ATOM 5791  O OE1  . GLU A 1 64  ? -7.413  15.325  4.278   1.00 0.00 ? 83  GLU A OE1  3  
ATOM 5792  O OE2  . GLU A 1 64  ? -7.129  15.473  2.104   1.00 0.00 ? 83  GLU A OE2  3  
ATOM 5793  H H    . GLU A 1 64  ? -4.394  11.474  3.503   1.00 0.00 ? 83  GLU A H    3  
ATOM 5794  H HA   . GLU A 1 64  ? -6.781  10.351  2.880   1.00 0.00 ? 83  GLU A HA   3  
ATOM 5795  H HB2  . GLU A 1 64  ? -7.812  12.591  3.255   2.00 0.00 ? 83  GLU A HB2  3  
ATOM 5796  H HB3  . GLU A 1 64  ? -6.656  12.123  4.493   2.00 0.00 ? 83  GLU A HB3  3  
ATOM 5797  H HG2  . GLU A 1 64  ? -5.298  13.834  4.046   2.00 0.00 ? 83  GLU A HG2  3  
ATOM 5798  H HG3  . GLU A 1 64  ? -5.477  13.648  2.303   2.00 0.00 ? 83  GLU A HG3  3  
ATOM 5799  N N    . GLY A 1 65  ? -5.679  12.089  0.377   1.00 0.00 ? 84  GLY A N    3  
ATOM 5800  C CA   . GLY A 1 65  ? -5.906  12.396  -1.022  1.00 0.00 ? 84  GLY A CA   3  
ATOM 5801  C C    . GLY A 1 65  ? -4.736  13.125  -1.652  1.00 0.00 ? 84  GLY A C    3  
ATOM 5802  O O    . GLY A 1 65  ? -4.923  14.013  -2.483  1.00 0.00 ? 84  GLY A O    3  
ATOM 5803  H H    . GLY A 1 65  ? -4.811  12.284  0.785   1.00 0.00 ? 84  GLY A H    3  
ATOM 5804  H HA2  . GLY A 1 65  ? -6.073  11.474  -1.561  2.00 0.00 ? 84  GLY A HA2  3  
ATOM 5805  H HA3  . GLY A 1 65  ? -6.788  13.016  -1.105  2.00 0.00 ? 84  GLY A HA3  3  
ATOM 5806  N N    . HIS A 1 66  ? -3.525  12.749  -1.253  1.00 0.00 ? 85  HIS A N    3  
ATOM 5807  C CA   . HIS A 1 66  ? -2.318  13.372  -1.782  1.00 0.00 ? 85  HIS A CA   3  
ATOM 5808  C C    . HIS A 1 66  ? -1.068  12.632  -1.317  1.00 0.00 ? 85  HIS A C    3  
ATOM 5809  O O    . HIS A 1 66  ? -1.011  12.126  -0.197  1.00 0.00 ? 85  HIS A O    3  
ATOM 5810  C CB   . HIS A 1 66  ? -2.245  14.837  -1.346  1.00 0.00 ? 85  HIS A CB   3  
ATOM 5811  C CG   . HIS A 1 66  ? -2.253  15.819  -2.476  1.00 0.00 ? 85  HIS A CG   3  
ATOM 5812  N ND1  . HIS A 1 66  ? -1.398  15.732  -3.555  1.00 0.00 ? 85  HIS A ND1  3  
ATOM 5813  C CD2  . HIS A 1 66  ? -3.019  16.914  -2.692  1.00 0.00 ? 85  HIS A CD2  3  
ATOM 5814  C CE1  . HIS A 1 66  ? -1.638  16.731  -4.385  1.00 0.00 ? 85  HIS A CE1  3  
ATOM 5815  N NE2  . HIS A 1 66  ? -2.617  17.462  -3.887  1.00 0.00 ? 85  HIS A NE2  3  
ATOM 5816  H H    . HIS A 1 66  ? -3.441  12.034  -0.587  1.00 0.00 ? 85  HIS A H    3  
ATOM 5817  H HA   . HIS A 1 66  ? -2.368  13.330  -2.859  1.00 0.00 ? 85  HIS A HA   3  
ATOM 5818  H HB2  . HIS A 1 66  ? -3.091  15.057  -0.712  2.00 0.00 ? 85  HIS A HB2  3  
ATOM 5819  H HB3  . HIS A 1 66  ? -1.336  14.990  -0.783  2.00 0.00 ? 85  HIS A HB3  3  
ATOM 5820  H HD1  . HIS A 1 66  ? -0.717  15.040  -3.691  1.00 0.00 ? 85  HIS A HD1  3  
ATOM 5821  H HD2  . HIS A 1 66  ? -3.802  17.286  -2.047  1.00 0.00 ? 85  HIS A HD2  3  
ATOM 5822  H HE1  . HIS A 1 66  ? -1.121  16.918  -5.316  1.00 0.00 ? 85  HIS A HE1  3  
ATOM 5823  H HE2  . HIS A 1 66  ? -3.054  18.209  -4.345  1.00 0.00 ? 85  HIS A HE2  3  
ATOM 5824  N N    . VAL A 1 67  ? -0.067  12.576  -2.189  1.00 0.00 ? 86  VAL A N    3  
ATOM 5825  C CA   . VAL A 1 67  ? 1.188   11.903  -1.877  1.00 0.00 ? 86  VAL A CA   3  
ATOM 5826  C C    . VAL A 1 67  ? 1.864   12.541  -0.667  1.00 0.00 ? 86  VAL A C    3  
ATOM 5827  O O    . VAL A 1 67  ? 2.431   13.630  -0.761  1.00 0.00 ? 86  VAL A O    3  
ATOM 5828  C CB   . VAL A 1 67  ? 2.141   11.937  -3.091  1.00 0.00 ? 86  VAL A CB   3  
ATOM 5829  C CG1  . VAL A 1 67  ? 1.905   13.188  -3.919  2.00 0.00 ? 86  VAL A CG1  3  
ATOM 5830  C CG2  . VAL A 1 67  ? 3.599   11.861  -2.664  2.00 0.00 ? 86  VAL A CG2  3  
ATOM 5831  H H    . VAL A 1 67  ? -0.175  13.001  -3.065  1.00 0.00 ? 86  VAL A H    3  
ATOM 5832  H HA   . VAL A 1 67  ? 0.965   10.871  -1.649  1.00 0.00 ? 86  VAL A HA   3  
ATOM 5833  H HB   . VAL A 1 67  ? 1.925   11.077  -3.709  1.00 0.00 ? 86  VAL A HB   3  
ATOM 5834  H HG11 . VAL A 1 67  ? 2.782   13.400  -4.511  1.00 0.00 ? 86  VAL A HG11 3  
ATOM 5835  H HG12 . VAL A 1 67  ? 1.703   14.020  -3.261  1.00 0.00 ? 86  VAL A HG12 3  
ATOM 5836  H HG13 . VAL A 1 67  ? 1.057   13.031  -4.571  1.00 0.00 ? 86  VAL A HG13 3  
ATOM 5837  H HG21 . VAL A 1 67  ? 4.152   11.264  -3.377  1.00 0.00 ? 86  VAL A HG21 3  
ATOM 5838  H HG22 . VAL A 1 67  ? 3.666   11.407  -1.686  1.00 0.00 ? 86  VAL A HG22 3  
ATOM 5839  H HG23 . VAL A 1 67  ? 4.017   12.856  -2.628  1.00 0.00 ? 86  VAL A HG23 3  
ATOM 5840  N N    . VAL A 1 68  ? 1.787   11.859  0.474   1.00 0.00 ? 87  VAL A N    3  
ATOM 5841  C CA   . VAL A 1 68  ? 2.379   12.364  1.708   1.00 0.00 ? 87  VAL A CA   3  
ATOM 5842  C C    . VAL A 1 68  ? 3.467   11.433  2.234   1.00 0.00 ? 87  VAL A C    3  
ATOM 5843  O O    . VAL A 1 68  ? 3.785   10.417  1.618   1.00 0.00 ? 87  VAL A O    3  
ATOM 5844  C CB   . VAL A 1 68  ? 1.311   12.550  2.803   1.00 0.00 ? 87  VAL A CB   3  
ATOM 5845  C CG1  . VAL A 1 68  ? 1.090   11.258  3.577   2.00 0.00 ? 87  VAL A CG1  3  
ATOM 5846  C CG2  . VAL A 1 68  ? 1.707   13.658  3.766   2.00 0.00 ? 87  VAL A CG2  3  
ATOM 5847  H H    . VAL A 1 68  ? 1.314   11.000  0.487   1.00 0.00 ? 87  VAL A H    3  
ATOM 5848  H HA   . VAL A 1 68  ? 2.818   13.328  1.495   1.00 0.00 ? 87  VAL A HA   3  
ATOM 5849  H HB   . VAL A 1 68  ? 0.383   12.828  2.328   1.00 0.00 ? 87  VAL A HB   3  
ATOM 5850  H HG11 . VAL A 1 68  ? 0.324   11.411  4.324   1.00 0.00 ? 87  VAL A HG11 3  
ATOM 5851  H HG12 . VAL A 1 68  ? 2.010   10.966  4.061   1.00 0.00 ? 87  VAL A HG12 3  
ATOM 5852  H HG13 . VAL A 1 68  ? 0.779   10.479  2.897   1.00 0.00 ? 87  VAL A HG13 3  
ATOM 5853  H HG21 . VAL A 1 68  ? 0.820   14.067  4.227   1.00 0.00 ? 87  VAL A HG21 3  
ATOM 5854  H HG22 . VAL A 1 68  ? 2.223   14.437  3.225   1.00 0.00 ? 87  VAL A HG22 3  
ATOM 5855  H HG23 . VAL A 1 68  ? 2.356   13.257  4.529   1.00 0.00 ? 87  VAL A HG23 3  
ATOM 5856  N N    . ILE A 1 69  ? 4.031   11.794  3.384   1.00 0.00 ? 88  ILE A N    3  
ATOM 5857  C CA   . ILE A 1 69  ? 5.082   11.000  4.010   1.00 0.00 ? 88  ILE A CA   3  
ATOM 5858  C C    . ILE A 1 69  ? 4.975   11.059  5.532   1.00 0.00 ? 88  ILE A C    3  
ATOM 5859  O O    . ILE A 1 69  ? 5.038   12.135  6.126   1.00 0.00 ? 88  ILE A O    3  
ATOM 5860  C CB   . ILE A 1 69  ? 6.482   11.490  3.587   1.00 0.00 ? 88  ILE A CB   3  
ATOM 5861  C CG1  . ILE A 1 69  ? 6.943   10.756  2.328   1.00 0.00 ? 88  ILE A CG1  3  
ATOM 5862  C CG2  . ILE A 1 69  ? 7.480   11.295  4.719   1.00 0.00 ? 88  ILE A CG2  3  
ATOM 5863  C CD1  . ILE A 1 69  ? 8.419   10.912  2.030   1.00 0.00 ? 88  ILE A CD1  3  
ATOM 5864  H H    . ILE A 1 69  ? 3.730   12.616  3.823   1.00 0.00 ? 88  ILE A H    3  
ATOM 5865  H HA   . ILE A 1 69  ? 4.966   9.976   3.685   1.00 0.00 ? 88  ILE A HA   3  
ATOM 5866  H HB   . ILE A 1 69  ? 6.419   12.547  3.376   1.00 0.00 ? 88  ILE A HB   3  
ATOM 5867  H HG12 . ILE A 1 69  ? 6.739   9.701   2.440   2.00 0.00 ? 88  ILE A HG12 3  
ATOM 5868  H HG13 . ILE A 1 69  ? 6.393   11.132  1.478   2.00 0.00 ? 88  ILE A HG13 3  
ATOM 5869  H HG21 . ILE A 1 69  ? 8.438   11.698  4.428   1.00 0.00 ? 88  ILE A HG21 3  
ATOM 5870  H HG22 . ILE A 1 69  ? 7.583   10.240  4.930   1.00 0.00 ? 88  ILE A HG22 3  
ATOM 5871  H HG23 . ILE A 1 69  ? 7.127   11.806  5.603   1.00 0.00 ? 88  ILE A HG23 3  
ATOM 5872  H HD11 . ILE A 1 69  ? 8.814   11.742  2.596   1.00 0.00 ? 88  ILE A HD11 3  
ATOM 5873  H HD12 . ILE A 1 69  ? 8.555   11.099  0.975   1.00 0.00 ? 88  ILE A HD12 3  
ATOM 5874  H HD13 . ILE A 1 69  ? 8.939   10.007  2.305   1.00 0.00 ? 88  ILE A HD13 3  
ATOM 5875  N N    . PRO A 1 70  ? 4.815   9.897   6.185   1.00 0.00 ? 89  PRO A N    3  
ATOM 5876  C CA   . PRO A 1 70  ? 4.706   9.823   7.645   1.00 0.00 ? 89  PRO A CA   3  
ATOM 5877  C C    . PRO A 1 70  ? 6.014   10.186  8.335   1.00 0.00 ? 89  PRO A C    3  
ATOM 5878  O O    . PRO A 1 70  ? 7.096   9.931   7.806   1.00 0.00 ? 89  PRO A O    3  
ATOM 5879  C CB   . PRO A 1 70  ? 4.361   8.356   7.895   1.00 0.00 ? 89  PRO A CB   3  
ATOM 5880  C CG   . PRO A 1 70  ? 4.905   7.632   6.716   1.00 0.00 ? 89  PRO A CG   3  
ATOM 5881  C CD   . PRO A 1 70  ? 4.735   8.567   5.549   1.00 0.00 ? 89  PRO A CD   3  
ATOM 5882  H HA   . PRO A 1 70  ? 3.912   10.453  8.017   1.00 0.00 ? 89  PRO A HA   3  
ATOM 5883  H HB2  . PRO A 1 70  ? 4.827   8.025   8.812   2.00 0.00 ? 89  PRO A HB2  3  
ATOM 5884  H HB3  . PRO A 1 70  ? 3.289   8.244   7.970   2.00 0.00 ? 89  PRO A HB3  3  
ATOM 5885  H HG2  . PRO A 1 70  ? 5.950   7.410   6.870   2.00 0.00 ? 89  PRO A HG2  3  
ATOM 5886  H HG3  . PRO A 1 70  ? 4.345   6.723   6.553   2.00 0.00 ? 89  PRO A HG3  3  
ATOM 5887  H HD2  . PRO A 1 70  ? 5.533   8.431   4.834   2.00 0.00 ? 89  PRO A HD2  3  
ATOM 5888  H HD3  . PRO A 1 70  ? 3.771   8.419   5.082   2.00 0.00 ? 89  PRO A HD3  3  
ATOM 5889  N N    . ARG A 1 71  ? 5.912   10.784  9.518   1.00 0.00 ? 90  ARG A N    3  
ATOM 5890  C CA   . ARG A 1 71  ? 7.096   11.180  10.271  1.00 0.00 ? 90  ARG A CA   3  
ATOM 5891  C C    . ARG A 1 71  ? 6.719   11.718  11.648  1.00 0.00 ? 90  ARG A C    3  
ATOM 5892  O O    . ARG A 1 71  ? 7.206   12.768  12.068  1.00 0.00 ? 90  ARG A O    3  
ATOM 5893  C CB   . ARG A 1 71  ? 7.884   12.239  9.497   1.00 0.00 ? 90  ARG A CB   3  
ATOM 5894  C CG   . ARG A 1 71  ? 9.271   11.804  9.047   1.00 0.00 ? 90  ARG A CG   3  
ATOM 5895  C CD   . ARG A 1 71  ? 9.415   11.856  7.534   1.00 0.00 ? 90  ARG A CD   3  
ATOM 5896  N NE   . ARG A 1 71  ? 9.018   13.152  6.992   1.00 0.00 ? 90  ARG A NE   3  
ATOM 5897  C CZ   . ARG A 1 71  ? 9.830   13.935  6.290   4.00 0.00 ? 90  ARG A CZ   3  
ATOM 5898  N NH1  . ARG A 1 71  ? 11.078  13.562  6.044   5.00 0.00 ? 90  ARG A NH1  3  
ATOM 5899  N NH2  . ARG A 1 71  ? 9.400   15.102  5.826   5.00 0.00 ? 90  ARG A NH2  3  
ATOM 5900  H H    . ARG A 1 71  ? 5.024   10.962  9.891   1.00 0.00 ? 90  ARG A H    3  
ATOM 5901  H HA   . ARG A 1 71  ? 7.715   10.306  10.399  1.00 0.00 ? 90  ARG A HA   3  
ATOM 5902  H HB2  . ARG A 1 71  ? 7.320   12.515  8.618   2.00 0.00 ? 90  ARG A HB2  3  
ATOM 5903  H HB3  . ARG A 1 71  ? 7.994   13.112  10.122  2.00 0.00 ? 90  ARG A HB3  3  
ATOM 5904  H HG2  . ARG A 1 71  ? 10.003  12.462  9.491   2.00 0.00 ? 90  ARG A HG2  3  
ATOM 5905  H HG3  . ARG A 1 71  ? 9.445   10.792  9.381   2.00 0.00 ? 90  ARG A HG3  3  
ATOM 5906  H HD2  . ARG A 1 71  ? 10.447  11.670  7.278   2.00 0.00 ? 90  ARG A HD2  3  
ATOM 5907  H HD3  . ARG A 1 71  ? 8.793   11.087  7.100   2.00 0.00 ? 90  ARG A HD3  3  
ATOM 5908  H HE   . ARG A 1 71  ? 8.101   13.452  7.160   1.00 0.00 ? 90  ARG A HE   3  
ATOM 5909  H HH11 . ARG A 1 71  ? 11.414  12.685  6.389   5.00 0.00 ? 90  ARG A HH11 3  
ATOM 5910  H HH12 . ARG A 1 71  ? 11.683  14.155  5.515   5.00 0.00 ? 90  ARG A HH12 3  
ATOM 5911  H HH21 . ARG A 1 71  ? 8.461   15.395  6.005   5.00 0.00 ? 90  ARG A HH21 3  
ATOM 5912  H HH22 . ARG A 1 71  ? 10.016  15.687  5.299   5.00 0.00 ? 90  ARG A HH22 3  
ATOM 5913  N N    . ILE A 1 72  ? 5.851   10.994  12.350  1.00 0.00 ? 91  ILE A N    3  
ATOM 5914  C CA   . ILE A 1 72  ? 5.418   11.405  13.679  1.00 0.00 ? 91  ILE A CA   3  
ATOM 5915  C C    . ILE A 1 72  ? 6.616   11.678  14.585  1.00 0.00 ? 91  ILE A C    3  
ATOM 5916  O O    . ILE A 1 72  ? 6.509   12.412  15.568  1.00 0.00 ? 91  ILE A O    3  
ATOM 5917  C CB   . ILE A 1 72  ? 4.526   10.335  14.336  1.00 0.00 ? 91  ILE A CB   3  
ATOM 5918  C CG1  . ILE A 1 72  ? 3.769   10.930  15.524  1.00 0.00 ? 91  ILE A CG1  3  
ATOM 5919  C CG2  . ILE A 1 72  ? 5.362   9.142   14.776  1.00 0.00 ? 91  ILE A CG2  3  
ATOM 5920  C CD1  . ILE A 1 72  ? 2.359   10.403  15.674  1.00 0.00 ? 91  ILE A CD1  3  
ATOM 5921  H H    . ILE A 1 72  ? 5.495   10.165  11.967  1.00 0.00 ? 91  ILE A H    3  
ATOM 5922  H HA   . ILE A 1 72  ? 4.841   12.313  13.577  1.00 0.00 ? 91  ILE A HA   3  
ATOM 5923  H HB   . ILE A 1 72  ? 3.814   9.992   13.601  1.00 0.00 ? 91  ILE A HB   3  
ATOM 5924  H HG12 . ILE A 1 72  ? 4.306   10.704  16.434  2.00 0.00 ? 91  ILE A HG12 3  
ATOM 5925  H HG13 . ILE A 1 72  ? 3.712   12.001  15.406  2.00 0.00 ? 91  ILE A HG13 3  
ATOM 5926  H HG21 . ILE A 1 72  ? 6.296   9.137   14.234  1.00 0.00 ? 91  ILE A HG21 3  
ATOM 5927  H HG22 . ILE A 1 72  ? 4.823   8.229   14.571  1.00 0.00 ? 91  ILE A HG22 3  
ATOM 5928  H HG23 . ILE A 1 72  ? 5.561   9.212   15.835  1.00 0.00 ? 91  ILE A HG23 3  
ATOM 5929  H HD11 . ILE A 1 72  ? 1.958   10.714  16.628  1.00 0.00 ? 91  ILE A HD11 3  
ATOM 5930  H HD12 . ILE A 1 72  ? 2.372   9.323   15.623  1.00 0.00 ? 91  ILE A HD12 3  
ATOM 5931  H HD13 . ILE A 1 72  ? 1.743   10.794  14.879  1.00 0.00 ? 91  ILE A HD13 3  
ATOM 5932  N N    . HIS A 1 73  ? 7.754   11.081  14.247  1.00 0.00 ? 92  HIS A N    3  
ATOM 5933  C CA   . HIS A 1 73  ? 8.974   11.258  15.029  1.00 0.00 ? 92  HIS A CA   3  
ATOM 5934  C C    . HIS A 1 73  ? 10.139  11.675  14.134  1.00 0.00 ? 92  HIS A C    3  
ATOM 5935  O O    . HIS A 1 73  ? 10.106  11.472  12.920  1.00 0.00 ? 92  HIS A O    3  
ATOM 5936  C CB   . HIS A 1 73  ? 9.320   9.965   15.768  1.00 0.00 ? 92  HIS A CB   3  
ATOM 5937  C CG   . HIS A 1 73  ? 8.722   9.860   17.136  1.00 0.00 ? 92  HIS A CG   3  
ATOM 5938  N ND1  . HIS A 1 73  ? 7.682   9.006   17.441  1.00 0.00 ? 92  HIS A ND1  3  
ATOM 5939  C CD2  . HIS A 1 73  ? 9.022   10.508  18.287  1.00 0.00 ? 92  HIS A CD2  3  
ATOM 5940  C CE1  . HIS A 1 73  ? 7.368   9.135   18.718  1.00 0.00 ? 92  HIS A CE1  3  
ATOM 5941  N NE2  . HIS A 1 73  ? 8.167   10.040  19.254  1.00 0.00 ? 92  HIS A NE2  3  
ATOM 5942  H H    . HIS A 1 73  ? 7.776   10.507  13.452  1.00 0.00 ? 92  HIS A H    3  
ATOM 5943  H HA   . HIS A 1 73  ? 8.793   12.039  15.752  1.00 0.00 ? 92  HIS A HA   3  
ATOM 5944  H HB2  . HIS A 1 73  ? 8.967   9.123   15.189  2.00 0.00 ? 92  HIS A HB2  3  
ATOM 5945  H HB3  . HIS A 1 73  ? 10.392  9.895   15.871  2.00 0.00 ? 92  HIS A HB3  3  
ATOM 5946  H HD1  . HIS A 1 73  ? 7.239   8.398   16.814  1.00 0.00 ? 92  HIS A HD1  3  
ATOM 5947  H HD2  . HIS A 1 73  ? 9.792   11.256  18.419  1.00 0.00 ? 92  HIS A HD2  3  
ATOM 5948  H HE1  . HIS A 1 73  ? 6.592   8.592   19.235  1.00 0.00 ? 92  HIS A HE1  3  
ATOM 5949  H HE2  . HIS A 1 73  ? 8.090   10.393  20.165  1.00 0.00 ? 92  HIS A HE2  3  
ATOM 5950  N N    . PRO A 1 74  ? 11.187  12.268  14.729  1.00 0.00 ? 93  PRO A N    3  
ATOM 5951  C CA   . PRO A 1 74  ? 12.368  12.720  13.987  1.00 0.00 ? 93  PRO A CA   3  
ATOM 5952  C C    . PRO A 1 74  ? 13.259  11.563  13.544  1.00 0.00 ? 93  PRO A C    3  
ATOM 5953  O O    . PRO A 1 74  ? 14.478  11.710  13.444  1.00 0.00 ? 93  PRO A O    3  
ATOM 5954  C CB   . PRO A 1 74  ? 13.098  13.596  15.002  1.00 0.00 ? 93  PRO A CB   3  
ATOM 5955  C CG   . PRO A 1 74  ? 12.711  13.041  16.328  1.00 0.00 ? 93  PRO A CG   3  
ATOM 5956  C CD   . PRO A 1 74  ? 11.295  12.550  16.175  1.00 0.00 ? 93  PRO A CD   3  
ATOM 5957  H HA   . PRO A 1 74  ? 12.093  13.312  13.127  1.00 0.00 ? 93  PRO A HA   3  
ATOM 5958  H HB2  . PRO A 1 74  ? 14.164  13.528  14.840  2.00 0.00 ? 93  PRO A HB2  3  
ATOM 5959  H HB3  . PRO A 1 74  ? 12.777  14.622  14.893  2.00 0.00 ? 93  PRO A HB3  3  
ATOM 5960  H HG2  . PRO A 1 74  ? 13.365  12.224  16.590  2.00 0.00 ? 93  PRO A HG2  3  
ATOM 5961  H HG3  . PRO A 1 74  ? 12.759  13.817  17.078  2.00 0.00 ? 93  PRO A HG3  3  
ATOM 5962  H HD2  . PRO A 1 74  ? 11.144  11.650  16.755  2.00 0.00 ? 93  PRO A HD2  3  
ATOM 5963  H HD3  . PRO A 1 74  ? 10.595  13.317  16.472  2.00 0.00 ? 93  PRO A HD3  3  
ATOM 5964  N N    . ASN A 1 75  ? 12.647  10.413  13.280  1.00 0.00 ? 94  ASN A N    3  
ATOM 5965  C CA   . ASN A 1 75  ? 13.388  9.235   12.847  1.00 0.00 ? 94  ASN A CA   3  
ATOM 5966  C C    . ASN A 1 75  ? 13.353  9.094   11.329  1.00 0.00 ? 94  ASN A C    3  
ATOM 5967  O O    . ASN A 1 75  ? 12.567  8.317   10.786  1.00 0.00 ? 94  ASN A O    3  
ATOM 5968  C CB   . ASN A 1 75  ? 12.815  7.977   13.501  1.00 0.00 ? 94  ASN A CB   3  
ATOM 5969  C CG   . ASN A 1 75  ? 11.313  8.050   13.694  1.00 0.00 ? 94  ASN A CG   3  
ATOM 5970  O OD1  . ASN A 1 75  ? 10.774  7.535   14.674  1.00 0.00 ? 94  ASN A OD1  3  
ATOM 5971  N ND2  . ASN A 1 75  ? 10.625  8.693   12.756  4.00 0.00 ? 94  ASN A ND2  3  
ATOM 5972  H H    . ASN A 1 75  ? 11.675  10.357  13.377  1.00 0.00 ? 94  ASN A H    3  
ATOM 5973  H HA   . ASN A 1 75  ? 14.413  9.357   13.162  1.00 0.00 ? 94  ASN A HA   3  
ATOM 5974  H HB2  . ASN A 1 75  ? 13.036  7.123   12.878  2.00 0.00 ? 94  ASN A HB2  3  
ATOM 5975  H HB3  . ASN A 1 75  ? 13.276  7.840   14.468  2.00 0.00 ? 94  ASN A HB3  3  
ATOM 5976  H HD21 . ASN A 1 75  ? 11.121  9.079   12.000  5.00 0.00 ? 94  ASN A HD21 3  
ATOM 5977  H HD22 . ASN A 1 75  ? 9.649   8.755   12.857  5.00 0.00 ? 94  ASN A HD22 3  
ATOM 5978  N N    . SER A 1 76  ? 14.210  9.852   10.649  1.00 0.00 ? 95  SER A N    3  
ATOM 5979  C CA   . SER A 1 76  ? 14.278  9.813   9.192   1.00 0.00 ? 95  SER A CA   3  
ATOM 5980  C C    . SER A 1 76  ? 14.379  8.378   8.687   1.00 0.00 ? 95  SER A C    3  
ATOM 5981  O O    . SER A 1 76  ? 15.015  7.532   9.315   1.00 0.00 ? 95  SER A O    3  
ATOM 5982  C CB   . SER A 1 76  ? 15.477  10.625  8.696   1.00 0.00 ? 95  SER A CB   3  
ATOM 5983  O OG   . SER A 1 76  ? 16.202  11.180  9.780   1.00 0.00 ? 95  SER A OG   3  
ATOM 5984  H H    . SER A 1 76  ? 14.811  10.452  11.140  1.00 0.00 ? 95  SER A H    3  
ATOM 5985  H HA   . SER A 1 76  ? 13.372  10.256  8.807   1.00 0.00 ? 95  SER A HA   3  
ATOM 5986  H HB2  . SER A 1 76  ? 16.134  9.982   8.130   2.00 0.00 ? 95  SER A HB2  3  
ATOM 5987  H HB3  . SER A 1 76  ? 15.128  11.428  8.063   2.00 0.00 ? 95  SER A HB3  3  
ATOM 5988  H HG   . SER A 1 76  ? 15.630  11.767  10.280  1.00 0.00 ? 95  SER A HG   3  
ATOM 5989  N N    . ILE A 1 77  ? 13.746  8.110   7.549   1.00 0.00 ? 96  ILE A N    3  
ATOM 5990  C CA   . ILE A 1 77  ? 13.764  6.776   6.960   1.00 0.00 ? 96  ILE A CA   3  
ATOM 5991  C C    . ILE A 1 77  ? 14.127  6.830   5.479   1.00 0.00 ? 96  ILE A C    3  
ATOM 5992  O O    . ILE A 1 77  ? 15.272  6.585   5.102   1.00 0.00 ? 96  ILE A O    3  
ATOM 5993  C CB   . ILE A 1 77  ? 12.403  6.072   7.119   1.00 0.00 ? 96  ILE A CB   3  
ATOM 5994  C CG1  . ILE A 1 77  ? 11.991  6.033   8.592   1.00 0.00 ? 96  ILE A CG1  3  
ATOM 5995  C CG2  . ILE A 1 77  ? 12.462  4.666   6.540   1.00 0.00 ? 96  ILE A CG2  3  
ATOM 5996  C CD1  . ILE A 1 77  ? 12.928  5.236   9.473   1.00 0.00 ? 96  ILE A CD1  3  
ATOM 5997  H H    . ILE A 1 77  ? 13.255  8.827   7.095   1.00 0.00 ? 96  ILE A H    3  
ATOM 5998  H HA   . ILE A 1 77  ? 14.509  6.194   7.481   1.00 0.00 ? 96  ILE A HA   3  
ATOM 5999  H HB   . ILE A 1 77  ? 11.666  6.632   6.561   1.00 0.00 ? 96  ILE A HB   3  
ATOM 6000  H HG12 . ILE A 1 77  ? 11.956  7.044   8.976   2.00 0.00 ? 96  ILE A HG12 3  
ATOM 6001  H HG13 . ILE A 1 77  ? 11.006  5.591   8.671   2.00 0.00 ? 96  ILE A HG13 3  
ATOM 6002  H HG21 . ILE A 1 77  ? 12.228  4.700   5.487   1.00 0.00 ? 96  ILE A HG21 3  
ATOM 6003  H HG22 . ILE A 1 77  ? 11.745  4.038   7.048   1.00 0.00 ? 96  ILE A HG22 3  
ATOM 6004  H HG23 . ILE A 1 77  ? 13.454  4.262   6.677   1.00 0.00 ? 96  ILE A HG23 3  
ATOM 6005  H HD11 . ILE A 1 77  ? 13.363  5.887   10.217  1.00 0.00 ? 96  ILE A HD11 3  
ATOM 6006  H HD12 . ILE A 1 77  ? 13.712  4.805   8.867   1.00 0.00 ? 96  ILE A HD12 3  
ATOM 6007  H HD13 . ILE A 1 77  ? 12.377  4.446   9.963   1.00 0.00 ? 96  ILE A HD13 3  
ATOM 6008  N N    . CYS A 1 78  ? 13.142  7.149   4.644   1.00 0.00 ? 97  CYS A N    3  
ATOM 6009  C CA   . CYS A 1 78  ? 13.360  7.232   3.203   1.00 0.00 ? 97  CYS A CA   3  
ATOM 6010  C C    . CYS A 1 78  ? 13.414  8.685   2.739   1.00 0.00 ? 97  CYS A C    3  
ATOM 6011  O O    . CYS A 1 78  ? 14.170  9.027   1.831   1.00 0.00 ? 97  CYS A O    3  
ATOM 6012  C CB   . CYS A 1 78  ? 12.252  6.487   2.454   1.00 0.00 ? 97  CYS A CB   3  
ATOM 6013  S SG   . CYS A 1 78  ? 12.092  4.730   2.915   1.00 0.00 ? 97  CYS A SG   3  
ATOM 6014  H H    . CYS A 1 78  ? 12.249  7.333   5.004   1.00 0.00 ? 97  CYS A H    3  
ATOM 6015  H HA   . CYS A 1 78  ? 14.308  6.762   2.985   1.00 0.00 ? 97  CYS A HA   3  
ATOM 6016  H HB2  . CYS A 1 78  ? 11.306  6.966   2.656   2.00 0.00 ? 97  CYS A HB2  3  
ATOM 6017  H HB3  . CYS A 1 78  ? 12.453  6.531   1.394   2.00 0.00 ? 97  CYS A HB3  3  
ATOM 6018  N N    . ALA A 1 79  ? 12.606  9.533   3.367   1.00 0.00 ? 98  ALA A N    3  
ATOM 6019  C CA   . ALA A 1 79  ? 12.563  10.948  3.015   1.00 0.00 ? 98  ALA A CA   3  
ATOM 6020  C C    . ALA A 1 79  ? 13.891  11.631  3.325   1.00 0.00 ? 98  ALA A C    3  
ATOM 6021  O O    . ALA A 1 79  ? 14.821  11.592  2.519   1.00 0.00 ? 98  ALA A O    3  
ATOM 6022  C CB   . ALA A 1 79  ? 11.423  11.642  3.745   1.00 0.00 ? 98  ALA A CB   3  
ATOM 6023  H H    . ALA A 1 79  ? 12.025  9.201   4.083   1.00 0.00 ? 98  ALA A H    3  
ATOM 6024  H HA   . ALA A 1 79  ? 12.375  11.019  1.953   1.00 0.00 ? 98  ALA A HA   3  
ATOM 6025  H HB1  . ALA A 1 79  ? 11.176  11.087  4.638   1.00 0.00 ? 98  ALA A HB1  3  
ATOM 6026  H HB2  . ALA A 1 79  ? 10.557  11.688  3.100   1.00 0.00 ? 98  ALA A HB2  3  
ATOM 6027  H HB3  . ALA A 1 79  ? 11.724  12.643  4.015   1.00 0.00 ? 98  ALA A HB3  3  
ATOM 6028  N N    . ALA A 1 80  ? 13.973  12.255  4.497   1.00 0.00 ? 99  ALA A N    3  
ATOM 6029  C CA   . ALA A 1 80  ? 15.190  12.945  4.911   1.00 0.00 ? 99  ALA A CA   3  
ATOM 6030  C C    . ALA A 1 80  ? 14.997  13.654  6.247   1.00 0.00 ? 99  ALA A C    3  
ATOM 6031  O O    . ALA A 1 80  ? 15.664  13.336  7.231   1.00 0.00 ? 99  ALA A O    3  
ATOM 6032  C CB   . ALA A 1 80  ? 15.621  13.942  3.844   1.00 0.00 ? 99  ALA A CB   3  
ATOM 6033  H H    . ALA A 1 80  ? 13.199  12.250  5.097   1.00 0.00 ? 99  ALA A H    3  
ATOM 6034  H HA   . ALA A 1 80  ? 15.972  12.208  5.016   1.00 0.00 ? 99  ALA A HA   3  
ATOM 6035  H HB1  . ALA A 1 80  ? 14.801  14.119  3.165   1.00 0.00 ? 99  ALA A HB1  3  
ATOM 6036  H HB2  . ALA A 1 80  ? 16.462  13.543  3.297   1.00 0.00 ? 99  ALA A HB2  3  
ATOM 6037  H HB3  . ALA A 1 80  ? 15.907  14.871  4.315   1.00 0.00 ? 99  ALA A HB3  3  
ATOM 6038  N N    . ASN A 1 81  ? 14.085  14.620  6.273   1.00 0.00 ? 100 ASN A N    3  
ATOM 6039  C CA   . ASN A 1 81  ? 13.809  15.379  7.489   1.00 0.00 ? 100 ASN A CA   3  
ATOM 6040  C C    . ASN A 1 81  ? 12.659  14.758  8.276   1.00 0.00 ? 100 ASN A C    3  
ATOM 6041  O O    . ASN A 1 81  ? 12.761  13.627  8.753   1.00 0.00 ? 100 ASN A O    3  
ATOM 6042  C CB   . ASN A 1 81  ? 13.484  16.833  7.142   1.00 0.00 ? 100 ASN A CB   3  
ATOM 6043  C CG   . ASN A 1 81  ? 14.702  17.608  6.680   1.00 0.00 ? 100 ASN A CG   3  
ATOM 6044  O OD1  . ASN A 1 81  ? 15.214  18.469  7.395   1.00 0.00 ? 100 ASN A OD1  3  
ATOM 6045  N ND2  . ASN A 1 81  ? 15.173  17.305  5.476   4.00 0.00 ? 100 ASN A ND2  3  
ATOM 6046  H H    . ASN A 1 81  ? 13.588  14.831  5.456   1.00 0.00 ? 100 ASN A H    3  
ATOM 6047  H HA   . ASN A 1 81  ? 14.700  15.357  8.100   1.00 0.00 ? 100 ASN A HA   3  
ATOM 6048  H HB2  . ASN A 1 81  ? 12.747  16.852  6.353   2.00 0.00 ? 100 ASN A HB2  3  
ATOM 6049  H HB3  . ASN A 1 81  ? 13.080  17.323  8.016   2.00 0.00 ? 100 ASN A HB3  3  
ATOM 6050  H HD21 . ASN A 1 81  ? 14.714  16.606  4.958   5.00 0.00 ? 100 ASN A HD21 3  
ATOM 6051  H HD22 . ASN A 1 81  ? 15.964  17.792  5.150   5.00 0.00 ? 100 ASN A HD22 3  
ATOM 6052  N N    . ASN A 1 82  ? 11.567  15.507  8.412   1.00 0.00 ? 101 ASN A N    3  
ATOM 6053  C CA   . ASN A 1 82  ? 10.397  15.034  9.145   1.00 0.00 ? 101 ASN A CA   3  
ATOM 6054  C C    . ASN A 1 82  ? 9.340   16.132  9.243   1.00 0.00 ? 101 ASN A C    3  
ATOM 6055  O O    . ASN A 1 82  ? 9.668   17.317  9.311   1.00 0.00 ? 101 ASN A O    3  
ATOM 6056  C CB   . ASN A 1 82  ? 10.797  14.574  10.548  1.00 0.00 ? 101 ASN A CB   3  
ATOM 6057  C CG   . ASN A 1 82  ? 11.426  15.680  11.370  1.00 0.00 ? 101 ASN A CG   3  
ATOM 6058  O OD1  . ASN A 1 82  ? 12.581  16.048  11.157  1.00 0.00 ? 101 ASN A OD1  3  
ATOM 6059  N ND2  . ASN A 1 82  ? 10.667  16.218  12.318  4.00 0.00 ? 101 ASN A ND2  3  
ATOM 6060  H H    . ASN A 1 82  ? 11.548  16.399  8.009   1.00 0.00 ? 101 ASN A H    3  
ATOM 6061  H HA   . ASN A 1 82  ? 9.981   14.199  8.604   1.00 0.00 ? 101 ASN A HA   3  
ATOM 6062  H HB2  . ASN A 1 82  ? 9.918   14.221  11.067  2.00 0.00 ? 101 ASN A HB2  3  
ATOM 6063  H HB3  . ASN A 1 82  ? 11.508  13.765  10.464  2.00 0.00 ? 101 ASN A HB3  3  
ATOM 6064  H HD21 . ASN A 1 82  ? 9.753   15.874  12.433  5.00 0.00 ? 101 ASN A HD21 3  
ATOM 6065  H HD22 . ASN A 1 82  ? 11.050  16.938  12.867  5.00 0.00 ? 101 ASN A HD22 3  
ATOM 6066  N N    . THR A 1 83  ? 8.073   15.730  9.252   1.00 0.00 ? 102 THR A N    3  
ATOM 6067  C CA   . THR A 1 83  ? 6.971   16.681  9.343   1.00 0.00 ? 102 THR A CA   3  
ATOM 6068  C C    . THR A 1 83  ? 5.646   15.968  9.581   1.00 0.00 ? 102 THR A C    3  
ATOM 6069  O O    . THR A 1 83  ? 4.638   16.600  9.900   1.00 0.00 ? 102 THR A O    3  
ATOM 6070  C CB   . THR A 1 83  ? 6.857   17.533  8.065   1.00 0.00 ? 102 THR A CB   3  
ATOM 6071  O OG1  . THR A 1 83  ? 7.717   17.010  7.046   1.00 0.00 ? 102 THR A OG1  3  
ATOM 6072  C CG2  . THR A 1 83  ? 7.222   18.983  8.347   1.00 0.00 ? 102 THR A CG2  3  
ATOM 6073  H H    . THR A 1 83  ? 7.874   14.772  9.195   1.00 0.00 ? 102 THR A H    3  
ATOM 6074  H HA   . THR A 1 83  ? 7.169   17.341  10.174  1.00 0.00 ? 102 THR A HA   3  
ATOM 6075  H HB   . THR A 1 83  ? 5.834   17.497  7.717   1.00 0.00 ? 102 THR A HB   3  
ATOM 6076  H HG1  . THR A 1 83  ? 7.544   16.073  6.931   1.00 0.00 ? 102 THR A HG1  3  
ATOM 6077  H HG21 . THR A 1 83  ? 8.029   19.284  7.696   1.00 0.00 ? 102 THR A HG21 3  
ATOM 6078  H HG22 . THR A 1 83  ? 7.534   19.081  9.376   1.00 0.00 ? 102 THR A HG22 3  
ATOM 6079  H HG23 . THR A 1 83  ? 6.362   19.611  8.171   1.00 0.00 ? 102 THR A HG23 3  
ATOM 6080  N N    . GLY A 1 84  ? 5.651   14.648  9.425   1.00 0.00 ? 103 GLY A N    3  
ATOM 6081  C CA   . GLY A 1 84  ? 4.441   13.872  9.627   1.00 0.00 ? 103 GLY A CA   3  
ATOM 6082  C C    . GLY A 1 84  ? 3.514   13.909  8.428   1.00 0.00 ? 103 GLY A C    3  
ATOM 6083  O O    . GLY A 1 84  ? 2.808   12.938  8.151   1.00 0.00 ? 103 GLY A O    3  
ATOM 6084  H H    . GLY A 1 84  ? 6.482   14.197  9.170   1.00 0.00 ? 103 GLY A H    3  
ATOM 6085  H HA2  . GLY A 1 84  ? 4.714   12.844  9.824   2.00 0.00 ? 103 GLY A HA2  3  
ATOM 6086  H HA3  . GLY A 1 84  ? 3.915   14.265  10.486  2.00 0.00 ? 103 GLY A HA3  3  
ATOM 6087  N N    . VAL A 1 85  ? 3.515   15.030  7.716   1.00 0.00 ? 104 VAL A N    3  
ATOM 6088  C CA   . VAL A 1 85  ? 2.669   15.191  6.539   1.00 0.00 ? 104 VAL A CA   3  
ATOM 6089  C C    . VAL A 1 85  ? 3.473   15.723  5.355   1.00 0.00 ? 104 VAL A C    3  
ATOM 6090  O O    . VAL A 1 85  ? 3.056   16.662  4.676   1.00 0.00 ? 104 VAL A O    3  
ATOM 6091  C CB   . VAL A 1 85  ? 1.487   16.139  6.824   1.00 0.00 ? 104 VAL A CB   3  
ATOM 6092  C CG1  . VAL A 1 85  ? 1.975   17.552  7.106   2.00 0.00 ? 104 VAL A CG1  3  
ATOM 6093  C CG2  . VAL A 1 85  ? 0.502   16.145  5.663   2.00 0.00 ? 104 VAL A CG2  3  
ATOM 6094  H H    . VAL A 1 85  ? 4.100   15.768  7.987   1.00 0.00 ? 104 VAL A H    3  
ATOM 6095  H HA   . VAL A 1 85  ? 2.271   14.220  6.282   1.00 0.00 ? 104 VAL A HA   3  
ATOM 6096  H HB   . VAL A 1 85  ? 0.973   15.775  7.701   1.00 0.00 ? 104 VAL A HB   3  
ATOM 6097  H HG11 . VAL A 1 85  ? 2.411   17.968  6.210   1.00 0.00 ? 104 VAL A HG11 3  
ATOM 6098  H HG12 . VAL A 1 85  ? 2.718   17.525  7.890   1.00 0.00 ? 104 VAL A HG12 3  
ATOM 6099  H HG13 . VAL A 1 85  ? 1.143   18.164  7.420   1.00 0.00 ? 104 VAL A HG13 3  
ATOM 6100  H HG21 . VAL A 1 85  ? -0.501  16.275  6.041   1.00 0.00 ? 104 VAL A HG21 3  
ATOM 6101  H HG22 . VAL A 1 85  ? 0.568   15.209  5.129   1.00 0.00 ? 104 VAL A HG22 3  
ATOM 6102  H HG23 . VAL A 1 85  ? 0.742   16.959  4.993   1.00 0.00 ? 104 VAL A HG23 3  
ATOM 6103  N N    . TYR A 1 86  ? 4.629   15.113  5.112   1.00 0.00 ? 105 TYR A N    3  
ATOM 6104  C CA   . TYR A 1 86  ? 5.493   15.521  4.010   1.00 0.00 ? 105 TYR A CA   3  
ATOM 6105  C C    . TYR A 1 86  ? 4.838   15.218  2.666   1.00 0.00 ? 105 TYR A C    3  
ATOM 6106  O O    . TYR A 1 86  ? 4.682   14.058  2.289   1.00 0.00 ? 105 TYR A O    3  
ATOM 6107  C CB   . TYR A 1 86  ? 6.844   14.807  4.105   1.00 0.00 ? 105 TYR A CB   3  
ATOM 6108  C CG   . TYR A 1 86  ? 7.768   15.051  2.933   1.00 0.00 ? 105 TYR A CG   3  
ATOM 6109  C CD1  . TYR A 1 86  ? 7.721   14.240  1.805   1.00 0.00 ? 105 TYR A CD1  3  
ATOM 6110  C CD2  . TYR A 1 86  ? 8.688   16.091  2.956   1.00 0.00 ? 105 TYR A CD2  3  
ATOM 6111  C CE1  . TYR A 1 86  ? 8.566   14.461  0.733   1.00 0.00 ? 105 TYR A CE1  3  
ATOM 6112  C CE2  . TYR A 1 86  ? 9.535   16.318  1.888   1.00 0.00 ? 105 TYR A CE2  3  
ATOM 6113  C CZ   . TYR A 1 86  ? 9.470   15.500  0.780   1.00 0.00 ? 105 TYR A CZ   3  
ATOM 6114  O OH   . TYR A 1 86  ? 10.312  15.723  -0.286  1.00 0.00 ? 105 TYR A OH   3  
ATOM 6115  H H    . TYR A 1 86  ? 4.906   14.370  5.687   1.00 0.00 ? 105 TYR A H    3  
ATOM 6116  H HA   . TYR A 1 86  ? 5.652   16.586  4.088   1.00 0.00 ? 105 TYR A HA   3  
ATOM 6117  H HB2  . TYR A 1 86  ? 7.352   15.138  4.999   2.00 0.00 ? 105 TYR A HB2  3  
ATOM 6118  H HB3  . TYR A 1 86  ? 6.673   13.744  4.174   2.00 0.00 ? 105 TYR A HB3  3  
ATOM 6119  H HD1  . TYR A 1 86  ? 7.011   13.426  1.770   1.00 0.00 ? 105 TYR A HD1  3  
ATOM 6120  H HD2  . TYR A 1 86  ? 8.738   16.730  3.826   1.00 0.00 ? 105 TYR A HD2  3  
ATOM 6121  H HE1  . TYR A 1 86  ? 8.515   13.820  -0.134  1.00 0.00 ? 105 TYR A HE1  3  
ATOM 6122  H HE2  . TYR A 1 86  ? 10.244  17.133  1.925   1.00 0.00 ? 105 TYR A HE2  3  
ATOM 6123  H HH   . TYR A 1 86  ? 9.846   15.547  -1.105  1.00 0.00 ? 105 TYR A HH   3  
ATOM 6124  N N    . ILE A 1 87  ? 4.459   16.270  1.947   1.00 0.00 ? 106 ILE A N    3  
ATOM 6125  C CA   . ILE A 1 87  ? 3.822   16.115  0.644   1.00 0.00 ? 106 ILE A CA   3  
ATOM 6126  C C    . ILE A 1 87  ? 4.815   16.362  -0.486  1.00 0.00 ? 106 ILE A C    3  
ATOM 6127  O O    . ILE A 1 87  ? 5.729   17.178  -0.356  1.00 0.00 ? 106 ILE A O    3  
ATOM 6128  C CB   . ILE A 1 87  ? 2.628   17.078  0.485   1.00 0.00 ? 106 ILE A CB   3  
ATOM 6129  C CG1  . ILE A 1 87  ? 1.471   16.645  1.390   1.00 0.00 ? 106 ILE A CG1  3  
ATOM 6130  C CG2  . ILE A 1 87  ? 2.178   17.134  -0.969  1.00 0.00 ? 106 ILE A CG2  3  
ATOM 6131  C CD1  . ILE A 1 87  ? 0.784   15.375  0.936   1.00 0.00 ? 106 ILE A CD1  3  
ATOM 6132  H H    . ILE A 1 87  ? 4.610   17.171  2.300   1.00 0.00 ? 106 ILE A H    3  
ATOM 6133  H HA   . ILE A 1 87  ? 3.454   15.102  0.571   1.00 0.00 ? 106 ILE A HA   3  
ATOM 6134  H HB   . ILE A 1 87  ? 2.951   18.066  0.774   1.00 0.00 ? 106 ILE A HB   3  
ATOM 6135  H HG12 . ILE A 1 87  ? 1.847   16.480  2.389   2.00 0.00 ? 106 ILE A HG12 3  
ATOM 6136  H HG13 . ILE A 1 87  ? 0.731   17.431  1.416   2.00 0.00 ? 106 ILE A HG13 3  
ATOM 6137  H HG21 . ILE A 1 87  ? 2.889   17.710  -1.543  1.00 0.00 ? 106 ILE A HG21 3  
ATOM 6138  H HG22 . ILE A 1 87  ? 1.207   17.601  -1.027  1.00 0.00 ? 106 ILE A HG22 3  
ATOM 6139  H HG23 . ILE A 1 87  ? 2.120   16.132  -1.368  1.00 0.00 ? 106 ILE A HG23 3  
ATOM 6140  H HD11 . ILE A 1 87  ? 1.515   14.587  0.834   1.00 0.00 ? 106 ILE A HD11 3  
ATOM 6141  H HD12 . ILE A 1 87  ? 0.303   15.546  -0.016  1.00 0.00 ? 106 ILE A HD12 3  
ATOM 6142  H HD13 . ILE A 1 87  ? 0.043   15.086  1.667   1.00 0.00 ? 106 ILE A HD13 3  
ATOM 6143  N N    . LEU A 1 88  ? 4.629   15.655  -1.596  1.00 0.00 ? 107 LEU A N    3  
ATOM 6144  C CA   . LEU A 1 88  ? 5.508   15.797  -2.751  1.00 0.00 ? 107 LEU A CA   3  
ATOM 6145  C C    . LEU A 1 88  ? 4.834   16.621  -3.845  1.00 0.00 ? 107 LEU A C    3  
ATOM 6146  O O    . LEU A 1 88  ? 3.864   16.179  -4.459  1.00 0.00 ? 107 LEU A O    3  
ATOM 6147  C CB   . LEU A 1 88  ? 5.895   14.420  -3.295  1.00 0.00 ? 107 LEU A CB   3  
ATOM 6148  C CG   . LEU A 1 88  ? 6.271   14.380  -4.778  1.00 0.00 ? 107 LEU A CG   3  
ATOM 6149  C CD1  . LEU A 1 88  ? 7.726   13.974  -4.952  2.00 0.00 ? 107 LEU A CD1  3  
ATOM 6150  C CD2  . LEU A 1 88  ? 5.360   13.425  -5.534  2.00 0.00 ? 107 LEU A CD2  3  
ATOM 6151  H H    . LEU A 1 88  ? 3.882   15.022  -1.639  1.00 0.00 ? 107 LEU A H    3  
ATOM 6152  H HA   . LEU A 1 88  ? 6.400   16.311  -2.427  1.00 0.00 ? 107 LEU A HA   3  
ATOM 6153  H HB2  . LEU A 1 88  ? 6.737   14.056  -2.724  2.00 0.00 ? 107 LEU A HB2  3  
ATOM 6154  H HB3  . LEU A 1 88  ? 5.065   13.748  -3.137  2.00 0.00 ? 107 LEU A HB3  3  
ATOM 6155  H HG   . LEU A 1 88  ? 6.145   15.367  -5.198  1.00 0.00 ? 107 LEU A HG   3  
ATOM 6156  H HD11 . LEU A 1 88  ? 7.826   12.911  -4.791  1.00 0.00 ? 107 LEU A HD11 3  
ATOM 6157  H HD12 . LEU A 1 88  ? 8.337   14.505  -4.235  1.00 0.00 ? 107 LEU A HD12 3  
ATOM 6158  H HD13 . LEU A 1 88  ? 8.051   14.219  -5.952  1.00 0.00 ? 107 LEU A HD13 3  
ATOM 6159  H HD21 . LEU A 1 88  ? 4.557   13.104  -4.886  1.00 0.00 ? 107 LEU A HD21 3  
ATOM 6160  H HD22 . LEU A 1 88  ? 5.928   12.565  -5.856  1.00 0.00 ? 107 LEU A HD22 3  
ATOM 6161  H HD23 . LEU A 1 88  ? 4.948   13.928  -6.397  1.00 0.00 ? 107 LEU A HD23 3  
ATOM 6162  N N    . THR A 1 89  ? 5.356   17.820  -4.081  1.00 0.00 ? 108 THR A N    3  
ATOM 6163  C CA   . THR A 1 89  ? 4.805   18.706  -5.100  1.00 0.00 ? 108 THR A CA   3  
ATOM 6164  C C    . THR A 1 89  ? 5.530   18.534  -6.430  1.00 0.00 ? 108 THR A C    3  
ATOM 6165  O O    . THR A 1 89  ? 5.190   19.178  -7.421  1.00 0.00 ? 108 THR A O    3  
ATOM 6166  C CB   . THR A 1 89  ? 4.891   20.181  -4.668  1.00 0.00 ? 108 THR A CB   3  
ATOM 6167  O OG1  . THR A 1 89  ? 5.346   20.270  -3.312  1.00 0.00 ? 108 THR A OG1  3  
ATOM 6168  C CG2  . THR A 1 89  ? 3.538   20.864  -4.799  1.00 0.00 ? 108 THR A CG2  3  
ATOM 6169  H H    . THR A 1 89  ? 6.129   18.117  -3.557  1.00 0.00 ? 108 THR A H    3  
ATOM 6170  H HA   . THR A 1 89  ? 3.763   18.452  -5.234  1.00 0.00 ? 108 THR A HA   3  
ATOM 6171  H HB   . THR A 1 89  ? 5.597   20.689  -5.311  1.00 0.00 ? 108 THR A HB   3  
ATOM 6172  H HG1  . THR A 1 89  ? 6.305   20.302  -3.298  1.00 0.00 ? 108 THR A HG1  3  
ATOM 6173  H HG21 . THR A 1 89  ? 3.229   20.855  -5.834  1.00 0.00 ? 108 THR A HG21 3  
ATOM 6174  H HG22 . THR A 1 89  ? 3.614   21.884  -4.455  1.00 0.00 ? 108 THR A HG22 3  
ATOM 6175  H HG23 . THR A 1 89  ? 2.809   20.336  -4.202  1.00 0.00 ? 108 THR A HG23 3  
ATOM 6176  N N    . SER A 1 90  ? 6.531   17.661  -6.443  1.00 0.00 ? 109 SER A N    3  
ATOM 6177  C CA   . SER A 1 90  ? 7.305   17.403  -7.652  1.00 0.00 ? 109 SER A CA   3  
ATOM 6178  C C    . SER A 1 90  ? 6.707   16.245  -8.445  1.00 0.00 ? 109 SER A C    3  
ATOM 6179  O O    . SER A 1 90  ? 6.472   15.165  -7.903  1.00 0.00 ? 109 SER A O    3  
ATOM 6180  C CB   . SER A 1 90  ? 8.761   17.094  -7.296  1.00 0.00 ? 109 SER A CB   3  
ATOM 6181  O OG   . SER A 1 90  ? 9.651   17.919  -8.026  1.00 0.00 ? 109 SER A OG   3  
ATOM 6182  H H    . SER A 1 90  ? 6.755   17.177  -5.621  1.00 0.00 ? 109 SER A H    3  
ATOM 6183  H HA   . SER A 1 90  ? 7.274   18.294  -8.261  1.00 0.00 ? 109 SER A HA   3  
ATOM 6184  H HB2  . SER A 1 90  ? 8.914   17.267  -6.239  2.00 0.00 ? 109 SER A HB2  3  
ATOM 6185  H HB3  . SER A 1 90  ? 8.974   16.060  -7.529  2.00 0.00 ? 109 SER A HB3  3  
ATOM 6186  H HG   . SER A 1 90  ? 9.971   17.443  -8.796  1.00 0.00 ? 109 SER A HG   3  
ATOM 6187  N N    . ASN A 1 91  ? 6.461   16.479  -9.730  1.00 0.00 ? 110 ASN A N    3  
ATOM 6188  C CA   . ASN A 1 91  ? 5.888   15.456  -10.597 1.00 0.00 ? 110 ASN A CA   3  
ATOM 6189  C C    . ASN A 1 91  ? 6.975   14.540  -11.149 1.00 0.00 ? 110 ASN A C    3  
ATOM 6190  O O    . ASN A 1 91  ? 7.932   14.999  -11.774 1.00 0.00 ? 110 ASN A O    3  
ATOM 6191  C CB   . ASN A 1 91  ? 5.119   16.106  -11.749 1.00 0.00 ? 110 ASN A CB   3  
ATOM 6192  C CG   . ASN A 1 91  ? 4.442   17.407  -11.367 1.00 0.00 ? 110 ASN A CG   3  
ATOM 6193  O OD1  . ASN A 1 91  ? 3.721   17.476  -10.371 1.00 0.00 ? 110 ASN A OD1  3  
ATOM 6194  N ND2  . ASN A 1 91  ? 4.670   18.449  -12.159 4.00 0.00 ? 110 ASN A ND2  3  
ATOM 6195  H H    . ASN A 1 91  ? 6.668   17.361  -10.104 1.00 0.00 ? 110 ASN A H    3  
ATOM 6196  H HA   . ASN A 1 91  ? 5.203   14.867  -10.007 1.00 0.00 ? 110 ASN A HA   3  
ATOM 6197  H HB2  . ASN A 1 91  ? 5.805   16.307  -12.559 2.00 0.00 ? 110 ASN A HB2  3  
ATOM 6198  H HB3  . ASN A 1 91  ? 4.362   15.419  -12.096 2.00 0.00 ? 110 ASN A HB3  3  
ATOM 6199  H HD21 . ASN A 1 91  ? 5.257   18.319  -12.937 5.00 0.00 ? 110 ASN A HD21 3  
ATOM 6200  H HD22 . ASN A 1 91  ? 4.244   19.305  -11.934 5.00 0.00 ? 110 ASN A HD22 3  
ATOM 6201  N N    . THR A 1 92  ? 6.820   13.240  -10.916 1.00 0.00 ? 111 THR A N    3  
ATOM 6202  C CA   . THR A 1 92  ? 7.786   12.257  -11.390 1.00 0.00 ? 111 THR A CA   3  
ATOM 6203  C C    . THR A 1 92  ? 7.095   10.956  -11.785 1.00 0.00 ? 111 THR A C    3  
ATOM 6204  O O    . THR A 1 92  ? 6.929   10.666  -12.970 1.00 0.00 ? 111 THR A O    3  
ATOM 6205  C CB   . THR A 1 92  ? 8.851   11.953  -10.320 1.00 0.00 ? 111 THR A CB   3  
ATOM 6206  O OG1  . THR A 1 92  ? 9.280   13.169  -9.696  1.00 0.00 ? 111 THR A OG1  3  
ATOM 6207  C CG2  . THR A 1 92  ? 10.049  11.245  -10.935 1.00 0.00 ? 111 THR A CG2  3  
ATOM 6208  H H    . THR A 1 92  ? 6.036   12.935  -10.413 1.00 0.00 ? 111 THR A H    3  
ATOM 6209  H HA   . THR A 1 92  ? 8.282   12.668  -12.257 1.00 0.00 ? 111 THR A HA   3  
ATOM 6210  H HB   . THR A 1 92  ? 8.415   11.308  -9.572  1.00 0.00 ? 111 THR A HB   3  
ATOM 6211  H HG1  . THR A 1 92  ? 9.665   13.751  -10.356 1.00 0.00 ? 111 THR A HG1  3  
ATOM 6212  H HG21 . THR A 1 92  ? 10.171  10.277  -10.471 1.00 0.00 ? 111 THR A HG21 3  
ATOM 6213  H HG22 . THR A 1 92  ? 10.938  11.836  -10.775 1.00 0.00 ? 111 THR A HG22 3  
ATOM 6214  H HG23 . THR A 1 92  ? 9.887   11.118  -11.995 1.00 0.00 ? 111 THR A HG23 3  
ATOM 6215  N N    . SER A 1 93  ? 6.692   10.179  -10.786 1.00 0.00 ? 112 SER A N    3  
ATOM 6216  C CA   . SER A 1 93  ? 6.016   8.910   -11.029 1.00 0.00 ? 112 SER A CA   3  
ATOM 6217  C C    . SER A 1 93  ? 4.831   8.734   -10.084 1.00 0.00 ? 112 SER A C    3  
ATOM 6218  O O    . SER A 1 93  ? 3.736   9.227   -10.353 1.00 0.00 ? 112 SER A O    3  
ATOM 6219  C CB   . SER A 1 93  ? 6.996   7.746   -10.863 1.00 0.00 ? 112 SER A CB   3  
ATOM 6220  O OG   . SER A 1 93  ? 7.895   7.677   -11.956 1.00 0.00 ? 112 SER A OG   3  
ATOM 6221  H H    . SER A 1 93  ? 6.851   10.465  -9.862  1.00 0.00 ? 112 SER A H    3  
ATOM 6222  H HA   . SER A 1 93  ? 5.652   8.919   -12.046 1.00 0.00 ? 112 SER A HA   3  
ATOM 6223  H HB2  . SER A 1 93  ? 7.563   7.881   -9.955  2.00 0.00 ? 112 SER A HB2  3  
ATOM 6224  H HB3  . SER A 1 93  ? 6.445   6.819   -10.809 2.00 0.00 ? 112 SER A HB3  3  
ATOM 6225  H HG   . SER A 1 93  ? 8.476   8.442   -11.943 1.00 0.00 ? 112 SER A HG   3  
ATOM 6226  N N    . GLN A 1 94  ? 5.060   8.035   -8.975  1.00 0.00 ? 113 GLN A N    3  
ATOM 6227  C CA   . GLN A 1 94  ? 4.016   7.796   -7.987  1.00 0.00 ? 113 GLN A CA   3  
ATOM 6228  C C    . GLN A 1 94  ? 4.630   7.397   -6.647  1.00 0.00 ? 113 GLN A C    3  
ATOM 6229  O O    . GLN A 1 94  ? 5.364   8.181   -6.046  1.00 0.00 ? 113 GLN A O    3  
ATOM 6230  C CB   . GLN A 1 94  ? 3.050   6.714   -8.474  1.00 0.00 ? 113 GLN A CB   3  
ATOM 6231  C CG   . GLN A 1 94  ? 2.112   7.173   -9.578  1.00 0.00 ? 113 GLN A CG   3  
ATOM 6232  C CD   . GLN A 1 94  ? 1.169   8.271   -9.130  1.00 0.00 ? 113 GLN A CD   3  
ATOM 6233  O OE1  . GLN A 1 94  ? 0.739   8.305   -7.977  1.00 0.00 ? 113 GLN A OE1  3  
ATOM 6234  N NE2  . GLN A 1 94  ? 0.840   9.179   -10.043 4.00 0.00 ? 113 GLN A NE2  3  
ATOM 6235  H H    . GLN A 1 94  ? 5.956   7.676   -8.815  1.00 0.00 ? 113 GLN A H    3  
ATOM 6236  H HA   . GLN A 1 94  ? 3.470   8.720   -7.856  1.00 0.00 ? 113 GLN A HA   3  
ATOM 6237  H HB2  . GLN A 1 94  ? 3.624   5.878   -8.844  2.00 0.00 ? 113 GLN A HB2  3  
ATOM 6238  H HB3  . GLN A 1 94  ? 2.450   6.384   -7.639  2.00 0.00 ? 113 GLN A HB3  3  
ATOM 6239  H HG2  . GLN A 1 94  ? 2.703   7.542   -10.403 2.00 0.00 ? 113 GLN A HG2  3  
ATOM 6240  H HG3  . GLN A 1 94  ? 1.525   6.328   -9.907  2.00 0.00 ? 113 GLN A HG3  3  
ATOM 6241  H HE21 . GLN A 1 94  ? 1.221   9.089   -10.944 5.00 0.00 ? 113 GLN A HE21 3  
ATOM 6242  H HE22 . GLN A 1 94  ? 0.230   9.903   -9.779  5.00 0.00 ? 113 GLN A HE22 3  
ATOM 6243  N N    . TYR A 1 95  ? 4.329   6.179   -6.180  1.00 0.00 ? 114 TYR A N    3  
ATOM 6244  C CA   . TYR A 1 95  ? 4.859   5.695   -4.904  1.00 0.00 ? 114 TYR A CA   3  
ATOM 6245  C C    . TYR A 1 95  ? 3.938   4.639   -4.290  1.00 0.00 ? 114 TYR A C    3  
ATOM 6246  O O    . TYR A 1 95  ? 3.347   3.828   -5.002  1.00 0.00 ? 114 TYR A O    3  
ATOM 6247  C CB   . TYR A 1 95  ? 5.030   6.861   -3.927  1.00 0.00 ? 114 TYR A CB   3  
ATOM 6248  C CG   . TYR A 1 95  ? 3.741   7.562   -3.564  1.00 0.00 ? 114 TYR A CG   3  
ATOM 6249  C CD1  . TYR A 1 95  ? 2.648   7.532   -4.423  1.00 0.00 ? 114 TYR A CD1  3  
ATOM 6250  C CD2  . TYR A 1 95  ? 3.614   8.255   -2.368  1.00 0.00 ? 114 TYR A CD2  3  
ATOM 6251  C CE1  . TYR A 1 95  ? 1.471   8.171   -4.103  1.00 0.00 ? 114 TYR A CE1  3  
ATOM 6252  C CE2  . TYR A 1 95  ? 2.438   8.898   -2.040  1.00 0.00 ? 114 TYR A CE2  3  
ATOM 6253  C CZ   . TYR A 1 95  ? 1.370   8.852   -2.912  1.00 0.00 ? 114 TYR A CZ   3  
ATOM 6254  O OH   . TYR A 1 95  ? 0.199   9.495   -2.593  1.00 0.00 ? 114 TYR A OH   3  
ATOM 6255  H H    . TYR A 1 95  ? 3.738   5.594   -6.704  1.00 0.00 ? 114 TYR A H    3  
ATOM 6256  H HA   . TYR A 1 95  ? 5.824   5.249   -5.093  1.00 0.00 ? 114 TYR A HA   3  
ATOM 6257  H HB2  . TYR A 1 95  ? 5.480   6.497   -3.016  2.00 0.00 ? 114 TYR A HB2  3  
ATOM 6258  H HB3  . TYR A 1 95  ? 5.688   7.593   -4.370  2.00 0.00 ? 114 TYR A HB3  3  
ATOM 6259  H HD1  . TYR A 1 95  ? 2.731   6.996   -5.356  1.00 0.00 ? 114 TYR A HD1  3  
ATOM 6260  H HD2  . TYR A 1 95  ? 4.454   8.288   -1.688  1.00 0.00 ? 114 TYR A HD2  3  
ATOM 6261  H HE1  . TYR A 1 95  ? 0.634   8.137   -4.784  1.00 0.00 ? 114 TYR A HE1  3  
ATOM 6262  H HE2  . TYR A 1 95  ? 2.357   9.433   -1.106  1.00 0.00 ? 114 TYR A HE2  3  
ATOM 6263  H HH   . TYR A 1 95  ? -0.044  10.090  -3.306  1.00 0.00 ? 114 TYR A HH   3  
ATOM 6264  N N    . ASP A 1 96  ? 3.826   4.657   -2.963  1.00 0.00 ? 115 ASP A N    3  
ATOM 6265  C CA   . ASP A 1 96  ? 2.983   3.707   -2.245  1.00 0.00 ? 115 ASP A CA   3  
ATOM 6266  C C    . ASP A 1 96  ? 1.596   4.291   -1.985  1.00 0.00 ? 115 ASP A C    3  
ATOM 6267  O O    . ASP A 1 96  ? 1.216   5.296   -2.587  1.00 0.00 ? 115 ASP A O    3  
ATOM 6268  C CB   . ASP A 1 96  ? 3.641   3.321   -0.920  1.00 0.00 ? 115 ASP A CB   3  
ATOM 6269  C CG   . ASP A 1 96  ? 5.156   3.375   -0.980  1.00 0.00 ? 115 ASP A CG   3  
ATOM 6270  O OD1  . ASP A 1 96  ? 5.715   3.153   -2.076  1.00 0.00 ? 115 ASP A OD1  3  
ATOM 6271  O OD2  . ASP A 1 96  ? 5.783   3.638   0.067   1.00 0.00 ? 115 ASP A OD2  3  
ATOM 6272  H H    . ASP A 1 96  ? 4.324   5.327   -2.452  1.00 0.00 ? 115 ASP A H    3  
ATOM 6273  H HA   . ASP A 1 96  ? 2.879   2.823   -2.856  1.00 0.00 ? 115 ASP A HA   3  
ATOM 6274  H HB2  . ASP A 1 96  ? 3.307   3.999   -0.149  2.00 0.00 ? 115 ASP A HB2  3  
ATOM 6275  H HB3  . ASP A 1 96  ? 3.347   2.315   -0.660  2.00 0.00 ? 115 ASP A HB3  3  
ATOM 6276  N N    . THR A 1 97  ? 0.842   3.657   -1.091  1.00 0.00 ? 116 THR A N    3  
ATOM 6277  C CA   . THR A 1 97  ? -0.502  4.122   -0.769  1.00 0.00 ? 116 THR A CA   3  
ATOM 6278  C C    . THR A 1 97  ? -0.959  3.647   0.608   1.00 0.00 ? 116 THR A C    3  
ATOM 6279  O O    . THR A 1 97  ? -0.626  2.544   1.042   1.00 0.00 ? 116 THR A O    3  
ATOM 6280  C CB   . THR A 1 97  ? -1.518  3.649   -1.827  1.00 0.00 ? 116 THR A CB   3  
ATOM 6281  O OG1  . THR A 1 97  ? -2.084  4.776   -2.507  1.00 0.00 ? 116 THR A OG1  3  
ATOM 6282  C CG2  . THR A 1 97  ? -2.630  2.827   -1.192  1.00 0.00 ? 116 THR A CG2  3  
ATOM 6283  H H    . THR A 1 97  ? 1.194   2.859   -0.644  1.00 0.00 ? 116 THR A H    3  
ATOM 6284  H HA   . THR A 1 97  ? -0.489  5.200   -0.776  1.00 0.00 ? 116 THR A HA   3  
ATOM 6285  H HB   . THR A 1 97  ? -1.002  3.030   -2.547  1.00 0.00 ? 116 THR A HB   3  
ATOM 6286  H HG1  . THR A 1 97  ? -3.038  4.681   -2.544  1.00 0.00 ? 116 THR A HG1  3  
ATOM 6287  H HG21 . THR A 1 97  ? -3.531  2.924   -1.780  1.00 0.00 ? 116 THR A HG21 3  
ATOM 6288  H HG22 . THR A 1 97  ? -2.815  3.184   -0.189  1.00 0.00 ? 116 THR A HG22 3  
ATOM 6289  H HG23 . THR A 1 97  ? -2.334  1.789   -1.157  1.00 0.00 ? 116 THR A HG23 3  
ATOM 6290  N N    . TYR A 1 98  ? -1.740  4.488   1.281   1.00 0.00 ? 117 TYR A N    3  
ATOM 6291  C CA   . TYR A 1 98  ? -2.271  4.168   2.602   1.00 0.00 ? 117 TYR A CA   3  
ATOM 6292  C C    . TYR A 1 98  ? -3.782  3.988   2.533   1.00 0.00 ? 117 TYR A C    3  
ATOM 6293  O O    . TYR A 1 98  ? -4.444  4.599   1.693   1.00 0.00 ? 117 TYR A O    3  
ATOM 6294  C CB   . TYR A 1 98  ? -1.959  5.289   3.594   1.00 0.00 ? 117 TYR A CB   3  
ATOM 6295  C CG   . TYR A 1 98  ? -0.538  5.331   4.099   1.00 0.00 ? 117 TYR A CG   3  
ATOM 6296  C CD1  . TYR A 1 98  ? 0.442   6.027   3.407   1.00 0.00 ? 117 TYR A CD1  3  
ATOM 6297  C CD2  . TYR A 1 98  ? -0.182  4.699   5.283   1.00 0.00 ? 117 TYR A CD2  3  
ATOM 6298  C CE1  . TYR A 1 98  ? 1.737   6.093   3.880   1.00 0.00 ? 117 TYR A CE1  3  
ATOM 6299  C CE2  . TYR A 1 98  ? 1.109   4.758   5.761   1.00 0.00 ? 117 TYR A CE2  3  
ATOM 6300  C CZ   . TYR A 1 98  ? 2.065   5.457   5.057   1.00 0.00 ? 117 TYR A CZ   3  
ATOM 6301  O OH   . TYR A 1 98  ? 3.353   5.521   5.532   1.00 0.00 ? 117 TYR A OH   3  
ATOM 6302  H H    . TYR A 1 98  ? -1.977  5.347   0.870   1.00 0.00 ? 117 TYR A H    3  
ATOM 6303  H HA   . TYR A 1 98  ? -1.816  3.251   2.942   1.00 0.00 ? 117 TYR A HA   3  
ATOM 6304  H HB2  . TYR A 1 98  ? -2.164  6.237   3.120   2.00 0.00 ? 117 TYR A HB2  3  
ATOM 6305  H HB3  . TYR A 1 98  ? -2.606  5.183   4.452   2.00 0.00 ? 117 TYR A HB3  3  
ATOM 6306  H HD1  . TYR A 1 98  ? 0.182   6.522   2.484   1.00 0.00 ? 117 TYR A HD1  3  
ATOM 6307  H HD2  . TYR A 1 98  ? -0.930  4.144   5.830   1.00 0.00 ? 117 TYR A HD2  3  
ATOM 6308  H HE1  . TYR A 1 98  ? 2.485   6.639   3.326   1.00 0.00 ? 117 TYR A HE1  3  
ATOM 6309  H HE2  . TYR A 1 98  ? 1.362   4.261   6.686   1.00 0.00 ? 117 TYR A HE2  3  
ATOM 6310  H HH   . TYR A 1 98  ? 3.904   5.993   4.903   1.00 0.00 ? 117 TYR A HH   3  
ATOM 6311  N N    . CYS A 1 99  ? -4.331  3.165   3.418   1.00 0.00 ? 118 CYS A N    3  
ATOM 6312  C CA   . CYS A 1 99  ? -5.770  2.941   3.435   1.00 0.00 ? 118 CYS A CA   3  
ATOM 6313  C C    . CYS A 1 99  ? -6.239  2.430   4.793   1.00 0.00 ? 118 CYS A C    3  
ATOM 6314  O O    . CYS A 1 99  ? -5.756  1.411   5.289   1.00 0.00 ? 118 CYS A O    3  
ATOM 6315  C CB   . CYS A 1 99  ? -6.169  1.965   2.328   1.00 0.00 ? 118 CYS A CB   3  
ATOM 6316  S SG   . CYS A 1 99  ? -6.438  2.728   0.695   1.00 0.00 ? 118 CYS A SG   3  
ATOM 6317  H H    . CYS A 1 99  ? -3.761  2.704   4.073   1.00 0.00 ? 118 CYS A H    3  
ATOM 6318  H HA   . CYS A 1 99  ? -6.248  3.892   3.245   1.00 0.00 ? 118 CYS A HA   3  
ATOM 6319  H HB2  . CYS A 1 99  ? -5.392  1.223   2.217   2.00 0.00 ? 118 CYS A HB2  3  
ATOM 6320  H HB3  . CYS A 1 99  ? -7.087  1.469   2.611   2.00 0.00 ? 118 CYS A HB3  3  
ATOM 6321  N N    . PHE A 1 100 ? -7.192  3.148   5.385   1.00 0.00 ? 119 PHE A N    3  
ATOM 6322  C CA   . PHE A 1 100 ? -7.740  2.773   6.682   1.00 0.00 ? 119 PHE A CA   3  
ATOM 6323  C C    . PHE A 1 100 ? -8.770  1.666   6.513   1.00 0.00 ? 119 PHE A C    3  
ATOM 6324  O O    . PHE A 1 100 ? -9.861  1.893   5.989   1.00 0.00 ? 119 PHE A O    3  
ATOM 6325  C CB   . PHE A 1 100 ? -8.390  3.976   7.369   1.00 0.00 ? 119 PHE A CB   3  
ATOM 6326  C CG   . PHE A 1 100 ? -9.020  3.687   8.702   1.00 0.00 ? 119 PHE A CG   3  
ATOM 6327  C CD1  . PHE A 1 100 ? -8.276  3.764   9.869   1.00 0.00 ? 119 PHE A CD1  3  
ATOM 6328  C CD2  . PHE A 1 100 ? -10.357 3.332   8.789   1.00 0.00 ? 119 PHE A CD2  3  
ATOM 6329  C CE1  . PHE A 1 100 ? -8.851  3.496   11.093  1.00 0.00 ? 119 PHE A CE1  3  
ATOM 6330  C CE2  . PHE A 1 100 ? -10.938 3.061   10.010  1.00 0.00 ? 119 PHE A CE2  3  
ATOM 6331  C CZ   . PHE A 1 100 ? -10.184 3.143   11.164  1.00 0.00 ? 119 PHE A CZ   3  
ATOM 6332  H H    . PHE A 1 100 ? -7.537  3.945   4.936   1.00 0.00 ? 119 PHE A H    3  
ATOM 6333  H HA   . PHE A 1 100 ? -6.929  2.408   7.293   1.00 0.00 ? 119 PHE A HA   3  
ATOM 6334  H HB2  . PHE A 1 100 ? -7.642  4.745   7.516   2.00 0.00 ? 119 PHE A HB2  3  
ATOM 6335  H HB3  . PHE A 1 100 ? -9.163  4.367   6.720   2.00 0.00 ? 119 PHE A HB3  3  
ATOM 6336  H HD1  . PHE A 1 100 ? -7.236  4.041   9.816   1.00 0.00 ? 119 PHE A HD1  3  
ATOM 6337  H HD2  . PHE A 1 100 ? -10.948 3.267   7.888   1.00 0.00 ? 119 PHE A HD2  3  
ATOM 6338  H HE1  . PHE A 1 100 ? -8.257  3.560   11.994  1.00 0.00 ? 119 PHE A HE1  3  
ATOM 6339  H HE2  . PHE A 1 100 ? -11.980 2.786   10.065  1.00 0.00 ? 119 PHE A HE2  3  
ATOM 6340  H HZ   . PHE A 1 100 ? -10.636 2.931   12.117  1.00 0.00 ? 119 PHE A HZ   3  
ATOM 6341  N N    . ASN A 1 101 ? -8.412  0.468   6.947   1.00 0.00 ? 120 ASN A N    3  
ATOM 6342  C CA   . ASN A 1 101 ? -9.295  -0.676  6.835   1.00 0.00 ? 120 ASN A CA   3  
ATOM 6343  C C    . ASN A 1 101 ? -10.139 -0.854  8.087   1.00 0.00 ? 120 ASN A C    3  
ATOM 6344  O O    . ASN A 1 101 ? -9.613  -1.093  9.175   1.00 0.00 ? 120 ASN A O    3  
ATOM 6345  C CB   . ASN A 1 101 ? -8.477  -1.937  6.586   1.00 0.00 ? 120 ASN A CB   3  
ATOM 6346  C CG   . ASN A 1 101 ? -7.440  -2.185  7.664   1.00 0.00 ? 120 ASN A CG   3  
ATOM 6347  O OD1  . ASN A 1 101 ? -7.475  -3.206  8.350   1.00 0.00 ? 120 ASN A OD1  3  
ATOM 6348  N ND2  . ASN A 1 101 ? -6.508  -1.253  7.816   4.00 0.00 ? 120 ASN A ND2  3  
ATOM 6349  H H    . ASN A 1 101 ? -7.527  0.349   7.345   1.00 0.00 ? 120 ASN A H    3  
ATOM 6350  H HA   . ASN A 1 101 ? -9.949  -0.512  5.993   1.00 0.00 ? 120 ASN A HA   3  
ATOM 6351  H HB2  . ASN A 1 101 ? -9.139  -2.782  6.551   2.00 0.00 ? 120 ASN A HB2  3  
ATOM 6352  H HB3  . ASN A 1 101 ? -7.969  -1.846  5.637   2.00 0.00 ? 120 ASN A HB3  3  
ATOM 6353  H HD21 . ASN A 1 101 ? -6.540  -0.464  7.230   5.00 0.00 ? 120 ASN A HD21 3  
ATOM 6354  H HD22 . ASN A 1 101 ? -5.825  -1.388  8.508   5.00 0.00 ? 120 ASN A HD22 3  
ATOM 6355  N N    . ALA A 1 102 ? -11.452 -0.755  7.926   1.00 0.00 ? 121 ALA A N    3  
ATOM 6356  C CA   . ALA A 1 102 ? -12.365 -0.925  9.044   1.00 0.00 ? 121 ALA A CA   3  
ATOM 6357  C C    . ALA A 1 102 ? -12.192 -2.311  9.652   1.00 0.00 ? 121 ALA A C    3  
ATOM 6358  O O    . ALA A 1 102 ? -12.525 -2.538  10.815  1.00 0.00 ? 121 ALA A O    3  
ATOM 6359  C CB   . ALA A 1 102 ? -13.802 -0.708  8.598   1.00 0.00 ? 121 ALA A CB   3  
ATOM 6360  H H    . ALA A 1 102 ? -11.814 -0.576  7.033   1.00 0.00 ? 121 ALA A H    3  
ATOM 6361  H HA   . ALA A 1 102 ? -12.123 -0.181  9.790   1.00 0.00 ? 121 ALA A HA   3  
ATOM 6362  H HB1  . ALA A 1 102 ? -14.415 -1.526  8.947   1.00 0.00 ? 121 ALA A HB1  3  
ATOM 6363  H HB2  . ALA A 1 102 ? -13.841 -0.664  7.520   1.00 0.00 ? 121 ALA A HB2  3  
ATOM 6364  H HB3  . ALA A 1 102 ? -14.170 0.219   9.010   1.00 0.00 ? 121 ALA A HB3  3  
ATOM 6365  N N    . SER A 1 103 ? -11.653 -3.231  8.854   1.00 0.00 ? 122 SER A N    3  
ATOM 6366  C CA   . SER A 1 103 ? -11.416 -4.594  9.311   1.00 0.00 ? 122 SER A CA   3  
ATOM 6367  C C    . SER A 1 103 ? -10.596 -4.577  10.594  1.00 0.00 ? 122 SER A C    3  
ATOM 6368  O O    . SER A 1 103 ? -10.950 -5.223  11.581  1.00 0.00 ? 122 SER A O    3  
ATOM 6369  C CB   . SER A 1 103 ? -10.686 -5.401  8.232   1.00 0.00 ? 122 SER A CB   3  
ATOM 6370  O OG   . SER A 1 103 ? -11.522 -6.412  7.698   1.00 0.00 ? 122 SER A OG   3  
ATOM 6371  H H    . SER A 1 103 ? -11.400 -2.982  7.941   1.00 0.00 ? 122 SER A H    3  
ATOM 6372  H HA   . SER A 1 103 ? -12.374 -5.052  9.511   1.00 0.00 ? 122 SER A HA   3  
ATOM 6373  H HB2  . SER A 1 103 ? -10.385 -4.741  7.431   2.00 0.00 ? 122 SER A HB2  3  
ATOM 6374  H HB3  . SER A 1 103 ? -9.812  -5.866  8.662   2.00 0.00 ? 122 SER A HB3  3  
ATOM 6375  H HG   . SER A 1 103 ? -11.245 -6.616  6.802   1.00 0.00 ? 122 SER A HG   3  
ATOM 6376  N N    . ALA A 1 104 ? -9.506  -3.818  10.575  1.00 0.00 ? 123 ALA A N    3  
ATOM 6377  C CA   . ALA A 1 104 ? -8.638  -3.694  11.736  1.00 0.00 ? 123 ALA A CA   3  
ATOM 6378  C C    . ALA A 1 104 ? -9.087  -2.533  12.618  1.00 0.00 ? 123 ALA A C    3  
ATOM 6379  O O    . ALA A 1 104 ? -9.142  -1.388  12.170  1.00 0.00 ? 123 ALA A O    3  
ATOM 6380  C CB   . ALA A 1 104 ? -7.193  -3.503  11.300  1.00 0.00 ? 123 ALA A CB   3  
ATOM 6381  H H    . ALA A 1 104 ? -9.287  -3.319  9.759   1.00 0.00 ? 123 ALA A H    3  
ATOM 6382  H HA   . ALA A 1 104 ? -8.703  -4.611  12.302  1.00 0.00 ? 123 ALA A HA   3  
ATOM 6383  H HB1  . ALA A 1 104 ? -7.151  -2.787  10.493  1.00 0.00 ? 123 ALA A HB1  3  
ATOM 6384  H HB2  . ALA A 1 104 ? -6.791  -4.447  10.965  1.00 0.00 ? 123 ALA A HB2  3  
ATOM 6385  H HB3  . ALA A 1 104 ? -6.610  -3.140  12.134  1.00 0.00 ? 123 ALA A HB3  3  
ATOM 6386  N N    . PRO A 1 105 ? -9.419  -2.817  13.883  1.00 0.00 ? 124 PRO A N    3  
ATOM 6387  C CA   . PRO A 1 105 ? -9.870  -1.793  14.831  1.00 0.00 ? 124 PRO A CA   3  
ATOM 6388  C C    . PRO A 1 105 ? -8.739  -0.862  15.261  1.00 0.00 ? 124 PRO A C    3  
ATOM 6389  O O    . PRO A 1 105 ? -7.607  -0.982  14.780  1.00 0.00 ? 124 PRO A O    3  
ATOM 6390  C CB   . PRO A 1 105 ? -10.369 -2.618  16.020  1.00 0.00 ? 124 PRO A CB   3  
ATOM 6391  C CG   . PRO A 1 105 ? -9.593  -3.886  15.953  1.00 0.00 ? 124 PRO A CG   3  
ATOM 6392  C CD   . PRO A 1 105 ? -9.384  -4.161  14.489  1.00 0.00 ? 124 PRO A CD   3  
ATOM 6393  H HA   . PRO A 1 105 ? -10.683 -1.209  14.426  1.00 0.00 ? 124 PRO A HA   3  
ATOM 6394  H HB2  . PRO A 1 105 ? -10.176 -2.084  16.938  2.00 0.00 ? 124 PRO A HB2  3  
ATOM 6395  H HB3  . PRO A 1 105 ? -11.429 -2.797  15.917  2.00 0.00 ? 124 PRO A HB3  3  
ATOM 6396  H HG2  . PRO A 1 105 ? -8.644  -3.764  16.451  2.00 0.00 ? 124 PRO A HG2  3  
ATOM 6397  H HG3  . PRO A 1 105 ? -10.157 -4.687  16.408  2.00 0.00 ? 124 PRO A HG3  3  
ATOM 6398  H HD2  . PRO A 1 105 ? -8.426  -4.632  14.327  2.00 0.00 ? 124 PRO A HD2  3  
ATOM 6399  H HD3  . PRO A 1 105 ? -10.181 -4.779  14.103  2.00 0.00 ? 124 PRO A HD3  3  
ATOM 6400  N N    . PRO A 1 106 ? -9.029  0.081   16.177  1.00 0.00 ? 125 PRO A N    3  
ATOM 6401  C CA   . PRO A 1 106 ? -8.030  1.029   16.678  1.00 0.00 ? 125 PRO A CA   3  
ATOM 6402  C C    . PRO A 1 106 ? -6.927  0.319   17.453  1.00 0.00 ? 125 PRO A C    3  
ATOM 6403  O O    . PRO A 1 106 ? -6.798  0.484   18.667  1.00 0.00 ? 125 PRO A O    3  
ATOM 6404  C CB   . PRO A 1 106 ? -8.833  1.944   17.602  1.00 0.00 ? 125 PRO A CB   3  
ATOM 6405  C CG   . PRO A 1 106 ? -10.029 1.147   17.991  1.00 0.00 ? 125 PRO A CG   3  
ATOM 6406  C CD   . PRO A 1 106 ? -10.353 0.290   16.798  1.00 0.00 ? 125 PRO A CD   3  
ATOM 6407  H HA   . PRO A 1 106 ? -7.593  1.608   15.877  1.00 0.00 ? 125 PRO A HA   3  
ATOM 6408  H HB2  . PRO A 1 106 ? -8.237  2.204   18.463  2.00 0.00 ? 125 PRO A HB2  3  
ATOM 6409  H HB3  . PRO A 1 106 ? -9.113  2.841   17.070  2.00 0.00 ? 125 PRO A HB3  3  
ATOM 6410  H HG2  . PRO A 1 106 ? -9.799  0.531   18.846  2.00 0.00 ? 125 PRO A HG2  3  
ATOM 6411  H HG3  . PRO A 1 106 ? -10.855 1.809   18.213  2.00 0.00 ? 125 PRO A HG3  3  
ATOM 6412  H HD2  . PRO A 1 106 ? -10.785 -0.648  17.112  2.00 0.00 ? 125 PRO A HD2  3  
ATOM 6413  H HD3  . PRO A 1 106 ? -11.017 0.813   16.125  2.00 0.00 ? 125 PRO A HD3  3  
ATOM 6414  N N    . GLU A 1 107 ? -6.143  -0.477  16.736  1.00 0.00 ? 126 GLU A N    3  
ATOM 6415  C CA   . GLU A 1 107 ? -5.049  -1.232  17.337  1.00 0.00 ? 126 GLU A CA   3  
ATOM 6416  C C    . GLU A 1 107 ? -4.462  -2.214  16.325  1.00 0.00 ? 126 GLU A C    3  
ATOM 6417  O O    . GLU A 1 107 ? -4.272  -1.871  15.160  1.00 0.00 ? 126 GLU A O    3  
ATOM 6418  C CB   . GLU A 1 107 ? -5.539  -1.981  18.580  1.00 0.00 ? 126 GLU A CB   3  
ATOM 6419  C CG   . GLU A 1 107 ? -6.649  -2.982  18.302  1.00 0.00 ? 126 GLU A CG   3  
ATOM 6420  C CD   . GLU A 1 107 ? -7.315  -3.486  19.568  1.00 0.00 ? 126 GLU A CD   3  
ATOM 6421  O OE1  . GLU A 1 107 ? -6.782  -4.434  20.182  1.00 0.00 ? 126 GLU A OE1  3  
ATOM 6422  O OE2  . GLU A 1 107 ? -8.369  -2.933  19.946  1.00 0.00 ? 126 GLU A OE2  3  
ATOM 6423  H H    . GLU A 1 107 ? -6.305  -0.560  15.773  1.00 0.00 ? 126 GLU A H    3  
ATOM 6424  H HA   . GLU A 1 107 ? -4.282  -0.531  17.629  1.00 0.00 ? 126 GLU A HA   3  
ATOM 6425  H HB2  . GLU A 1 107 ? -4.707  -2.513  19.019  2.00 0.00 ? 126 GLU A HB2  3  
ATOM 6426  H HB3  . GLU A 1 107 ? -5.907  -1.261  19.296  2.00 0.00 ? 126 GLU A HB3  3  
ATOM 6427  H HG2  . GLU A 1 107 ? -7.398  -2.507  17.686  2.00 0.00 ? 126 GLU A HG2  3  
ATOM 6428  H HG3  . GLU A 1 107 ? -6.232  -3.826  17.773  2.00 0.00 ? 126 GLU A HG3  3  
ATOM 6429  N N    . GLU A 1 108 ? -4.178  -3.435  16.769  1.00 0.00 ? 127 GLU A N    3  
ATOM 6430  C CA   . GLU A 1 108 ? -3.615  -4.450  15.886  1.00 0.00 ? 127 GLU A CA   3  
ATOM 6431  C C    . GLU A 1 108 ? -2.159  -4.140  15.570  1.00 0.00 ? 127 GLU A C    3  
ATOM 6432  O O    . GLU A 1 108 ? -1.417  -3.650  16.422  1.00 0.00 ? 127 GLU A O    3  
ATOM 6433  C CB   . GLU A 1 108 ? -4.428  -4.542  14.593  1.00 0.00 ? 127 GLU A CB   3  
ATOM 6434  C CG   . GLU A 1 108 ? -5.933  -4.622  14.785  1.00 0.00 ? 127 GLU A CG   3  
ATOM 6435  C CD   . GLU A 1 108 ? -6.499  -5.993  14.473  1.00 0.00 ? 127 GLU A CD   3  
ATOM 6436  O OE1  . GLU A 1 108 ? -6.371  -6.438  13.313  1.00 0.00 ? 127 GLU A OE1  3  
ATOM 6437  O OE2  . GLU A 1 108 ? -7.072  -6.621  15.388  1.00 0.00 ? 127 GLU A OE2  3  
ATOM 6438  H H    . GLU A 1 108 ? -4.351  -3.659  17.706  1.00 0.00 ? 127 GLU A H    3  
ATOM 6439  H HA   . GLU A 1 108 ? -3.660  -5.398  16.394  1.00 0.00 ? 127 GLU A HA   3  
ATOM 6440  H HB2  . GLU A 1 108 ? -4.214  -3.672  13.990  2.00 0.00 ? 127 GLU A HB2  3  
ATOM 6441  H HB3  . GLU A 1 108 ? -4.113  -5.421  14.050  2.00 0.00 ? 127 GLU A HB3  3  
ATOM 6442  H HG2  . GLU A 1 108 ? -6.163  -4.381  15.814  2.00 0.00 ? 127 GLU A HG2  3  
ATOM 6443  H HG3  . GLU A 1 108 ? -6.404  -3.898  14.134  2.00 0.00 ? 127 GLU A HG3  3  
ATOM 6444  N N    . ASP A 1 109 ? -1.757  -4.432  14.340  1.00 0.00 ? 128 ASP A N    3  
ATOM 6445  C CA   . ASP A 1 109 ? -0.386  -4.189  13.903  1.00 0.00 ? 128 ASP A CA   3  
ATOM 6446  C C    . ASP A 1 109 ? -0.148  -4.768  12.513  1.00 0.00 ? 128 ASP A C    3  
ATOM 6447  O O    . ASP A 1 109 ? -0.350  -4.091  11.506  1.00 0.00 ? 128 ASP A O    3  
ATOM 6448  C CB   . ASP A 1 109 ? 0.605   -4.798  14.898  1.00 0.00 ? 128 ASP A CB   3  
ATOM 6449  C CG   . ASP A 1 109 ? 1.613   -3.800  15.434  1.00 0.00 ? 128 ASP A CG   3  
ATOM 6450  O OD1  . ASP A 1 109 ? 1.188   -2.788  16.028  1.00 0.00 ? 128 ASP A OD1  3  
ATOM 6451  O OD2  . ASP A 1 109 ? 2.828   -4.032  15.258  1.00 0.00 ? 128 ASP A OD2  3  
ATOM 6452  H H    . ASP A 1 109 ? -2.399  -4.819  13.710  1.00 0.00 ? 128 ASP A H    3  
ATOM 6453  H HA   . ASP A 1 109 ? -0.234  -3.120  13.867  1.00 0.00 ? 128 ASP A HA   3  
ATOM 6454  H HB2  . ASP A 1 109 ? 0.056   -5.207  15.733  2.00 0.00 ? 128 ASP A HB2  3  
ATOM 6455  H HB3  . ASP A 1 109 ? 1.145   -5.596  14.409  2.00 0.00 ? 128 ASP A HB3  3  
ATOM 6456  N N    . CYS A 1 110 ? 0.284   -6.025  12.467  1.00 0.00 ? 129 CYS A N    3  
ATOM 6457  C CA   . CYS A 1 110 ? 0.551   -6.692  11.199  1.00 0.00 ? 129 CYS A CA   3  
ATOM 6458  C C    . CYS A 1 110 ? -0.477  -7.786  10.927  1.00 0.00 ? 129 CYS A C    3  
ATOM 6459  O O    . CYS A 1 110 ? -1.556  -7.516  10.401  1.00 0.00 ? 129 CYS A O    3  
ATOM 6460  C CB   . CYS A 1 110 ? 1.961   -7.285  11.200  1.00 0.00 ? 129 CYS A CB   3  
ATOM 6461  S SG   . CYS A 1 110 ? 3.246   -6.141  10.601  1.00 0.00 ? 129 CYS A SG   3  
ATOM 6462  H H    . CYS A 1 110 ? 0.427   -6.512  13.304  1.00 0.00 ? 129 CYS A H    3  
ATOM 6463  H HA   . CYS A 1 110 ? 0.485   -5.951  10.417  1.00 0.00 ? 129 CYS A HA   3  
ATOM 6464  H HB2  . CYS A 1 110 ? 2.222   -7.575  12.207  2.00 0.00 ? 129 CYS A HB2  3  
ATOM 6465  H HB3  . CYS A 1 110 ? 1.976   -8.159  10.565  2.00 0.00 ? 129 CYS A HB3  3  
ATOM 6466  N N    . THR A 1 111 ? -0.133  -9.020  11.284  1.00 0.00 ? 130 THR A N    3  
ATOM 6467  C CA   . THR A 1 111 ? -1.027  -10.152 11.074  1.00 0.00 ? 130 THR A CA   3  
ATOM 6468  C C    . THR A 1 111 ? -1.236  -10.415 9.585   1.00 0.00 ? 130 THR A C    3  
ATOM 6469  O O    . THR A 1 111 ? -1.279  -9.484  8.781   1.00 0.00 ? 130 THR A O    3  
ATOM 6470  C CB   . THR A 1 111 ? -2.396  -9.923  11.741  1.00 0.00 ? 130 THR A CB   3  
ATOM 6471  O OG1  . THR A 1 111 ? -2.235  -9.154  12.938  1.00 0.00 ? 130 THR A OG1  3  
ATOM 6472  C CG2  . THR A 1 111 ? -3.066  -11.249 12.072  1.00 0.00 ? 130 THR A CG2  3  
ATOM 6473  H H    . THR A 1 111 ? 0.742   -9.172  11.697  1.00 0.00 ? 130 THR A H    3  
ATOM 6474  H HA   . THR A 1 111 ? -0.572  -11.024 11.522  1.00 0.00 ? 130 THR A HA   3  
ATOM 6475  H HB   . THR A 1 111 ? -3.029  -9.379  11.055  1.00 0.00 ? 130 THR A HB   3  
ATOM 6476  H HG1  . THR A 1 111 ? -2.918  -8.481  12.982  1.00 0.00 ? 130 THR A HG1  3  
ATOM 6477  H HG21 . THR A 1 111 ? -3.957  -11.067 12.655  1.00 0.00 ? 130 THR A HG21 3  
ATOM 6478  H HG22 . THR A 1 111 ? -2.384  -11.865 12.640  1.00 0.00 ? 130 THR A HG22 3  
ATOM 6479  H HG23 . THR A 1 111 ? -3.332  -11.756 11.156  1.00 0.00 ? 130 THR A HG23 3  
ATOM 6480  N N    . SER A 1 112 ? -1.361  -11.687 9.225   1.00 0.00 ? 131 SER A N    3  
ATOM 6481  C CA   . SER A 1 112 ? -1.562  -12.071 7.832   1.00 0.00 ? 131 SER A CA   3  
ATOM 6482  C C    . SER A 1 112 ? -2.821  -11.426 7.261   1.00 0.00 ? 131 SER A C    3  
ATOM 6483  O O    . SER A 1 112 ? -3.931  -11.916 7.469   1.00 0.00 ? 131 SER A O    3  
ATOM 6484  C CB   . SER A 1 112 ? -1.653  -13.594 7.709   1.00 0.00 ? 131 SER A CB   3  
ATOM 6485  O OG   . SER A 1 112 ? -2.751  -14.098 8.450   1.00 0.00 ? 131 SER A OG   3  
ATOM 6486  H H    . SER A 1 112 ? -1.316  -12.385 9.911   1.00 0.00 ? 131 SER A H    3  
ATOM 6487  H HA   . SER A 1 112 ? -0.708  -11.725 7.268   1.00 0.00 ? 131 SER A HA   3  
ATOM 6488  H HB2  . SER A 1 112 ? -1.782  -13.862 6.670   2.00 0.00 ? 131 SER A HB2  3  
ATOM 6489  H HB3  . SER A 1 112 ? -0.743  -14.038 8.088   2.00 0.00 ? 131 SER A HB3  3  
ATOM 6490  H HG   . SER A 1 112 ? -2.510  -14.158 9.377   1.00 0.00 ? 131 SER A HG   3  
ATOM 6491  N N    . VAL A 1 113 ? -2.640  -10.327 6.536   1.00 0.00 ? 132 VAL A N    3  
ATOM 6492  C CA   . VAL A 1 113 ? -3.760  -9.615  5.932   1.00 0.00 ? 132 VAL A CA   3  
ATOM 6493  C C    . VAL A 1 113 ? -4.132  -10.223 4.580   1.00 0.00 ? 132 VAL A C    3  
ATOM 6494  O O    . VAL A 1 113 ? -4.706  -9.554  3.720   1.00 0.00 ? 132 VAL A O    3  
ATOM 6495  C CB   . VAL A 1 113 ? -3.444  -8.115  5.756   1.00 0.00 ? 132 VAL A CB   3  
ATOM 6496  C CG1  . VAL A 1 113 ? -2.911  -7.825  4.362   2.00 0.00 ? 132 VAL A CG1  3  
ATOM 6497  C CG2  . VAL A 1 113 ? -4.676  -7.267  6.039   2.00 0.00 ? 132 VAL A CG2  3  
ATOM 6498  H H    . VAL A 1 113 ? -1.731  -9.986  6.404   1.00 0.00 ? 132 VAL A H    3  
ATOM 6499  H HA   . VAL A 1 113 ? -4.606  -9.706  6.597   1.00 0.00 ? 132 VAL A HA   3  
ATOM 6500  H HB   . VAL A 1 113 ? -2.681  -7.852  6.473   1.00 0.00 ? 132 VAL A HB   3  
ATOM 6501  H HG11 . VAL A 1 113 ? -3.719  -7.483  3.733   1.00 0.00 ? 132 VAL A HG11 3  
ATOM 6502  H HG12 . VAL A 1 113 ? -2.488  -8.727  3.945   1.00 0.00 ? 132 VAL A HG12 3  
ATOM 6503  H HG13 . VAL A 1 113 ? -2.150  -7.061  4.419   1.00 0.00 ? 132 VAL A HG13 3  
ATOM 6504  H HG21 . VAL A 1 113 ? -4.560  -6.771  6.992   1.00 0.00 ? 132 VAL A HG21 3  
ATOM 6505  H HG22 . VAL A 1 113 ? -5.551  -7.901  6.067   1.00 0.00 ? 132 VAL A HG22 3  
ATOM 6506  H HG23 . VAL A 1 113 ? -4.791  -6.529  5.260   1.00 0.00 ? 132 VAL A HG23 3  
ATOM 6507  N N    . THR A 1 114 ? -3.807  -11.502 4.405   1.00 0.00 ? 133 THR A N    3  
ATOM 6508  C CA   . THR A 1 114 ? -4.106  -12.217 3.166   1.00 0.00 ? 133 THR A CA   3  
ATOM 6509  C C    . THR A 1 114 ? -5.599  -12.187 2.860   1.00 0.00 ? 133 THR A C    3  
ATOM 6510  O O    . THR A 1 114 ? -6.077  -12.884 1.964   1.00 0.00 ? 133 THR A O    3  
ATOM 6511  C CB   . THR A 1 114 ? -3.646  -13.683 3.249   1.00 0.00 ? 133 THR A CB   3  
ATOM 6512  O OG1  . THR A 1 114 ? -3.266  -14.153 1.950   1.00 0.00 ? 133 THR A OG1  3  
ATOM 6513  C CG2  . THR A 1 114 ? -4.753  -14.563 3.810   1.00 0.00 ? 133 THR A CG2  3  
ATOM 6514  H H    . THR A 1 114 ? -3.356  -11.981 5.132   1.00 0.00 ? 133 THR A H    3  
ATOM 6515  H HA   . THR A 1 114 ? -3.572  -11.737 2.363   1.00 0.00 ? 133 THR A HA   3  
ATOM 6516  H HB   . THR A 1 114 ? -2.792  -13.740 3.908   1.00 0.00 ? 133 THR A HB   3  
ATOM 6517  H HG1  . THR A 1 114 ? -2.319  -14.312 1.931   1.00 0.00 ? 133 THR A HG1  3  
ATOM 6518  H HG21 . THR A 1 114 ? -5.656  -13.978 3.922   1.00 0.00 ? 133 THR A HG21 3  
ATOM 6519  H HG22 . THR A 1 114 ? -4.453  -14.950 4.772   1.00 0.00 ? 133 THR A HG22 3  
ATOM 6520  H HG23 . THR A 1 114 ? -4.939  -15.383 3.133   1.00 0.00 ? 133 THR A HG23 3  
ATOM 6521  N N    . ASP A 1 115 ? -6.327  -11.385 3.618   1.00 0.00 ? 134 ASP A N    3  
ATOM 6522  C CA   . ASP A 1 115 ? -7.769  -11.264 3.450   1.00 0.00 ? 134 ASP A CA   3  
ATOM 6523  C C    . ASP A 1 115 ? -8.134  -10.621 2.115   1.00 0.00 ? 134 ASP A C    3  
ATOM 6524  O O    . ASP A 1 115 ? -8.420  -11.316 1.140   1.00 0.00 ? 134 ASP A O    3  
ATOM 6525  C CB   . ASP A 1 115 ? -8.366  -10.453 4.601   1.00 0.00 ? 134 ASP A CB   3  
ATOM 6526  C CG   . ASP A 1 115 ? -9.129  -11.314 5.589   1.00 0.00 ? 134 ASP A CG   3  
ATOM 6527  O OD1  . ASP A 1 115 ? -8.517  -12.229 6.177   1.00 0.00 ? 134 ASP A OD1  3  
ATOM 6528  O OD2  . ASP A 1 115 ? -10.342 -11.074 5.773   1.00 0.00 ? 134 ASP A OD2  3  
ATOM 6529  H H    . ASP A 1 115 ? -5.883  -10.864 4.319   1.00 0.00 ? 134 ASP A H    3  
ATOM 6530  H HA   . ASP A 1 115 ? -8.185  -12.259 3.478   1.00 0.00 ? 134 ASP A HA   3  
ATOM 6531  H HB2  . ASP A 1 115 ? -7.569  -9.952  5.132   2.00 0.00 ? 134 ASP A HB2  3  
ATOM 6532  H HB3  . ASP A 1 115 ? -9.045  -9.713  4.198   2.00 0.00 ? 134 ASP A HB3  3  
ATOM 6533  N N    . LEU A 1 116 ? -8.149  -9.291  2.086   1.00 0.00 ? 135 LEU A N    3  
ATOM 6534  C CA   . LEU A 1 116 ? -8.511  -8.551  0.878   1.00 0.00 ? 135 LEU A CA   3  
ATOM 6535  C C    . LEU A 1 116 ? -9.798  -9.114  0.267   1.00 0.00 ? 135 LEU A C    3  
ATOM 6536  O O    . LEU A 1 116 ? -9.911  -9.241  -0.952  1.00 0.00 ? 135 LEU A O    3  
ATOM 6537  C CB   . LEU A 1 116 ? -7.390  -8.621  -0.159  1.00 0.00 ? 135 LEU A CB   3  
ATOM 6538  C CG   . LEU A 1 116 ? -5.989  -8.863  0.403   1.00 0.00 ? 135 LEU A CG   3  
ATOM 6539  C CD1  . LEU A 1 116 ? -4.950  -8.830  -0.704  2.00 0.00 ? 135 LEU A CD1  3  
ATOM 6540  C CD2  . LEU A 1 116 ? -5.654  -7.823  1.453   2.00 0.00 ? 135 LEU A CD2  3  
ATOM 6541  H H    . LEU A 1 116 ? -7.930  -8.796  2.902   1.00 0.00 ? 135 LEU A H    3  
ATOM 6542  H HA   . LEU A 1 116 ? -8.667  -7.518  1.160   1.00 0.00 ? 135 LEU A HA   3  
ATOM 6543  H HB2  . LEU A 1 116 ? -7.627  -9.412  -0.852  2.00 0.00 ? 135 LEU A HB2  3  
ATOM 6544  H HB3  . LEU A 1 116 ? -7.378  -7.688  -0.704  2.00 0.00 ? 135 LEU A HB3  3  
ATOM 6545  H HG   . LEU A 1 116 ? -5.956  -9.837  0.869   1.00 0.00 ? 135 LEU A HG   3  
ATOM 6546  H HD11 . LEU A 1 116 ? -4.203  -8.085  -0.469  1.00 0.00 ? 135 LEU A HD11 3  
ATOM 6547  H HD12 . LEU A 1 116 ? -5.428  -8.579  -1.639  1.00 0.00 ? 135 LEU A HD12 3  
ATOM 6548  H HD13 . LEU A 1 116 ? -4.481  -9.798  -0.786  1.00 0.00 ? 135 LEU A HD13 3  
ATOM 6549  H HD21 . LEU A 1 116 ? -4.597  -7.603  1.411   1.00 0.00 ? 135 LEU A HD21 3  
ATOM 6550  H HD22 . LEU A 1 116 ? -5.905  -8.205  2.431   1.00 0.00 ? 135 LEU A HD22 3  
ATOM 6551  H HD23 . LEU A 1 116 ? -6.217  -6.924  1.257   1.00 0.00 ? 135 LEU A HD23 3  
ATOM 6552  N N    . PRO A 1 117 ? -10.776 -9.485  1.112   1.00 0.00 ? 136 PRO A N    3  
ATOM 6553  C CA   . PRO A 1 117 ? -12.052 -10.064 0.659   1.00 0.00 ? 136 PRO A CA   3  
ATOM 6554  C C    . PRO A 1 117 ? -12.907 -9.111  -0.169  1.00 0.00 ? 136 PRO A C    3  
ATOM 6555  O O    . PRO A 1 117 ? -14.009 -9.464  -0.586  1.00 0.00 ? 136 PRO A O    3  
ATOM 6556  C CB   . PRO A 1 117 ? -12.786 -10.389 1.960   1.00 0.00 ? 136 PRO A CB   3  
ATOM 6557  C CG   . PRO A 1 117 ? -12.138 -9.536  2.994   1.00 0.00 ? 136 PRO A CG   3  
ATOM 6558  C CD   . PRO A 1 117 ? -10.705 -9.390  2.579   1.00 0.00 ? 136 PRO A CD   3  
ATOM 6559  H HA   . PRO A 1 117 ? -11.893 -10.975 0.102   1.00 0.00 ? 136 PRO A HA   3  
ATOM 6560  H HB2  . PRO A 1 117 ? -13.828 -10.138 1.845   2.00 0.00 ? 136 PRO A HB2  3  
ATOM 6561  H HB3  . PRO A 1 117 ? -12.682 -11.440 2.186   2.00 0.00 ? 136 PRO A HB3  3  
ATOM 6562  H HG2  . PRO A 1 117 ? -12.619 -8.568  3.024   2.00 0.00 ? 136 PRO A HG2  3  
ATOM 6563  H HG3  . PRO A 1 117 ? -12.202 -10.015 3.958   2.00 0.00 ? 136 PRO A HG3  3  
ATOM 6564  H HD2  . PRO A 1 117 ? -10.318 -8.430  2.887   2.00 0.00 ? 136 PRO A HD2  3  
ATOM 6565  H HD3  . PRO A 1 117 ? -10.109 -10.193 2.990   2.00 0.00 ? 136 PRO A HD3  3  
ATOM 6566  N N    . ASN A 1 118 ? -12.414 -7.905  -0.390  1.00 0.00 ? 137 ASN A N    3  
ATOM 6567  C CA   . ASN A 1 118 ? -13.168 -6.913  -1.157  1.00 0.00 ? 137 ASN A CA   3  
ATOM 6568  C C    . ASN A 1 118 ? -12.825 -6.963  -2.642  1.00 0.00 ? 137 ASN A C    3  
ATOM 6569  O O    . ASN A 1 118 ? -13.499 -6.338  -3.460  1.00 0.00 ? 137 ASN A O    3  
ATOM 6570  C CB   . ASN A 1 118 ? -12.927 -5.505  -0.611  1.00 0.00 ? 137 ASN A CB   3  
ATOM 6571  C CG   . ASN A 1 118 ? -13.978 -5.082  0.395   1.00 0.00 ? 137 ASN A CG   3  
ATOM 6572  O OD1  . ASN A 1 118 ? -14.754 -4.158  0.150   1.00 0.00 ? 137 ASN A OD1  3  
ATOM 6573  N ND2  . ASN A 1 118 ? -14.010 -5.758  1.537   4.00 0.00 ? 137 ASN A ND2  3  
ATOM 6574  H H    . ASN A 1 118 ? -11.536 -7.675  -0.023  1.00 0.00 ? 137 ASN A H    3  
ATOM 6575  H HA   . ASN A 1 118 ? -14.216 -7.149  -1.044  1.00 0.00 ? 137 ASN A HA   3  
ATOM 6576  H HB2  . ASN A 1 118 ? -11.962 -5.473  -0.127  2.00 0.00 ? 137 ASN A HB2  3  
ATOM 6577  H HB3  . ASN A 1 118 ? -12.938 -4.800  -1.432  2.00 0.00 ? 137 ASN A HB3  3  
ATOM 6578  H HD21 . ASN A 1 118 ? -13.357 -6.484  1.665   5.00 0.00 ? 137 ASN A HD21 3  
ATOM 6579  H HD22 . ASN A 1 118 ? -14.683 -5.507  2.208   5.00 0.00 ? 137 ASN A HD22 3  
ATOM 6580  N N    . ALA A 1 119 ? -11.784 -7.709  -2.991  1.00 0.00 ? 138 ALA A N    3  
ATOM 6581  C CA   . ALA A 1 119 ? -11.380 -7.828  -4.386  1.00 0.00 ? 138 ALA A CA   3  
ATOM 6582  C C    . ALA A 1 119 ? -12.433 -8.590  -5.187  1.00 0.00 ? 138 ALA A C    3  
ATOM 6583  O O    . ALA A 1 119 ? -13.562 -8.764  -4.730  1.00 0.00 ? 138 ALA A O    3  
ATOM 6584  C CB   . ALA A 1 119 ? -10.025 -8.509  -4.494  1.00 0.00 ? 138 ALA A CB   3  
ATOM 6585  H H    . ALA A 1 119 ? -11.283 -8.191  -2.302  1.00 0.00 ? 138 ALA A H    3  
ATOM 6586  H HA   . ALA A 1 119 ? -11.289 -6.831  -4.791  1.00 0.00 ? 138 ALA A HA   3  
ATOM 6587  H HB1  . ALA A 1 119 ? -10.164 -9.567  -4.657  1.00 0.00 ? 138 ALA A HB1  3  
ATOM 6588  H HB2  . ALA A 1 119 ? -9.470  -8.355  -3.579  1.00 0.00 ? 138 ALA A HB2  3  
ATOM 6589  H HB3  . ALA A 1 119 ? -9.476  -8.085  -5.323  1.00 0.00 ? 138 ALA A HB3  3  
ATOM 6590  N N    . PHE A 1 120 ? -12.063 -9.040  -6.382  1.00 0.00 ? 139 PHE A N    3  
ATOM 6591  C CA   . PHE A 1 120 ? -12.991 -9.777  -7.232  1.00 0.00 ? 139 PHE A CA   3  
ATOM 6592  C C    . PHE A 1 120 ? -12.517 -11.209 -7.449  1.00 0.00 ? 139 PHE A C    3  
ATOM 6593  O O    . PHE A 1 120 ? -11.394 -11.566 -7.090  1.00 0.00 ? 139 PHE A O    3  
ATOM 6594  C CB   . PHE A 1 120 ? -13.175 -9.074  -8.584  1.00 0.00 ? 139 PHE A CB   3  
ATOM 6595  C CG   . PHE A 1 120 ? -12.203 -7.960  -8.867  1.00 0.00 ? 139 PHE A CG   3  
ATOM 6596  C CD1  . PHE A 1 120 ? -11.907 -7.010  -7.903  1.00 0.00 ? 139 PHE A CD1  3  
ATOM 6597  C CD2  . PHE A 1 120 ? -11.589 -7.865  -10.106 1.00 0.00 ? 139 PHE A CD2  3  
ATOM 6598  C CE1  . PHE A 1 120 ? -11.017 -5.988  -8.168  1.00 0.00 ? 139 PHE A CE1  3  
ATOM 6599  C CE2  . PHE A 1 120 ? -10.698 -6.843  -10.377 1.00 0.00 ? 139 PHE A CE2  3  
ATOM 6600  C CZ   . PHE A 1 120 ? -10.411 -5.903  -9.405  1.00 0.00 ? 139 PHE A CZ   3  
ATOM 6601  H H    . PHE A 1 120 ? -11.151 -8.872  -6.698  1.00 0.00 ? 139 PHE A H    3  
ATOM 6602  H HA   . PHE A 1 120 ? -13.945 -9.805  -6.724  1.00 0.00 ? 139 PHE A HA   3  
ATOM 6603  H HB2  . PHE A 1 120 ? -13.071 -9.807  -9.372  2.00 0.00 ? 139 PHE A HB2  3  
ATOM 6604  H HB3  . PHE A 1 120 ? -14.172 -8.656  -8.625  2.00 0.00 ? 139 PHE A HB3  3  
ATOM 6605  H HD1  . PHE A 1 120 ? -12.379 -7.075  -6.934  1.00 0.00 ? 139 PHE A HD1  3  
ATOM 6606  H HD2  . PHE A 1 120 ? -11.812 -8.600  -10.866 1.00 0.00 ? 139 PHE A HD2  3  
ATOM 6607  H HE1  . PHE A 1 120 ? -10.794 -5.256  -7.404  1.00 0.00 ? 139 PHE A HE1  3  
ATOM 6608  H HE2  . PHE A 1 120 ? -10.226 -6.780  -11.346 1.00 0.00 ? 139 PHE A HE2  3  
ATOM 6609  H HZ   . PHE A 1 120 ? -9.715  -5.105  -9.616  1.00 0.00 ? 139 PHE A HZ   3  
ATOM 6610  N N    . ASP A 1 121 ? -13.385 -12.028 -8.035  1.00 0.00 ? 140 ASP A N    3  
ATOM 6611  C CA   . ASP A 1 121 ? -13.064 -13.426 -8.298  1.00 0.00 ? 140 ASP A CA   3  
ATOM 6612  C C    . ASP A 1 121 ? -12.010 -13.552 -9.392  1.00 0.00 ? 140 ASP A C    3  
ATOM 6613  O O    . ASP A 1 121 ? -12.147 -12.977 -10.472 1.00 0.00 ? 140 ASP A O    3  
ATOM 6614  C CB   . ASP A 1 121 ? -14.326 -14.192 -8.701  1.00 0.00 ? 140 ASP A CB   3  
ATOM 6615  C CG   . ASP A 1 121 ? -14.264 -15.660 -8.327  1.00 0.00 ? 140 ASP A CG   3  
ATOM 6616  O OD1  . ASP A 1 121 ? -14.323 -15.968 -7.118  1.00 0.00 ? 140 ASP A OD1  3  
ATOM 6617  O OD2  . ASP A 1 121 ? -14.159 -16.502 -9.243  1.00 0.00 ? 140 ASP A OD2  3  
ATOM 6618  H H    . ASP A 1 121 ? -14.265 -11.684 -8.294  1.00 0.00 ? 140 ASP A H    3  
ATOM 6619  H HA   . ASP A 1 121 ? -12.671 -13.853 -7.386  1.00 0.00 ? 140 ASP A HA   3  
ATOM 6620  H HB2  . ASP A 1 121 ? -15.179 -13.750 -8.207  2.00 0.00 ? 140 ASP A HB2  3  
ATOM 6621  H HB3  . ASP A 1 121 ? -14.458 -14.118 -9.770  2.00 0.00 ? 140 ASP A HB3  3  
ATOM 6622  N N    . GLY A 1 122 ? -10.959 -14.311 -9.102  1.00 0.00 ? 141 GLY A N    3  
ATOM 6623  C CA   . GLY A 1 122 ? -9.893  -14.506 -10.066 1.00 0.00 ? 141 GLY A CA   3  
ATOM 6624  C C    . GLY A 1 122 ? -8.722  -15.278 -9.489  1.00 0.00 ? 141 GLY A C    3  
ATOM 6625  O O    . GLY A 1 122 ? -8.412  -15.146 -8.305  1.00 0.00 ? 141 GLY A O    3  
ATOM 6626  H H    . GLY A 1 122 ? -10.907 -14.744 -8.225  1.00 0.00 ? 141 GLY A H    3  
ATOM 6627  H HA2  . GLY A 1 122 ? -10.285 -15.050 -10.915 2.00 0.00 ? 141 GLY A HA2  3  
ATOM 6628  H HA3  . GLY A 1 122 ? -9.543  -13.539 -10.401 2.00 0.00 ? 141 GLY A HA3  3  
ATOM 6629  N N    . PRO A 1 123 ? -8.053  -16.103 -10.307 1.00 0.00 ? 142 PRO A N    3  
ATOM 6630  C CA   . PRO A 1 123 ? -6.908  -16.905 -9.867  1.00 0.00 ? 142 PRO A CA   3  
ATOM 6631  C C    . PRO A 1 123 ? -5.678  -16.048 -9.578  1.00 0.00 ? 142 PRO A C    3  
ATOM 6632  O O    . PRO A 1 123 ? -4.546  -16.519 -9.681  1.00 0.00 ? 142 PRO A O    3  
ATOM 6633  C CB   . PRO A 1 123 ? -6.633  -17.843 -11.055 1.00 0.00 ? 142 PRO A CB   3  
ATOM 6634  C CG   . PRO A 1 123 ? -7.825  -17.713 -11.950 1.00 0.00 ? 142 PRO A CG   3  
ATOM 6635  C CD   . PRO A 1 123 ? -8.358  -16.331 -11.720 1.00 0.00 ? 142 PRO A CD   3  
ATOM 6636  H HA   . PRO A 1 123 ? -7.149  -17.490 -8.992  1.00 0.00 ? 142 PRO A HA   3  
ATOM 6637  H HB2  . PRO A 1 123 ? -5.729  -17.532 -11.558 2.00 0.00 ? 142 PRO A HB2  3  
ATOM 6638  H HB3  . PRO A 1 123 ? -6.520  -18.855 -10.696 2.00 0.00 ? 142 PRO A HB3  3  
ATOM 6639  H HG2  . PRO A 1 123 ? -7.524  -17.833 -12.981 2.00 0.00 ? 142 PRO A HG2  3  
ATOM 6640  H HG3  . PRO A 1 123 ? -8.566  -18.451 -11.683 2.00 0.00 ? 142 PRO A HG3  3  
ATOM 6641  H HD2  . PRO A 1 123 ? -7.845  -15.616 -12.348 2.00 0.00 ? 142 PRO A HD2  3  
ATOM 6642  H HD3  . PRO A 1 123 ? -9.422  -16.300 -11.897 2.00 0.00 ? 142 PRO A HD3  3  
ATOM 6643  N N    . ILE A 1 124 ? -5.905  -14.788 -9.219  1.00 0.00 ? 143 ILE A N    3  
ATOM 6644  C CA   . ILE A 1 124 ? -4.812  -13.870 -8.920  1.00 0.00 ? 143 ILE A CA   3  
ATOM 6645  C C    . ILE A 1 124 ? -4.137  -14.223 -7.599  1.00 0.00 ? 143 ILE A C    3  
ATOM 6646  O O    . ILE A 1 124 ? -4.550  -13.760 -6.537  1.00 0.00 ? 143 ILE A O    3  
ATOM 6647  C CB   . ILE A 1 124 ? -5.300  -12.411 -8.859  1.00 0.00 ? 143 ILE A CB   3  
ATOM 6648  C CG1  . ILE A 1 124 ? -5.889  -11.992 -10.207 1.00 0.00 ? 143 ILE A CG1  3  
ATOM 6649  C CG2  . ILE A 1 124 ? -4.159  -11.486 -8.459  1.00 0.00 ? 143 ILE A CG2  3  
ATOM 6650  C CD1  . ILE A 1 124 ? -4.857  -11.783 -11.294 1.00 0.00 ? 143 ILE A CD1  3  
ATOM 6651  H H    . ILE A 1 124 ? -6.829  -14.466 -9.155  1.00 0.00 ? 143 ILE A H    3  
ATOM 6652  H HA   . ILE A 1 124 ? -4.086  -13.948 -9.714  1.00 0.00 ? 143 ILE A HA   3  
ATOM 6653  H HB   . ILE A 1 124 ? -6.067  -12.344 -8.102  1.00 0.00 ? 143 ILE A HB   3  
ATOM 6654  H HG12 . ILE A 1 124 ? -6.575  -12.755 -10.545 2.00 0.00 ? 143 ILE A HG12 3  
ATOM 6655  H HG13 . ILE A 1 124 ? -6.429  -11.064 -10.083 2.00 0.00 ? 143 ILE A HG13 3  
ATOM 6656  H HG21 . ILE A 1 124 ? -3.238  -12.047 -8.418  1.00 0.00 ? 143 ILE A HG21 3  
ATOM 6657  H HG22 . ILE A 1 124 ? -4.365  -11.059 -7.489  1.00 0.00 ? 143 ILE A HG22 3  
ATOM 6658  H HG23 . ILE A 1 124 ? -4.066  -10.694 -9.187  1.00 0.00 ? 143 ILE A HG23 3  
ATOM 6659  H HD11 . ILE A 1 124 ? -4.235  -12.662 -11.372 1.00 0.00 ? 143 ILE A HD11 3  
ATOM 6660  H HD12 . ILE A 1 124 ? -4.245  -10.929 -11.050 1.00 0.00 ? 143 ILE A HD12 3  
ATOM 6661  H HD13 . ILE A 1 124 ? -5.355  -11.612 -12.236 1.00 0.00 ? 143 ILE A HD13 3  
ATOM 6662  N N    . THR A 1 125 ? -3.092  -15.041 -7.674  1.00 0.00 ? 144 THR A N    3  
ATOM 6663  C CA   . THR A 1 125 ? -2.356  -15.448 -6.485  1.00 0.00 ? 144 THR A CA   3  
ATOM 6664  C C    . THR A 1 125 ? -1.614  -14.263 -5.878  1.00 0.00 ? 144 THR A C    3  
ATOM 6665  O O    . THR A 1 125 ? -0.408  -14.108 -6.067  1.00 0.00 ? 144 THR A O    3  
ATOM 6666  C CB   . THR A 1 125 ? -1.346  -16.567 -6.802  1.00 0.00 ? 144 THR A CB   3  
ATOM 6667  O OG1  . THR A 1 125 ? -1.661  -17.169 -8.063  1.00 0.00 ? 144 THR A OG1  3  
ATOM 6668  C CG2  . THR A 1 125 ? -1.355  -17.627 -5.712  1.00 0.00 ? 144 THR A CG2  3  
ATOM 6669  H H    . THR A 1 125 ? -2.807  -15.374 -8.550  1.00 0.00 ? 144 THR A H    3  
ATOM 6670  H HA   . THR A 1 125 ? -3.067  -15.825 -5.764  1.00 0.00 ? 144 THR A HA   3  
ATOM 6671  H HB   . THR A 1 125 ? -0.357  -16.134 -6.855  1.00 0.00 ? 144 THR A HB   3  
ATOM 6672  H HG1  . THR A 1 125 ? -2.526  -17.582 -8.014  1.00 0.00 ? 144 THR A HG1  3  
ATOM 6673  H HG21 . THR A 1 125 ? -0.413  -17.610 -5.185  1.00 0.00 ? 144 THR A HG21 3  
ATOM 6674  H HG22 . THR A 1 125 ? -1.500  -18.600 -6.158  1.00 0.00 ? 144 THR A HG22 3  
ATOM 6675  H HG23 . THR A 1 125 ? -2.158  -17.426 -5.020  1.00 0.00 ? 144 THR A HG23 3  
ATOM 6676  N N    . ILE A 1 126 ? -2.346  -13.426 -5.151  1.00 0.00 ? 145 ILE A N    3  
ATOM 6677  C CA   . ILE A 1 126 ? -1.764  -12.249 -4.521  1.00 0.00 ? 145 ILE A CA   3  
ATOM 6678  C C    . ILE A 1 126 ? -1.044  -12.609 -3.228  1.00 0.00 ? 145 ILE A C    3  
ATOM 6679  O O    . ILE A 1 126 ? -1.625  -13.206 -2.322  1.00 0.00 ? 145 ILE A O    3  
ATOM 6680  C CB   . ILE A 1 126 ? -2.838  -11.182 -4.220  1.00 0.00 ? 145 ILE A CB   3  
ATOM 6681  C CG1  . ILE A 1 126 ? -2.688  -10.001 -5.178  1.00 0.00 ? 145 ILE A CG1  3  
ATOM 6682  C CG2  . ILE A 1 126 ? -2.748  -10.710 -2.773  1.00 0.00 ? 145 ILE A CG2  3  
ATOM 6683  C CD1  . ILE A 1 126 ? -3.257  -8.706  -4.648  1.00 0.00 ? 145 ILE A CD1  3  
ATOM 6684  H H    . ILE A 1 126 ? -3.304  -13.601 -5.041  1.00 0.00 ? 145 ILE A H    3  
ATOM 6685  H HA   . ILE A 1 126 ? -1.049  -11.822 -5.211  1.00 0.00 ? 145 ILE A HA   3  
ATOM 6686  H HB   . ILE A 1 126 ? -3.809  -11.631 -4.365  1.00 0.00 ? 145 ILE A HB   3  
ATOM 6687  H HG12 . ILE A 1 126 ? -1.640  -9.843  -5.384  2.00 0.00 ? 145 ILE A HG12 3  
ATOM 6688  H HG13 . ILE A 1 126 ? -3.197  -10.232 -6.100  2.00 0.00 ? 145 ILE A HG13 3  
ATOM 6689  H HG21 . ILE A 1 126 ? -3.548  -10.011 -2.571  1.00 0.00 ? 145 ILE A HG21 3  
ATOM 6690  H HG22 . ILE A 1 126 ? -1.797  -10.222 -2.613  1.00 0.00 ? 145 ILE A HG22 3  
ATOM 6691  H HG23 . ILE A 1 126 ? -2.834  -11.558 -2.111  1.00 0.00 ? 145 ILE A HG23 3  
ATOM 6692  H HD11 . ILE A 1 126 ? -2.717  -8.411  -3.760  1.00 0.00 ? 145 ILE A HD11 3  
ATOM 6693  H HD12 . ILE A 1 126 ? -4.300  -8.848  -4.405  1.00 0.00 ? 145 ILE A HD12 3  
ATOM 6694  H HD13 . ILE A 1 126 ? -3.163  -7.937  -5.400  1.00 0.00 ? 145 ILE A HD13 3  
ATOM 6695  N N    . THR A 1 127 ? 0.225   -12.228 -3.147  1.00 0.00 ? 146 THR A N    3  
ATOM 6696  C CA   . THR A 1 127 ? 1.026   -12.491 -1.965  1.00 0.00 ? 146 THR A CA   3  
ATOM 6697  C C    . THR A 1 127 ? 1.464   -11.180 -1.326  1.00 0.00 ? 146 THR A C    3  
ATOM 6698  O O    . THR A 1 127 ? 2.359   -10.500 -1.828  1.00 0.00 ? 146 THR A O    3  
ATOM 6699  C CB   . THR A 1 127 ? 2.270   -13.329 -2.296  1.00 0.00 ? 146 THR A CB   3  
ATOM 6700  O OG1  . THR A 1 127 ? 1.888   -14.678 -2.596  1.00 0.00 ? 146 THR A OG1  3  
ATOM 6701  C CG2  . THR A 1 127 ? 3.237   -13.316 -1.127  1.00 0.00 ? 146 THR A CG2  3  
ATOM 6702  H H    . THR A 1 127 ? 0.630   -11.748 -3.898  1.00 0.00 ? 146 THR A H    3  
ATOM 6703  H HA   . THR A 1 127 ? 0.419   -13.041 -1.262  1.00 0.00 ? 146 THR A HA   3  
ATOM 6704  H HB   . THR A 1 127 ? 2.759   -12.899 -3.157  1.00 0.00 ? 146 THR A HB   3  
ATOM 6705  H HG1  . THR A 1 127 ? 2.668   -15.236 -2.605  1.00 0.00 ? 146 THR A HG1  3  
ATOM 6706  H HG21 . THR A 1 127 ? 2.726   -12.949 -0.247  1.00 0.00 ? 146 THR A HG21 3  
ATOM 6707  H HG22 . THR A 1 127 ? 4.070   -12.670 -1.357  1.00 0.00 ? 146 THR A HG22 3  
ATOM 6708  H HG23 . THR A 1 127 ? 3.595   -14.318 -0.944  1.00 0.00 ? 146 THR A HG23 3  
ATOM 6709  N N    . ILE A 1 128 ? 0.815   -10.824 -0.229  1.00 0.00 ? 147 ILE A N    3  
ATOM 6710  C CA   . ILE A 1 128 ? 1.120   -9.583  0.471   1.00 0.00 ? 147 ILE A CA   3  
ATOM 6711  C C    . ILE A 1 128 ? 2.271   -9.752  1.455   1.00 0.00 ? 147 ILE A C    3  
ATOM 6712  O O    . ILE A 1 128 ? 2.206   -10.570 2.371   1.00 0.00 ? 147 ILE A O    3  
ATOM 6713  C CB   . ILE A 1 128 ? -0.114  -9.064  1.226   1.00 0.00 ? 147 ILE A CB   3  
ATOM 6714  C CG1  . ILE A 1 128 ? -1.383  -9.357  0.430   1.00 0.00 ? 147 ILE A CG1  3  
ATOM 6715  C CG2  . ILE A 1 128 ? 0.011   -7.578  1.498   1.00 0.00 ? 147 ILE A CG2  3  
ATOM 6716  C CD1  . ILE A 1 128 ? -2.182  -10.511 0.978   1.00 0.00 ? 147 ILE A CD1  3  
ATOM 6717  H H    . ILE A 1 128 ? 0.102   -11.403 0.115   1.00 0.00 ? 147 ILE A H    3  
ATOM 6718  H HA   . ILE A 1 128 ? 1.398   -8.845  -0.268  1.00 0.00 ? 147 ILE A HA   3  
ATOM 6719  H HB   . ILE A 1 128 ? -0.168  -9.574  2.176   1.00 0.00 ? 147 ILE A HB   3  
ATOM 6720  H HG12 . ILE A 1 128 ? -2.015  -8.481  0.435   2.00 0.00 ? 147 ILE A HG12 3  
ATOM 6721  H HG13 . ILE A 1 128 ? -1.115  -9.592  -0.589  2.00 0.00 ? 147 ILE A HG13 3  
ATOM 6722  H HG21 . ILE A 1 128 ? -0.281  -7.024  0.617   1.00 0.00 ? 147 ILE A HG21 3  
ATOM 6723  H HG22 . ILE A 1 128 ? 1.034   -7.342  1.749   1.00 0.00 ? 147 ILE A HG22 3  
ATOM 6724  H HG23 . ILE A 1 128 ? -0.634  -7.309  2.321   1.00 0.00 ? 147 ILE A HG23 3  
ATOM 6725  H HD11 . ILE A 1 128 ? -1.561  -11.396 1.009   1.00 0.00 ? 147 ILE A HD11 3  
ATOM 6726  H HD12 . ILE A 1 128 ? -3.037  -10.692 0.343   1.00 0.00 ? 147 ILE A HD12 3  
ATOM 6727  H HD13 . ILE A 1 128 ? -2.518  -10.271 1.977   1.00 0.00 ? 147 ILE A HD13 3  
ATOM 6728  N N    . VAL A 1 129 ? 3.319   -8.958  1.263   1.00 0.00 ? 148 VAL A N    3  
ATOM 6729  C CA   . VAL A 1 129 ? 4.485   -9.001  2.136   1.00 0.00 ? 148 VAL A CA   3  
ATOM 6730  C C    . VAL A 1 129 ? 4.373   -7.942  3.230   1.00 0.00 ? 148 VAL A C    3  
ATOM 6731  O O    . VAL A 1 129 ? 4.294   -6.748  2.943   1.00 0.00 ? 148 VAL A O    3  
ATOM 6732  C CB   . VAL A 1 129 ? 5.790   -8.777  1.348   1.00 0.00 ? 148 VAL A CB   3  
ATOM 6733  C CG1  . VAL A 1 129 ? 6.996   -8.816  2.276   2.00 0.00 ? 148 VAL A CG1  3  
ATOM 6734  C CG2  . VAL A 1 129 ? 5.938   -9.811  0.242   2.00 0.00 ? 148 VAL A CG2  3  
ATOM 6735  H H    . VAL A 1 129 ? 3.304   -8.323  0.518   1.00 0.00 ? 148 VAL A H    3  
ATOM 6736  H HA   . VAL A 1 129 ? 4.525   -9.977  2.594   1.00 0.00 ? 148 VAL A HA   3  
ATOM 6737  H HB   . VAL A 1 129 ? 5.742   -7.798  0.894   1.00 0.00 ? 148 VAL A HB   3  
ATOM 6738  H HG11 . VAL A 1 129 ? 7.839   -8.347  1.789   1.00 0.00 ? 148 VAL A HG11 3  
ATOM 6739  H HG12 . VAL A 1 129 ? 7.239   -9.843  2.506   1.00 0.00 ? 148 VAL A HG12 3  
ATOM 6740  H HG13 . VAL A 1 129 ? 6.765   -8.287  3.188   1.00 0.00 ? 148 VAL A HG13 3  
ATOM 6741  H HG21 . VAL A 1 129 ? 6.670   -10.549 0.535   1.00 0.00 ? 148 VAL A HG21 3  
ATOM 6742  H HG22 . VAL A 1 129 ? 6.264   -9.322  -0.665  1.00 0.00 ? 148 VAL A HG22 3  
ATOM 6743  H HG23 . VAL A 1 129 ? 4.987   -10.293 0.070   1.00 0.00 ? 148 VAL A HG23 3  
ATOM 6744  N N    . ASN A 1 130 ? 4.358   -8.386  4.482   1.00 0.00 ? 149 ASN A N    3  
ATOM 6745  C CA   . ASN A 1 130 ? 4.243   -7.474  5.615   1.00 0.00 ? 149 ASN A CA   3  
ATOM 6746  C C    . ASN A 1 130 ? 5.583   -6.828  5.948   1.00 0.00 ? 149 ASN A C    3  
ATOM 6747  O O    . ASN A 1 130 ? 6.641   -7.430  5.759   1.00 0.00 ? 149 ASN A O    3  
ATOM 6748  C CB   . ASN A 1 130 ? 3.709   -8.217  6.840   1.00 0.00 ? 149 ASN A CB   3  
ATOM 6749  C CG   . ASN A 1 130 ? 2.226   -7.994  7.061   1.00 0.00 ? 149 ASN A CG   3  
ATOM 6750  O OD1  . ASN A 1 130 ? 1.559   -8.789  7.724   1.00 0.00 ? 149 ASN A OD1  3  
ATOM 6751  N ND2  . ASN A 1 130 ? 1.700   -6.909  6.504   4.00 0.00 ? 149 ASN A ND2  3  
ATOM 6752  H H    . ASN A 1 130 ? 4.418   -9.351  4.648   1.00 0.00 ? 149 ASN A H    3  
ATOM 6753  H HA   . ASN A 1 130 ? 3.542   -6.699  5.344   1.00 0.00 ? 149 ASN A HA   3  
ATOM 6754  H HB2  . ASN A 1 130 ? 3.879   -9.277  6.712   2.00 0.00 ? 149 ASN A HB2  3  
ATOM 6755  H HB3  . ASN A 1 130 ? 4.238   -7.874  7.719   2.00 0.00 ? 149 ASN A HB3  3  
ATOM 6756  H HD21 . ASN A 1 130 ? 2.292   -6.319  5.987   5.00 0.00 ? 149 ASN A HD21 3  
ATOM 6757  H HD22 . ASN A 1 130 ? 0.740   -6.741  6.631   5.00 0.00 ? 149 ASN A HD22 3  
ATOM 6758  N N    . ARG A 1 131 ? 5.524   -5.597  6.451   1.00 0.00 ? 150 ARG A N    3  
ATOM 6759  C CA   . ARG A 1 131 ? 6.726   -4.856  6.821   1.00 0.00 ? 150 ARG A CA   3  
ATOM 6760  C C    . ARG A 1 131 ? 7.558   -5.642  7.829   1.00 0.00 ? 150 ARG A C    3  
ATOM 6761  O O    . ARG A 1 131 ? 8.759   -5.414  7.971   1.00 0.00 ? 150 ARG A O    3  
ATOM 6762  C CB   . ARG A 1 131 ? 6.348   -3.494  7.407   1.00 0.00 ? 150 ARG A CB   3  
ATOM 6763  C CG   . ARG A 1 131 ? 6.651   -2.323  6.486   1.00 0.00 ? 150 ARG A CG   3  
ATOM 6764  C CD   . ARG A 1 131 ? 8.113   -1.911  6.546   1.00 0.00 ? 150 ARG A CD   3  
ATOM 6765  N NE   . ARG A 1 131 ? 8.538   -1.226  5.328   1.00 0.00 ? 150 ARG A NE   3  
ATOM 6766  C CZ   . ARG A 1 131 ? 9.808   -1.001  5.014   4.00 0.00 ? 150 ARG A CZ   3  
ATOM 6767  N NH1  . ARG A 1 131 ? 10.780  -1.406  5.822   5.00 0.00 ? 150 ARG A NH1  3  
ATOM 6768  N NH2  . ARG A 1 131 ? 10.121  -0.373  3.890   5.00 0.00 ? 150 ARG A NH2  3  
ATOM 6769  H H    . ARG A 1 131 ? 4.649   -5.176  6.580   1.00 0.00 ? 150 ARG A H    3  
ATOM 6770  H HA   . ARG A 1 131 ? 7.312   -4.706  5.926   1.00 0.00 ? 150 ARG A HA   3  
ATOM 6771  H HB2  . ARG A 1 131 ? 5.289   -3.490  7.623   2.00 0.00 ? 150 ARG A HB2  3  
ATOM 6772  H HB3  . ARG A 1 131 ? 6.893   -3.349  8.328   2.00 0.00 ? 150 ARG A HB3  3  
ATOM 6773  H HG2  . ARG A 1 131 ? 6.410   -2.605  5.471   2.00 0.00 ? 150 ARG A HG2  3  
ATOM 6774  H HG3  . ARG A 1 131 ? 6.040   -1.481  6.778   2.00 0.00 ? 150 ARG A HG3  3  
ATOM 6775  H HD2  . ARG A 1 131 ? 8.253   -1.248  7.387   2.00 0.00 ? 150 ARG A HD2  3  
ATOM 6776  H HD3  . ARG A 1 131 ? 8.718   -2.795  6.680   2.00 0.00 ? 150 ARG A HD3  3  
ATOM 6777  H HE   . ARG A 1 131 ? 7.838   -0.919  4.713   1.00 0.00 ? 150 ARG A HE   3  
ATOM 6778  H HH11 . ARG A 1 131 ? 10.557  -1.881  6.672   5.00 0.00 ? 150 ARG A HH11 3  
ATOM 6779  H HH12 . ARG A 1 131 ? 11.735  -1.234  5.580   5.00 0.00 ? 150 ARG A HH12 3  
ATOM 6780  H HH21 . ARG A 1 131 ? 9.398   -0.063  3.272   5.00 0.00 ? 150 ARG A HH21 3  
ATOM 6781  H HH22 . ARG A 1 131 ? 11.080  -0.206  3.659   5.00 0.00 ? 150 ARG A HH22 3  
ATOM 6782  N N    . ASP A 1 132 ? 6.910   -6.568  8.530   1.00 0.00 ? 151 ASP A N    3  
ATOM 6783  C CA   . ASP A 1 132 ? 7.587   -7.388  9.527   1.00 0.00 ? 151 ASP A CA   3  
ATOM 6784  C C    . ASP A 1 132 ? 8.287   -8.574  8.870   1.00 0.00 ? 151 ASP A C    3  
ATOM 6785  O O    . ASP A 1 132 ? 8.575   -9.577  9.524   1.00 0.00 ? 151 ASP A O    3  
ATOM 6786  C CB   . ASP A 1 132 ? 6.589   -7.884  10.574  1.00 0.00 ? 151 ASP A CB   3  
ATOM 6787  C CG   . ASP A 1 132 ? 7.173   -7.993  11.969  1.00 0.00 ? 151 ASP A CG   3  
ATOM 6788  O OD1  . ASP A 1 132 ? 7.879   -7.053  12.391  1.00 0.00 ? 151 ASP A OD1  3  
ATOM 6789  O OD2  . ASP A 1 132 ? 6.924   -9.016  12.639  1.00 0.00 ? 151 ASP A OD2  3  
ATOM 6790  H H    . ASP A 1 132 ? 5.952   -6.703  8.372   1.00 0.00 ? 151 ASP A H    3  
ATOM 6791  H HA   . ASP A 1 132 ? 8.330   -6.774  10.013  1.00 0.00 ? 151 ASP A HA   3  
ATOM 6792  H HB2  . ASP A 1 132 ? 5.751   -7.202  10.610  2.00 0.00 ? 151 ASP A HB2  3  
ATOM 6793  H HB3  . ASP A 1 132 ? 6.231   -8.863  10.281  2.00 0.00 ? 151 ASP A HB3  3  
ATOM 6794  N N    . GLY A 1 133 ? 8.556   -8.453  7.575   1.00 0.00 ? 152 GLY A N    3  
ATOM 6795  C CA   . GLY A 1 133 ? 9.219   -9.522  6.851   1.00 0.00 ? 152 GLY A CA   3  
ATOM 6796  C C    . GLY A 1 133 ? 8.374   -10.775 6.740   1.00 0.00 ? 152 GLY A C    3  
ATOM 6797  O O    . GLY A 1 133 ? 8.872   -11.885 6.929   1.00 0.00 ? 152 GLY A O    3  
ATOM 6798  H H    . GLY A 1 133 ? 8.303   -7.630  7.106   1.00 0.00 ? 152 GLY A H    3  
ATOM 6799  H HA2  . GLY A 1 133 ? 9.456   -9.172  5.855   2.00 0.00 ? 152 GLY A HA2  3  
ATOM 6800  H HA3  . GLY A 1 133 ? 10.141  -9.767  7.363   2.00 0.00 ? 152 GLY A HA3  3  
ATOM 6801  N N    . THR A 1 134 ? 7.093   -10.600 6.431   1.00 0.00 ? 153 THR A N    3  
ATOM 6802  C CA   . THR A 1 134 ? 6.180   -11.728 6.294   1.00 0.00 ? 153 THR A CA   3  
ATOM 6803  C C    . THR A 1 134 ? 5.637   -11.825 4.873   1.00 0.00 ? 153 THR A C    3  
ATOM 6804  O O    . THR A 1 134 ? 5.743   -10.879 4.092   1.00 0.00 ? 153 THR A O    3  
ATOM 6805  C CB   . THR A 1 134 ? 5.000   -11.627 7.279   1.00 0.00 ? 153 THR A CB   3  
ATOM 6806  O OG1  . THR A 1 134 ? 3.826   -11.174 6.595   1.00 0.00 ? 153 THR A OG1  3  
ATOM 6807  C CG2  . THR A 1 134 ? 5.327   -10.675 8.420   1.00 0.00 ? 153 THR A CG2  3  
ATOM 6808  H H    . THR A 1 134 ? 6.755   -9.689  6.291   1.00 0.00 ? 153 THR A H    3  
ATOM 6809  H HA   . THR A 1 134 ? 6.729   -12.631 6.518   1.00 0.00 ? 153 THR A HA   3  
ATOM 6810  H HB   . THR A 1 134 ? 4.810   -12.607 7.691   1.00 0.00 ? 153 THR A HB   3  
ATOM 6811  H HG1  . THR A 1 134 ? 3.076   -11.200 7.193   1.00 0.00 ? 153 THR A HG1  3  
ATOM 6812  H HG21 . THR A 1 134 ? 6.325   -10.876 8.782   1.00 0.00 ? 153 THR A HG21 3  
ATOM 6813  H HG22 . THR A 1 134 ? 4.618   -10.819 9.223   1.00 0.00 ? 153 THR A HG22 3  
ATOM 6814  H HG23 . THR A 1 134 ? 5.269   -9.656  8.068   1.00 0.00 ? 153 THR A HG23 3  
ATOM 6815  N N    . ARG A 1 135 ? 5.058   -12.975 4.541   1.00 0.00 ? 154 ARG A N    3  
ATOM 6816  C CA   . ARG A 1 135 ? 4.502   -13.195 3.211   1.00 0.00 ? 154 ARG A CA   3  
ATOM 6817  C C    . ARG A 1 135 ? 3.342   -14.185 3.258   1.00 0.00 ? 154 ARG A C    3  
ATOM 6818  O O    . ARG A 1 135 ? 3.504   -15.325 3.695   1.00 0.00 ? 154 ARG A O    3  
ATOM 6819  C CB   . ARG A 1 135 ? 5.588   -13.710 2.264   1.00 0.00 ? 154 ARG A CB   3  
ATOM 6820  C CG   . ARG A 1 135 ? 6.528   -14.722 2.897   1.00 0.00 ? 154 ARG A CG   3  
ATOM 6821  C CD   . ARG A 1 135 ? 7.940   -14.617 2.342   1.00 0.00 ? 154 ARG A CD   3  
ATOM 6822  N NE   . ARG A 1 135 ? 8.532   -13.307 2.594   1.00 0.00 ? 154 ARG A NE   3  
ATOM 6823  C CZ   . ARG A 1 135 ? 9.840   -13.099 2.707   4.00 0.00 ? 154 ARG A CZ   3  
ATOM 6824  N NH1  . ARG A 1 135 ? 10.692  -14.109 2.591   5.00 0.00 ? 154 ARG A NH1  3  
ATOM 6825  N NH2  . ARG A 1 135 ? 10.308  -11.880 2.936   5.00 0.00 ? 154 ARG A NH2  3  
ATOM 6826  H H    . ARG A 1 135 ? 5.006   -13.694 5.206   1.00 0.00 ? 154 ARG A H    3  
ATOM 6827  H HA   . ARG A 1 135 ? 4.137   -12.247 2.844   1.00 0.00 ? 154 ARG A HA   3  
ATOM 6828  H HB2  . ARG A 1 135 ? 5.114   -14.175 1.412   2.00 0.00 ? 154 ARG A HB2  3  
ATOM 6829  H HB3  . ARG A 1 135 ? 6.175   -12.872 1.920   2.00 0.00 ? 154 ARG A HB3  3  
ATOM 6830  H HG2  . ARG A 1 135 ? 6.561   -14.549 3.965   2.00 0.00 ? 154 ARG A HG2  3  
ATOM 6831  H HG3  . ARG A 1 135 ? 6.151   -15.718 2.705   2.00 0.00 ? 154 ARG A HG3  3  
ATOM 6832  H HD2  . ARG A 1 135 ? 8.553   -15.374 2.807   2.00 0.00 ? 154 ARG A HD2  3  
ATOM 6833  H HD3  . ARG A 1 135 ? 7.906   -14.787 1.276   2.00 0.00 ? 154 ARG A HD3  3  
ATOM 6834  H HE   . ARG A 1 135 ? 7.924   -12.543 2.682   1.00 0.00 ? 154 ARG A HE   3  
ATOM 6835  H HH11 . ARG A 1 135 ? 10.352  -15.033 2.418   5.00 0.00 ? 154 ARG A HH11 3  
ATOM 6836  H HH12 . ARG A 1 135 ? 11.675  -13.945 2.678   5.00 0.00 ? 154 ARG A HH12 3  
ATOM 6837  H HH21 . ARG A 1 135 ? 9.675   -11.110 3.024   5.00 0.00 ? 154 ARG A HH21 3  
ATOM 6838  H HH22 . ARG A 1 135 ? 11.293  -11.730 3.021   5.00 0.00 ? 154 ARG A HH22 3  
ATOM 6839  N N    . TYR A 1 136 ? 2.174   -13.742 2.806   1.00 0.00 ? 155 TYR A N    3  
ATOM 6840  C CA   . TYR A 1 136 ? 0.986   -14.589 2.795   1.00 0.00 ? 155 TYR A CA   3  
ATOM 6841  C C    . TYR A 1 136 ? 0.382   -14.653 1.396   1.00 0.00 ? 155 TYR A C    3  
ATOM 6842  O O    . TYR A 1 136 ? 0.124   -13.622 0.773   1.00 0.00 ? 155 TYR A O    3  
ATOM 6843  C CB   . TYR A 1 136 ? -0.052  -14.069 3.792   1.00 0.00 ? 155 TYR A CB   3  
ATOM 6844  C CG   . TYR A 1 136 ? 0.078   -12.613 4.179   1.00 0.00 ? 155 TYR A CG   3  
ATOM 6845  C CD1  . TYR A 1 136 ? 1.229   -12.138 4.795   1.00 0.00 ? 155 TYR A CD1  3  
ATOM 6846  C CD2  . TYR A 1 136 ? -0.950  -11.714 3.925   1.00 0.00 ? 155 TYR A CD2  3  
ATOM 6847  C CE1  . TYR A 1 136 ? 1.353   -10.808 5.146   1.00 0.00 ? 155 TYR A CE1  3  
ATOM 6848  C CE2  . TYR A 1 136 ? -0.833  -10.383 4.274   1.00 0.00 ? 155 TYR A CE2  3  
ATOM 6849  C CZ   . TYR A 1 136 ? 0.319   -9.935  4.883   1.00 0.00 ? 155 TYR A CZ   3  
ATOM 6850  O OH   . TYR A 1 136 ? 0.435   -8.609  5.226   1.00 0.00 ? 155 TYR A OH   3  
ATOM 6851  H H    . TYR A 1 136 ? 2.109   -12.823 2.469   1.00 0.00 ? 155 TYR A H    3  
ATOM 6852  H HA   . TYR A 1 136 ? 1.288   -15.584 3.088   1.00 0.00 ? 155 TYR A HA   3  
ATOM 6853  H HB2  . TYR A 1 136 ? -1.038  -14.207 3.369   2.00 0.00 ? 155 TYR A HB2  3  
ATOM 6854  H HB3  . TYR A 1 136 ? 0.017   -14.654 4.700   2.00 0.00 ? 155 TYR A HB3  3  
ATOM 6855  H HD1  . TYR A 1 136 ? 2.037   -12.825 5.000   1.00 0.00 ? 155 TYR A HD1  3  
ATOM 6856  H HD2  . TYR A 1 136 ? -1.855  -12.066 3.450   1.00 0.00 ? 155 TYR A HD2  3  
ATOM 6857  H HE1  . TYR A 1 136 ? 2.257   -10.457 5.624   1.00 0.00 ? 155 TYR A HE1  3  
ATOM 6858  H HE2  . TYR A 1 136 ? -1.642  -9.700  4.068   1.00 0.00 ? 155 TYR A HE2  3  
ATOM 6859  H HH   . TYR A 1 136 ? 0.179   -8.061  4.481   1.00 0.00 ? 155 TYR A HH   3  
ATOM 6860  N N    . VAL A 1 137 ? 0.164   -15.869 0.907   1.00 0.00 ? 156 VAL A N    3  
ATOM 6861  C CA   . VAL A 1 137 ? -0.403  -16.069 -0.421  1.00 0.00 ? 156 VAL A CA   3  
ATOM 6862  C C    . VAL A 1 137 ? -1.927  -16.120 -0.375  1.00 0.00 ? 156 VAL A C    3  
ATOM 6863  O O    . VAL A 1 137 ? -2.516  -16.593 0.597   1.00 0.00 ? 156 VAL A O    3  
ATOM 6864  C CB   . VAL A 1 137 ? 0.124   -17.367 -1.064  1.00 0.00 ? 156 VAL A CB   3  
ATOM 6865  C CG1  . VAL A 1 137 ? -0.081  -18.554 -0.137  2.00 0.00 ? 156 VAL A CG1  3  
ATOM 6866  C CG2  . VAL A 1 137 ? -0.556  -17.628 -2.400  2.00 0.00 ? 156 VAL A CG2  3  
ATOM 6867  H H    . VAL A 1 137 ? 0.395   -16.651 1.451   1.00 0.00 ? 156 VAL A H    3  
ATOM 6868  H HA   . VAL A 1 137 ? -0.100  -15.239 -1.041  1.00 0.00 ? 156 VAL A HA   3  
ATOM 6869  H HB   . VAL A 1 137 ? 1.183   -17.250 -1.238  1.00 0.00 ? 156 VAL A HB   3  
ATOM 6870  H HG11 . VAL A 1 137 ? 0.726   -18.595 0.580   1.00 0.00 ? 156 VAL A HG11 3  
ATOM 6871  H HG12 . VAL A 1 137 ? -0.095  -19.465 -0.716  1.00 0.00 ? 156 VAL A HG12 3  
ATOM 6872  H HG13 . VAL A 1 137 ? -1.020  -18.446 0.385   1.00 0.00 ? 156 VAL A HG13 3  
ATOM 6873  H HG21 . VAL A 1 137 ? -1.397  -18.289 -2.252  1.00 0.00 ? 156 VAL A HG21 3  
ATOM 6874  H HG22 . VAL A 1 137 ? 0.148   -18.085 -3.079  1.00 0.00 ? 156 VAL A HG22 3  
ATOM 6875  H HG23 . VAL A 1 137 ? -0.902  -16.693 -2.816  1.00 0.00 ? 156 VAL A HG23 3  
ATOM 6876  N N    . GLN A 1 138 ? -2.557  -15.632 -1.438  1.00 0.00 ? 157 GLN A N    3  
ATOM 6877  C CA   . GLN A 1 138 ? -4.011  -15.620 -1.537  1.00 0.00 ? 157 GLN A CA   3  
ATOM 6878  C C    . GLN A 1 138 ? -4.445  -15.437 -2.987  1.00 0.00 ? 157 GLN A C    3  
ATOM 6879  O O    . GLN A 1 138 ? -3.668  -14.972 -3.819  1.00 0.00 ? 157 GLN A O    3  
ATOM 6880  C CB   . GLN A 1 138 ? -4.595  -14.501 -0.671  1.00 0.00 ? 157 GLN A CB   3  
ATOM 6881  C CG   . GLN A 1 138 ? -4.699  -13.165 -1.388  1.00 0.00 ? 157 GLN A CG   3  
ATOM 6882  C CD   . GLN A 1 138 ? -6.123  -12.656 -1.489  1.00 0.00 ? 157 GLN A CD   3  
ATOM 6883  O OE1  . GLN A 1 138 ? -6.885  -13.077 -2.359  1.00 0.00 ? 157 GLN A OE1  3  
ATOM 6884  N NE2  . GLN A 1 138 ? -6.491  -11.745 -0.595  4.00 0.00 ? 157 GLN A NE2  3  
ATOM 6885  H H    . GLN A 1 138 ? -2.027  -15.273 -2.181  1.00 0.00 ? 157 GLN A H    3  
ATOM 6886  H HA   . GLN A 1 138 ? -4.377  -16.570 -1.179  1.00 0.00 ? 157 GLN A HA   3  
ATOM 6887  H HB2  . GLN A 1 138 ? -5.585  -14.791 -0.349  2.00 0.00 ? 157 GLN A HB2  3  
ATOM 6888  H HB3  . GLN A 1 138 ? -3.967  -14.370 0.198   2.00 0.00 ? 157 GLN A HB3  3  
ATOM 6889  H HG2  . GLN A 1 138 ? -4.111  -12.436 -0.852  2.00 0.00 ? 157 GLN A HG2  3  
ATOM 6890  H HG3  . GLN A 1 138 ? -4.303  -13.277 -2.387  2.00 0.00 ? 157 GLN A HG3  3  
ATOM 6891  H HE21 . GLN A 1 138 ? -5.829  -11.455 0.070   5.00 0.00 ? 157 GLN A HE21 3  
ATOM 6892  H HE22 . GLN A 1 138 ? -7.409  -11.397 -0.637  5.00 0.00 ? 157 GLN A HE22 3  
ATOM 6893  N N    . LYS A 1 139 ? -5.684  -15.808 -3.288  1.00 0.00 ? 158 LYS A N    3  
ATOM 6894  C CA   . LYS A 1 139 ? -6.204  -15.684 -4.643  1.00 0.00 ? 158 LYS A CA   3  
ATOM 6895  C C    . LYS A 1 139 ? -7.327  -14.656 -4.715  1.00 0.00 ? 158 LYS A C    3  
ATOM 6896  O O    . LYS A 1 139 ? -8.320  -14.751 -3.993  1.00 0.00 ? 158 LYS A O    3  
ATOM 6897  C CB   . LYS A 1 139 ? -6.701  -17.040 -5.143  1.00 0.00 ? 158 LYS A CB   3  
ATOM 6898  C CG   . LYS A 1 139 ? -7.985  -16.964 -5.954  1.00 0.00 ? 158 LYS A CG   3  
ATOM 6899  C CD   . LYS A 1 139 ? -8.535  -18.346 -6.270  1.00 0.00 ? 158 LYS A CD   3  
ATOM 6900  C CE   . LYS A 1 139 ? -9.602  -18.295 -7.352  1.00 0.00 ? 158 LYS A CE   3  
ATOM 6901  N NZ   . LYS A 1 139 ? -10.798 -19.107 -6.995  1.00 0.00 ? 158 LYS A NZ   3  
ATOM 6902  H H    . LYS A 1 139 ? -6.259  -16.178 -2.587  1.00 0.00 ? 158 LYS A H    3  
ATOM 6903  H HA   . LYS A 1 139 ? -5.395  -15.356 -5.276  1.00 0.00 ? 158 LYS A HA   3  
ATOM 6904  H HB2  . LYS A 1 139 ? -5.935  -17.476 -5.761  2.00 0.00 ? 158 LYS A HB2  3  
ATOM 6905  H HB3  . LYS A 1 139 ? -6.875  -17.683 -4.293  2.00 0.00 ? 158 LYS A HB3  3  
ATOM 6906  H HG2  . LYS A 1 139 ? -8.723  -16.414 -5.390  2.00 0.00 ? 158 LYS A HG2  3  
ATOM 6907  H HG3  . LYS A 1 139 ? -7.782  -16.449 -6.881  2.00 0.00 ? 158 LYS A HG3  3  
ATOM 6908  H HD2  . LYS A 1 139 ? -7.725  -18.976 -6.607  2.00 0.00 ? 158 LYS A HD2  3  
ATOM 6909  H HD3  . LYS A 1 139 ? -8.967  -18.763 -5.372  2.00 0.00 ? 158 LYS A HD3  3  
ATOM 6910  H HE2  . LYS A 1 139 ? -9.904  -17.268 -7.494  2.00 0.00 ? 158 LYS A HE2  3  
ATOM 6911  H HE3  . LYS A 1 139 ? -9.180  -18.675 -8.272  2.00 0.00 ? 158 LYS A HE3  3  
ATOM 6912  H HZ1  . LYS A 1 139 ? -10.678 -19.522 -6.049  1.00 0.00 ? 158 LYS A HZ1  3  
ATOM 6913  H HZ2  . LYS A 1 139 ? -10.927 -19.875 -7.684  1.00 0.00 ? 158 LYS A HZ2  3  
ATOM 6914  H HZ3  . LYS A 1 139 ? -11.648 -18.509 -6.995  1.00 0.00 ? 158 LYS A HZ3  3  
ATOM 6915  N N    . GLY A 1 140 ? -7.160  -13.678 -5.597  1.00 0.00 ? 159 GLY A N    3  
ATOM 6916  C CA   . GLY A 1 140 ? -8.163  -12.644 -5.761  1.00 0.00 ? 159 GLY A CA   3  
ATOM 6917  C C    . GLY A 1 140 ? -8.164  -12.066 -7.163  1.00 0.00 ? 159 GLY A C    3  
ATOM 6918  O O    . GLY A 1 140 ? -8.093  -12.803 -8.146  1.00 0.00 ? 159 GLY A O    3  
ATOM 6919  H H    . GLY A 1 140 ? -6.347  -13.658 -6.144  1.00 0.00 ? 159 GLY A H    3  
ATOM 6920  H HA2  . GLY A 1 140 ? -9.138  -13.064 -5.554  2.00 0.00 ? 159 GLY A HA2  3  
ATOM 6921  H HA3  . GLY A 1 140 ? -7.966  -11.849 -5.055  2.00 0.00 ? 159 GLY A HA3  3  
ATOM 6922  N N    . GLU A 1 141 ? -8.241  -10.745 -7.254  1.00 0.00 ? 160 GLU A N    3  
ATOM 6923  C CA   . GLU A 1 141 ? -8.247  -10.065 -8.543  1.00 0.00 ? 160 GLU A CA   3  
ATOM 6924  C C    . GLU A 1 141 ? -7.947  -8.582  -8.365  1.00 0.00 ? 160 GLU A C    3  
ATOM 6925  O O    . GLU A 1 141 ? -8.820  -7.802  -7.989  1.00 0.00 ? 160 GLU A O    3  
ATOM 6926  C CB   . GLU A 1 141 ? -9.598  -10.248 -9.235  1.00 0.00 ? 160 GLU A CB   3  
ATOM 6927  C CG   . GLU A 1 141 ? -9.538  -11.116 -10.481 1.00 0.00 ? 160 GLU A CG   3  
ATOM 6928  C CD   . GLU A 1 141 ? -9.115  -10.346 -11.716 1.00 0.00 ? 160 GLU A CD   3  
ATOM 6929  O OE1  . GLU A 1 141 ? -7.938  -9.931  -11.783 1.00 0.00 ? 160 GLU A OE1  3  
ATOM 6930  O OE2  . GLU A 1 141 ? -9.960  -10.159 -12.616 1.00 0.00 ? 160 GLU A OE2  3  
ATOM 6931  H H    . GLU A 1 141 ? -8.293  -10.212 -6.434  1.00 0.00 ? 160 GLU A H    3  
ATOM 6932  H HA   . GLU A 1 141 ? -7.475  -10.507 -9.154  1.00 0.00 ? 160 GLU A HA   3  
ATOM 6933  H HB2  . GLU A 1 141 ? -10.286 -10.704 -8.538  2.00 0.00 ? 160 GLU A HB2  3  
ATOM 6934  H HB3  . GLU A 1 141 ? -9.978  -9.278  -9.517  2.00 0.00 ? 160 GLU A HB3  3  
ATOM 6935  H HG2  . GLU A 1 141 ? -8.829  -11.915 -10.313 2.00 0.00 ? 160 GLU A HG2  3  
ATOM 6936  H HG3  . GLU A 1 141 ? -10.516 -11.538 -10.656 2.00 0.00 ? 160 GLU A HG3  3  
ATOM 6937  N N    . TYR A 1 142 ? -6.700  -8.201  -8.625  1.00 0.00 ? 161 TYR A N    3  
ATOM 6938  C CA   . TYR A 1 142 ? -6.280  -6.813  -8.483  1.00 0.00 ? 161 TYR A CA   3  
ATOM 6939  C C    . TYR A 1 142 ? -5.358  -6.402  -9.625  1.00 0.00 ? 161 TYR A C    3  
ATOM 6940  O O    . TYR A 1 142 ? -4.718  -5.351  -9.572  1.00 0.00 ? 161 TYR A O    3  
ATOM 6941  C CB   . TYR A 1 142 ? -5.569  -6.605  -7.140  1.00 0.00 ? 161 TYR A CB   3  
ATOM 6942  C CG   . TYR A 1 142 ? -5.948  -7.600  -6.061  1.00 0.00 ? 161 TYR A CG   3  
ATOM 6943  C CD1  . TYR A 1 142 ? -5.851  -8.968  -6.284  1.00 0.00 ? 161 TYR A CD1  3  
ATOM 6944  C CD2  . TYR A 1 142 ? -6.400  -7.170  -4.819  1.00 0.00 ? 161 TYR A CD2  3  
ATOM 6945  C CE1  . TYR A 1 142 ? -6.194  -9.879  -5.304  1.00 0.00 ? 161 TYR A CE1  3  
ATOM 6946  C CE2  . TYR A 1 142 ? -6.744  -8.074  -3.833  1.00 0.00 ? 161 TYR A CE2  3  
ATOM 6947  C CZ   . TYR A 1 142 ? -6.641  -9.427  -4.081  1.00 0.00 ? 161 TYR A CZ   3  
ATOM 6948  O OH   . TYR A 1 142 ? -6.984  -10.330 -3.101  1.00 0.00 ? 161 TYR A OH   3  
ATOM 6949  H H    . TYR A 1 142 ? -6.045  -8.872  -8.913  1.00 0.00 ? 161 TYR A H    3  
ATOM 6950  H HA   . TYR A 1 142 ? -7.165  -6.195  -8.509  1.00 0.00 ? 161 TYR A HA   3  
ATOM 6951  H HB2  . TYR A 1 142 ? -4.502  -6.680  -7.295  2.00 0.00 ? 161 TYR A HB2  3  
ATOM 6952  H HB3  . TYR A 1 142 ? -5.803  -5.616  -6.770  2.00 0.00 ? 161 TYR A HB3  3  
ATOM 6953  H HD1  . TYR A 1 142 ? -5.501  -9.320  -7.244  1.00 0.00 ? 161 TYR A HD1  3  
ATOM 6954  H HD2  . TYR A 1 142 ? -6.480  -6.110  -4.625  1.00 0.00 ? 161 TYR A HD2  3  
ATOM 6955  H HE1  . TYR A 1 142 ? -6.112  -10.939 -5.499  1.00 0.00 ? 161 TYR A HE1  3  
ATOM 6956  H HE2  . TYR A 1 142 ? -7.094  -7.718  -2.876  1.00 0.00 ? 161 TYR A HE2  3  
ATOM 6957  H HH   . TYR A 1 142 ? -7.810  -10.060 -2.691  1.00 0.00 ? 161 TYR A HH   3  
ATOM 6958  N N    . ARG A 1 143 ? -5.294  -7.236  -10.659 1.00 0.00 ? 162 ARG A N    3  
ATOM 6959  C CA   . ARG A 1 143 ? -4.449  -6.956  -11.814 1.00 0.00 ? 162 ARG A CA   3  
ATOM 6960  C C    . ARG A 1 143 ? -5.130  -5.969  -12.757 1.00 0.00 ? 162 ARG A C    3  
ATOM 6961  O O    . ARG A 1 143 ? -5.135  -6.159  -13.973 1.00 0.00 ? 162 ARG A O    3  
ATOM 6962  C CB   . ARG A 1 143 ? -4.121  -8.250  -12.561 1.00 0.00 ? 162 ARG A CB   3  
ATOM 6963  C CG   . ARG A 1 143 ? -2.647  -8.417  -12.894 1.00 0.00 ? 162 ARG A CG   3  
ATOM 6964  C CD   . ARG A 1 143 ? -2.437  -9.024  -14.273 1.00 0.00 ? 162 ARG A CD   3  
ATOM 6965  N NE   . ARG A 1 143 ? -2.768  -10.446 -14.298 1.00 0.00 ? 162 ARG A NE   3  
ATOM 6966  C CZ   . ARG A 1 143 ? -3.075  -11.111 -15.408 4.00 0.00 ? 162 ARG A CZ   3  
ATOM 6967  N NH1  . ARG A 1 143 ? -3.096  -10.489 -16.579 5.00 0.00 ? 162 ARG A NH1  3  
ATOM 6968  N NH2  . ARG A 1 143 ? -3.365  -12.404 -15.356 5.00 0.00 ? 162 ARG A NH2  3  
ATOM 6969  H H    . ARG A 1 143 ? -5.826  -8.058  -10.644 1.00 0.00 ? 162 ARG A H    3  
ATOM 6970  H HA   . ARG A 1 143 ? -3.530  -6.516  -11.454 1.00 0.00 ? 162 ARG A HA   3  
ATOM 6971  H HB2  . ARG A 1 143 ? -4.426  -9.088  -11.953 2.00 0.00 ? 162 ARG A HB2  3  
ATOM 6972  H HB3  . ARG A 1 143 ? -4.680  -8.270  -13.485 2.00 0.00 ? 162 ARG A HB3  3  
ATOM 6973  H HG2  . ARG A 1 143 ? -2.171  -7.448  -12.865 2.00 0.00 ? 162 ARG A HG2  3  
ATOM 6974  H HG3  . ARG A 1 143 ? -2.193  -9.062  -12.157 2.00 0.00 ? 162 ARG A HG3  3  
ATOM 6975  H HD2  . ARG A 1 143 ? -3.065  -8.505  -14.981 2.00 0.00 ? 162 ARG A HD2  3  
ATOM 6976  H HD3  . ARG A 1 143 ? -1.401  -8.900  -14.552 2.00 0.00 ? 162 ARG A HD3  3  
ATOM 6977  H HE   . ARG A 1 143 ? -2.761  -10.929 -13.446 1.00 0.00 ? 162 ARG A HE   3  
ATOM 6978  H HH11 . ARG A 1 143 ? -2.879  -9.514  -16.630 5.00 0.00 ? 162 ARG A HH11 3  
ATOM 6979  H HH12 . ARG A 1 143 ? -3.327  -10.995 -17.410 5.00 0.00 ? 162 ARG A HH12 3  
ATOM 6980  H HH21 . ARG A 1 143 ? -3.354  -12.884 -14.479 5.00 0.00 ? 162 ARG A HH21 3  
ATOM 6981  H HH22 . ARG A 1 143 ? -3.596  -12.898 -16.194 5.00 0.00 ? 162 ARG A HH22 3  
ATOM 6982  N N    . THR A 1 144 ? -5.702  -4.914  -12.186 1.00 0.00 ? 163 THR A N    3  
ATOM 6983  C CA   . THR A 1 144 ? -6.387  -3.896  -12.974 1.00 0.00 ? 163 THR A CA   3  
ATOM 6984  C C    . THR A 1 144 ? -5.390  -2.950  -13.636 1.00 0.00 ? 163 THR A C    3  
ATOM 6985  O O    . THR A 1 144 ? -5.773  -1.935  -14.216 1.00 0.00 ? 163 THR A O    3  
ATOM 6986  C CB   . THR A 1 144 ? -7.357  -3.073  -12.106 1.00 0.00 ? 163 THR A CB   3  
ATOM 6987  O OG1  . THR A 1 144 ? -6.730  -2.723  -10.867 1.00 0.00 ? 163 THR A OG1  3  
ATOM 6988  C CG2  . THR A 1 144 ? -8.632  -3.855  -11.831 1.00 0.00 ? 163 THR A CG2  3  
ATOM 6989  H H    . THR A 1 144 ? -5.664  -4.818  -11.212 1.00 0.00 ? 163 THR A H    3  
ATOM 6990  H HA   . THR A 1 144 ? -6.959  -4.396  -13.742 1.00 0.00 ? 163 THR A HA   3  
ATOM 6991  H HB   . THR A 1 144 ? -7.614  -2.169  -12.638 1.00 0.00 ? 163 THR A HB   3  
ATOM 6992  H HG1  . THR A 1 144 ? -6.079  -2.034  -11.019 1.00 0.00 ? 163 THR A HG1  3  
ATOM 6993  H HG21 . THR A 1 144 ? -9.473  -3.338  -12.271 1.00 0.00 ? 163 THR A HG21 3  
ATOM 6994  H HG22 . THR A 1 144 ? -8.780  -3.940  -10.764 1.00 0.00 ? 163 THR A HG22 3  
ATOM 6995  H HG23 . THR A 1 144 ? -8.550  -4.842  -12.263 1.00 0.00 ? 163 THR A HG23 3  
ATOM 6996  N N    . ASN A 1 145 ? -4.107  -3.289  -13.544 1.00 0.00 ? 164 ASN A N    3  
ATOM 6997  C CA   . ASN A 1 145 ? -3.055  -2.469  -14.134 1.00 0.00 ? 164 ASN A CA   3  
ATOM 6998  C C    . ASN A 1 145 ? -2.190  -3.290  -15.085 1.00 0.00 ? 164 ASN A C    3  
ATOM 6999  O O    . ASN A 1 145 ? -1.182  -3.869  -14.682 1.00 0.00 ? 164 ASN A O    3  
ATOM 7000  C CB   . ASN A 1 145 ? -2.184  -1.856  -13.036 1.00 0.00 ? 164 ASN A CB   3  
ATOM 7001  C CG   . ASN A 1 145 ? -1.909  -0.377  -13.232 1.00 0.00 ? 164 ASN A CG   3  
ATOM 7002  O OD1  . ASN A 1 145 ? -1.631  0.071   -14.345 1.00 0.00 ? 164 ASN A OD1  3  
ATOM 7003  N ND2  . ASN A 1 145 ? -1.984  0.387   -12.150 4.00 0.00 ? 164 ASN A ND2  3  
ATOM 7004  H H    . ASN A 1 145 ? -3.863  -4.111  -13.068 1.00 0.00 ? 164 ASN A H    3  
ATOM 7005  H HA   . ASN A 1 145 ? -3.528  -1.675  -14.691 1.00 0.00 ? 164 ASN A HA   3  
ATOM 7006  H HB2  . ASN A 1 145 ? -2.679  -1.983  -12.083 2.00 0.00 ? 164 ASN A HB2  3  
ATOM 7007  H HB3  . ASN A 1 145 ? -1.236  -2.375  -13.010 2.00 0.00 ? 164 ASN A HB3  3  
ATOM 7008  H HD21 . ASN A 1 145 ? -2.211  -0.040  -11.294 5.00 0.00 ? 164 ASN A HD21 3  
ATOM 7009  H HD22 . ASN A 1 145 ? -1.810  1.350   -12.248 5.00 0.00 ? 164 ASN A HD22 3  
ATOM 7010  N N    . PRO A 1 146 ? -2.578  -3.350  -16.369 1.00 0.00 ? 165 PRO A N    3  
ATOM 7011  C CA   . PRO A 1 146 ? -1.840  -4.103  -17.390 1.00 0.00 ? 165 PRO A CA   3  
ATOM 7012  C C    . PRO A 1 146 ? -0.391  -3.644  -17.511 1.00 0.00 ? 165 PRO A C    3  
ATOM 7013  O O    . PRO A 1 146 ? 0.429   -4.304  -18.151 1.00 0.00 ? 165 PRO A O    3  
ATOM 7014  C CB   . PRO A 1 146 ? -2.599  -3.807  -18.689 1.00 0.00 ? 165 PRO A CB   3  
ATOM 7015  C CG   . PRO A 1 146 ? -3.958  -3.374  -18.250 1.00 0.00 ? 165 PRO A CG   3  
ATOM 7016  C CD   . PRO A 1 146 ? -3.766  -2.690  -16.929 1.00 0.00 ? 165 PRO A CD   3  
ATOM 7017  H HA   . PRO A 1 146 ? -1.863  -5.162  -17.192 1.00 0.00 ? 165 PRO A HA   3  
ATOM 7018  H HB2  . PRO A 1 146 ? -2.091  -3.027  -19.231 2.00 0.00 ? 165 PRO A HB2  3  
ATOM 7019  H HB3  . PRO A 1 146 ? -2.647  -4.702  -19.292 2.00 0.00 ? 165 PRO A HB3  3  
ATOM 7020  H HG2  . PRO A 1 146 ? -4.375  -2.685  -18.971 2.00 0.00 ? 165 PRO A HG2  3  
ATOM 7021  H HG3  . PRO A 1 146 ? -4.601  -4.235  -18.137 2.00 0.00 ? 165 PRO A HG3  3  
ATOM 7022  H HD2  . PRO A 1 146 ? -3.589  -1.635  -17.072 2.00 0.00 ? 165 PRO A HD2  3  
ATOM 7023  H HD3  . PRO A 1 146 ? -4.627  -2.846  -16.295 2.00 0.00 ? 165 PRO A HD3  3  
ATOM 7024  N N    . GLU A 1 147 ? -0.080  -2.509  -16.893 1.00 0.00 ? 166 GLU A N    3  
ATOM 7025  C CA   . GLU A 1 147 ? 1.272   -1.961  -16.933 1.00 0.00 ? 166 GLU A CA   3  
ATOM 7026  C C    . GLU A 1 147 ? 2.255   -2.880  -16.214 1.00 0.00 ? 166 GLU A C    3  
ATOM 7027  O O    . GLU A 1 147 ? 3.469   -2.731  -16.346 1.00 0.00 ? 166 GLU A O    3  
ATOM 7028  C CB   . GLU A 1 147 ? 1.298   -0.570  -16.297 1.00 0.00 ? 166 GLU A CB   3  
ATOM 7029  C CG   . GLU A 1 147 ? 1.127   0.570   -17.289 1.00 0.00 ? 166 GLU A CG   3  
ATOM 7030  C CD   . GLU A 1 147 ? 0.413   1.766   -16.691 1.00 0.00 ? 166 GLU A CD   3  
ATOM 7031  O OE1  . GLU A 1 147 ? 0.950   2.360   -15.734 1.00 0.00 ? 166 GLU A OE1  3  
ATOM 7032  O OE2  . GLU A 1 147 ? -0.684  2.109   -17.182 1.00 0.00 ? 166 GLU A OE2  3  
ATOM 7033  H H    . GLU A 1 147 ? -0.776  -2.027  -16.399 1.00 0.00 ? 166 GLU A H    3  
ATOM 7034  H HA   . GLU A 1 147 ? 1.565   -1.880  -17.968 1.00 0.00 ? 166 GLU A HA   3  
ATOM 7035  H HB2  . GLU A 1 147 ? 0.504   -0.505  -15.570 2.00 0.00 ? 166 GLU A HB2  3  
ATOM 7036  H HB3  . GLU A 1 147 ? 2.245   -0.436  -15.793 2.00 0.00 ? 166 GLU A HB3  3  
ATOM 7037  H HG2  . GLU A 1 147 ? 2.103   0.885   -17.628 2.00 0.00 ? 166 GLU A HG2  3  
ATOM 7038  H HG3  . GLU A 1 147 ? 0.551   0.211   -18.132 2.00 0.00 ? 166 GLU A HG3  3  
ATOM 7039  N N    . ASP A 1 148 ? 1.721   -3.829  -15.451 1.00 0.00 ? 167 ASP A N    3  
ATOM 7040  C CA   . ASP A 1 148 ? 2.552   -4.772  -14.711 1.00 0.00 ? 167 ASP A CA   3  
ATOM 7041  C C    . ASP A 1 148 ? 2.963   -5.946  -15.594 1.00 0.00 ? 167 ASP A C    3  
ATOM 7042  O O    . ASP A 1 148 ? 3.771   -6.784  -15.194 1.00 0.00 ? 167 ASP A O    3  
ATOM 7043  C CB   . ASP A 1 148 ? 1.806   -5.284  -13.478 1.00 0.00 ? 167 ASP A CB   3  
ATOM 7044  C CG   . ASP A 1 148 ? 2.677   -5.314  -12.239 1.00 0.00 ? 167 ASP A CG   3  
ATOM 7045  O OD1  . ASP A 1 148 ? 3.513   -6.235  -12.122 1.00 0.00 ? 167 ASP A OD1  3  
ATOM 7046  O OD2  . ASP A 1 148 ? 2.526   -4.416  -11.384 1.00 0.00 ? 167 ASP A OD2  3  
ATOM 7047  H H    . ASP A 1 148 ? 0.746   -3.898  -15.385 1.00 0.00 ? 167 ASP A H    3  
ATOM 7048  H HA   . ASP A 1 148 ? 3.442   -4.248  -14.392 1.00 0.00 ? 167 ASP A HA   3  
ATOM 7049  H HB2  . ASP A 1 148 ? 0.960   -4.637  -13.284 2.00 0.00 ? 167 ASP A HB2  3  
ATOM 7050  H HB3  . ASP A 1 148 ? 1.452   -6.287  -13.670 2.00 0.00 ? 167 ASP A HB3  3  
ATOM 7051  N N    . ILE A 1 149 ? 2.401   -5.998  -16.798 1.00 0.00 ? 168 ILE A N    3  
ATOM 7052  C CA   . ILE A 1 149 ? 2.708   -7.069  -17.739 1.00 0.00 ? 168 ILE A CA   3  
ATOM 7053  C C    . ILE A 1 149 ? 3.398   -6.524  -18.984 1.00 0.00 ? 168 ILE A C    3  
ATOM 7054  O O    . ILE A 1 149 ? 4.586   -6.765  -19.203 1.00 0.00 ? 168 ILE A O    3  
ATOM 7055  C CB   . ILE A 1 149 ? 1.436   -7.829  -18.161 1.00 0.00 ? 168 ILE A CB   3  
ATOM 7056  C CG1  . ILE A 1 149 ? 0.513   -8.032  -16.959 1.00 0.00 ? 168 ILE A CG1  3  
ATOM 7057  C CG2  . ILE A 1 149 ? 1.801   -9.165  -18.790 1.00 0.00 ? 168 ILE A CG2  3  
ATOM 7058  C CD1  . ILE A 1 149 ? -0.959  -7.912  -17.290 1.00 0.00 ? 168 ILE A CD1  3  
ATOM 7059  H H    . ILE A 1 149 ? 1.765   -5.300  -17.059 1.00 0.00 ? 168 ILE A H    3  
ATOM 7060  H HA   . ILE A 1 149 ? 3.372   -7.765  -17.246 1.00 0.00 ? 168 ILE A HA   3  
ATOM 7061  H HB   . ILE A 1 149 ? 0.922   -7.238  -18.905 1.00 0.00 ? 168 ILE A HB   3  
ATOM 7062  H HG12 . ILE A 1 149 ? 0.680   -9.017  -16.548 2.00 0.00 ? 168 ILE A HG12 3  
ATOM 7063  H HG13 . ILE A 1 149 ? 0.744   -7.293  -16.207 2.00 0.00 ? 168 ILE A HG13 3  
ATOM 7064  H HG21 . ILE A 1 149 ? 1.479   -9.967  -18.141 1.00 0.00 ? 168 ILE A HG21 3  
ATOM 7065  H HG22 . ILE A 1 149 ? 2.871   -9.220  -18.924 1.00 0.00 ? 168 ILE A HG22 3  
ATOM 7066  H HG23 . ILE A 1 149 ? 1.311   -9.259  -19.748 1.00 0.00 ? 168 ILE A HG23 3  
ATOM 7067  H HD11 . ILE A 1 149 ? -1.409  -7.160  -16.660 1.00 0.00 ? 168 ILE A HD11 3  
ATOM 7068  H HD12 . ILE A 1 149 ? -1.445  -8.862  -17.120 1.00 0.00 ? 168 ILE A HD12 3  
ATOM 7069  H HD13 . ILE A 1 149 ? -1.073  -7.629  -18.326 1.00 0.00 ? 168 ILE A HD13 3  
ATOM 7070  N N    . TYR A 1 150 ? 2.647   -5.788  -19.797 1.00 0.00 ? 169 TYR A N    3  
ATOM 7071  C CA   . TYR A 1 150 ? 3.185   -5.209  -21.022 1.00 0.00 ? 169 TYR A CA   3  
ATOM 7072  C C    . TYR A 1 150 ? 3.139   -3.685  -20.969 1.00 0.00 ? 169 TYR A C    3  
ATOM 7073  O O    . TYR A 1 150 ? 2.223   -3.063  -21.506 1.00 0.00 ? 169 TYR A O    3  
ATOM 7074  C CB   . TYR A 1 150 ? 2.405   -5.712  -22.238 1.00 0.00 ? 169 TYR A CB   3  
ATOM 7075  C CG   . TYR A 1 150 ? 1.030   -6.260  -21.931 1.00 0.00 ? 169 TYR A CG   3  
ATOM 7076  C CD1  . TYR A 1 150 ? -0.059  -5.411  -21.783 1.00 0.00 ? 169 TYR A CD1  3  
ATOM 7077  C CD2  . TYR A 1 150 ? 0.823   -7.626  -21.791 1.00 0.00 ? 169 TYR A CD2  3  
ATOM 7078  C CE1  . TYR A 1 150 ? -1.317  -5.908  -21.502 1.00 0.00 ? 169 TYR A CE1  3  
ATOM 7079  C CE2  . TYR A 1 150 ? -0.433  -8.131  -21.511 1.00 0.00 ? 169 TYR A CE2  3  
ATOM 7080  C CZ   . TYR A 1 150 ? -1.499  -7.268  -21.367 1.00 0.00 ? 169 TYR A CZ   3  
ATOM 7081  O OH   . TYR A 1 150 ? -2.750  -7.767  -21.089 1.00 0.00 ? 169 TYR A OH   3  
ATOM 7082  H H    . TYR A 1 150 ? 1.707   -5.632  -19.568 1.00 0.00 ? 169 TYR A H    3  
ATOM 7083  H HA   . TYR A 1 150 ? 4.214   -5.523  -21.112 1.00 0.00 ? 169 TYR A HA   3  
ATOM 7084  H HB2  . TYR A 1 150 ? 2.285   -4.897  -22.936 2.00 0.00 ? 169 TYR A HB2  3  
ATOM 7085  H HB3  . TYR A 1 150 ? 2.972   -6.498  -22.715 2.00 0.00 ? 169 TYR A HB3  3  
ATOM 7086  H HD1  . TYR A 1 150 ? 0.087   -4.347  -21.889 1.00 0.00 ? 169 TYR A HD1  3  
ATOM 7087  H HD2  . TYR A 1 150 ? 1.659   -8.298  -21.903 1.00 0.00 ? 169 TYR A HD2  3  
ATOM 7088  H HE1  . TYR A 1 150 ? -2.151  -5.232  -21.390 1.00 0.00 ? 169 TYR A HE1  3  
ATOM 7089  H HE2  . TYR A 1 150 ? -0.574  -9.196  -21.405 1.00 0.00 ? 169 TYR A HE2  3  
ATOM 7090  H HH   . TYR A 1 150 ? -2.690  -8.710  -20.922 1.00 0.00 ? 169 TYR A HH   3  
ATOM 7091  N N    . PRO A 1 151 ? 4.132   -3.064  -20.314 1.00 0.00 ? 170 PRO A N    3  
ATOM 7092  C CA   . PRO A 1 151 ? 4.208   -1.605  -20.186 1.00 0.00 ? 170 PRO A CA   3  
ATOM 7093  C C    . PRO A 1 151 ? 4.040   -0.898  -21.526 1.00 0.00 ? 170 PRO A C    3  
ATOM 7094  O O    . PRO A 1 151 ? 4.737   -1.205  -22.493 1.00 0.00 ? 170 PRO A O    3  
ATOM 7095  C CB   . PRO A 1 151 ? 5.616   -1.370  -19.631 1.00 0.00 ? 170 PRO A CB   3  
ATOM 7096  C CG   . PRO A 1 151 ? 5.944   -2.625  -18.896 1.00 0.00 ? 170 PRO A CG   3  
ATOM 7097  C CD   . PRO A 1 151 ? 5.260   -3.734  -19.646 1.00 0.00 ? 170 PRO A CD   3  
ATOM 7098  H HA   . PRO A 1 151 ? 3.476   -1.230  -19.488 1.00 0.00 ? 170 PRO A HA   3  
ATOM 7099  H HB2  . PRO A 1 151 ? 6.304   -1.198  -20.446 2.00 0.00 ? 170 PRO A HB2  3  
ATOM 7100  H HB3  . PRO A 1 151 ? 5.608   -0.515  -18.971 2.00 0.00 ? 170 PRO A HB3  3  
ATOM 7101  H HG2  . PRO A 1 151 ? 7.014   -2.780  -18.891 2.00 0.00 ? 170 PRO A HG2  3  
ATOM 7102  H HG3  . PRO A 1 151 ? 5.568   -2.569  -17.885 2.00 0.00 ? 170 PRO A HG3  3  
ATOM 7103  H HD2  . PRO A 1 151 ? 5.932   -4.169  -20.370 2.00 0.00 ? 170 PRO A HD2  3  
ATOM 7104  H HD3  . PRO A 1 151 ? 4.906   -4.489  -18.960 2.00 0.00 ? 170 PRO A HD3  3  
ATOM 7105  N N    . SER A 1 152 ? 3.110   0.050   -21.577 1.00 0.00 ? 171 SER A N    3  
ATOM 7106  C CA   . SER A 1 152 ? 2.848   0.802   -22.798 1.00 0.00 ? 171 SER A CA   3  
ATOM 7107  C C    . SER A 1 152 ? 4.111   1.507   -23.284 1.00 0.00 ? 171 SER A C    3  
ATOM 7108  O O    . SER A 1 152 ? 4.918   1.979   -22.482 1.00 0.00 ? 171 SER A O    3  
ATOM 7109  C CB   . SER A 1 152 ? 1.736   1.826   -22.566 1.00 0.00 ? 171 SER A CB   3  
ATOM 7110  O OG   . SER A 1 152 ? 1.475   2.574   -23.740 1.00 0.00 ? 171 SER A OG   3  
ATOM 7111  H H    . SER A 1 152 ? 2.586   0.248   -20.772 1.00 0.00 ? 171 SER A H    3  
ATOM 7112  H HA   . SER A 1 152 ? 2.528   0.102   -23.556 1.00 0.00 ? 171 SER A HA   3  
ATOM 7113  H HB2  . SER A 1 152 ? 0.833   1.312   -22.272 2.00 0.00 ? 171 SER A HB2  3  
ATOM 7114  H HB3  . SER A 1 152 ? 2.034   2.505   -21.780 2.00 0.00 ? 171 SER A HB3  3  
ATOM 7115  H HG   . SER A 1 152 ? 1.738   2.063   -24.509 1.00 0.00 ? 171 SER A HG   3  
ATOM 7116  N N    . ASN A 1 153 ? 4.276   1.573   -24.601 1.00 0.00 ? 172 ASN A N    3  
ATOM 7117  C CA   . ASN A 1 153 ? 5.441   2.221   -25.194 1.00 0.00 ? 172 ASN A CA   3  
ATOM 7118  C C    . ASN A 1 153 ? 5.119   3.657   -25.596 1.00 0.00 ? 172 ASN A C    3  
ATOM 7119  O O    . ASN A 1 153 ? 3.971   3.989   -25.891 1.00 0.00 ? 172 ASN A O    3  
ATOM 7120  C CB   . ASN A 1 153 ? 5.921   1.433   -26.414 1.00 0.00 ? 172 ASN A CB   3  
ATOM 7121  C CG   . ASN A 1 153 ? 4.785   1.029   -27.335 1.00 0.00 ? 172 ASN A CG   3  
ATOM 7122  O OD1  . ASN A 1 153 ? 4.505   1.704   -28.326 1.00 0.00 ? 172 ASN A OD1  3  
ATOM 7123  N ND2  . ASN A 1 153 ? 4.125   -0.076  -27.010 4.00 0.00 ? 172 ASN A ND2  3  
ATOM 7124  H H    . ASN A 1 153 ? 3.598   1.178   -25.188 1.00 0.00 ? 172 ASN A H    3  
ATOM 7125  H HA   . ASN A 1 153 ? 6.226   2.233   -24.453 1.00 0.00 ? 172 ASN A HA   3  
ATOM 7126  H HB2  . ASN A 1 153 ? 6.616   2.041   -26.976 2.00 0.00 ? 172 ASN A HB2  3  
ATOM 7127  H HB3  . ASN A 1 153 ? 6.424   0.537   -26.080 2.00 0.00 ? 172 ASN A HB3  3  
ATOM 7128  H HD21 . ASN A 1 153 ? 4.404   -0.563  -26.203 5.00 0.00 ? 172 ASN A HD21 3  
ATOM 7129  H HD22 . ASN A 1 153 ? 3.384   -0.360  -27.590 5.00 0.00 ? 172 ASN A HD22 3  
ATOM 7130  N N    . PRO A 1 154 ? 6.138   4.531   -25.612 1.00 0.00 ? 173 PRO A N    3  
ATOM 7131  C CA   . PRO A 1 154 ? 5.967   5.940   -25.981 1.00 0.00 ? 173 PRO A CA   3  
ATOM 7132  C C    . PRO A 1 154 ? 5.557   6.111   -27.439 1.00 0.00 ? 173 PRO A C    3  
ATOM 7133  O O    . PRO A 1 154 ? 6.260   5.672   -28.348 1.00 0.00 ? 173 PRO A O    3  
ATOM 7134  C CB   . PRO A 1 154 ? 7.354   6.544   -25.741 1.00 0.00 ? 173 PRO A CB   3  
ATOM 7135  C CG   . PRO A 1 154 ? 8.296   5.393   -25.810 1.00 0.00 ? 173 PRO A CG   3  
ATOM 7136  C CD   . PRO A 1 154 ? 7.537   4.211   -25.274 1.00 0.00 ? 173 PRO A CD   3  
ATOM 7137  H HA   . PRO A 1 154 ? 5.243   6.430   -25.345 1.00 0.00 ? 173 PRO A HA   3  
ATOM 7138  H HB2  . PRO A 1 154 ? 7.567   7.275   -26.507 2.00 0.00 ? 173 PRO A HB2  3  
ATOM 7139  H HB3  . PRO A 1 154 ? 7.379   7.017   -24.770 2.00 0.00 ? 173 PRO A HB3  3  
ATOM 7140  H HG2  . PRO A 1 154 ? 8.590   5.218   -26.835 2.00 0.00 ? 173 PRO A HG2  3  
ATOM 7141  H HG3  . PRO A 1 154 ? 9.164   5.590   -25.196 2.00 0.00 ? 173 PRO A HG3  3  
ATOM 7142  H HD2  . PRO A 1 154 ? 7.855   3.304   -25.766 2.00 0.00 ? 173 PRO A HD2  3  
ATOM 7143  H HD3  . PRO A 1 154 ? 7.667   4.131   -24.206 2.00 0.00 ? 173 PRO A HD3  3  
ATOM 7144  N N    . THR A 1 155 ? 4.413   6.754   -27.655 1.00 0.00 ? 174 THR A N    3  
ATOM 7145  C CA   . THR A 1 155 ? 3.908   6.984   -29.003 1.00 0.00 ? 174 THR A CA   3  
ATOM 7146  C C    . THR A 1 155 ? 4.765   8.005   -29.744 1.00 0.00 ? 174 THR A C    3  
ATOM 7147  O O    . THR A 1 155 ? 5.544   8.737   -29.132 1.00 0.00 ? 174 THR A O    3  
ATOM 7148  C CB   . THR A 1 155 ? 2.450   7.475   -28.981 1.00 0.00 ? 174 THR A CB   3  
ATOM 7149  O OG1  . THR A 1 155 ? 1.947   7.461   -27.639 1.00 0.00 ? 174 THR A OG1  3  
ATOM 7150  C CG2  . THR A 1 155 ? 1.571   6.601   -29.864 1.00 0.00 ? 174 THR A CG2  3  
ATOM 7151  H H    . THR A 1 155 ? 3.897   7.081   -26.889 1.00 0.00 ? 174 THR A H    3  
ATOM 7152  H HA   . THR A 1 155 ? 3.943   6.045   -29.536 1.00 0.00 ? 174 THR A HA   3  
ATOM 7153  H HB   . THR A 1 155 ? 2.419   8.487   -29.358 1.00 0.00 ? 174 THR A HB   3  
ATOM 7154  H HG1  . THR A 1 155 ? 1.011   7.247   -27.649 1.00 0.00 ? 174 THR A HG1  3  
ATOM 7155  H HG21 . THR A 1 155 ? 1.109   7.210   -30.627 1.00 0.00 ? 174 THR A HG21 3  
ATOM 7156  H HG22 . THR A 1 155 ? 0.805   6.135   -29.262 1.00 0.00 ? 174 THR A HG22 3  
ATOM 7157  H HG23 . THR A 1 155 ? 2.176   5.837   -30.331 1.00 0.00 ? 174 THR A HG23 3  
ATOM 7158  N N    . ASP A 1 156 ? 4.615   8.049   -31.063 1.00 0.00 ? 175 ASP A N    3  
ATOM 7159  C CA   . ASP A 1 156 ? 5.376   8.981   -31.888 1.00 0.00 ? 175 ASP A CA   3  
ATOM 7160  C C    . ASP A 1 156 ? 4.477   10.092  -32.423 1.00 0.00 ? 175 ASP A C    3  
ATOM 7161  O O    . ASP A 1 156 ? 4.551   11.235  -31.972 1.00 0.00 ? 175 ASP A O    3  
ATOM 7162  C CB   . ASP A 1 156 ? 6.039   8.242   -33.051 1.00 0.00 ? 175 ASP A CB   3  
ATOM 7163  C CG   . ASP A 1 156 ? 7.476   7.858   -32.758 1.00 0.00 ? 175 ASP A CG   3  
ATOM 7164  O OD1  . ASP A 1 156 ? 8.371   8.705   -32.970 1.00 0.00 ? 175 ASP A OD1  3  
ATOM 7165  O OD2  . ASP A 1 156 ? 7.708   6.713   -32.318 1.00 0.00 ? 175 ASP A OD2  3  
ATOM 7166  H H    . ASP A 1 156 ? 3.979   7.440   -31.493 1.00 0.00 ? 175 ASP A H    3  
ATOM 7167  H HA   . ASP A 1 156 ? 6.143   9.421   -31.269 1.00 0.00 ? 175 ASP A HA   3  
ATOM 7168  H HB2  . ASP A 1 156 ? 5.483   7.340   -33.259 2.00 0.00 ? 175 ASP A HB2  3  
ATOM 7169  H HB3  . ASP A 1 156 ? 6.027   8.875   -33.926 2.00 0.00 ? 175 ASP A HB3  3  
ATOM 7170  N N    . ASP A 1 157 ? 3.630   9.748   -33.387 1.00 0.00 ? 176 ASP A N    3  
ATOM 7171  C CA   . ASP A 1 157 ? 2.717   10.716  -33.984 1.00 0.00 ? 176 ASP A CA   3  
ATOM 7172  C C    . ASP A 1 157 ? 1.763   11.281  -32.937 1.00 0.00 ? 176 ASP A C    3  
ATOM 7173  O O    . ASP A 1 157 ? 1.435   10.612  -31.956 1.00 0.00 ? 176 ASP A O    3  
ATOM 7174  C CB   . ASP A 1 157 ? 1.922   10.066  -35.118 1.00 0.00 ? 176 ASP A CB   3  
ATOM 7175  C CG   . ASP A 1 157 ? 2.734   9.847   -36.380 1.00 0.00 ? 176 ASP A CG   3  
ATOM 7176  O OD1  . ASP A 1 157 ? 3.432   8.815   -36.464 1.00 0.00 ? 176 ASP A OD1  3  
ATOM 7177  O OD2  . ASP A 1 157 ? 2.672   10.709  -37.282 1.00 0.00 ? 176 ASP A OD2  3  
ATOM 7178  H H    . ASP A 1 157 ? 3.619   8.821   -33.705 1.00 0.00 ? 176 ASP A H    3  
ATOM 7179  H HA   . ASP A 1 157 ? 3.309   11.524  -34.388 1.00 0.00 ? 176 ASP A HA   3  
ATOM 7180  H HB2  . ASP A 1 157 ? 1.553   9.108   -34.783 2.00 0.00 ? 176 ASP A HB2  3  
ATOM 7181  H HB3  . ASP A 1 157 ? 1.081   10.698  -35.363 2.00 0.00 ? 176 ASP A HB3  3  
ATOM 7182  N N    . ASP A 1 158 ? 1.319   12.514  -33.153 1.00 0.00 ? 177 ASP A N    3  
ATOM 7183  C CA   . ASP A 1 158 ? 0.399   13.169  -32.229 1.00 0.00 ? 177 ASP A CA   3  
ATOM 7184  C C    . ASP A 1 158 ? -0.900  12.381  -32.105 1.00 0.00 ? 177 ASP A C    3  
ATOM 7185  O O    . ASP A 1 158 ? -1.499  11.990  -33.107 1.00 0.00 ? 177 ASP A O    3  
ATOM 7186  C CB   . ASP A 1 158 ? 0.104   14.595  -32.696 1.00 0.00 ? 177 ASP A CB   3  
ATOM 7187  C CG   . ASP A 1 158 ? 0.580   15.645  -31.711 1.00 0.00 ? 177 ASP A CG   3  
ATOM 7188  O OD1  . ASP A 1 158 ? 1.806   15.867  -31.628 1.00 0.00 ? 177 ASP A OD1  3  
ATOM 7189  O OD2  . ASP A 1 158 ? -0.272  16.244  -31.022 1.00 0.00 ? 177 ASP A OD2  3  
ATOM 7190  H H    . ASP A 1 158 ? 1.615   12.996  -33.954 1.00 0.00 ? 177 ASP A H    3  
ATOM 7191  H HA   . ASP A 1 158 ? 0.877   13.209  -31.260 1.00 0.00 ? 177 ASP A HA   3  
ATOM 7192  H HB2  . ASP A 1 158 ? 0.596   14.767  -33.641 2.00 0.00 ? 177 ASP A HB2  3  
ATOM 7193  H HB3  . ASP A 1 158 ? -0.963  14.710  -32.826 2.00 0.00 ? 177 ASP A HB3  3  
ATOM 7194  N N    . VAL A 1 159 ? -1.331  12.152  -30.869 1.00 0.00 ? 178 VAL A N    3  
ATOM 7195  C CA   . VAL A 1 159 ? -2.560  11.411  -30.613 1.00 0.00 ? 178 VAL A CA   3  
ATOM 7196  C C    . VAL A 1 159 ? -3.745  12.354  -30.440 1.00 0.00 ? 178 VAL A C    3  
ATOM 7197  O O    . VAL A 1 159 ? -3.523  13.582  -30.394 1.00 0.00 ? 178 VAL A O    3  
ATOM 7198  C CB   . VAL A 1 159 ? -2.433  10.529  -29.357 1.00 0.00 ? 178 VAL A CB   3  
ATOM 7199  C CG1  . VAL A 1 159 ? -1.556  9.317   -29.633 2.00 0.00 ? 178 VAL A CG1  3  
ATOM 7200  C CG2  . VAL A 1 159 ? -1.877  11.328  -28.188 2.00 0.00 ? 178 VAL A CG2  3  
ATOM 7201  H H    . VAL A 1 159 ? -0.810  12.490  -30.110 1.00 0.00 ? 178 VAL A H    3  
ATOM 7202  H HA   . VAL A 1 159 ? -2.745  10.768  -31.463 1.00 0.00 ? 178 VAL A HA   3  
ATOM 7203  H HB   . VAL A 1 159 ? -3.420  10.180  -29.092 1.00 0.00 ? 178 VAL A HB   3  
ATOM 7204  H HG11 . VAL A 1 159 ? -1.783  8.925   -30.613 1.00 0.00 ? 178 VAL A HG11 3  
ATOM 7205  H HG12 . VAL A 1 159 ? -1.745  8.558   -28.888 1.00 0.00 ? 178 VAL A HG12 3  
ATOM 7206  H HG13 . VAL A 1 159 ? -0.517  9.609   -29.594 1.00 0.00 ? 178 VAL A HG13 3  
ATOM 7207  H HG21 . VAL A 1 159 ? -2.064  12.379  -28.350 1.00 0.00 ? 178 VAL A HG21 3  
ATOM 7208  H HG22 . VAL A 1 159 ? -0.812  11.161  -28.113 1.00 0.00 ? 178 VAL A HG22 3  
ATOM 7209  H HG23 . VAL A 1 159 ? -2.357  11.012  -27.275 1.00 0.00 ? 178 VAL A HG23 3  
ATOM 7210  N N    . ALA A 1 1   ? 0.398   -16.267 -13.402 1.00 0.00 ? 20  ALA A N    4  
ATOM 7211  C CA   . ALA A 1 1   ? -0.214  -15.032 -12.848 1.00 0.00 ? 20  ALA A CA   4  
ATOM 7212  C C    . ALA A 1 1   ? 0.077   -14.898 -11.357 1.00 0.00 ? 20  ALA A C    4  
ATOM 7213  O O    . ALA A 1 1   ? -0.425  -15.675 -10.545 1.00 0.00 ? 20  ALA A O    4  
ATOM 7214  C CB   . ALA A 1 1   ? -1.715  -15.030 -13.095 1.00 0.00 ? 20  ALA A CB   4  
ATOM 7215  H H1   . ALA A 1 1   ? -0.317  -17.019 -13.472 1.00 0.00 ? 20  ALA A H1   4  
ATOM 7216  H H2   . ALA A 1 1   ? 1.168   -16.593 -12.785 1.00 0.00 ? 20  ALA A H2   4  
ATOM 7217  H H3   . ALA A 1 1   ? 0.784   -16.081 -14.350 1.00 0.00 ? 20  ALA A H3   4  
ATOM 7218  H HA   . ALA A 1 1   ? 0.211   -14.183 -13.363 1.00 0.00 ? 20  ALA A HA   4  
ATOM 7219  H HB1  . ALA A 1 1   ? -2.181  -15.788 -12.483 1.00 0.00 ? 20  ALA A HB1  4  
ATOM 7220  H HB2  . ALA A 1 1   ? -1.908  -15.239 -14.137 1.00 0.00 ? 20  ALA A HB2  4  
ATOM 7221  H HB3  . ALA A 1 1   ? -2.121  -14.063 -12.841 1.00 0.00 ? 20  ALA A HB3  4  
ATOM 7222  N N    . GLN A 1 2   ? 0.891   -13.909 -11.004 1.00 0.00 ? 21  GLN A N    4  
ATOM 7223  C CA   . GLN A 1 2   ? 1.249   -13.674 -9.610  1.00 0.00 ? 21  GLN A CA   4  
ATOM 7224  C C    . GLN A 1 2   ? 1.583   -12.205 -9.373  1.00 0.00 ? 21  GLN A C    4  
ATOM 7225  O O    . GLN A 1 2   ? 2.336   -11.598 -10.135 1.00 0.00 ? 21  GLN A O    4  
ATOM 7226  C CB   . GLN A 1 2   ? 2.439   -14.548 -9.211  1.00 0.00 ? 21  GLN A CB   4  
ATOM 7227  C CG   . GLN A 1 2   ? 3.248   -15.109 -10.370 1.00 0.00 ? 21  GLN A CG   4  
ATOM 7228  C CD   . GLN A 1 2   ? 4.644   -14.524 -10.447 1.00 0.00 ? 21  GLN A CD   4  
ATOM 7229  O OE1  . GLN A 1 2   ? 5.606   -15.224 -10.763 1.00 0.00 ? 21  GLN A OE1  4  
ATOM 7230  N NE2  . GLN A 1 2   ? 4.762   -13.234 -10.157 4.00 0.00 ? 21  GLN A NE2  4  
ATOM 7231  H H    . GLN A 1 2   ? 1.260   -13.323 -11.698 1.00 0.00 ? 21  GLN A H    4  
ATOM 7232  H HA   . GLN A 1 2   ? 0.398   -13.940 -9.001  1.00 0.00 ? 21  GLN A HA   4  
ATOM 7233  H HB2  . GLN A 1 2   ? 3.105   -13.961 -8.594  2.00 0.00 ? 21  GLN A HB2  4  
ATOM 7234  H HB3  . GLN A 1 2   ? 2.074   -15.378 -8.625  2.00 0.00 ? 21  GLN A HB3  4  
ATOM 7235  H HG2  . GLN A 1 2   ? 3.328   -16.180 -10.250 2.00 0.00 ? 21  GLN A HG2  4  
ATOM 7236  H HG3  . GLN A 1 2   ? 2.731   -14.889 -11.292 2.00 0.00 ? 21  GLN A HG3  4  
ATOM 7237  H HE21 . GLN A 1 2   ? 3.950   -12.737 -9.912  5.00 0.00 ? 21  GLN A HE21 4  
ATOM 7238  H HE22 . GLN A 1 2   ? 5.657   -12.828 -10.199 5.00 0.00 ? 21  GLN A HE22 4  
ATOM 7239  N N    . ILE A 1 3   ? 1.014   -11.637 -8.314  1.00 0.00 ? 22  ILE A N    4  
ATOM 7240  C CA   . ILE A 1 3   ? 1.249   -10.239 -7.980  1.00 0.00 ? 22  ILE A CA   4  
ATOM 7241  C C    . ILE A 1 3   ? 1.862   -10.092 -6.591  1.00 0.00 ? 22  ILE A C    4  
ATOM 7242  O O    . ILE A 1 3   ? 1.572   -10.872 -5.684  1.00 0.00 ? 22  ILE A O    4  
ATOM 7243  C CB   . ILE A 1 3   ? -0.056  -9.423  -8.038  1.00 0.00 ? 22  ILE A CB   4  
ATOM 7244  C CG1  . ILE A 1 3   ? -1.223  -10.310 -8.478  1.00 0.00 ? 22  ILE A CG1  4  
ATOM 7245  C CG2  . ILE A 1 3   ? 0.106   -8.245  -8.984  1.00 0.00 ? 22  ILE A CG2  4  
ATOM 7246  C CD1  . ILE A 1 3   ? -2.436  -9.535  -8.945  1.00 0.00 ? 22  ILE A CD1  4  
ATOM 7247  H H    . ILE A 1 3   ? 0.421   -12.171 -7.747  1.00 0.00 ? 22  ILE A H    4  
ATOM 7248  H HA   . ILE A 1 3   ? 1.935   -9.833  -8.710  1.00 0.00 ? 22  ILE A HA   4  
ATOM 7249  H HB   . ILE A 1 3   ? -0.258  -9.036  -7.052  1.00 0.00 ? 22  ILE A HB   4  
ATOM 7250  H HG12 . ILE A 1 3   ? -0.899  -10.942 -9.292  2.00 0.00 ? 22  ILE A HG12 4  
ATOM 7251  H HG13 . ILE A 1 3   ? -1.527  -10.931 -7.649  2.00 0.00 ? 22  ILE A HG13 4  
ATOM 7252  H HG21 . ILE A 1 3   ? -0.847  -7.756  -9.116  1.00 0.00 ? 22  ILE A HG21 4  
ATOM 7253  H HG22 . ILE A 1 3   ? 0.466   -8.598  -9.937  1.00 0.00 ? 22  ILE A HG22 4  
ATOM 7254  H HG23 . ILE A 1 3   ? 0.814   -7.545  -8.567  1.00 0.00 ? 22  ILE A HG23 4  
ATOM 7255  H HD11 . ILE A 1 3   ? -3.220  -10.224 -9.221  1.00 0.00 ? 22  ILE A HD11 4  
ATOM 7256  H HD12 . ILE A 1 3   ? -2.170  -8.933  -9.802  1.00 0.00 ? 22  ILE A HD12 4  
ATOM 7257  H HD13 . ILE A 1 3   ? -2.783  -8.894  -8.148  1.00 0.00 ? 22  ILE A HD13 4  
ATOM 7258  N N    . ASP A 1 4   ? 2.709   -9.078  -6.434  1.00 0.00 ? 23  ASP A N    4  
ATOM 7259  C CA   . ASP A 1 4   ? 3.365   -8.811  -5.158  1.00 0.00 ? 23  ASP A CA   4  
ATOM 7260  C C    . ASP A 1 4   ? 2.840   -7.516  -4.549  1.00 0.00 ? 23  ASP A C    4  
ATOM 7261  O O    . ASP A 1 4   ? 3.175   -6.424  -5.007  1.00 0.00 ? 23  ASP A O    4  
ATOM 7262  C CB   . ASP A 1 4   ? 4.880   -8.721  -5.348  1.00 0.00 ? 23  ASP A CB   4  
ATOM 7263  C CG   . ASP A 1 4   ? 5.486   -10.025 -5.829  1.00 0.00 ? 23  ASP A CG   4  
ATOM 7264  O OD1  . ASP A 1 4   ? 5.139   -10.465 -6.946  1.00 0.00 ? 23  ASP A OD1  4  
ATOM 7265  O OD2  . ASP A 1 4   ? 6.306   -10.607 -5.088  1.00 0.00 ? 23  ASP A OD2  4  
ATOM 7266  H H    . ASP A 1 4   ? 2.893   -8.490  -7.196  1.00 0.00 ? 23  ASP A H    4  
ATOM 7267  H HA   . ASP A 1 4   ? 3.141   -9.629  -4.487  1.00 0.00 ? 23  ASP A HA   4  
ATOM 7268  H HB2  . ASP A 1 4   ? 5.100   -7.954  -6.078  2.00 0.00 ? 23  ASP A HB2  4  
ATOM 7269  H HB3  . ASP A 1 4   ? 5.339   -8.459  -4.405  2.00 0.00 ? 23  ASP A HB3  4  
ATOM 7270  N N    . LEU A 1 5   ? 2.015   -7.642  -3.516  1.00 0.00 ? 24  LEU A N    4  
ATOM 7271  C CA   . LEU A 1 5   ? 1.445   -6.478  -2.849  1.00 0.00 ? 24  LEU A CA   4  
ATOM 7272  C C    . LEU A 1 5   ? 2.157   -6.210  -1.530  1.00 0.00 ? 24  LEU A C    4  
ATOM 7273  O O    . LEU A 1 5   ? 1.760   -6.724  -0.484  1.00 0.00 ? 24  LEU A O    4  
ATOM 7274  C CB   . LEU A 1 5   ? -0.049  -6.680  -2.599  1.00 0.00 ? 24  LEU A CB   4  
ATOM 7275  C CG   . LEU A 1 5   ? -0.496  -8.098  -2.259  1.00 0.00 ? 24  LEU A CG   4  
ATOM 7276  C CD1  . LEU A 1 5   ? -1.914  -8.093  -1.711  2.00 0.00 ? 24  LEU A CD1  4  
ATOM 7277  C CD2  . LEU A 1 5   ? -0.407  -8.993  -3.487  2.00 0.00 ? 24  LEU A CD2  4  
ATOM 7278  H H    . LEU A 1 5   ? 1.783   -8.539  -3.195  1.00 0.00 ? 24  LEU A H    4  
ATOM 7279  H HA   . LEU A 1 5   ? 1.577   -5.629  -3.497  1.00 0.00 ? 24  LEU A HA   4  
ATOM 7280  H HB2  . LEU A 1 5   ? -0.343  -6.032  -1.786  2.00 0.00 ? 24  LEU A HB2  4  
ATOM 7281  H HB3  . LEU A 1 5   ? -0.581  -6.363  -3.484  2.00 0.00 ? 24  LEU A HB3  4  
ATOM 7282  H HG   . LEU A 1 5   ? 0.157   -8.503  -1.501  1.00 0.00 ? 24  LEU A HG   4  
ATOM 7283  H HD11 . LEU A 1 5   ? -2.104  -9.023  -1.195  1.00 0.00 ? 24  LEU A HD11 4  
ATOM 7284  H HD12 . LEU A 1 5   ? -2.614  -7.985  -2.525  1.00 0.00 ? 24  LEU A HD12 4  
ATOM 7285  H HD13 . LEU A 1 5   ? -2.031  -7.269  -1.023  1.00 0.00 ? 24  LEU A HD13 4  
ATOM 7286  H HD21 . LEU A 1 5   ? 0.180   -8.498  -4.248  1.00 0.00 ? 24  LEU A HD21 4  
ATOM 7287  H HD22 . LEU A 1 5   ? -1.400  -9.185  -3.866  1.00 0.00 ? 24  LEU A HD22 4  
ATOM 7288  H HD23 . LEU A 1 5   ? 0.064   -9.926  -3.219  1.00 0.00 ? 24  LEU A HD23 4  
ATOM 7289  N N    . ASN A 1 6   ? 3.210   -5.406  -1.587  1.00 0.00 ? 25  ASN A N    4  
ATOM 7290  C CA   . ASN A 1 6   ? 3.976   -5.075  -0.396  1.00 0.00 ? 25  ASN A CA   4  
ATOM 7291  C C    . ASN A 1 6   ? 3.283   -3.989  0.413   1.00 0.00 ? 25  ASN A C    4  
ATOM 7292  O O    . ASN A 1 6   ? 3.108   -2.866  -0.056  1.00 0.00 ? 25  ASN A O    4  
ATOM 7293  C CB   . ASN A 1 6   ? 5.385   -4.623  -0.777  1.00 0.00 ? 25  ASN A CB   4  
ATOM 7294  C CG   . ASN A 1 6   ? 6.177   -4.119  0.414   1.00 0.00 ? 25  ASN A CG   4  
ATOM 7295  O OD1  . ASN A 1 6   ? 6.051   -2.962  0.814   1.00 0.00 ? 25  ASN A OD1  4  
ATOM 7296  N ND2  . ASN A 1 6   ? 6.999   -4.989  0.988   4.00 0.00 ? 25  ASN A ND2  4  
ATOM 7297  H H    . ASN A 1 6   ? 3.479   -5.029  -2.451  1.00 0.00 ? 25  ASN A H    4  
ATOM 7298  H HA   . ASN A 1 6   ? 4.047   -5.967  0.209   1.00 0.00 ? 25  ASN A HA   4  
ATOM 7299  H HB2  . ASN A 1 6   ? 5.918   -5.455  -1.214  2.00 0.00 ? 25  ASN A HB2  4  
ATOM 7300  H HB3  . ASN A 1 6   ? 5.316   -3.825  -1.502  2.00 0.00 ? 25  ASN A HB3  4  
ATOM 7301  H HD21 . ASN A 1 6   ? 7.049   -5.897  0.613   5.00 0.00 ? 25  ASN A HD21 4  
ATOM 7302  H HD22 . ASN A 1 6   ? 7.526   -4.690  1.762   5.00 0.00 ? 25  ASN A HD22 4  
ATOM 7303  N N    . ILE A 1 7   ? 2.891   -4.332  1.633   1.00 0.00 ? 26  ILE A N    4  
ATOM 7304  C CA   . ILE A 1 7   ? 2.222   -3.382  2.510   1.00 0.00 ? 26  ILE A CA   4  
ATOM 7305  C C    . ILE A 1 7   ? 3.093   -3.052  3.716   1.00 0.00 ? 26  ILE A C    4  
ATOM 7306  O O    . ILE A 1 7   ? 4.259   -3.443  3.777   1.00 0.00 ? 26  ILE A O    4  
ATOM 7307  C CB   . ILE A 1 7   ? 0.852   -3.912  2.983   1.00 0.00 ? 26  ILE A CB   4  
ATOM 7308  C CG1  . ILE A 1 7   ? 0.991   -4.720  4.274   1.00 0.00 ? 26  ILE A CG1  4  
ATOM 7309  C CG2  . ILE A 1 7   ? 0.204   -4.753  1.894   1.00 0.00 ? 26  ILE A CG2  4  
ATOM 7310  C CD1  . ILE A 1 7   ? -0.178  -4.558  5.224   1.00 0.00 ? 26  ILE A CD1  4  
ATOM 7311  H H    . ILE A 1 7   ? 3.062   -5.243  1.952   1.00 0.00 ? 26  ILE A H    4  
ATOM 7312  H HA   . ILE A 1 7   ? 2.056   -2.475  1.946   1.00 0.00 ? 26  ILE A HA   4  
ATOM 7313  H HB   . ILE A 1 7   ? 0.212   -3.062  3.168   1.00 0.00 ? 26  ILE A HB   4  
ATOM 7314  H HG12 . ILE A 1 7   ? 1.076   -5.768  4.027   2.00 0.00 ? 26  ILE A HG12 4  
ATOM 7315  H HG13 . ILE A 1 7   ? 1.884   -4.407  4.794   2.00 0.00 ? 26  ILE A HG13 4  
ATOM 7316  H HG21 . ILE A 1 7   ? 0.186   -5.787  2.201   1.00 0.00 ? 26  ILE A HG21 4  
ATOM 7317  H HG22 . ILE A 1 7   ? 0.771   -4.658  0.980   1.00 0.00 ? 26  ILE A HG22 4  
ATOM 7318  H HG23 . ILE A 1 7   ? -0.807  -4.408  1.728   1.00 0.00 ? 26  ILE A HG23 4  
ATOM 7319  H HD11 . ILE A 1 7   ? 0.071   -3.831  5.983   1.00 0.00 ? 26  ILE A HD11 4  
ATOM 7320  H HD12 . ILE A 1 7   ? -0.396  -5.507  5.691   1.00 0.00 ? 26  ILE A HD12 4  
ATOM 7321  H HD13 . ILE A 1 7   ? -1.047  -4.220  4.674   1.00 0.00 ? 26  ILE A HD13 4  
ATOM 7322  N N    . THR A 1 8   ? 2.523   -2.331  4.675   1.00 0.00 ? 27  THR A N    4  
ATOM 7323  C CA   . THR A 1 8   ? 3.253   -1.949  5.875   1.00 0.00 ? 27  THR A CA   4  
ATOM 7324  C C    . THR A 1 8   ? 2.763   -2.743  7.078   1.00 0.00 ? 27  THR A C    4  
ATOM 7325  O O    . THR A 1 8   ? 3.560   -3.268  7.854   1.00 0.00 ? 27  THR A O    4  
ATOM 7326  C CB   . THR A 1 8   ? 3.098   -0.445  6.161   1.00 0.00 ? 27  THR A CB   4  
ATOM 7327  O OG1  . THR A 1 8   ? 3.850   0.313   5.207   1.00 0.00 ? 27  THR A OG1  4  
ATOM 7328  C CG2  . THR A 1 8   ? 3.564   -0.101  7.568   1.00 0.00 ? 27  THR A CG2  4  
ATOM 7329  H H    . THR A 1 8   ? 1.589   -2.048  4.572   1.00 0.00 ? 27  THR A H    4  
ATOM 7330  H HA   . THR A 1 8   ? 4.301   -2.161  5.716   1.00 0.00 ? 27  THR A HA   4  
ATOM 7331  H HB   . THR A 1 8   ? 2.053   -0.184  6.072   1.00 0.00 ? 27  THR A HB   4  
ATOM 7332  H HG1  . THR A 1 8   ? 3.747   -0.076  4.336   1.00 0.00 ? 27  THR A HG1  4  
ATOM 7333  H HG21 . THR A 1 8   ? 3.256   -0.880  8.250   1.00 0.00 ? 27  THR A HG21 4  
ATOM 7334  H HG22 . THR A 1 8   ? 3.124   0.838   7.871   1.00 0.00 ? 27  THR A HG22 4  
ATOM 7335  H HG23 . THR A 1 8   ? 4.640   -0.016  7.580   1.00 0.00 ? 27  THR A HG23 4  
ATOM 7336  N N    . CYS A 1 9   ? 1.443   -2.822  7.208   1.00 0.00 ? 28  CYS A N    4  
ATOM 7337  C CA   . CYS A 1 9   ? 0.797   -3.550  8.302   1.00 0.00 ? 28  CYS A CA   4  
ATOM 7338  C C    . CYS A 1 9   ? -0.464  -2.825  8.744   1.00 0.00 ? 28  CYS A C    4  
ATOM 7339  O O    . CYS A 1 9   ? -0.802  -1.776  8.204   1.00 0.00 ? 28  CYS A O    4  
ATOM 7340  C CB   . CYS A 1 9   ? 1.736   -3.714  9.500   1.00 0.00 ? 28  CYS A CB   4  
ATOM 7341  S SG   . CYS A 1 9   ? 2.712   -5.252  9.481   1.00 0.00 ? 28  CYS A SG   4  
ATOM 7342  H H    . CYS A 1 9   ? 0.879   -2.375  6.537   1.00 0.00 ? 28  CYS A H    4  
ATOM 7343  H HA   . CYS A 1 9   ? 0.524   -4.527  7.933   1.00 0.00 ? 28  CYS A HA   4  
ATOM 7344  H HB2  . CYS A 1 9   ? 2.426   -2.885  9.521   2.00 0.00 ? 28  CYS A HB2  4  
ATOM 7345  H HB3  . CYS A 1 9   ? 1.149   -3.711  10.408  2.00 0.00 ? 28  CYS A HB3  4  
ATOM 7346  N N    . ARG A 1 10  ? -1.150  -3.382  9.734   1.00 0.00 ? 29  ARG A N    4  
ATOM 7347  C CA   . ARG A 1 10  ? -2.373  -2.772  10.244  1.00 0.00 ? 29  ARG A CA   4  
ATOM 7348  C C    . ARG A 1 10  ? -2.271  -2.539  11.745  1.00 0.00 ? 29  ARG A C    4  
ATOM 7349  O O    . ARG A 1 10  ? -2.583  -3.417  12.550  1.00 0.00 ? 29  ARG A O    4  
ATOM 7350  C CB   . ARG A 1 10  ? -3.583  -3.648  9.922   1.00 0.00 ? 29  ARG A CB   4  
ATOM 7351  C CG   . ARG A 1 10  ? -3.385  -4.542  8.710   1.00 0.00 ? 29  ARG A CG   4  
ATOM 7352  C CD   . ARG A 1 10  ? -2.825  -5.899  9.098   1.00 0.00 ? 29  ARG A CD   4  
ATOM 7353  N NE   . ARG A 1 10  ? -3.870  -6.910  9.239   1.00 0.00 ? 29  ARG A NE   4  
ATOM 7354  C CZ   . ARG A 1 10  ? -4.381  -7.282  10.407  4.00 0.00 ? 29  ARG A CZ   4  
ATOM 7355  N NH1  . ARG A 1 10  ? -3.950  -6.734  11.535  5.00 0.00 ? 29  ARG A NH1  4  
ATOM 7356  N NH2  . ARG A 1 10  ? -5.329  -8.209  10.458  5.00 0.00 ? 29  ARG A NH2  4  
ATOM 7357  H H    . ARG A 1 10  ? -0.824  -4.216  10.136  1.00 0.00 ? 29  ARG A H    4  
ATOM 7358  H HA   . ARG A 1 10  ? -2.492  -1.818  9.755   1.00 0.00 ? 29  ARG A HA   4  
ATOM 7359  H HB2  . ARG A 1 10  ? -3.798  -4.276  10.774  2.00 0.00 ? 29  ARG A HB2  4  
ATOM 7360  H HB3  . ARG A 1 10  ? -4.434  -3.010  9.733   2.00 0.00 ? 29  ARG A HB3  4  
ATOM 7361  H HG2  . ARG A 1 10  ? -4.335  -4.679  8.212   2.00 0.00 ? 29  ARG A HG2  4  
ATOM 7362  H HG3  . ARG A 1 10  ? -2.693  -4.061  8.032   2.00 0.00 ? 29  ARG A HG3  4  
ATOM 7363  H HD2  . ARG A 1 10  ? -2.128  -6.217  8.338   2.00 0.00 ? 29  ARG A HD2  4  
ATOM 7364  H HD3  . ARG A 1 10  ? -2.304  -5.797  10.040  2.00 0.00 ? 29  ARG A HD3  4  
ATOM 7365  H HE   . ARG A 1 10  ? -4.206  -7.331  8.420   1.00 0.00 ? 29  ARG A HE   4  
ATOM 7366  H HH11 . ARG A 1 10  ? -3.235  -6.035  11.509  5.00 0.00 ? 29  ARG A HH11 4  
ATOM 7367  H HH12 . ARG A 1 10  ? -4.339  -7.019  12.411  5.00 0.00 ? 29  ARG A HH12 4  
ATOM 7368  H HH21 . ARG A 1 10  ? -5.662  -8.631  9.615   5.00 0.00 ? 29  ARG A HH21 4  
ATOM 7369  H HH22 . ARG A 1 10  ? -5.710  -8.486  11.341  5.00 0.00 ? 29  ARG A HH22 4  
ATOM 7370  N N    . PHE A 1 11  ? -1.819  -1.347  12.110  1.00 0.00 ? 30  PHE A N    4  
ATOM 7371  C CA   . PHE A 1 11  ? -1.656  -0.984  13.514  1.00 0.00 ? 30  PHE A CA   4  
ATOM 7372  C C    . PHE A 1 11  ? -2.991  -0.581  14.137  1.00 0.00 ? 30  PHE A C    4  
ATOM 7373  O O    . PHE A 1 11  ? -3.933  -1.373  14.164  1.00 0.00 ? 30  PHE A O    4  
ATOM 7374  C CB   . PHE A 1 11  ? -0.643  0.155   13.650  1.00 0.00 ? 30  PHE A CB   4  
ATOM 7375  C CG   . PHE A 1 11  ? 0.760   -0.179  13.225  1.00 0.00 ? 30  PHE A CG   4  
ATOM 7376  C CD1  . PHE A 1 11  ? 0.993   -0.951  12.098  1.00 0.00 ? 30  PHE A CD1  4  
ATOM 7377  C CD2  . PHE A 1 11  ? 1.847   0.281   13.953  1.00 0.00 ? 30  PHE A CD2  4  
ATOM 7378  C CE1  . PHE A 1 11  ? 2.281   -1.258  11.705  1.00 0.00 ? 30  PHE A CE1  4  
ATOM 7379  C CE2  . PHE A 1 11  ? 3.138   -0.024  13.564  1.00 0.00 ? 30  PHE A CE2  4  
ATOM 7380  C CZ   . PHE A 1 11  ? 3.355   -0.794  12.438  1.00 0.00 ? 30  PHE A CZ   4  
ATOM 7381  H H    . PHE A 1 11  ? -1.583  -0.697  11.414  1.00 0.00 ? 30  PHE A H    4  
ATOM 7382  H HA   . PHE A 1 11  ? -1.279  -1.851  14.037  1.00 0.00 ? 30  PHE A HA   4  
ATOM 7383  H HB2  . PHE A 1 11  ? -0.976  0.990   13.051  2.00 0.00 ? 30  PHE A HB2  4  
ATOM 7384  H HB3  . PHE A 1 11  ? -0.607  0.465   14.683  2.00 0.00 ? 30  PHE A HB3  4  
ATOM 7385  H HD1  . PHE A 1 11  ? 0.155   -1.315  11.523  1.00 0.00 ? 30  PHE A HD1  4  
ATOM 7386  H HD2  . PHE A 1 11  ? 1.679   0.884   14.834  1.00 0.00 ? 30  PHE A HD2  4  
ATOM 7387  H HE1  . PHE A 1 11  ? 2.448   -1.861  10.824  1.00 0.00 ? 30  PHE A HE1  4  
ATOM 7388  H HE2  . PHE A 1 11  ? 3.976   0.341   14.140  1.00 0.00 ? 30  PHE A HE2  4  
ATOM 7389  H HZ   . PHE A 1 11  ? 4.363   -1.033  12.133  1.00 0.00 ? 30  PHE A HZ   4  
ATOM 7390  N N    . ALA A 1 12  ? -3.060  0.651   14.640  1.00 0.00 ? 31  ALA A N    4  
ATOM 7391  C CA   . ALA A 1 12  ? -4.275  1.167   15.267  1.00 0.00 ? 31  ALA A CA   4  
ATOM 7392  C C    . ALA A 1 12  ? -5.521  0.798   14.468  1.00 0.00 ? 31  ALA A C    4  
ATOM 7393  O O    . ALA A 1 12  ? -6.645  1.005   14.923  1.00 0.00 ? 31  ALA A O    4  
ATOM 7394  C CB   . ALA A 1 12  ? -4.182  2.677   15.423  1.00 0.00 ? 31  ALA A CB   4  
ATOM 7395  H H    . ALA A 1 12  ? -2.271  1.227   14.596  1.00 0.00 ? 31  ALA A H    4  
ATOM 7396  H HA   . ALA A 1 12  ? -4.350  0.734   16.252  1.00 0.00 ? 31  ALA A HA   4  
ATOM 7397  H HB1  . ALA A 1 12  ? -4.981  3.146   14.868  1.00 0.00 ? 31  ALA A HB1  4  
ATOM 7398  H HB2  . ALA A 1 12  ? -3.231  3.019   15.044  1.00 0.00 ? 31  ALA A HB2  4  
ATOM 7399  H HB3  . ALA A 1 12  ? -4.269  2.937   16.468  1.00 0.00 ? 31  ALA A HB3  4  
ATOM 7400  N N    . GLY A 1 13  ? -5.309  0.252   13.278  1.00 0.00 ? 32  GLY A N    4  
ATOM 7401  C CA   . GLY A 1 13  ? -6.413  -0.136  12.421  1.00 0.00 ? 32  GLY A CA   4  
ATOM 7402  C C    . GLY A 1 13  ? -6.188  0.256   10.974  1.00 0.00 ? 32  GLY A C    4  
ATOM 7403  O O    . GLY A 1 13  ? -7.062  0.070   10.127  1.00 0.00 ? 32  GLY A O    4  
ATOM 7404  H H    . GLY A 1 13  ? -4.392  0.110   12.977  1.00 0.00 ? 32  GLY A H    4  
ATOM 7405  H HA2  . GLY A 1 13  ? -6.539  -1.208  12.478  2.00 0.00 ? 32  GLY A HA2  4  
ATOM 7406  H HA3  . GLY A 1 13  ? -7.315  0.341   12.776  2.00 0.00 ? 32  GLY A HA3  4  
ATOM 7407  N N    . VAL A 1 14  ? -5.008  0.804   10.694  1.00 0.00 ? 33  VAL A N    4  
ATOM 7408  C CA   . VAL A 1 14  ? -4.655  1.229   9.348   1.00 0.00 ? 33  VAL A CA   4  
ATOM 7409  C C    . VAL A 1 14  ? -3.600  0.309   8.743   1.00 0.00 ? 33  VAL A C    4  
ATOM 7410  O O    . VAL A 1 14  ? -2.590  0.003   9.383   1.00 0.00 ? 33  VAL A O    4  
ATOM 7411  C CB   . VAL A 1 14  ? -4.107  2.673   9.340   1.00 0.00 ? 33  VAL A CB   4  
ATOM 7412  C CG1  . VAL A 1 14  ? -2.799  2.751   8.569   2.00 0.00 ? 33  VAL A CG1  4  
ATOM 7413  C CG2  . VAL A 1 14  ? -5.115  3.642   8.749   2.00 0.00 ? 33  VAL A CG2  4  
ATOM 7414  H H    . VAL A 1 14  ? -4.356  0.925   11.414  1.00 0.00 ? 33  VAL A H    4  
ATOM 7415  H HA   . VAL A 1 14  ? -5.545  1.197   8.738   1.00 0.00 ? 33  VAL A HA   4  
ATOM 7416  H HB   . VAL A 1 14  ? -3.917  2.962   10.363  1.00 0.00 ? 33  VAL A HB   4  
ATOM 7417  H HG11 . VAL A 1 14  ? -2.387  3.744   8.659   1.00 0.00 ? 33  VAL A HG11 4  
ATOM 7418  H HG12 . VAL A 1 14  ? -2.985  2.529   7.529   1.00 0.00 ? 33  VAL A HG12 4  
ATOM 7419  H HG13 . VAL A 1 14  ? -2.101  2.032   8.972   1.00 0.00 ? 33  VAL A HG13 4  
ATOM 7420  H HG21 . VAL A 1 14  ? -5.030  4.597   9.247   1.00 0.00 ? 33  VAL A HG21 4  
ATOM 7421  H HG22 . VAL A 1 14  ? -6.112  3.253   8.881   1.00 0.00 ? 33  VAL A HG22 4  
ATOM 7422  H HG23 . VAL A 1 14  ? -4.913  3.769   7.695   1.00 0.00 ? 33  VAL A HG23 4  
ATOM 7423  N N    . PHE A 1 15  ? -3.826  -0.107  7.502   1.00 0.00 ? 34  PHE A N    4  
ATOM 7424  C CA   . PHE A 1 15  ? -2.881  -0.962  6.803   1.00 0.00 ? 34  PHE A CA   4  
ATOM 7425  C C    . PHE A 1 15  ? -2.463  -0.288  5.507   1.00 0.00 ? 34  PHE A C    4  
ATOM 7426  O O    . PHE A 1 15  ? -3.283  -0.016  4.628   1.00 0.00 ? 34  PHE A O    4  
ATOM 7427  C CB   . PHE A 1 15  ? -3.479  -2.377  6.602   1.00 0.00 ? 34  PHE A CB   4  
ATOM 7428  C CG   . PHE A 1 15  ? -3.213  -3.078  5.282   1.00 0.00 ? 34  PHE A CG   4  
ATOM 7429  C CD1  . PHE A 1 15  ? -2.467  -2.498  4.267   1.00 0.00 ? 34  PHE A CD1  4  
ATOM 7430  C CD2  . PHE A 1 15  ? -3.756  -4.342  5.058   1.00 0.00 ? 34  PHE A CD2  4  
ATOM 7431  C CE1  . PHE A 1 15  ? -2.269  -3.159  3.070   1.00 0.00 ? 34  PHE A CE1  4  
ATOM 7432  C CE2  . PHE A 1 15  ? -3.563  -5.002  3.862   1.00 0.00 ? 34  PHE A CE2  4  
ATOM 7433  C CZ   . PHE A 1 15  ? -2.818  -4.408  2.867   1.00 0.00 ? 34  PHE A CZ   4  
ATOM 7434  H H    . PHE A 1 15  ? -4.639  0.186   7.037   1.00 0.00 ? 34  PHE A H    4  
ATOM 7435  H HA   . PHE A 1 15  ? -2.009  -1.045  7.432   1.00 0.00 ? 34  PHE A HA   4  
ATOM 7436  H HB2  . PHE A 1 15  ? -3.089  -3.013  7.379   2.00 0.00 ? 34  PHE A HB2  4  
ATOM 7437  H HB3  . PHE A 1 15  ? -4.551  -2.310  6.716   2.00 0.00 ? 34  PHE A HB3  4  
ATOM 7438  H HD1  . PHE A 1 15  ? -2.033  -1.526  4.415   1.00 0.00 ? 34  PHE A HD1  4  
ATOM 7439  H HD2  . PHE A 1 15  ? -4.340  -4.814  5.832   1.00 0.00 ? 34  PHE A HD2  4  
ATOM 7440  H HE1  . PHE A 1 15  ? -1.688  -2.693  2.288   1.00 0.00 ? 34  PHE A HE1  4  
ATOM 7441  H HE2  . PHE A 1 15  ? -4.005  -5.980  3.702   1.00 0.00 ? 34  PHE A HE2  4  
ATOM 7442  H HZ   . PHE A 1 15  ? -2.665  -4.918  1.932   1.00 0.00 ? 34  PHE A HZ   4  
ATOM 7443  N N    . HIS A 1 16  ? -1.173  0.011   5.423   1.00 0.00 ? 35  HIS A N    4  
ATOM 7444  C CA   . HIS A 1 16  ? -0.605  0.684   4.266   1.00 0.00 ? 35  HIS A CA   4  
ATOM 7445  C C    . HIS A 1 16  ? -0.263  -0.327  3.175   1.00 0.00 ? 35  HIS A C    4  
ATOM 7446  O O    . HIS A 1 16  ? 0.579   -1.198  3.371   1.00 0.00 ? 35  HIS A O    4  
ATOM 7447  C CB   . HIS A 1 16  ? 0.645   1.463   4.698   1.00 0.00 ? 35  HIS A CB   4  
ATOM 7448  C CG   . HIS A 1 16  ? 1.528   1.901   3.575   1.00 0.00 ? 35  HIS A CG   4  
ATOM 7449  N ND1  . HIS A 1 16  ? 2.476   2.894   3.700   1.00 0.00 ? 35  HIS A ND1  4  
ATOM 7450  C CD2  . HIS A 1 16  ? 1.607   1.467   2.303   1.00 0.00 ? 35  HIS A CD2  4  
ATOM 7451  C CE1  . HIS A 1 16  ? 3.099   3.051   2.546   1.00 0.00 ? 35  HIS A CE1  4  
ATOM 7452  N NE2  . HIS A 1 16  ? 2.591   2.195   1.680   1.00 0.00 ? 35  HIS A NE2  4  
ATOM 7453  H H    . HIS A 1 16  ? -0.586  -0.213  6.175   1.00 0.00 ? 35  HIS A H    4  
ATOM 7454  H HA   . HIS A 1 16  ? -1.341  1.376   3.886   1.00 0.00 ? 35  HIS A HA   4  
ATOM 7455  H HB2  . HIS A 1 16  ? 0.336   2.346   5.237   2.00 0.00 ? 35  HIS A HB2  4  
ATOM 7456  H HB3  . HIS A 1 16  ? 1.234   0.840   5.356   2.00 0.00 ? 35  HIS A HB3  4  
ATOM 7457  H HD1  . HIS A 1 16  ? 2.663   3.408   4.513   1.00 0.00 ? 35  HIS A HD1  4  
ATOM 7458  H HD2  . HIS A 1 16  ? 1.004   0.691   1.862   1.00 0.00 ? 35  HIS A HD2  4  
ATOM 7459  H HE1  . HIS A 1 16  ? 3.891   3.758   2.347   1.00 0.00 ? 35  HIS A HE1  4  
ATOM 7460  H HE2  . HIS A 1 16  ? 2.962   2.004   0.793   1.00 0.00 ? 35  HIS A HE2  4  
ATOM 7461  N N    . VAL A 1 17  ? -0.925  -0.207  2.027   1.00 0.00 ? 36  VAL A N    4  
ATOM 7462  C CA   . VAL A 1 17  ? -0.687  -1.121  0.912   1.00 0.00 ? 36  VAL A CA   4  
ATOM 7463  C C    . VAL A 1 17  ? 0.240   -0.504  -0.133  1.00 0.00 ? 36  VAL A C    4  
ATOM 7464  O O    . VAL A 1 17  ? 0.260   0.712   -0.322  1.00 0.00 ? 36  VAL A O    4  
ATOM 7465  C CB   . VAL A 1 17  ? -2.003  -1.536  0.223   1.00 0.00 ? 36  VAL A CB   4  
ATOM 7466  C CG1  . VAL A 1 17  ? -3.074  -0.481  0.428   2.00 0.00 ? 36  VAL A CG1  4  
ATOM 7467  C CG2  . VAL A 1 17  ? -1.787  -1.786  -1.263  2.00 0.00 ? 36  VAL A CG2  4  
ATOM 7468  H H    . VAL A 1 17  ? -1.589  0.507   1.928   1.00 0.00 ? 36  VAL A H    4  
ATOM 7469  H HA   . VAL A 1 17  ? -0.227  -2.011  1.314   1.00 0.00 ? 36  VAL A HA   4  
ATOM 7470  H HB   . VAL A 1 17  ? -2.342  -2.455  0.677   1.00 0.00 ? 36  VAL A HB   4  
ATOM 7471  H HG11 . VAL A 1 17  ? -3.531  -0.617  1.397   1.00 0.00 ? 36  VAL A HG11 4  
ATOM 7472  H HG12 . VAL A 1 17  ? -3.826  -0.578  -0.342  1.00 0.00 ? 36  VAL A HG12 4  
ATOM 7473  H HG13 . VAL A 1 17  ? -2.627  0.499   0.374   1.00 0.00 ? 36  VAL A HG13 4  
ATOM 7474  H HG21 . VAL A 1 17  ? -0.913  -2.406  -1.400  1.00 0.00 ? 36  VAL A HG21 4  
ATOM 7475  H HG22 . VAL A 1 17  ? -1.644  -0.843  -1.771  1.00 0.00 ? 36  VAL A HG22 4  
ATOM 7476  H HG23 . VAL A 1 17  ? -2.652  -2.287  -1.673  1.00 0.00 ? 36  VAL A HG23 4  
ATOM 7477  N N    . GLU A 1 18  ? 0.997   -1.357  -0.819  1.00 0.00 ? 37  GLU A N    4  
ATOM 7478  C CA   . GLU A 1 18  ? 1.917   -0.908  -1.859  1.00 0.00 ? 37  GLU A CA   4  
ATOM 7479  C C    . GLU A 1 18  ? 2.197   -2.038  -2.846  1.00 0.00 ? 37  GLU A C    4  
ATOM 7480  O O    . GLU A 1 18  ? 2.182   -3.211  -2.477  1.00 0.00 ? 37  GLU A O    4  
ATOM 7481  C CB   . GLU A 1 18  ? 3.227   -0.411  -1.243  1.00 0.00 ? 37  GLU A CB   4  
ATOM 7482  C CG   . GLU A 1 18  ? 4.126   0.323   -2.224  1.00 0.00 ? 37  GLU A CG   4  
ATOM 7483  C CD   . GLU A 1 18  ? 5.551   0.462   -1.726  1.00 0.00 ? 37  GLU A CD   4  
ATOM 7484  O OE1  . GLU A 1 18  ? 5.838   -0.009  -0.606  1.00 0.00 ? 37  GLU A OE1  4  
ATOM 7485  O OE2  . GLU A 1 18  ? 6.381   1.042   -2.458  1.00 0.00 ? 37  GLU A OE2  4  
ATOM 7486  H H    . GLU A 1 18  ? 0.928   -2.316  -0.627  1.00 0.00 ? 37  GLU A H    4  
ATOM 7487  H HA   . GLU A 1 18  ? 1.445   -0.092  -2.387  1.00 0.00 ? 37  GLU A HA   4  
ATOM 7488  H HB2  . GLU A 1 18  ? 2.997   0.259   -0.428  2.00 0.00 ? 37  GLU A HB2  4  
ATOM 7489  H HB3  . GLU A 1 18  ? 3.772   -1.259  -0.855  2.00 0.00 ? 37  GLU A HB3  4  
ATOM 7490  H HG2  . GLU A 1 18  ? 4.139   -0.223  -3.156  2.00 0.00 ? 37  GLU A HG2  4  
ATOM 7491  H HG3  . GLU A 1 18  ? 3.722   1.310   -2.393  2.00 0.00 ? 37  GLU A HG3  4  
ATOM 7492  N N    . LYS A 1 19  ? 2.441   -1.680  -4.104  1.00 0.00 ? 38  LYS A N    4  
ATOM 7493  C CA   . LYS A 1 19  ? 2.714   -2.674  -5.138  1.00 0.00 ? 38  LYS A CA   4  
ATOM 7494  C C    . LYS A 1 19  ? 4.212   -2.860  -5.347  1.00 0.00 ? 38  LYS A C    4  
ATOM 7495  O O    . LYS A 1 19  ? 4.959   -1.889  -5.463  1.00 0.00 ? 38  LYS A O    4  
ATOM 7496  C CB   . LYS A 1 19  ? 2.055   -2.263  -6.457  1.00 0.00 ? 38  LYS A CB   4  
ATOM 7497  C CG   . LYS A 1 19  ? 2.311   -3.229  -7.601  1.00 0.00 ? 38  LYS A CG   4  
ATOM 7498  C CD   . LYS A 1 19  ? 1.266   -4.331  -7.657  1.00 0.00 ? 38  LYS A CD   4  
ATOM 7499  C CE   . LYS A 1 19  ? 1.127   -4.911  -9.056  1.00 0.00 ? 38  LYS A CE   4  
ATOM 7500  N NZ   . LYS A 1 19  ? 2.269   -5.800  -9.403  1.00 0.00 ? 38  LYS A NZ   4  
ATOM 7501  H H    . LYS A 1 19  ? 2.434   -0.729  -4.342  1.00 0.00 ? 38  LYS A H    4  
ATOM 7502  H HA   . LYS A 1 19  ? 2.289   -3.612  -4.814  1.00 0.00 ? 38  LYS A HA   4  
ATOM 7503  H HB2  . LYS A 1 19  ? 0.988   -2.196  -6.305  2.00 0.00 ? 38  LYS A HB2  4  
ATOM 7504  H HB3  . LYS A 1 19  ? 2.429   -1.292  -6.743  2.00 0.00 ? 38  LYS A HB3  4  
ATOM 7505  H HG2  . LYS A 1 19  ? 2.291   -2.680  -8.532  2.00 0.00 ? 38  LYS A HG2  4  
ATOM 7506  H HG3  . LYS A 1 19  ? 3.285   -3.677  -7.470  2.00 0.00 ? 38  LYS A HG3  4  
ATOM 7507  H HD2  . LYS A 1 19  ? 1.555   -5.120  -6.979  2.00 0.00 ? 38  LYS A HD2  4  
ATOM 7508  H HD3  . LYS A 1 19  ? 0.313   -3.924  -7.351  2.00 0.00 ? 38  LYS A HD3  4  
ATOM 7509  H HE2  . LYS A 1 19  ? 0.211   -5.479  -9.106  2.00 0.00 ? 38  LYS A HE2  4  
ATOM 7510  H HE3  . LYS A 1 19  ? 1.085   -4.098  -9.765  2.00 0.00 ? 38  LYS A HE3  4  
ATOM 7511  H HZ1  . LYS A 1 19  ? 2.121   -6.221  -10.342 1.00 0.00 ? 38  LYS A HZ1  4  
ATOM 7512  H HZ2  . LYS A 1 19  ? 2.354   -6.564  -8.703  1.00 0.00 ? 38  LYS A HZ2  4  
ATOM 7513  H HZ3  . LYS A 1 19  ? 3.156   -5.256  -9.413  1.00 0.00 ? 38  LYS A HZ3  4  
ATOM 7514  N N    . ASN A 1 20  ? 4.641   -4.118  -5.401  1.00 0.00 ? 39  ASN A N    4  
ATOM 7515  C CA   . ASN A 1 20  ? 6.050   -4.440  -5.604  1.00 0.00 ? 39  ASN A CA   4  
ATOM 7516  C C    . ASN A 1 20  ? 6.936   -3.686  -4.619  1.00 0.00 ? 39  ASN A C    4  
ATOM 7517  O O    . ASN A 1 20  ? 8.112   -3.441  -4.891  1.00 0.00 ? 39  ASN A O    4  
ATOM 7518  C CB   . ASN A 1 20  ? 6.467   -4.107  -7.038  1.00 0.00 ? 39  ASN A CB   4  
ATOM 7519  C CG   . ASN A 1 20  ? 7.137   -5.272  -7.740  1.00 0.00 ? 39  ASN A CG   4  
ATOM 7520  O OD1  . ASN A 1 20  ? 6.491   -6.267  -8.070  1.00 0.00 ? 39  ASN A OD1  4  
ATOM 7521  N ND2  . ASN A 1 20  ? 8.439   -5.153  -7.973  4.00 0.00 ? 39  ASN A ND2  4  
ATOM 7522  H H    . ASN A 1 20  ? 3.992   -4.848  -5.306  1.00 0.00 ? 39  ASN A H    4  
ATOM 7523  H HA   . ASN A 1 20  ? 6.173   -5.498  -5.440  1.00 0.00 ? 39  ASN A HA   4  
ATOM 7524  H HB2  . ASN A 1 20  ? 5.590   -3.828  -7.604  2.00 0.00 ? 39  ASN A HB2  4  
ATOM 7525  H HB3  . ASN A 1 20  ? 7.158   -3.277  -7.022  2.00 0.00 ? 39  ASN A HB3  4  
ATOM 7526  H HD21 . ASN A 1 20  ? 8.889   -4.330  -7.682  5.00 0.00 ? 39  ASN A HD21 4  
ATOM 7527  H HD22 . ASN A 1 20  ? 8.898   -5.894  -8.427  5.00 0.00 ? 39  ASN A HD22 4  
ATOM 7528  N N    . GLY A 1 21  ? 6.367   -3.320  -3.476  1.00 0.00 ? 40  GLY A N    4  
ATOM 7529  C CA   . GLY A 1 21  ? 7.125   -2.595  -2.472  1.00 0.00 ? 40  GLY A CA   4  
ATOM 7530  C C    . GLY A 1 21  ? 7.775   -1.351  -3.041  1.00 0.00 ? 40  GLY A C    4  
ATOM 7531  O O    . GLY A 1 21  ? 8.584   -0.704  -2.377  1.00 0.00 ? 40  GLY A O    4  
ATOM 7532  H H    . GLY A 1 21  ? 5.427   -3.541  -3.312  1.00 0.00 ? 40  GLY A H    4  
ATOM 7533  H HA2  . GLY A 1 21  ? 6.461   -2.309  -1.669  2.00 0.00 ? 40  GLY A HA2  4  
ATOM 7534  H HA3  . GLY A 1 21  ? 7.893   -3.243  -2.078  2.00 0.00 ? 40  GLY A HA3  4  
ATOM 7535  N N    . ARG A 1 22  ? 7.420   -1.021  -4.278  1.00 0.00 ? 41  ARG A N    4  
ATOM 7536  C CA   . ARG A 1 22  ? 7.974   0.150   -4.945  1.00 0.00 ? 41  ARG A CA   4  
ATOM 7537  C C    . ARG A 1 22  ? 6.874   1.113   -5.368  1.00 0.00 ? 41  ARG A C    4  
ATOM 7538  O O    . ARG A 1 22  ? 5.694   0.872   -5.116  1.00 0.00 ? 41  ARG A O    4  
ATOM 7539  C CB   . ARG A 1 22  ? 8.796   -0.274  -6.164  1.00 0.00 ? 41  ARG A CB   4  
ATOM 7540  C CG   . ARG A 1 22  ? 7.964   -0.585  -7.398  1.00 0.00 ? 41  ARG A CG   4  
ATOM 7541  C CD   . ARG A 1 22  ? 8.831   -0.784  -8.630  1.00 0.00 ? 41  ARG A CD   4  
ATOM 7542  N NE   . ARG A 1 22  ? 8.634   -2.096  -9.240  1.00 0.00 ? 41  ARG A NE   4  
ATOM 7543  C CZ   . ARG A 1 22  ? 9.265   -2.501  -10.338 4.00 0.00 ? 41  ARG A CZ   4  
ATOM 7544  N NH1  . ARG A 1 22  ? 10.133  -1.702  -10.945 5.00 0.00 ? 41  ARG A NH1  4  
ATOM 7545  N NH2  . ARG A 1 22  ? 9.035   -3.707  -10.837 5.00 0.00 ? 41  ARG A NH2  4  
ATOM 7546  H H    . ARG A 1 22  ? 6.772   -1.582  -4.755  1.00 0.00 ? 41  ARG A H    4  
ATOM 7547  H HA   . ARG A 1 22  ? 8.617   0.655   -4.248  1.00 0.00 ? 41  ARG A HA   4  
ATOM 7548  H HB2  . ARG A 1 22  ? 9.483   0.520   -6.413  2.00 0.00 ? 41  ARG A HB2  4  
ATOM 7549  H HB3  . ARG A 1 22  ? 9.362   -1.158  -5.909  2.00 0.00 ? 41  ARG A HB3  4  
ATOM 7550  H HG2  . ARG A 1 22  ? 7.398   -1.488  -7.219  2.00 0.00 ? 41  ARG A HG2  4  
ATOM 7551  H HG3  . ARG A 1 22  ? 7.285   0.235   -7.578  2.00 0.00 ? 41  ARG A HG3  4  
ATOM 7552  H HD2  . ARG A 1 22  ? 8.587   -0.022  -9.353  2.00 0.00 ? 41  ARG A HD2  4  
ATOM 7553  H HD3  . ARG A 1 22  ? 9.869   -0.684  -8.344  2.00 0.00 ? 41  ARG A HD3  4  
ATOM 7554  H HE   . ARG A 1 22  ? 7.998   -2.707  -8.810  1.00 0.00 ? 41  ARG A HE   4  
ATOM 7555  H HH11 . ARG A 1 22  ? 10.315  -0.790  -10.578 5.00 0.00 ? 41  ARG A HH11 4  
ATOM 7556  H HH12 . ARG A 1 22  ? 10.604  -2.013  -11.771 5.00 0.00 ? 41  ARG A HH12 4  
ATOM 7557  H HH21 . ARG A 1 22  ? 8.385   -4.319  -10.388 5.00 0.00 ? 41  ARG A HH21 4  
ATOM 7558  H HH22 . ARG A 1 22  ? 9.513   -4.006  -11.663 5.00 0.00 ? 41  ARG A HH22 4  
ATOM 7559  N N    . TYR A 1 23  ? 7.271   2.201   -6.019  1.00 0.00 ? 42  TYR A N    4  
ATOM 7560  C CA   . TYR A 1 23  ? 6.323   3.194   -6.488  1.00 0.00 ? 42  TYR A CA   4  
ATOM 7561  C C    . TYR A 1 23  ? 5.537   2.643   -7.666  1.00 0.00 ? 42  TYR A C    4  
ATOM 7562  O O    . TYR A 1 23  ? 5.245   3.357   -8.621  1.00 0.00 ? 42  TYR A O    4  
ATOM 7563  C CB   . TYR A 1 23  ? 7.050   4.477   -6.891  1.00 0.00 ? 42  TYR A CB   4  
ATOM 7564  C CG   . TYR A 1 23  ? 8.150   4.925   -5.955  1.00 0.00 ? 42  TYR A CG   4  
ATOM 7565  C CD1  . TYR A 1 23  ? 7.882   5.204   -4.621  1.00 0.00 ? 42  TYR A CD1  4  
ATOM 7566  C CD2  . TYR A 1 23  ? 9.456   5.070   -6.406  1.00 0.00 ? 42  TYR A CD2  4  
ATOM 7567  C CE1  . TYR A 1 23  ? 8.884   5.613   -3.763  1.00 0.00 ? 42  TYR A CE1  4  
ATOM 7568  C CE2  . TYR A 1 23  ? 10.464  5.478   -5.553  1.00 0.00 ? 42  TYR A CE2  4  
ATOM 7569  C CZ   . TYR A 1 23  ? 10.172  5.749   -4.233  1.00 0.00 ? 42  TYR A CZ   4  
ATOM 7570  O OH   . TYR A 1 23  ? 11.173  6.157   -3.381  1.00 0.00 ? 42  TYR A OH   4  
ATOM 7571  H H    . TYR A 1 23  ? 8.223   2.334   -6.195  1.00 0.00 ? 42  TYR A H    4  
ATOM 7572  H HA   . TYR A 1 23  ? 5.640   3.411   -5.680  1.00 0.00 ? 42  TYR A HA   4  
ATOM 7573  H HB2  . TYR A 1 23  ? 7.490   4.335   -7.867  2.00 0.00 ? 42  TYR A HB2  4  
ATOM 7574  H HB3  . TYR A 1 23  ? 6.328   5.280   -6.954  2.00 0.00 ? 42  TYR A HB3  4  
ATOM 7575  H HD1  . TYR A 1 23  ? 6.871   5.096   -4.255  1.00 0.00 ? 42  TYR A HD1  4  
ATOM 7576  H HD2  . TYR A 1 23  ? 9.681   4.858   -7.440  1.00 0.00 ? 42  TYR A HD2  4  
ATOM 7577  H HE1  . TYR A 1 23  ? 8.655   5.825   -2.728  1.00 0.00 ? 42  TYR A HE1  4  
ATOM 7578  H HE2  . TYR A 1 23  ? 11.473  5.584   -5.923  1.00 0.00 ? 42  TYR A HE2  4  
ATOM 7579  H HH   . TYR A 1 23  ? 11.979  5.672   -3.577  1.00 0.00 ? 42  TYR A HH   4  
ATOM 7580  N N    . SER A 1 24  ? 5.210   1.357   -7.591  1.00 0.00 ? 43  SER A N    4  
ATOM 7581  C CA   . SER A 1 24  ? 4.462   0.692   -8.651  1.00 0.00 ? 43  SER A CA   4  
ATOM 7582  C C    . SER A 1 24  ? 2.958   0.835   -8.435  1.00 0.00 ? 43  SER A C    4  
ATOM 7583  O O    . SER A 1 24  ? 2.161   0.473   -9.300  1.00 0.00 ? 43  SER A O    4  
ATOM 7584  C CB   . SER A 1 24  ? 4.839   -0.790  -8.718  1.00 0.00 ? 43  SER A CB   4  
ATOM 7585  O OG   . SER A 1 24  ? 4.209   -1.428  -9.815  1.00 0.00 ? 43  SER A OG   4  
ATOM 7586  H H    . SER A 1 24  ? 5.489   0.840   -6.802  1.00 0.00 ? 43  SER A H    4  
ATOM 7587  H HA   . SER A 1 24  ? 4.726   1.162   -9.586  1.00 0.00 ? 43  SER A HA   4  
ATOM 7588  H HB2  . SER A 1 24  ? 5.910   -0.881  -8.831  2.00 0.00 ? 43  SER A HB2  4  
ATOM 7589  H HB3  . SER A 1 24  ? 4.531   -1.279  -7.807  2.00 0.00 ? 43  SER A HB3  4  
ATOM 7590  H HG   . SER A 1 24  ? 4.875   -1.834  -10.375 1.00 0.00 ? 43  SER A HG   4  
ATOM 7591  N N    . ILE A 1 25  ? 2.574   1.365   -7.276  1.00 0.00 ? 44  ILE A N    4  
ATOM 7592  C CA   . ILE A 1 25  ? 1.163   1.552   -6.954  1.00 0.00 ? 44  ILE A CA   4  
ATOM 7593  C C    . ILE A 1 25  ? 0.733   2.998   -7.171  1.00 0.00 ? 44  ILE A C    4  
ATOM 7594  O O    . ILE A 1 25  ? 1.478   3.931   -6.866  1.00 0.00 ? 44  ILE A O    4  
ATOM 7595  C CB   . ILE A 1 25  ? 0.855   1.151   -5.496  1.00 0.00 ? 44  ILE A CB   4  
ATOM 7596  C CG1  . ILE A 1 25  ? -0.086  -0.053  -5.464  1.00 0.00 ? 44  ILE A CG1  4  
ATOM 7597  C CG2  . ILE A 1 25  ? 0.243   2.319   -4.734  1.00 0.00 ? 44  ILE A CG2  4  
ATOM 7598  C CD1  . ILE A 1 25  ? -0.547  -0.434  -4.076  1.00 0.00 ? 44  ILE A CD1  4  
ATOM 7599  H H    . ILE A 1 25  ? 3.255   1.635   -6.624  1.00 0.00 ? 44  ILE A H    4  
ATOM 7600  H HA   . ILE A 1 25  ? 0.586   0.915   -7.608  1.00 0.00 ? 44  ILE A HA   4  
ATOM 7601  H HB   . ILE A 1 25  ? 1.784   0.885   -5.015  1.00 0.00 ? 44  ILE A HB   4  
ATOM 7602  H HG12 . ILE A 1 25  ? -0.962  0.168   -6.054  2.00 0.00 ? 44  ILE A HG12 4  
ATOM 7603  H HG13 . ILE A 1 25  ? 0.417   -0.907  -5.892  2.00 0.00 ? 44  ILE A HG13 4  
ATOM 7604  H HG21 . ILE A 1 25  ? 0.781   3.225   -4.971  1.00 0.00 ? 44  ILE A HG21 4  
ATOM 7605  H HG22 . ILE A 1 25  ? 0.308   2.131   -3.673  1.00 0.00 ? 44  ILE A HG22 4  
ATOM 7606  H HG23 . ILE A 1 25  ? -0.793  2.431   -5.017  1.00 0.00 ? 44  ILE A HG23 4  
ATOM 7607  H HD11 . ILE A 1 25  ? -1.621  -0.340  -4.014  1.00 0.00 ? 44  ILE A HD11 4  
ATOM 7608  H HD12 . ILE A 1 25  ? -0.086  0.223   -3.353  1.00 0.00 ? 44  ILE A HD12 4  
ATOM 7609  H HD13 . ILE A 1 25  ? -0.262  -1.455  -3.869  1.00 0.00 ? 44  ILE A HD13 4  
ATOM 7610  N N    . SER A 1 26  ? -0.479  3.169   -7.693  1.00 0.00 ? 45  SER A N    4  
ATOM 7611  C CA   . SER A 1 26  ? -1.028  4.495   -7.951  1.00 0.00 ? 45  SER A CA   4  
ATOM 7612  C C    . SER A 1 26  ? -2.421  4.625   -7.343  1.00 0.00 ? 45  SER A C    4  
ATOM 7613  O O    . SER A 1 26  ? -2.679  4.122   -6.250  1.00 0.00 ? 45  SER A O    4  
ATOM 7614  C CB   . SER A 1 26  ? -1.091  4.762   -9.457  1.00 0.00 ? 45  SER A CB   4  
ATOM 7615  O OG   . SER A 1 26  ? -0.866  6.131   -9.742  1.00 0.00 ? 45  SER A OG   4  
ATOM 7616  H H    . SER A 1 26  ? -1.021  2.381   -7.907  1.00 0.00 ? 45  SER A H    4  
ATOM 7617  H HA   . SER A 1 26  ? -0.376  5.221   -7.490  1.00 0.00 ? 45  SER A HA   4  
ATOM 7618  H HB2  . SER A 1 26  ? -0.335  4.174   -9.955  2.00 0.00 ? 45  SER A HB2  4  
ATOM 7619  H HB3  . SER A 1 26  ? -2.066  4.485   -9.829  2.00 0.00 ? 45  SER A HB3  4  
ATOM 7620  H HG   . SER A 1 26  ? 0.043   6.357   -9.529  1.00 0.00 ? 45  SER A HG   4  
ATOM 7621  N N    . ARG A 1 27  ? -3.317  5.300   -8.057  1.00 0.00 ? 46  ARG A N    4  
ATOM 7622  C CA   . ARG A 1 27  ? -4.683  5.491   -7.585  1.00 0.00 ? 46  ARG A CA   4  
ATOM 7623  C C    . ARG A 1 27  ? -5.535  4.256   -7.862  1.00 0.00 ? 46  ARG A C    4  
ATOM 7624  O O    . ARG A 1 27  ? -6.298  3.810   -7.006  1.00 0.00 ? 46  ARG A O    4  
ATOM 7625  C CB   . ARG A 1 27  ? -5.308  6.716   -8.256  1.00 0.00 ? 46  ARG A CB   4  
ATOM 7626  C CG   . ARG A 1 27  ? -6.058  7.623   -7.295  1.00 0.00 ? 46  ARG A CG   4  
ATOM 7627  C CD   . ARG A 1 27  ? -6.712  8.793   -8.012  1.00 0.00 ? 46  ARG A CD   4  
ATOM 7628  N NE   . ARG A 1 27  ? -7.984  8.420   -8.622  1.00 0.00 ? 46  ARG A NE   4  
ATOM 7629  C CZ   . ARG A 1 27  ? -8.224  8.491   -9.928  4.00 0.00 ? 46  ARG A CZ   4  
ATOM 7630  N NH1  . ARG A 1 27  ? -7.283  8.914   -10.761 5.00 0.00 ? 46  ARG A NH1  4  
ATOM 7631  N NH2  . ARG A 1 27  ? -9.406  8.136   -10.412 5.00 0.00 ? 46  ARG A NH2  4  
ATOM 7632  H H    . ARG A 1 27  ? -3.054  5.677   -8.922  1.00 0.00 ? 46  ARG A H    4  
ATOM 7633  H HA   . ARG A 1 27  ? -4.646  5.656   -6.519  1.00 0.00 ? 46  ARG A HA   4  
ATOM 7634  H HB2  . ARG A 1 27  ? -4.525  7.293   -8.725  2.00 0.00 ? 46  ARG A HB2  4  
ATOM 7635  H HB3  . ARG A 1 27  ? -6.000  6.381   -9.015  2.00 0.00 ? 46  ARG A HB3  4  
ATOM 7636  H HG2  . ARG A 1 27  ? -6.825  7.047   -6.796  2.00 0.00 ? 46  ARG A HG2  4  
ATOM 7637  H HG3  . ARG A 1 27  ? -5.364  8.006   -6.562  2.00 0.00 ? 46  ARG A HG3  4  
ATOM 7638  H HD2  . ARG A 1 27  ? -6.883  9.586   -7.299  2.00 0.00 ? 46  ARG A HD2  4  
ATOM 7639  H HD3  . ARG A 1 27  ? -6.043  9.145   -8.783  2.00 0.00 ? 46  ARG A HD3  4  
ATOM 7640  H HE   . ARG A 1 27  ? -8.696  8.103   -8.029  1.00 0.00 ? 46  ARG A HE   4  
ATOM 7641  H HH11 . ARG A 1 27  ? -6.387  9.183   -10.407 5.00 0.00 ? 46  ARG A HH11 4  
ATOM 7642  H HH12 . ARG A 1 27  ? -7.469  8.965   -11.742 5.00 0.00 ? 46  ARG A HH12 4  
ATOM 7643  H HH21 . ARG A 1 27  ? -10.123 7.813   -9.795  5.00 0.00 ? 46  ARG A HH21 4  
ATOM 7644  H HH22 . ARG A 1 27  ? -9.581  8.191   -11.396 5.00 0.00 ? 46  ARG A HH22 4  
ATOM 7645  N N    . THR A 1 28  ? -5.400  3.709   -9.067  1.00 0.00 ? 47  THR A N    4  
ATOM 7646  C CA   . THR A 1 28  ? -6.157  2.526   -9.461  1.00 0.00 ? 47  THR A CA   4  
ATOM 7647  C C    . THR A 1 28  ? -5.733  1.303   -8.655  1.00 0.00 ? 47  THR A C    4  
ATOM 7648  O O    . THR A 1 28  ? -6.557  0.661   -8.005  1.00 0.00 ? 47  THR A O    4  
ATOM 7649  C CB   . THR A 1 28  ? -5.986  2.224   -10.960 1.00 0.00 ? 47  THR A CB   4  
ATOM 7650  O OG1  . THR A 1 28  ? -5.268  3.289   -11.597 1.00 0.00 ? 47  THR A OG1  4  
ATOM 7651  C CG2  . THR A 1 28  ? -7.337  2.044   -11.634 1.00 0.00 ? 47  THR A CG2  4  
ATOM 7652  H H    . THR A 1 28  ? -4.776  4.112   -9.707  1.00 0.00 ? 47  THR A H    4  
ATOM 7653  H HA   . THR A 1 28  ? -7.203  2.723   -9.272  1.00 0.00 ? 47  THR A HA   4  
ATOM 7654  H HB   . THR A 1 28  ? -5.422  1.307   -11.065 1.00 0.00 ? 47  THR A HB   4  
ATOM 7655  H HG1  . THR A 1 28  ? -4.680  2.925   -12.263 1.00 0.00 ? 47  THR A HG1  4  
ATOM 7656  H HG21 . THR A 1 28  ? -7.229  1.396   -12.491 1.00 0.00 ? 47  THR A HG21 4  
ATOM 7657  H HG22 . THR A 1 28  ? -7.710  3.006   -11.955 1.00 0.00 ? 47  THR A HG22 4  
ATOM 7658  H HG23 . THR A 1 28  ? -8.033  1.603   -10.935 1.00 0.00 ? 47  THR A HG23 4  
ATOM 7659  N N    . GLU A 1 29  ? -4.443  0.984   -8.704  1.00 0.00 ? 48  GLU A N    4  
ATOM 7660  C CA   . GLU A 1 29  ? -3.912  -0.165  -7.978  1.00 0.00 ? 48  GLU A CA   4  
ATOM 7661  C C    . GLU A 1 29  ? -4.259  -0.079  -6.495  1.00 0.00 ? 48  GLU A C    4  
ATOM 7662  O O    . GLU A 1 29  ? -4.877  -0.986  -5.938  1.00 0.00 ? 48  GLU A O    4  
ATOM 7663  C CB   . GLU A 1 29  ? -2.395  -0.251  -8.156  1.00 0.00 ? 48  GLU A CB   4  
ATOM 7664  C CG   . GLU A 1 29  ? -1.924  -0.594  -9.560  1.00 0.00 ? 48  GLU A CG   4  
ATOM 7665  C CD   . GLU A 1 29  ? -1.066  -1.844  -9.602  1.00 0.00 ? 48  GLU A CD   4  
ATOM 7666  O OE1  . GLU A 1 29  ? -1.417  -2.829  -8.919  1.00 0.00 ? 48  GLU A OE1  4  
ATOM 7667  O OE2  . GLU A 1 29  ? -0.044  -1.838  -10.320 1.00 0.00 ? 48  GLU A OE2  4  
ATOM 7668  H H    . GLU A 1 29  ? -3.835  1.534   -9.240  1.00 0.00 ? 48  GLU A H    4  
ATOM 7669  H HA   . GLU A 1 29  ? -4.366  -1.054  -8.390  1.00 0.00 ? 48  GLU A HA   4  
ATOM 7670  H HB2  . GLU A 1 29  ? -1.963  0.700   -7.883  2.00 0.00 ? 48  GLU A HB2  4  
ATOM 7671  H HB3  . GLU A 1 29  ? -2.013  -1.004  -7.483  2.00 0.00 ? 48  GLU A HB3  4  
ATOM 7672  H HG2  . GLU A 1 29  ? -2.788  -0.749  -10.189 2.00 0.00 ? 48  GLU A HG2  4  
ATOM 7673  H HG3  . GLU A 1 29  ? -1.345  0.234   -9.943  2.00 0.00 ? 48  GLU A HG3  4  
ATOM 7674  N N    . ALA A 1 30  ? -3.857  1.019   -5.863  1.00 0.00 ? 49  ALA A N    4  
ATOM 7675  C CA   . ALA A 1 30  ? -4.125  1.228   -4.445  1.00 0.00 ? 49  ALA A CA   4  
ATOM 7676  C C    . ALA A 1 30  ? -5.579  0.933   -4.109  1.00 0.00 ? 49  ALA A C    4  
ATOM 7677  O O    . ALA A 1 30  ? -5.890  -0.067  -3.464  1.00 0.00 ? 49  ALA A O    4  
ATOM 7678  C CB   . ALA A 1 30  ? -3.792  2.657   -4.053  1.00 0.00 ? 49  ALA A CB   4  
ATOM 7679  H H    . ALA A 1 30  ? -3.368  1.706   -6.361  1.00 0.00 ? 49  ALA A H    4  
ATOM 7680  H HA   . ALA A 1 30  ? -3.489  0.565   -3.878  1.00 0.00 ? 49  ALA A HA   4  
ATOM 7681  H HB1  . ALA A 1 30  ? -2.899  2.666   -3.448  1.00 0.00 ? 49  ALA A HB1  4  
ATOM 7682  H HB2  . ALA A 1 30  ? -4.616  3.074   -3.488  1.00 0.00 ? 49  ALA A HB2  4  
ATOM 7683  H HB3  . ALA A 1 30  ? -3.632  3.246   -4.943  1.00 0.00 ? 49  ALA A HB3  4  
ATOM 7684  N N    . ALA A 1 31  ? -6.462  1.825   -4.542  1.00 0.00 ? 50  ALA A N    4  
ATOM 7685  C CA   . ALA A 1 31  ? -7.888  1.685   -4.285  1.00 0.00 ? 50  ALA A CA   4  
ATOM 7686  C C    . ALA A 1 31  ? -8.329  0.226   -4.365  1.00 0.00 ? 50  ALA A C    4  
ATOM 7687  O O    . ALA A 1 31  ? -9.162  -0.224  -3.577  1.00 0.00 ? 50  ALA A O    4  
ATOM 7688  C CB   . ALA A 1 31  ? -8.684  2.534   -5.264  1.00 0.00 ? 50  ALA A CB   4  
ATOM 7689  H H    . ALA A 1 31  ? -6.144  2.607   -5.043  1.00 0.00 ? 50  ALA A H    4  
ATOM 7690  H HA   . ALA A 1 31  ? -8.078  2.054   -3.289  1.00 0.00 ? 50  ALA A HA   4  
ATOM 7691  H HB1  . ALA A 1 31  ? -9.639  2.787   -4.829  1.00 0.00 ? 50  ALA A HB1  4  
ATOM 7692  H HB2  . ALA A 1 31  ? -8.840  1.980   -6.178  1.00 0.00 ? 50  ALA A HB2  4  
ATOM 7693  H HB3  . ALA A 1 31  ? -8.137  3.440   -5.482  1.00 0.00 ? 50  ALA A HB3  4  
ATOM 7694  N N    . ASP A 1 32  ? -7.767  -0.509  -5.320  1.00 0.00 ? 51  ASP A N    4  
ATOM 7695  C CA   . ASP A 1 32  ? -8.106  -1.916  -5.501  1.00 0.00 ? 51  ASP A CA   4  
ATOM 7696  C C    . ASP A 1 32  ? -7.813  -2.718  -4.237  1.00 0.00 ? 51  ASP A C    4  
ATOM 7697  O O    . ASP A 1 32  ? -8.674  -3.441  -3.736  1.00 0.00 ? 51  ASP A O    4  
ATOM 7698  C CB   . ASP A 1 32  ? -7.329  -2.504  -6.681  1.00 0.00 ? 51  ASP A CB   4  
ATOM 7699  C CG   . ASP A 1 32  ? -8.117  -2.463  -7.975  1.00 0.00 ? 51  ASP A CG   4  
ATOM 7700  O OD1  . ASP A 1 32  ? -9.259  -2.968  -7.990  1.00 0.00 ? 51  ASP A OD1  4  
ATOM 7701  O OD2  . ASP A 1 32  ? -7.592  -1.926  -8.973  1.00 0.00 ? 51  ASP A OD2  4  
ATOM 7702  H H    . ASP A 1 32  ? -7.111  -0.094  -5.917  1.00 0.00 ? 51  ASP A H    4  
ATOM 7703  H HA   . ASP A 1 32  ? -9.163  -1.977  -5.713  1.00 0.00 ? 51  ASP A HA   4  
ATOM 7704  H HB2  . ASP A 1 32  ? -6.417  -1.941  -6.818  2.00 0.00 ? 51  ASP A HB2  4  
ATOM 7705  H HB3  . ASP A 1 32  ? -7.082  -3.532  -6.464  2.00 0.00 ? 51  ASP A HB3  4  
ATOM 7706  N N    . LEU A 1 33  ? -6.592  -2.590  -3.727  1.00 0.00 ? 52  LEU A N    4  
ATOM 7707  C CA   . LEU A 1 33  ? -6.192  -3.309  -2.522  1.00 0.00 ? 52  LEU A CA   4  
ATOM 7708  C C    . LEU A 1 33  ? -6.779  -2.661  -1.277  1.00 0.00 ? 52  LEU A C    4  
ATOM 7709  O O    . LEU A 1 33  ? -7.414  -3.328  -0.455  1.00 0.00 ? 52  LEU A O    4  
ATOM 7710  C CB   . LEU A 1 33  ? -4.673  -3.357  -2.405  1.00 0.00 ? 52  LEU A CB   4  
ATOM 7711  C CG   . LEU A 1 33  ? -4.070  -4.624  -1.810  1.00 0.00 ? 52  LEU A CG   4  
ATOM 7712  C CD1  . LEU A 1 33  ? -2.911  -5.118  -2.661  2.00 0.00 ? 52  LEU A CD1  4  
ATOM 7713  C CD2  . LEU A 1 33  ? -3.619  -4.395  -0.377  2.00 0.00 ? 52  LEU A CD2  4  
ATOM 7714  H H    . LEU A 1 33  ? -5.946  -2.002  -4.170  1.00 0.00 ? 52  LEU A H    4  
ATOM 7715  H HA   . LEU A 1 33  ? -6.569  -4.317  -2.599  1.00 0.00 ? 52  LEU A HA   4  
ATOM 7716  H HB2  . LEU A 1 33  ? -4.258  -3.221  -3.393  2.00 0.00 ? 52  LEU A HB2  4  
ATOM 7717  H HB3  . LEU A 1 33  ? -4.358  -2.521  -1.798  2.00 0.00 ? 52  LEU A HB3  4  
ATOM 7718  H HG   . LEU A 1 33  ? -4.839  -5.383  -1.804  1.00 0.00 ? 52  LEU A HG   4  
ATOM 7719  H HD11 . LEU A 1 33  ? -3.125  -4.933  -3.703  1.00 0.00 ? 52  LEU A HD11 4  
ATOM 7720  H HD12 . LEU A 1 33  ? -2.774  -6.177  -2.504  1.00 0.00 ? 52  LEU A HD12 4  
ATOM 7721  H HD13 . LEU A 1 33  ? -2.009  -4.593  -2.381  1.00 0.00 ? 52  LEU A HD13 4  
ATOM 7722  H HD21 . LEU A 1 33  ? -3.163  -3.419  -0.295  1.00 0.00 ? 52  LEU A HD21 4  
ATOM 7723  H HD22 . LEU A 1 33  ? -2.901  -5.152  -0.098  1.00 0.00 ? 52  LEU A HD22 4  
ATOM 7724  H HD23 . LEU A 1 33  ? -4.473  -4.448  0.282   1.00 0.00 ? 52  LEU A HD23 4  
ATOM 7725  N N    . CYS A 1 34  ? -6.566  -1.357  -1.145  1.00 0.00 ? 53  CYS A N    4  
ATOM 7726  C CA   . CYS A 1 34  ? -7.081  -0.619  -0.005  1.00 0.00 ? 53  CYS A CA   4  
ATOM 7727  C C    . CYS A 1 34  ? -8.492  -1.090  0.314   1.00 0.00 ? 53  CYS A C    4  
ATOM 7728  O O    . CYS A 1 34  ? -8.900  -1.139  1.474   1.00 0.00 ? 53  CYS A O    4  
ATOM 7729  C CB   . CYS A 1 34  ? -7.087  0.882   -0.302  1.00 0.00 ? 53  CYS A CB   4  
ATOM 7730  S SG   . CYS A 1 34  ? -5.503  1.736   -0.037  1.00 0.00 ? 53  CYS A SG   4  
ATOM 7731  H H    . CYS A 1 34  ? -6.056  -0.882  -1.832  1.00 0.00 ? 53  CYS A H    4  
ATOM 7732  H HA   . CYS A 1 34  ? -6.438  -0.817  0.842   1.00 0.00 ? 53  CYS A HA   4  
ATOM 7733  H HB2  . CYS A 1 34  ? -7.368  1.031   -1.333  2.00 0.00 ? 53  CYS A HB2  4  
ATOM 7734  H HB3  . CYS A 1 34  ? -7.823  1.359   0.329   2.00 0.00 ? 53  CYS A HB3  4  
ATOM 7735  N N    . LYS A 1 35  ? -9.223  -1.453  -0.732  1.00 0.00 ? 54  LYS A N    4  
ATOM 7736  C CA   . LYS A 1 35  ? -10.585 -1.945  -0.584  1.00 0.00 ? 54  LYS A CA   4  
ATOM 7737  C C    . LYS A 1 35  ? -10.579 -3.456  -0.414  1.00 0.00 ? 54  LYS A C    4  
ATOM 7738  O O    . LYS A 1 35  ? -11.423 -4.021  0.281   1.00 0.00 ? 54  LYS A O    4  
ATOM 7739  C CB   . LYS A 1 35  ? -11.432 -1.551  -1.796  1.00 0.00 ? 54  LYS A CB   4  
ATOM 7740  C CG   . LYS A 1 35  ? -11.348 -2.503  -2.977  1.00 0.00 ? 54  LYS A CG   4  
ATOM 7741  C CD   . LYS A 1 35  ? -12.518 -2.339  -3.934  1.00 0.00 ? 54  LYS A CD   4  
ATOM 7742  C CE   . LYS A 1 35  ? -12.463 -3.333  -5.082  1.00 0.00 ? 54  LYS A CE   4  
ATOM 7743  N NZ   . LYS A 1 35  ? -13.776 -4.001  -5.302  1.00 0.00 ? 54  LYS A NZ   4  
ATOM 7744  H H    . LYS A 1 35  ? -8.824  -1.409  -1.629  1.00 0.00 ? 54  LYS A H    4  
ATOM 7745  H HA   . LYS A 1 35  ? -11.006 -1.495  0.304   1.00 0.00 ? 54  LYS A HA   4  
ATOM 7746  H HB2  . LYS A 1 35  ? -12.466 -1.492  -1.488  2.00 0.00 ? 54  LYS A HB2  4  
ATOM 7747  H HB3  . LYS A 1 35  ? -11.119 -0.573  -2.132  2.00 0.00 ? 54  LYS A HB3  4  
ATOM 7748  H HG2  . LYS A 1 35  ? -10.430 -2.313  -3.514  2.00 0.00 ? 54  LYS A HG2  4  
ATOM 7749  H HG3  . LYS A 1 35  ? -11.341 -3.518  -2.608  2.00 0.00 ? 54  LYS A HG3  4  
ATOM 7750  H HD2  . LYS A 1 35  ? -13.437 -2.487  -3.388  2.00 0.00 ? 54  LYS A HD2  4  
ATOM 7751  H HD3  . LYS A 1 35  ? -12.499 -1.337  -4.338  2.00 0.00 ? 54  LYS A HD3  4  
ATOM 7752  H HE2  . LYS A 1 35  ? -12.181 -2.808  -5.983  2.00 0.00 ? 54  LYS A HE2  4  
ATOM 7753  H HE3  . LYS A 1 35  ? -11.721 -4.083  -4.858  2.00 0.00 ? 54  LYS A HE3  4  
ATOM 7754  H HZ1  . LYS A 1 35  ? -13.630 -4.999  -5.559  1.00 0.00 ? 54  LYS A HZ1  4  
ATOM 7755  H HZ2  . LYS A 1 35  ? -14.293 -3.530  -6.071  1.00 0.00 ? 54  LYS A HZ2  4  
ATOM 7756  H HZ3  . LYS A 1 35  ? -14.349 -3.957  -4.435  1.00 0.00 ? 54  LYS A HZ3  4  
ATOM 7757  N N    . ALA A 1 36  ? -9.615  -4.100  -1.064  1.00 0.00 ? 55  ALA A N    4  
ATOM 7758  C CA   . ALA A 1 36  ? -9.474  -5.548  -1.008  1.00 0.00 ? 55  ALA A CA   4  
ATOM 7759  C C    . ALA A 1 36  ? -9.705  -6.077  0.401   1.00 0.00 ? 55  ALA A C    4  
ATOM 7760  O O    . ALA A 1 36  ? -10.395 -7.076  0.586   1.00 0.00 ? 55  ALA A O    4  
ATOM 7761  C CB   . ALA A 1 36  ? -8.100  -5.961  -1.512  1.00 0.00 ? 55  ALA A CB   4  
ATOM 7762  H H    . ALA A 1 36  ? -8.979  -3.582  -1.602  1.00 0.00 ? 55  ALA A H    4  
ATOM 7763  H HA   . ALA A 1 36  ? -10.215 -5.977  -1.666  1.00 0.00 ? 55  ALA A HA   4  
ATOM 7764  H HB1  . ALA A 1 36  ? -8.013  -7.037  -1.476  1.00 0.00 ? 55  ALA A HB1  4  
ATOM 7765  H HB2  . ALA A 1 36  ? -7.339  -5.517  -0.888  1.00 0.00 ? 55  ALA A HB2  4  
ATOM 7766  H HB3  . ALA A 1 36  ? -7.974  -5.624  -2.530  1.00 0.00 ? 55  ALA A HB3  4  
ATOM 7767  N N    . PHE A 1 37  ? -9.121  -5.415  1.397   1.00 0.00 ? 56  PHE A N    4  
ATOM 7768  C CA   . PHE A 1 37  ? -9.282  -5.855  2.781   1.00 0.00 ? 56  PHE A CA   4  
ATOM 7769  C C    . PHE A 1 37  ? -10.177 -4.911  3.580   1.00 0.00 ? 56  PHE A C    4  
ATOM 7770  O O    . PHE A 1 37  ? -9.791  -4.429  4.645   1.00 0.00 ? 56  PHE A O    4  
ATOM 7771  C CB   . PHE A 1 37  ? -7.929  -5.999  3.468   1.00 0.00 ? 56  PHE A CB   4  
ATOM 7772  C CG   . PHE A 1 37  ? -7.106  -4.749  3.532   1.00 0.00 ? 56  PHE A CG   4  
ATOM 7773  C CD1  . PHE A 1 37  ? -6.472  -4.254  2.404   1.00 0.00 ? 56  PHE A CD1  4  
ATOM 7774  C CD2  . PHE A 1 37  ? -6.950  -4.084  4.732   1.00 0.00 ? 56  PHE A CD2  4  
ATOM 7775  C CE1  . PHE A 1 37  ? -5.692  -3.116  2.479   1.00 0.00 ? 56  PHE A CE1  4  
ATOM 7776  C CE2  . PHE A 1 37  ? -6.180  -2.944  4.812   1.00 0.00 ? 56  PHE A CE2  4  
ATOM 7777  C CZ   . PHE A 1 37  ? -5.547  -2.460  3.686   1.00 0.00 ? 56  PHE A CZ   4  
ATOM 7778  H H    . PHE A 1 37  ? -8.572  -4.623  1.198   1.00 0.00 ? 56  PHE A H    4  
ATOM 7779  H HA   . PHE A 1 37  ? -9.750  -6.825  2.754   1.00 0.00 ? 56  PHE A HA   4  
ATOM 7780  H HB2  . PHE A 1 37  ? -8.093  -6.332  4.483   2.00 0.00 ? 56  PHE A HB2  4  
ATOM 7781  H HB3  . PHE A 1 37  ? -7.351  -6.746  2.945   2.00 0.00 ? 56  PHE A HB3  4  
ATOM 7782  H HD1  . PHE A 1 37  ? -6.587  -4.767  1.462   1.00 0.00 ? 56  PHE A HD1  4  
ATOM 7783  H HD2  . PHE A 1 37  ? -7.443  -4.460  5.615   1.00 0.00 ? 56  PHE A HD2  4  
ATOM 7784  H HE1  . PHE A 1 37  ? -5.200  -2.738  1.596   1.00 0.00 ? 56  PHE A HE1  4  
ATOM 7785  H HE2  . PHE A 1 37  ? -6.065  -2.436  5.756   1.00 0.00 ? 56  PHE A HE2  4  
ATOM 7786  H HZ   . PHE A 1 37  ? -4.922  -1.583  3.758   1.00 0.00 ? 56  PHE A HZ   4  
ATOM 7787  N N    . ASN A 1 38  ? -11.380 -4.665  3.069   1.00 0.00 ? 57  ASN A N    4  
ATOM 7788  C CA   . ASN A 1 38  ? -12.340 -3.793  3.739   1.00 0.00 ? 57  ASN A CA   4  
ATOM 7789  C C    . ASN A 1 38  ? -11.657 -2.574  4.351   1.00 0.00 ? 57  ASN A C    4  
ATOM 7790  O O    . ASN A 1 38  ? -11.294 -2.578  5.528   1.00 0.00 ? 57  ASN A O    4  
ATOM 7791  C CB   . ASN A 1 38  ? -13.088 -4.567  4.828   1.00 0.00 ? 57  ASN A CB   4  
ATOM 7792  C CG   . ASN A 1 38  ? -12.761 -6.048  4.818   1.00 0.00 ? 57  ASN A CG   4  
ATOM 7793  O OD1  . ASN A 1 38  ? -13.496 -6.854  4.247   1.00 0.00 ? 57  ASN A OD1  4  
ATOM 7794  N ND2  . ASN A 1 38  ? -11.655 -6.414  5.455   4.00 0.00 ? 57  ASN A ND2  4  
ATOM 7795  H H    . ASN A 1 38  ? -11.632 -5.088  2.222   1.00 0.00 ? 57  ASN A H    4  
ATOM 7796  H HA   . ASN A 1 38  ? -13.052 -3.456  3.000   1.00 0.00 ? 57  ASN A HA   4  
ATOM 7797  H HB2  . ASN A 1 38  ? -12.821 -4.165  5.795   2.00 0.00 ? 57  ASN A HB2  4  
ATOM 7798  H HB3  . ASN A 1 38  ? -14.153 -4.452  4.675   2.00 0.00 ? 57  ASN A HB3  4  
ATOM 7799  H HD21 . ASN A 1 38  ? -11.118 -5.716  5.890   5.00 0.00 ? 57  ASN A HD21 4  
ATOM 7800  H HD22 . ASN A 1 38  ? -11.420 -7.368  5.464   5.00 0.00 ? 57  ASN A HD22 4  
ATOM 7801  N N    . SER A 1 39  ? -11.493 -1.530  3.548   1.00 0.00 ? 58  SER A N    4  
ATOM 7802  C CA   . SER A 1 39  ? -10.861 -0.299  4.011   1.00 0.00 ? 58  SER A CA   4  
ATOM 7803  C C    . SER A 1 39  ? -11.237 0.874   3.113   1.00 0.00 ? 58  SER A C    4  
ATOM 7804  O O    . SER A 1 39  ? -11.738 0.683   2.004   1.00 0.00 ? 58  SER A O    4  
ATOM 7805  C CB   . SER A 1 39  ? -9.341  -0.461  4.052   1.00 0.00 ? 58  SER A CB   4  
ATOM 7806  O OG   . SER A 1 39  ? -8.966  -1.818  3.892   1.00 0.00 ? 58  SER A OG   4  
ATOM 7807  H H    . SER A 1 39  ? -11.808 -1.587  2.621   1.00 0.00 ? 58  SER A H    4  
ATOM 7808  H HA   . SER A 1 39  ? -11.220 -0.100  5.010   1.00 0.00 ? 58  SER A HA   4  
ATOM 7809  H HB2  . SER A 1 39  ? -8.898  0.119   3.256   2.00 0.00 ? 58  SER A HB2  4  
ATOM 7810  H HB3  . SER A 1 39  ? -8.970  -0.109  5.004   2.00 0.00 ? 58  SER A HB3  4  
ATOM 7811  H HG   . SER A 1 39  ? -9.519  -2.226  3.221   1.00 0.00 ? 58  SER A HG   4  
ATOM 7812  N N    . THR A 1 40  ? -10.996 2.088   3.597   1.00 0.00 ? 59  THR A N    4  
ATOM 7813  C CA   . THR A 1 40  ? -11.313 3.288   2.834   1.00 0.00 ? 59  THR A CA   4  
ATOM 7814  C C    . THR A 1 40  ? -10.070 4.138   2.596   1.00 0.00 ? 59  THR A C    4  
ATOM 7815  O O    . THR A 1 40  ? -9.020  3.902   3.195   1.00 0.00 ? 59  THR A O    4  
ATOM 7816  C CB   . THR A 1 40  ? -12.377 4.143   3.547   1.00 0.00 ? 59  THR A CB   4  
ATOM 7817  O OG1  . THR A 1 40  ? -11.968 4.416   4.892   1.00 0.00 ? 59  THR A OG1  4  
ATOM 7818  C CG2  . THR A 1 40  ? -13.723 3.434   3.554   1.00 0.00 ? 59  THR A CG2  4  
ATOM 7819  H H    . THR A 1 40  ? -10.595 2.178   4.489   1.00 0.00 ? 59  THR A H    4  
ATOM 7820  H HA   . THR A 1 40  ? -11.712 2.979   1.879   1.00 0.00 ? 59  THR A HA   4  
ATOM 7821  H HB   . THR A 1 40  ? -12.483 5.078   3.015   1.00 0.00 ? 59  THR A HB   4  
ATOM 7822  H HG1  . THR A 1 40  ? -12.170 5.329   5.109   1.00 0.00 ? 59  THR A HG1  4  
ATOM 7823  H HG21 . THR A 1 40  ? -13.642 2.514   4.114   1.00 0.00 ? 59  THR A HG21 4  
ATOM 7824  H HG22 . THR A 1 40  ? -14.020 3.213   2.540   1.00 0.00 ? 59  THR A HG22 4  
ATOM 7825  H HG23 . THR A 1 40  ? -14.463 4.071   4.015   1.00 0.00 ? 59  THR A HG23 4  
ATOM 7826  N N    . LEU A 1 41  ? -10.198 5.127   1.716   1.00 0.00 ? 60  LEU A N    4  
ATOM 7827  C CA   . LEU A 1 41  ? -9.089  6.018   1.392   1.00 0.00 ? 60  LEU A CA   4  
ATOM 7828  C C    . LEU A 1 41  ? -8.396  6.512   2.658   1.00 0.00 ? 60  LEU A C    4  
ATOM 7829  O O    . LEU A 1 41  ? -9.002  6.569   3.728   1.00 0.00 ? 60  LEU A O    4  
ATOM 7830  C CB   . LEU A 1 41  ? -9.589  7.209   0.572   1.00 0.00 ? 60  LEU A CB   4  
ATOM 7831  C CG   . LEU A 1 41  ? -9.455  7.125   -0.950  1.00 0.00 ? 60  LEU A CG   4  
ATOM 7832  C CD1  . LEU A 1 41  ? -10.825 7.074   -1.609  2.00 0.00 ? 60  LEU A CD1  4  
ATOM 7833  C CD2  . LEU A 1 41  ? -8.647  8.297   -1.486  2.00 0.00 ? 60  LEU A CD2  4  
ATOM 7834  H H    . LEU A 1 41  ? -11.062 5.261   1.273   1.00 0.00 ? 60  LEU A H    4  
ATOM 7835  H HA   . LEU A 1 41  ? -8.379  5.459   0.802   1.00 0.00 ? 60  LEU A HA   4  
ATOM 7836  H HB2  . LEU A 1 41  ? -10.633 7.356   0.805   2.00 0.00 ? 60  LEU A HB2  4  
ATOM 7837  H HB3  . LEU A 1 41  ? -9.052  8.085   0.903   2.00 0.00 ? 60  LEU A HB3  4  
ATOM 7838  H HG   . LEU A 1 41  ? -8.929  6.214   -1.192  1.00 0.00 ? 60  LEU A HG   4  
ATOM 7839  H HD11 . LEU A 1 41  ? -11.576 7.404   -0.907  1.00 0.00 ? 60  LEU A HD11 4  
ATOM 7840  H HD12 . LEU A 1 41  ? -11.040 6.060   -1.916  1.00 0.00 ? 60  LEU A HD12 4  
ATOM 7841  H HD13 . LEU A 1 41  ? -10.833 7.720   -2.474  1.00 0.00 ? 60  LEU A HD13 4  
ATOM 7842  H HD21 . LEU A 1 41  ? -8.391  8.117   -2.519  1.00 0.00 ? 60  LEU A HD21 4  
ATOM 7843  H HD22 . LEU A 1 41  ? -7.743  8.407   -0.905  1.00 0.00 ? 60  LEU A HD22 4  
ATOM 7844  H HD23 . LEU A 1 41  ? -9.234  9.202   -1.413  1.00 0.00 ? 60  LEU A HD23 4  
ATOM 7845  N N    . PRO A 1 42  ? -7.109  6.878   2.548   1.00 0.00 ? 61  PRO A N    4  
ATOM 7846  C CA   . PRO A 1 42  ? -6.327  7.370   3.686   1.00 0.00 ? 61  PRO A CA   4  
ATOM 7847  C C    . PRO A 1 42  ? -6.758  8.764   4.124   1.00 0.00 ? 61  PRO A C    4  
ATOM 7848  O O    . PRO A 1 42  ? -6.746  9.707   3.332   1.00 0.00 ? 61  PRO A O    4  
ATOM 7849  C CB   . PRO A 1 42  ? -4.896  7.398   3.145   1.00 0.00 ? 61  PRO A CB   4  
ATOM 7850  C CG   . PRO A 1 42  ? -5.052  7.563   1.673   1.00 0.00 ? 61  PRO A CG   4  
ATOM 7851  C CD   . PRO A 1 42  ? -6.318  6.838   1.305   1.00 0.00 ? 61  PRO A CD   4  
ATOM 7852  H HA   . PRO A 1 42  ? -6.384  6.695   4.527   1.00 0.00 ? 61  PRO A HA   4  
ATOM 7853  H HB2  . PRO A 1 42  ? -4.360  8.227   3.582   1.00 0.00 ? 61  PRO A HB2  4  
ATOM 7854  H HB3  . PRO A 1 42  ? -4.399  6.471   3.387   1.00 0.00 ? 61  PRO A HB3  4  
ATOM 7855  H HG2  . PRO A 1 42  ? -5.135  8.612   1.429   1.00 0.00 ? 61  PRO A HG2  4  
ATOM 7856  H HG3  . PRO A 1 42  ? -4.207  7.123   1.163   1.00 0.00 ? 61  PRO A HG3  4  
ATOM 7857  H HD2  . PRO A 1 42  ? -6.829  7.355   0.506   1.00 0.00 ? 61  PRO A HD2  4  
ATOM 7858  H HD3  . PRO A 1 42  ? -6.100  5.820   1.019   1.00 0.00 ? 61  PRO A HD3  4  
ATOM 7859  N N    . THR A 1 43  ? -7.139  8.889   5.391   1.00 0.00 ? 62  THR A N    4  
ATOM 7860  C CA   . THR A 1 43  ? -7.575  10.169  5.936   1.00 0.00 ? 62  THR A CA   4  
ATOM 7861  C C    . THR A 1 43  ? -6.555  10.716  6.929   1.00 0.00 ? 62  THR A C    4  
ATOM 7862  O O    . THR A 1 43  ? -5.756  9.965   7.489   1.00 0.00 ? 62  THR A O    4  
ATOM 7863  C CB   . THR A 1 43  ? -8.942  10.046  6.635   1.00 0.00 ? 62  THR A CB   4  
ATOM 7864  O OG1  . THR A 1 43  ? -9.835  9.268   5.830   1.00 0.00 ? 62  THR A OG1  4  
ATOM 7865  C CG2  . THR A 1 43  ? -9.545  11.420  6.887   1.00 0.00 ? 62  THR A CG2  4  
ATOM 7866  H H    . THR A 1 43  ? -7.127  8.100   5.973   1.00 0.00 ? 62  THR A H    4  
ATOM 7867  H HA   . THR A 1 43  ? -7.673  10.865  5.115   1.00 0.00 ? 62  THR A HA   4  
ATOM 7868  H HB   . THR A 1 43  ? -8.801  9.552   7.585   1.00 0.00 ? 62  THR A HB   4  
ATOM 7869  H HG1  . THR A 1 43  ? -10.577 8.977   6.365   1.00 0.00 ? 62  THR A HG1  4  
ATOM 7870  H HG21 . THR A 1 43  ? -9.024  11.899  7.702   1.00 0.00 ? 62  THR A HG21 4  
ATOM 7871  H HG22 . THR A 1 43  ? -10.590 11.312  7.140   1.00 0.00 ? 62  THR A HG22 4  
ATOM 7872  H HG23 . THR A 1 43  ? -9.452  12.023  5.996   1.00 0.00 ? 62  THR A HG23 4  
ATOM 7873  N N    . MET A 1 44  ? -6.587  12.026  7.141   1.00 0.00 ? 63  MET A N    4  
ATOM 7874  C CA   . MET A 1 44  ? -5.665  12.674  8.065   1.00 0.00 ? 63  MET A CA   4  
ATOM 7875  C C    . MET A 1 44  ? -5.885  12.181  9.491   1.00 0.00 ? 63  MET A C    4  
ATOM 7876  O O    . MET A 1 44  ? -4.985  12.252  10.328  1.00 0.00 ? 63  MET A O    4  
ATOM 7877  C CB   . MET A 1 44  ? -5.837  14.193  8.008   1.00 0.00 ? 63  MET A CB   4  
ATOM 7878  C CG   . MET A 1 44  ? -7.278  14.653  8.157   1.00 0.00 ? 63  MET A CG   4  
ATOM 7879  S SD   . MET A 1 44  ? -7.422  16.212  9.052   1.00 0.00 ? 63  MET A SD   4  
ATOM 7880  C CE   . MET A 1 44  ? -6.678  17.345  7.881   1.00 0.00 ? 63  MET A CE   4  
ATOM 7881  H H    . MET A 1 44  ? -7.247  12.572  6.664   1.00 0.00 ? 63  MET A H    4  
ATOM 7882  H HA   . MET A 1 44  ? -4.660  12.424  7.762   1.00 0.00 ? 63  MET A HA   4  
ATOM 7883  H HB2  . MET A 1 44  ? -5.255  14.639  8.802   2.00 0.00 ? 63  MET A HB2  4  
ATOM 7884  H HB3  . MET A 1 44  ? -5.464  14.550  7.060   2.00 0.00 ? 63  MET A HB3  4  
ATOM 7885  H HG2  . MET A 1 44  ? -7.705  14.779  7.173   2.00 0.00 ? 63  MET A HG2  4  
ATOM 7886  H HG3  . MET A 1 44  ? -7.830  13.896  8.693   2.00 0.00 ? 63  MET A HG3  4  
ATOM 7887  H HE1  . MET A 1 44  ? -7.207  17.289  6.941   1.00 0.00 ? 63  MET A HE1  4  
ATOM 7888  H HE2  . MET A 1 44  ? -5.643  17.077  7.728   1.00 0.00 ? 63  MET A HE2  4  
ATOM 7889  H HE3  . MET A 1 44  ? -6.737  18.352  8.268   1.00 0.00 ? 63  MET A HE3  4  
ATOM 7890  N N    . ALA A 1 45  ? -7.087  11.683  9.763   1.00 0.00 ? 64  ALA A N    4  
ATOM 7891  C CA   . ALA A 1 45  ? -7.422  11.181  11.090  1.00 0.00 ? 64  ALA A CA   4  
ATOM 7892  C C    . ALA A 1 45  ? -6.898  9.764   11.294  1.00 0.00 ? 64  ALA A C    4  
ATOM 7893  O O    . ALA A 1 45  ? -6.319  9.451   12.334  1.00 0.00 ? 64  ALA A O    4  
ATOM 7894  C CB   . ALA A 1 45  ? -8.928  11.223  11.304  1.00 0.00 ? 64  ALA A CB   4  
ATOM 7895  H H    . ALA A 1 45  ? -7.764  11.654  9.055   1.00 0.00 ? 64  ALA A H    4  
ATOM 7896  H HA   . ALA A 1 45  ? -6.961  11.832  11.818  1.00 0.00 ? 64  ALA A HA   4  
ATOM 7897  H HB1  . ALA A 1 45  ? -9.417  11.467  10.373  1.00 0.00 ? 64  ALA A HB1  4  
ATOM 7898  H HB2  . ALA A 1 45  ? -9.166  11.973  12.043  1.00 0.00 ? 64  ALA A HB2  4  
ATOM 7899  H HB3  . ALA A 1 45  ? -9.270  10.258  11.648  1.00 0.00 ? 64  ALA A HB3  4  
ATOM 7900  N N    . GLN A 1 46  ? -7.105  8.910   10.297  1.00 0.00 ? 65  GLN A N    4  
ATOM 7901  C CA   . GLN A 1 46  ? -6.655  7.525   10.371  1.00 0.00 ? 65  GLN A CA   4  
ATOM 7902  C C    . GLN A 1 46  ? -5.134  7.439   10.316  1.00 0.00 ? 65  GLN A C    4  
ATOM 7903  O O    . GLN A 1 46  ? -4.527  6.582   10.959  1.00 0.00 ? 65  GLN A O    4  
ATOM 7904  C CB   . GLN A 1 46  ? -7.268  6.711   9.231   1.00 0.00 ? 65  GLN A CB   4  
ATOM 7905  C CG   . GLN A 1 46  ? -8.786  6.745   9.168   1.00 0.00 ? 65  GLN A CG   4  
ATOM 7906  C CD   . GLN A 1 46  ? -9.324  6.616   7.757   1.00 0.00 ? 65  GLN A CD   4  
ATOM 7907  O OE1  . GLN A 1 46  ? -8.700  7.068   6.798   1.00 0.00 ? 65  GLN A OE1  4  
ATOM 7908  N NE2  . GLN A 1 46  ? -10.489 5.991   7.623   4.00 0.00 ? 65  GLN A NE2  4  
ATOM 7909  H H    . GLN A 1 46  ? -7.575  9.218   9.494   1.00 0.00 ? 65  GLN A H    4  
ATOM 7910  H HA   . GLN A 1 46  ? -6.992  7.118   11.312  1.00 0.00 ? 65  GLN A HA   4  
ATOM 7911  H HB2  . GLN A 1 46  ? -6.887  7.087   8.294   2.00 0.00 ? 65  GLN A HB2  4  
ATOM 7912  H HB3  . GLN A 1 46  ? -6.961  5.681   9.338   2.00 0.00 ? 65  GLN A HB3  4  
ATOM 7913  H HG2  . GLN A 1 46  ? -9.176  5.930   9.760   2.00 0.00 ? 65  GLN A HG2  4  
ATOM 7914  H HG3  . GLN A 1 46  ? -9.129  7.682   9.582   2.00 0.00 ? 65  GLN A HG3  4  
ATOM 7915  H HE21 . GLN A 1 46  ? -10.931 5.653   8.434   5.00 0.00 ? 65  GLN A HE21 4  
ATOM 7916  H HE22 . GLN A 1 46  ? -10.862 5.893   6.718   5.00 0.00 ? 65  GLN A HE22 4  
ATOM 7917  N N    . MET A 1 47  ? -4.520  8.331   9.544   1.00 0.00 ? 66  MET A N    4  
ATOM 7918  C CA   . MET A 1 47  ? -3.069  8.352   9.408   1.00 0.00 ? 66  MET A CA   4  
ATOM 7919  C C    . MET A 1 47  ? -2.409  8.857   10.687  1.00 0.00 ? 66  MET A C    4  
ATOM 7920  O O    . MET A 1 47  ? -1.508  8.216   11.226  1.00 0.00 ? 66  MET A O    4  
ATOM 7921  C CB   . MET A 1 47  ? -2.661  9.235   8.229   1.00 0.00 ? 66  MET A CB   4  
ATOM 7922  C CG   . MET A 1 47  ? -2.537  8.489   6.910   1.00 0.00 ? 66  MET A CG   4  
ATOM 7923  S SD   . MET A 1 47  ? -0.868  7.873   6.615   1.00 0.00 ? 66  MET A SD   4  
ATOM 7924  C CE   . MET A 1 47  ? 0.100   9.349   6.919   1.00 0.00 ? 66  MET A CE   4  
ATOM 7925  H H    . MET A 1 47  ? -5.056  8.989   9.056   1.00 0.00 ? 66  MET A H    4  
ATOM 7926  H HA   . MET A 1 47  ? -2.739  7.342   9.221   1.00 0.00 ? 66  MET A HA   4  
ATOM 7927  H HB2  . MET A 1 47  ? -3.398  10.014  8.106   2.00 0.00 ? 66  MET A HB2  4  
ATOM 7928  H HB3  . MET A 1 47  ? -1.707  9.690   8.449   2.00 0.00 ? 66  MET A HB3  4  
ATOM 7929  H HG2  . MET A 1 47  ? -3.218  7.650   6.922   2.00 0.00 ? 66  MET A HG2  4  
ATOM 7930  H HG3  . MET A 1 47  ? -2.806  9.158   6.107   2.00 0.00 ? 66  MET A HG3  4  
ATOM 7931  H HE1  . MET A 1 47  ? -0.019  10.035  6.093   1.00 0.00 ? 66  MET A HE1  4  
ATOM 7932  H HE2  . MET A 1 47  ? 1.141   9.083   7.019   1.00 0.00 ? 66  MET A HE2  4  
ATOM 7933  H HE3  . MET A 1 47  ? -0.239  9.822   7.830   1.00 0.00 ? 66  MET A HE3  4  
ATOM 7934  N N    . GLU A 1 48  ? -2.862  10.011  11.165  1.00 0.00 ? 67  GLU A N    4  
ATOM 7935  C CA   . GLU A 1 48  ? -2.317  10.603  12.378  1.00 0.00 ? 67  GLU A CA   4  
ATOM 7936  C C    . GLU A 1 48  ? -2.518  9.679   13.573  1.00 0.00 ? 67  GLU A C    4  
ATOM 7937  O O    . GLU A 1 48  ? -1.601  9.472   14.366  1.00 0.00 ? 67  GLU A O    4  
ATOM 7938  C CB   . GLU A 1 48  ? -2.983  11.946  12.648  1.00 0.00 ? 67  GLU A CB   4  
ATOM 7939  C CG   . GLU A 1 48  ? -2.563  13.047  11.688  1.00 0.00 ? 67  GLU A CG   4  
ATOM 7940  C CD   . GLU A 1 48  ? -2.729  14.434  12.273  1.00 0.00 ? 67  GLU A CD   4  
ATOM 7941  O OE1  . GLU A 1 48  ? -2.083  14.727  13.301  1.00 0.00 ? 67  GLU A OE1  4  
ATOM 7942  O OE2  . GLU A 1 48  ? -3.505  15.231  11.703  1.00 0.00 ? 67  GLU A OE2  4  
ATOM 7943  H H    . GLU A 1 48  ? -3.583  10.476  10.692  1.00 0.00 ? 67  GLU A H    4  
ATOM 7944  H HA   . GLU A 1 48  ? -1.260  10.757  12.228  1.00 0.00 ? 67  GLU A HA   4  
ATOM 7945  H HB2  . GLU A 1 48  ? -4.050  11.817  12.573  2.00 0.00 ? 67  GLU A HB2  4  
ATOM 7946  H HB3  . GLU A 1 48  ? -2.740  12.259  13.649  2.00 0.00 ? 67  GLU A HB3  4  
ATOM 7947  H HG2  . GLU A 1 48  ? -1.522  12.903  11.430  2.00 0.00 ? 67  GLU A HG2  4  
ATOM 7948  H HG3  . GLU A 1 48  ? -3.167  12.976  10.792  2.00 0.00 ? 67  GLU A HG3  4  
ATOM 7949  N N    . LYS A 1 49  ? -3.719  9.119   13.692  1.00 0.00 ? 68  LYS A N    4  
ATOM 7950  C CA   . LYS A 1 49  ? -4.021  8.211   14.787  1.00 0.00 ? 68  LYS A CA   4  
ATOM 7951  C C    . LYS A 1 49  ? -2.990  7.098   14.816  1.00 0.00 ? 68  LYS A C    4  
ATOM 7952  O O    . LYS A 1 49  ? -2.404  6.800   15.857  1.00 0.00 ? 68  LYS A O    4  
ATOM 7953  C CB   . LYS A 1 49  ? -5.425  7.627   14.625  1.00 0.00 ? 68  LYS A CB   4  
ATOM 7954  C CG   . LYS A 1 49  ? -6.326  7.777   15.838  1.00 0.00 ? 68  LYS A CG   4  
ATOM 7955  C CD   . LYS A 1 49  ? -5.995  6.769   16.925  1.00 0.00 ? 68  LYS A CD   4  
ATOM 7956  C CE   . LYS A 1 49  ? -6.274  7.311   18.318  1.00 0.00 ? 68  LYS A CE   4  
ATOM 7957  N NZ   . LYS A 1 49  ? -6.527  6.217   19.297  1.00 0.00 ? 68  LYS A NZ   4  
ATOM 7958  H H    . LYS A 1 49  ? -4.409  9.310   13.026  1.00 0.00 ? 68  LYS A H    4  
ATOM 7959  H HA   . LYS A 1 49  ? -3.968  8.768   15.711  1.00 0.00 ? 68  LYS A HA   4  
ATOM 7960  H HB2  . LYS A 1 49  ? -5.905  8.113   13.790  2.00 0.00 ? 68  LYS A HB2  4  
ATOM 7961  H HB3  . LYS A 1 49  ? -5.336  6.574   14.403  2.00 0.00 ? 68  LYS A HB3  4  
ATOM 7962  H HG2  . LYS A 1 49  ? -6.208  8.774   16.237  2.00 0.00 ? 68  LYS A HG2  4  
ATOM 7963  H HG3  . LYS A 1 49  ? -7.351  7.636   15.531  2.00 0.00 ? 68  LYS A HG3  4  
ATOM 7964  H HD2  . LYS A 1 49  ? -6.590  5.881   16.771  2.00 0.00 ? 68  LYS A HD2  4  
ATOM 7965  H HD3  . LYS A 1 49  ? -4.948  6.511   16.855  2.00 0.00 ? 68  LYS A HD3  4  
ATOM 7966  H HE2  . LYS A 1 49  ? -5.420  7.885   18.645  2.00 0.00 ? 68  LYS A HE2  4  
ATOM 7967  H HE3  . LYS A 1 49  ? -7.141  7.952   18.274  2.00 0.00 ? 68  LYS A HE3  4  
ATOM 7968  H HZ1  . LYS A 1 49  ? -5.645  5.961   19.783  1.00 0.00 ? 68  LYS A HZ1  4  
ATOM 7969  H HZ2  . LYS A 1 49  ? -6.898  5.378   18.808  1.00 0.00 ? 68  LYS A HZ2  4  
ATOM 7970  H HZ3  . LYS A 1 49  ? -7.224  6.527   20.005  1.00 0.00 ? 68  LYS A HZ3  4  
ATOM 7971  N N    . ALA A 1 50  ? -2.761  6.505   13.654  1.00 0.00 ? 69  ALA A N    4  
ATOM 7972  C CA   . ALA A 1 50  ? -1.785  5.438   13.519  1.00 0.00 ? 69  ALA A CA   4  
ATOM 7973  C C    . ALA A 1 50  ? -0.381  5.977   13.756  1.00 0.00 ? 69  ALA A C    4  
ATOM 7974  O O    . ALA A 1 50  ? 0.509   5.251   14.196  1.00 0.00 ? 69  ALA A O    4  
ATOM 7975  C CB   . ALA A 1 50  ? -1.885  4.797   12.141  1.00 0.00 ? 69  ALA A CB   4  
ATOM 7976  H H    . ALA A 1 50  ? -3.252  6.805   12.864  1.00 0.00 ? 69  ALA A H    4  
ATOM 7977  H HA   . ALA A 1 50  ? -2.005  4.685   14.263  1.00 0.00 ? 69  ALA A HA   4  
ATOM 7978  H HB1  . ALA A 1 50  ? -1.902  5.568   11.385  1.00 0.00 ? 69  ALA A HB1  4  
ATOM 7979  H HB2  . ALA A 1 50  ? -2.792  4.214   12.080  1.00 0.00 ? 69  ALA A HB2  4  
ATOM 7980  H HB3  . ALA A 1 50  ? -1.033  4.153   11.980  1.00 0.00 ? 69  ALA A HB3  4  
ATOM 7981  N N    . LEU A 1 51  ? -0.187  7.262   13.469  1.00 0.00 ? 70  LEU A N    4  
ATOM 7982  C CA   . LEU A 1 51  ? 1.110   7.894   13.657  1.00 0.00 ? 70  LEU A CA   4  
ATOM 7983  C C    . LEU A 1 51  ? 1.369   8.157   15.137  1.00 0.00 ? 70  LEU A C    4  
ATOM 7984  O O    . LEU A 1 51  ? 2.511   8.113   15.595  1.00 0.00 ? 70  LEU A O    4  
ATOM 7985  C CB   . LEU A 1 51  ? 1.177   9.202   12.869  1.00 0.00 ? 70  LEU A CB   4  
ATOM 7986  C CG   . LEU A 1 51  ? 1.690   9.136   11.428  1.00 0.00 ? 70  LEU A CG   4  
ATOM 7987  C CD1  . LEU A 1 51  ? 1.437   7.764   10.819  2.00 0.00 ? 70  LEU A CD1  4  
ATOM 7988  C CD2  . LEU A 1 51  ? 1.048   10.220  10.575  2.00 0.00 ? 70  LEU A CD2  4  
ATOM 7989  H H    . LEU A 1 51  ? -0.937  7.801   13.126  1.00 0.00 ? 70  LEU A H    4  
ATOM 7990  H HA   . LEU A 1 51  ? 1.865   7.218   13.285  1.00 0.00 ? 70  LEU A HA   4  
ATOM 7991  H HB2  . LEU A 1 51  ? 0.183   9.625   12.846  2.00 0.00 ? 70  LEU A HB2  4  
ATOM 7992  H HB3  . LEU A 1 51  ? 1.810   9.882   13.413  2.00 0.00 ? 70  LEU A HB3  4  
ATOM 7993  H HG   . LEU A 1 51  ? 2.756   9.305   11.444  1.00 0.00 ? 70  LEU A HG   4  
ATOM 7994  H HD11 . LEU A 1 51  ? 1.749   6.999   11.514  1.00 0.00 ? 70  LEU A HD11 4  
ATOM 7995  H HD12 . LEU A 1 51  ? 1.997   7.669   9.900   1.00 0.00 ? 70  LEU A HD12 4  
ATOM 7996  H HD13 . LEU A 1 51  ? 0.383   7.653   10.611  1.00 0.00 ? 70  LEU A HD13 4  
ATOM 7997  H HD21 . LEU A 1 51  ? 1.155   11.176  11.068  1.00 0.00 ? 70  LEU A HD21 4  
ATOM 7998  H HD22 . LEU A 1 51  ? -0.001  10.000  10.443  1.00 0.00 ? 70  LEU A HD22 4  
ATOM 7999  H HD23 . LEU A 1 51  ? 1.533   10.256  9.611   1.00 0.00 ? 70  LEU A HD23 4  
ATOM 8000  N N    . SER A 1 52  ? 0.300   8.429   15.879  1.00 0.00 ? 71  SER A N    4  
ATOM 8001  C CA   . SER A 1 52  ? 0.407   8.700   17.309  1.00 0.00 ? 71  SER A CA   4  
ATOM 8002  C C    . SER A 1 52  ? 0.417   7.404   18.107  1.00 0.00 ? 71  SER A C    4  
ATOM 8003  O O    . SER A 1 52  ? 0.729   7.397   19.298  1.00 0.00 ? 71  SER A O    4  
ATOM 8004  C CB   . SER A 1 52  ? -0.752  9.587   17.769  1.00 0.00 ? 71  SER A CB   4  
ATOM 8005  O OG   . SER A 1 52  ? -0.867  9.587   19.181  1.00 0.00 ? 71  SER A OG   4  
ATOM 8006  H H    . SER A 1 52  ? -0.584  8.447   15.456  1.00 0.00 ? 71  SER A H    4  
ATOM 8007  H HA   . SER A 1 52  ? 1.335   9.219   17.479  1.00 0.00 ? 71  SER A HA   4  
ATOM 8008  H HB2  . SER A 1 52  ? -0.581  10.600  17.435  2.00 0.00 ? 71  SER A HB2  4  
ATOM 8009  H HB3  . SER A 1 52  ? -1.674  9.220   17.344  2.00 0.00 ? 71  SER A HB3  4  
ATOM 8010  H HG   . SER A 1 52  ? -1.358  10.362  19.463  1.00 0.00 ? 71  SER A HG   4  
ATOM 8011  N N    . ILE A 1 53  ? 0.075   6.308   17.442  1.00 0.00 ? 72  ILE A N    4  
ATOM 8012  C CA   . ILE A 1 53  ? 0.044   5.003   18.085  1.00 0.00 ? 72  ILE A CA   4  
ATOM 8013  C C    . ILE A 1 53  ? 1.324   4.224   17.803  1.00 0.00 ? 72  ILE A C    4  
ATOM 8014  O O    . ILE A 1 53  ? 1.538   3.141   18.346  1.00 0.00 ? 72  ILE A O    4  
ATOM 8015  C CB   . ILE A 1 53  ? -1.169  4.178   17.615  1.00 0.00 ? 72  ILE A CB   4  
ATOM 8016  C CG1  . ILE A 1 53  ? -1.013  3.788   16.146  1.00 0.00 ? 72  ILE A CG1  4  
ATOM 8017  C CG2  . ILE A 1 53  ? -2.450  4.968   17.829  1.00 0.00 ? 72  ILE A CG2  4  
ATOM 8018  C CD1  . ILE A 1 53  ? -0.317  2.462   15.936  1.00 0.00 ? 72  ILE A CD1  4  
ATOM 8019  H H    . ILE A 1 53  ? -0.163  6.378   16.494  1.00 0.00 ? 72  ILE A H    4  
ATOM 8020  H HA   . ILE A 1 53  ? -0.043  5.158   19.151  1.00 0.00 ? 72  ILE A HA   4  
ATOM 8021  H HB   . ILE A 1 53  ? -1.225  3.285   18.213  1.00 0.00 ? 72  ILE A HB   4  
ATOM 8022  H HG12 . ILE A 1 53  ? -1.991  3.725   15.692  2.00 0.00 ? 72  ILE A HG12 4  
ATOM 8023  H HG13 . ILE A 1 53  ? -0.438  4.547   15.638  2.00 0.00 ? 72  ILE A HG13 4  
ATOM 8024  H HG21 . ILE A 1 53  ? -2.220  6.024   17.862  1.00 0.00 ? 72  ILE A HG21 4  
ATOM 8025  H HG22 . ILE A 1 53  ? -2.907  4.669   18.761  1.00 0.00 ? 72  ILE A HG22 4  
ATOM 8026  H HG23 . ILE A 1 53  ? -3.132  4.775   17.015  1.00 0.00 ? 72  ILE A HG23 4  
ATOM 8027  H HD11 . ILE A 1 53  ? -1.023  1.744   15.545  1.00 0.00 ? 72  ILE A HD11 4  
ATOM 8028  H HD12 . ILE A 1 53  ? 0.073   2.107   16.878  1.00 0.00 ? 72  ILE A HD12 4  
ATOM 8029  H HD13 . ILE A 1 53  ? 0.494   2.588   15.234  1.00 0.00 ? 72  ILE A HD13 4  
ATOM 8030  N N    . GLY A 1 54  ? 2.175   4.790   16.951  1.00 0.00 ? 73  GLY A N    4  
ATOM 8031  C CA   . GLY A 1 54  ? 3.426   4.139   16.612  1.00 0.00 ? 73  GLY A CA   4  
ATOM 8032  C C    . GLY A 1 54  ? 3.384   3.423   15.277  1.00 0.00 ? 73  GLY A C    4  
ATOM 8033  O O    . GLY A 1 54  ? 3.773   2.261   15.180  1.00 0.00 ? 73  GLY A O    4  
ATOM 8034  H H    . GLY A 1 54  ? 1.951   5.656   16.552  1.00 0.00 ? 73  GLY A H    4  
ATOM 8035  H HA2  . GLY A 1 54  ? 4.208   4.886   16.579  2.00 0.00 ? 73  GLY A HA2  4  
ATOM 8036  H HA3  . GLY A 1 54  ? 3.665   3.421   17.383  2.00 0.00 ? 73  GLY A HA3  4  
ATOM 8037  N N    . PHE A 1 55  ? 2.914   4.117   14.245  1.00 0.00 ? 74  PHE A N    4  
ATOM 8038  C CA   . PHE A 1 55  ? 2.829   3.530   12.911  1.00 0.00 ? 74  PHE A CA   4  
ATOM 8039  C C    . PHE A 1 55  ? 3.570   4.386   11.889  1.00 0.00 ? 74  PHE A C    4  
ATOM 8040  O O    . PHE A 1 55  ? 3.220   5.544   11.662  1.00 0.00 ? 74  PHE A O    4  
ATOM 8041  C CB   . PHE A 1 55  ? 1.366   3.364   12.493  1.00 0.00 ? 74  PHE A CB   4  
ATOM 8042  C CG   . PHE A 1 55  ? 1.150   3.122   11.026  1.00 0.00 ? 74  PHE A CG   4  
ATOM 8043  C CD1  . PHE A 1 55  ? 1.392   1.876   10.471  1.00 0.00 ? 74  PHE A CD1  4  
ATOM 8044  C CD2  . PHE A 1 55  ? 0.700   4.143   10.202  1.00 0.00 ? 74  PHE A CD2  4  
ATOM 8045  C CE1  . PHE A 1 55  ? 1.190   1.652   9.123   1.00 0.00 ? 74  PHE A CE1  4  
ATOM 8046  C CE2  . PHE A 1 55  ? 0.497   3.924   8.854   1.00 0.00 ? 74  PHE A CE2  4  
ATOM 8047  C CZ   . PHE A 1 55  ? 0.742   2.676   8.314   1.00 0.00 ? 74  PHE A CZ   4  
ATOM 8048  H H    . PHE A 1 55  ? 2.619   5.045   14.381  1.00 0.00 ? 74  PHE A H    4  
ATOM 8049  H HA   . PHE A 1 55  ? 3.295   2.558   12.949  1.00 0.00 ? 74  PHE A HA   4  
ATOM 8050  H HB2  . PHE A 1 55  ? 0.943   2.527   13.029  2.00 0.00 ? 74  PHE A HB2  4  
ATOM 8051  H HB3  . PHE A 1 55  ? 0.823   4.258   12.760  2.00 0.00 ? 74  PHE A HB3  4  
ATOM 8052  H HD1  . PHE A 1 55  ? 1.742   1.074   11.102  1.00 0.00 ? 74  PHE A HD1  4  
ATOM 8053  H HD2  . PHE A 1 55  ? 0.508   5.118   10.623  1.00 0.00 ? 74  PHE A HD2  4  
ATOM 8054  H HE1  . PHE A 1 55  ? 1.382   0.675   8.703   1.00 0.00 ? 74  PHE A HE1  4  
ATOM 8055  H HE2  . PHE A 1 55  ? 0.148   4.728   8.222   1.00 0.00 ? 74  PHE A HE2  4  
ATOM 8056  H HZ   . PHE A 1 55  ? 0.583   2.502   7.260   1.00 0.00 ? 74  PHE A HZ   4  
ATOM 8057  N N    . GLU A 1 56  ? 4.593   3.805   11.275  1.00 0.00 ? 75  GLU A N    4  
ATOM 8058  C CA   . GLU A 1 56  ? 5.387   4.506   10.274  1.00 0.00 ? 75  GLU A CA   4  
ATOM 8059  C C    . GLU A 1 56  ? 5.898   3.534   9.217   1.00 0.00 ? 75  GLU A C    4  
ATOM 8060  O O    . GLU A 1 56  ? 6.112   2.355   9.498   1.00 0.00 ? 75  GLU A O    4  
ATOM 8061  C CB   . GLU A 1 56  ? 6.564   5.230   10.933  1.00 0.00 ? 75  GLU A CB   4  
ATOM 8062  C CG   . GLU A 1 56  ? 6.962   4.659   12.285  1.00 0.00 ? 75  GLU A CG   4  
ATOM 8063  C CD   . GLU A 1 56  ? 8.392   4.990   12.666  1.00 0.00 ? 75  GLU A CD   4  
ATOM 8064  O OE1  . GLU A 1 56  ? 8.721   6.192   12.752  1.00 0.00 ? 75  GLU A OE1  4  
ATOM 8065  O OE2  . GLU A 1 56  ? 9.183   4.046   12.876  1.00 0.00 ? 75  GLU A OE2  4  
ATOM 8066  H H    . GLU A 1 56  ? 4.821   2.878   11.500  1.00 0.00 ? 75  GLU A H    4  
ATOM 8067  H HA   . GLU A 1 56  ? 4.749   5.235   9.798   1.00 0.00 ? 75  GLU A HA   4  
ATOM 8068  H HB2  . GLU A 1 56  ? 7.420   5.170   10.276  2.00 0.00 ? 75  GLU A HB2  4  
ATOM 8069  H HB3  . GLU A 1 56  ? 6.299   6.270   11.070  2.00 0.00 ? 75  GLU A HB3  4  
ATOM 8070  H HG2  . GLU A 1 56  ? 6.303   5.063   13.039  2.00 0.00 ? 75  GLU A HG2  4  
ATOM 8071  H HG3  . GLU A 1 56  ? 6.853   3.586   12.253  2.00 0.00 ? 75  GLU A HG3  4  
ATOM 8072  N N    . THR A 1 57  ? 6.084   4.032   8.000   1.00 0.00 ? 76  THR A N    4  
ATOM 8073  C CA   . THR A 1 57  ? 6.563   3.202   6.903   1.00 0.00 ? 76  THR A CA   4  
ATOM 8074  C C    . THR A 1 57  ? 7.889   3.714   6.357   1.00 0.00 ? 76  THR A C    4  
ATOM 8075  O O    . THR A 1 57  ? 8.576   3.016   5.611   1.00 0.00 ? 76  THR A O    4  
ATOM 8076  C CB   . THR A 1 57  ? 5.538   3.148   5.756   1.00 0.00 ? 76  THR A CB   4  
ATOM 8077  O OG1  . THR A 1 57  ? 5.576   4.367   5.004   1.00 0.00 ? 76  THR A OG1  4  
ATOM 8078  C CG2  . THR A 1 57  ? 4.134   2.924   6.297   1.00 0.00 ? 76  THR A CG2  4  
ATOM 8079  H H    . THR A 1 57  ? 5.891   4.979   7.835   1.00 0.00 ? 76  THR A H    4  
ATOM 8080  H HA   . THR A 1 57  ? 6.703   2.199   7.279   1.00 0.00 ? 76  THR A HA   4  
ATOM 8081  H HB   . THR A 1 57  ? 5.791   2.324   5.105   1.00 0.00 ? 76  THR A HB   4  
ATOM 8082  H HG1  . THR A 1 57  ? 5.907   5.076   5.560   1.00 0.00 ? 76  THR A HG1  4  
ATOM 8083  H HG21 . THR A 1 57  ? 4.066   3.320   7.299   1.00 0.00 ? 76  THR A HG21 4  
ATOM 8084  H HG22 . THR A 1 57  ? 3.919   1.866   6.312   1.00 0.00 ? 76  THR A HG22 4  
ATOM 8085  H HG23 . THR A 1 57  ? 3.419   3.428   5.663   1.00 0.00 ? 76  THR A HG23 4  
ATOM 8086  N N    . CYS A 1 58  ? 8.245   4.940   6.728   1.00 0.00 ? 77  CYS A N    4  
ATOM 8087  C CA   . CYS A 1 58  ? 9.490   5.546   6.269   1.00 0.00 ? 77  CYS A CA   4  
ATOM 8088  C C    . CYS A 1 58  ? 9.510   5.650   4.747   1.00 0.00 ? 77  CYS A C    4  
ATOM 8089  O O    . CYS A 1 58  ? 10.525  6.010   4.152   1.00 0.00 ? 77  CYS A O    4  
ATOM 8090  C CB   . CYS A 1 58  ? 10.688  4.727   6.753   1.00 0.00 ? 77  CYS A CB   4  
ATOM 8091  S SG   . CYS A 1 58  ? 12.249  5.655   6.910   1.00 0.00 ? 77  CYS A SG   4  
ATOM 8092  H H    . CYS A 1 58  ? 7.655   5.451   7.321   1.00 0.00 ? 77  CYS A H    4  
ATOM 8093  H HA   . CYS A 1 58  ? 9.549   6.539   6.688   1.00 0.00 ? 77  CYS A HA   4  
ATOM 8094  H HB2  . CYS A 1 58  ? 10.459  4.312   7.723   2.00 0.00 ? 77  CYS A HB2  4  
ATOM 8095  H HB3  . CYS A 1 58  ? 10.861  3.917   6.060   2.00 0.00 ? 77  CYS A HB3  4  
ATOM 8096  N N    . ARG A 1 59  ? 8.378   5.332   4.125   1.00 0.00 ? 78  ARG A N    4  
ATOM 8097  C CA   . ARG A 1 59  ? 8.260   5.389   2.673   1.00 0.00 ? 78  ARG A CA   4  
ATOM 8098  C C    . ARG A 1 59  ? 7.187   6.391   2.255   1.00 0.00 ? 78  ARG A C    4  
ATOM 8099  O O    . ARG A 1 59  ? 6.499   6.965   3.098   1.00 0.00 ? 78  ARG A O    4  
ATOM 8100  C CB   . ARG A 1 59  ? 7.927   4.004   2.113   1.00 0.00 ? 78  ARG A CB   4  
ATOM 8101  C CG   . ARG A 1 59  ? 8.956   3.479   1.125   1.00 0.00 ? 78  ARG A CG   4  
ATOM 8102  C CD   . ARG A 1 59  ? 9.889   2.463   1.762   1.00 0.00 ? 78  ARG A CD   4  
ATOM 8103  N NE   . ARG A 1 59  ? 10.543  1.619   0.768   1.00 0.00 ? 78  ARG A NE   4  
ATOM 8104  C CZ   . ARG A 1 59  ? 11.806  1.215   0.859   4.00 0.00 ? 78  ARG A CZ   4  
ATOM 8105  N NH1  . ARG A 1 59  ? 12.550  1.573   1.897   5.00 0.00 ? 78  ARG A NH1  4  
ATOM 8106  N NH2  . ARG A 1 59  ? 12.335  0.449   -0.085  5.00 0.00 ? 78  ARG A NH2  4  
ATOM 8107  H H    . ARG A 1 59  ? 7.603   5.053   4.656   1.00 0.00 ? 78  ARG A H    4  
ATOM 8108  H HA   . ARG A 1 59  ? 9.210   5.710   2.275   1.00 0.00 ? 78  ARG A HA   4  
ATOM 8109  H HB2  . ARG A 1 59  ? 7.857   3.305   2.933   2.00 0.00 ? 78  ARG A HB2  4  
ATOM 8110  H HB3  . ARG A 1 59  ? 6.972   4.051   1.614   2.00 0.00 ? 78  ARG A HB3  4  
ATOM 8111  H HG2  . ARG A 1 59  ? 8.440   3.009   0.300   2.00 0.00 ? 78  ARG A HG2  4  
ATOM 8112  H HG3  . ARG A 1 59  ? 9.542   4.307   0.756   2.00 0.00 ? 78  ARG A HG3  4  
ATOM 8113  H HD2  . ARG A 1 59  ? 10.645  2.990   2.326   2.00 0.00 ? 78  ARG A HD2  4  
ATOM 8114  H HD3  . ARG A 1 59  ? 9.316   1.836   2.431   2.00 0.00 ? 78  ARG A HD3  4  
ATOM 8115  H HE   . ARG A 1 59  ? 10.014  1.339   -0.009  1.00 0.00 ? 78  ARG A HE   4  
ATOM 8116  H HH11 . ARG A 1 59  ? 12.161  2.148   2.616   5.00 0.00 ? 78  ARG A HH11 4  
ATOM 8117  H HH12 . ARG A 1 59  ? 13.500  1.265   1.961   5.00 0.00 ? 78  ARG A HH12 4  
ATOM 8118  H HH21 . ARG A 1 59  ? 11.784  0.171   -0.872  5.00 0.00 ? 78  ARG A HH21 4  
ATOM 8119  H HH22 . ARG A 1 59  ? 13.286  0.149   -0.010  5.00 0.00 ? 78  ARG A HH22 4  
ATOM 8120  N N    . TYR A 1 60  ? 7.054   6.595   0.949   1.00 0.00 ? 79  TYR A N    4  
ATOM 8121  C CA   . TYR A 1 60  ? 6.067   7.530   0.418   1.00 0.00 ? 79  TYR A CA   4  
ATOM 8122  C C    . TYR A 1 60  ? 4.722   6.850   0.202   1.00 0.00 ? 79  TYR A C    4  
ATOM 8123  O O    . TYR A 1 60  ? 4.493   6.225   -0.832  1.00 0.00 ? 79  TYR A O    4  
ATOM 8124  C CB   . TYR A 1 60  ? 6.558   8.125   -0.899  1.00 0.00 ? 79  TYR A CB   4  
ATOM 8125  C CG   . TYR A 1 60  ? 7.767   9.021   -0.797  1.00 0.00 ? 79  TYR A CG   4  
ATOM 8126  C CD1  . TYR A 1 60  ? 7.765   10.131  0.038   1.00 0.00 ? 79  TYR A CD1  4  
ATOM 8127  C CD2  . TYR A 1 60  ? 8.910   8.758   -1.538  1.00 0.00 ? 79  TYR A CD2  4  
ATOM 8128  C CE1  . TYR A 1 60  ? 8.870   10.954  0.130   1.00 0.00 ? 79  TYR A CE1  4  
ATOM 8129  C CE2  . TYR A 1 60  ? 10.020  9.574   -1.452  1.00 0.00 ? 79  TYR A CE2  4  
ATOM 8130  C CZ   . TYR A 1 60  ? 9.995   10.671  -0.616  1.00 0.00 ? 79  TYR A CZ   4  
ATOM 8131  O OH   . TYR A 1 60  ? 11.099  11.489  -0.527  1.00 0.00 ? 79  TYR A OH   4  
ATOM 8132  H H    . TYR A 1 60  ? 7.633   6.108   0.326   1.00 0.00 ? 79  TYR A H    4  
ATOM 8133  H HA   . TYR A 1 60  ? 5.945   8.325   1.138   1.00 0.00 ? 79  TYR A HA   4  
ATOM 8134  H HB2  . TYR A 1 60  ? 6.805   7.320   -1.574  2.00 0.00 ? 79  TYR A HB2  4  
ATOM 8135  H HB3  . TYR A 1 60  ? 5.759   8.706   -1.335  2.00 0.00 ? 79  TYR A HB3  4  
ATOM 8136  H HD1  . TYR A 1 60  ? 6.882   10.349  0.621   1.00 0.00 ? 79  TYR A HD1  4  
ATOM 8137  H HD2  . TYR A 1 60  ? 8.924   7.898   -2.192  1.00 0.00 ? 79  TYR A HD2  4  
ATOM 8138  H HE1  . TYR A 1 60  ? 8.847   11.813  0.785   1.00 0.00 ? 79  TYR A HE1  4  
ATOM 8139  H HE2  . TYR A 1 60  ? 10.898  9.352   -2.037  1.00 0.00 ? 79  TYR A HE2  4  
ATOM 8140  H HH   . TYR A 1 60  ? 10.818  12.385  -0.327  1.00 0.00 ? 79  TYR A HH   4  
ATOM 8141  N N    . GLY A 1 61  ? 3.832   6.984   1.178   1.00 0.00 ? 80  GLY A N    4  
ATOM 8142  C CA   . GLY A 1 61  ? 2.519   6.382   1.065   1.00 0.00 ? 80  GLY A CA   4  
ATOM 8143  C C    . GLY A 1 61  ? 1.448   7.377   0.669   1.00 0.00 ? 80  GLY A C    4  
ATOM 8144  O O    . GLY A 1 61  ? 1.358   8.463   1.242   1.00 0.00 ? 80  GLY A O    4  
ATOM 8145  H H    . GLY A 1 61  ? 4.067   7.501   1.978   1.00 0.00 ? 80  GLY A H    4  
ATOM 8146  H HA2  . GLY A 1 61  ? 2.559   5.599   0.319   2.00 0.00 ? 80  GLY A HA2  4  
ATOM 8147  H HA3  . GLY A 1 61  ? 2.254   5.942   2.015   2.00 0.00 ? 80  GLY A HA3  4  
ATOM 8148  N N    . PHE A 1 62  ? 0.636   7.010   -0.316  1.00 0.00 ? 81  PHE A N    4  
ATOM 8149  C CA   . PHE A 1 62  ? -0.432  7.880   -0.792  1.00 0.00 ? 81  PHE A CA   4  
ATOM 8150  C C    . PHE A 1 62  ? -1.330  8.323   0.356   1.00 0.00 ? 81  PHE A C    4  
ATOM 8151  O O    . PHE A 1 62  ? -1.723  7.516   1.200   1.00 0.00 ? 81  PHE A O    4  
ATOM 8152  C CB   . PHE A 1 62  ? -1.263  7.167   -1.858  1.00 0.00 ? 81  PHE A CB   4  
ATOM 8153  C CG   . PHE A 1 62  ? -1.341  7.889   -3.174  1.00 0.00 ? 81  PHE A CG   4  
ATOM 8154  C CD1  . PHE A 1 62  ? -0.312  8.723   -3.585  1.00 0.00 ? 81  PHE A CD1  4  
ATOM 8155  C CD2  . PHE A 1 62  ? -2.442  7.733   -3.998  1.00 0.00 ? 81  PHE A CD2  4  
ATOM 8156  C CE1  . PHE A 1 62  ? -0.382  9.387   -4.795  1.00 0.00 ? 81  PHE A CE1  4  
ATOM 8157  C CE2  . PHE A 1 62  ? -2.519  8.396   -5.210  1.00 0.00 ? 81  PHE A CE2  4  
ATOM 8158  C CZ   . PHE A 1 62  ? -1.486  9.223   -5.608  1.00 0.00 ? 81  PHE A CZ   4  
ATOM 8159  H H    . PHE A 1 62  ? 0.761   6.132   -0.735  1.00 0.00 ? 81  PHE A H    4  
ATOM 8160  H HA   . PHE A 1 62  ? 0.026   8.753   -1.231  1.00 0.00 ? 81  PHE A HA   4  
ATOM 8161  H HB2  . PHE A 1 62  ? -0.834  6.194   -2.043  2.00 0.00 ? 81  PHE A HB2  4  
ATOM 8162  H HB3  . PHE A 1 62  ? -2.270  7.041   -1.490  2.00 0.00 ? 81  PHE A HB3  4  
ATOM 8163  H HD1  . PHE A 1 62  ? 0.552   8.851   -2.949  1.00 0.00 ? 81  PHE A HD1  4  
ATOM 8164  H HD2  . PHE A 1 62  ? -3.250  7.087   -3.688  1.00 0.00 ? 81  PHE A HD2  4  
ATOM 8165  H HE1  . PHE A 1 62  ? 0.426   10.033  -5.103  1.00 0.00 ? 81  PHE A HE1  4  
ATOM 8166  H HE2  . PHE A 1 62  ? -3.383  8.265   -5.844  1.00 0.00 ? 81  PHE A HE2  4  
ATOM 8167  H HZ   . PHE A 1 62  ? -1.542  9.741   -6.554  1.00 0.00 ? 81  PHE A HZ   4  
ATOM 8168  N N    . ILE A 1 63  ? -1.654  9.610   0.375   1.00 0.00 ? 82  ILE A N    4  
ATOM 8169  C CA   . ILE A 1 63  ? -2.510  10.172  1.412   1.00 0.00 ? 82  ILE A CA   4  
ATOM 8170  C C    . ILE A 1 63  ? -3.873  10.555  0.837   1.00 0.00 ? 82  ILE A C    4  
ATOM 8171  O O    . ILE A 1 63  ? -4.326  9.965   -0.143  1.00 0.00 ? 82  ILE A O    4  
ATOM 8172  C CB   . ILE A 1 63  ? -1.853  11.406  2.066   1.00 0.00 ? 82  ILE A CB   4  
ATOM 8173  C CG1  . ILE A 1 63  ? -2.462  11.669  3.444   1.00 0.00 ? 82  ILE A CG1  4  
ATOM 8174  C CG2  . ILE A 1 63  ? -1.992  12.631  1.174   1.00 0.00 ? 82  ILE A CG2  4  
ATOM 8175  C CD1  . ILE A 1 63  ? -1.889  10.809  4.547   1.00 0.00 ? 82  ILE A CD1  4  
ATOM 8176  H H    . ILE A 1 63  ? -1.312  10.197  -0.331  1.00 0.00 ? 82  ILE A H    4  
ATOM 8177  H HA   . ILE A 1 63  ? -2.651  9.418   2.172   1.00 0.00 ? 82  ILE A HA   4  
ATOM 8178  H HB   . ILE A 1 63  ? -0.799  11.200  2.184   1.00 0.00 ? 82  ILE A HB   4  
ATOM 8179  H HG12 . ILE A 1 63  ? -2.296  12.703  3.709   2.00 0.00 ? 82  ILE A HG12 4  
ATOM 8180  H HG13 . ILE A 1 63  ? -3.525  11.485  3.400   2.00 0.00 ? 82  ILE A HG13 4  
ATOM 8181  H HG21 . ILE A 1 63  ? -1.480  13.467  1.627   1.00 0.00 ? 82  ILE A HG21 4  
ATOM 8182  H HG22 . ILE A 1 63  ? -3.038  12.873  1.055   1.00 0.00 ? 82  ILE A HG22 4  
ATOM 8183  H HG23 . ILE A 1 63  ? -1.558  12.423  0.208   1.00 0.00 ? 82  ILE A HG23 4  
ATOM 8184  H HD11 . ILE A 1 63  ? -1.528  9.881   4.130   1.00 0.00 ? 82  ILE A HD11 4  
ATOM 8185  H HD12 . ILE A 1 63  ? -2.657  10.600  5.277   1.00 0.00 ? 82  ILE A HD12 4  
ATOM 8186  H HD13 . ILE A 1 63  ? -1.072  11.331  5.024   1.00 0.00 ? 82  ILE A HD13 4  
ATOM 8187  N N    . GLU A 1 64  ? -4.521  11.544  1.445   1.00 0.00 ? 83  GLU A N    4  
ATOM 8188  C CA   . GLU A 1 64  ? -5.828  11.995  0.983   1.00 0.00 ? 83  GLU A CA   4  
ATOM 8189  C C    . GLU A 1 64  ? -5.808  12.271  -0.517  1.00 0.00 ? 83  GLU A C    4  
ATOM 8190  O O    . GLU A 1 64  ? -6.857  12.389  -1.151  1.00 0.00 ? 83  GLU A O    4  
ATOM 8191  C CB   . GLU A 1 64  ? -6.253  13.256  1.740   1.00 0.00 ? 83  GLU A CB   4  
ATOM 8192  C CG   . GLU A 1 64  ? -5.208  14.359  1.733   1.00 0.00 ? 83  GLU A CG   4  
ATOM 8193  C CD   . GLU A 1 64  ? -5.813  15.745  1.624   1.00 0.00 ? 83  GLU A CD   4  
ATOM 8194  O OE1  . GLU A 1 64  ? -6.730  16.054  2.413   1.00 0.00 ? 83  GLU A OE1  4  
ATOM 8195  O OE2  . GLU A 1 64  ? -5.371  16.520  0.750   1.00 0.00 ? 83  GLU A OE2  4  
ATOM 8196  H H    . GLU A 1 64  ? -4.112  11.980  2.222   1.00 0.00 ? 83  GLU A H    4  
ATOM 8197  H HA   . GLU A 1 64  ? -6.539  11.210  1.183   1.00 0.00 ? 83  GLU A HA   4  
ATOM 8198  H HB2  . GLU A 1 64  ? -7.156  13.642  1.292   2.00 0.00 ? 83  GLU A HB2  4  
ATOM 8199  H HB3  . GLU A 1 64  ? -6.457  12.992  2.767   2.00 0.00 ? 83  GLU A HB3  4  
ATOM 8200  H HG2  . GLU A 1 64  ? -4.638  14.303  2.648   2.00 0.00 ? 83  GLU A HG2  4  
ATOM 8201  H HG3  . GLU A 1 64  ? -4.547  14.206  0.891   2.00 0.00 ? 83  GLU A HG3  4  
ATOM 8202  N N    . GLY A 1 65  ? -4.606  12.367  -1.081  1.00 0.00 ? 84  GLY A N    4  
ATOM 8203  C CA   . GLY A 1 65  ? -4.475  12.623  -2.504  1.00 0.00 ? 84  GLY A CA   4  
ATOM 8204  C C    . GLY A 1 65  ? -3.083  13.087  -2.892  1.00 0.00 ? 84  GLY A C    4  
ATOM 8205  O O    . GLY A 1 65  ? -2.923  13.857  -3.839  1.00 0.00 ? 84  GLY A O    4  
ATOM 8206  H H    . GLY A 1 65  ? -3.805  12.261  -0.529  1.00 0.00 ? 84  GLY A H    4  
ATOM 8207  H HA2  . GLY A 1 65  ? -4.701  11.713  -3.043  2.00 0.00 ? 84  GLY A HA2  4  
ATOM 8208  H HA3  . GLY A 1 65  ? -5.188  13.385  -2.788  2.00 0.00 ? 84  GLY A HA3  4  
ATOM 8209  N N    . HIS A 1 66  ? -2.074  12.621  -2.162  1.00 0.00 ? 85  HIS A N    4  
ATOM 8210  C CA   . HIS A 1 66  ? -0.692  12.999  -2.444  1.00 0.00 ? 85  HIS A CA   4  
ATOM 8211  C C    . HIS A 1 66  ? 0.290   12.116  -1.680  1.00 0.00 ? 85  HIS A C    4  
ATOM 8212  O O    . HIS A 1 66  ? -0.085  11.425  -0.734  1.00 0.00 ? 85  HIS A O    4  
ATOM 8213  C CB   . HIS A 1 66  ? -0.463  14.468  -2.086  1.00 0.00 ? 85  HIS A CB   4  
ATOM 8214  C CG   . HIS A 1 66  ? -0.390  15.387  -3.265  1.00 0.00 ? 85  HIS A CG   4  
ATOM 8215  N ND1  . HIS A 1 66  ? -1.069  16.586  -3.330  1.00 0.00 ? 85  HIS A ND1  4  
ATOM 8216  C CD2  . HIS A 1 66  ? 0.289   15.279  -4.433  1.00 0.00 ? 85  HIS A CD2  4  
ATOM 8217  C CE1  . HIS A 1 66  ? -0.813  17.174  -4.485  1.00 0.00 ? 85  HIS A CE1  4  
ATOM 8218  N NE2  . HIS A 1 66  ? 0.009   16.403  -5.172  1.00 0.00 ? 85  HIS A NE2  4  
ATOM 8219  H H    . HIS A 1 66  ? -2.261  12.010  -1.418  1.00 0.00 ? 85  HIS A H    4  
ATOM 8220  H HA   . HIS A 1 66  ? -0.524  12.868  -3.503  1.00 0.00 ? 85  HIS A HA   4  
ATOM 8221  H HB2  . HIS A 1 66  ? -1.271  14.805  -1.454  2.00 0.00 ? 85  HIS A HB2  4  
ATOM 8222  H HB3  . HIS A 1 66  ? 0.466   14.555  -1.542  2.00 0.00 ? 85  HIS A HB3  4  
ATOM 8223  H HD1  . HIS A 1 66  ? -1.653  16.951  -2.632  1.00 0.00 ? 85  HIS A HD1  4  
ATOM 8224  H HD2  . HIS A 1 66  ? 0.930   14.461  -4.727  1.00 0.00 ? 85  HIS A HD2  4  
ATOM 8225  H HE1  . HIS A 1 66  ? -1.207  18.125  -4.811  1.00 0.00 ? 85  HIS A HE1  4  
ATOM 8226  H HE2  . HIS A 1 66  ? 0.431   16.644  -6.022  1.00 0.00 ? 85  HIS A HE2  4  
ATOM 8227  N N    . VAL A 1 67  ? 1.554   12.146  -2.096  1.00 0.00 ? 86  VAL A N    4  
ATOM 8228  C CA   . VAL A 1 67  ? 2.593   11.348  -1.450  1.00 0.00 ? 86  VAL A CA   4  
ATOM 8229  C C    . VAL A 1 67  ? 3.055   11.999  -0.154  1.00 0.00 ? 86  VAL A C    4  
ATOM 8230  O O    . VAL A 1 67  ? 3.476   13.152  -0.152  1.00 0.00 ? 86  VAL A O    4  
ATOM 8231  C CB   . VAL A 1 67  ? 3.819   11.149  -2.361  1.00 0.00 ? 86  VAL A CB   4  
ATOM 8232  C CG1  . VAL A 1 67  ? 4.009   9.679   -2.693  2.00 0.00 ? 86  VAL A CG1  4  
ATOM 8233  C CG2  . VAL A 1 67  ? 3.695   11.960  -3.642  2.00 0.00 ? 86  VAL A CG2  4  
ATOM 8234  H H    . VAL A 1 67  ? 1.790   12.720  -2.852  1.00 0.00 ? 86  VAL A H    4  
ATOM 8235  H HA   . VAL A 1 67  ? 2.178   10.376  -1.225  1.00 0.00 ? 86  VAL A HA   4  
ATOM 8236  H HB   . VAL A 1 67  ? 4.693   11.492  -1.827  1.00 0.00 ? 86  VAL A HB   4  
ATOM 8237  H HG11 . VAL A 1 67  ? 3.275   9.376   -3.425  1.00 0.00 ? 86  VAL A HG11 4  
ATOM 8238  H HG12 . VAL A 1 67  ? 3.887   9.089   -1.797  1.00 0.00 ? 86  VAL A HG12 4  
ATOM 8239  H HG13 . VAL A 1 67  ? 5.001   9.525   -3.093  1.00 0.00 ? 86  VAL A HG13 4  
ATOM 8240  H HG21 . VAL A 1 67  ? 2.751   11.740  -4.118  1.00 0.00 ? 86  VAL A HG21 4  
ATOM 8241  H HG22 . VAL A 1 67  ? 4.503   11.700  -4.311  1.00 0.00 ? 86  VAL A HG22 4  
ATOM 8242  H HG23 . VAL A 1 67  ? 3.747   13.015  -3.409  1.00 0.00 ? 86  VAL A HG23 4  
ATOM 8243  N N    . VAL A 1 68  ? 2.977   11.256  0.945   1.00 0.00 ? 87  VAL A N    4  
ATOM 8244  C CA   . VAL A 1 68  ? 3.391   11.775  2.242   1.00 0.00 ? 87  VAL A CA   4  
ATOM 8245  C C    . VAL A 1 68  ? 4.190   10.743  3.029   1.00 0.00 ? 87  VAL A C    4  
ATOM 8246  O O    . VAL A 1 68  ? 4.120   9.545   2.756   1.00 0.00 ? 87  VAL A O    4  
ATOM 8247  C CB   . VAL A 1 68  ? 2.179   12.214  3.087   1.00 0.00 ? 87  VAL A CB   4  
ATOM 8248  C CG1  . VAL A 1 68  ? 1.262   13.130  2.291   2.00 0.00 ? 87  VAL A CG1  4  
ATOM 8249  C CG2  . VAL A 1 68  ? 1.391   11.008  3.579   2.00 0.00 ? 87  VAL A CG2  4  
ATOM 8250  H H    . VAL A 1 68  ? 2.634   10.340  0.882   1.00 0.00 ? 87  VAL A H    4  
ATOM 8251  H HA   . VAL A 1 68  ? 4.015   12.641  2.069   1.00 0.00 ? 87  VAL A HA   4  
ATOM 8252  H HB   . VAL A 1 68  ? 2.543   12.758  3.946   1.00 0.00 ? 87  VAL A HB   4  
ATOM 8253  H HG11 . VAL A 1 68  ? 0.269   13.101  2.715   1.00 0.00 ? 87  VAL A HG11 4  
ATOM 8254  H HG12 . VAL A 1 68  ? 1.226   12.799  1.264   1.00 0.00 ? 87  VAL A HG12 4  
ATOM 8255  H HG13 . VAL A 1 68  ? 1.641   14.141  2.331   1.00 0.00 ? 87  VAL A HG13 4  
ATOM 8256  H HG21 . VAL A 1 68  ? 0.700   10.691  2.813   1.00 0.00 ? 87  VAL A HG21 4  
ATOM 8257  H HG22 . VAL A 1 68  ? 0.843   11.275  4.471   1.00 0.00 ? 87  VAL A HG22 4  
ATOM 8258  H HG23 . VAL A 1 68  ? 2.072   10.200  3.806   1.00 0.00 ? 87  VAL A HG23 4  
ATOM 8259  N N    . ILE A 1 69  ? 4.945   11.223  4.012   1.00 0.00 ? 88  ILE A N    4  
ATOM 8260  C CA   . ILE A 1 69  ? 5.757   10.352  4.852   1.00 0.00 ? 88  ILE A CA   4  
ATOM 8261  C C    . ILE A 1 69  ? 5.482   10.622  6.328   1.00 0.00 ? 88  ILE A C    4  
ATOM 8262  O O    . ILE A 1 69  ? 5.448   11.774  6.762   1.00 0.00 ? 88  ILE A O    4  
ATOM 8263  C CB   . ILE A 1 69  ? 7.261   10.545  4.575   1.00 0.00 ? 88  ILE A CB   4  
ATOM 8264  C CG1  . ILE A 1 69  ? 7.708   9.654   3.413   1.00 0.00 ? 88  ILE A CG1  4  
ATOM 8265  C CG2  . ILE A 1 69  ? 8.077   10.243  5.824   1.00 0.00 ? 88  ILE A CG2  4  
ATOM 8266  C CD1  . ILE A 1 69  ? 9.199   9.682   3.158   1.00 0.00 ? 88  ILE A CD1  4  
ATOM 8267  H H    . ILE A 1 69  ? 4.952   12.188  4.179   1.00 0.00 ? 88  ILE A H    4  
ATOM 8268  H HA   . ILE A 1 69  ? 5.496   9.329   4.624   1.00 0.00 ? 88  ILE A HA   4  
ATOM 8269  H HB   . ILE A 1 69  ? 7.426   11.579  4.310   1.00 0.00 ? 88  ILE A HB   4  
ATOM 8270  H HG12 . ILE A 1 69  ? 7.427   8.634   3.624   2.00 0.00 ? 88  ILE A HG12 4  
ATOM 8271  H HG13 . ILE A 1 69  ? 7.211   9.976   2.510   2.00 0.00 ? 88  ILE A HG13 4  
ATOM 8272  H HG21 . ILE A 1 69  ? 9.128   10.371  5.609   1.00 0.00 ? 88  ILE A HG21 4  
ATOM 8273  H HG22 . ILE A 1 69  ? 7.894   9.226   6.136   1.00 0.00 ? 88  ILE A HG22 4  
ATOM 8274  H HG23 . ILE A 1 69  ? 7.787   10.920  6.615   1.00 0.00 ? 88  ILE A HG23 4  
ATOM 8275  H HD11 . ILE A 1 69  ? 9.547   10.704  3.165   1.00 0.00 ? 88  ILE A HD11 4  
ATOM 8276  H HD12 . ILE A 1 69  ? 9.407   9.238   2.196   1.00 0.00 ? 88  ILE A HD12 4  
ATOM 8277  H HD13 . ILE A 1 69  ? 9.707   9.123   3.930   1.00 0.00 ? 88  ILE A HD13 4  
ATOM 8278  N N    . PRO A 1 70  ? 5.280   9.556   7.120   1.00 0.00 ? 89  PRO A N    4  
ATOM 8279  C CA   . PRO A 1 70  ? 5.005   9.680   8.557   1.00 0.00 ? 89  PRO A CA   4  
ATOM 8280  C C    . PRO A 1 70  ? 6.139   10.372  9.305   1.00 0.00 ? 89  PRO A C    4  
ATOM 8281  O O    . PRO A 1 70  ? 7.310   10.215  8.961   1.00 0.00 ? 89  PRO A O    4  
ATOM 8282  C CB   . PRO A 1 70  ? 4.867   8.227   9.021   1.00 0.00 ? 89  PRO A CB   4  
ATOM 8283  C CG   . PRO A 1 70  ? 4.573   7.449   7.787   1.00 0.00 ? 89  PRO A CG   4  
ATOM 8284  C CD   . PRO A 1 70  ? 5.303   8.152   6.677   1.00 0.00 ? 89  PRO A CD   4  
ATOM 8285  H HA   . PRO A 1 70  ? 4.082   10.209  8.737   1.00 0.00 ? 89  PRO A HA   4  
ATOM 8286  H HB2  . PRO A 1 70  ? 5.790   7.906   9.481   2.00 0.00 ? 89  PRO A HB2  4  
ATOM 8287  H HB3  . PRO A 1 70  ? 4.060   8.153   9.736   2.00 0.00 ? 89  PRO A HB3  4  
ATOM 8288  H HG2  . PRO A 1 70  ? 4.936   6.438   7.895   2.00 0.00 ? 89  PRO A HG2  4  
ATOM 8289  H HG3  . PRO A 1 70  ? 3.509   7.450   7.596   2.00 0.00 ? 89  PRO A HG3  4  
ATOM 8290  H HD2  . PRO A 1 70  ? 6.316   7.787   6.599   2.00 0.00 ? 89  PRO A HD2  4  
ATOM 8291  H HD3  . PRO A 1 70  ? 4.777   8.032   5.742   2.00 0.00 ? 89  PRO A HD3  4  
ATOM 8292  N N    . ARG A 1 71  ? 5.783   11.138  10.332  1.00 0.00 ? 90  ARG A N    4  
ATOM 8293  C CA   . ARG A 1 71  ? 6.772   11.854  11.129  1.00 0.00 ? 90  ARG A CA   4  
ATOM 8294  C C    . ARG A 1 71  ? 6.120   12.524  12.335  1.00 0.00 ? 90  ARG A C    4  
ATOM 8295  O O    . ARG A 1 71  ? 6.359   13.701  12.608  1.00 0.00 ? 90  ARG A O    4  
ATOM 8296  C CB   . ARG A 1 71  ? 7.485   12.904  10.274  1.00 0.00 ? 90  ARG A CB   4  
ATOM 8297  C CG   . ARG A 1 71  ? 8.860   13.312  10.776  1.00 0.00 ? 90  ARG A CG   4  
ATOM 8298  C CD   . ARG A 1 71  ? 9.879   12.198  10.599  1.00 0.00 ? 90  ARG A CD   4  
ATOM 8299  N NE   . ARG A 1 71  ? 10.180  11.531  11.863  1.00 0.00 ? 90  ARG A NE   4  
ATOM 8300  C CZ   . ARG A 1 71  ? 9.854   10.270  12.127  4.00 0.00 ? 90  ARG A CZ   4  
ATOM 8301  N NH1  . ARG A 1 71  ? 9.219   9.537   11.221  5.00 0.00 ? 90  ARG A NH1  4  
ATOM 8302  N NH2  . ARG A 1 71  ? 10.160  9.730   13.299  5.00 0.00 ? 90  ARG A NH2  4  
ATOM 8303  H H    . ARG A 1 71  ? 4.833   11.225  10.557  1.00 0.00 ? 90  ARG A H    4  
ATOM 8304  H HA   . ARG A 1 71  ? 7.497   11.136  11.480  1.00 0.00 ? 90  ARG A HA   4  
ATOM 8305  H HB2  . ARG A 1 71  ? 7.596   12.514  9.273   2.00 0.00 ? 90  ARG A HB2  4  
ATOM 8306  H HB3  . ARG A 1 71  ? 6.868   13.789  10.231  2.00 0.00 ? 90  ARG A HB3  4  
ATOM 8307  H HG2  . ARG A 1 71  ? 9.190   14.179  10.222  2.00 0.00 ? 90  ARG A HG2  4  
ATOM 8308  H HG3  . ARG A 1 71  ? 8.790   13.560  11.825  2.00 0.00 ? 90  ARG A HG3  4  
ATOM 8309  H HD2  . ARG A 1 71  ? 9.482   11.472  9.905   2.00 0.00 ? 90  ARG A HD2  4  
ATOM 8310  H HD3  . ARG A 1 71  ? 10.788  12.619  10.198  2.00 0.00 ? 90  ARG A HD3  4  
ATOM 8311  H HE   . ARG A 1 71  ? 10.650  12.051  12.548  1.00 0.00 ? 90  ARG A HE   4  
ATOM 8312  H HH11 . ARG A 1 71  ? 8.984   9.933   10.333  5.00 0.00 ? 90  ARG A HH11 4  
ATOM 8313  H HH12 . ARG A 1 71  ? 8.977   8.590   11.427  5.00 0.00 ? 90  ARG A HH12 4  
ATOM 8314  H HH21 . ARG A 1 71  ? 10.639  10.272  13.989  5.00 0.00 ? 90  ARG A HH21 4  
ATOM 8315  H HH22 . ARG A 1 71  ? 9.911   8.781   13.492  5.00 0.00 ? 90  ARG A HH22 4  
ATOM 8316  N N    . ILE A 1 72  ? 5.297   11.768  13.055  1.00 0.00 ? 91  ILE A N    4  
ATOM 8317  C CA   . ILE A 1 72  ? 4.613   12.292  14.231  1.00 0.00 ? 91  ILE A CA   4  
ATOM 8318  C C    . ILE A 1 72  ? 5.609   12.716  15.307  1.00 0.00 ? 91  ILE A C    4  
ATOM 8319  O O    . ILE A 1 72  ? 5.267   13.462  16.224  1.00 0.00 ? 91  ILE A O    4  
ATOM 8320  C CB   . ILE A 1 72  ? 3.644   11.253  14.826  1.00 0.00 ? 91  ILE A CB   4  
ATOM 8321  C CG1  . ILE A 1 72  ? 2.483   11.953  15.532  1.00 0.00 ? 91  ILE A CG1  4  
ATOM 8322  C CG2  . ILE A 1 72  ? 4.378   10.329  15.787  1.00 0.00 ? 91  ILE A CG2  4  
ATOM 8323  C CD1  . ILE A 1 72  ? 1.154   11.254  15.356  1.00 0.00 ? 91  ILE A CD1  4  
ATOM 8324  H H    . ILE A 1 72  ? 5.144   10.836  12.789  1.00 0.00 ? 91  ILE A H    4  
ATOM 8325  H HA   . ILE A 1 72  ? 4.039   13.155  13.926  1.00 0.00 ? 91  ILE A HA   4  
ATOM 8326  H HB   . ILE A 1 72  ? 3.254   10.653  14.017  1.00 0.00 ? 91  ILE A HB   4  
ATOM 8327  H HG12 . ILE A 1 72  ? 2.692   12.004  16.590  2.00 0.00 ? 91  ILE A HG12 4  
ATOM 8328  H HG13 . ILE A 1 72  ? 2.385   12.955  15.143  2.00 0.00 ? 91  ILE A HG13 4  
ATOM 8329  H HG21 . ILE A 1 72  ? 4.898   10.920  16.527  1.00 0.00 ? 91  ILE A HG21 4  
ATOM 8330  H HG22 . ILE A 1 72  ? 5.090   9.730   15.238  1.00 0.00 ? 91  ILE A HG22 4  
ATOM 8331  H HG23 . ILE A 1 72  ? 3.667   9.682   16.278  1.00 0.00 ? 91  ILE A HG23 4  
ATOM 8332  H HD11 . ILE A 1 72  ? 1.323   10.215  15.108  1.00 0.00 ? 91  ILE A HD11 4  
ATOM 8333  H HD12 . ILE A 1 72  ? 0.600   11.729  14.559  1.00 0.00 ? 91  ILE A HD12 4  
ATOM 8334  H HD13 . ILE A 1 72  ? 0.589   11.316  16.273  1.00 0.00 ? 91  ILE A HD13 4  
ATOM 8335  N N    . HIS A 1 73  ? 6.842   12.233  15.190  1.00 0.00 ? 92  HIS A N    4  
ATOM 8336  C CA   . HIS A 1 73  ? 7.886   12.558  16.155  1.00 0.00 ? 92  HIS A CA   4  
ATOM 8337  C C    . HIS A 1 73  ? 8.742   13.722  15.663  1.00 0.00 ? 92  HIS A C    4  
ATOM 8338  O O    . HIS A 1 73  ? 9.193   13.733  14.517  1.00 0.00 ? 92  HIS A O    4  
ATOM 8339  C CB   . HIS A 1 73  ? 8.767   11.335  16.415  1.00 0.00 ? 92  HIS A CB   4  
ATOM 8340  C CG   . HIS A 1 73  ? 8.679   10.800  17.810  1.00 0.00 ? 92  HIS A CG   4  
ATOM 8341  N ND1  . HIS A 1 73  ? 9.382   11.336  18.869  1.00 0.00 ? 92  HIS A ND1  4  
ATOM 8342  C CD2  . HIS A 1 73  ? 7.966   9.767   18.320  1.00 0.00 ? 92  HIS A CD2  4  
ATOM 8343  C CE1  . HIS A 1 73  ? 9.105   10.658  19.968  1.00 0.00 ? 92  HIS A CE1  4  
ATOM 8344  N NE2  . HIS A 1 73  ? 8.249   9.702   19.662  1.00 0.00 ? 92  HIS A NE2  4  
ATOM 8345  H H    . HIS A 1 73  ? 7.054   11.640  14.439  1.00 0.00 ? 92  HIS A H    4  
ATOM 8346  H HA   . HIS A 1 73  ? 7.405   12.846  17.078  1.00 0.00 ? 92  HIS A HA   4  
ATOM 8347  H HB2  . HIS A 1 73  ? 8.476   10.544  15.739  2.00 0.00 ? 92  HIS A HB2  4  
ATOM 8348  H HB3  . HIS A 1 73  ? 9.797   11.599  16.227  2.00 0.00 ? 92  HIS A HB3  4  
ATOM 8349  H HD1  . HIS A 1 73  ? 9.993   12.101  18.821  1.00 0.00 ? 92  HIS A HD1  4  
ATOM 8350  H HD2  . HIS A 1 73  ? 7.299   9.117   17.772  1.00 0.00 ? 92  HIS A HD2  4  
ATOM 8351  H HE1  . HIS A 1 73  ? 9.510   10.854  20.950  1.00 0.00 ? 92  HIS A HE1  4  
ATOM 8352  H HE2  . HIS A 1 73  ? 7.944   8.999   20.273  1.00 0.00 ? 92  HIS A HE2  4  
ATOM 8353  N N    . PRO A 1 74  ? 8.980   14.719  16.531  1.00 0.00 ? 93  PRO A N    4  
ATOM 8354  C CA   . PRO A 1 74  ? 9.789   15.892  16.187  1.00 0.00 ? 93  PRO A CA   4  
ATOM 8355  C C    . PRO A 1 74  ? 11.202  15.512  15.757  1.00 0.00 ? 93  PRO A C    4  
ATOM 8356  O O    . PRO A 1 74  ? 11.859  16.252  15.025  1.00 0.00 ? 93  PRO A O    4  
ATOM 8357  C CB   . PRO A 1 74  ? 9.826   16.700  17.489  1.00 0.00 ? 93  PRO A CB   4  
ATOM 8358  C CG   . PRO A 1 74  ? 8.653   16.225  18.273  1.00 0.00 ? 93  PRO A CG   4  
ATOM 8359  C CD   . PRO A 1 74  ? 8.479   14.776  17.915  1.00 0.00 ? 93  PRO A CD   4  
ATOM 8360  H HA   . PRO A 1 74  ? 9.323   16.479  15.409  1.00 0.00 ? 93  PRO A HA   4  
ATOM 8361  H HB2  . PRO A 1 74  ? 10.753  16.507  18.008  2.00 0.00 ? 93  PRO A HB2  4  
ATOM 8362  H HB3  . PRO A 1 74  ? 9.749   17.754  17.263  2.00 0.00 ? 93  PRO A HB3  4  
ATOM 8363  H HG2  . PRO A 1 74  ? 8.851   16.328  19.331  2.00 0.00 ? 93  PRO A HG2  4  
ATOM 8364  H HG3  . PRO A 1 74  ? 7.773   16.787  17.998  2.00 0.00 ? 93  PRO A HG3  4  
ATOM 8365  H HD2  . PRO A 1 74  ? 9.070   14.151  18.567  2.00 0.00 ? 93  PRO A HD2  4  
ATOM 8366  H HD3  . PRO A 1 74  ? 7.437   14.497  17.961  2.00 0.00 ? 93  PRO A HD3  4  
ATOM 8367  N N    . ASN A 1 75  ? 11.661  14.352  16.216  1.00 0.00 ? 94  ASN A N    4  
ATOM 8368  C CA   . ASN A 1 75  ? 12.995  13.872  15.878  1.00 0.00 ? 94  ASN A CA   4  
ATOM 8369  C C    . ASN A 1 75  ? 13.009  13.245  14.488  1.00 0.00 ? 94  ASN A C    4  
ATOM 8370  O O    . ASN A 1 75  ? 12.884  12.027  14.344  1.00 0.00 ? 94  ASN A O    4  
ATOM 8371  C CB   . ASN A 1 75  ? 13.472  12.853  16.916  1.00 0.00 ? 94  ASN A CB   4  
ATOM 8372  C CG   . ASN A 1 75  ? 14.976  12.669  16.904  1.00 0.00 ? 94  ASN A CG   4  
ATOM 8373  O OD1  . ASN A 1 75  ? 15.723  13.595  16.587  1.00 0.00 ? 94  ASN A OD1  4  
ATOM 8374  N ND2  . ASN A 1 75  ? 15.429  11.470  17.250  4.00 0.00 ? 94  ASN A ND2  4  
ATOM 8375  H H    . ASN A 1 75  ? 11.089  13.806  16.795  1.00 0.00 ? 94  ASN A H    4  
ATOM 8376  H HA   . ASN A 1 75  ? 13.664  14.719  15.884  1.00 0.00 ? 94  ASN A HA   4  
ATOM 8377  H HB2  . ASN A 1 75  ? 13.177  13.187  17.900  2.00 0.00 ? 94  ASN A HB2  4  
ATOM 8378  H HB3  . ASN A 1 75  ? 13.010  11.898  16.713  2.00 0.00 ? 94  ASN A HB3  4  
ATOM 8379  H HD21 . ASN A 1 75  ? 14.773  10.779  17.491  5.00 0.00 ? 94  ASN A HD21 4  
ATOM 8380  H HD22 . ASN A 1 75  ? 16.400  11.323  17.251  5.00 0.00 ? 94  ASN A HD22 4  
ATOM 8381  N N    . SER A 1 76  ? 13.158  14.083  13.468  1.00 0.00 ? 95  SER A N    4  
ATOM 8382  C CA   . SER A 1 76  ? 13.186  13.614  12.087  1.00 0.00 ? 95  SER A CA   4  
ATOM 8383  C C    . SER A 1 76  ? 14.220  12.510  11.906  1.00 0.00 ? 95  SER A C    4  
ATOM 8384  O O    . SER A 1 76  ? 15.412  12.717  12.133  1.00 0.00 ? 95  SER A O    4  
ATOM 8385  C CB   . SER A 1 76  ? 13.491  14.775  11.138  1.00 0.00 ? 95  SER A CB   4  
ATOM 8386  O OG   . SER A 1 76  ? 14.663  15.466  11.537  1.00 0.00 ? 95  SER A OG   4  
ATOM 8387  H H    . SER A 1 76  ? 13.250  15.042  13.649  1.00 0.00 ? 95  SER A H    4  
ATOM 8388  H HA   . SER A 1 76  ? 12.208  13.219  11.853  1.00 0.00 ? 95  SER A HA   4  
ATOM 8389  H HB2  . SER A 1 76  ? 13.637  14.391  10.139  2.00 0.00 ? 95  SER A HB2  4  
ATOM 8390  H HB3  . SER A 1 76  ? 12.662  15.467  11.142  2.00 0.00 ? 95  SER A HB3  4  
ATOM 8391  H HG   . SER A 1 76  ? 14.581  15.733  12.455  1.00 0.00 ? 95  SER A HG   4  
ATOM 8392  N N    . ILE A 1 77  ? 13.756  11.335  11.491  1.00 0.00 ? 96  ILE A N    4  
ATOM 8393  C CA   . ILE A 1 77  ? 14.640  10.197  11.275  1.00 0.00 ? 96  ILE A CA   4  
ATOM 8394  C C    . ILE A 1 77  ? 14.519  9.675   9.847   1.00 0.00 ? 96  ILE A C    4  
ATOM 8395  O O    . ILE A 1 77  ? 15.489  9.186   9.269   1.00 0.00 ? 96  ILE A O    4  
ATOM 8396  C CB   . ILE A 1 77  ? 14.334  9.050   12.258  1.00 0.00 ? 96  ILE A CB   4  
ATOM 8397  C CG1  . ILE A 1 77  ? 15.316  7.896   12.053  1.00 0.00 ? 96  ILE A CG1  4  
ATOM 8398  C CG2  . ILE A 1 77  ? 12.901  8.571   12.084  1.00 0.00 ? 96  ILE A CG2  4  
ATOM 8399  C CD1  . ILE A 1 77  ? 15.539  7.053   13.289  1.00 0.00 ? 96  ILE A CD1  4  
ATOM 8400  H H    . ILE A 1 77  ? 12.796  11.232  11.324  1.00 0.00 ? 96  ILE A H    4  
ATOM 8401  H HA   . ILE A 1 77  ? 15.655  10.526  11.442  1.00 0.00 ? 96  ILE A HA   4  
ATOM 8402  H HB   . ILE A 1 77  ? 14.441  9.431   13.262  1.00 0.00 ? 96  ILE A HB   4  
ATOM 8403  H HG12 . ILE A 1 77  ? 14.942  7.247   11.273  2.00 0.00 ? 96  ILE A HG12 4  
ATOM 8404  H HG13 . ILE A 1 77  ? 16.274  8.297   11.749  2.00 0.00 ? 96  ILE A HG13 4  
ATOM 8405  H HG21 . ILE A 1 77  ? 12.349  9.288   11.495  1.00 0.00 ? 96  ILE A HG21 4  
ATOM 8406  H HG22 . ILE A 1 77  ? 12.435  8.468   13.054  1.00 0.00 ? 96  ILE A HG22 4  
ATOM 8407  H HG23 . ILE A 1 77  ? 12.899  7.615   11.581  1.00 0.00 ? 96  ILE A HG23 4  
ATOM 8408  H HD11 . ILE A 1 77  ? 15.802  7.692   14.119  1.00 0.00 ? 96  ILE A HD11 4  
ATOM 8409  H HD12 . ILE A 1 77  ? 16.340  6.351   13.107  1.00 0.00 ? 96  ILE A HD12 4  
ATOM 8410  H HD13 . ILE A 1 77  ? 14.635  6.512   13.524  1.00 0.00 ? 96  ILE A HD13 4  
ATOM 8411  N N    . CYS A 1 78  ? 13.320  9.784   9.283   1.00 0.00 ? 97  CYS A N    4  
ATOM 8412  C CA   . CYS A 1 78  ? 13.069  9.327   7.921   1.00 0.00 ? 97  CYS A CA   4  
ATOM 8413  C C    . CYS A 1 78  ? 12.964  10.507  6.962   1.00 0.00 ? 97  CYS A C    4  
ATOM 8414  O O    . CYS A 1 78  ? 13.066  11.664  7.373   1.00 0.00 ? 97  CYS A O    4  
ATOM 8415  C CB   . CYS A 1 78  ? 11.785  8.495   7.869   1.00 0.00 ? 97  CYS A CB   4  
ATOM 8416  S SG   . CYS A 1 78  ? 11.959  6.815   8.550   1.00 0.00 ? 97  CYS A SG   4  
ATOM 8417  H H    . CYS A 1 78  ? 12.586  10.185  9.795   1.00 0.00 ? 97  CYS A H    4  
ATOM 8418  H HA   . CYS A 1 78  ? 13.901  8.707   7.621   1.00 0.00 ? 97  CYS A HA   4  
ATOM 8419  H HB2  . CYS A 1 78  ? 11.016  9.002   8.433   2.00 0.00 ? 97  CYS A HB2  4  
ATOM 8420  H HB3  . CYS A 1 78  ? 11.468  8.402   6.840   2.00 0.00 ? 97  CYS A HB3  4  
ATOM 8421  N N    . ALA A 1 79  ? 12.759  10.208  5.683   1.00 0.00 ? 98  ALA A N    4  
ATOM 8422  C CA   . ALA A 1 79  ? 12.639  11.244  4.664   1.00 0.00 ? 98  ALA A CA   4  
ATOM 8423  C C    . ALA A 1 79  ? 13.887  12.120  4.620   1.00 0.00 ? 98  ALA A C    4  
ATOM 8424  O O    . ALA A 1 79  ? 14.829  11.838  3.879   1.00 0.00 ? 98  ALA A O    4  
ATOM 8425  C CB   . ALA A 1 79  ? 11.402  12.094  4.917   1.00 0.00 ? 98  ALA A CB   4  
ATOM 8426  H H    . ALA A 1 79  ? 12.686  9.268   5.418   1.00 0.00 ? 98  ALA A H    4  
ATOM 8427  H HA   . ALA A 1 79  ? 12.521  10.756  3.707   1.00 0.00 ? 98  ALA A HA   4  
ATOM 8428  H HB1  . ALA A 1 79  ? 10.597  11.754  4.284   1.00 0.00 ? 98  ALA A HB1  4  
ATOM 8429  H HB2  . ALA A 1 79  ? 11.625  13.128  4.696   1.00 0.00 ? 98  ALA A HB2  4  
ATOM 8430  H HB3  . ALA A 1 79  ? 11.109  12.002  5.953   1.00 0.00 ? 98  ALA A HB3  4  
ATOM 8431  N N    . ALA A 1 80  ? 13.887  13.185  5.416   1.00 0.00 ? 99  ALA A N    4  
ATOM 8432  C CA   . ALA A 1 80  ? 15.020  14.101  5.466   1.00 0.00 ? 99  ALA A CA   4  
ATOM 8433  C C    . ALA A 1 80  ? 15.077  14.831  6.803   1.00 0.00 ? 99  ALA A C    4  
ATOM 8434  O O    . ALA A 1 80  ? 15.848  14.465  7.690   1.00 0.00 ? 99  ALA A O    4  
ATOM 8435  C CB   . ALA A 1 80  ? 14.941  15.099  4.321   1.00 0.00 ? 99  ALA A CB   4  
ATOM 8436  H H    . ALA A 1 80  ? 13.106  13.358  5.983   1.00 0.00 ? 99  ALA A H    4  
ATOM 8437  H HA   . ALA A 1 80  ? 15.923  13.521  5.346   1.00 0.00 ? 99  ALA A HA   4  
ATOM 8438  H HB1  . ALA A 1 80  ? 14.314  15.929  4.609   1.00 0.00 ? 99  ALA A HB1  4  
ATOM 8439  H HB2  . ALA A 1 80  ? 14.522  14.615  3.451   1.00 0.00 ? 99  ALA A HB2  4  
ATOM 8440  H HB3  . ALA A 1 80  ? 15.932  15.461  4.090   1.00 0.00 ? 99  ALA A HB3  4  
ATOM 8441  N N    . ASN A 1 81  ? 14.255  15.868  6.942   1.00 0.00 ? 100 ASN A N    4  
ATOM 8442  C CA   . ASN A 1 81  ? 14.212  16.650  8.172   1.00 0.00 ? 100 ASN A CA   4  
ATOM 8443  C C    . ASN A 1 81  ? 12.798  17.142  8.458   1.00 0.00 ? 100 ASN A C    4  
ATOM 8444  O O    . ASN A 1 81  ? 12.377  17.215  9.612   1.00 0.00 ? 100 ASN A O    4  
ATOM 8445  C CB   . ASN A 1 81  ? 15.169  17.841  8.076   1.00 0.00 ? 100 ASN A CB   4  
ATOM 8446  C CG   . ASN A 1 81  ? 16.477  17.597  8.803   1.00 0.00 ? 100 ASN A CG   4  
ATOM 8447  O OD1  . ASN A 1 81  ? 16.650  16.577  9.469   1.00 0.00 ? 100 ASN A OD1  4  
ATOM 8448  N ND2  . ASN A 1 81  ? 17.406  18.538  8.677   4.00 0.00 ? 100 ASN A ND2  4  
ATOM 8449  H H    . ASN A 1 81  ? 13.664  16.112  6.200   1.00 0.00 ? 100 ASN A H    4  
ATOM 8450  H HA   . ASN A 1 81  ? 14.529  16.011  8.983   1.00 0.00 ? 100 ASN A HA   4  
ATOM 8451  H HB2  . ASN A 1 81  ? 15.387  18.037  7.036   2.00 0.00 ? 100 ASN A HB2  4  
ATOM 8452  H HB3  . ASN A 1 81  ? 14.696  18.711  8.508   2.00 0.00 ? 100 ASN A HB3  4  
ATOM 8453  H HD21 . ASN A 1 81  ? 17.199  19.326  8.130   5.00 0.00 ? 100 ASN A HD21 4  
ATOM 8454  H HD22 . ASN A 1 81  ? 18.265  18.404  9.138   5.00 0.00 ? 100 ASN A HD22 4  
ATOM 8455  N N    . ASN A 1 82  ? 12.068  17.481  7.399   1.00 0.00 ? 101 ASN A N    4  
ATOM 8456  C CA   . ASN A 1 82  ? 10.700  17.968  7.535   1.00 0.00 ? 101 ASN A CA   4  
ATOM 8457  C C    . ASN A 1 82  ? 9.867   17.021  8.393   1.00 0.00 ? 101 ASN A C    4  
ATOM 8458  O O    . ASN A 1 82  ? 10.067  15.807  8.369   1.00 0.00 ? 101 ASN A O    4  
ATOM 8459  C CB   . ASN A 1 82  ? 10.054  18.127  6.158   1.00 0.00 ? 101 ASN A CB   4  
ATOM 8460  C CG   . ASN A 1 82  ? 10.411  19.442  5.494   1.00 0.00 ? 101 ASN A CG   4  
ATOM 8461  O OD1  . ASN A 1 82  ? 11.298  20.162  5.951   1.00 0.00 ? 101 ASN A OD1  4  
ATOM 8462  N ND2  . ASN A 1 82  ? 9.718   19.763  4.407   4.00 0.00 ? 101 ASN A ND2  4  
ATOM 8463  H H    . ASN A 1 82  ? 12.460  17.403  6.504   1.00 0.00 ? 101 ASN A H    4  
ATOM 8464  H HA   . ASN A 1 82  ? 10.738  18.933  8.018   1.00 0.00 ? 101 ASN A HA   4  
ATOM 8465  H HB2  . ASN A 1 82  ? 10.384  17.321  5.519   2.00 0.00 ? 101 ASN A HB2  4  
ATOM 8466  H HB3  . ASN A 1 82  ? 8.981   18.079  6.265   2.00 0.00 ? 101 ASN A HB3  4  
ATOM 8467  H HD21 . ASN A 1 82  ? 9.024   19.140  4.099   5.00 0.00 ? 101 ASN A HD21 4  
ATOM 8468  H HD22 . ASN A 1 82  ? 9.929   20.611  3.956   5.00 0.00 ? 101 ASN A HD22 4  
ATOM 8469  N N    . THR A 1 83  ? 8.933   17.586  9.151   1.00 0.00 ? 102 THR A N    4  
ATOM 8470  C CA   . THR A 1 83  ? 8.069   16.796  10.016  1.00 0.00 ? 102 THR A CA   4  
ATOM 8471  C C    . THR A 1 83  ? 6.654   16.714  9.455   1.00 0.00 ? 102 THR A C    4  
ATOM 8472  O O    . THR A 1 83  ? 6.286   17.475  8.559   1.00 0.00 ? 102 THR A O    4  
ATOM 8473  C CB   . THR A 1 83  ? 8.012   17.379  11.439  1.00 0.00 ? 102 THR A CB   4  
ATOM 8474  O OG1  . THR A 1 83  ? 7.644   18.763  11.387  1.00 0.00 ? 102 THR A OG1  4  
ATOM 8475  C CG2  . THR A 1 83  ? 9.355   17.234  12.139  1.00 0.00 ? 102 THR A CG2  4  
ATOM 8476  H H    . THR A 1 83  ? 8.821   18.557  9.128   1.00 0.00 ? 102 THR A H    4  
ATOM 8477  H HA   . THR A 1 83  ? 8.480   15.801  10.074  1.00 0.00 ? 102 THR A HA   4  
ATOM 8478  H HB   . THR A 1 83  ? 7.268   16.837  12.005  1.00 0.00 ? 102 THR A HB   4  
ATOM 8479  H HG1  . THR A 1 83  ? 7.447   19.076  12.273  1.00 0.00 ? 102 THR A HG1  4  
ATOM 8480  H HG21 . THR A 1 83  ? 9.197   16.912  13.157  1.00 0.00 ? 102 THR A HG21 4  
ATOM 8481  H HG22 . THR A 1 83  ? 9.867   18.184  12.136  1.00 0.00 ? 102 THR A HG22 4  
ATOM 8482  H HG23 . THR A 1 83  ? 9.954   16.501  11.618  1.00 0.00 ? 102 THR A HG23 4  
ATOM 8483  N N    . GLY A 1 84  ? 5.863   15.789  9.988   1.00 0.00 ? 103 GLY A N    4  
ATOM 8484  C CA   . GLY A 1 84  ? 4.497   15.626  9.529   1.00 0.00 ? 103 GLY A CA   4  
ATOM 8485  C C    . GLY A 1 84  ? 4.409   14.942  8.179   1.00 0.00 ? 103 GLY A C    4  
ATOM 8486  O O    . GLY A 1 84  ? 5.316   14.208  7.787   1.00 0.00 ? 103 GLY A O    4  
ATOM 8487  H H    . GLY A 1 84  ? 6.211   15.212  10.700  1.00 0.00 ? 103 GLY A H    4  
ATOM 8488  H HA2  . GLY A 1 84  ? 3.953   15.037  10.254  2.00 0.00 ? 103 GLY A HA2  4  
ATOM 8489  H HA3  . GLY A 1 84  ? 4.036   16.602  9.454   2.00 0.00 ? 103 GLY A HA3  4  
ATOM 8490  N N    . VAL A 1 85  ? 3.312   15.182  7.466   1.00 0.00 ? 104 VAL A N    4  
ATOM 8491  C CA   . VAL A 1 85  ? 3.107   14.583  6.154   1.00 0.00 ? 104 VAL A CA   4  
ATOM 8492  C C    . VAL A 1 85  ? 4.068   15.171  5.126   1.00 0.00 ? 104 VAL A C    4  
ATOM 8493  O O    . VAL A 1 85  ? 3.761   16.171  4.476   1.00 0.00 ? 104 VAL A O    4  
ATOM 8494  C CB   . VAL A 1 85  ? 1.661   14.785  5.664   1.00 0.00 ? 104 VAL A CB   4  
ATOM 8495  C CG1  . VAL A 1 85  ? 0.769   13.644  6.126   2.00 0.00 ? 104 VAL A CG1  4  
ATOM 8496  C CG2  . VAL A 1 85  ? 1.103   16.115  6.147   2.00 0.00 ? 104 VAL A CG2  4  
ATOM 8497  H H    . VAL A 1 85  ? 2.624   15.775  7.832   1.00 0.00 ? 104 VAL A H    4  
ATOM 8498  H HA   . VAL A 1 85  ? 3.293   13.522  6.239   1.00 0.00 ? 104 VAL A HA   4  
ATOM 8499  H HB   . VAL A 1 85  ? 1.674   14.793  4.585   1.00 0.00 ? 104 VAL A HB   4  
ATOM 8500  H HG11 . VAL A 1 85  ? 1.314   13.014  6.812   1.00 0.00 ? 104 VAL A HG11 4  
ATOM 8501  H HG12 . VAL A 1 85  ? 0.458   13.061  5.271   1.00 0.00 ? 104 VAL A HG12 4  
ATOM 8502  H HG13 . VAL A 1 85  ? -0.102  14.046  6.622   1.00 0.00 ? 104 VAL A HG13 4  
ATOM 8503  H HG21 . VAL A 1 85  ? 1.883   16.862  6.127   1.00 0.00 ? 104 VAL A HG21 4  
ATOM 8504  H HG22 . VAL A 1 85  ? 0.735   16.005  7.157   1.00 0.00 ? 104 VAL A HG22 4  
ATOM 8505  H HG23 . VAL A 1 85  ? 0.294   16.422  5.501   1.00 0.00 ? 104 VAL A HG23 4  
ATOM 8506  N N    . TYR A 1 86  ? 5.230   14.543  4.981   1.00 0.00 ? 105 TYR A N    4  
ATOM 8507  C CA   . TYR A 1 86  ? 6.235   15.003  4.028   1.00 0.00 ? 105 TYR A CA   4  
ATOM 8508  C C    . TYR A 1 86  ? 5.930   14.481  2.628   1.00 0.00 ? 105 TYR A C    4  
ATOM 8509  O O    . TYR A 1 86  ? 5.924   13.273  2.396   1.00 0.00 ? 105 TYR A O    4  
ATOM 8510  C CB   . TYR A 1 86  ? 7.628   14.544  4.466   1.00 0.00 ? 105 TYR A CB   4  
ATOM 8511  C CG   . TYR A 1 86  ? 8.704   14.716  3.419   1.00 0.00 ? 105 TYR A CG   4  
ATOM 8512  C CD1  . TYR A 1 86  ? 9.386   15.921  3.289   1.00 0.00 ? 105 TYR A CD1  4  
ATOM 8513  C CD2  . TYR A 1 86  ? 9.041   13.677  2.560   1.00 0.00 ? 105 TYR A CD2  4  
ATOM 8514  C CE1  . TYR A 1 86  ? 10.371  16.084  2.334   1.00 0.00 ? 105 TYR A CE1  4  
ATOM 8515  C CE2  . TYR A 1 86  ? 10.026  13.832  1.604   1.00 0.00 ? 105 TYR A CE2  4  
ATOM 8516  C CZ   . TYR A 1 86  ? 10.687  15.037  1.495   1.00 0.00 ? 105 TYR A CZ   4  
ATOM 8517  O OH   . TYR A 1 86  ? 11.669  15.196  0.543   1.00 0.00 ? 105 TYR A OH   4  
ATOM 8518  H H    . TYR A 1 86  ? 5.416   13.749  5.526   1.00 0.00 ? 105 TYR A H    4  
ATOM 8519  H HA   . TYR A 1 86  ? 6.210   16.082  4.013   1.00 0.00 ? 105 TYR A HA   4  
ATOM 8520  H HB2  . TYR A 1 86  ? 7.925   15.106  5.339   2.00 0.00 ? 105 TYR A HB2  4  
ATOM 8521  H HB3  . TYR A 1 86  ? 7.586   13.495  4.723   2.00 0.00 ? 105 TYR A HB3  4  
ATOM 8522  H HD1  . TYR A 1 86  ? 9.136   16.739  3.949   1.00 0.00 ? 105 TYR A HD1  4  
ATOM 8523  H HD2  . TYR A 1 86  ? 8.521   12.734  2.648   1.00 0.00 ? 105 TYR A HD2  4  
ATOM 8524  H HE1  . TYR A 1 86  ? 10.889  17.028  2.249   1.00 0.00 ? 105 TYR A HE1  4  
ATOM 8525  H HE2  . TYR A 1 86  ? 10.274  13.012  0.946   1.00 0.00 ? 105 TYR A HE2  4  
ATOM 8526  H HH   . TYR A 1 86  ? 12.491  14.819  0.865   1.00 0.00 ? 105 TYR A HH   4  
ATOM 8527  N N    . ILE A 1 87  ? 5.676   15.396  1.696   1.00 0.00 ? 106 ILE A N    4  
ATOM 8528  C CA   . ILE A 1 87  ? 5.368   15.012  0.323   1.00 0.00 ? 106 ILE A CA   4  
ATOM 8529  C C    . ILE A 1 87  ? 6.623   14.596  -0.433  1.00 0.00 ? 106 ILE A C    4  
ATOM 8530  O O    . ILE A 1 87  ? 7.728   15.039  -0.121  1.00 0.00 ? 106 ILE A O    4  
ATOM 8531  C CB   . ILE A 1 87  ? 4.669   16.148  -0.454  1.00 0.00 ? 106 ILE A CB   4  
ATOM 8532  C CG1  . ILE A 1 87  ? 3.173   15.859  -0.581  1.00 0.00 ? 106 ILE A CG1  4  
ATOM 8533  C CG2  . ILE A 1 87  ? 5.288   16.303  -1.834  1.00 0.00 ? 106 ILE A CG2  4  
ATOM 8534  C CD1  . ILE A 1 87  ? 2.720   15.585  -2.001  1.00 0.00 ? 106 ILE A CD1  4  
ATOM 8535  H H    . ILE A 1 87  ? 5.693   16.347  1.937   1.00 0.00 ? 106 ILE A H    4  
ATOM 8536  H HA   . ILE A 1 87  ? 4.695   14.170  0.364   1.00 0.00 ? 106 ILE A HA   4  
ATOM 8537  H HB   . ILE A 1 87  ? 4.809   17.070  0.087   1.00 0.00 ? 106 ILE A HB   4  
ATOM 8538  H HG12 . ILE A 1 87  ? 2.936   14.992  0.010   2.00 0.00 ? 106 ILE A HG12 4  
ATOM 8539  H HG13 . ILE A 1 87  ? 2.614   16.705  -0.210  2.00 0.00 ? 106 ILE A HG13 4  
ATOM 8540  H HG21 . ILE A 1 87  ? 5.002   15.460  -2.447  1.00 0.00 ? 106 ILE A HG21 4  
ATOM 8541  H HG22 . ILE A 1 87  ? 6.364   16.338  -1.745  1.00 0.00 ? 106 ILE A HG22 4  
ATOM 8542  H HG23 . ILE A 1 87  ? 4.933   17.216  -2.287  1.00 0.00 ? 106 ILE A HG23 4  
ATOM 8543  H HD11 . ILE A 1 87  ? 2.779   16.495  -2.580  1.00 0.00 ? 106 ILE A HD11 4  
ATOM 8544  H HD12 . ILE A 1 87  ? 1.700   15.230  -1.992  1.00 0.00 ? 106 ILE A HD12 4  
ATOM 8545  H HD13 . ILE A 1 87  ? 3.359   14.834  -2.446  1.00 0.00 ? 106 ILE A HD13 4  
ATOM 8546  N N    . LEU A 1 88  ? 6.436   13.742  -1.432  1.00 0.00 ? 107 LEU A N    4  
ATOM 8547  C CA   . LEU A 1 88  ? 7.544   13.259  -2.246  1.00 0.00 ? 107 LEU A CA   4  
ATOM 8548  C C    . LEU A 1 88  ? 7.783   14.181  -3.439  1.00 0.00 ? 107 LEU A C    4  
ATOM 8549  O O    . LEU A 1 88  ? 6.848   14.548  -4.149  1.00 0.00 ? 107 LEU A O    4  
ATOM 8550  C CB   . LEU A 1 88  ? 7.257   11.837  -2.730  1.00 0.00 ? 107 LEU A CB   4  
ATOM 8551  C CG   . LEU A 1 88  ? 7.988   11.411  -4.004  1.00 0.00 ? 107 LEU A CG   4  
ATOM 8552  C CD1  . LEU A 1 88  ? 9.485   11.647  -3.873  2.00 0.00 ? 107 LEU A CD1  4  
ATOM 8553  C CD2  . LEU A 1 88  ? 7.707   9.949   -4.308  2.00 0.00 ? 107 LEU A CD2  4  
ATOM 8554  H H    . LEU A 1 88  ? 5.527   13.430  -1.628  1.00 0.00 ? 107 LEU A H    4  
ATOM 8555  H HA   . LEU A 1 88  ? 8.430   13.249  -1.630  1.00 0.00 ? 107 LEU A HA   4  
ATOM 8556  H HB2  . LEU A 1 88  ? 7.526   11.152  -1.941  2.00 0.00 ? 107 LEU A HB2  4  
ATOM 8557  H HB3  . LEU A 1 88  ? 6.195   11.748  -2.905  2.00 0.00 ? 107 LEU A HB3  4  
ATOM 8558  H HG   . LEU A 1 88  ? 7.626   12.002  -4.832  1.00 0.00 ? 107 LEU A HG   4  
ATOM 8559  H HD11 . LEU A 1 88  ? 9.816   12.303  -4.664  1.00 0.00 ? 107 LEU A HD11 4  
ATOM 8560  H HD12 . LEU A 1 88  ? 10.007  10.704  -3.945  1.00 0.00 ? 107 LEU A HD12 4  
ATOM 8561  H HD13 . LEU A 1 88  ? 9.696   12.102  -2.916  1.00 0.00 ? 107 LEU A HD13 4  
ATOM 8562  H HD21 . LEU A 1 88  ? 8.431   9.330   -3.799  1.00 0.00 ? 107 LEU A HD21 4  
ATOM 8563  H HD22 . LEU A 1 88  ? 7.776   9.783   -5.372  1.00 0.00 ? 107 LEU A HD22 4  
ATOM 8564  H HD23 . LEU A 1 88  ? 6.713   9.695   -3.967  1.00 0.00 ? 107 LEU A HD23 4  
ATOM 8565  N N    . THR A 1 89  ? 9.043   14.549  -3.652  1.00 0.00 ? 108 THR A N    4  
ATOM 8566  C CA   . THR A 1 89  ? 9.406   15.427  -4.759  1.00 0.00 ? 108 THR A CA   4  
ATOM 8567  C C    . THR A 1 89  ? 10.267  14.694  -5.782  1.00 0.00 ? 108 THR A C    4  
ATOM 8568  O O    . THR A 1 89  ? 11.488  14.624  -5.644  1.00 0.00 ? 108 THR A O    4  
ATOM 8569  C CB   . THR A 1 89  ? 10.167  16.670  -4.263  1.00 0.00 ? 108 THR A CB   4  
ATOM 8570  O OG1  . THR A 1 89  ? 11.085  16.302  -3.226  1.00 0.00 ? 108 THR A OG1  4  
ATOM 8571  C CG2  . THR A 1 89  ? 9.203   17.725  -3.741  1.00 0.00 ? 108 THR A CG2  4  
ATOM 8572  H H    . THR A 1 89  ? 9.744   14.222  -3.051  1.00 0.00 ? 108 THR A H    4  
ATOM 8573  H HA   . THR A 1 89  ? 8.495   15.756  -5.237  1.00 0.00 ? 108 THR A HA   4  
ATOM 8574  H HB   . THR A 1 89  ? 10.721  17.089  -5.090  1.00 0.00 ? 108 THR A HB   4  
ATOM 8575  H HG1  . THR A 1 89  ? 10.674  15.654  -2.649  1.00 0.00 ? 108 THR A HG1  4  
ATOM 8576  H HG21 . THR A 1 89  ? 8.195   17.337  -3.772  1.00 0.00 ? 108 THR A HG21 4  
ATOM 8577  H HG22 . THR A 1 89  ? 9.267   18.608  -4.358  1.00 0.00 ? 108 THR A HG22 4  
ATOM 8578  H HG23 . THR A 1 89  ? 9.460   17.977  -2.723  1.00 0.00 ? 108 THR A HG23 4  
ATOM 8579  N N    . SER A 1 90  ? 9.623   14.150  -6.811  1.00 0.00 ? 109 SER A N    4  
ATOM 8580  C CA   . SER A 1 90  ? 10.331  13.422  -7.858  1.00 0.00 ? 109 SER A CA   4  
ATOM 8581  C C    . SER A 1 90  ? 9.444   13.231  -9.084  1.00 0.00 ? 109 SER A C    4  
ATOM 8582  O O    . SER A 1 90  ? 8.389   13.853  -9.204  1.00 0.00 ? 109 SER A O    4  
ATOM 8583  C CB   . SER A 1 90  ? 10.801  12.063  -7.338  1.00 0.00 ? 109 SER A CB   4  
ATOM 8584  O OG   . SER A 1 90  ? 12.089  12.157  -6.756  1.00 0.00 ? 109 SER A OG   4  
ATOM 8585  H H    . SER A 1 90  ? 8.649   14.240  -6.866  1.00 0.00 ? 109 SER A H    4  
ATOM 8586  H HA   . SER A 1 90  ? 11.194  14.007  -8.142  1.00 0.00 ? 109 SER A HA   4  
ATOM 8587  H HB2  . SER A 1 90  ? 10.107  11.707  -6.588  2.00 0.00 ? 109 SER A HB2  4  
ATOM 8588  H HB3  . SER A 1 90  ? 10.841  11.360  -8.158  2.00 0.00 ? 109 SER A HB3  4  
ATOM 8589  H HG   . SER A 1 90  ? 12.400  11.280  -6.520  1.00 0.00 ? 109 SER A HG   4  
ATOM 8590  N N    . ASN A 1 91  ? 9.880   12.363  -9.994  1.00 0.00 ? 110 ASN A N    4  
ATOM 8591  C CA   . ASN A 1 91  ? 9.126   12.087  -11.212 1.00 0.00 ? 110 ASN A CA   4  
ATOM 8592  C C    . ASN A 1 91  ? 7.772   11.467  -10.884 1.00 0.00 ? 110 ASN A C    4  
ATOM 8593  O O    . ASN A 1 91  ? 7.678   10.551  -10.068 1.00 0.00 ? 110 ASN A O    4  
ATOM 8594  C CB   . ASN A 1 91  ? 9.920   11.153  -12.128 1.00 0.00 ? 110 ASN A CB   4  
ATOM 8595  C CG   . ASN A 1 91  ? 10.663  11.878  -13.233 1.00 0.00 ? 110 ASN A CG   4  
ATOM 8596  O OD1  . ASN A 1 91  ? 11.821  12.262  -13.070 1.00 0.00 ? 110 ASN A OD1  4  
ATOM 8597  N ND2  . ASN A 1 91  ? 9.997   12.067  -14.367 4.00 0.00 ? 110 ASN A ND2  4  
ATOM 8598  H H    . ASN A 1 91  ? 10.728  11.898  -9.842  1.00 0.00 ? 110 ASN A H    4  
ATOM 8599  H HA   . ASN A 1 91  ? 8.966   13.025  -11.721 1.00 0.00 ? 110 ASN A HA   4  
ATOM 8600  H HB2  . ASN A 1 91  ? 10.641  10.610  -11.534 2.00 0.00 ? 110 ASN A HB2  4  
ATOM 8601  H HB3  . ASN A 1 91  ? 9.240   10.448  -12.583 2.00 0.00 ? 110 ASN A HB3  4  
ATOM 8602  H HD21 . ASN A 1 91  ? 9.076   11.733  -14.426 5.00 0.00 ? 110 ASN A HD21 4  
ATOM 8603  H HD22 . ASN A 1 91  ? 10.456  12.535  -15.101 5.00 0.00 ? 110 ASN A HD22 4  
ATOM 8604  N N    . THR A 1 92  ? 6.724   11.972  -11.527 1.00 0.00 ? 111 THR A N    4  
ATOM 8605  C CA   . THR A 1 92  ? 5.374   11.468  -11.305 1.00 0.00 ? 111 THR A CA   4  
ATOM 8606  C C    . THR A 1 92  ? 5.207   10.069  -11.887 1.00 0.00 ? 111 THR A C    4  
ATOM 8607  O O    . THR A 1 92  ? 5.566   9.816   -13.037 1.00 0.00 ? 111 THR A O    4  
ATOM 8608  C CB   . THR A 1 92  ? 4.316   12.399  -11.926 1.00 0.00 ? 111 THR A CB   4  
ATOM 8609  O OG1  . THR A 1 92  ? 4.498   13.737  -11.447 1.00 0.00 ? 111 THR A OG1  4  
ATOM 8610  C CG2  . THR A 1 92  ? 2.911   11.922  -11.590 1.00 0.00 ? 111 THR A CG2  4  
ATOM 8611  H H    . THR A 1 92  ? 6.862   12.703  -12.167 1.00 0.00 ? 111 THR A H    4  
ATOM 8612  H HA   . THR A 1 92  ? 5.206   11.427  -10.239 1.00 0.00 ? 111 THR A HA   4  
ATOM 8613  H HB   . THR A 1 92  ? 4.436   12.390  -13.000 1.00 0.00 ? 111 THR A HB   4  
ATOM 8614  H HG1  . THR A 1 92  ? 4.130   14.357  -12.082 1.00 0.00 ? 111 THR A HG1  4  
ATOM 8615  H HG21 . THR A 1 92  ? 2.299   11.948  -12.480 1.00 0.00 ? 111 THR A HG21 4  
ATOM 8616  H HG22 . THR A 1 92  ? 2.482   12.567  -10.838 1.00 0.00 ? 111 THR A HG22 4  
ATOM 8617  H HG23 . THR A 1 92  ? 2.954   10.911  -11.213 1.00 0.00 ? 111 THR A HG23 4  
ATOM 8618  N N    . SER A 1 93  ? 4.658   9.163   -11.084 1.00 0.00 ? 112 SER A N    4  
ATOM 8619  C CA   . SER A 1 93  ? 4.440   7.788   -11.518 1.00 0.00 ? 112 SER A CA   4  
ATOM 8620  C C    . SER A 1 93  ? 3.327   7.132   -10.705 1.00 0.00 ? 112 SER A C    4  
ATOM 8621  O O    . SER A 1 93  ? 2.144   7.361   -10.957 1.00 0.00 ? 112 SER A O    4  
ATOM 8622  C CB   . SER A 1 93  ? 5.732   6.979   -11.387 1.00 0.00 ? 112 SER A CB   4  
ATOM 8623  O OG   . SER A 1 93  ? 6.651   7.315   -12.413 1.00 0.00 ? 112 SER A OG   4  
ATOM 8624  H H    . SER A 1 93  ? 4.392   9.426   -10.179 1.00 0.00 ? 112 SER A H    4  
ATOM 8625  H HA   . SER A 1 93  ? 4.144   7.812   -12.556 1.00 0.00 ? 112 SER A HA   4  
ATOM 8626  H HB2  . SER A 1 93  ? 6.189   7.185   -10.431 2.00 0.00 ? 112 SER A HB2  4  
ATOM 8627  H HB3  . SER A 1 93  ? 5.504   5.925   -11.458 2.00 0.00 ? 112 SER A HB3  4  
ATOM 8628  H HG   . SER A 1 93  ? 6.904   8.237   -12.326 1.00 0.00 ? 112 SER A HG   4  
ATOM 8629  N N    . GLN A 1 94  ? 3.713   6.316   -9.729  1.00 0.00 ? 113 GLN A N    4  
ATOM 8630  C CA   . GLN A 1 94  ? 2.750   5.628   -8.881  1.00 0.00 ? 113 GLN A CA   4  
ATOM 8631  C C    . GLN A 1 94  ? 2.992   5.975   -7.410  1.00 0.00 ? 113 GLN A C    4  
ATOM 8632  O O    . GLN A 1 94  ? 2.519   7.004   -6.931  1.00 0.00 ? 113 GLN A O    4  
ATOM 8633  C CB   . GLN A 1 94  ? 2.850   4.120   -9.104  1.00 0.00 ? 113 GLN A CB   4  
ATOM 8634  C CG   . GLN A 1 94  ? 1.854   3.579   -10.116 1.00 0.00 ? 113 GLN A CG   4  
ATOM 8635  C CD   . GLN A 1 94  ? 2.426   3.493   -11.517 1.00 0.00 ? 113 GLN A CD   4  
ATOM 8636  O OE1  . GLN A 1 94  ? 3.507   2.942   -11.726 1.00 0.00 ? 113 GLN A OE1  4  
ATOM 8637  N NE2  . GLN A 1 94  ? 1.700   4.037   -12.488 4.00 0.00 ? 113 GLN A NE2  4  
ATOM 8638  H H    . GLN A 1 94  ? 4.670   6.171   -9.575  1.00 0.00 ? 113 GLN A H    4  
ATOM 8639  H HA   . GLN A 1 94  ? 1.762   5.963   -9.161  1.00 0.00 ? 113 GLN A HA   4  
ATOM 8640  H HB2  . GLN A 1 94  ? 3.843   3.887   -9.455  2.00 0.00 ? 113 GLN A HB2  4  
ATOM 8641  H HB3  . GLN A 1 94  ? 2.685   3.618   -8.164  2.00 0.00 ? 113 GLN A HB3  4  
ATOM 8642  H HG2  . GLN A 1 94  ? 1.547   2.590   -9.807  2.00 0.00 ? 113 GLN A HG2  4  
ATOM 8643  H HG3  . GLN A 1 94  ? 0.992   4.230   -10.136 2.00 0.00 ? 113 GLN A HG3  4  
ATOM 8644  H HE21 . GLN A 1 94  ? 0.846   4.460   -12.246 5.00 0.00 ? 113 GLN A HE21 4  
ATOM 8645  H HE22 . GLN A 1 94  ? 2.048   3.995   -13.406 5.00 0.00 ? 113 GLN A HE22 4  
ATOM 8646  N N    . TYR A 1 95  ? 3.731   5.107   -6.710  1.00 0.00 ? 114 TYR A N    4  
ATOM 8647  C CA   . TYR A 1 95  ? 4.059   5.301   -5.291  1.00 0.00 ? 114 TYR A CA   4  
ATOM 8648  C C    . TYR A 1 95  ? 3.294   4.313   -4.415  1.00 0.00 ? 114 TYR A C    4  
ATOM 8649  O O    . TYR A 1 95  ? 2.774   3.314   -4.906  1.00 0.00 ? 114 TYR A O    4  
ATOM 8650  C CB   . TYR A 1 95  ? 3.772   6.739   -4.834  1.00 0.00 ? 114 TYR A CB   4  
ATOM 8651  C CG   . TYR A 1 95  ? 4.540   7.813   -5.580  1.00 0.00 ? 114 TYR A CG   4  
ATOM 8652  C CD1  . TYR A 1 95  ? 5.764   7.540   -6.179  1.00 0.00 ? 114 TYR A CD1  4  
ATOM 8653  C CD2  . TYR A 1 95  ? 4.034   9.104   -5.685  1.00 0.00 ? 114 TYR A CD2  4  
ATOM 8654  C CE1  . TYR A 1 95  ? 6.459   8.522   -6.860  1.00 0.00 ? 114 TYR A CE1  4  
ATOM 8655  C CE2  . TYR A 1 95  ? 4.722   10.090  -6.363  1.00 0.00 ? 114 TYR A CE2  4  
ATOM 8656  C CZ   . TYR A 1 95  ? 5.934   9.794   -6.950  1.00 0.00 ? 114 TYR A CZ   4  
ATOM 8657  O OH   . TYR A 1 95  ? 6.624   10.773  -7.628  1.00 0.00 ? 114 TYR A OH   4  
ATOM 8658  H H    . TYR A 1 95  ? 4.065   4.304   -7.161  1.00 0.00 ? 114 TYR A H    4  
ATOM 8659  H HA   . TYR A 1 95  ? 5.116   5.107   -5.177  1.00 0.00 ? 114 TYR A HA   4  
ATOM 8660  H HB2  . TYR A 1 95  ? 2.719   6.942   -4.960  2.00 0.00 ? 114 TYR A HB2  4  
ATOM 8661  H HB3  . TYR A 1 95  ? 4.021   6.829   -3.788  2.00 0.00 ? 114 TYR A HB3  4  
ATOM 8662  H HD1  . TYR A 1 95  ? 6.174   6.544   -6.105  1.00 0.00 ? 114 TYR A HD1  4  
ATOM 8663  H HD2  . TYR A 1 95  ? 3.084   9.333   -5.223  1.00 0.00 ? 114 TYR A HD2  4  
ATOM 8664  H HE1  . TYR A 1 95  ? 7.408   8.289   -7.320  1.00 0.00 ? 114 TYR A HE1  4  
ATOM 8665  H HE2  . TYR A 1 95  ? 4.311   11.088  -6.429  1.00 0.00 ? 114 TYR A HE2  4  
ATOM 8666  H HH   . TYR A 1 95  ? 6.993   11.398  -7.000  1.00 0.00 ? 114 TYR A HH   4  
ATOM 8667  N N    . ASP A 1 96  ? 3.231   4.595   -3.116  1.00 0.00 ? 115 ASP A N    4  
ATOM 8668  C CA   . ASP A 1 96  ? 2.528   3.726   -2.179  1.00 0.00 ? 115 ASP A CA   4  
ATOM 8669  C C    . ASP A 1 96  ? 1.149   4.291   -1.861  1.00 0.00 ? 115 ASP A C    4  
ATOM 8670  O O    . ASP A 1 96  ? 0.711   5.258   -2.484  1.00 0.00 ? 115 ASP A O    4  
ATOM 8671  C CB   . ASP A 1 96  ? 3.335   3.561   -0.890  1.00 0.00 ? 115 ASP A CB   4  
ATOM 8672  C CG   . ASP A 1 96  ? 4.829   3.473   -1.142  1.00 0.00 ? 115 ASP A CG   4  
ATOM 8673  O OD1  . ASP A 1 96  ? 5.225   3.310   -2.315  1.00 0.00 ? 115 ASP A OD1  4  
ATOM 8674  O OD2  . ASP A 1 96  ? 5.602   3.569   -0.166  1.00 0.00 ? 115 ASP A OD2  4  
ATOM 8675  H H    . ASP A 1 96  ? 3.667   5.405   -2.778  1.00 0.00 ? 115 ASP A H    4  
ATOM 8676  H HA   . ASP A 1 96  ? 2.408   2.760   -2.647  1.00 0.00 ? 115 ASP A HA   4  
ATOM 8677  H HB2  . ASP A 1 96  ? 3.148   4.407   -0.246  2.00 0.00 ? 115 ASP A HB2  4  
ATOM 8678  H HB3  . ASP A 1 96  ? 3.021   2.658   -0.390  2.00 0.00 ? 115 ASP A HB3  4  
ATOM 8679  N N    . THR A 1 97  ? 0.465   3.688   -0.892  1.00 0.00 ? 116 THR A N    4  
ATOM 8680  C CA   . THR A 1 97  ? -0.865  4.148   -0.508  1.00 0.00 ? 116 THR A CA   4  
ATOM 8681  C C    . THR A 1 97  ? -1.254  3.669   0.886   1.00 0.00 ? 116 THR A C    4  
ATOM 8682  O O    . THR A 1 97  ? -0.829  2.603   1.334   1.00 0.00 ? 116 THR A O    4  
ATOM 8683  C CB   . THR A 1 97  ? -1.930  3.675   -1.511  1.00 0.00 ? 116 THR A CB   4  
ATOM 8684  O OG1  . THR A 1 97  ? -3.150  4.401   -1.312  1.00 0.00 ? 116 THR A OG1  4  
ATOM 8685  C CG2  . THR A 1 97  ? -2.190  2.185   -1.358  1.00 0.00 ? 116 THR A CG2  4  
ATOM 8686  H H    . THR A 1 97  ? 0.861   2.921   -0.428  1.00 0.00 ? 116 THR A H    4  
ATOM 8687  H HA   . THR A 1 97  ? -0.855  5.228   -0.512  1.00 0.00 ? 116 THR A HA   4  
ATOM 8688  H HB   . THR A 1 97  ? -1.568  3.861   -2.513  1.00 0.00 ? 116 THR A HB   4  
ATOM 8689  H HG1  . THR A 1 97  ? -3.897  3.808   -1.422  1.00 0.00 ? 116 THR A HG1  4  
ATOM 8690  H HG21 . THR A 1 97  ? -3.161  2.034   -0.911  1.00 0.00 ? 116 THR A HG21 4  
ATOM 8691  H HG22 . THR A 1 97  ? -1.430  1.750   -0.726  1.00 0.00 ? 116 THR A HG22 4  
ATOM 8692  H HG23 . THR A 1 97  ? -2.164  1.713   -2.329  1.00 0.00 ? 116 THR A HG23 4  
ATOM 8693  N N    . TYR A 1 98  ? -2.077  4.465   1.561   1.00 0.00 ? 117 TYR A N    4  
ATOM 8694  C CA   . TYR A 1 98  ? -2.545  4.133   2.903   1.00 0.00 ? 117 TYR A CA   4  
ATOM 8695  C C    . TYR A 1 98  ? -4.050  3.895   2.898   1.00 0.00 ? 117 TYR A C    4  
ATOM 8696  O O    . TYR A 1 98  ? -4.768  4.441   2.060   1.00 0.00 ? 117 TYR A O    4  
ATOM 8697  C CB   . TYR A 1 98  ? -2.219  5.264   3.874   1.00 0.00 ? 117 TYR A CB   4  
ATOM 8698  C CG   . TYR A 1 98  ? -0.780  5.333   4.318   1.00 0.00 ? 117 TYR A CG   4  
ATOM 8699  C CD1  . TYR A 1 98  ? -0.310  4.530   5.348   1.00 0.00 ? 117 TYR A CD1  4  
ATOM 8700  C CD2  . TYR A 1 98  ? 0.104   6.220   3.722   1.00 0.00 ? 117 TYR A CD2  4  
ATOM 8701  C CE1  . TYR A 1 98  ? 0.999   4.610   5.772   1.00 0.00 ? 117 TYR A CE1  4  
ATOM 8702  C CE2  . TYR A 1 98  ? 1.419   6.302   4.135   1.00 0.00 ? 117 TYR A CE2  4  
ATOM 8703  C CZ   . TYR A 1 98  ? 1.862   5.497   5.163   1.00 0.00 ? 117 TYR A CZ   4  
ATOM 8704  O OH   . TYR A 1 98  ? 3.169   5.580   5.583   1.00 0.00 ? 117 TYR A OH   4  
ATOM 8705  H H    . TYR A 1 98  ? -2.384  5.297   1.143   1.00 0.00 ? 117 TYR A H    4  
ATOM 8706  H HA   . TYR A 1 98  ? -2.045  3.232   3.223   1.00 0.00 ? 117 TYR A HA   4  
ATOM 8707  H HB2  . TYR A 1 98  ? -2.461  6.207   3.405   2.00 0.00 ? 117 TYR A HB2  4  
ATOM 8708  H HB3  . TYR A 1 98  ? -2.828  5.150   4.758   2.00 0.00 ? 117 TYR A HB3  4  
ATOM 8709  H HD1  . TYR A 1 98  ? -0.982  3.828   5.817   1.00 0.00 ? 117 TYR A HD1  4  
ATOM 8710  H HD2  . TYR A 1 98  ? -0.245  6.848   2.918   1.00 0.00 ? 117 TYR A HD2  4  
ATOM 8711  H HE1  . TYR A 1 98  ? 1.340   3.979   6.580   1.00 0.00 ? 117 TYR A HE1  4  
ATOM 8712  H HE2  . TYR A 1 98  ? 2.091   6.996   3.656   1.00 0.00 ? 117 TYR A HE2  4  
ATOM 8713  H HH   . TYR A 1 98  ? 3.740   5.732   4.826   1.00 0.00 ? 117 TYR A HH   4  
ATOM 8714  N N    . CYS A 1 99  ? -4.528  3.086   3.838   1.00 0.00 ? 118 CYS A N    4  
ATOM 8715  C CA   . CYS A 1 99  ? -5.955  2.796   3.925   1.00 0.00 ? 118 CYS A CA   4  
ATOM 8716  C C    . CYS A 1 99  ? -6.332  2.285   5.307   1.00 0.00 ? 118 CYS A C    4  
ATOM 8717  O O    . CYS A 1 99  ? -5.699  1.374   5.839   1.00 0.00 ? 118 CYS A O    4  
ATOM 8718  C CB   . CYS A 1 99  ? -6.346  1.766   2.869   1.00 0.00 ? 118 CYS A CB   4  
ATOM 8719  S SG   . CYS A 1 99  ? -4.973  1.171   1.836   1.00 0.00 ? 118 CYS A SG   4  
ATOM 8720  H H    . CYS A 1 99  ? -3.913  2.675   4.483   1.00 0.00 ? 118 CYS A H    4  
ATOM 8721  H HA   . CYS A 1 99  ? -6.490  3.713   3.734   1.00 0.00 ? 118 CYS A HA   4  
ATOM 8722  H HB2  . CYS A 1 99  ? -6.779  0.908   3.360   2.00 0.00 ? 118 CYS A HB2  4  
ATOM 8723  H HB3  . CYS A 1 99  ? -7.084  2.202   2.211   2.00 0.00 ? 118 CYS A HB3  4  
ATOM 8724  N N    . PHE A 1 100 ? -7.380  2.868   5.877   1.00 0.00 ? 119 PHE A N    4  
ATOM 8725  C CA   . PHE A 1 100 ? -7.855  2.460   7.190   1.00 0.00 ? 119 PHE A CA   4  
ATOM 8726  C C    . PHE A 1 100 ? -8.830  1.301   7.054   1.00 0.00 ? 119 PHE A C    4  
ATOM 8727  O O    . PHE A 1 100 ? -9.959  1.476   6.593   1.00 0.00 ? 119 PHE A O    4  
ATOM 8728  C CB   . PHE A 1 100 ? -8.529  3.628   7.908   1.00 0.00 ? 119 PHE A CB   4  
ATOM 8729  C CG   . PHE A 1 100 ? -9.043  3.326   9.287   1.00 0.00 ? 119 PHE A CG   4  
ATOM 8730  C CD1  . PHE A 1 100 ? -10.309 2.792   9.467   1.00 0.00 ? 119 PHE A CD1  4  
ATOM 8731  C CD2  . PHE A 1 100 ? -8.260  3.575   10.402  1.00 0.00 ? 119 PHE A CD2  4  
ATOM 8732  C CE1  . PHE A 1 100 ? -10.783 2.513   10.731  1.00 0.00 ? 119 PHE A CE1  4  
ATOM 8733  C CE2  . PHE A 1 100 ? -8.730  3.297   11.670  1.00 0.00 ? 119 PHE A CE2  4  
ATOM 8734  C CZ   . PHE A 1 100 ? -9.993  2.765   11.834  1.00 0.00 ? 119 PHE A CZ   4  
ATOM 8735  H H    . PHE A 1 100 ? -7.852  3.580   5.397   1.00 0.00 ? 119 PHE A H    4  
ATOM 8736  H HA   . PHE A 1 100 ? -6.999  2.135   7.765   1.00 0.00 ? 119 PHE A HA   4  
ATOM 8737  H HB2  . PHE A 1 100 ? -7.820  4.441   7.993   2.00 0.00 ? 119 PHE A HB2  4  
ATOM 8738  H HB3  . PHE A 1 100 ? -9.368  3.964   7.313   2.00 0.00 ? 119 PHE A HB3  4  
ATOM 8739  H HD1  . PHE A 1 100 ? -10.928 2.592   8.606   1.00 0.00 ? 119 PHE A HD1  4  
ATOM 8740  H HD2  . PHE A 1 100 ? -7.274  3.990   10.276  1.00 0.00 ? 119 PHE A HD2  4  
ATOM 8741  H HE1  . PHE A 1 100 ? -11.772 2.097   10.859  1.00 0.00 ? 119 PHE A HE1  4  
ATOM 8742  H HE2  . PHE A 1 100 ? -8.109  3.494   12.532  1.00 0.00 ? 119 PHE A HE2  4  
ATOM 8743  H HZ   . PHE A 1 100 ? -10.362 2.547   12.822  1.00 0.00 ? 119 PHE A HZ   4  
ATOM 8744  N N    . ASN A 1 101 ? -8.384  0.116   7.441   1.00 0.00 ? 120 ASN A N    4  
ATOM 8745  C CA   . ASN A 1 101 ? -9.211  -1.077  7.347   1.00 0.00 ? 120 ASN A CA   4  
ATOM 8746  C C    . ASN A 1 101 ? -9.766  -1.480  8.707   1.00 0.00 ? 120 ASN A C    4  
ATOM 8747  O O    . ASN A 1 101 ? -9.013  -1.729  9.648   1.00 0.00 ? 120 ASN A O    4  
ATOM 8748  C CB   . ASN A 1 101 ? -8.396  -2.222  6.749   1.00 0.00 ? 120 ASN A CB   4  
ATOM 8749  C CG   . ASN A 1 101 ? -7.511  -2.907  7.771   1.00 0.00 ? 120 ASN A CG   4  
ATOM 8750  O OD1  . ASN A 1 101 ? -6.439  -2.409  8.113   1.00 0.00 ? 120 ASN A OD1  4  
ATOM 8751  N ND2  . ASN A 1 101 ? -7.954  -4.058  8.261   4.00 0.00 ? 120 ASN A ND2  4  
ATOM 8752  H H    . ASN A 1 101 ? -7.470  0.040   7.787   1.00 0.00 ? 120 ASN A H    4  
ATOM 8753  H HA   . ASN A 1 101 ? -10.037 -0.855  6.686   1.00 0.00 ? 120 ASN A HA   4  
ATOM 8754  H HB2  . ASN A 1 101 ? -9.066  -2.956  6.329   2.00 0.00 ? 120 ASN A HB2  4  
ATOM 8755  H HB3  . ASN A 1 101 ? -7.766  -1.830  5.965   2.00 0.00 ? 120 ASN A HB3  4  
ATOM 8756  H HD21 . ASN A 1 101 ? -8.820  -4.397  7.940   5.00 0.00 ? 120 ASN A HD21 4  
ATOM 8757  H HD22 . ASN A 1 101 ? -7.401  -4.523  8.926   5.00 0.00 ? 120 ASN A HD22 4  
ATOM 8758  N N    . ALA A 1 102 ? -11.091 -1.546  8.802   1.00 0.00 ? 121 ALA A N    4  
ATOM 8759  C CA   . ALA A 1 102 ? -11.748 -1.927  10.045  1.00 0.00 ? 121 ALA A CA   4  
ATOM 8760  C C    . ALA A 1 102 ? -11.328 -3.329  10.468  1.00 0.00 ? 121 ALA A C    4  
ATOM 8761  O O    . ALA A 1 102 ? -11.346 -3.664  11.653  1.00 0.00 ? 121 ALA A O    4  
ATOM 8762  C CB   . ALA A 1 102 ? -13.260 -1.848  9.890   1.00 0.00 ? 121 ALA A CB   4  
ATOM 8763  H H    . ALA A 1 102 ? -11.638 -1.338  8.015   1.00 0.00 ? 121 ALA A H    4  
ATOM 8764  H HA   . ALA A 1 102 ? -11.449 -1.224  10.809  1.00 0.00 ? 121 ALA A HA   4  
ATOM 8765  H HB1  . ALA A 1 102 ? -13.519 -1.925  8.844   1.00 0.00 ? 121 ALA A HB1  4  
ATOM 8766  H HB2  . ALA A 1 102 ? -13.612 -0.904  10.278  1.00 0.00 ? 121 ALA A HB2  4  
ATOM 8767  H HB3  . ALA A 1 102 ? -13.720 -2.657  10.436  1.00 0.00 ? 121 ALA A HB3  4  
ATOM 8768  N N    . SER A 1 103 ? -10.941 -4.144  9.489   1.00 0.00 ? 122 SER A N    4  
ATOM 8769  C CA   . SER A 1 103 ? -10.508 -5.510  9.758   1.00 0.00 ? 122 SER A CA   4  
ATOM 8770  C C    . SER A 1 103 ? -9.262  -5.509  10.637  1.00 0.00 ? 122 SER A C    4  
ATOM 8771  O O    . SER A 1 103 ? -8.888  -6.535  11.207  1.00 0.00 ? 122 SER A O    4  
ATOM 8772  C CB   . SER A 1 103 ? -10.224 -6.249  8.447   1.00 0.00 ? 122 SER A CB   4  
ATOM 8773  O OG   . SER A 1 103 ? -11.342 -7.022  8.045   1.00 0.00 ? 122 SER A OG   4  
ATOM 8774  H H    . SER A 1 103 ? -10.945 -3.816  8.565   1.00 0.00 ? 122 SER A H    4  
ATOM 8775  H HA   . SER A 1 103 ? -11.305 -6.014  10.283  1.00 0.00 ? 122 SER A HA   4  
ATOM 8776  H HB2  . SER A 1 103 ? -10.001 -5.532  7.668   2.00 0.00 ? 122 SER A HB2  4  
ATOM 8777  H HB3  . SER A 1 103 ? -9.379  -6.907  8.581   2.00 0.00 ? 122 SER A HB3  4  
ATOM 8778  H HG   . SER A 1 103 ? -12.103 -6.789  8.583   1.00 0.00 ? 122 SER A HG   4  
ATOM 8779  N N    . ALA A 1 104 ? -8.622  -4.349  10.739  1.00 0.00 ? 123 ALA A N    4  
ATOM 8780  C CA   . ALA A 1 104 ? -7.418  -4.201  11.544  1.00 0.00 ? 123 ALA A CA   4  
ATOM 8781  C C    . ALA A 1 104 ? -7.754  -3.808  12.977  1.00 0.00 ? 123 ALA A C    4  
ATOM 8782  O O    . ALA A 1 104 ? -8.700  -3.057  13.220  1.00 0.00 ? 123 ALA A O    4  
ATOM 8783  C CB   . ALA A 1 104 ? -6.493  -3.170  10.919  1.00 0.00 ? 123 ALA A CB   4  
ATOM 8784  H H    . ALA A 1 104 ? -8.972  -3.570  10.258  1.00 0.00 ? 123 ALA A H    4  
ATOM 8785  H HA   . ALA A 1 104 ? -6.904  -5.152  11.552  1.00 0.00 ? 123 ALA A HA   4  
ATOM 8786  H HB1  . ALA A 1 104 ? -5.619  -3.046  11.540  1.00 0.00 ? 123 ALA A HB1  4  
ATOM 8787  H HB2  . ALA A 1 104 ? -7.012  -2.225  10.836  1.00 0.00 ? 123 ALA A HB2  4  
ATOM 8788  H HB3  . ALA A 1 104 ? -6.194  -3.502  9.936   1.00 0.00 ? 123 ALA A HB3  4  
ATOM 8789  N N    . PRO A 1 105 ? -6.978  -4.311  13.948  1.00 0.00 ? 124 PRO A N    4  
ATOM 8790  C CA   . PRO A 1 105 ? -7.188  -4.013  15.368  1.00 0.00 ? 124 PRO A CA   4  
ATOM 8791  C C    . PRO A 1 105 ? -7.008  -2.530  15.682  1.00 0.00 ? 124 PRO A C    4  
ATOM 8792  O O    . PRO A 1 105 ? -6.199  -1.843  15.053  1.00 0.00 ? 124 PRO A O    4  
ATOM 8793  C CB   . PRO A 1 105 ? -6.111  -4.842  16.082  1.00 0.00 ? 124 PRO A CB   4  
ATOM 8794  C CG   . PRO A 1 105 ? -5.680  -5.862  15.083  1.00 0.00 ? 124 PRO A CG   4  
ATOM 8795  C CD   . PRO A 1 105 ? -5.835  -5.211  13.740  1.00 0.00 ? 124 PRO A CD   4  
ATOM 8796  H HA   . PRO A 1 105 ? -8.167  -4.331  15.697  1.00 0.00 ? 124 PRO A HA   4  
ATOM 8797  H HB2  . PRO A 1 105 ? -5.292  -4.201  16.368  2.00 0.00 ? 124 PRO A HB2  4  
ATOM 8798  H HB3  . PRO A 1 105 ? -6.535  -5.307  16.960  2.00 0.00 ? 124 PRO A HB3  4  
ATOM 8799  H HG2  . PRO A 1 105 ? -4.647  -6.130  15.253  2.00 0.00 ? 124 PRO A HG2  4  
ATOM 8800  H HG3  . PRO A 1 105 ? -6.312  -6.736  15.151  2.00 0.00 ? 124 PRO A HG3  4  
ATOM 8801  H HD2  . PRO A 1 105 ? -4.946  -4.655  13.483  2.00 0.00 ? 124 PRO A HD2  4  
ATOM 8802  H HD3  . PRO A 1 105 ? -6.056  -5.949  12.984  2.00 0.00 ? 124 PRO A HD3  4  
ATOM 8803  N N    . PRO A 1 106 ? -7.768  -2.019  16.664  1.00 0.00 ? 125 PRO A N    4  
ATOM 8804  C CA   . PRO A 1 106 ? -7.700  -0.615  17.068  1.00 0.00 ? 125 PRO A CA   4  
ATOM 8805  C C    . PRO A 1 106 ? -6.518  -0.333  17.991  1.00 0.00 ? 125 PRO A C    4  
ATOM 8806  O O    . PRO A 1 106 ? -6.698  0.013   19.158  1.00 0.00 ? 125 PRO A O    4  
ATOM 8807  C CB   . PRO A 1 106 ? -9.013  -0.423  17.812  1.00 0.00 ? 125 PRO A CB   4  
ATOM 8808  C CG   . PRO A 1 106 ? -9.304  -1.751  18.418  1.00 0.00 ? 125 PRO A CG   4  
ATOM 8809  C CD   . PRO A 1 106 ? -8.761  -2.780  17.453  1.00 0.00 ? 125 PRO A CD   4  
ATOM 8810  H HA   . PRO A 1 106 ? -7.661  0.046   16.215  1.00 0.00 ? 125 PRO A HA   4  
ATOM 8811  H HB2  . PRO A 1 106 ? -8.895  0.339   18.568  2.00 0.00 ? 125 PRO A HB2  4  
ATOM 8812  H HB3  . PRO A 1 106 ? -9.785  -0.128  17.116  2.00 0.00 ? 125 PRO A HB3  4  
ATOM 8813  H HG2  . PRO A 1 106 ? -8.807  -1.834  19.373  2.00 0.00 ? 125 PRO A HG2  4  
ATOM 8814  H HG3  . PRO A 1 106 ? -10.370 -1.874  18.536  2.00 0.00 ? 125 PRO A HG3  4  
ATOM 8815  H HD2  . PRO A 1 106 ? -8.286  -3.587  17.992  2.00 0.00 ? 125 PRO A HD2  4  
ATOM 8816  H HD3  . PRO A 1 106 ? -9.550  -3.156  16.819  2.00 0.00 ? 125 PRO A HD3  4  
ATOM 8817  N N    . GLU A 1 107 ? -5.308  -0.485  17.460  1.00 0.00 ? 126 GLU A N    4  
ATOM 8818  C CA   . GLU A 1 107 ? -4.096  -0.247  18.242  1.00 0.00 ? 126 GLU A CA   4  
ATOM 8819  C C    . GLU A 1 107 ? -2.840  -0.453  17.398  1.00 0.00 ? 126 GLU A C    4  
ATOM 8820  O O    . GLU A 1 107 ? -2.277  0.499   16.856  1.00 0.00 ? 126 GLU A O    4  
ATOM 8821  C CB   . GLU A 1 107 ? -4.061  -1.170  19.462  1.00 0.00 ? 126 GLU A CB   4  
ATOM 8822  C CG   . GLU A 1 107 ? -4.049  -0.435  20.792  1.00 0.00 ? 126 GLU A CG   4  
ATOM 8823  C CD   . GLU A 1 107 ? -3.334  -1.208  21.882  1.00 0.00 ? 126 GLU A CD   4  
ATOM 8824  O OE1  . GLU A 1 107 ? -2.085  -1.223  21.879  1.00 0.00 ? 126 GLU A OE1  4  
ATOM 8825  O OE2  . GLU A 1 107 ? -4.022  -1.799  22.741  1.00 0.00 ? 126 GLU A OE2  4  
ATOM 8826  H H    . GLU A 1 107 ? -5.230  -0.763  16.522  1.00 0.00 ? 126 GLU A H    4  
ATOM 8827  H HA   . GLU A 1 107 ? -4.119  0.777   18.581  1.00 0.00 ? 126 GLU A HA   4  
ATOM 8828  H HB2  . GLU A 1 107 ? -4.930  -1.810  19.438  2.00 0.00 ? 126 GLU A HB2  4  
ATOM 8829  H HB3  . GLU A 1 107 ? -3.174  -1.784  19.407  2.00 0.00 ? 126 GLU A HB3  4  
ATOM 8830  H HG2  . GLU A 1 107 ? -3.551  0.514   20.659  2.00 0.00 ? 126 GLU A HG2  4  
ATOM 8831  H HG3  . GLU A 1 107 ? -5.068  -0.264  21.104  2.00 0.00 ? 126 GLU A HG3  4  
ATOM 8832  N N    . GLU A 1 108 ? -2.403  -1.703  17.294  1.00 0.00 ? 127 GLU A N    4  
ATOM 8833  C CA   . GLU A 1 108 ? -1.212  -2.035  16.519  1.00 0.00 ? 127 GLU A CA   4  
ATOM 8834  C C    . GLU A 1 108 ? -1.098  -3.541  16.315  1.00 0.00 ? 127 GLU A C    4  
ATOM 8835  O O    . GLU A 1 108 ? -1.051  -4.305  17.280  1.00 0.00 ? 127 GLU A O    4  
ATOM 8836  C CB   . GLU A 1 108 ? 0.042   -1.509  17.220  1.00 0.00 ? 127 GLU A CB   4  
ATOM 8837  C CG   . GLU A 1 108 ? -0.082  -1.342  18.725  1.00 0.00 ? 127 GLU A CG   4  
ATOM 8838  C CD   . GLU A 1 108 ? 1.179   -1.728  19.472  1.00 0.00 ? 127 GLU A CD   4  
ATOM 8839  O OE1  . GLU A 1 108 ? 2.232   -1.102  19.222  1.00 0.00 ? 127 GLU A OE1  4  
ATOM 8840  O OE2  . GLU A 1 108 ? 1.115   -2.655  20.306  1.00 0.00 ? 127 GLU A OE2  4  
ATOM 8841  H H    . GLU A 1 108 ? -2.892  -2.419  17.751  1.00 0.00 ? 127 GLU A H    4  
ATOM 8842  H HA   . GLU A 1 108 ? -1.301  -1.560  15.556  1.00 0.00 ? 127 GLU A HA   4  
ATOM 8843  H HB2  . GLU A 1 108 ? 0.856   -2.192  17.025  2.00 0.00 ? 127 GLU A HB2  4  
ATOM 8844  H HB3  . GLU A 1 108 ? 0.294   -0.548  16.797  2.00 0.00 ? 127 GLU A HB3  4  
ATOM 8845  H HG2  . GLU A 1 108 ? -0.306  -0.306  18.940  2.00 0.00 ? 127 GLU A HG2  4  
ATOM 8846  H HG3  . GLU A 1 108 ? -0.894  -1.965  19.076  2.00 0.00 ? 127 GLU A HG3  4  
ATOM 8847  N N    . ASP A 1 109 ? -1.056  -3.967  15.056  1.00 0.00 ? 128 ASP A N    4  
ATOM 8848  C CA   . ASP A 1 109 ? -0.949  -5.386  14.741  1.00 0.00 ? 128 ASP A CA   4  
ATOM 8849  C C    . ASP A 1 109 ? -0.402  -5.608  13.335  1.00 0.00 ? 128 ASP A C    4  
ATOM 8850  O O    . ASP A 1 109 ? -0.821  -4.957  12.375  1.00 0.00 ? 128 ASP A O    4  
ATOM 8851  C CB   . ASP A 1 109 ? -2.315  -6.062  14.880  1.00 0.00 ? 128 ASP A CB   4  
ATOM 8852  C CG   . ASP A 1 109 ? -2.312  -7.233  15.843  1.00 0.00 ? 128 ASP A CG   4  
ATOM 8853  O OD1  . ASP A 1 109 ? -1.390  -8.069  15.758  1.00 0.00 ? 128 ASP A OD1  4  
ATOM 8854  O OD2  . ASP A 1 109 ? -3.234  -7.311  16.683  1.00 0.00 ? 128 ASP A OD2  4  
ATOM 8855  H H    . ASP A 1 109 ? -1.099  -3.315  14.325  1.00 0.00 ? 128 ASP A H    4  
ATOM 8856  H HA   . ASP A 1 109 ? -0.268  -5.830  15.451  1.00 0.00 ? 128 ASP A HA   4  
ATOM 8857  H HB2  . ASP A 1 109 ? -3.032  -5.335  15.232  2.00 0.00 ? 128 ASP A HB2  4  
ATOM 8858  H HB3  . ASP A 1 109 ? -2.627  -6.421  13.911  2.00 0.00 ? 128 ASP A HB3  4  
ATOM 8859  N N    . CYS A 1 110 ? 0.532   -6.545  13.220  1.00 0.00 ? 129 CYS A N    4  
ATOM 8860  C CA   . CYS A 1 110 ? 1.133   -6.873  11.935  1.00 0.00 ? 129 CYS A CA   4  
ATOM 8861  C C    . CYS A 1 110 ? 0.642   -8.234  11.457  1.00 0.00 ? 129 CYS A C    4  
ATOM 8862  O O    . CYS A 1 110 ? 1.314   -8.914  10.682  1.00 0.00 ? 129 CYS A O    4  
ATOM 8863  C CB   . CYS A 1 110 ? 2.660   -6.874  12.044  1.00 0.00 ? 129 CYS A CB   4  
ATOM 8864  S SG   . CYS A 1 110 ? 3.452   -5.380  11.367  1.00 0.00 ? 129 CYS A SG   4  
ATOM 8865  H H    . CYS A 1 110 ? 0.817   -7.035  14.019  1.00 0.00 ? 129 CYS A H    4  
ATOM 8866  H HA   . CYS A 1 110 ? 0.830   -6.122  11.223  1.00 0.00 ? 129 CYS A HA   4  
ATOM 8867  H HB2  . CYS A 1 110 ? 2.939   -6.952  13.084  2.00 0.00 ? 129 CYS A HB2  4  
ATOM 8868  H HB3  . CYS A 1 110 ? 3.051   -7.726  11.507  2.00 0.00 ? 129 CYS A HB3  4  
ATOM 8869  N N    . THR A 1 111 ? -0.539  -8.622  11.933  1.00 0.00 ? 130 THR A N    4  
ATOM 8870  C CA   . THR A 1 111 ? -1.135  -9.900  11.567  1.00 0.00 ? 130 THR A CA   4  
ATOM 8871  C C    . THR A 1 111 ? -0.955  -10.189 10.083  1.00 0.00 ? 130 THR A C    4  
ATOM 8872  O O    . THR A 1 111 ? -0.909  -9.273  9.261   1.00 0.00 ? 130 THR A O    4  
ATOM 8873  C CB   . THR A 1 111 ? -2.637  -9.937  11.906  1.00 0.00 ? 130 THR A CB   4  
ATOM 8874  O OG1  . THR A 1 111 ? -2.889  -9.184  13.098  1.00 0.00 ? 130 THR A OG1  4  
ATOM 8875  C CG2  . THR A 1 111 ? -3.114  -11.369 12.095  1.00 0.00 ? 130 THR A CG2  4  
ATOM 8876  H H    . THR A 1 111 ? -1.020  -8.032  12.550  1.00 0.00 ? 130 THR A H    4  
ATOM 8877  H HA   . THR A 1 111 ? -0.641  -10.674 12.137  1.00 0.00 ? 130 THR A HA   4  
ATOM 8878  H HB   . THR A 1 111 ? -3.185  -9.495  11.087  1.00 0.00 ? 130 THR A HB   4  
ATOM 8879  H HG1  . THR A 1 111 ? -3.653  -8.619  12.964  1.00 0.00 ? 130 THR A HG1  4  
ATOM 8880  H HG21 . THR A 1 111 ? -3.627  -11.455 13.042  1.00 0.00 ? 130 THR A HG21 4  
ATOM 8881  H HG22 . THR A 1 111 ? -2.265  -12.036 12.083  1.00 0.00 ? 130 THR A HG22 4  
ATOM 8882  H HG23 . THR A 1 111 ? -3.790  -11.632 11.294  1.00 0.00 ? 130 THR A HG23 4  
ATOM 8883  N N    . SER A 1 112 ? -0.853  -11.469 9.746   1.00 0.00 ? 131 SER A N    4  
ATOM 8884  C CA   . SER A 1 112 ? -0.677  -11.882 8.361   1.00 0.00 ? 131 SER A CA   4  
ATOM 8885  C C    . SER A 1 112 ? -1.923  -11.579 7.536   1.00 0.00 ? 131 SER A C    4  
ATOM 8886  O O    . SER A 1 112 ? -2.829  -12.406 7.440   1.00 0.00 ? 131 SER A O    4  
ATOM 8887  C CB   . SER A 1 112 ? -0.357  -13.376 8.291   1.00 0.00 ? 131 SER A CB   4  
ATOM 8888  O OG   . SER A 1 112 ? -1.047  -14.091 9.301   1.00 0.00 ? 131 SER A OG   4  
ATOM 8889  H H    . SER A 1 112 ? -0.897  -12.153 10.447  1.00 0.00 ? 131 SER A H    4  
ATOM 8890  H HA   . SER A 1 112 ? 0.154   -11.327 7.954   1.00 0.00 ? 131 SER A HA   4  
ATOM 8891  H HB2  . SER A 1 112 ? -0.656  -13.762 7.326   2.00 0.00 ? 131 SER A HB2  4  
ATOM 8892  H HB3  . SER A 1 112 ? 0.706   -13.522 8.426   2.00 0.00 ? 131 SER A HB3  4  
ATOM 8893  H HG   . SER A 1 112 ? -1.594  -14.768 8.897   1.00 0.00 ? 131 SER A HG   4  
ATOM 8894  N N    . VAL A 1 113 ? -1.959  -10.389 6.938   1.00 0.00 ? 132 VAL A N    4  
ATOM 8895  C CA   . VAL A 1 113 ? -3.093  -9.982  6.116   1.00 0.00 ? 132 VAL A CA   4  
ATOM 8896  C C    . VAL A 1 113 ? -3.551  -11.129 5.221   1.00 0.00 ? 132 VAL A C    4  
ATOM 8897  O O    . VAL A 1 113 ? -4.391  -11.935 5.617   1.00 0.00 ? 132 VAL A O    4  
ATOM 8898  C CB   . VAL A 1 113 ? -2.749  -8.753  5.244   1.00 0.00 ? 132 VAL A CB   4  
ATOM 8899  C CG1  . VAL A 1 113 ? -3.762  -8.580  4.122   2.00 0.00 ? 132 VAL A CG1  4  
ATOM 8900  C CG2  . VAL A 1 113 ? -2.684  -7.490  6.090   2.00 0.00 ? 132 VAL A CG2  4  
ATOM 8901  H H    . VAL A 1 113 ? -1.204  -9.774  7.051   1.00 0.00 ? 132 VAL A H    4  
ATOM 8902  H HA   . VAL A 1 113 ? -3.902  -9.713  6.774   1.00 0.00 ? 132 VAL A HA   4  
ATOM 8903  H HB   . VAL A 1 113 ? -1.777  -8.919  4.803   1.00 0.00 ? 132 VAL A HB   4  
ATOM 8904  H HG11 . VAL A 1 113 ? -3.797  -9.480  3.527   1.00 0.00 ? 132 VAL A HG11 4  
ATOM 8905  H HG12 . VAL A 1 113 ? -3.468  -7.747  3.499   1.00 0.00 ? 132 VAL A HG12 4  
ATOM 8906  H HG13 . VAL A 1 113 ? -4.737  -8.388  4.543   1.00 0.00 ? 132 VAL A HG13 4  
ATOM 8907  H HG21 . VAL A 1 113 ? -3.370  -6.753  5.694   1.00 0.00 ? 132 VAL A HG21 4  
ATOM 8908  H HG22 . VAL A 1 113 ? -1.680  -7.093  6.069   1.00 0.00 ? 132 VAL A HG22 4  
ATOM 8909  H HG23 . VAL A 1 113 ? -2.955  -7.723  7.109   1.00 0.00 ? 132 VAL A HG23 4  
ATOM 8910  N N    . THR A 1 114 ? -2.991  -11.197 4.017   1.00 0.00 ? 133 THR A N    4  
ATOM 8911  C CA   . THR A 1 114 ? -3.341  -12.249 3.064   1.00 0.00 ? 133 THR A CA   4  
ATOM 8912  C C    . THR A 1 114 ? -4.846  -12.459 3.009   1.00 0.00 ? 133 THR A C    4  
ATOM 8913  O O    . THR A 1 114 ? -5.329  -13.456 2.472   1.00 0.00 ? 133 THR A O    4  
ATOM 8914  C CB   . THR A 1 114 ? -2.676  -13.584 3.437   1.00 0.00 ? 133 THR A CB   4  
ATOM 8915  O OG1  . THR A 1 114 ? -2.479  -14.381 2.264   1.00 0.00 ? 133 THR A OG1  4  
ATOM 8916  C CG2  . THR A 1 114 ? -3.533  -14.344 4.438   1.00 0.00 ? 133 THR A CG2  4  
ATOM 8917  H H    . THR A 1 114 ? -2.327  -10.524 3.765   1.00 0.00 ? 133 THR A H    4  
ATOM 8918  H HA   . THR A 1 114 ? -2.988  -11.952 2.087   1.00 0.00 ? 133 THR A HA   4  
ATOM 8919  H HB   . THR A 1 114 ? -1.718  -13.377 3.891   1.00 0.00 ? 133 THR A HB   4  
ATOM 8920  H HG1  . THR A 1 114 ? -2.262  -15.281 2.521   1.00 0.00 ? 133 THR A HG1  4  
ATOM 8921  H HG21 . THR A 1 114 ? -3.748  -15.330 4.053   1.00 0.00 ? 133 THR A HG21 4  
ATOM 8922  H HG22 . THR A 1 114 ? -4.462  -13.809 4.594   1.00 0.00 ? 133 THR A HG22 4  
ATOM 8923  H HG23 . THR A 1 114 ? -3.004  -14.429 5.375   1.00 0.00 ? 133 THR A HG23 4  
ATOM 8924  N N    . ASP A 1 115 ? -5.580  -11.525 3.591   1.00 0.00 ? 134 ASP A N    4  
ATOM 8925  C CA   . ASP A 1 115 ? -7.031  -11.618 3.635   1.00 0.00 ? 134 ASP A CA   4  
ATOM 8926  C C    . ASP A 1 115 ? -7.681  -11.002 2.402   1.00 0.00 ? 134 ASP A C    4  
ATOM 8927  O O    . ASP A 1 115 ? -8.114  -11.714 1.496   1.00 0.00 ? 134 ASP A O    4  
ATOM 8928  C CB   . ASP A 1 115 ? -7.566  -10.945 4.901   1.00 0.00 ? 134 ASP A CB   4  
ATOM 8929  C CG   . ASP A 1 115 ? -6.676  -9.818  5.391   1.00 0.00 ? 134 ASP A CG   4  
ATOM 8930  O OD1  . ASP A 1 115 ? -6.660  -8.750  4.745   1.00 0.00 ? 134 ASP A OD1  4  
ATOM 8931  O OD2  . ASP A 1 115 ? -5.997  -10.004 6.422   1.00 0.00 ? 134 ASP A OD2  4  
ATOM 8932  H H    . ASP A 1 115 ? -5.131  -10.763 4.016   1.00 0.00 ? 134 ASP A H    4  
ATOM 8933  H HA   . ASP A 1 115 ? -7.288  -12.664 3.669   1.00 0.00 ? 134 ASP A HA   4  
ATOM 8934  H HB2  . ASP A 1 115 ? -8.547  -10.538 4.698   2.00 0.00 ? 134 ASP A HB2  4  
ATOM 8935  H HB3  . ASP A 1 115 ? -7.643  -11.682 5.688   2.00 0.00 ? 134 ASP A HB3  4  
ATOM 8936  N N    . LEU A 1 116 ? -7.774  -9.677  2.390   1.00 0.00 ? 135 LEU A N    4  
ATOM 8937  C CA   . LEU A 1 116 ? -8.406  -8.963  1.285   1.00 0.00 ? 135 LEU A CA   4  
ATOM 8938  C C    . LEU A 1 116 ? -9.705  -9.658  0.872   1.00 0.00 ? 135 LEU A C    4  
ATOM 8939  O O    . LEU A 1 116 ? -10.001 -9.781  -0.317  1.00 0.00 ? 135 LEU A O    4  
ATOM 8940  C CB   . LEU A 1 116 ? -7.478  -8.874  0.071   1.00 0.00 ? 135 LEU A CB   4  
ATOM 8941  C CG   . LEU A 1 116 ? -5.992  -8.662  0.380   1.00 0.00 ? 135 LEU A CG   4  
ATOM 8942  C CD1  . LEU A 1 116 ? -5.807  -7.818  1.628   2.00 0.00 ? 135 LEU A CD1  4  
ATOM 8943  C CD2  . LEU A 1 116 ? -5.278  -9.991  0.541   2.00 0.00 ? 135 LEU A CD2  4  
ATOM 8944  H H    . LEU A 1 116 ? -7.429  -9.169  3.151   1.00 0.00 ? 135 LEU A H    4  
ATOM 8945  H HA   . LEU A 1 116 ? -8.633  -7.964  1.627   1.00 0.00 ? 135 LEU A HA   4  
ATOM 8946  H HB2  . LEU A 1 116 ? -7.584  -9.787  -0.494  2.00 0.00 ? 135 LEU A HB2  4  
ATOM 8947  H HB3  . LEU A 1 116 ? -7.812  -8.054  -0.547  2.00 0.00 ? 135 LEU A HB3  4  
ATOM 8948  H HG   . LEU A 1 116 ? -5.534  -8.138  -0.445  1.00 0.00 ? 135 LEU A HG   4  
ATOM 8949  H HD11 . LEU A 1 116 ? -6.687  -7.212  1.785   1.00 0.00 ? 135 LEU A HD11 4  
ATOM 8950  H HD12 . LEU A 1 116 ? -4.945  -7.180  1.503   1.00 0.00 ? 135 LEU A HD12 4  
ATOM 8951  H HD13 . LEU A 1 116 ? -5.657  -8.466  2.480   1.00 0.00 ? 135 LEU A HD13 4  
ATOM 8952  H HD21 . LEU A 1 116 ? -6.004  -10.770 0.712   1.00 0.00 ? 135 LEU A HD21 4  
ATOM 8953  H HD22 . LEU A 1 116 ? -4.604  -9.933  1.383   1.00 0.00 ? 135 LEU A HD22 4  
ATOM 8954  H HD23 . LEU A 1 116 ? -4.719  -10.208 -0.357  1.00 0.00 ? 135 LEU A HD23 4  
ATOM 8955  N N    . PRO A 1 117 ? -10.494 -10.134 1.851   1.00 0.00 ? 136 PRO A N    4  
ATOM 8956  C CA   . PRO A 1 117 ? -11.761 -10.831 1.584   1.00 0.00 ? 136 PRO A CA   4  
ATOM 8957  C C    . PRO A 1 117 ? -12.761 -9.970  0.825   1.00 0.00 ? 136 PRO A C    4  
ATOM 8958  O O    . PRO A 1 117 ? -13.860 -10.418 0.499   1.00 0.00 ? 136 PRO A O    4  
ATOM 8959  C CB   . PRO A 1 117 ? -12.310 -11.149 2.979   1.00 0.00 ? 136 PRO A CB   4  
ATOM 8960  C CG   . PRO A 1 117 ? -11.566 -10.247 3.904   1.00 0.00 ? 136 PRO A CG   4  
ATOM 8961  C CD   . PRO A 1 117 ? -10.214 -10.039 3.291   1.00 0.00 ? 136 PRO A CD   4  
ATOM 8962  H HA   . PRO A 1 117 ? -11.598 -11.751 1.043   1.00 0.00 ? 136 PRO A HA   4  
ATOM 8963  H HB2  . PRO A 1 117 ? -13.368 -10.941 2.998   2.00 0.00 ? 136 PRO A HB2  4  
ATOM 8964  H HB3  . PRO A 1 117 ? -12.134 -12.189 3.212   2.00 0.00 ? 136 PRO A HB3  4  
ATOM 8965  H HG2  . PRO A 1 117 ? -12.085 -9.304  3.992   2.00 0.00 ? 136 PRO A HG2  4  
ATOM 8966  H HG3  . PRO A 1 117 ? -11.470 -10.713 4.873   2.00 0.00 ? 136 PRO A HG3  4  
ATOM 8967  H HD2  . PRO A 1 117 ? -9.826  -9.065  3.547   2.00 0.00 ? 136 PRO A HD2  4  
ATOM 8968  H HD3  . PRO A 1 117 ? -9.531  -10.818 3.605   2.00 0.00 ? 136 PRO A HD3  4  
ATOM 8969  N N    . ASN A 1 118 ? -12.379 -8.731  0.556   1.00 0.00 ? 137 ASN A N    4  
ATOM 8970  C CA   . ASN A 1 118 ? -13.252 -7.803  -0.157  1.00 0.00 ? 137 ASN A CA   4  
ATOM 8971  C C    . ASN A 1 118 ? -13.055 -7.909  -1.665  1.00 0.00 ? 137 ASN A C    4  
ATOM 8972  O O    . ASN A 1 118 ? -13.606 -7.115  -2.428  1.00 0.00 ? 137 ASN A O    4  
ATOM 8973  C CB   . ASN A 1 118 ? -12.994 -6.368  0.300   1.00 0.00 ? 137 ASN A CB   4  
ATOM 8974  C CG   . ASN A 1 118 ? -14.242 -5.694  0.836   1.00 0.00 ? 137 ASN A CG   4  
ATOM 8975  O OD1  . ASN A 1 118 ? -15.185 -5.425  0.092   1.00 0.00 ? 137 ASN A OD1  4  
ATOM 8976  N ND2  . ASN A 1 118 ? -14.251 -5.416  2.134   4.00 0.00 ? 137 ASN A ND2  4  
ATOM 8977  H H    . ASN A 1 118 ? -11.492 -8.434  0.849   1.00 0.00 ? 137 ASN A H    4  
ATOM 8978  H HA   . ASN A 1 118 ? -14.273 -8.066  0.077   1.00 0.00 ? 137 ASN A HA   4  
ATOM 8979  H HB2  . ASN A 1 118 ? -12.249 -6.375  1.084   2.00 0.00 ? 137 ASN A HB2  4  
ATOM 8980  H HB3  . ASN A 1 118 ? -12.628 -5.789  -0.536  2.00 0.00 ? 137 ASN A HB3  4  
ATOM 8981  H HD21 . ASN A 1 118 ? -13.461 -5.659  2.666   5.00 0.00 ? 137 ASN A HD21 4  
ATOM 8982  H HD22 . ASN A 1 118 ? -15.048 -4.979  2.509   5.00 0.00 ? 137 ASN A HD22 4  
ATOM 8983  N N    . ALA A 1 119 ? -12.273 -8.892  -2.089  1.00 0.00 ? 138 ALA A N    4  
ATOM 8984  C CA   . ALA A 1 119 ? -12.012 -9.097  -3.507  1.00 0.00 ? 138 ALA A CA   4  
ATOM 8985  C C    . ALA A 1 119 ? -12.856 -10.243 -4.056  1.00 0.00 ? 138 ALA A C    4  
ATOM 8986  O O    . ALA A 1 119 ? -13.836 -10.656 -3.436  1.00 0.00 ? 138 ALA A O    4  
ATOM 8987  C CB   . ALA A 1 119 ? -10.533 -9.365  -3.740  1.00 0.00 ? 138 ALA A CB   4  
ATOM 8988  H H    . ALA A 1 119 ? -11.862 -9.496  -1.435  1.00 0.00 ? 138 ALA A H    4  
ATOM 8989  H HA   . ALA A 1 119 ? -12.276 -8.188  -4.028  1.00 0.00 ? 138 ALA A HA   4  
ATOM 8990  H HB1  . ALA A 1 119 ? -9.954  -8.888  -2.964  1.00 0.00 ? 138 ALA A HB1  4  
ATOM 8991  H HB2  . ALA A 1 119 ? -10.243 -8.965  -4.702  1.00 0.00 ? 138 ALA A HB2  4  
ATOM 8992  H HB3  . ALA A 1 119 ? -10.352 -10.429 -3.723  1.00 0.00 ? 138 ALA A HB3  4  
ATOM 8993  N N    . PHE A 1 120 ? -12.472 -10.750 -5.222  1.00 0.00 ? 139 PHE A N    4  
ATOM 8994  C CA   . PHE A 1 120 ? -13.196 -11.846 -5.853  1.00 0.00 ? 139 PHE A CA   4  
ATOM 8995  C C    . PHE A 1 120 ? -12.286 -13.052 -6.056  1.00 0.00 ? 139 PHE A C    4  
ATOM 8996  O O    . PHE A 1 120 ? -11.062 -12.929 -6.031  1.00 0.00 ? 139 PHE A O    4  
ATOM 8997  C CB   . PHE A 1 120 ? -13.781 -11.398 -7.195  1.00 0.00 ? 139 PHE A CB   4  
ATOM 8998  C CG   . PHE A 1 120 ? -12.933 -10.420 -7.961  1.00 0.00 ? 139 PHE A CG   4  
ATOM 8999  C CD1  . PHE A 1 120 ? -12.620 -9.183  -7.422  1.00 0.00 ? 139 PHE A CD1  4  
ATOM 9000  C CD2  . PHE A 1 120 ? -12.449 -10.740 -9.219  1.00 0.00 ? 139 PHE A CD2  4  
ATOM 9001  C CE1  . PHE A 1 120 ? -11.838 -8.284  -8.122  1.00 0.00 ? 139 PHE A CE1  4  
ATOM 9002  C CE2  . PHE A 1 120 ? -11.666 -9.845  -9.924  1.00 0.00 ? 139 PHE A CE2  4  
ATOM 9003  C CZ   . PHE A 1 120 ? -11.360 -8.616  -9.375  1.00 0.00 ? 139 PHE A CZ   4  
ATOM 9004  H H    . PHE A 1 120 ? -11.683 -10.378 -5.668  1.00 0.00 ? 139 PHE A H    4  
ATOM 9005  H HA   . PHE A 1 120 ? -14.005 -12.129 -5.196  1.00 0.00 ? 139 PHE A HA   4  
ATOM 9006  H HB2  . PHE A 1 120 ? -13.924 -12.269 -7.822  2.00 0.00 ? 139 PHE A HB2  4  
ATOM 9007  H HB3  . PHE A 1 120 ? -14.742 -10.932 -7.020  2.00 0.00 ? 139 PHE A HB3  4  
ATOM 9008  H HD1  . PHE A 1 120 ? -12.992 -8.922  -6.442  1.00 0.00 ? 139 PHE A HD1  4  
ATOM 9009  H HD2  . PHE A 1 120 ? -12.687 -11.701 -9.649  1.00 0.00 ? 139 PHE A HD2  4  
ATOM 9010  H HE1  . PHE A 1 120 ? -11.600 -7.323  -7.689  1.00 0.00 ? 139 PHE A HE1  4  
ATOM 9011  H HE2  . PHE A 1 120 ? -11.294 -10.107 -10.904 1.00 0.00 ? 139 PHE A HE2  4  
ATOM 9012  H HZ   . PHE A 1 120 ? -10.747 -7.915  -9.923  1.00 0.00 ? 139 PHE A HZ   4  
ATOM 9013  N N    . ASP A 1 121 ? -12.893 -14.217 -6.257  1.00 0.00 ? 140 ASP A N    4  
ATOM 9014  C CA   . ASP A 1 121 ? -12.136 -15.446 -6.463  1.00 0.00 ? 140 ASP A CA   4  
ATOM 9015  C C    . ASP A 1 121 ? -11.282 -15.352 -7.722  1.00 0.00 ? 140 ASP A C    4  
ATOM 9016  O O    . ASP A 1 121 ? -11.560 -14.549 -8.613  1.00 0.00 ? 140 ASP A O    4  
ATOM 9017  C CB   . ASP A 1 121 ? -13.083 -16.643 -6.562  1.00 0.00 ? 140 ASP A CB   4  
ATOM 9018  C CG   . ASP A 1 121 ? -13.934 -16.612 -7.816  1.00 0.00 ? 140 ASP A CG   4  
ATOM 9019  O OD1  . ASP A 1 121 ? -14.598 -15.582 -8.059  1.00 0.00 ? 140 ASP A OD1  4  
ATOM 9020  O OD2  . ASP A 1 121 ? -13.939 -17.619 -8.555  1.00 0.00 ? 140 ASP A OD2  4  
ATOM 9021  H H    . ASP A 1 121 ? -13.872 -14.250 -6.265  1.00 0.00 ? 140 ASP A H    4  
ATOM 9022  H HA   . ASP A 1 121 ? -11.486 -15.582 -5.611  1.00 0.00 ? 140 ASP A HA   4  
ATOM 9023  H HB2  . ASP A 1 121 ? -12.502 -17.553 -6.567  2.00 0.00 ? 140 ASP A HB2  4  
ATOM 9024  H HB3  . ASP A 1 121 ? -13.740 -16.646 -5.705  2.00 0.00 ? 140 ASP A HB3  4  
ATOM 9025  N N    . GLY A 1 122 ? -10.241 -16.176 -7.790  1.00 0.00 ? 141 GLY A N    4  
ATOM 9026  C CA   . GLY A 1 122 ? -9.365  -16.168 -8.946  1.00 0.00 ? 141 GLY A CA   4  
ATOM 9027  C C    . GLY A 1 122 ? -7.986  -16.714 -8.634  1.00 0.00 ? 141 GLY A C    4  
ATOM 9028  O O    . GLY A 1 122 ? -7.522  -16.632 -7.498  1.00 0.00 ? 141 GLY A O    4  
ATOM 9029  H H    . GLY A 1 122 ? -10.068 -16.795 -7.051  1.00 0.00 ? 141 GLY A H    4  
ATOM 9030  H HA2  . GLY A 1 122 ? -9.811  -16.768 -9.727  2.00 0.00 ? 141 GLY A HA2  4  
ATOM 9031  H HA3  . GLY A 1 122 ? -9.265  -15.151 -9.299  2.00 0.00 ? 141 GLY A HA3  4  
ATOM 9032  N N    . PRO A 1 123 ? -7.305  -17.291 -9.637  1.00 0.00 ? 142 PRO A N    4  
ATOM 9033  C CA   . PRO A 1 123 ? -5.967  -17.863 -9.467  1.00 0.00 ? 142 PRO A CA   4  
ATOM 9034  C C    . PRO A 1 123 ? -4.903  -16.799 -9.207  1.00 0.00 ? 142 PRO A C    4  
ATOM 9035  O O    . PRO A 1 123 ? -3.718  -17.113 -9.090  1.00 0.00 ? 142 PRO A O    4  
ATOM 9036  C CB   . PRO A 1 123 ? -5.694  -18.567 -10.809 1.00 0.00 ? 142 PRO A CB   4  
ATOM 9037  C CG   . PRO A 1 123 ? -7.020  -18.635 -11.495 1.00 0.00 ? 142 PRO A CG   4  
ATOM 9038  C CD   . PRO A 1 123 ? -7.787  -17.442 -11.011 1.00 0.00 ? 142 PRO A CD   4  
ATOM 9039  H HA   . PRO A 1 123 ? -5.947  -18.590 -8.669  1.00 0.00 ? 142 PRO A HA   4  
ATOM 9040  H HB2  . PRO A 1 123 ? -4.985  -17.988 -11.383 2.00 0.00 ? 142 PRO A HB2  4  
ATOM 9041  H HB3  . PRO A 1 123 ? -5.296  -19.553 -10.624 2.00 0.00 ? 142 PRO A HB3  4  
ATOM 9042  H HG2  . PRO A 1 123 ? -6.885  -18.587 -12.566 2.00 0.00 ? 142 PRO A HG2  4  
ATOM 9043  H HG3  . PRO A 1 123 ? -7.531  -19.546 -11.219 2.00 0.00 ? 142 PRO A HG3  4  
ATOM 9044  H HD2  . PRO A 1 123 ? -7.549  -16.572 -11.604 2.00 0.00 ? 142 PRO A HD2  4  
ATOM 9045  H HD3  . PRO A 1 123 ? -8.849  -17.639 -11.031 2.00 0.00 ? 142 PRO A HD3  4  
ATOM 9046  N N    . ILE A 1 124 ? -5.329  -15.542 -9.117  1.00 0.00 ? 143 ILE A N    4  
ATOM 9047  C CA   . ILE A 1 124 ? -4.404  -14.441 -8.869  1.00 0.00 ? 143 ILE A CA   4  
ATOM 9048  C C    . ILE A 1 124 ? -3.591  -14.682 -7.602  1.00 0.00 ? 143 ILE A C    4  
ATOM 9049  O O    . ILE A 1 124 ? -4.141  -14.761 -6.504  1.00 0.00 ? 143 ILE A O    4  
ATOM 9050  C CB   . ILE A 1 124 ? -5.143  -13.095 -8.746  1.00 0.00 ? 143 ILE A CB   4  
ATOM 9051  C CG1  . ILE A 1 124 ? -5.549  -12.585 -10.131 1.00 0.00 ? 143 ILE A CG1  4  
ATOM 9052  C CG2  . ILE A 1 124 ? -4.268  -12.074 -8.033  1.00 0.00 ? 143 ILE A CG2  4  
ATOM 9053  C CD1  . ILE A 1 124 ? -6.074  -11.165 -10.139 1.00 0.00 ? 143 ILE A CD1  4  
ATOM 9054  H H    . ILE A 1 124 ? -6.285  -15.351 -9.218  1.00 0.00 ? 143 ILE A H    4  
ATOM 9055  H HA   . ILE A 1 124 ? -3.728  -14.378 -9.710  1.00 0.00 ? 143 ILE A HA   4  
ATOM 9056  H HB   . ILE A 1 124 ? -6.030  -13.249 -8.152  1.00 0.00 ? 143 ILE A HB   4  
ATOM 9057  H HG12 . ILE A 1 124 ? -4.691  -12.622 -10.786 2.00 0.00 ? 143 ILE A HG12 4  
ATOM 9058  H HG13 . ILE A 1 124 ? -6.322  -13.225 -10.530 2.00 0.00 ? 143 ILE A HG13 4  
ATOM 9059  H HG21 . ILE A 1 124 ? -4.566  -12.006 -6.998  1.00 0.00 ? 143 ILE A HG21 4  
ATOM 9060  H HG22 . ILE A 1 124 ? -4.383  -11.109 -8.504  1.00 0.00 ? 143 ILE A HG22 4  
ATOM 9061  H HG23 . ILE A 1 124 ? -3.234  -12.381 -8.091  1.00 0.00 ? 143 ILE A HG23 4  
ATOM 9062  H HD11 . ILE A 1 124 ? -5.278  -10.488 -10.409 1.00 0.00 ? 143 ILE A HD11 4  
ATOM 9063  H HD12 . ILE A 1 124 ? -6.443  -10.913 -9.157  1.00 0.00 ? 143 ILE A HD12 4  
ATOM 9064  H HD13 . ILE A 1 124 ? -6.876  -11.082 -10.858 1.00 0.00 ? 143 ILE A HD13 4  
ATOM 9065  N N    . THR A 1 125 ? -2.276  -14.799 -7.762  1.00 0.00 ? 144 THR A N    4  
ATOM 9066  C CA   . THR A 1 125 ? -1.387  -15.031 -6.631  1.00 0.00 ? 144 THR A CA   4  
ATOM 9067  C C    . THR A 1 125 ? -1.167  -13.749 -5.834  1.00 0.00 ? 144 THR A C    4  
ATOM 9068  O O    . THR A 1 125 ? -0.196  -13.026 -6.058  1.00 0.00 ? 144 THR A O    4  
ATOM 9069  C CB   . THR A 1 125 ? -0.024  -15.580 -7.090  1.00 0.00 ? 144 THR A CB   4  
ATOM 9070  O OG1  . THR A 1 125 ? -0.208  -16.784 -7.844  1.00 0.00 ? 144 THR A OG1  4  
ATOM 9071  C CG2  . THR A 1 125 ? 0.880   -15.857 -5.898  1.00 0.00 ? 144 THR A CG2  4  
ATOM 9072  H H    . THR A 1 125 ? -1.896  -14.728 -8.662  1.00 0.00 ? 144 THR A H    4  
ATOM 9073  H HA   . THR A 1 125 ? -1.850  -15.767 -5.988  1.00 0.00 ? 144 THR A HA   4  
ATOM 9074  H HB   . THR A 1 125 ? 0.451   -14.841 -7.718  1.00 0.00 ? 144 THR A HB   4  
ATOM 9075  H HG1  . THR A 1 125 ? 0.101   -17.534 -7.331  1.00 0.00 ? 144 THR A HG1  4  
ATOM 9076  H HG21 . THR A 1 125 ? 1.106   -14.929 -5.395  1.00 0.00 ? 144 THR A HG21 4  
ATOM 9077  H HG22 . THR A 1 125 ? 1.795   -16.315 -6.240  1.00 0.00 ? 144 THR A HG22 4  
ATOM 9078  H HG23 . THR A 1 125 ? 0.377   -16.524 -5.213  1.00 0.00 ? 144 THR A HG23 4  
ATOM 9079  N N    . ILE A 1 126 ? -2.076  -13.473 -4.906  1.00 0.00 ? 145 ILE A N    4  
ATOM 9080  C CA   . ILE A 1 126 ? -1.986  -12.277 -4.077  1.00 0.00 ? 145 ILE A CA   4  
ATOM 9081  C C    . ILE A 1 126 ? -1.028  -12.487 -2.907  1.00 0.00 ? 145 ILE A C    4  
ATOM 9082  O O    . ILE A 1 126 ? -1.379  -13.117 -1.910  1.00 0.00 ? 145 ILE A O    4  
ATOM 9083  C CB   . ILE A 1 126 ? -3.368  -11.874 -3.526  1.00 0.00 ? 145 ILE A CB   4  
ATOM 9084  C CG1  . ILE A 1 126 ? -4.331  -11.576 -4.673  1.00 0.00 ? 145 ILE A CG1  4  
ATOM 9085  C CG2  . ILE A 1 126 ? -3.246  -10.665 -2.610  1.00 0.00 ? 145 ILE A CG2  4  
ATOM 9086  C CD1  . ILE A 1 126 ? -5.792  -11.715 -4.304  1.00 0.00 ? 145 ILE A CD1  4  
ATOM 9087  H H    . ILE A 1 126 ? -2.828  -14.088 -4.777  1.00 0.00 ? 145 ILE A H    4  
ATOM 9088  H HA   . ILE A 1 126 ? -1.617  -11.470 -4.694  1.00 0.00 ? 145 ILE A HA   4  
ATOM 9089  H HB   . ILE A 1 126 ? -3.756  -12.699 -2.948  1.00 0.00 ? 145 ILE A HB   4  
ATOM 9090  H HG12 . ILE A 1 126 ? -4.172  -10.562 -5.012  2.00 0.00 ? 145 ILE A HG12 4  
ATOM 9091  H HG13 . ILE A 1 126 ? -4.129  -12.253 -5.487  2.00 0.00 ? 145 ILE A HG13 4  
ATOM 9092  H HG21 . ILE A 1 126 ? -4.116  -10.038 -2.724  1.00 0.00 ? 145 ILE A HG21 4  
ATOM 9093  H HG22 . ILE A 1 126 ? -2.360  -10.102 -2.873  1.00 0.00 ? 145 ILE A HG22 4  
ATOM 9094  H HG23 . ILE A 1 126 ? -3.171  -10.996 -1.584  1.00 0.00 ? 145 ILE A HG23 4  
ATOM 9095  H HD11 . ILE A 1 126 ? -5.985  -11.174 -3.389  1.00 0.00 ? 145 ILE A HD11 4  
ATOM 9096  H HD12 . ILE A 1 126 ? -6.028  -12.760 -4.159  1.00 0.00 ? 145 ILE A HD12 4  
ATOM 9097  H HD13 . ILE A 1 126 ? -6.404  -11.313 -5.097  1.00 0.00 ? 145 ILE A HD13 4  
ATOM 9098  N N    . THR A 1 127 ? 0.183   -11.952 -3.036  1.00 0.00 ? 146 THR A N    4  
ATOM 9099  C CA   . THR A 1 127 ? 1.190   -12.076 -1.990  1.00 0.00 ? 146 THR A CA   4  
ATOM 9100  C C    . THR A 1 127 ? 1.377   -10.754 -1.251  1.00 0.00 ? 146 THR A C    4  
ATOM 9101  O O    . THR A 1 127 ? 1.986   -9.821  -1.775  1.00 0.00 ? 146 THR A O    4  
ATOM 9102  C CB   . THR A 1 127 ? 2.548   -12.518 -2.565  1.00 0.00 ? 146 THR A CB   4  
ATOM 9103  O OG1  . THR A 1 127 ? 2.505   -13.907 -2.914  1.00 0.00 ? 146 THR A OG1  4  
ATOM 9104  C CG2  . THR A 1 127 ? 3.664   -12.277 -1.559  1.00 0.00 ? 146 THR A CG2  4  
ATOM 9105  H H    . THR A 1 127 ? 0.404   -11.459 -3.854  1.00 0.00 ? 146 THR A H    4  
ATOM 9106  H HA   . THR A 1 127 ? 0.856   -12.828 -1.289  1.00 0.00 ? 146 THR A HA   4  
ATOM 9107  H HB   . THR A 1 127 ? 2.752   -11.938 -3.452  1.00 0.00 ? 146 THR A HB   4  
ATOM 9108  H HG1  . THR A 1 127 ? 1.696   -14.297 -2.575  1.00 0.00 ? 146 THR A HG1  4  
ATOM 9109  H HG21 . THR A 1 127 ? 3.236   -12.099 -0.584  1.00 0.00 ? 146 THR A HG21 4  
ATOM 9110  H HG22 . THR A 1 127 ? 4.242   -11.415 -1.861  1.00 0.00 ? 146 THR A HG22 4  
ATOM 9111  H HG23 . THR A 1 127 ? 4.306   -13.144 -1.518  1.00 0.00 ? 146 THR A HG23 4  
ATOM 9112  N N    . ILE A 1 128 ? 0.852   -10.678 -0.032  1.00 0.00 ? 147 ILE A N    4  
ATOM 9113  C CA   . ILE A 1 128 ? 0.969   -9.464  0.770   1.00 0.00 ? 147 ILE A CA   4  
ATOM 9114  C C    . ILE A 1 128 ? 2.304   -9.421  1.502   1.00 0.00 ? 147 ILE A C    4  
ATOM 9115  O O    . ILE A 1 128 ? 2.530   -10.170 2.453   1.00 0.00 ? 147 ILE A O    4  
ATOM 9116  C CB   . ILE A 1 128 ? -0.170  -9.333  1.801   1.00 0.00 ? 147 ILE A CB   4  
ATOM 9117  C CG1  . ILE A 1 128 ? -1.102  -10.546 1.745   1.00 0.00 ? 147 ILE A CG1  4  
ATOM 9118  C CG2  . ILE A 1 128 ? -0.952  -8.048  1.565   1.00 0.00 ? 147 ILE A CG2  4  
ATOM 9119  C CD1  . ILE A 1 128 ? -1.889  -10.659 0.457   1.00 0.00 ? 147 ILE A CD1  4  
ATOM 9120  H H    . ILE A 1 128 ? 0.380   -11.452 0.334   1.00 0.00 ? 147 ILE A H    4  
ATOM 9121  H HA   . ILE A 1 128 ? 0.915   -8.619  0.098   1.00 0.00 ? 147 ILE A HA   4  
ATOM 9122  H HB   . ILE A 1 128 ? 0.273   -9.276  2.784   1.00 0.00 ? 147 ILE A HB   4  
ATOM 9123  H HG12 . ILE A 1 128 ? -0.517  -11.447 1.857   2.00 0.00 ? 147 ILE A HG12 4  
ATOM 9124  H HG13 . ILE A 1 128 ? -1.808  -10.483 2.558   2.00 0.00 ? 147 ILE A HG13 4  
ATOM 9125  H HG21 . ILE A 1 128 ? -1.979  -8.189  1.869   1.00 0.00 ? 147 ILE A HG21 4  
ATOM 9126  H HG22 . ILE A 1 128 ? -0.919  -7.793  0.515   1.00 0.00 ? 147 ILE A HG22 4  
ATOM 9127  H HG23 . ILE A 1 128 ? -0.513  -7.249  2.143   1.00 0.00 ? 147 ILE A HG23 4  
ATOM 9128  H HD11 . ILE A 1 128 ? -1.547  -11.518 -0.099  1.00 0.00 ? 147 ILE A HD11 4  
ATOM 9129  H HD12 . ILE A 1 128 ? -1.744  -9.766  -0.132  1.00 0.00 ? 147 ILE A HD12 4  
ATOM 9130  H HD13 . ILE A 1 128 ? -2.939  -10.773 0.688   1.00 0.00 ? 147 ILE A HD13 4  
ATOM 9131  N N    . VAL A 1 129 ? 3.185   -8.539  1.050   1.00 0.00 ? 148 VAL A N    4  
ATOM 9132  C CA   . VAL A 1 129 ? 4.502   -8.387  1.652   1.00 0.00 ? 148 VAL A CA   4  
ATOM 9133  C C    . VAL A 1 129 ? 4.516   -7.225  2.642   1.00 0.00 ? 148 VAL A C    4  
ATOM 9134  O O    . VAL A 1 129 ? 4.600   -6.065  2.248   1.00 0.00 ? 148 VAL A O    4  
ATOM 9135  C CB   . VAL A 1 129 ? 5.579   -8.146  0.577   1.00 0.00 ? 148 VAL A CB   4  
ATOM 9136  C CG1  . VAL A 1 129 ? 6.605   -9.268  0.583   2.00 0.00 ? 148 VAL A CG1  4  
ATOM 9137  C CG2  . VAL A 1 129 ? 4.952   -8.018  -0.803  2.00 0.00 ? 148 VAL A CG2  4  
ATOM 9138  H H    . VAL A 1 129 ? 2.942   -7.974  0.288   1.00 0.00 ? 148 VAL A H    4  
ATOM 9139  H HA   . VAL A 1 129 ? 4.739   -9.300  2.175   1.00 0.00 ? 148 VAL A HA   4  
ATOM 9140  H HB   . VAL A 1 129 ? 6.079   -7.217  0.812   1.00 0.00 ? 148 VAL A HB   4  
ATOM 9141  H HG11 . VAL A 1 129 ? 6.686   -9.679  1.578   1.00 0.00 ? 148 VAL A HG11 4  
ATOM 9142  H HG12 . VAL A 1 129 ? 7.564   -8.881  0.273   1.00 0.00 ? 148 VAL A HG12 4  
ATOM 9143  H HG13 . VAL A 1 129 ? 6.290   -10.044 -0.103  1.00 0.00 ? 148 VAL A HG13 4  
ATOM 9144  H HG21 . VAL A 1 129 ? 5.727   -7.844  -1.534  1.00 0.00 ? 148 VAL A HG21 4  
ATOM 9145  H HG22 . VAL A 1 129 ? 4.259   -7.191  -0.809  1.00 0.00 ? 148 VAL A HG22 4  
ATOM 9146  H HG23 . VAL A 1 129 ? 4.427   -8.930  -1.046  1.00 0.00 ? 148 VAL A HG23 4  
ATOM 9147  N N    . ASN A 1 130 ? 4.423   -7.544  3.930   1.00 0.00 ? 149 ASN A N    4  
ATOM 9148  C CA   . ASN A 1 130 ? 4.409   -6.519  4.971   1.00 0.00 ? 149 ASN A CA   4  
ATOM 9149  C C    . ASN A 1 130 ? 5.812   -6.010  5.287   1.00 0.00 ? 149 ASN A C    4  
ATOM 9150  O O    . ASN A 1 130 ? 6.785   -6.767  5.265   1.00 0.00 ? 149 ASN A O    4  
ATOM 9151  C CB   . ASN A 1 130 ? 3.754   -7.065  6.241   1.00 0.00 ? 149 ASN A CB   4  
ATOM 9152  C CG   . ASN A 1 130 ? 2.241   -6.983  6.200   1.00 0.00 ? 149 ASN A CG   4  
ATOM 9153  O OD1  . ASN A 1 130 ? 1.614   -6.419  7.097   1.00 0.00 ? 149 ASN A OD1  4  
ATOM 9154  N ND2  . ASN A 1 130 ? 1.646   -7.546  5.155   4.00 0.00 ? 149 ASN A ND2  4  
ATOM 9155  H H    . ASN A 1 130 ? 4.352   -8.487  4.187   1.00 0.00 ? 149 ASN A H    4  
ATOM 9156  H HA   . ASN A 1 130 ? 3.818   -5.693  4.606   1.00 0.00 ? 149 ASN A HA   4  
ATOM 9157  H HB2  . ASN A 1 130 ? 4.036   -8.102  6.366   2.00 0.00 ? 149 ASN A HB2  4  
ATOM 9158  H HB3  . ASN A 1 130 ? 4.104   -6.496  7.092   2.00 0.00 ? 149 ASN A HB3  4  
ATOM 9159  H HD21 . ASN A 1 130 ? 2.211   -7.978  4.477   5.00 0.00 ? 149 ASN A HD21 4  
ATOM 9160  H HD22 . ASN A 1 130 ? 0.665   -7.507  5.103   5.00 0.00 ? 149 ASN A HD22 4  
ATOM 9161  N N    . ARG A 1 131 ? 5.897   -4.711  5.577   1.00 0.00 ? 150 ARG A N    4  
ATOM 9162  C CA   . ARG A 1 131 ? 7.164   -4.060  5.898   1.00 0.00 ? 150 ARG A CA   4  
ATOM 9163  C C    . ARG A 1 131 ? 7.825   -4.689  7.123   1.00 0.00 ? 150 ARG A C    4  
ATOM 9164  O O    . ARG A 1 131 ? 8.911   -4.278  7.530   1.00 0.00 ? 150 ARG A O    4  
ATOM 9165  C CB   . ARG A 1 131 ? 6.935   -2.568  6.149   1.00 0.00 ? 150 ARG A CB   4  
ATOM 9166  C CG   . ARG A 1 131 ? 6.795   -1.745  4.880   1.00 0.00 ? 150 ARG A CG   4  
ATOM 9167  C CD   . ARG A 1 131 ? 8.137   -1.253  4.364   1.00 0.00 ? 150 ARG A CD   4  
ATOM 9168  N NE   . ARG A 1 131 ? 9.007   -0.802  5.447   1.00 0.00 ? 150 ARG A NE   4  
ATOM 9169  C CZ   . ARG A 1 131 ? 10.234  -0.327  5.257   4.00 0.00 ? 150 ARG A CZ   4  
ATOM 9170  N NH1  . ARG A 1 131 ? 10.738  -0.240  4.033   5.00 0.00 ? 150 ARG A NH1  4  
ATOM 9171  N NH2  . ARG A 1 131 ? 10.969  0.067   6.288   5.00 0.00 ? 150 ARG A NH2  4  
ATOM 9172  H H    . ARG A 1 131 ? 5.078   -4.173  5.573   1.00 0.00 ? 150 ARG A H    4  
ATOM 9173  H HA   . ARG A 1 131 ? 7.821   -4.176  5.050   1.00 0.00 ? 150 ARG A HA   4  
ATOM 9174  H HB2  . ARG A 1 131 ? 6.031   -2.448  6.731   2.00 0.00 ? 150 ARG A HB2  4  
ATOM 9175  H HB3  . ARG A 1 131 ? 7.770   -2.178  6.715   2.00 0.00 ? 150 ARG A HB3  4  
ATOM 9176  H HG2  . ARG A 1 131 ? 6.331   -2.354  4.119   2.00 0.00 ? 150 ARG A HG2  4  
ATOM 9177  H HG3  . ARG A 1 131 ? 6.166   -0.890  5.087   2.00 0.00 ? 150 ARG A HG3  4  
ATOM 9178  H HD2  . ARG A 1 131 ? 8.624   -2.061  3.837   2.00 0.00 ? 150 ARG A HD2  4  
ATOM 9179  H HD3  . ARG A 1 131 ? 7.968   -0.432  3.684   2.00 0.00 ? 150 ARG A HD3  4  
ATOM 9180  H HE   . ARG A 1 131 ? 8.658   -0.856  6.361   1.00 0.00 ? 150 ARG A HE   4  
ATOM 9181  H HH11 . ARG A 1 131 ? 10.194  -0.532  3.246   5.00 0.00 ? 150 ARG A HH11 4  
ATOM 9182  H HH12 . ARG A 1 131 ? 11.661  0.118   3.896   5.00 0.00 ? 150 ARG A HH12 4  
ATOM 9183  H HH21 . ARG A 1 131 ? 10.599  0.007   7.217   5.00 0.00 ? 150 ARG A HH21 4  
ATOM 9184  H HH22 . ARG A 1 131 ? 11.890  0.422   6.139   5.00 0.00 ? 150 ARG A HH22 4  
ATOM 9185  N N    . ASP A 1 132 ? 7.169   -5.685  7.706   1.00 0.00 ? 151 ASP A N    4  
ATOM 9186  C CA   . ASP A 1 132 ? 7.701   -6.363  8.878   1.00 0.00 ? 151 ASP A CA   4  
ATOM 9187  C C    . ASP A 1 132 ? 8.462   -7.612  8.461   1.00 0.00 ? 151 ASP A C    4  
ATOM 9188  O O    . ASP A 1 132 ? 8.713   -8.502  9.273   1.00 0.00 ? 151 ASP A O    4  
ATOM 9189  C CB   . ASP A 1 132 ? 6.571   -6.734  9.840   1.00 0.00 ? 151 ASP A CB   4  
ATOM 9190  C CG   . ASP A 1 132 ? 6.941   -6.579  11.302  1.00 0.00 ? 151 ASP A CG   4  
ATOM 9191  O OD1  . ASP A 1 132 ? 6.855   -5.446  11.819  1.00 0.00 ? 151 ASP A OD1  4  
ATOM 9192  O OD2  . ASP A 1 132 ? 7.316   -7.592  11.929  1.00 0.00 ? 151 ASP A OD2  4  
ATOM 9193  H H    . ASP A 1 132 ? 6.311   -5.974  7.336   1.00 0.00 ? 151 ASP A H    4  
ATOM 9194  H HA   . ASP A 1 132 ? 8.381   -5.688  9.375   1.00 0.00 ? 151 ASP A HA   4  
ATOM 9195  H HB2  . ASP A 1 132 ? 5.717   -6.101  9.638   2.00 0.00 ? 151 ASP A HB2  4  
ATOM 9196  H HB3  . ASP A 1 132 ? 6.289   -7.764  9.670   2.00 0.00 ? 151 ASP A HB3  4  
ATOM 9197  N N    . GLY A 1 133 ? 8.821   -7.668  7.184   1.00 0.00 ? 152 GLY A N    4  
ATOM 9198  C CA   . GLY A 1 133 ? 9.545   -8.811  6.672   1.00 0.00 ? 152 GLY A CA   4  
ATOM 9199  C C    . GLY A 1 133 ? 8.683   -10.051 6.573   1.00 0.00 ? 152 GLY A C    4  
ATOM 9200  O O    . GLY A 1 133 ? 9.157   -11.167 6.787   1.00 0.00 ? 152 GLY A O    4  
ATOM 9201  H H    . GLY A 1 133 ? 8.588   -6.929  6.584   1.00 0.00 ? 152 GLY A H    4  
ATOM 9202  H HA2  . GLY A 1 133 ? 9.930   -8.572  5.690   2.00 0.00 ? 152 GLY A HA2  4  
ATOM 9203  H HA3  . GLY A 1 133 ? 10.374  -9.016  7.331   2.00 0.00 ? 152 GLY A HA3  4  
ATOM 9204  N N    . THR A 1 134 ? 7.409   -9.854  6.251   1.00 0.00 ? 153 THR A N    4  
ATOM 9205  C CA   . THR A 1 134 ? 6.473   -10.964 6.129   1.00 0.00 ? 153 THR A CA   4  
ATOM 9206  C C    . THR A 1 134 ? 5.913   -11.059 4.715   1.00 0.00 ? 153 THR A C    4  
ATOM 9207  O O    . THR A 1 134 ? 5.822   -10.059 4.002   1.00 0.00 ? 153 THR A O    4  
ATOM 9208  C CB   . THR A 1 134 ? 5.309   -10.824 7.125   1.00 0.00 ? 153 THR A CB   4  
ATOM 9209  O OG1  . THR A 1 134 ? 5.152   -9.452  7.509   1.00 0.00 ? 153 THR A OG1  4  
ATOM 9210  C CG2  . THR A 1 134 ? 5.549   -11.676 8.362   1.00 0.00 ? 153 THR A CG2  4  
ATOM 9211  H H    . THR A 1 134 ? 7.090   -8.938  6.095   1.00 0.00 ? 153 THR A H    4  
ATOM 9212  H HA   . THR A 1 134 ? 7.006   -11.876 6.356   1.00 0.00 ? 153 THR A HA   4  
ATOM 9213  H HB   . THR A 1 134 ? 4.401   -11.161 6.645   1.00 0.00 ? 153 THR A HB   4  
ATOM 9214  H HG1  . THR A 1 134 ? 5.069   -9.394  8.463   1.00 0.00 ? 153 THR A HG1  4  
ATOM 9215  H HG21 . THR A 1 134 ? 6.414   -11.304 8.893   1.00 0.00 ? 153 THR A HG21 4  
ATOM 9216  H HG22 . THR A 1 134 ? 5.721   -12.700 8.066   1.00 0.00 ? 153 THR A HG22 4  
ATOM 9217  H HG23 . THR A 1 134 ? 4.684   -11.628 9.006   1.00 0.00 ? 153 THR A HG23 4  
ATOM 9218  N N    . ARG A 1 135 ? 5.537   -12.269 4.313   1.00 0.00 ? 154 ARG A N    4  
ATOM 9219  C CA   . ARG A 1 135 ? 4.986   -12.496 2.982   1.00 0.00 ? 154 ARG A CA   4  
ATOM 9220  C C    . ARG A 1 135 ? 3.948   -13.613 3.004   1.00 0.00 ? 154 ARG A C    4  
ATOM 9221  O O    . ARG A 1 135 ? 4.274   -14.774 3.252   1.00 0.00 ? 154 ARG A O    4  
ATOM 9222  C CB   . ARG A 1 135 ? 6.105   -12.845 1.999   1.00 0.00 ? 154 ARG A CB   4  
ATOM 9223  C CG   . ARG A 1 135 ? 7.104   -13.858 2.534   1.00 0.00 ? 154 ARG A CG   4  
ATOM 9224  C CD   . ARG A 1 135 ? 8.505   -13.279 2.638   1.00 0.00 ? 154 ARG A CD   4  
ATOM 9225  N NE   . ARG A 1 135 ? 9.530   -14.254 2.274   1.00 0.00 ? 154 ARG A NE   4  
ATOM 9226  C CZ   . ARG A 1 135 ? 10.034  -14.370 1.051   4.00 0.00 ? 154 ARG A CZ   4  
ATOM 9227  N NH1  . ARG A 1 135 ? 9.614   -13.579 0.074   5.00 0.00 ? 154 ARG A NH1  4  
ATOM 9228  N NH2  . ARG A 1 135 ? 10.965  -15.280 0.792   5.00 0.00 ? 154 ARG A NH2  4  
ATOM 9229  H H    . ARG A 1 135 ? 5.635   -13.028 4.925   1.00 0.00 ? 154 ARG A H    4  
ATOM 9230  H HA   . ARG A 1 135 ? 4.509   -11.582 2.661   1.00 0.00 ? 154 ARG A HA   4  
ATOM 9231  H HB2  . ARG A 1 135 ? 5.664   -13.248 1.099   2.00 0.00 ? 154 ARG A HB2  4  
ATOM 9232  H HB3  . ARG A 1 135 ? 6.641   -11.942 1.747   2.00 0.00 ? 154 ARG A HB3  4  
ATOM 9233  H HG2  . ARG A 1 135 ? 6.784   -14.178 3.516   2.00 0.00 ? 154 ARG A HG2  4  
ATOM 9234  H HG3  . ARG A 1 135 ? 7.128   -14.711 1.868   2.00 0.00 ? 154 ARG A HG3  4  
ATOM 9235  H HD2  . ARG A 1 135 ? 8.580   -12.429 1.976   2.00 0.00 ? 154 ARG A HD2  4  
ATOM 9236  H HD3  . ARG A 1 135 ? 8.674   -12.958 3.656   2.00 0.00 ? 154 ARG A HD3  4  
ATOM 9237  H HE   . ARG A 1 135 ? 9.858   -14.852 2.979   1.00 0.00 ? 154 ARG A HE   4  
ATOM 9238  H HH11 . ARG A 1 135 ? 8.914   -12.888 0.256   5.00 0.00 ? 154 ARG A HH11 4  
ATOM 9239  H HH12 . ARG A 1 135 ? 9.998   -13.671 -0.845  5.00 0.00 ? 154 ARG A HH12 4  
ATOM 9240  H HH21 . ARG A 1 135 ? 11.290  -15.882 1.521   5.00 0.00 ? 154 ARG A HH21 4  
ATOM 9241  H HH22 . ARG A 1 135 ? 11.340  -15.363 -0.131  5.00 0.00 ? 154 ARG A HH22 4  
ATOM 9242  N N    . TYR A 1 136 ? 2.695   -13.255 2.739   1.00 0.00 ? 155 TYR A N    4  
ATOM 9243  C CA   . TYR A 1 136 ? 1.608   -14.228 2.725   1.00 0.00 ? 155 TYR A CA   4  
ATOM 9244  C C    . TYR A 1 136 ? 1.044   -14.383 1.318   1.00 0.00 ? 155 TYR A C    4  
ATOM 9245  O O    . TYR A 1 136 ? 0.498   -13.437 0.749   1.00 0.00 ? 155 TYR A O    4  
ATOM 9246  C CB   . TYR A 1 136 ? 0.497   -13.807 3.690   1.00 0.00 ? 155 TYR A CB   4  
ATOM 9247  C CG   . TYR A 1 136 ? 0.818   -12.637 4.591   1.00 0.00 ? 155 TYR A CG   4  
ATOM 9248  C CD1  . TYR A 1 136 ? 1.933   -12.662 5.420   1.00 0.00 ? 155 TYR A CD1  4  
ATOM 9249  C CD2  . TYR A 1 136 ? 0.007   -11.506 4.614   1.00 0.00 ? 155 TYR A CD2  4  
ATOM 9250  C CE1  . TYR A 1 136 ? 2.233   -11.596 6.244   1.00 0.00 ? 155 TYR A CE1  4  
ATOM 9251  C CE2  . TYR A 1 136 ? 0.303   -10.436 5.437   1.00 0.00 ? 155 TYR A CE2  4  
ATOM 9252  C CZ   . TYR A 1 136 ? 1.416   -10.486 6.249   1.00 0.00 ? 155 TYR A CZ   4  
ATOM 9253  O OH   . TYR A 1 136 ? 1.712   -9.424  7.071   1.00 0.00 ? 155 TYR A OH   4  
ATOM 9254  H H    . TYR A 1 136 ? 2.497   -12.314 2.547   1.00 0.00 ? 155 TYR A H    4  
ATOM 9255  H HA   . TYR A 1 136 ? 2.010   -15.178 3.046   1.00 0.00 ? 155 TYR A HA   4  
ATOM 9256  H HB2  . TYR A 1 136 ? -0.379  -13.543 3.114   2.00 0.00 ? 155 TYR A HB2  4  
ATOM 9257  H HB3  . TYR A 1 136 ? 0.252   -14.648 4.324   2.00 0.00 ? 155 TYR A HB3  4  
ATOM 9258  H HD1  . TYR A 1 136 ? 2.571   -13.532 5.414   1.00 0.00 ? 155 TYR A HD1  4  
ATOM 9259  H HD2  . TYR A 1 136 ? -0.869  -11.470 3.978   1.00 0.00 ? 155 TYR A HD2  4  
ATOM 9260  H HE1  . TYR A 1 136 ? 3.104   -11.635 6.881   1.00 0.00 ? 155 TYR A HE1  4  
ATOM 9261  H HE2  . TYR A 1 136 ? -0.336  -9.566  5.440   1.00 0.00 ? 155 TYR A HE2  4  
ATOM 9262  H HH   . TYR A 1 136 ? 2.665   -9.341  7.156   1.00 0.00 ? 155 TYR A HH   4  
ATOM 9263  N N    . VAL A 1 137 ? 1.183   -15.580 0.759   1.00 0.00 ? 156 VAL A N    4  
ATOM 9264  C CA   . VAL A 1 137 ? 0.693   -15.856 -0.584  1.00 0.00 ? 156 VAL A CA   4  
ATOM 9265  C C    . VAL A 1 137 ? -0.707  -16.461 -0.552  1.00 0.00 ? 156 VAL A C    4  
ATOM 9266  O O    . VAL A 1 137 ? -0.997  -17.343 0.255   1.00 0.00 ? 156 VAL A O    4  
ATOM 9267  C CB   . VAL A 1 137 ? 1.634   -16.815 -1.336  1.00 0.00 ? 156 VAL A CB   4  
ATOM 9268  C CG1  . VAL A 1 137 ? 1.211   -16.962 -2.789  2.00 0.00 ? 156 VAL A CG1  4  
ATOM 9269  C CG2  . VAL A 1 137 ? 3.074   -16.332 -1.260  2.00 0.00 ? 156 VAL A CG2  4  
ATOM 9270  H H    . VAL A 1 137 ? 1.631   -16.293 1.262   1.00 0.00 ? 156 VAL A H    4  
ATOM 9271  H HA   . VAL A 1 137 ? 0.659   -14.923 -1.124  1.00 0.00 ? 156 VAL A HA   4  
ATOM 9272  H HB   . VAL A 1 137 ? 1.574   -17.782 -0.863  1.00 0.00 ? 156 VAL A HB   4  
ATOM 9273  H HG11 . VAL A 1 137 ? 1.633   -16.156 -3.371  1.00 0.00 ? 156 VAL A HG11 4  
ATOM 9274  H HG12 . VAL A 1 137 ? 0.133   -16.930 -2.855  1.00 0.00 ? 156 VAL A HG12 4  
ATOM 9275  H HG13 . VAL A 1 137 ? 1.566   -17.908 -3.174  1.00 0.00 ? 156 VAL A HG13 4  
ATOM 9276  H HG21 . VAL A 1 137 ? 3.507   -16.332 -2.250  1.00 0.00 ? 156 VAL A HG21 4  
ATOM 9277  H HG22 . VAL A 1 137 ? 3.641   -16.991 -0.619  1.00 0.00 ? 156 VAL A HG22 4  
ATOM 9278  H HG23 . VAL A 1 137 ? 3.097   -15.330 -0.858  1.00 0.00 ? 156 VAL A HG23 4  
ATOM 9279  N N    . GLN A 1 138 ? -1.569  -15.981 -1.443  1.00 0.00 ? 157 GLN A N    4  
ATOM 9280  C CA   . GLN A 1 138 ? -2.939  -16.471 -1.529  1.00 0.00 ? 157 GLN A CA   4  
ATOM 9281  C C    . GLN A 1 138 ? -3.435  -16.414 -2.969  1.00 0.00 ? 157 GLN A C    4  
ATOM 9282  O O    . GLN A 1 138 ? -2.814  -15.780 -3.822  1.00 0.00 ? 157 GLN A O    4  
ATOM 9283  C CB   . GLN A 1 138 ? -3.859  -15.647 -0.625  1.00 0.00 ? 157 GLN A CB   4  
ATOM 9284  C CG   . GLN A 1 138 ? -4.224  -14.289 -1.201  1.00 0.00 ? 157 GLN A CG   4  
ATOM 9285  C CD   . GLN A 1 138 ? -5.710  -13.997 -1.128  1.00 0.00 ? 157 GLN A CD   4  
ATOM 9286  O OE1  . GLN A 1 138 ? -6.530  -14.746 -1.660  1.00 0.00 ? 157 GLN A OE1  4  
ATOM 9287  N NE2  . GLN A 1 138 ? -6.066  -12.902 -0.466  4.00 0.00 ? 157 GLN A NE2  4  
ATOM 9288  H H    . GLN A 1 138 ? -1.273  -15.281 -2.061  1.00 0.00 ? 157 GLN A H    4  
ATOM 9289  H HA   . GLN A 1 138 ? -2.946  -17.499 -1.198  1.00 0.00 ? 157 GLN A HA   4  
ATOM 9290  H HB2  . GLN A 1 138 ? -4.770  -16.202 -0.458  2.00 0.00 ? 157 GLN A HB2  4  
ATOM 9291  H HB3  . GLN A 1 138 ? -3.365  -15.491 0.323   2.00 0.00 ? 157 GLN A HB3  4  
ATOM 9292  H HG2  . GLN A 1 138 ? -3.696  -13.526 -0.650  2.00 0.00 ? 157 GLN A HG2  4  
ATOM 9293  H HG3  . GLN A 1 138 ? -3.919  -14.258 -2.235  2.00 0.00 ? 157 GLN A HG3  4  
ATOM 9294  H HE21 . GLN A 1 138 ? -5.357  -12.351 -0.066  5.00 0.00 ? 157 GLN A HE21 4  
ATOM 9295  H HE22 . GLN A 1 138 ? -7.023  -12.688 -0.402  5.00 0.00 ? 157 GLN A HE22 4  
ATOM 9296  N N    . LYS A 1 139 ? -4.552  -17.081 -3.239  1.00 0.00 ? 158 LYS A N    4  
ATOM 9297  C CA   . LYS A 1 139 ? -5.117  -17.100 -4.581  1.00 0.00 ? 158 LYS A CA   4  
ATOM 9298  C C    . LYS A 1 139 ? -6.478  -16.416 -4.615  1.00 0.00 ? 158 LYS A C    4  
ATOM 9299  O O    . LYS A 1 139 ? -7.477  -16.970 -4.155  1.00 0.00 ? 158 LYS A O    4  
ATOM 9300  C CB   . LYS A 1 139 ? -5.251  -18.535 -5.081  1.00 0.00 ? 158 LYS A CB   4  
ATOM 9301  C CG   . LYS A 1 139 ? -4.189  -18.932 -6.094  1.00 0.00 ? 158 LYS A CG   4  
ATOM 9302  C CD   . LYS A 1 139 ? -3.814  -20.400 -5.969  1.00 0.00 ? 158 LYS A CD   4  
ATOM 9303  C CE   . LYS A 1 139 ? -2.329  -20.624 -6.202  1.00 0.00 ? 158 LYS A CE   4  
ATOM 9304  N NZ   . LYS A 1 139 ? -2.045  -21.994 -6.713  1.00 0.00 ? 158 LYS A NZ   4  
ATOM 9305  H H    . LYS A 1 139 ? -5.005  -17.572 -2.522  1.00 0.00 ? 158 LYS A H    4  
ATOM 9306  H HA   . LYS A 1 139 ? -4.443  -16.564 -5.231  1.00 0.00 ? 158 LYS A HA   4  
ATOM 9307  H HB2  . LYS A 1 139 ? -5.185  -19.207 -4.238  2.00 0.00 ? 158 LYS A HB2  4  
ATOM 9308  H HB3  . LYS A 1 139 ? -6.219  -18.646 -5.543  2.00 0.00 ? 158 LYS A HB3  4  
ATOM 9309  H HG2  . LYS A 1 139 ? -4.570  -18.751 -7.088  2.00 0.00 ? 158 LYS A HG2  4  
ATOM 9310  H HG3  . LYS A 1 139 ? -3.307  -18.331 -5.930  2.00 0.00 ? 158 LYS A HG3  4  
ATOM 9311  H HD2  . LYS A 1 139 ? -4.069  -20.743 -4.978  2.00 0.00 ? 158 LYS A HD2  4  
ATOM 9312  H HD3  . LYS A 1 139 ? -4.372  -20.966 -6.700  2.00 0.00 ? 158 LYS A HD3  4  
ATOM 9313  H HE2  . LYS A 1 139 ? -1.977  -19.901 -6.923  2.00 0.00 ? 158 LYS A HE2  4  
ATOM 9314  H HE3  . LYS A 1 139 ? -1.806  -20.483 -5.268  2.00 0.00 ? 158 LYS A HE3  4  
ATOM 9315  H HZ1  . LYS A 1 139 ? -1.863  -21.962 -7.736  1.00 0.00 ? 158 LYS A HZ1  4  
ATOM 9316  H HZ2  . LYS A 1 139 ? -2.859  -22.616 -6.537  1.00 0.00 ? 158 LYS A HZ2  4  
ATOM 9317  H HZ3  . LYS A 1 139 ? -1.211  -22.388 -6.234  1.00 0.00 ? 158 LYS A HZ3  4  
ATOM 9318  N N    . GLY A 1 140 ? -6.509  -15.211 -5.169  1.00 0.00 ? 159 GLY A N    4  
ATOM 9319  C CA   . GLY A 1 140 ? -7.751  -14.468 -5.263  1.00 0.00 ? 159 GLY A CA   4  
ATOM 9320  C C    . GLY A 1 140 ? -7.860  -13.689 -6.560  1.00 0.00 ? 159 GLY A C    4  
ATOM 9321  O O    . GLY A 1 140 ? -7.508  -14.191 -7.627  1.00 0.00 ? 159 GLY A O    4  
ATOM 9322  H H    . GLY A 1 140 ? -5.680  -14.824 -5.519  1.00 0.00 ? 159 GLY A H    4  
ATOM 9323  H HA2  . GLY A 1 140 ? -8.578  -15.161 -5.201  2.00 0.00 ? 159 GLY A HA2  4  
ATOM 9324  H HA3  . GLY A 1 140 ? -7.808  -13.777 -4.433  2.00 0.00 ? 159 GLY A HA3  4  
ATOM 9325  N N    . GLU A 1 141 ? -8.349  -12.458 -6.463  1.00 0.00 ? 160 GLU A N    4  
ATOM 9326  C CA   . GLU A 1 141 ? -8.507  -11.596 -7.630  1.00 0.00 ? 160 GLU A CA   4  
ATOM 9327  C C    . GLU A 1 141 ? -8.879  -10.186 -7.193  1.00 0.00 ? 160 GLU A C    4  
ATOM 9328  O O    . GLU A 1 141 ? -9.658  -10.008 -6.258  1.00 0.00 ? 160 GLU A O    4  
ATOM 9329  C CB   . GLU A 1 141 ? -9.580  -12.158 -8.565  1.00 0.00 ? 160 GLU A CB   4  
ATOM 9330  C CG   . GLU A 1 141 ? -9.022  -12.810 -9.820  1.00 0.00 ? 160 GLU A CG   4  
ATOM 9331  C CD   . GLU A 1 141 ? -10.037 -12.889 -10.944 1.00 0.00 ? 160 GLU A CD   4  
ATOM 9332  O OE1  . GLU A 1 141 ? -10.167 -11.901 -11.697 1.00 0.00 ? 160 GLU A OE1  4  
ATOM 9333  O OE2  . GLU A 1 141 ? -10.702 -13.939 -11.071 1.00 0.00 ? 160 GLU A OE2  4  
ATOM 9334  H H    . GLU A 1 141 ? -8.609  -12.118 -5.583  1.00 0.00 ? 160 GLU A H    4  
ATOM 9335  H HA   . GLU A 1 141 ? -7.562  -11.565 -8.153  1.00 0.00 ? 160 GLU A HA   4  
ATOM 9336  H HB2  . GLU A 1 141 ? -10.156 -12.897 -8.028  2.00 0.00 ? 160 GLU A HB2  4  
ATOM 9337  H HB3  . GLU A 1 141 ? -10.234 -11.354 -8.865  2.00 0.00 ? 160 GLU A HB3  4  
ATOM 9338  H HG2  . GLU A 1 141 ? -8.174  -12.235 -10.162 2.00 0.00 ? 160 GLU A HG2  4  
ATOM 9339  H HG3  . GLU A 1 141 ? -8.700  -13.812 -9.577  2.00 0.00 ? 160 GLU A HG3  4  
ATOM 9340  N N    . TYR A 1 142 ? -8.318  -9.184  -7.862  1.00 0.00 ? 161 TYR A N    4  
ATOM 9341  C CA   . TYR A 1 142 ? -8.600  -7.795  -7.514  1.00 0.00 ? 161 TYR A CA   4  
ATOM 9342  C C    . TYR A 1 142 ? -7.927  -6.823  -8.482  1.00 0.00 ? 161 TYR A C    4  
ATOM 9343  O O    . TYR A 1 142 ? -8.463  -5.753  -8.768  1.00 0.00 ? 161 TYR A O    4  
ATOM 9344  C CB   . TYR A 1 142 ? -8.141  -7.509  -6.081  1.00 0.00 ? 161 TYR A CB   4  
ATOM 9345  C CG   . TYR A 1 142 ? -6.666  -7.744  -5.824  1.00 0.00 ? 161 TYR A CG   4  
ATOM 9346  C CD1  . TYR A 1 142 ? -5.938  -8.656  -6.583  1.00 0.00 ? 161 TYR A CD1  4  
ATOM 9347  C CD2  . TYR A 1 142 ? -5.999  -7.048  -4.824  1.00 0.00 ? 161 TYR A CD2  4  
ATOM 9348  C CE1  . TYR A 1 142 ? -4.593  -8.864  -6.352  1.00 0.00 ? 161 TYR A CE1  4  
ATOM 9349  C CE2  . TYR A 1 142 ? -4.654  -7.253  -4.588  1.00 0.00 ? 161 TYR A CE2  4  
ATOM 9350  C CZ   . TYR A 1 142 ? -3.956  -8.160  -5.354  1.00 0.00 ? 161 TYR A CZ   4  
ATOM 9351  O OH   . TYR A 1 142 ? -2.616  -8.363  -5.123  1.00 0.00 ? 161 TYR A OH   4  
ATOM 9352  H H    . TYR A 1 142 ? -7.699  -9.381  -8.597  1.00 0.00 ? 161 TYR A H    4  
ATOM 9353  H HA   . TYR A 1 142 ? -9.668  -7.654  -7.572  1.00 0.00 ? 161 TYR A HA   4  
ATOM 9354  H HB2  . TYR A 1 142 ? -8.353  -6.475  -5.846  2.00 0.00 ? 161 TYR A HB2  4  
ATOM 9355  H HB3  . TYR A 1 142 ? -8.696  -8.143  -5.403  2.00 0.00 ? 161 TYR A HB3  4  
ATOM 9356  H HD1  . TYR A 1 142 ? -6.438  -9.210  -7.362  1.00 0.00 ? 161 TYR A HD1  4  
ATOM 9357  H HD2  . TYR A 1 142 ? -6.548  -6.340  -4.222  1.00 0.00 ? 161 TYR A HD2  4  
ATOM 9358  H HE1  . TYR A 1 142 ? -4.046  -9.576  -6.953  1.00 0.00 ? 161 TYR A HE1  4  
ATOM 9359  H HE2  . TYR A 1 142 ? -4.155  -6.703  -3.804  1.00 0.00 ? 161 TYR A HE2  4  
ATOM 9360  H HH   . TYR A 1 142 ? -2.118  -8.153  -5.917  1.00 0.00 ? 161 TYR A HH   4  
ATOM 9361  N N    . ARG A 1 143 ? -6.754  -7.197  -8.981  1.00 0.00 ? 162 ARG A N    4  
ATOM 9362  C CA   . ARG A 1 143 ? -6.017  -6.349  -9.911  1.00 0.00 ? 162 ARG A CA   4  
ATOM 9363  C C    . ARG A 1 143 ? -6.224  -6.808  -11.350 1.00 0.00 ? 162 ARG A C    4  
ATOM 9364  O O    . ARG A 1 143 ? -5.359  -7.460  -11.935 1.00 0.00 ? 162 ARG A O    4  
ATOM 9365  C CB   . ARG A 1 143 ? -4.526  -6.353  -9.570  1.00 0.00 ? 162 ARG A CB   4  
ATOM 9366  C CG   . ARG A 1 143 ? -3.760  -5.161  -10.118 1.00 0.00 ? 162 ARG A CG   4  
ATOM 9367  C CD   . ARG A 1 143 ? -2.352  -5.536  -10.554 1.00 0.00 ? 162 ARG A CD   4  
ATOM 9368  N NE   . ARG A 1 143 ? -2.098  -5.175  -11.945 1.00 0.00 ? 162 ARG A NE   4  
ATOM 9369  C CZ   . ARG A 1 143 ? -0.979  -5.486  -12.594 4.00 0.00 ? 162 ARG A CZ   4  
ATOM 9370  N NH1  . ARG A 1 143 ? -0.013  -6.157  -11.981 5.00 0.00 ? 162 ARG A NH1  4  
ATOM 9371  N NH2  . ARG A 1 143 ? -0.817  -5.126  -13.859 5.00 0.00 ? 162 ARG A NH2  4  
ATOM 9372  H H    . ARG A 1 143 ? -6.373  -8.060  -8.717  1.00 0.00 ? 162 ARG A H    4  
ATOM 9373  H HA   . ARG A 1 143 ? -6.395  -5.342  -9.811  1.00 0.00 ? 162 ARG A HA   4  
ATOM 9374  H HB2  . ARG A 1 143 ? -4.415  -6.361  -8.496  2.00 0.00 ? 162 ARG A HB2  4  
ATOM 9375  H HB3  . ARG A 1 143 ? -4.081  -7.254  -9.970  2.00 0.00 ? 162 ARG A HB3  4  
ATOM 9376  H HG2  . ARG A 1 143 ? -4.294  -4.765  -10.970 2.00 0.00 ? 162 ARG A HG2  4  
ATOM 9377  H HG3  . ARG A 1 143 ? -3.698  -4.403  -9.351  2.00 0.00 ? 162 ARG A HG3  4  
ATOM 9378  H HD2  . ARG A 1 143 ? -1.644  -5.018  -9.922  2.00 0.00 ? 162 ARG A HD2  4  
ATOM 9379  H HD3  . ARG A 1 143 ? -2.224  -6.601  -10.438 2.00 0.00 ? 162 ARG A HD3  4  
ATOM 9380  H HE   . ARG A 1 143 ? -2.795  -4.677  -12.420 1.00 0.00 ? 162 ARG A HE   4  
ATOM 9381  H HH11 . ARG A 1 143 ? -0.124  -6.433  -11.027 5.00 0.00 ? 162 ARG A HH11 4  
ATOM 9382  H HH12 . ARG A 1 143 ? 0.826   -6.387  -12.475 5.00 0.00 ? 162 ARG A HH12 4  
ATOM 9383  H HH21 . ARG A 1 143 ? -1.537  -4.619  -14.332 5.00 0.00 ? 162 ARG A HH21 4  
ATOM 9384  H HH22 . ARG A 1 143 ? 0.027   -5.363  -14.342 5.00 0.00 ? 162 ARG A HH22 4  
ATOM 9385  N N    . THR A 1 144 ? -7.376  -6.462  -11.916 1.00 0.00 ? 163 THR A N    4  
ATOM 9386  C CA   . THR A 1 144 ? -7.697  -6.836  -13.286 1.00 0.00 ? 163 THR A CA   4  
ATOM 9387  C C    . THR A 1 144 ? -7.190  -5.788  -14.272 1.00 0.00 ? 163 THR A C    4  
ATOM 9388  O O    . THR A 1 144 ? -7.945  -4.920  -14.711 1.00 0.00 ? 163 THR A O    4  
ATOM 9389  C CB   . THR A 1 144 ? -9.214  -7.015  -13.480 1.00 0.00 ? 163 THR A CB   4  
ATOM 9390  O OG1  . THR A 1 144 ? -9.912  -6.594  -12.302 1.00 0.00 ? 163 THR A OG1  4  
ATOM 9391  C CG2  . THR A 1 144 ? -9.553  -8.467  -13.784 1.00 0.00 ? 163 THR A CG2  4  
ATOM 9392  H H    . THR A 1 144 ? -8.025  -5.941  -11.398 1.00 0.00 ? 163 THR A H    4  
ATOM 9393  H HA   . THR A 1 144 ? -7.214  -7.780  -13.496 1.00 0.00 ? 163 THR A HA   4  
ATOM 9394  H HB   . THR A 1 144 ? -9.530  -6.406  -14.314 1.00 0.00 ? 163 THR A HB   4  
ATOM 9395  H HG1  . THR A 1 144 ? -9.517  -7.007  -11.530 1.00 0.00 ? 163 THR A HG1  4  
ATOM 9396  H HG21 . THR A 1 144 ? -10.413 -8.765  -13.201 1.00 0.00 ? 163 THR A HG21 4  
ATOM 9397  H HG22 . THR A 1 144 ? -8.711  -9.094  -13.530 1.00 0.00 ? 163 THR A HG22 4  
ATOM 9398  H HG23 . THR A 1 144 ? -9.776  -8.572  -14.835 1.00 0.00 ? 163 THR A HG23 4  
ATOM 9399  N N    . ASN A 1 145 ? -5.908  -5.870  -14.614 1.00 0.00 ? 164 ASN A N    4  
ATOM 9400  C CA   . ASN A 1 145 ? -5.306  -4.923  -15.547 1.00 0.00 ? 164 ASN A CA   4  
ATOM 9401  C C    . ASN A 1 145 ? -4.158  -5.563  -16.321 1.00 0.00 ? 164 ASN A C    4  
ATOM 9402  O O    . ASN A 1 145 ? -2.992  -5.433  -15.946 1.00 0.00 ? 164 ASN A O    4  
ATOM 9403  C CB   . ASN A 1 145 ? -4.803  -3.688  -14.794 1.00 0.00 ? 164 ASN A CB   4  
ATOM 9404  C CG   . ASN A 1 145 ? -4.107  -2.676  -15.682 1.00 0.00 ? 164 ASN A CG   4  
ATOM 9405  O OD1  . ASN A 1 145 ? -4.537  -2.418  -16.806 1.00 0.00 ? 164 ASN A OD1  4  
ATOM 9406  N ND2  . ASN A 1 145 ? -3.023  -2.095  -15.179 4.00 0.00 ? 164 ASN A ND2  4  
ATOM 9407  H H    . ASN A 1 145 ? -5.353  -6.582  -14.231 1.00 0.00 ? 164 ASN A H    4  
ATOM 9408  H HA   . ASN A 1 145 ? -6.069  -4.618  -16.246 1.00 0.00 ? 164 ASN A HA   4  
ATOM 9409  H HB2  . ASN A 1 145 ? -5.644  -3.200  -14.319 2.00 0.00 ? 164 ASN A HB2  4  
ATOM 9410  H HB3  . ASN A 1 145 ? -4.105  -4.004  -14.031 2.00 0.00 ? 164 ASN A HB3  4  
ATOM 9411  H HD21 . ASN A 1 145 ? -2.737  -2.350  -14.274 5.00 0.00 ? 164 ASN A HD21 4  
ATOM 9412  H HD22 . ASN A 1 145 ? -2.551  -1.434  -15.733 5.00 0.00 ? 164 ASN A HD22 4  
ATOM 9413  N N    . PRO A 1 146 ? -4.476  -6.263  -17.422 1.00 0.00 ? 165 PRO A N    4  
ATOM 9414  C CA   . PRO A 1 146 ? -3.477  -6.924  -18.261 1.00 0.00 ? 165 PRO A CA   4  
ATOM 9415  C C    . PRO A 1 146 ? -2.817  -5.965  -19.244 1.00 0.00 ? 165 PRO A C    4  
ATOM 9416  O O    . PRO A 1 146 ? -3.335  -5.730  -20.336 1.00 0.00 ? 165 PRO A O    4  
ATOM 9417  C CB   . PRO A 1 146 ? -4.301  -7.969  -19.008 1.00 0.00 ? 165 PRO A CB   4  
ATOM 9418  C CG   . PRO A 1 146 ? -5.656  -7.355  -19.141 1.00 0.00 ? 165 PRO A CG   4  
ATOM 9419  C CD   . PRO A 1 146 ? -5.840  -6.462  -17.940 1.00 0.00 ? 165 PRO A CD   4  
ATOM 9420  H HA   . PRO A 1 146 ? -2.718  -7.418  -17.670 1.00 0.00 ? 165 PRO A HA   4  
ATOM 9421  H HB2  . PRO A 1 146 ? -3.856  -8.158  -19.974 2.00 0.00 ? 165 PRO A HB2  4  
ATOM 9422  H HB3  . PRO A 1 146 ? -4.333  -8.883  -18.435 2.00 0.00 ? 165 PRO A HB3  4  
ATOM 9423  H HG2  . PRO A 1 146 ? -5.705  -6.773  -20.050 2.00 0.00 ? 165 PRO A HG2  4  
ATOM 9424  H HG3  . PRO A 1 146 ? -6.408  -8.129  -19.151 2.00 0.00 ? 165 PRO A HG3  4  
ATOM 9425  H HD2  . PRO A 1 146 ? -6.278  -5.521  -18.237 2.00 0.00 ? 165 PRO A HD2  4  
ATOM 9426  H HD3  . PRO A 1 146 ? -6.462  -6.949  -17.203 2.00 0.00 ? 165 PRO A HD3  4  
ATOM 9427  N N    . GLU A 1 147 ? -1.665  -5.424  -18.857 1.00 0.00 ? 166 GLU A N    4  
ATOM 9428  C CA   . GLU A 1 147 ? -0.926  -4.506  -19.714 1.00 0.00 ? 166 GLU A CA   4  
ATOM 9429  C C    . GLU A 1 147 ? -0.288  -5.284  -20.850 1.00 0.00 ? 166 GLU A C    4  
ATOM 9430  O O    . GLU A 1 147 ? 0.935   -5.350  -20.969 1.00 0.00 ? 166 GLU A O    4  
ATOM 9431  C CB   . GLU A 1 147 ? 0.145   -3.764  -18.912 1.00 0.00 ? 166 GLU A CB   4  
ATOM 9432  C CG   . GLU A 1 147 ? -0.250  -2.354  -18.504 1.00 0.00 ? 166 GLU A CG   4  
ATOM 9433  C CD   . GLU A 1 147 ? 0.623   -1.796  -17.397 1.00 0.00 ? 166 GLU A CD   4  
ATOM 9434  O OE1  . GLU A 1 147 ? 0.534   -2.303  -16.259 1.00 0.00 ? 166 GLU A OE1  4  
ATOM 9435  O OE2  . GLU A 1 147 ? 1.397   -0.855  -17.668 1.00 0.00 ? 166 GLU A OE2  4  
ATOM 9436  H H    . GLU A 1 147 ? -1.299  -5.658  -17.984 1.00 0.00 ? 166 GLU A H    4  
ATOM 9437  H HA   . GLU A 1 147 ? -1.624  -3.795  -20.125 1.00 0.00 ? 166 GLU A HA   4  
ATOM 9438  H HB2  . GLU A 1 147 ? 0.360   -4.326  -18.015 2.00 0.00 ? 166 GLU A HB2  4  
ATOM 9439  H HB3  . GLU A 1 147 ? 1.044   -3.702  -19.508 2.00 0.00 ? 166 GLU A HB3  4  
ATOM 9440  H HG2  . GLU A 1 147 ? -0.168  -1.706  -19.367 2.00 0.00 ? 166 GLU A HG2  4  
ATOM 9441  H HG3  . GLU A 1 147 ? -1.275  -2.366  -18.161 2.00 0.00 ? 166 GLU A HG3  4  
ATOM 9442  N N    . ASP A 1 148 ? -1.139  -5.901  -21.659 1.00 0.00 ? 167 ASP A N    4  
ATOM 9443  C CA   . ASP A 1 148 ? -0.690  -6.721  -22.773 1.00 0.00 ? 167 ASP A CA   4  
ATOM 9444  C C    . ASP A 1 148 ? -0.357  -8.109  -22.252 1.00 0.00 ? 167 ASP A C    4  
ATOM 9445  O O    . ASP A 1 148 ? 0.467   -8.827  -22.819 1.00 0.00 ? 167 ASP A O    4  
ATOM 9446  C CB   . ASP A 1 148 ? 0.530   -6.101  -23.457 1.00 0.00 ? 167 ASP A CB   4  
ATOM 9447  C CG   . ASP A 1 148 ? 0.398   -6.064  -24.967 1.00 0.00 ? 167 ASP A CG   4  
ATOM 9448  O OD1  . ASP A 1 148 ? -0.211  -5.103  -25.485 1.00 0.00 ? 167 ASP A OD1  4  
ATOM 9449  O OD2  . ASP A 1 148 ? 0.901   -6.994  -25.631 1.00 0.00 ? 167 ASP A OD2  4  
ATOM 9450  H H    . ASP A 1 148 ? -2.098  -5.824  -21.479 1.00 0.00 ? 167 ASP A H    4  
ATOM 9451  H HA   . ASP A 1 148 ? -1.501  -6.796  -23.482 1.00 0.00 ? 167 ASP A HA   4  
ATOM 9452  H HB2  . ASP A 1 148 ? 0.658   -5.087  -23.101 2.00 0.00 ? 167 ASP A HB2  4  
ATOM 9453  H HB3  . ASP A 1 148 ? 1.408   -6.680  -23.207 2.00 0.00 ? 167 ASP A HB3  4  
ATOM 9454  N N    . ILE A 1 149 ? -1.014  -8.469  -21.152 1.00 0.00 ? 168 ILE A N    4  
ATOM 9455  C CA   . ILE A 1 149 ? -0.813  -9.754  -20.514 1.00 0.00 ? 168 ILE A CA   4  
ATOM 9456  C C    . ILE A 1 149 ? 0.665   -9.982  -20.219 1.00 0.00 ? 168 ILE A C    4  
ATOM 9457  O O    . ILE A 1 149 ? 1.084   -11.082 -19.857 1.00 0.00 ? 168 ILE A O    4  
ATOM 9458  C CB   . ILE A 1 149 ? -1.360  -10.878 -21.395 1.00 0.00 ? 168 ILE A CB   4  
ATOM 9459  C CG1  . ILE A 1 149 ? -2.880  -10.762 -21.508 1.00 0.00 ? 168 ILE A CG1  4  
ATOM 9460  C CG2  . ILE A 1 149 ? -0.964  -12.238 -20.842 1.00 0.00 ? 168 ILE A CG2  4  
ATOM 9461  C CD1  . ILE A 1 149 ? -3.625  -11.202 -20.266 1.00 0.00 ? 168 ILE A CD1  4  
ATOM 9462  H H    . ILE A 1 149 ? -1.651  -7.849  -20.760 1.00 0.00 ? 168 ILE A H    4  
ATOM 9463  H HA   . ILE A 1 149 ? -1.361  -9.755  -19.582 1.00 0.00 ? 168 ILE A HA   4  
ATOM 9464  H HB   . ILE A 1 149 ? -0.925  -10.761 -22.371 1.00 0.00 ? 168 ILE A HB   4  
ATOM 9465  H HG12 . ILE A 1 149 ? -3.141  -9.731  -21.701 2.00 0.00 ? 168 ILE A HG12 4  
ATOM 9466  H HG13 . ILE A 1 149 ? -3.222  -11.370 -22.333 2.00 0.00 ? 168 ILE A HG13 4  
ATOM 9467  H HG21 . ILE A 1 149 ? -1.033  -12.216 -19.763 1.00 0.00 ? 168 ILE A HG21 4  
ATOM 9468  H HG22 . ILE A 1 149 ? 0.049   -12.464 -21.134 1.00 0.00 ? 168 ILE A HG22 4  
ATOM 9469  H HG23 . ILE A 1 149 ? -1.632  -12.992 -21.230 1.00 0.00 ? 168 ILE A HG23 4  
ATOM 9470  H HD11 . ILE A 1 149 ? -3.249  -12.162 -19.943 1.00 0.00 ? 168 ILE A HD11 4  
ATOM 9471  H HD12 . ILE A 1 149 ? -4.678  -11.284 -20.487 1.00 0.00 ? 168 ILE A HD12 4  
ATOM 9472  H HD13 . ILE A 1 149 ? -3.478  -10.475 -19.481 1.00 0.00 ? 168 ILE A HD13 4  
ATOM 9473  N N    . TYR A 1 150 ? 1.447   -8.917  -20.365 1.00 0.00 ? 169 TYR A N    4  
ATOM 9474  C CA   . TYR A 1 150 ? 2.882   -8.967  -20.107 1.00 0.00 ? 169 TYR A CA   4  
ATOM 9475  C C    . TYR A 1 150 ? 3.463   -10.328 -20.485 1.00 0.00 ? 169 TYR A C    4  
ATOM 9476  O O    . TYR A 1 150 ? 3.701   -11.174 -19.623 1.00 0.00 ? 169 TYR A O    4  
ATOM 9477  C CB   . TYR A 1 150 ? 3.167   -8.664  -18.632 1.00 0.00 ? 169 TYR A CB   4  
ATOM 9478  C CG   . TYR A 1 150 ? 2.067   -9.060  -17.669 1.00 0.00 ? 169 TYR A CG   4  
ATOM 9479  C CD1  . TYR A 1 150 ? 0.810   -8.469  -17.734 1.00 0.00 ? 169 TYR A CD1  4  
ATOM 9480  C CD2  . TYR A 1 150 ? 2.287   -10.024 -16.693 1.00 0.00 ? 169 TYR A CD2  4  
ATOM 9481  C CE1  . TYR A 1 150 ? -0.195  -8.830  -16.857 1.00 0.00 ? 169 TYR A CE1  4  
ATOM 9482  C CE2  . TYR A 1 150 ? 1.287   -10.389 -15.812 1.00 0.00 ? 169 TYR A CE2  4  
ATOM 9483  C CZ   . TYR A 1 150 ? 0.048   -9.789  -15.899 1.00 0.00 ? 169 TYR A CZ   4  
ATOM 9484  O OH   . TYR A 1 150 ? -0.950  -10.151 -15.023 1.00 0.00 ? 169 TYR A OH   4  
ATOM 9485  H H    . TYR A 1 150 ? 1.041   -8.068  -20.645 1.00 0.00 ? 169 TYR A H    4  
ATOM 9486  H HA   . TYR A 1 150 ? 3.351   -8.210  -20.715 1.00 0.00 ? 169 TYR A HA   4  
ATOM 9487  H HB2  . TYR A 1 150 ? 4.064   -9.188  -18.337 2.00 0.00 ? 169 TYR A HB2  4  
ATOM 9488  H HB3  . TYR A 1 150 ? 3.333   -7.603  -18.520 2.00 0.00 ? 169 TYR A HB3  4  
ATOM 9489  H HD1  . TYR A 1 150 ? 0.619   -7.718  -18.487 1.00 0.00 ? 169 TYR A HD1  4  
ATOM 9490  H HD2  . TYR A 1 150 ? 3.258   -10.493 -16.628 1.00 0.00 ? 169 TYR A HD2  4  
ATOM 9491  H HE1  . TYR A 1 150 ? -1.164  -8.360  -16.927 1.00 0.00 ? 169 TYR A HE1  4  
ATOM 9492  H HE2  . TYR A 1 150 ? 1.478   -11.142 -15.061 1.00 0.00 ? 169 TYR A HE2  4  
ATOM 9493  H HH   . TYR A 1 150 ? -0.624  -10.085 -14.122 1.00 0.00 ? 169 TYR A HH   4  
ATOM 9494  N N    . PRO A 1 151 ? 3.698   -10.552 -21.787 1.00 0.00 ? 170 PRO A N    4  
ATOM 9495  C CA   . PRO A 1 151 ? 4.253   -11.812 -22.289 1.00 0.00 ? 170 PRO A CA   4  
ATOM 9496  C C    . PRO A 1 151 ? 5.753   -11.925 -22.046 1.00 0.00 ? 170 PRO A C    4  
ATOM 9497  O O    . PRO A 1 151 ? 6.410   -12.826 -22.569 1.00 0.00 ? 170 PRO A O    4  
ATOM 9498  C CB   . PRO A 1 151 ? 3.957   -11.747 -23.788 1.00 0.00 ? 170 PRO A CB   4  
ATOM 9499  C CG   . PRO A 1 151 ? 3.964   -10.289 -24.106 1.00 0.00 ? 170 PRO A CG   4  
ATOM 9500  C CD   . PRO A 1 151 ? 3.440   -9.595  -22.876 1.00 0.00 ? 170 PRO A CD   4  
ATOM 9501  H HA   . PRO A 1 151 ? 3.752   -12.666 -21.857 1.00 0.00 ? 170 PRO A HA   4  
ATOM 9502  H HB2  . PRO A 1 151 ? 4.726   -12.274 -24.333 2.00 0.00 ? 170 PRO A HB2  4  
ATOM 9503  H HB3  . PRO A 1 151 ? 2.994   -12.192 -23.989 2.00 0.00 ? 170 PRO A HB3  4  
ATOM 9504  H HG2  . PRO A 1 151 ? 4.971   -9.965  -24.319 2.00 0.00 ? 170 PRO A HG2  4  
ATOM 9505  H HG3  . PRO A 1 151 ? 3.319   -10.095 -24.949 2.00 0.00 ? 170 PRO A HG3  4  
ATOM 9506  H HD2  . PRO A 1 151 ? 3.975   -8.672  -22.710 2.00 0.00 ? 170 PRO A HD2  4  
ATOM 9507  H HD3  . PRO A 1 151 ? 2.382   -9.402  -22.976 2.00 0.00 ? 170 PRO A HD3  4  
ATOM 9508  N N    . SER A 1 152 ? 6.291   -11.005 -21.250 1.00 0.00 ? 171 SER A N    4  
ATOM 9509  C CA   . SER A 1 152 ? 7.716   -11.002 -20.940 1.00 0.00 ? 171 SER A CA   4  
ATOM 9510  C C    . SER A 1 152 ? 8.149   -12.343 -20.356 1.00 0.00 ? 171 SER A C    4  
ATOM 9511  O O    . SER A 1 152 ? 7.500   -12.880 -19.458 1.00 0.00 ? 171 SER A O    4  
ATOM 9512  C CB   . SER A 1 152 ? 8.043   -9.876  -19.958 1.00 0.00 ? 171 SER A CB   4  
ATOM 9513  O OG   . SER A 1 152 ? 7.194   -8.759  -20.160 1.00 0.00 ? 171 SER A OG   4  
ATOM 9514  H H    . SER A 1 152 ? 5.717   -10.313 -20.864 1.00 0.00 ? 171 SER A H    4  
ATOM 9515  H HA   . SER A 1 152 ? 8.256   -10.833 -21.860 1.00 0.00 ? 171 SER A HA   4  
ATOM 9516  H HB2  . SER A 1 152 ? 7.912   -10.233 -18.947 2.00 0.00 ? 171 SER A HB2  4  
ATOM 9517  H HB3  . SER A 1 152 ? 9.067   -9.564  -20.100 2.00 0.00 ? 171 SER A HB3  4  
ATOM 9518  H HG   . SER A 1 152 ? 7.722   -7.958  -20.192 1.00 0.00 ? 171 SER A HG   4  
ATOM 9519  N N    . ASN A 1 153 ? 9.251   -12.879 -20.872 1.00 0.00 ? 172 ASN A N    4  
ATOM 9520  C CA   . ASN A 1 153 ? 9.772   -14.158 -20.401 1.00 0.00 ? 172 ASN A CA   4  
ATOM 9521  C C    . ASN A 1 153 ? 11.013  -13.955 -19.536 1.00 0.00 ? 172 ASN A C    4  
ATOM 9522  O O    . ASN A 1 153 ? 11.952  -13.264 -19.932 1.00 0.00 ? 172 ASN A O    4  
ATOM 9523  C CB   . ASN A 1 153 ? 10.106  -15.064 -21.588 1.00 0.00 ? 172 ASN A CB   4  
ATOM 9524  C CG   . ASN A 1 153 ? 8.941   -15.941 -22.000 1.00 0.00 ? 172 ASN A CG   4  
ATOM 9525  O OD1  . ASN A 1 153 ? 7.920   -15.452 -22.485 1.00 0.00 ? 172 ASN A OD1  4  
ATOM 9526  N ND2  . ASN A 1 153 ? 9.086   -17.248 -21.809 4.00 0.00 ? 172 ASN A ND2  4  
ATOM 9527  H H    . ASN A 1 153 ? 9.725   -12.403 -21.585 1.00 0.00 ? 172 ASN A H    4  
ATOM 9528  H HA   . ASN A 1 153 ? 9.004   -14.629 -19.805 1.00 0.00 ? 172 ASN A HA   4  
ATOM 9529  H HB2  . ASN A 1 153 ? 10.386  -14.451 -22.432 2.00 0.00 ? 172 ASN A HB2  4  
ATOM 9530  H HB3  . ASN A 1 153 ? 10.935  -15.702 -21.322 2.00 0.00 ? 172 ASN A HB3  4  
ATOM 9531  H HD21 . ASN A 1 153 ? 9.930   -17.568 -21.417 5.00 0.00 ? 172 ASN A HD21 4  
ATOM 9532  H HD22 . ASN A 1 153 ? 8.346   -17.840 -22.067 5.00 0.00 ? 172 ASN A HD22 4  
ATOM 9533  N N    . PRO A 1 154 ? 11.030  -14.560 -18.338 1.00 0.00 ? 173 PRO A N    4  
ATOM 9534  C CA   . PRO A 1 154 ? 12.160  -14.447 -17.410 1.00 0.00 ? 173 PRO A CA   4  
ATOM 9535  C C    . PRO A 1 154 ? 13.420  -15.117 -17.949 1.00 0.00 ? 173 PRO A C    4  
ATOM 9536  O O    . PRO A 1 154 ? 13.369  -16.233 -18.467 1.00 0.00 ? 173 PRO A O    4  
ATOM 9537  C CB   . PRO A 1 154 ? 11.665  -15.168 -16.155 1.00 0.00 ? 173 PRO A CB   4  
ATOM 9538  C CG   . PRO A 1 154 ? 10.603  -16.097 -16.635 1.00 0.00 ? 173 PRO A CG   4  
ATOM 9539  C CD   . PRO A 1 154 ? 9.948   -15.401 -17.796 1.00 0.00 ? 173 PRO A CD   4  
ATOM 9540  H HA   . PRO A 1 154 ? 12.376  -13.415 -17.175 1.00 0.00 ? 173 PRO A HA   4  
ATOM 9541  H HB2  . PRO A 1 154 ? 12.483  -15.707 -15.701 2.00 0.00 ? 173 PRO A HB2  4  
ATOM 9542  H HB3  . PRO A 1 154 ? 11.271  -14.447 -15.455 2.00 0.00 ? 173 PRO A HB3  4  
ATOM 9543  H HG2  . PRO A 1 154 ? 11.046  -17.027 -16.956 2.00 0.00 ? 173 PRO A HG2  4  
ATOM 9544  H HG3  . PRO A 1 154 ? 9.885   -16.271 -15.848 2.00 0.00 ? 173 PRO A HG3  4  
ATOM 9545  H HD2  . PRO A 1 154 ? 9.615   -16.121 -18.529 2.00 0.00 ? 173 PRO A HD2  4  
ATOM 9546  H HD3  . PRO A 1 154 ? 9.122   -14.795 -17.456 2.00 0.00 ? 173 PRO A HD3  4  
ATOM 9547  N N    . THR A 1 155 ? 14.551  -14.429 -17.822 1.00 0.00 ? 174 THR A N    4  
ATOM 9548  C CA   . THR A 1 155 ? 15.824  -14.957 -18.295 1.00 0.00 ? 174 THR A CA   4  
ATOM 9549  C C    . THR A 1 155 ? 16.322  -16.081 -17.393 1.00 0.00 ? 174 THR A C    4  
ATOM 9550  O O    . THR A 1 155 ? 15.912  -16.192 -16.238 1.00 0.00 ? 174 THR A O    4  
ATOM 9551  C CB   . THR A 1 155 ? 16.899  -13.856 -18.364 1.00 0.00 ? 174 THR A CB   4  
ATOM 9552  O OG1  . THR A 1 155 ? 16.331  -12.593 -17.998 1.00 0.00 ? 174 THR A OG1  4  
ATOM 9553  C CG2  . THR A 1 155 ? 17.491  -13.764 -19.761 1.00 0.00 ? 174 THR A CG2  4  
ATOM 9554  H H    . THR A 1 155 ? 14.527  -13.545 -17.399 1.00 0.00 ? 174 THR A H    4  
ATOM 9555  H HA   . THR A 1 155 ? 15.674  -15.347 -19.291 1.00 0.00 ? 174 THR A HA   4  
ATOM 9556  H HB   . THR A 1 155 ? 17.690  -14.102 -17.669 1.00 0.00 ? 174 THR A HB   4  
ATOM 9557  H HG1  . THR A 1 155 ? 16.471  -11.961 -18.706 1.00 0.00 ? 174 THR A HG1  4  
ATOM 9558  H HG21 . THR A 1 155 ? 17.430  -14.730 -20.243 1.00 0.00 ? 174 THR A HG21 4  
ATOM 9559  H HG22 . THR A 1 155 ? 18.525  -13.460 -19.695 1.00 0.00 ? 174 THR A HG22 4  
ATOM 9560  H HG23 . THR A 1 155 ? 16.939  -13.039 -20.340 1.00 0.00 ? 174 THR A HG23 4  
ATOM 9561  N N    . ASP A 1 156 ? 17.209  -16.913 -17.929 1.00 0.00 ? 175 ASP A N    4  
ATOM 9562  C CA   . ASP A 1 156 ? 17.764  -18.030 -17.173 1.00 0.00 ? 175 ASP A CA   4  
ATOM 9563  C C    . ASP A 1 156 ? 19.056  -18.530 -17.810 1.00 0.00 ? 175 ASP A C    4  
ATOM 9564  O O    . ASP A 1 156 ? 20.082  -18.657 -17.142 1.00 0.00 ? 175 ASP A O    4  
ATOM 9565  C CB   . ASP A 1 156 ? 16.748  -19.172 -17.090 1.00 0.00 ? 175 ASP A CB   4  
ATOM 9566  C CG   . ASP A 1 156 ? 16.062  -19.248 -15.741 1.00 0.00 ? 175 ASP A CG   4  
ATOM 9567  O OD1  . ASP A 1 156 ? 16.768  -19.200 -14.712 1.00 0.00 ? 175 ASP A OD1  4  
ATOM 9568  O OD2  . ASP A 1 156 ? 14.817  -19.356 -15.713 1.00 0.00 ? 175 ASP A OD2  4  
ATOM 9569  H H    . ASP A 1 156 ? 17.498  -16.774 -18.855 1.00 0.00 ? 175 ASP A H    4  
ATOM 9570  H HA   . ASP A 1 156 ? 17.981  -17.680 -16.175 1.00 0.00 ? 175 ASP A HA   4  
ATOM 9571  H HB2  . ASP A 1 156 ? 15.993  -19.028 -17.849 2.00 0.00 ? 175 ASP A HB2  4  
ATOM 9572  H HB3  . ASP A 1 156 ? 17.255  -20.108 -17.268 2.00 0.00 ? 175 ASP A HB3  4  
ATOM 9573  N N    . ASP A 1 157 ? 18.996  -18.813 -19.108 1.00 0.00 ? 176 ASP A N    4  
ATOM 9574  C CA   . ASP A 1 157 ? 20.161  -19.300 -19.839 1.00 0.00 ? 176 ASP A CA   4  
ATOM 9575  C C    . ASP A 1 157 ? 20.674  -20.606 -19.242 1.00 0.00 ? 176 ASP A C    4  
ATOM 9576  O O    . ASP A 1 157 ? 21.796  -21.030 -19.520 1.00 0.00 ? 176 ASP A O    4  
ATOM 9577  C CB   . ASP A 1 157 ? 21.273  -18.249 -19.830 1.00 0.00 ? 176 ASP A CB   4  
ATOM 9578  C CG   . ASP A 1 157 ? 21.630  -17.732 -21.209 1.00 0.00 ? 176 ASP A CG   4  
ATOM 9579  O OD1  . ASP A 1 157 ? 20.949  -16.803 -21.690 1.00 0.00 ? 176 ASP A OD1  4  
ATOM 9580  O OD2  . ASP A 1 157 ? 22.592  -18.257 -21.809 1.00 0.00 ? 176 ASP A OD2  4  
ATOM 9581  H H    . ASP A 1 157 ? 18.150  -18.693 -19.586 1.00 0.00 ? 176 ASP A H    4  
ATOM 9582  H HA   . ASP A 1 157 ? 19.859  -19.481 -20.860 1.00 0.00 ? 176 ASP A HA   4  
ATOM 9583  H HB2  . ASP A 1 157 ? 20.957  -17.411 -19.226 2.00 0.00 ? 176 ASP A HB2  4  
ATOM 9584  H HB3  . ASP A 1 157 ? 22.160  -18.681 -19.390 2.00 0.00 ? 176 ASP A HB3  4  
ATOM 9585  N N    . ASP A 1 158 ? 19.844  -21.239 -18.417 1.00 0.00 ? 177 ASP A N    4  
ATOM 9586  C CA   . ASP A 1 158 ? 20.211  -22.499 -17.778 1.00 0.00 ? 177 ASP A CA   4  
ATOM 9587  C C    . ASP A 1 158 ? 21.493  -22.345 -16.965 1.00 0.00 ? 177 ASP A C    4  
ATOM 9588  O O    . ASP A 1 158 ? 22.129  -23.334 -16.598 1.00 0.00 ? 177 ASP A O    4  
ATOM 9589  C CB   . ASP A 1 158 ? 20.390  -23.596 -18.830 1.00 0.00 ? 177 ASP A CB   4  
ATOM 9590  C CG   . ASP A 1 158 ? 19.730  -24.901 -18.431 1.00 0.00 ? 177 ASP A CG   4  
ATOM 9591  O OD1  . ASP A 1 158 ? 20.170  -25.508 -17.433 1.00 0.00 ? 177 ASP A OD1  4  
ATOM 9592  O OD2  . ASP A 1 158 ? 18.772  -25.316 -19.117 1.00 0.00 ? 177 ASP A OD2  4  
ATOM 9593  H H    . ASP A 1 158 ? 18.963  -20.851 -18.235 1.00 0.00 ? 177 ASP A H    4  
ATOM 9594  H HA   . ASP A 1 158 ? 19.409  -22.778 -17.112 1.00 0.00 ? 177 ASP A HA   4  
ATOM 9595  H HB2  . ASP A 1 158 ? 19.954  -23.265 -19.761 2.00 0.00 ? 177 ASP A HB2  4  
ATOM 9596  H HB3  . ASP A 1 158 ? 21.444  -23.777 -18.975 2.00 0.00 ? 177 ASP A HB3  4  
ATOM 9597  N N    . VAL A 1 159 ? 21.867  -21.100 -16.687 1.00 0.00 ? 178 VAL A N    4  
ATOM 9598  C CA   . VAL A 1 159 ? 23.072  -20.816 -15.917 1.00 0.00 ? 178 VAL A CA   4  
ATOM 9599  C C    . VAL A 1 159 ? 24.290  -21.496 -16.532 1.00 0.00 ? 178 VAL A C    4  
ATOM 9600  O O    . VAL A 1 159 ? 24.876  -20.923 -17.475 1.00 0.00 ? 178 VAL A O    4  
ATOM 9601  C CB   . VAL A 1 159 ? 22.926  -21.275 -14.453 1.00 0.00 ? 178 VAL A CB   4  
ATOM 9602  C CG1  . VAL A 1 159 ? 24.060  -20.729 -13.600 2.00 0.00 ? 178 VAL A CG1  4  
ATOM 9603  C CG2  . VAL A 1 159 ? 21.583  -20.844 -13.884 2.00 0.00 ? 178 VAL A CG2  4  
ATOM 9604  H H    . VAL A 1 159 ? 21.318  -20.353 -17.006 1.00 0.00 ? 178 VAL A H    4  
ATOM 9605  H HA   . VAL A 1 159 ? 23.228  -19.747 -15.923 1.00 0.00 ? 178 VAL A HA   4  
ATOM 9606  H HB   . VAL A 1 159 ? 22.974  -22.353 -14.434 1.00 0.00 ? 178 VAL A HB   4  
ATOM 9607  H HG11 . VAL A 1 159 ? 24.608  -21.550 -13.161 1.00 0.00 ? 178 VAL A HG11 4  
ATOM 9608  H HG12 . VAL A 1 159 ? 23.654  -20.108 -12.815 1.00 0.00 ? 178 VAL A HG12 4  
ATOM 9609  H HG13 . VAL A 1 159 ? 24.725  -20.141 -14.216 1.00 0.00 ? 178 VAL A HG13 4  
ATOM 9610  H HG21 . VAL A 1 159 ? 21.124  -20.127 -14.547 1.00 0.00 ? 178 VAL A HG21 4  
ATOM 9611  H HG22 . VAL A 1 159 ? 21.731  -20.394 -12.913 1.00 0.00 ? 178 VAL A HG22 4  
ATOM 9612  H HG23 . VAL A 1 159 ? 20.941  -21.707 -13.786 1.00 0.00 ? 178 VAL A HG23 4  
ATOM 9613  N N    . ALA A 1 1   ? -1.166  -15.905 -13.654 1.00 0.00 ? 20  ALA A N    5  
ATOM 9614  C CA   . ALA A 1 1   ? -1.991  -14.860 -12.994 1.00 0.00 ? 20  ALA A CA   5  
ATOM 9615  C C    . ALA A 1 1   ? -1.594  -14.693 -11.531 1.00 0.00 ? 20  ALA A C    5  
ATOM 9616  O O    . ALA A 1 1   ? -1.995  -15.482 -10.675 1.00 0.00 ? 20  ALA A O    5  
ATOM 9617  C CB   . ALA A 1 1   ? -3.468  -15.207 -13.103 1.00 0.00 ? 20  ALA A CB   5  
ATOM 9618  H H1   . ALA A 1 1   ? -0.912  -15.604 -14.618 1.00 0.00 ? 20  ALA A H1   5  
ATOM 9619  H H2   . ALA A 1 1   ? -1.697  -16.797 -13.711 1.00 0.00 ? 20  ALA A H2   5  
ATOM 9620  H H3   . ALA A 1 1   ? -0.293  -16.067 -13.112 1.00 0.00 ? 20  ALA A H3   5  
ATOM 9621  H HA   . ALA A 1 1   ? -1.828  -13.924 -13.508 1.00 0.00 ? 20  ALA A HA   5  
ATOM 9622  H HB1  . ALA A 1 1   ? -3.577  -16.163 -13.595 1.00 0.00 ? 20  ALA A HB1  5  
ATOM 9623  H HB2  . ALA A 1 1   ? -3.975  -14.446 -13.678 1.00 0.00 ? 20  ALA A HB2  5  
ATOM 9624  H HB3  . ALA A 1 1   ? -3.900  -15.260 -12.115 1.00 0.00 ? 20  ALA A HB3  5  
ATOM 9625  N N    . GLN A 1 2   ? -0.804  -13.661 -11.252 1.00 0.00 ? 21  GLN A N    5  
ATOM 9626  C CA   . GLN A 1 2   ? -0.352  -13.388 -9.892  1.00 0.00 ? 21  GLN A CA   5  
ATOM 9627  C C    . GLN A 1 2   ? 0.289   -12.008 -9.802  1.00 0.00 ? 21  GLN A C    5  
ATOM 9628  O O    . GLN A 1 2   ? 0.556   -11.369 -10.819 1.00 0.00 ? 21  GLN A O    5  
ATOM 9629  C CB   . GLN A 1 2   ? 0.645   -14.457 -9.441  1.00 0.00 ? 21  GLN A CB   5  
ATOM 9630  C CG   . GLN A 1 2   ? 1.814   -14.691 -10.382 1.00 0.00 ? 21  GLN A CG   5  
ATOM 9631  C CD   . GLN A 1 2   ? 3.145   -14.753 -9.659  1.00 0.00 ? 21  GLN A CD   5  
ATOM 9632  O OE1  . GLN A 1 2   ? 3.611   -15.830 -9.285  1.00 0.00 ? 21  GLN A OE1  5  
ATOM 9633  N NE2  . GLN A 1 2   ? 3.765   -13.596 -9.458  4.00 0.00 ? 21  GLN A NE2  5  
ATOM 9634  H H    . GLN A 1 2   ? -0.519  -13.068 -11.978 1.00 0.00 ? 21  GLN A H    5  
ATOM 9635  H HA   . GLN A 1 2   ? -1.214  -13.416 -9.244  1.00 0.00 ? 21  GLN A HA   5  
ATOM 9636  H HB2  . GLN A 1 2   ? 1.043   -14.170 -8.478  2.00 0.00 ? 21  GLN A HB2  5  
ATOM 9637  H HB3  . GLN A 1 2   ? 0.117   -15.393 -9.325  2.00 0.00 ? 21  GLN A HB3  5  
ATOM 9638  H HG2  . GLN A 1 2   ? 1.660   -15.625 -10.902 2.00 0.00 ? 21  GLN A HG2  5  
ATOM 9639  H HG3  . GLN A 1 2   ? 1.849   -13.883 -11.099 2.00 0.00 ? 21  GLN A HG3  5  
ATOM 9640  H HE21 . GLN A 1 2   ? 3.333   -12.776 -9.784  5.00 0.00 ? 21  GLN A HE21 5  
ATOM 9641  H HE22 . GLN A 1 2   ? 4.630   -13.607 -8.992  5.00 0.00 ? 21  GLN A HE22 5  
ATOM 9642  N N    . ILE A 1 3   ? 0.533   -11.551 -8.576  1.00 0.00 ? 22  ILE A N    5  
ATOM 9643  C CA   . ILE A 1 3   ? 1.142   -10.246 -8.356  1.00 0.00 ? 22  ILE A CA   5  
ATOM 9644  C C    . ILE A 1 3   ? 1.826   -10.180 -6.996  1.00 0.00 ? 22  ILE A C    5  
ATOM 9645  O O    . ILE A 1 3   ? 1.453   -10.896 -6.066  1.00 0.00 ? 22  ILE A O    5  
ATOM 9646  C CB   . ILE A 1 3   ? 0.103   -9.113  -8.451  1.00 0.00 ? 22  ILE A CB   5  
ATOM 9647  C CG1  . ILE A 1 3   ? -1.308  -9.661  -8.226  1.00 0.00 ? 22  ILE A CG1  5  
ATOM 9648  C CG2  . ILE A 1 3   ? 0.199   -8.422  -9.801  1.00 0.00 ? 22  ILE A CG2  5  
ATOM 9649  C CD1  . ILE A 1 3   ? -2.392  -8.609  -8.317  1.00 0.00 ? 22  ILE A CD1  5  
ATOM 9650  H H    . ILE A 1 3   ? 0.299   -12.105 -7.803  1.00 0.00 ? 22  ILE A H    5  
ATOM 9651  H HA   . ILE A 1 3   ? 1.884   -10.091 -9.128  1.00 0.00 ? 22  ILE A HA   5  
ATOM 9652  H HB   . ILE A 1 3   ? 0.325   -8.386  -7.685  1.00 0.00 ? 22  ILE A HB   5  
ATOM 9653  H HG12 . ILE A 1 3   ? -1.517  -10.416 -8.969  2.00 0.00 ? 22  ILE A HG12 5  
ATOM 9654  H HG13 . ILE A 1 3   ? -1.361  -10.107 -7.244  2.00 0.00 ? 22  ILE A HG13 5  
ATOM 9655  H HG21 . ILE A 1 3   ? 0.448   -9.150  -10.560 1.00 0.00 ? 22  ILE A HG21 5  
ATOM 9656  H HG22 . ILE A 1 3   ? 0.967   -7.664  -9.764  1.00 0.00 ? 22  ILE A HG22 5  
ATOM 9657  H HG23 . ILE A 1 3   ? -0.749  -7.964  -10.040 1.00 0.00 ? 22  ILE A HG23 5  
ATOM 9658  H HD11 . ILE A 1 3   ? -1.946  -7.650  -8.537  1.00 0.00 ? 22  ILE A HD11 5  
ATOM 9659  H HD12 . ILE A 1 3   ? -2.920  -8.553  -7.377  1.00 0.00 ? 22  ILE A HD12 5  
ATOM 9660  H HD13 . ILE A 1 3   ? -3.084  -8.872  -9.104  1.00 0.00 ? 22  ILE A HD13 5  
ATOM 9661  N N    . ASP A 1 4   ? 2.828   -9.314  -6.886  1.00 0.00 ? 23  ASP A N    5  
ATOM 9662  C CA   . ASP A 1 4   ? 3.565   -9.151  -5.639  1.00 0.00 ? 23  ASP A CA   5  
ATOM 9663  C C    . ASP A 1 4   ? 3.171   -7.854  -4.941  1.00 0.00 ? 23  ASP A C    5  
ATOM 9664  O O    . ASP A 1 4   ? 3.291   -6.770  -5.511  1.00 0.00 ? 23  ASP A O    5  
ATOM 9665  C CB   . ASP A 1 4   ? 5.071   -9.163  -5.907  1.00 0.00 ? 23  ASP A CB   5  
ATOM 9666  C CG   . ASP A 1 4   ? 5.874   -9.592  -4.695  1.00 0.00 ? 23  ASP A CG   5  
ATOM 9667  O OD1  . ASP A 1 4   ? 6.056   -8.761  -3.780  1.00 0.00 ? 23  ASP A OD1  5  
ATOM 9668  O OD2  . ASP A 1 4   ? 6.320   -10.758 -4.660  1.00 0.00 ? 23  ASP A OD2  5  
ATOM 9669  H H    . ASP A 1 4   ? 3.078   -8.771  -7.663  1.00 0.00 ? 23  ASP A H    5  
ATOM 9670  H HA   . ASP A 1 4   ? 3.316   -9.983  -4.996  1.00 0.00 ? 23  ASP A HA   5  
ATOM 9671  H HB2  . ASP A 1 4   ? 5.281   -9.850  -6.716  2.00 0.00 ? 23  ASP A HB2  5  
ATOM 9672  H HB3  . ASP A 1 4   ? 5.387   -8.169  -6.192  2.00 0.00 ? 23  ASP A HB3  5  
ATOM 9673  N N    . LEU A 1 5   ? 2.704   -7.974  -3.703  1.00 0.00 ? 24  LEU A N    5  
ATOM 9674  C CA   . LEU A 1 5   ? 2.296   -6.813  -2.924  1.00 0.00 ? 24  LEU A CA   5  
ATOM 9675  C C    . LEU A 1 5   ? 3.263   -6.578  -1.771  1.00 0.00 ? 24  LEU A C    5  
ATOM 9676  O O    . LEU A 1 5   ? 4.159   -7.384  -1.528  1.00 0.00 ? 24  LEU A O    5  
ATOM 9677  C CB   . LEU A 1 5   ? 0.876   -7.003  -2.384  1.00 0.00 ? 24  LEU A CB   5  
ATOM 9678  C CG   . LEU A 1 5   ? -0.232  -7.175  -3.425  1.00 0.00 ? 24  LEU A CG   5  
ATOM 9679  C CD1  . LEU A 1 5   ? -0.212  -6.030  -4.428  2.00 0.00 ? 24  LEU A CD1  5  
ATOM 9680  C CD2  . LEU A 1 5   ? -0.088  -8.506  -4.146  2.00 0.00 ? 24  LEU A CD2  5  
ATOM 9681  H H    . LEU A 1 5   ? 2.635   -8.866  -3.301  1.00 0.00 ? 24  LEU A H    5  
ATOM 9682  H HA   . LEU A 1 5   ? 2.312   -5.951  -3.575  1.00 0.00 ? 24  LEU A HA   5  
ATOM 9683  H HB2  . LEU A 1 5   ? 0.875   -7.874  -1.746  2.00 0.00 ? 24  LEU A HB2  5  
ATOM 9684  H HB3  . LEU A 1 5   ? 0.633   -6.145  -1.775  2.00 0.00 ? 24  LEU A HB3  5  
ATOM 9685  H HG   . LEU A 1 5   ? -1.190  -7.165  -2.926  1.00 0.00 ? 24  LEU A HG   5  
ATOM 9686  H HD11 . LEU A 1 5   ? 0.550   -6.217  -5.171  1.00 0.00 ? 24  LEU A HD11 5  
ATOM 9687  H HD12 . LEU A 1 5   ? 0.006   -5.106  -3.913  1.00 0.00 ? 24  LEU A HD12 5  
ATOM 9688  H HD13 . LEU A 1 5   ? -1.175  -5.956  -4.910  1.00 0.00 ? 24  LEU A HD13 5  
ATOM 9689  H HD21 . LEU A 1 5   ? -0.795  -8.551  -4.962  1.00 0.00 ? 24  LEU A HD21 5  
ATOM 9690  H HD22 . LEU A 1 5   ? -0.285  -9.313  -3.455  1.00 0.00 ? 24  LEU A HD22 5  
ATOM 9691  H HD23 . LEU A 1 5   ? 0.915   -8.600  -4.533  1.00 0.00 ? 24  LEU A HD23 5  
ATOM 9692  N N    . ASN A 1 6   ? 3.077   -5.471  -1.066  1.00 0.00 ? 25  ASN A N    5  
ATOM 9693  C CA   . ASN A 1 6   ? 3.934   -5.135  0.061   1.00 0.00 ? 25  ASN A CA   5  
ATOM 9694  C C    . ASN A 1 6   ? 3.252   -4.131  0.981   1.00 0.00 ? 25  ASN A C    5  
ATOM 9695  O O    . ASN A 1 6   ? 2.920   -3.022  0.569   1.00 0.00 ? 25  ASN A O    5  
ATOM 9696  C CB   . ASN A 1 6   ? 5.267   -4.570  -0.434  1.00 0.00 ? 25  ASN A CB   5  
ATOM 9697  C CG   . ASN A 1 6   ? 6.460   -5.330  0.111   1.00 0.00 ? 25  ASN A CG   5  
ATOM 9698  O OD1  . ASN A 1 6   ? 6.762   -5.264  1.302   1.00 0.00 ? 25  ASN A OD1  5  
ATOM 9699  N ND2  . ASN A 1 6   ? 7.148   -6.056  -0.764  4.00 0.00 ? 25  ASN A ND2  5  
ATOM 9700  H H    . ASN A 1 6   ? 2.344   -4.866  -1.307  1.00 0.00 ? 25  ASN A H    5  
ATOM 9701  H HA   . ASN A 1 6   ? 4.123   -6.043  0.615   1.00 0.00 ? 25  ASN A HA   5  
ATOM 9702  H HB2  . ASN A 1 6   ? 5.293   -4.621  -1.513  2.00 0.00 ? 25  ASN A HB2  5  
ATOM 9703  H HB3  . ASN A 1 6   ? 5.350   -3.539  -0.124  2.00 0.00 ? 25  ASN A HB3  5  
ATOM 9704  H HD21 . ASN A 1 6   ? 6.849   -6.061  -1.700  5.00 0.00 ? 25  ASN A HD21 5  
ATOM 9705  H HD22 . ASN A 1 6   ? 7.926   -6.560  -0.437  5.00 0.00 ? 25  ASN A HD22 5  
ATOM 9706  N N    . ILE A 1 7   ? 3.042   -4.529  2.228   1.00 0.00 ? 26  ILE A N    5  
ATOM 9707  C CA   . ILE A 1 7   ? 2.400   -3.660  3.199   1.00 0.00 ? 26  ILE A CA   5  
ATOM 9708  C C    . ILE A 1 7   ? 3.263   -3.503  4.446   1.00 0.00 ? 26  ILE A C    5  
ATOM 9709  O O    . ILE A 1 7   ? 4.318   -4.127  4.563   1.00 0.00 ? 26  ILE A O    5  
ATOM 9710  C CB   . ILE A 1 7   ? 1.006   -4.191  3.594   1.00 0.00 ? 26  ILE A CB   5  
ATOM 9711  C CG1  . ILE A 1 7   ? 1.067   -4.987  4.898   1.00 0.00 ? 26  ILE A CG1  5  
ATOM 9712  C CG2  . ILE A 1 7   ? 0.427   -5.041  2.474   1.00 0.00 ? 26  ILE A CG2  5  
ATOM 9713  C CD1  . ILE A 1 7   ? -0.175  -4.846  5.754   1.00 0.00 ? 26  ILE A CD1  5  
ATOM 9714  H H    . ILE A 1 7   ? 3.325   -5.425  2.499   1.00 0.00 ? 26  ILE A H    5  
ATOM 9715  H HA   . ILE A 1 7   ? 2.271   -2.689  2.741   1.00 0.00 ? 26  ILE A HA   5  
ATOM 9716  H HB   . ILE A 1 7   ? 0.358   -3.342  3.732   1.00 0.00 ? 26  ILE A HB   5  
ATOM 9717  H HG12 . ILE A 1 7   ? 1.192   -6.035  4.668   2.00 0.00 ? 26  ILE A HG12 5  
ATOM 9718  H HG13 . ILE A 1 7   ? 1.909   -4.651  5.482   2.00 0.00 ? 26  ILE A HG13 5  
ATOM 9719  H HG21 . ILE A 1 7   ? 1.075   -4.994  1.613   1.00 0.00 ? 26  ILE A HG21 5  
ATOM 9720  H HG22 . ILE A 1 7   ? -0.552  -4.664  2.209   1.00 0.00 ? 26  ILE A HG22 5  
ATOM 9721  H HG23 . ILE A 1 7   ? 0.340   -6.064  2.807   1.00 0.00 ? 26  ILE A HG23 5  
ATOM 9722  H HD11 . ILE A 1 7   ? -0.979  -4.430  5.160   1.00 0.00 ? 26  ILE A HD11 5  
ATOM 9723  H HD12 . ILE A 1 7   ? 0.033   -4.189  6.585   1.00 0.00 ? 26  ILE A HD12 5  
ATOM 9724  H HD13 . ILE A 1 7   ? -0.469  -5.816  6.127   1.00 0.00 ? 26  ILE A HD13 5  
ATOM 9725  N N    . THR A 1 8   ? 2.811   -2.668  5.373   1.00 0.00 ? 27  THR A N    5  
ATOM 9726  C CA   . THR A 1 8   ? 3.545   -2.433  6.610   1.00 0.00 ? 27  THR A CA   5  
ATOM 9727  C C    . THR A 1 8   ? 2.845   -3.116  7.773   1.00 0.00 ? 27  THR A C    5  
ATOM 9728  O O    . THR A 1 8   ? 3.488   -3.663  8.668   1.00 0.00 ? 27  THR A O    5  
ATOM 9729  C CB   . THR A 1 8   ? 3.681   -0.926  6.903   1.00 0.00 ? 27  THR A CB   5  
ATOM 9730  O OG1  . THR A 1 8   ? 5.014   -0.489  6.615   1.00 0.00 ? 27  THR A OG1  5  
ATOM 9731  C CG2  . THR A 1 8   ? 3.344   -0.612  8.353   1.00 0.00 ? 27  THR A CG2  5  
ATOM 9732  H H    . THR A 1 8   ? 1.959   -2.202  5.225   1.00 0.00 ? 27  THR A H    5  
ATOM 9733  H HA   . THR A 1 8   ? 4.535   -2.853  6.499   1.00 0.00 ? 27  THR A HA   5  
ATOM 9734  H HB   . THR A 1 8   ? 2.992   -0.391  6.268   1.00 0.00 ? 27  THR A HB   5  
ATOM 9735  H HG1  . THR A 1 8   ? 5.472   -0.293  7.435   1.00 0.00 ? 27  THR A HG1  5  
ATOM 9736  H HG21 . THR A 1 8   ? 4.082   -1.064  9.001   1.00 0.00 ? 27  THR A HG21 5  
ATOM 9737  H HG22 . THR A 1 8   ? 2.368   -1.006  8.589   1.00 0.00 ? 27  THR A HG22 5  
ATOM 9738  H HG23 . THR A 1 8   ? 3.345   0.459   8.498   1.00 0.00 ? 27  THR A HG23 5  
ATOM 9739  N N    . CYS A 1 9   ? 1.517   -3.076  7.733   1.00 0.00 ? 28  CYS A N    5  
ATOM 9740  C CA   . CYS A 1 9   ? 0.671   -3.685  8.761   1.00 0.00 ? 28  CYS A CA   5  
ATOM 9741  C C    . CYS A 1 9   ? -0.478  -2.758  9.114   1.00 0.00 ? 28  CYS A C    5  
ATOM 9742  O O    . CYS A 1 9   ? -0.574  -1.653  8.587   1.00 0.00 ? 28  CYS A O    5  
ATOM 9743  C CB   . CYS A 1 9   ? 1.463   -4.020  10.026  1.00 0.00 ? 28  CYS A CB   5  
ATOM 9744  S SG   . CYS A 1 9   ? 2.185   -5.693  10.036  1.00 0.00 ? 28  CYS A SG   5  
ATOM 9745  H H    . CYS A 1 9   ? 1.085   -2.619  6.973   1.00 0.00 ? 28  CYS A H    5  
ATOM 9746  H HA   . CYS A 1 9   ? 0.263   -4.598  8.352   1.00 0.00 ? 28  CYS A HA   5  
ATOM 9747  H HB2  . CYS A 1 9   ? 2.269   -3.312  10.132  2.00 0.00 ? 28  CYS A HB2  5  
ATOM 9748  H HB3  . CYS A 1 9   ? 0.807   -3.942  10.882  2.00 0.00 ? 28  CYS A HB3  5  
ATOM 9749  N N    . ARG A 1 10  ? -1.346  -3.213  10.005  1.00 0.00 ? 29  ARG A N    5  
ATOM 9750  C CA   . ARG A 1 10  ? -2.497  -2.419  10.417  1.00 0.00 ? 29  ARG A CA   5  
ATOM 9751  C C    . ARG A 1 10  ? -2.356  -1.921  11.850  1.00 0.00 ? 29  ARG A C    5  
ATOM 9752  O O    . ARG A 1 10  ? -2.955  -2.472  12.775  1.00 0.00 ? 29  ARG A O    5  
ATOM 9753  C CB   . ARG A 1 10  ? -3.781  -3.232  10.264  1.00 0.00 ? 29  ARG A CB   5  
ATOM 9754  C CG   . ARG A 1 10  ? -3.703  -4.292  9.179   1.00 0.00 ? 29  ARG A CG   5  
ATOM 9755  C CD   . ARG A 1 10  ? -3.350  -5.653  9.749   1.00 0.00 ? 29  ARG A CD   5  
ATOM 9756  N NE   . ARG A 1 10  ? -4.530  -6.396  10.184  1.00 0.00 ? 29  ARG A NE   5  
ATOM 9757  C CZ   . ARG A 1 10  ? -5.414  -6.931  9.347   4.00 0.00 ? 29  ARG A CZ   5  
ATOM 9758  N NH1  . ARG A 1 10  ? -5.256  -6.806  8.036   5.00 0.00 ? 29  ARG A NH1  5  
ATOM 9759  N NH2  . ARG A 1 10  ? -6.460  -7.597  9.815   5.00 0.00 ? 29  ARG A NH2  5  
ATOM 9760  H H    . ARG A 1 10  ? -1.212  -4.104  10.392  1.00 0.00 ? 29  ARG A H    5  
ATOM 9761  H HA   . ARG A 1 10  ? -2.551  -1.563  9.761   1.00 0.00 ? 29  ARG A HA   5  
ATOM 9762  H HB2  . ARG A 1 10  ? -3.997  -3.721  11.200  2.00 0.00 ? 29  ARG A HB2  5  
ATOM 9763  H HB3  . ARG A 1 10  ? -4.593  -2.560  10.022  2.00 0.00 ? 29  ARG A HB3  5  
ATOM 9764  H HG2  . ARG A 1 10  ? -4.657  -4.352  8.673   2.00 0.00 ? 29  ARG A HG2  5  
ATOM 9765  H HG3  . ARG A 1 10  ? -2.941  -4.007  8.469   2.00 0.00 ? 29  ARG A HG3  5  
ATOM 9766  H HD2  . ARG A 1 10  ? -2.835  -6.224  8.990   2.00 0.00 ? 29  ARG A HD2  5  
ATOM 9767  H HD3  . ARG A 1 10  ? -2.693  -5.511  10.596  2.00 0.00 ? 29  ARG A HD3  5  
ATOM 9768  H HE   . ARG A 1 10  ? -4.668  -6.503  11.148  1.00 0.00 ? 29  ARG A HE   5  
ATOM 9769  H HH11 . ARG A 1 10  ? -4.470  -6.307  7.672   5.00 0.00 ? 29  ARG A HH11 5  
ATOM 9770  H HH12 . ARG A 1 10  ? -5.925  -7.210  7.413   5.00 0.00 ? 29  ARG A HH12 5  
ATOM 9771  H HH21 . ARG A 1 10  ? -6.587  -7.699  10.801  5.00 0.00 ? 29  ARG A HH21 5  
ATOM 9772  H HH22 . ARG A 1 10  ? -7.121  -7.997  9.181   5.00 0.00 ? 29  ARG A HH22 5  
ATOM 9773  N N    . PHE A 1 11  ? -1.573  -0.864  12.022  1.00 0.00 ? 30  PHE A N    5  
ATOM 9774  C CA   . PHE A 1 11  ? -1.361  -0.268  13.335  1.00 0.00 ? 30  PHE A CA   5  
ATOM 9775  C C    . PHE A 1 11  ? -2.538  0.633   13.698  1.00 0.00 ? 30  PHE A C    5  
ATOM 9776  O O    . PHE A 1 11  ? -2.939  1.485   12.904  1.00 0.00 ? 30  PHE A O    5  
ATOM 9777  C CB   . PHE A 1 11  ? -0.068  0.549   13.355  1.00 0.00 ? 30  PHE A CB   5  
ATOM 9778  C CG   . PHE A 1 11  ? 1.196   -0.225  13.114  1.00 0.00 ? 30  PHE A CG   5  
ATOM 9779  C CD1  . PHE A 1 11  ? 1.377   -0.935  11.938  1.00 0.00 ? 30  PHE A CD1  5  
ATOM 9780  C CD2  . PHE A 1 11  ? 2.209   -0.232  14.058  1.00 0.00 ? 30  PHE A CD2  5  
ATOM 9781  C CE1  . PHE A 1 11  ? 2.544   -1.638  11.710  1.00 0.00 ? 30  PHE A CE1  5  
ATOM 9782  C CE2  . PHE A 1 11  ? 3.379   -0.933  13.836  1.00 0.00 ? 30  PHE A CE2  5  
ATOM 9783  C CZ   . PHE A 1 11  ? 3.546   -1.637  12.659  1.00 0.00 ? 30  PHE A CZ   5  
ATOM 9784  H H    . PHE A 1 11  ? -1.136  -0.467  11.240  1.00 0.00 ? 30  PHE A H    5  
ATOM 9785  H HA   . PHE A 1 11  ? -1.291  -1.066  14.060  1.00 0.00 ? 30  PHE A HA   5  
ATOM 9786  H HB2  . PHE A 1 11  ? -0.131  1.315   12.597  2.00 0.00 ? 30  PHE A HB2  5  
ATOM 9787  H HB3  . PHE A 1 11  ? 0.024   1.027   14.319  2.00 0.00 ? 30  PHE A HB3  5  
ATOM 9788  H HD1  . PHE A 1 11  ? 0.595   -0.936  11.194  1.00 0.00 ? 30  PHE A HD1  5  
ATOM 9789  H HD2  . PHE A 1 11  ? 2.078   0.319   14.979  1.00 0.00 ? 30  PHE A HD2  5  
ATOM 9790  H HE1  . PHE A 1 11  ? 2.673   -2.188  10.790  1.00 0.00 ? 30  PHE A HE1  5  
ATOM 9791  H HE2  . PHE A 1 11  ? 4.161   -0.930  14.580  1.00 0.00 ? 30  PHE A HE2  5  
ATOM 9792  H HZ   . PHE A 1 11  ? 4.459   -2.185  12.480  1.00 0.00 ? 30  PHE A HZ   5  
ATOM 9793  N N    . ALA A 1 12  ? -3.090  0.444   14.892  1.00 0.00 ? 31  ALA A N    5  
ATOM 9794  C CA   . ALA A 1 12  ? -4.222  1.247   15.339  1.00 0.00 ? 31  ALA A CA   5  
ATOM 9795  C C    . ALA A 1 12  ? -5.433  1.032   14.438  1.00 0.00 ? 31  ALA A C    5  
ATOM 9796  O O    . ALA A 1 12  ? -6.510  1.569   14.692  1.00 0.00 ? 31  ALA A O    5  
ATOM 9797  C CB   . ALA A 1 12  ? -3.844  2.720   15.374  1.00 0.00 ? 31  ALA A CB   5  
ATOM 9798  H H    . ALA A 1 12  ? -2.729  -0.250  15.484  1.00 0.00 ? 31  ALA A H    5  
ATOM 9799  H HA   . ALA A 1 12  ? -4.472  0.941   16.343  1.00 0.00 ? 31  ALA A HA   5  
ATOM 9800  H HB1  . ALA A 1 12  ? -3.090  2.917   14.627  1.00 0.00 ? 31  ALA A HB1  5  
ATOM 9801  H HB2  . ALA A 1 12  ? -3.455  2.969   16.351  1.00 0.00 ? 31  ALA A HB2  5  
ATOM 9802  H HB3  . ALA A 1 12  ? -4.718  3.321   15.170  1.00 0.00 ? 31  ALA A HB3  5  
ATOM 9803  N N    . GLY A 1 13  ? -5.245  0.245   13.383  1.00 0.00 ? 32  GLY A N    5  
ATOM 9804  C CA   . GLY A 1 13  ? -6.322  -0.027  12.450  1.00 0.00 ? 32  GLY A CA   5  
ATOM 9805  C C    . GLY A 1 13  ? -6.003  0.432   11.040  1.00 0.00 ? 32  GLY A C    5  
ATOM 9806  O O    . GLY A 1 13  ? -6.861  0.395   10.157  1.00 0.00 ? 32  GLY A O    5  
ATOM 9807  H H    . GLY A 1 13  ? -4.363  -0.155  13.237  1.00 0.00 ? 32  GLY A H    5  
ATOM 9808  H HA2  . GLY A 1 13  ? -6.511  -1.091  12.438  2.00 0.00 ? 32  GLY A HA2  5  
ATOM 9809  H HA3  . GLY A 1 13  ? -7.214  0.483   12.789  2.00 0.00 ? 32  GLY A HA3  5  
ATOM 9810  N N    . VAL A 1 14  ? -4.763  0.867   10.831  1.00 0.00 ? 33  VAL A N    5  
ATOM 9811  C CA   . VAL A 1 14  ? -4.321  1.341   9.523   1.00 0.00 ? 33  VAL A CA   5  
ATOM 9812  C C    . VAL A 1 14  ? -3.283  0.400   8.917   1.00 0.00 ? 33  VAL A C    5  
ATOM 9813  O O    . VAL A 1 14  ? -2.205  0.211   9.482   1.00 0.00 ? 33  VAL A O    5  
ATOM 9814  C CB   . VAL A 1 14  ? -3.703  2.753   9.616   1.00 0.00 ? 33  VAL A CB   5  
ATOM 9815  C CG1  . VAL A 1 14  ? -2.382  2.816   8.866   2.00 0.00 ? 33  VAL A CG1  5  
ATOM 9816  C CG2  . VAL A 1 14  ? -4.651  3.807   9.078   2.00 0.00 ? 33  VAL A CG2  5  
ATOM 9817  H H    . VAL A 1 14  ? -4.129  0.872   11.577  1.00 0.00 ? 33  VAL A H    5  
ATOM 9818  H HA   . VAL A 1 14  ? -5.182  1.386   8.872   1.00 0.00 ? 33  VAL A HA   5  
ATOM 9819  H HB   . VAL A 1 14  ? -3.513  2.965   10.658  1.00 0.00 ? 33  VAL A HB   5  
ATOM 9820  H HG11 . VAL A 1 14  ? -2.533  2.484   7.849   1.00 0.00 ? 33  VAL A HG11 5  
ATOM 9821  H HG12 . VAL A 1 14  ? -1.662  2.174   9.351   1.00 0.00 ? 33  VAL A HG12 5  
ATOM 9822  H HG13 . VAL A 1 14  ? -2.017  3.831   8.864   1.00 0.00 ? 33  VAL A HG13 5  
ATOM 9823  H HG21 . VAL A 1 14  ? -4.085  4.552   8.535   1.00 0.00 ? 33  VAL A HG21 5  
ATOM 9824  H HG22 . VAL A 1 14  ? -5.172  4.277   9.899   1.00 0.00 ? 33  VAL A HG22 5  
ATOM 9825  H HG23 . VAL A 1 14  ? -5.365  3.343   8.415   1.00 0.00 ? 33  VAL A HG23 5  
ATOM 9826  N N    . PHE A 1 15  ? -3.597  -0.169  7.758   1.00 0.00 ? 34  PHE A N    5  
ATOM 9827  C CA   . PHE A 1 15  ? -2.668  -1.061  7.084   1.00 0.00 ? 34  PHE A CA   5  
ATOM 9828  C C    . PHE A 1 15  ? -2.181  -0.410  5.801   1.00 0.00 ? 34  PHE A C    5  
ATOM 9829  O O    . PHE A 1 15  ? -2.954  -0.149  4.878   1.00 0.00 ? 34  PHE A O    5  
ATOM 9830  C CB   . PHE A 1 15  ? -3.312  -2.447  6.866   1.00 0.00 ? 34  PHE A CB   5  
ATOM 9831  C CG   . PHE A 1 15  ? -3.033  -3.161  5.558   1.00 0.00 ? 34  PHE A CG   5  
ATOM 9832  C CD1  . PHE A 1 15  ? -2.154  -2.662  4.611   1.00 0.00 ? 34  PHE A CD1  5  
ATOM 9833  C CD2  . PHE A 1 15  ? -3.691  -4.356  5.280   1.00 0.00 ? 34  PHE A CD2  5  
ATOM 9834  C CE1  . PHE A 1 15  ? -1.939  -3.335  3.425   1.00 0.00 ? 34  PHE A CE1  5  
ATOM 9835  C CE2  . PHE A 1 15  ? -3.480  -5.030  4.095   1.00 0.00 ? 34  PHE A CE2  5  
ATOM 9836  C CZ   . PHE A 1 15  ? -2.602  -4.518  3.167   1.00 0.00 ? 34  PHE A CZ   5  
ATOM 9837  H H    . PHE A 1 15  ? -4.463  0.028   7.340   1.00 0.00 ? 34  PHE A H    5  
ATOM 9838  H HA   . PHE A 1 15  ? -1.817  -1.178  7.737   1.00 0.00 ? 34  PHE A HA   5  
ATOM 9839  H HB2  . PHE A 1 15  ? -2.968  -3.098  7.653   2.00 0.00 ? 34  PHE A HB2  5  
ATOM 9840  H HB3  . PHE A 1 15  ? -4.383  -2.341  6.949   2.00 0.00 ? 34  PHE A HB3  5  
ATOM 9841  H HD1  . PHE A 1 15  ? -1.631  -1.742  4.802   1.00 0.00 ? 34  PHE A HD1  5  
ATOM 9842  H HD2  . PHE A 1 15  ? -4.379  -4.761  6.003   1.00 0.00 ? 34  PHE A HD2  5  
ATOM 9843  H HE1  . PHE A 1 15  ? -1.250  -2.935  2.695   1.00 0.00 ? 34  PHE A HE1  5  
ATOM 9844  H HE2  . PHE A 1 15  ? -4.010  -5.955  3.893   1.00 0.00 ? 34  PHE A HE2  5  
ATOM 9845  H HZ   . PHE A 1 15  ? -2.433  -5.040  2.240   1.00 0.00 ? 34  PHE A HZ   5  
ATOM 9846  N N    . HIS A 1 16  ? -0.884  -0.130  5.775   1.00 0.00 ? 35  HIS A N    5  
ATOM 9847  C CA   . HIS A 1 16  ? -0.252  0.511   4.634   1.00 0.00 ? 35  HIS A CA   5  
ATOM 9848  C C    . HIS A 1 16  ? 0.013   -0.519  3.544   1.00 0.00 ? 35  HIS A C    5  
ATOM 9849  O O    . HIS A 1 16  ? 0.751   -1.478  3.754   1.00 0.00 ? 35  HIS A O    5  
ATOM 9850  C CB   . HIS A 1 16  ? 1.052   1.182   5.082   1.00 0.00 ? 35  HIS A CB   5  
ATOM 9851  C CG   . HIS A 1 16  ? 1.931   1.637   3.963   1.00 0.00 ? 35  HIS A CG   5  
ATOM 9852  N ND1  . HIS A 1 16  ? 2.856   2.649   4.092   1.00 0.00 ? 35  HIS A ND1  5  
ATOM 9853  C CD2  . HIS A 1 16  ? 2.019   1.210   2.690   1.00 0.00 ? 35  HIS A CD2  5  
ATOM 9854  C CE1  . HIS A 1 16  ? 3.476   2.823   2.939   1.00 0.00 ? 35  HIS A CE1  5  
ATOM 9855  N NE2  . HIS A 1 16  ? 2.985   1.962   2.069   1.00 0.00 ? 35  HIS A NE2  5  
ATOM 9856  H H    . HIS A 1 16  ? -0.336  -0.353  6.557   1.00 0.00 ? 35  HIS A H    5  
ATOM 9857  H HA   . HIS A 1 16  ? -0.927  1.263   4.253   1.00 0.00 ? 35  HIS A HA   5  
ATOM 9858  H HB2  . HIS A 1 16  ? 0.812   2.045   5.685   2.00 0.00 ? 35  HIS A HB2  5  
ATOM 9859  H HB3  . HIS A 1 16  ? 1.618   0.483   5.681   2.00 0.00 ? 35  HIS A HB3  5  
ATOM 9860  H HD1  . HIS A 1 16  ? 3.034   3.161   4.907   1.00 0.00 ? 35  HIS A HD1  5  
ATOM 9861  H HD2  . HIS A 1 16  ? 1.433   0.420   2.250   1.00 0.00 ? 35  HIS A HD2  5  
ATOM 9862  H HE1  . HIS A 1 16  ? 4.253   3.547   2.742   1.00 0.00 ? 35  HIS A HE1  5  
ATOM 9863  H HE2  . HIS A 1 16  ? 3.146   1.988   1.105   1.00 0.00 ? 35  HIS A HE2  5  
ATOM 9864  N N    . VAL A 1 17  ? -0.615  -0.327  2.388   1.00 0.00 ? 36  VAL A N    5  
ATOM 9865  C CA   . VAL A 1 17  ? -0.471  -1.261  1.277   1.00 0.00 ? 36  VAL A CA   5  
ATOM 9866  C C    . VAL A 1 17  ? 0.330   -0.677  0.117   1.00 0.00 ? 36  VAL A C    5  
ATOM 9867  O O    . VAL A 1 17  ? 0.341   0.532   -0.108  1.00 0.00 ? 36  VAL A O    5  
ATOM 9868  C CB   . VAL A 1 17  ? -1.846  -1.695  0.740   1.00 0.00 ? 36  VAL A CB   5  
ATOM 9869  C CG1  . VAL A 1 17  ? -2.912  -0.684  1.123   2.00 0.00 ? 36  VAL A CG1  5  
ATOM 9870  C CG2  . VAL A 1 17  ? -1.807  -1.873  -0.771  2.00 0.00 ? 36  VAL A CG2  5  
ATOM 9871  H H    . VAL A 1 17  ? -1.208  0.447   2.289   1.00 0.00 ? 36  VAL A H    5  
ATOM 9872  H HA   . VAL A 1 17  ? 0.034   -2.139  1.648   1.00 0.00 ? 36  VAL A HA   5  
ATOM 9873  H HB   . VAL A 1 17  ? -2.097  -2.644  1.189   1.00 0.00 ? 36  VAL A HB   5  
ATOM 9874  H HG11 . VAL A 1 17  ? -2.841  -0.471  2.180   1.00 0.00 ? 36  VAL A HG11 5  
ATOM 9875  H HG12 . VAL A 1 17  ? -3.888  -1.088  0.901   1.00 0.00 ? 36  VAL A HG12 5  
ATOM 9876  H HG13 . VAL A 1 17  ? -2.760  0.227   0.561   1.00 0.00 ? 36  VAL A HG13 5  
ATOM 9877  H HG21 . VAL A 1 17  ? -2.792  -2.133  -1.129  1.00 0.00 ? 36  VAL A HG21 5  
ATOM 9878  H HG22 . VAL A 1 17  ? -1.112  -2.661  -1.023  1.00 0.00 ? 36  VAL A HG22 5  
ATOM 9879  H HG23 . VAL A 1 17  ? -1.488  -0.951  -1.234  1.00 0.00 ? 36  VAL A HG23 5  
ATOM 9880  N N    . GLU A 1 18  ? 0.967   -1.566  -0.635  1.00 0.00 ? 37  GLU A N    5  
ATOM 9881  C CA   . GLU A 1 18  ? 1.744   -1.184  -1.806  1.00 0.00 ? 37  GLU A CA   5  
ATOM 9882  C C    . GLU A 1 18  ? 1.930   -2.390  -2.717  1.00 0.00 ? 37  GLU A C    5  
ATOM 9883  O O    . GLU A 1 18  ? 1.451   -3.484  -2.417  1.00 0.00 ? 37  GLU A O    5  
ATOM 9884  C CB   . GLU A 1 18  ? 3.105   -0.603  -1.414  1.00 0.00 ? 37  GLU A CB   5  
ATOM 9885  C CG   . GLU A 1 18  ? 4.215   -1.638  -1.320  1.00 0.00 ? 37  GLU A CG   5  
ATOM 9886  C CD   . GLU A 1 18  ? 5.282   -1.267  -0.309  1.00 0.00 ? 37  GLU A CD   5  
ATOM 9887  O OE1  . GLU A 1 18  ? 5.005   -1.349  0.906   1.00 0.00 ? 37  GLU A OE1  5  
ATOM 9888  O OE2  . GLU A 1 18  ? 6.396   -0.893  -0.733  1.00 0.00 ? 37  GLU A OE2  5  
ATOM 9889  H H    . GLU A 1 18  ? 0.892   -2.517  -0.410  1.00 0.00 ? 37  GLU A H    5  
ATOM 9890  H HA   . GLU A 1 18  ? 1.179   -0.431  -2.338  1.00 0.00 ? 37  GLU A HA   5  
ATOM 9891  H HB2  . GLU A 1 18  ? 3.395   0.127   -2.157  2.00 0.00 ? 37  GLU A HB2  5  
ATOM 9892  H HB3  . GLU A 1 18  ? 3.015   -0.113  -0.457  2.00 0.00 ? 37  GLU A HB3  5  
ATOM 9893  H HG2  . GLU A 1 18  ? 3.782   -2.585  -1.032  2.00 0.00 ? 37  GLU A HG2  5  
ATOM 9894  H HG3  . GLU A 1 18  ? 4.679   -1.738  -2.290  2.00 0.00 ? 37  GLU A HG3  5  
ATOM 9895  N N    . LYS A 1 19  ? 2.626   -2.191  -3.825  1.00 0.00 ? 38  LYS A N    5  
ATOM 9896  C CA   . LYS A 1 19  ? 2.871   -3.270  -4.771  1.00 0.00 ? 38  LYS A CA   5  
ATOM 9897  C C    . LYS A 1 19  ? 4.340   -3.306  -5.169  1.00 0.00 ? 38  LYS A C    5  
ATOM 9898  O O    . LYS A 1 19  ? 5.148   -2.527  -4.664  1.00 0.00 ? 38  LYS A O    5  
ATOM 9899  C CB   . LYS A 1 19  ? 1.995   -3.093  -6.013  1.00 0.00 ? 38  LYS A CB   5  
ATOM 9900  C CG   . LYS A 1 19  ? 1.749   -4.378  -6.785  1.00 0.00 ? 38  LYS A CG   5  
ATOM 9901  C CD   . LYS A 1 19  ? 2.152   -4.244  -8.246  1.00 0.00 ? 38  LYS A CD   5  
ATOM 9902  C CE   . LYS A 1 19  ? 1.897   -5.525  -9.024  1.00 0.00 ? 38  LYS A CE   5  
ATOM 9903  N NZ   . LYS A 1 19  ? 3.016   -6.495  -8.877  1.00 0.00 ? 38  LYS A NZ   5  
ATOM 9904  H H    . LYS A 1 19  ? 2.986   -1.298  -4.012  1.00 0.00 ? 38  LYS A H    5  
ATOM 9905  H HA   . LYS A 1 19  ? 2.616   -4.201  -4.288  1.00 0.00 ? 38  LYS A HA   5  
ATOM 9906  H HB2  . LYS A 1 19  ? 1.040   -2.693  -5.709  2.00 0.00 ? 38  LYS A HB2  5  
ATOM 9907  H HB3  . LYS A 1 19  ? 2.473   -2.386  -6.676  2.00 0.00 ? 38  LYS A HB3  5  
ATOM 9908  H HG2  . LYS A 1 19  ? 2.323   -5.173  -6.335  2.00 0.00 ? 38  LYS A HG2  5  
ATOM 9909  H HG3  . LYS A 1 19  ? 0.697   -4.620  -6.734  2.00 0.00 ? 38  LYS A HG3  5  
ATOM 9910  H HD2  . LYS A 1 19  ? 1.582   -3.445  -8.694  2.00 0.00 ? 38  LYS A HD2  5  
ATOM 9911  H HD3  . LYS A 1 19  ? 3.204   -4.008  -8.297  2.00 0.00 ? 38  LYS A HD3  5  
ATOM 9912  H HE2  . LYS A 1 19  ? 0.988   -5.979  -8.657  2.00 0.00 ? 38  LYS A HE2  5  
ATOM 9913  H HE3  . LYS A 1 19  ? 1.779   -5.280  -10.068 2.00 0.00 ? 38  LYS A HE3  5  
ATOM 9914  H HZ1  . LYS A 1 19  ? 3.460   -6.671  -9.802  1.00 0.00 ? 38  LYS A HZ1  5  
ATOM 9915  H HZ2  . LYS A 1 19  ? 2.663   -7.397  -8.499  1.00 0.00 ? 38  LYS A HZ2  5  
ATOM 9916  H HZ3  . LYS A 1 19  ? 3.734   -6.118  -8.226  1.00 0.00 ? 38  LYS A HZ3  5  
ATOM 9917  N N    . ASN A 1 20  ? 4.678   -4.205  -6.086  1.00 0.00 ? 39  ASN A N    5  
ATOM 9918  C CA   . ASN A 1 20  ? 6.046   -4.327  -6.559  1.00 0.00 ? 39  ASN A CA   5  
ATOM 9919  C C    . ASN A 1 20  ? 6.521   -2.993  -7.117  1.00 0.00 ? 39  ASN A C    5  
ATOM 9920  O O    . ASN A 1 20  ? 7.660   -2.862  -7.563  1.00 0.00 ? 39  ASN A O    5  
ATOM 9921  C CB   . ASN A 1 20  ? 6.146   -5.413  -7.632  1.00 0.00 ? 39  ASN A CB   5  
ATOM 9922  C CG   . ASN A 1 20  ? 7.536   -6.009  -7.735  1.00 0.00 ? 39  ASN A CG   5  
ATOM 9923  O OD1  . ASN A 1 20  ? 8.125   -6.057  -8.815  1.00 0.00 ? 39  ASN A OD1  5  
ATOM 9924  N ND2  . ASN A 1 20  ? 8.067   -6.470  -6.608  4.00 0.00 ? 39  ASN A ND2  5  
ATOM 9925  H H    . ASN A 1 20  ? 3.993   -4.790  -6.456  1.00 0.00 ? 39  ASN A H    5  
ATOM 9926  H HA   . ASN A 1 20  ? 6.668   -4.598  -5.719  1.00 0.00 ? 39  ASN A HA   5  
ATOM 9927  H HB2  . ASN A 1 20  ? 5.452   -6.206  -7.397  2.00 0.00 ? 39  ASN A HB2  5  
ATOM 9928  H HB3  . ASN A 1 20  ? 5.886   -4.988  -8.590  2.00 0.00 ? 39  ASN A HB3  5  
ATOM 9929  H HD21 . ASN A 1 20  ? 7.539   -6.400  -5.783  5.00 0.00 ? 39  ASN A HD21 5  
ATOM 9930  H HD22 . ASN A 1 20  ? 8.968   -6.862  -6.647  5.00 0.00 ? 39  ASN A HD22 5  
ATOM 9931  N N    . GLY A 1 21  ? 5.636   -1.998  -7.073  1.00 0.00 ? 40  GLY A N    5  
ATOM 9932  C CA   . GLY A 1 21  ? 5.984   -0.683  -7.559  1.00 0.00 ? 40  GLY A CA   5  
ATOM 9933  C C    . GLY A 1 21  ? 7.013   -0.028  -6.672  1.00 0.00 ? 40  GLY A C    5  
ATOM 9934  O O    . GLY A 1 21  ? 7.930   0.634   -7.159  1.00 0.00 ? 40  GLY A O    5  
ATOM 9935  H H    . GLY A 1 21  ? 4.746   -2.159  -6.692  1.00 0.00 ? 40  GLY A H    5  
ATOM 9936  H HA2  . GLY A 1 21  ? 6.381   -0.771  -8.559  2.00 0.00 ? 40  GLY A HA2  5  
ATOM 9937  H HA3  . GLY A 1 21  ? 5.095   -0.069  -7.584  2.00 0.00 ? 40  GLY A HA3  5  
ATOM 9938  N N    . ARG A 1 22  ? 6.870   -0.232  -5.363  1.00 0.00 ? 41  ARG A N    5  
ATOM 9939  C CA   . ARG A 1 22  ? 7.805   0.325   -4.397  1.00 0.00 ? 41  ARG A CA   5  
ATOM 9940  C C    . ARG A 1 22  ? 8.372   1.638   -4.917  1.00 0.00 ? 41  ARG A C    5  
ATOM 9941  O O    . ARG A 1 22  ? 9.439   1.664   -5.529  1.00 0.00 ? 41  ARG A O    5  
ATOM 9942  C CB   . ARG A 1 22  ? 8.927   -0.678  -4.148  1.00 0.00 ? 41  ARG A CB   5  
ATOM 9943  C CG   . ARG A 1 22  ? 9.269   -1.517  -5.366  1.00 0.00 ? 41  ARG A CG   5  
ATOM 9944  C CD   . ARG A 1 22  ? 10.710  -2.000  -5.337  1.00 0.00 ? 41  ARG A CD   5  
ATOM 9945  N NE   . ARG A 1 22  ? 11.267  -2.162  -6.676  1.00 0.00 ? 41  ARG A NE   5  
ATOM 9946  C CZ   . ARG A 1 22  ? 12.192  -3.065  -6.985  4.00 0.00 ? 41  ARG A CZ   5  
ATOM 9947  N NH1  . ARG A 1 22  ? 12.666  -3.884  -6.055  5.00 0.00 ? 41  ARG A NH1  5  
ATOM 9948  N NH2  . ARG A 1 22  ? 12.653  -3.155  -8.224  5.00 0.00 ? 41  ARG A NH2  5  
ATOM 9949  H H    . ARG A 1 22  ? 6.125   -0.783  -5.044  1.00 0.00 ? 41  ARG A H    5  
ATOM 9950  H HA   . ARG A 1 22  ? 7.274   0.506   -3.474  1.00 0.00 ? 41  ARG A HA   5  
ATOM 9951  H HB2  . ARG A 1 22  ? 9.814   -0.144  -3.841  2.00 0.00 ? 41  ARG A HB2  5  
ATOM 9952  H HB3  . ARG A 1 22  ? 8.627   -1.344  -3.353  2.00 0.00 ? 41  ARG A HB3  5  
ATOM 9953  H HG2  . ARG A 1 22  ? 8.610   -2.374  -5.396  2.00 0.00 ? 41  ARG A HG2  5  
ATOM 9954  H HG3  . ARG A 1 22  ? 9.117   -0.914  -6.253  2.00 0.00 ? 41  ARG A HG3  5  
ATOM 9955  H HD2  . ARG A 1 22  ? 11.306  -1.281  -4.795  2.00 0.00 ? 41  ARG A HD2  5  
ATOM 9956  H HD3  . ARG A 1 22  ? 10.747  -2.950  -4.825  2.00 0.00 ? 41  ARG A HD3  5  
ATOM 9957  H HE   . ARG A 1 22  ? 10.934  -1.569  -7.381  1.00 0.00 ? 41  ARG A HE   5  
ATOM 9958  H HH11 . ARG A 1 22  ? 12.326  -3.825  -5.117  5.00 0.00 ? 41  ARG A HH11 5  
ATOM 9959  H HH12 . ARG A 1 22  ? 13.362  -4.562  -6.293  5.00 0.00 ? 41  ARG A HH12 5  
ATOM 9960  H HH21 . ARG A 1 22  ? 12.305  -2.543  -8.934  5.00 0.00 ? 41  ARG A HH21 5  
ATOM 9961  H HH22 . ARG A 1 22  ? 13.350  -3.836  -8.451  5.00 0.00 ? 41  ARG A HH22 5  
ATOM 9962  N N    . TYR A 1 23  ? 7.626   2.715   -4.699  1.00 0.00 ? 42  TYR A N    5  
ATOM 9963  C CA   . TYR A 1 23  ? 8.018   4.035   -5.172  1.00 0.00 ? 42  TYR A CA   5  
ATOM 9964  C C    . TYR A 1 23  ? 7.506   4.228   -6.592  1.00 0.00 ? 42  TYR A C    5  
ATOM 9965  O O    . TYR A 1 23  ? 7.602   5.315   -7.162  1.00 0.00 ? 42  TYR A O    5  
ATOM 9966  C CB   . TYR A 1 23  ? 9.538   4.215   -5.122  1.00 0.00 ? 42  TYR A CB   5  
ATOM 9967  C CG   . TYR A 1 23  ? 10.113  4.514   -3.755  1.00 0.00 ? 42  TYR A CG   5  
ATOM 9968  C CD1  . TYR A 1 23  ? 9.291   4.889   -2.699  1.00 0.00 ? 42  TYR A CD1  5  
ATOM 9969  C CD2  . TYR A 1 23  ? 11.480  4.423   -3.521  1.00 0.00 ? 42  TYR A CD2  5  
ATOM 9970  C CE1  . TYR A 1 23  ? 9.814   5.163   -1.450  1.00 0.00 ? 42  TYR A CE1  5  
ATOM 9971  C CE2  . TYR A 1 23  ? 12.011  4.696   -2.274  1.00 0.00 ? 42  TYR A CE2  5  
ATOM 9972  C CZ   . TYR A 1 23  ? 11.174  5.065   -1.243  1.00 0.00 ? 42  TYR A CZ   5  
ATOM 9973  O OH   . TYR A 1 23  ? 11.698  5.339   0.000   1.00 0.00 ? 42  TYR A OH   5  
ATOM 9974  H H    . TYR A 1 23  ? 6.773   2.616   -4.229  1.00 0.00 ? 42  TYR A H    5  
ATOM 9975  H HA   . TYR A 1 23  ? 7.551   4.768   -4.531  1.00 0.00 ? 42  TYR A HA   5  
ATOM 9976  H HB2  . TYR A 1 23  ? 10.007  3.313   -5.482  2.00 0.00 ? 42  TYR A HB2  5  
ATOM 9977  H HB3  . TYR A 1 23  ? 9.812   5.029   -5.775  2.00 0.00 ? 42  TYR A HB3  5  
ATOM 9978  H HD1  . TYR A 1 23  ? 8.227   4.964   -2.864  1.00 0.00 ? 42  TYR A HD1  5  
ATOM 9979  H HD2  . TYR A 1 23  ? 12.133  4.133   -4.332  1.00 0.00 ? 42  TYR A HD2  5  
ATOM 9980  H HE1  . TYR A 1 23  ? 9.158   5.453   -0.642  1.00 0.00 ? 42  TYR A HE1  5  
ATOM 9981  H HE2  . TYR A 1 23  ? 13.075  4.620   -2.112  1.00 0.00 ? 42  TYR A HE2  5  
ATOM 9982  H HH   . TYR A 1 23  ? 11.054  5.826   0.520   1.00 0.00 ? 42  TYR A HH   5  
ATOM 9983  N N    . SER A 1 24  ? 6.954   3.153   -7.153  1.00 0.00 ? 43  SER A N    5  
ATOM 9984  C CA   . SER A 1 24  ? 6.410   3.185   -8.505  1.00 0.00 ? 43  SER A CA   5  
ATOM 9985  C C    . SER A 1 24  ? 5.031   2.530   -8.553  1.00 0.00 ? 43  SER A C    5  
ATOM 9986  O O    . SER A 1 24  ? 4.639   1.965   -9.574  1.00 0.00 ? 43  SER A O    5  
ATOM 9987  C CB   . SER A 1 24  ? 7.358   2.480   -9.477  1.00 0.00 ? 43  SER A CB   5  
ATOM 9988  O OG   . SER A 1 24  ? 8.688   2.941   -9.320  1.00 0.00 ? 43  SER A OG   5  
ATOM 9989  H H    . SER A 1 24  ? 6.911   2.315   -6.642  1.00 0.00 ? 43  SER A H    5  
ATOM 9990  H HA   . SER A 1 24  ? 6.314   4.221   -8.798  1.00 0.00 ? 43  SER A HA   5  
ATOM 9991  H HB2  . SER A 1 24  ? 7.335   1.416   -9.290  2.00 0.00 ? 43  SER A HB2  5  
ATOM 9992  H HB3  . SER A 1 24  ? 7.040   2.673   -10.491 2.00 0.00 ? 43  SER A HB3  5  
ATOM 9993  H HG   . SER A 1 24  ? 8.736   3.535   -8.568  1.00 0.00 ? 43  SER A HG   5  
ATOM 9994  N N    . ILE A 1 25  ? 4.295   2.610   -7.444  1.00 0.00 ? 44  ILE A N    5  
ATOM 9995  C CA   . ILE A 1 25  ? 2.960   2.024   -7.369  1.00 0.00 ? 44  ILE A CA   5  
ATOM 9996  C C    . ILE A 1 25  ? 1.887   3.065   -7.661  1.00 0.00 ? 44  ILE A C    5  
ATOM 9997  O O    . ILE A 1 25  ? 1.948   4.188   -7.164  1.00 0.00 ? 44  ILE A O    5  
ATOM 9998  C CB   . ILE A 1 25  ? 2.688   1.405   -5.987  1.00 0.00 ? 44  ILE A CB   5  
ATOM 9999  C CG1  . ILE A 1 25  ? 3.903   0.614   -5.504  1.00 0.00 ? 44  ILE A CG1  5  
ATOM 10000 C CG2  . ILE A 1 25  ? 1.452   0.516   -6.036  1.00 0.00 ? 44  ILE A CG2  5  
ATOM 10001 C CD1  . ILE A 1 25  ? 4.392   1.010   -4.128  1.00 0.00 ? 44  ILE A CD1  5  
ATOM 10002 H H    . ILE A 1 25  ? 4.658   3.074   -6.660  1.00 0.00 ? 44  ILE A H    5  
ATOM 10003 H HA   . ILE A 1 25  ? 2.897   1.240   -8.105  1.00 0.00 ? 44  ILE A HA   5  
ATOM 10004 H HB   . ILE A 1 25  ? 2.492   2.208   -5.298  1.00 0.00 ? 44  ILE A HB   5  
ATOM 10005 H HG12 . ILE A 1 25  ? 3.653   -0.436  -5.476  2.00 0.00 ? 44  ILE A HG12 5  
ATOM 10006 H HG13 . ILE A 1 25  ? 4.718   0.762   -6.198  2.00 0.00 ? 44  ILE A HG13 5  
ATOM 10007 H HG21 . ILE A 1 25  ? 0.567   1.122   -5.911  1.00 0.00 ? 44  ILE A HG21 5  
ATOM 10008 H HG22 . ILE A 1 25  ? 1.503   -0.214  -5.242  1.00 0.00 ? 44  ILE A HG22 5  
ATOM 10009 H HG23 . ILE A 1 25  ? 1.411   0.010   -6.990  1.00 0.00 ? 44  ILE A HG23 5  
ATOM 10010 H HD11 . ILE A 1 25  ? 5.240   0.399   -3.857  1.00 0.00 ? 44  ILE A HD11 5  
ATOM 10011 H HD12 . ILE A 1 25  ? 3.599   0.865   -3.410  1.00 0.00 ? 44  ILE A HD12 5  
ATOM 10012 H HD13 . ILE A 1 25  ? 4.686   2.050   -4.136  1.00 0.00 ? 44  ILE A HD13 5  
ATOM 10013 N N    . SER A 1 26  ? 0.903   2.682   -8.471  1.00 0.00 ? 45  SER A N    5  
ATOM 10014 C CA   . SER A 1 26  ? -0.186  3.585   -8.828  1.00 0.00 ? 45  SER A CA   5  
ATOM 10015 C C    . SER A 1 26  ? -1.393  3.364   -7.923  1.00 0.00 ? 45  SER A C    5  
ATOM 10016 O O    . SER A 1 26  ? -1.413  2.438   -7.113  1.00 0.00 ? 45  SER A O    5  
ATOM 10017 C CB   . SER A 1 26  ? -0.584  3.382   -10.291 1.00 0.00 ? 45  SER A CB   5  
ATOM 10018 O OG   . SER A 1 26  ? -0.101  2.146   -10.786 1.00 0.00 ? 45  SER A OG   5  
ATOM 10019 H H    . SER A 1 26  ? 0.909   1.772   -8.834  1.00 0.00 ? 45  SER A H    5  
ATOM 10020 H HA   . SER A 1 26  ? 0.167   4.597   -8.697  1.00 0.00 ? 45  SER A HA   5  
ATOM 10021 H HB2  . SER A 1 26  ? -1.661  3.393   -10.373 2.00 0.00 ? 45  SER A HB2  5  
ATOM 10022 H HB3  . SER A 1 26  ? -0.170  4.181   -10.888 2.00 0.00 ? 45  SER A HB3  5  
ATOM 10023 H HG   . SER A 1 26  ? 0.846   2.092   -10.644 1.00 0.00 ? 45  SER A HG   5  
ATOM 10024 N N    . ARG A 1 27  ? -2.397  4.223   -8.066  1.00 0.00 ? 46  ARG A N    5  
ATOM 10025 C CA   . ARG A 1 27  ? -3.608  4.121   -7.260  1.00 0.00 ? 46  ARG A CA   5  
ATOM 10026 C C    . ARG A 1 27  ? -4.419  2.889   -7.645  1.00 0.00 ? 46  ARG A C    5  
ATOM 10027 O O    . ARG A 1 27  ? -5.236  2.403   -6.864  1.00 0.00 ? 46  ARG A O    5  
ATOM 10028 C CB   . ARG A 1 27  ? -4.462  5.380   -7.424  1.00 0.00 ? 46  ARG A CB   5  
ATOM 10029 C CG   . ARG A 1 27  ? -5.493  5.566   -6.323  1.00 0.00 ? 46  ARG A CG   5  
ATOM 10030 C CD   . ARG A 1 27  ? -5.735  7.033   -6.011  1.00 0.00 ? 46  ARG A CD   5  
ATOM 10031 N NE   . ARG A 1 27  ? -6.960  7.530   -6.630  1.00 0.00 ? 46  ARG A NE   5  
ATOM 10032 C CZ   . ARG A 1 27  ? -6.982  8.479   -7.560  4.00 0.00 ? 46  ARG A CZ   5  
ATOM 10033 N NH1  . ARG A 1 27  ? -5.853  9.036   -7.979  5.00 0.00 ? 46  ARG A NH1  5  
ATOM 10034 N NH2  . ARG A 1 27  ? -8.134  8.882   -8.079  5.00 0.00 ? 46  ARG A NH2  5  
ATOM 10035 H H    . ARG A 1 27  ? -2.322  4.940   -8.728  1.00 0.00 ? 46  ARG A H    5  
ATOM 10036 H HA   . ARG A 1 27  ? -3.310  4.031   -6.226  1.00 0.00 ? 46  ARG A HA   5  
ATOM 10037 H HB2  . ARG A 1 27  ? -3.812  6.243   -7.426  2.00 0.00 ? 46  ARG A HB2  5  
ATOM 10038 H HB3  . ARG A 1 27  ? -4.981  5.328   -8.368  2.00 0.00 ? 46  ARG A HB3  5  
ATOM 10039 H HG2  . ARG A 1 27  ? -6.425  5.118   -6.637  2.00 0.00 ? 46  ARG A HG2  5  
ATOM 10040 H HG3  . ARG A 1 27  ? -5.142  5.072   -5.429  2.00 0.00 ? 46  ARG A HG3  5  
ATOM 10041 H HD2  . ARG A 1 27  ? -5.809  7.154   -4.940  2.00 0.00 ? 46  ARG A HD2  5  
ATOM 10042 H HD3  . ARG A 1 27  ? -4.898  7.609   -6.379  2.00 0.00 ? 46  ARG A HD3  5  
ATOM 10043 H HE   . ARG A 1 27  ? -7.808  7.137   -6.338  1.00 0.00 ? 46  ARG A HE   5  
ATOM 10044 H HH11 . ARG A 1 27  ? -4.978  8.741   -7.594  5.00 0.00 ? 46  ARG A HH11 5  
ATOM 10045 H HH12 . ARG A 1 27  ? -5.877  9.749   -8.679  5.00 0.00 ? 46  ARG A HH12 5  
ATOM 10046 H HH21 . ARG A 1 27  ? -8.992  8.471   -7.771  5.00 0.00 ? 46  ARG A HH21 5  
ATOM 10047 H HH22 . ARG A 1 27  ? -8.144  9.596   -8.780  5.00 0.00 ? 46  ARG A HH22 5  
ATOM 10048 N N    . THR A 1 28  ? -4.189  2.387   -8.853  1.00 0.00 ? 47  THR A N    5  
ATOM 10049 C CA   . THR A 1 28  ? -4.901  1.211   -9.339  1.00 0.00 ? 47  THR A CA   5  
ATOM 10050 C C    . THR A 1 28  ? -4.656  0.009   -8.434  1.00 0.00 ? 47  THR A C    5  
ATOM 10051 O O    . THR A 1 28  ? -5.561  -0.448  -7.735  1.00 0.00 ? 47  THR A O    5  
ATOM 10052 C CB   . THR A 1 28  ? -4.478  0.851   -10.775 1.00 0.00 ? 47  THR A CB   5  
ATOM 10053 O OG1  . THR A 1 28  ? -3.261  1.528   -11.113 1.00 0.00 ? 47  THR A OG1  5  
ATOM 10054 C CG2  . THR A 1 28  ? -5.566  1.229   -11.770 1.00 0.00 ? 47  THR A CG2  5  
ATOM 10055 H H    . THR A 1 28  ? -3.526  2.819   -9.432  1.00 0.00 ? 47  THR A H    5  
ATOM 10056 H HA   . THR A 1 28  ? -5.957  1.438   -9.342  1.00 0.00 ? 47  THR A HA   5  
ATOM 10057 H HB   . THR A 1 28  ? -4.316  -0.215  -10.831 1.00 0.00 ? 47  THR A HB   5  
ATOM 10058 H HG1  . THR A 1 28  ? -2.524  1.099   -10.672 1.00 0.00 ? 47  THR A HG1  5  
ATOM 10059 H HG21 . THR A 1 28  ? -6.203  0.375   -11.946 1.00 0.00 ? 47  THR A HG21 5  
ATOM 10060 H HG22 . THR A 1 28  ? -5.111  1.537   -12.700 1.00 0.00 ? 47  THR A HG22 5  
ATOM 10061 H HG23 . THR A 1 28  ? -6.154  2.040   -11.369 1.00 0.00 ? 47  THR A HG23 5  
ATOM 10062 N N    . GLU A 1 29  ? -3.428  -0.499  -8.450  1.00 0.00 ? 48  GLU A N    5  
ATOM 10063 C CA   . GLU A 1 29  ? -3.063  -1.647  -7.629  1.00 0.00 ? 48  GLU A CA   5  
ATOM 10064 C C    . GLU A 1 29  ? -3.275  -1.342  -6.150  1.00 0.00 ? 48  GLU A C    5  
ATOM 10065 O O    . GLU A 1 29  ? -3.915  -2.111  -5.429  1.00 0.00 ? 48  GLU A O    5  
ATOM 10066 C CB   . GLU A 1 29  ? -1.604  -2.033  -7.878  1.00 0.00 ? 48  GLU A CB   5  
ATOM 10067 C CG   . GLU A 1 29  ? -1.392  -3.192  -8.840  1.00 0.00 ? 48  GLU A CG   5  
ATOM 10068 C CD   . GLU A 1 29  ? -1.982  -4.492  -8.331  1.00 0.00 ? 48  GLU A CD   5  
ATOM 10069 O OE1  . GLU A 1 29  ? -3.204  -4.693  -8.490  1.00 0.00 ? 48  GLU A OE1  5  
ATOM 10070 O OE2  . GLU A 1 29  ? -1.221  -5.309  -7.771  1.00 0.00 ? 48  GLU A OE2  5  
ATOM 10071 H H    . GLU A 1 29  ? -2.749  -0.088  -9.027  1.00 0.00 ? 48  GLU A H    5  
ATOM 10072 H HA   . GLU A 1 29  ? -3.699  -2.473  -7.911  1.00 0.00 ? 48  GLU A HA   5  
ATOM 10073 H HB2  . GLU A 1 29  ? -1.083  -1.173  -8.272  2.00 0.00 ? 48  GLU A HB2  5  
ATOM 10074 H HB3  . GLU A 1 29  ? -1.154  -2.300  -6.933  2.00 0.00 ? 48  GLU A HB3  5  
ATOM 10075 H HG2  . GLU A 1 29  ? -1.859  -2.949  -9.783  2.00 0.00 ? 48  GLU A HG2  5  
ATOM 10076 H HG3  . GLU A 1 29  ? -0.332  -3.329  -8.990  2.00 0.00 ? 48  GLU A HG3  5  
ATOM 10077 N N    . ALA A 1 30  ? -2.736  -0.210  -5.709  1.00 0.00 ? 49  ALA A N    5  
ATOM 10078 C CA   . ALA A 1 30  ? -2.864  0.210   -4.318  1.00 0.00 ? 49  ALA A CA   5  
ATOM 10079 C C    . ALA A 1 30  ? -4.312  0.143   -3.857  1.00 0.00 ? 49  ALA A C    5  
ATOM 10080 O O    . ALA A 1 30  ? -4.689  -0.733  -3.081  1.00 0.00 ? 49  ALA A O    5  
ATOM 10081 C CB   . ALA A 1 30  ? -2.335  1.625   -4.145  1.00 0.00 ? 49  ALA A CB   5  
ATOM 10082 H H    . ALA A 1 30  ? -2.242  0.359   -6.334  1.00 0.00 ? 49  ALA A H    5  
ATOM 10083 H HA   . ALA A 1 30  ? -2.267  -0.453  -3.709  1.00 0.00 ? 49  ALA A HA   5  
ATOM 10084 H HB1  . ALA A 1 30  ? -3.127  2.258   -3.767  1.00 0.00 ? 49  ALA A HB1  5  
ATOM 10085 H HB2  . ALA A 1 30  ? -1.995  2.004   -5.098  1.00 0.00 ? 49  ALA A HB2  5  
ATOM 10086 H HB3  . ALA A 1 30  ? -1.513  1.621   -3.445  1.00 0.00 ? 49  ALA A HB3  5  
ATOM 10087 N N    . ALA A 1 31  ? -5.113  1.086   -4.337  1.00 0.00 ? 50  ALA A N    5  
ATOM 10088 C CA   . ALA A 1 31  ? -6.520  1.153   -3.974  1.00 0.00 ? 50  ALA A CA   5  
ATOM 10089 C C    . ALA A 1 31  ? -7.188  -0.216  -4.073  1.00 0.00 ? 50  ALA A C    5  
ATOM 10090 O O    . ALA A 1 31  ? -8.059  -0.552  -3.270  1.00 0.00 ? 50  ALA A O    5  
ATOM 10091 C CB   . ALA A 1 31  ? -7.246  2.158   -4.855  1.00 0.00 ? 50  ALA A CB   5  
ATOM 10092 H H    . ALA A 1 31  ? -4.745  1.759   -4.947  1.00 0.00 ? 50  ALA A H    5  
ATOM 10093 H HA   . ALA A 1 31  ? -6.577  1.499   -2.953  1.00 0.00 ? 50  ALA A HA   5  
ATOM 10094 H HB1  . ALA A 1 31  ? -8.312  2.053   -4.719  1.00 0.00 ? 50  ALA A HB1  5  
ATOM 10095 H HB2  . ALA A 1 31  ? -6.995  1.978   -5.890  1.00 0.00 ? 50  ALA A HB2  5  
ATOM 10096 H HB3  . ALA A 1 31  ? -6.946  3.159   -4.581  1.00 0.00 ? 50  ALA A HB3  5  
ATOM 10097 N N    . ASP A 1 32  ? -6.778  -1.000  -5.065  1.00 0.00 ? 51  ASP A N    5  
ATOM 10098 C CA   . ASP A 1 32  ? -7.343  -2.330  -5.271  1.00 0.00 ? 51  ASP A CA   5  
ATOM 10099 C C    . ASP A 1 32  ? -7.300  -3.154  -3.988  1.00 0.00 ? 51  ASP A C    5  
ATOM 10100 O O    . ASP A 1 32  ? -8.309  -3.297  -3.298  1.00 0.00 ? 51  ASP A O    5  
ATOM 10101 C CB   . ASP A 1 32  ? -6.591  -3.064  -6.382  1.00 0.00 ? 51  ASP A CB   5  
ATOM 10102 C CG   . ASP A 1 32  ? -7.361  -3.083  -7.688  1.00 0.00 ? 51  ASP A CG   5  
ATOM 10103 O OD1  . ASP A 1 32  ? -8.413  -3.754  -7.748  1.00 0.00 ? 51  ASP A OD1  5  
ATOM 10104 O OD2  . ASP A 1 32  ? -6.912  -2.427  -8.651  1.00 0.00 ? 51  ASP A OD2  5  
ATOM 10105 H H    . ASP A 1 32  ? -6.084  -0.676  -5.674  1.00 0.00 ? 51  ASP A H    5  
ATOM 10106 H HA   . ASP A 1 32  ? -8.373  -2.208  -5.568  1.00 0.00 ? 51  ASP A HA   5  
ATOM 10107 H HB2  . ASP A 1 32  ? -5.643  -2.575  -6.551  2.00 0.00 ? 51  ASP A HB2  5  
ATOM 10108 H HB3  . ASP A 1 32  ? -6.416  -4.085  -6.074  2.00 0.00 ? 51  ASP A HB3  5  
ATOM 10109 N N    . LEU A 1 33  ? -6.128  -3.698  -3.674  1.00 0.00 ? 52  LEU A N    5  
ATOM 10110 C CA   . LEU A 1 33  ? -5.965  -4.510  -2.474  1.00 0.00 ? 52  LEU A CA   5  
ATOM 10111 C C    . LEU A 1 33  ? -6.282  -3.695  -1.224  1.00 0.00 ? 52  LEU A C    5  
ATOM 10112 O O    . LEU A 1 33  ? -6.887  -4.199  -0.271  1.00 0.00 ? 52  LEU A O    5  
ATOM 10113 C CB   . LEU A 1 33  ? -4.544  -5.080  -2.406  1.00 0.00 ? 52  LEU A CB   5  
ATOM 10114 C CG   . LEU A 1 33  ? -3.534  -4.380  -1.497  1.00 0.00 ? 52  LEU A CG   5  
ATOM 10115 C CD1  . LEU A 1 33  ? -3.845  -4.640  -0.031  2.00 0.00 ? 52  LEU A CD1  5  
ATOM 10116 C CD2  . LEU A 1 33  ? -2.119  -4.828  -1.827  2.00 0.00 ? 52  LEU A CD2  5  
ATOM 10117 H H    . LEU A 1 33  ? -5.357  -3.550  -4.265  1.00 0.00 ? 52  LEU A H    5  
ATOM 10118 H HA   . LEU A 1 33  ? -6.665  -5.329  -2.537  1.00 0.00 ? 52  LEU A HA   5  
ATOM 10119 H HB2  . LEU A 1 33  ? -4.616  -6.110  -2.089  2.00 0.00 ? 52  LEU A HB2  5  
ATOM 10120 H HB3  . LEU A 1 33  ? -4.142  -5.072  -3.407  2.00 0.00 ? 52  LEU A HB3  5  
ATOM 10121 H HG   . LEU A 1 33  ? -3.602  -3.316  -1.674  1.00 0.00 ? 52  LEU A HG   5  
ATOM 10122 H HD11 . LEU A 1 33  ? -3.081  -5.277  0.390   1.00 0.00 ? 52  LEU A HD11 5  
ATOM 10123 H HD12 . LEU A 1 33  ? -4.805  -5.126  0.051   1.00 0.00 ? 52  LEU A HD12 5  
ATOM 10124 H HD13 . LEU A 1 33  ? -3.868  -3.702  0.503   1.00 0.00 ? 52  LEU A HD13 5  
ATOM 10125 H HD21 . LEU A 1 33  ? -1.440  -3.998  -1.700  1.00 0.00 ? 52  LEU A HD21 5  
ATOM 10126 H HD22 . LEU A 1 33  ? -2.080  -5.172  -2.850  1.00 0.00 ? 52  LEU A HD22 5  
ATOM 10127 H HD23 . LEU A 1 33  ? -1.833  -5.633  -1.166  1.00 0.00 ? 52  LEU A HD23 5  
ATOM 10128 N N    . CYS A 1 34  ? -5.883  -2.429  -1.236  1.00 0.00 ? 53  CYS A N    5  
ATOM 10129 C CA   . CYS A 1 34  ? -6.141  -1.543  -0.109  1.00 0.00 ? 53  CYS A CA   5  
ATOM 10130 C C    . CYS A 1 34  ? -7.577  -1.715  0.368   1.00 0.00 ? 53  CYS A C    5  
ATOM 10131 O O    . CYS A 1 34  ? -7.824  -2.047  1.527   1.00 0.00 ? 53  CYS A O    5  
ATOM 10132 C CB   . CYS A 1 34  ? -5.893  -0.086  -0.503  1.00 0.00 ? 53  CYS A CB   5  
ATOM 10133 S SG   . CYS A 1 34  ? -7.071  1.122   0.184   1.00 0.00 ? 53  CYS A SG   5  
ATOM 10134 H H    . CYS A 1 34  ? -5.415  -2.081  -2.024  1.00 0.00 ? 53  CYS A H    5  
ATOM 10135 H HA   . CYS A 1 34  ? -5.469  -1.815  0.692   1.00 0.00 ? 53  CYS A HA   5  
ATOM 10136 H HB2  . CYS A 1 34  ? -4.905  0.200   -0.172  2.00 0.00 ? 53  CYS A HB2  5  
ATOM 10137 H HB3  . CYS A 1 34  ? -5.935  -0.003  -1.578  2.00 0.00 ? 53  CYS A HB3  5  
ATOM 10138 N N    . LYS A 1 35  ? -8.522  -1.503  -0.543  1.00 0.00 ? 54  LYS A N    5  
ATOM 10139 C CA   . LYS A 1 35  ? -9.934  -1.650  -0.224  1.00 0.00 ? 54  LYS A CA   5  
ATOM 10140 C C    . LYS A 1 35  ? -10.288 -3.125  -0.068  1.00 0.00 ? 54  LYS A C    5  
ATOM 10141 O O    . LYS A 1 35  ? -11.294 -3.470  0.552   1.00 0.00 ? 54  LYS A O    5  
ATOM 10142 C CB   . LYS A 1 35  ? -10.797 -1.018  -1.318  1.00 0.00 ? 54  LYS A CB   5  
ATOM 10143 C CG   . LYS A 1 35  ? -10.355 0.364   -1.769  1.00 0.00 ? 54  LYS A CG   5  
ATOM 10144 C CD   . LYS A 1 35  ? -10.848 0.700   -3.168  1.00 0.00 ? 54  LYS A CD   5  
ATOM 10145 C CE   . LYS A 1 35  ? -12.317 0.356   -3.358  1.00 0.00 ? 54  LYS A CE   5  
ATOM 10146 N NZ   . LYS A 1 35  ? -13.210 1.339   -2.687  1.00 0.00 ? 54  LYS A NZ   5  
ATOM 10147 H H    . LYS A 1 35  ? -8.259  -1.254  -1.453  1.00 0.00 ? 54  LYS A H    5  
ATOM 10148 H HA   . LYS A 1 35  ? -10.119 -1.145  0.711   1.00 0.00 ? 54  LYS A HA   5  
ATOM 10149 H HB2  . LYS A 1 35  ? -10.791 -1.669  -2.180  2.00 0.00 ? 54  LYS A HB2  5  
ATOM 10150 H HB3  . LYS A 1 35  ? -11.811 -0.943  -0.955  2.00 0.00 ? 54  LYS A HB3  5  
ATOM 10151 H HG2  . LYS A 1 35  ? -10.742 1.098   -1.078  2.00 0.00 ? 54  LYS A HG2  5  
ATOM 10152 H HG3  . LYS A 1 35  ? -9.275  0.404   -1.762  2.00 0.00 ? 54  LYS A HG3  5  
ATOM 10153 H HD2  . LYS A 1 35  ? -10.712 1.757   -3.342  2.00 0.00 ? 54  LYS A HD2  5  
ATOM 10154 H HD3  . LYS A 1 35  ? -10.264 0.142   -3.886  2.00 0.00 ? 54  LYS A HD3  5  
ATOM 10155 H HE2  . LYS A 1 35  ? -12.537 0.345   -4.415  2.00 0.00 ? 54  LYS A HE2  5  
ATOM 10156 H HE3  . LYS A 1 35  ? -12.500 -0.625  -2.944  2.00 0.00 ? 54  LYS A HE3  5  
ATOM 10157 H HZ1  . LYS A 1 35  ? -13.824 1.801   -3.388  1.00 0.00 ? 54  LYS A HZ1  5  
ATOM 10158 H HZ2  . LYS A 1 35  ? -12.644 2.067   -2.207  1.00 0.00 ? 54  LYS A HZ2  5  
ATOM 10159 H HZ3  . LYS A 1 35  ? -13.806 0.858   -1.983  1.00 0.00 ? 54  LYS A HZ3  5  
ATOM 10160 N N    . ALA A 1 36  ? -9.451  -3.990  -0.636  1.00 0.00 ? 55  ALA A N    5  
ATOM 10161 C CA   . ALA A 1 36  ? -9.673  -5.429  -0.560  1.00 0.00 ? 55  ALA A CA   5  
ATOM 10162 C C    . ALA A 1 36  ? -9.890  -5.867  0.883   1.00 0.00 ? 55  ALA A C    5  
ATOM 10163 O O    . ALA A 1 36  ? -10.758 -6.690  1.165   1.00 0.00 ? 55  ALA A O    5  
ATOM 10164 C CB   . ALA A 1 36  ? -8.509  -6.186  -1.180  1.00 0.00 ? 55  ALA A CB   5  
ATOM 10165 H H    . ALA A 1 36  ? -8.667  -3.652  -1.116  1.00 0.00 ? 55  ALA A H    5  
ATOM 10166 H HA   . ALA A 1 36  ? -10.563 -5.656  -1.129  1.00 0.00 ? 55  ALA A HA   5  
ATOM 10167 H HB1  . ALA A 1 36  ? -8.457  -5.963  -2.235  1.00 0.00 ? 55  ALA A HB1  5  
ATOM 10168 H HB2  . ALA A 1 36  ? -8.656  -7.246  -1.041  1.00 0.00 ? 55  ALA A HB2  5  
ATOM 10169 H HB3  . ALA A 1 36  ? -7.589  -5.885  -0.702  1.00 0.00 ? 55  ALA A HB3  5  
ATOM 10170 N N    . PHE A 1 37  ? -9.109  -5.313  1.802   1.00 0.00 ? 56  PHE A N    5  
ATOM 10171 C CA   . PHE A 1 37  ? -9.259  -5.666  3.208   1.00 0.00 ? 56  PHE A CA   5  
ATOM 10172 C C    . PHE A 1 37  ? -10.109 -4.633  3.943   1.00 0.00 ? 56  PHE A C    5  
ATOM 10173 O O    . PHE A 1 37  ? -9.798  -4.239  5.065   1.00 0.00 ? 56  PHE A O    5  
ATOM 10174 C CB   . PHE A 1 37  ? -7.906  -5.830  3.896   1.00 0.00 ? 56  PHE A CB   5  
ATOM 10175 C CG   . PHE A 1 37  ? -7.023  -4.618  3.893   1.00 0.00 ? 56  PHE A CG   5  
ATOM 10176 C CD1  . PHE A 1 37  ? -6.287  -4.277  2.770   1.00 0.00 ? 56  PHE A CD1  5  
ATOM 10177 C CD2  . PHE A 1 37  ? -6.904  -3.840  5.030   1.00 0.00 ? 56  PHE A CD2  5  
ATOM 10178 C CE1  . PHE A 1 37  ? -5.451  -3.177  2.783   1.00 0.00 ? 56  PHE A CE1  5  
ATOM 10179 C CE2  . PHE A 1 37  ? -6.063  -2.747  5.054   1.00 0.00 ? 56  PHE A CE2  5  
ATOM 10180 C CZ   . PHE A 1 37  ? -5.335  -2.413  3.929   1.00 0.00 ? 56  PHE A CZ   5  
ATOM 10181 H H    . PHE A 1 37  ? -8.428  -4.655  1.531   1.00 0.00 ? 56  PHE A H    5  
ATOM 10182 H HA   . PHE A 1 37  ? -9.774  -6.613  3.244   1.00 0.00 ? 56  PHE A HA   5  
ATOM 10183 H HB2  . PHE A 1 37  ? -8.076  -6.103  4.928   2.00 0.00 ? 56  PHE A HB2  5  
ATOM 10184 H HB3  . PHE A 1 37  ? -7.364  -6.628  3.410   2.00 0.00 ? 56  PHE A HB3  5  
ATOM 10185 H HD1  . PHE A 1 37  ? -6.378  -4.874  1.875   1.00 0.00 ? 56  PHE A HD1  5  
ATOM 10186 H HD2  . PHE A 1 37  ? -7.472  -4.099  5.910   1.00 0.00 ? 56  PHE A HD2  5  
ATOM 10187 H HE1  . PHE A 1 37  ? -4.882  -2.919  1.902   1.00 0.00 ? 56  PHE A HE1  5  
ATOM 10188 H HE2  . PHE A 1 37  ? -5.979  -2.149  5.949   1.00 0.00 ? 56  PHE A HE2  5  
ATOM 10189 H HZ   . PHE A 1 37  ? -4.659  -1.571  3.956   1.00 0.00 ? 56  PHE A HZ   5  
ATOM 10190 N N    . ASN A 1 38  ? -11.193 -4.210  3.296   1.00 0.00 ? 57  ASN A N    5  
ATOM 10191 C CA   . ASN A 1 38  ? -12.107 -3.230  3.877   1.00 0.00 ? 57  ASN A CA   5  
ATOM 10192 C C    . ASN A 1 38  ? -11.352 -2.026  4.429   1.00 0.00 ? 57  ASN A C    5  
ATOM 10193 O O    . ASN A 1 38  ? -11.397 -1.752  5.629   1.00 0.00 ? 57  ASN A O    5  
ATOM 10194 C CB   . ASN A 1 38  ? -12.938 -3.876  4.988   1.00 0.00 ? 57  ASN A CB   5  
ATOM 10195 C CG   . ASN A 1 38  ? -13.502 -5.223  4.580   1.00 0.00 ? 57  ASN A CG   5  
ATOM 10196 O OD1  . ASN A 1 38  ? -14.680 -5.339  4.242   1.00 0.00 ? 57  ASN A OD1  5  
ATOM 10197 N ND2  . ASN A 1 38  ? -12.662 -6.251  4.613   4.00 0.00 ? 57  ASN A ND2  5  
ATOM 10198 H H    . ASN A 1 38  ? -11.388 -4.571  2.406   1.00 0.00 ? 57  ASN A H    5  
ATOM 10199 H HA   . ASN A 1 38  ? -12.771 -2.895  3.095   1.00 0.00 ? 57  ASN A HA   5  
ATOM 10200 H HB2  . ASN A 1 38  ? -12.315 -4.016  5.859   2.00 0.00 ? 57  ASN A HB2  5  
ATOM 10201 H HB3  . ASN A 1 38  ? -13.763 -3.222  5.238   2.00 0.00 ? 57  ASN A HB3  5  
ATOM 10202 H HD21 . ASN A 1 38  ? -11.735 -6.084  4.894   5.00 0.00 ? 57  ASN A HD21 5  
ATOM 10203 H HD22 . ASN A 1 38  ? -13.001 -7.136  4.353   5.00 0.00 ? 57  ASN A HD22 5  
ATOM 10204 N N    . SER A 1 39  ? -10.661 -1.309  3.550   1.00 0.00 ? 58  SER A N    5  
ATOM 10205 C CA   . SER A 1 39  ? -9.900  -0.132  3.956   1.00 0.00 ? 58  SER A CA   5  
ATOM 10206 C C    . SER A 1 39  ? -10.459 1.132   3.312   1.00 0.00 ? 58  SER A C    5  
ATOM 10207 O O    . SER A 1 39  ? -11.141 1.069   2.288   1.00 0.00 ? 58  SER A O    5  
ATOM 10208 C CB   . SER A 1 39  ? -8.426  -0.299  3.588   1.00 0.00 ? 58  SER A CB   5  
ATOM 10209 O OG   . SER A 1 39  ? -7.590  -0.060  4.707   1.00 0.00 ? 58  SER A OG   5  
ATOM 10210 H H    . SER A 1 39  ? -10.665 -1.574  2.607   1.00 0.00 ? 58  SER A H    5  
ATOM 10211 H HA   . SER A 1 39  ? -9.984  -0.040  5.026   1.00 0.00 ? 58  SER A HA   5  
ATOM 10212 H HB2  . SER A 1 39  ? -8.257  -1.307  3.237   2.00 0.00 ? 58  SER A HB2  5  
ATOM 10213 H HB3  . SER A 1 39  ? -8.170  0.402   2.807   2.00 0.00 ? 58  SER A HB3  5  
ATOM 10214 H HG   . SER A 1 39  ? -7.737  0.831   5.031   1.00 0.00 ? 58  SER A HG   5  
ATOM 10215 N N    . THR A 1 40  ? -10.169 2.277   3.921   1.00 0.00 ? 59  THR A N    5  
ATOM 10216 C CA   . THR A 1 40  ? -10.645 3.557   3.410   1.00 0.00 ? 59  THR A CA   5  
ATOM 10217 C C    . THR A 1 40  ? -9.482  4.446   2.974   1.00 0.00 ? 59  THR A C    5  
ATOM 10218 O O    . THR A 1 40  ? -8.332  4.209   3.349   1.00 0.00 ? 59  THR A O    5  
ATOM 10219 C CB   . THR A 1 40  ? -11.490 4.298   4.462   1.00 0.00 ? 59  THR A CB   5  
ATOM 10220 O OG1  . THR A 1 40  ? -11.613 3.498   5.644   1.00 0.00 ? 59  THR A OG1  5  
ATOM 10221 C CG2  . THR A 1 40  ? -12.873 4.618   3.916   1.00 0.00 ? 59  THR A CG2  5  
ATOM 10222 H H    . THR A 1 40  ? -9.624  2.260   4.735   1.00 0.00 ? 59  THR A H    5  
ATOM 10223 H HA   . THR A 1 40  ? -11.272 3.358   2.553   1.00 0.00 ? 59  THR A HA   5  
ATOM 10224 H HB   . THR A 1 40  ? -10.995 5.224   4.713   1.00 0.00 ? 59  THR A HB   5  
ATOM 10225 H HG1  . THR A 1 40  ? -11.886 2.609   5.403   1.00 0.00 ? 59  THR A HG1  5  
ATOM 10226 H HG21 . THR A 1 40  ? -13.565 4.742   4.735   1.00 0.00 ? 59  THR A HG21 5  
ATOM 10227 H HG22 . THR A 1 40  ? -13.206 3.810   3.282   1.00 0.00 ? 59  THR A HG22 5  
ATOM 10228 H HG23 . THR A 1 40  ? -12.831 5.532   3.340   1.00 0.00 ? 59  THR A HG23 5  
ATOM 10229 N N    . LEU A 1 41  ? -9.792  5.461   2.168   1.00 0.00 ? 60  LEU A N    5  
ATOM 10230 C CA   . LEU A 1 41  ? -8.777  6.382   1.658   1.00 0.00 ? 60  LEU A CA   5  
ATOM 10231 C C    . LEU A 1 41  ? -8.557  7.589   2.578   1.00 0.00 ? 60  LEU A C    5  
ATOM 10232 O O    . LEU A 1 41  ? -7.510  8.233   2.507   1.00 0.00 ? 60  LEU A O    5  
ATOM 10233 C CB   . LEU A 1 41  ? -9.164  6.865   0.259   1.00 0.00 ? 60  LEU A CB   5  
ATOM 10234 C CG   . LEU A 1 41  ? -10.597 7.362   0.054   1.00 0.00 ? 60  LEU A CG   5  
ATOM 10235 C CD1  . LEU A 1 41  ? -10.620 8.866   -0.167  2.00 0.00 ? 60  LEU A CD1  5  
ATOM 10236 C CD2  . LEU A 1 41  ? -11.255 6.640   -1.112  2.00 0.00 ? 60  LEU A CD2  5  
ATOM 10237 H H    . LEU A 1 41  ? -10.725 5.587   1.899   1.00 0.00 ? 60  LEU A H    5  
ATOM 10238 H HA   . LEU A 1 41  ? -7.850  5.835   1.586   1.00 0.00 ? 60  LEU A HA   5  
ATOM 10239 H HB2  . LEU A 1 41  ? -8.494  7.668   -0.010  2.00 0.00 ? 60  LEU A HB2  5  
ATOM 10240 H HB3  . LEU A 1 41  ? -8.996  6.051   -0.429  2.00 0.00 ? 60  LEU A HB3  5  
ATOM 10241 H HG   . LEU A 1 41  ? -11.160 7.143   0.948   1.00 0.00 ? 60  LEU A HG   5  
ATOM 10242 H HD11 . LEU A 1 41  ? -11.644 9.208   -0.209  1.00 0.00 ? 60  LEU A HD11 5  
ATOM 10243 H HD12 . LEU A 1 41  ? -10.123 9.102   -1.096  1.00 0.00 ? 60  LEU A HD12 5  
ATOM 10244 H HD13 . LEU A 1 41  ? -10.111 9.359   0.649   1.00 0.00 ? 60  LEU A HD13 5  
ATOM 10245 H HD21 . LEU A 1 41  ? -12.109 7.207   -1.452  1.00 0.00 ? 60  LEU A HD21 5  
ATOM 10246 H HD22 . LEU A 1 41  ? -11.579 5.660   -0.791  1.00 0.00 ? 60  LEU A HD22 5  
ATOM 10247 H HD23 . LEU A 1 41  ? -10.545 6.538   -1.919  1.00 0.00 ? 60  LEU A HD23 5  
ATOM 10248 N N    . PRO A 1 42  ? -9.533  7.931   3.443   1.00 0.00 ? 61  PRO A N    5  
ATOM 10249 C CA   . PRO A 1 42  ? -9.412  9.079   4.355   1.00 0.00 ? 61  PRO A CA   5  
ATOM 10250 C C    . PRO A 1 42  ? -8.229  8.952   5.315   1.00 0.00 ? 61  PRO A C    5  
ATOM 10251 O O    . PRO A 1 42  ? -8.223  9.556   6.387   1.00 0.00 ? 61  PRO A O    5  
ATOM 10252 C CB   . PRO A 1 42  ? -10.734 9.073   5.133   1.00 0.00 ? 61  PRO A CB   5  
ATOM 10253 C CG   . PRO A 1 42  ? -11.289 7.703   4.949   1.00 0.00 ? 61  PRO A CG   5  
ATOM 10254 C CD   . PRO A 1 42  ? -10.826 7.249   3.596   1.00 0.00 ? 61  PRO A CD   5  
ATOM 10255 H HA   . PRO A 1 42  ? -9.324  10.005  3.806   1.00 0.00 ? 61  PRO A HA   5  
ATOM 10256 H HB2  . PRO A 1 42  ? -10.541 9.284   6.174   1.00 0.00 ? 61  PRO A HB2  5  
ATOM 10257 H HB3  . PRO A 1 42  ? -11.397 9.823   4.726   1.00 0.00 ? 61  PRO A HB3  5  
ATOM 10258 H HG2  . PRO A 1 42  ? -10.906 7.045   5.717   1.00 0.00 ? 61  PRO A HG2  5  
ATOM 10259 H HG3  . PRO A 1 42  ? -12.368 7.735   4.985   1.00 0.00 ? 61  PRO A HG3  5  
ATOM 10260 H HD2  . PRO A 1 42  ? -10.703 6.177   3.579   1.00 0.00 ? 61  PRO A HD2  5  
ATOM 10261 H HD3  . PRO A 1 42  ? -11.522 7.565   2.832   1.00 0.00 ? 61  PRO A HD3  5  
ATOM 10262 N N    . THR A 1 43  ? -7.236  8.157   4.922   1.00 0.00 ? 62  THR A N    5  
ATOM 10263 C CA   . THR A 1 43  ? -6.044  7.935   5.730   1.00 0.00 ? 62  THR A CA   5  
ATOM 10264 C C    . THR A 1 43  ? -5.469  9.234   6.284   1.00 0.00 ? 62  THR A C    5  
ATOM 10265 O O    . THR A 1 43  ? -4.484  9.213   7.013   1.00 0.00 ? 62  THR A O    5  
ATOM 10266 C CB   . THR A 1 43  ? -4.950  7.209   4.928   1.00 0.00 ? 62  THR A CB   5  
ATOM 10267 O OG1  . THR A 1 43  ? -5.350  7.080   3.558   1.00 0.00 ? 62  THR A OG1  5  
ATOM 10268 C CG2  . THR A 1 43  ? -4.674  5.831   5.512   1.00 0.00 ? 62  THR A CG2  5  
ATOM 10269 H H    . THR A 1 43  ? -7.310  7.697   4.070   1.00 0.00 ? 62  THR A H    5  
ATOM 10270 H HA   . THR A 1 43  ? -6.324  7.305   6.559   1.00 0.00 ? 62  THR A HA   5  
ATOM 10271 H HB   . THR A 1 43  ? -4.041  7.792   4.976   1.00 0.00 ? 62  THR A HB   5  
ATOM 10272 H HG1  . THR A 1 43  ? -5.414  6.150   3.329   1.00 0.00 ? 62  THR A HG1  5  
ATOM 10273 H HG21 . THR A 1 43  ? -5.560  5.469   6.012   1.00 0.00 ? 62  THR A HG21 5  
ATOM 10274 H HG22 . THR A 1 43  ? -3.862  5.897   6.221   1.00 0.00 ? 62  THR A HG22 5  
ATOM 10275 H HG23 . THR A 1 43  ? -4.406  5.151   4.717   1.00 0.00 ? 62  THR A HG23 5  
ATOM 10276 N N    . MET A 1 44  ? -6.084  10.363  5.955   1.00 0.00 ? 63  MET A N    5  
ATOM 10277 C CA   . MET A 1 44  ? -5.608  11.639  6.466   1.00 0.00 ? 63  MET A CA   5  
ATOM 10278 C C    . MET A 1 44  ? -5.662  11.612  7.987   1.00 0.00 ? 63  MET A C    5  
ATOM 10279 O O    . MET A 1 44  ? -4.645  11.772  8.665   1.00 0.00 ? 63  MET A O    5  
ATOM 10280 C CB   . MET A 1 44  ? -6.458  12.791  5.924   1.00 0.00 ? 63  MET A CB   5  
ATOM 10281 C CG   . MET A 1 44  ? -5.930  14.169  6.286   1.00 0.00 ? 63  MET A CG   5  
ATOM 10282 S SD   . MET A 1 44  ? -6.063  15.346  4.927   1.00 0.00 ? 63  MET A SD   5  
ATOM 10283 C CE   . MET A 1 44  ? -5.815  16.893  5.792   1.00 0.00 ? 63  MET A CE   5  
ATOM 10284 H H    . MET A 1 44  ? -6.873  10.337  5.377   1.00 0.00 ? 63  MET A H    5  
ATOM 10285 H HA   . MET A 1 44  ? -4.584  11.765  6.153   1.00 0.00 ? 63  MET A HA   5  
ATOM 10286 H HB2  . MET A 1 44  ? -6.498  12.716  4.846   2.00 0.00 ? 63  MET A HB2  5  
ATOM 10287 H HB3  . MET A 1 44  ? -7.460  12.699  6.317   2.00 0.00 ? 63  MET A HB3  5  
ATOM 10288 H HG2  . MET A 1 44  ? -6.494  14.546  7.126   2.00 0.00 ? 63  MET A HG2  5  
ATOM 10289 H HG3  . MET A 1 44  ? -4.890  14.079  6.564   2.00 0.00 ? 63  MET A HG3  5  
ATOM 10290 H HE1  . MET A 1 44  ? -5.922  16.732  6.856   1.00 0.00 ? 63  MET A HE1  5  
ATOM 10291 H HE2  . MET A 1 44  ? -6.549  17.612  5.462   1.00 0.00 ? 63  MET A HE2  5  
ATOM 10292 H HE3  . MET A 1 44  ? -4.824  17.268  5.583   1.00 0.00 ? 63  MET A HE3  5  
ATOM 10293 N N    . ALA A 1 45  ? -6.855  11.362  8.513   1.00 0.00 ? 64  ALA A N    5  
ATOM 10294 C CA   . ALA A 1 45  ? -7.050  11.266  9.950   1.00 0.00 ? 64  ALA A CA   5  
ATOM 10295 C C    . ALA A 1 45  ? -6.725  9.852   10.405  1.00 0.00 ? 64  ALA A C    5  
ATOM 10296 O O    . ALA A 1 45  ? -6.352  9.621   11.556  1.00 0.00 ? 64  ALA A O    5  
ATOM 10297 C CB   . ALA A 1 45  ? -8.478  11.637  10.322  1.00 0.00 ? 64  ALA A CB   5  
ATOM 10298 H H    . ALA A 1 45  ? -7.617  11.209  7.915   1.00 0.00 ? 64  ALA A H    5  
ATOM 10299 H HA   . ALA A 1 45  ? -6.376  11.960  10.432  1.00 0.00 ? 64  ALA A HA   5  
ATOM 10300 H HB1  . ALA A 1 45  ? -9.058  10.737  10.466  1.00 0.00 ? 64  ALA A HB1  5  
ATOM 10301 H HB2  . ALA A 1 45  ? -8.916  12.226  9.530   1.00 0.00 ? 64  ALA A HB2  5  
ATOM 10302 H HB3  . ALA A 1 45  ? -8.474  12.210  11.237  1.00 0.00 ? 64  ALA A HB3  5  
ATOM 10303 N N    . GLN A 1 46  ? -6.863  8.911   9.475   1.00 0.00 ? 65  GLN A N    5  
ATOM 10304 C CA   . GLN A 1 46  ? -6.579  7.513   9.741   1.00 0.00 ? 65  GLN A CA   5  
ATOM 10305 C C    . GLN A 1 46  ? -5.083  7.311   9.976   1.00 0.00 ? 65  GLN A C    5  
ATOM 10306 O O    . GLN A 1 46  ? -4.675  6.457   10.765  1.00 0.00 ? 65  GLN A O    5  
ATOM 10307 C CB   . GLN A 1 46  ? -7.064  6.663   8.563   1.00 0.00 ? 65  GLN A CB   5  
ATOM 10308 C CG   . GLN A 1 46  ? -8.564  6.720   8.316   1.00 0.00 ? 65  GLN A CG   5  
ATOM 10309 C CD   . GLN A 1 46  ? -8.973  6.098   6.995   1.00 0.00 ? 65  GLN A CD   5  
ATOM 10310 O OE1  . GLN A 1 46  ? -8.340  6.322   5.963   1.00 0.00 ? 65  GLN A OE1  5  
ATOM 10311 N NE2  . GLN A 1 46  ? -10.040 5.308   7.022   4.00 0.00 ? 65  GLN A NE2  5  
ATOM 10312 H H    . GLN A 1 46  ? -7.157  9.167   8.576   1.00 0.00 ? 65  GLN A H    5  
ATOM 10313 H HA   . GLN A 1 46  ? -7.117  7.226   10.632  1.00 0.00 ? 65  GLN A HA   5  
ATOM 10314 H HB2  . GLN A 1 46  ? -6.567  6.999   7.661   2.00 0.00 ? 65  GLN A HB2  5  
ATOM 10315 H HB3  . GLN A 1 46  ? -6.791  5.634   8.743   2.00 0.00 ? 65  GLN A HB3  5  
ATOM 10316 H HG2  . GLN A 1 46  ? -9.066  6.195   9.114   2.00 0.00 ? 65  GLN A HG2  5  
ATOM 10317 H HG3  . GLN A 1 46  ? -8.875  7.754   8.319   2.00 0.00 ? 65  GLN A HG3  5  
ATOM 10318 H HE21 . GLN A 1 46  ? -10.496 5.173   7.883   5.00 0.00 ? 65  GLN A HE21 5  
ATOM 10319 H HE22 . GLN A 1 46  ? -10.328 4.891   6.182   5.00 0.00 ? 65  GLN A HE22 5  
ATOM 10320 N N    . MET A 1 47  ? -4.272  8.118   9.296   1.00 0.00 ? 66  MET A N    5  
ATOM 10321 C CA   . MET A 1 47  ? -2.823  8.042   9.438   1.00 0.00 ? 66  MET A CA   5  
ATOM 10322 C C    . MET A 1 47  ? -2.373  8.795   10.681  1.00 0.00 ? 66  MET A C    5  
ATOM 10323 O O    . MET A 1 47  ? -1.580  8.287   11.470  1.00 0.00 ? 66  MET A O    5  
ATOM 10324 C CB   . MET A 1 47  ? -2.125  8.611   8.202   1.00 0.00 ? 66  MET A CB   5  
ATOM 10325 C CG   . MET A 1 47  ? -1.631  7.555   7.227   1.00 0.00 ? 66  MET A CG   5  
ATOM 10326 S SD   . MET A 1 47  ? 0.164   7.555   7.054   1.00 0.00 ? 66  MET A SD   5  
ATOM 10327 C CE   . MET A 1 47  ? 0.450   9.234   6.500   1.00 0.00 ? 66  MET A CE   5  
ATOM 10328 H H    . MET A 1 47  ? -4.659  8.790   8.696   1.00 0.00 ? 66  MET A H    5  
ATOM 10329 H HA   . MET A 1 47  ? -2.555  7.001   9.545   1.00 0.00 ? 66  MET A HA   5  
ATOM 10330 H HB2  . MET A 1 47  ? -2.815  9.257   7.679   2.00 0.00 ? 66  MET A HB2  5  
ATOM 10331 H HB3  . MET A 1 47  ? -1.276  9.197   8.522   2.00 0.00 ? 66  MET A HB3  5  
ATOM 10332 H HG2  . MET A 1 47  ? -1.944  6.584   7.581   2.00 0.00 ? 66  MET A HG2  5  
ATOM 10333 H HG3  . MET A 1 47  ? -2.072  7.743   6.259   2.00 0.00 ? 66  MET A HG3  5  
ATOM 10334 H HE1  . MET A 1 47  ? -0.144  9.429   5.619   1.00 0.00 ? 66  MET A HE1  5  
ATOM 10335 H HE2  . MET A 1 47  ? 1.497   9.362   6.264   1.00 0.00 ? 66  MET A HE2  5  
ATOM 10336 H HE3  . MET A 1 47  ? 0.172   9.924   7.283   1.00 0.00 ? 66  MET A HE3  5  
ATOM 10337 N N    . GLU A 1 48  ? -2.895  10.008  10.855  1.00 0.00 ? 67  GLU A N    5  
ATOM 10338 C CA   . GLU A 1 48  ? -2.552  10.820  12.011  1.00 0.00 ? 67  GLU A CA   5  
ATOM 10339 C C    . GLU A 1 48  ? -2.633  9.987   13.284  1.00 0.00 ? 67  GLU A C    5  
ATOM 10340 O O    . GLU A 1 48  ? -1.687  9.942   14.069  1.00 0.00 ? 67  GLU A O    5  
ATOM 10341 C CB   . GLU A 1 48  ? -3.503  12.004  12.117  1.00 0.00 ? 67  GLU A CB   5  
ATOM 10342 C CG   . GLU A 1 48  ? -3.387  12.993  10.967  1.00 0.00 ? 67  GLU A CG   5  
ATOM 10343 C CD   . GLU A 1 48  ? -3.142  14.414  11.435  1.00 0.00 ? 67  GLU A CD   5  
ATOM 10344 O OE1  . GLU A 1 48  ? -4.065  15.011  12.028  1.00 0.00 ? 67  GLU A OE1  5  
ATOM 10345 O OE2  . GLU A 1 48  ? -2.026  14.929  11.210  1.00 0.00 ? 67  GLU A OE2  5  
ATOM 10346 H H    . GLU A 1 48  ? -3.531  10.361  10.196  1.00 0.00 ? 67  GLU A H    5  
ATOM 10347 H HA   . GLU A 1 48  ? -1.543  11.181  11.886  1.00 0.00 ? 67  GLU A HA   5  
ATOM 10348 H HB2  . GLU A 1 48  ? -4.513  11.628  12.144  2.00 0.00 ? 67  GLU A HB2  5  
ATOM 10349 H HB3  . GLU A 1 48  ? -3.302  12.529  13.034  2.00 0.00 ? 67  GLU A HB3  5  
ATOM 10350 H HG2  . GLU A 1 48  ? -2.565  12.692  10.332  2.00 0.00 ? 67  GLU A HG2  5  
ATOM 10351 H HG3  . GLU A 1 48  ? -4.306  12.972  10.398  2.00 0.00 ? 67  GLU A HG3  5  
ATOM 10352 N N    . LYS A 1 49  ? -3.767  9.318   13.471  1.00 0.00 ? 68  LYS A N    5  
ATOM 10353 C CA   . LYS A 1 49  ? -3.964  8.475   14.636  1.00 0.00 ? 68  LYS A CA   5  
ATOM 10354 C C    . LYS A 1 49  ? -2.937  7.356   14.631  1.00 0.00 ? 68  LYS A C    5  
ATOM 10355 O O    . LYS A 1 49  ? -2.187  7.181   15.591  1.00 0.00 ? 68  LYS A O    5  
ATOM 10356 C CB   . LYS A 1 49  ? -5.379  7.895   14.643  1.00 0.00 ? 68  LYS A CB   5  
ATOM 10357 C CG   . LYS A 1 49  ? -6.193  8.205   15.888  1.00 0.00 ? 68  LYS A CG   5  
ATOM 10358 C CD   . LYS A 1 49  ? -7.648  7.792   15.739  1.00 0.00 ? 68  LYS A CD   5  
ATOM 10359 C CE   . LYS A 1 49  ? -8.455  8.063   16.998  1.00 0.00 ? 68  LYS A CE   5  
ATOM 10360 N NZ   . LYS A 1 49  ? -9.887  7.693   16.829  1.00 0.00 ? 68  LYS A NZ   5  
ATOM 10361 H H    . LYS A 1 49  ? -4.480  9.383   12.803  1.00 0.00 ? 68  LYS A H    5  
ATOM 10362 H HA   . LYS A 1 49  ? -3.822  9.081   15.518  1.00 0.00 ? 68  LYS A HA   5  
ATOM 10363 H HB2  . LYS A 1 49  ? -5.914  8.282   13.790  2.00 0.00 ? 68  LYS A HB2  5  
ATOM 10364 H HB3  . LYS A 1 49  ? -5.311  6.822   14.546  2.00 0.00 ? 68  LYS A HB3  5  
ATOM 10365 H HG2  . LYS A 1 49  ? -5.764  7.676   16.727  2.00 0.00 ? 68  LYS A HG2  5  
ATOM 10366 H HG3  . LYS A 1 49  ? -6.150  9.268   16.078  2.00 0.00 ? 68  LYS A HG3  5  
ATOM 10367 H HD2  . LYS A 1 49  ? -8.085  8.344   14.919  2.00 0.00 ? 68  LYS A HD2  5  
ATOM 10368 H HD3  . LYS A 1 49  ? -7.689  6.735   15.519  2.00 0.00 ? 68  LYS A HD3  5  
ATOM 10369 H HE2  . LYS A 1 49  ? -8.037  7.487   17.810  2.00 0.00 ? 68  LYS A HE2  5  
ATOM 10370 H HE3  . LYS A 1 49  ? -8.389  9.115   17.233  2.00 0.00 ? 68  LYS A HE3  5  
ATOM 10371 H HZ1  . LYS A 1 49  ? -10.452 8.085   17.610  1.00 0.00 ? 68  LYS A HZ1  5  
ATOM 10372 H HZ2  . LYS A 1 49  ? -9.991  6.659   16.824  1.00 0.00 ? 68  LYS A HZ2  5  
ATOM 10373 H HZ3  . LYS A 1 49  ? -10.250 8.071   15.930  1.00 0.00 ? 68  LYS A HZ3  5  
ATOM 10374 N N    . ALA A 1 50  ? -2.893  6.617   13.528  1.00 0.00 ? 69  ALA A N    5  
ATOM 10375 C CA   . ALA A 1 50  ? -1.938  5.531   13.383  1.00 0.00 ? 69  ALA A CA   5  
ATOM 10376 C C    . ALA A 1 50  ? -0.518  6.054   13.553  1.00 0.00 ? 69  ALA A C    5  
ATOM 10377 O O    . ALA A 1 50  ? 0.417   5.286   13.775  1.00 0.00 ? 69  ALA A O    5  
ATOM 10378 C CB   . ALA A 1 50  ? -2.098  4.858   12.028  1.00 0.00 ? 69  ALA A CB   5  
ATOM 10379 H H    . ALA A 1 50  ? -3.506  6.819   12.790  1.00 0.00 ? 69  ALA A H    5  
ATOM 10380 H HA   . ALA A 1 50  ? -2.140  4.799   14.153  1.00 0.00 ? 69  ALA A HA   5  
ATOM 10381 H HB1  . ALA A 1 50  ? -2.257  3.799   12.167  1.00 0.00 ? 69  ALA A HB1  5  
ATOM 10382 H HB2  . ALA A 1 50  ? -1.204  5.014   11.439  1.00 0.00 ? 69  ALA A HB2  5  
ATOM 10383 H HB3  . ALA A 1 50  ? -2.945  5.285   11.512  1.00 0.00 ? 69  ALA A HB3  5  
ATOM 10384 N N    . LEU A 1 51  ? -0.363  7.373   13.451  1.00 0.00 ? 70  LEU A N    5  
ATOM 10385 C CA   . LEU A 1 51  ? 0.945   8.000   13.595  1.00 0.00 ? 70  LEU A CA   5  
ATOM 10386 C C    . LEU A 1 51  ? 1.267   8.254   15.064  1.00 0.00 ? 70  LEU A C    5  
ATOM 10387 O O    . LEU A 1 51  ? 2.400   8.061   15.504  1.00 0.00 ? 70  LEU A O    5  
ATOM 10388 C CB   . LEU A 1 51  ? 0.995   9.314   12.813  1.00 0.00 ? 70  LEU A CB   5  
ATOM 10389 C CG   . LEU A 1 51  ? 1.659   9.289   11.434  1.00 0.00 ? 70  LEU A CG   5  
ATOM 10390 C CD1  . LEU A 1 51  ? 1.371   7.981   10.714  2.00 0.00 ? 70  LEU A CD1  5  
ATOM 10391 C CD2  . LEU A 1 51  ? 1.199   10.470  10.593  2.00 0.00 ? 70  LEU A CD2  5  
ATOM 10392 H H    . LEU A 1 51  ? -1.150  7.939   13.274  1.00 0.00 ? 70  LEU A H    5  
ATOM 10393 H HA   . LEU A 1 51  ? 1.683   7.323   13.191  1.00 0.00 ? 70  LEU A HA   5  
ATOM 10394 H HB2  . LEU A 1 51  ? -0.019  9.662   12.687  2.00 0.00 ? 70  LEU A HB2  5  
ATOM 10395 H HB3  . LEU A 1 51  ? 1.518   10.039  13.419  2.00 0.00 ? 70  LEU A HB3  5  
ATOM 10396 H HG   . LEU A 1 51  ? 2.727   9.370   11.574  1.00 0.00 ? 70  LEU A HG   5  
ATOM 10397 H HD11 . LEU A 1 51  ? 0.303   7.860   10.600  1.00 0.00 ? 70  LEU A HD11 5  
ATOM 10398 H HD12 . LEU A 1 51  ? 1.767   7.158   11.290  1.00 0.00 ? 70  LEU A HD12 5  
ATOM 10399 H HD13 . LEU A 1 51  ? 1.837   7.995   9.740   1.00 0.00 ? 70  LEU A HD13 5  
ATOM 10400 H HD21 . LEU A 1 51  ? 1.877   10.607  9.763   1.00 0.00 ? 70  LEU A HD21 5  
ATOM 10401 H HD22 . LEU A 1 51  ? 1.189   11.363  11.200  1.00 0.00 ? 70  LEU A HD22 5  
ATOM 10402 H HD23 . LEU A 1 51  ? 0.204   10.279  10.217  1.00 0.00 ? 70  LEU A HD23 5  
ATOM 10403 N N    . SER A 1 52  ? 0.261   8.685   15.819  1.00 0.00 ? 71  SER A N    5  
ATOM 10404 C CA   . SER A 1 52  ? 0.438   8.963   17.240  1.00 0.00 ? 71  SER A CA   5  
ATOM 10405 C C    . SER A 1 52  ? 0.425   7.672   18.052  1.00 0.00 ? 71  SER A C    5  
ATOM 10406 O O    . SER A 1 52  ? 0.681   7.682   19.255  1.00 0.00 ? 71  SER A O    5  
ATOM 10407 C CB   . SER A 1 52  ? -0.662  9.903   17.738  1.00 0.00 ? 71  SER A CB   5  
ATOM 10408 O OG   . SER A 1 52  ? -0.185  11.233  17.855  1.00 0.00 ? 71  SER A OG   5  
ATOM 10409 H H    . SER A 1 52  ? -0.620  8.818   15.411  1.00 0.00 ? 71  SER A H    5  
ATOM 10410 H HA   . SER A 1 52  ? 1.395   9.444   17.367  1.00 0.00 ? 71  SER A HA   5  
ATOM 10411 H HB2  . SER A 1 52  ? -1.487  9.891   17.041  2.00 0.00 ? 71  SER A HB2  5  
ATOM 10412 H HB3  . SER A 1 52  ? -1.005  9.571   18.706  2.00 0.00 ? 71  SER A HB3  5  
ATOM 10413 H HG   . SER A 1 52  ? 0.081   11.555  16.990  1.00 0.00 ? 71  SER A HG   5  
ATOM 10414 N N    . ILE A 1 53  ? 0.125   6.563   17.384  1.00 0.00 ? 72  ILE A N    5  
ATOM 10415 C CA   . ILE A 1 53  ? 0.078   5.263   18.042  1.00 0.00 ? 72  ILE A CA   5  
ATOM 10416 C C    . ILE A 1 53  ? 1.380   4.497   17.836  1.00 0.00 ? 72  ILE A C    5  
ATOM 10417 O O    . ILE A 1 53  ? 1.545   3.387   18.342  1.00 0.00 ? 72  ILE A O    5  
ATOM 10418 C CB   . ILE A 1 53  ? -1.095  4.411   17.519  1.00 0.00 ? 72  ILE A CB   5  
ATOM 10419 C CG1  . ILE A 1 53  ? -0.781  3.870   16.123  1.00 0.00 ? 72  ILE A CG1  5  
ATOM 10420 C CG2  . ILE A 1 53  ? -2.378  5.225   17.505  1.00 0.00 ? 72  ILE A CG2  5  
ATOM 10421 C CD1  . ILE A 1 53  ? -0.433  2.398   16.103  1.00 0.00 ? 72  ILE A CD1  5  
ATOM 10422 H H    . ILE A 1 53  ? -0.070  6.620   16.425  1.00 0.00 ? 72  ILE A H    5  
ATOM 10423 H HA   . ILE A 1 53  ? -0.067  5.430   19.099  1.00 0.00 ? 72  ILE A HA   5  
ATOM 10424 H HB   . ILE A 1 53  ? -1.236  3.582   18.193  1.00 0.00 ? 72  ILE A HB   5  
ATOM 10425 H HG12 . ILE A 1 53  ? -1.640  4.016   15.486  2.00 0.00 ? 72  ILE A HG12 5  
ATOM 10426 H HG13 . ILE A 1 53  ? 0.057   4.415   15.714  2.00 0.00 ? 72  ILE A HG13 5  
ATOM 10427 H HG21 . ILE A 1 53  ? -2.138  6.278   17.516  1.00 0.00 ? 72  ILE A HG21 5  
ATOM 10428 H HG22 . ILE A 1 53  ? -2.969  4.983   18.376  1.00 0.00 ? 72  ILE A HG22 5  
ATOM 10429 H HG23 . ILE A 1 53  ? -2.942  4.994   16.612  1.00 0.00 ? 72  ILE A HG23 5  
ATOM 10430 H HD11 . ILE A 1 53  ? -1.067  1.888   15.393  1.00 0.00 ? 72  ILE A HD11 5  
ATOM 10431 H HD12 . ILE A 1 53  ? -0.583  1.980   17.088  1.00 0.00 ? 72  ILE A HD12 5  
ATOM 10432 H HD13 . ILE A 1 53  ? 0.601   2.277   15.814  1.00 0.00 ? 72  ILE A HD13 5  
ATOM 10433 N N    . GLY A 1 54  ? 2.301   5.095   17.089  1.00 0.00 ? 73  GLY A N    5  
ATOM 10434 C CA   . GLY A 1 54  ? 3.577   4.454   16.827  1.00 0.00 ? 73  GLY A CA   5  
ATOM 10435 C C    . GLY A 1 54  ? 3.560   3.595   15.578  1.00 0.00 ? 73  GLY A C    5  
ATOM 10436 O O    . GLY A 1 54  ? 3.664   2.370   15.657  1.00 0.00 ? 73  GLY A O    5  
ATOM 10437 H H    . GLY A 1 54  ? 2.114   5.979   16.711  1.00 0.00 ? 73  GLY A H    5  
ATOM 10438 H HA2  . GLY A 1 54  ? 4.335   5.218   16.713  2.00 0.00 ? 73  GLY A HA2  5  
ATOM 10439 H HA3  . GLY A 1 54  ? 3.833   3.832   17.673  2.00 0.00 ? 73  GLY A HA3  5  
ATOM 10440 N N    . PHE A 1 55  ? 3.424   4.237   14.422  1.00 0.00 ? 74  PHE A N    5  
ATOM 10441 C CA   . PHE A 1 55  ? 3.390   3.525   13.151  1.00 0.00 ? 74  PHE A CA   5  
ATOM 10442 C C    . PHE A 1 55  ? 3.910   4.405   12.020  1.00 0.00 ? 74  PHE A C    5  
ATOM 10443 O O    . PHE A 1 55  ? 3.446   5.529   11.829  1.00 0.00 ? 74  PHE A O    5  
ATOM 10444 C CB   . PHE A 1 55  ? 1.962   3.060   12.851  1.00 0.00 ? 74  PHE A CB   5  
ATOM 10445 C CG   . PHE A 1 55  ? 1.580   3.063   11.397  1.00 0.00 ? 74  PHE A CG   5  
ATOM 10446 C CD1  . PHE A 1 55  ? 1.023   4.191   10.813  1.00 0.00 ? 74  PHE A CD1  5  
ATOM 10447 C CD2  . PHE A 1 55  ? 1.768   1.935   10.615  1.00 0.00 ? 74  PHE A CD2  5  
ATOM 10448 C CE1  . PHE A 1 55  ? 0.663   4.191   9.480   1.00 0.00 ? 74  PHE A CE1  5  
ATOM 10449 C CE2  . PHE A 1 55  ? 1.409   1.931   9.282   1.00 0.00 ? 74  PHE A CE2  5  
ATOM 10450 C CZ   . PHE A 1 55  ? 0.857   3.060   8.714   1.00 0.00 ? 74  PHE A CZ   5  
ATOM 10451 H H    . PHE A 1 55  ? 3.344   5.214   14.425  1.00 0.00 ? 74  PHE A H    5  
ATOM 10452 H HA   . PHE A 1 55  ? 4.029   2.659   13.239  1.00 0.00 ? 74  PHE A HA   5  
ATOM 10453 H HB2  . PHE A 1 55  ? 1.842   2.051   13.218  2.00 0.00 ? 74  PHE A HB2  5  
ATOM 10454 H HB3  . PHE A 1 55  ? 1.270   3.703   13.373  2.00 0.00 ? 74  PHE A HB3  5  
ATOM 10455 H HD1  . PHE A 1 55  ? 0.872   5.077   11.413  1.00 0.00 ? 74  PHE A HD1  5  
ATOM 10456 H HD2  . PHE A 1 55  ? 2.200   1.050   11.058  1.00 0.00 ? 74  PHE A HD2  5  
ATOM 10457 H HE1  . PHE A 1 55  ? 0.231   5.076   9.037   1.00 0.00 ? 74  PHE A HE1  5  
ATOM 10458 H HE2  . PHE A 1 55  ? 1.561   1.045   8.683   1.00 0.00 ? 74  PHE A HE2  5  
ATOM 10459 H HZ   . PHE A 1 55  ? 0.575   3.057   7.672   1.00 0.00 ? 74  PHE A HZ   5  
ATOM 10460 N N    . GLU A 1 56  ? 4.880   3.886   11.274  1.00 0.00 ? 75  GLU A N    5  
ATOM 10461 C CA   . GLU A 1 56  ? 5.468   4.620   10.161  1.00 0.00 ? 75  GLU A CA   5  
ATOM 10462 C C    . GLU A 1 56  ? 6.166   3.670   9.195   1.00 0.00 ? 75  GLU A C    5  
ATOM 10463 O O    . GLU A 1 56  ? 6.559   2.565   9.571   1.00 0.00 ? 75  GLU A O    5  
ATOM 10464 C CB   . GLU A 1 56  ? 6.458   5.667   10.680  1.00 0.00 ? 75  GLU A CB   5  
ATOM 10465 C CG   . GLU A 1 56  ? 7.619   5.946   9.738   1.00 0.00 ? 75  GLU A CG   5  
ATOM 10466 C CD   . GLU A 1 56  ? 8.695   6.807   10.369  1.00 0.00 ? 75  GLU A CD   5  
ATOM 10467 O OE1  . GLU A 1 56  ? 9.583   6.248   11.045  1.00 0.00 ? 75  GLU A OE1  5  
ATOM 10468 O OE2  . GLU A 1 56  ? 8.649   8.042   10.186  1.00 0.00 ? 75  GLU A OE2  5  
ATOM 10469 H H    . GLU A 1 56  ? 5.207   2.985   11.478  1.00 0.00 ? 75  GLU A H    5  
ATOM 10470 H HA   . GLU A 1 56  ? 4.669   5.123   9.638   1.00 0.00 ? 75  GLU A HA   5  
ATOM 10471 H HB2  . GLU A 1 56  ? 5.927   6.594   10.843  2.00 0.00 ? 75  GLU A HB2  5  
ATOM 10472 H HB3  . GLU A 1 56  ? 6.863   5.324   11.623  2.00 0.00 ? 75  GLU A HB3  5  
ATOM 10473 H HG2  . GLU A 1 56  ? 8.060   5.005   9.443   2.00 0.00 ? 75  GLU A HG2  5  
ATOM 10474 H HG3  . GLU A 1 56  ? 7.241   6.452   8.863   2.00 0.00 ? 75  GLU A HG3  5  
ATOM 10475 N N    . THR A 1 57  ? 6.314   4.105   7.949   1.00 0.00 ? 76  THR A N    5  
ATOM 10476 C CA   . THR A 1 57  ? 6.962   3.292   6.929   1.00 0.00 ? 76  THR A CA   5  
ATOM 10477 C C    . THR A 1 57  ? 8.202   3.986   6.376   1.00 0.00 ? 76  THR A C    5  
ATOM 10478 O O    . THR A 1 57  ? 8.996   3.378   5.658   1.00 0.00 ? 76  THR A O    5  
ATOM 10479 C CB   . THR A 1 57  ? 6.000   2.981   5.769   1.00 0.00 ? 76  THR A CB   5  
ATOM 10480 O OG1  . THR A 1 57  ? 5.809   4.149   4.962   1.00 0.00 ? 76  THR A OG1  5  
ATOM 10481 C CG2  . THR A 1 57  ? 4.657   2.495   6.297   1.00 0.00 ? 76  THR A CG2  5  
ATOM 10482 H H    . THR A 1 57  ? 5.978   4.994   7.711   1.00 0.00 ? 76  THR A H    5  
ATOM 10483 H HA   . THR A 1 57  ? 7.257   2.358   7.385   1.00 0.00 ? 76  THR A HA   5  
ATOM 10484 H HB   . THR A 1 57  ? 6.433   2.201   5.161   1.00 0.00 ? 76  THR A HB   5  
ATOM 10485 H HG1  . THR A 1 57  ? 6.055   4.929   5.465   1.00 0.00 ? 76  THR A HG1  5  
ATOM 10486 H HG21 . THR A 1 57  ? 3.865   3.115   5.898   1.00 0.00 ? 76  THR A HG21 5  
ATOM 10487 H HG22 . THR A 1 57  ? 4.651   2.556   7.376   1.00 0.00 ? 76  THR A HG22 5  
ATOM 10488 H HG23 . THR A 1 57  ? 4.499   1.471   5.993   1.00 0.00 ? 76  THR A HG23 5  
ATOM 10489 N N    . CYS A 1 58  ? 8.363   5.261   6.716   1.00 0.00 ? 77  CYS A N    5  
ATOM 10490 C CA   . CYS A 1 58  ? 9.507   6.038   6.253   1.00 0.00 ? 77  CYS A CA   5  
ATOM 10491 C C    . CYS A 1 58  ? 9.593   6.028   4.731   1.00 0.00 ? 77  CYS A C    5  
ATOM 10492 O O    . CYS A 1 58  ? 10.637  6.339   4.156   1.00 0.00 ? 77  CYS A O    5  
ATOM 10493 C CB   . CYS A 1 58  ? 10.802  5.486   6.853   1.00 0.00 ? 77  CYS A CB   5  
ATOM 10494 S SG   . CYS A 1 58  ? 12.154  6.695   7.026   1.00 0.00 ? 77  CYS A SG   5  
ATOM 10495 H H    . CYS A 1 58  ? 7.695   5.689   7.291   1.00 0.00 ? 77  CYS A H    5  
ATOM 10496 H HA   . CYS A 1 58  ? 9.373   7.056   6.588   1.00 0.00 ? 77  CYS A HA   5  
ATOM 10497 H HB2  . CYS A 1 58  ? 10.591  5.092   7.836   2.00 0.00 ? 77  CYS A HB2  5  
ATOM 10498 H HB3  . CYS A 1 58  ? 11.162  4.685   6.225   2.00 0.00 ? 77  CYS A HB3  5  
ATOM 10499 N N    . ARG A 1 59  ? 8.489   5.671   4.083   1.00 0.00 ? 78  ARG A N    5  
ATOM 10500 C CA   . ARG A 1 59  ? 8.440   5.622   2.627   1.00 0.00 ? 78  ARG A CA   5  
ATOM 10501 C C    . ARG A 1 59  ? 7.224   6.378   2.101   1.00 0.00 ? 78  ARG A C    5  
ATOM 10502 O O    . ARG A 1 59  ? 6.125   6.257   2.641   1.00 0.00 ? 78  ARG A O    5  
ATOM 10503 C CB   . ARG A 1 59  ? 8.401   4.171   2.145   1.00 0.00 ? 78  ARG A CB   5  
ATOM 10504 C CG   . ARG A 1 59  ? 9.774   3.543   1.970   1.00 0.00 ? 78  ARG A CG   5  
ATOM 10505 C CD   . ARG A 1 59  ? 9.714   2.260   1.159   1.00 0.00 ? 78  ARG A CD   5  
ATOM 10506 N NE   . ARG A 1 59  ? 9.765   1.072   2.008   1.00 0.00 ? 78  ARG A NE   5  
ATOM 10507 C CZ   . ARG A 1 59  ? 9.912   -0.163  1.538   4.00 0.00 ? 78  ARG A CZ   5  
ATOM 10508 N NH1  . ARG A 1 59  ? 10.025  -0.376  0.234   5.00 0.00 ? 78  ARG A NH1  5  
ATOM 10509 N NH2  . ARG A 1 59  ? 9.951   -1.195  2.370   5.00 0.00 ? 78  ARG A NH2  5  
ATOM 10510 H H    . ARG A 1 59  ? 7.688   5.435   4.597   1.00 0.00 ? 78  ARG A H    5  
ATOM 10511 H HA   . ARG A 1 59  ? 9.334   6.094   2.248   1.00 0.00 ? 78  ARG A HA   5  
ATOM 10512 H HB2  . ARG A 1 59  ? 7.848   3.581   2.860   2.00 0.00 ? 78  ARG A HB2  5  
ATOM 10513 H HB3  . ARG A 1 59  ? 7.889   4.133   1.194   2.00 0.00 ? 78  ARG A HB3  5  
ATOM 10514 H HG2  . ARG A 1 59  ? 10.418  4.246   1.462   2.00 0.00 ? 78  ARG A HG2  5  
ATOM 10515 H HG3  . ARG A 1 59  ? 10.184  3.322   2.945   2.00 0.00 ? 78  ARG A HG3  5  
ATOM 10516 H HD2  . ARG A 1 59  ? 8.792   2.248   0.595   2.00 0.00 ? 78  ARG A HD2  5  
ATOM 10517 H HD3  . ARG A 1 59  ? 10.552  2.239   0.478   2.00 0.00 ? 78  ARG A HD3  5  
ATOM 10518 H HE   . ARG A 1 59  ? 9.685   1.202   2.975   1.00 0.00 ? 78  ARG A HE   5  
ATOM 10519 H HH11 . ARG A 1 59  ? 9.999   0.395   -0.402  5.00 0.00 ? 78  ARG A HH11 5  
ATOM 10520 H HH12 . ARG A 1 59  ? 10.137  -1.307  -0.112  5.00 0.00 ? 78  ARG A HH12 5  
ATOM 10521 H HH21 . ARG A 1 59  ? 9.870   -1.048  3.355   5.00 0.00 ? 78  ARG A HH21 5  
ATOM 10522 H HH22 . ARG A 1 59  ? 10.063  -2.123  2.010   5.00 0.00 ? 78  ARG A HH22 5  
ATOM 10523 N N    . TYR A 1 60  ? 7.431   7.158   1.045   1.00 0.00 ? 79  TYR A N    5  
ATOM 10524 C CA   . TYR A 1 60  ? 6.354   7.936   0.445   1.00 0.00 ? 79  TYR A CA   5  
ATOM 10525 C C    . TYR A 1 60  ? 5.103   7.083   0.264   1.00 0.00 ? 79  TYR A C    5  
ATOM 10526 O O    . TYR A 1 60  ? 5.074   6.174   -0.566  1.00 0.00 ? 79  TYR A O    5  
ATOM 10527 C CB   . TYR A 1 60  ? 6.795   8.501   -0.906  1.00 0.00 ? 79  TYR A CB   5  
ATOM 10528 C CG   . TYR A 1 60  ? 7.550   9.809   -0.852  1.00 0.00 ? 79  TYR A CG   5  
ATOM 10529 C CD1  . TYR A 1 60  ? 7.129   10.847  -0.029  1.00 0.00 ? 79  TYR A CD1  5  
ATOM 10530 C CD2  . TYR A 1 60  ? 8.685   10.008  -1.629  1.00 0.00 ? 79  TYR A CD2  5  
ATOM 10531 C CE1  . TYR A 1 60  ? 7.817   12.044  0.017   1.00 0.00 ? 79  TYR A CE1  5  
ATOM 10532 C CE2  . TYR A 1 60  ? 9.378   11.202  -1.588  1.00 0.00 ? 79  TYR A CE2  5  
ATOM 10533 C CZ   . TYR A 1 60  ? 8.941   12.216  -0.765  1.00 0.00 ? 79  TYR A CZ   5  
ATOM 10534 O OH   . TYR A 1 60  ? 9.628   13.407  -0.722  1.00 0.00 ? 79  TYR A OH   5  
ATOM 10535 H H    . TYR A 1 60  ? 8.331   7.213   0.661   1.00 0.00 ? 79  TYR A H    5  
ATOM 10536 H HA   . TYR A 1 60  ? 6.123   8.754   1.111   1.00 0.00 ? 79  TYR A HA   5  
ATOM 10537 H HB2  . TYR A 1 60  ? 7.432   7.777   -1.393  2.00 0.00 ? 79  TYR A HB2  5  
ATOM 10538 H HB3  . TYR A 1 60  ? 5.919   8.655   -1.520  2.00 0.00 ? 79  TYR A HB3  5  
ATOM 10539 H HD1  . TYR A 1 60  ? 6.250   10.710  0.584   1.00 0.00 ? 79  TYR A HD1  5  
ATOM 10540 H HD2  . TYR A 1 60  ? 9.024   9.211   -2.275  1.00 0.00 ? 79  TYR A HD2  5  
ATOM 10541 H HE1  . TYR A 1 60  ? 7.473   12.838  0.663   1.00 0.00 ? 79  TYR A HE1  5  
ATOM 10542 H HE2  . TYR A 1 60  ? 10.257  11.337  -2.201  1.00 0.00 ? 79  TYR A HE2  5  
ATOM 10543 H HH   . TYR A 1 60  ? 10.361  13.377  -1.341  1.00 0.00 ? 79  TYR A HH   5  
ATOM 10544 N N    . GLY A 1 61  ? 4.070   7.380   1.045   1.00 0.00 ? 80  GLY A N    5  
ATOM 10545 C CA   . GLY A 1 61  ? 2.832   6.632   0.953   1.00 0.00 ? 80  GLY A CA   5  
ATOM 10546 C C    . GLY A 1 61  ? 1.632   7.504   0.636   1.00 0.00 ? 80  GLY A C    5  
ATOM 10547 O O    . GLY A 1 61  ? 1.476   8.588   1.199   1.00 0.00 ? 80  GLY A O    5  
ATOM 10548 H H    . GLY A 1 61  ? 4.150   8.114   1.688   1.00 0.00 ? 80  GLY A H    5  
ATOM 10549 H HA2  . GLY A 1 61  ? 2.934   5.887   0.176   2.00 0.00 ? 80  GLY A HA2  5  
ATOM 10550 H HA3  . GLY A 1 61  ? 2.659   6.131   1.894   2.00 0.00 ? 80  GLY A HA3  5  
ATOM 10551 N N    . PHE A 1 62  ? 0.786   7.027   -0.269  1.00 0.00 ? 81  PHE A N    5  
ATOM 10552 C CA   . PHE A 1 62  ? -0.410  7.760   -0.667  1.00 0.00 ? 81  PHE A CA   5  
ATOM 10553 C C    . PHE A 1 62  ? -1.256  8.133   0.546   1.00 0.00 ? 81  PHE A C    5  
ATOM 10554 O O    . PHE A 1 62  ? -1.435  7.330   1.462   1.00 0.00 ? 81  PHE A O    5  
ATOM 10555 C CB   . PHE A 1 62  ? -1.243  6.920   -1.636  1.00 0.00 ? 81  PHE A CB   5  
ATOM 10556 C CG   . PHE A 1 62  ? -1.487  7.566   -2.968  1.00 0.00 ? 81  PHE A CG   5  
ATOM 10557 C CD1  . PHE A 1 62  ? -1.995  8.852   -3.046  1.00 0.00 ? 81  PHE A CD1  5  
ATOM 10558 C CD2  . PHE A 1 62  ? -1.204  6.888   -4.143  1.00 0.00 ? 81  PHE A CD2  5  
ATOM 10559 C CE1  . PHE A 1 62  ? -2.217  9.452   -4.271  1.00 0.00 ? 81  PHE A CE1  5  
ATOM 10560 C CE2  . PHE A 1 62  ? -1.422  7.483   -5.371  1.00 0.00 ? 81  PHE A CE2  5  
ATOM 10561 C CZ   . PHE A 1 62  ? -1.929  8.767   -5.435  1.00 0.00 ? 81  PHE A CZ   5  
ATOM 10562 H H    . PHE A 1 62  ? 0.972   6.158   -0.682  1.00 0.00 ? 81  PHE A H    5  
ATOM 10563 H HA   . PHE A 1 62  ? -0.096  8.664   -1.166  1.00 0.00 ? 81  PHE A HA   5  
ATOM 10564 H HB2  . PHE A 1 62  ? -0.735  5.983   -1.812  2.00 0.00 ? 81  PHE A HB2  5  
ATOM 10565 H HB3  . PHE A 1 62  ? -2.204  6.718   -1.186  2.00 0.00 ? 81  PHE A HB3  5  
ATOM 10566 H HD1  . PHE A 1 62  ? -2.220  9.389   -2.136  1.00 0.00 ? 81  PHE A HD1  5  
ATOM 10567 H HD2  . PHE A 1 62  ? -0.809  5.882   -4.092  1.00 0.00 ? 81  PHE A HD2  5  
ATOM 10568 H HE1  . PHE A 1 62  ? -2.612  10.456  -4.318  1.00 0.00 ? 81  PHE A HE1  5  
ATOM 10569 H HE2  . PHE A 1 62  ? -1.198  6.944   -6.280  1.00 0.00 ? 81  PHE A HE2  5  
ATOM 10570 H HZ   . PHE A 1 62  ? -2.098  9.235   -6.392  1.00 0.00 ? 81  PHE A HZ   5  
ATOM 10571 N N    . ILE A 1 63  ? -1.779  9.355   0.543   1.00 0.00 ? 82  ILE A N    5  
ATOM 10572 C CA   . ILE A 1 63  ? -2.614  9.833   1.640   1.00 0.00 ? 82  ILE A CA   5  
ATOM 10573 C C    . ILE A 1 63  ? -4.084  9.873   1.221   1.00 0.00 ? 82  ILE A C    5  
ATOM 10574 O O    . ILE A 1 63  ? -4.520  9.069   0.396   1.00 0.00 ? 82  ILE A O    5  
ATOM 10575 C CB   . ILE A 1 63  ? -2.166  11.233  2.114   1.00 0.00 ? 82  ILE A CB   5  
ATOM 10576 C CG1  . ILE A 1 63  ? -2.729  11.535  3.505   1.00 0.00 ? 82  ILE A CG1  5  
ATOM 10577 C CG2  . ILE A 1 63  ? -2.590  12.302  1.119   1.00 0.00 ? 82  ILE A CG2  5  
ATOM 10578 C CD1  . ILE A 1 63  ? -2.123  10.704  4.613   1.00 0.00 ? 82  ILE A CD1  5  
ATOM 10579 H H    . ILE A 1 63  ? -1.604  9.949   -0.218  1.00 0.00 ? 82  ILE A H    5  
ATOM 10580 H HA   . ILE A 1 63  ? -2.506  9.143   2.464   1.00 0.00 ? 82  ILE A HA   5  
ATOM 10581 H HB   . ILE A 1 63  ? -1.087  11.237  2.165   1.00 0.00 ? 82  ILE A HB   5  
ATOM 10582 H HG12 . ILE A 1 63  ? -2.551  12.575  3.736   2.00 0.00 ? 82  ILE A HG12 5  
ATOM 10583 H HG13 . ILE A 1 63  ? -3.794  11.354  3.500   2.00 0.00 ? 82  ILE A HG13 5  
ATOM 10584 H HG21 . ILE A 1 63  ? -2.291  13.273  1.485   1.00 0.00 ? 82  ILE A HG21 5  
ATOM 10585 H HG22 . ILE A 1 63  ? -3.663  12.277  1.000   1.00 0.00 ? 82  ILE A HG22 5  
ATOM 10586 H HG23 . ILE A 1 63  ? -2.117  12.115  0.167   1.00 0.00 ? 82  ILE A HG23 5  
ATOM 10587 H HD11 . ILE A 1 63  ? -2.068  9.671   4.300   1.00 0.00 ? 82  ILE A HD11 5  
ATOM 10588 H HD12 . ILE A 1 63  ? -2.740  10.778  5.497   1.00 0.00 ? 82  ILE A HD12 5  
ATOM 10589 H HD13 . ILE A 1 63  ? -1.130  11.067  4.835   1.00 0.00 ? 82  ILE A HD13 5  
ATOM 10590 N N    . GLU A 1 64  ? -4.845  10.808  1.785   1.00 0.00 ? 83  GLU A N    5  
ATOM 10591 C CA   . GLU A 1 64  ? -6.260  10.941  1.457   1.00 0.00 ? 83  GLU A CA   5  
ATOM 10592 C C    . GLU A 1 64  ? -6.449  11.133  -0.043  1.00 0.00 ? 83  GLU A C    5  
ATOM 10593 O O    . GLU A 1 64  ? -7.574  11.144  -0.543  1.00 0.00 ? 83  GLU A O    5  
ATOM 10594 C CB   . GLU A 1 64  ? -6.871  12.120  2.217   1.00 0.00 ? 83  GLU A CB   5  
ATOM 10595 C CG   . GLU A 1 64  ? -6.172  13.445  1.959   1.00 0.00 ? 83  GLU A CG   5  
ATOM 10596 C CD   . GLU A 1 64  ? -7.098  14.501  1.390   1.00 0.00 ? 83  GLU A CD   5  
ATOM 10597 O OE1  . GLU A 1 64  ? -7.510  14.360  0.219   1.00 0.00 ? 83  GLU A OE1  5  
ATOM 10598 O OE2  . GLU A 1 64  ? -7.412  15.469  2.115   1.00 0.00 ? 83  GLU A OE2  5  
ATOM 10599 H H    . GLU A 1 64  ? -4.446  11.423  2.433   1.00 0.00 ? 83  GLU A H    5  
ATOM 10600 H HA   . GLU A 1 64  ? -6.758  10.032  1.759   1.00 0.00 ? 83  GLU A HA   5  
ATOM 10601 H HB2  . GLU A 1 64  ? -7.906  12.222  1.924   2.00 0.00 ? 83  GLU A HB2  5  
ATOM 10602 H HB3  . GLU A 1 64  ? -6.826  11.914  3.275   2.00 0.00 ? 83  GLU A HB3  5  
ATOM 10603 H HG2  . GLU A 1 64  ? -5.766  13.809  2.892   2.00 0.00 ? 83  GLU A HG2  5  
ATOM 10604 H HG3  . GLU A 1 64  ? -5.366  13.281  1.259   2.00 0.00 ? 83  GLU A HG3  5  
ATOM 10605 N N    . GLY A 1 65  ? -5.337  11.284  -0.754  1.00 0.00 ? 84  GLY A N    5  
ATOM 10606 C CA   . GLY A 1 65  ? -5.390  11.475  -2.190  1.00 0.00 ? 84  GLY A CA   5  
ATOM 10607 C C    . GLY A 1 65  ? -4.197  12.248  -2.718  1.00 0.00 ? 84  GLY A C    5  
ATOM 10608 O O    . GLY A 1 65  ? -4.313  12.989  -3.695  1.00 0.00 ? 84  GLY A O    5  
ATOM 10609 H H    . GLY A 1 65  ? -4.472  11.266  -0.297  1.00 0.00 ? 84  GLY A H    5  
ATOM 10610 H HA2  . GLY A 1 65  ? -5.418  10.507  -2.670  2.00 0.00 ? 84  GLY A HA2  5  
ATOM 10611 H HA3  . GLY A 1 65  ? -6.293  12.016  -2.437  2.00 0.00 ? 84  GLY A HA3  5  
ATOM 10612 N N    . HIS A 1 66  ? -3.046  12.077  -2.072  1.00 0.00 ? 85  HIS A N    5  
ATOM 10613 C CA   . HIS A 1 66  ? -1.831  12.769  -2.486  1.00 0.00 ? 85  HIS A CA   5  
ATOM 10614 C C    . HIS A 1 66  ? -0.585  12.074  -1.942  1.00 0.00 ? 85  HIS A C    5  
ATOM 10615 O O    . HIS A 1 66  ? -0.670  11.014  -1.323  1.00 0.00 ? 85  HIS A O    5  
ATOM 10616 C CB   . HIS A 1 66  ? -1.863  14.224  -2.016  1.00 0.00 ? 85  HIS A CB   5  
ATOM 10617 C CG   . HIS A 1 66  ? -1.594  15.227  -3.094  1.00 0.00 ? 85  HIS A CG   5  
ATOM 10618 N ND1  . HIS A 1 66  ? -0.583  15.082  -4.022  1.00 0.00 ? 85  HIS A ND1  5  
ATOM 10619 C CD2  . HIS A 1 66  ? -2.210  16.395  -3.393  1.00 0.00 ? 85  HIS A CD2  5  
ATOM 10620 C CE1  . HIS A 1 66  ? -0.589  16.117  -4.843  1.00 0.00 ? 85  HIS A CE1  5  
ATOM 10621 N NE2  . HIS A 1 66  ? -1.566  16.928  -4.483  1.00 0.00 ? 85  HIS A NE2  5  
ATOM 10622 H H    . HIS A 1 66  ? -3.014  11.475  -1.299  1.00 0.00 ? 85  HIS A H    5  
ATOM 10623 H HA   . HIS A 1 66  ? -1.793  12.751  -3.565  1.00 0.00 ? 85  HIS A HA   5  
ATOM 10624 H HB2  . HIS A 1 66  ? -2.837  14.437  -1.603  2.00 0.00 ? 85  HIS A HB2  5  
ATOM 10625 H HB3  . HIS A 1 66  ? -1.118  14.360  -1.246  2.00 0.00 ? 85  HIS A HB3  5  
ATOM 10626 H HD1  . HIS A 1 66  ? 0.047   14.332  -4.070  1.00 0.00 ? 85  HIS A HD1  5  
ATOM 10627 H HD2  . HIS A 1 66  ? -3.052  16.828  -2.871  1.00 0.00 ? 85  HIS A HD2  5  
ATOM 10628 H HE1  . HIS A 1 66  ? 0.090   16.272  -5.669  1.00 0.00 ? 85  HIS A HE1  5  
ATOM 10629 H HE2  . HIS A 1 66  ? -1.849  17.725  -4.978  1.00 0.00 ? 85  HIS A HE2  5  
ATOM 10630 N N    . VAL A 1 67  ? 0.570   12.683  -2.184  1.00 0.00 ? 86  VAL A N    5  
ATOM 10631 C CA   . VAL A 1 67  ? 1.847   12.138  -1.730  1.00 0.00 ? 86  VAL A CA   5  
ATOM 10632 C C    . VAL A 1 67  ? 2.160   12.584  -0.308  1.00 0.00 ? 86  VAL A C    5  
ATOM 10633 O O    . VAL A 1 67  ? 2.445   13.754  -0.074  1.00 0.00 ? 86  VAL A O    5  
ATOM 10634 C CB   . VAL A 1 67  ? 2.991   12.592  -2.655  1.00 0.00 ? 86  VAL A CB   5  
ATOM 10635 C CG1  . VAL A 1 67  ? 3.986   11.468  -2.901  2.00 0.00 ? 86  VAL A CG1  5  
ATOM 10636 C CG2  . VAL A 1 67  ? 2.438   13.093  -3.978  2.00 0.00 ? 86  VAL A CG2  5  
ATOM 10637 H H    . VAL A 1 67  ? 0.565   13.525  -2.685  1.00 0.00 ? 86  VAL A H    5  
ATOM 10638 H HA   . VAL A 1 67  ? 1.787   11.061  -1.762  1.00 0.00 ? 86  VAL A HA   5  
ATOM 10639 H HB   . VAL A 1 67  ? 3.511   13.407  -2.172  1.00 0.00 ? 86  VAL A HB   5  
ATOM 10640 H HG11 . VAL A 1 67  ? 4.125   10.906  -1.989  1.00 0.00 ? 86  VAL A HG11 5  
ATOM 10641 H HG12 . VAL A 1 67  ? 4.931   11.885  -3.214  1.00 0.00 ? 86  VAL A HG12 5  
ATOM 10642 H HG13 . VAL A 1 67  ? 3.608   10.814  -3.672  1.00 0.00 ? 86  VAL A HG13 5  
ATOM 10643 H HG21 . VAL A 1 67  ? 3.181   12.969  -4.751  1.00 0.00 ? 86  VAL A HG21 5  
ATOM 10644 H HG22 . VAL A 1 67  ? 2.183   14.140  -3.885  1.00 0.00 ? 86  VAL A HG22 5  
ATOM 10645 H HG23 . VAL A 1 67  ? 1.551   12.528  -4.234  1.00 0.00 ? 86  VAL A HG23 5  
ATOM 10646 N N    . VAL A 1 68  ? 2.113   11.652  0.640   1.00 0.00 ? 87  VAL A N    5  
ATOM 10647 C CA   . VAL A 1 68  ? 2.398   11.983  2.031   1.00 0.00 ? 87  VAL A CA   5  
ATOM 10648 C C    . VAL A 1 68  ? 3.455   11.061  2.625   1.00 0.00 ? 87  VAL A C    5  
ATOM 10649 O O    . VAL A 1 68  ? 3.872   10.084  2.002   1.00 0.00 ? 87  VAL A O    5  
ATOM 10650 C CB   . VAL A 1 68  ? 1.133   11.910  2.904   1.00 0.00 ? 87  VAL A CB   5  
ATOM 10651 C CG1  . VAL A 1 68  ? 0.814   10.473  3.286   2.00 0.00 ? 87  VAL A CG1  5  
ATOM 10652 C CG2  . VAL A 1 68  ? 1.291   12.748  4.164   2.00 0.00 ? 87  VAL A CG2  5  
ATOM 10653 H H    . VAL A 1 68  ? 1.882   10.730  0.400   1.00 0.00 ? 87  VAL A H    5  
ATOM 10654 H HA   . VAL A 1 68  ? 2.767   12.997  2.060   1.00 0.00 ? 87  VAL A HA   5  
ATOM 10655 H HB   . VAL A 1 68  ? 0.308   12.305  2.337   1.00 0.00 ? 87  VAL A HB   5  
ATOM 10656 H HG11 . VAL A 1 68  ? 0.073   10.075  2.608   1.00 0.00 ? 87  VAL A HG11 5  
ATOM 10657 H HG12 . VAL A 1 68  ? 0.430   10.445  4.296   1.00 0.00 ? 87  VAL A HG12 5  
ATOM 10658 H HG13 . VAL A 1 68  ? 1.713   9.876   3.227   1.00 0.00 ? 87  VAL A HG13 5  
ATOM 10659 H HG21 . VAL A 1 68  ? 1.540   13.763  3.892   1.00 0.00 ? 87  VAL A HG21 5  
ATOM 10660 H HG22 . VAL A 1 68  ? 2.080   12.335  4.775   1.00 0.00 ? 87  VAL A HG22 5  
ATOM 10661 H HG23 . VAL A 1 68  ? 0.365   12.741  4.719   1.00 0.00 ? 87  VAL A HG23 5  
ATOM 10662 N N    . ILE A 1 69  ? 3.875   11.384  3.842   1.00 0.00 ? 88  ILE A N    5  
ATOM 10663 C CA   . ILE A 1 69  ? 4.879   10.596  4.548   1.00 0.00 ? 88  ILE A CA   5  
ATOM 10664 C C    . ILE A 1 69  ? 4.742   10.775  6.059   1.00 0.00 ? 88  ILE A C    5  
ATOM 10665 O O    . ILE A 1 69  ? 4.736   11.899  6.564   1.00 0.00 ? 88  ILE A O    5  
ATOM 10666 C CB   . ILE A 1 69  ? 6.309   10.980  4.109   1.00 0.00 ? 88  ILE A CB   5  
ATOM 10667 C CG1  . ILE A 1 69  ? 6.981   9.802   3.401   1.00 0.00 ? 88  ILE A CG1  5  
ATOM 10668 C CG2  . ILE A 1 69  ? 7.139   11.429  5.304   1.00 0.00 ? 88  ILE A CG2  5  
ATOM 10669 C CD1  . ILE A 1 69  ? 7.377   8.673   4.328   1.00 0.00 ? 88  ILE A CD1  5  
ATOM 10670 H H    . ILE A 1 69  ? 3.495   12.174  4.279   1.00 0.00 ? 88  ILE A H    5  
ATOM 10671 H HA   . ILE A 1 69  ? 4.716   9.557   4.303   1.00 0.00 ? 88  ILE A HA   5  
ATOM 10672 H HB   . ILE A 1 69  ? 6.238   11.809  3.421   1.00 0.00 ? 88  ILE A HB   5  
ATOM 10673 H HG12 . ILE A 1 69  ? 6.301   9.400   2.663   2.00 0.00 ? 88  ILE A HG12 5  
ATOM 10674 H HG13 . ILE A 1 69  ? 7.873   10.150  2.904   2.00 0.00 ? 88  ILE A HG13 5  
ATOM 10675 H HG21 . ILE A 1 69  ? 8.158   11.600  4.990   1.00 0.00 ? 88  ILE A HG21 5  
ATOM 10676 H HG22 . ILE A 1 69  ? 7.120   10.661  6.064   1.00 0.00 ? 88  ILE A HG22 5  
ATOM 10677 H HG23 . ILE A 1 69  ? 6.728   12.344  5.705   1.00 0.00 ? 88  ILE A HG23 5  
ATOM 10678 H HD11 . ILE A 1 69  ? 6.980   8.861   5.315   1.00 0.00 ? 88  ILE A HD11 5  
ATOM 10679 H HD12 . ILE A 1 69  ? 8.454   8.611   4.380   1.00 0.00 ? 88  ILE A HD12 5  
ATOM 10680 H HD13 . ILE A 1 69  ? 6.980   7.742   3.952   1.00 0.00 ? 88  ILE A HD13 5  
ATOM 10681 N N    . PRO A 1 70  ? 4.622   9.662   6.800   1.00 0.00 ? 89  PRO A N    5  
ATOM 10682 C CA   . PRO A 1 70  ? 4.477   9.695   8.259   1.00 0.00 ? 89  PRO A CA   5  
ATOM 10683 C C    . PRO A 1 70  ? 5.769   10.091  8.966   1.00 0.00 ? 89  PRO A C    5  
ATOM 10684 O O    . PRO A 1 70  ? 6.865   9.799   8.485   1.00 0.00 ? 89  PRO A O    5  
ATOM 10685 C CB   . PRO A 1 70  ? 4.104   8.256   8.601   1.00 0.00 ? 89  PRO A CB   5  
ATOM 10686 C CG   . PRO A 1 70  ? 4.703   7.440   7.511   1.00 0.00 ? 89  PRO A CG   5  
ATOM 10687 C CD   . PRO A 1 70  ? 4.609   8.284   6.266   1.00 0.00 ? 89  PRO A CD   5  
ATOM 10688 H HA   . PRO A 1 70  ? 3.681   10.359  8.564   1.00 0.00 ? 89  PRO A HA   5  
ATOM 10689 H HB2  . PRO A 1 70  ? 4.515   7.993   9.564   2.00 0.00 ? 89  PRO A HB2  5  
ATOM 10690 H HB3  . PRO A 1 70  ? 3.029   8.155   8.625   2.00 0.00 ? 89  PRO A HB3  5  
ATOM 10691 H HG2  . PRO A 1 70  ? 5.736   7.224   7.740   2.00 0.00 ? 89  PRO A HG2  5  
ATOM 10692 H HG3  . PRO A 1 70  ? 4.144   6.525   7.387   2.00 0.00 ? 89  PRO A HG3  5  
ATOM 10693 H HD2  . PRO A 1 70  ? 5.460   8.110   5.626   2.00 0.00 ? 89  PRO A HD2  5  
ATOM 10694 H HD3  . PRO A 1 70  ? 3.686   8.082   5.742   2.00 0.00 ? 89  PRO A HD3  5  
ATOM 10695 N N    . ARG A 1 71  ? 5.632   10.753  10.111  1.00 0.00 ? 90  ARG A N    5  
ATOM 10696 C CA   . ARG A 1 71  ? 6.789   11.187  10.888  1.00 0.00 ? 90  ARG A CA   5  
ATOM 10697 C C    . ARG A 1 71  ? 6.355   11.977  12.119  1.00 0.00 ? 90  ARG A C    5  
ATOM 10698 O O    . ARG A 1 71  ? 7.017   12.939  12.511  1.00 0.00 ? 90  ARG A O    5  
ATOM 10699 C CB   . ARG A 1 71  ? 7.720   12.040  10.024  1.00 0.00 ? 90  ARG A CB   5  
ATOM 10700 C CG   . ARG A 1 71  ? 9.174   11.592  10.012  1.00 0.00 ? 90  ARG A CG   5  
ATOM 10701 C CD   . ARG A 1 71  ? 9.829   11.768  11.372  1.00 0.00 ? 90  ARG A CD   5  
ATOM 10702 N NE   . ARG A 1 71  ? 10.365  10.512  11.884  1.00 0.00 ? 90  ARG A NE   5  
ATOM 10703 C CZ   . ARG A 1 71  ? 9.835   9.846   12.906  4.00 0.00 ? 90  ARG A CZ   5  
ATOM 10704 N NH1  . ARG A 1 71  ? 8.757   10.312  13.522  5.00 0.00 ? 90  ARG A NH1  5  
ATOM 10705 N NH2  . ARG A 1 71  ? 10.377  8.709   13.318  5.00 0.00 ? 90  ARG A NH2  5  
ATOM 10706 H H    . ARG A 1 71  ? 4.732   10.953  10.443  1.00 0.00 ? 90  ARG A H    5  
ATOM 10707 H HA   . ARG A 1 71  ? 7.321   10.304  11.210  1.00 0.00 ? 90  ARG A HA   5  
ATOM 10708 H HB2  . ARG A 1 71  ? 7.358   12.025  9.007   2.00 0.00 ? 90  ARG A HB2  5  
ATOM 10709 H HB3  . ARG A 1 71  ? 7.688   13.058  10.384  2.00 0.00 ? 90  ARG A HB3  5  
ATOM 10710 H HG2  . ARG A 1 71  ? 9.215   10.548  9.737   2.00 0.00 ? 90  ARG A HG2  5  
ATOM 10711 H HG3  . ARG A 1 71  ? 9.715   12.179  9.284   2.00 0.00 ? 90  ARG A HG3  5  
ATOM 10712 H HD2  . ARG A 1 71  ? 10.634  12.483  11.280  2.00 0.00 ? 90  ARG A HD2  5  
ATOM 10713 H HD3  . ARG A 1 71  ? 9.092   12.145  12.067  2.00 0.00 ? 90  ARG A HD3  5  
ATOM 10714 H HE   . ARG A 1 71  ? 11.161  10.145  11.446  1.00 0.00 ? 90  ARG A HE   5  
ATOM 10715 H HH11 . ARG A 1 71  ? 8.338   11.167  13.219  5.00 0.00 ? 90  ARG A HH11 5  
ATOM 10716 H HH12 . ARG A 1 71  ? 8.363   9.806   14.290  5.00 0.00 ? 90  ARG A HH12 5  
ATOM 10717 H HH21 . ARG A 1 71  ? 11.189  8.347   12.862  5.00 0.00 ? 90  ARG A HH21 5  
ATOM 10718 H HH22 . ARG A 1 71  ? 9.974   8.213   14.087  5.00 0.00 ? 90  ARG A HH22 5  
ATOM 10719 N N    . ILE A 1 72  ? 5.244   11.563  12.724  1.00 0.00 ? 91  ILE A N    5  
ATOM 10720 C CA   . ILE A 1 72  ? 4.719   12.230  13.912  1.00 0.00 ? 91  ILE A CA   5  
ATOM 10721 C C    . ILE A 1 72  ? 5.073   13.715  13.919  1.00 0.00 ? 91  ILE A C    5  
ATOM 10722 O O    . ILE A 1 72  ? 4.478   14.507  13.187  1.00 0.00 ? 91  ILE A O    5  
ATOM 10723 C CB   . ILE A 1 72  ? 5.250   11.579  15.203  1.00 0.00 ? 91  ILE A CB   5  
ATOM 10724 C CG1  . ILE A 1 72  ? 5.136   10.056  15.114  1.00 0.00 ? 91  ILE A CG1  5  
ATOM 10725 C CG2  . ILE A 1 72  ? 4.492   12.109  16.413  1.00 0.00 ? 91  ILE A CG2  5  
ATOM 10726 C CD1  . ILE A 1 72  ? 4.905   9.381   16.448  1.00 0.00 ? 91  ILE A CD1  5  
ATOM 10727 H H    . ILE A 1 72  ? 4.764   10.790  12.361  1.00 0.00 ? 91  ILE A H    5  
ATOM 10728 H HA   . ILE A 1 72  ? 3.644   12.127  13.903  1.00 0.00 ? 91  ILE A HA   5  
ATOM 10729 H HB   . ILE A 1 72  ? 6.289   11.849  15.315  1.00 0.00 ? 91  ILE A HB   5  
ATOM 10730 H HG12 . ILE A 1 72  ? 4.307   9.802   14.468  2.00 0.00 ? 91  ILE A HG12 5  
ATOM 10731 H HG13 . ILE A 1 72  ? 6.047   9.656   14.694  2.00 0.00 ? 91  ILE A HG13 5  
ATOM 10732 H HG21 . ILE A 1 72  ? 4.425   13.185  16.353  1.00 0.00 ? 91  ILE A HG21 5  
ATOM 10733 H HG22 . ILE A 1 72  ? 5.015   11.830  17.316  1.00 0.00 ? 91  ILE A HG22 5  
ATOM 10734 H HG23 . ILE A 1 72  ? 3.498   11.687  16.427  1.00 0.00 ? 91  ILE A HG23 5  
ATOM 10735 H HD11 . ILE A 1 72  ? 5.618   9.755   17.167  1.00 0.00 ? 91  ILE A HD11 5  
ATOM 10736 H HD12 . ILE A 1 72  ? 5.029   8.314   16.338  1.00 0.00 ? 91  ILE A HD12 5  
ATOM 10737 H HD13 . ILE A 1 72  ? 3.904   9.594   16.789  1.00 0.00 ? 91  ILE A HD13 5  
ATOM 10738 N N    . HIS A 1 73  ? 6.047   14.086  14.746  1.00 0.00 ? 92  HIS A N    5  
ATOM 10739 C CA   . HIS A 1 73  ? 6.481   15.475  14.843  1.00 0.00 ? 92  HIS A CA   5  
ATOM 10740 C C    . HIS A 1 73  ? 7.682   15.615  15.779  1.00 0.00 ? 92  HIS A C    5  
ATOM 10741 O O    . HIS A 1 73  ? 7.723   16.515  16.618  1.00 0.00 ? 92  HIS A O    5  
ATOM 10742 C CB   . HIS A 1 73  ? 5.333   16.358  15.336  1.00 0.00 ? 92  HIS A CB   5  
ATOM 10743 C CG   . HIS A 1 73  ? 4.586   15.801  16.509  1.00 0.00 ? 92  HIS A CG   5  
ATOM 10744 N ND1  . HIS A 1 73  ? 3.241   15.499  16.471  1.00 0.00 ? 92  HIS A ND1  5  
ATOM 10745 C CD2  . HIS A 1 73  ? 5.004   15.489  17.759  1.00 0.00 ? 92  HIS A CD2  5  
ATOM 10746 C CE1  . HIS A 1 73  ? 2.864   15.029  17.647  1.00 0.00 ? 92  HIS A CE1  5  
ATOM 10747 N NE2  . HIS A 1 73  ? 3.915   15.012  18.445  1.00 0.00 ? 92  HIS A NE2  5  
ATOM 10748 H H    . HIS A 1 73  ? 6.485   13.409  15.303  1.00 0.00 ? 92  HIS A H    5  
ATOM 10749 H HA   . HIS A 1 73  ? 6.773   15.799  13.855  1.00 0.00 ? 92  HIS A HA   5  
ATOM 10750 H HB2  . HIS A 1 73  ? 5.729   17.320  15.625  2.00 0.00 ? 92  HIS A HB2  5  
ATOM 10751 H HB3  . HIS A 1 73  ? 4.626   16.496  14.531  2.00 0.00 ? 92  HIS A HB3  5  
ATOM 10752 H HD1  . HIS A 1 73  ? 2.650   15.615  15.698  1.00 0.00 ? 92  HIS A HD1  5  
ATOM 10753 H HD2  . HIS A 1 73  ? 6.008   15.597  18.145  1.00 0.00 ? 92  HIS A HD2  5  
ATOM 10754 H HE1  . HIS A 1 73  ? 1.866   14.710  17.909  1.00 0.00 ? 92  HIS A HE1  5  
ATOM 10755 H HE2  . HIS A 1 73  ? 3.934   14.627  19.346  1.00 0.00 ? 92  HIS A HE2  5  
ATOM 10756 N N    . PRO A 1 74  ? 8.679   14.723  15.646  1.00 0.00 ? 93  PRO A N    5  
ATOM 10757 C CA   . PRO A 1 74  ? 9.878   14.754  16.482  1.00 0.00 ? 93  PRO A CA   5  
ATOM 10758 C C    . PRO A 1 74  ? 10.890  15.793  16.008  1.00 0.00 ? 93  PRO A C    5  
ATOM 10759 O O    . PRO A 1 74  ? 11.061  16.839  16.634  1.00 0.00 ? 93  PRO A O    5  
ATOM 10760 C CB   . PRO A 1 74  ? 10.439  13.346  16.317  1.00 0.00 ? 93  PRO A CB   5  
ATOM 10761 C CG   . PRO A 1 74  ? 10.031  12.935  14.944  1.00 0.00 ? 93  PRO A CG   5  
ATOM 10762 C CD   . PRO A 1 74  ? 8.711   13.615  14.669  1.00 0.00 ? 93  PRO A CD   5  
ATOM 10763 H HA   . PRO A 1 74  ? 9.637   14.932  17.519  1.00 0.00 ? 93  PRO A HA   5  
ATOM 10764 H HB2  . PRO A 1 74  ? 11.513  13.368  16.420  2.00 0.00 ? 93  PRO A HB2  5  
ATOM 10765 H HB3  . PRO A 1 74  ? 10.013  12.696  17.067  2.00 0.00 ? 93  PRO A HB3  5  
ATOM 10766 H HG2  . PRO A 1 74  ? 10.774  13.259  14.229  2.00 0.00 ? 93  PRO A HG2  5  
ATOM 10767 H HG3  . PRO A 1 74  ? 9.914   11.862  14.903  2.00 0.00 ? 93  PRO A HG3  5  
ATOM 10768 H HD2  . PRO A 1 74  ? 8.687   13.994  13.658  2.00 0.00 ? 93  PRO A HD2  5  
ATOM 10769 H HD3  . PRO A 1 74  ? 7.893   12.931  14.839  2.00 0.00 ? 93  PRO A HD3  5  
ATOM 10770 N N    . ASN A 1 75  ? 11.558  15.497  14.898  1.00 0.00 ? 94  ASN A N    5  
ATOM 10771 C CA   . ASN A 1 75  ? 12.552  16.403  14.336  1.00 0.00 ? 94  ASN A CA   5  
ATOM 10772 C C    . ASN A 1 75  ? 12.802  16.089  12.864  1.00 0.00 ? 94  ASN A C    5  
ATOM 10773 O O    . ASN A 1 75  ? 13.791  16.536  12.284  1.00 0.00 ? 94  ASN A O    5  
ATOM 10774 C CB   . ASN A 1 75  ? 13.863  16.306  15.120  1.00 0.00 ? 94  ASN A CB   5  
ATOM 10775 C CG   . ASN A 1 75  ? 14.431  14.900  15.133  1.00 0.00 ? 94  ASN A CG   5  
ATOM 10776 O OD1  . ASN A 1 75  ? 13.814  13.974  15.659  1.00 0.00 ? 94  ASN A OD1  5  
ATOM 10777 N ND2  . ASN A 1 75  ? 15.613  14.735  14.552  4.00 0.00 ? 94  ASN A ND2  5  
ATOM 10778 H H    . ASN A 1 75  ? 11.378  14.648  14.444  1.00 0.00 ? 94  ASN A H    5  
ATOM 10779 H HA   . ASN A 1 75  ? 12.168  17.409  14.419  1.00 0.00 ? 94  ASN A HA   5  
ATOM 10780 H HB2  . ASN A 1 75  ? 14.592  16.964  14.672  2.00 0.00 ? 94  ASN A HB2  5  
ATOM 10781 H HB3  . ASN A 1 75  ? 13.688  16.612  16.141  2.00 0.00 ? 94  ASN A HB3  5  
ATOM 10782 H HD21 . ASN A 1 75  ? 16.049  15.521  14.152  5.00 0.00 ? 94  ASN A HD21 5  
ATOM 10783 H HD22 . ASN A 1 75  ? 16.005  13.834  14.546  5.00 0.00 ? 94  ASN A HD22 5  
ATOM 10784 N N    . SER A 1 76  ? 11.897  15.318  12.270  1.00 0.00 ? 95  SER A N    5  
ATOM 10785 C CA   . SER A 1 76  ? 12.016  14.942  10.866  1.00 0.00 ? 95  SER A CA   5  
ATOM 10786 C C    . SER A 1 76  ? 13.312  14.178  10.614  1.00 0.00 ? 95  SER A C    5  
ATOM 10787 O O    . SER A 1 76  ? 14.316  14.758  10.201  1.00 0.00 ? 95  SER A O    5  
ATOM 10788 C CB   . SER A 1 76  ? 11.960  16.183  9.974   1.00 0.00 ? 95  SER A CB   5  
ATOM 10789 O OG   . SER A 1 76  ? 11.180  15.945  8.816   1.00 0.00 ? 95  SER A OG   5  
ATOM 10790 H H    . SER A 1 76  ? 11.131  14.994  12.787  1.00 0.00 ? 95  SER A H    5  
ATOM 10791 H HA   . SER A 1 76  ? 11.182  14.299  10.624  1.00 0.00 ? 95  SER A HA   5  
ATOM 10792 H HB2  . SER A 1 76  ? 11.520  17.001  10.527  2.00 0.00 ? 95  SER A HB2  5  
ATOM 10793 H HB3  . SER A 1 76  ? 12.960  16.452  9.670   2.00 0.00 ? 95  SER A HB3  5  
ATOM 10794 H HG   . SER A 1 76  ? 10.828  15.053  8.843   1.00 0.00 ? 95  SER A HG   5  
ATOM 10795 N N    . ILE A 1 77  ? 13.281  12.872  10.863  1.00 0.00 ? 96  ILE A N    5  
ATOM 10796 C CA   . ILE A 1 77  ? 14.453  12.029  10.663  1.00 0.00 ? 96  ILE A CA   5  
ATOM 10797 C C    . ILE A 1 77  ? 14.283  11.138  9.436   1.00 0.00 ? 96  ILE A C    5  
ATOM 10798 O O    . ILE A 1 77  ? 15.246  10.547  8.947   1.00 0.00 ? 96  ILE A O    5  
ATOM 10799 C CB   . ILE A 1 77  ? 14.725  11.144  11.894  1.00 0.00 ? 96  ILE A CB   5  
ATOM 10800 C CG1  . ILE A 1 77  ? 16.108  10.498  11.791  1.00 0.00 ? 96  ILE A CG1  5  
ATOM 10801 C CG2  . ILE A 1 77  ? 13.647  10.078  12.032  1.00 0.00 ? 96  ILE A CG2  5  
ATOM 10802 C CD1  . ILE A 1 77  ? 16.850  10.422  13.108  1.00 0.00 ? 96  ILE A CD1  5  
ATOM 10803 H H    . ILE A 1 77  ? 12.450  12.468  11.189  1.00 0.00 ? 96  ILE A H    5  
ATOM 10804 H HA   . ILE A 1 77  ? 15.306  12.673  10.512  1.00 0.00 ? 96  ILE A HA   5  
ATOM 10805 H HB   . ILE A 1 77  ? 14.692  11.770  12.774  1.00 0.00 ? 96  ILE A HB   5  
ATOM 10806 H HG12 . ILE A 1 77  ? 16.001  9.491   11.413  2.00 0.00 ? 96  ILE A HG12 5  
ATOM 10807 H HG13 . ILE A 1 77  ? 16.715  11.072  11.104  2.00 0.00 ? 96  ILE A HG13 5  
ATOM 10808 H HG21 . ILE A 1 77  ? 13.836  9.488   12.916  1.00 0.00 ? 96  ILE A HG21 5  
ATOM 10809 H HG22 . ILE A 1 77  ? 13.658  9.440   11.162  1.00 0.00 ? 96  ILE A HG22 5  
ATOM 10810 H HG23 . ILE A 1 77  ? 12.680  10.553  12.117  1.00 0.00 ? 96  ILE A HG23 5  
ATOM 10811 H HD11 . ILE A 1 77  ? 16.422  11.128  13.804  1.00 0.00 ? 96  ILE A HD11 5  
ATOM 10812 H HD12 . ILE A 1 77  ? 17.892  10.659  12.949  1.00 0.00 ? 96  ILE A HD12 5  
ATOM 10813 H HD13 . ILE A 1 77  ? 16.766  9.423   13.511  1.00 0.00 ? 96  ILE A HD13 5  
ATOM 10814 N N    . CYS A 1 78  ? 13.052  11.046  8.944   1.00 0.00 ? 97  CYS A N    5  
ATOM 10815 C CA   . CYS A 1 78  ? 12.754  10.227  7.774   1.00 0.00 ? 97  CYS A CA   5  
ATOM 10816 C C    . CYS A 1 78  ? 12.694  11.081  6.512   1.00 0.00 ? 97  CYS A C    5  
ATOM 10817 O O    . CYS A 1 78  ? 13.593  11.030  5.672   1.00 0.00 ? 97  CYS A O    5  
ATOM 10818 C CB   . CYS A 1 78  ? 11.429  9.487   7.967   1.00 0.00 ? 97  CYS A CB   5  
ATOM 10819 S SG   . CYS A 1 78  ? 11.609  7.803   8.638   1.00 0.00 ? 97  CYS A SG   5  
ATOM 10820 H H    . CYS A 1 78  ? 12.326  11.540  9.377   1.00 0.00 ? 97  CYS A H    5  
ATOM 10821 H HA   . CYS A 1 78  ? 13.549  9.503   7.666   1.00 0.00 ? 97  CYS A HA   5  
ATOM 10822 H HB2  . CYS A 1 78  ? 10.809  10.047  8.650   2.00 0.00 ? 97  CYS A HB2  5  
ATOM 10823 H HB3  . CYS A 1 78  ? 10.928  9.410   7.014   2.00 0.00 ? 97  CYS A HB3  5  
ATOM 10824 N N    . ALA A 1 79  ? 11.628  11.866  6.385   1.00 0.00 ? 98  ALA A N    5  
ATOM 10825 C CA   . ALA A 1 79  ? 11.452  12.731  5.224   1.00 0.00 ? 98  ALA A CA   5  
ATOM 10826 C C    . ALA A 1 79  ? 12.494  13.844  5.205   1.00 0.00 ? 98  ALA A C    5  
ATOM 10827 O O    . ALA A 1 79  ? 13.618  13.645  4.744   1.00 0.00 ? 98  ALA A O    5  
ATOM 10828 C CB   . ALA A 1 79  ? 10.047  13.316  5.212   1.00 0.00 ? 98  ALA A CB   5  
ATOM 10829 H H    . ALA A 1 79  ? 10.946  11.863  7.087   1.00 0.00 ? 98  ALA A H    5  
ATOM 10830 H HA   . ALA A 1 79  ? 11.571  12.125  4.338   1.00 0.00 ? 98  ALA A HA   5  
ATOM 10831 H HB1  . ALA A 1 79  ? 9.401   12.687  4.618   1.00 0.00 ? 98  ALA A HB1  5  
ATOM 10832 H HB2  . ALA A 1 79  ? 10.075  14.308  4.786   1.00 0.00 ? 98  ALA A HB2  5  
ATOM 10833 H HB3  . ALA A 1 79  ? 9.671   13.368  6.223   1.00 0.00 ? 98  ALA A HB3  5  
ATOM 10834 N N    . ALA A 1 80  ? 12.116  15.016  5.707   1.00 0.00 ? 99  ALA A N    5  
ATOM 10835 C CA   . ALA A 1 80  ? 13.020  16.159  5.746   1.00 0.00 ? 99  ALA A CA   5  
ATOM 10836 C C    . ALA A 1 80  ? 12.378  17.348  6.453   1.00 0.00 ? 99  ALA A C    5  
ATOM 10837 O O    . ALA A 1 80  ? 12.942  17.898  7.398   1.00 0.00 ? 99  ALA A O    5  
ATOM 10838 C CB   . ALA A 1 80  ? 13.441  16.547  4.336   1.00 0.00 ? 99  ALA A CB   5  
ATOM 10839 H H    . ALA A 1 80  ? 11.207  15.113  6.060   1.00 0.00 ? 99  ALA A H    5  
ATOM 10840 H HA   . ALA A 1 80  ? 13.906  15.864  6.290   1.00 0.00 ? 99  ALA A HA   5  
ATOM 10841 H HB1  . ALA A 1 80  ? 12.769  17.302  3.955   1.00 0.00 ? 99  ALA A HB1  5  
ATOM 10842 H HB2  . ALA A 1 80  ? 13.404  15.677  3.697   1.00 0.00 ? 99  ALA A HB2  5  
ATOM 10843 H HB3  . ALA A 1 80  ? 14.447  16.937  4.355   1.00 0.00 ? 99  ALA A HB3  5  
ATOM 10844 N N    . ASN A 1 81  ? 11.198  17.740  5.985   1.00 0.00 ? 100 ASN A N    5  
ATOM 10845 C CA   . ASN A 1 81  ? 10.479  18.867  6.571   1.00 0.00 ? 100 ASN A CA   5  
ATOM 10846 C C    . ASN A 1 81  ? 10.171  18.613  8.044   1.00 0.00 ? 100 ASN A C    5  
ATOM 10847 O O    . ASN A 1 81  ? 11.013  18.841  8.912   1.00 0.00 ? 100 ASN A O    5  
ATOM 10848 C CB   . ASN A 1 81  ? 9.182   19.128  5.803   1.00 0.00 ? 100 ASN A CB   5  
ATOM 10849 C CG   . ASN A 1 81  ? 8.807   20.596  5.775   1.00 0.00 ? 100 ASN A CG   5  
ATOM 10850 O OD1  . ASN A 1 81  ? 7.686   20.969  6.118   1.00 0.00 ? 100 ASN A OD1  5  
ATOM 10851 N ND2  . ASN A 1 81  ? 9.748   21.439  5.365   4.00 0.00 ? 100 ASN A ND2  5  
ATOM 10852 H H    . ASN A 1 81  ? 10.800  17.263  5.227   1.00 0.00 ? 100 ASN A H    5  
ATOM 10853 H HA   . ASN A 1 81  ? 11.112  19.738  6.495   1.00 0.00 ? 100 ASN A HA   5  
ATOM 10854 H HB2  . ASN A 1 81  ? 9.300   18.786  4.785   2.00 0.00 ? 100 ASN A HB2  5  
ATOM 10855 H HB3  . ASN A 1 81  ? 8.378   18.579  6.270   2.00 0.00 ? 100 ASN A HB3  5  
ATOM 10856 H HD21 . ASN A 1 81  ? 10.622  21.070  5.106   5.00 0.00 ? 100 ASN A HD21 5  
ATOM 10857 H HD22 . ASN A 1 81  ? 9.532   22.397  5.337   5.00 0.00 ? 100 ASN A HD22 5  
ATOM 10858 N N    . ASN A 1 82  ? 8.958   18.141  8.320   1.00 0.00 ? 101 ASN A N    5  
ATOM 10859 C CA   . ASN A 1 82  ? 8.540   17.857  9.687   1.00 0.00 ? 101 ASN A CA   5  
ATOM 10860 C C    . ASN A 1 82  ? 7.133   17.267  9.715   1.00 0.00 ? 101 ASN A C    5  
ATOM 10861 O O    . ASN A 1 82  ? 6.593   16.877  8.681   1.00 0.00 ? 101 ASN A O    5  
ATOM 10862 C CB   . ASN A 1 82  ? 8.586   19.131  10.534  1.00 0.00 ? 101 ASN A CB   5  
ATOM 10863 C CG   . ASN A 1 82  ? 7.596   20.180  10.064  1.00 0.00 ? 101 ASN A CG   5  
ATOM 10864 O OD1  . ASN A 1 82  ? 7.311   20.293  8.873   1.00 0.00 ? 101 ASN A OD1  5  
ATOM 10865 N ND2  . ASN A 1 82  ? 7.068   20.956  11.003  4.00 0.00 ? 101 ASN A ND2  5  
ATOM 10866 H H    . ASN A 1 82  ? 8.330   17.980  7.585   1.00 0.00 ? 101 ASN A H    5  
ATOM 10867 H HA   . ASN A 1 82  ? 9.228   17.136  10.101  1.00 0.00 ? 101 ASN A HA   5  
ATOM 10868 H HB2  . ASN A 1 82  ? 8.358   18.883  11.560  2.00 0.00 ? 101 ASN A HB2  5  
ATOM 10869 H HB3  . ASN A 1 82  ? 9.579   19.554  10.483  2.00 0.00 ? 101 ASN A HB3  5  
ATOM 10870 H HD21 . ASN A 1 82  ? 7.343   20.810  11.935  5.00 0.00 ? 101 ASN A HD21 5  
ATOM 10871 H HD22 . ASN A 1 82  ? 6.423   21.645  10.727  5.00 0.00 ? 101 ASN A HD22 5  
ATOM 10872 N N    . THR A 1 83  ? 6.547   17.205  10.907  1.00 0.00 ? 102 THR A N    5  
ATOM 10873 C CA   . THR A 1 83  ? 5.204   16.662  11.075  1.00 0.00 ? 102 THR A CA   5  
ATOM 10874 C C    . THR A 1 83  ? 5.098   15.258  10.489  1.00 0.00 ? 102 THR A C    5  
ATOM 10875 O O    . THR A 1 83  ? 6.099   14.671  10.075  1.00 0.00 ? 102 THR A O    5  
ATOM 10876 C CB   . THR A 1 83  ? 4.145   17.564  10.411  1.00 0.00 ? 102 THR A CB   5  
ATOM 10877 O OG1  . THR A 1 83  ? 4.085   17.299  9.005   1.00 0.00 ? 102 THR A OG1  5  
ATOM 10878 C CG2  . THR A 1 83  ? 4.464   19.034  10.641  1.00 0.00 ? 102 THR A CG2  5  
ATOM 10879 H H    . THR A 1 83  ? 7.031   17.532  11.694  1.00 0.00 ? 102 THR A H    5  
ATOM 10880 H HA   . THR A 1 83  ? 4.993   16.616  12.133  1.00 0.00 ? 102 THR A HA   5  
ATOM 10881 H HB   . THR A 1 83  ? 3.182   17.347  10.851  1.00 0.00 ? 102 THR A HB   5  
ATOM 10882 H HG1  . THR A 1 83  ? 3.468   17.907  8.590   1.00 0.00 ? 102 THR A HG1  5  
ATOM 10883 H HG21 . THR A 1 83  ? 3.544   19.597  10.695  1.00 0.00 ? 102 THR A HG21 5  
ATOM 10884 H HG22 . THR A 1 83  ? 5.065   19.403  9.824   1.00 0.00 ? 102 THR A HG22 5  
ATOM 10885 H HG23 . THR A 1 83  ? 5.009   19.144  11.567  1.00 0.00 ? 102 THR A HG23 5  
ATOM 10886 N N    . GLY A 1 84  ? 3.881   14.725  10.457  1.00 0.00 ? 103 GLY A N    5  
ATOM 10887 C CA   . GLY A 1 84  ? 3.669   13.393  9.922   1.00 0.00 ? 103 GLY A CA   5  
ATOM 10888 C C    . GLY A 1 84  ? 2.870   13.398  8.634   1.00 0.00 ? 103 GLY A C    5  
ATOM 10889 O O    . GLY A 1 84  ? 2.394   12.354  8.188   1.00 0.00 ? 103 GLY A O    5  
ATOM 10890 H H    . GLY A 1 84  ? 3.122   15.240  10.802  1.00 0.00 ? 103 GLY A H    5  
ATOM 10891 H HA2  . GLY A 1 84  ? 4.630   12.936  9.734   2.00 0.00 ? 103 GLY A HA2  5  
ATOM 10892 H HA3  . GLY A 1 84  ? 3.140   12.802  10.658  2.00 0.00 ? 103 GLY A HA3  5  
ATOM 10893 N N    . VAL A 1 85  ? 2.724   14.575  8.035   1.00 0.00 ? 104 VAL A N    5  
ATOM 10894 C CA   . VAL A 1 85  ? 1.977   14.710  6.790   1.00 0.00 ? 104 VAL A CA   5  
ATOM 10895 C C    . VAL A 1 85  ? 2.840   15.336  5.698   1.00 0.00 ? 104 VAL A C    5  
ATOM 10896 O O    . VAL A 1 85  ? 2.395   16.225  4.970   1.00 0.00 ? 104 VAL A O    5  
ATOM 10897 C CB   . VAL A 1 85  ? 0.705   15.560  6.986   1.00 0.00 ? 104 VAL A CB   5  
ATOM 10898 C CG1  . VAL A 1 85  ? 1.058   17.003  7.313   2.00 0.00 ? 104 VAL A CG1  5  
ATOM 10899 C CG2  . VAL A 1 85  ? -0.183  15.502  5.752   2.00 0.00 ? 104 VAL A CG2  5  
ATOM 10900 H H    . VAL A 1 85  ? 3.126   15.371  8.439   1.00 0.00 ? 104 VAL A H    5  
ATOM 10901 H HA   . VAL A 1 85  ? 1.678   13.721  6.473   1.00 0.00 ? 104 VAL A HA   5  
ATOM 10902 H HB   . VAL A 1 85  ? 0.155   15.147  7.819   1.00 0.00 ? 104 VAL A HB   5  
ATOM 10903 H HG11 . VAL A 1 85  ? 2.074   17.052  7.675   1.00 0.00 ? 104 VAL A HG11 5  
ATOM 10904 H HG12 . VAL A 1 85  ? 0.386   17.375  8.073   1.00 0.00 ? 104 VAL A HG12 5  
ATOM 10905 H HG13 . VAL A 1 85  ? 0.964   17.607  6.423   1.00 0.00 ? 104 VAL A HG13 5  
ATOM 10906 H HG21 . VAL A 1 85  ? -1.202  15.306  6.049   1.00 0.00 ? 104 VAL A HG21 5  
ATOM 10907 H HG22 . VAL A 1 85  ? 0.160   14.713  5.098   1.00 0.00 ? 104 VAL A HG22 5  
ATOM 10908 H HG23 . VAL A 1 85  ? -0.135  16.447  5.230   1.00 0.00 ? 104 VAL A HG23 5  
ATOM 10909 N N    . TYR A 1 86  ? 4.078   14.866  5.589   1.00 0.00 ? 105 TYR A N    5  
ATOM 10910 C CA   . TYR A 1 86  ? 5.003   15.378  4.585   1.00 0.00 ? 105 TYR A CA   5  
ATOM 10911 C C    . TYR A 1 86  ? 4.549   14.989  3.183   1.00 0.00 ? 105 TYR A C    5  
ATOM 10912 O O    . TYR A 1 86  ? 4.385   13.807  2.881   1.00 0.00 ? 105 TYR A O    5  
ATOM 10913 C CB   . TYR A 1 86  ? 6.413   14.842  4.843   1.00 0.00 ? 105 TYR A CB   5  
ATOM 10914 C CG   . TYR A 1 86  ? 7.434   15.237  3.799   1.00 0.00 ? 105 TYR A CG   5  
ATOM 10915 C CD1  . TYR A 1 86  ? 8.148   16.422  3.916   1.00 0.00 ? 105 TYR A CD1  5  
ATOM 10916 C CD2  . TYR A 1 86  ? 7.683   14.425  2.698   1.00 0.00 ? 105 TYR A CD2  5  
ATOM 10917 C CE1  . TYR A 1 86  ? 9.084   16.789  2.966   1.00 0.00 ? 105 TYR A CE1  5  
ATOM 10918 C CE2  . TYR A 1 86  ? 8.617   14.786  1.746   1.00 0.00 ? 105 TYR A CE2  5  
ATOM 10919 C CZ   . TYR A 1 86  ? 9.313   15.967  1.883   1.00 0.00 ? 105 TYR A CZ   5  
ATOM 10920 O OH   . TYR A 1 86  ? 10.243  16.329  0.936   1.00 0.00 ? 105 TYR A OH   5  
ATOM 10921 H H    . TYR A 1 86  ? 4.376   14.157  6.197   1.00 0.00 ? 105 TYR A H    5  
ATOM 10922 H HA   . TYR A 1 86  ? 5.017   16.454  4.662   1.00 0.00 ? 105 TYR A HA   5  
ATOM 10923 H HB2  . TYR A 1 86  ? 6.759   15.210  5.797   2.00 0.00 ? 105 TYR A HB2  5  
ATOM 10924 H HB3  . TYR A 1 86  ? 6.377   13.763  4.875   2.00 0.00 ? 105 TYR A HB3  5  
ATOM 10925 H HD1  . TYR A 1 86  ? 7.967   17.064  4.766   1.00 0.00 ? 105 TYR A HD1  5  
ATOM 10926 H HD2  . TYR A 1 86  ? 7.136   13.499  2.591   1.00 0.00 ? 105 TYR A HD2  5  
ATOM 10927 H HE1  . TYR A 1 86  ? 9.628   17.714  3.075   1.00 0.00 ? 105 TYR A HE1  5  
ATOM 10928 H HE2  . TYR A 1 86  ? 8.798   14.142  0.897   1.00 0.00 ? 105 TYR A HE2  5  
ATOM 10929 H HH   . TYR A 1 86  ? 10.802  17.027  1.284   1.00 0.00 ? 105 TYR A HH   5  
ATOM 10930 N N    . ILE A 1 87  ? 4.345   15.989  2.330   1.00 0.00 ? 106 ILE A N    5  
ATOM 10931 C CA   . ILE A 1 87  ? 3.909   15.742  0.960   1.00 0.00 ? 106 ILE A CA   5  
ATOM 10932 C C    . ILE A 1 87  ? 4.998   16.103  -0.043  1.00 0.00 ? 106 ILE A C    5  
ATOM 10933 O O    . ILE A 1 87  ? 5.866   16.931  0.235   1.00 0.00 ? 106 ILE A O    5  
ATOM 10934 C CB   . ILE A 1 87  ? 2.625   16.526  0.620   1.00 0.00 ? 106 ILE A CB   5  
ATOM 10935 C CG1  . ILE A 1 87  ? 1.431   15.933  1.370   1.00 0.00 ? 106 ILE A CG1  5  
ATOM 10936 C CG2  . ILE A 1 87  ? 2.376   16.513  -0.881  1.00 0.00 ? 106 ILE A CG2  5  
ATOM 10937 C CD1  . ILE A 1 87  ? 0.297   15.486  0.470   1.00 0.00 ? 106 ILE A CD1  5  
ATOM 10938 H H    . ILE A 1 87  ? 4.492   16.911  2.627   1.00 0.00 ? 106 ILE A H    5  
ATOM 10939 H HA   . ILE A 1 87  ? 3.692   14.687  0.870   1.00 0.00 ? 106 ILE A HA   5  
ATOM 10940 H HB   . ILE A 1 87  ? 2.763   17.551  0.929   1.00 0.00 ? 106 ILE A HB   5  
ATOM 10941 H HG12 . ILE A 1 87  ? 1.763   15.073  1.929   2.00 0.00 ? 106 ILE A HG12 5  
ATOM 10942 H HG13 . ILE A 1 87  ? 1.041   16.669  2.054   2.00 0.00 ? 106 ILE A HG13 5  
ATOM 10943 H HG21 . ILE A 1 87  ? 1.504   17.110  -1.106  1.00 0.00 ? 106 ILE A HG21 5  
ATOM 10944 H HG22 . ILE A 1 87  ? 2.211   15.497  -1.209  1.00 0.00 ? 106 ILE A HG22 5  
ATOM 10945 H HG23 . ILE A 1 87  ? 3.235   16.921  -1.393  1.00 0.00 ? 106 ILE A HG23 5  
ATOM 10946 H HD11 . ILE A 1 87  ? -0.599  15.354  1.059   1.00 0.00 ? 106 ILE A HD11 5  
ATOM 10947 H HD12 . ILE A 1 87  ? 0.559   14.549  -0.001  1.00 0.00 ? 106 ILE A HD12 5  
ATOM 10948 H HD13 . ILE A 1 87  ? 0.123   16.234  -0.288  1.00 0.00 ? 106 ILE A HD13 5  
ATOM 10949 N N    . LEU A 1 88  ? 4.942   15.473  -1.212  1.00 0.00 ? 107 LEU A N    5  
ATOM 10950 C CA   . LEU A 1 88  ? 5.919   15.720  -2.265  1.00 0.00 ? 107 LEU A CA   5  
ATOM 10951 C C    . LEU A 1 88  ? 5.544   16.953  -3.080  1.00 0.00 ? 107 LEU A C    5  
ATOM 10952 O O    . LEU A 1 88  ? 4.388   17.378  -3.087  1.00 0.00 ? 107 LEU A O    5  
ATOM 10953 C CB   . LEU A 1 88  ? 6.024   14.503  -3.185  1.00 0.00 ? 107 LEU A CB   5  
ATOM 10954 C CG   . LEU A 1 88  ? 7.431   13.925  -3.353  1.00 0.00 ? 107 LEU A CG   5  
ATOM 10955 C CD1  . LEU A 1 88  ? 7.374   12.579  -4.060  2.00 0.00 ? 107 LEU A CD1  5  
ATOM 10956 C CD2  . LEU A 1 88  ? 8.318   14.891  -4.122  2.00 0.00 ? 107 LEU A CD2  5  
ATOM 10957 H H    . LEU A 1 88  ? 4.225   14.826  -1.369  1.00 0.00 ? 107 LEU A H    5  
ATOM 10958 H HA   . LEU A 1 88  ? 6.877   15.890  -1.797  1.00 0.00 ? 107 LEU A HA   5  
ATOM 10959 H HB2  . LEU A 1 88  ? 5.384   13.726  -2.792  2.00 0.00 ? 107 LEU A HB2  5  
ATOM 10960 H HB3  . LEU A 1 88  ? 5.654   14.782  -4.160  2.00 0.00 ? 107 LEU A HB3  5  
ATOM 10961 H HG   . LEU A 1 88  ? 7.867   13.773  -2.376  1.00 0.00 ? 107 LEU A HG   5  
ATOM 10962 H HD11 . LEU A 1 88  ? 8.078   12.574  -4.879  1.00 0.00 ? 107 LEU A HD11 5  
ATOM 10963 H HD12 . LEU A 1 88  ? 6.378   12.414  -4.439  1.00 0.00 ? 107 LEU A HD12 5  
ATOM 10964 H HD13 . LEU A 1 88  ? 7.628   11.795  -3.362  1.00 0.00 ? 107 LEU A HD13 5  
ATOM 10965 H HD21 . LEU A 1 88  ? 7.728   15.409  -4.864  1.00 0.00 ? 107 LEU A HD21 5  
ATOM 10966 H HD22 . LEU A 1 88  ? 9.110   14.342  -4.609  1.00 0.00 ? 107 LEU A HD22 5  
ATOM 10967 H HD23 . LEU A 1 88  ? 8.746   15.609  -3.438  1.00 0.00 ? 107 LEU A HD23 5  
ATOM 10968 N N    . THR A 1 89  ? 6.527   17.523  -3.769  1.00 0.00 ? 108 THR A N    5  
ATOM 10969 C CA   . THR A 1 89  ? 6.303   18.705  -4.590  1.00 0.00 ? 108 THR A CA   5  
ATOM 10970 C C    . THR A 1 89  ? 7.062   18.607  -5.908  1.00 0.00 ? 108 THR A C    5  
ATOM 10971 O O    . THR A 1 89  ? 6.771   19.333  -6.859  1.00 0.00 ? 108 THR A O    5  
ATOM 10972 C CB   . THR A 1 89  ? 6.732   19.990  -3.857  1.00 0.00 ? 108 THR A CB   5  
ATOM 10973 O OG1  . THR A 1 89  ? 6.783   19.756  -2.445  1.00 0.00 ? 108 THR A OG1  5  
ATOM 10974 C CG2  . THR A 1 89  ? 5.767   21.129  -4.153  1.00 0.00 ? 108 THR A CG2  5  
ATOM 10975 H H    . THR A 1 89  ? 7.427   17.137  -3.724  1.00 0.00 ? 108 THR A H    5  
ATOM 10976 H HA   . THR A 1 89  ? 5.245   18.771  -4.799  1.00 0.00 ? 108 THR A HA   5  
ATOM 10977 H HB   . THR A 1 89  ? 7.716   20.272  -4.204  1.00 0.00 ? 108 THR A HB   5  
ATOM 10978 H HG1  . THR A 1 89  ? 5.931   19.433  -2.142  1.00 0.00 ? 108 THR A HG1  5  
ATOM 10979 H HG21 . THR A 1 89  ? 5.535   21.139  -5.208  1.00 0.00 ? 108 THR A HG21 5  
ATOM 10980 H HG22 . THR A 1 89  ? 6.223   22.068  -3.874  1.00 0.00 ? 108 THR A HG22 5  
ATOM 10981 H HG23 . THR A 1 89  ? 4.860   20.987  -3.585  1.00 0.00 ? 108 THR A HG23 5  
ATOM 10982 N N    . SER A 1 90  ? 8.037   17.704  -5.955  1.00 0.00 ? 109 SER A N    5  
ATOM 10983 C CA   . SER A 1 90  ? 8.841   17.508  -7.156  1.00 0.00 ? 109 SER A CA   5  
ATOM 10984 C C    . SER A 1 90  ? 8.418   16.239  -7.890  1.00 0.00 ? 109 SER A C    5  
ATOM 10985 O O    . SER A 1 90  ? 8.175   15.204  -7.271  1.00 0.00 ? 109 SER A O    5  
ATOM 10986 C CB   . SER A 1 90  ? 10.325  17.431  -6.795  1.00 0.00 ? 109 SER A CB   5  
ATOM 10987 O OG   . SER A 1 90  ? 11.024  18.571  -7.264  1.00 0.00 ? 109 SER A OG   5  
ATOM 10988 H H    . SER A 1 90  ? 8.219   17.157  -5.165  1.00 0.00 ? 109 SER A H    5  
ATOM 10989 H HA   . SER A 1 90  ? 8.680   18.356  -7.806  1.00 0.00 ? 109 SER A HA   5  
ATOM 10990 H HB2  . SER A 1 90  ? 10.429  17.377  -5.720  2.00 0.00 ? 109 SER A HB2  5  
ATOM 10991 H HB3  . SER A 1 90  ? 10.758  16.548  -7.245  2.00 0.00 ? 109 SER A HB3  5  
ATOM 10992 H HG   . SER A 1 90  ? 10.723  18.790  -8.149  1.00 0.00 ? 109 SER A HG   5  
ATOM 10993 N N    . ASN A 1 91  ? 8.335   16.327  -9.214  1.00 0.00 ? 110 ASN A N    5  
ATOM 10994 C CA   . ASN A 1 91  ? 7.941   15.186  -10.032 1.00 0.00 ? 110 ASN A CA   5  
ATOM 10995 C C    . ASN A 1 91  ? 9.018   14.105  -10.011 1.00 0.00 ? 110 ASN A C    5  
ATOM 10996 O O    . ASN A 1 91  ? 10.210  14.405  -9.955  1.00 0.00 ? 110 ASN A O    5  
ATOM 10997 C CB   . ASN A 1 91  ? 7.676   15.631  -11.471 1.00 0.00 ? 110 ASN A CB   5  
ATOM 10998 C CG   . ASN A 1 91  ? 6.914   16.939  -11.569 1.00 0.00 ? 110 ASN A CG   5  
ATOM 10999 O OD1  . ASN A 1 91  ? 7.510   18.012  -11.664 1.00 0.00 ? 110 ASN A OD1  5  
ATOM 11000 N ND2  . ASN A 1 91  ? 5.589   16.855  -11.546 4.00 0.00 ? 110 ASN A ND2  5  
ATOM 11001 H H    . ASN A 1 91  ? 8.541   17.180  -9.650  1.00 0.00 ? 110 ASN A H    5  
ATOM 11002 H HA   . ASN A 1 91  ? 7.032   14.779  -9.618  1.00 0.00 ? 110 ASN A HA   5  
ATOM 11003 H HB2  . ASN A 1 91  ? 8.621   15.752  -11.981 2.00 0.00 ? 110 ASN A HB2  5  
ATOM 11004 H HB3  . ASN A 1 91  ? 7.103   14.867  -11.974 2.00 0.00 ? 110 ASN A HB3  5  
ATOM 11005 H HD21 . ASN A 1 91  ? 5.182   15.963  -11.469 5.00 0.00 ? 110 ASN A HD21 5  
ATOM 11006 H HD22 . ASN A 1 91  ? 5.070   17.686  -11.609 5.00 0.00 ? 110 ASN A HD22 5  
ATOM 11007 N N    . THR A 1 92  ? 8.587   12.849  -10.058 1.00 0.00 ? 111 THR A N    5  
ATOM 11008 C CA   . THR A 1 92  ? 9.513   11.723  -10.046 1.00 0.00 ? 111 THR A CA   5  
ATOM 11009 C C    . THR A 1 92  ? 8.888   10.492  -10.697 1.00 0.00 ? 111 THR A C    5  
ATOM 11010 O O    . THR A 1 92  ? 9.261   10.109  -11.806 1.00 0.00 ? 111 THR A O    5  
ATOM 11011 C CB   . THR A 1 92  ? 9.947   11.366  -8.611  1.00 0.00 ? 111 THR A CB   5  
ATOM 11012 O OG1  . THR A 1 92  ? 10.283  9.976   -8.531  1.00 0.00 ? 111 THR A OG1  5  
ATOM 11013 C CG2  . THR A 1 92  ? 8.840   11.683  -7.616  1.00 0.00 ? 111 THR A CG2  5  
ATOM 11014 H H    . THR A 1 92  ? 7.624   12.675  -10.102 1.00 0.00 ? 111 THR A H    5  
ATOM 11015 H HA   . THR A 1 92  ? 10.391  12.007  -10.606 1.00 0.00 ? 111 THR A HA   5  
ATOM 11016 H HB   . THR A 1 92  ? 10.817  11.955  -8.358  1.00 0.00 ? 111 THR A HB   5  
ATOM 11017 H HG1  . THR A 1 92  ? 11.167  9.840   -8.879  1.00 0.00 ? 111 THR A HG1  5  
ATOM 11018 H HG21 . THR A 1 92  ? 7.884   11.427  -8.046  1.00 0.00 ? 111 THR A HG21 5  
ATOM 11019 H HG22 . THR A 1 92  ? 8.858   12.737  -7.381  1.00 0.00 ? 111 THR A HG22 5  
ATOM 11020 H HG23 . THR A 1 92  ? 8.993   11.111  -6.713  1.00 0.00 ? 111 THR A HG23 5  
ATOM 11021 N N    . SER A 1 93  ? 7.936   9.880   -10.000 1.00 0.00 ? 112 SER A N    5  
ATOM 11022 C CA   . SER A 1 93  ? 7.259   8.693   -10.511 1.00 0.00 ? 112 SER A CA   5  
ATOM 11023 C C    . SER A 1 93  ? 5.993   8.402   -9.709  1.00 0.00 ? 112 SER A C    5  
ATOM 11024 O O    . SER A 1 93  ? 4.938   8.981   -9.968  1.00 0.00 ? 112 SER A O    5  
ATOM 11025 C CB   . SER A 1 93  ? 8.196   7.485   -10.466 1.00 0.00 ? 112 SER A CB   5  
ATOM 11026 O OG   . SER A 1 93  ? 8.882   7.326   -11.697 1.00 0.00 ? 112 SER A OG   5  
ATOM 11027 H H    . SER A 1 93  ? 7.683   10.234  -9.123  1.00 0.00 ? 112 SER A H    5  
ATOM 11028 H HA   . SER A 1 93  ? 6.983   8.886   -11.537 1.00 0.00 ? 112 SER A HA   5  
ATOM 11029 H HB2  . SER A 1 93  ? 8.924   7.625   -9.680  2.00 0.00 ? 112 SER A HB2  5  
ATOM 11030 H HB3  . SER A 1 93  ? 7.621   6.593   -10.271 2.00 0.00 ? 112 SER A HB3  5  
ATOM 11031 H HG   . SER A 1 93  ? 8.244   7.222   -12.407 1.00 0.00 ? 112 SER A HG   5  
ATOM 11032 N N    . GLN A 1 94  ? 6.105   7.505   -8.736  1.00 0.00 ? 113 GLN A N    5  
ATOM 11033 C CA   . GLN A 1 94  ? 4.970   7.138   -7.899  1.00 0.00 ? 113 GLN A CA   5  
ATOM 11034 C C    . GLN A 1 94  ? 5.438   6.743   -6.501  1.00 0.00 ? 113 GLN A C    5  
ATOM 11035 O O    . GLN A 1 94  ? 6.491   7.186   -6.043  1.00 0.00 ? 113 GLN A O    5  
ATOM 11036 C CB   . GLN A 1 94  ? 4.193   5.989   -8.545  1.00 0.00 ? 113 GLN A CB   5  
ATOM 11037 C CG   . GLN A 1 94  ? 2.733   6.310   -8.811  1.00 0.00 ? 113 GLN A CG   5  
ATOM 11038 C CD   . GLN A 1 94  ? 2.548   7.525   -9.698  1.00 0.00 ? 113 GLN A CD   5  
ATOM 11039 O OE1  . GLN A 1 94  ? 2.129   8.587   -9.237  1.00 0.00 ? 113 GLN A OE1  5  
ATOM 11040 N NE2  . GLN A 1 94  ? 2.860   7.374   -10.980 4.00 0.00 ? 113 GLN A NE2  5  
ATOM 11041 H H    . GLN A 1 94  ? 6.972   7.076   -8.576  1.00 0.00 ? 113 GLN A H    5  
ATOM 11042 H HA   . GLN A 1 94  ? 4.325   8.000   -7.820  1.00 0.00 ? 113 GLN A HA   5  
ATOM 11043 H HB2  . GLN A 1 94  ? 4.661   5.741   -9.486  2.00 0.00 ? 113 GLN A HB2  5  
ATOM 11044 H HB3  . GLN A 1 94  ? 4.238   5.128   -7.895  2.00 0.00 ? 113 GLN A HB3  5  
ATOM 11045 H HG2  . GLN A 1 94  ? 2.275   5.459   -9.294  2.00 0.00 ? 113 GLN A HG2  5  
ATOM 11046 H HG3  . GLN A 1 94  ? 2.239   6.493   -7.868  2.00 0.00 ? 113 GLN A HG3  5  
ATOM 11047 H HE21 . GLN A 1 94  ? 3.189   6.497   -11.278 5.00 0.00 ? 113 GLN A HE21 5  
ATOM 11048 H HE22 . GLN A 1 94  ? 2.751   8.147   -11.579 5.00 0.00 ? 113 GLN A HE22 5  
ATOM 11049 N N    . TYR A 1 95  ? 4.652   5.909   -5.824  1.00 0.00 ? 114 TYR A N    5  
ATOM 11050 C CA   . TYR A 1 95  ? 4.996   5.461   -4.481  1.00 0.00 ? 114 TYR A CA   5  
ATOM 11051 C C    . TYR A 1 95  ? 3.976   4.451   -3.961  1.00 0.00 ? 114 TYR A C    5  
ATOM 11052 O O    . TYR A 1 95  ? 3.212   3.878   -4.736  1.00 0.00 ? 114 TYR A O    5  
ATOM 11053 C CB   . TYR A 1 95  ? 5.099   6.656   -3.527  1.00 0.00 ? 114 TYR A CB   5  
ATOM 11054 C CG   . TYR A 1 95  ? 3.865   7.531   -3.465  1.00 0.00 ? 114 TYR A CG   5  
ATOM 11055 C CD1  . TYR A 1 95  ? 3.067   7.728   -4.585  1.00 0.00 ? 114 TYR A CD1  5  
ATOM 11056 C CD2  . TYR A 1 95  ? 3.505   8.166   -2.284  1.00 0.00 ? 114 TYR A CD2  5  
ATOM 11057 C CE1  . TYR A 1 95  ? 1.946   8.532   -4.530  1.00 0.00 ? 114 TYR A CE1  5  
ATOM 11058 C CE2  . TYR A 1 95  ? 2.385   8.973   -2.222  1.00 0.00 ? 114 TYR A CE2  5  
ATOM 11059 C CZ   . TYR A 1 95  ? 1.610   9.152   -3.346  1.00 0.00 ? 114 TYR A CZ   5  
ATOM 11060 O OH   . TYR A 1 95  ? 0.497   9.957   -3.289  1.00 0.00 ? 114 TYR A OH   5  
ATOM 11061 H H    . TYR A 1 95  ? 3.823   5.588   -6.238  1.00 0.00 ? 114 TYR A H    5  
ATOM 11062 H HA   . TYR A 1 95  ? 5.960   4.977   -4.534  1.00 0.00 ? 114 TYR A HA   5  
ATOM 11063 H HB2  . TYR A 1 95  ? 5.294   6.294   -2.530  2.00 0.00 ? 114 TYR A HB2  5  
ATOM 11064 H HB3  . TYR A 1 95  ? 5.924   7.278   -3.838  2.00 0.00 ? 114 TYR A HB3  5  
ATOM 11065 H HD1  . TYR A 1 95  ? 3.332   7.240   -5.511  1.00 0.00 ? 114 TYR A HD1  5  
ATOM 11066 H HD2  . TYR A 1 95  ? 4.114   8.024   -1.405  1.00 0.00 ? 114 TYR A HD2  5  
ATOM 11067 H HE1  . TYR A 1 95  ? 1.338   8.672   -5.411  1.00 0.00 ? 114 TYR A HE1  5  
ATOM 11068 H HE2  . TYR A 1 95  ? 2.123   9.463   -1.293  1.00 0.00 ? 114 TYR A HE2  5  
ATOM 11069 H HH   . TYR A 1 95  ? 0.323   10.324  -4.159  1.00 0.00 ? 114 TYR A HH   5  
ATOM 11070 N N    . ASP A 1 96  ? 3.977   4.233   -2.649  1.00 0.00 ? 115 ASP A N    5  
ATOM 11071 C CA   . ASP A 1 96  ? 3.058   3.284   -2.027  1.00 0.00 ? 115 ASP A CA   5  
ATOM 11072 C C    . ASP A 1 96  ? 1.713   3.936   -1.717  1.00 0.00 ? 115 ASP A C    5  
ATOM 11073 O O    . ASP A 1 96  ? 1.350   4.947   -2.319  1.00 0.00 ? 115 ASP A O    5  
ATOM 11074 C CB   . ASP A 1 96  ? 3.673   2.721   -0.746  1.00 0.00 ? 115 ASP A CB   5  
ATOM 11075 C CG   . ASP A 1 96  ? 5.189   2.691   -0.790  1.00 0.00 ? 115 ASP A CG   5  
ATOM 11076 O OD1  . ASP A 1 96  ? 5.745   1.771   -1.426  1.00 0.00 ? 115 ASP A OD1  5  
ATOM 11077 O OD2  . ASP A 1 96  ? 5.819   3.586   -0.190  1.00 0.00 ? 115 ASP A OD2  5  
ATOM 11078 H H    . ASP A 1 96  ? 4.617   4.714   -2.085  1.00 0.00 ? 115 ASP A H    5  
ATOM 11079 H HA   . ASP A 1 96  ? 2.899   2.474   -2.723  1.00 0.00 ? 115 ASP A HA   5  
ATOM 11080 H HB2  . ASP A 1 96  ? 3.369   3.333   0.090   2.00 0.00 ? 115 ASP A HB2  5  
ATOM 11081 H HB3  . ASP A 1 96  ? 3.317   1.713   -0.596  2.00 0.00 ? 115 ASP A HB3  5  
ATOM 11082 N N    . THR A 1 97  ? 0.975   3.349   -0.777  1.00 0.00 ? 116 THR A N    5  
ATOM 11083 C CA   . THR A 1 97  ? -0.333  3.873   -0.394  1.00 0.00 ? 116 THR A CA   5  
ATOM 11084 C C    . THR A 1 97  ? -0.742  3.410   1.000   1.00 0.00 ? 116 THR A C    5  
ATOM 11085 O O    . THR A 1 97  ? -0.373  2.321   1.441   1.00 0.00 ? 116 THR A O    5  
ATOM 11086 C CB   . THR A 1 97  ? -1.422  3.448   -1.397  1.00 0.00 ? 116 THR A CB   5  
ATOM 11087 O OG1  . THR A 1 97  ? -2.493  4.398   -1.392  1.00 0.00 ? 116 THR A OG1  5  
ATOM 11088 C CG2  . THR A 1 97  ? -1.964  2.068   -1.053  1.00 0.00 ? 116 THR A CG2  5  
ATOM 11089 H H    . THR A 1 97  ? 1.315   2.544   -0.335  1.00 0.00 ? 116 THR A H    5  
ATOM 11090 H HA   . THR A 1 97  ? -0.274  4.950   -0.399  1.00 0.00 ? 116 THR A HA   5  
ATOM 11091 H HB   . THR A 1 97  ? -0.987  3.411   -2.385  1.00 0.00 ? 116 THR A HB   5  
ATOM 11092 H HG1  . THR A 1 97  ? -3.224  4.060   -1.915  1.00 0.00 ? 116 THR A HG1  5  
ATOM 11093 H HG21 . THR A 1 97  ? -1.194  1.328   -1.214  1.00 0.00 ? 116 THR A HG21 5  
ATOM 11094 H HG22 . THR A 1 97  ? -2.813  1.846   -1.684  1.00 0.00 ? 116 THR A HG22 5  
ATOM 11095 H HG23 . THR A 1 97  ? -2.271  2.048   -0.018  1.00 0.00 ? 116 THR A HG23 5  
ATOM 11096 N N    . TYR A 1 98  ? -1.522  4.242   1.682   1.00 0.00 ? 117 TYR A N    5  
ATOM 11097 C CA   . TYR A 1 98  ? -2.004  3.925   3.020   1.00 0.00 ? 117 TYR A CA   5  
ATOM 11098 C C    . TYR A 1 98  ? -3.518  3.748   3.003   1.00 0.00 ? 117 TYR A C    5  
ATOM 11099 O O    . TYR A 1 98  ? -4.207  4.334   2.168   1.00 0.00 ? 117 TYR A O    5  
ATOM 11100 C CB   . TYR A 1 98  ? -1.644  5.037   4.003   1.00 0.00 ? 117 TYR A CB   5  
ATOM 11101 C CG   . TYR A 1 98  ? -0.196  5.085   4.428   1.00 0.00 ? 117 TYR A CG   5  
ATOM 11102 C CD1  . TYR A 1 98  ? 0.745   5.766   3.671   1.00 0.00 ? 117 TYR A CD1  5  
ATOM 11103 C CD2  . TYR A 1 98  ? 0.226   4.474   5.603   1.00 0.00 ? 117 TYR A CD2  5  
ATOM 11104 C CE1  . TYR A 1 98  ? 2.063   5.841   4.070   1.00 0.00 ? 117 TYR A CE1  5  
ATOM 11105 C CE2  . TYR A 1 98  ? 1.542   4.540   6.007   1.00 0.00 ? 117 TYR A CE2  5  
ATOM 11106 C CZ   . TYR A 1 98  ? 2.457   5.228   5.240   1.00 0.00 ? 117 TYR A CZ   5  
ATOM 11107 O OH   . TYR A 1 98  ? 3.771   5.302   5.643   1.00 0.00 ? 117 TYR A OH   5  
ATOM 11108 H H    . TYR A 1 98  ? -1.788  5.090   1.268   1.00 0.00 ? 117 TYR A H    5  
ATOM 11109 H HA   . TYR A 1 98  ? -1.543  3.003   3.338   1.00 0.00 ? 117 TYR A HA   5  
ATOM 11110 H HB2  . TYR A 1 98  ? -1.881  5.990   3.551   2.00 0.00 ? 117 TYR A HB2  5  
ATOM 11111 H HB3  . TYR A 1 98  ? -2.242  4.919   4.895   2.00 0.00 ? 117 TYR A HB3  5  
ATOM 11112 H HD1  . TYR A 1 98  ? 0.433   6.241   2.754   1.00 0.00 ? 117 TYR A HD1  5  
ATOM 11113 H HD2  . TYR A 1 98  ? -0.488  3.927   6.199   1.00 0.00 ? 117 TYR A HD2  5  
ATOM 11114 H HE1  . TYR A 1 98  ? 2.778   6.377   3.465   1.00 0.00 ? 117 TYR A HE1  5  
ATOM 11115 H HE2  . TYR A 1 98  ? 1.845   4.062   6.927   1.00 0.00 ? 117 TYR A HE2  5  
ATOM 11116 H HH   . TYR A 1 98  ? 3.824   5.155   6.590   1.00 0.00 ? 117 TYR A HH   5  
ATOM 11117 N N    . CYS A 1 99  ? -4.033  2.950   3.929   1.00 0.00 ? 118 CYS A N    5  
ATOM 11118 C CA   . CYS A 1 99  ? -5.469  2.714   4.010   1.00 0.00 ? 118 CYS A CA   5  
ATOM 11119 C C    . CYS A 1 99  ? -5.858  2.179   5.384   1.00 0.00 ? 118 CYS A C    5  
ATOM 11120 O O    . CYS A 1 99  ? -5.287  1.199   5.863   1.00 0.00 ? 118 CYS A O    5  
ATOM 11121 C CB   . CYS A 1 99  ? -5.908  1.734   2.921   1.00 0.00 ? 118 CYS A CB   5  
ATOM 11122 S SG   . CYS A 1 99  ? -5.895  2.406   1.226   1.00 0.00 ? 118 CYS A SG   5  
ATOM 11123 H H    . CYS A 1 99  ? -3.437  2.512   4.574   1.00 0.00 ? 118 CYS A H    5  
ATOM 11124 H HA   . CYS A 1 99  ? -5.968  3.659   3.853   1.00 0.00 ? 118 CYS A HA   5  
ATOM 11125 H HB2  . CYS A 1 99  ? -5.252  0.877   2.936   2.00 0.00 ? 118 CYS A HB2  5  
ATOM 11126 H HB3  . CYS A 1 99  ? -6.915  1.406   3.132   2.00 0.00 ? 118 CYS A HB3  5  
ATOM 11127 N N    . PHE A 1 100 ? -6.838  2.824   6.012   1.00 0.00 ? 119 PHE A N    5  
ATOM 11128 C CA   . PHE A 1 100 ? -7.305  2.403   7.327   1.00 0.00 ? 119 PHE A CA   5  
ATOM 11129 C C    . PHE A 1 100 ? -8.507  1.479   7.190   1.00 0.00 ? 119 PHE A C    5  
ATOM 11130 O O    . PHE A 1 100 ? -9.588  1.904   6.782   1.00 0.00 ? 119 PHE A O    5  
ATOM 11131 C CB   . PHE A 1 100 ? -7.665  3.616   8.191   1.00 0.00 ? 119 PHE A CB   5  
ATOM 11132 C CG   . PHE A 1 100 ? -8.396  3.311   9.470   1.00 0.00 ? 119 PHE A CG   5  
ATOM 11133 C CD1  . PHE A 1 100 ? -9.722  2.906   9.453   1.00 0.00 ? 119 PHE A CD1  5  
ATOM 11134 C CD2  . PHE A 1 100 ? -7.754  3.429   10.692  1.00 0.00 ? 119 PHE A CD2  5  
ATOM 11135 C CE1  . PHE A 1 100 ? -10.390 2.625   10.628  1.00 0.00 ? 119 PHE A CE1  5  
ATOM 11136 C CE2  . PHE A 1 100 ? -8.417  3.151   11.869  1.00 0.00 ? 119 PHE A CE2  5  
ATOM 11137 C CZ   . PHE A 1 100 ? -9.737  2.748   11.837  1.00 0.00 ? 119 PHE A CZ   5  
ATOM 11138 H H    . PHE A 1 100 ? -7.260  3.594   5.576   1.00 0.00 ? 119 PHE A H    5  
ATOM 11139 H HA   . PHE A 1 100 ? -6.499  1.860   7.804   1.00 0.00 ? 119 PHE A HA   5  
ATOM 11140 H HB2  . PHE A 1 100 ? -6.753  4.132   8.456   2.00 0.00 ? 119 PHE A HB2  5  
ATOM 11141 H HB3  . PHE A 1 100 ? -8.285  4.290   7.612   2.00 0.00 ? 119 PHE A HB3  5  
ATOM 11142 H HD1  . PHE A 1 100 ? -10.234 2.806   8.509   1.00 0.00 ? 119 PHE A HD1  5  
ATOM 11143 H HD2  . PHE A 1 100 ? -6.723  3.744   10.720  1.00 0.00 ? 119 PHE A HD2  5  
ATOM 11144 H HE1  . PHE A 1 100 ? -11.423 2.312   10.601  1.00 0.00 ? 119 PHE A HE1  5  
ATOM 11145 H HE2  . PHE A 1 100 ? -7.905  3.248   12.815  1.00 0.00 ? 119 PHE A HE2  5  
ATOM 11146 H HZ   . PHE A 1 100 ? -10.257 2.531   12.754  1.00 0.00 ? 119 PHE A HZ   5  
ATOM 11147 N N    . ASN A 1 101 ? -8.306  0.210   7.517   1.00 0.00 ? 120 ASN A N    5  
ATOM 11148 C CA   . ASN A 1 101 ? -9.360  -0.781  7.417   1.00 0.00 ? 120 ASN A CA   5  
ATOM 11149 C C    . ASN A 1 101 ? -9.996  -1.064  8.771   1.00 0.00 ? 120 ASN A C    5  
ATOM 11150 O O    . ASN A 1 101 ? -9.300  -1.304  9.758   1.00 0.00 ? 120 ASN A O    5  
ATOM 11151 C CB   . ASN A 1 101 ? -8.791  -2.072  6.840   1.00 0.00 ? 120 ASN A CB   5  
ATOM 11152 C CG   . ASN A 1 101 ? -7.781  -2.727  7.761   1.00 0.00 ? 120 ASN A CG   5  
ATOM 11153 O OD1  . ASN A 1 101 ? -7.991  -3.841  8.240   1.00 0.00 ? 120 ASN A OD1  5  
ATOM 11154 N ND2  . ASN A 1 101 ? -6.674  -2.037  8.014   4.00 0.00 ? 120 ASN A ND2  5  
ATOM 11155 H H    . ASN A 1 101 ? -7.421  -0.073  7.819   1.00 0.00 ? 120 ASN A H    5  
ATOM 11156 H HA   . ASN A 1 101 ? -10.116 -0.402  6.749   1.00 0.00 ? 120 ASN A HA   5  
ATOM 11157 H HB2  . ASN A 1 101 ? -9.596  -2.763  6.674   2.00 0.00 ? 120 ASN A HB2  5  
ATOM 11158 H HB3  . ASN A 1 101 ? -8.307  -1.857  5.898   2.00 0.00 ? 120 ASN A HB3  5  
ATOM 11159 H HD21 . ASN A 1 101 ? -6.574  -1.153  7.596   5.00 0.00 ? 120 ASN A HD21 5  
ATOM 11160 H HD22 . ASN A 1 101 ? -6.002  -2.438  8.607   5.00 0.00 ? 120 ASN A HD22 5  
ATOM 11161 N N    . ALA A 1 102 ? -11.324 -1.056  8.804   1.00 0.00 ? 121 ALA A N    5  
ATOM 11162 C CA   . ALA A 1 102 ? -12.054 -1.332  10.032  1.00 0.00 ? 121 ALA A CA   5  
ATOM 11163 C C    . ALA A 1 102 ? -11.787 -2.761  10.491  1.00 0.00 ? 121 ALA A C    5  
ATOM 11164 O O    . ALA A 1 102 ? -11.955 -3.091  11.665  1.00 0.00 ? 121 ALA A O    5  
ATOM 11165 C CB   . ALA A 1 102 ? -13.544 -1.109  9.824   1.00 0.00 ? 121 ALA A CB   5  
ATOM 11166 H H    . ALA A 1 102 ? -11.822 -0.872  7.981   1.00 0.00 ? 121 ALA A H    5  
ATOM 11167 H HA   . ALA A 1 102 ? -11.709 -0.646  10.791  1.00 0.00 ? 121 ALA A HA   5  
ATOM 11168 H HB1  . ALA A 1 102 ? -13.963 -0.637  10.701  1.00 0.00 ? 121 ALA A HB1  5  
ATOM 11169 H HB2  . ALA A 1 102 ? -14.032 -2.058  9.659   1.00 0.00 ? 121 ALA A HB2  5  
ATOM 11170 H HB3  . ALA A 1 102 ? -13.697 -0.472  8.965   1.00 0.00 ? 121 ALA A HB3  5  
ATOM 11171 N N    . SER A 1 103 ? -11.358 -3.602  9.552   1.00 0.00 ? 122 SER A N    5  
ATOM 11172 C CA   . SER A 1 103 ? -11.053 -4.996  9.850   1.00 0.00 ? 122 SER A CA   5  
ATOM 11173 C C    . SER A 1 103 ? -9.832  -5.091  10.757  1.00 0.00 ? 122 SER A C    5  
ATOM 11174 O O    . SER A 1 103 ? -9.587  -6.121  11.384  1.00 0.00 ? 122 SER A O    5  
ATOM 11175 C CB   . SER A 1 103 ? -10.806 -5.777  8.555   1.00 0.00 ? 122 SER A CB   5  
ATOM 11176 O OG   . SER A 1 103 ? -12.000 -5.909  7.803   1.00 0.00 ? 122 SER A OG   5  
ATOM 11177 H H    . SER A 1 103 ? -11.239 -3.273  8.637   1.00 0.00 ? 122 SER A H    5  
ATOM 11178 H HA   . SER A 1 103 ? -11.903 -5.420  10.362  1.00 0.00 ? 122 SER A HA   5  
ATOM 11179 H HB2  . SER A 1 103 ? -10.072 -5.257  7.954   2.00 0.00 ? 122 SER A HB2  5  
ATOM 11180 H HB3  . SER A 1 103 ? -10.439 -6.763  8.797   2.00 0.00 ? 122 SER A HB3  5  
ATOM 11181 H HG   . SER A 1 103 ? -11.787 -5.934  6.867   1.00 0.00 ? 122 SER A HG   5  
ATOM 11182 N N    . ALA A 1 104 ? -9.070  -4.004  10.819  1.00 0.00 ? 123 ALA A N    5  
ATOM 11183 C CA   . ALA A 1 104 ? -7.873  -3.950  11.646  1.00 0.00 ? 123 ALA A CA   5  
ATOM 11184 C C    . ALA A 1 104 ? -8.197  -3.450  13.050  1.00 0.00 ? 123 ALA A C    5  
ATOM 11185 O O    . ALA A 1 104 ? -8.984  -2.520  13.222  1.00 0.00 ? 123 ALA A O    5  
ATOM 11186 C CB   . ALA A 1 104 ? -6.826  -3.059  10.998  1.00 0.00 ? 123 ALA A CB   5  
ATOM 11187 H H    . ALA A 1 104 ? -9.322  -3.215  10.294  1.00 0.00 ? 123 ALA A H    5  
ATOM 11188 H HA   . ALA A 1 104 ? -7.469  -4.950  11.714  1.00 0.00 ? 123 ALA A HA   5  
ATOM 11189 H HB1  . ALA A 1 104 ? -7.282  -2.126  10.700  1.00 0.00 ? 123 ALA A HB1  5  
ATOM 11190 H HB2  . ALA A 1 104 ? -6.420  -3.555  10.128  1.00 0.00 ? 123 ALA A HB2  5  
ATOM 11191 H HB3  . ALA A 1 104 ? -6.032  -2.864  11.704  1.00 0.00 ? 123 ALA A HB3  5  
ATOM 11192 N N    . PRO A 1 105 ? -7.589  -4.067  14.074  1.00 0.00 ? 124 PRO A N    5  
ATOM 11193 C CA   . PRO A 1 105 ? -7.812  -3.688  15.473  1.00 0.00 ? 124 PRO A CA   5  
ATOM 11194 C C    . PRO A 1 105 ? -7.495  -2.219  15.737  1.00 0.00 ? 124 PRO A C    5  
ATOM 11195 O O    . PRO A 1 105 ? -6.441  -1.717  15.340  1.00 0.00 ? 124 PRO A O    5  
ATOM 11196 C CB   . PRO A 1 105 ? -6.846  -4.590  16.248  1.00 0.00 ? 124 PRO A CB   5  
ATOM 11197 C CG   . PRO A 1 105 ? -6.588  -5.743  15.343  1.00 0.00 ? 124 PRO A CG   5  
ATOM 11198 C CD   . PRO A 1 105 ? -6.641  -5.186  13.949  1.00 0.00 ? 124 PRO A CD   5  
ATOM 11199 H HA   . PRO A 1 105 ? -8.826  -3.896  15.781  1.00 0.00 ? 124 PRO A HA   5  
ATOM 11200 H HB2  . PRO A 1 105 ? -5.938  -4.046  16.464  2.00 0.00 ? 124 PRO A HB2  5  
ATOM 11201 H HB3  . PRO A 1 105 ? -7.309  -4.908  17.172  2.00 0.00 ? 124 PRO A HB3  5  
ATOM 11202 H HG2  . PRO A 1 105 ? -5.611  -6.158  15.544  2.00 0.00 ? 124 PRO A HG2  5  
ATOM 11203 H HG3  . PRO A 1 105 ? -7.352  -6.495  15.477  2.00 0.00 ? 124 PRO A HG3  5  
ATOM 11204 H HD2  . PRO A 1 105 ? -5.666  -4.834  13.644  2.00 0.00 ? 124 PRO A HD2  5  
ATOM 11205 H HD3  . PRO A 1 105 ? -7.009  -5.930  13.258  2.00 0.00 ? 124 PRO A HD3  5  
ATOM 11206 N N    . PRO A 1 106 ? -8.412  -1.510  16.415  1.00 0.00 ? 125 PRO A N    5  
ATOM 11207 C CA   . PRO A 1 106 ? -8.242  -0.093  16.743  1.00 0.00 ? 125 PRO A CA   5  
ATOM 11208 C C    . PRO A 1 106 ? -7.205  0.117   17.840  1.00 0.00 ? 125 PRO A C    5  
ATOM 11209 O O    . PRO A 1 106 ? -7.548  0.425   18.983  1.00 0.00 ? 125 PRO A O    5  
ATOM 11210 C CB   . PRO A 1 106 ? -9.633  0.338   17.235  1.00 0.00 ? 125 PRO A CB   5  
ATOM 11211 C CG   . PRO A 1 106 ? -10.549 -0.801  16.925  1.00 0.00 ? 125 PRO A CG   5  
ATOM 11212 C CD   . PRO A 1 106 ? -9.688  -2.031  16.918  1.00 0.00 ? 125 PRO A CD   5  
ATOM 11213 H HA   . PRO A 1 106 ? -7.968  0.485   15.873  1.00 0.00 ? 125 PRO A HA   5  
ATOM 11214 H HB2  . PRO A 1 106 ? -9.594  0.531   18.297  2.00 0.00 ? 125 PRO A HB2  5  
ATOM 11215 H HB3  . PRO A 1 106 ? -9.935  1.235   16.716  2.00 0.00 ? 125 PRO A HB3  5  
ATOM 11216 H HG2  . PRO A 1 106 ? -11.309 -0.881  17.687  2.00 0.00 ? 125 PRO A HG2  5  
ATOM 11217 H HG3  . PRO A 1 106 ? -11.002 -0.656  15.955  2.00 0.00 ? 125 PRO A HG3  5  
ATOM 11218 H HD2  . PRO A 1 106 ? -9.579  -2.427  17.917  2.00 0.00 ? 125 PRO A HD2  5  
ATOM 11219 H HD3  . PRO A 1 106 ? -10.094 -2.777  16.251  2.00 0.00 ? 125 PRO A HD3  5  
ATOM 11220 N N    . GLU A 1 107 ? -5.935  -0.056  17.486  1.00 0.00 ? 126 GLU A N    5  
ATOM 11221 C CA   . GLU A 1 107 ? -4.843  0.110   18.442  1.00 0.00 ? 126 GLU A CA   5  
ATOM 11222 C C    . GLU A 1 107 ? -3.499  -0.200  17.792  1.00 0.00 ? 126 GLU A C    5  
ATOM 11223 O O    . GLU A 1 107 ? -2.668  0.688   17.606  1.00 0.00 ? 126 GLU A O    5  
ATOM 11224 C CB   . GLU A 1 107 ? -5.055  -0.796  19.656  1.00 0.00 ? 126 GLU A CB   5  
ATOM 11225 C CG   . GLU A 1 107 ? -4.128  -0.491  20.823  1.00 0.00 ? 126 GLU A CG   5  
ATOM 11226 C CD   . GLU A 1 107 ? -4.746  -0.828  22.166  1.00 0.00 ? 126 GLU A CD   5  
ATOM 11227 O OE1  . GLU A 1 107 ? -5.818  -0.270  22.484  1.00 0.00 ? 126 GLU A OE1  5  
ATOM 11228 O OE2  . GLU A 1 107 ? -4.159  -1.650  22.900  1.00 0.00 ? 126 GLU A OE2  5  
ATOM 11229 H H    . GLU A 1 107 ? -5.729  -0.301  16.560  1.00 0.00 ? 126 GLU A H    5  
ATOM 11230 H HA   . GLU A 1 107 ? -4.842  1.137   18.767  1.00 0.00 ? 126 GLU A HA   5  
ATOM 11231 H HB2  . GLU A 1 107 ? -6.073  -0.687  19.998  2.00 0.00 ? 126 GLU A HB2  5  
ATOM 11232 H HB3  . GLU A 1 107 ? -4.894  -1.821  19.358  2.00 0.00 ? 126 GLU A HB3  5  
ATOM 11233 H HG2  . GLU A 1 107 ? -3.223  -1.066  20.706  2.00 0.00 ? 126 GLU A HG2  5  
ATOM 11234 H HG3  . GLU A 1 107 ? -3.888  0.562   20.810  2.00 0.00 ? 126 GLU A HG3  5  
ATOM 11235 N N    . GLU A 1 108 ? -3.298  -1.465  17.448  1.00 0.00 ? 127 GLU A N    5  
ATOM 11236 C CA   . GLU A 1 108 ? -2.056  -1.899  16.815  1.00 0.00 ? 127 GLU A CA   5  
ATOM 11237 C C    . GLU A 1 108 ? -2.084  -3.399  16.542  1.00 0.00 ? 127 GLU A C    5  
ATOM 11238 O O    . GLU A 1 108 ? -2.303  -4.201  17.450  1.00 0.00 ? 127 GLU A O    5  
ATOM 11239 C CB   . GLU A 1 108 ? -0.861  -1.554  17.703  1.00 0.00 ? 127 GLU A CB   5  
ATOM 11240 C CG   . GLU A 1 108 ? -1.061  -1.829  19.183  1.00 0.00 ? 127 GLU A CG   5  
ATOM 11241 C CD   . GLU A 1 108 ? -0.101  -1.057  20.066  1.00 0.00 ? 127 GLU A CD   5  
ATOM 11242 O OE1  . GLU A 1 108 ? 1.125   -1.240  19.913  1.00 0.00 ? 127 GLU A OE1  5  
ATOM 11243 O OE2  . GLU A 1 108 ? -0.575  -0.269  20.912  1.00 0.00 ? 127 GLU A OE2  5  
ATOM 11244 H H    . GLU A 1 108 ? -4.001  -2.122  17.624  1.00 0.00 ? 127 GLU A H    5  
ATOM 11245 H HA   . GLU A 1 108 ? -1.962  -1.374  15.876  1.00 0.00 ? 127 GLU A HA   5  
ATOM 11246 H HB2  . GLU A 1 108 ? -0.007  -2.125  17.368  2.00 0.00 ? 127 GLU A HB2  5  
ATOM 11247 H HB3  . GLU A 1 108 ? -0.636  -0.504  17.585  2.00 0.00 ? 127 GLU A HB3  5  
ATOM 11248 H HG2  . GLU A 1 108 ? -2.073  -1.555  19.451  2.00 0.00 ? 127 GLU A HG2  5  
ATOM 11249 H HG3  . GLU A 1 108 ? -0.918  -2.885  19.359  2.00 0.00 ? 127 GLU A HG3  5  
ATOM 11250 N N    . ASP A 1 109 ? -1.862  -3.773  15.285  1.00 0.00 ? 128 ASP A N    5  
ATOM 11251 C CA   . ASP A 1 109 ? -1.863  -5.179  14.899  1.00 0.00 ? 128 ASP A CA   5  
ATOM 11252 C C    . ASP A 1 109 ? -1.050  -5.401  13.629  1.00 0.00 ? 128 ASP A C    5  
ATOM 11253 O O    . ASP A 1 109 ? -1.362  -4.852  12.573  1.00 0.00 ? 128 ASP A O    5  
ATOM 11254 C CB   . ASP A 1 109 ? -3.296  -5.671  14.693  1.00 0.00 ? 128 ASP A CB   5  
ATOM 11255 C CG   . ASP A 1 109 ? -3.506  -7.111  15.118  1.00 0.00 ? 128 ASP A CG   5  
ATOM 11256 O OD1  . ASP A 1 109 ? -2.853  -7.542  16.093  1.00 0.00 ? 128 ASP A OD1  5  
ATOM 11257 O OD2  . ASP A 1 109 ? -4.321  -7.807  14.478  1.00 0.00 ? 128 ASP A OD2  5  
ATOM 11258 H H    . ASP A 1 109 ? -1.694  -3.088  14.604  1.00 0.00 ? 128 ASP A H    5  
ATOM 11259 H HA   . ASP A 1 109 ? -1.413  -5.742  15.703  1.00 0.00 ? 128 ASP A HA   5  
ATOM 11260 H HB2  . ASP A 1 109 ? -3.967  -5.048  15.264  2.00 0.00 ? 128 ASP A HB2  5  
ATOM 11261 H HB3  . ASP A 1 109 ? -3.548  -5.588  13.645  2.00 0.00 ? 128 ASP A HB3  5  
ATOM 11262 N N    . CYS A 1 110 ? -0.008  -6.218  13.740  1.00 0.00 ? 129 CYS A N    5  
ATOM 11263 C CA   . CYS A 1 110 ? 0.851   -6.524  12.603  1.00 0.00 ? 129 CYS A CA   5  
ATOM 11264 C C    . CYS A 1 110 ? 0.580   -7.937  12.096  1.00 0.00 ? 129 CYS A C    5  
ATOM 11265 O O    . CYS A 1 110 ? 1.359   -8.489  11.319  1.00 0.00 ? 129 CYS A O    5  
ATOM 11266 C CB   . CYS A 1 110 ? 2.324   -6.382  12.993  1.00 0.00 ? 129 CYS A CB   5  
ATOM 11267 S SG   . CYS A 1 110 ? 3.381   -5.693  11.677  1.00 0.00 ? 129 CYS A SG   5  
ATOM 11268 H H    . CYS A 1 110 ? 0.187   -6.629  14.609  1.00 0.00 ? 129 CYS A H    5  
ATOM 11269 H HA   . CYS A 1 110 ? 0.624   -5.821  11.816  1.00 0.00 ? 129 CYS A HA   5  
ATOM 11270 H HB2  . CYS A 1 110 ? 2.399   -5.729  13.850  2.00 0.00 ? 129 CYS A HB2  5  
ATOM 11271 H HB3  . CYS A 1 110 ? 2.715   -7.354  13.253  2.00 0.00 ? 129 CYS A HB3  5  
ATOM 11272 N N    . THR A 1 111 ? -0.531  -8.514  12.545  1.00 0.00 ? 130 THR A N    5  
ATOM 11273 C CA   . THR A 1 111 ? -0.913  -9.862  12.147  1.00 0.00 ? 130 THR A CA   5  
ATOM 11274 C C    . THR A 1 111 ? -0.785  -10.052 10.640  1.00 0.00 ? 130 THR A C    5  
ATOM 11275 O O    . THR A 1 111 ? -0.728  -9.083  9.883   1.00 0.00 ? 130 THR A O    5  
ATOM 11276 C CB   . THR A 1 111 ? -2.358  -10.183 12.571  1.00 0.00 ? 130 THR A CB   5  
ATOM 11277 O OG1  . THR A 1 111 ? -3.229  -9.108  12.201  1.00 0.00 ? 130 THR A OG1  5  
ATOM 11278 C CG2  . THR A 1 111 ? -2.442  -10.416 14.072  1.00 0.00 ? 130 THR A CG2  5  
ATOM 11279 H H    . THR A 1 111 ? -1.107  -8.020  13.164  1.00 0.00 ? 130 THR A H    5  
ATOM 11280 H HA   . THR A 1 111 ? -0.252  -10.555 12.645  1.00 0.00 ? 130 THR A HA   5  
ATOM 11281 H HB   . THR A 1 111 ? -2.675  -11.084 12.064  1.00 0.00 ? 130 THR A HB   5  
ATOM 11282 H HG1  . THR A 1 111 ? -2.960  -8.306  12.657  1.00 0.00 ? 130 THR A HG1  5  
ATOM 11283 H HG21 . THR A 1 111 ? -3.244  -9.823  14.484  1.00 0.00 ? 130 THR A HG21 5  
ATOM 11284 H HG22 . THR A 1 111 ? -1.508  -10.131 14.533  1.00 0.00 ? 130 THR A HG22 5  
ATOM 11285 H HG23 . THR A 1 111 ? -2.633  -11.462 14.264  1.00 0.00 ? 130 THR A HG23 5  
ATOM 11286 N N    . SER A 1 112 ? -0.737  -11.309 10.210  1.00 0.00 ? 131 SER A N    5  
ATOM 11287 C CA   . SER A 1 112 ? -0.612  -11.629 8.794   1.00 0.00 ? 131 SER A CA   5  
ATOM 11288 C C    . SER A 1 112 ? -1.889  -11.279 8.037   1.00 0.00 ? 131 SER A C    5  
ATOM 11289 O O    . SER A 1 112 ? -2.920  -11.929 8.205   1.00 0.00 ? 131 SER A O    5  
ATOM 11290 C CB   . SER A 1 112 ? -0.289  -13.112 8.613   1.00 0.00 ? 131 SER A CB   5  
ATOM 11291 O OG   . SER A 1 112 ? -1.175  -13.921 9.366   1.00 0.00 ? 131 SER A OG   5  
ATOM 11292 H H    . SER A 1 112 ? -0.785  -12.038 10.863  1.00 0.00 ? 131 SER A H    5  
ATOM 11293 H HA   . SER A 1 112 ? 0.201   -11.042 8.393   1.00 0.00 ? 131 SER A HA   5  
ATOM 11294 H HB2  . SER A 1 112 ? -0.381  -13.375 7.567   2.00 0.00 ? 131 SER A HB2  5  
ATOM 11295 H HB3  . SER A 1 112 ? 0.723   -13.302 8.944   2.00 0.00 ? 131 SER A HB3  5  
ATOM 11296 H HG   . SER A 1 112 ? -0.785  -14.790 9.494   1.00 0.00 ? 131 SER A HG   5  
ATOM 11297 N N    . VAL A 1 113 ? -1.811  -10.249 7.199   1.00 0.00 ? 132 VAL A N    5  
ATOM 11298 C CA   . VAL A 1 113 ? -2.957  -9.815  6.411   1.00 0.00 ? 132 VAL A CA   5  
ATOM 11299 C C    . VAL A 1 113 ? -3.504  -10.963 5.570   1.00 0.00 ? 132 VAL A C    5  
ATOM 11300 O O    . VAL A 1 113 ? -4.441  -11.650 5.978   1.00 0.00 ? 132 VAL A O    5  
ATOM 11301 C CB   . VAL A 1 113 ? -2.591  -8.630  5.492   1.00 0.00 ? 132 VAL A CB   5  
ATOM 11302 C CG1  . VAL A 1 113 ? -3.566  -8.512  4.330   2.00 0.00 ? 132 VAL A CG1  5  
ATOM 11303 C CG2  . VAL A 1 113 ? -2.554  -7.329  6.281   2.00 0.00 ? 132 VAL A CG2  5  
ATOM 11304 H H    . VAL A 1 113 ? -0.959  -9.773  7.106   1.00 0.00 ? 132 VAL A H    5  
ATOM 11305 H HA   . VAL A 1 113 ? -3.724  -9.489  7.091   1.00 0.00 ? 132 VAL A HA   5  
ATOM 11306 H HB   . VAL A 1 113 ? -1.605  -8.812  5.091   1.00 0.00 ? 132 VAL A HB   5  
ATOM 11307 H HG11 . VAL A 1 113 ? -4.573  -8.426  4.711   1.00 0.00 ? 132 VAL A HG11 5  
ATOM 11308 H HG12 . VAL A 1 113 ? -3.489  -9.389  3.705   1.00 0.00 ? 132 VAL A HG12 5  
ATOM 11309 H HG13 . VAL A 1 113 ? -3.326  -7.635  3.746   1.00 0.00 ? 132 VAL A HG13 5  
ATOM 11310 H HG21 . VAL A 1 113 ? -2.827  -7.524  7.308   1.00 0.00 ? 132 VAL A HG21 5  
ATOM 11311 H HG22 . VAL A 1 113 ? -3.252  -6.625  5.850   1.00 0.00 ? 132 VAL A HG22 5  
ATOM 11312 H HG23 . VAL A 1 113 ? -1.557  -6.916  6.245   1.00 0.00 ? 132 VAL A HG23 5  
ATOM 11313 N N    . THR A 1 114 ? -2.912  -11.165 4.398   1.00 0.00 ? 133 THR A N    5  
ATOM 11314 C CA   . THR A 1 114 ? -3.334  -12.232 3.492   1.00 0.00 ? 133 THR A CA   5  
ATOM 11315 C C    . THR A 1 114 ? -4.844  -12.212 3.284   1.00 0.00 ? 133 THR A C    5  
ATOM 11316 O O    . THR A 1 114 ? -5.415  -13.138 2.705   1.00 0.00 ? 133 THR A O    5  
ATOM 11317 C CB   . THR A 1 114 ? -2.927  -13.617 4.029   1.00 0.00 ? 133 THR A CB   5  
ATOM 11318 O OG1  . THR A 1 114 ? -2.688  -14.514 2.938   1.00 0.00 ? 133 THR A OG1  5  
ATOM 11319 C CG2  . THR A 1 114 ? -4.012  -14.185 4.932   1.00 0.00 ? 133 THR A CG2  5  
ATOM 11320 H H    . THR A 1 114 ? -2.172  -10.581 4.137   1.00 0.00 ? 133 THR A H    5  
ATOM 11321 H HA   . THR A 1 114 ? -2.845  -12.077 2.542   1.00 0.00 ? 133 THR A HA   5  
ATOM 11322 H HB   . THR A 1 114 ? -2.019  -13.510 4.604   1.00 0.00 ? 133 THR A HB   5  
ATOM 11323 H HG1  . THR A 1 114 ? -2.688  -15.418 3.262   1.00 0.00 ? 133 THR A HG1  5  
ATOM 11324 H HG21 . THR A 1 114 ? -4.316  -15.154 4.564   1.00 0.00 ? 133 THR A HG21 5  
ATOM 11325 H HG22 . THR A 1 114 ? -4.862  -13.518 4.937   1.00 0.00 ? 133 THR A HG22 5  
ATOM 11326 H HG23 . THR A 1 114 ? -3.628  -14.286 5.936   1.00 0.00 ? 133 THR A HG23 5  
ATOM 11327 N N    . ASP A 1 115 ? -5.485  -11.161 3.771   1.00 0.00 ? 134 ASP A N    5  
ATOM 11328 C CA   . ASP A 1 115 ? -6.932  -11.024 3.654   1.00 0.00 ? 134 ASP A CA   5  
ATOM 11329 C C    . ASP A 1 115 ? -7.344  -10.605 2.246   1.00 0.00 ? 134 ASP A C    5  
ATOM 11330 O O    . ASP A 1 115 ? -7.393  -11.426 1.330   1.00 0.00 ? 134 ASP A O    5  
ATOM 11331 C CB   . ASP A 1 115 ? -7.446  -10.007 4.674   1.00 0.00 ? 134 ASP A CB   5  
ATOM 11332 C CG   . ASP A 1 115 ? -7.356  -10.511 6.102   1.00 0.00 ? 134 ASP A CG   5  
ATOM 11333 O OD1  . ASP A 1 115 ? -7.866  -11.619 6.373   1.00 0.00 ? 134 ASP A OD1  5  
ATOM 11334 O OD2  . ASP A 1 115 ? -6.777  -9.798  6.948   1.00 0.00 ? 134 ASP A OD2  5  
ATOM 11335 H H    . ASP A 1 115 ? -4.974  -10.463 4.230   1.00 0.00 ? 134 ASP A H    5  
ATOM 11336 H HA   . ASP A 1 115 ? -7.370  -11.986 3.871   1.00 0.00 ? 134 ASP A HA   5  
ATOM 11337 H HB2  . ASP A 1 115 ? -6.862  -9.100  4.596   2.00 0.00 ? 134 ASP A HB2  5  
ATOM 11338 H HB3  . ASP A 1 115 ? -8.482  -9.782  4.457   2.00 0.00 ? 134 ASP A HB3  5  
ATOM 11339 N N    . LEU A 1 116 ? -7.655  -9.322  2.089   1.00 0.00 ? 135 LEU A N    5  
ATOM 11340 C CA   . LEU A 1 116 ? -8.086  -8.781  0.805   1.00 0.00 ? 135 LEU A CA   5  
ATOM 11341 C C    . LEU A 1 116 ? -9.357  -9.477  0.313   1.00 0.00 ? 135 LEU A C    5  
ATOM 11342 O O    . LEU A 1 116 ? -9.515  -9.726  -0.882  1.00 0.00 ? 135 LEU A O    5  
ATOM 11343 C CB   . LEU A 1 116 ? -6.989  -8.934  -0.251  1.00 0.00 ? 135 LEU A CB   5  
ATOM 11344 C CG   . LEU A 1 116 ? -5.557  -8.691  0.240   1.00 0.00 ? 135 LEU A CG   5  
ATOM 11345 C CD1  . LEU A 1 116 ? -4.698  -8.116  -0.873  2.00 0.00 ? 135 LEU A CD1  5  
ATOM 11346 C CD2  . LEU A 1 116 ? -5.546  -7.759  1.437   2.00 0.00 ? 135 LEU A CD2  5  
ATOM 11347 H H    . LEU A 1 116 ? -7.606  -8.724  2.862   1.00 0.00 ? 135 LEU A H    5  
ATOM 11348 H HA   . LEU A 1 116 ? -8.289  -7.728  0.946   1.00 0.00 ? 135 LEU A HA   5  
ATOM 11349 H HB2  . LEU A 1 116 ? -7.044  -9.936  -0.651  2.00 0.00 ? 135 LEU A HB2  5  
ATOM 11350 H HB3  . LEU A 1 116 ? -7.202  -8.239  -1.049  2.00 0.00 ? 135 LEU A HB3  5  
ATOM 11351 H HG   . LEU A 1 116 ? -5.124  -9.632  0.545   1.00 0.00 ? 135 LEU A HG   5  
ATOM 11352 H HD11 . LEU A 1 116 ? -4.333  -7.142  -0.578  1.00 0.00 ? 135 LEU A HD11 5  
ATOM 11353 H HD12 . LEU A 1 116 ? -5.288  -8.022  -1.773  1.00 0.00 ? 135 LEU A HD12 5  
ATOM 11354 H HD13 . LEU A 1 116 ? -3.861  -8.773  -1.057  1.00 0.00 ? 135 LEU A HD13 5  
ATOM 11355 H HD21 . LEU A 1 116 ? -6.350  -7.044  1.341   1.00 0.00 ? 135 LEU A HD21 5  
ATOM 11356 H HD22 . LEU A 1 116 ? -4.602  -7.238  1.472   1.00 0.00 ? 135 LEU A HD22 5  
ATOM 11357 H HD23 . LEU A 1 116 ? -5.678  -8.334  2.341   1.00 0.00 ? 135 LEU A HD23 5  
ATOM 11358 N N    . PRO A 1 117 ? -10.273 -9.818  1.234   1.00 0.00 ? 136 PRO A N    5  
ATOM 11359 C CA   . PRO A 1 117 ? -11.526 -10.509 0.892   1.00 0.00 ? 136 PRO A CA   5  
ATOM 11360 C C    . PRO A 1 117 ? -12.538 -9.624  0.171   1.00 0.00 ? 136 PRO A C    5  
ATOM 11361 O O    . PRO A 1 117 ? -13.618 -10.084 -0.200  1.00 0.00 ? 136 PRO A O    5  
ATOM 11362 C CB   . PRO A 1 117 ? -12.090 -10.912 2.250   1.00 0.00 ? 136 PRO A CB   5  
ATOM 11363 C CG   . PRO A 1 117 ? -11.513 -9.928  3.207   1.00 0.00 ? 136 PRO A CG   5  
ATOM 11364 C CD   . PRO A 1 117 ? -10.150 -9.576  2.684   1.00 0.00 ? 136 PRO A CD   5  
ATOM 11365 H HA   . PRO A 1 117 ? -11.340 -11.394 0.303   1.00 0.00 ? 136 PRO A HA   5  
ATOM 11366 H HB2  . PRO A 1 117 ? -13.164 -10.842 2.219   2.00 0.00 ? 136 PRO A HB2  5  
ATOM 11367 H HB3  . PRO A 1 117 ? -11.791 -11.923 2.486   2.00 0.00 ? 136 PRO A HB3  5  
ATOM 11368 H HG2  . PRO A 1 117 ? -12.136 -9.048  3.247   2.00 0.00 ? 136 PRO A HG2  5  
ATOM 11369 H HG3  . PRO A 1 117 ? -11.433 -10.375 4.187   2.00 0.00 ? 136 PRO A HG3  5  
ATOM 11370 H HD2  . PRO A 1 117 ? -9.925  -8.540  2.883   2.00 0.00 ? 136 PRO A HD2  5  
ATOM 11371 H HD3  . PRO A 1 117 ? -9.399  -10.221 3.119   2.00 0.00 ? 136 PRO A HD3  5  
ATOM 11372 N N    . ASN A 1 118 ? -12.201 -8.357  -0.006  1.00 0.00 ? 137 ASN A N    5  
ATOM 11373 C CA   . ASN A 1 118 ? -13.111 -7.420  -0.666  1.00 0.00 ? 137 ASN A CA   5  
ATOM 11374 C C    . ASN A 1 118 ? -12.919 -7.410  -2.179  1.00 0.00 ? 137 ASN A C    5  
ATOM 11375 O O    . ASN A 1 118 ? -13.769 -6.904  -2.913  1.00 0.00 ? 137 ASN A O    5  
ATOM 11376 C CB   . ASN A 1 118 ? -12.931 -6.009  -0.111  1.00 0.00 ? 137 ASN A CB   5  
ATOM 11377 C CG   . ASN A 1 118 ? -13.687 -5.792  1.185   1.00 0.00 ? 137 ASN A CG   5  
ATOM 11378 O OD1  . ASN A 1 118 ? -14.255 -4.724  1.416   1.00 0.00 ? 137 ASN A OD1  5  
ATOM 11379 N ND2  . ASN A 1 118 ? -13.698 -6.808  2.041   4.00 0.00 ? 137 ASN A ND2  5  
ATOM 11380 H H    . ASN A 1 118 ? -11.333 -8.044  0.323   1.00 0.00 ? 137 ASN A H    5  
ATOM 11381 H HA   . ASN A 1 118 ? -14.115 -7.743  -0.453  1.00 0.00 ? 137 ASN A HA   5  
ATOM 11382 H HB2  . ASN A 1 118 ? -11.884 -5.837  0.073   2.00 0.00 ? 137 ASN A HB2  5  
ATOM 11383 H HB3  . ASN A 1 118 ? -13.289 -5.293  -0.839  2.00 0.00 ? 137 ASN A HB3  5  
ATOM 11384 H HD21 . ASN A 1 118 ? -13.224 -7.631  1.790   5.00 0.00 ? 137 ASN A HD21 5  
ATOM 11385 H HD22 . ASN A 1 118 ? -14.182 -6.694  2.890   5.00 0.00 ? 137 ASN A HD22 5  
ATOM 11386 N N    . ALA A 1 119 ? -11.810 -7.970  -2.646  1.00 0.00 ? 138 ALA A N    5  
ATOM 11387 C CA   . ALA A 1 119 ? -11.535 -8.015  -4.076  1.00 0.00 ? 138 ALA A CA   5  
ATOM 11388 C C    . ALA A 1 119 ? -12.616 -8.805  -4.808  1.00 0.00 ? 138 ALA A C    5  
ATOM 11389 O O    . ALA A 1 119 ? -13.648 -9.144  -4.230  1.00 0.00 ? 138 ALA A O    5  
ATOM 11390 C CB   . ALA A 1 119 ? -10.161 -8.611  -4.340  1.00 0.00 ? 138 ALA A CB   5  
ATOM 11391 H H    . ALA A 1 119 ? -11.166 -8.361  -2.019  1.00 0.00 ? 138 ALA A H    5  
ATOM 11392 H HA   . ALA A 1 119 ? -11.536 -6.999  -4.444  1.00 0.00 ? 138 ALA A HA   5  
ATOM 11393 H HB1  . ALA A 1 119 ? -9.520  -8.428  -3.490  1.00 0.00 ? 138 ALA A HB1  5  
ATOM 11394 H HB2  . ALA A 1 119 ? -9.734  -8.152  -5.220  1.00 0.00 ? 138 ALA A HB2  5  
ATOM 11395 H HB3  . ALA A 1 119 ? -10.255 -9.675  -4.498  1.00 0.00 ? 138 ALA A HB3  5  
ATOM 11396 N N    . PHE A 1 120 ? -12.377 -9.091  -6.082  1.00 0.00 ? 139 PHE A N    5  
ATOM 11397 C CA   . PHE A 1 120 ? -13.340 -9.837  -6.886  1.00 0.00 ? 139 PHE A CA   5  
ATOM 11398 C C    . PHE A 1 120 ? -12.780 -11.198 -7.284  1.00 0.00 ? 139 PHE A C    5  
ATOM 11399 O O    . PHE A 1 120 ? -11.572 -11.426 -7.226  1.00 0.00 ? 139 PHE A O    5  
ATOM 11400 C CB   . PHE A 1 120 ? -13.732 -9.041  -8.137  1.00 0.00 ? 139 PHE A CB   5  
ATOM 11401 C CG   . PHE A 1 120 ? -12.708 -8.043  -8.605  1.00 0.00 ? 139 PHE A CG   5  
ATOM 11402 C CD1  . PHE A 1 120 ? -12.206 -7.085  -7.739  1.00 0.00 ? 139 PHE A CD1  5  
ATOM 11403 C CD2  . PHE A 1 120 ? -12.250 -8.065  -9.911  1.00 0.00 ? 139 PHE A CD2  5  
ATOM 11404 C CE1  . PHE A 1 120 ? -11.265 -6.168  -8.167  1.00 0.00 ? 139 PHE A CE1  5  
ATOM 11405 C CE2  . PHE A 1 120 ? -11.309 -7.151  -10.347 1.00 0.00 ? 139 PHE A CE2  5  
ATOM 11406 C CZ   . PHE A 1 120 ? -10.816 -6.202  -9.473  1.00 0.00 ? 139 PHE A CZ   5  
ATOM 11407 H H    . PHE A 1 120 ? -11.539 -8.794  -6.493  1.00 0.00 ? 139 PHE A H    5  
ATOM 11408 H HA   . PHE A 1 120 ? -14.221 -9.991  -6.281  1.00 0.00 ? 139 PHE A HA   5  
ATOM 11409 H HB2  . PHE A 1 120 ? -13.909 -9.734  -8.948  2.00 0.00 ? 139 PHE A HB2  5  
ATOM 11410 H HB3  . PHE A 1 120 ? -14.647 -8.501  -7.933  2.00 0.00 ? 139 PHE A HB3  5  
ATOM 11411 H HD1  . PHE A 1 120 ? -12.555 -7.058  -6.717  1.00 0.00 ? 139 PHE A HD1  5  
ATOM 11412 H HD2  . PHE A 1 120 ? -12.634 -8.807  -10.595 1.00 0.00 ? 139 PHE A HD2  5  
ATOM 11413 H HE1  . PHE A 1 120 ? -10.880 -5.429  -7.481  1.00 0.00 ? 139 PHE A HE1  5  
ATOM 11414 H HE2  . PHE A 1 120 ? -10.959 -7.179  -11.368 1.00 0.00 ? 139 PHE A HE2  5  
ATOM 11415 H HZ   . PHE A 1 120 ? -10.079 -5.487  -9.811  1.00 0.00 ? 139 PHE A HZ   5  
ATOM 11416 N N    . ASP A 1 121 ? -13.671 -12.102 -7.684  1.00 0.00 ? 140 ASP A N    5  
ATOM 11417 C CA   . ASP A 1 121 ? -13.271 -13.445 -8.088  1.00 0.00 ? 140 ASP A CA   5  
ATOM 11418 C C    . ASP A 1 121 ? -12.165 -13.396 -9.138  1.00 0.00 ? 140 ASP A C    5  
ATOM 11419 O O    . ASP A 1 121 ? -12.214 -12.593 -10.069 1.00 0.00 ? 140 ASP A O    5  
ATOM 11420 C CB   . ASP A 1 121 ? -14.475 -14.214 -8.636  1.00 0.00 ? 140 ASP A CB   5  
ATOM 11421 C CG   . ASP A 1 121 ? -15.376 -14.745 -7.540  1.00 0.00 ? 140 ASP A CG   5  
ATOM 11422 O OD1  . ASP A 1 121 ? -16.192 -13.961 -7.009  1.00 0.00 ? 140 ASP A OD1  5  
ATOM 11423 O OD2  . ASP A 1 121 ? -15.269 -15.945 -7.212  1.00 0.00 ? 140 ASP A OD2  5  
ATOM 11424 H H    . ASP A 1 121 ? -14.619 -11.860 -7.705  1.00 0.00 ? 140 ASP A H    5  
ATOM 11425 H HA   . ASP A 1 121 ? -12.898 -13.956 -7.215  1.00 0.00 ? 140 ASP A HA   5  
ATOM 11426 H HB2  . ASP A 1 121 ? -15.056 -13.557 -9.267  2.00 0.00 ? 140 ASP A HB2  5  
ATOM 11427 H HB3  . ASP A 1 121 ? -14.124 -15.049 -9.223  2.00 0.00 ? 140 ASP A HB3  5  
ATOM 11428 N N    . GLY A 1 122 ? -11.170 -14.261 -8.980  1.00 0.00 ? 141 GLY A N    5  
ATOM 11429 C CA   . GLY A 1 122 ? -10.066 -14.303 -9.919  1.00 0.00 ? 141 GLY A CA   5  
ATOM 11430 C C    . GLY A 1 122 ? -8.912  -15.155 -9.424  1.00 0.00 ? 141 GLY A C    5  
ATOM 11431 O O    . GLY A 1 122 ? -8.503  -15.041 -8.269  1.00 0.00 ? 141 GLY A O    5  
ATOM 11432 H H    . GLY A 1 122 ? -11.185 -14.878 -8.218  1.00 0.00 ? 141 GLY A H    5  
ATOM 11433 H HA2  . GLY A 1 122 ? -10.421 -14.708 -10.857 2.00 0.00 ? 141 GLY A HA2  5  
ATOM 11434 H HA3  . GLY A 1 122 ? -9.710  -13.295 -10.084 2.00 0.00 ? 141 GLY A HA3  5  
ATOM 11435 N N    . PRO A 1 123 ? -8.366  -16.028 -10.284 1.00 0.00 ? 142 PRO A N    5  
ATOM 11436 C CA   . PRO A 1 123 ? -7.251  -16.909 -9.927  1.00 0.00 ? 142 PRO A CA   5  
ATOM 11437 C C    . PRO A 1 123 ? -5.950  -16.142 -9.705  1.00 0.00 ? 142 PRO A C    5  
ATOM 11438 O O    . PRO A 1 123 ? -4.864  -16.720 -9.754  1.00 0.00 ? 142 PRO A O    5  
ATOM 11439 C CB   . PRO A 1 123 ? -7.112  -17.844 -11.141 1.00 0.00 ? 142 PRO A CB   5  
ATOM 11440 C CG   . PRO A 1 123 ? -8.361  -17.645 -11.939 1.00 0.00 ? 142 PRO A CG   5  
ATOM 11441 C CD   . PRO A 1 123 ? -8.795  -16.236 -11.670 1.00 0.00 ? 142 PRO A CD   5  
ATOM 11442 H HA   . PRO A 1 123 ? -7.476  -17.492 -9.046  1.00 0.00 ? 142 PRO A HA   5  
ATOM 11443 H HB2  . PRO A 1 123 ? -6.236  -17.570 -11.709 2.00 0.00 ? 142 PRO A HB2  5  
ATOM 11444 H HB3  . PRO A 1 123 ? -7.022  -18.866 -10.802 2.00 0.00 ? 142 PRO A HB3  5  
ATOM 11445 H HG2  . PRO A 1 123 ? -8.152  -17.781 -12.989 2.00 0.00 ? 142 PRO A HG2  5  
ATOM 11446 H HG3  . PRO A 1 123 ? -9.120  -18.340 -11.612 2.00 0.00 ? 142 PRO A HG3  5  
ATOM 11447 H HD2  . PRO A 1 123 ? -8.295  -15.550 -12.338 2.00 0.00 ? 142 PRO A HD2  5  
ATOM 11448 H HD3  . PRO A 1 123 ? -9.868  -16.145 -11.762 2.00 0.00 ? 142 PRO A HD3  5  
ATOM 11449 N N    . ILE A 1 124 ? -6.062  -14.839 -9.462  1.00 0.00 ? 143 ILE A N    5  
ATOM 11450 C CA   . ILE A 1 124 ? -4.888  -14.003 -9.235  1.00 0.00 ? 143 ILE A CA   5  
ATOM 11451 C C    . ILE A 1 124 ? -4.248  -14.308 -7.886  1.00 0.00 ? 143 ILE A C    5  
ATOM 11452 O O    . ILE A 1 124 ? -4.872  -14.139 -6.839  1.00 0.00 ? 143 ILE A O    5  
ATOM 11453 C CB   . ILE A 1 124 ? -5.236  -12.505 -9.305  1.00 0.00 ? 143 ILE A CB   5  
ATOM 11454 C CG1  . ILE A 1 124 ? -5.483  -12.087 -10.755 1.00 0.00 ? 143 ILE A CG1  5  
ATOM 11455 C CG2  . ILE A 1 124 ? -4.122  -11.672 -8.686  1.00 0.00 ? 143 ILE A CG2  5  
ATOM 11456 C CD1  . ILE A 1 124 ? -5.689  -10.599 -10.943 1.00 0.00 ? 143 ILE A CD1  5  
ATOM 11457 H H    . ILE A 1 124 ? -6.952  -14.430 -9.435  1.00 0.00 ? 143 ILE A H    5  
ATOM 11458 H HA   . ILE A 1 124 ? -4.173  -14.219 -10.014 1.00 0.00 ? 143 ILE A HA   5  
ATOM 11459 H HB   . ILE A 1 124 ? -6.136  -12.340 -8.732  1.00 0.00 ? 143 ILE A HB   5  
ATOM 11460 H HG12 . ILE A 1 124 ? -4.633  -12.381 -11.355 2.00 0.00 ? 143 ILE A HG12 5  
ATOM 11461 H HG13 . ILE A 1 124 ? -6.362  -12.592 -11.123 2.00 0.00 ? 143 ILE A HG13 5  
ATOM 11462 H HG21 . ILE A 1 124 ? -4.444  -11.296 -7.726  1.00 0.00 ? 143 ILE A HG21 5  
ATOM 11463 H HG22 . ILE A 1 124 ? -3.889  -10.842 -9.338  1.00 0.00 ? 143 ILE A HG22 5  
ATOM 11464 H HG23 . ILE A 1 124 ? -3.243  -12.285 -8.557  1.00 0.00 ? 143 ILE A HG23 5  
ATOM 11465 H HD11 . ILE A 1 124 ? -6.323  -10.222 -10.155 1.00 0.00 ? 143 ILE A HD11 5  
ATOM 11466 H HD12 . ILE A 1 124 ? -6.156  -10.419 -11.900 1.00 0.00 ? 143 ILE A HD12 5  
ATOM 11467 H HD13 . ILE A 1 124 ? -4.734  -10.097 -10.908 1.00 0.00 ? 143 ILE A HD13 5  
ATOM 11468 N N    . THR A 1 125 ? -2.999  -14.755 -7.922  1.00 0.00 ? 144 THR A N    5  
ATOM 11469 C CA   . THR A 1 125 ? -2.268  -15.083 -6.704  1.00 0.00 ? 144 THR A CA   5  
ATOM 11470 C C    . THR A 1 125 ? -1.600  -13.845 -6.117  1.00 0.00 ? 144 THR A C    5  
ATOM 11471 O O    . THR A 1 125 ? -0.467  -13.516 -6.464  1.00 0.00 ? 144 THR A O    5  
ATOM 11472 C CB   . THR A 1 125 ? -1.196  -16.158 -6.962  1.00 0.00 ? 144 THR A CB   5  
ATOM 11473 O OG1  . THR A 1 125 ? -1.761  -17.245 -7.705  1.00 0.00 ? 144 THR A OG