data_1PPE
# 
_entry.id   1PPE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1PPE         
WWPDB D_1000175784 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1PPE 
_pdbx_database_status.recvd_initial_deposition_date   1991-10-24 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bode, W.'  1 
'Huber, R.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;The refined 2.0 A X-ray crystal structure of the complex formed between bovine beta-trypsin and CMTI-I, a trypsin inhibitor from squash seeds (Cucurbita maxima). Topological similarity of the squash seed inhibitors with the carboxypeptidase A inhibitor from potatoes
;
'FEBS Lett.'                     242 285 292 1989 FEBLAL NE 0014-5793 0165 ? 2914611 '10.1016/0014-5793(89)80486-7' 
1       'Ligand Binding: Proteinase-Protein Inhibitor Interactions' Curr.Opin.Struct.Biol.           1   45  ?   1991 COSBEF UK 
0959-440X 0801 ? ?       ?                              
2       
;Nuclear Magnetic Resonance Solution and X-Ray Structures of Squash Trypsin Inhibitor Exhibit the Same Conformation of the Proteinase Binding Loop
;
J.Mol.Biol.                      210 649 ?   1989 JMOBAK UK 0022-2836 0070 ? ?       ?                              
3       
;The Squash Family of Serine Proteinase Inhibitors. Amino Acid Sequences and Association Equilibrium Constants of Inhibitors from Squash, Summer Squash, Zucchini, and Cucumber Seeds
;
Biochem.Biophys.Res.Commun.      126 646 ?   1985 BBRCA9 US 0006-291X 0146 ? ?       ?                              
4       'Amino-Acid Sequence of Two Trypsin Isoinhibitors, Itd I and Itd III from Squash Seeds (Cucurbita Maxima)' 
;Hoppe-Seyler's Z.Physiol.Chem.
;
364 93  ?   1983 HSZPAZ GW 0018-4888 0905 ? ?       ?                              
5       
;The Refined Crystal Structure of Bovine Beta-Trypsin at 1.8 Angstroms Resolution. Crystallographic Refinement, Calcium Binding Site, Benzamidine Binding Site and Active Site at Ph 7.0
;
J.Mol.Biol.                      98  693 ?   1975 JMOBAK UK 0022-2836 0070 ? ?       ?                              
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bode, W.'             1  
primary 'Greyling, H.J.'       2  
primary 'Huber, R.'            3  
primary 'Otlewski, J.'         4  
primary 'Wilusz, T.'           5  
1       'Bode, W.'             6  
1       'Huber, R.'            7  
2       'Holak, T.A.'          8  
2       'Bode, W.'             9  
2       'Huber, R.'            10 
2       'Otlewski, J.'         11 
2       'Wilusz, T.'           12 
3       'Wieczorek, M.'        13 
3       'Otlewski, J.'         14 
3       'Cook, J.'             15 
3       'Parks, K.'            16 
3       'Leluk, J.'            17 
3       'Wilimowska-Pelc, A.'  18 
3       'Polanowski, A.'       19 
3       'Wilusz, T.'           20 
3       'Laskowski Junior, M.' 21 
4       'Wilusz, T.'           22 
4       'Wieczorek, M.'        23 
4       'Polanowski, A.'       24 
4       'Denton, A.'           25 
4       'Cook, J.'             26 
4       'Laskowski Junior, M.' 27 
5       'Bode, W.'             28 
5       'Schwager, P.'         29 
# 
_cell.entry_id           1PPE 
_cell.length_a           59.280 
_cell.length_b           55.470 
_cell.length_c           74.590 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1PPE 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man TRYPSIN                    23324.287 1   3.4.21.4 ? ? ? 
2 polymer man 'TRYPSIN INHIBITOR CMTI-I' 3279.919  1   ?        ? ? ? 
3 water   nat water                      18.015    140 ?        ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
E ? 
2 'polypeptide(L)' no no RVCPRILMECKKDSDCLAECVCLEHGYCG RVCPRILMECKKDSDCLAECVCLEHGYCG I ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   VAL n 
1 3   GLY n 
1 4   GLY n 
1 5   TYR n 
1 6   THR n 
1 7   CYS n 
1 8   GLY n 
1 9   ALA n 
1 10  ASN n 
1 11  THR n 
1 12  VAL n 
1 13  PRO n 
1 14  TYR n 
1 15  GLN n 
1 16  VAL n 
1 17  SER n 
1 18  LEU n 
1 19  ASN n 
1 20  SER n 
1 21  GLY n 
1 22  TYR n 
1 23  HIS n 
1 24  PHE n 
1 25  CYS n 
1 26  GLY n 
1 27  GLY n 
1 28  SER n 
1 29  LEU n 
1 30  ILE n 
1 31  ASN n 
1 32  SER n 
1 33  GLN n 
1 34  TRP n 
1 35  VAL n 
1 36  VAL n 
1 37  SER n 
1 38  ALA n 
1 39  ALA n 
1 40  HIS n 
1 41  CYS n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  GLY n 
1 46  ILE n 
1 47  GLN n 
1 48  VAL n 
1 49  ARG n 
1 50  LEU n 
1 51  GLY n 
1 52  GLU n 
1 53  ASP n 
1 54  ASN n 
1 55  ILE n 
1 56  ASN n 
1 57  VAL n 
1 58  VAL n 
1 59  GLU n 
1 60  GLY n 
1 61  ASN n 
1 62  GLU n 
1 63  GLN n 
1 64  PHE n 
1 65  ILE n 
1 66  SER n 
1 67  ALA n 
1 68  SER n 
1 69  LYS n 
1 70  SER n 
1 71  ILE n 
1 72  VAL n 
1 73  HIS n 
1 74  PRO n 
1 75  SER n 
1 76  TYR n 
1 77  ASN n 
1 78  SER n 
1 79  ASN n 
1 80  THR n 
1 81  LEU n 
1 82  ASN n 
1 83  ASN n 
1 84  ASP n 
1 85  ILE n 
1 86  MET n 
1 87  LEU n 
1 88  ILE n 
1 89  LYS n 
1 90  LEU n 
1 91  LYS n 
1 92  SER n 
1 93  ALA n 
1 94  ALA n 
1 95  SER n 
1 96  LEU n 
1 97  ASN n 
1 98  SER n 
1 99  ARG n 
1 100 VAL n 
1 101 ALA n 
1 102 SER n 
1 103 ILE n 
1 104 SER n 
1 105 LEU n 
1 106 PRO n 
1 107 THR n 
1 108 SER n 
1 109 CYS n 
1 110 ALA n 
1 111 SER n 
1 112 ALA n 
1 113 GLY n 
1 114 THR n 
1 115 GLN n 
1 116 CYS n 
1 117 LEU n 
1 118 ILE n 
1 119 SER n 
1 120 GLY n 
1 121 TRP n 
1 122 GLY n 
1 123 ASN n 
1 124 THR n 
1 125 LYS n 
1 126 SER n 
1 127 SER n 
1 128 GLY n 
1 129 THR n 
1 130 SER n 
1 131 TYR n 
1 132 PRO n 
1 133 ASP n 
1 134 VAL n 
1 135 LEU n 
1 136 LYS n 
1 137 CYS n 
1 138 LEU n 
1 139 LYS n 
1 140 ALA n 
1 141 PRO n 
1 142 ILE n 
1 143 LEU n 
1 144 SER n 
1 145 ASP n 
1 146 SER n 
1 147 SER n 
1 148 CYS n 
1 149 LYS n 
1 150 SER n 
1 151 ALA n 
1 152 TYR n 
1 153 PRO n 
1 154 GLY n 
1 155 GLN n 
1 156 ILE n 
1 157 THR n 
1 158 SER n 
1 159 ASN n 
1 160 MET n 
1 161 PHE n 
1 162 CYS n 
1 163 ALA n 
1 164 GLY n 
1 165 TYR n 
1 166 LEU n 
1 167 GLU n 
1 168 GLY n 
1 169 GLY n 
1 170 LYS n 
1 171 ASP n 
1 172 SER n 
1 173 CYS n 
1 174 GLN n 
1 175 GLY n 
1 176 ASP n 
1 177 SER n 
1 178 GLY n 
1 179 GLY n 
1 180 PRO n 
1 181 VAL n 
1 182 VAL n 
1 183 CYS n 
1 184 SER n 
1 185 GLY n 
1 186 LYS n 
1 187 LEU n 
1 188 GLN n 
1 189 GLY n 
1 190 ILE n 
1 191 VAL n 
1 192 SER n 
1 193 TRP n 
1 194 GLY n 
1 195 SER n 
1 196 GLY n 
1 197 CYS n 
1 198 ALA n 
1 199 GLN n 
1 200 LYS n 
1 201 ASN n 
1 202 LYS n 
1 203 PRO n 
1 204 GLY n 
1 205 VAL n 
1 206 TYR n 
1 207 THR n 
1 208 LYS n 
1 209 VAL n 
1 210 CYS n 
1 211 ASN n 
1 212 TYR n 
1 213 VAL n 
1 214 SER n 
1 215 TRP n 
1 216 ILE n 
1 217 LYS n 
1 218 GLN n 
1 219 THR n 
1 220 ILE n 
1 221 ALA n 
1 222 SER n 
1 223 ASN n 
2 1   ARG n 
2 2   VAL n 
2 3   CYS n 
2 4   PRO n 
2 5   ARG n 
2 6   ILE n 
2 7   LEU n 
2 8   MET n 
2 9   GLU n 
2 10  CYS n 
2 11  LYS n 
2 12  LYS n 
2 13  ASP n 
2 14  SER n 
2 15  ASP n 
2 16  CYS n 
2 17  LEU n 
2 18  ALA n 
2 19  GLU n 
2 20  CYS n 
2 21  VAL n 
2 22  CYS n 
2 23  LEU n 
2 24  GLU n 
2 25  HIS n 
2 26  GLY n 
2 27  TYR n 
2 28  CYS n 
2 29  GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               cattle 
_entity_src_gen.gene_src_genus                     Bos 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bos taurus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9913 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                SEED 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP TRY1_BOVIN 1 P00760 1 
;FIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEG
NEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKA
PILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTI
ASN
;
? 
2 UNP ITR1_CUCMA 2 P01074 1 RVCPRILMECKKDSDCLAECVCLEHGYCG ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1PPE E 1 ? 223 ? P00760 21 ? 243 ? 16 245 
2 2 1PPE I 1 ? 29  ? P01074 1  ? 29  ? 1  29  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1PPE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.30 
_exptl_crystal.density_percent_sol   46.62 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1PPE 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6.0 
_refine.ls_d_res_high                            2.0 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.151 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1851 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             140 
_refine_hist.number_atoms_total               1991 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        6.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
o_bond_d                0.020 ? ? ? 'X-RAY DIFFRACTION' ? 
o_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_deg             2.70  ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1PPE 
_struct.title                     
;THE REFINED 2.0 ANGSTROMS X-RAY CRYSTAL STRUCTURE OF THE COMPLEX FORMED BETWEEN BOVINE BETA-TRYPSIN AND CMTI-I, A TRYPSIN INHIBITOR FROM SQUASH SEEDS (CUCURBITA MAXIMA): TOPOLOGICAL SIMILARITY OF THE SQUASH SEED INHIBITORS WITH THE CARBOXYPEPTIDASE A INHIBITOR FROM POTATOES
;
_struct.pdbx_descriptor           'TRYPSIN (E.C.3.4.21.4) COMPLEX WITH (CUCURBITA MAXIMA) TRYPSIN INHIBITOR (CMTI-I)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1PPE 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            'SERINE PROTEINASE, HYDROLASE-HYDROLASE INHIBITOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 38  ? TYR A 42  ? ALA E 55  TYR E 59  5 ? 5  
HELX_P HELX_P2 2 SER A 144 ? TYR A 152 ? SER E 164 TYR E 172 1 ? 9  
HELX_P HELX_P3 3 TYR A 212 ? SER A 222 ? TYR E 234 SER E 244 1 ? 11 
HELX_P HELX_P4 4 LYS B 12  ? CYS B 16  ? LYS I 12  CYS I 16  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 7   SG ? ? ? 1_555 A CYS 137 SG ? ? E CYS 22  E CYS 157 1_555 ? ? ? ? ? ? ? 1.998 ? 
disulf2 disulf ? ? A CYS 25  SG ? ? ? 1_555 A CYS 41  SG ? ? E CYS 42  E CYS 58  1_555 ? ? ? ? ? ? ? 1.988 ? 
disulf3 disulf ? ? A CYS 109 SG ? ? ? 1_555 A CYS 210 SG ? ? E CYS 128 E CYS 232 1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf4 disulf ? ? A CYS 116 SG ? ? ? 1_555 A CYS 183 SG ? ? E CYS 136 E CYS 201 1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf5 disulf ? ? A CYS 148 SG ? ? ? 1_555 A CYS 162 SG ? ? E CYS 168 E CYS 182 1_555 ? ? ? ? ? ? ? 1.995 ? 
disulf6 disulf ? ? A CYS 173 SG ? ? ? 1_555 A CYS 197 SG ? ? E CYS 191 E CYS 220 1_555 ? ? ? ? ? ? ? 2.008 ? 
disulf7 disulf ? ? B CYS 3   SG ? ? ? 1_555 B CYS 20  SG ? ? I CYS 3   I CYS 20  1_555 ? ? ? ? ? ? ? 2.011 ? 
disulf8 disulf ? ? B CYS 10  SG ? ? ? 1_555 B CYS 22  SG ? ? I CYS 10  I CYS 22  1_555 ? ? ? ? ? ? ? 2.092 ? 
disulf9 disulf ? ? B CYS 16  SG ? ? ? 1_555 B CYS 28  SG ? ? I CYS 16  I CYS 28  1_555 ? ? ? ? ? ? ? 2.073 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 4 ? 
C ? 7 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 160 ? ALA A 163 ? MET E 180 ALA E 183 
A 2 GLY A 204 ? LYS A 208 ? GLY E 226 LYS E 230 
A 3 LYS A 186 ? GLY A 194 ? LYS E 204 GLY E 216 
A 4 PRO A 180 ? CYS A 183 ? PRO E 198 CYS E 201 
A 5 GLN A 115 ? GLY A 120 ? GLN E 135 GLY E 140 
A 6 LYS A 136 ? PRO A 141 ? LYS E 156 PRO E 161 
A 7 TYR A 5   ? THR A 6   ? TYR E 20  THR E 21  
B 1 MET A 160 ? ALA A 163 ? MET E 180 ALA E 183 
B 2 GLY A 204 ? LYS A 208 ? GLY E 226 LYS E 230 
B 3 LYS A 186 ? GLY A 194 ? LYS E 204 GLY E 216 
B 4 CYS B 3   ? PRO B 4   ? CYS I 3   PRO I 4   
C 1 GLN A 15  ? ASN A 19  ? GLN E 30  ASN E 34  
C 2 HIS A 23  ? LEU A 29  ? HIS E 40  LEU E 46  
C 3 TRP A 34  ? SER A 37  ? TRP E 51  SER E 54  
C 4 MET A 86  ? LEU A 90  ? MET E 104 LEU E 108 
C 5 GLN A 63  ? VAL A 72  ? GLN E 81  VAL E 90  
C 6 GLN A 47  ? LEU A 50  ? GLN E 64  LEU E 67  
C 7 GLN A 15  ? ASN A 19  ? GLN E 30  ASN E 34  
D 1 VAL B 21  ? CYS B 22  ? VAL I 21  CYS I 22  
D 2 CYS B 28  ? GLY B 29  ? CYS I 28  GLY I 29  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 163 ? N ALA E 183 O GLY A 204 ? O GLY E 226 
A 2 3 N THR A 207 ? N THR E 229 O ILE A 190 ? O ILE E 212 
A 3 4 O GLY A 189 ? O GLY E 211 N VAL A 181 ? N VAL E 199 
A 4 5 O VAL A 182 ? O VAL E 200 N LEU A 117 ? N LEU E 137 
A 5 6 N GLY A 120 ? N GLY E 140 O LYS A 136 ? O LYS E 156 
A 6 7 N CYS A 137 ? N CYS E 157 O TYR A 5   ? O TYR E 20  
B 1 2 N ALA A 163 ? N ALA E 183 O GLY A 204 ? O GLY E 226 
B 2 3 N THR A 207 ? N THR E 229 O ILE A 190 ? O ILE E 212 
B 3 4 O GLY A 194 ? O GLY E 216 N CYS B 3   ? N CYS I 3   
C 1 2 O LEU A 18  ? O LEU E 33  N PHE A 24  ? N PHE E 41  
C 2 3 O SER A 28  ? O SER E 45  N VAL A 36  ? N VAL E 53  
C 3 4 O SER A 37  ? O SER E 54  N MET A 86  ? N MET E 104 
C 4 5 O LYS A 89  ? O LYS E 107 N SER A 68  ? N SER E 86  
C 5 6 N ILE A 65  ? N ILE E 83  O VAL A 48  ? O VAL E 65  
C 6 7 N ARG A 49  ? N ARG E 66  O SER A 17  ? O SER E 32  
D 1 2 N VAL B 21  ? N VAL I 21  O GLY B 29  ? O GLY I 29  
# 
_database_PDB_matrix.entry_id          1PPE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1PPE 
_atom_sites.fract_transf_matrix[1][1]   0.016869 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018028 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013407 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
_atom_sites_footnote.id     1 
_atom_sites_footnote.text   
'GLU E    70  - ASP E    71     OMEGA ANGLE =   149.885 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ILE A 1 1   ? 16.792 12.871  4.991  1.00 3.00  ? 16  ILE E N   1 
ATOM   2    C CA  . ILE A 1 1   ? 17.415 14.067  5.486  1.00 3.00  ? 16  ILE E CA  1 
ATOM   3    C C   . ILE A 1 1   ? 17.370 15.207  4.480  1.00 11.29 ? 16  ILE E C   1 
ATOM   4    O O   . ILE A 1 1   ? 18.040 15.120  3.445  1.00 3.00  ? 16  ILE E O   1 
ATOM   5    C CB  . ILE A 1 1   ? 18.878 13.807  5.993  1.00 3.00  ? 16  ILE E CB  1 
ATOM   6    C CG1 . ILE A 1 1   ? 18.976 12.643  6.989  1.00 3.97  ? 16  ILE E CG1 1 
ATOM   7    C CG2 . ILE A 1 1   ? 19.566 15.056  6.546  1.00 3.00  ? 16  ILE E CG2 1 
ATOM   8    C CD1 . ILE A 1 1   ? 18.413 13.065  8.374  1.00 3.00  ? 16  ILE E CD1 1 
ATOM   9    N N   . VAL A 1 2   ? 16.723 16.321  4.866  1.00 5.39  ? 17  VAL E N   1 
ATOM   10   C CA  . VAL A 1 2   ? 16.732 17.608  4.076  1.00 5.62  ? 17  VAL E CA  1 
ATOM   11   C C   . VAL A 1 2   ? 17.820 18.575  4.601  1.00 10.26 ? 17  VAL E C   1 
ATOM   12   O O   . VAL A 1 2   ? 17.908 18.931  5.774  1.00 5.92  ? 17  VAL E O   1 
ATOM   13   C CB  . VAL A 1 2   ? 15.333 18.307  4.062  1.00 3.00  ? 17  VAL E CB  1 
ATOM   14   C CG1 . VAL A 1 2   ? 15.400 19.511  3.139  1.00 3.00  ? 17  VAL E CG1 1 
ATOM   15   C CG2 . VAL A 1 2   ? 14.147 17.352  3.760  1.00 3.00  ? 17  VAL E CG2 1 
ATOM   16   N N   . GLY A 1 3   ? 18.681 19.030  3.737  1.00 7.30  ? 18  GLY E N   1 
ATOM   17   C CA  . GLY A 1 3   ? 19.574 20.103  4.153  1.00 3.00  ? 18  GLY E CA  1 
ATOM   18   C C   . GLY A 1 3   ? 20.879 19.538  4.650  1.00 3.00  ? 18  GLY E C   1 
ATOM   19   O O   . GLY A 1 3   ? 21.505 20.190  5.470  1.00 9.38  ? 18  GLY E O   1 
ATOM   20   N N   . GLY A 1 4   ? 21.113 18.305  4.421  1.00 3.00  ? 19  GLY E N   1 
ATOM   21   C CA  . GLY A 1 4   ? 22.222 17.735  5.167  1.00 3.05  ? 19  GLY E CA  1 
ATOM   22   C C   . GLY A 1 4   ? 23.450 17.490  4.274  1.00 3.00  ? 19  GLY E C   1 
ATOM   23   O O   . GLY A 1 4   ? 23.560 18.038  3.198  1.00 8.66  ? 19  GLY E O   1 
ATOM   24   N N   . TYR A 1 5   ? 24.386 16.754  4.772  1.00 7.53  ? 20  TYR E N   1 
ATOM   25   C CA  . TYR A 1 5   ? 25.610 16.442  4.055  1.00 3.97  ? 20  TYR E CA  1 
ATOM   26   C C   . TYR A 1 5   ? 25.788 14.913  4.069  1.00 19.80 ? 20  TYR E C   1 
ATOM   27   O O   . TYR A 1 5   ? 24.973 14.142  4.560  1.00 4.96  ? 20  TYR E O   1 
ATOM   28   C CB  . TYR A 1 5   ? 26.756 17.249  4.716  1.00 3.00  ? 20  TYR E CB  1 
ATOM   29   C CG  . TYR A 1 5   ? 27.093 16.767  6.145  1.00 5.92  ? 20  TYR E CG  1 
ATOM   30   C CD1 . TYR A 1 5   ? 27.993 15.705  6.378  1.00 15.27 ? 20  TYR E CD1 1 
ATOM   31   C CD2 . TYR A 1 5   ? 26.423 17.320  7.210  1.00 7.76  ? 20  TYR E CD2 1 
ATOM   32   C CE1 . TYR A 1 5   ? 28.223 15.208  7.683  1.00 6.86  ? 20  TYR E CE1 1 
ATOM   33   C CE2 . TYR A 1 5   ? 26.637 16.835  8.508  1.00 3.91  ? 20  TYR E CE2 1 
ATOM   34   C CZ  . TYR A 1 5   ? 27.527 15.801  8.743  1.00 14.47 ? 20  TYR E CZ  1 
ATOM   35   O OH  . TYR A 1 5   ? 27.747 15.454  10.016 1.00 3.00  ? 20  TYR E OH  1 
ATOM   36   N N   . THR A 1 6   ? 26.768 14.446  3.403  1.00 3.73  ? 21  THR E N   1 
ATOM   37   C CA  . THR A 1 6   ? 26.992 13.011  3.250  1.00 4.27  ? 21  THR E CA  1 
ATOM   38   C C   . THR A 1 6   ? 27.951 12.439  4.299  1.00 7.27  ? 21  THR E C   1 
ATOM   39   O O   . THR A 1 6   ? 28.944 13.068  4.640  1.00 14.62 ? 21  THR E O   1 
ATOM   40   C CB  . THR A 1 6   ? 27.633 12.835  1.854  1.00 3.00  ? 21  THR E CB  1 
ATOM   41   O OG1 . THR A 1 6   ? 26.575 13.154  0.899  1.00 3.61  ? 21  THR E OG1 1 
ATOM   42   C CG2 . THR A 1 6   ? 28.083 11.399  1.747  1.00 4.15  ? 21  THR E CG2 1 
ATOM   43   N N   . CYS A 1 7   ? 27.464 11.530  5.079  1.00 3.94  ? 22  CYS E N   1 
ATOM   44   C CA  . CYS A 1 7   ? 28.145 11.229  6.334  1.00 6.63  ? 22  CYS E CA  1 
ATOM   45   C C   . CYS A 1 7   ? 29.533 10.687  5.996  1.00 27.08 ? 22  CYS E C   1 
ATOM   46   O O   . CYS A 1 7   ? 30.482 10.896  6.737  1.00 16.79 ? 22  CYS E O   1 
ATOM   47   C CB  . CYS A 1 7   ? 27.424 10.112  7.119  1.00 3.00  ? 22  CYS E CB  1 
ATOM   48   S SG  . CYS A 1 7   ? 25.727 10.430  7.588  1.00 3.00  ? 22  CYS E SG  1 
ATOM   49   N N   . GLY A 1 8   ? 29.567 9.954   4.925  1.00 17.18 ? 23  GLY E N   1 
ATOM   50   C CA  . GLY A 1 8   ? 30.711 9.158   4.490  1.00 6.72  ? 23  GLY E CA  1 
ATOM   51   C C   . GLY A 1 8   ? 30.477 7.731   4.972  1.00 29.82 ? 23  GLY E C   1 
ATOM   52   O O   . GLY A 1 8   ? 29.943 7.492   6.072  1.00 12.89 ? 23  GLY E O   1 
ATOM   53   N N   . ALA A 1 9   ? 30.992 6.857   4.153  1.00 19.66 ? 24  ALA E N   1 
ATOM   54   C CA  . ALA A 1 9   ? 30.803 5.414   4.381  1.00 27.03 ? 24  ALA E CA  1 
ATOM   55   C C   . ALA A 1 9   ? 31.227 4.887   5.732  1.00 22.52 ? 24  ALA E C   1 
ATOM   56   O O   . ALA A 1 9   ? 32.345 5.125   6.171  1.00 12.04 ? 24  ALA E O   1 
ATOM   57   C CB  . ALA A 1 9   ? 31.399 4.539   3.272  1.00 22.29 ? 24  ALA E CB  1 
ATOM   58   N N   . ASN A 1 10  ? 30.272 4.211   6.378  1.00 17.58 ? 25  ASN E N   1 
ATOM   59   C CA  . ASN A 1 10  ? 30.510 3.615   7.692  1.00 12.10 ? 25  ASN E CA  1 
ATOM   60   C C   . ASN A 1 10  ? 31.046 4.554   8.781  1.00 18.31 ? 25  ASN E C   1 
ATOM   61   O O   . ASN A 1 10  ? 31.644 4.054   9.728  1.00 22.39 ? 25  ASN E O   1 
ATOM   62   C CB  . ASN A 1 10  ? 31.547 2.472   7.501  1.00 36.91 ? 25  ASN E CB  1 
ATOM   63   C CG  . ASN A 1 10  ? 31.121 1.585   6.335  1.00 26.68 ? 25  ASN E CG  1 
ATOM   64   O OD1 . ASN A 1 10  ? 30.001 1.073   6.311  1.00 27.68 ? 25  ASN E OD1 1 
ATOM   65   N ND2 . ASN A 1 10  ? 32.024 1.461   5.398  1.00 25.24 ? 25  ASN E ND2 1 
ATOM   66   N N   . THR A 1 11  ? 30.849 5.854   8.696  1.00 21.16 ? 26  THR E N   1 
ATOM   67   C CA  . THR A 1 11  ? 31.251 6.810   9.780  1.00 8.77  ? 26  THR E CA  1 
ATOM   68   C C   . THR A 1 11  ? 30.117 6.890   10.816 1.00 25.67 ? 26  THR E C   1 
ATOM   69   O O   . THR A 1 11  ? 30.191 7.583   11.822 1.00 12.87 ? 26  THR E O   1 
ATOM   70   C CB  . THR A 1 11  ? 31.483 8.199   9.110  1.00 35.31 ? 26  THR E CB  1 
ATOM   71   O OG1 . THR A 1 11  ? 30.222 8.682   8.583  1.00 19.19 ? 26  THR E OG1 1 
ATOM   72   C CG2 . THR A 1 11  ? 32.549 8.188   7.936  1.00 10.32 ? 26  THR E CG2 1 
ATOM   73   N N   . VAL A 1 12  ? 29.018 6.198   10.581 1.00 18.65 ? 27  VAL E N   1 
ATOM   74   C CA  . VAL A 1 12  ? 27.911 6.167   11.616 1.00 5.48  ? 27  VAL E CA  1 
ATOM   75   C C   . VAL A 1 12  ? 27.547 4.692   11.819 1.00 3.00  ? 27  VAL E C   1 
ATOM   76   O O   . VAL A 1 12  ? 26.630 4.178   11.175 1.00 8.44  ? 27  VAL E O   1 
ATOM   77   C CB  . VAL A 1 12  ? 26.636 6.960   11.122 1.00 3.00  ? 27  VAL E CB  1 
ATOM   78   C CG1 . VAL A 1 12  ? 25.454 6.837   12.090 1.00 3.00  ? 27  VAL E CG1 1 
ATOM   79   C CG2 . VAL A 1 12  ? 26.942 8.420   10.865 1.00 3.00  ? 27  VAL E CG2 1 
ATOM   80   N N   . PRO A 1 13  ? 28.465 3.999   12.469 1.00 5.09  ? 28  PRO E N   1 
ATOM   81   C CA  . PRO A 1 13  ? 28.506 2.523   12.451 1.00 3.00  ? 28  PRO E CA  1 
ATOM   82   C C   . PRO A 1 13  ? 27.344 1.816   13.182 1.00 5.17  ? 28  PRO E C   1 
ATOM   83   O O   . PRO A 1 13  ? 27.210 0.597   13.101 1.00 3.17  ? 28  PRO E O   1 
ATOM   84   C CB  . PRO A 1 13  ? 29.910 2.230   13.101 1.00 8.33  ? 28  PRO E CB  1 
ATOM   85   C CG  . PRO A 1 13  ? 30.170 3.418   14.025 1.00 3.00  ? 28  PRO E CG  1 
ATOM   86   C CD  . PRO A 1 13  ? 29.558 4.636   13.309 1.00 3.00  ? 28  PRO E CD  1 
ATOM   87   N N   . TYR A 1 14  ? 26.508 2.541   13.928 1.00 3.35  ? 29  TYR E N   1 
ATOM   88   C CA  . TYR A 1 14  ? 25.401 2.034   14.692 1.00 3.00  ? 29  TYR E CA  1 
ATOM   89   C C   . TYR A 1 14  ? 24.138 2.270   13.879 1.00 10.89 ? 29  TYR E C   1 
ATOM   90   O O   . TYR A 1 14  ? 23.108 1.790   14.300 1.00 6.82  ? 29  TYR E O   1 
ATOM   91   C CB  . TYR A 1 14  ? 25.264 2.835   15.992 1.00 3.00  ? 29  TYR E CB  1 
ATOM   92   C CG  . TYR A 1 14  ? 25.283 4.386   15.885 1.00 3.00  ? 29  TYR E CG  1 
ATOM   93   C CD1 . TYR A 1 14  ? 24.150 5.109   15.619 1.00 3.00  ? 29  TYR E CD1 1 
ATOM   94   C CD2 . TYR A 1 14  ? 26.469 5.049   16.043 1.00 3.00  ? 29  TYR E CD2 1 
ATOM   95   C CE1 . TYR A 1 14  ? 24.259 6.463   15.463 1.00 3.00  ? 29  TYR E CE1 1 
ATOM   96   C CE2 . TYR A 1 14  ? 26.571 6.421   15.900 1.00 3.00  ? 29  TYR E CE2 1 
ATOM   97   C CZ  . TYR A 1 14  ? 25.479 7.133   15.570 1.00 10.75 ? 29  TYR E CZ  1 
ATOM   98   O OH  . TYR A 1 14  ? 25.610 8.527   15.275 1.00 3.27  ? 29  TYR E OH  1 
ATOM   99   N N   . GLN A 1 15  ? 24.235 2.942   12.765 1.00 3.00  ? 30  GLN E N   1 
ATOM   100  C CA  . GLN A 1 15  ? 23.071 3.104   11.877 1.00 8.38  ? 30  GLN E CA  1 
ATOM   101  C C   . GLN A 1 15  ? 22.748 1.807   11.135 1.00 3.00  ? 30  GLN E C   1 
ATOM   102  O O   . GLN A 1 15  ? 23.614 1.252   10.518 1.00 5.02  ? 30  GLN E O   1 
ATOM   103  C CB  . GLN A 1 15  ? 23.390 4.228   10.871 1.00 6.84  ? 30  GLN E CB  1 
ATOM   104  C CG  . GLN A 1 15  ? 22.326 4.449   9.751  1.00 3.00  ? 30  GLN E CG  1 
ATOM   105  C CD  . GLN A 1 15  ? 21.146 5.313   10.223 1.00 3.00  ? 30  GLN E CD  1 
ATOM   106  O OE1 . GLN A 1 15  ? 19.990 4.907   10.065 1.00 10.76 ? 30  GLN E OE1 1 
ATOM   107  N NE2 . GLN A 1 15  ? 21.405 6.447   10.716 1.00 3.00  ? 30  GLN E NE2 1 
ATOM   108  N N   . VAL A 1 16  ? 21.538 1.330   11.153 1.00 3.00  ? 31  VAL E N   1 
ATOM   109  C CA  . VAL A 1 16  ? 21.061 0.214   10.386 1.00 8.40  ? 31  VAL E CA  1 
ATOM   110  C C   . VAL A 1 16  ? 19.852 0.616   9.506  1.00 4.83  ? 31  VAL E C   1 
ATOM   111  O O   . VAL A 1 16  ? 19.219 1.667   9.694  1.00 3.00  ? 31  VAL E O   1 
ATOM   112  C CB  . VAL A 1 16  ? 20.692 -1.016  11.288 1.00 4.45  ? 31  VAL E CB  1 
ATOM   113  C CG1 . VAL A 1 16  ? 21.695 -1.392  12.345 1.00 3.00  ? 31  VAL E CG1 1 
ATOM   114  C CG2 . VAL A 1 16  ? 19.337 -0.924  11.944 1.00 3.00  ? 31  VAL E CG2 1 
ATOM   115  N N   . SER A 1 17  ? 19.576 -0.217  8.533  1.00 8.67  ? 32  SER E N   1 
ATOM   116  C CA  . SER A 1 17  ? 18.399 -0.029  7.661  1.00 3.00  ? 32  SER E CA  1 
ATOM   117  C C   . SER A 1 17  ? 17.428 -1.206  7.873  1.00 6.06  ? 32  SER E C   1 
ATOM   118  O O   . SER A 1 17  ? 17.863 -2.362  8.041  1.00 3.00  ? 32  SER E O   1 
ATOM   119  C CB  . SER A 1 17  ? 19.005 -0.053  6.252  1.00 3.00  ? 32  SER E CB  1 
ATOM   120  O OG  . SER A 1 17  ? 17.924 -0.079  5.373  1.00 15.07 ? 32  SER E OG  1 
ATOM   121  N N   . LEU A 1 18  ? 16.152 -0.907  8.094  1.00 3.00  ? 33  LEU E N   1 
ATOM   122  C CA  . LEU A 1 18  ? 15.052 -1.947  8.134  1.00 20.08 ? 33  LEU E CA  1 
ATOM   123  C C   . LEU A 1 18  ? 14.385 -2.155  6.767  1.00 5.72  ? 33  LEU E C   1 
ATOM   124  O O   . LEU A 1 18  ? 14.215 -1.159  6.051  1.00 5.96  ? 33  LEU E O   1 
ATOM   125  C CB  . LEU A 1 18  ? 13.875 -1.620  9.075  1.00 4.28  ? 33  LEU E CB  1 
ATOM   126  C CG  . LEU A 1 18  ? 14.362 -1.249  10.502 1.00 12.26 ? 33  LEU E CG  1 
ATOM   127  C CD1 . LEU A 1 18  ? 13.221 -1.013  11.463 1.00 10.05 ? 33  LEU E CD1 1 
ATOM   128  C CD2 . LEU A 1 18  ? 15.407 -2.188  11.098 1.00 14.29 ? 33  LEU E CD2 1 
ATOM   129  N N   . ASN A 1 19  ? 14.432 -3.435  6.290  1.00 5.39  ? 34  ASN E N   1 
ATOM   130  C CA  . ASN A 1 19  ? 14.181 -3.641  4.865  1.00 6.57  ? 34  ASN E CA  1 
ATOM   131  C C   . ASN A 1 19  ? 13.078 -4.676  4.767  1.00 3.11  ? 34  ASN E C   1 
ATOM   132  O O   . ASN A 1 19  ? 13.155 -5.669  5.460  1.00 15.76 ? 34  ASN E O   1 
ATOM   133  C CB  . ASN A 1 19  ? 15.498 -4.100  4.123  1.00 3.98  ? 34  ASN E CB  1 
ATOM   134  C CG  . ASN A 1 19  ? 15.278 -4.454  2.627  1.00 42.67 ? 34  ASN E CG  1 
ATOM   135  O OD1 . ASN A 1 19  ? 14.709 -5.497  2.294  1.00 26.76 ? 34  ASN E OD1 1 
ATOM   136  N ND2 . ASN A 1 19  ? 15.749 -3.596  1.697  1.00 22.31 ? 34  ASN E ND2 1 
ATOM   137  N N   . SER A 1 20  ? 12.035 -4.410  4.000  1.00 12.48 ? 37  SER E N   1 
ATOM   138  C CA  . SER A 1 20  ? 11.006 -5.466  3.715  1.00 8.90  ? 37  SER E CA  1 
ATOM   139  C C   . SER A 1 20  ? 10.812 -5.556  2.190  1.00 28.18 ? 37  SER E C   1 
ATOM   140  O O   . SER A 1 20  ? 9.869  -5.010  1.639  1.00 20.93 ? 37  SER E O   1 
ATOM   141  C CB  . SER A 1 20  ? 9.650  -5.075  4.283  1.00 6.06  ? 37  SER E CB  1 
ATOM   142  O OG  . SER A 1 20  ? 9.386  -3.722  3.824  1.00 27.88 ? 37  SER E OG  1 
ATOM   143  N N   . GLY A 1 21  ? 11.839 -5.787  1.441  1.00 24.67 ? 38  GLY E N   1 
ATOM   144  C CA  . GLY A 1 21  ? 11.609 -5.552  0.006  1.00 24.50 ? 38  GLY E CA  1 
ATOM   145  C C   . GLY A 1 21  ? 12.398 -4.332  -0.389 1.00 22.68 ? 38  GLY E C   1 
ATOM   146  O O   . GLY A 1 21  ? 13.217 -4.387  -1.282 1.00 33.32 ? 38  GLY E O   1 
ATOM   147  N N   . TYR A 1 22  ? 12.270 -3.333  0.396  1.00 15.67 ? 39  TYR E N   1 
ATOM   148  C CA  . TYR A 1 22  ? 13.038 -2.138  0.130  1.00 9.33  ? 39  TYR E CA  1 
ATOM   149  C C   . TYR A 1 22  ? 13.373 -1.435  1.467  1.00 17.74 ? 39  TYR E C   1 
ATOM   150  O O   . TYR A 1 22  ? 12.813 -1.792  2.504  1.00 7.63  ? 39  TYR E O   1 
ATOM   151  C CB  . TYR A 1 22  ? 12.047 -1.343  -0.744 1.00 12.81 ? 39  TYR E CB  1 
ATOM   152  C CG  . TYR A 1 22  ? 10.659 -1.047  -0.098 1.00 13.07 ? 39  TYR E CG  1 
ATOM   153  C CD1 . TYR A 1 22  ? 9.598  -1.928  -0.184 1.00 25.12 ? 39  TYR E CD1 1 
ATOM   154  C CD2 . TYR A 1 22  ? 10.434 0.197   0.431  1.00 20.45 ? 39  TYR E CD2 1 
ATOM   155  C CE1 . TYR A 1 22  ? 8.300  -1.547  0.219  1.00 36.31 ? 39  TYR E CE1 1 
ATOM   156  C CE2 . TYR A 1 22  ? 9.133  0.598   0.801  1.00 47.34 ? 39  TYR E CE2 1 
ATOM   157  C CZ  . TYR A 1 22  ? 8.046  -0.262  0.664  1.00 52.52 ? 39  TYR E CZ  1 
ATOM   158  O OH  . TYR A 1 22  ? 6.712  0.187   0.952  1.00 35.20 ? 39  TYR E OH  1 
ATOM   159  N N   . HIS A 1 23  ? 14.203 -0.410  1.452  1.00 3.40  ? 40  HIS E N   1 
ATOM   160  C CA  . HIS A 1 23  ? 14.469 0.341   2.713  1.00 4.16  ? 40  HIS E CA  1 
ATOM   161  C C   . HIS A 1 23  ? 13.248 1.135   3.185  1.00 9.22  ? 40  HIS E C   1 
ATOM   162  O O   . HIS A 1 23  ? 12.706 1.899   2.414  1.00 5.01  ? 40  HIS E O   1 
ATOM   163  C CB  . HIS A 1 23  ? 15.647 1.323   2.501  1.00 3.00  ? 40  HIS E CB  1 
ATOM   164  C CG  . HIS A 1 23  ? 15.717 2.358   3.629  1.00 19.89 ? 40  HIS E CG  1 
ATOM   165  N ND1 . HIS A 1 23  ? 16.416 2.074   4.846  1.00 9.27  ? 40  HIS E ND1 1 
ATOM   166  C CD2 . HIS A 1 23  ? 15.154 3.590   3.687  1.00 7.54  ? 40  HIS E CD2 1 
ATOM   167  C CE1 . HIS A 1 23  ? 16.257 3.213   5.667  1.00 13.71 ? 40  HIS E CE1 1 
ATOM   168  N NE2 . HIS A 1 23  ? 15.476 4.172   4.939  1.00 17.66 ? 40  HIS E NE2 1 
ATOM   169  N N   . PHE A 1 24  ? 12.794 1.008   4.429  1.00 7.60  ? 41  PHE E N   1 
ATOM   170  C CA  . PHE A 1 24  ? 11.627 1.858   4.776  1.00 3.00  ? 41  PHE E CA  1 
ATOM   171  C C   . PHE A 1 24  ? 11.765 2.616   6.105  1.00 3.73  ? 41  PHE E C   1 
ATOM   172  O O   . PHE A 1 24  ? 11.087 3.630   6.276  1.00 5.06  ? 41  PHE E O   1 
ATOM   173  C CB  . PHE A 1 24  ? 10.346 0.985   4.786  1.00 5.48  ? 41  PHE E CB  1 
ATOM   174  C CG  . PHE A 1 24  ? 10.318 -0.079  5.923  1.00 11.70 ? 41  PHE E CG  1 
ATOM   175  C CD1 . PHE A 1 24  ? 10.857 -1.324  5.695  1.00 4.62  ? 41  PHE E CD1 1 
ATOM   176  C CD2 . PHE A 1 24  ? 9.747  0.197   7.160  1.00 3.21  ? 41  PHE E CD2 1 
ATOM   177  C CE1 . PHE A 1 24  ? 10.862 -2.296  6.681  1.00 7.39  ? 41  PHE E CE1 1 
ATOM   178  C CE2 . PHE A 1 24  ? 9.738  -0.767  8.157  1.00 3.00  ? 41  PHE E CE2 1 
ATOM   179  C CZ  . PHE A 1 24  ? 10.305 -2.015  7.927  1.00 4.74  ? 41  PHE E CZ  1 
ATOM   180  N N   . CYS A 1 25  ? 12.656 2.161   7.011  1.00 3.00  ? 42  CYS E N   1 
ATOM   181  C CA  . CYS A 1 25  ? 12.958 2.918   8.216  1.00 3.00  ? 42  CYS E CA  1 
ATOM   182  C C   . CYS A 1 25  ? 14.433 2.762   8.504  1.00 3.00  ? 42  CYS E C   1 
ATOM   183  O O   . CYS A 1 25  ? 14.988 1.746   8.056  1.00 3.00  ? 42  CYS E O   1 
ATOM   184  C CB  . CYS A 1 25  ? 12.169 2.367   9.381  1.00 3.00  ? 42  CYS E CB  1 
ATOM   185  S SG  . CYS A 1 25  ? 10.431 2.975   9.519  1.00 3.83  ? 42  CYS E SG  1 
ATOM   186  N N   . GLY A 1 26  ? 14.953 3.662   9.400  1.00 3.00  ? 43  GLY E N   1 
ATOM   187  C CA  . GLY A 1 26  ? 16.226 3.301   10.073 1.00 3.21  ? 43  GLY E CA  1 
ATOM   188  C C   . GLY A 1 26  ? 16.096 2.545   11.411 1.00 3.00  ? 43  GLY E C   1 
ATOM   189  O O   . GLY A 1 26  ? 14.998 2.219   11.870 1.00 3.00  ? 43  GLY E O   1 
ATOM   190  N N   . GLY A 1 27  ? 17.204 2.486   12.150 1.00 3.00  ? 44  GLY E N   1 
ATOM   191  C CA  . GLY A 1 27  ? 17.262 2.028   13.542 1.00 3.00  ? 44  GLY E CA  1 
ATOM   192  C C   . GLY A 1 27  ? 18.690 2.145   14.044 1.00 3.00  ? 44  GLY E C   1 
ATOM   193  O O   . GLY A 1 27  ? 19.543 2.631   13.311 1.00 5.06  ? 44  GLY E O   1 
ATOM   194  N N   . SER A 1 28  ? 18.915 1.850   15.279 1.00 3.00  ? 45  SER E N   1 
ATOM   195  C CA  . SER A 1 28  ? 20.271 1.972   15.920 1.00 6.15  ? 45  SER E CA  1 
ATOM   196  C C   . SER A 1 28  ? 20.658 0.698   16.641 1.00 3.25  ? 45  SER E C   1 
ATOM   197  O O   . SER A 1 28  ? 19.763 0.128   17.253 1.00 3.36  ? 45  SER E O   1 
ATOM   198  C CB  . SER A 1 28  ? 20.278 2.994   17.027 1.00 3.00  ? 45  SER E CB  1 
ATOM   199  O OG  . SER A 1 28  ? 19.786 4.241   16.529 1.00 13.76 ? 45  SER E OG  1 
ATOM   200  N N   . LEU A 1 29  ? 21.858 0.192   16.368 1.00 3.90  ? 46  LEU E N   1 
ATOM   201  C CA  . LEU A 1 29  ? 22.316 -1.067  16.939 1.00 3.00  ? 46  LEU E CA  1 
ATOM   202  C C   . LEU A 1 29  ? 22.802 -0.747  18.360 1.00 16.04 ? 46  LEU E C   1 
ATOM   203  O O   . LEU A 1 29  ? 23.511 0.238   18.576 1.00 4.53  ? 46  LEU E O   1 
ATOM   204  C CB  . LEU A 1 29  ? 23.454 -1.556  16.070 1.00 3.00  ? 46  LEU E CB  1 
ATOM   205  C CG  . LEU A 1 29  ? 24.053 -2.925  16.499 1.00 4.65  ? 46  LEU E CG  1 
ATOM   206  C CD1 . LEU A 1 29  ? 23.138 -4.142  16.213 1.00 6.73  ? 46  LEU E CD1 1 
ATOM   207  C CD2 . LEU A 1 29  ? 25.391 -3.200  15.771 1.00 10.72 ? 46  LEU E CD2 1 
ATOM   208  N N   . ILE A 1 30  ? 22.186 -1.355  19.343 1.00 8.87  ? 47  ILE E N   1 
ATOM   209  C CA  . ILE A 1 30  ? 22.548 -0.964  20.735 1.00 16.19 ? 47  ILE E CA  1 
ATOM   210  C C   . ILE A 1 30  ? 23.220 -2.120  21.508 1.00 10.81 ? 47  ILE E C   1 
ATOM   211  O O   . ILE A 1 30  ? 23.957 -1.916  22.465 1.00 20.87 ? 47  ILE E O   1 
ATOM   212  C CB  . ILE A 1 30  ? 21.291 -0.501  21.486 1.00 14.73 ? 47  ILE E CB  1 
ATOM   213  C CG1 . ILE A 1 30  ? 20.349 -1.675  21.633 1.00 14.34 ? 47  ILE E CG1 1 
ATOM   214  C CG2 . ILE A 1 30  ? 20.600 0.827   21.034 1.00 3.17  ? 47  ILE E CG2 1 
ATOM   215  C CD1 . ILE A 1 30  ? 19.218 -1.363  22.642 1.00 32.68 ? 47  ILE E CD1 1 
ATOM   216  N N   . ASN A 1 31  ? 23.319 -3.228  20.868 1.00 10.74 ? 48  ASN E N   1 
ATOM   217  C CA  . ASN A 1 31  ? 24.307 -4.256  21.076 1.00 9.60  ? 48  ASN E CA  1 
ATOM   218  C C   . ASN A 1 31  ? 24.256 -5.268  19.930 1.00 35.10 ? 48  ASN E C   1 
ATOM   219  O O   . ASN A 1 31  ? 23.661 -4.944  18.901 1.00 16.56 ? 48  ASN E O   1 
ATOM   220  C CB  . ASN A 1 31  ? 24.225 -4.929  22.451 1.00 23.72 ? 48  ASN E CB  1 
ATOM   221  C CG  . ASN A 1 31  ? 22.890 -5.610  22.670 1.00 5.84  ? 48  ASN E CG  1 
ATOM   222  O OD1 . ASN A 1 31  ? 22.332 -5.485  23.743 1.00 33.34 ? 48  ASN E OD1 1 
ATOM   223  N ND2 . ASN A 1 31  ? 22.430 -6.346  21.725 1.00 7.38  ? 48  ASN E ND2 1 
ATOM   224  N N   . SER A 1 32  ? 24.985 -6.384  20.033 1.00 13.54 ? 49  SER E N   1 
ATOM   225  C CA  . SER A 1 32  ? 25.207 -7.212  18.826 1.00 14.84 ? 49  SER E CA  1 
ATOM   226  C C   . SER A 1 32  ? 23.955 -7.966  18.424 1.00 8.84  ? 49  SER E C   1 
ATOM   227  O O   . SER A 1 32  ? 23.938 -8.561  17.342 1.00 12.82 ? 49  SER E O   1 
ATOM   228  C CB  . SER A 1 32  ? 26.334 -8.270  18.996 1.00 26.98 ? 49  SER E CB  1 
ATOM   229  O OG  . SER A 1 32  ? 26.030 -9.116  20.101 1.00 19.90 ? 49  SER E OG  1 
ATOM   230  N N   . GLN A 1 33  ? 23.005 -8.006  19.338 1.00 11.81 ? 50  GLN E N   1 
ATOM   231  C CA  . GLN A 1 33  ? 21.726 -8.704  19.112 1.00 23.11 ? 50  GLN E CA  1 
ATOM   232  C C   . GLN A 1 33  ? 20.457 -7.824  19.007 1.00 13.10 ? 50  GLN E C   1 
ATOM   233  O O   . GLN A 1 33  ? 19.368 -8.352  18.794 1.00 15.64 ? 50  GLN E O   1 
ATOM   234  C CB  . GLN A 1 33  ? 21.585 -9.951  20.038 1.00 16.08 ? 50  GLN E CB  1 
ATOM   235  C CG  . GLN A 1 33  ? 21.915 -11.105 19.088 1.00 47.72 ? 50  GLN E CG  1 
ATOM   236  C CD  . GLN A 1 33  ? 21.389 -12.412 19.646 1.00 62.58 ? 50  GLN E CD  1 
ATOM   237  O OE1 . GLN A 1 33  ? 20.647 -13.139 18.939 1.00 31.43 ? 50  GLN E OE1 1 
ATOM   238  N NE2 . GLN A 1 33  ? 21.833 -12.552 20.906 1.00 33.83 ? 50  GLN E NE2 1 
ATOM   239  N N   . TRP A 1 34  ? 20.512 -6.535  19.420 1.00 5.11  ? 51  TRP E N   1 
ATOM   240  C CA  . TRP A 1 34  ? 19.299 -5.668  19.482 1.00 7.07  ? 51  TRP E CA  1 
ATOM   241  C C   . TRP A 1 34  ? 19.480 -4.316  18.818 1.00 3.00  ? 51  TRP E C   1 
ATOM   242  O O   . TRP A 1 34  ? 20.524 -3.666  18.927 1.00 9.99  ? 51  TRP E O   1 
ATOM   243  C CB  . TRP A 1 34  ? 18.941 -5.320  20.918 1.00 3.00  ? 51  TRP E CB  1 
ATOM   244  C CG  . TRP A 1 34  ? 18.562 -6.620  21.596 1.00 7.87  ? 51  TRP E CG  1 
ATOM   245  C CD1 . TRP A 1 34  ? 19.382 -7.607  22.143 1.00 14.24 ? 51  TRP E CD1 1 
ATOM   246  C CD2 . TRP A 1 34  ? 17.238 -7.028  21.836 1.00 5.90  ? 51  TRP E CD2 1 
ATOM   247  N NE1 . TRP A 1 34  ? 18.550 -8.599  22.691 1.00 20.07 ? 51  TRP E NE1 1 
ATOM   248  C CE2 . TRP A 1 34  ? 17.306 -8.240  22.572 1.00 13.33 ? 51  TRP E CE2 1 
ATOM   249  C CE3 . TRP A 1 34  ? 16.032 -6.423  21.509 1.00 15.81 ? 51  TRP E CE3 1 
ATOM   250  C CZ2 . TRP A 1 34  ? 16.173 -8.864  23.095 1.00 5.48  ? 51  TRP E CZ2 1 
ATOM   251  C CZ3 . TRP A 1 34  ? 14.885 -7.064  21.997 1.00 27.73 ? 51  TRP E CZ3 1 
ATOM   252  C CH2 . TRP A 1 34  ? 14.956 -8.237  22.786 1.00 14.48 ? 51  TRP E CH2 1 
ATOM   253  N N   . VAL A 1 35  ? 18.438 -3.958  18.174 1.00 5.56  ? 52  VAL E N   1 
ATOM   254  C CA  . VAL A 1 35  ? 18.355 -2.642  17.486 1.00 5.33  ? 52  VAL E CA  1 
ATOM   255  C C   . VAL A 1 35  ? 17.175 -1.873  18.093 1.00 7.30  ? 52  VAL E C   1 
ATOM   256  O O   . VAL A 1 35  ? 16.146 -2.514  18.279 1.00 13.93 ? 52  VAL E O   1 
ATOM   257  C CB  . VAL A 1 35  ? 18.020 -3.057  16.014 1.00 10.80 ? 52  VAL E CB  1 
ATOM   258  C CG1 . VAL A 1 35  ? 17.396 -1.896  15.183 1.00 4.63  ? 52  VAL E CG1 1 
ATOM   259  C CG2 . VAL A 1 35  ? 19.277 -3.654  15.326 1.00 3.00  ? 52  VAL E CG2 1 
ATOM   260  N N   . VAL A 1 36  ? 17.235 -0.551  18.209 1.00 3.00  ? 53  VAL E N   1 
ATOM   261  C CA  . VAL A 1 36  ? 16.056 0.233   18.544 1.00 3.00  ? 53  VAL E CA  1 
ATOM   262  C C   . VAL A 1 36  ? 15.525 1.022   17.341 1.00 3.00  ? 53  VAL E C   1 
ATOM   263  O O   . VAL A 1 36  ? 16.330 1.531   16.558 1.00 6.41  ? 53  VAL E O   1 
ATOM   264  C CB  . VAL A 1 36  ? 16.300 1.160   19.788 1.00 11.15 ? 53  VAL E CB  1 
ATOM   265  C CG1 . VAL A 1 36  ? 17.330 2.235   19.514 1.00 17.19 ? 53  VAL E CG1 1 
ATOM   266  C CG2 . VAL A 1 36  ? 15.026 1.820   20.339 1.00 16.76 ? 53  VAL E CG2 1 
ATOM   267  N N   . SER A 1 37  ? 14.200 1.123   17.249 1.00 5.03  ? 54  SER E N   1 
ATOM   268  C CA  . SER A 1 37  ? 13.486 1.816   16.134 1.00 6.25  ? 54  SER E CA  1 
ATOM   269  C C   . SER A 1 37  ? 12.156 2.361   16.636 1.00 4.75  ? 54  SER E C   1 
ATOM   270  O O   . SER A 1 37  ? 11.910 2.386   17.852 1.00 11.24 ? 54  SER E O   1 
ATOM   271  C CB  . SER A 1 37  ? 13.408 0.937   14.832 1.00 3.00  ? 54  SER E CB  1 
ATOM   272  O OG  . SER A 1 37  ? 12.994 1.675   13.621 1.00 3.00  ? 54  SER E OG  1 
ATOM   273  N N   . ALA A 1 38  ? 11.429 2.964   15.728 1.00 8.51  ? 55  ALA E N   1 
ATOM   274  C CA  . ALA A 1 38  ? 10.124 3.554   15.942 1.00 3.00  ? 55  ALA E CA  1 
ATOM   275  C C   . ALA A 1 38  ? 9.086  2.429   15.900 1.00 12.10 ? 55  ALA E C   1 
ATOM   276  O O   . ALA A 1 38  ? 9.120  1.605   14.982 1.00 5.35  ? 55  ALA E O   1 
ATOM   277  C CB  . ALA A 1 38  ? 9.819  4.642   14.917 1.00 3.00  ? 55  ALA E CB  1 
ATOM   278  N N   . ALA A 1 39  ? 8.133  2.432   16.854 1.00 12.70 ? 56  ALA E N   1 
ATOM   279  C CA  . ALA A 1 39  ? 7.037  1.445   16.794 1.00 8.36  ? 56  ALA E CA  1 
ATOM   280  C C   . ALA A 1 39  ? 6.182  1.539   15.509 1.00 3.00  ? 56  ALA E C   1 
ATOM   281  O O   . ALA A 1 39  ? 5.795  0.474   15.085 1.00 3.58  ? 56  ALA E O   1 
ATOM   282  C CB  . ALA A 1 39  ? 6.141  1.584   18.060 1.00 3.34  ? 56  ALA E CB  1 
ATOM   283  N N   . HIS A 1 40  ? 5.914  2.696   14.928 1.00 3.00  ? 57  HIS E N   1 
ATOM   284  C CA  . HIS A 1 40  ? 5.258  2.734   13.660 1.00 3.00  ? 57  HIS E CA  1 
ATOM   285  C C   . HIS A 1 40  ? 6.099  2.109   12.530 1.00 6.44  ? 57  HIS E C   1 
ATOM   286  O O   . HIS A 1 40  ? 5.510  1.877   11.462 1.00 7.93  ? 57  HIS E O   1 
ATOM   287  C CB  . HIS A 1 40  ? 4.880  4.130   13.351 1.00 3.00  ? 57  HIS E CB  1 
ATOM   288  C CG  . HIS A 1 40  ? 6.041  5.000   12.842 1.00 6.82  ? 57  HIS E CG  1 
ATOM   289  N ND1 . HIS A 1 40  ? 6.523  6.014   13.593 1.00 3.45  ? 57  HIS E ND1 1 
ATOM   290  C CD2 . HIS A 1 40  ? 6.641  5.057   11.633 1.00 15.72 ? 57  HIS E CD2 1 
ATOM   291  C CE1 . HIS A 1 40  ? 7.496  6.678   12.840 1.00 19.29 ? 57  HIS E CE1 1 
ATOM   292  N NE2 . HIS A 1 40  ? 7.586  6.088   11.603 1.00 10.13 ? 57  HIS E NE2 1 
ATOM   293  N N   . CYS A 1 41  ? 7.380  1.661   12.815 1.00 6.01  ? 58  CYS E N   1 
ATOM   294  C CA  . CYS A 1 41  ? 8.092  0.919   11.765 1.00 3.48  ? 58  CYS E CA  1 
ATOM   295  C C   . CYS A 1 41  ? 7.778  -0.566  11.730 1.00 3.80  ? 58  CYS E C   1 
ATOM   296  O O   . CYS A 1 41  ? 8.476  -1.308  11.032 1.00 3.00  ? 58  CYS E O   1 
ATOM   297  C CB  . CYS A 1 41  ? 9.606  1.146   11.812 1.00 3.00  ? 58  CYS E CB  1 
ATOM   298  S SG  . CYS A 1 41  ? 10.076 2.826   11.469 1.00 4.62  ? 58  CYS E SG  1 
ATOM   299  N N   . TYR A 1 42  ? 7.068  -1.016  12.769 1.00 3.96  ? 59  TYR E N   1 
ATOM   300  C CA  . TYR A 1 42  ? 6.766  -2.462  12.857 1.00 10.65 ? 59  TYR E CA  1 
ATOM   301  C C   . TYR A 1 42  ? 6.186  -2.983  11.530 1.00 22.06 ? 59  TYR E C   1 
ATOM   302  O O   . TYR A 1 42  ? 5.220  -2.457  10.957 1.00 6.56  ? 59  TYR E O   1 
ATOM   303  C CB  . TYR A 1 42  ? 5.750  -2.726  14.019 1.00 15.93 ? 59  TYR E CB  1 
ATOM   304  C CG  . TYR A 1 42  ? 5.318  -4.210  13.999 1.00 4.07  ? 59  TYR E CG  1 
ATOM   305  C CD1 . TYR A 1 42  ? 6.128  -5.182  14.525 1.00 14.23 ? 59  TYR E CD1 1 
ATOM   306  C CD2 . TYR A 1 42  ? 4.205  -4.564  13.272 1.00 18.15 ? 59  TYR E CD2 1 
ATOM   307  C CE1 . TYR A 1 42  ? 5.810  -6.504  14.324 1.00 23.07 ? 59  TYR E CE1 1 
ATOM   308  C CE2 . TYR A 1 42  ? 3.896  -5.876  13.040 1.00 12.29 ? 59  TYR E CE2 1 
ATOM   309  C CZ  . TYR A 1 42  ? 4.694  -6.845  13.577 1.00 23.30 ? 59  TYR E CZ  1 
ATOM   310  O OH  . TYR A 1 42  ? 4.427  -8.133  13.284 1.00 31.71 ? 59  TYR E OH  1 
ATOM   311  N N   . LYS A 1 43  ? 6.727  -4.110  11.144 1.00 11.91 ? 60  LYS E N   1 
ATOM   312  C CA  . LYS A 1 43  ? 6.235  -4.918  10.004 1.00 21.05 ? 60  LYS E CA  1 
ATOM   313  C C   . LYS A 1 43  ? 6.596  -6.364  10.331 1.00 16.43 ? 60  LYS E C   1 
ATOM   314  O O   . LYS A 1 43  ? 7.595  -6.681  10.951 1.00 14.90 ? 60  LYS E O   1 
ATOM   315  C CB  . LYS A 1 43  ? 6.902  -4.640  8.622  1.00 3.72  ? 60  LYS E CB  1 
ATOM   316  C CG  . LYS A 1 43  ? 6.574  -3.320  7.926  1.00 9.02  ? 60  LYS E CG  1 
ATOM   317  C CD  . LYS A 1 43  ? 7.062  -3.392  6.455  1.00 27.26 ? 60  LYS E CD  1 
ATOM   318  C CE  . LYS A 1 43  ? 7.257  -1.984  5.822  1.00 16.23 ? 60  LYS E CE  1 
ATOM   319  N NZ  . LYS A 1 43  ? 6.017  -1.245  5.811  1.00 26.44 ? 60  LYS E NZ  1 
ATOM   320  N N   . SER A 1 44  ? 5.869  -7.286  9.836  1.00 20.24 ? 61  SER E N   1 
ATOM   321  C CA  . SER A 1 44  ? 6.387  -8.617  10.084 1.00 15.52 ? 61  SER E CA  1 
ATOM   322  C C   . SER A 1 44  ? 7.419  -8.877  8.972  1.00 20.08 ? 61  SER E C   1 
ATOM   323  O O   . SER A 1 44  ? 7.349  -8.263  7.917  1.00 36.45 ? 61  SER E O   1 
ATOM   324  C CB  . SER A 1 44  ? 5.113  -9.473  9.929  1.00 35.56 ? 61  SER E CB  1 
ATOM   325  O OG  . SER A 1 44  ? 5.380  -10.620 9.164  1.00 43.38 ? 61  SER E OG  1 
ATOM   326  N N   . GLY A 1 45  ? 8.358  -9.747  9.171  1.00 17.00 ? 62  GLY E N   1 
ATOM   327  C CA  . GLY A 1 45  ? 9.332  -10.077 8.154  1.00 21.68 ? 62  GLY E CA  1 
ATOM   328  C C   . GLY A 1 45  ? 10.371 -8.976  7.868  1.00 36.12 ? 62  GLY E C   1 
ATOM   329  O O   . GLY A 1 45  ? 10.959 -9.052  6.796  1.00 34.43 ? 62  GLY E O   1 
ATOM   330  N N   . ILE A 1 46  ? 10.748 -8.163  8.854  1.00 15.49 ? 63  ILE E N   1 
ATOM   331  C CA  . ILE A 1 46  ? 11.948 -7.233  8.752  1.00 6.97  ? 63  ILE E CA  1 
ATOM   332  C C   . ILE A 1 46  ? 13.239 -8.016  8.514  1.00 19.48 ? 63  ILE E C   1 
ATOM   333  O O   . ILE A 1 46  ? 13.631 -8.938  9.250  1.00 8.30  ? 63  ILE E O   1 
ATOM   334  C CB  . ILE A 1 46  ? 12.040 -6.295  10.001 1.00 8.61  ? 63  ILE E CB  1 
ATOM   335  C CG1 . ILE A 1 46  ? 10.806 -5.385  10.050 1.00 19.88 ? 63  ILE E CG1 1 
ATOM   336  C CG2 . ILE A 1 46  ? 13.312 -5.405  9.988  1.00 11.30 ? 63  ILE E CG2 1 
ATOM   337  C CD1 . ILE A 1 46  ? 10.671 -4.566  11.366 1.00 10.82 ? 63  ILE E CD1 1 
ATOM   338  N N   . GLN A 1 47  ? 13.966 -7.523  7.550  1.00 16.10 ? 64  GLN E N   1 
ATOM   339  C CA  . GLN A 1 47  ? 15.421 -7.826  7.506  1.00 8.29  ? 64  GLN E CA  1 
ATOM   340  C C   . GLN A 1 47  ? 16.234 -6.580  7.864  1.00 16.87 ? 64  GLN E C   1 
ATOM   341  O O   . GLN A 1 47  ? 16.005 -5.482  7.357  1.00 12.46 ? 64  GLN E O   1 
ATOM   342  C CB  . GLN A 1 47  ? 15.859 -8.340  6.134  1.00 6.07  ? 64  GLN E CB  1 
ATOM   343  C CG  . GLN A 1 47  ? 17.348 -8.698  5.995  1.00 11.78 ? 64  GLN E CG  1 
ATOM   344  C CD  . GLN A 1 47  ? 17.658 -8.934  4.515  1.00 35.01 ? 64  GLN E CD  1 
ATOM   345  O OE1 . GLN A 1 47  ? 18.121 -10.009 4.126  1.00 35.09 ? 64  GLN E OE1 1 
ATOM   346  N NE2 . GLN A 1 47  ? 17.389 -7.905  3.735  1.00 19.58 ? 64  GLN E NE2 1 
ATOM   347  N N   . VAL A 1 48  ? 17.159 -6.771  8.789  1.00 8.42  ? 65  VAL E N   1 
ATOM   348  C CA  . VAL A 1 48  ? 17.982 -5.704  9.202  1.00 4.23  ? 65  VAL E CA  1 
ATOM   349  C C   . VAL A 1 48  ? 19.336 -5.675  8.484  1.00 3.00  ? 65  VAL E C   1 
ATOM   350  O O   . VAL A 1 48  ? 19.969 -6.713  8.418  1.00 8.12  ? 65  VAL E O   1 
ATOM   351  C CB  . VAL A 1 48  ? 18.211 -5.930  10.672 1.00 3.92  ? 65  VAL E CB  1 
ATOM   352  C CG1 . VAL A 1 48  ? 19.130 -4.758  11.107 1.00 3.00  ? 65  VAL E CG1 1 
ATOM   353  C CG2 . VAL A 1 48  ? 16.845 -5.963  11.381 1.00 12.00 ? 65  VAL E CG2 1 
ATOM   354  N N   . ARG A 1 49  ? 19.731 -4.533  7.927  1.00 8.72  ? 66  ARG E N   1 
ATOM   355  C CA  . ARG A 1 49  ? 21.015 -4.416  7.228  1.00 10.76 ? 66  ARG E CA  1 
ATOM   356  C C   . ARG A 1 49  ? 22.017 -3.515  7.930  1.00 19.38 ? 66  ARG E C   1 
ATOM   357  O O   . ARG A 1 49  ? 21.699 -2.347  8.171  1.00 7.64  ? 66  ARG E O   1 
ATOM   358  C CB  . ARG A 1 49  ? 20.948 -4.085  5.731  1.00 3.00  ? 66  ARG E CB  1 
ATOM   359  C CG  . ARG A 1 49  ? 19.832 -4.901  5.111  1.00 10.25 ? 66  ARG E CG  1 
ATOM   360  C CD  . ARG A 1 49  ? 19.659 -4.547  3.615  1.00 14.73 ? 66  ARG E CD  1 
ATOM   361  N NE  . ARG A 1 49  ? 18.886 -5.640  2.971  1.00 12.07 ? 66  ARG E NE  1 
ATOM   362  C CZ  . ARG A 1 49  ? 18.753 -5.705  1.627  1.00 28.10 ? 66  ARG E CZ  1 
ATOM   363  N NH1 . ARG A 1 49  ? 19.269 -4.816  0.827  1.00 17.16 ? 66  ARG E NH1 1 
ATOM   364  N NH2 . ARG A 1 49  ? 18.055 -6.619  1.050  1.00 22.27 ? 66  ARG E NH2 1 
ATOM   365  N N   . LEU A 1 50  ? 23.212 -4.126  8.222  1.00 8.75  ? 67  LEU E N   1 
ATOM   366  C CA  . LEU A 1 50  ? 24.240 -3.416  8.995  1.00 15.63 ? 67  LEU E CA  1 
ATOM   367  C C   . LEU A 1 50  ? 25.446 -3.168  8.112  1.00 13.01 ? 67  LEU E C   1 
ATOM   368  O O   . LEU A 1 50  ? 25.604 -3.913  7.158  1.00 4.48  ? 67  LEU E O   1 
ATOM   369  C CB  . LEU A 1 50  ? 24.749 -4.120  10.246 1.00 13.54 ? 67  LEU E CB  1 
ATOM   370  C CG  . LEU A 1 50  ? 23.730 -4.392  11.421 1.00 11.17 ? 67  LEU E CG  1 
ATOM   371  C CD1 . LEU A 1 50  ? 22.775 -5.511  10.997 1.00 24.71 ? 67  LEU E CD1 1 
ATOM   372  C CD2 . LEU A 1 50  ? 24.584 -5.159  12.469 1.00 34.44 ? 67  LEU E CD2 1 
ATOM   373  N N   . GLY A 1 51  ? 26.216 -2.159  8.437  1.00 8.10  ? 69  GLY E N   1 
ATOM   374  C CA  . GLY A 1 51  ? 27.455 -1.887  7.665  1.00 4.67  ? 69  GLY E CA  1 
ATOM   375  C C   . GLY A 1 51  ? 27.157 -1.363  6.265  1.00 14.34 ? 69  GLY E C   1 
ATOM   376  O O   . GLY A 1 51  ? 28.046 -1.398  5.420  1.00 23.18 ? 69  GLY E O   1 
ATOM   377  N N   . GLU A 1 52  ? 26.019 -0.749  6.050  1.00 13.89 ? 70  GLU E N   1 
ATOM   378  C CA  . GLU A 1 52  ? 25.636 -0.112  4.724  1.00 18.47 ? 70  GLU E CA  1 
ATOM   379  C C   . GLU A 1 52  ? 26.225 1.304   4.596  1.00 11.13 ? 70  GLU E C   1 
ATOM   380  O O   . GLU A 1 52  ? 26.006 2.135   5.470  1.00 6.44  ? 70  GLU E O   1 
ATOM   381  C CB  . GLU A 1 52  ? 24.118 0.169   4.674  1.00 14.82 ? 70  GLU E CB  1 
ATOM   382  C CG  . GLU A 1 52  ? 23.055 -0.973  4.685  1.00 8.90  ? 70  GLU E CG  1 
ATOM   383  C CD  . GLU A 1 52  ? 23.094 -1.529  3.270  1.00 45.93 ? 70  GLU E CD  1 
ATOM   384  O OE1 . GLU A 1 52  ? 23.940 -1.065  2.451  1.00 44.93 ? 70  GLU E OE1 1 
ATOM   385  O OE2 . GLU A 1 52  ? 22.312 -2.444  2.902  1.00 24.49 ? 70  GLU E OE2 1 
ATOM   386  N N   . ASP A 1 53  ? 26.605 1.669   3.404  1.00 6.98  ? 71  ASP E N   1 
ATOM   387  C CA  . ASP A 1 53  ? 26.550 3.083   3.007  1.00 7.93  ? 71  ASP E CA  1 
ATOM   388  C C   . ASP A 1 53  ? 25.627 3.311   1.783  1.00 8.79  ? 71  ASP E C   1 
ATOM   389  O O   . ASP A 1 53  ? 24.504 3.848   1.802  1.00 10.11 ? 71  ASP E O   1 
ATOM   390  C CB  . ASP A 1 53  ? 28.012 3.507   2.688  1.00 18.21 ? 71  ASP E CB  1 
ATOM   391  C CG  . ASP A 1 53  ? 27.912 5.011   2.436  1.00 29.46 ? 71  ASP E CG  1 
ATOM   392  O OD1 . ASP A 1 53  ? 27.324 5.733   3.285  1.00 18.35 ? 71  ASP E OD1 1 
ATOM   393  O OD2 . ASP A 1 53  ? 28.375 5.532   1.392  1.00 27.81 ? 71  ASP E OD2 1 
ATOM   394  N N   . ASN A 1 54  ? 26.060 2.739   0.683  1.00 18.84 ? 72  ASN E N   1 
ATOM   395  C CA  . ASN A 1 54  ? 25.228 2.799   -0.514 1.00 8.26  ? 72  ASN E CA  1 
ATOM   396  C C   . ASN A 1 54  ? 24.229 1.667   -0.480 1.00 9.28  ? 72  ASN E C   1 
ATOM   397  O O   . ASN A 1 54  ? 24.610 0.558   -0.812 1.00 18.39 ? 72  ASN E O   1 
ATOM   398  C CB  . ASN A 1 54  ? 26.086 2.604   -1.775 1.00 3.00  ? 72  ASN E CB  1 
ATOM   399  C CG  . ASN A 1 54  ? 25.227 2.955   -2.993 1.00 21.72 ? 72  ASN E CG  1 
ATOM   400  O OD1 . ASN A 1 54  ? 24.112 2.445   -3.250 1.00 15.43 ? 72  ASN E OD1 1 
ATOM   401  N ND2 . ASN A 1 54  ? 25.801 3.877   -3.694 1.00 13.01 ? 72  ASN E ND2 1 
ATOM   402  N N   . ILE A 1 55  ? 23.005 1.957   -0.185 1.00 3.15  ? 73  ILE E N   1 
ATOM   403  C CA  . ILE A 1 55  ? 21.976 0.938   -0.111 1.00 16.76 ? 73  ILE E CA  1 
ATOM   404  C C   . ILE A 1 55  ? 21.683 0.178   -1.406 1.00 28.24 ? 73  ILE E C   1 
ATOM   405  O O   . ILE A 1 55  ? 20.890 -0.751  -1.280 1.00 22.02 ? 73  ILE E O   1 
ATOM   406  C CB  . ILE A 1 55  ? 20.644 1.535   0.398  1.00 23.13 ? 73  ILE E CB  1 
ATOM   407  C CG1 . ILE A 1 55  ? 20.148 2.769   -0.399 1.00 16.55 ? 73  ILE E CG1 1 
ATOM   408  C CG2 . ILE A 1 55  ? 20.470 1.642   1.935  1.00 17.21 ? 73  ILE E CG2 1 
ATOM   409  C CD1 . ILE A 1 55  ? 18.779 3.237   0.129  1.00 27.53 ? 73  ILE E CD1 1 
ATOM   410  N N   . ASN A 1 56  ? 22.206 0.557   -2.592 1.00 20.05 ? 74  ASN E N   1 
ATOM   411  C CA  . ASN A 1 56  ? 21.805 -0.133  -3.844 1.00 33.59 ? 74  ASN E CA  1 
ATOM   412  C C   . ASN A 1 56  ? 22.880 -1.052  -4.363 1.00 40.87 ? 74  ASN E C   1 
ATOM   413  O O   . ASN A 1 56  ? 22.682 -1.734  -5.372 1.00 40.82 ? 74  ASN E O   1 
ATOM   414  C CB  . ASN A 1 56  ? 21.395 0.832   -4.981 1.00 24.75 ? 74  ASN E CB  1 
ATOM   415  C CG  . ASN A 1 56  ? 20.062 1.433   -4.565 1.00 29.55 ? 74  ASN E CG  1 
ATOM   416  O OD1 . ASN A 1 56  ? 19.165 0.736   -4.050 1.00 31.30 ? 74  ASN E OD1 1 
ATOM   417  N ND2 . ASN A 1 56  ? 20.015 2.728   -4.738 1.00 20.22 ? 74  ASN E ND2 1 
ATOM   418  N N   . VAL A 1 57  ? 24.011 -0.805  -3.775 1.00 36.97 ? 75  VAL E N   1 
ATOM   419  C CA  . VAL A 1 57  ? 25.283 -1.305  -4.288 1.00 30.59 ? 75  VAL E CA  1 
ATOM   420  C C   . VAL A 1 57  ? 26.043 -2.003  -3.162 1.00 27.48 ? 75  VAL E C   1 
ATOM   421  O O   . VAL A 1 57  ? 26.341 -1.347  -2.176 1.00 39.84 ? 75  VAL E O   1 
ATOM   422  C CB  . VAL A 1 57  ? 26.047 -0.066  -4.848 1.00 37.28 ? 75  VAL E CB  1 
ATOM   423  C CG1 . VAL A 1 57  ? 27.247 -0.494  -5.665 1.00 36.96 ? 75  VAL E CG1 1 
ATOM   424  C CG2 . VAL A 1 57  ? 25.192 0.863   -5.754 1.00 41.71 ? 75  VAL E CG2 1 
ATOM   425  N N   . VAL A 1 58  ? 26.397 -3.268  -3.320 0.00 39.56 ? 76  VAL E N   1 
ATOM   426  C CA  . VAL A 1 58  ? 27.135 -4.055  -2.300 1.00 25.67 ? 76  VAL E CA  1 
ATOM   427  C C   . VAL A 1 58  ? 28.617 -3.674  -2.203 1.00 20.93 ? 76  VAL E C   1 
ATOM   428  O O   . VAL A 1 58  ? 29.273 -3.500  -3.227 1.00 46.19 ? 76  VAL E O   1 
ATOM   429  C CB  . VAL A 1 58  ? 27.039 -5.534  -2.696 1.00 28.24 ? 76  VAL E CB  1 
ATOM   430  C CG1 . VAL A 1 58  ? 28.299 -6.332  -2.380 1.00 42.24 ? 76  VAL E CG1 1 
ATOM   431  C CG2 . VAL A 1 58  ? 25.823 -6.168  -2.026 1.00 28.58 ? 76  VAL E CG2 1 
ATOM   432  N N   . GLU A 1 59  ? 29.054 -3.185  -1.072 1.00 29.14 ? 77  GLU E N   1 
ATOM   433  C CA  . GLU A 1 59  ? 30.411 -2.639  -1.019 1.00 40.09 ? 77  GLU E CA  1 
ATOM   434  C C   . GLU A 1 59  ? 31.305 -3.518  -0.151 1.00 51.43 ? 77  GLU E C   1 
ATOM   435  O O   . GLU A 1 59  ? 32.530 -3.312  -0.049 1.00 35.43 ? 77  GLU E O   1 
ATOM   436  C CB  . GLU A 1 59  ? 30.294 -1.213  -0.505 1.00 30.51 ? 77  GLU E CB  1 
ATOM   437  C CG  . GLU A 1 59  ? 29.621 -0.379  -1.614 1.00 38.55 ? 77  GLU E CG  1 
ATOM   438  C CD  . GLU A 1 59  ? 29.364 1.046   -1.131 1.00 43.15 ? 77  GLU E CD  1 
ATOM   439  O OE1 . GLU A 1 59  ? 28.808 1.261   -0.029 1.00 36.13 ? 77  GLU E OE1 1 
ATOM   440  O OE2 . GLU A 1 59  ? 29.684 2.026   -1.845 1.00 46.69 ? 77  GLU E OE2 1 
ATOM   441  N N   . GLY A 1 60  ? 30.587 -4.563  0.226  1.00 32.64 ? 78  GLY E N   1 
ATOM   442  C CA  . GLY A 1 60  ? 31.023 -5.711  1.024  1.00 24.37 ? 78  GLY E CA  1 
ATOM   443  C C   . GLY A 1 60  ? 31.413 -5.325  2.446  1.00 35.13 ? 78  GLY E C   1 
ATOM   444  O O   . GLY A 1 60  ? 31.973 -6.173  3.139  1.00 48.24 ? 78  GLY E O   1 
ATOM   445  N N   . ASN A 1 61  ? 30.869 -4.285  3.026  1.00 30.18 ? 79  ASN E N   1 
ATOM   446  C CA  . ASN A 1 61  ? 31.002 -4.400  4.511  1.00 45.63 ? 79  ASN E CA  1 
ATOM   447  C C   . ASN A 1 61  ? 29.689 -4.859  5.200  1.00 46.31 ? 79  ASN E C   1 
ATOM   448  O O   . ASN A 1 61  ? 29.458 -4.693  6.413  1.00 26.80 ? 79  ASN E O   1 
ATOM   449  C CB  . ASN A 1 61  ? 31.511 -3.049  5.092  1.00 39.33 ? 79  ASN E CB  1 
ATOM   450  C CG  . ASN A 1 61  ? 32.906 -2.689  4.574  1.00 58.71 ? 79  ASN E CG  1 
ATOM   451  O OD1 . ASN A 1 61  ? 33.868 -3.406  4.849  1.00 48.74 ? 79  ASN E OD1 1 
ATOM   452  N ND2 . ASN A 1 61  ? 33.006 -1.573  3.860  1.00 51.17 ? 79  ASN E ND2 1 
ATOM   453  N N   . GLU A 1 62  ? 28.692 -5.094  4.377  1.00 22.32 ? 80  GLU E N   1 
ATOM   454  C CA  . GLU A 1 62  ? 27.339 -5.196  4.928  1.00 9.58  ? 80  GLU E CA  1 
ATOM   455  C C   . GLU A 1 62  ? 27.121 -6.518  5.652  1.00 17.21 ? 80  GLU E C   1 
ATOM   456  O O   . GLU A 1 62  ? 27.631 -7.534  5.213  1.00 23.33 ? 80  GLU E O   1 
ATOM   457  C CB  . GLU A 1 62  ? 26.227 -5.068  3.878  1.00 8.63  ? 80  GLU E CB  1 
ATOM   458  C CG  . GLU A 1 62  ? 26.365 -3.786  3.064  1.00 17.25 ? 80  GLU E CG  1 
ATOM   459  C CD  . GLU A 1 62  ? 27.264 -3.979  1.827  1.00 48.55 ? 80  GLU E CD  1 
ATOM   460  O OE1 . GLU A 1 62  ? 28.059 -4.940  1.678  1.00 35.91 ? 80  GLU E OE1 1 
ATOM   461  O OE2 . GLU A 1 62  ? 27.219 -3.137  0.901  1.00 27.87 ? 80  GLU E OE2 1 
ATOM   462  N N   . GLN A 1 63  ? 26.223 -6.517  6.629  1.00 15.24 ? 81  GLN E N   1 
ATOM   463  C CA  . GLN A 1 63  ? 25.630 -7.748  7.186  1.00 24.94 ? 81  GLN E CA  1 
ATOM   464  C C   . GLN A 1 63  ? 24.118 -7.654  7.237  1.00 17.41 ? 81  GLN E C   1 
ATOM   465  O O   . GLN A 1 63  ? 23.647 -6.531  7.481  1.00 10.72 ? 81  GLN E O   1 
ATOM   466  C CB  . GLN A 1 63  ? 26.064 -8.011  8.627  1.00 14.17 ? 81  GLN E CB  1 
ATOM   467  C CG  . GLN A 1 63  ? 27.558 -7.758  8.767  1.00 8.69  ? 81  GLN E CG  1 
ATOM   468  C CD  . GLN A 1 63  ? 27.923 -7.840  10.245 1.00 25.40 ? 81  GLN E CD  1 
ATOM   469  O OE1 . GLN A 1 63  ? 27.318 -8.654  10.950 1.00 15.55 ? 81  GLN E OE1 1 
ATOM   470  N NE2 . GLN A 1 63  ? 28.919 -7.010  10.646 1.00 10.90 ? 81  GLN E NE2 1 
ATOM   471  N N   . PHE A 1 64  ? 23.477 -8.738  6.712  1.00 12.40 ? 82  PHE E N   1 
ATOM   472  C CA  . PHE A 1 64  ? 22.005 -8.820  6.545  1.00 18.05 ? 82  PHE E CA  1 
ATOM   473  C C   . PHE A 1 64  ? 21.475 -9.905  7.471  1.00 16.69 ? 82  PHE E C   1 
ATOM   474  O O   . PHE A 1 64  ? 21.854 -11.079 7.354  1.00 14.62 ? 82  PHE E O   1 
ATOM   475  C CB  . PHE A 1 64  ? 21.554 -9.234  5.132  1.00 12.32 ? 82  PHE E CB  1 
ATOM   476  C CG  . PHE A 1 64  ? 21.767 -8.225  4.008  1.00 14.10 ? 82  PHE E CG  1 
ATOM   477  C CD1 . PHE A 1 64  ? 22.674 -7.218  4.165  1.00 39.01 ? 82  PHE E CD1 1 
ATOM   478  C CD2 . PHE A 1 64  ? 21.160 -8.437  2.797  1.00 27.52 ? 82  PHE E CD2 1 
ATOM   479  C CE1 . PHE A 1 64  ? 23.004 -6.436  3.109  1.00 31.73 ? 82  PHE E CE1 1 
ATOM   480  C CE2 . PHE A 1 64  ? 21.512 -7.666  1.724  1.00 29.88 ? 82  PHE E CE2 1 
ATOM   481  C CZ  . PHE A 1 64  ? 22.446 -6.674  1.885  1.00 19.05 ? 82  PHE E CZ  1 
ATOM   482  N N   . ILE A 1 65  ? 20.677 -9.488  8.407  1.00 9.61  ? 83  ILE E N   1 
ATOM   483  C CA  . ILE A 1 65  ? 20.240 -10.429 9.433  1.00 12.74 ? 83  ILE E CA  1 
ATOM   484  C C   . ILE A 1 65  ? 18.747 -10.226 9.611  1.00 6.32  ? 83  ILE E C   1 
ATOM   485  O O   . ILE A 1 65  ? 18.378 -9.089  9.864  1.00 9.98  ? 83  ILE E O   1 
ATOM   486  C CB  . ILE A 1 65  ? 20.989 -10.182 10.756 1.00 13.75 ? 83  ILE E CB  1 
ATOM   487  C CG1 . ILE A 1 65  ? 22.516 -10.165 10.556 1.00 12.93 ? 83  ILE E CG1 1 
ATOM   488  C CG2 . ILE A 1 65  ? 20.543 -11.200 11.837 1.00 3.00  ? 83  ILE E CG2 1 
ATOM   489  C CD1 . ILE A 1 65  ? 23.307 -9.558  11.757 1.00 11.40 ? 83  ILE E CD1 1 
ATOM   490  N N   . SER A 1 66  ? 17.954 -11.296 9.563  1.00 8.08  ? 84  SER E N   1 
ATOM   491  C CA  . SER A 1 66  ? 16.515 -11.155 9.907  1.00 9.51  ? 84  SER E CA  1 
ATOM   492  C C   . SER A 1 66  ? 16.234 -10.853 11.377 1.00 14.06 ? 84  SER E C   1 
ATOM   493  O O   . SER A 1 66  ? 16.904 -11.375 12.280 1.00 11.04 ? 84  SER E O   1 
ATOM   494  C CB  . SER A 1 66  ? 15.855 -12.529 9.689  1.00 23.90 ? 84  SER E CB  1 
ATOM   495  O OG  . SER A 1 66  ? 15.757 -12.735 8.291  1.00 41.22 ? 84  SER E OG  1 
ATOM   496  N N   . ALA A 1 67  ? 15.134 -10.173 11.558 1.00 7.33  ? 85  ALA E N   1 
ATOM   497  C CA  . ALA A 1 67  ? 14.607 -9.986  12.888 1.00 17.07 ? 85  ALA E CA  1 
ATOM   498  C C   . ALA A 1 67  ? 13.993 -11.310 13.355 1.00 22.09 ? 85  ALA E C   1 
ATOM   499  O O   . ALA A 1 67  ? 13.052 -11.806 12.758 1.00 27.73 ? 85  ALA E O   1 
ATOM   500  C CB  . ALA A 1 67  ? 13.532 -8.842  12.885 1.00 9.76  ? 85  ALA E CB  1 
ATOM   501  N N   . SER A 1 68  ? 14.351 -11.724 14.510 1.00 9.29  ? 86  SER E N   1 
ATOM   502  C CA  . SER A 1 68  ? 13.709 -12.841 15.159 1.00 3.37  ? 86  SER E CA  1 
ATOM   503  C C   . SER A 1 68  ? 12.497 -12.379 15.973 1.00 15.13 ? 86  SER E C   1 
ATOM   504  O O   . SER A 1 68  ? 11.520 -13.110 16.109 1.00 25.63 ? 86  SER E O   1 
ATOM   505  C CB  . SER A 1 68  ? 14.749 -13.380 16.100 1.00 5.69  ? 86  SER E CB  1 
ATOM   506  O OG  . SER A 1 68  ? 14.076 -14.239 16.974 1.00 39.12 ? 86  SER E OG  1 
ATOM   507  N N   . LYS A 1 69  ? 12.579 -11.223 16.543 1.00 14.63 ? 87  LYS E N   1 
ATOM   508  C CA  . LYS A 1 69  ? 11.480 -10.801 17.433 1.00 7.07  ? 87  LYS E CA  1 
ATOM   509  C C   . LYS A 1 69  ? 11.386 -9.276  17.448 1.00 13.15 ? 87  LYS E C   1 
ATOM   510  O O   . LYS A 1 69  ? 12.389 -8.583  17.630 1.00 12.34 ? 87  LYS E O   1 
ATOM   511  C CB  . LYS A 1 69  ? 11.991 -11.290 18.819 1.00 24.04 ? 87  LYS E CB  1 
ATOM   512  C CG  . LYS A 1 69  ? 10.882 -11.476 19.873 1.00 35.57 ? 87  LYS E CG  1 
ATOM   513  C CD  . LYS A 1 69  ? 11.106 -12.699 20.808 0.00 33.84 ? 87  LYS E CD  1 
ATOM   514  C CE  . LYS A 1 69  ? 12.363 -12.616 21.708 1.00 56.72 ? 87  LYS E CE  1 
ATOM   515  N NZ  . LYS A 1 69  ? 12.516 -13.813 22.592 1.00 39.53 ? 87  LYS E NZ  1 
ATOM   516  N N   . SER A 1 70  ? 10.189 -8.751  17.515 1.00 11.15 ? 88  SER E N   1 
ATOM   517  C CA  . SER A 1 70  ? 9.995  -7.281  17.587 1.00 19.72 ? 88  SER E CA  1 
ATOM   518  C C   . SER A 1 70  ? 9.090  -6.941  18.762 1.00 38.23 ? 88  SER E C   1 
ATOM   519  O O   . SER A 1 70  ? 8.123  -7.653  18.968 1.00 32.81 ? 88  SER E O   1 
ATOM   520  C CB  . SER A 1 70  ? 9.306  -6.747  16.313 1.00 13.19 ? 88  SER E CB  1 
ATOM   521  O OG  . SER A 1 70  ? 10.121 -7.010  15.111 1.00 39.71 ? 88  SER E OG  1 
ATOM   522  N N   . ILE A 1 71  ? 9.491  -6.021  19.612 1.00 8.67  ? 89  ILE E N   1 
ATOM   523  C CA  . ILE A 1 71  ? 8.718  -5.840  20.809 1.00 3.00  ? 89  ILE E CA  1 
ATOM   524  C C   . ILE A 1 71  ? 8.297  -4.386  20.846 1.00 6.16  ? 89  ILE E C   1 
ATOM   525  O O   . ILE A 1 71  ? 9.152  -3.539  21.053 1.00 10.62 ? 89  ILE E O   1 
ATOM   526  C CB  . ILE A 1 71  ? 9.675  -6.119  21.966 1.00 6.65  ? 89  ILE E CB  1 
ATOM   527  C CG1 . ILE A 1 71  ? 10.188 -7.553  21.874 1.00 9.33  ? 89  ILE E CG1 1 
ATOM   528  C CG2 . ILE A 1 71  ? 8.937  -5.862  23.288 1.00 13.68 ? 89  ILE E CG2 1 
ATOM   529  C CD1 . ILE A 1 71  ? 10.942 -8.079  23.121 1.00 13.46 ? 89  ILE E CD1 1 
ATOM   530  N N   . VAL A 1 72  ? 7.084  -4.115  20.418 1.00 12.73 ? 90  VAL E N   1 
ATOM   531  C CA  . VAL A 1 72  ? 6.526  -2.748  20.389 1.00 6.04  ? 90  VAL E CA  1 
ATOM   532  C C   . VAL A 1 72  ? 6.251  -2.244  21.834 1.00 20.66 ? 90  VAL E C   1 
ATOM   533  O O   . VAL A 1 72  ? 5.981  -3.073  22.708 1.00 20.27 ? 90  VAL E O   1 
ATOM   534  C CB  . VAL A 1 72  ? 5.252  -2.769  19.484 1.00 8.53  ? 90  VAL E CB  1 
ATOM   535  C CG1 . VAL A 1 72  ? 4.473  -1.436  19.484 1.00 5.90  ? 90  VAL E CG1 1 
ATOM   536  C CG2 . VAL A 1 72  ? 5.556  -3.152  18.018 1.00 14.15 ? 90  VAL E CG2 1 
ATOM   537  N N   . HIS A 1 73  ? 6.622  -0.988  22.191 1.00 12.88 ? 91  HIS E N   1 
ATOM   538  C CA  . HIS A 1 73  ? 6.387  -0.519  23.599 1.00 13.00 ? 91  HIS E CA  1 
ATOM   539  C C   . HIS A 1 73  ? 4.892  -0.739  24.016 1.00 31.18 ? 91  HIS E C   1 
ATOM   540  O O   . HIS A 1 73  ? 4.008  -0.446  23.211 1.00 15.39 ? 91  HIS E O   1 
ATOM   541  C CB  . HIS A 1 73  ? 6.593  1.015   23.671 1.00 4.41  ? 91  HIS E CB  1 
ATOM   542  C CG  . HIS A 1 73  ? 6.662  1.389   25.151 1.00 14.72 ? 91  HIS E CG  1 
ATOM   543  N ND1 . HIS A 1 73  ? 5.539  1.798   25.822 1.00 13.82 ? 91  HIS E ND1 1 
ATOM   544  C CD2 . HIS A 1 73  ? 7.695  1.385   26.002 1.00 10.01 ? 91  HIS E CD2 1 
ATOM   545  C CE1 . HIS A 1 73  ? 5.880  2.058   27.155 1.00 14.03 ? 91  HIS E CE1 1 
ATOM   546  N NE2 . HIS A 1 73  ? 7.237  1.810   27.264 1.00 12.17 ? 91  HIS E NE2 1 
ATOM   547  N N   . PRO A 1 74  ? 4.589  -1.319  25.194 1.00 10.13 ? 92  PRO E N   1 
ATOM   548  C CA  . PRO A 1 74  ? 3.230  -1.570  25.699 1.00 13.14 ? 92  PRO E CA  1 
ATOM   549  C C   . PRO A 1 74  ? 2.346  -0.354  25.654 1.00 11.90 ? 92  PRO E C   1 
ATOM   550  O O   . PRO A 1 74  ? 1.153  -0.551  25.528 1.00 19.23 ? 92  PRO E O   1 
ATOM   551  C CB  . PRO A 1 74  ? 3.413  -1.843  27.204 1.00 17.64 ? 92  PRO E CB  1 
ATOM   552  C CG  . PRO A 1 74  ? 4.894  -1.651  27.487 1.00 23.38 ? 92  PRO E CG  1 
ATOM   553  C CD  . PRO A 1 74  ? 5.550  -1.927  26.149 1.00 18.43 ? 92  PRO E CD  1 
ATOM   554  N N   . SER A 1 75  ? 2.891  0.857   25.705 1.00 10.91 ? 93  SER E N   1 
ATOM   555  C CA  . SER A 1 75  ? 1.957  1.979   25.704 1.00 7.06  ? 93  SER E CA  1 
ATOM   556  C C   . SER A 1 75  ? 1.957  2.713   24.399 1.00 18.51 ? 93  SER E C   1 
ATOM   557  O O   . SER A 1 75  ? 1.461  3.862   24.353 1.00 15.09 ? 93  SER E O   1 
ATOM   558  C CB  . SER A 1 75  ? 2.146  2.910   26.930 1.00 25.42 ? 93  SER E CB  1 
ATOM   559  O OG  . SER A 1 75  ? 2.396  2.098   28.110 1.00 24.14 ? 93  SER E OG  1 
ATOM   560  N N   . TYR A 1 76  ? 2.457  1.971   23.406 1.00 10.13 ? 94  TYR E N   1 
ATOM   561  C CA  . TYR A 1 76  ? 2.432  2.652   22.042 1.00 6.60  ? 94  TYR E CA  1 
ATOM   562  C C   . TYR A 1 76  ? 1.019  3.062   21.628 1.00 6.60  ? 94  TYR E C   1 
ATOM   563  O O   . TYR A 1 76  ? 0.112  2.249   21.645 1.00 21.64 ? 94  TYR E O   1 
ATOM   564  C CB  . TYR A 1 76  ? 3.104  1.765   20.963 1.00 3.00  ? 94  TYR E CB  1 
ATOM   565  C CG  . TYR A 1 76  ? 3.008  2.351   19.524 1.00 15.63 ? 94  TYR E CG  1 
ATOM   566  C CD1 . TYR A 1 76  ? 3.465  3.609   19.226 1.00 6.19  ? 94  TYR E CD1 1 
ATOM   567  C CD2 . TYR A 1 76  ? 2.434  1.604   18.528 1.00 16.80 ? 94  TYR E CD2 1 
ATOM   568  C CE1 . TYR A 1 76  ? 3.349  4.152   17.949 1.00 4.32  ? 94  TYR E CE1 1 
ATOM   569  C CE2 . TYR A 1 76  ? 2.305  2.125   17.262 1.00 7.12  ? 94  TYR E CE2 1 
ATOM   570  C CZ  . TYR A 1 76  ? 2.747  3.387   16.967 1.00 17.01 ? 94  TYR E CZ  1 
ATOM   571  O OH  . TYR A 1 76  ? 2.642  3.820   15.674 1.00 12.41 ? 94  TYR E OH  1 
ATOM   572  N N   . ASN A 1 77  ? 0.856  4.245   21.097 1.00 18.54 ? 95  ASN E N   1 
ATOM   573  C CA  . ASN A 1 77  ? -0.406 4.705   20.567 1.00 9.54  ? 95  ASN E CA  1 
ATOM   574  C C   . ASN A 1 77  ? -0.235 5.126   19.134 1.00 5.69  ? 95  ASN E C   1 
ATOM   575  O O   . ASN A 1 77  ? 0.397  6.154   18.894 1.00 17.56 ? 95  ASN E O   1 
ATOM   576  C CB  . ASN A 1 77  ? -0.892 6.026   21.221 1.00 22.21 ? 95  ASN E CB  1 
ATOM   577  C CG  . ASN A 1 77  ? -2.349 6.291   20.779 1.00 10.61 ? 95  ASN E CG  1 
ATOM   578  O OD1 . ASN A 1 77  ? -2.672 6.806   19.722 1.00 27.73 ? 95  ASN E OD1 1 
ATOM   579  N ND2 . ASN A 1 77  ? -3.244 5.958   21.616 1.00 38.22 ? 95  ASN E ND2 1 
ATOM   580  N N   . SER A 1 78  ? -0.842 4.393   18.224 1.00 9.85  ? 96  SER E N   1 
ATOM   581  C CA  . SER A 1 78  ? -0.699 4.737   16.787 1.00 19.40 ? 96  SER E CA  1 
ATOM   582  C C   . SER A 1 78  ? -1.462 5.958   16.330 1.00 24.63 ? 96  SER E C   1 
ATOM   583  O O   . SER A 1 78  ? -1.225 6.394   15.208 1.00 24.02 ? 96  SER E O   1 
ATOM   584  C CB  . SER A 1 78  ? -1.122 3.569   15.886 1.00 18.78 ? 96  SER E CB  1 
ATOM   585  O OG  . SER A 1 78  ? -2.437 3.200   16.284 1.00 23.31 ? 96  SER E OG  1 
ATOM   586  N N   . ASN A 1 79  ? -2.384 6.455   17.137 1.00 10.25 ? 97  ASN E N   1 
ATOM   587  C CA  . ASN A 1 79  ? -3.082 7.706   16.746 1.00 21.60 ? 97  ASN E CA  1 
ATOM   588  C C   . ASN A 1 79  ? -2.191 8.912   17.105 1.00 33.22 ? 97  ASN E C   1 
ATOM   589  O O   . ASN A 1 79  ? -2.147 9.936   16.428 1.00 19.38 ? 97  ASN E O   1 
ATOM   590  C CB  . ASN A 1 79  ? -4.443 7.809   17.529 1.00 26.82 ? 97  ASN E CB  1 
ATOM   591  C CG  . ASN A 1 79  ? -5.322 6.632   17.117 1.00 50.94 ? 97  ASN E CG  1 
ATOM   592  O OD1 . ASN A 1 79  ? -5.734 5.791   17.930 1.00 35.26 ? 97  ASN E OD1 1 
ATOM   593  N ND2 . ASN A 1 79  ? -5.566 6.604   15.832 1.00 29.12 ? 97  ASN E ND2 1 
ATOM   594  N N   . THR A 1 80  ? -1.505 8.824   18.228 1.00 20.30 ? 98  THR E N   1 
ATOM   595  C CA  . THR A 1 80  ? -0.800 10.000  18.699 1.00 7.46  ? 98  THR E CA  1 
ATOM   596  C C   . THR A 1 80  ? 0.719  9.872   18.584 1.00 3.48  ? 98  THR E C   1 
ATOM   597  O O   . THR A 1 80  ? 1.444  10.896  18.487 1.00 9.99  ? 98  THR E O   1 
ATOM   598  C CB  . THR A 1 80  ? -1.120 10.161  20.175 1.00 15.51 ? 98  THR E CB  1 
ATOM   599  O OG1 . THR A 1 80  ? -0.690 8.983   20.858 1.00 17.52 ? 98  THR E OG1 1 
ATOM   600  C CG2 . THR A 1 80  ? -2.634 10.356  20.323 1.00 37.69 ? 98  THR E CG2 1 
ATOM   601  N N   . LEU A 1 81  ? 1.053  8.655   18.292 1.00 4.00  ? 99  LEU E N   1 
ATOM   602  C CA  . LEU A 1 81  ? 2.481  8.311   18.073 1.00 24.80 ? 99  LEU E CA  1 
ATOM   603  C C   . LEU A 1 81  ? 3.222  8.445   19.399 1.00 17.21 ? 99  LEU E C   1 
ATOM   604  O O   . LEU A 1 81  ? 4.443  8.508   19.421 1.00 18.39 ? 99  LEU E O   1 
ATOM   605  C CB  . LEU A 1 81  ? 3.151  9.204   16.994 1.00 8.07  ? 99  LEU E CB  1 
ATOM   606  C CG  . LEU A 1 81  ? 2.751  8.782   15.535 1.00 5.47  ? 99  LEU E CG  1 
ATOM   607  C CD1 . LEU A 1 81  ? 3.364  9.747   14.493 1.00 10.75 ? 99  LEU E CD1 1 
ATOM   608  C CD2 . LEU A 1 81  ? 3.254  7.366   15.261 1.00 15.39 ? 99  LEU E CD2 1 
ATOM   609  N N   . ASN A 1 82  ? 2.487  8.429   20.517 1.00 21.30 ? 100 ASN E N   1 
ATOM   610  C CA  . ASN A 1 82  ? 3.097  8.492   21.889 1.00 8.94  ? 100 ASN E CA  1 
ATOM   611  C C   . ASN A 1 82  ? 3.734  7.171   22.233 1.00 11.08 ? 100 ASN E C   1 
ATOM   612  O O   . ASN A 1 82  ? 3.194  6.197   21.769 1.00 7.49  ? 100 ASN E O   1 
ATOM   613  C CB  . ASN A 1 82  ? 1.995  8.740   22.940 1.00 14.97 ? 100 ASN E CB  1 
ATOM   614  C CG  . ASN A 1 82  ? 2.673  9.098   24.269 1.00 15.81 ? 100 ASN E CG  1 
ATOM   615  O OD1 . ASN A 1 82  ? 2.120  8.816   25.329 1.00 22.85 ? 100 ASN E OD1 1 
ATOM   616  N ND2 . ASN A 1 82  ? 3.802  9.771   24.223 1.00 17.74 ? 100 ASN E ND2 1 
ATOM   617  N N   . ASN A 1 83  ? 4.906  7.128   22.857 1.00 9.01  ? 101 ASN E N   1 
ATOM   618  C CA  . ASN A 1 83  ? 5.610  5.851   23.086 1.00 13.39 ? 101 ASN E CA  1 
ATOM   619  C C   . ASN A 1 83  ? 6.051  5.168   21.798 1.00 3.11  ? 101 ASN E C   1 
ATOM   620  O O   . ASN A 1 83  ? 6.085  3.942   21.669 1.00 6.29  ? 101 ASN E O   1 
ATOM   621  C CB  . ASN A 1 83  ? 4.928  4.858   24.081 1.00 6.90  ? 101 ASN E CB  1 
ATOM   622  C CG  . ASN A 1 83  ? 4.507  5.615   25.344 1.00 14.62 ? 101 ASN E CG  1 
ATOM   623  O OD1 . ASN A 1 83  ? 3.342  5.946   25.471 1.00 18.46 ? 101 ASN E OD1 1 
ATOM   624  N ND2 . ASN A 1 83  ? 5.412  5.917   26.177 1.00 3.00  ? 101 ASN E ND2 1 
ATOM   625  N N   . ASP A 1 84  ? 6.503  5.998   20.860 1.00 17.31 ? 102 ASP E N   1 
ATOM   626  C CA  . ASP A 1 84  ? 6.865  5.444   19.514 1.00 5.57  ? 102 ASP E CA  1 
ATOM   627  C C   . ASP A 1 84  ? 8.263  4.842   19.513 1.00 15.47 ? 102 ASP E C   1 
ATOM   628  O O   . ASP A 1 84  ? 9.245  5.538   19.185 1.00 16.69 ? 102 ASP E O   1 
ATOM   629  C CB  . ASP A 1 84  ? 6.800  6.583   18.476 1.00 11.09 ? 102 ASP E CB  1 
ATOM   630  C CG  . ASP A 1 84  ? 6.865  6.059   17.037 1.00 9.60  ? 102 ASP E CG  1 
ATOM   631  O OD1 . ASP A 1 84  ? 6.804  4.825   16.794 1.00 3.00  ? 102 ASP E OD1 1 
ATOM   632  O OD2 . ASP A 1 84  ? 6.930  6.894   16.089 1.00 3.00  ? 102 ASP E OD2 1 
ATOM   633  N N   . ILE A 1 85  ? 8.327  3.650   20.077 1.00 6.30  ? 103 ILE E N   1 
ATOM   634  C CA  . ILE A 1 85  ? 9.638  3.000   20.282 1.00 7.69  ? 103 ILE E CA  1 
ATOM   635  C C   . ILE A 1 85  ? 9.506  1.490   20.065 1.00 3.00  ? 103 ILE E C   1 
ATOM   636  O O   . ILE A 1 85  ? 8.479  0.975   20.449 1.00 14.77 ? 103 ILE E O   1 
ATOM   637  C CB  . ILE A 1 85  ? 10.287 3.378   21.669 1.00 14.80 ? 103 ILE E CB  1 
ATOM   638  C CG1 . ILE A 1 85  ? 11.678 2.748   21.833 1.00 5.29  ? 103 ILE E CG1 1 
ATOM   639  C CG2 . ILE A 1 85  ? 9.435  3.254   22.998 1.00 3.02  ? 103 ILE E CG2 1 
ATOM   640  C CD1 . ILE A 1 85  ? 12.435 3.402   23.015 1.00 11.45 ? 103 ILE E CD1 1 
ATOM   641  N N   . MET A 1 86  ? 10.492 0.758   19.656 1.00 3.00  ? 104 MET E N   1 
ATOM   642  C CA  . MET A 1 86  ? 10.331 -0.709  19.541 1.00 3.00  ? 104 MET E CA  1 
ATOM   643  C C   . MET A 1 86  ? 11.728 -1.317  19.534 1.00 3.09  ? 104 MET E C   1 
ATOM   644  O O   . MET A 1 86  ? 12.694 -0.695  19.123 1.00 3.00  ? 104 MET E O   1 
ATOM   645  C CB  . MET A 1 86  ? 9.660  -0.969  18.148 1.00 17.64 ? 104 MET E CB  1 
ATOM   646  C CG  . MET A 1 86  ? 9.853  -2.321  17.466 1.00 13.49 ? 104 MET E CG  1 
ATOM   647  S SD  . MET A 1 86  ? 9.166  -2.405  15.765 1.00 16.69 ? 104 MET E SD  1 
ATOM   648  C CE  . MET A 1 86  ? 10.422 -1.617  14.744 1.00 8.69  ? 104 MET E CE  1 
ATOM   649  N N   . LEU A 1 87  ? 11.798 -2.530  19.991 1.00 5.49  ? 105 LEU E N   1 
ATOM   650  C CA  . LEU A 1 87  ? 13.078 -3.257  20.020 1.00 12.62 ? 105 LEU E CA  1 
ATOM   651  C C   . LEU A 1 87  ? 13.003 -4.431  19.047 1.00 11.42 ? 105 LEU E C   1 
ATOM   652  O O   . LEU A 1 87  ? 12.018 -5.149  19.012 1.00 11.39 ? 105 LEU E O   1 
ATOM   653  C CB  . LEU A 1 87  ? 13.241 -3.810  21.477 1.00 19.48 ? 105 LEU E CB  1 
ATOM   654  C CG  . LEU A 1 87  ? 14.209 -3.078  22.491 1.00 25.25 ? 105 LEU E CG  1 
ATOM   655  C CD1 . LEU A 1 87  ? 14.691 -1.660  22.168 1.00 15.96 ? 105 LEU E CD1 1 
ATOM   656  C CD2 . LEU A 1 87  ? 13.609 -3.081  23.889 1.00 19.45 ? 105 LEU E CD2 1 
ATOM   657  N N   . ILE A 1 88  ? 14.052 -4.672  18.308 1.00 5.01  ? 106 ILE E N   1 
ATOM   658  C CA  . ILE A 1 88  ? 14.089 -5.796  17.390 1.00 12.52 ? 106 ILE E CA  1 
ATOM   659  C C   . ILE A 1 88  ? 15.271 -6.637  17.843 1.00 13.33 ? 106 ILE E C   1 
ATOM   660  O O   . ILE A 1 88  ? 16.384 -6.145  17.933 1.00 10.45 ? 106 ILE E O   1 
ATOM   661  C CB  . ILE A 1 88  ? 14.278 -5.358  15.878 1.00 8.49  ? 106 ILE E CB  1 
ATOM   662  C CG1 . ILE A 1 88  ? 13.153 -4.481  15.301 1.00 4.72  ? 106 ILE E CG1 1 
ATOM   663  C CG2 . ILE A 1 88  ? 14.596 -6.508  14.902 1.00 3.74  ? 106 ILE E CG2 1 
ATOM   664  C CD1 . ILE A 1 88  ? 13.574 -3.669  14.057 1.00 11.75 ? 106 ILE E CD1 1 
ATOM   665  N N   . LYS A 1 89  ? 15.003 -7.872  18.085 1.00 9.45  ? 107 LYS E N   1 
ATOM   666  C CA  . LYS A 1 89  ? 16.060 -8.806  18.300 1.00 4.30  ? 107 LYS E CA  1 
ATOM   667  C C   . LYS A 1 89  ? 16.461 -9.455  16.987 1.00 4.87  ? 107 LYS E C   1 
ATOM   668  O O   . LYS A 1 89  ? 15.596 -10.009 16.330 1.00 12.15 ? 107 LYS E O   1 
ATOM   669  C CB  . LYS A 1 89  ? 15.503 -9.920  19.247 1.00 9.48  ? 107 LYS E CB  1 
ATOM   670  C CG  . LYS A 1 89  ? 16.675 -10.750 19.824 1.00 7.87  ? 107 LYS E CG  1 
ATOM   671  C CD  . LYS A 1 89  ? 16.186 -11.910 20.688 1.00 16.41 ? 107 LYS E CD  1 
ATOM   672  C CE  . LYS A 1 89  ? 17.418 -12.381 21.497 1.00 23.19 ? 107 LYS E CE  1 
ATOM   673  N NZ  . LYS A 1 89  ? 17.066 -13.556 22.303 1.00 31.43 ? 107 LYS E NZ  1 
ATOM   674  N N   . LEU A 1 90  ? 17.737 -9.543  16.741 1.00 8.35  ? 108 LEU E N   1 
ATOM   675  C CA  . LEU A 1 90  ? 18.298 -10.218 15.573 1.00 6.15  ? 108 LEU E CA  1 
ATOM   676  C C   . LEU A 1 90  ? 18.284 -11.721 15.705 1.00 13.45 ? 108 LEU E C   1 
ATOM   677  O O   . LEU A 1 90  ? 18.403 -12.231 16.816 1.00 23.07 ? 108 LEU E O   1 
ATOM   678  C CB  . LEU A 1 90  ? 19.742 -9.662  15.299 1.00 18.40 ? 108 LEU E CB  1 
ATOM   679  C CG  . LEU A 1 90  ? 19.729 -8.103  15.133 1.00 6.50  ? 108 LEU E CG  1 
ATOM   680  C CD1 . LEU A 1 90  ? 21.174 -7.552  15.152 1.00 3.00  ? 108 LEU E CD1 1 
ATOM   681  C CD2 . LEU A 1 90  ? 18.874 -7.708  13.880 1.00 3.00  ? 108 LEU E CD2 1 
ATOM   682  N N   . LYS A 1 91  ? 18.122 -12.388 14.584 1.00 14.97 ? 109 LYS E N   1 
ATOM   683  C CA  . LYS A 1 91  ? 18.159 -13.874 14.554 1.00 8.11  ? 109 LYS E CA  1 
ATOM   684  C C   . LYS A 1 91  ? 19.562 -14.455 14.828 1.00 12.56 ? 109 LYS E C   1 
ATOM   685  O O   . LYS A 1 91  ? 19.706 -15.430 15.556 1.00 20.67 ? 109 LYS E O   1 
ATOM   686  C CB  . LYS A 1 91  ? 17.674 -14.278 13.156 1.00 23.27 ? 109 LYS E CB  1 
ATOM   687  C CG  . LYS A 1 91  ? 17.211 -15.732 13.116 1.00 24.95 ? 109 LYS E CG  1 
ATOM   688  C CD  . LYS A 1 91  ? 16.504 -16.048 11.794 1.00 52.98 ? 109 LYS E CD  1 
ATOM   689  C CE  . LYS A 1 91  ? 15.155 -15.294 11.588 1.00 53.24 ? 109 LYS E CE  1 
ATOM   690  N NZ  . LYS A 1 91  ? 14.613 -15.638 10.239 1.00 52.65 ? 109 LYS E NZ  1 
ATOM   691  N N   . SER A 1 92  ? 20.588 -13.655 14.618 1.00 10.22 ? 110 SER E N   1 
ATOM   692  C CA  . SER A 1 92  ? 21.964 -13.996 15.004 1.00 17.26 ? 110 SER E CA  1 
ATOM   693  C C   . SER A 1 92  ? 22.600 -12.735 15.516 1.00 19.61 ? 110 SER E C   1 
ATOM   694  O O   . SER A 1 92  ? 22.206 -11.686 15.052 1.00 12.49 ? 110 SER E O   1 
ATOM   695  C CB  . SER A 1 92  ? 22.768 -14.265 13.726 1.00 35.08 ? 110 SER E CB  1 
ATOM   696  O OG  . SER A 1 92  ? 22.449 -15.539 13.266 1.00 45.25 ? 110 SER E OG  1 
ATOM   697  N N   . ALA A 1 93  ? 23.659 -12.862 16.263 1.00 12.19 ? 111 ALA E N   1 
ATOM   698  C CA  . ALA A 1 93  ? 24.301 -11.654 16.741 1.00 9.37  ? 111 ALA E CA  1 
ATOM   699  C C   . ALA A 1 93  ? 24.998 -11.128 15.506 1.00 23.08 ? 111 ALA E C   1 
ATOM   700  O O   . ALA A 1 93  ? 25.653 -11.915 14.854 1.00 9.85  ? 111 ALA E O   1 
ATOM   701  C CB  . ALA A 1 93  ? 25.436 -12.191 17.655 1.00 7.52  ? 111 ALA E CB  1 
ATOM   702  N N   . ALA A 1 94  ? 25.157 -9.860  15.413 1.00 11.57 ? 112 ALA E N   1 
ATOM   703  C CA  . ALA A 1 94  ? 26.000 -9.264  14.379 1.00 14.16 ? 112 ALA E CA  1 
ATOM   704  C C   . ALA A 1 94  ? 27.460 -9.390  14.802 1.00 28.44 ? 112 ALA E C   1 
ATOM   705  O O   . ALA A 1 94  ? 27.678 -9.352  16.018 1.00 13.03 ? 112 ALA E O   1 
ATOM   706  C CB  . ALA A 1 94  ? 25.634 -7.736  14.279 1.00 6.39  ? 112 ALA E CB  1 
ATOM   707  N N   . SER A 1 95  ? 28.404 -9.312  13.835 1.00 18.39 ? 113 SER E N   1 
ATOM   708  C CA  . SER A 1 95  ? 29.861 -9.113  14.245 1.00 15.57 ? 113 SER E CA  1 
ATOM   709  C C   . SER A 1 95  ? 30.138 -7.634  14.273 1.00 13.93 ? 113 SER E C   1 
ATOM   710  O O   . SER A 1 95  ? 30.112 -6.988  13.220 1.00 17.40 ? 113 SER E O   1 
ATOM   711  C CB  . SER A 1 95  ? 30.990 -9.594  13.269 1.00 18.82 ? 113 SER E CB  1 
ATOM   712  O OG  . SER A 1 95  ? 30.361 -10.471 12.328 1.00 51.53 ? 113 SER E OG  1 
ATOM   713  N N   . LEU A 1 96  ? 30.594 -7.260  15.433 1.00 4.61  ? 114 LEU E N   1 
ATOM   714  C CA  . LEU A 1 96  ? 31.017 -5.927  15.664 1.00 7.63  ? 114 LEU E CA  1 
ATOM   715  C C   . LEU A 1 96  ? 32.426 -5.746  15.088 1.00 14.45 ? 114 LEU E C   1 
ATOM   716  O O   . LEU A 1 96  ? 33.280 -6.630  15.170 1.00 14.38 ? 114 LEU E O   1 
ATOM   717  C CB  . LEU A 1 96  ? 30.922 -5.560  17.183 1.00 4.07  ? 114 LEU E CB  1 
ATOM   718  C CG  . LEU A 1 96  ? 29.574 -5.812  17.878 1.00 6.72  ? 114 LEU E CG  1 
ATOM   719  C CD1 . LEU A 1 96  ? 29.644 -5.378  19.332 1.00 18.08 ? 114 LEU E CD1 1 
ATOM   720  C CD2 . LEU A 1 96  ? 28.450 -5.024  17.238 1.00 14.21 ? 114 LEU E CD2 1 
ATOM   721  N N   . ASN A 1 97  ? 32.596 -4.707  14.365 1.00 3.40  ? 115 ASN E N   1 
ATOM   722  C CA  . ASN A 1 97  ? 33.889 -4.379  13.805 1.00 10.74 ? 115 ASN E CA  1 
ATOM   723  C C   . ASN A 1 97  ? 33.966 -2.876  13.712 1.00 14.13 ? 115 ASN E C   1 
ATOM   724  O O   . ASN A 1 97  ? 33.256 -2.153  14.426 1.00 18.75 ? 115 ASN E O   1 
ATOM   725  C CB  . ASN A 1 97  ? 34.199 -5.053  12.446 1.00 5.99  ? 115 ASN E CB  1 
ATOM   726  C CG  . ASN A 1 97  ? 33.077 -4.754  11.464 1.00 22.33 ? 115 ASN E CG  1 
ATOM   727  O OD1 . ASN A 1 97  ? 32.750 -3.597  11.250 1.00 23.03 ? 115 ASN E OD1 1 
ATOM   728  N ND2 . ASN A 1 97  ? 32.561 -5.804  10.877 1.00 20.08 ? 115 ASN E ND2 1 
ATOM   729  N N   . SER A 1 98  ? 34.824 -2.453  12.834 1.00 13.28 ? 116 SER E N   1 
ATOM   730  C CA  . SER A 1 98  ? 35.037 -0.984  12.789 1.00 47.51 ? 116 SER E CA  1 
ATOM   731  C C   . SER A 1 98  ? 33.946 -0.226  12.005 1.00 24.38 ? 116 SER E C   1 
ATOM   732  O O   . SER A 1 98  ? 33.541 0.860   12.403 1.00 24.15 ? 116 SER E O   1 
ATOM   733  C CB  . SER A 1 98  ? 36.399 -0.753  12.135 1.00 24.27 ? 116 SER E CB  1 
ATOM   734  O OG  . SER A 1 98  ? 36.348 -1.400  10.852 1.00 38.49 ? 116 SER E OG  1 
ATOM   735  N N   . ARG A 1 99  ? 33.266 -0.943  11.166 1.00 15.37 ? 117 ARG E N   1 
ATOM   736  C CA  . ARG A 1 99  ? 32.085 -0.466  10.425 1.00 34.21 ? 117 ARG E CA  1 
ATOM   737  C C   . ARG A 1 99  ? 30.769 -0.730  11.153 1.00 23.36 ? 117 ARG E C   1 
ATOM   738  O O   . ARG A 1 99  ? 29.750 -0.201  10.706 1.00 21.08 ? 117 ARG E O   1 
ATOM   739  C CB  . ARG A 1 99  ? 32.132 -1.055  8.979  1.00 20.69 ? 117 ARG E CB  1 
ATOM   740  C CG  . ARG A 1 99  ? 33.443 -0.452  8.396  1.00 36.27 ? 117 ARG E CG  1 
ATOM   741  C CD  . ARG A 1 99  ? 34.009 -1.022  7.095  1.00 36.71 ? 117 ARG E CD  1 
ATOM   742  N NE  . ARG A 1 99  ? 35.265 -0.285  6.812  1.00 56.06 ? 117 ARG E NE  1 
ATOM   743  C CZ  . ARG A 1 99  ? 36.278 -0.603  5.984  1.00 75.33 ? 117 ARG E CZ  1 
ATOM   744  N NH1 . ARG A 1 99  ? 36.257 -1.653  5.174  1.00 51.49 ? 117 ARG E NH1 1 
ATOM   745  N NH2 . ARG A 1 99  ? 37.295 0.238   5.856  1.00 49.19 ? 117 ARG E NH2 1 
ATOM   746  N N   . VAL A 1 100 ? 30.757 -1.676  12.123 1.00 14.05 ? 118 VAL E N   1 
ATOM   747  C CA  . VAL A 1 100 ? 29.523 -2.123  12.725 1.00 3.00  ? 118 VAL E CA  1 
ATOM   748  C C   . VAL A 1 100 ? 29.637 -2.038  14.235 1.00 8.48  ? 118 VAL E C   1 
ATOM   749  O O   . VAL A 1 100 ? 30.442 -2.727  14.821 1.00 10.63 ? 118 VAL E O   1 
ATOM   750  C CB  . VAL A 1 100 ? 29.010 -3.472  12.219 1.00 3.00  ? 118 VAL E CB  1 
ATOM   751  C CG1 . VAL A 1 100 ? 27.679 -3.864  12.861 1.00 3.00  ? 118 VAL E CG1 1 
ATOM   752  C CG2 . VAL A 1 100 ? 28.767 -3.407  10.730 1.00 5.48  ? 118 VAL E CG2 1 
ATOM   753  N N   . ALA A 1 101 ? 29.035 -1.042  14.842 1.00 6.45  ? 119 ALA E N   1 
ATOM   754  C CA  . ALA A 1 101 ? 29.329 -0.814  16.267 1.00 5.81  ? 119 ALA E CA  1 
ATOM   755  C C   . ALA A 1 101 ? 28.040 -0.290  16.877 1.00 17.45 ? 119 ALA E C   1 
ATOM   756  O O   . ALA A 1 101 ? 27.171 0.144   16.148 1.00 5.84  ? 119 ALA E O   1 
ATOM   757  C CB  . ALA A 1 101 ? 30.400 0.270   16.368 1.00 15.66 ? 119 ALA E CB  1 
ATOM   758  N N   . SER A 1 102 ? 27.867 -0.472  18.134 1.00 11.21 ? 120 SER E N   1 
ATOM   759  C CA  . SER A 1 102 ? 26.665 -0.081  18.853 1.00 7.32  ? 120 SER E CA  1 
ATOM   760  C C   . SER A 1 102 ? 26.843 1.238   19.613 1.00 13.28 ? 120 SER E C   1 
ATOM   761  O O   . SER A 1 102 ? 27.907 1.837   19.582 1.00 14.33 ? 120 SER E O   1 
ATOM   762  C CB  . SER A 1 102 ? 26.317 -1.182  19.863 1.00 5.52  ? 120 SER E CB  1 
ATOM   763  O OG  . SER A 1 102 ? 27.458 -1.543  20.623 1.00 21.53 ? 120 SER E OG  1 
ATOM   764  N N   . ILE A 1 103 ? 25.739 1.881   19.845 1.00 3.46  ? 121 ILE E N   1 
ATOM   765  C CA  . ILE A 1 103 ? 25.690 3.253   20.363 1.00 11.70 ? 121 ILE E CA  1 
ATOM   766  C C   . ILE A 1 103 ? 25.221 3.147   21.819 1.00 19.13 ? 121 ILE E C   1 
ATOM   767  O O   . ILE A 1 103 ? 24.431 2.270   22.165 1.00 14.70 ? 121 ILE E O   1 
ATOM   768  C CB  . ILE A 1 103 ? 24.681 4.103   19.519 1.00 4.50  ? 121 ILE E CB  1 
ATOM   769  C CG1 . ILE A 1 103 ? 24.676 5.557   19.974 1.00 3.00  ? 121 ILE E CG1 1 
ATOM   770  C CG2 . ILE A 1 103 ? 23.262 3.492   19.402 1.00 3.00  ? 121 ILE E CG2 1 
ATOM   771  C CD1 . ILE A 1 103 ? 26.105 6.187   19.865 1.00 6.70  ? 121 ILE E CD1 1 
ATOM   772  N N   . SER A 1 104 ? 25.740 3.971   22.688 1.00 7.42  ? 122 SER E N   1 
ATOM   773  C CA  . SER A 1 104 ? 25.321 3.830   24.092 1.00 14.27 ? 122 SER E CA  1 
ATOM   774  C C   . SER A 1 104 ? 23.943 4.440   24.292 1.00 4.85  ? 122 SER E C   1 
ATOM   775  O O   . SER A 1 104 ? 23.614 5.480   23.668 1.00 10.89 ? 122 SER E O   1 
ATOM   776  C CB  . SER A 1 104 ? 26.298 4.693   24.992 1.00 14.88 ? 122 SER E CB  1 
ATOM   777  O OG  . SER A 1 104 ? 27.566 4.023   25.015 1.00 29.85 ? 122 SER E OG  1 
ATOM   778  N N   . LEU A 1 105 ? 23.402 3.979   25.390 1.00 6.93  ? 123 LEU E N   1 
ATOM   779  C CA  . LEU A 1 105 ? 22.159 4.506   25.955 1.00 4.66  ? 123 LEU E CA  1 
ATOM   780  C C   . LEU A 1 105 ? 22.493 5.643   26.902 1.00 9.72  ? 123 LEU E C   1 
ATOM   781  O O   . LEU A 1 105 ? 23.447 5.527   27.647 1.00 12.61 ? 123 LEU E O   1 
ATOM   782  C CB  . LEU A 1 105 ? 21.354 3.434   26.721 1.00 6.20  ? 123 LEU E CB  1 
ATOM   783  C CG  . LEU A 1 105 ? 20.719 2.366   25.791 1.00 30.36 ? 123 LEU E CG  1 
ATOM   784  C CD1 . LEU A 1 105 ? 19.954 1.245   26.548 1.00 23.49 ? 123 LEU E CD1 1 
ATOM   785  C CD2 . LEU A 1 105 ? 19.808 3.021   24.722 1.00 20.46 ? 123 LEU E CD2 1 
ATOM   786  N N   . PRO A 1 106 ? 21.634 6.670   26.972 1.00 22.57 ? 124 PRO E N   1 
ATOM   787  C CA  . PRO A 1 106 ? 21.900 7.812   27.845 1.00 18.79 ? 124 PRO E CA  1 
ATOM   788  C C   . PRO A 1 106 ? 21.664 7.472   29.325 1.00 21.33 ? 124 PRO E C   1 
ATOM   789  O O   . PRO A 1 106 ? 20.721 6.757   29.644 1.00 16.14 ? 124 PRO E O   1 
ATOM   790  C CB  . PRO A 1 106 ? 20.916 8.871   27.294 1.00 10.05 ? 124 PRO E CB  1 
ATOM   791  C CG  . PRO A 1 106 ? 19.713 8.111   26.820 1.00 3.00  ? 124 PRO E CG  1 
ATOM   792  C CD  . PRO A 1 106 ? 20.350 6.814   26.288 1.00 6.04  ? 124 PRO E CD  1 
ATOM   793  N N   . THR A 1 107 ? 22.359 8.194   30.198 1.00 17.66 ? 125 THR E N   1 
ATOM   794  C CA  . THR A 1 107 ? 22.107 8.147   31.629 1.00 21.23 ? 125 THR E CA  1 
ATOM   795  C C   . THR A 1 107 ? 21.291 9.349   32.060 1.00 24.36 ? 125 THR E C   1 
ATOM   796  O O   . THR A 1 107 ? 20.468 9.249   32.959 1.00 39.74 ? 125 THR E O   1 
ATOM   797  C CB  . THR A 1 107 ? 23.451 8.103   32.425 1.00 32.81 ? 125 THR E CB  1 
ATOM   798  O OG1 . THR A 1 107 ? 24.157 9.330   32.288 1.00 33.20 ? 125 THR E OG1 1 
ATOM   799  C CG2 . THR A 1 107 ? 24.407 7.020   31.921 1.00 15.44 ? 125 THR E CG2 1 
ATOM   800  N N   . SER A 1 108 ? 21.323 10.400  31.317 1.00 15.69 ? 127 SER E N   1 
ATOM   801  C CA  . SER A 1 108 ? 20.254 11.432  31.574 1.00 19.51 ? 127 SER E CA  1 
ATOM   802  C C   . SER A 1 108 ? 19.774 12.031  30.256 1.00 10.38 ? 127 SER E C   1 
ATOM   803  O O   . SER A 1 108 ? 20.371 11.679  29.232 1.00 19.77 ? 127 SER E O   1 
ATOM   804  C CB  . SER A 1 108 ? 20.805 12.590  32.423 1.00 20.11 ? 127 SER E CB  1 
ATOM   805  O OG  . SER A 1 108 ? 22.003 13.012  31.803 1.00 36.51 ? 127 SER E OG  1 
ATOM   806  N N   . CYS A 1 109 ? 18.664 12.791  30.308 1.00 6.91  ? 128 CYS E N   1 
ATOM   807  C CA  . CYS A 1 109 ? 18.048 13.398  29.125 1.00 3.00  ? 128 CYS E CA  1 
ATOM   808  C C   . CYS A 1 109 ? 18.942 14.574  28.762 1.00 11.66 ? 128 CYS E C   1 
ATOM   809  O O   . CYS A 1 109 ? 19.580 15.109  29.643 1.00 21.94 ? 128 CYS E O   1 
ATOM   810  C CB  . CYS A 1 109 ? 16.706 13.979  29.541 1.00 3.00  ? 128 CYS E CB  1 
ATOM   811  S SG  . CYS A 1 109 ? 15.623 12.659  30.091 1.00 17.25 ? 128 CYS E SG  1 
ATOM   812  N N   . ALA A 1 110 ? 18.864 15.010  27.561 1.00 11.13 ? 129 ALA E N   1 
ATOM   813  C CA  . ALA A 1 110 ? 19.668 16.097  27.076 1.00 11.02 ? 129 ALA E CA  1 
ATOM   814  C C   . ALA A 1 110 ? 18.872 17.373  27.024 1.00 13.44 ? 129 ALA E C   1 
ATOM   815  O O   . ALA A 1 110 ? 17.656 17.302  26.950 1.00 22.03 ? 129 ALA E O   1 
ATOM   816  C CB  . ALA A 1 110 ? 20.030 15.738  25.633 1.00 10.58 ? 129 ALA E CB  1 
ATOM   817  N N   . SER A 1 111 ? 19.591 18.490  27.137 1.00 7.85  ? 130 SER E N   1 
ATOM   818  C CA  . SER A 1 111 ? 18.961 19.772  27.322 1.00 15.82 ? 130 SER E CA  1 
ATOM   819  C C   . SER A 1 111 ? 18.819 20.510  26.000 1.00 3.74  ? 130 SER E C   1 
ATOM   820  O O   . SER A 1 111 ? 19.605 20.322  25.066 1.00 7.07  ? 130 SER E O   1 
ATOM   821  C CB  . SER A 1 111 ? 19.733 20.642  28.373 1.00 19.36 ? 130 SER E CB  1 
ATOM   822  O OG  . SER A 1 111 ? 21.084 20.947  27.936 1.00 41.34 ? 130 SER E OG  1 
ATOM   823  N N   . ALA A 1 112 ? 17.963 21.461  26.105 1.00 3.00  ? 132 ALA E N   1 
ATOM   824  C CA  . ALA A 1 112 ? 17.596 22.304  25.005 1.00 4.72  ? 132 ALA E CA  1 
ATOM   825  C C   . ALA A 1 112 ? 18.842 23.068  24.567 1.00 18.21 ? 132 ALA E C   1 
ATOM   826  O O   . ALA A 1 112 ? 19.633 23.366  25.422 1.00 4.48  ? 132 ALA E O   1 
ATOM   827  C CB  . ALA A 1 112 ? 16.434 23.281  25.411 1.00 6.69  ? 132 ALA E CB  1 
ATOM   828  N N   . GLY A 1 113 ? 19.144 23.148  23.299 1.00 18.06 ? 133 GLY E N   1 
ATOM   829  C CA  . GLY A 1 113 ? 20.367 23.797  22.819 1.00 5.18  ? 133 GLY E CA  1 
ATOM   830  C C   . GLY A 1 113 ? 21.481 22.815  22.475 1.00 3.00  ? 133 GLY E C   1 
ATOM   831  O O   . GLY A 1 113 ? 22.486 23.250  21.947 1.00 4.14  ? 133 GLY E O   1 
ATOM   832  N N   . THR A 1 114 ? 21.403 21.608  22.937 1.00 6.69  ? 134 THR E N   1 
ATOM   833  C CA  . THR A 1 114 ? 22.457 20.639  22.678 1.00 9.80  ? 134 THR E CA  1 
ATOM   834  C C   . THR A 1 114 ? 22.417 20.102  21.253 1.00 8.77  ? 134 THR E C   1 
ATOM   835  O O   . THR A 1 114 ? 21.369 19.776  20.723 1.00 4.39  ? 134 THR E O   1 
ATOM   836  C CB  . THR A 1 114 ? 22.277 19.451  23.611 1.00 5.69  ? 134 THR E CB  1 
ATOM   837  O OG1 . THR A 1 114 ? 22.279 19.917  24.965 1.00 13.26 ? 134 THR E OG1 1 
ATOM   838  C CG2 . THR A 1 114 ? 23.314 18.305  23.325 1.00 7.93  ? 134 THR E CG2 1 
ATOM   839  N N   . GLN A 1 115 ? 23.528 20.235  20.625 1.00 3.00  ? 135 GLN E N   1 
ATOM   840  C CA  . GLN A 1 115 ? 23.669 19.878  19.233 1.00 8.65  ? 135 GLN E CA  1 
ATOM   841  C C   . GLN A 1 115 ? 23.741 18.344  19.061 1.00 17.81 ? 135 GLN E C   1 
ATOM   842  O O   . GLN A 1 115 ? 24.405 17.650  19.807 1.00 12.17 ? 135 GLN E O   1 
ATOM   843  C CB  . GLN A 1 115 ? 24.971 20.558  18.701 1.00 10.05 ? 135 GLN E CB  1 
ATOM   844  C CG  . GLN A 1 115 ? 25.111 20.219  17.204 1.00 44.35 ? 135 GLN E CG  1 
ATOM   845  C CD  . GLN A 1 115 ? 26.512 20.536  16.680 1.00 53.29 ? 135 GLN E CD  1 
ATOM   846  O OE1 . GLN A 1 115 ? 27.458 19.749  16.821 1.00 35.74 ? 135 GLN E OE1 1 
ATOM   847  N NE2 . GLN A 1 115 ? 26.567 21.684  16.083 1.00 31.73 ? 135 GLN E NE2 1 
ATOM   848  N N   . CYS A 1 116 ? 23.003 17.779  18.141 1.00 7.41  ? 136 CYS E N   1 
ATOM   849  C CA  . CYS A 1 116 ? 22.973 16.338  17.869 1.00 6.22  ? 136 CYS E CA  1 
ATOM   850  C C   . CYS A 1 116 ? 23.183 16.018  16.358 1.00 3.03  ? 136 CYS E C   1 
ATOM   851  O O   . CYS A 1 116 ? 23.103 16.874  15.469 1.00 5.92  ? 136 CYS E O   1 
ATOM   852  C CB  . CYS A 1 116 ? 21.605 15.765  18.293 1.00 3.00  ? 136 CYS E CB  1 
ATOM   853  S SG  . CYS A 1 116 ? 21.126 16.213  19.952 1.00 10.90 ? 136 CYS E SG  1 
ATOM   854  N N   . LEU A 1 117 ? 23.477 14.770  16.103 1.00 3.00  ? 137 LEU E N   1 
ATOM   855  C CA  . LEU A 1 117 ? 23.660 14.208  14.781 1.00 6.43  ? 137 LEU E CA  1 
ATOM   856  C C   . LEU A 1 117 ? 22.437 13.337  14.488 1.00 7.60  ? 137 LEU E C   1 
ATOM   857  O O   . LEU A 1 117 ? 22.166 12.392  15.224 1.00 11.15 ? 137 LEU E O   1 
ATOM   858  C CB  . LEU A 1 117 ? 24.932 13.297  14.769 1.00 3.00  ? 137 LEU E CB  1 
ATOM   859  C CG  . LEU A 1 117 ? 25.287 12.767  13.352 1.00 3.00  ? 137 LEU E CG  1 
ATOM   860  C CD1 . LEU A 1 117 ? 25.539 13.923  12.357 1.00 13.66 ? 137 LEU E CD1 1 
ATOM   861  C CD2 . LEU A 1 117 ? 26.487 11.821  13.373 1.00 3.00  ? 137 LEU E CD2 1 
ATOM   862  N N   . ILE A 1 118 ? 21.814 13.580  13.385 1.00 3.00  ? 138 ILE E N   1 
ATOM   863  C CA  . ILE A 1 118 ? 20.712 12.796  12.828 1.00 3.00  ? 138 ILE E CA  1 
ATOM   864  C C   . ILE A 1 118 ? 21.131 12.193  11.496 1.00 7.65  ? 138 ILE E C   1 
ATOM   865  O O   . ILE A 1 118 ? 21.761 12.878  10.696 1.00 3.00  ? 138 ILE E O   1 
ATOM   866  C CB  . ILE A 1 118 ? 19.482 13.718  12.623 1.00 3.00  ? 138 ILE E CB  1 
ATOM   867  C CG1 . ILE A 1 118 ? 19.247 14.413  14.011 1.00 4.89  ? 138 ILE E CG1 1 
ATOM   868  C CG2 . ILE A 1 118 ? 18.224 12.865  12.167 1.00 3.00  ? 138 ILE E CG2 1 
ATOM   869  C CD1 . ILE A 1 118 ? 18.227 15.578  14.009 1.00 9.70  ? 138 ILE E CD1 1 
ATOM   870  N N   . SER A 1 119 ? 20.770 10.936  11.268 1.00 4.45  ? 139 SER E N   1 
ATOM   871  C CA  . SER A 1 119 ? 21.127 10.287  9.981  1.00 7.61  ? 139 SER E CA  1 
ATOM   872  C C   . SER A 1 119 ? 20.022 9.425   9.378  1.00 3.00  ? 139 SER E C   1 
ATOM   873  O O   . SER A 1 119 ? 19.127 8.950   10.083 1.00 3.00  ? 139 SER E O   1 
ATOM   874  C CB  . SER A 1 119 ? 22.421 9.464   10.126 1.00 3.00  ? 139 SER E CB  1 
ATOM   875  O OG  . SER A 1 119 ? 22.411 8.942   11.422 1.00 3.11  ? 139 SER E OG  1 
ATOM   876  N N   . GLY A 1 120 ? 20.150 9.243   8.098  1.00 3.00  ? 140 GLY E N   1 
ATOM   877  C CA  . GLY A 1 120 ? 19.253 8.322   7.440  1.00 3.00  ? 140 GLY E CA  1 
ATOM   878  C C   . GLY A 1 120 ? 19.227 8.411   5.918  1.00 3.00  ? 140 GLY E C   1 
ATOM   879  O O   . GLY A 1 120 ? 19.929 9.195   5.324  1.00 4.71  ? 140 GLY E O   1 
ATOM   880  N N   . TRP A 1 121 ? 18.504 7.519   5.270  1.00 5.66  ? 141 TRP E N   1 
ATOM   881  C CA  . TRP A 1 121 ? 18.440 7.423   3.813  1.00 3.00  ? 141 TRP E CA  1 
ATOM   882  C C   . TRP A 1 121 ? 17.095 7.996   3.381  1.00 12.86 ? 141 TRP E C   1 
ATOM   883  O O   . TRP A 1 121 ? 16.586 7.658   2.326  1.00 6.68  ? 141 TRP E O   1 
ATOM   884  C CB  . TRP A 1 121 ? 18.521 5.902   3.422  1.00 3.00  ? 141 TRP E CB  1 
ATOM   885  C CG  . TRP A 1 121 ? 19.967 5.364   3.579  1.00 12.55 ? 141 TRP E CG  1 
ATOM   886  C CD1 . TRP A 1 121 ? 21.030 5.563   2.715  1.00 3.00  ? 141 TRP E CD1 1 
ATOM   887  C CD2 . TRP A 1 121 ? 20.496 4.611   4.651  1.00 10.85 ? 141 TRP E CD2 1 
ATOM   888  N NE1 . TRP A 1 121 ? 22.144 4.832   3.165  1.00 8.82  ? 141 TRP E NE1 1 
ATOM   889  C CE2 . TRP A 1 121 ? 21.836 4.232   4.262  1.00 9.44  ? 141 TRP E CE2 1 
ATOM   890  C CE3 . TRP A 1 121 ? 19.926 4.164   5.858  1.00 3.00  ? 141 TRP E CE3 1 
ATOM   891  C CZ2 . TRP A 1 121 ? 22.615 3.367   5.033  1.00 3.09  ? 141 TRP E CZ2 1 
ATOM   892  C CZ3 . TRP A 1 121 ? 20.709 3.257   6.651  1.00 3.00  ? 141 TRP E CZ3 1 
ATOM   893  C CH2 . TRP A 1 121 ? 22.008 2.853   6.260  1.00 6.71  ? 141 TRP E CH2 1 
ATOM   894  N N   . GLY A 1 122 ? 16.525 8.892   4.144  1.00 3.00  ? 142 GLY E N   1 
ATOM   895  C CA  . GLY A 1 122 ? 15.226 9.372   3.665  1.00 3.00  ? 142 GLY E CA  1 
ATOM   896  C C   . GLY A 1 122 ? 15.310 10.566  2.721  1.00 3.00  ? 142 GLY E C   1 
ATOM   897  O O   . GLY A 1 122 ? 16.398 10.931  2.250  1.00 3.00  ? 142 GLY E O   1 
ATOM   898  N N   . ASN A 1 123 ? 14.112 11.002  2.327  1.00 3.00  ? 143 ASN E N   1 
ATOM   899  C CA  . ASN A 1 123 ? 13.926 12.035  1.339  1.00 3.00  ? 143 ASN E CA  1 
ATOM   900  C C   . ASN A 1 123 ? 14.784 13.271  1.672  1.00 3.68  ? 143 ASN E C   1 
ATOM   901  O O   . ASN A 1 123 ? 14.877 13.720  2.830  1.00 4.29  ? 143 ASN E O   1 
ATOM   902  C CB  . ASN A 1 123 ? 12.421 12.375  1.371  1.00 3.35  ? 143 ASN E CB  1 
ATOM   903  C CG  . ASN A 1 123 ? 12.010 13.244  0.167  1.00 6.46  ? 143 ASN E CG  1 
ATOM   904  O OD1 . ASN A 1 123 ? 12.830 13.648  -0.649 1.00 9.66  ? 143 ASN E OD1 1 
ATOM   905  N ND2 . ASN A 1 123 ? 10.736 13.497  0.069  1.00 9.44  ? 143 ASN E ND2 1 
ATOM   906  N N   . THR A 1 124 ? 15.509 13.771  0.646  1.00 3.00  ? 144 THR E N   1 
ATOM   907  C CA  . THR A 1 124 ? 16.276 14.997  0.806  1.00 6.49  ? 144 THR E CA  1 
ATOM   908  C C   . THR A 1 124 ? 15.557 16.252  0.255  1.00 9.49  ? 144 THR E C   1 
ATOM   909  O O   . THR A 1 124 ? 16.173 17.315  0.172  1.00 4.97  ? 144 THR E O   1 
ATOM   910  C CB  . THR A 1 124 ? 17.688 14.796  0.160  1.00 11.58 ? 144 THR E CB  1 
ATOM   911  O OG1 . THR A 1 124 ? 17.538 14.649  -1.235 1.00 11.20 ? 144 THR E OG1 1 
ATOM   912  C CG2 . THR A 1 124 ? 18.361 13.519  0.696  1.00 3.00  ? 144 THR E CG2 1 
ATOM   913  N N   . LYS A 1 125 ? 14.287 16.147  -0.229 1.00 8.29  ? 145 LYS E N   1 
ATOM   914  C CA  . LYS A 1 125 ? 13.621 17.389  -0.696 1.00 10.88 ? 145 LYS E CA  1 
ATOM   915  C C   . LYS A 1 125 ? 12.503 17.717  0.258  1.00 6.32  ? 145 LYS E C   1 
ATOM   916  O O   . LYS A 1 125 ? 11.750 16.809  0.581  1.00 9.70  ? 145 LYS E O   1 
ATOM   917  C CB  . LYS A 1 125 ? 12.851 17.218  -2.053 1.00 10.93 ? 145 LYS E CB  1 
ATOM   918  C CG  . LYS A 1 125 ? 13.856 16.854  -3.159 1.00 18.70 ? 145 LYS E CG  1 
ATOM   919  C CD  . LYS A 1 125 ? 15.151 17.656  -2.976 1.00 15.21 ? 145 LYS E CD  1 
ATOM   920  C CE  . LYS A 1 125 ? 16.257 17.218  -3.951 0.00 20.00 ? 145 LYS E CE  1 
ATOM   921  N NZ  . LYS A 1 125 ? 17.524 17.864  -3.589 0.00 20.00 ? 145 LYS E NZ  1 
ATOM   922  N N   . SER A 1 126 ? 12.265 18.978  0.469  1.00 12.86 ? 146 SER E N   1 
ATOM   923  C CA  . SER A 1 126 ? 11.138 19.347  1.314  1.00 20.32 ? 146 SER E CA  1 
ATOM   924  C C   . SER A 1 126 ? 9.960  19.672  0.409  1.00 38.93 ? 146 SER E C   1 
ATOM   925  O O   . SER A 1 126 ? 8.848  19.639  0.889  1.00 38.16 ? 146 SER E O   1 
ATOM   926  C CB  . SER A 1 126 ? 11.430 20.654  2.065  1.00 34.46 ? 146 SER E CB  1 
ATOM   927  O OG  . SER A 1 126 ? 11.744 21.704  1.112  1.00 32.18 ? 146 SER E OG  1 
ATOM   928  N N   . SER A 1 127 ? 10.189 19.741  -0.867 1.00 42.45 ? 147 SER E N   1 
ATOM   929  C CA  . SER A 1 127 ? 9.064  19.630  -1.812 1.00 47.83 ? 147 SER E CA  1 
ATOM   930  C C   . SER A 1 127 ? 9.470  18.617  -2.843 1.00 31.74 ? 147 SER E C   1 
ATOM   931  O O   . SER A 1 127 ? 10.555 18.680  -3.422 1.00 38.80 ? 147 SER E O   1 
ATOM   932  C CB  . SER A 1 127 ? 8.766  20.939  -2.578 1.00 37.86 ? 147 SER E CB  1 
ATOM   933  O OG  . SER A 1 127 ? 8.396  21.962  -1.642 0.00 42.86 ? 147 SER E OG  1 
ATOM   934  N N   . GLY A 1 128 ? 8.664  17.654  -3.020 1.00 30.22 ? 148 GLY E N   1 
ATOM   935  C CA  . GLY A 1 128 ? 9.174  16.681  -3.983 1.00 39.48 ? 148 GLY E CA  1 
ATOM   936  C C   . GLY A 1 128 ? 9.925  15.546  -3.301 1.00 27.65 ? 148 GLY E C   1 
ATOM   937  O O   . GLY A 1 128 ? 9.760  15.238  -2.116 1.00 31.22 ? 148 GLY E O   1 
ATOM   938  N N   . THR A 1 129 ? 10.512 14.795  -4.159 1.00 24.93 ? 149 THR E N   1 
ATOM   939  C CA  . THR A 1 129 ? 10.981 13.478  -3.755 1.00 27.12 ? 149 THR E CA  1 
ATOM   940  C C   . THR A 1 129 ? 12.368 13.363  -4.334 1.00 26.35 ? 149 THR E C   1 
ATOM   941  O O   . THR A 1 129 ? 12.520 13.552  -5.526 1.00 20.74 ? 149 THR E O   1 
ATOM   942  C CB  . THR A 1 129 ? 10.023 12.428  -4.409 1.00 27.98 ? 149 THR E CB  1 
ATOM   943  O OG1 . THR A 1 129 ? 8.919  12.082  -3.522 1.00 29.02 ? 149 THR E OG1 1 
ATOM   944  C CG2 . THR A 1 129 ? 10.725 11.149  -4.845 1.00 32.66 ? 149 THR E CG2 1 
ATOM   945  N N   . SER A 1 130 ? 13.321 13.056  -3.501 1.00 7.27  ? 150 SER E N   1 
ATOM   946  C CA  . SER A 1 130 ? 14.566 12.598  -4.004 1.00 3.00  ? 150 SER E CA  1 
ATOM   947  C C   . SER A 1 130 ? 15.188 11.727  -2.924 1.00 15.64 ? 150 SER E C   1 
ATOM   948  O O   . SER A 1 130 ? 15.578 12.261  -1.905 1.00 14.11 ? 150 SER E O   1 
ATOM   949  C CB  . SER A 1 130 ? 15.380 13.853  -4.178 1.00 3.00  ? 150 SER E CB  1 
ATOM   950  O OG  . SER A 1 130 ? 16.683 13.406  -4.551 1.00 23.91 ? 150 SER E OG  1 
ATOM   951  N N   . TYR A 1 131 ? 15.309 10.451  -3.152 1.00 3.31  ? 151 TYR E N   1 
ATOM   952  C CA  . TYR A 1 131 ? 15.786 9.499   -2.202 1.00 3.00  ? 151 TYR E CA  1 
ATOM   953  C C   . TYR A 1 131 ? 17.191 9.057   -2.525 1.00 12.64 ? 151 TYR E C   1 
ATOM   954  O O   . TYR A 1 131 ? 17.460 8.730   -3.675 1.00 12.36 ? 151 TYR E O   1 
ATOM   955  C CB  . TYR A 1 131 ? 14.918 8.263   -2.354 1.00 3.00  ? 151 TYR E CB  1 
ATOM   956  C CG  . TYR A 1 131 ? 13.537 8.623   -1.779 1.00 12.12 ? 151 TYR E CG  1 
ATOM   957  C CD1 . TYR A 1 131 ? 13.444 8.706   -0.425 1.00 11.29 ? 151 TYR E CD1 1 
ATOM   958  C CD2 . TYR A 1 131 ? 12.431 8.895   -2.552 1.00 17.45 ? 151 TYR E CD2 1 
ATOM   959  C CE1 . TYR A 1 131 ? 12.243 8.994   0.180  1.00 28.81 ? 151 TYR E CE1 1 
ATOM   960  C CE2 . TYR A 1 131 ? 11.194 9.199   -1.937 1.00 10.78 ? 151 TYR E CE2 1 
ATOM   961  C CZ  . TYR A 1 131 ? 11.123 9.210   -0.566 1.00 21.67 ? 151 TYR E CZ  1 
ATOM   962  O OH  . TYR A 1 131 ? 9.921  9.372   0.097  1.00 41.42 ? 151 TYR E OH  1 
ATOM   963  N N   . PRO A 1 132 ? 18.057 9.235   -1.551 1.00 11.88 ? 152 PRO E N   1 
ATOM   964  C CA  . PRO A 1 132 ? 19.477 9.117   -1.826 1.00 6.70  ? 152 PRO E CA  1 
ATOM   965  C C   . PRO A 1 132 ? 19.973 7.659   -1.782 1.00 3.00  ? 152 PRO E C   1 
ATOM   966  O O   . PRO A 1 132 ? 19.348 6.753   -1.229 1.00 5.01  ? 152 PRO E O   1 
ATOM   967  C CB  . PRO A 1 132 ? 20.090 9.933   -0.696 1.00 12.85 ? 152 PRO E CB  1 
ATOM   968  C CG  . PRO A 1 132 ? 19.094 9.799   0.478  1.00 3.00  ? 152 PRO E CG  1 
ATOM   969  C CD  . PRO A 1 132 ? 17.761 9.754   -0.186 1.00 3.00  ? 152 PRO E CD  1 
ATOM   970  N N   . ASP A 1 133 ? 21.105 7.476   -2.368 1.00 3.00  ? 153 ASP E N   1 
ATOM   971  C CA  . ASP A 1 133 ? 21.825 6.197   -2.432 1.00 6.31  ? 153 ASP E CA  1 
ATOM   972  C C   . ASP A 1 133 ? 22.646 5.945   -1.178 1.00 21.35 ? 153 ASP E C   1 
ATOM   973  O O   . ASP A 1 133 ? 22.652 4.801   -0.727 1.00 15.12 ? 153 ASP E O   1 
ATOM   974  C CB  . ASP A 1 133 ? 22.736 6.155   -3.709 1.00 16.30 ? 153 ASP E CB  1 
ATOM   975  C CG  . ASP A 1 133 ? 21.885 5.499   -4.785 1.00 64.82 ? 153 ASP E CG  1 
ATOM   976  O OD1 . ASP A 1 133 ? 20.652 5.746   -4.877 1.00 53.59 ? 153 ASP E OD1 1 
ATOM   977  O OD2 . ASP A 1 133 ? 22.394 4.677   -5.580 1.00 59.19 ? 153 ASP E OD2 1 
ATOM   978  N N   . VAL A 1 134 ? 23.283 7.023   -0.703 1.00 10.22 ? 154 VAL E N   1 
ATOM   979  C CA  . VAL A 1 134 ? 24.179 7.093   0.427  1.00 4.79  ? 154 VAL E CA  1 
ATOM   980  C C   . VAL A 1 134 ? 23.646 7.869   1.666  1.00 3.00  ? 154 VAL E C   1 
ATOM   981  O O   . VAL A 1 134 ? 22.679 8.601   1.612  1.00 3.00  ? 154 VAL E O   1 
ATOM   982  C CB  . VAL A 1 134 ? 25.624 7.500   0.016  1.00 5.67  ? 154 VAL E CB  1 
ATOM   983  C CG1 . VAL A 1 134 ? 26.339 6.553   -0.988 1.00 10.82 ? 154 VAL E CG1 1 
ATOM   984  C CG2 . VAL A 1 134 ? 25.804 8.987   -0.337 1.00 8.17  ? 154 VAL E CG2 1 
ATOM   985  N N   . LEU A 1 135 ? 24.169 7.472   2.819  1.00 6.31  ? 155 LEU E N   1 
ATOM   986  C CA  . LEU A 1 135 ? 23.611 7.854   4.122  1.00 3.00  ? 155 LEU E CA  1 
ATOM   987  C C   . LEU A 1 135 ? 23.919 9.331   4.276  1.00 7.63  ? 155 LEU E C   1 
ATOM   988  O O   . LEU A 1 135 ? 25.019 9.812   3.944  1.00 6.87  ? 155 LEU E O   1 
ATOM   989  C CB  . LEU A 1 135 ? 24.347 7.026   5.186  1.00 3.00  ? 155 LEU E CB  1 
ATOM   990  C CG  . LEU A 1 135 ? 23.818 7.341   6.626  1.00 3.00  ? 155 LEU E CG  1 
ATOM   991  C CD1 . LEU A 1 135 ? 22.378 6.867   6.767  1.00 3.00  ? 155 LEU E CD1 1 
ATOM   992  C CD2 . LEU A 1 135 ? 24.667 6.587   7.658  1.00 3.00  ? 155 LEU E CD2 1 
ATOM   993  N N   . LYS A 1 136 ? 22.903 10.072  4.670  1.00 3.70  ? 156 LYS E N   1 
ATOM   994  C CA  . LYS A 1 136 ? 23.100 11.540  4.906  1.00 5.08  ? 156 LYS E CA  1 
ATOM   995  C C   . LYS A 1 136 ? 23.046 11.842  6.418  1.00 15.07 ? 156 LYS E C   1 
ATOM   996  O O   . LYS A 1 136 ? 22.454 11.015  7.130  1.00 3.00  ? 156 LYS E O   1 
ATOM   997  C CB  . LYS A 1 136 ? 21.922 12.260  4.186  1.00 3.00  ? 156 LYS E CB  1 
ATOM   998  C CG  . LYS A 1 136 ? 21.860 11.970  2.675  1.00 3.00  ? 156 LYS E CG  1 
ATOM   999  C CD  . LYS A 1 136 ? 23.081 12.642  1.967  1.00 3.00  ? 156 LYS E CD  1 
ATOM   1000 C CE  . LYS A 1 136 ? 23.182 12.065  0.550  1.00 5.34  ? 156 LYS E CE  1 
ATOM   1001 N NZ  . LYS A 1 136 ? 24.424 12.479  -0.115 1.00 3.00  ? 156 LYS E NZ  1 
ATOM   1002 N N   . CYS A 1 137 ? 23.686 12.973  6.825  1.00 3.00  ? 157 CYS E N   1 
ATOM   1003 C CA  . CYS A 1 137 ? 23.857 13.404  8.195  1.00 3.00  ? 157 CYS E CA  1 
ATOM   1004 C C   . CYS A 1 137 ? 23.366 14.839  8.370  1.00 3.76  ? 157 CYS E C   1 
ATOM   1005 O O   . CYS A 1 137 ? 23.445 15.621  7.431  1.00 3.00  ? 157 CYS E O   1 
ATOM   1006 C CB  . CYS A 1 137 ? 25.317 13.355  8.498  1.00 3.00  ? 157 CYS E CB  1 
ATOM   1007 S SG  . CYS A 1 137 ? 25.784 11.759  9.079  1.00 4.26  ? 157 CYS E SG  1 
ATOM   1008 N N   . LEU A 1 138 ? 23.002 15.193  9.567  1.00 3.00  ? 158 LEU E N   1 
ATOM   1009 C CA  . LEU A 1 138 ? 22.587 16.570  9.807  1.00 3.00  ? 158 LEU E CA  1 
ATOM   1010 C C   . LEU A 1 138 ? 22.899 16.892  11.245 1.00 4.52  ? 158 LEU E C   1 
ATOM   1011 O O   . LEU A 1 138 ? 22.474 16.145  12.117 1.00 3.00  ? 158 LEU E O   1 
ATOM   1012 C CB  . LEU A 1 138 ? 21.015 16.624  9.703  1.00 5.00  ? 158 LEU E CB  1 
ATOM   1013 C CG  . LEU A 1 138 ? 20.323 17.996  9.994  1.00 4.45  ? 158 LEU E CG  1 
ATOM   1014 C CD1 . LEU A 1 138 ? 20.858 19.180  9.181  1.00 3.00  ? 158 LEU E CD1 1 
ATOM   1015 C CD2 . LEU A 1 138 ? 18.757 17.816  9.989  1.00 3.00  ? 158 LEU E CD2 1 
ATOM   1016 N N   . LYS A 1 139 ? 23.411 18.066  11.466 1.00 3.00  ? 159 LYS E N   1 
ATOM   1017 C CA  . LYS A 1 139 ? 23.558 18.461  12.855 1.00 4.11  ? 159 LYS E CA  1 
ATOM   1018 C C   . LYS A 1 139 ? 22.447 19.437  13.197 1.00 3.87  ? 159 LYS E C   1 
ATOM   1019 O O   . LYS A 1 139 ? 22.128 20.264  12.356 1.00 6.23  ? 159 LYS E O   1 
ATOM   1020 C CB  . LYS A 1 139 ? 24.926 19.135  13.108 1.00 7.96  ? 159 LYS E CB  1 
ATOM   1021 C CG  . LYS A 1 139 ? 26.042 18.067  12.983 1.00 6.51  ? 159 LYS E CG  1 
ATOM   1022 C CD  . LYS A 1 139 ? 27.405 18.710  12.882 1.00 30.87 ? 159 LYS E CD  1 
ATOM   1023 C CE  . LYS A 1 139 ? 28.489 17.658  12.621 1.00 39.92 ? 159 LYS E CE  1 
ATOM   1024 N NZ  . LYS A 1 139 ? 29.682 18.382  12.164 1.00 43.69 ? 159 LYS E NZ  1 
ATOM   1025 N N   . ALA A 1 140 ? 21.819 19.222  14.321 1.00 5.03  ? 160 ALA E N   1 
ATOM   1026 C CA  . ALA A 1 140 ? 20.621 19.997  14.644 1.00 5.58  ? 160 ALA E CA  1 
ATOM   1027 C C   . ALA A 1 140 ? 20.509 20.099  16.180 1.00 15.48 ? 160 ALA E C   1 
ATOM   1028 O O   . ALA A 1 140 ? 20.797 19.096  16.816 1.00 3.43  ? 160 ALA E O   1 
ATOM   1029 C CB  . ALA A 1 140 ? 19.429 19.173  14.113 1.00 3.00  ? 160 ALA E CB  1 
ATOM   1030 N N   . PRO A 1 141 ? 20.049 21.235  16.783 1.00 15.64 ? 161 PRO E N   1 
ATOM   1031 C CA  . PRO A 1 141 ? 19.939 21.396  18.256 1.00 8.03  ? 161 PRO E CA  1 
ATOM   1032 C C   . PRO A 1 141 ? 18.591 20.926  18.750 1.00 13.75 ? 161 PRO E C   1 
ATOM   1033 O O   . PRO A 1 141 ? 17.626 20.982  17.983 1.00 3.00  ? 161 PRO E O   1 
ATOM   1034 C CB  . PRO A 1 141 ? 20.096 22.937  18.511 1.00 3.00  ? 161 PRO E CB  1 
ATOM   1035 C CG  . PRO A 1 141 ? 19.341 23.487  17.299 1.00 11.52 ? 161 PRO E CG  1 
ATOM   1036 C CD  . PRO A 1 141 ? 19.623 22.502  16.124 1.00 13.87 ? 161 PRO E CD  1 
ATOM   1037 N N   . ILE A 1 142 ? 18.593 20.436  20.004 1.00 9.73  ? 162 ILE E N   1 
ATOM   1038 C CA  . ILE A 1 142 ? 17.323 20.162  20.713 1.00 22.94 ? 162 ILE E CA  1 
ATOM   1039 C C   . ILE A 1 142 ? 16.644 21.504  21.005 1.00 18.95 ? 162 ILE E C   1 
ATOM   1040 O O   . ILE A 1 142 ? 17.322 22.484  21.270 1.00 7.21  ? 162 ILE E O   1 
ATOM   1041 C CB  . ILE A 1 142 ? 17.530 19.306  21.996 1.00 15.33 ? 162 ILE E CB  1 
ATOM   1042 C CG1 . ILE A 1 142 ? 18.038 17.912  21.584 1.00 3.20  ? 162 ILE E CG1 1 
ATOM   1043 C CG2 . ILE A 1 142 ? 16.227 19.108  22.841 1.00 3.00  ? 162 ILE E CG2 1 
ATOM   1044 C CD1 . ILE A 1 142 ? 18.507 17.026  22.731 1.00 6.34  ? 162 ILE E CD1 1 
ATOM   1045 N N   . LEU A 1 143 ? 15.377 21.622  20.690 1.00 3.29  ? 163 LEU E N   1 
ATOM   1046 C CA  . LEU A 1 143 ? 14.740 22.922  20.884 1.00 3.00  ? 163 LEU E CA  1 
ATOM   1047 C C   . LEU A 1 143 ? 14.003 22.853  22.229 1.00 6.10  ? 163 LEU E C   1 
ATOM   1048 O O   . LEU A 1 143 ? 13.647 21.771  22.711 1.00 3.00  ? 163 LEU E O   1 
ATOM   1049 C CB  . LEU A 1 143 ? 13.672 23.030  19.791 1.00 8.22  ? 163 LEU E CB  1 
ATOM   1050 C CG  . LEU A 1 143 ? 14.215 23.201  18.349 1.00 7.91  ? 163 LEU E CG  1 
ATOM   1051 C CD1 . LEU A 1 143 ? 13.009 23.123  17.376 1.00 12.99 ? 163 LEU E CD1 1 
ATOM   1052 C CD2 . LEU A 1 143 ? 14.813 24.609  18.229 1.00 6.14  ? 163 LEU E CD2 1 
ATOM   1053 N N   . SER A 1 144 ? 13.605 24.009  22.686 1.00 11.22 ? 164 SER E N   1 
ATOM   1054 C CA  . SER A 1 144 ? 12.891 24.017  23.957 1.00 15.20 ? 164 SER E CA  1 
ATOM   1055 C C   . SER A 1 144 ? 11.545 23.297  23.933 1.00 12.79 ? 164 SER E C   1 
ATOM   1056 O O   . SER A 1 144 ? 10.890 23.285  22.895 1.00 9.07  ? 164 SER E O   1 
ATOM   1057 C CB  . SER A 1 144 ? 12.681 25.477  24.350 1.00 4.41  ? 164 SER E CB  1 
ATOM   1058 O OG  . SER A 1 144 ? 11.755 26.030  23.432 1.00 28.42 ? 164 SER E OG  1 
ATOM   1059 N N   . ASP A 1 145 ? 11.072 22.892  25.079 1.00 12.93 ? 165 ASP E N   1 
ATOM   1060 C CA  . ASP A 1 145 ? 9.674  22.371  25.096 1.00 11.81 ? 165 ASP E CA  1 
ATOM   1061 C C   . ASP A 1 145 ? 8.617  23.378  24.748 1.00 24.44 ? 165 ASP E C   1 
ATOM   1062 O O   . ASP A 1 145 ? 7.600  22.998  24.158 1.00 13.88 ? 165 ASP E O   1 
ATOM   1063 C CB  . ASP A 1 145 ? 9.239  21.635  26.371 1.00 31.04 ? 165 ASP E CB  1 
ATOM   1064 C CG  . ASP A 1 145 ? 9.943  20.283  26.401 1.00 29.77 ? 165 ASP E CG  1 
ATOM   1065 O OD1 . ASP A 1 145 ? 11.171 20.237  26.469 0.00 20.00 ? 165 ASP E OD1 1 
ATOM   1066 O OD2 . ASP A 1 145 ? 9.153  19.231  26.339 0.00 20.00 ? 165 ASP E OD2 1 
ATOM   1067 N N   . SER A 1 146 ? 8.915  24.601  25.076 1.00 16.82 ? 166 SER E N   1 
ATOM   1068 C CA  . SER A 1 146 ? 7.952  25.634  24.779 1.00 15.14 ? 166 SER E CA  1 
ATOM   1069 C C   . SER A 1 146 ? 7.776  25.668  23.296 1.00 21.50 ? 166 SER E C   1 
ATOM   1070 O O   . SER A 1 146 ? 6.671  25.856  22.812 1.00 27.54 ? 166 SER E O   1 
ATOM   1071 C CB  . SER A 1 146 ? 8.544  27.024  25.056 1.00 24.18 ? 166 SER E CB  1 
ATOM   1072 O OG  . SER A 1 146 ? 8.975  27.000  26.399 1.00 50.02 ? 166 SER E OG  1 
ATOM   1073 N N   . SER A 1 147 ? 8.931  25.791  22.677 1.00 21.81 ? 167 SER E N   1 
ATOM   1074 C CA  . SER A 1 147 ? 8.871  26.169  21.284 1.00 19.26 ? 167 SER E CA  1 
ATOM   1075 C C   . SER A 1 147 ? 8.308  24.966  20.521 1.00 17.24 ? 167 SER E C   1 
ATOM   1076 O O   . SER A 1 147 ? 7.434  25.118  19.671 1.00 20.22 ? 167 SER E O   1 
ATOM   1077 C CB  . SER A 1 147 ? 10.244 26.637  20.761 1.00 3.00  ? 167 SER E CB  1 
ATOM   1078 O OG  . SER A 1 147 ? 10.843 25.373  20.627 1.00 18.51 ? 167 SER E OG  1 
ATOM   1079 N N   . CYS A 1 148 ? 8.501  23.797  21.081 1.00 13.04 ? 168 CYS E N   1 
ATOM   1080 C CA  . CYS A 1 148 ? 7.981  22.589  20.461 1.00 14.01 ? 168 CYS E CA  1 
ATOM   1081 C C   . CYS A 1 148 ? 6.475  22.600  20.599 1.00 19.31 ? 168 CYS E C   1 
ATOM   1082 O O   . CYS A 1 148 ? 5.772  22.248  19.652 1.00 16.14 ? 168 CYS E O   1 
ATOM   1083 C CB  . CYS A 1 148 ? 8.591  21.333  21.147 1.00 3.00  ? 168 CYS E CB  1 
ATOM   1084 S SG  . CYS A 1 148 ? 8.342  19.708  20.324 1.00 19.93 ? 168 CYS E SG  1 
ATOM   1085 N N   . LYS A 1 149 ? 6.065  22.821  21.828 1.00 15.53 ? 169 LYS E N   1 
ATOM   1086 C CA  . LYS A 1 149 ? 4.638  22.686  22.061 1.00 18.51 ? 169 LYS E CA  1 
ATOM   1087 C C   . LYS A 1 149 ? 3.886  23.733  21.298 1.00 8.05  ? 169 LYS E C   1 
ATOM   1088 O O   . LYS A 1 149 ? 2.792  23.426  20.852 1.00 22.52 ? 169 LYS E O   1 
ATOM   1089 C CB  . LYS A 1 149 ? 4.226  22.767  23.532 1.00 15.98 ? 169 LYS E CB  1 
ATOM   1090 C CG  . LYS A 1 149 ? 4.728  21.537  24.297 1.00 17.69 ? 169 LYS E CG  1 
ATOM   1091 C CD  . LYS A 1 149 ? 4.487  21.632  25.811 1.00 22.69 ? 169 LYS E CD  1 
ATOM   1092 C CE  . LYS A 1 149 ? 4.641  20.195  26.409 1.00 32.77 ? 169 LYS E CE  1 
ATOM   1093 N NZ  . LYS A 1 149 ? 4.464  20.230  27.866 0.00 20.00 ? 169 LYS E NZ  1 
ATOM   1094 N N   . SER A 1 150 ? 4.479  24.876  21.099 1.00 17.99 ? 170 SER E N   1 
ATOM   1095 C CA  . SER A 1 150 ? 3.675  25.814  20.369 1.00 12.64 ? 170 SER E CA  1 
ATOM   1096 C C   . SER A 1 150 ? 3.735  25.501  18.894 1.00 26.39 ? 170 SER E C   1 
ATOM   1097 O O   . SER A 1 150 ? 2.952  26.097  18.165 1.00 27.29 ? 170 SER E O   1 
ATOM   1098 C CB  . SER A 1 150 ? 4.195  27.222  20.537 1.00 14.14 ? 170 SER E CB  1 
ATOM   1099 O OG  . SER A 1 150 ? 5.494  27.216  19.973 1.00 41.60 ? 170 SER E OG  1 
ATOM   1100 N N   . ALA A 1 151 ? 4.717  24.706  18.473 1.00 19.46 ? 171 ALA E N   1 
ATOM   1101 C CA  . ALA A 1 151 ? 4.789  24.473  17.012 1.00 4.32  ? 171 ALA E CA  1 
ATOM   1102 C C   . ALA A 1 151 ? 3.652  23.526  16.772 1.00 8.97  ? 171 ALA E C   1 
ATOM   1103 O O   . ALA A 1 151 ? 3.195  23.460  15.646 1.00 18.36 ? 171 ALA E O   1 
ATOM   1104 C CB  . ALA A 1 151 ? 6.096  23.772  16.502 1.00 12.35 ? 171 ALA E CB  1 
ATOM   1105 N N   . TYR A 1 152 ? 3.461  22.650  17.729 1.00 3.09  ? 172 TYR E N   1 
ATOM   1106 C CA  . TYR A 1 152 ? 2.469  21.549  17.579 1.00 3.00  ? 172 TYR E CA  1 
ATOM   1107 C C   . TYR A 1 152 ? 1.486  21.527  18.769 1.00 6.89  ? 172 TYR E C   1 
ATOM   1108 O O   . TYR A 1 152 ? 1.393  20.574  19.575 1.00 10.22 ? 172 TYR E O   1 
ATOM   1109 C CB  . TYR A 1 152 ? 3.177  20.173  17.526 1.00 5.13  ? 172 TYR E CB  1 
ATOM   1110 C CG  . TYR A 1 152 ? 4.079  20.055  16.277 1.00 22.62 ? 172 TYR E CG  1 
ATOM   1111 C CD1 . TYR A 1 152 ? 3.497  19.733  15.078 1.00 14.21 ? 172 TYR E CD1 1 
ATOM   1112 C CD2 . TYR A 1 152 ? 5.450  20.216  16.361 1.00 19.00 ? 172 TYR E CD2 1 
ATOM   1113 C CE1 . TYR A 1 152 ? 4.285  19.510  13.958 1.00 22.81 ? 172 TYR E CE1 1 
ATOM   1114 C CE2 . TYR A 1 152 ? 6.234  19.975  15.247 1.00 11.30 ? 172 TYR E CE2 1 
ATOM   1115 C CZ  . TYR A 1 152 ? 5.648  19.569  14.062 1.00 3.00  ? 172 TYR E CZ  1 
ATOM   1116 O OH  . TYR A 1 152 ? 6.415  19.476  12.946 1.00 6.19  ? 172 TYR E OH  1 
ATOM   1117 N N   . PRO A 1 153 ? 0.550  22.425  18.664 1.00 14.61 ? 173 PRO E N   1 
ATOM   1118 C CA  . PRO A 1 153 ? -0.459 22.595  19.752 1.00 25.29 ? 173 PRO E CA  1 
ATOM   1119 C C   . PRO A 1 153 ? -1.298 21.366  20.086 1.00 12.75 ? 173 PRO E C   1 
ATOM   1120 O O   . PRO A 1 153 ? -1.923 20.709  19.255 1.00 19.07 ? 173 PRO E O   1 
ATOM   1121 C CB  . PRO A 1 153 ? -1.291 23.765  19.260 1.00 26.35 ? 173 PRO E CB  1 
ATOM   1122 C CG  . PRO A 1 153 ? -0.301 24.574  18.454 1.00 36.66 ? 173 PRO E CG  1 
ATOM   1123 C CD  . PRO A 1 153 ? 0.445  23.485  17.670 1.00 23.21 ? 173 PRO E CD  1 
ATOM   1124 N N   . GLY A 1 154 ? -1.237 20.949  21.282 1.00 15.09 ? 174 GLY E N   1 
ATOM   1125 C CA  . GLY A 1 154 ? -2.033 19.789  21.406 1.00 10.31 ? 174 GLY E CA  1 
ATOM   1126 C C   . GLY A 1 154 ? -1.266 18.504  21.143 1.00 30.09 ? 174 GLY E C   1 
ATOM   1127 O O   . GLY A 1 154 ? -1.830 17.452  21.444 1.00 31.46 ? 174 GLY E O   1 
ATOM   1128 N N   . GLN A 1 155 ? -0.160 18.553  20.367 1.00 13.56 ? 175 GLN E N   1 
ATOM   1129 C CA  . GLN A 1 155 ? 0.298  17.188  20.002 1.00 9.83  ? 175 GLN E CA  1 
ATOM   1130 C C   . GLN A 1 155 ? 1.540  16.633  20.695 1.00 36.07 ? 175 GLN E C   1 
ATOM   1131 O O   . GLN A 1 155 ? 1.926  15.487  20.412 1.00 25.50 ? 175 GLN E O   1 
ATOM   1132 C CB  . GLN A 1 155 ? 0.443  17.104  18.504 1.00 13.56 ? 175 GLN E CB  1 
ATOM   1133 C CG  . GLN A 1 155 ? -0.926 17.422  17.855 1.00 10.68 ? 175 GLN E CG  1 
ATOM   1134 C CD  . GLN A 1 155 ? -0.669 18.313  16.641 1.00 35.73 ? 175 GLN E CD  1 
ATOM   1135 O OE1 . GLN A 1 155 ? -1.040 19.476  16.674 1.00 53.30 ? 175 GLN E OE1 1 
ATOM   1136 N NE2 . GLN A 1 155 ? -0.055 17.831  15.590 1.00 43.06 ? 175 GLN E NE2 1 
ATOM   1137 N N   . ILE A 1 156 ? 2.202  17.471  21.495 1.00 28.41 ? 176 ILE E N   1 
ATOM   1138 C CA  . ILE A 1 156 ? 3.514  17.083  22.053 1.00 24.02 ? 176 ILE E CA  1 
ATOM   1139 C C   . ILE A 1 156 ? 3.373  16.376  23.404 1.00 19.00 ? 176 ILE E C   1 
ATOM   1140 O O   . ILE A 1 156 ? 2.836  16.973  24.320 1.00 33.29 ? 176 ILE E O   1 
ATOM   1141 C CB  . ILE A 1 156 ? 4.479  18.310  22.072 1.00 8.26  ? 176 ILE E CB  1 
ATOM   1142 C CG1 . ILE A 1 156 ? 4.644  18.839  20.604 1.00 4.39  ? 176 ILE E CG1 1 
ATOM   1143 C CG2 . ILE A 1 156 ? 5.877  17.881  22.636 1.00 3.00  ? 176 ILE E CG2 1 
ATOM   1144 C CD1 . ILE A 1 156 ? 5.252  17.697  19.692 1.00 4.22  ? 176 ILE E CD1 1 
ATOM   1145 N N   . THR A 1 157 ? 3.698  15.111  23.536 1.00 21.63 ? 177 THR E N   1 
ATOM   1146 C CA  . THR A 1 157 ? 3.635  14.535  24.865 1.00 3.00  ? 177 THR E CA  1 
ATOM   1147 C C   . THR A 1 157 ? 4.998  14.599  25.551 1.00 20.51 ? 177 THR E C   1 
ATOM   1148 O O   . THR A 1 157 ? 5.900  15.192  24.990 1.00 23.82 ? 177 THR E O   1 
ATOM   1149 C CB  . THR A 1 157 ? 3.192  13.122  24.864 1.00 7.77  ? 177 THR E CB  1 
ATOM   1150 O OG1 . THR A 1 157 ? 4.368  12.312  24.597 1.00 14.10 ? 177 THR E OG1 1 
ATOM   1151 C CG2 . THR A 1 157 ? 2.061  12.878  23.810 1.00 7.18  ? 177 THR E CG2 1 
ATOM   1152 N N   . SER A 1 158 ? 5.141  14.034  26.723 1.00 17.86 ? 178 SER E N   1 
ATOM   1153 C CA  . SER A 1 158 ? 6.350  14.164  27.544 1.00 14.47 ? 178 SER E CA  1 
ATOM   1154 C C   . SER A 1 158 ? 7.376  13.143  27.076 1.00 11.19 ? 178 SER E C   1 
ATOM   1155 O O   . SER A 1 158 ? 8.548  13.171  27.486 1.00 14.05 ? 178 SER E O   1 
ATOM   1156 C CB  . SER A 1 158 ? 5.997  13.849  29.008 1.00 15.39 ? 178 SER E CB  1 
ATOM   1157 O OG  . SER A 1 158 ? 5.522  12.480  29.110 1.00 17.87 ? 178 SER E OG  1 
ATOM   1158 N N   . ASN A 1 159 ? 6.840  12.289  26.203 1.00 3.00  ? 179 ASN E N   1 
ATOM   1159 C CA  . ASN A 1 159 ? 7.781  11.306  25.598 1.00 21.81 ? 179 ASN E CA  1 
ATOM   1160 C C   . ASN A 1 159 ? 8.442  11.735  24.252 1.00 11.50 ? 179 ASN E C   1 
ATOM   1161 O O   . ASN A 1 159 ? 8.821  10.886  23.423 1.00 3.21  ? 179 ASN E O   1 
ATOM   1162 C CB  . ASN A 1 159 ? 6.935  10.042  25.404 1.00 12.73 ? 179 ASN E CB  1 
ATOM   1163 C CG  . ASN A 1 159 ? 6.488  9.524   26.782 1.00 19.83 ? 179 ASN E CG  1 
ATOM   1164 O OD1 . ASN A 1 159 ? 7.286  9.498   27.744 1.00 22.19 ? 179 ASN E OD1 1 
ATOM   1165 N ND2 . ASN A 1 159 ? 5.250  9.085   26.807 1.00 24.64 ? 179 ASN E ND2 1 
ATOM   1166 N N   . MET A 1 160 ? 8.258  13.003  23.877 1.00 4.61  ? 180 MET E N   1 
ATOM   1167 C CA  . MET A 1 160 ? 8.703  13.542  22.542 1.00 9.77  ? 180 MET E CA  1 
ATOM   1168 C C   . MET A 1 160 ? 9.622  14.714  22.732 1.00 10.10 ? 180 MET E C   1 
ATOM   1169 O O   . MET A 1 160 ? 9.260  15.453  23.609 1.00 7.67  ? 180 MET E O   1 
ATOM   1170 C CB  . MET A 1 160 ? 7.463  14.116  21.788 1.00 3.06  ? 180 MET E CB  1 
ATOM   1171 C CG  . MET A 1 160 ? 6.512  12.930  21.481 1.00 3.00  ? 180 MET E CG  1 
ATOM   1172 S SD  . MET A 1 160 ? 4.966  13.537  20.795 1.00 11.27 ? 180 MET E SD  1 
ATOM   1173 C CE  . MET A 1 160 ? 4.046  11.998  20.671 1.00 8.48  ? 180 MET E CE  1 
ATOM   1174 N N   . PHE A 1 161 ? 10.488 15.095  21.790 1.00 3.00  ? 181 PHE E N   1 
ATOM   1175 C CA  . PHE A 1 161 ? 11.094 16.453  21.827 1.00 3.00  ? 181 PHE E CA  1 
ATOM   1176 C C   . PHE A 1 161 ? 11.249 16.897  20.386 1.00 3.47  ? 181 PHE E C   1 
ATOM   1177 O O   . PHE A 1 161 ? 11.312 16.060  19.477 1.00 5.14  ? 181 PHE E O   1 
ATOM   1178 C CB  . PHE A 1 161 ? 12.509 16.556  22.480 1.00 3.00  ? 181 PHE E CB  1 
ATOM   1179 C CG  . PHE A 1 161 ? 13.556 15.649  21.785 1.00 3.00  ? 181 PHE E CG  1 
ATOM   1180 C CD1 . PHE A 1 161 ? 13.741 14.346  22.260 1.00 12.75 ? 181 PHE E CD1 1 
ATOM   1181 C CD2 . PHE A 1 161 ? 14.402 16.187  20.831 1.00 3.00  ? 181 PHE E CD2 1 
ATOM   1182 C CE1 . PHE A 1 161 ? 14.773 13.551  21.743 1.00 10.68 ? 181 PHE E CE1 1 
ATOM   1183 C CE2 . PHE A 1 161 ? 15.389 15.398  20.293 1.00 3.00  ? 181 PHE E CE2 1 
ATOM   1184 C CZ  . PHE A 1 161 ? 15.581 14.069  20.744 1.00 3.00  ? 181 PHE E CZ  1 
ATOM   1185 N N   . CYS A 1 162 ? 11.379 18.165  20.252 1.00 9.34  ? 182 CYS E N   1 
ATOM   1186 C CA  . CYS A 1 162 ? 11.638 18.767  18.978 1.00 6.20  ? 182 CYS E CA  1 
ATOM   1187 C C   . CYS A 1 162 ? 13.121 19.016  18.883 1.00 3.00  ? 182 CYS E C   1 
ATOM   1188 O O   . CYS A 1 162 ? 13.649 19.514  19.841 1.00 3.00  ? 182 CYS E O   1 
ATOM   1189 C CB  . CYS A 1 162 ? 10.894 20.081  18.780 1.00 7.54  ? 182 CYS E CB  1 
ATOM   1190 S SG  . CYS A 1 162 ? 9.125  19.941  18.504 1.00 10.25 ? 182 CYS E SG  1 
ATOM   1191 N N   . ALA A 1 163 ? 13.658 18.834  17.682 1.00 4.29  ? 183 ALA E N   1 
ATOM   1192 C CA  . ALA A 1 163 ? 15.046 19.146  17.268 1.00 16.94 ? 183 ALA E CA  1 
ATOM   1193 C C   . ALA A 1 163 ? 14.987 19.711  15.839 1.00 19.09 ? 183 ALA E C   1 
ATOM   1194 O O   . ALA A 1 163 ? 14.136 19.280  15.049 1.00 8.25  ? 183 ALA E O   1 
ATOM   1195 C CB  . ALA A 1 163 ? 15.995 17.875  17.330 1.00 3.00  ? 183 ALA E CB  1 
ATOM   1196 N N   . GLY A 1 164 A 15.869 20.683  15.529 1.00 8.86  ? 184 GLY E N   1 
ATOM   1197 C CA  . GLY A 1 164 A 15.884 21.255  14.203 1.00 3.00  ? 184 GLY E CA  1 
ATOM   1198 C C   . GLY A 1 164 A 15.857 22.758  14.292 1.00 8.02  ? 184 GLY E C   1 
ATOM   1199 O O   . GLY A 1 164 A 16.488 23.273  15.204 1.00 3.40  ? 184 GLY E O   1 
ATOM   1200 N N   . TYR A 1 165 ? 15.214 23.373  13.275 1.00 7.80  ? 184 TYR E N   1 
ATOM   1201 C CA  . TYR A 1 165 ? 15.322 24.823  12.984 1.00 12.58 ? 184 TYR E CA  1 
ATOM   1202 C C   . TYR A 1 165 ? 13.916 25.367  12.704 1.00 21.00 ? 184 TYR E C   1 
ATOM   1203 O O   . TYR A 1 165 ? 13.200 24.862  11.841 1.00 16.24 ? 184 TYR E O   1 
ATOM   1204 C CB  . TYR A 1 165 ? 16.241 25.047  11.699 1.00 8.33  ? 184 TYR E CB  1 
ATOM   1205 C CG  . TYR A 1 165 ? 17.681 24.496  11.876 1.00 6.36  ? 184 TYR E CG  1 
ATOM   1206 C CD1 . TYR A 1 165 ? 17.989 23.160  11.611 1.00 6.53  ? 184 TYR E CD1 1 
ATOM   1207 C CD2 . TYR A 1 165 ? 18.630 25.321  12.425 1.00 16.08 ? 184 TYR E CD2 1 
ATOM   1208 C CE1 . TYR A 1 165 ? 19.267 22.637  11.865 1.00 3.00  ? 184 TYR E CE1 1 
ATOM   1209 C CE2 . TYR A 1 165 ? 19.906 24.837  12.665 1.00 11.15 ? 184 TYR E CE2 1 
ATOM   1210 C CZ  . TYR A 1 165 ? 20.211 23.512  12.384 1.00 4.48  ? 184 TYR E CZ  1 
ATOM   1211 O OH  . TYR A 1 165 ? 21.442 23.104  12.700 1.00 21.46 ? 184 TYR E OH  1 
ATOM   1212 N N   . LEU A 1 166 ? 13.490 26.338  13.478 1.00 12.25 ? 185 LEU E N   1 
ATOM   1213 C CA  . LEU A 1 166 ? 12.188 26.963  13.249 1.00 12.36 ? 185 LEU E CA  1 
ATOM   1214 C C   . LEU A 1 166 ? 12.183 27.667  11.882 1.00 13.48 ? 185 LEU E C   1 
ATOM   1215 O O   . LEU A 1 166 ? 11.150 27.798  11.242 1.00 15.10 ? 185 LEU E O   1 
ATOM   1216 C CB  . LEU A 1 166 ? 11.928 27.966  14.399 1.00 7.79  ? 185 LEU E CB  1 
ATOM   1217 C CG  . LEU A 1 166 ? 11.592 27.196  15.710 1.00 6.54  ? 185 LEU E CG  1 
ATOM   1218 C CD1 . LEU A 1 166 ? 10.810 28.042  16.706 1.00 22.64 ? 185 LEU E CD1 1 
ATOM   1219 C CD2 . LEU A 1 166 ? 10.690 25.985  15.430 1.00 13.67 ? 185 LEU E CD2 1 
ATOM   1220 N N   . GLU A 1 167 ? 13.339 28.029  11.388 1.00 11.31 ? 186 GLU E N   1 
ATOM   1221 C CA  . GLU A 1 167 ? 13.411 28.677  10.092 1.00 23.27 ? 186 GLU E CA  1 
ATOM   1222 C C   . GLU A 1 167 ? 13.009 27.778  8.917  1.00 22.22 ? 186 GLU E C   1 
ATOM   1223 O O   . GLU A 1 167 ? 12.957 28.280  7.803  1.00 24.29 ? 186 GLU E O   1 
ATOM   1224 C CB  . GLU A 1 167 ? 14.853 29.149  9.911  1.00 35.58 ? 186 GLU E CB  1 
ATOM   1225 C CG  . GLU A 1 167 ? 15.010 30.302  8.902  0.00 61.64 ? 186 GLU E CG  1 
ATOM   1226 C CD  . GLU A 1 167 ? 16.480 30.702  8.848  0.00 50.77 ? 186 GLU E CD  1 
ATOM   1227 O OE1 . GLU A 1 167 ? 17.015 31.204  9.835  0.00 20.00 ? 186 GLU E OE1 1 
ATOM   1228 O OE2 . GLU A 1 167 ? 17.090 30.464  7.705  0.00 20.00 ? 186 GLU E OE2 1 
ATOM   1229 N N   . GLY A 1 168 ? 13.047 26.487  9.110  1.00 21.63 ? 187 GLY E N   1 
ATOM   1230 C CA  . GLY A 1 168 ? 12.874 25.472  8.026  1.00 25.36 ? 187 GLY E CA  1 
ATOM   1231 C C   . GLY A 1 168 ? 14.212 25.032  7.413  1.00 30.52 ? 187 GLY E C   1 
ATOM   1232 O O   . GLY A 1 168 ? 15.246 25.559  7.826  1.00 17.66 ? 187 GLY E O   1 
ATOM   1233 N N   . GLY A 1 169 A 14.126 24.346  6.264  1.00 7.35  ? 188 GLY E N   1 
ATOM   1234 C CA  . GLY A 1 169 A 15.278 24.115  5.385  1.00 3.00  ? 188 GLY E CA  1 
ATOM   1235 C C   . GLY A 1 169 A 16.124 22.897  5.823  1.00 11.44 ? 188 GLY E C   1 
ATOM   1236 O O   . GLY A 1 169 A 16.785 22.288  5.011  1.00 17.96 ? 188 GLY E O   1 
ATOM   1237 N N   . LYS A 1 170 ? 16.132 22.475  7.065  1.00 16.63 ? 188 LYS E N   1 
ATOM   1238 C CA  . LYS A 1 170 ? 16.920 21.249  7.378  1.00 3.36  ? 188 LYS E CA  1 
ATOM   1239 C C   . LYS A 1 170 ? 16.128 20.440  8.421  1.00 4.61  ? 188 LYS E C   1 
ATOM   1240 O O   . LYS A 1 170 ? 15.707 21.052  9.414  1.00 7.77  ? 188 LYS E O   1 
ATOM   1241 C CB  . LYS A 1 170 ? 18.229 21.670  8.055  1.00 6.00  ? 188 LYS E CB  1 
ATOM   1242 C CG  . LYS A 1 170 ? 19.120 22.661  7.274  1.00 16.03 ? 188 LYS E CG  1 
ATOM   1243 C CD  . LYS A 1 170 ? 20.384 22.960  8.089  1.00 23.65 ? 188 LYS E CD  1 
ATOM   1244 C CE  . LYS A 1 170 ? 20.357 24.394  8.616  1.00 47.40 ? 188 LYS E CE  1 
ATOM   1245 N NZ  . LYS A 1 170 ? 21.490 24.609  9.529  0.00 20.00 ? 188 LYS E NZ  1 
ATOM   1246 N N   . ASP A 1 171 ? 15.987 19.141  8.219  1.00 3.00  ? 189 ASP E N   1 
ATOM   1247 C CA  . ASP A 1 171 ? 15.130 18.358  9.049  1.00 3.00  ? 189 ASP E CA  1 
ATOM   1248 C C   . ASP A 1 171 ? 15.334 16.928  8.628  1.00 3.00  ? 189 ASP E C   1 
ATOM   1249 O O   . ASP A 1 171 ? 15.934 16.709  7.580  1.00 3.00  ? 189 ASP E O   1 
ATOM   1250 C CB  . ASP A 1 171 ? 13.681 18.784  8.603  1.00 3.00  ? 189 ASP E CB  1 
ATOM   1251 C CG  . ASP A 1 171 ? 12.634 18.372  9.629  1.00 7.71  ? 189 ASP E CG  1 
ATOM   1252 O OD1 . ASP A 1 171 ? 12.954 17.736  10.678 1.00 4.37  ? 189 ASP E OD1 1 
ATOM   1253 O OD2 . ASP A 1 171 ? 11.429 18.635  9.416  1.00 7.88  ? 189 ASP E OD2 1 
ATOM   1254 N N   . SER A 1 172 ? 14.796 15.988  9.346  1.00 3.00  ? 190 SER E N   1 
ATOM   1255 C CA  . SER A 1 172 ? 14.742 14.643  8.818  1.00 3.00  ? 190 SER E CA  1 
ATOM   1256 C C   . SER A 1 172 ? 13.465 14.559  7.997  1.00 3.97  ? 190 SER E C   1 
ATOM   1257 O O   . SER A 1 172 ? 12.754 15.549  7.915  1.00 3.00  ? 190 SER E O   1 
ATOM   1258 C CB  . SER A 1 172 ? 14.707 13.595  9.929  1.00 3.82  ? 190 SER E CB  1 
ATOM   1259 O OG  . SER A 1 172 ? 13.751 13.990  10.930 1.00 3.98  ? 190 SER E OG  1 
ATOM   1260 N N   . CYS A 1 173 ? 13.151 13.379  7.437  1.00 4.67  ? 191 CYS E N   1 
ATOM   1261 C CA  . CYS A 1 173 ? 12.002 13.330  6.487  1.00 4.63  ? 191 CYS E CA  1 
ATOM   1262 C C   . CYS A 1 173 ? 11.698 11.865  6.147  1.00 3.00  ? 191 CYS E C   1 
ATOM   1263 O O   . CYS A 1 173 ? 12.291 10.976  6.742  1.00 3.00  ? 191 CYS E O   1 
ATOM   1264 C CB  . CYS A 1 173 ? 12.382 14.057  5.161  1.00 3.00  ? 191 CYS E CB  1 
ATOM   1265 S SG  . CYS A 1 173 ? 10.969 14.517  4.059  1.00 4.54  ? 191 CYS E SG  1 
ATOM   1266 N N   . GLN A 1 174 ? 10.670 11.630  5.351  1.00 5.82  ? 192 GLN E N   1 
ATOM   1267 C CA  . GLN A 1 174 ? 10.162 10.251  5.102  1.00 13.55 ? 192 GLN E CA  1 
ATOM   1268 C C   . GLN A 1 174 ? 11.306 9.280   4.689  1.00 11.01 ? 192 GLN E C   1 
ATOM   1269 O O   . GLN A 1 174 ? 12.078 9.666   3.813  1.00 3.00  ? 192 GLN E O   1 
ATOM   1270 C CB  . GLN A 1 174 ? 8.915  10.231  4.166  1.00 3.00  ? 192 GLN E CB  1 
ATOM   1271 C CG  . GLN A 1 174 ? 7.575  10.509  4.941  1.00 4.39  ? 192 GLN E CG  1 
ATOM   1272 C CD  . GLN A 1 174 ? 7.432  11.959  5.356  1.00 8.24  ? 192 GLN E CD  1 
ATOM   1273 O OE1 . GLN A 1 174 ? 7.978  12.805  4.645  1.00 6.72  ? 192 GLN E OE1 1 
ATOM   1274 N NE2 . GLN A 1 174 ? 6.717  12.234  6.470  1.00 4.17  ? 192 GLN E NE2 1 
ATOM   1275 N N   . GLY A 1 175 ? 11.401 8.109   5.376  1.00 3.00  ? 193 GLY E N   1 
ATOM   1276 C CA  . GLY A 1 175 ? 12.350 7.083   5.173  1.00 3.00  ? 193 GLY E CA  1 
ATOM   1277 C C   . GLY A 1 175 ? 13.474 7.317   6.173  1.00 3.00  ? 193 GLY E C   1 
ATOM   1278 O O   . GLY A 1 175 ? 14.341 6.470   6.284  1.00 3.07  ? 193 GLY E O   1 
ATOM   1279 N N   . ASP A 1 176 ? 13.372 8.340   6.981  1.00 3.00  ? 194 ASP E N   1 
ATOM   1280 C CA  . ASP A 1 176 ? 14.347 8.464   8.067  1.00 3.00  ? 194 ASP E CA  1 
ATOM   1281 C C   . ASP A 1 176 ? 13.777 7.899   9.379  1.00 10.30 ? 194 ASP E C   1 
ATOM   1282 O O   . ASP A 1 176 ? 14.557 7.782   10.332 1.00 3.91  ? 194 ASP E O   1 
ATOM   1283 C CB  . ASP A 1 176 ? 14.707 9.924   8.407  1.00 3.40  ? 194 ASP E CB  1 
ATOM   1284 C CG  . ASP A 1 176 ? 15.506 10.533  7.278  1.00 3.00  ? 194 ASP E CG  1 
ATOM   1285 O OD1 . ASP A 1 176 ? 16.379 9.828   6.725  1.00 3.00  ? 194 ASP E OD1 1 
ATOM   1286 O OD2 . ASP A 1 176 ? 15.290 11.726  6.933  1.00 3.00  ? 194 ASP E OD2 1 
ATOM   1287 N N   . SER A 1 177 ? 12.453 7.698   9.448  1.00 3.00  ? 195 SER E N   1 
ATOM   1288 C CA  . SER A 1 177 ? 11.896 7.113   10.706 1.00 3.00  ? 195 SER E CA  1 
ATOM   1289 C C   . SER A 1 177 ? 12.777 6.034   11.363 1.00 3.21  ? 195 SER E C   1 
ATOM   1290 O O   . SER A 1 177 ? 13.129 5.069   10.706 1.00 3.00  ? 195 SER E O   1 
ATOM   1291 C CB  . SER A 1 177 ? 10.515 6.468   10.541 1.00 3.00  ? 195 SER E CB  1 
ATOM   1292 O OG  . SER A 1 177 ? 9.592  7.512   10.618 1.00 3.00  ? 195 SER E OG  1 
ATOM   1293 N N   . GLY A 1 178 ? 12.831 6.083   12.657 1.00 3.00  ? 196 GLY E N   1 
ATOM   1294 C CA  . GLY A 1 178 ? 13.281 5.011   13.460 1.00 3.00  ? 196 GLY E CA  1 
ATOM   1295 C C   . GLY A 1 178 ? 14.774 5.208   13.705 1.00 11.82 ? 196 GLY E C   1 
ATOM   1296 O O   . GLY A 1 178 ? 15.359 4.457   14.505 1.00 4.24  ? 196 GLY E O   1 
ATOM   1297 N N   . GLY A 1 179 ? 15.383 6.142   12.924 1.00 3.00  ? 197 GLY E N   1 
ATOM   1298 C CA  . GLY A 1 179 ? 16.858 6.320   12.953 1.00 3.00  ? 197 GLY E CA  1 
ATOM   1299 C C   . GLY A 1 179 ? 17.290 7.192   14.143 1.00 7.78  ? 197 GLY E C   1 
ATOM   1300 O O   . GLY A 1 179 ? 16.457 7.726   14.890 1.00 6.95  ? 197 GLY E O   1 
ATOM   1301 N N   . PRO A 1 180 ? 18.597 7.312   14.266 1.00 7.75  ? 198 PRO E N   1 
ATOM   1302 C CA  . PRO A 1 180 ? 19.184 7.867   15.501 1.00 3.00  ? 198 PRO E CA  1 
ATOM   1303 C C   . PRO A 1 180 ? 19.126 9.371   15.527 1.00 5.14  ? 198 PRO E C   1 
ATOM   1304 O O   . PRO A 1 180 ? 19.612 9.972   14.554 1.00 6.00  ? 198 PRO E O   1 
ATOM   1305 C CB  . PRO A 1 180 ? 20.637 7.383   15.514 1.00 3.52  ? 198 PRO E CB  1 
ATOM   1306 C CG  . PRO A 1 180 ? 20.913 6.924   14.054 1.00 3.08  ? 198 PRO E CG  1 
ATOM   1307 C CD  . PRO A 1 180 ? 19.567 6.509   13.461 1.00 7.33  ? 198 PRO E CD  1 
ATOM   1308 N N   . VAL A 1 181 ? 19.057 9.863   16.781 1.00 4.37  ? 199 VAL E N   1 
ATOM   1309 C CA  . VAL A 1 181 ? 19.481 11.253  17.115 1.00 3.00  ? 199 VAL E CA  1 
ATOM   1310 C C   . VAL A 1 181 ? 20.524 11.168  18.236 1.00 3.60  ? 199 VAL E C   1 
ATOM   1311 O O   . VAL A 1 181 ? 20.268 10.584  19.298 1.00 3.00  ? 199 VAL E O   1 
ATOM   1312 C CB  . VAL A 1 181 ? 18.194 12.005  17.615 1.00 4.51  ? 199 VAL E CB  1 
ATOM   1313 C CG1 . VAL A 1 181 ? 18.390 13.422  18.190 1.00 5.65  ? 199 VAL E CG1 1 
ATOM   1314 C CG2 . VAL A 1 181 ? 17.160 12.147  16.504 1.00 5.43  ? 199 VAL E CG2 1 
ATOM   1315 N N   . VAL A 1 182 ? 21.747 11.456  17.876 1.00 3.00  ? 200 VAL E N   1 
ATOM   1316 C CA  . VAL A 1 182 ? 22.824 11.109  18.833 1.00 5.70  ? 200 VAL E CA  1 
ATOM   1317 C C   . VAL A 1 182 ? 23.452 12.428  19.299 1.00 21.64 ? 200 VAL E C   1 
ATOM   1318 O O   . VAL A 1 182 ? 23.822 13.243  18.458 1.00 7.96  ? 200 VAL E O   1 
ATOM   1319 C CB  . VAL A 1 182 ? 23.927 10.155  18.270 1.00 3.00  ? 200 VAL E CB  1 
ATOM   1320 C CG1 . VAL A 1 182 ? 25.242 10.120  19.120 1.00 3.00  ? 200 VAL E CG1 1 
ATOM   1321 C CG2 . VAL A 1 182 ? 23.394 8.732   18.064 1.00 3.00  ? 200 VAL E CG2 1 
ATOM   1322 N N   . CYS A 1 183 ? 23.509 12.619  20.608 1.00 19.90 ? 201 CYS E N   1 
ATOM   1323 C CA  . CYS A 1 183 ? 24.037 13.840  21.275 1.00 10.95 ? 201 CYS E CA  1 
ATOM   1324 C C   . CYS A 1 183 ? 24.997 13.436  22.404 1.00 11.49 ? 201 CYS E C   1 
ATOM   1325 O O   . CYS A 1 183 ? 24.734 12.499  23.181 1.00 5.53  ? 201 CYS E O   1 
ATOM   1326 C CB  . CYS A 1 183 ? 22.885 14.593  21.919 1.00 3.00  ? 201 CYS E CB  1 
ATOM   1327 S SG  . CYS A 1 183 ? 21.257 14.554  21.145 1.00 5.55  ? 201 CYS E SG  1 
ATOM   1328 N N   . SER A 1 184 ? 26.215 13.883  22.214 1.00 17.76 ? 202 SER E N   1 
ATOM   1329 C CA  . SER A 1 184 ? 27.359 13.545  23.109 1.00 25.01 ? 202 SER E CA  1 
ATOM   1330 C C   . SER A 1 184 ? 27.607 12.044  23.204 1.00 26.46 ? 202 SER E C   1 
ATOM   1331 O O   . SER A 1 184 ? 27.818 11.541  24.300 1.00 27.39 ? 202 SER E O   1 
ATOM   1332 C CB  . SER A 1 184 ? 27.077 13.989  24.574 1.00 33.00 ? 202 SER E CB  1 
ATOM   1333 O OG  . SER A 1 184 ? 26.404 15.270  24.613 1.00 42.97 ? 202 SER E OG  1 
ATOM   1334 N N   . GLY A 1 185 ? 27.499 11.379  22.109 1.00 17.40 ? 203 GLY E N   1 
ATOM   1335 C CA  . GLY A 1 185 ? 27.800 9.963   22.026 1.00 14.57 ? 203 GLY E CA  1 
ATOM   1336 C C   . GLY A 1 185 ? 26.688 9.106   22.619 1.00 15.62 ? 203 GLY E C   1 
ATOM   1337 O O   . GLY A 1 185 ? 26.962 7.937   22.813 1.00 16.14 ? 203 GLY E O   1 
ATOM   1338 N N   . LYS A 1 186 ? 25.552 9.699   23.032 1.00 9.13  ? 204 LYS E N   1 
ATOM   1339 C CA  . LYS A 1 186 ? 24.480 8.815   23.559 1.00 3.00  ? 204 LYS E CA  1 
ATOM   1340 C C   . LYS A 1 186 ? 23.302 8.860   22.567 1.00 21.97 ? 204 LYS E C   1 
ATOM   1341 O O   . LYS A 1 186 ? 22.993 9.937   22.066 1.00 4.99  ? 204 LYS E O   1 
ATOM   1342 C CB  . LYS A 1 186 ? 23.924 9.346   24.898 1.00 3.00  ? 204 LYS E CB  1 
ATOM   1343 C CG  . LYS A 1 186 ? 25.145 9.469   25.814 1.00 3.26  ? 204 LYS E CG  1 
ATOM   1344 C CD  . LYS A 1 186 ? 25.887 8.164   25.955 1.00 14.14 ? 204 LYS E CD  1 
ATOM   1345 C CE  . LYS A 1 186 ? 27.005 8.327   27.018 1.00 35.72 ? 204 LYS E CE  1 
ATOM   1346 N NZ  . LYS A 1 186 ? 27.134 7.064   27.732 1.00 54.75 ? 204 LYS E NZ  1 
ATOM   1347 N N   . LEU A 1 187 ? 22.524 7.793   22.464 1.00 5.91  ? 209 LEU E N   1 
ATOM   1348 C CA  . LEU A 1 187 ? 21.274 7.873   21.702 1.00 3.00  ? 209 LEU E CA  1 
ATOM   1349 C C   . LEU A 1 187 ? 20.130 8.588   22.437 1.00 7.09  ? 209 LEU E C   1 
ATOM   1350 O O   . LEU A 1 187 ? 19.597 8.046   23.388 1.00 8.69  ? 209 LEU E O   1 
ATOM   1351 C CB  . LEU A 1 187 ? 20.846 6.451   21.446 1.00 3.00  ? 209 LEU E CB  1 
ATOM   1352 C CG  . LEU A 1 187 ? 19.597 6.336   20.518 1.00 10.47 ? 209 LEU E CG  1 
ATOM   1353 C CD1 . LEU A 1 187 ? 19.815 6.838   19.031 1.00 3.00  ? 209 LEU E CD1 1 
ATOM   1354 C CD2 . LEU A 1 187 ? 19.205 4.859   20.641 1.00 3.00  ? 209 LEU E CD2 1 
ATOM   1355 N N   . GLN A 1 188 ? 19.923 9.855   22.182 1.00 3.00  ? 210 GLN E N   1 
ATOM   1356 C CA  . GLN A 1 188 ? 18.870 10.581  22.822 1.00 3.00  ? 210 GLN E CA  1 
ATOM   1357 C C   . GLN A 1 188 ? 17.510 10.427  22.152 1.00 20.69 ? 210 GLN E C   1 
ATOM   1358 O O   . GLN A 1 188 ? 16.532 10.789  22.805 1.00 10.35 ? 210 GLN E O   1 
ATOM   1359 C CB  . GLN A 1 188 ? 19.165 12.055  22.986 1.00 3.00  ? 210 GLN E CB  1 
ATOM   1360 C CG  . GLN A 1 188 ? 20.379 12.285  23.958 1.00 5.64  ? 210 GLN E CG  1 
ATOM   1361 C CD  . GLN A 1 188 ? 20.107 12.022  25.441 1.00 19.82 ? 210 GLN E CD  1 
ATOM   1362 O OE1 . GLN A 1 188 ? 21.043 12.110  26.240 1.00 27.60 ? 210 GLN E OE1 1 
ATOM   1363 N NE2 . GLN A 1 188 ? 18.907 11.671  25.824 1.00 11.43 ? 210 GLN E NE2 1 
ATOM   1364 N N   . GLY A 1 189 ? 17.459 10.205  20.838 1.00 9.45  ? 211 GLY E N   1 
ATOM   1365 C CA  . GLY A 1 189 ? 16.202 10.464  20.038 1.00 3.00  ? 211 GLY E CA  1 
ATOM   1366 C C   . GLY A 1 189 ? 16.006 9.306   19.077 1.00 6.09  ? 211 GLY E C   1 
ATOM   1367 O O   . GLY A 1 189 ? 16.984 8.714   18.638 1.00 4.93  ? 211 GLY E O   1 
ATOM   1368 N N   . ILE A 1 190 ? 14.764 9.045   18.669 1.00 7.63  ? 212 ILE E N   1 
ATOM   1369 C CA  . ILE A 1 190 ? 14.383 8.248   17.477 1.00 4.80  ? 212 ILE E CA  1 
ATOM   1370 C C   . ILE A 1 190 ? 13.572 9.139   16.546 1.00 3.93  ? 212 ILE E C   1 
ATOM   1371 O O   . ILE A 1 190 ? 12.625 9.814   17.008 1.00 5.71  ? 212 ILE E O   1 
ATOM   1372 C CB  . ILE A 1 190 ? 13.573 7.006   17.944 1.00 7.32  ? 212 ILE E CB  1 
ATOM   1373 C CG1 . ILE A 1 190 ? 14.353 6.189   18.990 1.00 3.00  ? 212 ILE E CG1 1 
ATOM   1374 C CG2 . ILE A 1 190 ? 13.000 6.049   16.840 1.00 3.00  ? 212 ILE E CG2 1 
ATOM   1375 C CD1 . ILE A 1 190 ? 13.426 5.102   19.640 1.00 6.83  ? 212 ILE E CD1 1 
ATOM   1376 N N   . VAL A 1 191 ? 13.980 9.183   15.298 1.00 3.00  ? 213 VAL E N   1 
ATOM   1377 C CA  . VAL A 1 191 ? 13.156 9.917   14.243 1.00 4.09  ? 213 VAL E CA  1 
ATOM   1378 C C   . VAL A 1 191 ? 11.684 9.417   14.209 1.00 4.91  ? 213 VAL E C   1 
ATOM   1379 O O   . VAL A 1 191 ? 11.384 8.224   14.062 1.00 3.00  ? 213 VAL E O   1 
ATOM   1380 C CB  . VAL A 1 191 ? 13.817 9.818   12.801 1.00 3.00  ? 213 VAL E CB  1 
ATOM   1381 C CG1 . VAL A 1 191 ? 12.983 10.566  11.728 1.00 3.00  ? 213 VAL E CG1 1 
ATOM   1382 C CG2 . VAL A 1 191 ? 15.244 10.405  12.809 1.00 3.00  ? 213 VAL E CG2 1 
ATOM   1383 N N   . SER A 1 192 ? 10.753 10.354  14.440 1.00 3.00  ? 214 SER E N   1 
ATOM   1384 C CA  . SER A 1 192 ? 9.397  9.828   14.561 1.00 3.37  ? 214 SER E CA  1 
ATOM   1385 C C   . SER A 1 192 ? 8.433  10.516  13.540 1.00 3.46  ? 214 SER E C   1 
ATOM   1386 O O   . SER A 1 192 ? 7.811  9.825   12.738 1.00 4.02  ? 214 SER E O   1 
ATOM   1387 C CB  . SER A 1 192 ? 8.900  9.963   16.040 1.00 3.00  ? 214 SER E CB  1 
ATOM   1388 O OG  . SER A 1 192 ? 7.584  9.395   16.158 1.00 4.62  ? 214 SER E OG  1 
ATOM   1389 N N   . TRP A 1 193 ? 8.156  11.808  13.645 1.00 3.00  ? 215 TRP E N   1 
ATOM   1390 C CA  . TRP A 1 193 ? 7.069  12.433  12.853 1.00 3.00  ? 215 TRP E CA  1 
ATOM   1391 C C   . TRP A 1 193 ? 7.361  13.909  12.713 1.00 3.00  ? 215 TRP E C   1 
ATOM   1392 O O   . TRP A 1 193 ? 8.253  14.372  13.420 1.00 5.02  ? 215 TRP E O   1 
ATOM   1393 C CB  . TRP A 1 193 ? 5.623  12.055  13.384 1.00 3.07  ? 215 TRP E CB  1 
ATOM   1394 C CG  . TRP A 1 193 ? 5.282  12.713  14.751 1.00 9.00  ? 215 TRP E CG  1 
ATOM   1395 C CD1 . TRP A 1 193 ? 5.565  12.221  15.968 1.00 8.20  ? 215 TRP E CD1 1 
ATOM   1396 C CD2 . TRP A 1 193 ? 4.614  13.943  14.994 1.00 14.41 ? 215 TRP E CD2 1 
ATOM   1397 N NE1 . TRP A 1 193 ? 5.054  13.100  16.939 1.00 6.14  ? 215 TRP E NE1 1 
ATOM   1398 C CE2 . TRP A 1 193 ? 4.531  14.114  16.395 1.00 19.63 ? 215 TRP E CE2 1 
ATOM   1399 C CE3 . TRP A 1 193 ? 4.092  14.900  14.136 1.00 4.20  ? 215 TRP E CE3 1 
ATOM   1400 C CZ2 . TRP A 1 193 ? 3.926  15.220  17.008 1.00 3.57  ? 215 TRP E CZ2 1 
ATOM   1401 C CZ3 . TRP A 1 193 ? 3.502  16.016  14.739 1.00 3.00  ? 215 TRP E CZ3 1 
ATOM   1402 C CH2 . TRP A 1 193 ? 3.402  16.170  16.142 1.00 8.34  ? 215 TRP E CH2 1 
ATOM   1403 N N   . GLY A 1 194 ? 6.561  14.673  11.951 1.00 3.00  ? 216 GLY E N   1 
ATOM   1404 C CA  . GLY A 1 194 ? 6.674  16.085  11.675 1.00 3.00  ? 216 GLY E CA  1 
ATOM   1405 C C   . GLY A 1 194 ? 5.461  16.441  10.815 1.00 7.61  ? 216 GLY E C   1 
ATOM   1406 O O   . GLY A 1 194 ? 4.770  15.557  10.356 1.00 3.81  ? 216 GLY E O   1 
ATOM   1407 N N   . SER A 1 195 ? 5.209  17.676  10.580 1.00 12.66 ? 217 SER E N   1 
ATOM   1408 C CA  . SER A 1 195 ? 4.181  18.105  9.605  1.00 17.10 ? 217 SER E CA  1 
ATOM   1409 C C   . SER A 1 195 ? 4.947  18.593  8.352  1.00 16.39 ? 217 SER E C   1 
ATOM   1410 O O   . SER A 1 195 ? 5.731  19.552  8.456  1.00 14.29 ? 217 SER E O   1 
ATOM   1411 C CB  . SER A 1 195 ? 3.423  19.335  10.202 1.00 6.32  ? 217 SER E CB  1 
ATOM   1412 O OG  . SER A 1 195 ? 2.315  19.571  9.348  1.00 16.72 ? 217 SER E OG  1 
ATOM   1413 N N   . GLY A 1 196 ? 4.951  17.770  7.306  1.00 14.47 ? 219 GLY E N   1 
ATOM   1414 C CA  . GLY A 1 196 ? 5.857  17.949  6.148  1.00 12.00 ? 219 GLY E CA  1 
ATOM   1415 C C   . GLY A 1 196 ? 7.313  17.660  6.520  1.00 13.39 ? 219 GLY E C   1 
ATOM   1416 O O   . GLY A 1 196 ? 7.575  16.844  7.407  1.00 15.22 ? 219 GLY E O   1 
ATOM   1417 N N   . CYS A 1 197 ? 8.228  18.334  5.845  1.00 5.72  ? 220 CYS E N   1 
ATOM   1418 C CA  . CYS A 1 197 ? 9.659  18.205  6.157  1.00 7.08  ? 220 CYS E CA  1 
ATOM   1419 C C   . CYS A 1 197 ? 10.218 19.594  6.018  1.00 5.48  ? 220 CYS E C   1 
ATOM   1420 O O   . CYS A 1 197 ? 10.183 20.134  4.929  1.00 5.30  ? 220 CYS E O   1 
ATOM   1421 C CB  . CYS A 1 197 ? 10.457 17.225  5.262  1.00 3.00  ? 220 CYS E CB  1 
ATOM   1422 S SG  . CYS A 1 197 ? 9.777  15.542  5.308  1.00 3.29  ? 220 CYS E SG  1 
ATOM   1423 N N   . ALA A 1 198 A 10.987 19.952  6.954  1.00 3.99  ? 221 ALA E N   1 
ATOM   1424 C CA  . ALA A 1 198 A 11.792 21.163  6.740  1.00 3.00  ? 221 ALA E CA  1 
ATOM   1425 C C   . ALA A 1 198 A 10.952 22.406  6.507  1.00 11.01 ? 221 ALA E C   1 
ATOM   1426 O O   . ALA A 1 198 A 11.493 23.443  6.093  1.00 11.02 ? 221 ALA E O   1 
ATOM   1427 C CB  . ALA A 1 198 A 12.900 20.993  5.719  1.00 3.00  ? 221 ALA E CB  1 
ATOM   1428 N N   . GLN A 1 199 ? 9.708  22.279  6.970  1.00 7.24  ? 221 GLN E N   1 
ATOM   1429 C CA  . GLN A 1 199 ? 8.770  23.464  6.894  1.00 9.51  ? 221 GLN E CA  1 
ATOM   1430 C C   . GLN A 1 199 ? 9.008  24.440  8.057  1.00 19.30 ? 221 GLN E C   1 
ATOM   1431 O O   . GLN A 1 199 ? 9.511  24.089  9.137  1.00 15.79 ? 221 GLN E O   1 
ATOM   1432 C CB  . GLN A 1 199 ? 7.323  22.888  6.899  1.00 3.74  ? 221 GLN E CB  1 
ATOM   1433 C CG  . GLN A 1 199 ? 6.621  22.883  5.537  1.00 31.05 ? 221 GLN E CG  1 
ATOM   1434 C CD  . GLN A 1 199 ? 7.585  22.257  4.559  1.00 58.84 ? 221 GLN E CD  1 
ATOM   1435 O OE1 . GLN A 1 199 ? 8.135  22.901  3.667  1.00 34.71 ? 221 GLN E OE1 1 
ATOM   1436 N NE2 . GLN A 1 199 ? 7.765  20.995  4.804  1.00 58.51 ? 221 GLN E NE2 1 
ATOM   1437 N N   . LYS A 1 200 ? 8.902  25.693  7.714  1.00 8.33  ? 222 LYS E N   1 
ATOM   1438 C CA  . LYS A 1 200 ? 9.123  26.778  8.716  1.00 12.16 ? 222 LYS E CA  1 
ATOM   1439 C C   . LYS A 1 200 ? 8.186  26.551  9.894  1.00 8.56  ? 222 LYS E C   1 
ATOM   1440 O O   . LYS A 1 200 ? 7.031  26.171  9.710  1.00 13.55 ? 222 LYS E O   1 
ATOM   1441 C CB  . LYS A 1 200 ? 8.731  28.128  8.037  1.00 14.42 ? 222 LYS E CB  1 
ATOM   1442 C CG  . LYS A 1 200 ? 8.948  29.352  8.971  1.00 34.97 ? 222 LYS E CG  1 
ATOM   1443 C CD  . LYS A 1 200 ? 8.733  30.718  8.284  1.00 42.21 ? 222 LYS E CD  1 
ATOM   1444 C CE  . LYS A 1 200 ? 9.061  31.909  9.232  1.00 63.37 ? 222 LYS E CE  1 
ATOM   1445 N NZ  . LYS A 1 200 ? 8.477  33.194  8.724  1.00 63.72 ? 222 LYS E NZ  1 
ATOM   1446 N N   . ASN A 1 201 ? 8.672  26.692  11.067 1.00 5.33  ? 223 ASN E N   1 
ATOM   1447 C CA  . ASN A 1 201 ? 7.862  26.530  12.276 1.00 3.16  ? 223 ASN E CA  1 
ATOM   1448 C C   . ASN A 1 201 ? 7.290  25.148  12.440 1.00 17.99 ? 223 ASN E C   1 
ATOM   1449 O O   . ASN A 1 201 ? 6.354  25.026  13.228 1.00 20.00 ? 223 ASN E O   1 
ATOM   1450 C CB  . ASN A 1 201 ? 6.668  27.503  12.399 1.00 17.76 ? 223 ASN E CB  1 
ATOM   1451 C CG  . ASN A 1 201 ? 7.267  28.899  12.481 1.00 47.99 ? 223 ASN E CG  1 
ATOM   1452 O OD1 . ASN A 1 201 ? 8.119  29.139  13.326 1.00 40.49 ? 223 ASN E OD1 1 
ATOM   1453 N ND2 . ASN A 1 201 ? 6.832  29.752  11.585 1.00 35.08 ? 223 ASN E ND2 1 
ATOM   1454 N N   . LYS A 1 202 ? 7.831  24.174  11.726 1.00 18.46 ? 224 LYS E N   1 
ATOM   1455 C CA  . LYS A 1 202 ? 7.366  22.782  11.974 1.00 5.83  ? 224 LYS E CA  1 
ATOM   1456 C C   . LYS A 1 202 ? 8.582  21.848  12.053 1.00 18.13 ? 224 LYS E C   1 
ATOM   1457 O O   . LYS A 1 202 ? 8.933  21.161  11.074 1.00 11.14 ? 224 LYS E O   1 
ATOM   1458 C CB  . LYS A 1 202 ? 6.448  22.310  10.799 1.00 6.95  ? 224 LYS E CB  1 
ATOM   1459 C CG  . LYS A 1 202 ? 5.078  23.047  10.772 1.00 15.80 ? 224 LYS E CG  1 
ATOM   1460 C CD  . LYS A 1 202 ? 4.331  22.734  12.086 1.00 20.00 ? 224 LYS E CD  1 
ATOM   1461 C CE  . LYS A 1 202 ? 3.066  23.584  12.325 1.00 52.06 ? 224 LYS E CE  1 
ATOM   1462 N NZ  . LYS A 1 202 ? 2.142  22.818  13.219 1.00 43.80 ? 224 LYS E NZ  1 
ATOM   1463 N N   . PRO A 1 203 ? 9.252  21.873  13.193 1.00 25.00 ? 225 PRO E N   1 
ATOM   1464 C CA  . PRO A 1 203 ? 10.482 21.032  13.326 1.00 17.73 ? 225 PRO E CA  1 
ATOM   1465 C C   . PRO A 1 203 ? 10.149 19.530  13.493 1.00 10.79 ? 225 PRO E C   1 
ATOM   1466 O O   . PRO A 1 203 ? 8.997  19.126  13.607 1.00 4.77  ? 225 PRO E O   1 
ATOM   1467 C CB  . PRO A 1 203 ? 11.144 21.651  14.548 1.00 10.72 ? 225 PRO E CB  1 
ATOM   1468 C CG  . PRO A 1 203 ? 9.943  22.115  15.413 1.00 16.86 ? 225 PRO E CG  1 
ATOM   1469 C CD  . PRO A 1 203 ? 8.884  22.591  14.435 1.00 8.31  ? 225 PRO E CD  1 
ATOM   1470 N N   . GLY A 1 204 ? 11.105 18.674  13.351 1.00 3.00  ? 226 GLY E N   1 
ATOM   1471 C CA  . GLY A 1 204 ? 10.825 17.276  13.563 1.00 3.00  ? 226 GLY E CA  1 
ATOM   1472 C C   . GLY A 1 204 ? 10.601 16.948  15.031 1.00 3.00  ? 226 GLY E C   1 
ATOM   1473 O O   . GLY A 1 204 ? 11.163 17.606  15.919 1.00 3.10  ? 226 GLY E O   1 
ATOM   1474 N N   . VAL A 1 205 ? 9.857  15.878  15.206 1.00 3.63  ? 227 VAL E N   1 
ATOM   1475 C CA  . VAL A 1 205 ? 9.529  15.339  16.488 1.00 3.66  ? 227 VAL E CA  1 
ATOM   1476 C C   . VAL A 1 205 ? 10.026 13.903  16.588 1.00 4.47  ? 227 VAL E C   1 
ATOM   1477 O O   . VAL A 1 205 ? 10.024 13.152  15.611 1.00 3.14  ? 227 VAL E O   1 
ATOM   1478 C CB  . VAL A 1 205 ? 8.002  15.441  16.681 1.00 4.15  ? 227 VAL E CB  1 
ATOM   1479 C CG1 . VAL A 1 205 ? 7.738  15.043  18.159 1.00 5.32  ? 227 VAL E CG1 1 
ATOM   1480 C CG2 . VAL A 1 205 ? 7.551  16.893  16.393 1.00 3.00  ? 227 VAL E CG2 1 
ATOM   1481 N N   . TYR A 1 206 ? 10.739 13.699  17.705 1.00 7.25  ? 228 TYR E N   1 
ATOM   1482 C CA  . TYR A 1 206 ? 11.600 12.562  18.049 1.00 3.00  ? 228 TYR E CA  1 
ATOM   1483 C C   . TYR A 1 206 ? 11.152 11.918  19.380 1.00 9.92  ? 228 TYR E C   1 
ATOM   1484 O O   . TYR A 1 206 ? 10.701 12.575  20.317 1.00 3.00  ? 228 TYR E O   1 
ATOM   1485 C CB  . TYR A 1 206 ? 13.014 13.163  18.223 1.00 3.00  ? 228 TYR E CB  1 
ATOM   1486 C CG  . TYR A 1 206 ? 13.513 13.749  16.866 1.00 3.03  ? 228 TYR E CG  1 
ATOM   1487 C CD1 . TYR A 1 206 ? 14.088 12.914  15.917 1.00 4.69  ? 228 TYR E CD1 1 
ATOM   1488 C CD2 . TYR A 1 206 ? 13.437 15.114  16.604 1.00 4.05  ? 228 TYR E CD2 1 
ATOM   1489 C CE1 . TYR A 1 206 ? 14.488 13.464  14.667 1.00 6.51  ? 228 TYR E CE1 1 
ATOM   1490 C CE2 . TYR A 1 206 ? 13.850 15.712  15.389 1.00 3.00  ? 228 TYR E CE2 1 
ATOM   1491 C CZ  . TYR A 1 206 ? 14.354 14.847  14.397 1.00 4.40  ? 228 TYR E CZ  1 
ATOM   1492 O OH  . TYR A 1 206 ? 14.591 15.337  13.132 1.00 3.00  ? 228 TYR E OH  1 
ATOM   1493 N N   . THR A 1 207 ? 11.224 10.622  19.443 1.00 3.51  ? 229 THR E N   1 
ATOM   1494 C CA  . THR A 1 207 ? 10.953 9.923   20.682 1.00 3.00  ? 229 THR E CA  1 
ATOM   1495 C C   . THR A 1 207 ? 12.101 10.225  21.632 1.00 3.98  ? 229 THR E C   1 
ATOM   1496 O O   . THR A 1 207 ? 13.244 10.097  21.233 1.00 3.00  ? 229 THR E O   1 
ATOM   1497 C CB  . THR A 1 207 ? 10.876 8.388   20.442 1.00 3.88  ? 229 THR E CB  1 
ATOM   1498 O OG1 . THR A 1 207 ? 9.932  8.133   19.370 1.00 5.11  ? 229 THR E OG1 1 
ATOM   1499 C CG2 . THR A 1 207 ? 10.475 7.509   21.683 1.00 4.54  ? 229 THR E CG2 1 
ATOM   1500 N N   . LYS A 1 208 ? 11.738 10.562  22.855 1.00 3.67  ? 230 LYS E N   1 
ATOM   1501 C CA  . LYS A 1 208 ? 12.647 10.857  23.939 1.00 13.94 ? 230 LYS E CA  1 
ATOM   1502 C C   . LYS A 1 208 ? 13.236 9.661   24.672 1.00 13.84 ? 230 LYS E C   1 
ATOM   1503 O O   . LYS A 1 208 ? 12.610 9.213   25.630 1.00 9.77  ? 230 LYS E O   1 
ATOM   1504 C CB  . LYS A 1 208 ? 11.899 11.765  24.903 1.00 6.59  ? 230 LYS E CB  1 
ATOM   1505 C CG  . LYS A 1 208 ? 12.881 12.516  25.807 1.00 15.39 ? 230 LYS E CG  1 
ATOM   1506 C CD  . LYS A 1 208 ? 12.045 13.660  26.404 1.00 15.36 ? 230 LYS E CD  1 
ATOM   1507 C CE  . LYS A 1 208 ? 12.755 14.264  27.621 1.00 32.45 ? 230 LYS E CE  1 
ATOM   1508 N NZ  . LYS A 1 208 ? 11.980 15.427  28.061 1.00 47.86 ? 230 LYS E NZ  1 
ATOM   1509 N N   . VAL A 1 209 ? 14.343 9.105   24.104 1.00 3.00  ? 231 VAL E N   1 
ATOM   1510 C CA  . VAL A 1 209 ? 14.937 7.824   24.574 1.00 14.56 ? 231 VAL E CA  1 
ATOM   1511 C C   . VAL A 1 209 ? 15.242 7.781   26.094 1.00 24.40 ? 231 VAL E C   1 
ATOM   1512 O O   . VAL A 1 209 ? 15.110 6.758   26.776 1.00 8.86  ? 231 VAL E O   1 
ATOM   1513 C CB  . VAL A 1 209 ? 16.143 7.406   23.648 1.00 3.19  ? 231 VAL E CB  1 
ATOM   1514 C CG1 . VAL A 1 209 ? 16.833 6.084   24.078 1.00 3.00  ? 231 VAL E CG1 1 
ATOM   1515 C CG2 . VAL A 1 209 ? 15.651 7.211   22.201 1.00 3.00  ? 231 VAL E CG2 1 
ATOM   1516 N N   . CYS A 1 210 ? 15.577 8.903   26.690 1.00 12.18 ? 232 CYS E N   1 
ATOM   1517 C CA  . CYS A 1 210 ? 16.048 8.823   28.090 1.00 13.63 ? 232 CYS E CA  1 
ATOM   1518 C C   . CYS A 1 210 ? 14.885 8.396   28.999 1.00 5.81  ? 232 CYS E C   1 
ATOM   1519 O O   . CYS A 1 210 ? 15.127 7.995   30.100 1.00 12.58 ? 232 CYS E O   1 
ATOM   1520 C CB  . CYS A 1 210 ? 16.591 10.222  28.489 1.00 6.99  ? 232 CYS E CB  1 
ATOM   1521 S SG  . CYS A 1 210 ? 15.365 11.550  28.383 1.00 16.31 ? 232 CYS E SG  1 
ATOM   1522 N N   . ASN A 1 211 ? 13.626 8.514   28.555 1.00 8.57  ? 233 ASN E N   1 
ATOM   1523 C CA  . ASN A 1 211 ? 12.487 8.179   29.342 1.00 3.00  ? 233 ASN E CA  1 
ATOM   1524 C C   . ASN A 1 211 ? 12.360 6.669   29.261 1.00 10.10 ? 233 ASN E C   1 
ATOM   1525 O O   . ASN A 1 211 ? 11.391 6.207   29.804 1.00 13.56 ? 233 ASN E O   1 
ATOM   1526 C CB  . ASN A 1 211 ? 11.180 8.769   28.774 1.00 3.00  ? 233 ASN E CB  1 
ATOM   1527 C CG  . ASN A 1 211 ? 11.079 10.256  29.083 1.00 6.75  ? 233 ASN E CG  1 
ATOM   1528 O OD1 . ASN A 1 211 ? 11.993 10.770  29.711 1.00 13.45 ? 233 ASN E OD1 1 
ATOM   1529 N ND2 . ASN A 1 211 ? 10.029 10.920  28.569 1.00 4.31  ? 233 ASN E ND2 1 
ATOM   1530 N N   . TYR A 1 212 ? 13.143 5.964   28.443 1.00 3.13  ? 234 TYR E N   1 
ATOM   1531 C CA  . TYR A 1 212 ? 12.868 4.518   28.258 1.00 4.38  ? 234 TYR E CA  1 
ATOM   1532 C C   . TYR A 1 212 ? 14.047 3.602   28.634 1.00 20.05 ? 234 TYR E C   1 
ATOM   1533 O O   . TYR A 1 212 ? 13.983 2.433   28.263 1.00 9.48  ? 234 TYR E O   1 
ATOM   1534 C CB  . TYR A 1 212 ? 12.444 4.241   26.759 1.00 14.14 ? 234 TYR E CB  1 
ATOM   1535 C CG  . TYR A 1 212 ? 11.140 4.939   26.339 1.00 8.25  ? 234 TYR E CG  1 
ATOM   1536 C CD1 . TYR A 1 212 ? 9.926  4.316   26.576 1.00 15.86 ? 234 TYR E CD1 1 
ATOM   1537 C CD2 . TYR A 1 212 ? 11.155 6.179   25.775 1.00 3.08  ? 234 TYR E CD2 1 
ATOM   1538 C CE1 . TYR A 1 212 ? 8.746  4.943   26.273 1.00 4.73  ? 234 TYR E CE1 1 
ATOM   1539 C CE2 . TYR A 1 212 ? 9.977  6.804   25.456 1.00 6.06  ? 234 TYR E CE2 1 
ATOM   1540 C CZ  . TYR A 1 212 ? 8.769  6.210   25.729 1.00 3.84  ? 234 TYR E CZ  1 
ATOM   1541 O OH  . TYR A 1 212 ? 7.601  6.880   25.433 1.00 4.04  ? 234 TYR E OH  1 
ATOM   1542 N N   . VAL A 1 213 ? 15.166 4.144   29.160 1.00 4.24  ? 235 VAL E N   1 
ATOM   1543 C CA  . VAL A 1 213 ? 16.401 3.344   29.253 1.00 7.75  ? 235 VAL E CA  1 
ATOM   1544 C C   . VAL A 1 213 ? 16.158 2.118   30.093 1.00 15.19 ? 235 VAL E C   1 
ATOM   1545 O O   . VAL A 1 213 ? 16.718 1.074   29.784 1.00 14.26 ? 235 VAL E O   1 
ATOM   1546 C CB  . VAL A 1 213 ? 17.636 4.170   29.763 1.00 13.83 ? 235 VAL E CB  1 
ATOM   1547 C CG1 . VAL A 1 213 ? 18.921 3.364   30.076 1.00 10.52 ? 235 VAL E CG1 1 
ATOM   1548 C CG2 . VAL A 1 213 ? 18.036 5.209   28.662 1.00 18.73 ? 235 VAL E CG2 1 
ATOM   1549 N N   . SER A 1 214 ? 15.305 2.275   31.091 1.00 9.71  ? 236 SER E N   1 
ATOM   1550 C CA  . SER A 1 214 ? 15.098 1.099   31.996 1.00 22.82 ? 236 SER E CA  1 
ATOM   1551 C C   . SER A 1 214 ? 14.406 -0.050  31.282 1.00 12.02 ? 236 SER E C   1 
ATOM   1552 O O   . SER A 1 214 ? 14.910 -1.189  31.412 1.00 26.53 ? 236 SER E O   1 
ATOM   1553 C CB  . SER A 1 214 ? 14.139 1.442   33.139 1.00 36.98 ? 236 SER E CB  1 
ATOM   1554 O OG  . SER A 1 214 ? 14.835 2.286   33.991 1.00 47.54 ? 236 SER E OG  1 
ATOM   1555 N N   . TRP A 1 215 ? 13.236 0.328   30.697 1.00 7.16  ? 237 TRP E N   1 
ATOM   1556 C CA  . TRP A 1 215 ? 12.380 -0.559  29.866 1.00 20.63 ? 237 TRP E CA  1 
ATOM   1557 C C   . TRP A 1 215 ? 13.235 -1.238  28.783 1.00 13.71 ? 237 TRP E C   1 
ATOM   1558 O O   . TRP A 1 215 ? 13.216 -2.447  28.637 1.00 7.53  ? 237 TRP E O   1 
ATOM   1559 C CB  . TRP A 1 215 ? 11.175 0.200   29.215 1.00 6.59  ? 237 TRP E CB  1 
ATOM   1560 C CG  . TRP A 1 215 ? 10.393 -0.692  28.245 1.00 22.43 ? 237 TRP E CG  1 
ATOM   1561 C CD1 . TRP A 1 215 ? 9.541  -1.684  28.568 1.00 30.92 ? 237 TRP E CD1 1 
ATOM   1562 C CD2 . TRP A 1 215 ? 10.467 -0.709  26.835 1.00 34.55 ? 237 TRP E CD2 1 
ATOM   1563 N NE1 . TRP A 1 215 ? 9.098  -2.336  27.386 1.00 32.08 ? 237 TRP E NE1 1 
ATOM   1564 C CE2 . TRP A 1 215 ? 9.639  -1.762  26.382 1.00 47.74 ? 237 TRP E CE2 1 
ATOM   1565 C CE3 . TRP A 1 215 ? 11.201 0.057   25.943 1.00 25.79 ? 237 TRP E CE3 1 
ATOM   1566 C CZ2 . TRP A 1 215 ? 9.502  -2.088  25.038 1.00 12.36 ? 237 TRP E CZ2 1 
ATOM   1567 C CZ3 . TRP A 1 215 ? 11.069 -0.290  24.599 1.00 25.80 ? 237 TRP E CZ3 1 
ATOM   1568 C CH2 . TRP A 1 215 ? 10.244 -1.335  24.162 1.00 8.70  ? 237 TRP E CH2 1 
ATOM   1569 N N   . ILE A 1 216 ? 14.131 -0.516  28.144 1.00 10.50 ? 238 ILE E N   1 
ATOM   1570 C CA  . ILE A 1 216 ? 15.004 -1.189  27.173 1.00 3.76  ? 238 ILE E CA  1 
ATOM   1571 C C   . ILE A 1 216 ? 15.930 -2.169  27.880 1.00 16.00 ? 238 ILE E C   1 
ATOM   1572 O O   . ILE A 1 216 ? 16.060 -3.287  27.388 1.00 18.35 ? 238 ILE E O   1 
ATOM   1573 C CB  . ILE A 1 216 ? 15.875 -0.088  26.457 1.00 3.00  ? 238 ILE E CB  1 
ATOM   1574 C CG1 . ILE A 1 216 ? 15.084 0.796   25.518 1.00 3.60  ? 238 ILE E CG1 1 
ATOM   1575 C CG2 . ILE A 1 216 ? 17.073 -0.657  25.769 1.00 6.67  ? 238 ILE E CG2 1 
ATOM   1576 C CD1 . ILE A 1 216 ? 15.793 2.144   25.187 1.00 3.46  ? 238 ILE E CD1 1 
ATOM   1577 N N   . LYS A 1 217 ? 16.637 -1.754  28.930 1.00 17.58 ? 239 LYS E N   1 
ATOM   1578 C CA  . LYS A 1 217 ? 17.655 -2.656  29.511 1.00 12.93 ? 239 LYS E CA  1 
ATOM   1579 C C   . LYS A 1 217 ? 16.979 -3.874  30.148 1.00 15.09 ? 239 LYS E C   1 
ATOM   1580 O O   . LYS A 1 217 ? 17.478 -4.994  29.988 1.00 11.50 ? 239 LYS E O   1 
ATOM   1581 C CB  . LYS A 1 217 ? 18.489 -1.873  30.576 1.00 13.36 ? 239 LYS E CB  1 
ATOM   1582 C CG  . LYS A 1 217 ? 19.638 -1.076  29.956 1.00 14.87 ? 239 LYS E CG  1 
ATOM   1583 C CD  . LYS A 1 217 ? 20.092 0.035   30.889 1.00 21.61 ? 239 LYS E CD  1 
ATOM   1584 C CE  . LYS A 1 217 ? 21.434 0.587   30.386 1.00 61.42 ? 239 LYS E CE  1 
ATOM   1585 N NZ  . LYS A 1 217 ? 22.041 1.329   31.503 1.00 63.81 ? 239 LYS E NZ  1 
ATOM   1586 N N   . GLN A 1 218 ? 15.763 -3.627  30.577 1.00 13.59 ? 240 GLN E N   1 
ATOM   1587 C CA  . GLN A 1 218 ? 14.868 -4.693  31.103 1.00 32.18 ? 240 GLN E CA  1 
ATOM   1588 C C   . GLN A 1 218 ? 14.596 -5.739  30.013 1.00 43.62 ? 240 GLN E C   1 
ATOM   1589 O O   . GLN A 1 218 ? 14.930 -6.923  30.196 1.00 21.08 ? 240 GLN E O   1 
ATOM   1590 C CB  . GLN A 1 218 ? 13.520 -4.083  31.614 1.00 36.36 ? 240 GLN E CB  1 
ATOM   1591 C CG  . GLN A 1 218 ? 12.810 -4.801  32.815 1.00 49.24 ? 240 GLN E CG  1 
ATOM   1592 C CD  . GLN A 1 218 ? 11.578 -5.579  32.352 1.00 46.44 ? 240 GLN E CD  1 
ATOM   1593 O OE1 . GLN A 1 218 ? 11.263 -6.623  32.916 1.00 42.16 ? 240 GLN E OE1 1 
ATOM   1594 N NE2 . GLN A 1 218 ? 10.895 -5.146  31.290 1.00 43.55 ? 240 GLN E NE2 1 
ATOM   1595 N N   . THR A 1 219 ? 13.966 -5.242  28.931 1.00 30.14 ? 241 THR E N   1 
ATOM   1596 C CA  . THR A 1 219 ? 13.505 -6.069  27.787 1.00 19.39 ? 241 THR E CA  1 
ATOM   1597 C C   . THR A 1 219 ? 14.588 -6.921  27.130 1.00 10.64 ? 241 THR E C   1 
ATOM   1598 O O   . THR A 1 219 ? 14.471 -8.136  27.053 1.00 15.37 ? 241 THR E O   1 
ATOM   1599 C CB  . THR A 1 219 ? 12.773 -5.123  26.824 1.00 15.33 ? 241 THR E CB  1 
ATOM   1600 O OG1 . THR A 1 219 ? 11.862 -4.369  27.666 1.00 12.39 ? 241 THR E OG1 1 
ATOM   1601 C CG2 . THR A 1 219 ? 11.947 -5.843  25.726 1.00 22.01 ? 241 THR E CG2 1 
ATOM   1602 N N   . ILE A 1 220 ? 15.701 -6.299  26.864 1.00 11.64 ? 242 ILE E N   1 
ATOM   1603 C CA  . ILE A 1 220 ? 16.896 -6.875  26.325 1.00 16.01 ? 242 ILE E CA  1 
ATOM   1604 C C   . ILE A 1 220 ? 17.486 -7.972  27.177 1.00 35.48 ? 242 ILE E C   1 
ATOM   1605 O O   . ILE A 1 220 ? 17.993 -8.923  26.599 1.00 29.81 ? 242 ILE E O   1 
ATOM   1606 C CB  . ILE A 1 220 ? 17.906 -5.732  26.091 1.00 9.97  ? 242 ILE E CB  1 
ATOM   1607 C CG1 . ILE A 1 220 ? 17.518 -5.111  24.767 1.00 7.47  ? 242 ILE E CG1 1 
ATOM   1608 C CG2 . ILE A 1 220 ? 19.351 -6.168  25.984 1.00 31.97 ? 242 ILE E CG2 1 
ATOM   1609 C CD1 . ILE A 1 220 ? 18.032 -3.678  24.738 1.00 53.97 ? 242 ILE E CD1 1 
ATOM   1610 N N   . ALA A 1 221 ? 17.510 -7.783  28.485 1.00 32.44 ? 243 ALA E N   1 
ATOM   1611 C CA  . ALA A 1 221 ? 18.192 -8.805  29.293 1.00 19.02 ? 243 ALA E CA  1 
ATOM   1612 C C   . ALA A 1 221 ? 17.176 -9.862  29.701 1.00 15.87 ? 243 ALA E C   1 
ATOM   1613 O O   . ALA A 1 221 ? 17.547 -10.975 30.039 1.00 44.93 ? 243 ALA E O   1 
ATOM   1614 C CB  . ALA A 1 221 ? 18.931 -8.244  30.514 1.00 26.71 ? 243 ALA E CB  1 
ATOM   1615 N N   . SER A 1 222 ? 15.963 -9.609  29.429 1.00 23.28 ? 244 SER E N   1 
ATOM   1616 C CA  . SER A 1 222 ? 14.951 -10.654 29.654 1.00 26.62 ? 244 SER E CA  1 
ATOM   1617 C C   . SER A 1 222 ? 14.351 -11.442 28.462 1.00 45.02 ? 244 SER E C   1 
ATOM   1618 O O   . SER A 1 222 ? 13.304 -12.079 28.649 1.00 36.68 ? 244 SER E O   1 
ATOM   1619 C CB  . SER A 1 222 ? 13.853 -9.947  30.401 1.00 29.13 ? 244 SER E CB  1 
ATOM   1620 O OG  . SER A 1 222 ? 14.572 -9.560  31.566 1.00 37.04 ? 244 SER E OG  1 
ATOM   1621 N N   . ASN A 1 223 ? 14.880 -11.266 27.221 1.00 37.73 ? 245 ASN E N   1 
ATOM   1622 C CA  . ASN A 1 223 ? 14.275 -11.869 25.998 1.00 24.34 ? 245 ASN E CA  1 
ATOM   1623 C C   . ASN A 1 223 ? 15.334 -12.436 25.060 1.00 16.17 ? 245 ASN E C   1 
ATOM   1624 O O   . ASN A 1 223 ? 15.083 -12.405 23.865 1.00 30.31 ? 245 ASN E O   1 
ATOM   1625 C CB  . ASN A 1 223 ? 13.484 -10.851 25.166 1.00 18.35 ? 245 ASN E CB  1 
ATOM   1626 C CG  . ASN A 1 223 ? 12.131 -10.487 25.760 1.00 13.28 ? 245 ASN E CG  1 
ATOM   1627 O OD1 . ASN A 1 223 ? 11.146 -11.190 25.532 1.00 35.95 ? 245 ASN E OD1 1 
ATOM   1628 N ND2 . ASN A 1 223 ? 12.087 -9.424  26.508 1.00 24.25 ? 245 ASN E ND2 1 
ATOM   1629 O OXT . ASN A 1 223 ? 16.558 -12.460 25.376 1.00 27.93 ? 245 ASN E OXT 1 
ATOM   1630 N N   . ARG B 2 1   ? -0.012 18.656  10.567 1.00 33.34 ? 1   ARG I N   1 
ATOM   1631 C CA  . ARG B 2 1   ? -0.471 17.243  10.547 1.00 32.42 ? 1   ARG I CA  1 
ATOM   1632 C C   . ARG B 2 1   ? 0.571  16.320  11.166 1.00 24.38 ? 1   ARG I C   1 
ATOM   1633 O O   . ARG B 2 1   ? 1.785  16.601  11.121 1.00 27.42 ? 1   ARG I O   1 
ATOM   1634 C CB  . ARG B 2 1   ? -0.702 16.787  9.099  1.00 18.37 ? 1   ARG I CB  1 
ATOM   1635 C CG  . ARG B 2 1   ? -0.012 17.775  8.205  1.00 13.85 ? 1   ARG I CG  1 
ATOM   1636 C CD  . ARG B 2 1   ? -0.579 17.675  6.778  1.00 20.56 ? 1   ARG I CD  1 
ATOM   1637 N NE  . ARG B 2 1   ? -0.192 16.393  6.261  1.00 37.25 ? 1   ARG I NE  1 
ATOM   1638 C CZ  . ARG B 2 1   ? 0.962  16.055  5.690  1.00 28.69 ? 1   ARG I CZ  1 
ATOM   1639 N NH1 . ARG B 2 1   ? 1.981  16.864  5.350  1.00 30.80 ? 1   ARG I NH1 1 
ATOM   1640 N NH2 . ARG B 2 1   ? 0.905  14.866  5.208  1.00 23.22 ? 1   ARG I NH2 1 
ATOM   1641 N N   . VAL B 2 2   ? 0.026  15.273  11.716 1.00 16.32 ? 2   VAL I N   1 
ATOM   1642 C CA  . VAL B 2 2   ? 0.875  14.213  12.248 1.00 15.60 ? 2   VAL I CA  1 
ATOM   1643 C C   . VAL B 2 2   ? 1.167  13.185  11.159 1.00 14.33 ? 2   VAL I C   1 
ATOM   1644 O O   . VAL B 2 2   ? 0.366  12.310  10.825 1.00 12.69 ? 2   VAL I O   1 
ATOM   1645 C CB  . VAL B 2 2   ? 0.255  13.631  13.523 1.00 21.44 ? 2   VAL I CB  1 
ATOM   1646 C CG1 . VAL B 2 2   ? 1.074  12.512  14.194 1.00 13.21 ? 2   VAL I CG1 1 
ATOM   1647 C CG2 . VAL B 2 2   ? -0.100 14.784  14.482 1.00 15.92 ? 2   VAL I CG2 1 
ATOM   1648 N N   . CYS B 2 3   ? 2.347  13.334  10.581 1.00 15.61 ? 3   CYS I N   1 
ATOM   1649 C CA  . CYS B 2 3   ? 2.737  12.316  9.611  1.00 8.79  ? 3   CYS I CA  1 
ATOM   1650 C C   . CYS B 2 3   ? 4.069  11.610  9.986  1.00 11.83 ? 3   CYS I C   1 
ATOM   1651 O O   . CYS B 2 3   ? 5.114  12.252  9.990  1.00 3.56  ? 3   CYS I O   1 
ATOM   1652 C CB  . CYS B 2 3   ? 2.778  13.078  8.275  1.00 14.41 ? 3   CYS I CB  1 
ATOM   1653 S SG  . CYS B 2 3   ? 3.423  12.104  6.938  1.00 7.31  ? 3   CYS I SG  1 
ATOM   1654 N N   . PRO B 2 4   ? 4.020  10.344  10.379 1.00 11.42 ? 4   PRO I N   1 
ATOM   1655 C CA  . PRO B 2 4   ? 5.234  9.570   10.623 1.00 3.00  ? 4   PRO I CA  1 
ATOM   1656 C C   . PRO B 2 4   ? 6.175  9.502   9.406  1.00 5.11  ? 4   PRO I C   1 
ATOM   1657 O O   . PRO B 2 4   ? 5.713  9.516   8.264  1.00 3.00  ? 4   PRO I O   1 
ATOM   1658 C CB  . PRO B 2 4   ? 4.769  8.201   10.988 1.00 3.00  ? 4   PRO I CB  1 
ATOM   1659 C CG  . PRO B 2 4   ? 3.295  8.161   10.609 1.00 14.11 ? 4   PRO I CG  1 
ATOM   1660 C CD  . PRO B 2 4   ? 2.778  9.571   10.661 1.00 3.60  ? 4   PRO I CD  1 
ATOM   1661 N N   . ARG B 2 5   ? 7.473  9.408   9.714  1.00 3.00  ? 5   ARG I N   1 
ATOM   1662 C CA  . ARG B 2 5   ? 8.536  9.553   8.761  1.00 13.81 ? 5   ARG I CA  1 
ATOM   1663 C C   . ARG B 2 5   ? 8.913  8.253   8.124  1.00 3.00  ? 5   ARG I C   1 
ATOM   1664 O O   . ARG B 2 5   ? 10.086 8.063   7.830  1.00 3.00  ? 5   ARG I O   1 
ATOM   1665 C CB  . ARG B 2 5   ? 9.698  10.474  9.209  1.00 3.00  ? 5   ARG I CB  1 
ATOM   1666 C CG  . ARG B 2 5   ? 9.129  11.918  9.373  1.00 4.47  ? 5   ARG I CG  1 
ATOM   1667 C CD  . ARG B 2 5   ? 10.083 12.946  9.980  1.00 3.00  ? 5   ARG I CD  1 
ATOM   1668 N NE  . ARG B 2 5   ? 9.435  14.208  9.737  1.00 3.00  ? 5   ARG I NE  1 
ATOM   1669 C CZ  . ARG B 2 5   ? 10.007 15.325  10.111 1.00 6.07  ? 5   ARG I CZ  1 
ATOM   1670 N NH1 . ARG B 2 5   ? 11.134 15.314  10.789 1.00 4.50  ? 5   ARG I NH1 1 
ATOM   1671 N NH2 . ARG B 2 5   ? 9.530  16.492  9.780  1.00 5.62  ? 5   ARG I NH2 1 
ATOM   1672 N N   . ILE B 2 6   ? 7.940  7.370   8.010  1.00 3.77  ? 6   ILE I N   1 
ATOM   1673 C CA  . ILE B 2 6   ? 8.294  6.039   7.320  1.00 3.00  ? 6   ILE I CA  1 
ATOM   1674 C C   . ILE B 2 6   ? 8.189  6.218   5.792  1.00 9.34  ? 6   ILE I C   1 
ATOM   1675 O O   . ILE B 2 6   ? 7.344  7.001   5.273  1.00 5.14  ? 6   ILE I O   1 
ATOM   1676 C CB  . ILE B 2 6   ? 7.301  4.888   7.788  1.00 7.04  ? 6   ILE I CB  1 
ATOM   1677 C CG1 . ILE B 2 6   ? 7.532  3.495   7.167  1.00 3.00  ? 6   ILE I CG1 1 
ATOM   1678 C CG2 . ILE B 2 6   ? 5.810  5.373   7.719  1.00 3.10  ? 6   ILE I CG2 1 
ATOM   1679 C CD1 . ILE B 2 6   ? 6.684  2.447   7.888  1.00 4.89  ? 6   ILE I CD1 1 
ATOM   1680 N N   . LEU B 2 7   ? 9.040  5.428   5.094  1.00 11.09 ? 7   LEU I N   1 
ATOM   1681 C CA  . LEU B 2 7   ? 8.936  5.443   3.612  1.00 3.00  ? 7   LEU I CA  1 
ATOM   1682 C C   . LEU B 2 7   ? 7.866  4.426   3.246  1.00 12.66 ? 7   LEU I C   1 
ATOM   1683 O O   . LEU B 2 7   ? 8.001  3.257   3.615  1.00 4.25  ? 7   LEU I O   1 
ATOM   1684 C CB  . LEU B 2 7   ? 10.253 4.985   2.969  1.00 7.89  ? 7   LEU I CB  1 
ATOM   1685 C CG  . LEU B 2 7   ? 10.264 5.001   1.393  1.00 13.86 ? 7   LEU I CG  1 
ATOM   1686 C CD1 . LEU B 2 7   ? 9.758  6.343   0.885  1.00 13.88 ? 7   LEU I CD1 1 
ATOM   1687 C CD2 . LEU B 2 7   ? 11.704 4.868   0.845  1.00 5.11  ? 7   LEU I CD2 1 
ATOM   1688 N N   . MET B 2 8   ? 6.749  4.932   2.683  1.00 8.64  ? 8   MET I N   1 
ATOM   1689 C CA  . MET B 2 8   ? 5.630  4.076   2.362  1.00 3.00  ? 8   MET I CA  1 
ATOM   1690 C C   . MET B 2 8   ? 5.068  4.386   0.964  1.00 11.88 ? 8   MET I C   1 
ATOM   1691 O O   . MET B 2 8   ? 4.745  5.542   0.651  1.00 4.49  ? 8   MET I O   1 
ATOM   1692 C CB  . MET B 2 8   ? 4.582  4.222   3.471  1.00 5.23  ? 8   MET I CB  1 
ATOM   1693 C CG  . MET B 2 8   ? 3.298  3.393   3.298  1.00 12.17 ? 8   MET I CG  1 
ATOM   1694 S SD  . MET B 2 8   ? 2.179  3.301   4.796  1.00 24.21 ? 8   MET I SD  1 
ATOM   1695 C CE  . MET B 2 8   ? 3.466  3.180   6.070  1.00 21.40 ? 8   MET I CE  1 
ATOM   1696 N N   . GLU B 2 9   ? 5.087  3.351   0.099  1.00 7.23  ? 9   GLU I N   1 
ATOM   1697 C CA  . GLU B 2 9   ? 4.505  3.490   -1.271 1.00 26.64 ? 9   GLU I CA  1 
ATOM   1698 C C   . GLU B 2 9   ? 2.999  3.719   -1.140 1.00 23.44 ? 9   GLU I C   1 
ATOM   1699 O O   . GLU B 2 9   ? 2.355  3.149   -0.256 1.00 15.55 ? 9   GLU I O   1 
ATOM   1700 C CB  . GLU B 2 9   ? 4.741  2.171   -2.053 1.00 10.59 ? 9   GLU I CB  1 
ATOM   1701 C CG  . GLU B 2 9   ? 6.107  2.125   -2.760 1.00 28.46 ? 9   GLU I CG  1 
ATOM   1702 C CD  . GLU B 2 9   ? 6.509  0.696   -3.149 1.00 17.54 ? 9   GLU I CD  1 
ATOM   1703 O OE1 . GLU B 2 9   ? 5.806  -0.022  -3.883 1.00 29.40 ? 9   GLU I OE1 1 
ATOM   1704 O OE2 . GLU B 2 9   ? 7.564  0.181   -2.736 1.00 26.45 ? 9   GLU I OE2 1 
ATOM   1705 N N   . CYS B 2 10  ? 2.394  4.509   -2.004 1.00 6.88  ? 10  CYS I N   1 
ATOM   1706 C CA  . CYS B 2 10  ? 0.921  4.492   -1.912 1.00 5.74  ? 10  CYS I CA  1 
ATOM   1707 C C   . CYS B 2 10  ? 0.298  4.677   -3.311 1.00 33.94 ? 10  CYS I C   1 
ATOM   1708 O O   . CYS B 2 10  ? 0.947  5.234   -4.199 1.00 14.26 ? 10  CYS I O   1 
ATOM   1709 C CB  . CYS B 2 10  ? 0.542  5.639   -0.984 1.00 3.00  ? 10  CYS I CB  1 
ATOM   1710 S SG  . CYS B 2 10  ? 1.310  7.186   -1.506 1.00 5.50  ? 10  CYS I SG  1 
ATOM   1711 N N   . LYS B 2 11  ? -1.007 4.522   -3.426 1.00 23.70 ? 11  LYS I N   1 
ATOM   1712 C CA  . LYS B 2 11  ? -1.724 4.992   -4.643 1.00 11.76 ? 11  LYS I CA  1 
ATOM   1713 C C   . LYS B 2 11  ? -2.836 5.983   -4.312 1.00 12.95 ? 11  LYS I C   1 
ATOM   1714 O O   . LYS B 2 11  ? -3.238 6.796   -5.160 1.00 12.13 ? 11  LYS I O   1 
ATOM   1715 C CB  . LYS B 2 11  ? -2.377 3.813   -5.356 1.00 17.39 ? 11  LYS I CB  1 
ATOM   1716 C CG  . LYS B 2 11  ? -1.368 3.061   -6.231 1.00 30.12 ? 11  LYS I CG  1 
ATOM   1717 C CD  . LYS B 2 11  ? -2.057 2.034   -7.150 0.00 32.78 ? 11  LYS I CD  1 
ATOM   1718 C CE  . LYS B 2 11  ? -1.349 0.664   -7.148 1.00 39.14 ? 11  LYS I CE  1 
ATOM   1719 N NZ  . LYS B 2 11  ? -1.878 -0.167  -6.078 1.00 43.85 ? 11  LYS I NZ  1 
ATOM   1720 N N   . LYS B 2 12  ? -3.353 5.847   -3.091 1.00 13.80 ? 12  LYS I N   1 
ATOM   1721 C CA  . LYS B 2 12  ? -4.240 6.889   -2.635 1.00 13.15 ? 12  LYS I CA  1 
ATOM   1722 C C   . LYS B 2 12  ? -3.922 7.351   -1.229 1.00 22.23 ? 12  LYS I C   1 
ATOM   1723 O O   . LYS B 2 12  ? -3.189 6.631   -0.556 1.00 8.06  ? 12  LYS I O   1 
ATOM   1724 C CB  . LYS B 2 12  ? -5.683 6.456   -2.676 1.00 11.87 ? 12  LYS I CB  1 
ATOM   1725 C CG  . LYS B 2 12  ? -5.817 5.087   -2.101 1.00 11.39 ? 12  LYS I CG  1 
ATOM   1726 C CD  . LYS B 2 12  ? -6.624 4.287   -3.139 1.00 31.10 ? 12  LYS I CD  1 
ATOM   1727 C CE  . LYS B 2 12  ? -7.796 3.703   -2.414 1.00 42.73 ? 12  LYS I CE  1 
ATOM   1728 N NZ  . LYS B 2 12  ? -7.206 3.112   -1.219 1.00 41.01 ? 12  LYS I NZ  1 
ATOM   1729 N N   . ASP B 2 13  ? -4.483 8.535   -0.889 1.00 11.51 ? 13  ASP I N   1 
ATOM   1730 C CA  . ASP B 2 13  ? -4.233 9.099   0.451  1.00 8.27  ? 13  ASP I CA  1 
ATOM   1731 C C   . ASP B 2 13  ? -4.437 8.050   1.544  1.00 18.87 ? 13  ASP I C   1 
ATOM   1732 O O   . ASP B 2 13  ? -3.672 7.992   2.500  1.00 27.37 ? 13  ASP I O   1 
ATOM   1733 C CB  . ASP B 2 13  ? -5.119 10.312  0.788  1.00 24.47 ? 13  ASP I CB  1 
ATOM   1734 C CG  . ASP B 2 13  ? -4.644 11.515  -0.011 1.00 13.86 ? 13  ASP I CG  1 
ATOM   1735 O OD1 . ASP B 2 13  ? -3.524 11.563  -0.569 1.00 8.36  ? 13  ASP I OD1 1 
ATOM   1736 O OD2 . ASP B 2 13  ? -5.389 12.502  -0.131 1.00 10.42 ? 13  ASP I OD2 1 
ATOM   1737 N N   . SER B 2 14  ? -5.502 7.310   1.368  1.00 5.77  ? 14  SER I N   1 
ATOM   1738 C CA  . SER B 2 14  ? -6.053 6.352   2.365  1.00 8.51  ? 14  SER I CA  1 
ATOM   1739 C C   . SER B 2 14  ? -5.088 5.192   2.564  1.00 3.52  ? 14  SER I C   1 
ATOM   1740 O O   . SER B 2 14  ? -5.045 4.594   3.627  1.00 13.85 ? 14  SER I O   1 
ATOM   1741 C CB  . SER B 2 14  ? -7.409 5.797   1.863  1.00 20.50 ? 14  SER I CB  1 
ATOM   1742 O OG  . SER B 2 14  ? -7.190 4.744   0.919  1.00 24.94 ? 14  SER I OG  1 
ATOM   1743 N N   . ASP B 2 15  ? -4.153 5.070   1.643  1.00 5.92  ? 15  ASP I N   1 
ATOM   1744 C CA  . ASP B 2 15  ? -3.080 4.085   1.893  1.00 10.99 ? 15  ASP I CA  1 
ATOM   1745 C C   . ASP B 2 15  ? -2.142 4.483   3.045  1.00 22.47 ? 15  ASP I C   1 
ATOM   1746 O O   . ASP B 2 15  ? -1.297 3.673   3.411  1.00 12.29 ? 15  ASP I O   1 
ATOM   1747 C CB  . ASP B 2 15  ? -2.226 3.935   0.623  1.00 9.99  ? 15  ASP I CB  1 
ATOM   1748 C CG  . ASP B 2 15  ? -3.026 3.262   -0.509 1.00 13.56 ? 15  ASP I CG  1 
ATOM   1749 O OD1 . ASP B 2 15  ? -4.089 2.633   -0.293 1.00 16.33 ? 15  ASP I OD1 1 
ATOM   1750 O OD2 . ASP B 2 15  ? -2.624 3.343   -1.694 1.00 14.39 ? 15  ASP I OD2 1 
ATOM   1751 N N   . CYS B 2 16  ? -2.100 5.760   3.399  1.00 4.27  ? 16  CYS I N   1 
ATOM   1752 C CA  . CYS B 2 16  ? -0.988 6.246   4.223  1.00 3.00  ? 16  CYS I CA  1 
ATOM   1753 C C   . CYS B 2 16  ? -1.230 6.112   5.731  1.00 11.88 ? 16  CYS I C   1 
ATOM   1754 O O   . CYS B 2 16  ? -2.383 6.117   6.126  1.00 15.03 ? 16  CYS I O   1 
ATOM   1755 C CB  . CYS B 2 16  ? -0.658 7.689   3.858  1.00 3.00  ? 16  CYS I CB  1 
ATOM   1756 S SG  . CYS B 2 16  ? -0.015 7.744   2.188  1.00 5.76  ? 16  CYS I SG  1 
ATOM   1757 N N   . LEU B 2 17  ? -0.176 6.332   6.564  1.00 12.85 ? 17  LEU I N   1 
ATOM   1758 C CA  . LEU B 2 17  ? -0.432 6.351   8.019  1.00 10.24 ? 17  LEU I CA  1 
ATOM   1759 C C   . LEU B 2 17  ? -0.917 7.722   8.476  1.00 6.48  ? 17  LEU I C   1 
ATOM   1760 O O   . LEU B 2 17  ? -0.331 8.728   8.109  1.00 11.35 ? 17  LEU I O   1 
ATOM   1761 C CB  . LEU B 2 17  ? 0.773  5.979   8.887  1.00 9.83  ? 17  LEU I CB  1 
ATOM   1762 C CG  . LEU B 2 17  ? 1.349  4.578   8.787  1.00 14.51 ? 17  LEU I CG  1 
ATOM   1763 C CD1 . LEU B 2 17  ? 2.505  4.399   9.805  1.00 14.44 ? 17  LEU I CD1 1 
ATOM   1764 C CD2 . LEU B 2 17  ? 0.231  3.576   9.119  1.00 22.84 ? 17  LEU I CD2 1 
ATOM   1765 N N   . ALA B 2 18  ? -1.690 7.714   9.558  1.00 10.63 ? 18  ALA I N   1 
ATOM   1766 C CA  . ALA B 2 18  ? -1.940 8.949   10.351 1.00 10.47 ? 18  ALA I CA  1 
ATOM   1767 C C   . ALA B 2 18  ? -2.506 10.079  9.518  1.00 12.73 ? 18  ALA I C   1 
ATOM   1768 O O   . ALA B 2 18  ? -3.381 9.851   8.704  1.00 19.62 ? 18  ALA I O   1 
ATOM   1769 C CB  . ALA B 2 18  ? -0.762 9.465   11.237 1.00 3.00  ? 18  ALA I CB  1 
ATOM   1770 N N   . GLU B 2 19  ? -1.894 11.222  9.573  1.00 5.57  ? 19  GLU I N   1 
ATOM   1771 C CA  . GLU B 2 19  ? -2.302 12.256  8.644  1.00 3.00  ? 19  GLU I CA  1 
ATOM   1772 C C   . GLU B 2 19  ? -1.206 12.558  7.647  1.00 3.00  ? 19  GLU I C   1 
ATOM   1773 O O   . GLU B 2 19  ? -1.253 13.631  7.037  1.00 8.05  ? 19  GLU I O   1 
ATOM   1774 C CB  . GLU B 2 19  ? -2.567 13.575  9.348  1.00 10.47 ? 19  GLU I CB  1 
ATOM   1775 C CG  . GLU B 2 19  ? -3.787 13.482  10.312 1.00 18.79 ? 19  GLU I CG  1 
ATOM   1776 C CD  . GLU B 2 19  ? -3.411 13.918  11.716 1.00 62.93 ? 19  GLU I CD  1 
ATOM   1777 O OE1 . GLU B 2 19  ? -3.038 15.114  11.925 1.00 37.65 ? 19  GLU I OE1 1 
ATOM   1778 O OE2 . GLU B 2 19  ? -3.459 13.064  12.656 1.00 52.39 ? 19  GLU I OE2 1 
ATOM   1779 N N   . CYS B 2 20  ? -0.570 11.489  7.226  1.00 5.82  ? 20  CYS I N   1 
ATOM   1780 C CA  . CYS B 2 20  ? 0.183  11.619  5.972  1.00 18.76 ? 20  CYS I CA  1 
ATOM   1781 C C   . CYS B 2 20  ? -0.748 11.635  4.755  1.00 12.93 ? 20  CYS I C   1 
ATOM   1782 O O   . CYS B 2 20  ? -1.720 10.889  4.774  1.00 14.38 ? 20  CYS I O   1 
ATOM   1783 C CB  . CYS B 2 20  ? 1.143  10.449  5.802  1.00 4.60  ? 20  CYS I CB  1 
ATOM   1784 S SG  . CYS B 2 20  ? 2.472  10.334  7.028  1.00 6.41  ? 20  CYS I SG  1 
ATOM   1785 N N   . VAL B 2 21  ? -0.295 12.167  3.636  1.00 3.00  ? 21  VAL I N   1 
ATOM   1786 C CA  . VAL B 2 21  ? -1.112 11.983  2.405  1.00 10.33 ? 21  VAL I CA  1 
ATOM   1787 C C   . VAL B 2 21  ? -0.274 11.315  1.312  1.00 19.31 ? 21  VAL I C   1 
ATOM   1788 O O   . VAL B 2 21  ? 0.940  11.212  1.480  1.00 9.47  ? 21  VAL I O   1 
ATOM   1789 C CB  . VAL B 2 21  ? -1.601 13.370  1.944  1.00 3.03  ? 21  VAL I CB  1 
ATOM   1790 C CG1 . VAL B 2 21  ? -2.502 14.061  3.005  1.00 3.69  ? 21  VAL I CG1 1 
ATOM   1791 C CG2 . VAL B 2 21  ? -0.379 14.273  1.593  1.00 8.57  ? 21  VAL I CG2 1 
ATOM   1792 N N   . CYS B 2 22  ? -0.900 10.873  0.213  1.00 7.02  ? 22  CYS I N   1 
ATOM   1793 C CA  . CYS B 2 22  ? -0.147 10.183  -0.822 1.00 3.33  ? 22  CYS I CA  1 
ATOM   1794 C C   . CYS B 2 22  ? 0.301  11.185  -1.842 1.00 14.48 ? 22  CYS I C   1 
ATOM   1795 O O   . CYS B 2 22  ? -0.574 11.811  -2.416 1.00 9.02  ? 22  CYS I O   1 
ATOM   1796 C CB  . CYS B 2 22  ? -1.026 9.221   -1.580 1.00 3.00  ? 22  CYS I CB  1 
ATOM   1797 S SG  . CYS B 2 22  ? -0.083 8.169   -2.719 1.00 6.58  ? 22  CYS I SG  1 
ATOM   1798 N N   . LEU B 2 23  ? 1.606  11.400  -1.954 1.00 10.27 ? 23  LEU I N   1 
ATOM   1799 C CA  . LEU B 2 23  ? 1.954  12.509  -2.853 1.00 15.09 ? 23  LEU I CA  1 
ATOM   1800 C C   . LEU B 2 23  ? 2.233  11.991  -4.267 1.00 23.96 ? 23  LEU I C   1 
ATOM   1801 O O   . LEU B 2 23  ? 2.194  10.779  -4.482 1.00 24.44 ? 23  LEU I O   1 
ATOM   1802 C CB  . LEU B 2 23  ? 3.200  13.140  -2.255 1.00 4.86  ? 23  LEU I CB  1 
ATOM   1803 C CG  . LEU B 2 23  ? 2.825  13.767  -0.918 1.00 12.51 ? 23  LEU I CG  1 
ATOM   1804 C CD1 . LEU B 2 23  ? 4.090  14.020  -0.115 1.00 28.01 ? 23  LEU I CD1 1 
ATOM   1805 C CD2 . LEU B 2 23  ? 2.020  15.051  -1.191 1.00 16.05 ? 23  LEU I CD2 1 
ATOM   1806 N N   . GLU B 2 24  ? 2.331  12.950  -5.184 1.00 11.91 ? 24  GLU I N   1 
ATOM   1807 C CA  . GLU B 2 24  ? 2.634  12.810  -6.613 1.00 28.44 ? 24  GLU I CA  1 
ATOM   1808 C C   . GLU B 2 24  ? 3.552  11.634  -7.038 1.00 27.08 ? 24  GLU I C   1 
ATOM   1809 O O   . GLU B 2 24  ? 3.166  10.950  -7.986 1.00 40.03 ? 24  GLU I O   1 
ATOM   1810 C CB  . GLU B 2 24  ? 3.172  14.169  -7.133 1.00 42.99 ? 24  GLU I CB  1 
ATOM   1811 C CG  . GLU B 2 24  ? 3.185  14.302  -8.664 1.00 51.22 ? 24  GLU I CG  1 
ATOM   1812 C CD  . GLU B 2 24  ? 3.877  15.611  -9.033 0.00 34.20 ? 24  GLU I CD  1 
ATOM   1813 O OE1 . GLU B 2 24  ? 3.404  16.711  -8.641 0.00 0.00  ? 24  GLU I OE1 1 
ATOM   1814 O OE2 . GLU B 2 24  ? 4.927  15.600  -9.729 0.00 0.00  ? 24  GLU I OE2 1 
ATOM   1815 N N   . HIS B 2 25  ? 4.725  11.352  -6.467 1.00 12.40 ? 25  HIS I N   1 
ATOM   1816 C CA  . HIS B 2 25  ? 5.504  10.137  -7.003 1.00 8.41  ? 25  HIS I CA  1 
ATOM   1817 C C   . HIS B 2 25  ? 5.266  8.835   -6.226 1.00 33.52 ? 25  HIS I C   1 
ATOM   1818 O O   . HIS B 2 25  ? 6.027  7.881   -6.371 1.00 29.21 ? 25  HIS I O   1 
ATOM   1819 C CB  . HIS B 2 25  ? 7.019  10.338  -7.046 1.00 17.26 ? 25  HIS I CB  1 
ATOM   1820 C CG  . HIS B 2 25  ? 7.256  11.745  -7.627 1.00 58.38 ? 25  HIS I CG  1 
ATOM   1821 N ND1 . HIS B 2 25  ? 7.331  12.894  -6.769 1.00 46.25 ? 25  HIS I ND1 1 
ATOM   1822 C CD2 . HIS B 2 25  ? 7.364  12.135  -8.918 1.00 40.20 ? 25  HIS I CD2 1 
ATOM   1823 C CE1 . HIS B 2 25  ? 7.576  14.024  -7.584 1.00 43.88 ? 25  HIS I CE1 1 
ATOM   1824 N NE2 . HIS B 2 25  ? 7.590  13.524  -8.924 1.00 45.93 ? 25  HIS I NE2 1 
ATOM   1825 N N   . GLY B 2 26  ? 4.099  8.724   -5.658 1.00 9.40  ? 26  GLY I N   1 
ATOM   1826 C CA  . GLY B 2 26  ? 3.618  7.443   -5.199 1.00 3.00  ? 26  GLY I CA  1 
ATOM   1827 C C   . GLY B 2 26  ? 4.195  7.105   -3.824 1.00 6.20  ? 26  GLY I C   1 
ATOM   1828 O O   . GLY B 2 26  ? 4.193  5.930   -3.421 1.00 9.81  ? 26  GLY I O   1 
ATOM   1829 N N   . TYR B 2 27  ? 4.548  8.120   -3.105 1.00 3.00  ? 27  TYR I N   1 
ATOM   1830 C CA  . TYR B 2 27  ? 4.999  7.886   -1.717 1.00 3.00  ? 27  TYR I CA  1 
ATOM   1831 C C   . TYR B 2 27  ? 4.202  8.755   -0.730 1.00 5.39  ? 27  TYR I C   1 
ATOM   1832 O O   . TYR B 2 27  ? 3.910  9.905   -1.031 1.00 6.99  ? 27  TYR I O   1 
ATOM   1833 C CB  . TYR B 2 27  ? 6.478  8.247   -1.570 1.00 3.00  ? 27  TYR I CB  1 
ATOM   1834 C CG  . TYR B 2 27  ? 7.404  7.240   -2.258 1.00 11.13 ? 27  TYR I CG  1 
ATOM   1835 C CD1 . TYR B 2 27  ? 7.575  5.979   -1.723 1.00 9.16  ? 27  TYR I CD1 1 
ATOM   1836 C CD2 . TYR B 2 27  ? 8.045  7.606   -3.424 1.00 4.25  ? 27  TYR I CD2 1 
ATOM   1837 C CE1 . TYR B 2 27  ? 8.373  5.037   -2.358 1.00 4.25  ? 27  TYR I CE1 1 
ATOM   1838 C CE2 . TYR B 2 27  ? 8.855  6.672   -4.073 1.00 8.50  ? 27  TYR I CE2 1 
ATOM   1839 C CZ  . TYR B 2 27  ? 9.004  5.402   -3.552 1.00 24.42 ? 27  TYR I CZ  1 
ATOM   1840 O OH  . TYR B 2 27  ? 9.793  4.501   -4.193 1.00 30.06 ? 27  TYR I OH  1 
ATOM   1841 N N   . CYS B 2 28  ? 3.961  8.263   0.468  1.00 9.03  ? 28  CYS I N   1 
ATOM   1842 C CA  . CYS B 2 28  ? 3.327  9.063   1.536  1.00 3.96  ? 28  CYS I CA  1 
ATOM   1843 C C   . CYS B 2 28  ? 4.208  10.216  2.041  1.00 5.72  ? 28  CYS I C   1 
ATOM   1844 O O   . CYS B 2 28  ? 5.451  10.154  1.995  1.00 3.00  ? 28  CYS I O   1 
ATOM   1845 C CB  . CYS B 2 28  ? 2.971  8.120   2.708  1.00 3.00  ? 28  CYS I CB  1 
ATOM   1846 S SG  . CYS B 2 28  ? 1.821  6.789   2.307  1.00 6.81  ? 28  CYS I SG  1 
ATOM   1847 N N   . GLY B 2 29  ? 3.556  11.233  2.584  1.00 3.00  ? 29  GLY I N   1 
ATOM   1848 C CA  . GLY B 2 29  ? 4.383  12.342  2.982  1.00 3.56  ? 29  GLY I CA  1 
ATOM   1849 C C   . GLY B 2 29  ? 3.413  13.353  3.495  1.00 14.31 ? 29  GLY I C   1 
ATOM   1850 O O   . GLY B 2 29  ? 2.314  12.944  3.855  1.00 3.00  ? 29  GLY I O   1 
ATOM   1851 O OXT . GLY B 2 29  ? 3.859  14.453  3.888  1.00 11.48 ? 29  GLY I OXT 1 
HETATM 1852 O O   . HOH C 3 .   ? 17.043 4.766   16.720 1.00 3.14  ? 406 HOH E O   1 
HETATM 1853 O O   . HOH C 3 .   ? 6.856  10.214  19.045 1.00 17.08 ? 408 HOH E O   1 
HETATM 1854 O O   . HOH C 3 .   ? 16.954 5.838   7.248  1.00 3.00  ? 410 HOH E O   1 
HETATM 1855 O O   . HOH C 3 .   ? 27.539 8.429   3.542  1.00 7.57  ? 412 HOH E O   1 
HETATM 1856 O O   . HOH C 3 .   ? 8.362  20.078  8.487  1.00 12.90 ? 415 HOH E O   1 
HETATM 1857 O O   . HOH C 3 .   ? 11.335 13.371  13.221 1.00 11.58 ? 416 HOH E O   1 
HETATM 1858 O O   . HOH C 3 .   ? 20.362 16.095  2.683  1.00 11.32 ? 429 HOH E O   1 
HETATM 1859 O O   . HOH C 3 .   ? 18.672 11.198  3.669  1.00 3.00  ? 430 HOH E O   1 
HETATM 1860 O O   . HOH C 3 .   ? 17.695 -1.600  2.590  1.00 17.96 ? 457 HOH E O   1 
HETATM 1861 O O   . HOH C 3 .   ? 24.322 19.741  9.369  1.00 4.50  ? 470 HOH E O   1 
HETATM 1862 O O   . HOH C 3 .   ? 11.537 20.077  22.558 1.00 13.99 ? 473 HOH E O   1 
HETATM 1863 O O   . HOH C 3 .   ? 28.486 1.299   8.803  1.00 8.28  ? 516 HOH E O   1 
HETATM 1864 O O   . HOH C 3 .   ? 11.416 21.568  9.954  1.00 11.19 ? 562 HOH E O   1 
HETATM 1865 O O   . HOH C 3 .   ? 27.531 4.434   5.818  1.00 13.45 ? 604 HOH E O   1 
HETATM 1866 O O   . HOH C 3 .   ? 17.358 6.988   9.792  1.00 3.00  ? 701 HOH E O   1 
HETATM 1867 O O   . HOH C 3 .   ? 7.014  9.027   21.813 1.00 8.52  ? 703 HOH E O   1 
HETATM 1868 O O   . HOH C 3 .   ? 14.770 17.920  12.772 1.00 7.86  ? 704 HOH E O   1 
HETATM 1869 O O   . HOH C 3 .   ? 13.893 21.331  11.640 1.00 4.69  ? 705 HOH E O   1 
HETATM 1870 O O   . HOH C 3 .   ? 29.021 -1.518  2.624  1.00 19.75 ? 706 HOH E O   1 
HETATM 1871 O O   . HOH C 3 .   ? 23.516 -0.088  7.937  1.00 3.00  ? 708 HOH E O   1 
HETATM 1872 O O   . HOH C 3 .   ? 25.762 2.267   8.482  1.00 14.19 ? 709 HOH E O   1 
HETATM 1873 O O   . HOH C 3 .   ? 27.115 -0.297  1.185  1.00 12.94 ? 714 HOH E O   1 
HETATM 1874 O O   . HOH C 3 .   ? 25.663 -0.467  10.978 1.00 19.85 ? 716 HOH E O   1 
HETATM 1875 O O   . HOH C 3 .   ? 27.745 4.813   8.377  1.00 14.58 ? 717 HOH E O   1 
HETATM 1876 O O   . HOH C 3 .   ? 29.285 8.216   1.244  1.00 18.55 ? 718 HOH E O   1 
HETATM 1877 O O   . HOH C 3 .   ? 23.357 9.610   14.020 1.00 3.00  ? 721 HOH E O   1 
HETATM 1878 O O   . HOH C 3 .   ? 16.203 11.262  25.314 1.00 8.75  ? 722 HOH E O   1 
HETATM 1879 O O   . HOH C 3 .   ? 0.513  13.372  19.266 1.00 20.88 ? 723 HOH E O   1 
HETATM 1880 O O   . HOH C 3 .   ? 17.822 25.073  20.757 1.00 24.57 ? 726 HOH E O   1 
HETATM 1881 O O   . HOH C 3 .   ? 14.688 26.358  21.338 1.00 21.00 ? 727 HOH E O   1 
HETATM 1882 O O   . HOH C 3 .   ? 18.471 18.608  0.751  1.00 14.22 ? 728 HOH E O   1 
HETATM 1883 O O   . HOH C 3 .   ? 23.642 13.090  25.547 1.00 21.20 ? 729 HOH E O   1 
HETATM 1884 O O   . HOH C 3 .   ? 23.909 20.557  6.662  1.00 12.33 ? 730 HOH E O   1 
HETATM 1885 O O   . HOH C 3 .   ? 30.668 -5.945  8.411  1.00 22.33 ? 741 HOH E O   1 
HETATM 1886 O O   . HOH C 3 .   ? 32.620 -2.481  17.069 1.00 21.02 ? 743 HOH E O   1 
HETATM 1887 O O   . HOH C 3 .   ? 17.463 25.817  15.914 1.00 20.39 ? 746 HOH E O   1 
HETATM 1888 O O   . HOH C 3 .   ? 1.371  2.929   13.345 1.00 16.64 ? 747 HOH E O   1 
HETATM 1889 O O   . HOH C 3 .   ? 5.208  26.409  7.950  1.00 29.08 ? 749 HOH E O   1 
HETATM 1890 O O   . HOH C 3 .   ? 8.443  5.385   30.023 1.00 40.27 ? 750 HOH E O   1 
HETATM 1891 O O   . HOH C 3 .   ? 24.289 1.677   27.224 1.00 35.90 ? 754 HOH E O   1 
HETATM 1892 O O   . HOH C 3 .   ? 16.584 14.353  25.832 1.00 23.60 ? 755 HOH E O   1 
HETATM 1893 O O   . HOH C 3 .   ? 32.940 7.977   2.066  1.00 22.81 ? 801 HOH E O   1 
HETATM 1894 O O   . HOH C 3 .   ? 3.008  -0.524  14.714 1.00 20.68 ? 802 HOH E O   1 
HETATM 1895 O O   . HOH C 3 .   ? 7.904  26.276  4.824  1.00 21.94 ? 804 HOH E O   1 
HETATM 1896 O O   . HOH C 3 .   ? 18.953 -14.105 9.474  1.00 22.32 ? 806 HOH E O   1 
HETATM 1897 O O   . HOH C 3 .   ? -1.316 1.851   12.235 1.00 21.57 ? 807 HOH E O   1 
HETATM 1898 O O   . HOH C 3 .   ? 32.601 7.848   12.845 1.00 23.24 ? 809 HOH E O   1 
HETATM 1899 O O   . HOH C 3 .   ? 24.340 -15.464 17.526 1.00 21.09 ? 811 HOH E O   1 
HETATM 1900 O O   . HOH C 3 .   ? 29.086 -8.595  21.680 1.00 21.48 ? 812 HOH E O   1 
HETATM 1901 O O   . HOH C 3 .   ? 24.281 -9.217  22.949 1.00 19.65 ? 813 HOH E O   1 
HETATM 1902 O O   . HOH C 3 .   ? 20.402 -9.787  24.331 1.00 22.51 ? 814 HOH E O   1 
HETATM 1903 O O   . HOH C 3 .   ? 1.885  6.286   28.527 1.00 21.73 ? 816 HOH E O   1 
HETATM 1904 O O   . HOH C 3 .   ? 12.713 9.708   33.237 1.00 22.50 ? 818 HOH E O   1 
HETATM 1905 O O   . HOH C 3 .   ? 13.370 3.539   36.023 1.00 19.71 ? 819 HOH E O   1 
HETATM 1906 O O   . HOH C 3 .   ? 23.793 11.895  -2.846 1.00 29.86 ? 907 HOH E O   1 
HETATM 1907 O O   . HOH C 3 .   ? 16.930 6.260   -0.225 1.00 19.00 ? 910 HOH E O   1 
HETATM 1908 O O   . HOH C 3 .   ? 7.723  10.930  0.441  1.00 13.72 ? 913 HOH E O   1 
HETATM 1909 O O   . HOH C 3 .   ? 8.514  13.209  1.859  1.00 5.71  ? 916 HOH E O   1 
HETATM 1910 O O   . HOH C 3 .   ? 7.095  19.196  3.109  1.00 14.47 ? 917 HOH E O   1 
HETATM 1911 O O   . HOH C 3 .   ? 6.606  0.759   4.088  1.00 23.16 ? 918 HOH E O   1 
HETATM 1912 O O   . HOH C 3 .   ? 6.884  14.265  8.237  1.00 3.00  ? 921 HOH E O   1 
HETATM 1913 O O   . HOH C 3 .   ? 5.544  -0.201  9.598  1.00 18.14 ? 922 HOH E O   1 
HETATM 1914 O O   . HOH C 3 .   ? 12.311 -11.270 9.762  1.00 24.15 ? 923 HOH E O   1 
HETATM 1915 O O   . HOH C 3 .   ? 26.725 -11.250 10.404 1.00 34.43 ? 924 HOH E O   1 
HETATM 1916 O O   . HOH C 3 .   ? 33.753 -8.433  11.251 1.00 28.41 ? 925 HOH E O   1 
HETATM 1917 O O   . HOH C 3 .   ? 16.007 28.803  12.908 1.00 19.78 ? 927 HOH E O   1 
HETATM 1918 O O   . HOH C 3 .   ? 15.173 27.357  15.526 1.00 20.67 ? 928 HOH E O   1 
HETATM 1919 O O   . HOH C 3 .   ? 29.243 8.276   18.454 1.00 24.89 ? 929 HOH E O   1 
HETATM 1920 O O   . HOH C 3 .   ? 23.972 0.353   24.012 1.00 17.81 ? 930 HOH E O   1 
HETATM 1921 O O   . HOH C 3 .   ? -0.582 6.069   25.279 1.00 25.55 ? 931 HOH E O   1 
HETATM 1922 O O   . HOH C 3 .   ? 22.400 23.696  26.372 1.00 21.91 ? 932 HOH E O   1 
HETATM 1923 O O   . HOH C 3 .   ? 13.174 22.520  27.288 1.00 18.97 ? 933 HOH E O   1 
HETATM 1924 O O   . HOH C 3 .   ? 23.798 10.934  29.097 1.00 28.32 ? 934 HOH E O   1 
HETATM 1925 O O   . HOH C 3 .   ? 14.650 5.033   32.423 1.00 28.35 ? 935 HOH E O   1 
HETATM 1926 O O   . HOH C 3 .   ? 28.508 4.871   -3.672 1.00 31.19 ? 938 HOH E O   1 
HETATM 1927 O O   . HOH C 3 .   ? 29.569 4.613   -1.174 1.00 30.86 ? 939 HOH E O   1 
HETATM 1928 O O   . HOH C 3 .   ? 29.682 9.181   -1.473 1.00 30.65 ? 940 HOH E O   1 
HETATM 1929 O O   . HOH C 3 .   ? 14.854 4.674   -0.609 1.00 26.84 ? 941 HOH E O   1 
HETATM 1930 O O   . HOH C 3 .   ? 15.891 -0.039  -0.727 1.00 33.92 ? 942 HOH E O   1 
HETATM 1931 O O   . HOH C 3 .   ? 14.621 20.934  -0.648 1.00 35.71 ? 943 HOH E O   1 
HETATM 1932 O O   . HOH C 3 .   ? 25.096 -1.809  0.139  1.00 27.37 ? 944 HOH E O   1 
HETATM 1933 O O   . HOH C 3 .   ? 9.181  16.387  1.079  1.00 22.11 ? 945 HOH E O   1 
HETATM 1934 O O   . HOH C 3 .   ? 22.005 19.315  1.090  1.00 13.88 ? 946 HOH E O   1 
HETATM 1935 O O   . HOH C 3 .   ? 3.904  19.730  3.665  1.00 35.21 ? 947 HOH E O   1 
HETATM 1936 O O   . HOH C 3 .   ? 30.904 0.521   2.912  1.00 34.38 ? 948 HOH E O   1 
HETATM 1937 O O   . HOH C 3 .   ? 6.620  15.137  4.014  1.00 30.24 ? 949 HOH E O   1 
HETATM 1938 O O   . HOH C 3 .   ? 1.396  20.337  5.551  1.00 29.52 ? 951 HOH E O   1 
HETATM 1939 O O   . HOH C 3 .   ? 34.733 1.878   5.393  1.00 28.10 ? 952 HOH E O   1 
HETATM 1940 O O   . HOH C 3 .   ? 34.631 5.897   5.110  1.00 28.41 ? 953 HOH E O   1 
HETATM 1941 O O   . HOH C 3 .   ? 13.327 -11.240 6.754  1.00 30.64 ? 955 HOH E O   1 
HETATM 1942 O O   . HOH C 3 .   ? 3.149  -6.838  8.586  1.00 37.63 ? 956 HOH E O   1 
HETATM 1943 O O   . HOH C 3 .   ? 23.381 22.201  10.601 1.00 33.07 ? 957 HOH E O   1 
HETATM 1944 O O   . HOH C 3 .   ? 29.472 13.755  10.799 1.00 27.37 ? 958 HOH E O   1 
HETATM 1945 O O   . HOH C 3 .   ? 2.720  1.173   11.696 1.00 29.61 ? 960 HOH E O   1 
HETATM 1946 O O   . HOH C 3 .   ? 0.601  5.901   12.818 1.00 33.94 ? 961 HOH E O   1 
HETATM 1947 O O   . HOH C 3 .   ? -4.576 4.749   14.297 1.00 37.52 ? 962 HOH E O   1 
HETATM 1948 O O   . HOH C 3 .   ? 28.086 25.045  14.984 1.00 40.92 ? 964 HOH E O   1 
HETATM 1949 O O   . HOH C 3 .   ? 27.759 9.857   16.211 1.00 24.19 ? 965 HOH E O   1 
HETATM 1950 O O   . HOH C 3 .   ? 30.560 -9.351  17.560 1.00 29.74 ? 967 HOH E O   1 
HETATM 1951 O O   . HOH C 3 .   ? 0.751  27.686  18.508 1.00 49.64 ? 968 HOH E O   1 
HETATM 1952 O O   . HOH C 3 .   ? 18.194 26.292  18.427 1.00 32.45 ? 969 HOH E O   1 
HETATM 1953 O O   . HOH C 3 .   ? -0.836 -0.171  18.811 1.00 49.24 ? 970 HOH E O   1 
HETATM 1954 O O   . HOH C 3 .   ? 23.951 23.639  19.673 1.00 35.54 ? 971 HOH E O   1 
HETATM 1955 O O   . HOH C 3 .   ? 5.265  -6.465  20.503 1.00 33.21 ? 972 HOH E O   1 
HETATM 1956 O O   . HOH C 3 .   ? 26.307 16.761  21.268 1.00 22.01 ? 973 HOH E O   1 
HETATM 1957 O O   . HOH C 3 .   ? 28.411 5.397   22.265 1.00 30.06 ? 974 HOH E O   1 
HETATM 1958 O O   . HOH C 3 .   ? 13.859 20.269  25.256 1.00 31.91 ? 975 HOH E O   1 
HETATM 1959 O O   . HOH C 3 .   ? 2.351  14.657  28.391 1.00 31.68 ? 977 HOH E O   1 
HETATM 1960 O O   . HOH C 3 .   ? 15.920 21.481  28.156 1.00 36.90 ? 978 HOH E O   1 
HETATM 1961 O O   . HOH C 3 .   ? 5.661  5.858   28.915 1.00 30.93 ? 979 HOH E O   1 
HETATM 1962 O O   . HOH C 3 .   ? 8.547  2.552   29.763 1.00 24.29 ? 980 HOH E O   1 
HETATM 1963 O O   . HOH C 3 .   ? 20.201 -5.107  29.592 1.00 32.18 ? 981 HOH E O   1 
HETATM 1964 O O   . HOH C 3 .   ? 17.468 13.332  32.948 1.00 36.86 ? 982 HOH E O   1 
HETATM 1965 O O   . HOH C 3 .   ? 12.993 5.127   -2.907 1.00 29.73 ? 983 HOH E O   1 
HETATM 1966 O O   . HOH C 3 .   ? 13.733 2.216   -0.475 1.00 32.05 ? 984 HOH E O   1 
HETATM 1967 O O   . HOH C 3 .   ? 20.312 -2.304  1.220  1.00 33.72 ? 985 HOH E O   1 
HETATM 1968 O O   . HOH C 3 .   ? 30.083 11.251  9.552  1.00 35.50 ? 986 HOH E O   1 
HETATM 1969 O O   . HOH C 3 .   ? 33.096 3.542   12.150 1.00 35.80 ? 988 HOH E O   1 
HETATM 1970 O O   . HOH C 3 .   ? 7.614  27.522  17.618 1.00 26.49 ? 989 HOH E O   1 
HETATM 1971 O O   . HOH C 3 .   ? 27.178 -6.730  22.487 1.00 34.44 ? 990 HOH E O   1 
HETATM 1972 O O   . HOH C 3 .   ? 23.283 -3.831  25.862 1.00 36.08 ? 991 HOH E O   1 
HETATM 1973 O O   . HOH C 3 .   ? 27.627 11.821  27.603 1.00 32.04 ? 992 HOH E O   1 
HETATM 1974 O O   . HOH C 3 .   ? 0.084  0.580   28.615 1.00 33.00 ? 993 HOH E O   1 
HETATM 1975 O O   . HOH C 3 .   ? 30.820 -1.887  19.032 1.00 32.45 ? 997 HOH E O   1 
HETATM 1976 O O   . HOH C 3 .   ? -2.442 2.108   18.983 1.00 32.40 ? 998 HOH E O   1 
HETATM 1977 O O   . HOH C 3 .   ? 18.470 12.502  -2.757 1.00 21.64 ? 999 HOH E O   1 
HETATM 1978 O O   . HOH D 3 .   ? -8.714 10.207  0.819  1.00 22.09 ? 803 HOH I O   1 
HETATM 1979 O O   . HOH D 3 .   ? 2.645  6.715   5.776  1.00 3.00  ? 808 HOH I O   1 
HETATM 1980 O O   . HOH D 3 .   ? 5.755  11.100  -3.652 1.00 25.17 ? 904 HOH I O   1 
HETATM 1981 O O   . HOH D 3 .   ? 10.562 2.210   -2.759 1.00 19.30 ? 906 HOH I O   1 
HETATM 1982 O O   . HOH D 3 .   ? -8.096 12.272  -0.300 1.00 7.15  ? 911 HOH I O   1 
HETATM 1983 O O   . HOH D 3 .   ? -6.227 2.381   1.164  1.00 17.74 ? 914 HOH I O   1 
HETATM 1984 O O   . HOH D 3 .   ? 6.805  7.702   2.535  1.00 6.91  ? 915 HOH I O   1 
HETATM 1985 O O   . HOH D 3 .   ? 4.806  8.384   5.743  1.00 3.18  ? 919 HOH I O   1 
HETATM 1986 O O   . HOH D 3 .   ? -4.713 7.338   7.062  1.00 34.84 ? 920 HOH I O   1 
HETATM 1987 O O   . HOH D 3 .   ? 13.269 1.736   -3.411 1.00 29.07 ? 937 HOH I O   1 
HETATM 1988 O O   . HOH D 3 .   ? -4.066 9.748   4.823  1.00 41.16 ? 950 HOH I O   1 
HETATM 1989 O O   . HOH D 3 .   ? -3.595 15.175  6.005  1.00 31.73 ? 954 HOH I O   1 
HETATM 1990 O O   . HOH D 3 .   ? 2.931  15.885  -4.719 1.00 33.47 ? 994 HOH I O   1 
HETATM 1991 O O   . HOH D 3 .   ? -5.121 1.699   -2.770 1.00 32.85 ? 995 HOH I O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ILE 1   16  16  ILE ILE E . n 
A 1 2   VAL 2   17  17  VAL VAL E . n 
A 1 3   GLY 3   18  18  GLY GLY E . n 
A 1 4   GLY 4   19  19  GLY GLY E . n 
A 1 5   TYR 5   20  20  TYR TYR E . n 
A 1 6   THR 6   21  21  THR THR E . n 
A 1 7   CYS 7   22  22  CYS CYS E . n 
A 1 8   GLY 8   23  23  GLY GLY E . n 
A 1 9   ALA 9   24  24  ALA ALA E . n 
A 1 10  ASN 10  25  25  ASN ASN E . n 
A 1 11  THR 11  26  26  THR THR E . n 
A 1 12  VAL 12  27  27  VAL VAL E . n 
A 1 13  PRO 13  28  28  PRO PRO E . n 
A 1 14  TYR 14  29  29  TYR TYR E . n 
A 1 15  GLN 15  30  30  GLN GLN E . n 
A 1 16  VAL 16  31  31  VAL VAL E . n 
A 1 17  SER 17  32  32  SER SER E . n 
A 1 18  LEU 18  33  33  LEU LEU E . n 
A 1 19  ASN 19  34  34  ASN ASN E . n 
A 1 20  SER 20  37  37  SER SER E . n 
A 1 21  GLY 21  38  38  GLY GLY E . n 
A 1 22  TYR 22  39  39  TYR TYR E . n 
A 1 23  HIS 23  40  40  HIS HIS E . n 
A 1 24  PHE 24  41  41  PHE PHE E . n 
A 1 25  CYS 25  42  42  CYS CYS E . n 
A 1 26  GLY 26  43  43  GLY GLY E . n 
A 1 27  GLY 27  44  44  GLY GLY E . n 
A 1 28  SER 28  45  45  SER SER E . n 
A 1 29  LEU 29  46  46  LEU LEU E . n 
A 1 30  ILE 30  47  47  ILE ILE E . n 
A 1 31  ASN 31  48  48  ASN ASN E . n 
A 1 32  SER 32  49  49  SER SER E . n 
A 1 33  GLN 33  50  50  GLN GLN E . n 
A 1 34  TRP 34  51  51  TRP TRP E . n 
A 1 35  VAL 35  52  52  VAL VAL E . n 
A 1 36  VAL 36  53  53  VAL VAL E . n 
A 1 37  SER 37  54  54  SER SER E . n 
A 1 38  ALA 38  55  55  ALA ALA E . n 
A 1 39  ALA 39  56  56  ALA ALA E . n 
A 1 40  HIS 40  57  57  HIS HIS E . n 
A 1 41  CYS 41  58  58  CYS CYS E . n 
A 1 42  TYR 42  59  59  TYR TYR E . n 
A 1 43  LYS 43  60  60  LYS LYS E . n 
A 1 44  SER 44  61  61  SER SER E . n 
A 1 45  GLY 45  62  62  GLY GLY E . n 
A 1 46  ILE 46  63  63  ILE ILE E . n 
A 1 47  GLN 47  64  64  GLN GLN E . n 
A 1 48  VAL 48  65  65  VAL VAL E . n 
A 1 49  ARG 49  66  66  ARG ARG E . n 
A 1 50  LEU 50  67  67  LEU LEU E . n 
A 1 51  GLY 51  69  69  GLY GLY E . n 
A 1 52  GLU 52  70  70  GLU GLU E . n 
A 1 53  ASP 53  71  71  ASP ASP E . n 
A 1 54  ASN 54  72  72  ASN ASN E . n 
A 1 55  ILE 55  73  73  ILE ILE E . n 
A 1 56  ASN 56  74  74  ASN ASN E . n 
A 1 57  VAL 57  75  75  VAL VAL E . n 
A 1 58  VAL 58  76  76  VAL VAL E . n 
A 1 59  GLU 59  77  77  GLU GLU E . n 
A 1 60  GLY 60  78  78  GLY GLY E . n 
A 1 61  ASN 61  79  79  ASN ASN E . n 
A 1 62  GLU 62  80  80  GLU GLU E . n 
A 1 63  GLN 63  81  81  GLN GLN E . n 
A 1 64  PHE 64  82  82  PHE PHE E . n 
A 1 65  ILE 65  83  83  ILE ILE E . n 
A 1 66  SER 66  84  84  SER SER E . n 
A 1 67  ALA 67  85  85  ALA ALA E . n 
A 1 68  SER 68  86  86  SER SER E . n 
A 1 69  LYS 69  87  87  LYS LYS E . n 
A 1 70  SER 70  88  88  SER SER E . n 
A 1 71  ILE 71  89  89  ILE ILE E . n 
A 1 72  VAL 72  90  90  VAL VAL E . n 
A 1 73  HIS 73  91  91  HIS HIS E . n 
A 1 74  PRO 74  92  92  PRO PRO E . n 
A 1 75  SER 75  93  93  SER SER E . n 
A 1 76  TYR 76  94  94  TYR TYR E . n 
A 1 77  ASN 77  95  95  ASN ASN E . n 
A 1 78  SER 78  96  96  SER SER E . n 
A 1 79  ASN 79  97  97  ASN ASN E . n 
A 1 80  THR 80  98  98  THR THR E . n 
A 1 81  LEU 81  99  99  LEU LEU E . n 
A 1 82  ASN 82  100 100 ASN ASN E . n 
A 1 83  ASN 83  101 101 ASN ASN E . n 
A 1 84  ASP 84  102 102 ASP ASP E . n 
A 1 85  ILE 85  103 103 ILE ILE E . n 
A 1 86  MET 86  104 104 MET MET E . n 
A 1 87  LEU 87  105 105 LEU LEU E . n 
A 1 88  ILE 88  106 106 ILE ILE E . n 
A 1 89  LYS 89  107 107 LYS LYS E . n 
A 1 90  LEU 90  108 108 LEU LEU E . n 
A 1 91  LYS 91  109 109 LYS LYS E . n 
A 1 92  SER 92  110 110 SER SER E . n 
A 1 93  ALA 93  111 111 ALA ALA E . n 
A 1 94  ALA 94  112 112 ALA ALA E . n 
A 1 95  SER 95  113 113 SER SER E . n 
A 1 96  LEU 96  114 114 LEU LEU E . n 
A 1 97  ASN 97  115 115 ASN ASN E . n 
A 1 98  SER 98  116 116 SER SER E . n 
A 1 99  ARG 99  117 117 ARG ARG E . n 
A 1 100 VAL 100 118 118 VAL VAL E . n 
A 1 101 ALA 101 119 119 ALA ALA E . n 
A 1 102 SER 102 120 120 SER SER E . n 
A 1 103 ILE 103 121 121 ILE ILE E . n 
A 1 104 SER 104 122 122 SER SER E . n 
A 1 105 LEU 105 123 123 LEU LEU E . n 
A 1 106 PRO 106 124 124 PRO PRO E . n 
A 1 107 THR 107 125 125 THR THR E . n 
A 1 108 SER 108 127 127 SER SER E . n 
A 1 109 CYS 109 128 128 CYS CYS E . n 
A 1 110 ALA 110 129 129 ALA ALA E . n 
A 1 111 SER 111 130 130 SER SER E . n 
A 1 112 ALA 112 132 132 ALA ALA E . n 
A 1 113 GLY 113 133 133 GLY GLY E . n 
A 1 114 THR 114 134 134 THR THR E . n 
A 1 115 GLN 115 135 135 GLN GLN E . n 
A 1 116 CYS 116 136 136 CYS CYS E . n 
A 1 117 LEU 117 137 137 LEU LEU E . n 
A 1 118 ILE 118 138 138 ILE ILE E . n 
A 1 119 SER 119 139 139 SER SER E . n 
A 1 120 GLY 120 140 140 GLY GLY E . n 
A 1 121 TRP 121 141 141 TRP TRP E . n 
A 1 122 GLY 122 142 142 GLY GLY E . n 
A 1 123 ASN 123 143 143 ASN ASN E . n 
A 1 124 THR 124 144 144 THR THR E . n 
A 1 125 LYS 125 145 145 LYS LYS E . n 
A 1 126 SER 126 146 146 SER SER E . n 
A 1 127 SER 127 147 147 SER SER E . n 
A 1 128 GLY 128 148 148 GLY GLY E . n 
A 1 129 THR 129 149 149 THR THR E . n 
A 1 130 SER 130 150 150 SER SER E . n 
A 1 131 TYR 131 151 151 TYR TYR E . n 
A 1 132 PRO 132 152 152 PRO PRO E . n 
A 1 133 ASP 133 153 153 ASP ASP E . n 
A 1 134 VAL 134 154 154 VAL VAL E . n 
A 1 135 LEU 135 155 155 LEU LEU E . n 
A 1 136 LYS 136 156 156 LYS LYS E . n 
A 1 137 CYS 137 157 157 CYS CYS E . n 
A 1 138 LEU 138 158 158 LEU LEU E . n 
A 1 139 LYS 139 159 159 LYS LYS E . n 
A 1 140 ALA 140 160 160 ALA ALA E . n 
A 1 141 PRO 141 161 161 PRO PRO E . n 
A 1 142 ILE 142 162 162 ILE ILE E . n 
A 1 143 LEU 143 163 163 LEU LEU E . n 
A 1 144 SER 144 164 164 SER SER E . n 
A 1 145 ASP 145 165 165 ASP ASP E . n 
A 1 146 SER 146 166 166 SER SER E . n 
A 1 147 SER 147 167 167 SER SER E . n 
A 1 148 CYS 148 168 168 CYS CYS E . n 
A 1 149 LYS 149 169 169 LYS LYS E . n 
A 1 150 SER 150 170 170 SER SER E . n 
A 1 151 ALA 151 171 171 ALA ALA E . n 
A 1 152 TYR 152 172 172 TYR TYR E . n 
A 1 153 PRO 153 173 173 PRO PRO E . n 
A 1 154 GLY 154 174 174 GLY GLY E . n 
A 1 155 GLN 155 175 175 GLN GLN E . n 
A 1 156 ILE 156 176 176 ILE ILE E . n 
A 1 157 THR 157 177 177 THR THR E . n 
A 1 158 SER 158 178 178 SER SER E . n 
A 1 159 ASN 159 179 179 ASN ASN E . n 
A 1 160 MET 160 180 180 MET MET E . n 
A 1 161 PHE 161 181 181 PHE PHE E . n 
A 1 162 CYS 162 182 182 CYS CYS E . n 
A 1 163 ALA 163 183 183 ALA ALA E . n 
A 1 164 GLY 164 184 184 GLY GLY E A n 
A 1 165 TYR 165 184 184 TYR TYR E . n 
A 1 166 LEU 166 185 185 LEU LEU E . n 
A 1 167 GLU 167 186 186 GLU GLU E . n 
A 1 168 GLY 168 187 187 GLY GLY E . n 
A 1 169 GLY 169 188 188 GLY GLY E A n 
A 1 170 LYS 170 188 188 LYS LYS E . n 
A 1 171 ASP 171 189 189 ASP ASP E . n 
A 1 172 SER 172 190 190 SER SER E . n 
A 1 173 CYS 173 191 191 CYS CYS E . n 
A 1 174 GLN 174 192 192 GLN GLN E . n 
A 1 175 GLY 175 193 193 GLY GLY E . n 
A 1 176 ASP 176 194 194 ASP ASP E . n 
A 1 177 SER 177 195 195 SER SER E . n 
A 1 178 GLY 178 196 196 GLY GLY E . n 
A 1 179 GLY 179 197 197 GLY GLY E . n 
A 1 180 PRO 180 198 198 PRO PRO E . n 
A 1 181 VAL 181 199 199 VAL VAL E . n 
A 1 182 VAL 182 200 200 VAL VAL E . n 
A 1 183 CYS 183 201 201 CYS CYS E . n 
A 1 184 SER 184 202 202 SER SER E . n 
A 1 185 GLY 185 203 203 GLY GLY E . n 
A 1 186 LYS 186 204 204 LYS LYS E . n 
A 1 187 LEU 187 209 209 LEU LEU E . n 
A 1 188 GLN 188 210 210 GLN GLN E . n 
A 1 189 GLY 189 211 211 GLY GLY E . n 
A 1 190 ILE 190 212 212 ILE ILE E . n 
A 1 191 VAL 191 213 213 VAL VAL E . n 
A 1 192 SER 192 214 214 SER SER E . n 
A 1 193 TRP 193 215 215 TRP TRP E . n 
A 1 194 GLY 194 216 216 GLY GLY E . n 
A 1 195 SER 195 217 217 SER SER E . n 
A 1 196 GLY 196 219 219 GLY GLY E . n 
A 1 197 CYS 197 220 220 CYS CYS E . n 
A 1 198 ALA 198 221 221 ALA ALA E A n 
A 1 199 GLN 199 221 221 GLN GLN E . n 
A 1 200 LYS 200 222 222 LYS LYS E . n 
A 1 201 ASN 201 223 223 ASN ASN E . n 
A 1 202 LYS 202 224 224 LYS LYS E . n 
A 1 203 PRO 203 225 225 PRO PRO E . n 
A 1 204 GLY 204 226 226 GLY GLY E . n 
A 1 205 VAL 205 227 227 VAL VAL E . n 
A 1 206 TYR 206 228 228 TYR TYR E . n 
A 1 207 THR 207 229 229 THR THR E . n 
A 1 208 LYS 208 230 230 LYS LYS E . n 
A 1 209 VAL 209 231 231 VAL VAL E . n 
A 1 210 CYS 210 232 232 CYS CYS E . n 
A 1 211 ASN 211 233 233 ASN ASN E . n 
A 1 212 TYR 212 234 234 TYR TYR E . n 
A 1 213 VAL 213 235 235 VAL VAL E . n 
A 1 214 SER 214 236 236 SER SER E . n 
A 1 215 TRP 215 237 237 TRP TRP E . n 
A 1 216 ILE 216 238 238 ILE ILE E . n 
A 1 217 LYS 217 239 239 LYS LYS E . n 
A 1 218 GLN 218 240 240 GLN GLN E . n 
A 1 219 THR 219 241 241 THR THR E . n 
A 1 220 ILE 220 242 242 ILE ILE E . n 
A 1 221 ALA 221 243 243 ALA ALA E . n 
A 1 222 SER 222 244 244 SER SER E . n 
A 1 223 ASN 223 245 245 ASN ASN E . n 
B 2 1   ARG 1   1   1   ARG ARG I . n 
B 2 2   VAL 2   2   2   VAL VAL I . n 
B 2 3   CYS 3   3   3   CYS CYS I . n 
B 2 4   PRO 4   4   4   PRO PRO I . n 
B 2 5   ARG 5   5   5   ARG ARG I . n 
B 2 6   ILE 6   6   6   ILE ILE I . n 
B 2 7   LEU 7   7   7   LEU LEU I . n 
B 2 8   MET 8   8   8   MET MET I . n 
B 2 9   GLU 9   9   9   GLU GLU I . n 
B 2 10  CYS 10  10  10  CYS CYS I . n 
B 2 11  LYS 11  11  11  LYS LYS I . n 
B 2 12  LYS 12  12  12  LYS LYS I . n 
B 2 13  ASP 13  13  13  ASP ASP I . n 
B 2 14  SER 14  14  14  SER SER I . n 
B 2 15  ASP 15  15  15  ASP ASP I . n 
B 2 16  CYS 16  16  16  CYS CYS I . n 
B 2 17  LEU 17  17  17  LEU LEU I . n 
B 2 18  ALA 18  18  18  ALA ALA I . n 
B 2 19  GLU 19  19  19  GLU GLU I . n 
B 2 20  CYS 20  20  20  CYS CYS I . n 
B 2 21  VAL 21  21  21  VAL VAL I . n 
B 2 22  CYS 22  22  22  CYS CYS I . n 
B 2 23  LEU 23  23  23  LEU LEU I . n 
B 2 24  GLU 24  24  24  GLU GLU I . n 
B 2 25  HIS 25  25  25  HIS HIS I . n 
B 2 26  GLY 26  26  26  GLY GLY I . n 
B 2 27  TYR 27  27  27  TYR TYR I . n 
B 2 28  CYS 28  28  28  CYS CYS I . n 
B 2 29  GLY 29  29  29  GLY GLY I . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1680 ? 
1 MORE         -7   ? 
1 'SSA (A^2)'  9920 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-01-31 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SQUASH phasing    . ? 1 
EREF   refinement . ? 2 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    E 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     968 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    E 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     970 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   3_555 
_pdbx_validate_symm_contact.dist              0.15 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 NE1 E TRP 141 ? ? CE2 E TRP 141 ? ? 1.288 1.371 -0.083 0.013 N 
2 1 NE1 E TRP 215 ? ? CE2 E TRP 215 ? ? 1.264 1.371 -0.107 0.013 N 
3 1 NE1 E TRP 237 ? ? CE2 E TRP 237 ? ? 1.277 1.371 -0.094 0.013 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 N   E SER 61  ? ? CA E SER 61  ? ? CB  E SER 61  ? ? 101.37 110.50 -9.13  1.50 N 
2 1 NE  E ARG 117 ? ? CZ E ARG 117 ? ? NH1 E ARG 117 ? ? 123.41 120.30 3.11   0.50 N 
3 1 CB  E TYR 151 ? ? CG E TYR 151 ? ? CD1 E TYR 151 ? ? 116.60 121.00 -4.40  0.60 N 
4 1 C   E PRO 173 ? ? N  E GLY 174 ? ? CA  E GLY 174 ? ? 109.01 122.30 -13.29 2.10 Y 
5 1 NE  I ARG 1   ? ? CZ I ARG 1   ? ? NH1 I ARG 1   ? ? 127.78 120.30 7.48   0.50 N 
6 1 NE  I ARG 1   ? ? CZ I ARG 1   ? ? NH2 I ARG 1   ? ? 110.95 120.30 -9.35  0.50 N 
7 1 OE1 I GLU 9   ? ? CD I GLU 9   ? ? OE2 I GLU 9   ? ? 115.84 123.30 -7.46  1.20 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN E 115 ? ? -149.00 -157.34 
2 1 SER E 195 ? ? -37.55  140.24  
3 1 SER E 214 ? ? -123.99 -65.57  
4 1 ALA I 18  ? ? 55.88   -127.27 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLU 
_pdbx_validate_peptide_omega.auth_asym_id_1   E 
_pdbx_validate_peptide_omega.auth_seq_id_1    70 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ASP 
_pdbx_validate_peptide_omega.auth_asym_id_2   E 
_pdbx_validate_peptide_omega.auth_seq_id_2    71 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            149.88 
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1  1 THR E 21  ? ? 11.37  
2  1 LEU E 33  ? ? 10.94  
3  1 SER E 37  ? ? 12.96  
4  1 ILE E 47  ? ? -11.21 
5  1 CYS E 58  ? ? 11.28  
6  1 GLU E 70  ? ? -10.21 
7  1 VAL E 76  ? ? 10.18  
8  1 GLY E 78  ? ? -10.03 
9  1 LYS E 109 ? ? -11.04 
10 1 ALA E 111 ? ? -10.06 
11 1 SER E 120 ? ? 12.62  
12 1 SER E 167 ? ? -10.36 
13 1 MET E 180 ? ? -10.99 
14 1 PRO E 198 ? ? -13.59 
15 1 LEU I 17  ? ? -10.45 
16 1 GLU I 19  ? ? -11.24 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 TYR E 39  ? ? 0.095 'SIDE CHAIN' 
2 1 TYR E 59  ? ? 0.071 'SIDE CHAIN' 
3 1 TYR E 228 ? ? 0.063 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 E VAL 76  ? N   ? A VAL 58  N   
2  1 Y 0 E LYS 87  ? CD  ? A LYS 69  CD  
3  1 Y 0 E LYS 145 ? CE  ? A LYS 125 CE  
4  1 Y 0 E LYS 145 ? NZ  ? A LYS 125 NZ  
5  1 Y 0 E SER 147 ? OG  ? A SER 127 OG  
6  1 Y 0 E ASP 165 ? OD1 ? A ASP 145 OD1 
7  1 Y 0 E ASP 165 ? OD2 ? A ASP 145 OD2 
8  1 Y 0 E LYS 169 ? NZ  ? A LYS 149 NZ  
9  1 Y 0 E GLU 186 ? CG  ? A GLU 167 CG  
10 1 Y 0 E GLU 186 ? CD  ? A GLU 167 CD  
11 1 Y 0 E GLU 186 ? OE1 ? A GLU 167 OE1 
12 1 Y 0 E GLU 186 ? OE2 ? A GLU 167 OE2 
13 1 Y 0 E LYS 188 ? NZ  ? A LYS 170 NZ  
14 1 Y 0 I LYS 11  ? CD  ? B LYS 11  CD  
15 1 Y 0 I GLU 24  ? CD  ? B GLU 24  CD  
16 1 Y 0 I GLU 24  ? OE1 ? B GLU 24  OE1 
17 1 Y 0 I GLU 24  ? OE2 ? B GLU 24  OE2 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1   406 406 HOH HOH E . 
C 3 HOH 2   408 408 HOH HOH E . 
C 3 HOH 3   410 410 HOH HOH E . 
C 3 HOH 4   412 412 HOH HOH E . 
C 3 HOH 5   415 415 HOH HOH E . 
C 3 HOH 6   416 416 HOH HOH E . 
C 3 HOH 7   429 429 HOH HOH E . 
C 3 HOH 8   430 430 HOH HOH E . 
C 3 HOH 9   457 457 HOH HOH E . 
C 3 HOH 10  470 470 HOH HOH E . 
C 3 HOH 11  473 473 HOH HOH E . 
C 3 HOH 12  516 516 HOH HOH E . 
C 3 HOH 13  562 562 HOH HOH E . 
C 3 HOH 14  604 604 HOH HOH E . 
C 3 HOH 15  701 701 HOH HOH E . 
C 3 HOH 16  703 703 HOH HOH E . 
C 3 HOH 17  704 704 HOH HOH E . 
C 3 HOH 18  705 705 HOH HOH E . 
C 3 HOH 19  706 706 HOH HOH E . 
C 3 HOH 20  708 708 HOH HOH E . 
C 3 HOH 21  709 709 HOH HOH E . 
C 3 HOH 22  714 714 HOH HOH E . 
C 3 HOH 23  716 716 HOH HOH E . 
C 3 HOH 24  717 717 HOH HOH E . 
C 3 HOH 25  718 718 HOH HOH E . 
C 3 HOH 26  721 721 HOH HOH E . 
C 3 HOH 27  722 722 HOH HOH E . 
C 3 HOH 28  723 723 HOH HOH E . 
C 3 HOH 29  726 726 HOH HOH E . 
C 3 HOH 30  727 727 HOH HOH E . 
C 3 HOH 31  728 728 HOH HOH E . 
C 3 HOH 32  729 729 HOH HOH E . 
C 3 HOH 33  730 730 HOH HOH E . 
C 3 HOH 34  741 741 HOH HOH E . 
C 3 HOH 35  743 743 HOH HOH E . 
C 3 HOH 36  746 746 HOH HOH E . 
C 3 HOH 37  747 747 HOH HOH E . 
C 3 HOH 38  749 749 HOH HOH E . 
C 3 HOH 39  750 750 HOH HOH E . 
C 3 HOH 40  754 754 HOH HOH E . 
C 3 HOH 41  755 755 HOH HOH E . 
C 3 HOH 42  801 801 HOH HOH E . 
C 3 HOH 43  802 802 HOH HOH E . 
C 3 HOH 44  804 804 HOH HOH E . 
C 3 HOH 45  806 806 HOH HOH E . 
C 3 HOH 46  807 807 HOH HOH E . 
C 3 HOH 47  809 809 HOH HOH E . 
C 3 HOH 48  811 811 HOH HOH E . 
C 3 HOH 49  812 812 HOH HOH E . 
C 3 HOH 50  813 813 HOH HOH E . 
C 3 HOH 51  814 814 HOH HOH E . 
C 3 HOH 52  816 816 HOH HOH E . 
C 3 HOH 53  818 818 HOH HOH E . 
C 3 HOH 54  819 819 HOH HOH E . 
C 3 HOH 55  907 907 HOH HOH E . 
C 3 HOH 56  910 910 HOH HOH E . 
C 3 HOH 57  913 913 HOH HOH E . 
C 3 HOH 58  916 916 HOH HOH E . 
C 3 HOH 59  917 917 HOH HOH E . 
C 3 HOH 60  918 918 HOH HOH E . 
C 3 HOH 61  921 921 HOH HOH E . 
C 3 HOH 62  922 922 HOH HOH E . 
C 3 HOH 63  923 923 HOH HOH E . 
C 3 HOH 64  924 924 HOH HOH E . 
C 3 HOH 65  925 925 HOH HOH E . 
C 3 HOH 66  927 927 HOH HOH E . 
C 3 HOH 67  928 928 HOH HOH E . 
C 3 HOH 68  929 929 HOH HOH E . 
C 3 HOH 69  930 930 HOH HOH E . 
C 3 HOH 70  931 931 HOH HOH E . 
C 3 HOH 71  932 932 HOH HOH E . 
C 3 HOH 72  933 933 HOH HOH E . 
C 3 HOH 73  934 934 HOH HOH E . 
C 3 HOH 74  935 935 HOH HOH E . 
C 3 HOH 75  938 938 HOH HOH E . 
C 3 HOH 76  939 939 HOH HOH E . 
C 3 HOH 77  940 940 HOH HOH E . 
C 3 HOH 78  941 941 HOH HOH E . 
C 3 HOH 79  942 942 HOH HOH E . 
C 3 HOH 80  943 943 HOH HOH E . 
C 3 HOH 81  944 944 HOH HOH E . 
C 3 HOH 82  945 945 HOH HOH E . 
C 3 HOH 83  946 946 HOH HOH E . 
C 3 HOH 84  947 947 HOH HOH E . 
C 3 HOH 85  948 948 HOH HOH E . 
C 3 HOH 86  949 949 HOH HOH E . 
C 3 HOH 87  951 951 HOH HOH E . 
C 3 HOH 88  952 952 HOH HOH E . 
C 3 HOH 89  953 953 HOH HOH E . 
C 3 HOH 90  955 955 HOH HOH E . 
C 3 HOH 91  956 956 HOH HOH E . 
C 3 HOH 92  957 957 HOH HOH E . 
C 3 HOH 93  958 958 HOH HOH E . 
C 3 HOH 94  960 960 HOH HOH E . 
C 3 HOH 95  961 961 HOH HOH E . 
C 3 HOH 96  962 962 HOH HOH E . 
C 3 HOH 97  964 964 HOH HOH E . 
C 3 HOH 98  965 965 HOH HOH E . 
C 3 HOH 99  967 967 HOH HOH E . 
C 3 HOH 100 968 968 HOH HOH E . 
C 3 HOH 101 969 969 HOH HOH E . 
C 3 HOH 102 970 970 HOH HOH E . 
C 3 HOH 103 971 971 HOH HOH E . 
C 3 HOH 104 972 972 HOH HOH E . 
C 3 HOH 105 973 973 HOH HOH E . 
C 3 HOH 106 974 974 HOH HOH E . 
C 3 HOH 107 975 975 HOH HOH E . 
C 3 HOH 108 977 977 HOH HOH E . 
C 3 HOH 109 978 978 HOH HOH E . 
C 3 HOH 110 979 979 HOH HOH E . 
C 3 HOH 111 980 980 HOH HOH E . 
C 3 HOH 112 981 981 HOH HOH E . 
C 3 HOH 113 982 982 HOH HOH E . 
C 3 HOH 114 983 983 HOH HOH E . 
C 3 HOH 115 984 984 HOH HOH E . 
C 3 HOH 116 985 985 HOH HOH E . 
C 3 HOH 117 986 986 HOH HOH E . 
C 3 HOH 118 988 988 HOH HOH E . 
C 3 HOH 119 989 989 HOH HOH E . 
C 3 HOH 120 990 990 HOH HOH E . 
C 3 HOH 121 991 991 HOH HOH E . 
C 3 HOH 122 992 992 HOH HOH E . 
C 3 HOH 123 993 993 HOH HOH E . 
C 3 HOH 124 997 997 HOH HOH E . 
C 3 HOH 125 998 998 HOH HOH E . 
C 3 HOH 126 999 999 HOH HOH E . 
D 3 HOH 1   803 803 HOH HOH I . 
D 3 HOH 2   808 808 HOH HOH I . 
D 3 HOH 3   904 904 HOH HOH I . 
D 3 HOH 4   906 906 HOH HOH I . 
D 3 HOH 5   911 911 HOH HOH I . 
D 3 HOH 6   914 914 HOH HOH I . 
D 3 HOH 7   915 915 HOH HOH I . 
D 3 HOH 8   919 919 HOH HOH I . 
D 3 HOH 9   920 920 HOH HOH I . 
D 3 HOH 10  937 937 HOH HOH I . 
D 3 HOH 11  950 950 HOH HOH I . 
D 3 HOH 12  954 954 HOH HOH I . 
D 3 HOH 13  994 994 HOH HOH I . 
D 3 HOH 14  995 995 HOH HOH I . 
#