data_1PRH
# 
_entry.id   1PRH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1PRH         
WWPDB D_1000175802 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1PRH 
_pdbx_database_status.recvd_initial_deposition_date   1994-03-07 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Picot, D.'      1 
'Loll, P.J.'     2 
'Garavito, R.M.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The X-ray crystal structure of the membrane protein prostaglandin H2 synthase-1.' Nature      367 243 249 1994 NATUAS UK 
0028-0836 0006 ? 8121489 10.1038/367243a0 
1       'X-Ray Crystal Structure of Canine Myeloperoxidase at 3 Angstroms Resolution'      J.Mol.Biol. 226 185 ?   1992 JMOBAK UK 
0022-2836 0070 ? ?       ?                
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Picot, D.'      1 
primary 'Loll, P.J.'     2 
primary 'Garavito, R.M.' 3 
1       'Zeng, J.'       4 
1       'Fenna, R.E.'    5 
# 
_cell.entry_id           1PRH 
_cell.length_a           99.400 
_cell.length_b           210.300 
_cell.length_c           233.100 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1PRH 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROSTAGLANDIN H2 SYNTHASE-1'     63867.344 2 1.14.99.1 ? ? ? 
2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   2 ?         ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDTL
MRLVLTVRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRRFLLRRKFIPDPQ
GTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVL
MHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHQRVCDLLKAEHPTWGDEQLFQTAKLILIGETIKIVIEEYVQQL
SGYFLQLKFDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPAG
RIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKC
HPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVPDPR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDTL
MRLVLTVRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRRFLLRRKFIPDPQ
GTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVL
MHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHQRVCDLLKAEHPTWGDEQLFQTAKLILIGETIKIVIEEYVQQL
SGYFLQLKFDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPAG
RIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKC
HPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVPDPR
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   ASN n 
1 3   PRO n 
1 4   CYS n 
1 5   CYS n 
1 6   TYR n 
1 7   TYR n 
1 8   PRO n 
1 9   CYS n 
1 10  GLN n 
1 11  HIS n 
1 12  GLN n 
1 13  GLY n 
1 14  ILE n 
1 15  CYS n 
1 16  VAL n 
1 17  ARG n 
1 18  PHE n 
1 19  GLY n 
1 20  LEU n 
1 21  ASP n 
1 22  ARG n 
1 23  TYR n 
1 24  GLN n 
1 25  CYS n 
1 26  ASP n 
1 27  CYS n 
1 28  THR n 
1 29  ARG n 
1 30  THR n 
1 31  GLY n 
1 32  TYR n 
1 33  SER n 
1 34  GLY n 
1 35  PRO n 
1 36  ASN n 
1 37  CYS n 
1 38  THR n 
1 39  ILE n 
1 40  PRO n 
1 41  GLU n 
1 42  ILE n 
1 43  TRP n 
1 44  THR n 
1 45  TRP n 
1 46  LEU n 
1 47  ARG n 
1 48  THR n 
1 49  THR n 
1 50  LEU n 
1 51  ARG n 
1 52  PRO n 
1 53  SER n 
1 54  PRO n 
1 55  SER n 
1 56  PHE n 
1 57  ILE n 
1 58  HIS n 
1 59  PHE n 
1 60  LEU n 
1 61  LEU n 
1 62  THR n 
1 63  HIS n 
1 64  GLY n 
1 65  ARG n 
1 66  TRP n 
1 67  LEU n 
1 68  TRP n 
1 69  ASP n 
1 70  PHE n 
1 71  VAL n 
1 72  ASN n 
1 73  ALA n 
1 74  THR n 
1 75  PHE n 
1 76  ILE n 
1 77  ARG n 
1 78  ASP n 
1 79  THR n 
1 80  LEU n 
1 81  MET n 
1 82  ARG n 
1 83  LEU n 
1 84  VAL n 
1 85  LEU n 
1 86  THR n 
1 87  VAL n 
1 88  ARG n 
1 89  SER n 
1 90  ASN n 
1 91  LEU n 
1 92  ILE n 
1 93  PRO n 
1 94  SER n 
1 95  PRO n 
1 96  PRO n 
1 97  THR n 
1 98  TYR n 
1 99  ASN n 
1 100 ILE n 
1 101 ALA n 
1 102 HIS n 
1 103 ASP n 
1 104 TYR n 
1 105 ILE n 
1 106 SER n 
1 107 TRP n 
1 108 GLU n 
1 109 SER n 
1 110 PHE n 
1 111 SER n 
1 112 ASN n 
1 113 VAL n 
1 114 SER n 
1 115 TYR n 
1 116 TYR n 
1 117 THR n 
1 118 ARG n 
1 119 ILE n 
1 120 LEU n 
1 121 PRO n 
1 122 SER n 
1 123 VAL n 
1 124 PRO n 
1 125 ARG n 
1 126 ASP n 
1 127 CYS n 
1 128 PRO n 
1 129 THR n 
1 130 PRO n 
1 131 MET n 
1 132 GLY n 
1 133 THR n 
1 134 LYS n 
1 135 GLY n 
1 136 LYS n 
1 137 LYS n 
1 138 GLN n 
1 139 LEU n 
1 140 PRO n 
1 141 ASP n 
1 142 ALA n 
1 143 GLU n 
1 144 PHE n 
1 145 LEU n 
1 146 SER n 
1 147 ARG n 
1 148 ARG n 
1 149 PHE n 
1 150 LEU n 
1 151 LEU n 
1 152 ARG n 
1 153 ARG n 
1 154 LYS n 
1 155 PHE n 
1 156 ILE n 
1 157 PRO n 
1 158 ASP n 
1 159 PRO n 
1 160 GLN n 
1 161 GLY n 
1 162 THR n 
1 163 ASN n 
1 164 LEU n 
1 165 MET n 
1 166 PHE n 
1 167 ALA n 
1 168 PHE n 
1 169 PHE n 
1 170 ALA n 
1 171 GLN n 
1 172 HIS n 
1 173 PHE n 
1 174 THR n 
1 175 HIS n 
1 176 GLN n 
1 177 PHE n 
1 178 PHE n 
1 179 LYS n 
1 180 THR n 
1 181 SER n 
1 182 GLY n 
1 183 LYS n 
1 184 MET n 
1 185 GLY n 
1 186 PRO n 
1 187 GLY n 
1 188 PHE n 
1 189 THR n 
1 190 LYS n 
1 191 ALA n 
1 192 LEU n 
1 193 GLY n 
1 194 HIS n 
1 195 GLY n 
1 196 VAL n 
1 197 ASP n 
1 198 LEU n 
1 199 GLY n 
1 200 HIS n 
1 201 ILE n 
1 202 TYR n 
1 203 GLY n 
1 204 ASP n 
1 205 ASN n 
1 206 LEU n 
1 207 GLU n 
1 208 ARG n 
1 209 GLN n 
1 210 TYR n 
1 211 GLN n 
1 212 LEU n 
1 213 ARG n 
1 214 LEU n 
1 215 PHE n 
1 216 LYS n 
1 217 ASP n 
1 218 GLY n 
1 219 LYS n 
1 220 LEU n 
1 221 LYS n 
1 222 TYR n 
1 223 GLN n 
1 224 MET n 
1 225 LEU n 
1 226 ASN n 
1 227 GLY n 
1 228 GLU n 
1 229 VAL n 
1 230 TYR n 
1 231 PRO n 
1 232 PRO n 
1 233 SER n 
1 234 VAL n 
1 235 GLU n 
1 236 GLU n 
1 237 ALA n 
1 238 PRO n 
1 239 VAL n 
1 240 LEU n 
1 241 MET n 
1 242 HIS n 
1 243 TYR n 
1 244 PRO n 
1 245 ARG n 
1 246 GLY n 
1 247 ILE n 
1 248 PRO n 
1 249 PRO n 
1 250 GLN n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 ALA n 
1 255 VAL n 
1 256 GLY n 
1 257 GLN n 
1 258 GLU n 
1 259 VAL n 
1 260 PHE n 
1 261 GLY n 
1 262 LEU n 
1 263 LEU n 
1 264 PRO n 
1 265 GLY n 
1 266 LEU n 
1 267 MET n 
1 268 LEU n 
1 269 TYR n 
1 270 ALA n 
1 271 THR n 
1 272 ILE n 
1 273 TRP n 
1 274 LEU n 
1 275 ARG n 
1 276 GLU n 
1 277 HIS n 
1 278 GLN n 
1 279 ARG n 
1 280 VAL n 
1 281 CYS n 
1 282 ASP n 
1 283 LEU n 
1 284 LEU n 
1 285 LYS n 
1 286 ALA n 
1 287 GLU n 
1 288 HIS n 
1 289 PRO n 
1 290 THR n 
1 291 TRP n 
1 292 GLY n 
1 293 ASP n 
1 294 GLU n 
1 295 GLN n 
1 296 LEU n 
1 297 PHE n 
1 298 GLN n 
1 299 THR n 
1 300 ALA n 
1 301 LYS n 
1 302 LEU n 
1 303 ILE n 
1 304 LEU n 
1 305 ILE n 
1 306 GLY n 
1 307 GLU n 
1 308 THR n 
1 309 ILE n 
1 310 LYS n 
1 311 ILE n 
1 312 VAL n 
1 313 ILE n 
1 314 GLU n 
1 315 GLU n 
1 316 TYR n 
1 317 VAL n 
1 318 GLN n 
1 319 GLN n 
1 320 LEU n 
1 321 SER n 
1 322 GLY n 
1 323 TYR n 
1 324 PHE n 
1 325 LEU n 
1 326 GLN n 
1 327 LEU n 
1 328 LYS n 
1 329 PHE n 
1 330 ASP n 
1 331 PRO n 
1 332 GLU n 
1 333 LEU n 
1 334 LEU n 
1 335 PHE n 
1 336 GLY n 
1 337 ALA n 
1 338 GLN n 
1 339 PHE n 
1 340 GLN n 
1 341 TYR n 
1 342 ARG n 
1 343 ASN n 
1 344 ARG n 
1 345 ILE n 
1 346 ALA n 
1 347 MET n 
1 348 GLU n 
1 349 PHE n 
1 350 ASN n 
1 351 GLN n 
1 352 LEU n 
1 353 TYR n 
1 354 HIS n 
1 355 TRP n 
1 356 HIS n 
1 357 PRO n 
1 358 LEU n 
1 359 MET n 
1 360 PRO n 
1 361 ASP n 
1 362 SER n 
1 363 PHE n 
1 364 ARG n 
1 365 VAL n 
1 366 GLY n 
1 367 PRO n 
1 368 GLN n 
1 369 ASP n 
1 370 TYR n 
1 371 SER n 
1 372 TYR n 
1 373 GLU n 
1 374 GLN n 
1 375 PHE n 
1 376 LEU n 
1 377 PHE n 
1 378 ASN n 
1 379 THR n 
1 380 SER n 
1 381 MET n 
1 382 LEU n 
1 383 VAL n 
1 384 ASP n 
1 385 TYR n 
1 386 GLY n 
1 387 VAL n 
1 388 GLU n 
1 389 ALA n 
1 390 LEU n 
1 391 VAL n 
1 392 ASP n 
1 393 ALA n 
1 394 PHE n 
1 395 SER n 
1 396 ARG n 
1 397 GLN n 
1 398 PRO n 
1 399 ALA n 
1 400 GLY n 
1 401 ARG n 
1 402 ILE n 
1 403 GLY n 
1 404 GLY n 
1 405 GLY n 
1 406 ARG n 
1 407 ASN n 
1 408 ILE n 
1 409 ASP n 
1 410 HIS n 
1 411 HIS n 
1 412 ILE n 
1 413 LEU n 
1 414 HIS n 
1 415 VAL n 
1 416 ALA n 
1 417 VAL n 
1 418 ASP n 
1 419 VAL n 
1 420 ILE n 
1 421 LYS n 
1 422 GLU n 
1 423 SER n 
1 424 ARG n 
1 425 VAL n 
1 426 LEU n 
1 427 ARG n 
1 428 LEU n 
1 429 GLN n 
1 430 PRO n 
1 431 PHE n 
1 432 ASN n 
1 433 GLU n 
1 434 TYR n 
1 435 ARG n 
1 436 LYS n 
1 437 ARG n 
1 438 PHE n 
1 439 GLY n 
1 440 MET n 
1 441 LYS n 
1 442 PRO n 
1 443 TYR n 
1 444 THR n 
1 445 SER n 
1 446 PHE n 
1 447 GLN n 
1 448 GLU n 
1 449 LEU n 
1 450 THR n 
1 451 GLY n 
1 452 GLU n 
1 453 LYS n 
1 454 GLU n 
1 455 MET n 
1 456 ALA n 
1 457 ALA n 
1 458 GLU n 
1 459 LEU n 
1 460 GLU n 
1 461 GLU n 
1 462 LEU n 
1 463 TYR n 
1 464 GLY n 
1 465 ASP n 
1 466 ILE n 
1 467 ASP n 
1 468 ALA n 
1 469 LEU n 
1 470 GLU n 
1 471 PHE n 
1 472 TYR n 
1 473 PRO n 
1 474 GLY n 
1 475 LEU n 
1 476 LEU n 
1 477 LEU n 
1 478 GLU n 
1 479 LYS n 
1 480 CYS n 
1 481 HIS n 
1 482 PRO n 
1 483 ASN n 
1 484 SER n 
1 485 ILE n 
1 486 PHE n 
1 487 GLY n 
1 488 GLU n 
1 489 SER n 
1 490 MET n 
1 491 ILE n 
1 492 GLU n 
1 493 MET n 
1 494 GLY n 
1 495 ALA n 
1 496 PRO n 
1 497 PHE n 
1 498 SER n 
1 499 LEU n 
1 500 LYS n 
1 501 GLY n 
1 502 LEU n 
1 503 LEU n 
1 504 GLY n 
1 505 ASN n 
1 506 PRO n 
1 507 ILE n 
1 508 CYS n 
1 509 SER n 
1 510 PRO n 
1 511 GLU n 
1 512 TYR n 
1 513 TRP n 
1 514 LYS n 
1 515 ALA n 
1 516 SER n 
1 517 THR n 
1 518 PHE n 
1 519 GLY n 
1 520 GLY n 
1 521 GLU n 
1 522 VAL n 
1 523 GLY n 
1 524 PHE n 
1 525 ASN n 
1 526 LEU n 
1 527 VAL n 
1 528 LYS n 
1 529 THR n 
1 530 ALA n 
1 531 THR n 
1 532 LEU n 
1 533 LYS n 
1 534 LYS n 
1 535 LEU n 
1 536 VAL n 
1 537 CYS n 
1 538 LEU n 
1 539 ASN n 
1 540 THR n 
1 541 LYS n 
1 542 THR n 
1 543 CYS n 
1 544 PRO n 
1 545 TYR n 
1 546 VAL n 
1 547 SER n 
1 548 PHE n 
1 549 HIS n 
1 550 VAL n 
1 551 PRO n 
1 552 ASP n 
1 553 PRO n 
1 554 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               sheep 
_entity_src_gen.gene_src_genus                     Ovis 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Ovis aries' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9940 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PGH1_SHEEP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P05979 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MSRQSISLRFPLLLLLLSPSPVFSADPGAPAPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRT
TLRPSPSFIHFMLTHGRWLWDFVNATFIRDTLMRLVLTVRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCP
TPMGTKGKKQLPDAEFLSRRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLER
QYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHNRVCDLLKAEH
PTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQ
DYSYEQFLFNTSMLVDYGVEALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQE
LTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGEVGFNLVK
TATLKKLVCLNTKTCPYVSFHVPDPRQEDRPGVERPPTEL
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1PRH A 1 ? 554 ? P05979 33 ? 586 ? 33 586 
2 1 1PRH B 1 ? 554 ? P05979 33 ? 586 ? 33 586 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1PRH LEU A 60  ? UNP P05979 MET 92  CONFLICT 92  1 
1 1PRH GLN A 278 ? UNP P05979 ASN 310 CONFLICT 310 2 
1 1PRH LYS A 301 ? UNP P05979 ARG 333 CONFLICT 333 3 
2 1PRH LEU B 60  ? UNP P05979 MET 92  CONFLICT 92  4 
2 1PRH GLN B 278 ? UNP P05979 ASN 310 CONFLICT 310 5 
2 1PRH LYS B 301 ? UNP P05979 ARG 333 CONFLICT 333 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?    'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                          ?    'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?    'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?    'C6 H10 N3 O2 1'   156.162 
ILE 'L-peptide linking' y ISOLEUCINE                        ?    'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                           ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?    'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?    'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                           ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?    'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?    'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1PRH 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.77 
_exptl_crystal.density_percent_sol   74.19 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1PRH 
_refine.ls_number_reflns_obs                     32349 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            3.5 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.267 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.267 
_refine.ls_R_factor_R_free                       0.316 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;COORDINATES GIVEN HERE FOR RESIDUES 33 - 586 WHERE THE
MAIN CHAIN ELECTRON DENSITY IS WELL DEFINED.   ELECTRON
DENSITY FOR THE EXTREME AMINO-TERMINUS (RESIDUES 25 - 33)
AND THE EXTREME C-TERMINUS (RESIDUES 587 - 600) IS POORLY
DEFINED.

RESOLUTION IS TOO LIMITED TO CLEARLY DEFINE TURN
STEREOCHEMISTRY.

PHASED BY MIR (3 DERIVATIVES), SOLVENT FLATTENED AND
TWO-FOLD AVERAGED ABOUT THE NON-CRYSTALLOGRAPHIC SYMMETRY
AXIS.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9006 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         86 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               9092 
_refine_hist.d_res_high                       3.5 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.014 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             3.20  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.995340 
_struct_ncs_oper.matrix[1][2]   -0.059900 
_struct_ncs_oper.matrix[1][3]   0.075620 
_struct_ncs_oper.matrix[2][1]   -0.059260 
_struct_ncs_oper.matrix[2][2]   -0.238880 
_struct_ncs_oper.matrix[2][3]   -0.969240 
_struct_ncs_oper.matrix[3][1]   0.076120 
_struct_ncs_oper.matrix[3][2]   -0.969200 
_struct_ncs_oper.matrix[3][3]   0.234220 
_struct_ncs_oper.vector[1]      81.43000 
_struct_ncs_oper.vector[2]      234.50500 
_struct_ncs_oper.vector[3]      179.08299 
# 
_struct.entry_id                  1PRH 
_struct.title                     'THE X-RAY CRYSTAL STRUCTURE OF THE MEMBRANE PROTEIN PROSTAGLANDIN H2 SYNTHASE-1' 
_struct.pdbx_descriptor           'PROSTAGLANDIN H2 SYNTHASE-1 (CYCLOOXYGENASE I)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1PRH 
_struct_keywords.pdbx_keywords   'OXIDOREDUCTASE(DIOXYGENASE, PEROXIDASE)' 
_struct_keywords.text            'OXIDOREDUCTASE(DIOXYGENASE, PEROXIDASE)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;THE TRANSFORMATION PRESENTED ON *MTRIX* RECORDS BELOW WILL
YIELD APPROXIMATE COORDINATES FOR CHAIN *B* WHEN APPLIED TO
CHAIN *A*.
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA  ILE A 42  ? LEU A 50  ? ILE A 74  LEU A 82  1 ?     9  
HELX_P HELX_P2  BA  PRO A 54  ? LEU A 60  ? PRO A 86  LEU A 92  1 ?     7  
HELX_P HELX_P3  CA  ARG A 65  ? ALA A 73  ? ARG A 97  ALA A 105 1 ?     9  
HELX_P HELX_P4  DA  ILE A 76  ? ASN A 90  ? ILE A 108 ASN A 122 1 ?     15 
HELX_P HELX_P5  EA  TRP A 107 ? SER A 111 ? TRP A 139 SER A 143 1 ?     5  
HELX_P HELX_P6  1A  ALA A 142 ? PHE A 149 ? ALA A 174 PHE A 181 1 ?     8  
HELX_P HELX_P7  2A  LEU A 164 ? HIS A 175 ? LEU A 196 HIS A 207 1 ?     12 
HELX_P HELX_P8  3A  LEU A 206 ? LEU A 212 ? LEU A 238 LEU A 244 1 ?     7  
HELX_P HELX_P9  5A  PRO A 264 ? GLU A 287 ? PRO A 296 GLU A 319 1 ?     24 
HELX_P HELX_P10 6A  ASP A 293 ? SER A 321 ? ASP A 325 SER A 353 1 ?     29 
HELX_P HELX_P11 8A  MET A 347 ? TYR A 353 ? MET A 379 TYR A 385 1 ?     7  
HELX_P HELX_P12 9A  MET A 381 ? TYR A 385 ? MET A 413 TYR A 417 1 ?     5  
HELX_P HELX_P13 10A VAL A 387 ? ARG A 396 ? VAL A 419 ARG A 428 1 ?     10 
HELX_P HELX_P14 11A LEU A 413 ? VAL A 425 ? LEU A 445 VAL A 457 1 11/12 13 
HELX_P HELX_P15 13A PHE A 431 ? ARG A 437 ? PHE A 463 ARG A 469 1 ?     7  
HELX_P HELX_P16 14A PHE A 446 ? THR A 450 ? PHE A 478 THR A 482 1 ?     5  
HELX_P HELX_P17 15A GLU A 454 ? TYR A 463 ? GLU A 486 TYR A 495 1 ?     10 
HELX_P HELX_P18 16A PHE A 471 ? LEU A 477 ? PHE A 503 LEU A 509 1 ?     7  
HELX_P HELX_P19 17A GLU A 488 ? LEU A 503 ? GLU A 520 LEU A 535 1 ?     16 
HELX_P HELX_P20 18A GLU A 521 ? THR A 529 ? GLU A 553 THR A 561 1 ?     9  
HELX_P HELX_P21 19A LEU A 532 ? CYS A 537 ? LEU A 564 CYS A 569 1 ?     6  
HELX_P HELX_P22 AB  ILE B 42  ? LEU B 50  ? ILE B 74  LEU B 82  1 ?     9  
HELX_P HELX_P23 BB  PRO B 54  ? LEU B 60  ? PRO B 86  LEU B 92  1 ?     7  
HELX_P HELX_P24 CB  ARG B 65  ? ALA B 73  ? ARG B 97  ALA B 105 1 ?     9  
HELX_P HELX_P25 DB  ILE B 76  ? ASN B 90  ? ILE B 108 ASN B 122 1 ?     15 
HELX_P HELX_P26 EB  TRP B 107 ? SER B 111 ? TRP B 139 SER B 143 1 ?     5  
HELX_P HELX_P27 1B  ALA B 142 ? PHE B 149 ? ALA B 174 PHE B 181 1 ?     8  
HELX_P HELX_P28 2B  LEU B 164 ? HIS B 175 ? LEU B 196 HIS B 207 1 ?     12 
HELX_P HELX_P29 3B  LEU B 206 ? LEU B 212 ? LEU B 238 LEU B 244 1 ?     7  
HELX_P HELX_P30 5B  PRO B 264 ? GLU B 287 ? PRO B 296 GLU B 319 1 ?     24 
HELX_P HELX_P31 6B  ASP B 293 ? SER B 321 ? ASP B 325 SER B 353 1 ?     29 
HELX_P HELX_P32 8B  MET B 347 ? TYR B 353 ? MET B 379 TYR B 385 1 ?     7  
HELX_P HELX_P33 9B  MET B 381 ? TYR B 385 ? MET B 413 TYR B 417 1 ?     5  
HELX_P HELX_P34 10B VAL B 387 ? ARG B 396 ? VAL B 419 ARG B 428 1 ?     10 
HELX_P HELX_P35 11B LEU B 413 ? VAL B 425 ? LEU B 445 VAL B 457 1 11/12 13 
HELX_P HELX_P36 13B PHE B 431 ? ARG B 437 ? PHE B 463 ARG B 469 1 ?     7  
HELX_P HELX_P37 14B PHE B 446 ? THR B 450 ? PHE B 478 THR B 482 1 ?     5  
HELX_P HELX_P38 15B GLU B 454 ? TYR B 463 ? GLU B 486 TYR B 495 1 ?     10 
HELX_P HELX_P39 16B PHE B 471 ? LEU B 477 ? PHE B 503 LEU B 509 1 ?     7  
HELX_P HELX_P40 17B GLU B 488 ? LEU B 503 ? GLU B 520 LEU B 535 1 ?     16 
HELX_P HELX_P41 18B GLU B 521 ? THR B 529 ? GLU B 553 THR B 561 1 ?     9  
HELX_P HELX_P42 19B LEU B 532 ? CYS B 537 ? LEU B 564 CYS B 569 1 ?     6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 4   SG ? ? ? 1_555 A CYS 15  SG  ? ? A CYS 36  A CYS 47  1_555 ? ? ? ? ? ? ? 2.014 ? 
disulf2  disulf ? ? A CYS 5   SG ? ? ? 1_555 A CYS 127 SG  ? ? A CYS 37  A CYS 159 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf3  disulf ? ? A CYS 9   SG ? ? ? 1_555 A CYS 25  SG  ? ? A CYS 41  A CYS 57  1_555 ? ? ? ? ? ? ? 2.005 ? 
disulf4  disulf ? ? A CYS 27  SG ? ? ? 1_555 A CYS 37  SG  ? ? A CYS 59  A CYS 69  1_555 ? ? ? ? ? ? ? 2.011 ? 
disulf5  disulf ? ? A CYS 537 SG ? ? ? 1_555 A CYS 543 SG  ? ? A CYS 569 A CYS 575 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf6  disulf ? ? B CYS 4   SG ? ? ? 1_555 B CYS 15  SG  ? ? B CYS 36  B CYS 47  1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf7  disulf ? ? B CYS 5   SG ? ? ? 1_555 B CYS 127 SG  ? ? B CYS 37  B CYS 159 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf8  disulf ? ? B CYS 9   SG ? ? ? 1_555 B CYS 25  SG  ? ? B CYS 41  B CYS 57  1_555 ? ? ? ? ? ? ? 2.004 ? 
disulf9  disulf ? ? B CYS 27  SG ? ? ? 1_555 B CYS 37  SG  ? ? B CYS 59  B CYS 69  1_555 ? ? ? ? ? ? ? 2.010 ? 
disulf10 disulf ? ? B CYS 537 SG ? ? ? 1_555 B CYS 543 SG  ? ? B CYS 569 B CYS 575 1_555 ? ? ? ? ? ? ? 2.036 ? 
metalc1  metalc ? ? C HEM .   FE ? ? ? 1_555 A HIS 356 NE2 ? ? A HEM 601 A HIS 388 1_555 ? ? ? ? ? ? ? 2.137 ? 
metalc2  metalc ? ? D HEM .   FE ? ? ? 1_555 B HIS 356 NE2 ? ? B HEM 601 B HIS 388 1_555 ? ? ? ? ? ? ? 2.145 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 94 A . ? SER 126 A PRO 95 A ? PRO 127 A 1 -9.23 
2 SER 94 B . ? SER 126 B PRO 95 B ? PRO 127 B 1 -9.21 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 14  ? ARG A 17  ? ILE A 46  ARG A 49  
A 2 TYR A 23  ? ASP A 26  ? TYR A 55  ASP A 58  
B 1 TYR A 32  ? SER A 33  ? TYR A 64  SER A 65  
B 2 ILE A 39  ? PRO A 40  ? ILE A 71  PRO A 72  
C 1 THR A 180 ? GLY A 182 ? THR A 212 GLY A 214 
C 2 GLY A 185 ? THR A 189 ? GLY A 217 THR A 221 
D 1 GLN A 223 ? LEU A 225 ? GLN A 255 LEU A 257 
D 2 GLU A 228 ? TYR A 230 ? GLU A 260 TYR A 262 
E 1 PHE A 363 ? VAL A 365 ? PHE A 395 VAL A 397 
E 2 GLN A 368 ? TYR A 370 ? GLN A 400 TYR A 402 
F 1 ILE B 14  ? ARG B 17  ? ILE B 46  ARG B 49  
F 2 TYR B 23  ? ASP B 26  ? TYR B 55  ASP B 58  
G 1 TYR B 32  ? SER B 33  ? TYR B 64  SER B 65  
G 2 ILE B 39  ? PRO B 40  ? ILE B 71  PRO B 72  
H 1 THR B 180 ? GLY B 182 ? THR B 212 GLY B 214 
H 2 GLY B 185 ? THR B 189 ? GLY B 217 THR B 221 
I 1 GLN B 223 ? LEU B 225 ? GLN B 255 LEU B 257 
I 2 GLU B 228 ? TYR B 230 ? GLU B 260 TYR B 262 
J 1 PHE B 363 ? VAL B 365 ? PHE B 395 VAL B 397 
J 2 GLN B 368 ? TYR B 370 ? GLN B 400 TYR B 402 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 16  ? N VAL A 48  O GLN A 24  ? O GLN A 56  
B 1 2 O SER A 33  ? O SER A 65  N ILE A 39  ? N ILE A 71  
C 1 2 N GLY A 182 ? N GLY A 214 O GLY A 185 ? O GLY A 217 
D 1 2 N LEU A 225 ? N LEU A 257 O GLU A 228 ? O GLU A 260 
E 1 2 O VAL A 365 ? O VAL A 397 N GLN A 368 ? N GLN A 400 
F 1 2 N VAL B 16  ? N VAL B 48  O GLN B 24  ? O GLN B 56  
G 1 2 O SER B 33  ? O SER B 65  N ILE B 39  ? N ILE B 71  
H 1 2 N GLY B 182 ? N GLY B 214 O GLY B 185 ? O GLY B 217 
I 1 2 N LEU B 225 ? N LEU B 257 O GLU B 228 ? O GLU B 260 
J 1 2 O VAL B 365 ? O VAL B 397 N GLN B 368 ? N GLN B 400 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
COX Author   ? ? ? ? 4  'CYCLOOXYGENASE ACTIVE SITE IS LOCATED WITHIN A LONG HYDROPHOBIC CHANNEL' 
PER Author   ? ? ? ? 4  'PEROXIDASE ACTIVE SITE IS AT THE HEME (HEM 601) SITE'                    
AC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE HEM A 601'                                      
AC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE HEM B 601'                                      
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  COX 4  ARG A 88  ? ARG A 120 . ? 1_555 ? 
2  COX 4  SER A 498 ? SER A 530 . ? 1_555 ? 
3  COX 4  TYR A 353 ? TYR A 385 . ? 1_555 ? 
4  COX 4  GLU A 492 ? GLU A 524 . ? 1_555 ? 
5  PER 4  GLN A 171 ? GLN A 203 . ? 1_555 ? 
6  PER 4  HIS A 175 ? HIS A 207 . ? 1_555 ? 
7  PER 4  HIS A 356 ? HIS A 388 . ? 1_555 ? 
8  PER 4  HEM C .   ? HEM A 601 . ? 1_555 ? 
9  AC1 17 TYR A 116 ? TYR A 148 . ? 1_555 ? 
10 AC1 17 ALA A 167 ? ALA A 199 . ? 1_555 ? 
11 AC1 17 GLN A 171 ? GLN A 203 . ? 1_555 ? 
12 AC1 17 THR A 174 ? THR A 206 . ? 1_555 ? 
13 AC1 17 HIS A 175 ? HIS A 207 . ? 1_555 ? 
14 AC1 17 PHE A 178 ? PHE A 210 . ? 1_555 ? 
15 AC1 17 THR A 180 ? THR A 212 . ? 1_555 ? 
16 AC1 17 LEU A 263 ? LEU A 295 . ? 1_555 ? 
17 AC1 17 ASN A 350 ? ASN A 382 . ? 1_555 ? 
18 AC1 17 TYR A 353 ? TYR A 385 . ? 1_555 ? 
19 AC1 17 HIS A 354 ? HIS A 386 . ? 1_555 ? 
20 AC1 17 HIS A 356 ? HIS A 388 . ? 1_555 ? 
21 AC1 17 LEU A 358 ? LEU A 390 . ? 1_555 ? 
22 AC1 17 MET A 359 ? MET A 391 . ? 1_555 ? 
23 AC1 17 LEU A 376 ? LEU A 408 . ? 1_555 ? 
24 AC1 17 ILE A 412 ? ILE A 444 . ? 1_555 ? 
25 AC1 17 ASP A 418 ? ASP A 450 . ? 1_555 ? 
26 AC2 17 TYR B 116 ? TYR B 148 . ? 1_555 ? 
27 AC2 17 ALA B 167 ? ALA B 199 . ? 1_555 ? 
28 AC2 17 GLN B 171 ? GLN B 203 . ? 1_555 ? 
29 AC2 17 THR B 174 ? THR B 206 . ? 1_555 ? 
30 AC2 17 HIS B 175 ? HIS B 207 . ? 1_555 ? 
31 AC2 17 PHE B 178 ? PHE B 210 . ? 1_555 ? 
32 AC2 17 THR B 180 ? THR B 212 . ? 1_555 ? 
33 AC2 17 LEU B 263 ? LEU B 295 . ? 1_555 ? 
34 AC2 17 ASN B 350 ? ASN B 382 . ? 1_555 ? 
35 AC2 17 TYR B 353 ? TYR B 385 . ? 1_555 ? 
36 AC2 17 HIS B 354 ? HIS B 386 . ? 1_555 ? 
37 AC2 17 HIS B 356 ? HIS B 388 . ? 1_555 ? 
38 AC2 17 LEU B 358 ? LEU B 390 . ? 1_555 ? 
39 AC2 17 MET B 359 ? MET B 391 . ? 1_555 ? 
40 AC2 17 LEU B 376 ? LEU B 408 . ? 1_555 ? 
41 AC2 17 ILE B 412 ? ILE B 444 . ? 1_555 ? 
42 AC2 17 ASP B 418 ? ASP B 450 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1PRH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1PRH 
_atom_sites.fract_transf_matrix[1][1]   0.010060 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004755 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004290 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'CIS PROLINE - PRO A   127'                                                                                           
2 'ASP A   584  - PRO A   585               OMEGA = 240.54 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 
3 'CIS PROLINE - PRO B   127'                                                                                           
4 'ASP B   584  - PRO B   585               OMEGA = 240.42 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . VAL A 1 1   ? 21.640 10.980 177.700 1.00 15.00 ? 33  VAL A N   1 
ATOM   2    C  CA  . VAL A 1 1   ? 22.990 10.670 177.210 1.00 15.00 ? 33  VAL A CA  1 
ATOM   3    C  C   . VAL A 1 1   ? 23.750 11.760 177.960 1.00 15.00 ? 33  VAL A C   1 
ATOM   4    O  O   . VAL A 1 1   ? 23.170 12.830 178.170 1.00 15.00 ? 33  VAL A O   1 
ATOM   5    C  CB  . VAL A 1 1   ? 23.190 10.860 175.630 1.00 15.00 ? 33  VAL A CB  1 
ATOM   6    C  CG1 . VAL A 1 1   ? 24.460 10.120 175.150 1.00 15.00 ? 33  VAL A CG1 1 
ATOM   7    C  CG2 . VAL A 1 1   ? 22.020 10.270 174.820 1.00 15.00 ? 33  VAL A CG2 1 
ATOM   8    N  N   . ASN A 1 2   ? 25.000 11.490 178.330 1.00 15.00 ? 34  ASN A N   1 
ATOM   9    C  CA  . ASN A 1 2   ? 25.880 12.330 179.130 1.00 15.00 ? 34  ASN A CA  1 
ATOM   10   C  C   . ASN A 1 2   ? 25.500 12.060 180.570 1.00 15.00 ? 34  ASN A C   1 
ATOM   11   O  O   . ASN A 1 2   ? 24.530 12.580 181.120 1.00 15.00 ? 34  ASN A O   1 
ATOM   12   C  CB  . ASN A 1 2   ? 25.790 13.880 178.990 1.00 15.00 ? 34  ASN A CB  1 
ATOM   13   C  CG  . ASN A 1 2   ? 26.980 14.540 179.680 1.00 15.00 ? 34  ASN A CG  1 
ATOM   14   O  OD1 . ASN A 1 2   ? 27.380 14.220 180.800 1.00 15.00 ? 34  ASN A OD1 1 
ATOM   15   N  ND2 . ASN A 1 2   ? 27.700 15.440 179.030 1.00 15.00 ? 34  ASN A ND2 1 
ATOM   16   N  N   . PRO A 1 3   ? 26.270 11.160 181.190 1.00 15.00 ? 35  PRO A N   1 
ATOM   17   C  CA  . PRO A 1 3   ? 26.020 10.660 182.520 1.00 15.00 ? 35  PRO A CA  1 
ATOM   18   C  C   . PRO A 1 3   ? 26.030 11.770 183.550 1.00 15.00 ? 35  PRO A C   1 
ATOM   19   O  O   . PRO A 1 3   ? 25.190 11.830 184.440 1.00 15.00 ? 35  PRO A O   1 
ATOM   20   C  CB  . PRO A 1 3   ? 27.090 9.660  182.740 1.00 15.00 ? 35  PRO A CB  1 
ATOM   21   C  CG  . PRO A 1 3   ? 27.560 9.300  181.350 1.00 15.00 ? 35  PRO A CG  1 
ATOM   22   C  CD  . PRO A 1 3   ? 27.530 10.640 180.680 1.00 15.00 ? 35  PRO A CD  1 
ATOM   23   N  N   . CYS A 1 4   ? 26.940 12.730 183.390 1.00 15.00 ? 36  CYS A N   1 
ATOM   24   C  CA  . CYS A 1 4   ? 27.090 13.790 184.360 1.00 15.00 ? 36  CYS A CA  1 
ATOM   25   C  C   . CYS A 1 4   ? 25.850 14.670 184.430 1.00 15.00 ? 36  CYS A C   1 
ATOM   26   O  O   . CYS A 1 4   ? 25.720 15.380 185.420 1.00 15.00 ? 36  CYS A O   1 
ATOM   27   C  CB  . CYS A 1 4   ? 28.370 14.550 184.000 1.00 15.00 ? 36  CYS A CB  1 
ATOM   28   S  SG  . CYS A 1 4   ? 29.840 13.470 184.090 1.00 15.00 ? 36  CYS A SG  1 
ATOM   29   N  N   . CYS A 1 5   ? 24.870 14.590 183.510 1.00 15.00 ? 37  CYS A N   1 
ATOM   30   C  CA  . CYS A 1 5   ? 23.620 15.310 183.640 1.00 15.00 ? 37  CYS A CA  1 
ATOM   31   C  C   . CYS A 1 5   ? 22.760 14.840 184.810 1.00 15.00 ? 37  CYS A C   1 
ATOM   32   O  O   . CYS A 1 5   ? 21.860 15.540 185.290 1.00 15.00 ? 37  CYS A O   1 
ATOM   33   C  CB  . CYS A 1 5   ? 22.800 15.140 182.410 1.00 15.00 ? 37  CYS A CB  1 
ATOM   34   S  SG  . CYS A 1 5   ? 23.490 16.060 181.040 1.00 15.00 ? 37  CYS A SG  1 
ATOM   35   N  N   . TYR A 1 6   ? 23.030 13.630 185.290 1.00 15.00 ? 38  TYR A N   1 
ATOM   36   C  CA  . TYR A 1 6   ? 22.290 13.040 186.380 1.00 15.00 ? 38  TYR A CA  1 
ATOM   37   C  C   . TYR A 1 6   ? 22.900 13.380 187.710 1.00 15.00 ? 38  TYR A C   1 
ATOM   38   O  O   . TYR A 1 6   ? 22.470 12.860 188.740 1.00 15.00 ? 38  TYR A O   1 
ATOM   39   C  CB  . TYR A 1 6   ? 22.230 11.520 186.260 1.00 15.00 ? 38  TYR A CB  1 
ATOM   40   C  CG  . TYR A 1 6   ? 21.460 11.100 185.040 1.00 15.00 ? 38  TYR A CG  1 
ATOM   41   C  CD1 . TYR A 1 6   ? 22.100 11.020 183.820 1.00 15.00 ? 38  TYR A CD1 1 
ATOM   42   C  CD2 . TYR A 1 6   ? 20.100 10.900 185.120 1.00 15.00 ? 38  TYR A CD2 1 
ATOM   43   C  CE1 . TYR A 1 6   ? 21.390 10.750 182.670 1.00 15.00 ? 38  TYR A CE1 1 
ATOM   44   C  CE2 . TYR A 1 6   ? 19.380 10.630 183.970 1.00 15.00 ? 38  TYR A CE2 1 
ATOM   45   C  CZ  . TYR A 1 6   ? 20.030 10.560 182.740 1.00 15.00 ? 38  TYR A CZ  1 
ATOM   46   O  OH  . TYR A 1 6   ? 19.320 10.340 181.560 1.00 15.00 ? 38  TYR A OH  1 
ATOM   47   N  N   . TYR A 1 7   ? 23.930 14.220 187.710 1.00 15.00 ? 39  TYR A N   1 
ATOM   48   C  CA  . TYR A 1 7   ? 24.640 14.620 188.910 1.00 15.00 ? 39  TYR A CA  1 
ATOM   49   C  C   . TYR A 1 7   ? 24.990 13.420 189.790 1.00 15.00 ? 39  TYR A C   1 
ATOM   50   O  O   . TYR A 1 7   ? 24.690 13.360 190.970 1.00 15.00 ? 39  TYR A O   1 
ATOM   51   C  CB  . TYR A 1 7   ? 23.770 15.670 189.660 1.00 15.00 ? 39  TYR A CB  1 
ATOM   52   C  CG  . TYR A 1 7   ? 23.350 16.870 188.820 1.00 15.00 ? 39  TYR A CG  1 
ATOM   53   C  CD1 . TYR A 1 7   ? 24.200 17.440 187.900 1.00 15.00 ? 39  TYR A CD1 1 
ATOM   54   C  CD2 . TYR A 1 7   ? 22.080 17.370 188.950 1.00 15.00 ? 39  TYR A CD2 1 
ATOM   55   C  CE1 . TYR A 1 7   ? 23.800 18.490 187.110 1.00 15.00 ? 39  TYR A CE1 1 
ATOM   56   C  CE2 . TYR A 1 7   ? 21.670 18.420 188.160 1.00 15.00 ? 39  TYR A CE2 1 
ATOM   57   C  CZ  . TYR A 1 7   ? 22.520 18.970 187.240 1.00 15.00 ? 39  TYR A CZ  1 
ATOM   58   O  OH  . TYR A 1 7   ? 22.080 19.970 186.390 1.00 15.00 ? 39  TYR A OH  1 
ATOM   59   N  N   . PRO A 1 8   ? 25.670 12.400 189.230 1.00 15.00 ? 40  PRO A N   1 
ATOM   60   C  CA  . PRO A 1 8   ? 25.830 11.080 189.830 1.00 15.00 ? 40  PRO A CA  1 
ATOM   61   C  C   . PRO A 1 8   ? 26.680 11.010 191.080 1.00 15.00 ? 40  PRO A C   1 
ATOM   62   O  O   . PRO A 1 8   ? 26.420 10.220 191.990 1.00 15.00 ? 40  PRO A O   1 
ATOM   63   C  CB  . PRO A 1 8   ? 26.410 10.230 188.750 1.00 15.00 ? 40  PRO A CB  1 
ATOM   64   C  CG  . PRO A 1 8   ? 26.240 11.050 187.510 1.00 15.00 ? 40  PRO A CG  1 
ATOM   65   C  CD  . PRO A 1 8   ? 26.440 12.450 188.010 1.00 15.00 ? 40  PRO A CD  1 
ATOM   66   N  N   . CYS A 1 9   ? 27.720 11.860 191.130 1.00 15.00 ? 41  CYS A N   1 
ATOM   67   C  CA  . CYS A 1 9   ? 28.710 11.830 192.180 1.00 15.00 ? 41  CYS A CA  1 
ATOM   68   C  C   . CYS A 1 9   ? 28.300 12.740 193.320 1.00 15.00 ? 41  CYS A C   1 
ATOM   69   O  O   . CYS A 1 9   ? 28.200 13.970 193.250 1.00 15.00 ? 41  CYS A O   1 
ATOM   70   C  CB  . CYS A 1 9   ? 30.030 12.270 191.610 1.00 15.00 ? 41  CYS A CB  1 
ATOM   71   S  SG  . CYS A 1 9   ? 30.410 11.590 189.980 1.00 15.00 ? 41  CYS A SG  1 
ATOM   72   N  N   . GLN A 1 10  ? 28.030 11.960 194.350 1.00 15.00 ? 42  GLN A N   1 
ATOM   73   C  CA  . GLN A 1 10  ? 27.580 12.460 195.640 1.00 15.00 ? 42  GLN A CA  1 
ATOM   74   C  C   . GLN A 1 10  ? 28.740 13.020 196.430 1.00 15.00 ? 42  GLN A C   1 
ATOM   75   O  O   . GLN A 1 10  ? 29.890 12.890 196.010 1.00 15.00 ? 42  GLN A O   1 
ATOM   76   C  CB  . GLN A 1 10  ? 26.930 11.320 196.440 1.00 15.00 ? 42  GLN A CB  1 
ATOM   77   C  CG  . GLN A 1 10  ? 25.830 10.530 195.750 1.00 15.00 ? 42  GLN A CG  1 
ATOM   78   C  CD  . GLN A 1 10  ? 24.750 11.450 195.200 1.00 15.00 ? 42  GLN A CD  1 
ATOM   79   O  OE1 . GLN A 1 10  ? 24.140 12.220 195.960 1.00 15.00 ? 42  GLN A OE1 1 
ATOM   80   N  NE2 . GLN A 1 10  ? 24.500 11.450 193.890 1.00 15.00 ? 42  GLN A NE2 1 
ATOM   81   N  N   . HIS A 1 11  ? 28.490 13.650 197.590 1.00 15.00 ? 43  HIS A N   1 
ATOM   82   C  CA  . HIS A 1 11  ? 29.520 14.190 198.480 1.00 15.00 ? 43  HIS A CA  1 
ATOM   83   C  C   . HIS A 1 11  ? 30.740 14.860 197.840 1.00 15.00 ? 43  HIS A C   1 
ATOM   84   O  O   . HIS A 1 11  ? 31.910 14.680 198.190 1.00 15.00 ? 43  HIS A O   1 
ATOM   85   C  CB  . HIS A 1 11  ? 30.020 13.100 199.400 1.00 15.00 ? 43  HIS A CB  1 
ATOM   86   C  CG  . HIS A 1 11  ? 28.850 12.470 200.100 1.00 15.00 ? 43  HIS A CG  1 
ATOM   87   N  ND1 . HIS A 1 11  ? 28.340 11.220 199.760 1.00 15.00 ? 43  HIS A ND1 1 
ATOM   88   C  CD2 . HIS A 1 11  ? 28.080 13.120 201.050 1.00 15.00 ? 43  HIS A CD2 1 
ATOM   89   C  CE1 . HIS A 1 11  ? 27.200 11.140 200.460 1.00 15.00 ? 43  HIS A CE1 1 
ATOM   90   N  NE2 . HIS A 1 11  ? 27.050 12.190 201.220 1.00 15.00 ? 43  HIS A NE2 1 
ATOM   91   N  N   . GLN A 1 12  ? 30.350 15.640 196.840 1.00 15.00 ? 44  GLN A N   1 
ATOM   92   C  CA  . GLN A 1 12  ? 31.200 16.460 196.000 1.00 15.00 ? 44  GLN A CA  1 
ATOM   93   C  C   . GLN A 1 12  ? 32.370 15.730 195.320 1.00 15.00 ? 44  GLN A C   1 
ATOM   94   O  O   . GLN A 1 12  ? 33.440 16.280 195.070 1.00 15.00 ? 44  GLN A O   1 
ATOM   95   C  CB  . GLN A 1 12  ? 31.680 17.670 196.850 1.00 15.00 ? 44  GLN A CB  1 
ATOM   96   C  CG  . GLN A 1 12  ? 32.760 17.480 197.920 1.00 15.00 ? 44  GLN A CG  1 
ATOM   97   C  CD  . GLN A 1 12  ? 32.910 18.680 198.840 1.00 15.00 ? 44  GLN A CD  1 
ATOM   98   O  OE1 . GLN A 1 12  ? 32.180 18.810 199.820 1.00 15.00 ? 44  GLN A OE1 1 
ATOM   99   N  NE2 . GLN A 1 12  ? 33.850 19.590 198.590 1.00 15.00 ? 44  GLN A NE2 1 
ATOM   100  N  N   . GLY A 1 13  ? 32.130 14.470 194.990 1.00 15.00 ? 45  GLY A N   1 
ATOM   101  C  CA  . GLY A 1 13  ? 33.080 13.760 194.170 1.00 15.00 ? 45  GLY A CA  1 
ATOM   102  C  C   . GLY A 1 13  ? 32.960 14.350 192.780 1.00 15.00 ? 45  GLY A C   1 
ATOM   103  O  O   . GLY A 1 13  ? 31.940 14.980 192.470 1.00 15.00 ? 45  GLY A O   1 
ATOM   104  N  N   . ILE A 1 14  ? 33.910 14.170 191.880 1.00 15.00 ? 46  ILE A N   1 
ATOM   105  C  CA  . ILE A 1 14  ? 33.780 14.840 190.600 1.00 15.00 ? 46  ILE A CA  1 
ATOM   106  C  C   . ILE A 1 14  ? 33.600 13.890 189.420 1.00 15.00 ? 46  ILE A C   1 
ATOM   107  O  O   . ILE A 1 14  ? 34.330 12.930 189.220 1.00 15.00 ? 46  ILE A O   1 
ATOM   108  C  CB  . ILE A 1 14  ? 35.020 15.850 190.510 1.00 15.00 ? 46  ILE A CB  1 
ATOM   109  C  CG1 . ILE A 1 14  ? 35.400 16.090 189.050 1.00 15.00 ? 46  ILE A CG1 1 
ATOM   110  C  CG2 . ILE A 1 14  ? 36.220 15.350 191.290 1.00 15.00 ? 46  ILE A CG2 1 
ATOM   111  C  CD1 . ILE A 1 14  ? 34.480 17.040 188.210 1.00 15.00 ? 46  ILE A CD1 1 
ATOM   112  N  N   . CYS A 1 15  ? 32.550 14.170 188.640 1.00 15.00 ? 47  CYS A N   1 
ATOM   113  C  CA  . CYS A 1 15  ? 32.120 13.350 187.510 1.00 15.00 ? 47  CYS A CA  1 
ATOM   114  C  C   . CYS A 1 15  ? 32.940 13.640 186.280 1.00 15.00 ? 47  CYS A C   1 
ATOM   115  O  O   . CYS A 1 15  ? 32.760 14.660 185.600 1.00 15.00 ? 47  CYS A O   1 
ATOM   116  C  CB  . CYS A 1 15  ? 30.640 13.620 187.190 1.00 15.00 ? 47  CYS A CB  1 
ATOM   117  S  SG  . CYS A 1 15  ? 29.800 12.630 185.920 1.00 15.00 ? 47  CYS A SG  1 
ATOM   118  N  N   . VAL A 1 16  ? 33.920 12.790 186.030 1.00 15.00 ? 48  VAL A N   1 
ATOM   119  C  CA  . VAL A 1 16  ? 34.660 12.920 184.800 1.00 15.00 ? 48  VAL A CA  1 
ATOM   120  C  C   . VAL A 1 16  ? 34.060 11.920 183.810 1.00 15.00 ? 48  VAL A C   1 
ATOM   121  O  O   . VAL A 1 16  ? 33.830 10.720 184.040 1.00 15.00 ? 48  VAL A O   1 
ATOM   122  C  CB  . VAL A 1 16  ? 36.190 12.680 185.080 1.00 15.00 ? 48  VAL A CB  1 
ATOM   123  C  CG1 . VAL A 1 16  ? 36.450 11.420 185.880 1.00 15.00 ? 48  VAL A CG1 1 
ATOM   124  C  CG2 . VAL A 1 16  ? 36.900 12.660 183.730 1.00 15.00 ? 48  VAL A CG2 1 
ATOM   125  N  N   . ARG A 1 17  ? 33.710 12.550 182.700 1.00 15.00 ? 49  ARG A N   1 
ATOM   126  C  CA  . ARG A 1 17  ? 33.110 11.870 181.580 1.00 15.00 ? 49  ARG A CA  1 
ATOM   127  C  C   . ARG A 1 17  ? 34.180 11.060 180.900 1.00 15.00 ? 49  ARG A C   1 
ATOM   128  O  O   . ARG A 1 17  ? 35.220 11.590 180.530 1.00 15.00 ? 49  ARG A O   1 
ATOM   129  C  CB  . ARG A 1 17  ? 32.540 12.940 180.680 1.00 15.00 ? 49  ARG A CB  1 
ATOM   130  C  CG  . ARG A 1 17  ? 31.150 12.600 180.230 1.00 15.00 ? 49  ARG A CG  1 
ATOM   131  C  CD  . ARG A 1 17  ? 31.290 11.650 179.070 1.00 15.00 ? 49  ARG A CD  1 
ATOM   132  N  NE  . ARG A 1 17  ? 30.170 11.600 178.140 1.00 15.00 ? 49  ARG A NE  1 
ATOM   133  C  CZ  . ARG A 1 17  ? 29.560 12.680 177.630 1.00 15.00 ? 49  ARG A CZ  1 
ATOM   134  N  NH1 . ARG A 1 17  ? 29.860 13.960 177.910 1.00 15.00 ? 49  ARG A NH1 1 
ATOM   135  N  NH2 . ARG A 1 17  ? 28.690 12.480 176.640 1.00 15.00 ? 49  ARG A NH2 1 
ATOM   136  N  N   . PHE A 1 18  ? 33.980 9.770  180.760 1.00 15.00 ? 50  PHE A N   1 
ATOM   137  C  CA  . PHE A 1 18  ? 34.970 8.980  180.060 1.00 15.00 ? 50  PHE A CA  1 
ATOM   138  C  C   . PHE A 1 18  ? 34.470 8.600  178.670 1.00 15.00 ? 50  PHE A C   1 
ATOM   139  O  O   . PHE A 1 18  ? 33.490 9.170  178.180 1.00 15.00 ? 50  PHE A O   1 
ATOM   140  C  CB  . PHE A 1 18  ? 35.310 7.740  180.870 1.00 15.00 ? 50  PHE A CB  1 
ATOM   141  C  CG  . PHE A 1 18  ? 36.510 8.020  181.760 1.00 15.00 ? 50  PHE A CG  1 
ATOM   142  C  CD1 . PHE A 1 18  ? 36.380 8.760  182.920 1.00 15.00 ? 50  PHE A CD1 1 
ATOM   143  C  CD2 . PHE A 1 18  ? 37.760 7.550  181.400 1.00 15.00 ? 50  PHE A CD2 1 
ATOM   144  C  CE1 . PHE A 1 18  ? 37.480 9.010  183.710 1.00 15.00 ? 50  PHE A CE1 1 
ATOM   145  C  CE2 . PHE A 1 18  ? 38.860 7.810  182.190 1.00 15.00 ? 50  PHE A CE2 1 
ATOM   146  C  CZ  . PHE A 1 18  ? 38.720 8.540  183.350 1.00 15.00 ? 50  PHE A CZ  1 
ATOM   147  N  N   . GLY A 1 19  ? 35.130 7.660  177.990 1.00 15.00 ? 51  GLY A N   1 
ATOM   148  C  CA  . GLY A 1 19  ? 34.840 7.340  176.610 1.00 15.00 ? 51  GLY A CA  1 
ATOM   149  C  C   . GLY A 1 19  ? 33.390 7.350  176.160 1.00 15.00 ? 51  GLY A C   1 
ATOM   150  O  O   . GLY A 1 19  ? 32.650 6.400  176.420 1.00 15.00 ? 51  GLY A O   1 
ATOM   151  N  N   . LEU A 1 20  ? 32.940 8.450  175.570 1.00 15.00 ? 52  LEU A N   1 
ATOM   152  C  CA  . LEU A 1 20  ? 31.620 8.510  174.940 1.00 15.00 ? 52  LEU A CA  1 
ATOM   153  C  C   . LEU A 1 20  ? 30.420 8.210  175.850 1.00 15.00 ? 52  LEU A C   1 
ATOM   154  O  O   . LEU A 1 20  ? 29.800 9.090  176.460 1.00 15.00 ? 52  LEU A O   1 
ATOM   155  C  CB  . LEU A 1 20  ? 31.620 7.530  173.740 1.00 15.00 ? 52  LEU A CB  1 
ATOM   156  C  CG  . LEU A 1 20  ? 30.820 7.770  172.460 1.00 15.00 ? 52  LEU A CG  1 
ATOM   157  C  CD1 . LEU A 1 20  ? 29.550 8.600  172.720 1.00 15.00 ? 52  LEU A CD1 1 
ATOM   158  C  CD2 . LEU A 1 20  ? 31.730 8.480  171.460 1.00 15.00 ? 52  LEU A CD2 1 
ATOM   159  N  N   . ASP A 1 21  ? 30.090 6.930  175.930 1.00 15.00 ? 53  ASP A N   1 
ATOM   160  C  CA  . ASP A 1 21  ? 28.930 6.470  176.640 1.00 15.00 ? 53  ASP A CA  1 
ATOM   161  C  C   . ASP A 1 21  ? 29.120 6.390  178.140 1.00 15.00 ? 53  ASP A C   1 
ATOM   162  O  O   . ASP A 1 21  ? 28.110 6.300  178.840 1.00 15.00 ? 53  ASP A O   1 
ATOM   163  C  CB  . ASP A 1 21  ? 28.550 5.090  176.100 1.00 15.00 ? 53  ASP A CB  1 
ATOM   164  C  CG  . ASP A 1 21  ? 29.450 3.910  176.530 1.00 15.00 ? 53  ASP A CG  1 
ATOM   165  O  OD1 . ASP A 1 21  ? 30.680 4.060  176.660 1.00 15.00 ? 53  ASP A OD1 1 
ATOM   166  O  OD2 . ASP A 1 21  ? 28.910 2.810  176.730 1.00 15.00 ? 53  ASP A OD2 1 
ATOM   167  N  N   . ARG A 1 22  ? 30.350 6.340  178.680 1.00 15.00 ? 54  ARG A N   1 
ATOM   168  C  CA  . ARG A 1 22  ? 30.480 6.110  180.110 1.00 15.00 ? 54  ARG A CA  1 
ATOM   169  C  C   . ARG A 1 22  ? 31.080 7.300  180.860 1.00 15.00 ? 54  ARG A C   1 
ATOM   170  O  O   . ARG A 1 22  ? 31.440 8.300  180.220 1.00 15.00 ? 54  ARG A O   1 
ATOM   171  C  CB  . ARG A 1 22  ? 31.300 4.800  180.330 1.00 15.00 ? 54  ARG A CB  1 
ATOM   172  C  CG  . ARG A 1 22  ? 32.650 4.660  179.600 1.00 15.00 ? 54  ARG A CG  1 
ATOM   173  C  CD  . ARG A 1 22  ? 33.510 3.440  180.030 1.00 15.00 ? 54  ARG A CD  1 
ATOM   174  N  NE  . ARG A 1 22  ? 33.790 3.390  181.490 1.00 15.00 ? 54  ARG A NE  1 
ATOM   175  C  CZ  . ARG A 1 22  ? 34.990 3.650  182.100 1.00 15.00 ? 54  ARG A CZ  1 
ATOM   176  N  NH1 . ARG A 1 22  ? 36.110 4.000  181.410 1.00 15.00 ? 54  ARG A NH1 1 
ATOM   177  N  NH2 . ARG A 1 22  ? 35.070 3.550  183.450 1.00 15.00 ? 54  ARG A NH2 1 
ATOM   178  N  N   . TYR A 1 23  ? 31.190 7.220  182.210 1.00 15.00 ? 55  TYR A N   1 
ATOM   179  C  CA  . TYR A 1 23  ? 31.720 8.290  183.070 1.00 15.00 ? 55  TYR A CA  1 
ATOM   180  C  C   . TYR A 1 23  ? 32.400 7.640  184.280 1.00 15.00 ? 55  TYR A C   1 
ATOM   181  O  O   . TYR A 1 23  ? 32.350 6.410  184.400 1.00 15.00 ? 55  TYR A O   1 
ATOM   182  C  CB  . TYR A 1 23  ? 30.580 9.190  183.550 1.00 15.00 ? 55  TYR A CB  1 
ATOM   183  C  CG  . TYR A 1 23  ? 29.760 8.540  184.660 1.00 15.00 ? 55  TYR A CG  1 
ATOM   184  C  CD1 . TYR A 1 23  ? 29.200 7.290  184.460 1.00 15.00 ? 55  TYR A CD1 1 
ATOM   185  C  CD2 . TYR A 1 23  ? 29.620 9.150  185.890 1.00 15.00 ? 55  TYR A CD2 1 
ATOM   186  C  CE1 . TYR A 1 23  ? 28.530 6.660  185.480 1.00 15.00 ? 55  TYR A CE1 1 
ATOM   187  C  CE2 . TYR A 1 23  ? 28.950 8.520  186.910 1.00 15.00 ? 55  TYR A CE2 1 
ATOM   188  C  CZ  . TYR A 1 23  ? 28.410 7.280  186.690 1.00 15.00 ? 55  TYR A CZ  1 
ATOM   189  O  OH  . TYR A 1 23  ? 27.730 6.620  187.700 1.00 15.00 ? 55  TYR A OH  1 
ATOM   190  N  N   . GLN A 1 24  ? 32.960 8.440  185.200 1.00 15.00 ? 56  GLN A N   1 
ATOM   191  C  CA  . GLN A 1 24  ? 33.560 7.980  186.440 1.00 15.00 ? 56  GLN A CA  1 
ATOM   192  C  C   . GLN A 1 24  ? 33.500 9.060  187.510 1.00 15.00 ? 56  GLN A C   1 
ATOM   193  O  O   . GLN A 1 24  ? 33.650 10.240 187.200 1.00 15.00 ? 56  GLN A O   1 
ATOM   194  C  CB  . GLN A 1 24  ? 35.010 7.620  186.260 1.00 15.00 ? 56  GLN A CB  1 
ATOM   195  C  CG  . GLN A 1 24  ? 35.170 6.170  185.870 1.00 15.00 ? 56  GLN A CG  1 
ATOM   196  C  CD  . GLN A 1 24  ? 36.620 5.750  185.750 1.00 15.00 ? 56  GLN A CD  1 
ATOM   197  O  OE1 . GLN A 1 24  ? 37.350 5.610  186.740 1.00 15.00 ? 56  GLN A OE1 1 
ATOM   198  N  NE2 . GLN A 1 24  ? 37.080 5.520  184.520 1.00 15.00 ? 56  GLN A NE2 1 
ATOM   199  N  N   . CYS A 1 25  ? 33.250 8.690  188.770 1.00 15.00 ? 57  CYS A N   1 
ATOM   200  C  CA  . CYS A 1 25  ? 33.250 9.660  189.850 1.00 15.00 ? 57  CYS A CA  1 
ATOM   201  C  C   . CYS A 1 25  ? 34.580 9.630  190.550 1.00 15.00 ? 57  CYS A C   1 
ATOM   202  O  O   . CYS A 1 25  ? 35.030 8.560  190.980 1.00 15.00 ? 57  CYS A O   1 
ATOM   203  C  CB  . CYS A 1 25  ? 32.230 9.360  190.910 1.00 15.00 ? 57  CYS A CB  1 
ATOM   204  S  SG  . CYS A 1 25  ? 30.560 9.620  190.320 1.00 15.00 ? 57  CYS A SG  1 
ATOM   205  N  N   . ASP A 1 26  ? 35.240 10.770 190.720 1.00 15.00 ? 58  ASP A N   1 
ATOM   206  C  CA  . ASP A 1 26  ? 36.480 10.770 191.450 1.00 15.00 ? 58  ASP A CA  1 
ATOM   207  C  C   . ASP A 1 26  ? 36.200 11.110 192.900 1.00 15.00 ? 58  ASP A C   1 
ATOM   208  O  O   . ASP A 1 26  ? 36.020 12.270 193.230 1.00 15.00 ? 58  ASP A O   1 
ATOM   209  C  CB  . ASP A 1 26  ? 37.420 11.790 190.860 1.00 15.00 ? 58  ASP A CB  1 
ATOM   210  C  CG  . ASP A 1 26  ? 38.770 11.860 191.560 1.00 15.00 ? 58  ASP A CG  1 
ATOM   211  O  OD1 . ASP A 1 26  ? 39.220 10.850 192.100 1.00 15.00 ? 58  ASP A OD1 1 
ATOM   212  O  OD2 . ASP A 1 26  ? 39.370 12.920 191.570 1.00 15.00 ? 58  ASP A OD2 1 
ATOM   213  N  N   . CYS A 1 27  ? 36.170 10.130 193.780 1.00 15.00 ? 59  CYS A N   1 
ATOM   214  C  CA  . CYS A 1 27  ? 35.900 10.380 195.190 1.00 15.00 ? 59  CYS A CA  1 
ATOM   215  C  C   . CYS A 1 27  ? 37.170 10.660 195.980 1.00 15.00 ? 59  CYS A C   1 
ATOM   216  O  O   . CYS A 1 27  ? 37.220 10.310 197.170 1.00 15.00 ? 59  CYS A O   1 
ATOM   217  C  CB  . CYS A 1 27  ? 35.220 9.190  195.830 1.00 15.00 ? 59  CYS A CB  1 
ATOM   218  S  SG  . CYS A 1 27  ? 34.080 8.340  194.710 1.00 15.00 ? 59  CYS A SG  1 
ATOM   219  N  N   . THR A 1 28  ? 38.220 11.260 195.410 1.00 15.00 ? 60  THR A N   1 
ATOM   220  C  CA  . THR A 1 28  ? 39.460 11.410 196.150 1.00 15.00 ? 60  THR A CA  1 
ATOM   221  C  C   . THR A 1 28  ? 39.210 12.320 197.330 1.00 15.00 ? 60  THR A C   1 
ATOM   222  O  O   . THR A 1 28  ? 38.610 13.390 197.230 1.00 15.00 ? 60  THR A O   1 
ATOM   223  C  CB  . THR A 1 28  ? 40.530 11.940 195.210 1.00 15.00 ? 60  THR A CB  1 
ATOM   224  O  OG1 . THR A 1 28  ? 40.740 10.900 194.270 1.00 15.00 ? 60  THR A OG1 1 
ATOM   225  C  CG2 . THR A 1 28  ? 41.860 12.240 195.860 1.00 15.00 ? 60  THR A CG2 1 
ATOM   226  N  N   . ARG A 1 29  ? 39.490 11.660 198.450 1.00 15.00 ? 61  ARG A N   1 
ATOM   227  C  CA  . ARG A 1 29  ? 39.290 12.160 199.790 1.00 15.00 ? 61  ARG A CA  1 
ATOM   228  C  C   . ARG A 1 29  ? 38.010 12.980 200.010 1.00 15.00 ? 61  ARG A C   1 
ATOM   229  O  O   . ARG A 1 29  ? 37.980 14.130 200.430 1.00 15.00 ? 61  ARG A O   1 
ATOM   230  C  CB  . ARG A 1 29  ? 40.580 12.930 200.230 1.00 15.00 ? 61  ARG A CB  1 
ATOM   231  C  CG  . ARG A 1 29  ? 41.020 14.240 199.590 1.00 15.00 ? 61  ARG A CG  1 
ATOM   232  C  CD  . ARG A 1 29  ? 42.430 14.650 200.030 1.00 15.00 ? 61  ARG A CD  1 
ATOM   233  N  NE  . ARG A 1 29  ? 43.470 13.890 199.350 1.00 15.00 ? 61  ARG A NE  1 
ATOM   234  C  CZ  . ARG A 1 29  ? 43.890 14.190 198.110 1.00 15.00 ? 61  ARG A CZ  1 
ATOM   235  N  NH1 . ARG A 1 29  ? 43.390 15.220 197.420 1.00 15.00 ? 61  ARG A NH1 1 
ATOM   236  N  NH2 . ARG A 1 29  ? 44.820 13.420 197.530 1.00 15.00 ? 61  ARG A NH2 1 
ATOM   237  N  N   . THR A 1 30  ? 36.910 12.280 199.710 1.00 15.00 ? 62  THR A N   1 
ATOM   238  C  CA  . THR A 1 30  ? 35.570 12.810 199.970 1.00 15.00 ? 62  THR A CA  1 
ATOM   239  C  C   . THR A 1 30  ? 35.000 12.230 201.270 1.00 15.00 ? 62  THR A C   1 
ATOM   240  O  O   . THR A 1 30  ? 34.020 12.710 201.850 1.00 15.00 ? 62  THR A O   1 
ATOM   241  C  CB  . THR A 1 30  ? 34.670 12.460 198.830 1.00 15.00 ? 62  THR A CB  1 
ATOM   242  O  OG1 . THR A 1 30  ? 34.750 11.050 198.750 1.00 15.00 ? 62  THR A OG1 1 
ATOM   243  C  CG2 . THR A 1 30  ? 35.060 13.090 197.510 1.00 15.00 ? 62  THR A CG2 1 
ATOM   244  N  N   . GLY A 1 31  ? 35.610 11.140 201.710 1.00 15.00 ? 63  GLY A N   1 
ATOM   245  C  CA  . GLY A 1 31  ? 35.150 10.430 202.880 1.00 15.00 ? 63  GLY A CA  1 
ATOM   246  C  C   . GLY A 1 31  ? 34.290 9.240  202.460 1.00 15.00 ? 63  GLY A C   1 
ATOM   247  O  O   . GLY A 1 31  ? 34.030 8.360  203.290 1.00 15.00 ? 63  GLY A O   1 
ATOM   248  N  N   . TYR A 1 32  ? 33.870 9.190  201.200 1.00 15.00 ? 64  TYR A N   1 
ATOM   249  C  CA  . TYR A 1 32  ? 33.020 8.130  200.690 1.00 15.00 ? 64  TYR A CA  1 
ATOM   250  C  C   . TYR A 1 32  ? 33.750 7.380  199.610 1.00 15.00 ? 64  TYR A C   1 
ATOM   251  O  O   . TYR A 1 32  ? 34.730 7.860  199.050 1.00 15.00 ? 64  TYR A O   1 
ATOM   252  C  CB  . TYR A 1 32  ? 31.740 8.710  200.110 1.00 15.00 ? 64  TYR A CB  1 
ATOM   253  C  CG  . TYR A 1 32  ? 30.840 9.340  201.140 1.00 15.00 ? 64  TYR A CG  1 
ATOM   254  C  CD1 . TYR A 1 32  ? 31.190 10.550 201.680 1.00 15.00 ? 64  TYR A CD1 1 
ATOM   255  C  CD2 . TYR A 1 32  ? 29.720 8.690  201.560 1.00 15.00 ? 64  TYR A CD2 1 
ATOM   256  C  CE1 . TYR A 1 32  ? 30.410 11.120 202.650 1.00 15.00 ? 64  TYR A CE1 1 
ATOM   257  C  CE2 . TYR A 1 32  ? 28.940 9.250  202.540 1.00 15.00 ? 64  TYR A CE2 1 
ATOM   258  C  CZ  . TYR A 1 32  ? 29.290 10.460 203.070 1.00 15.00 ? 64  TYR A CZ  1 
ATOM   259  O  OH  . TYR A 1 32  ? 28.500 11.030 204.050 1.00 15.00 ? 64  TYR A OH  1 
ATOM   260  N  N   . SER A 1 33  ? 33.220 6.210  199.290 1.00 15.00 ? 65  SER A N   1 
ATOM   261  C  CA  . SER A 1 33  ? 33.830 5.340  198.290 1.00 15.00 ? 65  SER A CA  1 
ATOM   262  C  C   . SER A 1 33  ? 32.820 4.780  197.310 1.00 15.00 ? 65  SER A C   1 
ATOM   263  O  O   . SER A 1 33  ? 31.620 5.070  197.380 1.00 15.00 ? 65  SER A O   1 
ATOM   264  C  CB  . SER A 1 33  ? 34.560 4.220  199.050 1.00 15.00 ? 65  SER A CB  1 
ATOM   265  O  OG  . SER A 1 33  ? 33.810 3.740  200.160 1.00 15.00 ? 65  SER A OG  1 
ATOM   266  N  N   . GLY A 1 34  ? 33.330 4.000  196.370 1.00 15.00 ? 66  GLY A N   1 
ATOM   267  C  CA  . GLY A 1 34  ? 32.500 3.310  195.410 1.00 15.00 ? 66  GLY A CA  1 
ATOM   268  C  C   . GLY A 1 34  ? 32.040 4.210  194.280 1.00 15.00 ? 66  GLY A C   1 
ATOM   269  O  O   . GLY A 1 34  ? 32.290 5.410  194.320 1.00 15.00 ? 66  GLY A O   1 
ATOM   270  N  N   . PRO A 1 35  ? 31.310 3.700  193.290 1.00 15.00 ? 67  PRO A N   1 
ATOM   271  C  CA  . PRO A 1 35  ? 31.200 4.290  191.970 1.00 15.00 ? 67  PRO A CA  1 
ATOM   272  C  C   . PRO A 1 35  ? 30.460 5.610  191.890 1.00 15.00 ? 67  PRO A C   1 
ATOM   273  O  O   . PRO A 1 35  ? 30.630 6.350  190.920 1.00 15.00 ? 67  PRO A O   1 
ATOM   274  C  CB  . PRO A 1 35  ? 30.550 3.200  191.170 1.00 15.00 ? 67  PRO A CB  1 
ATOM   275  C  CG  . PRO A 1 35  ? 29.600 2.630  192.170 1.00 15.00 ? 67  PRO A CG  1 
ATOM   276  C  CD  . PRO A 1 35  ? 30.440 2.550  193.430 1.00 15.00 ? 67  PRO A CD  1 
ATOM   277  N  N   . ASN A 1 36  ? 29.590 5.930  192.850 1.00 15.00 ? 68  ASN A N   1 
ATOM   278  C  CA  . ASN A 1 36  ? 28.930 7.210  192.820 1.00 15.00 ? 68  ASN A CA  1 
ATOM   279  C  C   . ASN A 1 36  ? 29.340 7.990  194.050 1.00 15.00 ? 68  ASN A C   1 
ATOM   280  O  O   . ASN A 1 36  ? 28.750 9.020  194.340 1.00 15.00 ? 68  ASN A O   1 
ATOM   281  C  CB  . ASN A 1 36  ? 27.380 7.010  192.770 1.00 15.00 ? 68  ASN A CB  1 
ATOM   282  C  CG  . ASN A 1 36  ? 26.740 6.640  191.410 1.00 15.00 ? 68  ASN A CG  1 
ATOM   283  O  OD1 . ASN A 1 36  ? 25.650 6.030  191.280 1.00 15.00 ? 68  ASN A OD1 1 
ATOM   284  N  ND2 . ASN A 1 36  ? 27.410 6.940  190.300 1.00 15.00 ? 68  ASN A ND2 1 
ATOM   285  N  N   . CYS A 1 37  ? 30.410 7.570  194.760 1.00 15.00 ? 69  CYS A N   1 
ATOM   286  C  CA  . CYS A 1 37  ? 30.930 8.140  196.000 1.00 15.00 ? 69  CYS A CA  1 
ATOM   287  C  C   . CYS A 1 37  ? 29.860 8.230  197.060 1.00 15.00 ? 69  CYS A C   1 
ATOM   288  O  O   . CYS A 1 37  ? 29.430 9.290  197.520 1.00 15.00 ? 69  CYS A O   1 
ATOM   289  C  CB  . CYS A 1 37  ? 31.490 9.520  195.820 1.00 15.00 ? 69  CYS A CB  1 
ATOM   290  S  SG  . CYS A 1 37  ? 32.600 9.670  194.420 1.00 15.00 ? 69  CYS A SG  1 
ATOM   291  N  N   . THR A 1 38  ? 29.470 7.060  197.540 1.00 15.00 ? 70  THR A N   1 
ATOM   292  C  CA  . THR A 1 38  ? 28.330 6.930  198.420 1.00 15.00 ? 70  THR A CA  1 
ATOM   293  C  C   . THR A 1 38  ? 28.530 6.020  199.640 1.00 15.00 ? 70  THR A C   1 
ATOM   294  O  O   . THR A 1 38  ? 27.740 6.070  200.570 1.00 15.00 ? 70  THR A O   1 
ATOM   295  C  CB  . THR A 1 38  ? 27.180 6.470  197.480 1.00 15.00 ? 70  THR A CB  1 
ATOM   296  O  OG1 . THR A 1 38  ? 26.060 6.290  198.320 1.00 15.00 ? 70  THR A OG1 1 
ATOM   297  C  CG2 . THR A 1 38  ? 27.510 5.220  196.650 1.00 15.00 ? 70  THR A CG2 1 
ATOM   298  N  N   . ILE A 1 39  ? 29.560 5.190  199.710 1.00 15.00 ? 71  ILE A N   1 
ATOM   299  C  CA  . ILE A 1 39  ? 29.690 4.280  200.830 1.00 15.00 ? 71  ILE A CA  1 
ATOM   300  C  C   . ILE A 1 39  ? 30.570 5.020  201.810 1.00 15.00 ? 71  ILE A C   1 
ATOM   301  O  O   . ILE A 1 39  ? 31.700 5.370  201.460 1.00 15.00 ? 71  ILE A O   1 
ATOM   302  C  CB  . ILE A 1 39  ? 30.360 3.000  200.390 1.00 15.00 ? 71  ILE A CB  1 
ATOM   303  C  CG1 . ILE A 1 39  ? 29.700 2.410  199.170 1.00 15.00 ? 71  ILE A CG1 1 
ATOM   304  C  CG2 . ILE A 1 39  ? 30.270 2.020  201.530 1.00 15.00 ? 71  ILE A CG2 1 
ATOM   305  C  CD1 . ILE A 1 39  ? 30.490 1.250  198.570 1.00 15.00 ? 71  ILE A CD1 1 
ATOM   306  N  N   . PRO A 1 40  ? 30.110 5.330  203.010 1.00 15.00 ? 72  PRO A N   1 
ATOM   307  C  CA  . PRO A 1 40  ? 30.820 6.150  203.970 1.00 15.00 ? 72  PRO A CA  1 
ATOM   308  C  C   . PRO A 1 40  ? 31.970 5.440  204.670 1.00 15.00 ? 72  PRO A C   1 
ATOM   309  O  O   . PRO A 1 40  ? 31.730 4.310  205.070 1.00 15.00 ? 72  PRO A O   1 
ATOM   310  C  CB  . PRO A 1 40  ? 29.760 6.590  204.950 1.00 15.00 ? 72  PRO A CB  1 
ATOM   311  C  CG  . PRO A 1 40  ? 28.440 6.220  204.290 1.00 15.00 ? 72  PRO A CG  1 
ATOM   312  C  CD  . PRO A 1 40  ? 28.800 4.960  203.520 1.00 15.00 ? 72  PRO A CD  1 
ATOM   313  N  N   . GLU A 1 41  ? 33.190 6.000  204.840 1.00 15.00 ? 73  GLU A N   1 
ATOM   314  C  CA  . GLU A 1 41  ? 34.190 5.370  205.720 1.00 15.00 ? 73  GLU A CA  1 
ATOM   315  C  C   . GLU A 1 41  ? 33.570 5.410  207.120 1.00 15.00 ? 73  GLU A C   1 
ATOM   316  O  O   . GLU A 1 41  ? 32.770 6.310  207.410 1.00 15.00 ? 73  GLU A O   1 
ATOM   317  C  CB  . GLU A 1 41  ? 35.500 6.120  205.830 1.00 15.00 ? 73  GLU A CB  1 
ATOM   318  C  CG  . GLU A 1 41  ? 36.280 6.280  204.530 1.00 15.00 ? 73  GLU A CG  1 
ATOM   319  C  CD  . GLU A 1 41  ? 37.410 7.320  204.570 1.00 15.00 ? 73  GLU A CD  1 
ATOM   320  O  OE1 . GLU A 1 41  ? 37.410 8.230  205.420 1.00 15.00 ? 73  GLU A OE1 1 
ATOM   321  O  OE2 . GLU A 1 41  ? 38.310 7.240  203.710 1.00 15.00 ? 73  GLU A OE2 1 
ATOM   322  N  N   . ILE A 1 42  ? 33.950 4.510  208.030 1.00 15.00 ? 74  ILE A N   1 
ATOM   323  C  CA  . ILE A 1 42  ? 33.290 4.500  209.320 1.00 15.00 ? 74  ILE A CA  1 
ATOM   324  C  C   . ILE A 1 42  ? 33.330 5.820  210.090 1.00 15.00 ? 74  ILE A C   1 
ATOM   325  O  O   . ILE A 1 42  ? 32.360 6.200  210.760 1.00 15.00 ? 74  ILE A O   1 
ATOM   326  C  CB  . ILE A 1 42  ? 33.890 3.330  210.140 1.00 15.00 ? 74  ILE A CB  1 
ATOM   327  C  CG1 . ILE A 1 42  ? 32.840 2.920  211.150 1.00 15.00 ? 74  ILE A CG1 1 
ATOM   328  C  CG2 . ILE A 1 42  ? 35.170 3.690  210.880 1.00 15.00 ? 74  ILE A CG2 1 
ATOM   329  C  CD1 . ILE A 1 42  ? 31.470 2.470  210.550 1.00 15.00 ? 74  ILE A CD1 1 
ATOM   330  N  N   . TRP A 1 43  ? 34.410 6.560  209.910 1.00 15.00 ? 75  TRP A N   1 
ATOM   331  C  CA  . TRP A 1 43  ? 34.520 7.880  210.510 1.00 15.00 ? 75  TRP A CA  1 
ATOM   332  C  C   . TRP A 1 43  ? 33.530 8.840  209.870 1.00 15.00 ? 75  TRP A C   1 
ATOM   333  O  O   . TRP A 1 43  ? 32.680 9.390  210.570 1.00 15.00 ? 75  TRP A O   1 
ATOM   334  C  CB  . TRP A 1 43  ? 35.950 8.360  210.340 1.00 15.00 ? 75  TRP A CB  1 
ATOM   335  C  CG  . TRP A 1 43  ? 36.750 7.860  211.530 1.00 15.00 ? 75  TRP A CG  1 
ATOM   336  C  CD1 . TRP A 1 43  ? 37.170 6.550  211.640 1.00 15.00 ? 75  TRP A CD1 1 
ATOM   337  C  CD2 . TRP A 1 43  ? 37.100 8.620  212.640 1.00 15.00 ? 75  TRP A CD2 1 
ATOM   338  N  NE1 . TRP A 1 43  ? 37.770 6.450  212.810 1.00 15.00 ? 75  TRP A NE1 1 
ATOM   339  C  CE2 . TRP A 1 43  ? 37.740 7.650  213.440 1.00 15.00 ? 75  TRP A CE2 1 
ATOM   340  C  CE3 . TRP A 1 43  ? 36.950 9.940  213.070 1.00 15.00 ? 75  TRP A CE3 1 
ATOM   341  C  CZ2 . TRP A 1 43  ? 38.260 8.010  214.680 1.00 15.00 ? 75  TRP A CZ2 1 
ATOM   342  C  CZ3 . TRP A 1 43  ? 37.480 10.290 214.310 1.00 15.00 ? 75  TRP A CZ3 1 
ATOM   343  C  CH2 . TRP A 1 43  ? 38.120 9.330  215.100 1.00 15.00 ? 75  TRP A CH2 1 
ATOM   344  N  N   . THR A 1 44  ? 33.580 8.950  208.540 1.00 15.00 ? 76  THR A N   1 
ATOM   345  C  CA  . THR A 1 44  ? 32.710 9.780  207.730 1.00 15.00 ? 76  THR A CA  1 
ATOM   346  C  C   . THR A 1 44  ? 31.280 9.610  208.200 1.00 15.00 ? 76  THR A C   1 
ATOM   347  O  O   . THR A 1 44  ? 30.610 10.550 208.640 1.00 15.00 ? 76  THR A O   1 
ATOM   348  C  CB  . THR A 1 44  ? 32.850 9.340  206.290 1.00 15.00 ? 76  THR A CB  1 
ATOM   349  O  OG1 . THR A 1 44  ? 34.250 9.260  206.020 1.00 15.00 ? 76  THR A OG1 1 
ATOM   350  C  CG2 . THR A 1 44  ? 32.120 10.250 205.350 1.00 15.00 ? 76  THR A CG2 1 
ATOM   351  N  N   . TRP A 1 45  ? 30.940 8.330  208.250 1.00 15.00 ? 77  TRP A N   1 
ATOM   352  C  CA  . TRP A 1 45  ? 29.640 7.890  208.680 1.00 15.00 ? 77  TRP A CA  1 
ATOM   353  C  C   . TRP A 1 45  ? 29.260 8.460  210.040 1.00 15.00 ? 77  TRP A C   1 
ATOM   354  O  O   . TRP A 1 45  ? 28.310 9.250  210.180 1.00 15.00 ? 77  TRP A O   1 
ATOM   355  C  CB  . TRP A 1 45  ? 29.640 6.350  208.720 1.00 15.00 ? 77  TRP A CB  1 
ATOM   356  C  CG  . TRP A 1 45  ? 28.290 5.850  209.200 1.00 15.00 ? 77  TRP A CG  1 
ATOM   357  C  CD1 . TRP A 1 45  ? 27.190 5.940  208.390 1.00 15.00 ? 77  TRP A CD1 1 
ATOM   358  C  CD2 . TRP A 1 45  ? 28.000 5.380  210.450 1.00 15.00 ? 77  TRP A CD2 1 
ATOM   359  N  NE1 . TRP A 1 45  ? 26.190 5.550  209.140 1.00 15.00 ? 77  TRP A NE1 1 
ATOM   360  C  CE2 . TRP A 1 45  ? 26.630 5.200  210.370 1.00 15.00 ? 77  TRP A CE2 1 
ATOM   361  C  CE3 . TRP A 1 45  ? 28.680 5.090  211.620 1.00 15.00 ? 77  TRP A CE3 1 
ATOM   362  C  CZ2 . TRP A 1 45  ? 25.890 4.740  211.440 1.00 15.00 ? 77  TRP A CZ2 1 
ATOM   363  C  CZ3 . TRP A 1 45  ? 27.950 4.630  212.690 1.00 15.00 ? 77  TRP A CZ3 1 
ATOM   364  C  CH2 . TRP A 1 45  ? 26.570 4.460  212.610 1.00 15.00 ? 77  TRP A CH2 1 
ATOM   365  N  N   . LEU A 1 46  ? 30.030 8.060  211.040 1.00 15.00 ? 78  LEU A N   1 
ATOM   366  C  CA  . LEU A 1 46  ? 29.750 8.400  212.410 1.00 15.00 ? 78  LEU A CA  1 
ATOM   367  C  C   . LEU A 1 46  ? 29.580 9.890  212.630 1.00 15.00 ? 78  LEU A C   1 
ATOM   368  O  O   . LEU A 1 46  ? 28.650 10.340 213.310 1.00 15.00 ? 78  LEU A O   1 
ATOM   369  C  CB  . LEU A 1 46  ? 30.870 7.850  213.230 1.00 15.00 ? 78  LEU A CB  1 
ATOM   370  C  CG  . LEU A 1 46  ? 30.600 7.770  214.700 1.00 15.00 ? 78  LEU A CG  1 
ATOM   371  C  CD1 . LEU A 1 46  ? 29.290 7.000  214.940 1.00 15.00 ? 78  LEU A CD1 1 
ATOM   372  C  CD2 . LEU A 1 46  ? 31.790 7.110  215.380 1.00 15.00 ? 78  LEU A CD2 1 
ATOM   373  N  N   . ARG A 1 47  ? 30.420 10.660 211.970 1.00 15.00 ? 79  ARG A N   1 
ATOM   374  C  CA  . ARG A 1 47  ? 30.370 12.100 212.060 1.00 15.00 ? 79  ARG A CA  1 
ATOM   375  C  C   . ARG A 1 47  ? 29.000 12.550 211.570 1.00 15.00 ? 79  ARG A C   1 
ATOM   376  O  O   . ARG A 1 47  ? 28.200 13.100 212.330 1.00 15.00 ? 79  ARG A O   1 
ATOM   377  C  CB  . ARG A 1 47  ? 31.490 12.650 211.210 1.00 15.00 ? 79  ARG A CB  1 
ATOM   378  C  CG  . ARG A 1 47  ? 31.740 14.160 211.230 1.00 15.00 ? 79  ARG A CG  1 
ATOM   379  C  CD  . ARG A 1 47  ? 32.990 14.380 210.320 1.00 15.00 ? 79  ARG A CD  1 
ATOM   380  N  NE  . ARG A 1 47  ? 32.870 14.920 208.950 1.00 15.00 ? 79  ARG A NE  1 
ATOM   381  C  CZ  . ARG A 1 47  ? 31.770 15.090 208.150 1.00 15.00 ? 79  ARG A CZ  1 
ATOM   382  N  NH1 . ARG A 1 47  ? 30.500 14.760 208.490 1.00 15.00 ? 79  ARG A NH1 1 
ATOM   383  N  NH2 . ARG A 1 47  ? 31.990 15.620 206.920 1.00 15.00 ? 79  ARG A NH2 1 
ATOM   384  N  N   . THR A 1 48  ? 28.690 12.210 210.330 1.00 15.00 ? 80  THR A N   1 
ATOM   385  C  CA  . THR A 1 48  ? 27.460 12.660 209.720 1.00 15.00 ? 80  THR A CA  1 
ATOM   386  C  C   . THR A 1 48  ? 26.250 12.210 210.510 1.00 15.00 ? 80  THR A C   1 
ATOM   387  O  O   . THR A 1 48  ? 25.330 13.010 210.710 1.00 15.00 ? 80  THR A O   1 
ATOM   388  C  CB  . THR A 1 48  ? 27.360 12.130 208.300 1.00 15.00 ? 80  THR A CB  1 
ATOM   389  O  OG1 . THR A 1 48  ? 28.680 12.140 207.770 1.00 15.00 ? 80  THR A OG1 1 
ATOM   390  C  CG2 . THR A 1 48  ? 26.480 13.020 207.430 1.00 15.00 ? 80  THR A CG2 1 
ATOM   391  N  N   . THR A 1 49  ? 26.250 10.980 211.030 1.00 15.00 ? 81  THR A N   1 
ATOM   392  C  CA  . THR A 1 49  ? 25.080 10.520 211.750 1.00 15.00 ? 81  THR A CA  1 
ATOM   393  C  C   . THR A 1 49  ? 24.920 11.240 213.070 1.00 15.00 ? 81  THR A C   1 
ATOM   394  O  O   . THR A 1 49  ? 23.800 11.420 213.540 1.00 15.00 ? 81  THR A O   1 
ATOM   395  C  CB  . THR A 1 49  ? 25.120 8.960  212.020 1.00 15.00 ? 81  THR A CB  1 
ATOM   396  O  OG1 . THR A 1 49  ? 26.480 8.510  212.190 1.00 15.00 ? 81  THR A OG1 1 
ATOM   397  C  CG2 . THR A 1 49  ? 24.440 8.240  210.850 1.00 15.00 ? 81  THR A CG2 1 
ATOM   398  N  N   . LEU A 1 50  ? 26.030 11.680 213.680 1.00 15.00 ? 82  LEU A N   1 
ATOM   399  C  CA  . LEU A 1 50  ? 25.920 12.380 214.930 1.00 15.00 ? 82  LEU A CA  1 
ATOM   400  C  C   . LEU A 1 50  ? 25.700 13.870 214.740 1.00 15.00 ? 82  LEU A C   1 
ATOM   401  O  O   . LEU A 1 50  ? 25.320 14.540 215.700 1.00 15.00 ? 82  LEU A O   1 
ATOM   402  C  CB  . LEU A 1 50  ? 27.180 12.130 215.730 1.00 15.00 ? 82  LEU A CB  1 
ATOM   403  C  CG  . LEU A 1 50  ? 27.260 10.900 216.630 1.00 15.00 ? 82  LEU A CG  1 
ATOM   404  C  CD1 . LEU A 1 50  ? 26.540 9.700  216.010 1.00 15.00 ? 82  LEU A CD1 1 
ATOM   405  C  CD2 . LEU A 1 50  ? 28.750 10.620 216.890 1.00 15.00 ? 82  LEU A CD2 1 
ATOM   406  N  N   . ARG A 1 51  ? 25.950 14.410 213.540 1.00 15.00 ? 83  ARG A N   1 
ATOM   407  C  CA  . ARG A 1 51  ? 25.780 15.850 213.310 1.00 15.00 ? 83  ARG A CA  1 
ATOM   408  C  C   . ARG A 1 51  ? 24.330 16.280 213.600 1.00 15.00 ? 83  ARG A C   1 
ATOM   409  O  O   . ARG A 1 51  ? 23.400 15.740 212.990 1.00 15.00 ? 83  ARG A O   1 
ATOM   410  C  CB  . ARG A 1 51  ? 26.140 16.250 211.850 1.00 15.00 ? 83  ARG A CB  1 
ATOM   411  C  CG  . ARG A 1 51  ? 27.650 16.370 211.500 1.00 15.00 ? 83  ARG A CG  1 
ATOM   412  C  CD  . ARG A 1 51  ? 27.890 16.800 210.030 1.00 15.00 ? 83  ARG A CD  1 
ATOM   413  N  NE  . ARG A 1 51  ? 29.170 17.490 209.860 1.00 15.00 ? 83  ARG A NE  1 
ATOM   414  C  CZ  . ARG A 1 51  ? 29.610 17.970 208.660 1.00 15.00 ? 83  ARG A CZ  1 
ATOM   415  N  NH1 . ARG A 1 51  ? 28.910 17.840 207.510 1.00 15.00 ? 83  ARG A NH1 1 
ATOM   416  N  NH2 . ARG A 1 51  ? 30.780 18.610 208.620 1.00 15.00 ? 83  ARG A NH2 1 
ATOM   417  N  N   . PRO A 1 52  ? 24.090 17.210 214.540 1.00 15.00 ? 84  PRO A N   1 
ATOM   418  C  CA  . PRO A 1 52  ? 22.750 17.670 214.900 1.00 15.00 ? 84  PRO A CA  1 
ATOM   419  C  C   . PRO A 1 52  ? 22.080 18.460 213.770 1.00 15.00 ? 84  PRO A C   1 
ATOM   420  O  O   . PRO A 1 52  ? 22.770 18.990 212.890 1.00 15.00 ? 84  PRO A O   1 
ATOM   421  C  CB  . PRO A 1 52  ? 22.980 18.480 216.150 1.00 15.00 ? 84  PRO A CB  1 
ATOM   422  C  CG  . PRO A 1 52  ? 24.350 19.040 215.930 1.00 15.00 ? 84  PRO A CG  1 
ATOM   423  C  CD  . PRO A 1 52  ? 25.100 17.850 215.360 1.00 15.00 ? 84  PRO A CD  1 
ATOM   424  N  N   . SER A 1 53  ? 20.750 18.560 213.730 1.00 15.00 ? 85  SER A N   1 
ATOM   425  C  CA  . SER A 1 53  ? 20.080 19.310 212.680 1.00 15.00 ? 85  SER A CA  1 
ATOM   426  C  C   . SER A 1 53  ? 20.480 20.780 212.650 1.00 15.00 ? 85  SER A C   1 
ATOM   427  O  O   . SER A 1 53  ? 20.540 21.400 213.720 1.00 15.00 ? 85  SER A O   1 
ATOM   428  C  CB  . SER A 1 53  ? 18.580 19.190 212.880 1.00 15.00 ? 85  SER A CB  1 
ATOM   429  O  OG  . SER A 1 53  ? 17.830 19.960 211.950 1.00 15.00 ? 85  SER A OG  1 
ATOM   430  N  N   . PRO A 1 54  ? 20.750 21.420 211.500 1.00 15.00 ? 86  PRO A N   1 
ATOM   431  C  CA  . PRO A 1 54  ? 20.990 22.840 211.360 1.00 15.00 ? 86  PRO A CA  1 
ATOM   432  C  C   . PRO A 1 54  ? 19.930 23.680 212.040 1.00 15.00 ? 86  PRO A C   1 
ATOM   433  O  O   . PRO A 1 54  ? 20.240 24.490 212.930 1.00 15.00 ? 86  PRO A O   1 
ATOM   434  C  CB  . PRO A 1 54  ? 21.080 23.090 209.860 1.00 15.00 ? 86  PRO A CB  1 
ATOM   435  C  CG  . PRO A 1 54  ? 20.670 21.800 209.230 1.00 15.00 ? 86  PRO A CG  1 
ATOM   436  C  CD  . PRO A 1 54  ? 21.080 20.750 210.260 1.00 15.00 ? 86  PRO A CD  1 
ATOM   437  N  N   . SER A 1 55  ? 18.680 23.430 211.710 1.00 15.00 ? 87  SER A N   1 
ATOM   438  C  CA  . SER A 1 55  ? 17.550 24.100 212.320 1.00 15.00 ? 87  SER A CA  1 
ATOM   439  C  C   . SER A 1 55  ? 17.640 24.030 213.850 1.00 15.00 ? 87  SER A C   1 
ATOM   440  O  O   . SER A 1 55  ? 17.320 25.000 214.550 1.00 15.00 ? 87  SER A O   1 
ATOM   441  C  CB  . SER A 1 55  ? 16.270 23.420 211.790 1.00 15.00 ? 87  SER A CB  1 
ATOM   442  O  OG  . SER A 1 55  ? 16.490 22.750 210.540 1.00 15.00 ? 87  SER A OG  1 
ATOM   443  N  N   . PHE A 1 56  ? 18.170 22.920 214.390 1.00 15.00 ? 88  PHE A N   1 
ATOM   444  C  CA  . PHE A 1 56  ? 18.360 22.760 215.830 1.00 15.00 ? 88  PHE A CA  1 
ATOM   445  C  C   . PHE A 1 56  ? 19.520 23.600 216.350 1.00 15.00 ? 88  PHE A C   1 
ATOM   446  O  O   . PHE A 1 56  ? 19.370 24.300 217.360 1.00 15.00 ? 88  PHE A O   1 
ATOM   447  C  CB  . PHE A 1 56  ? 18.580 21.270 216.090 1.00 15.00 ? 88  PHE A CB  1 
ATOM   448  C  CG  . PHE A 1 56  ? 19.170 20.920 217.440 1.00 15.00 ? 88  PHE A CG  1 
ATOM   449  C  CD1 . PHE A 1 56  ? 18.430 21.070 218.600 1.00 15.00 ? 88  PHE A CD1 1 
ATOM   450  C  CD2 . PHE A 1 56  ? 20.470 20.470 217.500 1.00 15.00 ? 88  PHE A CD2 1 
ATOM   451  C  CE1 . PHE A 1 56  ? 18.990 20.770 219.820 1.00 15.00 ? 88  PHE A CE1 1 
ATOM   452  C  CE2 . PHE A 1 56  ? 21.020 20.160 218.730 1.00 15.00 ? 88  PHE A CE2 1 
ATOM   453  C  CZ  . PHE A 1 56  ? 20.280 20.310 219.890 1.00 15.00 ? 88  PHE A CZ  1 
ATOM   454  N  N   . ILE A 1 57  ? 20.680 23.560 215.690 1.00 15.00 ? 89  ILE A N   1 
ATOM   455  C  CA  . ILE A 1 57  ? 21.860 24.310 216.100 1.00 15.00 ? 89  ILE A CA  1 
ATOM   456  C  C   . ILE A 1 57  ? 21.470 25.780 216.200 1.00 15.00 ? 89  ILE A C   1 
ATOM   457  O  O   . ILE A 1 57  ? 21.830 26.450 217.170 1.00 15.00 ? 89  ILE A O   1 
ATOM   458  C  CB  . ILE A 1 57  ? 23.000 24.070 215.050 1.00 15.00 ? 89  ILE A CB  1 
ATOM   459  C  CG1 . ILE A 1 57  ? 23.580 22.670 215.210 1.00 15.00 ? 89  ILE A CG1 1 
ATOM   460  C  CG2 . ILE A 1 57  ? 24.130 25.070 215.240 1.00 15.00 ? 89  ILE A CG2 1 
ATOM   461  C  CD1 . ILE A 1 57  ? 24.430 22.480 216.490 1.00 15.00 ? 89  ILE A CD1 1 
ATOM   462  N  N   . HIS A 1 58  ? 20.650 26.240 215.250 1.00 15.00 ? 90  HIS A N   1 
ATOM   463  C  CA  . HIS A 1 58  ? 20.180 27.610 215.230 1.00 15.00 ? 90  HIS A CA  1 
ATOM   464  C  C   . HIS A 1 58  ? 19.480 27.960 216.520 1.00 15.00 ? 90  HIS A C   1 
ATOM   465  O  O   . HIS A 1 58  ? 19.780 28.970 217.160 1.00 15.00 ? 90  HIS A O   1 
ATOM   466  C  CB  . HIS A 1 58  ? 19.220 27.800 214.090 1.00 15.00 ? 90  HIS A CB  1 
ATOM   467  C  CG  . HIS A 1 58  ? 18.860 29.250 213.830 1.00 15.00 ? 90  HIS A CG  1 
ATOM   468  N  ND1 . HIS A 1 58  ? 19.660 30.160 213.160 1.00 15.00 ? 90  HIS A ND1 1 
ATOM   469  C  CD2 . HIS A 1 58  ? 17.620 29.800 214.130 1.00 15.00 ? 90  HIS A CD2 1 
ATOM   470  C  CE1 . HIS A 1 58  ? 18.890 31.260 213.010 1.00 15.00 ? 90  HIS A CE1 1 
ATOM   471  N  NE2 . HIS A 1 58  ? 17.720 31.070 213.540 1.00 15.00 ? 90  HIS A NE2 1 
ATOM   472  N  N   . PHE A 1 59  ? 18.590 27.060 216.950 1.00 15.00 ? 91  PHE A N   1 
ATOM   473  C  CA  . PHE A 1 59  ? 17.890 27.290 218.180 1.00 15.00 ? 91  PHE A CA  1 
ATOM   474  C  C   . PHE A 1 59  ? 18.860 27.310 219.340 1.00 15.00 ? 91  PHE A C   1 
ATOM   475  O  O   . PHE A 1 59  ? 18.680 28.100 220.250 1.00 15.00 ? 91  PHE A O   1 
ATOM   476  C  CB  . PHE A 1 59  ? 16.830 26.210 218.420 1.00 15.00 ? 91  PHE A CB  1 
ATOM   477  C  CG  . PHE A 1 59  ? 16.060 26.570 219.690 1.00 15.00 ? 91  PHE A CG  1 
ATOM   478  C  CD1 . PHE A 1 59  ? 15.600 27.880 219.900 1.00 15.00 ? 91  PHE A CD1 1 
ATOM   479  C  CD2 . PHE A 1 59  ? 15.900 25.600 220.670 1.00 15.00 ? 91  PHE A CD2 1 
ATOM   480  C  CE1 . PHE A 1 59  ? 14.990 28.260 221.080 1.00 15.00 ? 91  PHE A CE1 1 
ATOM   481  C  CE2 . PHE A 1 59  ? 15.290 25.980 221.850 1.00 15.00 ? 91  PHE A CE2 1 
ATOM   482  C  CZ  . PHE A 1 59  ? 14.840 27.280 222.050 1.00 15.00 ? 91  PHE A CZ  1 
ATOM   483  N  N   . LEU A 1 60  ? 19.910 26.520 219.360 1.00 15.00 ? 92  LEU A N   1 
ATOM   484  C  CA  . LEU A 1 60  ? 20.840 26.610 220.460 1.00 15.00 ? 92  LEU A CA  1 
ATOM   485  C  C   . LEU A 1 60  ? 21.520 27.950 220.480 1.00 15.00 ? 92  LEU A C   1 
ATOM   486  O  O   . LEU A 1 60  ? 21.700 28.520 221.550 1.00 15.00 ? 92  LEU A O   1 
ATOM   487  C  CB  . LEU A 1 60  ? 21.870 25.550 220.320 1.00 15.00 ? 92  LEU A CB  1 
ATOM   488  C  CG  . LEU A 1 60  ? 21.340 24.150 220.440 1.00 15.00 ? 92  LEU A CG  1 
ATOM   489  C  CD1 . LEU A 1 60  ? 22.460 23.230 220.100 1.00 15.00 ? 92  LEU A CD1 1 
ATOM   490  C  CD2 . LEU A 1 60  ? 20.790 23.880 221.830 1.00 15.00 ? 92  LEU A CD2 1 
ATOM   491  N  N   . LEU A 1 61  ? 21.850 28.500 219.330 1.00 15.00 ? 93  LEU A N   1 
ATOM   492  C  CA  . LEU A 1 61  ? 22.420 29.820 219.330 1.00 15.00 ? 93  LEU A CA  1 
ATOM   493  C  C   . LEU A 1 61  ? 21.380 30.870 219.680 1.00 15.00 ? 93  LEU A C   1 
ATOM   494  O  O   . LEU A 1 61  ? 21.770 32.030 219.780 1.00 15.00 ? 93  LEU A O   1 
ATOM   495  C  CB  . LEU A 1 61  ? 23.020 30.140 217.990 1.00 15.00 ? 93  LEU A CB  1 
ATOM   496  C  CG  . LEU A 1 61  ? 24.380 29.590 217.570 1.00 15.00 ? 93  LEU A CG  1 
ATOM   497  C  CD1 . LEU A 1 61  ? 25.300 29.370 218.760 1.00 15.00 ? 93  LEU A CD1 1 
ATOM   498  C  CD2 . LEU A 1 61  ? 24.170 28.310 216.850 1.00 15.00 ? 93  LEU A CD2 1 
ATOM   499  N  N   . THR A 1 62  ? 20.090 30.510 219.840 1.00 15.00 ? 94  THR A N   1 
ATOM   500  C  CA  . THR A 1 62  ? 19.000 31.390 220.270 1.00 15.00 ? 94  THR A CA  1 
ATOM   501  C  C   . THR A 1 62  ? 18.060 30.730 221.330 1.00 15.00 ? 94  THR A C   1 
ATOM   502  O  O   . THR A 1 62  ? 16.810 30.730 221.370 1.00 15.00 ? 94  THR A O   1 
ATOM   503  C  CB  . THR A 1 62  ? 18.260 31.810 218.990 1.00 15.00 ? 94  THR A CB  1 
ATOM   504  O  OG1 . THR A 1 62  ? 19.190 32.020 217.920 1.00 15.00 ? 94  THR A OG1 1 
ATOM   505  C  CG2 . THR A 1 62  ? 17.550 33.120 219.270 1.00 15.00 ? 94  THR A CG2 1 
ATOM   506  N  N   . HIS A 1 63  ? 18.800 30.080 222.210 1.00 15.00 ? 95  HIS A N   1 
ATOM   507  C  CA  . HIS A 1 63  ? 18.330 29.420 223.420 1.00 15.00 ? 95  HIS A CA  1 
ATOM   508  C  C   . HIS A 1 63  ? 18.740 30.410 224.510 1.00 15.00 ? 95  HIS A C   1 
ATOM   509  O  O   . HIS A 1 63  ? 19.180 31.530 224.230 1.00 15.00 ? 95  HIS A O   1 
ATOM   510  C  CB  . HIS A 1 63  ? 19.060 28.030 223.570 1.00 15.00 ? 95  HIS A CB  1 
ATOM   511  C  CG  . HIS A 1 63  ? 19.320 27.040 224.760 1.00 15.00 ? 95  HIS A CG  1 
ATOM   512  N  ND1 . HIS A 1 63  ? 20.560 26.370 224.960 1.00 15.00 ? 95  HIS A ND1 1 
ATOM   513  C  CD2 . HIS A 1 63  ? 18.380 26.670 225.760 1.00 15.00 ? 95  HIS A CD2 1 
ATOM   514  C  CE1 . HIS A 1 63  ? 20.360 25.620 226.070 1.00 15.00 ? 95  HIS A CE1 1 
ATOM   515  N  NE2 . HIS A 1 63  ? 19.150 25.780 226.540 1.00 15.00 ? 95  HIS A NE2 1 
ATOM   516  N  N   . GLY A 1 64  ? 18.720 30.030 225.790 1.00 15.00 ? 96  GLY A N   1 
ATOM   517  C  CA  . GLY A 1 64  ? 18.880 30.950 226.900 1.00 15.00 ? 96  GLY A CA  1 
ATOM   518  C  C   . GLY A 1 64  ? 20.110 31.840 227.010 1.00 15.00 ? 96  GLY A C   1 
ATOM   519  O  O   . GLY A 1 64  ? 21.150 31.410 227.530 1.00 15.00 ? 96  GLY A O   1 
ATOM   520  N  N   . ARG A 1 65  ? 19.920 33.110 226.630 1.00 15.00 ? 97  ARG A N   1 
ATOM   521  C  CA  . ARG A 1 65  ? 20.930 34.160 226.760 1.00 15.00 ? 97  ARG A CA  1 
ATOM   522  C  C   . ARG A 1 65  ? 21.720 34.090 228.070 1.00 15.00 ? 97  ARG A C   1 
ATOM   523  O  O   . ARG A 1 65  ? 22.910 34.400 228.050 1.00 15.00 ? 97  ARG A O   1 
ATOM   524  C  CB  . ARG A 1 65  ? 20.220 35.500 226.580 1.00 15.00 ? 97  ARG A CB  1 
ATOM   525  C  CG  . ARG A 1 65  ? 21.020 36.790 226.850 1.00 15.00 ? 97  ARG A CG  1 
ATOM   526  C  CD  . ARG A 1 65  ? 21.420 37.660 225.640 1.00 15.00 ? 97  ARG A CD  1 
ATOM   527  N  NE  . ARG A 1 65  ? 22.710 37.330 225.010 1.00 15.00 ? 97  ARG A NE  1 
ATOM   528  C  CZ  . ARG A 1 65  ? 23.380 38.210 224.210 1.00 15.00 ? 97  ARG A CZ  1 
ATOM   529  N  NH1 . ARG A 1 65  ? 22.920 39.450 223.950 1.00 15.00 ? 97  ARG A NH1 1 
ATOM   530  N  NH2 . ARG A 1 65  ? 24.510 37.840 223.590 1.00 15.00 ? 97  ARG A NH2 1 
ATOM   531  N  N   . TRP A 1 66  ? 21.170 33.610 229.210 1.00 15.00 ? 98  TRP A N   1 
ATOM   532  C  CA  . TRP A 1 66  ? 21.950 33.450 230.430 1.00 15.00 ? 98  TRP A CA  1 
ATOM   533  C  C   . TRP A 1 66  ? 23.160 32.560 230.200 1.00 15.00 ? 98  TRP A C   1 
ATOM   534  O  O   . TRP A 1 66  ? 24.290 33.000 230.420 1.00 15.00 ? 98  TRP A O   1 
ATOM   535  C  CB  . TRP A 1 66  ? 21.160 32.800 231.600 1.00 15.00 ? 98  TRP A CB  1 
ATOM   536  C  CG  . TRP A 1 66  ? 20.620 31.360 231.470 1.00 15.00 ? 98  TRP A CG  1 
ATOM   537  C  CD1 . TRP A 1 66  ? 21.310 30.220 231.880 1.00 15.00 ? 98  TRP A CD1 1 
ATOM   538  C  CD2 . TRP A 1 66  ? 19.380 31.050 230.980 1.00 15.00 ? 98  TRP A CD2 1 
ATOM   539  N  NE1 . TRP A 1 66  ? 20.500 29.200 231.650 1.00 15.00 ? 98  TRP A NE1 1 
ATOM   540  C  CE2 . TRP A 1 66  ? 19.350 29.660 231.110 1.00 15.00 ? 98  TRP A CE2 1 
ATOM   541  C  CE3 . TRP A 1 66  ? 18.330 31.800 230.460 1.00 15.00 ? 98  TRP A CE3 1 
ATOM   542  C  CZ2 . TRP A 1 66  ? 18.200 28.990 230.710 1.00 15.00 ? 98  TRP A CZ2 1 
ATOM   543  C  CZ3 . TRP A 1 66  ? 17.180 31.110 230.070 1.00 15.00 ? 98  TRP A CZ3 1 
ATOM   544  C  CH2 . TRP A 1 66  ? 17.130 29.720 230.190 1.00 15.00 ? 98  TRP A CH2 1 
ATOM   545  N  N   . LEU A 1 67  ? 22.920 31.370 229.650 1.00 15.00 ? 99  LEU A N   1 
ATOM   546  C  CA  . LEU A 1 67  ? 23.960 30.400 229.440 1.00 15.00 ? 99  LEU A CA  1 
ATOM   547  C  C   . LEU A 1 67  ? 24.950 31.020 228.480 1.00 15.00 ? 99  LEU A C   1 
ATOM   548  O  O   . LEU A 1 67  ? 26.170 30.950 228.710 1.00 15.00 ? 99  LEU A O   1 
ATOM   549  C  CB  . LEU A 1 67  ? 23.370 29.120 228.870 1.00 15.00 ? 99  LEU A CB  1 
ATOM   550  C  CG  . LEU A 1 67  ? 24.380 28.100 228.360 1.00 15.00 ? 99  LEU A CG  1 
ATOM   551  C  CD1 . LEU A 1 67  ? 25.000 27.380 229.540 1.00 15.00 ? 99  LEU A CD1 1 
ATOM   552  C  CD2 . LEU A 1 67  ? 23.710 27.130 227.410 1.00 15.00 ? 99  LEU A CD2 1 
ATOM   553  N  N   . TRP A 1 68  ? 24.450 31.690 227.440 1.00 15.00 ? 100 TRP A N   1 
ATOM   554  C  CA  . TRP A 1 68  ? 25.350 32.330 226.510 1.00 15.00 ? 100 TRP A CA  1 
ATOM   555  C  C   . TRP A 1 68  ? 26.070 33.510 227.110 1.00 15.00 ? 100 TRP A C   1 
ATOM   556  O  O   . TRP A 1 68  ? 27.170 33.790 226.650 1.00 15.00 ? 100 TRP A O   1 
ATOM   557  C  CB  . TRP A 1 68  ? 24.590 32.760 225.270 1.00 15.00 ? 100 TRP A CB  1 
ATOM   558  C  CG  . TRP A 1 68  ? 24.320 31.560 224.370 1.00 15.00 ? 100 TRP A CG  1 
ATOM   559  C  CD1 . TRP A 1 68  ? 23.040 31.120 224.140 1.00 15.00 ? 100 TRP A CD1 1 
ATOM   560  C  CD2 . TRP A 1 68  ? 25.260 30.800 223.720 1.00 15.00 ? 100 TRP A CD2 1 
ATOM   561  N  NE1 . TRP A 1 68  ? 23.160 30.090 223.340 1.00 15.00 ? 100 TRP A NE1 1 
ATOM   562  C  CE2 . TRP A 1 68  ? 24.460 29.860 223.070 1.00 15.00 ? 100 TRP A CE2 1 
ATOM   563  C  CE3 . TRP A 1 68  ? 26.630 30.730 223.570 1.00 15.00 ? 100 TRP A CE3 1 
ATOM   564  C  CZ2 . TRP A 1 68  ? 25.000 28.880 222.260 1.00 15.00 ? 100 TRP A CZ2 1 
ATOM   565  C  CZ3 . TRP A 1 68  ? 27.170 29.750 222.770 1.00 15.00 ? 100 TRP A CZ3 1 
ATOM   566  C  CH2 . TRP A 1 68  ? 26.370 28.820 222.130 1.00 15.00 ? 100 TRP A CH2 1 
ATOM   567  N  N   . ASP A 1 69  ? 25.590 34.180 228.150 1.00 15.00 ? 101 ASP A N   1 
ATOM   568  C  CA  . ASP A 1 69  ? 26.380 35.230 228.770 1.00 15.00 ? 101 ASP A CA  1 
ATOM   569  C  C   . ASP A 1 69  ? 27.530 34.600 229.490 1.00 15.00 ? 101 ASP A C   1 
ATOM   570  O  O   . ASP A 1 69  ? 28.640 35.130 229.430 1.00 15.00 ? 101 ASP A O   1 
ATOM   571  C  CB  . ASP A 1 69  ? 25.600 35.990 229.800 1.00 15.00 ? 101 ASP A CB  1 
ATOM   572  C  CG  . ASP A 1 69  ? 24.430 36.790 229.240 1.00 15.00 ? 101 ASP A CG  1 
ATOM   573  O  OD1 . ASP A 1 69  ? 24.400 37.100 228.040 1.00 15.00 ? 101 ASP A OD1 1 
ATOM   574  O  OD2 . ASP A 1 69  ? 23.560 37.110 230.060 1.00 15.00 ? 101 ASP A OD2 1 
ATOM   575  N  N   . PHE A 1 70  ? 27.270 33.470 230.130 1.00 15.00 ? 102 PHE A N   1 
ATOM   576  C  CA  . PHE A 1 70  ? 28.330 32.730 230.760 1.00 15.00 ? 102 PHE A CA  1 
ATOM   577  C  C   . PHE A 1 70  ? 29.300 32.200 229.730 1.00 15.00 ? 102 PHE A C   1 
ATOM   578  O  O   . PHE A 1 70  ? 30.500 32.420 229.880 1.00 15.00 ? 102 PHE A O   1 
ATOM   579  C  CB  . PHE A 1 70  ? 27.760 31.570 231.530 1.00 15.00 ? 102 PHE A CB  1 
ATOM   580  C  CG  . PHE A 1 70  ? 28.840 30.760 232.250 1.00 15.00 ? 102 PHE A CG  1 
ATOM   581  C  CD1 . PHE A 1 70  ? 29.630 31.330 233.230 1.00 15.00 ? 102 PHE A CD1 1 
ATOM   582  C  CD2 . PHE A 1 70  ? 29.020 29.420 231.940 1.00 15.00 ? 102 PHE A CD2 1 
ATOM   583  C  CE1 . PHE A 1 70  ? 30.570 30.570 233.890 1.00 15.00 ? 102 PHE A CE1 1 
ATOM   584  C  CE2 . PHE A 1 70  ? 29.970 28.670 232.610 1.00 15.00 ? 102 PHE A CE2 1 
ATOM   585  C  CZ  . PHE A 1 70  ? 30.750 29.240 233.590 1.00 15.00 ? 102 PHE A CZ  1 
ATOM   586  N  N   . VAL A 1 71  ? 28.880 31.520 228.650 1.00 15.00 ? 103 VAL A N   1 
ATOM   587  C  CA  . VAL A 1 71  ? 29.790 30.980 227.640 1.00 15.00 ? 103 VAL A CA  1 
ATOM   588  C  C   . VAL A 1 71  ? 30.580 32.130 227.020 1.00 15.00 ? 103 VAL A C   1 
ATOM   589  O  O   . VAL A 1 71  ? 31.800 32.030 226.870 1.00 15.00 ? 103 VAL A O   1 
ATOM   590  C  CB  . VAL A 1 71  ? 28.970 30.190 226.600 1.00 15.00 ? 103 VAL A CB  1 
ATOM   591  C  CG1 . VAL A 1 71  ? 29.740 29.900 225.340 1.00 15.00 ? 103 VAL A CG1 1 
ATOM   592  C  CG2 . VAL A 1 71  ? 28.630 28.840 227.200 1.00 15.00 ? 103 VAL A CG2 1 
ATOM   593  N  N   . ASN A 1 72  ? 29.940 33.250 226.740 1.00 15.00 ? 104 ASN A N   1 
ATOM   594  C  CA  . ASN A 1 72  ? 30.650 34.400 226.230 1.00 15.00 ? 104 ASN A CA  1 
ATOM   595  C  C   . ASN A 1 72  ? 31.670 34.930 227.200 1.00 15.00 ? 104 ASN A C   1 
ATOM   596  O  O   . ASN A 1 72  ? 32.560 35.680 226.810 1.00 15.00 ? 104 ASN A O   1 
ATOM   597  C  CB  . ASN A 1 72  ? 29.740 35.560 225.940 1.00 15.00 ? 104 ASN A CB  1 
ATOM   598  C  CG  . ASN A 1 72  ? 28.850 35.310 224.750 1.00 15.00 ? 104 ASN A CG  1 
ATOM   599  O  OD1 . ASN A 1 72  ? 29.120 34.450 223.900 1.00 15.00 ? 104 ASN A OD1 1 
ATOM   600  N  ND2 . ASN A 1 72  ? 27.750 36.040 224.650 1.00 15.00 ? 104 ASN A ND2 1 
ATOM   601  N  N   . ALA A 1 73  ? 31.580 34.610 228.480 1.00 15.00 ? 105 ALA A N   1 
ATOM   602  C  CA  . ALA A 1 73  ? 32.530 35.130 229.460 1.00 15.00 ? 105 ALA A CA  1 
ATOM   603  C  C   . ALA A 1 73  ? 33.720 34.230 229.710 1.00 15.00 ? 105 ALA A C   1 
ATOM   604  O  O   . ALA A 1 73  ? 34.660 34.560 230.450 1.00 15.00 ? 105 ALA A O   1 
ATOM   605  C  CB  . ALA A 1 73  ? 31.830 35.350 230.790 1.00 15.00 ? 105 ALA A CB  1 
ATOM   606  N  N   . THR A 1 74  ? 33.650 33.050 229.110 1.00 15.00 ? 106 THR A N   1 
ATOM   607  C  CA  . THR A 1 74  ? 34.720 32.110 229.300 1.00 15.00 ? 106 THR A CA  1 
ATOM   608  C  C   . THR A 1 74  ? 35.480 32.060 227.990 1.00 15.00 ? 106 THR A C   1 
ATOM   609  O  O   . THR A 1 74  ? 35.170 32.730 226.990 1.00 15.00 ? 106 THR A O   1 
ATOM   610  C  CB  . THR A 1 74  ? 34.130 30.740 229.660 1.00 15.00 ? 106 THR A CB  1 
ATOM   611  O  OG1 . THR A 1 74  ? 33.550 30.230 228.470 1.00 15.00 ? 106 THR A OG1 1 
ATOM   612  C  CG2 . THR A 1 74  ? 33.060 30.780 230.730 1.00 15.00 ? 106 THR A CG2 1 
ATOM   613  N  N   . PHE A 1 75  ? 36.460 31.160 227.960 1.00 15.00 ? 107 PHE A N   1 
ATOM   614  C  CA  . PHE A 1 75  ? 37.190 30.900 226.750 1.00 15.00 ? 107 PHE A CA  1 
ATOM   615  C  C   . PHE A 1 75  ? 36.350 30.130 225.740 1.00 15.00 ? 107 PHE A C   1 
ATOM   616  O  O   . PHE A 1 75  ? 36.720 30.110 224.560 1.00 15.00 ? 107 PHE A O   1 
ATOM   617  C  CB  . PHE A 1 75  ? 38.430 30.110 227.070 1.00 15.00 ? 107 PHE A CB  1 
ATOM   618  C  CG  . PHE A 1 75  ? 38.110 28.810 227.780 1.00 15.00 ? 107 PHE A CG  1 
ATOM   619  C  CD1 . PHE A 1 75  ? 37.880 27.650 227.050 1.00 15.00 ? 107 PHE A CD1 1 
ATOM   620  C  CD2 . PHE A 1 75  ? 38.090 28.780 229.170 1.00 15.00 ? 107 PHE A CD2 1 
ATOM   621  C  CE1 . PHE A 1 75  ? 37.620 26.460 227.720 1.00 15.00 ? 107 PHE A CE1 1 
ATOM   622  C  CE2 . PHE A 1 75  ? 37.830 27.590 229.820 1.00 15.00 ? 107 PHE A CE2 1 
ATOM   623  C  CZ  . PHE A 1 75  ? 37.600 26.420 229.100 1.00 15.00 ? 107 PHE A CZ  1 
ATOM   624  N  N   . ILE A 1 76  ? 35.230 29.500 226.120 1.00 15.00 ? 108 ILE A N   1 
ATOM   625  C  CA  . ILE A 1 76  ? 34.440 28.770 225.150 1.00 15.00 ? 108 ILE A CA  1 
ATOM   626  C  C   . ILE A 1 76  ? 33.990 29.690 224.020 1.00 15.00 ? 108 ILE A C   1 
ATOM   627  O  O   . ILE A 1 76  ? 33.890 29.220 222.890 1.00 15.00 ? 108 ILE A O   1 
ATOM   628  C  CB  . ILE A 1 76  ? 33.230 28.120 225.830 1.00 15.00 ? 108 ILE A CB  1 
ATOM   629  C  CG1 . ILE A 1 76  ? 33.700 27.340 227.030 1.00 15.00 ? 108 ILE A CG1 1 
ATOM   630  C  CG2 . ILE A 1 76  ? 32.540 27.150 224.880 1.00 15.00 ? 108 ILE A CG2 1 
ATOM   631  C  CD1 . ILE A 1 76  ? 32.570 26.810 227.910 1.00 15.00 ? 108 ILE A CD1 1 
ATOM   632  N  N   . ARG A 1 77  ? 33.810 30.990 224.260 1.00 15.00 ? 109 ARG A N   1 
ATOM   633  C  CA  . ARG A 1 77  ? 33.560 31.960 223.210 1.00 15.00 ? 109 ARG A CA  1 
ATOM   634  C  C   . ARG A 1 77  ? 34.560 31.730 222.080 1.00 15.00 ? 109 ARG A C   1 
ATOM   635  O  O   . ARG A 1 77  ? 34.210 31.400 220.950 1.00 15.00 ? 109 ARG A O   1 
ATOM   636  C  CB  . ARG A 1 77  ? 33.750 33.380 223.730 1.00 15.00 ? 109 ARG A CB  1 
ATOM   637  C  CG  . ARG A 1 77  ? 33.560 34.410 222.630 1.00 15.00 ? 109 ARG A CG  1 
ATOM   638  C  CD  . ARG A 1 77  ? 34.130 35.740 223.010 1.00 15.00 ? 109 ARG A CD  1 
ATOM   639  N  NE  . ARG A 1 77  ? 33.920 36.680 221.930 1.00 15.00 ? 109 ARG A NE  1 
ATOM   640  C  CZ  . ARG A 1 77  ? 33.930 38.010 222.130 1.00 15.00 ? 109 ARG A CZ  1 
ATOM   641  N  NH1 . ARG A 1 77  ? 34.150 38.540 223.330 1.00 15.00 ? 109 ARG A NH1 1 
ATOM   642  N  NH2 . ARG A 1 77  ? 33.740 38.850 221.130 1.00 15.00 ? 109 ARG A NH2 1 
ATOM   643  N  N   . ASP A 1 78  ? 35.830 31.720 222.470 1.00 15.00 ? 110 ASP A N   1 
ATOM   644  C  CA  . ASP A 1 78  ? 36.940 31.540 221.550 1.00 15.00 ? 110 ASP A CA  1 
ATOM   645  C  C   . ASP A 1 78  ? 36.920 30.170 220.940 1.00 15.00 ? 110 ASP A C   1 
ATOM   646  O  O   . ASP A 1 78  ? 37.160 30.040 219.740 1.00 15.00 ? 110 ASP A O   1 
ATOM   647  C  CB  . ASP A 1 78  ? 38.260 31.740 222.270 1.00 15.00 ? 110 ASP A CB  1 
ATOM   648  C  CG  . ASP A 1 78  ? 38.660 33.190 222.510 1.00 15.00 ? 110 ASP A CG  1 
ATOM   649  O  OD1 . ASP A 1 78  ? 37.910 33.930 223.150 1.00 15.00 ? 110 ASP A OD1 1 
ATOM   650  O  OD2 . ASP A 1 78  ? 39.740 33.590 222.070 1.00 15.00 ? 110 ASP A OD2 1 
ATOM   651  N  N   . THR A 1 79  ? 36.580 29.130 221.670 1.00 15.00 ? 111 THR A N   1 
ATOM   652  C  CA  . THR A 1 79  ? 36.590 27.800 221.090 1.00 15.00 ? 111 THR A CA  1 
ATOM   653  C  C   . THR A 1 79  ? 35.530 27.700 220.020 1.00 15.00 ? 111 THR A C   1 
ATOM   654  O  O   . THR A 1 79  ? 35.830 27.300 218.900 1.00 15.00 ? 111 THR A O   1 
ATOM   655  C  CB  . THR A 1 79  ? 36.320 26.760 222.160 1.00 15.00 ? 111 THR A CB  1 
ATOM   656  O  OG1 . THR A 1 79  ? 37.380 26.830 223.120 1.00 15.00 ? 111 THR A OG1 1 
ATOM   657  C  CG2 . THR A 1 79  ? 36.210 25.380 221.570 1.00 15.00 ? 111 THR A CG2 1 
ATOM   658  N  N   . LEU A 1 80  ? 34.310 28.100 220.350 1.00 15.00 ? 112 LEU A N   1 
ATOM   659  C  CA  . LEU A 1 80  ? 33.230 27.990 219.410 1.00 15.00 ? 112 LEU A CA  1 
ATOM   660  C  C   . LEU A 1 80  ? 33.560 28.900 218.260 1.00 15.00 ? 112 LEU A C   1 
ATOM   661  O  O   . LEU A 1 80  ? 33.430 28.480 217.130 1.00 15.00 ? 112 LEU A O   1 
ATOM   662  C  CB  . LEU A 1 80  ? 31.930 28.400 220.070 1.00 15.00 ? 112 LEU A CB  1 
ATOM   663  C  CG  . LEU A 1 80  ? 31.480 27.650 221.300 1.00 15.00 ? 112 LEU A CG  1 
ATOM   664  C  CD1 . LEU A 1 80  ? 30.300 28.360 221.870 1.00 15.00 ? 112 LEU A CD1 1 
ATOM   665  C  CD2 . LEU A 1 80  ? 31.110 26.230 220.980 1.00 15.00 ? 112 LEU A CD2 1 
ATOM   666  N  N   . MET A 1 81  ? 34.110 30.090 218.490 1.00 15.00 ? 113 MET A N   1 
ATOM   667  C  CA  . MET A 1 81  ? 34.440 31.000 217.410 1.00 15.00 ? 113 MET A CA  1 
ATOM   668  C  C   . MET A 1 81  ? 35.470 30.390 216.490 1.00 15.00 ? 113 MET A C   1 
ATOM   669  O  O   . MET A 1 81  ? 35.320 30.450 215.270 1.00 15.00 ? 113 MET A O   1 
ATOM   670  C  CB  . MET A 1 81  ? 34.960 32.300 218.010 1.00 15.00 ? 113 MET A CB  1 
ATOM   671  C  CG  . MET A 1 81  ? 35.100 33.410 216.990 1.00 15.00 ? 113 MET A CG  1 
ATOM   672  S  SD  . MET A 1 81  ? 33.510 33.760 216.200 1.00 15.00 ? 113 MET A SD  1 
ATOM   673  C  CE  . MET A 1 81  ? 33.890 33.920 214.490 1.00 15.00 ? 113 MET A CE  1 
ATOM   674  N  N   . ARG A 1 82  ? 36.470 29.690 217.010 1.00 15.00 ? 114 ARG A N   1 
ATOM   675  C  CA  . ARG A 1 82  ? 37.480 29.050 216.190 1.00 15.00 ? 114 ARG A CA  1 
ATOM   676  C  C   . ARG A 1 82  ? 36.820 27.990 215.350 1.00 15.00 ? 114 ARG A C   1 
ATOM   677  O  O   . ARG A 1 82  ? 37.030 27.860 214.150 1.00 15.00 ? 114 ARG A O   1 
ATOM   678  C  CB  . ARG A 1 82  ? 38.520 28.350 217.010 1.00 15.00 ? 114 ARG A CB  1 
ATOM   679  C  CG  . ARG A 1 82  ? 39.670 27.750 216.220 1.00 15.00 ? 114 ARG A CG  1 
ATOM   680  C  CD  . ARG A 1 82  ? 40.320 26.550 216.900 1.00 15.00 ? 114 ARG A CD  1 
ATOM   681  N  NE  . ARG A 1 82  ? 40.370 26.600 218.370 1.00 15.00 ? 114 ARG A NE  1 
ATOM   682  C  CZ  . ARG A 1 82  ? 41.050 27.510 219.130 1.00 15.00 ? 114 ARG A CZ  1 
ATOM   683  N  NH1 . ARG A 1 82  ? 41.780 28.500 218.590 1.00 15.00 ? 114 ARG A NH1 1 
ATOM   684  N  NH2 . ARG A 1 82  ? 40.960 27.440 220.460 1.00 15.00 ? 114 ARG A NH2 1 
ATOM   685  N  N   . LEU A 1 83  ? 36.020 27.220 216.040 1.00 15.00 ? 115 LEU A N   1 
ATOM   686  C  CA  . LEU A 1 83  ? 35.320 26.150 215.420 1.00 15.00 ? 115 LEU A CA  1 
ATOM   687  C  C   . LEU A 1 83  ? 34.370 26.650 214.360 1.00 15.00 ? 115 LEU A C   1 
ATOM   688  O  O   . LEU A 1 83  ? 34.260 26.000 213.330 1.00 15.00 ? 115 LEU A O   1 
ATOM   689  C  CB  . LEU A 1 83  ? 34.630 25.420 216.510 1.00 15.00 ? 115 LEU A CB  1 
ATOM   690  C  CG  . LEU A 1 83  ? 33.900 24.170 216.160 1.00 15.00 ? 115 LEU A CG  1 
ATOM   691  C  CD1 . LEU A 1 83  ? 34.170 23.170 217.260 1.00 15.00 ? 115 LEU A CD1 1 
ATOM   692  C  CD2 . LEU A 1 83  ? 32.410 24.440 215.980 1.00 15.00 ? 115 LEU A CD2 1 
ATOM   693  N  N   . VAL A 1 84  ? 33.680 27.770 214.500 1.00 15.00 ? 116 VAL A N   1 
ATOM   694  C  CA  . VAL A 1 84  ? 32.800 28.270 213.460 1.00 15.00 ? 116 VAL A CA  1 
ATOM   695  C  C   . VAL A 1 84  ? 33.650 28.540 212.250 1.00 15.00 ? 116 VAL A C   1 
ATOM   696  O  O   . VAL A 1 84  ? 33.350 28.090 211.150 1.00 15.00 ? 116 VAL A O   1 
ATOM   697  C  CB  . VAL A 1 84  ? 32.120 29.540 213.910 1.00 15.00 ? 116 VAL A CB  1 
ATOM   698  C  CG1 . VAL A 1 84  ? 31.290 30.070 212.780 1.00 15.00 ? 116 VAL A CG1 1 
ATOM   699  C  CG2 . VAL A 1 84  ? 31.200 29.280 215.070 1.00 15.00 ? 116 VAL A CG2 1 
ATOM   700  N  N   . LEU A 1 85  ? 34.760 29.230 212.480 1.00 15.00 ? 117 LEU A N   1 
ATOM   701  C  CA  . LEU A 1 85  ? 35.710 29.580 211.460 1.00 15.00 ? 117 LEU A CA  1 
ATOM   702  C  C   . LEU A 1 85  ? 36.190 28.370 210.710 1.00 15.00 ? 117 LEU A C   1 
ATOM   703  O  O   . LEU A 1 85  ? 36.020 28.320 209.490 1.00 15.00 ? 117 LEU A O   1 
ATOM   704  C  CB  . LEU A 1 85  ? 36.860 30.260 212.130 1.00 15.00 ? 117 LEU A CB  1 
ATOM   705  C  CG  . LEU A 1 85  ? 37.040 31.750 212.120 1.00 15.00 ? 117 LEU A CG  1 
ATOM   706  C  CD1 . LEU A 1 85  ? 35.760 32.470 211.800 1.00 15.00 ? 117 LEU A CD1 1 
ATOM   707  C  CD2 . LEU A 1 85  ? 37.590 32.140 213.460 1.00 15.00 ? 117 LEU A CD2 1 
ATOM   708  N  N   . THR A 1 86  ? 36.690 27.330 211.360 1.00 15.00 ? 118 THR A N   1 
ATOM   709  C  CA  . THR A 1 86  ? 37.290 26.210 210.660 1.00 15.00 ? 118 THR A CA  1 
ATOM   710  C  C   . THR A 1 86  ? 36.300 25.430 209.850 1.00 15.00 ? 118 THR A C   1 
ATOM   711  O  O   . THR A 1 86  ? 36.440 25.310 208.640 1.00 15.00 ? 118 THR A O   1 
ATOM   712  C  CB  . THR A 1 86  ? 37.990 25.280 211.660 1.00 15.00 ? 118 THR A CB  1 
ATOM   713  O  OG1 . THR A 1 86  ? 37.290 25.240 212.890 1.00 15.00 ? 118 THR A OG1 1 
ATOM   714  C  CG2 . THR A 1 86  ? 39.370 25.810 211.950 1.00 15.00 ? 118 THR A CG2 1 
ATOM   715  N  N   . VAL A 1 87  ? 35.260 25.040 210.560 1.00 15.00 ? 119 VAL A N   1 
ATOM   716  C  CA  . VAL A 1 87  ? 34.170 24.250 210.040 1.00 15.00 ? 119 VAL A CA  1 
ATOM   717  C  C   . VAL A 1 87  ? 33.500 24.930 208.880 1.00 15.00 ? 119 VAL A C   1 
ATOM   718  O  O   . VAL A 1 87  ? 33.330 24.320 207.830 1.00 15.00 ? 119 VAL A O   1 
ATOM   719  C  CB  . VAL A 1 87  ? 33.170 24.020 211.150 1.00 15.00 ? 119 VAL A CB  1 
ATOM   720  C  CG1 . VAL A 1 87  ? 31.830 23.540 210.650 1.00 15.00 ? 119 VAL A CG1 1 
ATOM   721  C  CG2 . VAL A 1 87  ? 33.740 22.950 212.040 1.00 15.00 ? 119 VAL A CG2 1 
ATOM   722  N  N   . ARG A 1 88  ? 33.090 26.170 209.040 1.00 15.00 ? 120 ARG A N   1 
ATOM   723  C  CA  . ARG A 1 88  ? 32.410 26.840 207.960 1.00 15.00 ? 120 ARG A CA  1 
ATOM   724  C  C   . ARG A 1 88  ? 33.410 27.030 206.830 1.00 15.00 ? 120 ARG A C   1 
ATOM   725  O  O   . ARG A 1 88  ? 33.100 26.600 205.720 1.00 15.00 ? 120 ARG A O   1 
ATOM   726  C  CB  . ARG A 1 88  ? 31.880 28.160 208.490 1.00 15.00 ? 120 ARG A CB  1 
ATOM   727  C  CG  . ARG A 1 88  ? 30.630 27.970 209.340 1.00 15.00 ? 120 ARG A CG  1 
ATOM   728  C  CD  . ARG A 1 88  ? 29.460 28.270 208.430 1.00 15.00 ? 120 ARG A CD  1 
ATOM   729  N  NE  . ARG A 1 88  ? 28.160 27.790 208.850 1.00 15.00 ? 120 ARG A NE  1 
ATOM   730  C  CZ  . ARG A 1 88  ? 27.360 28.420 209.710 1.00 15.00 ? 120 ARG A CZ  1 
ATOM   731  N  NH1 . ARG A 1 88  ? 27.600 29.600 210.360 1.00 15.00 ? 120 ARG A NH1 1 
ATOM   732  N  NH2 . ARG A 1 88  ? 26.220 27.810 209.870 1.00 15.00 ? 120 ARG A NH2 1 
ATOM   733  N  N   . SER A 1 89  ? 34.630 27.510 207.070 1.00 15.00 ? 121 SER A N   1 
ATOM   734  C  CA  . SER A 1 89  ? 35.610 27.740 206.010 1.00 15.00 ? 121 SER A CA  1 
ATOM   735  C  C   . SER A 1 89  ? 35.980 26.520 205.230 1.00 15.00 ? 121 SER A C   1 
ATOM   736  O  O   . SER A 1 89  ? 36.340 26.650 204.070 1.00 15.00 ? 121 SER A O   1 
ATOM   737  C  CB  . SER A 1 89  ? 36.900 28.260 206.520 1.00 15.00 ? 121 SER A CB  1 
ATOM   738  O  OG  . SER A 1 89  ? 36.670 29.520 207.100 1.00 15.00 ? 121 SER A OG  1 
ATOM   739  N  N   . ASN A 1 90  ? 35.910 25.320 205.790 1.00 15.00 ? 122 ASN A N   1 
ATOM   740  C  CA  . ASN A 1 90  ? 36.340 24.180 205.030 1.00 15.00 ? 122 ASN A CA  1 
ATOM   741  C  C   . ASN A 1 90  ? 35.470 23.900 203.840 1.00 15.00 ? 122 ASN A C   1 
ATOM   742  O  O   . ASN A 1 90  ? 35.970 23.330 202.880 1.00 15.00 ? 122 ASN A O   1 
ATOM   743  C  CB  . ASN A 1 90  ? 36.390 22.950 205.890 1.00 15.00 ? 122 ASN A CB  1 
ATOM   744  C  CG  . ASN A 1 90  ? 37.620 22.900 206.790 1.00 15.00 ? 122 ASN A CG  1 
ATOM   745  O  OD1 . ASN A 1 90  ? 37.710 21.990 207.620 1.00 15.00 ? 122 ASN A OD1 1 
ATOM   746  N  ND2 . ASN A 1 90  ? 38.630 23.810 206.760 1.00 15.00 ? 122 ASN A ND2 1 
ATOM   747  N  N   . LEU A 1 91  ? 34.230 24.350 203.830 1.00 15.00 ? 123 LEU A N   1 
ATOM   748  C  CA  . LEU A 1 91  ? 33.370 24.100 202.700 1.00 15.00 ? 123 LEU A CA  1 
ATOM   749  C  C   . LEU A 1 91  ? 33.740 24.850 201.430 1.00 15.00 ? 123 LEU A C   1 
ATOM   750  O  O   . LEU A 1 91  ? 33.230 24.530 200.350 1.00 15.00 ? 123 LEU A O   1 
ATOM   751  C  CB  . LEU A 1 91  ? 31.960 24.410 203.100 1.00 15.00 ? 123 LEU A CB  1 
ATOM   752  C  CG  . LEU A 1 91  ? 31.370 23.380 204.050 1.00 15.00 ? 123 LEU A CG  1 
ATOM   753  C  CD1 . LEU A 1 91  ? 30.150 23.920 204.770 1.00 15.00 ? 123 LEU A CD1 1 
ATOM   754  C  CD2 . LEU A 1 91  ? 30.990 22.170 203.250 1.00 15.00 ? 123 LEU A CD2 1 
ATOM   755  N  N   . ILE A 1 92  ? 34.610 25.850 201.460 1.00 15.00 ? 124 ILE A N   1 
ATOM   756  C  CA  . ILE A 1 92  ? 34.970 26.570 200.260 1.00 15.00 ? 124 ILE A CA  1 
ATOM   757  C  C   . ILE A 1 92  ? 36.360 26.130 199.790 1.00 15.00 ? 124 ILE A C   1 
ATOM   758  O  O   . ILE A 1 92  ? 37.330 26.230 200.550 1.00 15.00 ? 124 ILE A O   1 
ATOM   759  C  CB  . ILE A 1 92  ? 34.940 28.080 200.530 1.00 15.00 ? 124 ILE A CB  1 
ATOM   760  C  CG1 . ILE A 1 92  ? 33.560 28.500 200.980 1.00 15.00 ? 124 ILE A CG1 1 
ATOM   761  C  CG2 . ILE A 1 92  ? 35.330 28.840 199.280 1.00 15.00 ? 124 ILE A CG2 1 
ATOM   762  C  CD1 . ILE A 1 92  ? 32.420 28.220 200.000 1.00 15.00 ? 124 ILE A CD1 1 
ATOM   763  N  N   . PRO A 1 93  ? 36.520 25.610 198.560 1.00 15.00 ? 125 PRO A N   1 
ATOM   764  C  CA  . PRO A 1 93  ? 37.780 25.150 198.010 1.00 15.00 ? 125 PRO A CA  1 
ATOM   765  C  C   . PRO A 1 93  ? 38.910 26.160 197.950 1.00 15.00 ? 125 PRO A C   1 
ATOM   766  O  O   . PRO A 1 93  ? 38.670 27.310 197.570 1.00 15.00 ? 125 PRO A O   1 
ATOM   767  C  CB  . PRO A 1 93  ? 37.380 24.640 196.650 1.00 15.00 ? 125 PRO A CB  1 
ATOM   768  C  CG  . PRO A 1 93  ? 36.220 25.530 196.290 1.00 15.00 ? 125 PRO A CG  1 
ATOM   769  C  CD  . PRO A 1 93  ? 35.450 25.430 197.590 1.00 15.00 ? 125 PRO A CD  1 
ATOM   770  N  N   . SER A 1 94  ? 40.140 25.830 198.340 1.00 15.00 ? 126 SER A N   1 
ATOM   771  C  CA  . SER A 1 94  ? 41.240 26.750 198.130 1.00 15.00 ? 126 SER A CA  1 
ATOM   772  C  C   . SER A 1 94  ? 42.450 25.930 197.790 1.00 15.00 ? 126 SER A C   1 
ATOM   773  O  O   . SER A 1 94  ? 42.720 24.930 198.470 1.00 15.00 ? 126 SER A O   1 
ATOM   774  C  CB  . SER A 1 94  ? 41.530 27.590 199.350 1.00 15.00 ? 126 SER A CB  1 
ATOM   775  O  OG  . SER A 1 94  ? 41.080 28.890 199.030 1.00 15.00 ? 126 SER A OG  1 
ATOM   776  N  N   . PRO A 1 95  ? 43.180 26.220 196.710 1.00 15.00 ? 127 PRO A N   1 
ATOM   777  C  CA  . PRO A 1 95  ? 42.880 27.160 195.640 1.00 15.00 ? 127 PRO A CA  1 
ATOM   778  C  C   . PRO A 1 95  ? 41.560 27.030 194.890 1.00 15.00 ? 127 PRO A C   1 
ATOM   779  O  O   . PRO A 1 95  ? 40.890 26.020 195.070 1.00 15.00 ? 127 PRO A O   1 
ATOM   780  C  CB  . PRO A 1 95  ? 44.090 27.040 194.750 1.00 15.00 ? 127 PRO A CB  1 
ATOM   781  C  CG  . PRO A 1 95  ? 44.620 25.680 195.040 1.00 15.00 ? 127 PRO A CG  1 
ATOM   782  C  CD  . PRO A 1 95  ? 44.500 25.680 196.530 1.00 15.00 ? 127 PRO A CD  1 
ATOM   783  N  N   . PRO A 1 96  ? 41.090 28.010 194.110 1.00 15.00 ? 128 PRO A N   1 
ATOM   784  C  CA  . PRO A 1 96  ? 39.810 28.000 193.430 1.00 15.00 ? 128 PRO A CA  1 
ATOM   785  C  C   . PRO A 1 96  ? 39.700 26.860 192.460 1.00 15.00 ? 128 PRO A C   1 
ATOM   786  O  O   . PRO A 1 96  ? 40.700 26.330 191.990 1.00 15.00 ? 128 PRO A O   1 
ATOM   787  C  CB  . PRO A 1 96  ? 39.720 29.290 192.720 1.00 15.00 ? 128 PRO A CB  1 
ATOM   788  C  CG  . PRO A 1 96  ? 40.590 30.160 193.560 1.00 15.00 ? 128 PRO A CG  1 
ATOM   789  C  CD  . PRO A 1 96  ? 41.750 29.270 193.850 1.00 15.00 ? 128 PRO A CD  1 
ATOM   790  N  N   . THR A 1 97  ? 38.490 26.480 192.120 1.00 15.00 ? 129 THR A N   1 
ATOM   791  C  CA  . THR A 1 97  ? 38.360 25.410 191.170 1.00 15.00 ? 129 THR A CA  1 
ATOM   792  C  C   . THR A 1 97  ? 37.900 25.870 189.790 1.00 15.00 ? 129 THR A C   1 
ATOM   793  O  O   . THR A 1 97  ? 38.760 26.200 188.960 1.00 15.00 ? 129 THR A O   1 
ATOM   794  C  CB  . THR A 1 97  ? 37.440 24.420 191.880 1.00 15.00 ? 129 THR A CB  1 
ATOM   795  O  OG1 . THR A 1 97  ? 36.350 25.160 192.430 1.00 15.00 ? 129 THR A OG1 1 
ATOM   796  C  CG2 . THR A 1 97  ? 38.170 23.650 192.940 1.00 15.00 ? 129 THR A CG2 1 
ATOM   797  N  N   . TYR A 1 98  ? 36.590 26.000 189.540 1.00 15.00 ? 130 TYR A N   1 
ATOM   798  C  CA  . TYR A 1 98  ? 36.020 26.230 188.210 1.00 15.00 ? 130 TYR A CA  1 
ATOM   799  C  C   . TYR A 1 98  ? 35.660 27.680 187.870 1.00 15.00 ? 130 TYR A C   1 
ATOM   800  O  O   . TYR A 1 98  ? 35.940 28.590 188.660 1.00 15.00 ? 130 TYR A O   1 
ATOM   801  C  CB  . TYR A 1 98  ? 34.780 25.350 188.100 1.00 15.00 ? 130 TYR A CB  1 
ATOM   802  C  CG  . TYR A 1 98  ? 34.900 23.940 188.670 1.00 15.00 ? 130 TYR A CG  1 
ATOM   803  C  CD1 . TYR A 1 98  ? 35.380 22.900 187.900 1.00 15.00 ? 130 TYR A CD1 1 
ATOM   804  C  CD2 . TYR A 1 98  ? 34.530 23.660 189.980 1.00 15.00 ? 130 TYR A CD2 1 
ATOM   805  C  CE1 . TYR A 1 98  ? 35.500 21.600 188.400 1.00 15.00 ? 130 TYR A CE1 1 
ATOM   806  C  CE2 . TYR A 1 98  ? 34.650 22.360 190.490 1.00 15.00 ? 130 TYR A CE2 1 
ATOM   807  C  CZ  . TYR A 1 98  ? 35.140 21.330 189.700 1.00 15.00 ? 130 TYR A CZ  1 
ATOM   808  O  OH  . TYR A 1 98  ? 35.280 20.030 190.180 1.00 15.00 ? 130 TYR A OH  1 
ATOM   809  N  N   . ASN A 1 99  ? 35.060 27.960 186.710 1.00 15.00 ? 131 ASN A N   1 
ATOM   810  C  CA  . ASN A 1 99  ? 34.570 29.280 186.290 1.00 15.00 ? 131 ASN A CA  1 
ATOM   811  C  C   . ASN A 1 99  ? 33.660 29.120 185.080 1.00 15.00 ? 131 ASN A C   1 
ATOM   812  O  O   . ASN A 1 99  ? 33.630 27.980 184.600 1.00 15.00 ? 131 ASN A O   1 
ATOM   813  C  CB  . ASN A 1 99  ? 35.660 30.240 185.890 1.00 15.00 ? 131 ASN A CB  1 
ATOM   814  C  CG  . ASN A 1 99  ? 36.530 29.760 184.760 1.00 15.00 ? 131 ASN A CG  1 
ATOM   815  O  OD1 . ASN A 1 99  ? 36.130 29.600 183.620 1.00 15.00 ? 131 ASN A OD1 1 
ATOM   816  N  ND2 . ASN A 1 99  ? 37.810 29.570 184.990 1.00 15.00 ? 131 ASN A ND2 1 
ATOM   817  N  N   . ILE A 1 100 ? 32.930 30.100 184.490 1.00 15.00 ? 132 ILE A N   1 
ATOM   818  C  CA  . ILE A 1 100 ? 32.030 29.800 183.360 1.00 15.00 ? 132 ILE A CA  1 
ATOM   819  C  C   . ILE A 1 100 ? 32.670 29.060 182.200 1.00 15.00 ? 132 ILE A C   1 
ATOM   820  O  O   . ILE A 1 100 ? 32.020 28.220 181.570 1.00 15.00 ? 132 ILE A O   1 
ATOM   821  C  CB  . ILE A 1 100 ? 31.360 31.020 182.630 1.00 15.00 ? 132 ILE A CB  1 
ATOM   822  C  CG1 . ILE A 1 100 ? 32.060 32.310 182.910 1.00 15.00 ? 132 ILE A CG1 1 
ATOM   823  C  CG2 . ILE A 1 100 ? 29.910 31.050 183.020 1.00 15.00 ? 132 ILE A CG2 1 
ATOM   824  C  CD1 . ILE A 1 100 ? 33.270 32.490 182.000 1.00 15.00 ? 132 ILE A CD1 1 
ATOM   825  N  N   . ALA A 1 101 ? 33.930 29.380 181.930 1.00 15.00 ? 133 ALA A N   1 
ATOM   826  C  CA  . ALA A 1 101 ? 34.650 28.790 180.830 1.00 15.00 ? 133 ALA A CA  1 
ATOM   827  C  C   . ALA A 1 101 ? 35.070 27.400 181.170 1.00 15.00 ? 133 ALA A C   1 
ATOM   828  O  O   . ALA A 1 101 ? 35.100 26.590 180.240 1.00 15.00 ? 133 ALA A O   1 
ATOM   829  C  CB  . ALA A 1 101 ? 35.910 29.560 180.510 1.00 15.00 ? 133 ALA A CB  1 
ATOM   830  N  N   . HIS A 1 102 ? 35.380 27.030 182.410 1.00 15.00 ? 134 HIS A N   1 
ATOM   831  C  CA  . HIS A 1 102 ? 35.890 25.700 182.690 1.00 15.00 ? 134 HIS A CA  1 
ATOM   832  C  C   . HIS A 1 102 ? 35.250 24.920 183.820 1.00 15.00 ? 134 HIS A C   1 
ATOM   833  O  O   . HIS A 1 102 ? 35.320 25.300 184.990 1.00 15.00 ? 134 HIS A O   1 
ATOM   834  C  CB  . HIS A 1 102 ? 37.400 25.750 182.980 1.00 15.00 ? 134 HIS A CB  1 
ATOM   835  C  CG  . HIS A 1 102 ? 38.300 26.410 181.950 1.00 15.00 ? 134 HIS A CG  1 
ATOM   836  N  ND1 . HIS A 1 102 ? 38.440 26.110 180.590 1.00 15.00 ? 134 HIS A ND1 1 
ATOM   837  C  CD2 . HIS A 1 102 ? 39.160 27.460 182.280 1.00 15.00 ? 134 HIS A CD2 1 
ATOM   838  C  CE1 . HIS A 1 102 ? 39.360 26.950 180.120 1.00 15.00 ? 134 HIS A CE1 1 
ATOM   839  N  NE2 . HIS A 1 102 ? 39.800 27.710 181.060 1.00 15.00 ? 134 HIS A NE2 1 
ATOM   840  N  N   . ASP A 1 103 ? 34.620 23.780 183.510 1.00 15.00 ? 135 ASP A N   1 
ATOM   841  C  CA  . ASP A 1 103 ? 34.050 22.880 184.500 1.00 15.00 ? 135 ASP A CA  1 
ATOM   842  C  C   . ASP A 1 103 ? 35.000 21.710 184.740 1.00 15.00 ? 135 ASP A C   1 
ATOM   843  O  O   . ASP A 1 103 ? 34.660 20.530 184.680 1.00 15.00 ? 135 ASP A O   1 
ATOM   844  C  CB  . ASP A 1 103 ? 32.690 22.390 183.990 1.00 15.00 ? 135 ASP A CB  1 
ATOM   845  C  CG  . ASP A 1 103 ? 31.720 23.500 183.600 1.00 15.00 ? 135 ASP A CG  1 
ATOM   846  O  OD1 . ASP A 1 103 ? 31.550 24.430 184.390 1.00 15.00 ? 135 ASP A OD1 1 
ATOM   847  O  OD2 . ASP A 1 103 ? 31.140 23.450 182.520 1.00 15.00 ? 135 ASP A OD2 1 
ATOM   848  N  N   . TYR A 1 104 ? 36.260 22.080 184.960 1.00 15.00 ? 136 TYR A N   1 
ATOM   849  C  CA  . TYR A 1 104 ? 37.380 21.200 185.290 1.00 15.00 ? 136 TYR A CA  1 
ATOM   850  C  C   . TYR A 1 104 ? 38.460 22.090 185.910 1.00 15.00 ? 136 TYR A C   1 
ATOM   851  O  O   . TYR A 1 104 ? 38.330 23.310 185.790 1.00 15.00 ? 136 TYR A O   1 
ATOM   852  C  CB  . TYR A 1 104 ? 37.980 20.530 184.070 1.00 15.00 ? 136 TYR A CB  1 
ATOM   853  C  CG  . TYR A 1 104 ? 38.130 21.390 182.840 1.00 15.00 ? 136 TYR A CG  1 
ATOM   854  C  CD1 . TYR A 1 104 ? 37.050 21.510 182.020 1.00 15.00 ? 136 TYR A CD1 1 
ATOM   855  C  CD2 . TYR A 1 104 ? 39.310 22.000 182.510 1.00 15.00 ? 136 TYR A CD2 1 
ATOM   856  C  CE1 . TYR A 1 104 ? 37.160 22.240 180.860 1.00 15.00 ? 136 TYR A CE1 1 
ATOM   857  C  CE2 . TYR A 1 104 ? 39.420 22.730 181.350 1.00 15.00 ? 136 TYR A CE2 1 
ATOM   858  C  CZ  . TYR A 1 104 ? 38.330 22.840 180.540 1.00 15.00 ? 136 TYR A CZ  1 
ATOM   859  O  OH  . TYR A 1 104 ? 38.400 23.530 179.350 1.00 15.00 ? 136 TYR A OH  1 
ATOM   860  N  N   . ILE A 1 105 ? 39.510 21.600 186.570 1.00 15.00 ? 137 ILE A N   1 
ATOM   861  C  CA  . ILE A 1 105 ? 40.500 22.530 187.110 1.00 15.00 ? 137 ILE A CA  1 
ATOM   862  C  C   . ILE A 1 105 ? 41.430 22.810 185.940 1.00 15.00 ? 137 ILE A C   1 
ATOM   863  O  O   . ILE A 1 105 ? 41.700 21.910 185.140 1.00 15.00 ? 137 ILE A O   1 
ATOM   864  C  CB  . ILE A 1 105 ? 41.380 21.940 188.250 1.00 15.00 ? 137 ILE A CB  1 
ATOM   865  C  CG1 . ILE A 1 105 ? 40.660 21.270 189.430 1.00 15.00 ? 137 ILE A CG1 1 
ATOM   866  C  CG2 . ILE A 1 105 ? 42.060 23.160 188.790 1.00 15.00 ? 137 ILE A CG2 1 
ATOM   867  C  CD1 . ILE A 1 105 ? 40.140 19.820 189.220 1.00 15.00 ? 137 ILE A CD1 1 
ATOM   868  N  N   . SER A 1 106 ? 41.900 24.040 185.810 1.00 15.00 ? 138 SER A N   1 
ATOM   869  C  CA  . SER A 1 106 ? 42.810 24.350 184.750 1.00 15.00 ? 138 SER A CA  1 
ATOM   870  C  C   . SER A 1 106 ? 43.730 25.420 185.280 1.00 15.00 ? 138 SER A C   1 
ATOM   871  O  O   . SER A 1 106 ? 43.360 26.110 186.230 1.00 15.00 ? 138 SER A O   1 
ATOM   872  C  CB  . SER A 1 106 ? 42.050 24.870 183.530 1.00 15.00 ? 138 SER A CB  1 
ATOM   873  O  OG  . SER A 1 106 ? 41.680 26.250 183.540 1.00 15.00 ? 138 SER A OG  1 
ATOM   874  N  N   . TRP A 1 107 ? 44.830 25.610 184.600 1.00 15.00 ? 139 TRP A N   1 
ATOM   875  C  CA  . TRP A 1 107 ? 45.690 26.630 185.230 1.00 15.00 ? 139 TRP A CA  1 
ATOM   876  C  C   . TRP A 1 107 ? 45.090 28.020 185.020 1.00 15.00 ? 139 TRP A C   1 
ATOM   877  O  O   . TRP A 1 107 ? 45.250 28.910 185.860 1.00 15.00 ? 139 TRP A O   1 
ATOM   878  C  CB  . TRP A 1 107 ? 47.080 26.610 184.610 1.00 15.00 ? 139 TRP A CB  1 
ATOM   879  C  CG  . TRP A 1 107 ? 47.960 27.770 185.100 1.00 15.00 ? 139 TRP A CG  1 
ATOM   880  C  CD1 . TRP A 1 107 ? 48.110 28.970 184.520 1.00 15.00 ? 139 TRP A CD1 1 
ATOM   881  C  CD2 . TRP A 1 107 ? 48.750 27.740 186.270 1.00 15.00 ? 139 TRP A CD2 1 
ATOM   882  N  NE1 . TRP A 1 107 ? 49.010 29.720 185.340 1.00 15.00 ? 139 TRP A NE1 1 
ATOM   883  C  CE2 . TRP A 1 107 ? 49.370 28.980 186.360 1.00 15.00 ? 139 TRP A CE2 1 
ATOM   884  C  CE3 . TRP A 1 107 ? 48.990 26.770 187.250 1.00 15.00 ? 139 TRP A CE3 1 
ATOM   885  C  CZ2 . TRP A 1 107 ? 50.240 29.320 187.410 1.00 15.00 ? 139 TRP A CZ2 1 
ATOM   886  C  CZ3 . TRP A 1 107 ? 49.870 27.130 188.300 1.00 15.00 ? 139 TRP A CZ3 1 
ATOM   887  C  CH2 . TRP A 1 107 ? 50.460 28.340 188.380 1.00 15.00 ? 139 TRP A CH2 1 
ATOM   888  N  N   . GLU A 1 108 ? 44.420 28.150 183.890 1.00 15.00 ? 140 GLU A N   1 
ATOM   889  C  CA  . GLU A 1 108 ? 43.790 29.420 183.480 1.00 15.00 ? 140 GLU A CA  1 
ATOM   890  C  C   . GLU A 1 108 ? 42.740 29.840 184.500 1.00 15.00 ? 140 GLU A C   1 
ATOM   891  O  O   . GLU A 1 108 ? 42.730 30.990 184.960 1.00 15.00 ? 140 GLU A O   1 
ATOM   892  C  CB  . GLU A 1 108 ? 43.130 29.250 182.110 1.00 15.00 ? 140 GLU A CB  1 
ATOM   893  C  CG  . GLU A 1 108 ? 43.740 30.190 181.060 1.00 15.00 ? 140 GLU A CG  1 
ATOM   894  C  CD  . GLU A 1 108 ? 43.370 31.650 181.290 1.00 15.00 ? 140 GLU A CD  1 
ATOM   895  O  OE1 . GLU A 1 108 ? 42.130 32.000 181.390 1.00 15.00 ? 140 GLU A OE1 1 
ATOM   896  O  OE2 . GLU A 1 108 ? 44.300 32.540 181.370 1.00 15.00 ? 140 GLU A OE2 1 
ATOM   897  N  N   . SER A 1 109 ? 41.880 28.910 184.830 1.00 15.00 ? 141 SER A N   1 
ATOM   898  C  CA  . SER A 1 109 ? 40.850 29.150 185.830 1.00 15.00 ? 141 SER A CA  1 
ATOM   899  C  C   . SER A 1 109 ? 41.530 29.540 187.110 1.00 15.00 ? 141 SER A C   1 
ATOM   900  O  O   . SER A 1 109 ? 40.970 30.280 187.950 1.00 15.00 ? 141 SER A O   1 
ATOM   901  C  CB  . SER A 1 109 ? 40.030 27.880 186.070 1.00 15.00 ? 141 SER A CB  1 
ATOM   902  O  OG  . SER A 1 109 ? 40.760 26.980 186.880 1.00 15.00 ? 141 SER A OG  1 
ATOM   903  N  N   . PHE A 1 110 ? 42.740 29.050 187.240 1.00 15.00 ? 142 PHE A N   1 
ATOM   904  C  CA  . PHE A 1 110 ? 43.500 29.310 188.430 1.00 15.00 ? 142 PHE A CA  1 
ATOM   905  C  C   . PHE A 1 110 ? 44.160 30.680 188.450 1.00 15.00 ? 142 PHE A C   1 
ATOM   906  O  O   . PHE A 1 110 ? 44.310 31.300 189.520 1.00 15.00 ? 142 PHE A O   1 
ATOM   907  C  CB  . PHE A 1 110 ? 44.660 28.390 188.650 1.00 15.00 ? 142 PHE A CB  1 
ATOM   908  C  CG  . PHE A 1 110 ? 45.280 28.920 189.910 1.00 15.00 ? 142 PHE A CG  1 
ATOM   909  C  CD1 . PHE A 1 110 ? 45.900 30.170 189.870 1.00 15.00 ? 142 PHE A CD1 1 
ATOM   910  C  CD2 . PHE A 1 110 ? 45.150 28.200 191.090 1.00 15.00 ? 142 PHE A CD2 1 
ATOM   911  C  CE1 . PHE A 1 110 ? 46.380 30.720 191.050 1.00 15.00 ? 142 PHE A CE1 1 
ATOM   912  C  CE2 . PHE A 1 110 ? 45.630 28.750 192.270 1.00 15.00 ? 142 PHE A CE2 1 
ATOM   913  C  CZ  . PHE A 1 110 ? 46.250 30.020 192.250 1.00 15.00 ? 142 PHE A CZ  1 
ATOM   914  N  N   . SER A 1 111 ? 44.570 31.150 187.290 1.00 15.00 ? 143 SER A N   1 
ATOM   915  C  CA  . SER A 1 111 ? 45.230 32.460 187.170 1.00 15.00 ? 143 SER A CA  1 
ATOM   916  C  C   . SER A 1 111 ? 44.290 33.450 186.480 1.00 15.00 ? 143 SER A C   1 
ATOM   917  O  O   . SER A 1 111 ? 44.530 34.670 186.510 1.00 15.00 ? 143 SER A O   1 
ATOM   918  C  CB  . SER A 1 111 ? 46.510 32.330 186.350 1.00 15.00 ? 143 SER A CB  1 
ATOM   919  O  OG  . SER A 1 111 ? 46.370 31.300 185.380 1.00 15.00 ? 143 SER A OG  1 
ATOM   920  N  N   . ASN A 1 112 ? 43.370 33.480 185.590 1.00 15.00 ? 144 ASN A N   1 
ATOM   921  C  CA  . ASN A 1 112 ? 42.700 34.620 184.940 1.00 15.00 ? 144 ASN A CA  1 
ATOM   922  C  C   . ASN A 1 112 ? 41.740 34.980 186.030 1.00 15.00 ? 144 ASN A C   1 
ATOM   923  O  O   . ASN A 1 112 ? 40.780 34.280 186.310 1.00 15.00 ? 144 ASN A O   1 
ATOM   924  C  CB  . ASN A 1 112 ? 41.890 34.260 183.680 1.00 15.00 ? 144 ASN A CB  1 
ATOM   925  C  CG  . ASN A 1 112 ? 41.420 35.490 182.930 1.00 15.00 ? 144 ASN A CG  1 
ATOM   926  O  OD1 . ASN A 1 112 ? 41.250 36.510 183.580 1.00 15.00 ? 144 ASN A OD1 1 
ATOM   927  N  ND2 . ASN A 1 112 ? 41.170 35.540 181.620 1.00 15.00 ? 144 ASN A ND2 1 
ATOM   928  N  N   . VAL A 1 113 ? 42.120 36.020 186.730 1.00 15.00 ? 145 VAL A N   1 
ATOM   929  C  CA  . VAL A 1 113 ? 41.410 36.420 187.910 1.00 15.00 ? 145 VAL A CA  1 
ATOM   930  C  C   . VAL A 1 113 ? 40.300 37.430 187.630 1.00 15.00 ? 145 VAL A C   1 
ATOM   931  O  O   . VAL A 1 113 ? 39.750 38.070 188.520 1.00 15.00 ? 145 VAL A O   1 
ATOM   932  C  CB  . VAL A 1 113 ? 42.550 36.870 188.850 1.00 15.00 ? 145 VAL A CB  1 
ATOM   933  C  CG1 . VAL A 1 113 ? 43.120 38.180 188.380 1.00 15.00 ? 145 VAL A CG1 1 
ATOM   934  C  CG2 . VAL A 1 113 ? 42.050 36.950 190.260 1.00 15.00 ? 145 VAL A CG2 1 
ATOM   935  N  N   . SER A 1 114 ? 39.920 37.580 186.370 1.00 15.00 ? 146 SER A N   1 
ATOM   936  C  CA  . SER A 1 114 ? 38.750 38.360 186.060 1.00 15.00 ? 146 SER A CA  1 
ATOM   937  C  C   . SER A 1 114 ? 37.680 37.270 186.040 1.00 15.00 ? 146 SER A C   1 
ATOM   938  O  O   . SER A 1 114 ? 36.950 37.190 185.070 1.00 15.00 ? 146 SER A O   1 
ATOM   939  C  CB  . SER A 1 114 ? 38.940 38.990 184.690 1.00 15.00 ? 146 SER A CB  1 
ATOM   940  O  OG  . SER A 1 114 ? 40.170 39.690 184.570 1.00 15.00 ? 146 SER A OG  1 
ATOM   941  N  N   . TYR A 1 115 ? 37.420 36.400 187.020 1.00 15.00 ? 147 TYR A N   1 
ATOM   942  C  CA  . TYR A 1 115 ? 36.530 35.310 186.680 1.00 15.00 ? 147 TYR A CA  1 
ATOM   943  C  C   . TYR A 1 115 ? 35.410 34.790 187.530 1.00 15.00 ? 147 TYR A C   1 
ATOM   944  O  O   . TYR A 1 115 ? 34.400 34.370 186.930 1.00 15.00 ? 147 TYR A O   1 
ATOM   945  C  CB  . TYR A 1 115 ? 37.370 34.080 186.290 1.00 15.00 ? 147 TYR A CB  1 
ATOM   946  C  CG  . TYR A 1 115 ? 37.390 33.660 184.810 1.00 15.00 ? 147 TYR A CG  1 
ATOM   947  C  CD1 . TYR A 1 115 ? 36.610 34.250 183.840 1.00 15.00 ? 147 TYR A CD1 1 
ATOM   948  C  CD2 . TYR A 1 115 ? 38.240 32.650 184.440 1.00 15.00 ? 147 TYR A CD2 1 
ATOM   949  C  CE1 . TYR A 1 115 ? 36.700 33.820 182.540 1.00 15.00 ? 147 TYR A CE1 1 
ATOM   950  C  CE2 . TYR A 1 115 ? 38.330 32.220 183.140 1.00 15.00 ? 147 TYR A CE2 1 
ATOM   951  C  CZ  . TYR A 1 115 ? 37.560 32.810 182.190 1.00 15.00 ? 147 TYR A CZ  1 
ATOM   952  O  OH  . TYR A 1 115 ? 37.690 32.400 180.880 1.00 15.00 ? 147 TYR A OH  1 
ATOM   953  N  N   . TYR A 1 116 ? 35.530 34.850 188.850 1.00 15.00 ? 148 TYR A N   1 
ATOM   954  C  CA  . TYR A 1 116 ? 34.520 34.280 189.740 1.00 15.00 ? 148 TYR A CA  1 
ATOM   955  C  C   . TYR A 1 116 ? 34.510 32.750 189.670 1.00 15.00 ? 148 TYR A C   1 
ATOM   956  O  O   . TYR A 1 116 ? 34.150 32.150 188.660 1.00 15.00 ? 148 TYR A O   1 
ATOM   957  C  CB  . TYR A 1 116 ? 33.070 34.690 189.440 1.00 15.00 ? 148 TYR A CB  1 
ATOM   958  C  CG  . TYR A 1 116 ? 32.580 36.110 189.640 1.00 15.00 ? 148 TYR A CG  1 
ATOM   959  C  CD1 . TYR A 1 116 ? 32.620 36.700 190.880 1.00 15.00 ? 148 TYR A CD1 1 
ATOM   960  C  CD2 . TYR A 1 116 ? 32.000 36.770 188.590 1.00 15.00 ? 148 TYR A CD2 1 
ATOM   961  C  CE1 . TYR A 1 116 ? 32.060 37.950 191.050 1.00 15.00 ? 148 TYR A CE1 1 
ATOM   962  C  CE2 . TYR A 1 116 ? 31.430 38.010 188.760 1.00 15.00 ? 148 TYR A CE2 1 
ATOM   963  C  CZ  . TYR A 1 116 ? 31.460 38.600 189.990 1.00 15.00 ? 148 TYR A CZ  1 
ATOM   964  O  OH  . TYR A 1 116 ? 30.900 39.850 190.190 1.00 15.00 ? 148 TYR A OH  1 
ATOM   965  N  N   . THR A 1 117 ? 34.940 32.090 190.740 1.00 15.00 ? 149 THR A N   1 
ATOM   966  C  CA  . THR A 1 117 ? 34.860 30.660 190.760 1.00 15.00 ? 149 THR A CA  1 
ATOM   967  C  C   . THR A 1 117 ? 33.420 30.360 191.010 1.00 15.00 ? 149 THR A C   1 
ATOM   968  O  O   . THR A 1 117 ? 32.640 31.200 191.470 1.00 15.00 ? 149 THR A O   1 
ATOM   969  C  CB  . THR A 1 117 ? 35.780 30.140 191.860 1.00 15.00 ? 149 THR A CB  1 
ATOM   970  O  OG1 . THR A 1 117 ? 36.990 30.140 191.130 1.00 15.00 ? 149 THR A OG1 1 
ATOM   971  C  CG2 . THR A 1 117 ? 35.600 28.740 192.440 1.00 15.00 ? 149 THR A CG2 1 
ATOM   972  N  N   . ARG A 1 118 ? 33.020 29.190 190.580 1.00 15.00 ? 150 ARG A N   1 
ATOM   973  C  CA  . ARG A 1 118 ? 31.730 28.680 190.940 1.00 15.00 ? 150 ARG A CA  1 
ATOM   974  C  C   . ARG A 1 118 ? 32.140 27.480 191.760 1.00 15.00 ? 150 ARG A C   1 
ATOM   975  O  O   . ARG A 1 118 ? 33.220 26.940 191.550 1.00 15.00 ? 150 ARG A O   1 
ATOM   976  C  CB  . ARG A 1 118 ? 30.950 28.260 189.740 1.00 15.00 ? 150 ARG A CB  1 
ATOM   977  C  CG  . ARG A 1 118 ? 31.800 27.490 188.790 1.00 15.00 ? 150 ARG A CG  1 
ATOM   978  C  CD  . ARG A 1 118 ? 31.000 26.750 187.780 1.00 15.00 ? 150 ARG A CD  1 
ATOM   979  N  NE  . ARG A 1 118 ? 30.240 27.630 186.940 1.00 15.00 ? 150 ARG A NE  1 
ATOM   980  C  CZ  . ARG A 1 118 ? 28.920 27.530 186.900 1.00 15.00 ? 150 ARG A CZ  1 
ATOM   981  N  NH1 . ARG A 1 118 ? 28.230 26.630 187.620 1.00 15.00 ? 150 ARG A NH1 1 
ATOM   982  N  NH2 . ARG A 1 118 ? 28.290 28.350 186.090 1.00 15.00 ? 150 ARG A NH2 1 
ATOM   983  N  N   . ILE A 1 119 ? 31.390 27.060 192.760 1.00 15.00 ? 151 ILE A N   1 
ATOM   984  C  CA  . ILE A 1 119 ? 31.840 25.890 193.480 1.00 15.00 ? 151 ILE A CA  1 
ATOM   985  C  C   . ILE A 1 119 ? 31.260 24.590 192.940 1.00 15.00 ? 151 ILE A C   1 
ATOM   986  O  O   . ILE A 1 119 ? 31.710 23.510 193.270 1.00 15.00 ? 151 ILE A O   1 
ATOM   987  C  CB  . ILE A 1 119 ? 31.540 26.010 194.970 1.00 15.00 ? 151 ILE A CB  1 
ATOM   988  C  CG1 . ILE A 1 119 ? 30.100 25.800 195.230 1.00 15.00 ? 151 ILE A CG1 1 
ATOM   989  C  CG2 . ILE A 1 119 ? 31.940 27.390 195.480 1.00 15.00 ? 151 ILE A CG2 1 
ATOM   990  C  CD1 . ILE A 1 119 ? 30.130 24.960 196.490 1.00 15.00 ? 151 ILE A CD1 1 
ATOM   991  N  N   . LEU A 1 120 ? 30.210 24.710 192.130 1.00 15.00 ? 152 LEU A N   1 
ATOM   992  C  CA  . LEU A 1 120 ? 29.610 23.580 191.470 1.00 15.00 ? 152 LEU A CA  1 
ATOM   993  C  C   . LEU A 1 120 ? 29.580 23.960 190.010 1.00 15.00 ? 152 LEU A C   1 
ATOM   994  O  O   . LEU A 1 120 ? 29.170 25.090 189.720 1.00 15.00 ? 152 LEU A O   1 
ATOM   995  C  CB  . LEU A 1 120 ? 28.180 23.350 191.900 1.00 15.00 ? 152 LEU A CB  1 
ATOM   996  C  CG  . LEU A 1 120 ? 27.870 22.540 193.130 1.00 15.00 ? 152 LEU A CG  1 
ATOM   997  C  CD1 . LEU A 1 120 ? 26.370 22.400 193.290 1.00 15.00 ? 152 LEU A CD1 1 
ATOM   998  C  CD2 . LEU A 1 120 ? 28.490 21.180 192.990 1.00 15.00 ? 152 LEU A CD2 1 
ATOM   999  N  N   . PRO A 1 121 ? 29.980 23.090 189.080 1.00 15.00 ? 153 PRO A N   1 
ATOM   1000 C  CA  . PRO A 1 121 ? 29.980 23.280 187.650 1.00 15.00 ? 153 PRO A CA  1 
ATOM   1001 C  C   . PRO A 1 121 ? 28.640 23.550 187.000 1.00 15.00 ? 153 PRO A C   1 
ATOM   1002 O  O   . PRO A 1 121 ? 27.600 23.380 187.630 1.00 15.00 ? 153 PRO A O   1 
ATOM   1003 C  CB  . PRO A 1 121 ? 30.580 22.040 187.120 1.00 15.00 ? 153 PRO A CB  1 
ATOM   1004 C  CG  . PRO A 1 121 ? 30.090 21.010 188.080 1.00 15.00 ? 153 PRO A CG  1 
ATOM   1005 C  CD  . PRO A 1 121 ? 30.370 21.720 189.370 1.00 15.00 ? 153 PRO A CD  1 
ATOM   1006 N  N   . SER A 1 122 ? 28.670 23.890 185.730 1.00 15.00 ? 154 SER A N   1 
ATOM   1007 C  CA  . SER A 1 122 ? 27.480 24.200 184.970 1.00 15.00 ? 154 SER A CA  1 
ATOM   1008 C  C   . SER A 1 122 ? 26.640 22.960 184.790 1.00 15.00 ? 154 SER A C   1 
ATOM   1009 O  O   . SER A 1 122 ? 27.130 21.830 184.870 1.00 15.00 ? 154 SER A O   1 
ATOM   1010 C  CB  . SER A 1 122 ? 27.830 24.710 183.580 1.00 15.00 ? 154 SER A CB  1 
ATOM   1011 O  OG  . SER A 1 122 ? 29.070 25.410 183.490 1.00 15.00 ? 154 SER A OG  1 
ATOM   1012 N  N   . VAL A 1 123 ? 25.350 23.160 184.530 1.00 15.00 ? 155 VAL A N   1 
ATOM   1013 C  CA  . VAL A 1 123 ? 24.500 22.090 184.080 1.00 15.00 ? 155 VAL A CA  1 
ATOM   1014 C  C   . VAL A 1 123 ? 25.070 21.920 182.680 1.00 15.00 ? 155 VAL A C   1 
ATOM   1015 O  O   . VAL A 1 123 ? 25.190 22.890 181.930 1.00 15.00 ? 155 VAL A O   1 
ATOM   1016 C  CB  . VAL A 1 123 ? 23.060 22.540 184.000 1.00 15.00 ? 155 VAL A CB  1 
ATOM   1017 C  CG1 . VAL A 1 123 ? 22.180 21.460 183.420 1.00 15.00 ? 155 VAL A CG1 1 
ATOM   1018 C  CG2 . VAL A 1 123 ? 22.580 22.820 185.390 1.00 15.00 ? 155 VAL A CG2 1 
ATOM   1019 N  N   . PRO A 1 124 ? 25.570 20.750 182.320 1.00 15.00 ? 156 PRO A N   1 
ATOM   1020 C  CA  . PRO A 1 124 ? 26.160 20.480 181.040 1.00 15.00 ? 156 PRO A CA  1 
ATOM   1021 C  C   . PRO A 1 124 ? 25.200 20.880 179.950 1.00 15.00 ? 156 PRO A C   1 
ATOM   1022 O  O   . PRO A 1 124 ? 24.050 20.420 179.910 1.00 15.00 ? 156 PRO A O   1 
ATOM   1023 C  CB  . PRO A 1 124 ? 26.430 19.020 181.060 1.00 15.00 ? 156 PRO A CB  1 
ATOM   1024 C  CG  . PRO A 1 124 ? 26.750 18.810 182.510 1.00 15.00 ? 156 PRO A CG  1 
ATOM   1025 C  CD  . PRO A 1 124 ? 25.650 19.580 183.180 1.00 15.00 ? 156 PRO A CD  1 
ATOM   1026 N  N   . ARG A 1 125 ? 25.680 21.720 179.030 1.00 15.00 ? 157 ARG A N   1 
ATOM   1027 C  CA  . ARG A 1 125 ? 24.890 22.230 177.900 1.00 15.00 ? 157 ARG A CA  1 
ATOM   1028 C  C   . ARG A 1 125 ? 24.280 21.210 176.930 1.00 15.00 ? 157 ARG A C   1 
ATOM   1029 O  O   . ARG A 1 125 ? 23.630 21.590 175.960 1.00 15.00 ? 157 ARG A O   1 
ATOM   1030 C  CB  . ARG A 1 125 ? 25.770 23.220 177.120 1.00 15.00 ? 157 ARG A CB  1 
ATOM   1031 C  CG  . ARG A 1 125 ? 26.040 24.510 177.910 1.00 15.00 ? 157 ARG A CG  1 
ATOM   1032 C  CD  . ARG A 1 125 ? 27.130 25.460 177.330 1.00 15.00 ? 157 ARG A CD  1 
ATOM   1033 N  NE  . ARG A 1 125 ? 27.460 26.610 178.190 1.00 15.00 ? 157 ARG A NE  1 
ATOM   1034 C  CZ  . ARG A 1 125 ? 28.000 26.550 179.460 1.00 15.00 ? 157 ARG A CZ  1 
ATOM   1035 N  NH1 . ARG A 1 125 ? 28.300 25.400 180.120 1.00 15.00 ? 157 ARG A NH1 1 
ATOM   1036 N  NH2 . ARG A 1 125 ? 28.300 27.710 180.080 1.00 15.00 ? 157 ARG A NH2 1 
ATOM   1037 N  N   . ASP A 1 126 ? 24.440 19.920 177.180 1.00 15.00 ? 158 ASP A N   1 
ATOM   1038 C  CA  . ASP A 1 126 ? 23.900 18.860 176.360 1.00 15.00 ? 158 ASP A CA  1 
ATOM   1039 C  C   . ASP A 1 126 ? 22.900 18.030 177.180 1.00 15.00 ? 158 ASP A C   1 
ATOM   1040 O  O   . ASP A 1 126 ? 22.640 16.860 176.850 1.00 15.00 ? 158 ASP A O   1 
ATOM   1041 C  CB  . ASP A 1 126 ? 25.070 18.000 175.840 1.00 15.00 ? 158 ASP A CB  1 
ATOM   1042 C  CG  . ASP A 1 126 ? 26.080 17.400 176.870 1.00 15.00 ? 158 ASP A CG  1 
ATOM   1043 O  OD1 . ASP A 1 126 ? 25.830 17.430 178.080 1.00 15.00 ? 158 ASP A OD1 1 
ATOM   1044 O  OD2 . ASP A 1 126 ? 27.140 16.900 176.460 1.00 15.00 ? 158 ASP A OD2 1 
ATOM   1045 N  N   . CYS A 1 127 ? 22.410 18.560 178.300 1.00 15.00 ? 159 CYS A N   1 
ATOM   1046 C  CA  . CYS A 1 127 ? 21.420 17.830 179.080 1.00 15.00 ? 159 CYS A CA  1 
ATOM   1047 C  C   . CYS A 1 127 ? 20.040 17.980 178.460 1.00 15.00 ? 159 CYS A C   1 
ATOM   1048 O  O   . CYS A 1 127 ? 19.800 18.950 177.730 1.00 15.00 ? 159 CYS A O   1 
ATOM   1049 C  CB  . CYS A 1 127 ? 21.380 18.350 180.490 1.00 15.00 ? 159 CYS A CB  1 
ATOM   1050 S  SG  . CYS A 1 127 ? 22.920 17.980 181.350 1.00 15.00 ? 159 CYS A SG  1 
ATOM   1051 N  N   . PRO A 1 128 ? 19.120 17.020 178.630 1.00 15.00 ? 160 PRO A N   1 
ATOM   1052 C  CA  . PRO A 1 128 ? 17.730 17.140 178.270 1.00 15.00 ? 160 PRO A CA  1 
ATOM   1053 C  C   . PRO A 1 128 ? 17.040 18.360 178.870 1.00 15.00 ? 160 PRO A C   1 
ATOM   1054 O  O   . PRO A 1 128 ? 16.600 19.240 178.110 1.00 15.00 ? 160 PRO A O   1 
ATOM   1055 C  CB  . PRO A 1 128 ? 17.110 15.820 178.700 1.00 15.00 ? 160 PRO A CB  1 
ATOM   1056 C  CG  . PRO A 1 128 ? 18.050 15.290 179.740 1.00 15.00 ? 160 PRO A CG  1 
ATOM   1057 C  CD  . PRO A 1 128 ? 19.380 15.680 179.130 1.00 15.00 ? 160 PRO A CD  1 
ATOM   1058 N  N   . THR A 1 129 ? 16.900 18.480 180.200 1.00 15.00 ? 161 THR A N   1 
ATOM   1059 C  CA  . THR A 1 129 ? 16.270 19.680 180.690 1.00 15.00 ? 161 THR A CA  1 
ATOM   1060 C  C   . THR A 1 129 ? 17.400 20.660 180.780 1.00 15.00 ? 161 THR A C   1 
ATOM   1061 O  O   . THR A 1 129 ? 18.550 20.270 180.990 1.00 15.00 ? 161 THR A O   1 
ATOM   1062 C  CB  . THR A 1 129 ? 15.640 19.510 182.070 1.00 15.00 ? 161 THR A CB  1 
ATOM   1063 O  OG1 . THR A 1 129 ? 16.620 19.050 182.980 1.00 15.00 ? 161 THR A OG1 1 
ATOM   1064 C  CG2 . THR A 1 129 ? 14.490 18.560 182.000 1.00 15.00 ? 161 THR A CG2 1 
ATOM   1065 N  N   . PRO A 1 130 ? 17.130 21.950 180.720 1.00 15.00 ? 162 PRO A N   1 
ATOM   1066 C  CA  . PRO A 1 130 ? 18.060 22.990 181.110 1.00 15.00 ? 162 PRO A CA  1 
ATOM   1067 C  C   . PRO A 1 130 ? 18.520 22.890 182.550 1.00 15.00 ? 162 PRO A C   1 
ATOM   1068 O  O   . PRO A 1 130 ? 19.350 23.680 182.980 1.00 15.00 ? 162 PRO A O   1 
ATOM   1069 C  CB  . PRO A 1 130 ? 17.310 24.250 180.800 1.00 15.00 ? 162 PRO A CB  1 
ATOM   1070 C  CG  . PRO A 1 130 ? 15.870 23.820 180.900 1.00 15.00 ? 162 PRO A CG  1 
ATOM   1071 C  CD  . PRO A 1 130 ? 15.910 22.510 180.180 1.00 15.00 ? 162 PRO A CD  1 
ATOM   1072 N  N   . MET A 1 131 ? 18.010 21.950 183.340 1.00 15.00 ? 163 MET A N   1 
ATOM   1073 C  CA  . MET A 1 131 ? 18.470 21.800 184.690 1.00 15.00 ? 163 MET A CA  1 
ATOM   1074 C  C   . MET A 1 131 ? 19.080 20.430 184.880 1.00 15.00 ? 163 MET A C   1 
ATOM   1075 O  O   . MET A 1 131 ? 19.270 19.950 185.990 1.00 15.00 ? 163 MET A O   1 
ATOM   1076 C  CB  . MET A 1 131 ? 17.280 22.000 185.580 1.00 15.00 ? 163 MET A CB  1 
ATOM   1077 C  CG  . MET A 1 131 ? 17.680 22.860 186.750 1.00 15.00 ? 163 MET A CG  1 
ATOM   1078 S  SD  . MET A 1 131 ? 18.040 24.550 186.240 1.00 15.00 ? 163 MET A SD  1 
ATOM   1079 C  CE  . MET A 1 131 ? 17.480 25.310 187.730 1.00 15.00 ? 163 MET A CE  1 
ATOM   1080 N  N   . GLY A 1 132 ? 19.380 19.740 183.800 1.00 15.00 ? 164 GLY A N   1 
ATOM   1081 C  CA  . GLY A 1 132 ? 19.980 18.430 183.910 1.00 15.00 ? 164 GLY A CA  1 
ATOM   1082 C  C   . GLY A 1 132 ? 19.000 17.420 183.360 1.00 15.00 ? 164 GLY A C   1 
ATOM   1083 O  O   . GLY A 1 132 ? 18.770 17.310 182.160 1.00 15.00 ? 164 GLY A O   1 
ATOM   1084 N  N   . THR A 1 133 ? 18.410 16.720 184.290 1.00 15.00 ? 165 THR A N   1 
ATOM   1085 C  CA  . THR A 1 133 ? 17.480 15.690 183.920 1.00 15.00 ? 165 THR A CA  1 
ATOM   1086 C  C   . THR A 1 133 ? 16.030 15.980 184.210 1.00 15.00 ? 165 THR A C   1 
ATOM   1087 O  O   . THR A 1 133 ? 15.150 15.790 183.390 1.00 15.00 ? 165 THR A O   1 
ATOM   1088 C  CB  . THR A 1 133 ? 17.970 14.420 184.630 1.00 15.00 ? 165 THR A CB  1 
ATOM   1089 O  OG1 . THR A 1 133 ? 18.870 13.880 183.680 1.00 15.00 ? 165 THR A OG1 1 
ATOM   1090 C  CG2 . THR A 1 133 ? 16.920 13.390 185.060 1.00 15.00 ? 165 THR A CG2 1 
ATOM   1091 N  N   . LYS A 1 134 ? 15.800 16.440 185.430 1.00 15.00 ? 166 LYS A N   1 
ATOM   1092 C  CA  . LYS A 1 134 ? 14.450 16.610 185.880 1.00 15.00 ? 166 LYS A CA  1 
ATOM   1093 C  C   . LYS A 1 134 ? 14.000 18.000 185.520 1.00 15.00 ? 166 LYS A C   1 
ATOM   1094 O  O   . LYS A 1 134 ? 14.830 18.830 185.140 1.00 15.00 ? 166 LYS A O   1 
ATOM   1095 C  CB  . LYS A 1 134 ? 14.420 16.390 187.370 1.00 15.00 ? 166 LYS A CB  1 
ATOM   1096 C  CG  . LYS A 1 134 ? 14.680 14.950 187.790 1.00 15.00 ? 166 LYS A CG  1 
ATOM   1097 C  CD  . LYS A 1 134 ? 14.700 15.030 189.300 1.00 15.00 ? 166 LYS A CD  1 
ATOM   1098 C  CE  . LYS A 1 134 ? 14.590 13.700 190.040 1.00 15.00 ? 166 LYS A CE  1 
ATOM   1099 N  NZ  . LYS A 1 134 ? 14.350 13.950 191.460 1.00 15.00 ? 166 LYS A NZ  1 
ATOM   1100 N  N   . GLY A 1 135 ? 12.690 18.220 185.550 1.00 15.00 ? 167 GLY A N   1 
ATOM   1101 C  CA  . GLY A 1 135 ? 12.180 19.570 185.360 1.00 15.00 ? 167 GLY A CA  1 
ATOM   1102 C  C   . GLY A 1 135 ? 11.480 19.740 184.040 1.00 15.00 ? 167 GLY A C   1 
ATOM   1103 O  O   . GLY A 1 135 ? 11.460 18.840 183.190 1.00 15.00 ? 167 GLY A O   1 
ATOM   1104 N  N   . LYS A 1 136 ? 10.820 20.890 183.910 1.00 15.00 ? 168 LYS A N   1 
ATOM   1105 C  CA  . LYS A 1 136 ? 10.150 21.210 182.670 1.00 15.00 ? 168 LYS A CA  1 
ATOM   1106 C  C   . LYS A 1 136 ? 11.250 21.500 181.670 1.00 15.00 ? 168 LYS A C   1 
ATOM   1107 O  O   . LYS A 1 136 ? 12.350 21.990 181.950 1.00 15.00 ? 168 LYS A O   1 
ATOM   1108 C  CB  . LYS A 1 136 ? 9.270  22.460 182.760 1.00 15.00 ? 168 LYS A CB  1 
ATOM   1109 C  CG  . LYS A 1 136 ? 7.960  22.380 183.540 1.00 15.00 ? 168 LYS A CG  1 
ATOM   1110 C  CD  . LYS A 1 136 ? 6.820  21.750 182.720 1.00 15.00 ? 168 LYS A CD  1 
ATOM   1111 C  CE  . LYS A 1 136 ? 5.410  22.060 183.290 1.00 15.00 ? 168 LYS A CE  1 
ATOM   1112 N  NZ  . LYS A 1 136 ? 5.140  21.440 184.590 1.00 15.00 ? 168 LYS A NZ  1 
ATOM   1113 N  N   . LYS A 1 137 ? 10.850 21.150 180.470 1.00 15.00 ? 169 LYS A N   1 
ATOM   1114 C  CA  . LYS A 1 137 ? 11.640 21.290 179.260 1.00 15.00 ? 169 LYS A CA  1 
ATOM   1115 C  C   . LYS A 1 137 ? 12.160 22.690 178.980 1.00 15.00 ? 169 LYS A C   1 
ATOM   1116 O  O   . LYS A 1 137 ? 13.020 22.850 178.130 1.00 15.00 ? 169 LYS A O   1 
ATOM   1117 C  CB  . LYS A 1 137 ? 10.780 20.830 178.060 1.00 15.00 ? 169 LYS A CB  1 
ATOM   1118 C  CG  . LYS A 1 137 ? 9.530  21.700 177.630 1.00 15.00 ? 169 LYS A CG  1 
ATOM   1119 C  CD  . LYS A 1 137 ? 8.300  21.910 178.570 1.00 15.00 ? 169 LYS A CD  1 
ATOM   1120 C  CE  . LYS A 1 137 ? 7.400  20.670 178.810 1.00 15.00 ? 169 LYS A CE  1 
ATOM   1121 N  NZ  . LYS A 1 137 ? 8.040  19.670 179.660 1.00 15.00 ? 169 LYS A NZ  1 
ATOM   1122 N  N   . GLN A 1 138 ? 11.620 23.700 179.650 1.00 15.00 ? 170 GLN A N   1 
ATOM   1123 C  CA  . GLN A 1 138 ? 11.920 25.100 179.400 1.00 15.00 ? 170 GLN A CA  1 
ATOM   1124 C  C   . GLN A 1 138 ? 11.570 25.850 180.700 1.00 15.00 ? 170 GLN A C   1 
ATOM   1125 O  O   . GLN A 1 138 ? 10.450 25.650 181.210 1.00 15.00 ? 170 GLN A O   1 
ATOM   1126 C  CB  . GLN A 1 138 ? 11.050 25.470 178.220 1.00 15.00 ? 170 GLN A CB  1 
ATOM   1127 C  CG  . GLN A 1 138 ? 11.100 26.930 177.890 1.00 15.00 ? 170 GLN A CG  1 
ATOM   1128 C  CD  . GLN A 1 138 ? 9.690  27.450 177.600 1.00 15.00 ? 170 GLN A CD  1 
ATOM   1129 O  OE1 . GLN A 1 138 ? 9.260  27.450 176.430 1.00 15.00 ? 170 GLN A OE1 1 
ATOM   1130 N  NE2 . GLN A 1 138 ? 8.950  27.890 178.640 1.00 15.00 ? 170 GLN A NE2 1 
ATOM   1131 N  N   . LEU A 1 139 ? 12.440 26.700 181.270 1.00 15.00 ? 171 LEU A N   1 
ATOM   1132 C  CA  . LEU A 1 139 ? 12.140 27.250 182.590 1.00 15.00 ? 171 LEU A CA  1 
ATOM   1133 C  C   . LEU A 1 139 ? 11.090 28.340 182.610 1.00 15.00 ? 171 LEU A C   1 
ATOM   1134 O  O   . LEU A 1 139 ? 10.840 28.980 181.580 1.00 15.00 ? 171 LEU A O   1 
ATOM   1135 C  CB  . LEU A 1 139 ? 13.400 27.810 183.290 1.00 15.00 ? 171 LEU A CB  1 
ATOM   1136 C  CG  . LEU A 1 139 ? 14.530 26.940 183.830 1.00 15.00 ? 171 LEU A CG  1 
ATOM   1137 C  CD1 . LEU A 1 139 ? 14.040 25.580 184.280 1.00 15.00 ? 171 LEU A CD1 1 
ATOM   1138 C  CD2 . LEU A 1 139 ? 15.530 26.750 182.730 1.00 15.00 ? 171 LEU A CD2 1 
ATOM   1139 N  N   . PRO A 1 140 ? 10.430 28.510 183.770 1.00 15.00 ? 172 PRO A N   1 
ATOM   1140 C  CA  . PRO A 1 140 ? 9.520  29.600 184.080 1.00 15.00 ? 172 PRO A CA  1 
ATOM   1141 C  C   . PRO A 1 140 ? 9.970  30.950 183.610 1.00 15.00 ? 172 PRO A C   1 
ATOM   1142 O  O   . PRO A 1 140 ? 11.150 31.290 183.700 1.00 15.00 ? 172 PRO A O   1 
ATOM   1143 C  CB  . PRO A 1 140 ? 9.380  29.540 185.570 1.00 15.00 ? 172 PRO A CB  1 
ATOM   1144 C  CG  . PRO A 1 140 ? 9.350  28.070 185.830 1.00 15.00 ? 172 PRO A CG  1 
ATOM   1145 C  CD  . PRO A 1 140 ? 10.350 27.500 184.820 1.00 15.00 ? 172 PRO A CD  1 
ATOM   1146 N  N   . ASP A 1 141 ? 9.050  31.770 183.140 1.00 15.00 ? 173 ASP A N   1 
ATOM   1147 C  CA  . ASP A 1 141 ? 9.420  33.090 182.690 1.00 15.00 ? 173 ASP A CA  1 
ATOM   1148 C  C   . ASP A 1 141 ? 9.840  33.950 183.880 1.00 15.00 ? 173 ASP A C   1 
ATOM   1149 O  O   . ASP A 1 141 ? 9.030  34.260 184.740 1.00 15.00 ? 173 ASP A O   1 
ATOM   1150 C  CB  . ASP A 1 141 ? 8.240  33.700 181.960 1.00 15.00 ? 173 ASP A CB  1 
ATOM   1151 C  CG  . ASP A 1 141 ? 8.460  35.150 181.580 1.00 15.00 ? 173 ASP A CG  1 
ATOM   1152 O  OD1 . ASP A 1 141 ? 9.420  35.470 180.870 1.00 15.00 ? 173 ASP A OD1 1 
ATOM   1153 O  OD2 . ASP A 1 141 ? 7.660  35.950 182.040 1.00 15.00 ? 173 ASP A OD2 1 
ATOM   1154 N  N   . ALA A 1 142 ? 11.100 34.380 183.900 1.00 15.00 ? 174 ALA A N   1 
ATOM   1155 C  CA  . ALA A 1 142 ? 11.650 35.150 185.000 1.00 15.00 ? 174 ALA A CA  1 
ATOM   1156 C  C   . ALA A 1 142 ? 10.810 36.310 185.450 1.00 15.00 ? 174 ALA A C   1 
ATOM   1157 O  O   . ALA A 1 142 ? 10.480 36.440 186.630 1.00 15.00 ? 174 ALA A O   1 
ATOM   1158 C  CB  . ALA A 1 142 ? 13.010 35.710 184.650 1.00 15.00 ? 174 ALA A CB  1 
ATOM   1159 N  N   . GLU A 1 143 ? 10.390 37.080 184.450 1.00 15.00 ? 175 GLU A N   1 
ATOM   1160 C  CA  . GLU A 1 143 ? 9.530  38.220 184.620 1.00 15.00 ? 175 GLU A CA  1 
ATOM   1161 C  C   . GLU A 1 143 ? 8.350  37.840 185.500 1.00 15.00 ? 175 GLU A C   1 
ATOM   1162 O  O   . GLU A 1 143 ? 8.100  38.440 186.550 1.00 15.00 ? 175 GLU A O   1 
ATOM   1163 C  CB  . GLU A 1 143 ? 9.090  38.610 183.250 1.00 15.00 ? 175 GLU A CB  1 
ATOM   1164 C  CG  . GLU A 1 143 ? 8.050  39.690 183.150 1.00 15.00 ? 175 GLU A CG  1 
ATOM   1165 C  CD  . GLU A 1 143 ? 8.600  41.030 183.600 1.00 15.00 ? 175 GLU A CD  1 
ATOM   1166 O  OE1 . GLU A 1 143 ? 9.360  41.640 182.830 1.00 15.00 ? 175 GLU A OE1 1 
ATOM   1167 O  OE2 . GLU A 1 143 ? 8.260  41.440 184.710 1.00 15.00 ? 175 GLU A OE2 1 
ATOM   1168 N  N   . PHE A 1 144 ? 7.730  36.740 185.100 1.00 15.00 ? 176 PHE A N   1 
ATOM   1169 C  CA  . PHE A 1 144 ? 6.590  36.200 185.800 1.00 15.00 ? 176 PHE A CA  1 
ATOM   1170 C  C   . PHE A 1 144 ? 6.960  35.780 187.230 1.00 15.00 ? 176 PHE A C   1 
ATOM   1171 O  O   . PHE A 1 144 ? 6.410  36.390 188.130 1.00 15.00 ? 176 PHE A O   1 
ATOM   1172 C  CB  . PHE A 1 144 ? 6.050  35.030 184.990 1.00 15.00 ? 176 PHE A CB  1 
ATOM   1173 C  CG  . PHE A 1 144 ? 4.760  34.410 185.540 1.00 15.00 ? 176 PHE A CG  1 
ATOM   1174 C  CD1 . PHE A 1 144 ? 3.690  35.210 185.930 1.00 15.00 ? 176 PHE A CD1 1 
ATOM   1175 C  CD2 . PHE A 1 144 ? 4.660  33.040 185.690 1.00 15.00 ? 176 PHE A CD2 1 
ATOM   1176 C  CE1 . PHE A 1 144 ? 2.550  34.650 186.450 1.00 15.00 ? 176 PHE A CE1 1 
ATOM   1177 C  CE2 . PHE A 1 144 ? 3.500  32.490 186.210 1.00 15.00 ? 176 PHE A CE2 1 
ATOM   1178 C  CZ  . PHE A 1 144 ? 2.440  33.290 186.600 1.00 15.00 ? 176 PHE A CZ  1 
ATOM   1179 N  N   . LEU A 1 145 ? 7.890  34.870 187.510 1.00 15.00 ? 177 LEU A N   1 
ATOM   1180 C  CA  . LEU A 1 145 ? 8.190  34.450 188.880 1.00 15.00 ? 177 LEU A CA  1 
ATOM   1181 C  C   . LEU A 1 145 ? 8.440  35.600 189.840 1.00 15.00 ? 177 LEU A C   1 
ATOM   1182 O  O   . LEU A 1 145 ? 8.030  35.580 191.000 1.00 15.00 ? 177 LEU A O   1 
ATOM   1183 C  CB  . LEU A 1 145 ? 9.430  33.610 189.040 1.00 15.00 ? 177 LEU A CB  1 
ATOM   1184 C  CG  . LEU A 1 145 ? 9.500  32.280 188.410 1.00 15.00 ? 177 LEU A CG  1 
ATOM   1185 C  CD1 . LEU A 1 145 ? 10.460 32.380 187.270 1.00 15.00 ? 177 LEU A CD1 1 
ATOM   1186 C  CD2 . LEU A 1 145 ? 9.970  31.260 189.410 1.00 15.00 ? 177 LEU A CD2 1 
ATOM   1187 N  N   . SER A 1 146 ? 9.090  36.610 189.300 1.00 15.00 ? 178 SER A N   1 
ATOM   1188 C  CA  . SER A 1 146 ? 9.400  37.730 190.120 1.00 15.00 ? 178 SER A CA  1 
ATOM   1189 C  C   . SER A 1 146 ? 8.150  38.500 190.450 1.00 15.00 ? 178 SER A C   1 
ATOM   1190 O  O   . SER A 1 146 ? 7.910  38.740 191.630 1.00 15.00 ? 178 SER A O   1 
ATOM   1191 C  CB  . SER A 1 146 ? 10.390 38.560 189.390 1.00 15.00 ? 178 SER A CB  1 
ATOM   1192 O  OG  . SER A 1 146 ? 11.460 37.720 188.990 1.00 15.00 ? 178 SER A OG  1 
ATOM   1193 N  N   . ARG A 1 147 ? 7.280  38.810 189.470 1.00 15.00 ? 179 ARG A N   1 
ATOM   1194 C  CA  . ARG A 1 147 ? 6.060  39.550 189.760 1.00 15.00 ? 179 ARG A CA  1 
ATOM   1195 C  C   . ARG A 1 147 ? 5.110  38.750 190.670 1.00 15.00 ? 179 ARG A C   1 
ATOM   1196 O  O   . ARG A 1 147 ? 4.500  39.260 191.620 1.00 15.00 ? 179 ARG A O   1 
ATOM   1197 C  CB  . ARG A 1 147 ? 5.310  39.900 188.460 1.00 15.00 ? 179 ARG A CB  1 
ATOM   1198 C  CG  . ARG A 1 147 ? 5.990  40.820 187.430 1.00 15.00 ? 179 ARG A CG  1 
ATOM   1199 C  CD  . ARG A 1 147 ? 5.710  42.360 187.480 1.00 15.00 ? 179 ARG A CD  1 
ATOM   1200 N  NE  . ARG A 1 147 ? 6.670  43.060 186.610 1.00 15.00 ? 179 ARG A NE  1 
ATOM   1201 C  CZ  . ARG A 1 147 ? 7.290  44.260 186.870 1.00 15.00 ? 179 ARG A CZ  1 
ATOM   1202 N  NH1 . ARG A 1 147 ? 7.080  44.980 188.010 1.00 15.00 ? 179 ARG A NH1 1 
ATOM   1203 N  NH2 . ARG A 1 147 ? 8.260  44.680 186.010 1.00 15.00 ? 179 ARG A NH2 1 
ATOM   1204 N  N   . ARG A 1 148 ? 5.030  37.460 190.390 1.00 15.00 ? 180 ARG A N   1 
ATOM   1205 C  CA  . ARG A 1 148 ? 4.130  36.560 191.070 1.00 15.00 ? 180 ARG A CA  1 
ATOM   1206 C  C   . ARG A 1 148 ? 4.570  36.220 192.490 1.00 15.00 ? 180 ARG A C   1 
ATOM   1207 O  O   . ARG A 1 148 ? 3.750  36.150 193.400 1.00 15.00 ? 180 ARG A O   1 
ATOM   1208 C  CB  . ARG A 1 148 ? 4.050  35.330 190.160 1.00 15.00 ? 180 ARG A CB  1 
ATOM   1209 C  CG  . ARG A 1 148 ? 2.910  34.360 190.390 1.00 15.00 ? 180 ARG A CG  1 
ATOM   1210 C  CD  . ARG A 1 148 ? 1.580  35.000 190.030 1.00 15.00 ? 180 ARG A CD  1 
ATOM   1211 N  NE  . ARG A 1 148 ? 0.470  34.150 190.460 1.00 15.00 ? 180 ARG A NE  1 
ATOM   1212 C  CZ  . ARG A 1 148 ? -0.050 34.210 191.690 1.00 15.00 ? 180 ARG A CZ  1 
ATOM   1213 N  NH1 . ARG A 1 148 ? 0.380  35.080 192.620 1.00 15.00 ? 180 ARG A NH1 1 
ATOM   1214 N  NH2 . ARG A 1 148 ? -1.050 33.390 192.000 1.00 15.00 ? 180 ARG A NH2 1 
ATOM   1215 N  N   . PHE A 1 149 ? 5.850  35.990 192.710 1.00 15.00 ? 181 PHE A N   1 
ATOM   1216 C  CA  . PHE A 1 149 ? 6.310  35.560 194.020 1.00 15.00 ? 181 PHE A CA  1 
ATOM   1217 C  C   . PHE A 1 149 ? 7.300  36.480 194.690 1.00 15.00 ? 181 PHE A C   1 
ATOM   1218 O  O   . PHE A 1 149 ? 7.380  36.510 195.920 1.00 15.00 ? 181 PHE A O   1 
ATOM   1219 C  CB  . PHE A 1 149 ? 6.990  34.230 193.960 1.00 15.00 ? 181 PHE A CB  1 
ATOM   1220 C  CG  . PHE A 1 149 ? 6.170  33.100 193.410 1.00 15.00 ? 181 PHE A CG  1 
ATOM   1221 C  CD1 . PHE A 1 149 ? 6.100  32.890 192.050 1.00 15.00 ? 181 PHE A CD1 1 
ATOM   1222 C  CD2 . PHE A 1 149 ? 5.530  32.230 194.280 1.00 15.00 ? 181 PHE A CD2 1 
ATOM   1223 C  CE1 . PHE A 1 149 ? 5.400  31.800 191.560 1.00 15.00 ? 181 PHE A CE1 1 
ATOM   1224 C  CE2 . PHE A 1 149 ? 4.840  31.150 193.770 1.00 15.00 ? 181 PHE A CE2 1 
ATOM   1225 C  CZ  . PHE A 1 149 ? 4.780  30.930 192.410 1.00 15.00 ? 181 PHE A CZ  1 
ATOM   1226 N  N   . LEU A 1 150 ? 8.150  37.220 194.000 1.00 15.00 ? 182 LEU A N   1 
ATOM   1227 C  CA  . LEU A 1 150 ? 9.190  37.980 194.680 1.00 15.00 ? 182 LEU A CA  1 
ATOM   1228 C  C   . LEU A 1 150 ? 8.760  39.350 195.090 1.00 15.00 ? 182 LEU A C   1 
ATOM   1229 O  O   . LEU A 1 150 ? 9.190  39.860 196.120 1.00 15.00 ? 182 LEU A O   1 
ATOM   1230 C  CB  . LEU A 1 150 ? 10.400 38.060 193.780 1.00 15.00 ? 182 LEU A CB  1 
ATOM   1231 C  CG  . LEU A 1 150 ? 11.640 37.240 194.050 1.00 15.00 ? 182 LEU A CG  1 
ATOM   1232 C  CD1 . LEU A 1 150 ? 11.380 35.900 194.700 1.00 15.00 ? 182 LEU A CD1 1 
ATOM   1233 C  CD2 . LEU A 1 150 ? 12.300 37.100 192.710 1.00 15.00 ? 182 LEU A CD2 1 
ATOM   1234 N  N   . LEU A 1 151 ? 7.870  39.890 194.290 1.00 15.00 ? 183 LEU A N   1 
ATOM   1235 C  CA  . LEU A 1 151 ? 7.350  41.220 194.450 1.00 15.00 ? 183 LEU A CA  1 
ATOM   1236 C  C   . LEU A 1 151 ? 6.620  41.570 195.730 1.00 15.00 ? 183 LEU A C   1 
ATOM   1237 O  O   . LEU A 1 151 ? 5.710  40.880 196.190 1.00 15.00 ? 183 LEU A O   1 
ATOM   1238 C  CB  . LEU A 1 151 ? 6.460  41.460 193.260 1.00 15.00 ? 183 LEU A CB  1 
ATOM   1239 C  CG  . LEU A 1 151 ? 5.550  42.670 193.210 1.00 15.00 ? 183 LEU A CG  1 
ATOM   1240 C  CD1 . LEU A 1 151 ? 6.280  43.990 193.360 1.00 15.00 ? 183 LEU A CD1 1 
ATOM   1241 C  CD2 . LEU A 1 151 ? 4.880  42.630 191.860 1.00 15.00 ? 183 LEU A CD2 1 
ATOM   1242 N  N   . ARG A 1 152 ? 7.000  42.720 196.290 1.00 15.00 ? 184 ARG A N   1 
ATOM   1243 C  CA  . ARG A 1 152 ? 6.400  43.190 197.510 1.00 15.00 ? 184 ARG A CA  1 
ATOM   1244 C  C   . ARG A 1 152 ? 4.950  43.540 197.280 1.00 15.00 ? 184 ARG A C   1 
ATOM   1245 O  O   . ARG A 1 152 ? 4.590  44.350 196.420 1.00 15.00 ? 184 ARG A O   1 
ATOM   1246 C  CB  . ARG A 1 152 ? 7.080  44.420 198.020 1.00 15.00 ? 184 ARG A CB  1 
ATOM   1247 C  CG  . ARG A 1 152 ? 6.600  44.710 199.430 1.00 15.00 ? 184 ARG A CG  1 
ATOM   1248 C  CD  . ARG A 1 152 ? 7.770  44.860 200.380 1.00 15.00 ? 184 ARG A CD  1 
ATOM   1249 N  NE  . ARG A 1 152 ? 8.450  46.120 200.180 1.00 15.00 ? 184 ARG A NE  1 
ATOM   1250 C  CZ  . ARG A 1 152 ? 9.710  46.340 200.550 1.00 15.00 ? 184 ARG A CZ  1 
ATOM   1251 N  NH1 . ARG A 1 152 ? 10.480 45.420 201.150 1.00 15.00 ? 184 ARG A NH1 1 
ATOM   1252 N  NH2 . ARG A 1 152 ? 10.190 47.540 200.300 1.00 15.00 ? 184 ARG A NH2 1 
ATOM   1253 N  N   . ARG A 1 153 ? 4.180  42.830 198.090 1.00 15.00 ? 185 ARG A N   1 
ATOM   1254 C  CA  . ARG A 1 153 ? 2.730  43.010 198.140 1.00 15.00 ? 185 ARG A CA  1 
ATOM   1255 C  C   . ARG A 1 153 ? 2.430  44.030 199.250 1.00 15.00 ? 185 ARG A C   1 
ATOM   1256 O  O   . ARG A 1 153 ? 1.800  45.060 199.040 1.00 15.00 ? 185 ARG A O   1 
ATOM   1257 C  CB  . ARG A 1 153 ? 2.120  41.650 198.430 1.00 15.00 ? 185 ARG A CB  1 
ATOM   1258 C  CG  . ARG A 1 153 ? 0.830  41.320 197.710 1.00 15.00 ? 185 ARG A CG  1 
ATOM   1259 C  CD  . ARG A 1 153 ? 0.980  41.130 196.200 1.00 15.00 ? 185 ARG A CD  1 
ATOM   1260 N  NE  . ARG A 1 153 ? 1.880  40.040 195.790 1.00 15.00 ? 185 ARG A NE  1 
ATOM   1261 C  CZ  . ARG A 1 153 ? 1.960  39.660 194.500 1.00 15.00 ? 185 ARG A CZ  1 
ATOM   1262 N  NH1 . ARG A 1 153 ? 1.210  40.250 193.540 1.00 15.00 ? 185 ARG A NH1 1 
ATOM   1263 N  NH2 . ARG A 1 153 ? 2.860  38.760 194.110 1.00 15.00 ? 185 ARG A NH2 1 
ATOM   1264 N  N   . LYS A 1 154 ? 2.880  43.750 200.480 1.00 15.00 ? 186 LYS A N   1 
ATOM   1265 C  CA  . LYS A 1 154 ? 2.690  44.620 201.640 1.00 15.00 ? 186 LYS A CA  1 
ATOM   1266 C  C   . LYS A 1 154 ? 4.030  44.510 202.310 1.00 15.00 ? 186 LYS A C   1 
ATOM   1267 O  O   . LYS A 1 154 ? 4.550  43.400 202.350 1.00 15.00 ? 186 LYS A O   1 
ATOM   1268 C  CB  . LYS A 1 154 ? 1.670  44.090 202.650 1.00 15.00 ? 186 LYS A CB  1 
ATOM   1269 C  CG  . LYS A 1 154 ? 0.200  44.190 202.230 1.00 15.00 ? 186 LYS A CG  1 
ATOM   1270 C  CD  . LYS A 1 154 ? -0.270 43.100 201.240 1.00 15.00 ? 186 LYS A CD  1 
ATOM   1271 C  CE  . LYS A 1 154 ? -1.620 43.450 200.600 1.00 15.00 ? 186 LYS A CE  1 
ATOM   1272 N  NZ  . LYS A 1 154 ? -1.790 42.730 199.340 1.00 15.00 ? 186 LYS A NZ  1 
ATOM   1273 N  N   . PHE A 1 155 ? 4.610  45.600 202.830 1.00 15.00 ? 187 PHE A N   1 
ATOM   1274 C  CA  . PHE A 1 155 ? 5.940  45.570 203.410 1.00 15.00 ? 187 PHE A CA  1 
ATOM   1275 C  C   . PHE A 1 155 ? 6.070  44.710 204.640 1.00 15.00 ? 187 PHE A C   1 
ATOM   1276 O  O   . PHE A 1 155 ? 5.380  44.970 205.630 1.00 15.00 ? 187 PHE A O   1 
ATOM   1277 C  CB  . PHE A 1 155 ? 6.360  46.990 203.760 1.00 15.00 ? 187 PHE A CB  1 
ATOM   1278 C  CG  . PHE A 1 155 ? 7.620  47.100 204.600 1.00 15.00 ? 187 PHE A CG  1 
ATOM   1279 C  CD1 . PHE A 1 155 ? 8.850  46.930 204.010 1.00 15.00 ? 187 PHE A CD1 1 
ATOM   1280 C  CD2 . PHE A 1 155 ? 7.520  47.390 205.950 1.00 15.00 ? 187 PHE A CD2 1 
ATOM   1281 C  CE1 . PHE A 1 155 ? 10.000 47.040 204.780 1.00 15.00 ? 187 PHE A CE1 1 
ATOM   1282 C  CE2 . PHE A 1 155 ? 8.670  47.490 206.710 1.00 15.00 ? 187 PHE A CE2 1 
ATOM   1283 C  CZ  . PHE A 1 155 ? 9.900  47.330 206.130 1.00 15.00 ? 187 PHE A CZ  1 
ATOM   1284 N  N   . ILE A 1 156 ? 6.950  43.730 204.620 1.00 15.00 ? 188 ILE A N   1 
ATOM   1285 C  CA  . ILE A 1 156 ? 7.170  42.960 205.820 1.00 15.00 ? 188 ILE A CA  1 
ATOM   1286 C  C   . ILE A 1 156 ? 8.510  43.420 206.400 1.00 15.00 ? 188 ILE A C   1 
ATOM   1287 O  O   . ILE A 1 156 ? 9.550  43.200 205.770 1.00 15.00 ? 188 ILE A O   1 
ATOM   1288 C  CB  . ILE A 1 156 ? 7.250  41.470 205.520 1.00 15.00 ? 188 ILE A CB  1 
ATOM   1289 C  CG1 . ILE A 1 156 ? 6.120  41.000 204.620 1.00 15.00 ? 188 ILE A CG1 1 
ATOM   1290 C  CG2 . ILE A 1 156 ? 7.150  40.740 206.850 1.00 15.00 ? 188 ILE A CG2 1 
ATOM   1291 C  CD1 . ILE A 1 156 ? 6.420  39.610 204.000 1.00 15.00 ? 188 ILE A CD1 1 
ATOM   1292 N  N   . PRO A 1 157 ? 8.580  44.090 207.550 1.00 15.00 ? 189 PRO A N   1 
ATOM   1293 C  CA  . PRO A 1 157 ? 9.820  44.460 208.180 1.00 15.00 ? 189 PRO A CA  1 
ATOM   1294 C  C   . PRO A 1 157 ? 10.580 43.230 208.640 1.00 15.00 ? 189 PRO A C   1 
ATOM   1295 O  O   . PRO A 1 157 ? 9.990  42.170 208.810 1.00 15.00 ? 189 PRO A O   1 
ATOM   1296 C  CB  . PRO A 1 157 ? 9.410  45.350 209.310 1.00 15.00 ? 189 PRO A CB  1 
ATOM   1297 C  CG  . PRO A 1 157 ? 8.120  44.710 209.730 1.00 15.00 ? 189 PRO A CG  1 
ATOM   1298 C  CD  . PRO A 1 157 ? 7.460  44.450 208.390 1.00 15.00 ? 189 PRO A CD  1 
ATOM   1299 N  N   . ASP A 1 158 ? 11.900 43.330 208.800 1.00 15.00 ? 190 ASP A N   1 
ATOM   1300 C  CA  . ASP A 1 158 ? 12.640 42.230 209.340 1.00 15.00 ? 190 ASP A CA  1 
ATOM   1301 C  C   . ASP A 1 158 ? 12.400 42.170 210.830 1.00 15.00 ? 190 ASP A C   1 
ATOM   1302 O  O   . ASP A 1 158 ? 12.710 43.130 211.540 1.00 15.00 ? 190 ASP A O   1 
ATOM   1303 C  CB  . ASP A 1 158 ? 14.140 42.390 209.120 1.00 15.00 ? 190 ASP A CB  1 
ATOM   1304 C  CG  . ASP A 1 158 ? 14.950 41.510 210.080 1.00 15.00 ? 190 ASP A CG  1 
ATOM   1305 O  OD1 . ASP A 1 158 ? 14.730 40.300 210.160 1.00 15.00 ? 190 ASP A OD1 1 
ATOM   1306 O  OD2 . ASP A 1 158 ? 15.760 42.060 210.810 1.00 15.00 ? 190 ASP A OD2 1 
ATOM   1307 N  N   . PRO A 1 159 ? 12.010 41.000 211.330 1.00 15.00 ? 191 PRO A N   1 
ATOM   1308 C  CA  . PRO A 1 159 ? 11.830 40.730 212.730 1.00 15.00 ? 191 PRO A CA  1 
ATOM   1309 C  C   . PRO A 1 159 ? 13.040 40.930 213.600 1.00 15.00 ? 191 PRO A C   1 
ATOM   1310 O  O   . PRO A 1 159 ? 12.900 41.380 214.730 1.00 15.00 ? 191 PRO A O   1 
ATOM   1311 C  CB  . PRO A 1 159 ? 11.320 39.310 212.750 1.00 15.00 ? 191 PRO A CB  1 
ATOM   1312 C  CG  . PRO A 1 159 ? 11.800 38.740 211.450 1.00 15.00 ? 191 PRO A CG  1 
ATOM   1313 C  CD  . PRO A 1 159 ? 11.520 39.890 210.540 1.00 15.00 ? 191 PRO A CD  1 
ATOM   1314 N  N   . GLN A 1 160 ? 14.250 40.640 213.110 1.00 15.00 ? 192 GLN A N   1 
ATOM   1315 C  CA  . GLN A 1 160 ? 15.450 40.830 213.910 1.00 15.00 ? 192 GLN A CA  1 
ATOM   1316 C  C   . GLN A 1 160 ? 15.690 42.290 214.210 1.00 15.00 ? 192 GLN A C   1 
ATOM   1317 O  O   . GLN A 1 160 ? 16.430 42.630 215.130 1.00 15.00 ? 192 GLN A O   1 
ATOM   1318 C  CB  . GLN A 1 160 ? 16.640 40.250 213.180 1.00 15.00 ? 192 GLN A CB  1 
ATOM   1319 C  CG  . GLN A 1 160 ? 16.640 38.730 213.290 1.00 15.00 ? 192 GLN A CG  1 
ATOM   1320 C  CD  . GLN A 1 160 ? 17.690 38.000 212.460 1.00 15.00 ? 192 GLN A CD  1 
ATOM   1321 O  OE1 . GLN A 1 160 ? 17.330 37.120 211.670 1.00 15.00 ? 192 GLN A OE1 1 
ATOM   1322 N  NE2 . GLN A 1 160 ? 18.980 38.280 212.540 1.00 15.00 ? 192 GLN A NE2 1 
ATOM   1323 N  N   . GLY A 1 161 ? 15.060 43.200 213.470 1.00 15.00 ? 193 GLY A N   1 
ATOM   1324 C  CA  . GLY A 1 161 ? 15.110 44.620 213.770 1.00 15.00 ? 193 GLY A CA  1 
ATOM   1325 C  C   . GLY A 1 161 ? 16.260 45.320 213.120 1.00 15.00 ? 193 GLY A C   1 
ATOM   1326 O  O   . GLY A 1 161 ? 16.860 46.240 213.670 1.00 15.00 ? 193 GLY A O   1 
ATOM   1327 N  N   . THR A 1 162 ? 16.560 44.870 211.930 1.00 15.00 ? 194 THR A N   1 
ATOM   1328 C  CA  . THR A 1 162 ? 17.640 45.420 211.150 1.00 15.00 ? 194 THR A CA  1 
ATOM   1329 C  C   . THR A 1 162 ? 17.140 46.740 210.640 1.00 15.00 ? 194 THR A C   1 
ATOM   1330 O  O   . THR A 1 162 ? 15.950 46.930 210.400 1.00 15.00 ? 194 THR A O   1 
ATOM   1331 C  CB  . THR A 1 162 ? 17.900 44.420 210.070 1.00 15.00 ? 194 THR A CB  1 
ATOM   1332 O  OG1 . THR A 1 162 ? 18.200 43.220 210.770 1.00 15.00 ? 194 THR A OG1 1 
ATOM   1333 C  CG2 . THR A 1 162 ? 18.970 44.830 209.110 1.00 15.00 ? 194 THR A CG2 1 
ATOM   1334 N  N   . ASN A 1 163 ? 18.050 47.680 210.490 1.00 15.00 ? 195 ASN A N   1 
ATOM   1335 C  CA  . ASN A 1 163 ? 17.680 48.990 210.020 1.00 15.00 ? 195 ASN A CA  1 
ATOM   1336 C  C   . ASN A 1 163 ? 18.340 49.310 208.720 1.00 15.00 ? 195 ASN A C   1 
ATOM   1337 O  O   . ASN A 1 163 ? 19.070 48.490 208.160 1.00 15.00 ? 195 ASN A O   1 
ATOM   1338 C  CB  . ASN A 1 163 ? 18.060 50.010 211.050 1.00 15.00 ? 195 ASN A CB  1 
ATOM   1339 C  CG  . ASN A 1 163 ? 19.530 50.010 211.410 1.00 15.00 ? 195 ASN A CG  1 
ATOM   1340 O  OD1 . ASN A 1 163 ? 20.430 49.600 210.660 1.00 15.00 ? 195 ASN A OD1 1 
ATOM   1341 N  ND2 . ASN A 1 163 ? 19.820 50.470 212.600 1.00 15.00 ? 195 ASN A ND2 1 
ATOM   1342 N  N   . LEU A 1 164 ? 18.160 50.520 208.200 1.00 15.00 ? 196 LEU A N   1 
ATOM   1343 C  CA  . LEU A 1 164 ? 18.780 50.830 206.950 1.00 15.00 ? 196 LEU A CA  1 
ATOM   1344 C  C   . LEU A 1 164 ? 20.240 51.110 207.140 1.00 15.00 ? 196 LEU A C   1 
ATOM   1345 O  O   . LEU A 1 164 ? 20.960 50.970 206.150 1.00 15.00 ? 196 LEU A O   1 
ATOM   1346 C  CB  . LEU A 1 164 ? 18.150 52.040 206.260 1.00 15.00 ? 196 LEU A CB  1 
ATOM   1347 C  CG  . LEU A 1 164 ? 16.660 52.100 205.890 1.00 15.00 ? 196 LEU A CG  1 
ATOM   1348 C  CD1 . LEU A 1 164 ? 16.520 52.970 204.670 1.00 15.00 ? 196 LEU A CD1 1 
ATOM   1349 C  CD2 . LEU A 1 164 ? 16.100 50.750 205.520 1.00 15.00 ? 196 LEU A CD2 1 
ATOM   1350 N  N   . MET A 1 165 ? 20.780 51.460 208.300 1.00 15.00 ? 197 MET A N   1 
ATOM   1351 C  CA  . MET A 1 165 ? 22.230 51.640 208.450 1.00 15.00 ? 197 MET A CA  1 
ATOM   1352 C  C   . MET A 1 165 ? 22.920 50.350 208.050 1.00 15.00 ? 197 MET A C   1 
ATOM   1353 O  O   . MET A 1 165 ? 23.930 50.350 207.350 1.00 15.00 ? 197 MET A O   1 
ATOM   1354 C  CB  . MET A 1 165 ? 22.620 51.940 209.870 1.00 15.00 ? 197 MET A CB  1 
ATOM   1355 C  CG  . MET A 1 165 ? 23.010 53.350 210.170 1.00 15.00 ? 197 MET A CG  1 
ATOM   1356 S  SD  . MET A 1 165 ? 24.680 53.800 209.650 1.00 15.00 ? 197 MET A SD  1 
ATOM   1357 C  CE  . MET A 1 165 ? 24.200 54.900 208.350 1.00 15.00 ? 197 MET A CE  1 
ATOM   1358 N  N   . PHE A 1 166 ? 22.300 49.240 208.450 1.00 15.00 ? 198 PHE A N   1 
ATOM   1359 C  CA  . PHE A 1 166 ? 22.740 47.930 208.080 1.00 15.00 ? 198 PHE A CA  1 
ATOM   1360 C  C   . PHE A 1 166 ? 22.460 47.760 206.620 1.00 15.00 ? 198 PHE A C   1 
ATOM   1361 O  O   . PHE A 1 166 ? 23.390 47.370 205.930 1.00 15.00 ? 198 PHE A O   1 
ATOM   1362 C  CB  . PHE A 1 166 ? 21.970 46.910 208.830 1.00 15.00 ? 198 PHE A CB  1 
ATOM   1363 C  CG  . PHE A 1 166 ? 22.380 45.490 208.510 1.00 15.00 ? 198 PHE A CG  1 
ATOM   1364 C  CD1 . PHE A 1 166 ? 21.890 44.830 207.410 1.00 15.00 ? 198 PHE A CD1 1 
ATOM   1365 C  CD2 . PHE A 1 166 ? 23.200 44.820 209.370 1.00 15.00 ? 198 PHE A CD2 1 
ATOM   1366 C  CE1 . PHE A 1 166 ? 22.220 43.520 207.180 1.00 15.00 ? 198 PHE A CE1 1 
ATOM   1367 C  CE2 . PHE A 1 166 ? 23.520 43.510 209.140 1.00 15.00 ? 198 PHE A CE2 1 
ATOM   1368 C  CZ  . PHE A 1 166 ? 23.030 42.850 208.040 1.00 15.00 ? 198 PHE A CZ  1 
ATOM   1369 N  N   . ALA A 1 167 ? 21.270 48.000 206.100 1.00 15.00 ? 199 ALA A N   1 
ATOM   1370 C  CA  . ALA A 1 167 ? 20.990 47.790 204.700 1.00 15.00 ? 199 ALA A CA  1 
ATOM   1371 C  C   . ALA A 1 167 ? 22.020 48.420 203.810 1.00 15.00 ? 199 ALA A C   1 
ATOM   1372 O  O   . ALA A 1 167 ? 22.550 47.790 202.920 1.00 15.00 ? 199 ALA A O   1 
ATOM   1373 C  CB  . ALA A 1 167 ? 19.670 48.390 204.280 1.00 15.00 ? 199 ALA A CB  1 
ATOM   1374 N  N   . PHE A 1 168 ? 22.380 49.650 204.120 1.00 15.00 ? 200 PHE A N   1 
ATOM   1375 C  CA  . PHE A 1 168 ? 23.330 50.360 203.320 1.00 15.00 ? 200 PHE A CA  1 
ATOM   1376 C  C   . PHE A 1 168 ? 24.750 49.940 203.620 1.00 15.00 ? 200 PHE A C   1 
ATOM   1377 O  O   . PHE A 1 168 ? 25.540 49.900 202.680 1.00 15.00 ? 200 PHE A O   1 
ATOM   1378 C  CB  . PHE A 1 168 ? 23.160 51.850 203.520 1.00 15.00 ? 200 PHE A CB  1 
ATOM   1379 C  CG  . PHE A 1 168 ? 21.930 52.420 202.820 1.00 15.00 ? 200 PHE A CG  1 
ATOM   1380 C  CD1 . PHE A 1 168 ? 21.690 52.140 201.480 1.00 15.00 ? 200 PHE A CD1 1 
ATOM   1381 C  CD2 . PHE A 1 168 ? 21.050 53.230 203.510 1.00 15.00 ? 200 PHE A CD2 1 
ATOM   1382 C  CE1 . PHE A 1 168 ? 20.580 52.670 200.840 1.00 15.00 ? 200 PHE A CE1 1 
ATOM   1383 C  CE2 . PHE A 1 168 ? 19.950 53.740 202.860 1.00 15.00 ? 200 PHE A CE2 1 
ATOM   1384 C  CZ  . PHE A 1 168 ? 19.710 53.480 201.530 1.00 15.00 ? 200 PHE A CZ  1 
ATOM   1385 N  N   . PHE A 1 169 ? 25.130 49.540 204.820 1.00 15.00 ? 201 PHE A N   1 
ATOM   1386 C  CA  . PHE A 1 169 ? 26.460 49.060 205.090 1.00 15.00 ? 201 PHE A CA  1 
ATOM   1387 C  C   . PHE A 1 169 ? 26.690 47.880 204.190 1.00 15.00 ? 201 PHE A C   1 
ATOM   1388 O  O   . PHE A 1 169 ? 27.670 47.840 203.460 1.00 15.00 ? 201 PHE A O   1 
ATOM   1389 C  CB  . PHE A 1 169 ? 26.630 48.590 206.510 1.00 15.00 ? 201 PHE A CB  1 
ATOM   1390 C  CG  . PHE A 1 169 ? 28.070 48.250 206.830 1.00 15.00 ? 201 PHE A CG  1 
ATOM   1391 C  CD1 . PHE A 1 169 ? 28.930 49.250 207.220 1.00 15.00 ? 201 PHE A CD1 1 
ATOM   1392 C  CD2 . PHE A 1 169 ? 28.520 46.960 206.730 1.00 15.00 ? 201 PHE A CD2 1 
ATOM   1393 C  CE1 . PHE A 1 169 ? 30.240 48.960 207.500 1.00 15.00 ? 201 PHE A CE1 1 
ATOM   1394 C  CE2 . PHE A 1 169 ? 29.830 46.670 207.010 1.00 15.00 ? 201 PHE A CE2 1 
ATOM   1395 C  CZ  . PHE A 1 169 ? 30.690 47.670 207.400 1.00 15.00 ? 201 PHE A CZ  1 
ATOM   1396 N  N   . ALA A 1 170 ? 25.740 46.960 204.210 1.00 15.00 ? 202 ALA A N   1 
ATOM   1397 C  CA  . ALA A 1 170 ? 25.780 45.770 203.400 1.00 15.00 ? 202 ALA A CA  1 
ATOM   1398 C  C   . ALA A 1 170 ? 25.910 46.090 201.930 1.00 15.00 ? 202 ALA A C   1 
ATOM   1399 O  O   . ALA A 1 170 ? 26.610 45.390 201.210 1.00 15.00 ? 202 ALA A O   1 
ATOM   1400 C  CB  . ALA A 1 170 ? 24.520 44.960 203.550 1.00 15.00 ? 202 ALA A CB  1 
ATOM   1401 N  N   . GLN A 1 171 ? 25.260 47.140 201.460 1.00 15.00 ? 203 GLN A N   1 
ATOM   1402 C  CA  . GLN A 1 171 ? 25.320 47.480 200.060 1.00 15.00 ? 203 GLN A CA  1 
ATOM   1403 C  C   . GLN A 1 171 ? 26.730 47.920 199.780 1.00 15.00 ? 203 GLN A C   1 
ATOM   1404 O  O   . GLN A 1 171 ? 27.420 47.300 198.990 1.00 15.00 ? 203 GLN A O   1 
ATOM   1405 C  CB  . GLN A 1 171 ? 24.360 48.590 199.730 1.00 15.00 ? 203 GLN A CB  1 
ATOM   1406 C  CG  . GLN A 1 171 ? 24.150 48.680 198.230 1.00 15.00 ? 203 GLN A CG  1 
ATOM   1407 C  CD  . GLN A 1 171 ? 23.070 49.660 197.790 1.00 15.00 ? 203 GLN A CD  1 
ATOM   1408 O  OE1 . GLN A 1 171 ? 23.060 50.130 196.650 1.00 15.00 ? 203 GLN A OE1 1 
ATOM   1409 N  NE2 . GLN A 1 171 ? 22.090 50.020 198.600 1.00 15.00 ? 203 GLN A NE2 1 
ATOM   1410 N  N   . HIS A 1 172 ? 27.200 48.910 200.500 1.00 15.00 ? 204 HIS A N   1 
ATOM   1411 C  CA  . HIS A 1 172 ? 28.530 49.440 200.320 1.00 15.00 ? 204 HIS A CA  1 
ATOM   1412 C  C   . HIS A 1 172 ? 29.610 48.360 200.320 1.00 15.00 ? 204 HIS A C   1 
ATOM   1413 O  O   . HIS A 1 172 ? 30.360 48.220 199.350 1.00 15.00 ? 204 HIS A O   1 
ATOM   1414 C  CB  . HIS A 1 172 ? 28.760 50.440 201.430 1.00 15.00 ? 204 HIS A CB  1 
ATOM   1415 C  CG  . HIS A 1 172 ? 30.090 51.140 201.590 1.00 15.00 ? 204 HIS A CG  1 
ATOM   1416 N  ND1 . HIS A 1 172 ? 31.020 50.890 202.610 1.00 15.00 ? 204 HIS A ND1 1 
ATOM   1417 C  CD2 . HIS A 1 172 ? 30.510 52.150 200.730 1.00 15.00 ? 204 HIS A CD2 1 
ATOM   1418 C  CE1 . HIS A 1 172 ? 31.990 51.780 202.340 1.00 15.00 ? 204 HIS A CE1 1 
ATOM   1419 N  NE2 . HIS A 1 172 ? 31.730 52.520 201.290 1.00 15.00 ? 204 HIS A NE2 1 
ATOM   1420 N  N   . PHE A 1 173 ? 29.570 47.550 201.380 1.00 15.00 ? 205 PHE A N   1 
ATOM   1421 C  CA  . PHE A 1 173 ? 30.540 46.530 201.640 1.00 15.00 ? 205 PHE A CA  1 
ATOM   1422 C  C   . PHE A 1 173 ? 30.580 45.600 200.460 1.00 15.00 ? 205 PHE A C   1 
ATOM   1423 O  O   . PHE A 1 173 ? 31.560 45.520 199.760 1.00 15.00 ? 205 PHE A O   1 
ATOM   1424 C  CB  . PHE A 1 173 ? 30.140 45.810 202.890 1.00 15.00 ? 205 PHE A CB  1 
ATOM   1425 C  CG  . PHE A 1 173 ? 31.040 44.640 203.240 1.00 15.00 ? 205 PHE A CG  1 
ATOM   1426 C  CD1 . PHE A 1 173 ? 32.350 44.850 203.600 1.00 15.00 ? 205 PHE A CD1 1 
ATOM   1427 C  CD2 . PHE A 1 173 ? 30.530 43.360 203.230 1.00 15.00 ? 205 PHE A CD2 1 
ATOM   1428 C  CE1 . PHE A 1 173 ? 33.140 43.780 203.960 1.00 15.00 ? 205 PHE A CE1 1 
ATOM   1429 C  CE2 . PHE A 1 173 ? 31.330 42.300 203.580 1.00 15.00 ? 205 PHE A CE2 1 
ATOM   1430 C  CZ  . PHE A 1 173 ? 32.630 42.520 203.950 1.00 15.00 ? 205 PHE A CZ  1 
ATOM   1431 N  N   . THR A 1 174 ? 29.470 45.000 200.160 1.00 15.00 ? 206 THR A N   1 
ATOM   1432 C  CA  . THR A 1 174 ? 29.350 44.080 199.070 1.00 15.00 ? 206 THR A CA  1 
ATOM   1433 C  C   . THR A 1 174 ? 29.850 44.600 197.730 1.00 15.00 ? 206 THR A C   1 
ATOM   1434 O  O   . THR A 1 174 ? 30.500 43.880 196.960 1.00 15.00 ? 206 THR A O   1 
ATOM   1435 C  CB  . THR A 1 174 ? 27.900 43.770 199.150 1.00 15.00 ? 206 THR A CB  1 
ATOM   1436 O  OG1 . THR A 1 174 ? 27.870 42.900 200.270 1.00 15.00 ? 206 THR A OG1 1 
ATOM   1437 C  CG2 . THR A 1 174 ? 27.260 43.240 197.930 1.00 15.00 ? 206 THR A CG2 1 
ATOM   1438 N  N   . HIS A 1 175 ? 29.710 45.880 197.470 1.00 15.00 ? 207 HIS A N   1 
ATOM   1439 C  CA  . HIS A 1 175 ? 30.090 46.420 196.190 1.00 15.00 ? 207 HIS A CA  1 
ATOM   1440 C  C   . HIS A 1 175 ? 31.580 46.650 195.990 1.00 15.00 ? 207 HIS A C   1 
ATOM   1441 O  O   . HIS A 1 175 ? 31.980 47.290 195.020 1.00 15.00 ? 207 HIS A O   1 
ATOM   1442 C  CB  . HIS A 1 175 ? 29.300 47.690 195.990 1.00 15.00 ? 207 HIS A CB  1 
ATOM   1443 C  CG  . HIS A 1 175 ? 27.910 47.240 195.570 1.00 15.00 ? 207 HIS A CG  1 
ATOM   1444 N  ND1 . HIS A 1 175 ? 27.300 47.600 194.380 1.00 15.00 ? 207 HIS A ND1 1 
ATOM   1445 C  CD2 . HIS A 1 175 ? 27.080 46.380 196.280 1.00 15.00 ? 207 HIS A CD2 1 
ATOM   1446 C  CE1 . HIS A 1 175 ? 26.090 46.980 194.400 1.00 15.00 ? 207 HIS A CE1 1 
ATOM   1447 N  NE2 . HIS A 1 175 ? 25.950 46.270 195.470 1.00 15.00 ? 207 HIS A NE2 1 
ATOM   1448 N  N   . GLN A 1 176 ? 32.430 46.140 196.880 1.00 15.00 ? 208 GLN A N   1 
ATOM   1449 C  CA  . GLN A 1 176 ? 33.860 46.210 196.700 1.00 15.00 ? 208 GLN A CA  1 
ATOM   1450 C  C   . GLN A 1 176 ? 34.350 44.910 196.130 1.00 15.00 ? 208 GLN A C   1 
ATOM   1451 O  O   . GLN A 1 176 ? 35.490 44.840 195.700 1.00 15.00 ? 208 GLN A O   1 
ATOM   1452 C  CB  . GLN A 1 176 ? 34.580 46.450 198.000 1.00 15.00 ? 208 GLN A CB  1 
ATOM   1453 C  CG  . GLN A 1 176 ? 34.710 45.260 198.900 1.00 15.00 ? 208 GLN A CG  1 
ATOM   1454 C  CD  . GLN A 1 176 ? 35.200 45.640 200.260 1.00 15.00 ? 208 GLN A CD  1 
ATOM   1455 O  OE1 . GLN A 1 176 ? 34.510 45.510 201.250 1.00 15.00 ? 208 GLN A OE1 1 
ATOM   1456 N  NE2 . GLN A 1 176 ? 36.420 46.090 200.400 1.00 15.00 ? 208 GLN A NE2 1 
ATOM   1457 N  N   . PHE A 1 177 ? 33.570 43.840 196.230 1.00 15.00 ? 209 PHE A N   1 
ATOM   1458 C  CA  . PHE A 1 177 ? 33.990 42.600 195.610 1.00 15.00 ? 209 PHE A CA  1 
ATOM   1459 C  C   . PHE A 1 177 ? 33.020 42.100 194.570 1.00 15.00 ? 209 PHE A C   1 
ATOM   1460 O  O   . PHE A 1 177 ? 33.370 41.220 193.770 1.00 15.00 ? 209 PHE A O   1 
ATOM   1461 C  CB  . PHE A 1 177 ? 34.200 41.510 196.650 1.00 15.00 ? 209 PHE A CB  1 
ATOM   1462 C  CG  . PHE A 1 177 ? 33.290 41.360 197.840 1.00 15.00 ? 209 PHE A CG  1 
ATOM   1463 C  CD1 . PHE A 1 177 ? 32.120 40.660 197.740 1.00 15.00 ? 209 PHE A CD1 1 
ATOM   1464 C  CD2 . PHE A 1 177 ? 33.670 41.890 199.050 1.00 15.00 ? 209 PHE A CD2 1 
ATOM   1465 C  CE1 . PHE A 1 177 ? 31.330 40.490 198.870 1.00 15.00 ? 209 PHE A CE1 1 
ATOM   1466 C  CE2 . PHE A 1 177 ? 32.890 41.710 200.160 1.00 15.00 ? 209 PHE A CE2 1 
ATOM   1467 C  CZ  . PHE A 1 177 ? 31.720 41.010 200.070 1.00 15.00 ? 209 PHE A CZ  1 
ATOM   1468 N  N   . PHE A 1 178 ? 31.800 42.620 194.510 1.00 15.00 ? 210 PHE A N   1 
ATOM   1469 C  CA  . PHE A 1 178 ? 30.900 42.240 193.460 1.00 15.00 ? 210 PHE A CA  1 
ATOM   1470 C  C   . PHE A 1 178 ? 30.890 43.410 192.530 1.00 15.00 ? 210 PHE A C   1 
ATOM   1471 O  O   . PHE A 1 178 ? 30.490 44.520 192.900 1.00 15.00 ? 210 PHE A O   1 
ATOM   1472 C  CB  . PHE A 1 178 ? 29.560 42.010 194.030 1.00 15.00 ? 210 PHE A CB  1 
ATOM   1473 C  CG  . PHE A 1 178 ? 29.510 40.800 194.930 1.00 15.00 ? 210 PHE A CG  1 
ATOM   1474 C  CD1 . PHE A 1 178 ? 30.300 39.690 194.700 1.00 15.00 ? 210 PHE A CD1 1 
ATOM   1475 C  CD2 . PHE A 1 178 ? 28.640 40.810 195.990 1.00 15.00 ? 210 PHE A CD2 1 
ATOM   1476 C  CE1 . PHE A 1 178 ? 30.190 38.600 195.530 1.00 15.00 ? 210 PHE A CE1 1 
ATOM   1477 C  CE2 . PHE A 1 178 ? 28.530 39.710 196.810 1.00 15.00 ? 210 PHE A CE2 1 
ATOM   1478 C  CZ  . PHE A 1 178 ? 29.310 38.610 196.580 1.00 15.00 ? 210 PHE A CZ  1 
ATOM   1479 N  N   . LYS A 1 179 ? 31.480 43.200 191.370 1.00 15.00 ? 211 LYS A N   1 
ATOM   1480 C  CA  . LYS A 1 179 ? 31.500 44.220 190.340 1.00 15.00 ? 211 LYS A CA  1 
ATOM   1481 C  C   . LYS A 1 179 ? 31.480 43.430 189.050 1.00 15.00 ? 211 LYS A C   1 
ATOM   1482 O  O   . LYS A 1 179 ? 32.550 43.200 188.450 1.00 15.00 ? 211 LYS A O   1 
ATOM   1483 C  CB  . LYS A 1 179 ? 32.770 45.090 190.320 1.00 15.00 ? 211 LYS A CB  1 
ATOM   1484 C  CG  . LYS A 1 179 ? 33.080 46.160 191.370 1.00 15.00 ? 211 LYS A CG  1 
ATOM   1485 C  CD  . LYS A 1 179 ? 34.020 47.200 190.730 1.00 15.00 ? 211 LYS A CD  1 
ATOM   1486 C  CE  . LYS A 1 179 ? 34.660 48.210 191.690 1.00 15.00 ? 211 LYS A CE  1 
ATOM   1487 N  NZ  . LYS A 1 179 ? 35.380 49.220 190.940 1.00 15.00 ? 211 LYS A NZ  1 
ATOM   1488 N  N   . THR A 1 180 ? 30.330 42.920 188.610 1.00 15.00 ? 212 THR A N   1 
ATOM   1489 C  CA  . THR A 1 180 ? 30.270 42.170 187.380 1.00 15.00 ? 212 THR A CA  1 
ATOM   1490 C  C   . THR A 1 180 ? 30.610 43.100 186.240 1.00 15.00 ? 212 THR A C   1 
ATOM   1491 O  O   . THR A 1 180 ? 30.130 44.230 186.140 1.00 15.00 ? 212 THR A O   1 
ATOM   1492 C  CB  . THR A 1 180 ? 28.880 41.590 187.230 1.00 15.00 ? 212 THR A CB  1 
ATOM   1493 O  OG1 . THR A 1 180 ? 28.700 40.810 188.390 1.00 15.00 ? 212 THR A OG1 1 
ATOM   1494 C  CG2 . THR A 1 180 ? 28.690 40.720 186.000 1.00 15.00 ? 212 THR A CG2 1 
ATOM   1495 N  N   . SER A 1 181 ? 31.500 42.590 185.400 1.00 15.00 ? 213 SER A N   1 
ATOM   1496 C  CA  . SER A 1 181 ? 32.090 43.290 184.280 1.00 15.00 ? 213 SER A CA  1 
ATOM   1497 C  C   . SER A 1 181 ? 31.160 43.990 183.320 1.00 15.00 ? 213 SER A C   1 
ATOM   1498 O  O   . SER A 1 181 ? 31.500 45.060 182.760 1.00 15.00 ? 213 SER A O   1 
ATOM   1499 C  CB  . SER A 1 181 ? 32.940 42.340 183.470 1.00 15.00 ? 213 SER A CB  1 
ATOM   1500 O  OG  . SER A 1 181 ? 33.420 42.870 182.240 1.00 15.00 ? 213 SER A OG  1 
ATOM   1501 N  N   . GLY A 1 182 ? 30.010 43.370 183.040 1.00 15.00 ? 214 GLY A N   1 
ATOM   1502 C  CA  . GLY A 1 182 ? 29.110 43.970 182.070 1.00 15.00 ? 214 GLY A CA  1 
ATOM   1503 C  C   . GLY A 1 182 ? 29.800 43.810 180.730 1.00 15.00 ? 214 GLY A C   1 
ATOM   1504 O  O   . GLY A 1 182 ? 29.600 42.760 180.130 1.00 15.00 ? 214 GLY A O   1 
ATOM   1505 N  N   . LYS A 1 183 ? 30.710 44.720 180.330 1.00 15.00 ? 215 LYS A N   1 
ATOM   1506 C  CA  . LYS A 1 183 ? 31.380 44.650 179.030 1.00 15.00 ? 215 LYS A CA  1 
ATOM   1507 C  C   . LYS A 1 183 ? 32.050 43.300 178.660 1.00 15.00 ? 215 LYS A C   1 
ATOM   1508 O  O   . LYS A 1 183 ? 32.280 43.040 177.470 1.00 15.00 ? 215 LYS A O   1 
ATOM   1509 C  CB  . LYS A 1 183 ? 32.380 45.850 178.970 1.00 15.00 ? 215 LYS A CB  1 
ATOM   1510 C  CG  . LYS A 1 183 ? 33.890 45.650 178.730 1.00 15.00 ? 215 LYS A CG  1 
ATOM   1511 C  CD  . LYS A 1 183 ? 34.650 45.230 180.010 1.00 15.00 ? 215 LYS A CD  1 
ATOM   1512 C  CE  . LYS A 1 183 ? 34.590 46.300 181.130 1.00 15.00 ? 215 LYS A CE  1 
ATOM   1513 N  NZ  . LYS A 1 183 ? 35.170 45.810 182.380 1.00 15.00 ? 215 LYS A NZ  1 
ATOM   1514 N  N   . MET A 1 184 ? 32.410 42.450 179.630 1.00 15.00 ? 216 MET A N   1 
ATOM   1515 C  CA  . MET A 1 184 ? 32.870 41.100 179.300 1.00 15.00 ? 216 MET A CA  1 
ATOM   1516 C  C   . MET A 1 184 ? 31.740 40.080 179.450 1.00 15.00 ? 216 MET A C   1 
ATOM   1517 O  O   . MET A 1 184 ? 31.700 39.030 178.790 1.00 15.00 ? 216 MET A O   1 
ATOM   1518 C  CB  . MET A 1 184 ? 34.010 40.650 180.200 1.00 15.00 ? 216 MET A CB  1 
ATOM   1519 C  CG  . MET A 1 184 ? 35.350 41.300 179.920 1.00 15.00 ? 216 MET A CG  1 
ATOM   1520 S  SD  . MET A 1 184 ? 36.640 40.710 181.040 1.00 15.00 ? 216 MET A SD  1 
ATOM   1521 C  CE  . MET A 1 184 ? 36.510 41.880 182.370 1.00 15.00 ? 216 MET A CE  1 
ATOM   1522 N  N   . GLY A 1 185 ? 30.820 40.360 180.360 1.00 15.00 ? 217 GLY A N   1 
ATOM   1523 C  CA  . GLY A 1 185 ? 29.710 39.470 180.560 1.00 15.00 ? 217 GLY A CA  1 
ATOM   1524 C  C   . GLY A 1 185 ? 29.650 39.010 182.000 1.00 15.00 ? 217 GLY A C   1 
ATOM   1525 O  O   . GLY A 1 185 ? 30.280 39.600 182.880 1.00 15.00 ? 217 GLY A O   1 
ATOM   1526 N  N   . PRO A 1 186 ? 28.780 38.030 182.250 1.00 15.00 ? 218 PRO A N   1 
ATOM   1527 C  CA  . PRO A 1 186 ? 28.650 37.350 183.520 1.00 15.00 ? 218 PRO A CA  1 
ATOM   1528 C  C   . PRO A 1 186 ? 29.840 36.420 183.600 1.00 15.00 ? 218 PRO A C   1 
ATOM   1529 O  O   . PRO A 1 186 ? 30.310 35.900 182.580 1.00 15.00 ? 218 PRO A O   1 
ATOM   1530 C  CB  . PRO A 1 186 ? 27.320 36.680 183.400 1.00 15.00 ? 218 PRO A CB  1 
ATOM   1531 C  CG  . PRO A 1 186 ? 26.610 37.420 182.290 1.00 15.00 ? 218 PRO A CG  1 
ATOM   1532 C  CD  . PRO A 1 186 ? 27.750 37.570 181.320 1.00 15.00 ? 218 PRO A CD  1 
ATOM   1533 N  N   . GLY A 1 187 ? 30.210 36.110 184.840 1.00 15.00 ? 219 GLY A N   1 
ATOM   1534 C  CA  . GLY A 1 187 ? 31.560 35.610 185.110 1.00 15.00 ? 219 GLY A CA  1 
ATOM   1535 C  C   . GLY A 1 187 ? 32.270 36.960 185.160 1.00 15.00 ? 219 GLY A C   1 
ATOM   1536 O  O   . GLY A 1 187 ? 31.610 38.000 185.250 1.00 15.00 ? 219 GLY A O   1 
ATOM   1537 N  N   . PHE A 1 188 ? 33.570 37.100 185.130 1.00 15.00 ? 220 PHE A N   1 
ATOM   1538 C  CA  . PHE A 1 188 ? 34.200 38.430 185.040 1.00 15.00 ? 220 PHE A CA  1 
ATOM   1539 C  C   . PHE A 1 188 ? 33.930 39.520 186.070 1.00 15.00 ? 220 PHE A C   1 
ATOM   1540 O  O   . PHE A 1 188 ? 32.930 40.240 186.030 1.00 15.00 ? 220 PHE A O   1 
ATOM   1541 C  CB  . PHE A 1 188 ? 33.920 39.010 183.660 1.00 15.00 ? 220 PHE A CB  1 
ATOM   1542 C  CG  . PHE A 1 188 ? 34.280 38.020 182.580 1.00 15.00 ? 220 PHE A CG  1 
ATOM   1543 C  CD1 . PHE A 1 188 ? 35.600 37.780 182.280 1.00 15.00 ? 220 PHE A CD1 1 
ATOM   1544 C  CD2 . PHE A 1 188 ? 33.280 37.350 181.940 1.00 15.00 ? 220 PHE A CD2 1 
ATOM   1545 C  CE1 . PHE A 1 188 ? 35.910 36.850 181.340 1.00 15.00 ? 220 PHE A CE1 1 
ATOM   1546 C  CE2 . PHE A 1 188 ? 33.610 36.420 180.990 1.00 15.00 ? 220 PHE A CE2 1 
ATOM   1547 C  CZ  . PHE A 1 188 ? 34.920 36.170 180.690 1.00 15.00 ? 220 PHE A CZ  1 
ATOM   1548 N  N   . THR A 1 189 ? 34.850 39.650 187.010 1.00 15.00 ? 221 THR A N   1 
ATOM   1549 C  CA  . THR A 1 189 ? 34.800 40.680 188.010 1.00 15.00 ? 221 THR A CA  1 
ATOM   1550 C  C   . THR A 1 189 ? 35.830 41.630 187.510 1.00 15.00 ? 221 THR A C   1 
ATOM   1551 O  O   . THR A 1 189 ? 36.870 41.310 186.920 1.00 15.00 ? 221 THR A O   1 
ATOM   1552 C  CB  . THR A 1 189 ? 35.290 40.280 189.390 1.00 15.00 ? 221 THR A CB  1 
ATOM   1553 O  OG1 . THR A 1 189 ? 35.310 38.870 189.370 1.00 15.00 ? 221 THR A OG1 1 
ATOM   1554 C  CG2 . THR A 1 189 ? 34.440 40.780 190.530 1.00 15.00 ? 221 THR A CG2 1 
ATOM   1555 N  N   . LYS A 1 190 ? 35.430 42.860 187.770 1.00 15.00 ? 222 LYS A N   1 
ATOM   1556 C  CA  . LYS A 1 190 ? 36.280 44.010 187.560 1.00 15.00 ? 222 LYS A CA  1 
ATOM   1557 C  C   . LYS A 1 190 ? 36.970 44.270 188.900 1.00 15.00 ? 222 LYS A C   1 
ATOM   1558 O  O   . LYS A 1 190 ? 37.970 44.970 188.990 1.00 15.00 ? 222 LYS A O   1 
ATOM   1559 C  CB  . LYS A 1 190 ? 35.390 45.150 187.130 1.00 15.00 ? 222 LYS A CB  1 
ATOM   1560 C  CG  . LYS A 1 190 ? 36.140 46.310 186.540 1.00 15.00 ? 222 LYS A CG  1 
ATOM   1561 C  CD  . LYS A 1 190 ? 35.200 47.100 185.650 1.00 15.00 ? 222 LYS A CD  1 
ATOM   1562 C  CE  . LYS A 1 190 ? 35.950 48.280 184.990 1.00 15.00 ? 222 LYS A CE  1 
ATOM   1563 N  NZ  . LYS A 1 190 ? 36.990 47.850 184.040 1.00 15.00 ? 222 LYS A NZ  1 
ATOM   1564 N  N   . ALA A 1 191 ? 36.420 43.690 189.970 1.00 15.00 ? 223 ALA A N   1 
ATOM   1565 C  CA  . ALA A 1 191 ? 36.970 43.830 191.290 1.00 15.00 ? 223 ALA A CA  1 
ATOM   1566 C  C   . ALA A 1 191 ? 37.870 42.670 191.500 1.00 15.00 ? 223 ALA A C   1 
ATOM   1567 O  O   . ALA A 1 191 ? 37.560 41.690 192.200 1.00 15.00 ? 223 ALA A O   1 
ATOM   1568 C  CB  . ALA A 1 191 ? 35.900 43.790 192.350 1.00 15.00 ? 223 ALA A CB  1 
ATOM   1569 N  N   . LEU A 1 192 ? 39.000 42.760 190.800 1.00 15.00 ? 224 LEU A N   1 
ATOM   1570 C  CA  . LEU A 1 192 ? 40.060 41.780 190.930 1.00 15.00 ? 224 LEU A CA  1 
ATOM   1571 C  C   . LEU A 1 192 ? 40.620 42.030 192.320 1.00 15.00 ? 224 LEU A C   1 
ATOM   1572 O  O   . LEU A 1 192 ? 40.430 43.130 192.860 1.00 15.00 ? 224 LEU A O   1 
ATOM   1573 C  CB  . LEU A 1 192 ? 41.140 42.000 189.920 1.00 15.00 ? 224 LEU A CB  1 
ATOM   1574 C  CG  . LEU A 1 192 ? 40.650 42.100 188.500 1.00 15.00 ? 224 LEU A CG  1 
ATOM   1575 C  CD1 . LEU A 1 192 ? 40.630 43.540 188.060 1.00 15.00 ? 224 LEU A CD1 1 
ATOM   1576 C  CD2 . LEU A 1 192 ? 41.600 41.380 187.600 1.00 15.00 ? 224 LEU A CD2 1 
ATOM   1577 N  N   . GLY A 1 193 ? 41.290 41.110 192.980 1.00 15.00 ? 225 GLY A N   1 
ATOM   1578 C  CA  . GLY A 1 193 ? 41.620 41.400 194.380 1.00 15.00 ? 225 GLY A CA  1 
ATOM   1579 C  C   . GLY A 1 193 ? 40.620 40.690 195.270 1.00 15.00 ? 225 GLY A C   1 
ATOM   1580 O  O   . GLY A 1 193 ? 40.850 40.460 196.450 1.00 15.00 ? 225 GLY A O   1 
ATOM   1581 N  N   . HIS A 1 194 ? 39.440 40.480 194.690 1.00 15.00 ? 226 HIS A N   1 
ATOM   1582 C  CA  . HIS A 1 194 ? 38.520 39.460 195.160 1.00 15.00 ? 226 HIS A CA  1 
ATOM   1583 C  C   . HIS A 1 194 ? 38.110 39.370 196.590 1.00 15.00 ? 226 HIS A C   1 
ATOM   1584 O  O   . HIS A 1 194 ? 37.740 38.310 197.070 1.00 15.00 ? 226 HIS A O   1 
ATOM   1585 C  CB  . HIS A 1 194 ? 39.060 38.090 194.740 1.00 15.00 ? 226 HIS A CB  1 
ATOM   1586 C  CG  . HIS A 1 194 ? 38.720 37.760 193.310 1.00 15.00 ? 226 HIS A CG  1 
ATOM   1587 N  ND1 . HIS A 1 194 ? 39.060 38.470 192.170 1.00 15.00 ? 226 HIS A ND1 1 
ATOM   1588 C  CD2 . HIS A 1 194 ? 37.950 36.670 192.980 1.00 15.00 ? 226 HIS A CD2 1 
ATOM   1589 C  CE1 . HIS A 1 194 ? 38.490 37.800 191.160 1.00 15.00 ? 226 HIS A CE1 1 
ATOM   1590 N  NE2 . HIS A 1 194 ? 37.850 36.760 191.590 1.00 15.00 ? 226 HIS A NE2 1 
ATOM   1591 N  N   . GLY A 1 195 ? 38.090 40.490 197.280 1.00 15.00 ? 227 GLY A N   1 
ATOM   1592 C  CA  . GLY A 1 195 ? 37.700 40.430 198.660 1.00 15.00 ? 227 GLY A CA  1 
ATOM   1593 C  C   . GLY A 1 195 ? 37.710 41.820 199.210 1.00 15.00 ? 227 GLY A C   1 
ATOM   1594 O  O   . GLY A 1 195 ? 37.430 42.790 198.510 1.00 15.00 ? 227 GLY A O   1 
ATOM   1595 N  N   . VAL A 1 196 ? 38.130 41.900 200.480 1.00 15.00 ? 228 VAL A N   1 
ATOM   1596 C  CA  . VAL A 1 196 ? 38.130 43.170 201.140 1.00 15.00 ? 228 VAL A CA  1 
ATOM   1597 C  C   . VAL A 1 196 ? 39.400 43.970 200.840 1.00 15.00 ? 228 VAL A C   1 
ATOM   1598 O  O   . VAL A 1 196 ? 40.140 44.410 201.700 1.00 15.00 ? 228 VAL A O   1 
ATOM   1599 C  CB  . VAL A 1 196 ? 37.920 42.930 202.670 1.00 15.00 ? 228 VAL A CB  1 
ATOM   1600 C  CG1 . VAL A 1 196 ? 37.410 44.220 203.260 1.00 15.00 ? 228 VAL A CG1 1 
ATOM   1601 C  CG2 . VAL A 1 196 ? 36.870 41.880 202.980 1.00 15.00 ? 228 VAL A CG2 1 
ATOM   1602 N  N   . ASP A 1 197 ? 39.700 44.160 199.560 1.00 15.00 ? 229 ASP A N   1 
ATOM   1603 C  CA  . ASP A 1 197 ? 40.730 45.080 199.130 1.00 15.00 ? 229 ASP A CA  1 
ATOM   1604 C  C   . ASP A 1 197 ? 39.870 46.310 199.270 1.00 15.00 ? 229 ASP A C   1 
ATOM   1605 O  O   . ASP A 1 197 ? 38.780 46.260 198.700 1.00 15.00 ? 229 ASP A O   1 
ATOM   1606 C  CB  . ASP A 1 197 ? 41.130 44.860 197.640 1.00 15.00 ? 229 ASP A CB  1 
ATOM   1607 C  CG  . ASP A 1 197 ? 40.110 45.060 196.490 1.00 15.00 ? 229 ASP A CG  1 
ATOM   1608 O  OD1 . ASP A 1 197 ? 39.210 44.230 196.330 1.00 15.00 ? 229 ASP A OD1 1 
ATOM   1609 O  OD2 . ASP A 1 197 ? 40.210 46.050 195.760 1.00 15.00 ? 229 ASP A OD2 1 
ATOM   1610 N  N   . LEU A 1 198 ? 40.110 47.400 199.960 1.00 15.00 ? 230 LEU A N   1 
ATOM   1611 C  CA  . LEU A 1 198 ? 39.070 48.410 200.020 1.00 15.00 ? 230 LEU A CA  1 
ATOM   1612 C  C   . LEU A 1 198 ? 38.900 49.220 198.740 1.00 15.00 ? 230 LEU A C   1 
ATOM   1613 O  O   . LEU A 1 198 ? 38.700 50.440 198.740 1.00 15.00 ? 230 LEU A O   1 
ATOM   1614 C  CB  . LEU A 1 198 ? 39.350 49.280 201.210 1.00 15.00 ? 230 LEU A CB  1 
ATOM   1615 C  CG  . LEU A 1 198 ? 39.120 48.660 202.570 1.00 15.00 ? 230 LEU A CG  1 
ATOM   1616 C  CD1 . LEU A 1 198 ? 39.310 49.710 203.630 1.00 15.00 ? 230 LEU A CD1 1 
ATOM   1617 C  CD2 . LEU A 1 198 ? 37.710 48.170 202.690 1.00 15.00 ? 230 LEU A CD2 1 
ATOM   1618 N  N   . GLY A 1 199 ? 38.870 48.590 197.570 1.00 15.00 ? 231 GLY A N   1 
ATOM   1619 C  CA  . GLY A 1 199 ? 38.780 49.240 196.290 1.00 15.00 ? 231 GLY A CA  1 
ATOM   1620 C  C   . GLY A 1 199 ? 37.500 50.010 196.090 1.00 15.00 ? 231 GLY A C   1 
ATOM   1621 O  O   . GLY A 1 199 ? 37.350 50.670 195.070 1.00 15.00 ? 231 GLY A O   1 
ATOM   1622 N  N   . HIS A 1 200 ? 36.560 49.950 197.020 1.00 15.00 ? 232 HIS A N   1 
ATOM   1623 C  CA  . HIS A 1 200 ? 35.390 50.790 196.880 1.00 15.00 ? 232 HIS A CA  1 
ATOM   1624 C  C   . HIS A 1 200 ? 35.700 52.200 197.360 1.00 15.00 ? 232 HIS A C   1 
ATOM   1625 O  O   . HIS A 1 200 ? 35.080 53.150 196.880 1.00 15.00 ? 232 HIS A O   1 
ATOM   1626 C  CB  . HIS A 1 200 ? 34.220 50.190 197.660 1.00 15.00 ? 232 HIS A CB  1 
ATOM   1627 C  CG  . HIS A 1 200 ? 34.310 49.760 199.110 1.00 15.00 ? 232 HIS A CG  1 
ATOM   1628 N  ND1 . HIS A 1 200 ? 33.390 48.920 199.720 1.00 15.00 ? 232 HIS A ND1 1 
ATOM   1629 C  CD2 . HIS A 1 200 ? 35.240 50.220 200.010 1.00 15.00 ? 232 HIS A CD2 1 
ATOM   1630 C  CE1 . HIS A 1 200 ? 33.750 48.910 201.020 1.00 15.00 ? 232 HIS A CE1 1 
ATOM   1631 N  NE2 . HIS A 1 200 ? 34.790 49.660 201.210 1.00 15.00 ? 232 HIS A NE2 1 
ATOM   1632 N  N   . ILE A 1 201 ? 36.710 52.320 198.240 1.00 15.00 ? 233 ILE A N   1 
ATOM   1633 C  CA  . ILE A 1 201 ? 37.200 53.590 198.760 1.00 15.00 ? 233 ILE A CA  1 
ATOM   1634 C  C   . ILE A 1 201 ? 38.330 54.090 197.890 1.00 15.00 ? 233 ILE A C   1 
ATOM   1635 O  O   . ILE A 1 201 ? 38.400 55.270 197.590 1.00 15.00 ? 233 ILE A O   1 
ATOM   1636 C  CB  . ILE A 1 201 ? 37.730 53.430 200.210 1.00 15.00 ? 233 ILE A CB  1 
ATOM   1637 C  CG1 . ILE A 1 201 ? 36.580 53.080 201.130 1.00 15.00 ? 233 ILE A CG1 1 
ATOM   1638 C  CG2 . ILE A 1 201 ? 38.370 54.710 200.690 1.00 15.00 ? 233 ILE A CG2 1 
ATOM   1639 C  CD1 . ILE A 1 201 ? 37.030 52.460 202.450 1.00 15.00 ? 233 ILE A CD1 1 
ATOM   1640 N  N   . TYR A 1 202 ? 39.250 53.180 197.570 1.00 15.00 ? 234 TYR A N   1 
ATOM   1641 C  CA  . TYR A 1 202 ? 40.480 53.540 196.850 1.00 15.00 ? 234 TYR A CA  1 
ATOM   1642 C  C   . TYR A 1 202 ? 40.540 53.240 195.370 1.00 15.00 ? 234 TYR A C   1 
ATOM   1643 O  O   . TYR A 1 202 ? 41.360 53.860 194.710 1.00 15.00 ? 234 TYR A O   1 
ATOM   1644 C  CB  . TYR A 1 202 ? 41.700 52.870 197.460 1.00 15.00 ? 234 TYR A CB  1 
ATOM   1645 C  CG  . TYR A 1 202 ? 41.840 53.060 198.960 1.00 15.00 ? 234 TYR A CG  1 
ATOM   1646 C  CD1 . TYR A 1 202 ? 42.320 54.250 199.500 1.00 15.00 ? 234 TYR A CD1 1 
ATOM   1647 C  CD2 . TYR A 1 202 ? 41.480 52.030 199.780 1.00 15.00 ? 234 TYR A CD2 1 
ATOM   1648 C  CE1 . TYR A 1 202 ? 42.430 54.380 200.880 1.00 15.00 ? 234 TYR A CE1 1 
ATOM   1649 C  CE2 . TYR A 1 202 ? 41.580 52.170 201.150 1.00 15.00 ? 234 TYR A CE2 1 
ATOM   1650 C  CZ  . TYR A 1 202 ? 42.060 53.330 201.690 1.00 15.00 ? 234 TYR A CZ  1 
ATOM   1651 O  OH  . TYR A 1 202 ? 42.110 53.430 203.060 1.00 15.00 ? 234 TYR A OH  1 
ATOM   1652 N  N   . GLY A 1 203 ? 39.770 52.330 194.810 1.00 15.00 ? 235 GLY A N   1 
ATOM   1653 C  CA  . GLY A 1 203 ? 39.860 52.070 193.390 1.00 15.00 ? 235 GLY A CA  1 
ATOM   1654 C  C   . GLY A 1 203 ? 40.260 50.640 193.100 1.00 15.00 ? 235 GLY A C   1 
ATOM   1655 O  O   . GLY A 1 203 ? 41.040 50.010 193.820 1.00 15.00 ? 235 GLY A O   1 
ATOM   1656 N  N   . ASP A 1 204 ? 39.640 50.140 192.020 1.00 15.00 ? 236 ASP A N   1 
ATOM   1657 C  CA  . ASP A 1 204 ? 39.910 48.800 191.530 1.00 15.00 ? 236 ASP A CA  1 
ATOM   1658 C  C   . ASP A 1 204 ? 41.190 48.820 190.710 1.00 15.00 ? 236 ASP A C   1 
ATOM   1659 O  O   . ASP A 1 204 ? 41.810 47.790 190.490 1.00 15.00 ? 236 ASP A O   1 
ATOM   1660 C  CB  . ASP A 1 204 ? 38.760 48.280 190.650 1.00 15.00 ? 236 ASP A CB  1 
ATOM   1661 C  CG  . ASP A 1 204 ? 38.480 48.990 189.310 1.00 15.00 ? 236 ASP A CG  1 
ATOM   1662 O  OD1 . ASP A 1 204 ? 37.870 50.060 189.310 1.00 15.00 ? 236 ASP A OD1 1 
ATOM   1663 O  OD2 . ASP A 1 204 ? 38.870 48.440 188.270 1.00 15.00 ? 236 ASP A OD2 1 
ATOM   1664 N  N   . ASN A 1 205 ? 41.600 49.990 190.220 1.00 15.00 ? 237 ASN A N   1 
ATOM   1665 C  CA  . ASN A 1 205 ? 42.830 50.100 189.450 1.00 15.00 ? 237 ASN A CA  1 
ATOM   1666 C  C   . ASN A 1 205 ? 43.710 51.230 189.970 1.00 15.00 ? 237 ASN A C   1 
ATOM   1667 O  O   . ASN A 1 205 ? 43.240 52.340 190.200 1.00 15.00 ? 237 ASN A O   1 
ATOM   1668 C  CB  . ASN A 1 205 ? 42.530 50.350 187.970 1.00 15.00 ? 237 ASN A CB  1 
ATOM   1669 C  CG  . ASN A 1 205 ? 41.680 51.570 187.720 1.00 15.00 ? 237 ASN A CG  1 
ATOM   1670 O  OD1 . ASN A 1 205 ? 40.720 51.820 188.460 1.00 15.00 ? 237 ASN A OD1 1 
ATOM   1671 N  ND2 . ASN A 1 205 ? 41.950 52.400 186.720 1.00 15.00 ? 237 ASN A ND2 1 
ATOM   1672 N  N   . LEU A 1 206 ? 45.020 51.000 190.100 1.00 15.00 ? 238 LEU A N   1 
ATOM   1673 C  CA  . LEU A 1 206 ? 45.980 51.960 190.650 1.00 15.00 ? 238 LEU A CA  1 
ATOM   1674 C  C   . LEU A 1 206 ? 45.870 53.380 190.150 1.00 15.00 ? 238 LEU A C   1 
ATOM   1675 O  O   . LEU A 1 206 ? 45.870 54.320 190.930 1.00 15.00 ? 238 LEU A O   1 
ATOM   1676 C  CB  . LEU A 1 206 ? 47.390 51.530 190.380 1.00 15.00 ? 238 LEU A CB  1 
ATOM   1677 C  CG  . LEU A 1 206 ? 48.440 52.410 191.000 1.00 15.00 ? 238 LEU A CG  1 
ATOM   1678 C  CD1 . LEU A 1 206 ? 48.520 52.140 192.490 1.00 15.00 ? 238 LEU A CD1 1 
ATOM   1679 C  CD2 . LEU A 1 206 ? 49.760 52.140 190.340 1.00 15.00 ? 238 LEU A CD2 1 
ATOM   1680 N  N   . GLU A 1 207 ? 45.780 53.500 188.830 1.00 15.00 ? 239 GLU A N   1 
ATOM   1681 C  CA  . GLU A 1 207 ? 45.660 54.770 188.140 1.00 15.00 ? 239 GLU A CA  1 
ATOM   1682 C  C   . GLU A 1 207 ? 44.580 55.650 188.770 1.00 15.00 ? 239 GLU A C   1 
ATOM   1683 O  O   . GLU A 1 207 ? 44.840 56.820 189.010 1.00 15.00 ? 239 GLU A O   1 
ATOM   1684 C  CB  . GLU A 1 207 ? 45.360 54.460 186.690 1.00 15.00 ? 239 GLU A CB  1 
ATOM   1685 C  CG  . GLU A 1 207 ? 46.180 55.210 185.630 1.00 15.00 ? 239 GLU A CG  1 
ATOM   1686 C  CD  . GLU A 1 207 ? 45.820 56.700 185.440 1.00 15.00 ? 239 GLU A CD  1 
ATOM   1687 O  OE1 . GLU A 1 207 ? 44.810 56.950 184.750 1.00 15.00 ? 239 GLU A OE1 1 
ATOM   1688 O  OE2 . GLU A 1 207 ? 46.540 57.580 185.960 1.00 15.00 ? 239 GLU A OE2 1 
ATOM   1689 N  N   . ARG A 1 208 ? 43.420 55.080 189.130 1.00 15.00 ? 240 ARG A N   1 
ATOM   1690 C  CA  . ARG A 1 208 ? 42.310 55.780 189.770 1.00 15.00 ? 240 ARG A CA  1 
ATOM   1691 C  C   . ARG A 1 208 ? 42.690 56.050 191.220 1.00 15.00 ? 240 ARG A C   1 
ATOM   1692 O  O   . ARG A 1 208 ? 42.470 57.140 191.740 1.00 15.00 ? 240 ARG A O   1 
ATOM   1693 C  CB  . ARG A 1 208 ? 41.060 54.890 189.640 1.00 15.00 ? 240 ARG A CB  1 
ATOM   1694 C  CG  . ARG A 1 208 ? 39.780 55.160 190.460 1.00 15.00 ? 240 ARG A CG  1 
ATOM   1695 C  CD  . ARG A 1 208 ? 38.600 54.170 190.230 1.00 15.00 ? 240 ARG A CD  1 
ATOM   1696 N  NE  . ARG A 1 208 ? 37.520 54.720 189.410 1.00 15.00 ? 240 ARG A NE  1 
ATOM   1697 C  CZ  . ARG A 1 208 ? 36.560 55.530 189.900 1.00 15.00 ? 240 ARG A CZ  1 
ATOM   1698 N  NH1 . ARG A 1 208 ? 36.530 55.860 191.200 1.00 15.00 ? 240 ARG A NH1 1 
ATOM   1699 N  NH2 . ARG A 1 208 ? 35.640 56.060 189.070 1.00 15.00 ? 240 ARG A NH2 1 
ATOM   1700 N  N   . GLN A 1 209 ? 43.370 55.130 191.890 1.00 15.00 ? 241 GLN A N   1 
ATOM   1701 C  CA  . GLN A 1 209 ? 43.780 55.290 193.270 1.00 15.00 ? 241 GLN A CA  1 
ATOM   1702 C  C   . GLN A 1 209 ? 44.680 56.480 193.390 1.00 15.00 ? 241 GLN A C   1 
ATOM   1703 O  O   . GLN A 1 209 ? 44.620 57.210 194.370 1.00 15.00 ? 241 GLN A O   1 
ATOM   1704 C  CB  . GLN A 1 209 ? 44.460 54.000 193.700 1.00 15.00 ? 241 GLN A CB  1 
ATOM   1705 C  CG  . GLN A 1 209 ? 44.760 53.830 195.160 1.00 15.00 ? 241 GLN A CG  1 
ATOM   1706 C  CD  . GLN A 1 209 ? 46.250 53.780 195.360 1.00 15.00 ? 241 GLN A CD  1 
ATOM   1707 O  OE1 . GLN A 1 209 ? 46.890 52.750 195.530 1.00 15.00 ? 241 GLN A OE1 1 
ATOM   1708 N  NE2 . GLN A 1 209 ? 46.880 54.930 195.340 1.00 15.00 ? 241 GLN A NE2 1 
ATOM   1709 N  N   . TYR A 1 210 ? 45.510 56.740 192.390 1.00 15.00 ? 242 TYR A N   1 
ATOM   1710 C  CA  . TYR A 1 210 ? 46.380 57.900 192.400 1.00 15.00 ? 242 TYR A CA  1 
ATOM   1711 C  C   . TYR A 1 210 ? 45.590 59.170 192.140 1.00 15.00 ? 242 TYR A C   1 
ATOM   1712 O  O   . TYR A 1 210 ? 45.880 60.240 192.660 1.00 15.00 ? 242 TYR A O   1 
ATOM   1713 C  CB  . TYR A 1 210 ? 47.480 57.730 191.360 1.00 15.00 ? 242 TYR A CB  1 
ATOM   1714 C  CG  . TYR A 1 210 ? 48.660 56.860 191.790 1.00 15.00 ? 242 TYR A CG  1 
ATOM   1715 C  CD1 . TYR A 1 210 ? 48.720 56.260 193.030 1.00 15.00 ? 242 TYR A CD1 1 
ATOM   1716 C  CD2 . TYR A 1 210 ? 49.720 56.690 190.930 1.00 15.00 ? 242 TYR A CD2 1 
ATOM   1717 C  CE1 . TYR A 1 210 ? 49.820 55.510 193.400 1.00 15.00 ? 242 TYR A CE1 1 
ATOM   1718 C  CE2 . TYR A 1 210 ? 50.820 55.940 191.290 1.00 15.00 ? 242 TYR A CE2 1 
ATOM   1719 C  CZ  . TYR A 1 210 ? 50.870 55.360 192.520 1.00 15.00 ? 242 TYR A CZ  1 
ATOM   1720 O  OH  . TYR A 1 210 ? 51.990 54.630 192.900 1.00 15.00 ? 242 TYR A OH  1 
ATOM   1721 N  N   . GLN A 1 211 ? 44.540 59.040 191.340 1.00 15.00 ? 243 GLN A N   1 
ATOM   1722 C  CA  . GLN A 1 211 ? 43.630 60.140 191.110 1.00 15.00 ? 243 GLN A CA  1 
ATOM   1723 C  C   . GLN A 1 211 ? 42.850 60.580 192.330 1.00 15.00 ? 243 GLN A C   1 
ATOM   1724 O  O   . GLN A 1 211 ? 42.380 61.700 192.350 1.00 15.00 ? 243 GLN A O   1 
ATOM   1725 C  CB  . GLN A 1 211 ? 42.600 59.810 190.060 1.00 15.00 ? 243 GLN A CB  1 
ATOM   1726 C  CG  . GLN A 1 211 ? 43.100 60.260 188.740 1.00 15.00 ? 243 GLN A CG  1 
ATOM   1727 C  CD  . GLN A 1 211 ? 43.140 61.780 188.610 1.00 15.00 ? 243 GLN A CD  1 
ATOM   1728 O  OE1 . GLN A 1 211 ? 43.400 62.240 187.500 1.00 15.00 ? 243 GLN A OE1 1 
ATOM   1729 N  NE2 . GLN A 1 211 ? 42.880 62.670 189.570 1.00 15.00 ? 243 GLN A NE2 1 
ATOM   1730 N  N   . LEU A 1 212 ? 42.610 59.690 193.270 1.00 15.00 ? 244 LEU A N   1 
ATOM   1731 C  CA  . LEU A 1 212 ? 41.870 60.050 194.450 1.00 15.00 ? 244 LEU A CA  1 
ATOM   1732 C  C   . LEU A 1 212 ? 42.790 60.460 195.570 1.00 15.00 ? 244 LEU A C   1 
ATOM   1733 O  O   . LEU A 1 212 ? 42.300 60.900 196.620 1.00 15.00 ? 244 LEU A O   1 
ATOM   1734 C  CB  . LEU A 1 212 ? 41.070 58.880 194.910 1.00 15.00 ? 244 LEU A CB  1 
ATOM   1735 C  CG  . LEU A 1 212 ? 40.060 58.370 193.970 1.00 15.00 ? 244 LEU A CG  1 
ATOM   1736 C  CD1 . LEU A 1 212 ? 39.700 56.990 194.400 1.00 15.00 ? 244 LEU A CD1 1 
ATOM   1737 C  CD2 . LEU A 1 212 ? 38.900 59.310 193.920 1.00 15.00 ? 244 LEU A CD2 1 
ATOM   1738 N  N   . ARG A 1 213 ? 44.100 60.280 195.430 1.00 15.00 ? 245 ARG A N   1 
ATOM   1739 C  CA  . ARG A 1 213 ? 45.020 60.590 196.500 1.00 15.00 ? 245 ARG A CA  1 
ATOM   1740 C  C   . ARG A 1 213 ? 45.510 62.010 196.470 1.00 15.00 ? 245 ARG A C   1 
ATOM   1741 O  O   . ARG A 1 213 ? 45.710 62.650 195.440 1.00 15.00 ? 245 ARG A O   1 
ATOM   1742 C  CB  . ARG A 1 213 ? 46.230 59.730 196.460 1.00 15.00 ? 245 ARG A CB  1 
ATOM   1743 C  CG  . ARG A 1 213 ? 45.920 58.370 196.970 1.00 15.00 ? 245 ARG A CG  1 
ATOM   1744 C  CD  . ARG A 1 213 ? 47.110 57.580 196.620 1.00 15.00 ? 245 ARG A CD  1 
ATOM   1745 N  NE  . ARG A 1 213 ? 48.220 57.810 197.500 1.00 15.00 ? 245 ARG A NE  1 
ATOM   1746 C  CZ  . ARG A 1 213 ? 49.320 57.080 197.370 1.00 15.00 ? 245 ARG A CZ  1 
ATOM   1747 N  NH1 . ARG A 1 213 ? 49.420 56.150 196.440 1.00 15.00 ? 245 ARG A NH1 1 
ATOM   1748 N  NH2 . ARG A 1 213 ? 50.330 57.270 198.200 1.00 15.00 ? 245 ARG A NH2 1 
ATOM   1749 N  N   . LEU A 1 214 ? 45.710 62.490 197.680 1.00 15.00 ? 246 LEU A N   1 
ATOM   1750 C  CA  . LEU A 1 214 ? 46.190 63.830 197.810 1.00 15.00 ? 246 LEU A CA  1 
ATOM   1751 C  C   . LEU A 1 214 ? 47.680 63.910 197.540 1.00 15.00 ? 246 LEU A C   1 
ATOM   1752 O  O   . LEU A 1 214 ? 48.180 64.880 196.990 1.00 15.00 ? 246 LEU A O   1 
ATOM   1753 C  CB  . LEU A 1 214 ? 45.920 64.330 199.190 1.00 15.00 ? 246 LEU A CB  1 
ATOM   1754 C  CG  . LEU A 1 214 ? 46.240 65.760 199.480 1.00 15.00 ? 246 LEU A CG  1 
ATOM   1755 C  CD1 . LEU A 1 214 ? 45.480 66.690 198.540 1.00 15.00 ? 246 LEU A CD1 1 
ATOM   1756 C  CD2 . LEU A 1 214 ? 45.880 66.050 200.910 1.00 15.00 ? 246 LEU A CD2 1 
ATOM   1757 N  N   . PHE A 1 215 ? 48.340 62.850 197.980 1.00 15.00 ? 247 PHE A N   1 
ATOM   1758 C  CA  . PHE A 1 215 ? 49.790 62.750 197.970 1.00 15.00 ? 247 PHE A CA  1 
ATOM   1759 C  C   . PHE A 1 215 ? 50.420 63.740 198.940 1.00 15.00 ? 247 PHE A C   1 
ATOM   1760 O  O   . PHE A 1 215 ? 51.490 64.300 198.730 1.00 15.00 ? 247 PHE A O   1 
ATOM   1761 C  CB  . PHE A 1 215 ? 50.380 62.980 196.570 1.00 15.00 ? 247 PHE A CB  1 
ATOM   1762 C  CG  . PHE A 1 215 ? 50.100 61.830 195.630 1.00 15.00 ? 247 PHE A CG  1 
ATOM   1763 C  CD1 . PHE A 1 215 ? 50.510 60.560 195.950 1.00 15.00 ? 247 PHE A CD1 1 
ATOM   1764 C  CD2 . PHE A 1 215 ? 49.390 62.060 194.480 1.00 15.00 ? 247 PHE A CD2 1 
ATOM   1765 C  CE1 . PHE A 1 215 ? 50.210 59.500 195.120 1.00 15.00 ? 247 PHE A CE1 1 
ATOM   1766 C  CE2 . PHE A 1 215 ? 49.100 61.000 193.660 1.00 15.00 ? 247 PHE A CE2 1 
ATOM   1767 C  CZ  . PHE A 1 215 ? 49.500 59.730 193.970 1.00 15.00 ? 247 PHE A CZ  1 
ATOM   1768 N  N   . LYS A 1 216 ? 49.790 63.880 200.110 1.00 15.00 ? 248 LYS A N   1 
ATOM   1769 C  CA  . LYS A 1 216 ? 50.300 64.670 201.230 1.00 15.00 ? 248 LYS A CA  1 
ATOM   1770 C  C   . LYS A 1 216 ? 49.830 63.920 202.460 1.00 15.00 ? 248 LYS A C   1 
ATOM   1771 O  O   . LYS A 1 216 ? 48.680 63.500 202.520 1.00 15.00 ? 248 LYS A O   1 
ATOM   1772 C  CB  . LYS A 1 216 ? 49.710 66.040 201.340 1.00 15.00 ? 248 LYS A CB  1 
ATOM   1773 C  CG  . LYS A 1 216 ? 50.390 67.140 200.570 1.00 15.00 ? 248 LYS A CG  1 
ATOM   1774 C  CD  . LYS A 1 216 ? 49.850 68.510 201.020 1.00 15.00 ? 248 LYS A CD  1 
ATOM   1775 C  CE  . LYS A 1 216 ? 50.330 68.980 202.430 1.00 15.00 ? 248 LYS A CE  1 
ATOM   1776 N  NZ  . LYS A 1 216 ? 49.820 68.220 203.570 1.00 15.00 ? 248 LYS A NZ  1 
ATOM   1777 N  N   . ASP A 1 217 ? 50.710 63.690 203.430 1.00 15.00 ? 249 ASP A N   1 
ATOM   1778 C  CA  . ASP A 1 217 ? 50.430 62.950 204.660 1.00 15.00 ? 249 ASP A CA  1 
ATOM   1779 C  C   . ASP A 1 217 ? 49.710 61.610 204.490 1.00 15.00 ? 249 ASP A C   1 
ATOM   1780 O  O   . ASP A 1 217 ? 49.120 61.120 205.450 1.00 15.00 ? 249 ASP A O   1 
ATOM   1781 C  CB  . ASP A 1 217 ? 49.600 63.820 205.590 1.00 15.00 ? 249 ASP A CB  1 
ATOM   1782 C  CG  . ASP A 1 217 ? 50.250 65.120 206.050 1.00 15.00 ? 249 ASP A CG  1 
ATOM   1783 O  OD1 . ASP A 1 217 ? 50.850 65.830 205.220 1.00 15.00 ? 249 ASP A OD1 1 
ATOM   1784 O  OD2 . ASP A 1 217 ? 50.140 65.430 207.240 1.00 15.00 ? 249 ASP A OD2 1 
ATOM   1785 N  N   . GLY A 1 218 ? 49.750 60.970 203.320 1.00 15.00 ? 250 GLY A N   1 
ATOM   1786 C  CA  . GLY A 1 218 ? 49.080 59.700 203.080 1.00 15.00 ? 250 GLY A CA  1 
ATOM   1787 C  C   . GLY A 1 218 ? 47.600 59.880 202.790 1.00 15.00 ? 250 GLY A C   1 
ATOM   1788 O  O   . GLY A 1 218 ? 46.830 58.940 202.650 1.00 15.00 ? 250 GLY A O   1 
ATOM   1789 N  N   . LYS A 1 219 ? 47.200 61.110 202.640 1.00 15.00 ? 251 LYS A N   1 
ATOM   1790 C  CA  . LYS A 1 219 ? 45.810 61.410 202.520 1.00 15.00 ? 251 LYS A CA  1 
ATOM   1791 C  C   . LYS A 1 219 ? 45.280 61.290 201.110 1.00 15.00 ? 251 LYS A C   1 
ATOM   1792 O  O   . LYS A 1 219 ? 46.000 61.220 200.100 1.00 15.00 ? 251 LYS A O   1 
ATOM   1793 C  CB  . LYS A 1 219 ? 45.640 62.800 203.160 1.00 15.00 ? 251 LYS A CB  1 
ATOM   1794 C  CG  . LYS A 1 219 ? 45.430 62.540 204.660 1.00 15.00 ? 251 LYS A CG  1 
ATOM   1795 C  CD  . LYS A 1 219 ? 46.000 63.420 205.770 1.00 15.00 ? 251 LYS A CD  1 
ATOM   1796 C  CE  . LYS A 1 219 ? 45.500 64.840 205.850 1.00 15.00 ? 251 LYS A CE  1 
ATOM   1797 N  NZ  . LYS A 1 219 ? 45.870 65.440 207.120 1.00 15.00 ? 251 LYS A NZ  1 
ATOM   1798 N  N   . LEU A 1 220 ? 43.950 61.210 201.210 1.00 15.00 ? 252 LEU A N   1 
ATOM   1799 C  CA  . LEU A 1 220 ? 42.980 61.060 200.150 1.00 15.00 ? 252 LEU A CA  1 
ATOM   1800 C  C   . LEU A 1 220 ? 42.460 62.460 199.850 1.00 15.00 ? 252 LEU A C   1 
ATOM   1801 O  O   . LEU A 1 220 ? 42.390 63.270 200.770 1.00 15.00 ? 252 LEU A O   1 
ATOM   1802 C  CB  . LEU A 1 220 ? 41.920 60.150 200.690 1.00 15.00 ? 252 LEU A CB  1 
ATOM   1803 C  CG  . LEU A 1 220 ? 41.410 58.970 199.950 1.00 15.00 ? 252 LEU A CG  1 
ATOM   1804 C  CD1 . LEU A 1 220 ? 42.500 58.200 199.270 1.00 15.00 ? 252 LEU A CD1 1 
ATOM   1805 C  CD2 . LEU A 1 220 ? 40.730 58.120 200.980 1.00 15.00 ? 252 LEU A CD2 1 
ATOM   1806 N  N   . LYS A 1 221 ? 42.090 62.790 198.620 1.00 15.00 ? 253 LYS A N   1 
ATOM   1807 C  CA  . LYS A 1 221 ? 41.650 64.140 198.280 1.00 15.00 ? 253 LYS A CA  1 
ATOM   1808 C  C   . LYS A 1 221 ? 40.270 64.340 198.850 1.00 15.00 ? 253 LYS A C   1 
ATOM   1809 O  O   . LYS A 1 221 ? 39.580 63.350 199.140 1.00 15.00 ? 253 LYS A O   1 
ATOM   1810 C  CB  . LYS A 1 221 ? 41.560 64.320 196.790 1.00 15.00 ? 253 LYS A CB  1 
ATOM   1811 C  CG  . LYS A 1 221 ? 42.820 64.550 195.980 1.00 15.00 ? 253 LYS A CG  1 
ATOM   1812 C  CD  . LYS A 1 221 ? 42.420 64.170 194.550 1.00 15.00 ? 253 LYS A CD  1 
ATOM   1813 C  CE  . LYS A 1 221 ? 43.430 64.570 193.500 1.00 15.00 ? 253 LYS A CE  1 
ATOM   1814 N  NZ  . LYS A 1 221 ? 43.380 66.000 193.330 1.00 15.00 ? 253 LYS A NZ  1 
ATOM   1815 N  N   . TYR A 1 222 ? 39.830 65.580 199.020 1.00 15.00 ? 254 TYR A N   1 
ATOM   1816 C  CA  . TYR A 1 222 ? 38.480 65.850 199.480 1.00 15.00 ? 254 TYR A CA  1 
ATOM   1817 C  C   . TYR A 1 222 ? 38.150 67.290 199.160 1.00 15.00 ? 254 TYR A C   1 
ATOM   1818 O  O   . TYR A 1 222 ? 38.990 68.000 198.590 1.00 15.00 ? 254 TYR A O   1 
ATOM   1819 C  CB  . TYR A 1 222 ? 38.310 65.670 200.980 1.00 15.00 ? 254 TYR A CB  1 
ATOM   1820 C  CG  . TYR A 1 222 ? 39.290 66.430 201.820 1.00 15.00 ? 254 TYR A CG  1 
ATOM   1821 C  CD1 . TYR A 1 222 ? 39.130 67.770 202.100 1.00 15.00 ? 254 TYR A CD1 1 
ATOM   1822 C  CD2 . TYR A 1 222 ? 40.370 65.740 202.310 1.00 15.00 ? 254 TYR A CD2 1 
ATOM   1823 C  CE1 . TYR A 1 222 ? 40.060 68.420 202.880 1.00 15.00 ? 254 TYR A CE1 1 
ATOM   1824 C  CE2 . TYR A 1 222 ? 41.300 66.370 203.110 1.00 15.00 ? 254 TYR A CE2 1 
ATOM   1825 C  CZ  . TYR A 1 222 ? 41.150 67.710 203.390 1.00 15.00 ? 254 TYR A CZ  1 
ATOM   1826 O  OH  . TYR A 1 222 ? 42.090 68.330 204.210 1.00 15.00 ? 254 TYR A OH  1 
ATOM   1827 N  N   . GLN A 1 223 ? 36.920 67.660 199.540 1.00 15.00 ? 255 GLN A N   1 
ATOM   1828 C  CA  . GLN A 1 223 ? 36.400 69.000 199.380 1.00 15.00 ? 255 GLN A CA  1 
ATOM   1829 C  C   . GLN A 1 223 ? 35.700 69.340 200.690 1.00 15.00 ? 255 GLN A C   1 
ATOM   1830 O  O   . GLN A 1 223 ? 35.360 68.460 201.490 1.00 15.00 ? 255 GLN A O   1 
ATOM   1831 C  CB  . GLN A 1 223 ? 35.410 69.060 198.220 1.00 15.00 ? 255 GLN A CB  1 
ATOM   1832 C  CG  . GLN A 1 223 ? 34.040 68.420 198.370 1.00 15.00 ? 255 GLN A CG  1 
ATOM   1833 C  CD  . GLN A 1 223 ? 33.230 68.650 197.100 1.00 15.00 ? 255 GLN A CD  1 
ATOM   1834 O  OE1 . GLN A 1 223 ? 32.860 69.780 196.800 1.00 15.00 ? 255 GLN A OE1 1 
ATOM   1835 N  NE2 . GLN A 1 223 ? 32.930 67.630 196.310 1.00 15.00 ? 255 GLN A NE2 1 
ATOM   1836 N  N   . MET A 1 224 ? 35.500 70.630 200.910 1.00 15.00 ? 256 MET A N   1 
ATOM   1837 C  CA  . MET A 1 224 ? 34.950 71.130 202.160 1.00 15.00 ? 256 MET A CA  1 
ATOM   1838 C  C   . MET A 1 224 ? 33.660 71.890 201.870 1.00 15.00 ? 256 MET A C   1 
ATOM   1839 O  O   . MET A 1 224 ? 33.680 72.970 201.260 1.00 15.00 ? 256 MET A O   1 
ATOM   1840 C  CB  . MET A 1 224 ? 35.960 72.040 202.820 1.00 15.00 ? 256 MET A CB  1 
ATOM   1841 C  CG  . MET A 1 224 ? 35.740 72.090 204.310 1.00 15.00 ? 256 MET A CG  1 
ATOM   1842 S  SD  . MET A 1 224 ? 36.790 70.810 205.020 1.00 15.00 ? 256 MET A SD  1 
ATOM   1843 C  CE  . MET A 1 224 ? 37.010 71.500 206.640 1.00 15.00 ? 256 MET A CE  1 
ATOM   1844 N  N   . LEU A 1 225 ? 32.530 71.290 202.260 1.00 15.00 ? 257 LEU A N   1 
ATOM   1845 C  CA  . LEU A 1 225 ? 31.240 71.880 202.010 1.00 15.00 ? 257 LEU A CA  1 
ATOM   1846 C  C   . LEU A 1 225 ? 30.590 72.110 203.350 1.00 15.00 ? 257 LEU A C   1 
ATOM   1847 O  O   . LEU A 1 225 ? 30.530 71.220 204.220 1.00 15.00 ? 257 LEU A O   1 
ATOM   1848 C  CB  . LEU A 1 225 ? 30.410 70.940 201.150 1.00 15.00 ? 257 LEU A CB  1 
ATOM   1849 C  CG  . LEU A 1 225 ? 30.300 71.260 199.660 1.00 15.00 ? 257 LEU A CG  1 
ATOM   1850 C  CD1 . LEU A 1 225 ? 31.630 71.630 199.050 1.00 15.00 ? 257 LEU A CD1 1 
ATOM   1851 C  CD2 . LEU A 1 225 ? 29.790 70.020 198.980 1.00 15.00 ? 257 LEU A CD2 1 
ATOM   1852 N  N   . ASN A 1 226 ? 30.110 73.350 203.500 1.00 15.00 ? 258 ASN A N   1 
ATOM   1853 C  CA  . ASN A 1 226 ? 29.540 73.860 204.740 1.00 15.00 ? 258 ASN A CA  1 
ATOM   1854 C  C   . ASN A 1 226 ? 30.620 73.610 205.790 1.00 15.00 ? 258 ASN A C   1 
ATOM   1855 O  O   . ASN A 1 226 ? 31.760 74.010 205.550 1.00 15.00 ? 258 ASN A O   1 
ATOM   1856 C  CB  . ASN A 1 226 ? 28.220 73.130 205.090 1.00 15.00 ? 258 ASN A CB  1 
ATOM   1857 C  CG  . ASN A 1 226 ? 27.100 73.370 204.060 1.00 15.00 ? 258 ASN A CG  1 
ATOM   1858 O  OD1 . ASN A 1 226 ? 27.000 74.440 203.440 1.00 15.00 ? 258 ASN A OD1 1 
ATOM   1859 N  ND2 . ASN A 1 226 ? 26.230 72.390 203.800 1.00 15.00 ? 258 ASN A ND2 1 
ATOM   1860 N  N   . GLY A 1 227 ? 30.410 72.960 206.920 1.00 15.00 ? 259 GLY A N   1 
ATOM   1861 C  CA  . GLY A 1 227 ? 31.530 72.750 207.820 1.00 15.00 ? 259 GLY A CA  1 
ATOM   1862 C  C   . GLY A 1 227 ? 32.350 71.550 207.410 1.00 15.00 ? 259 GLY A C   1 
ATOM   1863 O  O   . GLY A 1 227 ? 33.570 71.550 207.580 1.00 15.00 ? 259 GLY A O   1 
ATOM   1864 N  N   . GLU A 1 228 ? 31.750 70.540 206.800 1.00 15.00 ? 260 GLU A N   1 
ATOM   1865 C  CA  . GLU A 1 228 ? 32.470 69.300 206.720 1.00 15.00 ? 260 GLU A CA  1 
ATOM   1866 C  C   . GLU A 1 228 ? 33.240 68.890 205.470 1.00 15.00 ? 260 GLU A C   1 
ATOM   1867 O  O   . GLU A 1 228 ? 33.190 69.490 204.390 1.00 15.00 ? 260 GLU A O   1 
ATOM   1868 C  CB  . GLU A 1 228 ? 31.490 68.240 207.130 1.00 15.00 ? 260 GLU A CB  1 
ATOM   1869 C  CG  . GLU A 1 228 ? 31.330 68.260 208.650 1.00 15.00 ? 260 GLU A CG  1 
ATOM   1870 C  CD  . GLU A 1 228 ? 29.870 68.180 209.040 1.00 15.00 ? 260 GLU A CD  1 
ATOM   1871 O  OE1 . GLU A 1 228 ? 29.300 67.080 209.070 1.00 15.00 ? 260 GLU A OE1 1 
ATOM   1872 O  OE2 . GLU A 1 228 ? 29.300 69.250 209.290 1.00 15.00 ? 260 GLU A OE2 1 
ATOM   1873 N  N   . VAL A 1 229 ? 33.920 67.780 205.730 1.00 15.00 ? 261 VAL A N   1 
ATOM   1874 C  CA  . VAL A 1 229 ? 34.820 67.110 204.800 1.00 15.00 ? 261 VAL A CA  1 
ATOM   1875 C  C   . VAL A 1 229 ? 33.960 66.200 203.940 1.00 15.00 ? 261 VAL A C   1 
ATOM   1876 O  O   . VAL A 1 229 ? 33.360 65.280 204.500 1.00 15.00 ? 261 VAL A O   1 
ATOM   1877 C  CB  . VAL A 1 229 ? 35.860 66.240 205.580 1.00 15.00 ? 261 VAL A CB  1 
ATOM   1878 C  CG1 . VAL A 1 229 ? 37.140 66.220 204.770 1.00 15.00 ? 261 VAL A CG1 1 
ATOM   1879 C  CG2 . VAL A 1 229 ? 36.120 66.760 207.010 1.00 15.00 ? 261 VAL A CG2 1 
ATOM   1880 N  N   . TYR A 1 230 ? 33.800 66.410 202.650 1.00 15.00 ? 262 TYR A N   1 
ATOM   1881 C  CA  . TYR A 1 230 ? 33.010 65.520 201.810 1.00 15.00 ? 262 TYR A CA  1 
ATOM   1882 C  C   . TYR A 1 230 ? 33.920 65.050 200.680 1.00 15.00 ? 262 TYR A C   1 
ATOM   1883 O  O   . TYR A 1 230 ? 34.910 65.730 200.430 1.00 15.00 ? 262 TYR A O   1 
ATOM   1884 C  CB  . TYR A 1 230 ? 31.810 66.300 201.270 1.00 15.00 ? 262 TYR A CB  1 
ATOM   1885 C  CG  . TYR A 1 230 ? 30.730 66.430 202.340 1.00 15.00 ? 262 TYR A CG  1 
ATOM   1886 C  CD1 . TYR A 1 230 ? 30.050 65.300 202.710 1.00 15.00 ? 262 TYR A CD1 1 
ATOM   1887 C  CD2 . TYR A 1 230 ? 30.500 67.620 202.980 1.00 15.00 ? 262 TYR A CD2 1 
ATOM   1888 C  CE1 . TYR A 1 230 ? 29.150 65.350 203.740 1.00 15.00 ? 262 TYR A CE1 1 
ATOM   1889 C  CE2 . TYR A 1 230 ? 29.590 67.670 204.020 1.00 15.00 ? 262 TYR A CE2 1 
ATOM   1890 C  CZ  . TYR A 1 230 ? 28.930 66.530 204.400 1.00 15.00 ? 262 TYR A CZ  1 
ATOM   1891 O  OH  . TYR A 1 230 ? 28.080 66.520 205.500 1.00 15.00 ? 262 TYR A OH  1 
ATOM   1892 N  N   . PRO A 1 231 ? 33.740 63.940 199.970 1.00 15.00 ? 263 PRO A N   1 
ATOM   1893 C  CA  . PRO A 1 231 ? 34.600 63.480 198.870 1.00 15.00 ? 263 PRO A CA  1 
ATOM   1894 C  C   . PRO A 1 231 ? 34.940 64.570 197.870 1.00 15.00 ? 263 PRO A C   1 
ATOM   1895 O  O   . PRO A 1 231 ? 34.150 65.490 197.740 1.00 15.00 ? 263 PRO A O   1 
ATOM   1896 C  CB  . PRO A 1 231 ? 33.830 62.350 198.270 1.00 15.00 ? 263 PRO A CB  1 
ATOM   1897 C  CG  . PRO A 1 231 ? 33.190 61.740 199.480 1.00 15.00 ? 263 PRO A CG  1 
ATOM   1898 C  CD  . PRO A 1 231 ? 32.690 62.970 200.220 1.00 15.00 ? 263 PRO A CD  1 
ATOM   1899 N  N   . PRO A 1 232 ? 36.030 64.600 197.110 1.00 15.00 ? 264 PRO A N   1 
ATOM   1900 C  CA  . PRO A 1 232 ? 36.310 65.660 196.170 1.00 15.00 ? 264 PRO A CA  1 
ATOM   1901 C  C   . PRO A 1 232 ? 35.300 65.630 195.030 1.00 15.00 ? 264 PRO A C   1 
ATOM   1902 O  O   . PRO A 1 232 ? 34.530 64.690 194.900 1.00 15.00 ? 264 PRO A O   1 
ATOM   1903 C  CB  . PRO A 1 232 ? 37.720 65.400 195.740 1.00 15.00 ? 264 PRO A CB  1 
ATOM   1904 C  CG  . PRO A 1 232 ? 37.800 63.900 195.750 1.00 15.00 ? 264 PRO A CG  1 
ATOM   1905 C  CD  . PRO A 1 232 ? 37.020 63.540 197.000 1.00 15.00 ? 264 PRO A CD  1 
ATOM   1906 N  N   . SER A 1 233 ? 35.270 66.670 194.210 1.00 15.00 ? 265 SER A N   1 
ATOM   1907 C  CA  . SER A 1 233 ? 34.380 66.660 193.070 1.00 15.00 ? 265 SER A CA  1 
ATOM   1908 C  C   . SER A 1 233 ? 35.080 65.980 191.900 1.00 15.00 ? 265 SER A C   1 
ATOM   1909 O  O   . SER A 1 233 ? 36.310 65.970 191.890 1.00 15.00 ? 265 SER A O   1 
ATOM   1910 C  CB  . SER A 1 233 ? 34.060 68.080 192.700 1.00 15.00 ? 265 SER A CB  1 
ATOM   1911 O  OG  . SER A 1 233 ? 35.310 68.750 192.560 1.00 15.00 ? 265 SER A OG  1 
ATOM   1912 N  N   . VAL A 1 234 ? 34.380 65.490 190.880 1.00 15.00 ? 266 VAL A N   1 
ATOM   1913 C  CA  . VAL A 1 234 ? 35.010 64.910 189.680 1.00 15.00 ? 266 VAL A CA  1 
ATOM   1914 C  C   . VAL A 1 234 ? 35.850 65.960 188.950 1.00 15.00 ? 266 VAL A C   1 
ATOM   1915 O  O   . VAL A 1 234 ? 36.680 65.710 188.090 1.00 15.00 ? 266 VAL A O   1 
ATOM   1916 C  CB  . VAL A 1 234 ? 33.880 64.320 188.790 1.00 15.00 ? 266 VAL A CB  1 
ATOM   1917 C  CG1 . VAL A 1 234 ? 34.330 63.830 187.430 1.00 15.00 ? 266 VAL A CG1 1 
ATOM   1918 C  CG2 . VAL A 1 234 ? 33.380 63.090 189.510 1.00 15.00 ? 266 VAL A CG2 1 
ATOM   1919 N  N   . GLU A 1 235 ? 35.600 67.210 189.360 1.00 15.00 ? 267 GLU A N   1 
ATOM   1920 C  CA  . GLU A 1 235 ? 36.370 68.380 188.990 1.00 15.00 ? 267 GLU A CA  1 
ATOM   1921 C  C   . GLU A 1 235 ? 37.810 68.290 189.510 1.00 15.00 ? 267 GLU A C   1 
ATOM   1922 O  O   . GLU A 1 235 ? 38.790 68.550 188.810 1.00 15.00 ? 267 GLU A O   1 
ATOM   1923 C  CB  . GLU A 1 235 ? 35.660 69.580 189.590 1.00 15.00 ? 267 GLU A CB  1 
ATOM   1924 C  CG  . GLU A 1 235 ? 35.160 70.630 188.610 1.00 15.00 ? 267 GLU A CG  1 
ATOM   1925 C  CD  . GLU A 1 235 ? 36.260 71.510 188.030 1.00 15.00 ? 267 GLU A CD  1 
ATOM   1926 O  OE1 . GLU A 1 235 ? 36.890 72.270 188.800 1.00 15.00 ? 267 GLU A OE1 1 
ATOM   1927 O  OE2 . GLU A 1 235 ? 36.470 71.430 186.810 1.00 15.00 ? 267 GLU A OE2 1 
ATOM   1928 N  N   . GLU A 1 236 ? 37.960 67.930 190.790 1.00 15.00 ? 268 GLU A N   1 
ATOM   1929 C  CA  . GLU A 1 236 ? 39.270 67.820 191.400 1.00 15.00 ? 268 GLU A CA  1 
ATOM   1930 C  C   . GLU A 1 236 ? 39.910 66.450 191.260 1.00 15.00 ? 268 GLU A C   1 
ATOM   1931 O  O   . GLU A 1 236 ? 41.100 66.320 191.510 1.00 15.00 ? 268 GLU A O   1 
ATOM   1932 C  CB  . GLU A 1 236 ? 39.160 68.170 192.880 1.00 15.00 ? 268 GLU A CB  1 
ATOM   1933 C  CG  . GLU A 1 236 ? 38.800 69.650 193.150 1.00 15.00 ? 268 GLU A CG  1 
ATOM   1934 C  CD  . GLU A 1 236 ? 39.750 70.690 192.500 1.00 15.00 ? 268 GLU A CD  1 
ATOM   1935 O  OE1 . GLU A 1 236 ? 40.960 70.690 192.820 1.00 15.00 ? 268 GLU A OE1 1 
ATOM   1936 O  OE2 . GLU A 1 236 ? 39.270 71.510 191.670 1.00 15.00 ? 268 GLU A OE2 1 
ATOM   1937 N  N   . ALA A 1 237 ? 39.160 65.410 190.930 1.00 15.00 ? 269 ALA A N   1 
ATOM   1938 C  CA  . ALA A 1 237 ? 39.730 64.090 190.720 1.00 15.00 ? 269 ALA A CA  1 
ATOM   1939 C  C   . ALA A 1 237 ? 38.940 63.520 189.560 1.00 15.00 ? 269 ALA A C   1 
ATOM   1940 O  O   . ALA A 1 237 ? 37.840 63.020 189.790 1.00 15.00 ? 269 ALA A O   1 
ATOM   1941 C  CB  . ALA A 1 237 ? 39.520 63.250 191.980 1.00 15.00 ? 269 ALA A CB  1 
ATOM   1942 N  N   . PRO A 1 238 ? 39.400 63.590 188.310 1.00 15.00 ? 270 PRO A N   1 
ATOM   1943 C  CA  . PRO A 1 238 ? 38.770 63.020 187.110 1.00 15.00 ? 270 PRO A CA  1 
ATOM   1944 C  C   . PRO A 1 238 ? 38.100 61.670 187.200 1.00 15.00 ? 270 PRO A C   1 
ATOM   1945 O  O   . PRO A 1 238 ? 36.970 61.460 186.760 1.00 15.00 ? 270 PRO A O   1 
ATOM   1946 C  CB  . PRO A 1 238 ? 39.870 63.040 186.110 1.00 15.00 ? 270 PRO A CB  1 
ATOM   1947 C  CG  . PRO A 1 238 ? 40.320 64.460 186.380 1.00 15.00 ? 270 PRO A CG  1 
ATOM   1948 C  CD  . PRO A 1 238 ? 40.420 64.520 187.900 1.00 15.00 ? 270 PRO A CD  1 
ATOM   1949 N  N   . VAL A 1 239 ? 38.880 60.740 187.740 1.00 15.00 ? 271 VAL A N   1 
ATOM   1950 C  CA  . VAL A 1 239 ? 38.440 59.400 188.090 1.00 15.00 ? 271 VAL A CA  1 
ATOM   1951 C  C   . VAL A 1 239 ? 37.360 58.610 187.290 1.00 15.00 ? 271 VAL A C   1 
ATOM   1952 O  O   . VAL A 1 239 ? 37.660 57.460 186.970 1.00 15.00 ? 271 VAL A O   1 
ATOM   1953 C  CB  . VAL A 1 239 ? 38.150 59.620 189.590 1.00 15.00 ? 271 VAL A CB  1 
ATOM   1954 C  CG1 . VAL A 1 239 ? 36.690 59.860 189.890 1.00 15.00 ? 271 VAL A CG1 1 
ATOM   1955 C  CG2 . VAL A 1 239 ? 38.760 58.450 190.290 1.00 15.00 ? 271 VAL A CG2 1 
ATOM   1956 N  N   . LEU A 1 240 ? 36.160 59.110 186.990 1.00 15.00 ? 272 LEU A N   1 
ATOM   1957 C  CA  . LEU A 1 240 ? 35.090 58.580 186.160 1.00 15.00 ? 272 LEU A CA  1 
ATOM   1958 C  C   . LEU A 1 240 ? 33.750 58.800 186.830 1.00 15.00 ? 272 LEU A C   1 
ATOM   1959 O  O   . LEU A 1 240 ? 33.200 59.900 186.600 1.00 15.00 ? 272 LEU A O   1 
ATOM   1960 C  CB  . LEU A 1 240 ? 35.100 57.080 185.860 1.00 15.00 ? 272 LEU A CB  1 
ATOM   1961 C  CG  . LEU A 1 240 ? 34.040 56.760 184.820 1.00 15.00 ? 272 LEU A CG  1 
ATOM   1962 C  CD1 . LEU A 1 240 ? 34.400 57.410 183.490 1.00 15.00 ? 272 LEU A CD1 1 
ATOM   1963 C  CD2 . LEU A 1 240 ? 33.910 55.260 184.700 1.00 15.00 ? 272 LEU A CD2 1 
ATOM   1964 N  N   . MET A 1 241 ? 33.230 57.890 187.690 1.00 15.00 ? 273 MET A N   1 
ATOM   1965 C  CA  . MET A 1 241 ? 31.880 57.990 188.240 1.00 15.00 ? 273 MET A CA  1 
ATOM   1966 C  C   . MET A 1 241 ? 30.760 57.840 187.200 1.00 15.00 ? 273 MET A C   1 
ATOM   1967 O  O   . MET A 1 241 ? 30.760 58.390 186.100 1.00 15.00 ? 273 MET A O   1 
ATOM   1968 C  CB  . MET A 1 241 ? 31.650 59.320 188.960 1.00 15.00 ? 273 MET A CB  1 
ATOM   1969 C  CG  . MET A 1 241 ? 32.550 59.530 190.130 1.00 15.00 ? 273 MET A CG  1 
ATOM   1970 S  SD  . MET A 1 241 ? 32.110 58.300 191.360 1.00 15.00 ? 273 MET A SD  1 
ATOM   1971 C  CE  . MET A 1 241 ? 33.600 57.360 191.360 1.00 15.00 ? 273 MET A CE  1 
ATOM   1972 N  N   . HIS A 1 242 ? 29.780 57.010 187.550 1.00 15.00 ? 274 HIS A N   1 
ATOM   1973 C  CA  . HIS A 1 242 ? 28.610 56.840 186.710 1.00 15.00 ? 274 HIS A CA  1 
ATOM   1974 C  C   . HIS A 1 242 ? 27.630 57.850 187.260 1.00 15.00 ? 274 HIS A C   1 
ATOM   1975 O  O   . HIS A 1 242 ? 27.320 57.800 188.450 1.00 15.00 ? 274 HIS A O   1 
ATOM   1976 C  CB  . HIS A 1 242 ? 28.020 55.470 186.870 1.00 15.00 ? 274 HIS A CB  1 
ATOM   1977 C  CG  . HIS A 1 242 ? 28.840 54.510 186.060 1.00 15.00 ? 274 HIS A CG  1 
ATOM   1978 N  ND1 . HIS A 1 242 ? 29.470 53.370 186.570 1.00 15.00 ? 274 HIS A ND1 1 
ATOM   1979 C  CD2 . HIS A 1 242 ? 29.100 54.690 184.690 1.00 15.00 ? 274 HIS A CD2 1 
ATOM   1980 C  CE1 . HIS A 1 242 ? 30.110 52.850 185.490 1.00 15.00 ? 274 HIS A CE1 1 
ATOM   1981 N  NE2 . HIS A 1 242 ? 29.910 53.580 184.420 1.00 15.00 ? 274 HIS A NE2 1 
ATOM   1982 N  N   . TYR A 1 243 ? 27.180 58.810 186.490 1.00 15.00 ? 275 TYR A N   1 
ATOM   1983 C  CA  . TYR A 1 243 ? 26.190 59.760 186.950 1.00 15.00 ? 275 TYR A CA  1 
ATOM   1984 C  C   . TYR A 1 243 ? 25.240 59.910 185.780 1.00 15.00 ? 275 TYR A C   1 
ATOM   1985 O  O   . TYR A 1 243 ? 25.680 59.750 184.630 1.00 15.00 ? 275 TYR A O   1 
ATOM   1986 C  CB  . TYR A 1 243 ? 26.830 61.100 187.290 1.00 15.00 ? 275 TYR A CB  1 
ATOM   1987 C  CG  . TYR A 1 243 ? 27.130 61.280 188.770 1.00 15.00 ? 275 TYR A CG  1 
ATOM   1988 C  CD1 . TYR A 1 243 ? 26.140 61.740 189.600 1.00 15.00 ? 275 TYR A CD1 1 
ATOM   1989 C  CD2 . TYR A 1 243 ? 28.370 61.030 189.300 1.00 15.00 ? 275 TYR A CD2 1 
ATOM   1990 C  CE1 . TYR A 1 243 ? 26.380 61.970 190.940 1.00 15.00 ? 275 TYR A CE1 1 
ATOM   1991 C  CE2 . TYR A 1 243 ? 28.630 61.260 190.640 1.00 15.00 ? 275 TYR A CE2 1 
ATOM   1992 C  CZ  . TYR A 1 243 ? 27.630 61.730 191.460 1.00 15.00 ? 275 TYR A CZ  1 
ATOM   1993 O  OH  . TYR A 1 243 ? 27.880 62.050 192.790 1.00 15.00 ? 275 TYR A OH  1 
ATOM   1994 N  N   . PRO A 1 244 ? 23.940 60.110 185.970 1.00 15.00 ? 276 PRO A N   1 
ATOM   1995 C  CA  . PRO A 1 244 ? 22.990 60.280 184.890 1.00 15.00 ? 276 PRO A CA  1 
ATOM   1996 C  C   . PRO A 1 244 ? 23.400 61.510 184.120 1.00 15.00 ? 276 PRO A C   1 
ATOM   1997 O  O   . PRO A 1 244 ? 23.710 62.580 184.650 1.00 15.00 ? 276 PRO A O   1 
ATOM   1998 C  CB  . PRO A 1 244 ? 21.670 60.430 185.570 1.00 15.00 ? 276 PRO A CB  1 
ATOM   1999 C  CG  . PRO A 1 244 ? 22.050 61.090 186.880 1.00 15.00 ? 276 PRO A CG  1 
ATOM   2000 C  CD  . PRO A 1 244 ? 23.290 60.290 187.260 1.00 15.00 ? 276 PRO A CD  1 
ATOM   2001 N  N   . ARG A 1 245 ? 23.570 61.140 182.850 1.00 15.00 ? 277 ARG A N   1 
ATOM   2002 C  CA  . ARG A 1 245 ? 23.920 62.020 181.760 1.00 15.00 ? 277 ARG A CA  1 
ATOM   2003 C  C   . ARG A 1 245 ? 23.400 63.420 182.000 1.00 15.00 ? 277 ARG A C   1 
ATOM   2004 O  O   . ARG A 1 245 ? 22.240 63.590 182.350 1.00 15.00 ? 277 ARG A O   1 
ATOM   2005 C  CB  . ARG A 1 245 ? 23.330 61.380 180.520 1.00 15.00 ? 277 ARG A CB  1 
ATOM   2006 C  CG  . ARG A 1 245 ? 23.660 61.860 179.110 1.00 15.00 ? 277 ARG A CG  1 
ATOM   2007 C  CD  . ARG A 1 245 ? 25.130 61.580 178.770 1.00 15.00 ? 277 ARG A CD  1 
ATOM   2008 N  NE  . ARG A 1 245 ? 25.990 62.700 179.130 1.00 15.00 ? 277 ARG A NE  1 
ATOM   2009 C  CZ  . ARG A 1 245 ? 26.860 63.260 178.250 1.00 15.00 ? 277 ARG A CZ  1 
ATOM   2010 N  NH1 . ARG A 1 245 ? 26.970 62.780 176.990 1.00 15.00 ? 277 ARG A NH1 1 
ATOM   2011 N  NH2 . ARG A 1 245 ? 27.590 64.320 178.630 1.00 15.00 ? 277 ARG A NH2 1 
ATOM   2012 N  N   . GLY A 1 246 ? 24.240 64.440 181.930 1.00 15.00 ? 278 GLY A N   1 
ATOM   2013 C  CA  . GLY A 1 246 ? 23.690 65.770 182.130 1.00 15.00 ? 278 GLY A CA  1 
ATOM   2014 C  C   . GLY A 1 246 ? 23.970 66.270 183.530 1.00 15.00 ? 278 GLY A C   1 
ATOM   2015 O  O   . GLY A 1 246 ? 23.740 67.450 183.810 1.00 15.00 ? 278 GLY A O   1 
ATOM   2016 N  N   . ILE A 1 247 ? 24.410 65.410 184.450 1.00 15.00 ? 279 ILE A N   1 
ATOM   2017 C  CA  . ILE A 1 247 ? 24.910 65.910 185.720 1.00 15.00 ? 279 ILE A CA  1 
ATOM   2018 C  C   . ILE A 1 247 ? 26.360 66.340 185.460 1.00 15.00 ? 279 ILE A C   1 
ATOM   2019 O  O   . ILE A 1 247 ? 27.070 65.790 184.590 1.00 15.00 ? 279 ILE A O   1 
ATOM   2020 C  CB  . ILE A 1 247 ? 24.820 64.830 186.810 1.00 15.00 ? 279 ILE A CB  1 
ATOM   2021 C  CG1 . ILE A 1 247 ? 23.340 64.540 187.040 1.00 15.00 ? 279 ILE A CG1 1 
ATOM   2022 C  CG2 . ILE A 1 247 ? 25.430 65.280 188.130 1.00 15.00 ? 279 ILE A CG2 1 
ATOM   2023 C  CD1 . ILE A 1 247 ? 22.470 65.810 187.130 1.00 15.00 ? 279 ILE A CD1 1 
ATOM   2024 N  N   . PRO A 1 248 ? 26.710 67.470 186.070 1.00 15.00 ? 280 PRO A N   1 
ATOM   2025 C  CA  . PRO A 1 248 ? 27.990 68.130 185.850 1.00 15.00 ? 280 PRO A CA  1 
ATOM   2026 C  C   . PRO A 1 248 ? 29.080 67.780 186.860 1.00 15.00 ? 280 PRO A C   1 
ATOM   2027 O  O   . PRO A 1 248 ? 28.830 67.670 188.080 1.00 15.00 ? 280 PRO A O   1 
ATOM   2028 C  CB  . PRO A 1 248 ? 27.630 69.600 185.830 1.00 15.00 ? 280 PRO A CB  1 
ATOM   2029 C  CG  . PRO A 1 248 ? 26.590 69.680 186.940 1.00 15.00 ? 280 PRO A CG  1 
ATOM   2030 C  CD  . PRO A 1 248 ? 25.760 68.420 186.700 1.00 15.00 ? 280 PRO A CD  1 
ATOM   2031 N  N   . PRO A 1 249 ? 30.330 67.710 186.360 1.00 15.00 ? 281 PRO A N   1 
ATOM   2032 C  CA  . PRO A 1 249 ? 31.500 67.280 187.130 1.00 15.00 ? 281 PRO A CA  1 
ATOM   2033 C  C   . PRO A 1 249 ? 31.600 67.750 188.580 1.00 15.00 ? 281 PRO A C   1 
ATOM   2034 O  O   . PRO A 1 249 ? 31.890 67.010 189.530 1.00 15.00 ? 281 PRO A O   1 
ATOM   2035 C  CB  . PRO A 1 249 ? 32.660 67.750 186.260 1.00 15.00 ? 281 PRO A CB  1 
ATOM   2036 C  CG  . PRO A 1 249 ? 32.130 67.540 184.870 1.00 15.00 ? 281 PRO A CG  1 
ATOM   2037 C  CD  . PRO A 1 249 ? 30.690 68.030 184.980 1.00 15.00 ? 281 PRO A CD  1 
ATOM   2038 N  N   . GLN A 1 250 ? 31.240 69.010 188.720 1.00 15.00 ? 282 GLN A N   1 
ATOM   2039 C  CA  . GLN A 1 250 ? 31.340 69.790 189.920 1.00 15.00 ? 282 GLN A CA  1 
ATOM   2040 C  C   . GLN A 1 250 ? 30.410 69.260 190.960 1.00 15.00 ? 282 GLN A C   1 
ATOM   2041 O  O   . GLN A 1 250 ? 30.760 69.220 192.150 1.00 15.00 ? 282 GLN A O   1 
ATOM   2042 C  CB  . GLN A 1 250 ? 30.960 71.220 189.660 1.00 15.00 ? 282 GLN A CB  1 
ATOM   2043 C  CG  . GLN A 1 250 ? 31.670 71.820 188.430 1.00 15.00 ? 282 GLN A CG  1 
ATOM   2044 C  CD  . GLN A 1 250 ? 30.910 71.670 187.090 1.00 15.00 ? 282 GLN A CD  1 
ATOM   2045 O  OE1 . GLN A 1 250 ? 30.530 70.570 186.650 1.00 15.00 ? 282 GLN A OE1 1 
ATOM   2046 N  NE2 . GLN A 1 250 ? 30.660 72.790 186.390 1.00 15.00 ? 282 GLN A NE2 1 
ATOM   2047 N  N   . SER A 1 251 ? 29.250 68.860 190.480 1.00 15.00 ? 283 SER A N   1 
ATOM   2048 C  CA  . SER A 1 251 ? 28.220 68.360 191.370 1.00 15.00 ? 283 SER A CA  1 
ATOM   2049 C  C   . SER A 1 251 ? 28.340 66.880 191.610 1.00 15.00 ? 283 SER A C   1 
ATOM   2050 O  O   . SER A 1 251 ? 27.600 66.290 192.400 1.00 15.00 ? 283 SER A O   1 
ATOM   2051 C  CB  . SER A 1 251 ? 26.900 68.710 190.750 1.00 15.00 ? 283 SER A CB  1 
ATOM   2052 O  OG  . SER A 1 251 ? 26.950 70.070 190.320 1.00 15.00 ? 283 SER A OG  1 
ATOM   2053 N  N   . GLN A 1 252 ? 29.280 66.260 190.910 1.00 15.00 ? 284 GLN A N   1 
ATOM   2054 C  CA  . GLN A 1 252 ? 29.520 64.850 191.090 1.00 15.00 ? 284 GLN A CA  1 
ATOM   2055 C  C   . GLN A 1 252 ? 30.580 64.670 192.160 1.00 15.00 ? 284 GLN A C   1 
ATOM   2056 O  O   . GLN A 1 252 ? 31.460 65.540 192.290 1.00 15.00 ? 284 GLN A O   1 
ATOM   2057 C  CB  . GLN A 1 252 ? 29.970 64.290 189.780 1.00 15.00 ? 284 GLN A CB  1 
ATOM   2058 C  CG  . GLN A 1 252 ? 28.890 64.430 188.730 1.00 15.00 ? 284 GLN A CG  1 
ATOM   2059 C  CD  . GLN A 1 252 ? 29.350 63.980 187.350 1.00 15.00 ? 284 GLN A CD  1 
ATOM   2060 O  OE1 . GLN A 1 252 ? 29.140 64.670 186.360 1.00 15.00 ? 284 GLN A OE1 1 
ATOM   2061 N  NE2 . GLN A 1 252 ? 30.010 62.840 187.210 1.00 15.00 ? 284 GLN A NE2 1 
ATOM   2062 N  N   . MET A 1 253 ? 30.540 63.620 192.980 1.00 15.00 ? 285 MET A N   1 
ATOM   2063 C  CA  . MET A 1 253 ? 31.590 63.420 193.960 1.00 15.00 ? 285 MET A CA  1 
ATOM   2064 C  C   . MET A 1 253 ? 32.370 62.220 193.480 1.00 15.00 ? 285 MET A C   1 
ATOM   2065 O  O   . MET A 1 253 ? 31.790 61.280 192.920 1.00 15.00 ? 285 MET A O   1 
ATOM   2066 C  CB  . MET A 1 253 ? 31.020 63.140 195.350 1.00 15.00 ? 285 MET A CB  1 
ATOM   2067 C  CG  . MET A 1 253 ? 30.360 64.420 195.830 1.00 15.00 ? 285 MET A CG  1 
ATOM   2068 S  SD  . MET A 1 253 ? 30.090 64.550 197.620 1.00 15.00 ? 285 MET A SD  1 
ATOM   2069 C  CE  . MET A 1 253 ? 28.860 63.290 197.760 1.00 15.00 ? 285 MET A CE  1 
ATOM   2070 N  N   . ALA A 1 254 ? 33.690 62.300 193.630 1.00 15.00 ? 286 ALA A N   1 
ATOM   2071 C  CA  . ALA A 1 254 ? 34.630 61.280 193.190 1.00 15.00 ? 286 ALA A CA  1 
ATOM   2072 C  C   . ALA A 1 254 ? 34.960 60.330 194.330 1.00 15.00 ? 286 ALA A C   1 
ATOM   2073 O  O   . ALA A 1 254 ? 35.420 60.740 195.400 1.00 15.00 ? 286 ALA A O   1 
ATOM   2074 C  CB  . ALA A 1 254 ? 35.870 61.970 192.710 1.00 15.00 ? 286 ALA A CB  1 
ATOM   2075 N  N   . VAL A 1 255 ? 34.750 59.030 194.130 1.00 15.00 ? 287 VAL A N   1 
ATOM   2076 C  CA  . VAL A 1 255 ? 34.800 58.170 195.280 1.00 15.00 ? 287 VAL A CA  1 
ATOM   2077 C  C   . VAL A 1 255 ? 35.630 56.920 195.310 1.00 15.00 ? 287 VAL A C   1 
ATOM   2078 O  O   . VAL A 1 255 ? 36.260 56.720 196.350 1.00 15.00 ? 287 VAL A O   1 
ATOM   2079 C  CB  . VAL A 1 255 ? 33.310 57.900 195.630 1.00 15.00 ? 287 VAL A CB  1 
ATOM   2080 C  CG1 . VAL A 1 255 ? 32.920 56.510 196.100 1.00 15.00 ? 287 VAL A CG1 1 
ATOM   2081 C  CG2 . VAL A 1 255 ? 33.090 58.800 196.820 1.00 15.00 ? 287 VAL A CG2 1 
ATOM   2082 N  N   . GLY A 1 256 ? 35.670 56.070 194.290 1.00 15.00 ? 288 GLY A N   1 
ATOM   2083 C  CA  . GLY A 1 256 ? 36.430 54.840 194.410 1.00 15.00 ? 288 GLY A CA  1 
ATOM   2084 C  C   . GLY A 1 256 ? 35.690 53.760 193.680 1.00 15.00 ? 288 GLY A C   1 
ATOM   2085 O  O   . GLY A 1 256 ? 36.190 53.180 192.710 1.00 15.00 ? 288 GLY A O   1 
ATOM   2086 N  N   . GLN A 1 257 ? 34.470 53.500 194.160 1.00 15.00 ? 289 GLN A N   1 
ATOM   2087 C  CA  . GLN A 1 257 ? 33.530 52.630 193.450 1.00 15.00 ? 289 GLN A CA  1 
ATOM   2088 C  C   . GLN A 1 257 ? 32.680 53.550 192.570 1.00 15.00 ? 289 GLN A C   1 
ATOM   2089 O  O   . GLN A 1 257 ? 31.950 54.430 193.040 1.00 15.00 ? 289 GLN A O   1 
ATOM   2090 C  CB  . GLN A 1 257 ? 32.650 51.900 194.440 1.00 15.00 ? 289 GLN A CB  1 
ATOM   2091 C  CG  . GLN A 1 257 ? 32.380 50.430 194.170 1.00 15.00 ? 289 GLN A CG  1 
ATOM   2092 C  CD  . GLN A 1 257 ? 31.600 50.070 192.920 1.00 15.00 ? 289 GLN A CD  1 
ATOM   2093 O  OE1 . GLN A 1 257 ? 31.490 50.850 191.970 1.00 15.00 ? 289 GLN A OE1 1 
ATOM   2094 N  NE2 . GLN A 1 257 ? 31.030 48.860 192.890 1.00 15.00 ? 289 GLN A NE2 1 
ATOM   2095 N  N   . GLU A 1 258 ? 32.700 53.350 191.260 1.00 15.00 ? 290 GLU A N   1 
ATOM   2096 C  CA  . GLU A 1 258 ? 32.080 54.300 190.340 1.00 15.00 ? 290 GLU A CA  1 
ATOM   2097 C  C   . GLU A 1 258 ? 30.560 54.450 190.430 1.00 15.00 ? 290 GLU A C   1 
ATOM   2098 O  O   . GLU A 1 258 ? 29.970 55.480 190.070 1.00 15.00 ? 290 GLU A O   1 
ATOM   2099 C  CB  . GLU A 1 258 ? 32.470 53.970 188.890 1.00 15.00 ? 290 GLU A CB  1 
ATOM   2100 C  CG  . GLU A 1 258 ? 32.470 52.520 188.420 1.00 15.00 ? 290 GLU A CG  1 
ATOM   2101 C  CD  . GLU A 1 258 ? 33.680 51.640 188.790 1.00 15.00 ? 290 GLU A CD  1 
ATOM   2102 O  OE1 . GLU A 1 258 ? 34.690 52.120 189.340 1.00 15.00 ? 290 GLU A OE1 1 
ATOM   2103 O  OE2 . GLU A 1 258 ? 33.600 50.440 188.500 1.00 15.00 ? 290 GLU A OE2 1 
ATOM   2104 N  N   . VAL A 1 259 ? 29.920 53.410 190.940 1.00 15.00 ? 291 VAL A N   1 
ATOM   2105 C  CA  . VAL A 1 259 ? 28.480 53.370 191.070 1.00 15.00 ? 291 VAL A CA  1 
ATOM   2106 C  C   . VAL A 1 259 ? 27.920 54.230 192.180 1.00 15.00 ? 291 VAL A C   1 
ATOM   2107 O  O   . VAL A 1 259 ? 26.820 54.750 192.060 1.00 15.00 ? 291 VAL A O   1 
ATOM   2108 C  CB  . VAL A 1 259 ? 28.180 51.900 191.230 1.00 15.00 ? 291 VAL A CB  1 
ATOM   2109 C  CG1 . VAL A 1 259 ? 26.870 51.570 191.920 1.00 15.00 ? 291 VAL A CG1 1 
ATOM   2110 C  CG2 . VAL A 1 259 ? 28.180 51.400 189.800 1.00 15.00 ? 291 VAL A CG2 1 
ATOM   2111 N  N   . PHE A 1 260 ? 28.670 54.490 193.230 1.00 15.00 ? 292 PHE A N   1 
ATOM   2112 C  CA  . PHE A 1 260 ? 28.120 55.100 194.420 1.00 15.00 ? 292 PHE A CA  1 
ATOM   2113 C  C   . PHE A 1 260 ? 27.440 56.450 194.300 1.00 15.00 ? 292 PHE A C   1 
ATOM   2114 O  O   . PHE A 1 260 ? 26.930 56.930 195.300 1.00 15.00 ? 292 PHE A O   1 
ATOM   2115 C  CB  . PHE A 1 260 ? 29.220 55.150 195.470 1.00 15.00 ? 292 PHE A CB  1 
ATOM   2116 C  CG  . PHE A 1 260 ? 29.660 53.790 196.020 1.00 15.00 ? 292 PHE A CG  1 
ATOM   2117 C  CD1 . PHE A 1 260 ? 29.160 52.590 195.540 1.00 15.00 ? 292 PHE A CD1 1 
ATOM   2118 C  CD2 . PHE A 1 260 ? 30.580 53.740 197.040 1.00 15.00 ? 292 PHE A CD2 1 
ATOM   2119 C  CE1 . PHE A 1 260 ? 29.580 51.390 196.070 1.00 15.00 ? 292 PHE A CE1 1 
ATOM   2120 C  CE2 . PHE A 1 260 ? 31.000 52.540 197.550 1.00 15.00 ? 292 PHE A CE2 1 
ATOM   2121 C  CZ  . PHE A 1 260 ? 30.510 51.360 197.080 1.00 15.00 ? 292 PHE A CZ  1 
ATOM   2122 N  N   . GLY A 1 261 ? 27.410 57.060 193.110 1.00 15.00 ? 293 GLY A N   1 
ATOM   2123 C  CA  . GLY A 1 261 ? 26.630 58.270 192.870 1.00 15.00 ? 293 GLY A CA  1 
ATOM   2124 C  C   . GLY A 1 261 ? 25.120 57.970 193.010 1.00 15.00 ? 293 GLY A C   1 
ATOM   2125 O  O   . GLY A 1 261 ? 24.350 58.760 193.570 1.00 15.00 ? 293 GLY A O   1 
ATOM   2126 N  N   . LEU A 1 262 ? 24.600 56.850 192.710 1.00 15.00 ? 294 LEU A N   1 
ATOM   2127 C  CA  . LEU A 1 262 ? 23.310 56.160 192.600 1.00 15.00 ? 294 LEU A CA  1 
ATOM   2128 C  C   . LEU A 1 262 ? 22.420 56.540 193.790 1.00 15.00 ? 294 LEU A C   1 
ATOM   2129 O  O   . LEU A 1 262 ? 21.240 56.890 193.620 1.00 15.00 ? 294 LEU A O   1 
ATOM   2130 C  CB  . LEU A 1 262 ? 23.550 54.650 192.540 1.00 15.00 ? 294 LEU A CB  1 
ATOM   2131 C  CG  . LEU A 1 262 ? 22.260 53.800 192.530 1.00 15.00 ? 294 LEU A CG  1 
ATOM   2132 C  CD1 . LEU A 1 262 ? 21.250 54.230 191.470 1.00 15.00 ? 294 LEU A CD1 1 
ATOM   2133 C  CD2 . LEU A 1 262 ? 22.530 52.320 192.260 1.00 15.00 ? 294 LEU A CD2 1 
ATOM   2134 N  N   . LEU A 1 263 ? 22.980 56.480 195.000 1.00 15.00 ? 295 LEU A N   1 
ATOM   2135 C  CA  . LEU A 1 263 ? 22.220 56.850 196.220 1.00 15.00 ? 295 LEU A CA  1 
ATOM   2136 C  C   . LEU A 1 263 ? 23.050 57.530 197.290 1.00 15.00 ? 295 LEU A C   1 
ATOM   2137 O  O   . LEU A 1 263 ? 24.280 57.390 197.340 1.00 15.00 ? 295 LEU A O   1 
ATOM   2138 C  CB  . LEU A 1 263 ? 21.690 55.650 197.020 1.00 15.00 ? 295 LEU A CB  1 
ATOM   2139 C  CG  . LEU A 1 263 ? 21.100 54.510 196.210 1.00 15.00 ? 295 LEU A CG  1 
ATOM   2140 C  CD1 . LEU A 1 263 ? 22.150 53.470 195.810 1.00 15.00 ? 295 LEU A CD1 1 
ATOM   2141 C  CD2 . LEU A 1 263 ? 20.030 53.730 196.990 1.00 15.00 ? 295 LEU A CD2 1 
ATOM   2142 N  N   . PRO A 1 264 ? 22.380 58.280 198.190 1.00 15.00 ? 296 PRO A N   1 
ATOM   2143 C  CA  . PRO A 1 264 ? 23.030 58.860 199.340 1.00 15.00 ? 296 PRO A CA  1 
ATOM   2144 C  C   . PRO A 1 264 ? 23.600 57.740 200.160 1.00 15.00 ? 296 PRO A C   1 
ATOM   2145 O  O   . PRO A 1 264 ? 24.770 57.850 200.630 1.00 15.00 ? 296 PRO A O   1 
ATOM   2146 C  CB  . PRO A 1 264 ? 21.920 59.600 200.050 1.00 15.00 ? 296 PRO A CB  1 
ATOM   2147 C  CG  . PRO A 1 264 ? 20.650 59.410 199.250 1.00 15.00 ? 296 PRO A CG  1 
ATOM   2148 C  CD  . PRO A 1 264 ? 20.950 58.570 198.050 1.00 15.00 ? 296 PRO A CD  1 
ATOM   2149 N  N   . GLY A 1 265 ? 22.780 56.710 200.320 1.00 15.00 ? 297 GLY A N   1 
ATOM   2150 C  CA  . GLY A 1 265 ? 23.170 55.520 201.070 1.00 15.00 ? 297 GLY A CA  1 
ATOM   2151 C  C   . GLY A 1 265 ? 24.650 55.240 200.820 1.00 15.00 ? 297 GLY A C   1 
ATOM   2152 O  O   . GLY A 1 265 ? 25.490 55.400 201.720 1.00 15.00 ? 297 GLY A O   1 
ATOM   2153 N  N   . LEU A 1 266 ? 24.940 54.860 199.600 1.00 15.00 ? 298 LEU A N   1 
ATOM   2154 C  CA  . LEU A 1 266 ? 26.300 54.520 199.190 1.00 15.00 ? 298 LEU A CA  1 
ATOM   2155 C  C   . LEU A 1 266 ? 27.280 55.680 199.500 1.00 15.00 ? 298 LEU A C   1 
ATOM   2156 O  O   . LEU A 1 266 ? 28.370 55.470 200.030 1.00 15.00 ? 298 LEU A O   1 
ATOM   2157 C  CB  . LEU A 1 266 ? 26.330 54.190 197.690 1.00 15.00 ? 298 LEU A CB  1 
ATOM   2158 C  CG  . LEU A 1 266 ? 26.740 52.730 197.410 1.00 15.00 ? 298 LEU A CG  1 
ATOM   2159 C  CD1 . LEU A 1 266 ? 26.640 51.840 198.650 1.00 15.00 ? 298 LEU A CD1 1 
ATOM   2160 C  CD2 . LEU A 1 266 ? 25.880 52.050 196.350 1.00 15.00 ? 298 LEU A CD2 1 
ATOM   2161 N  N   . MET A 1 267 ? 26.870 56.910 199.180 1.00 15.00 ? 299 MET A N   1 
ATOM   2162 C  CA  . MET A 1 267 ? 27.730 58.110 199.370 1.00 15.00 ? 299 MET A CA  1 
ATOM   2163 C  C   . MET A 1 267 ? 28.020 58.410 200.860 1.00 15.00 ? 299 MET A C   1 
ATOM   2164 O  O   . MET A 1 267 ? 29.160 58.740 201.240 1.00 15.00 ? 299 MET A O   1 
ATOM   2165 C  CB  . MET A 1 267 ? 27.080 59.350 198.760 1.00 15.00 ? 299 MET A CB  1 
ATOM   2166 C  CG  . MET A 1 267 ? 27.500 59.600 197.310 1.00 15.00 ? 299 MET A CG  1 
ATOM   2167 S  SD  . MET A 1 267 ? 29.270 59.660 197.090 1.00 15.00 ? 299 MET A SD  1 
ATOM   2168 C  CE  . MET A 1 267 ? 29.660 59.770 195.350 1.00 15.00 ? 299 MET A CE  1 
ATOM   2169 N  N   . LEU A 1 268 ? 26.990 58.290 201.680 1.00 15.00 ? 300 LEU A N   1 
ATOM   2170 C  CA  . LEU A 1 268 ? 27.090 58.540 203.130 1.00 15.00 ? 300 LEU A CA  1 
ATOM   2171 C  C   . LEU A 1 268 ? 28.320 57.820 203.710 1.00 15.00 ? 300 LEU A C   1 
ATOM   2172 O  O   . LEU A 1 268 ? 29.210 58.440 204.310 1.00 15.00 ? 300 LEU A O   1 
ATOM   2173 C  CB  . LEU A 1 268 ? 25.840 58.000 203.830 1.00 15.00 ? 300 LEU A CB  1 
ATOM   2174 C  CG  . LEU A 1 268 ? 25.600 58.600 205.220 1.00 15.00 ? 300 LEU A CG  1 
ATOM   2175 C  CD1 . LEU A 1 268 ? 24.590 57.800 206.060 1.00 15.00 ? 300 LEU A CD1 1 
ATOM   2176 C  CD2 . LEU A 1 268 ? 26.870 58.680 206.080 1.00 15.00 ? 300 LEU A CD2 1 
ATOM   2177 N  N   . TYR A 1 269 ? 28.310 56.520 203.490 1.00 15.00 ? 301 TYR A N   1 
ATOM   2178 C  CA  . TYR A 1 269 ? 29.340 55.610 204.000 1.00 15.00 ? 301 TYR A CA  1 
ATOM   2179 C  C   . TYR A 1 269 ? 30.730 55.940 203.430 1.00 15.00 ? 301 TYR A C   1 
ATOM   2180 O  O   . TYR A 1 269 ? 31.730 55.970 204.150 1.00 15.00 ? 301 TYR A O   1 
ATOM   2181 C  CB  . TYR A 1 269 ? 28.960 54.170 203.680 1.00 15.00 ? 301 TYR A CB  1 
ATOM   2182 C  CG  . TYR A 1 269 ? 28.240 53.510 204.860 1.00 15.00 ? 301 TYR A CG  1 
ATOM   2183 C  CD1 . TYR A 1 269 ? 28.950 53.240 206.040 1.00 15.00 ? 301 TYR A CD1 1 
ATOM   2184 C  CD2 . TYR A 1 269 ? 26.880 53.200 204.780 1.00 15.00 ? 301 TYR A CD2 1 
ATOM   2185 C  CE1 . TYR A 1 269 ? 28.310 52.650 207.120 1.00 15.00 ? 301 TYR A CE1 1 
ATOM   2186 C  CE2 . TYR A 1 269 ? 26.240 52.600 205.860 1.00 15.00 ? 301 TYR A CE2 1 
ATOM   2187 C  CZ  . TYR A 1 269 ? 26.950 52.320 207.040 1.00 15.00 ? 301 TYR A CZ  1 
ATOM   2188 O  OH  . TYR A 1 269 ? 26.320 51.740 208.090 1.00 15.00 ? 301 TYR A OH  1 
ATOM   2189 N  N   . ALA A 1 270 ? 30.800 56.170 202.130 1.00 15.00 ? 302 ALA A N   1 
ATOM   2190 C  CA  . ALA A 1 270 ? 32.080 56.490 201.480 1.00 15.00 ? 302 ALA A CA  1 
ATOM   2191 C  C   . ALA A 1 270 ? 32.650 57.790 202.080 1.00 15.00 ? 302 ALA A C   1 
ATOM   2192 O  O   . ALA A 1 270 ? 33.860 57.910 202.300 1.00 15.00 ? 302 ALA A O   1 
ATOM   2193 C  CB  . ALA A 1 270 ? 31.880 56.690 199.980 1.00 15.00 ? 302 ALA A CB  1 
ATOM   2194 N  N   . THR A 1 271 ? 31.770 58.720 202.520 1.00 15.00 ? 303 THR A N   1 
ATOM   2195 C  CA  . THR A 1 271 ? 32.200 59.900 203.230 1.00 15.00 ? 303 THR A CA  1 
ATOM   2196 C  C   . THR A 1 271 ? 32.770 59.470 204.560 1.00 15.00 ? 303 THR A C   1 
ATOM   2197 O  O   . THR A 1 271 ? 33.920 59.810 204.810 1.00 15.00 ? 303 THR A O   1 
ATOM   2198 C  CB  . THR A 1 271 ? 31.020 60.830 203.410 1.00 15.00 ? 303 THR A CB  1 
ATOM   2199 O  OG1 . THR A 1 271 ? 30.690 61.210 202.100 1.00 15.00 ? 303 THR A OG1 1 
ATOM   2200 C  CG2 . THR A 1 271 ? 31.270 62.070 204.190 1.00 15.00 ? 303 THR A CG2 1 
ATOM   2201 N  N   . ILE A 1 272 ? 32.080 58.650 205.380 1.00 15.00 ? 304 ILE A N   1 
ATOM   2202 C  CA  . ILE A 1 272 ? 32.600 58.240 206.680 1.00 15.00 ? 304 ILE A CA  1 
ATOM   2203 C  C   . ILE A 1 272 ? 33.960 57.610 206.490 1.00 15.00 ? 304 ILE A C   1 
ATOM   2204 O  O   . ILE A 1 272 ? 34.930 58.130 207.020 1.00 15.00 ? 304 ILE A O   1 
ATOM   2205 C  CB  . ILE A 1 272 ? 31.710 57.190 207.410 1.00 15.00 ? 304 ILE A CB  1 
ATOM   2206 C  CG1 . ILE A 1 272 ? 30.300 57.700 207.570 1.00 15.00 ? 304 ILE A CG1 1 
ATOM   2207 C  CG2 . ILE A 1 272 ? 32.280 56.920 208.800 1.00 15.00 ? 304 ILE A CG2 1 
ATOM   2208 C  CD1 . ILE A 1 272 ? 29.340 56.730 208.270 1.00 15.00 ? 304 ILE A CD1 1 
ATOM   2209 N  N   . TRP A 1 273 ? 34.100 56.600 205.640 1.00 15.00 ? 305 TRP A N   1 
ATOM   2210 C  CA  . TRP A 1 273 ? 35.390 55.990 205.460 1.00 15.00 ? 305 TRP A CA  1 
ATOM   2211 C  C   . TRP A 1 273 ? 36.460 56.920 204.900 1.00 15.00 ? 305 TRP A C   1 
ATOM   2212 O  O   . TRP A 1 273 ? 37.620 56.690 205.210 1.00 15.00 ? 305 TRP A O   1 
ATOM   2213 C  CB  . TRP A 1 273 ? 35.230 54.780 204.570 1.00 15.00 ? 305 TRP A CB  1 
ATOM   2214 C  CG  . TRP A 1 273 ? 34.560 53.610 205.260 1.00 15.00 ? 305 TRP A CG  1 
ATOM   2215 C  CD1 . TRP A 1 273 ? 33.300 53.280 204.890 1.00 15.00 ? 305 TRP A CD1 1 
ATOM   2216 C  CD2 . TRP A 1 273 ? 35.070 52.760 206.220 1.00 15.00 ? 305 TRP A CD2 1 
ATOM   2217 N  NE1 . TRP A 1 273 ? 33.000 52.240 205.600 1.00 15.00 ? 305 TRP A NE1 1 
ATOM   2218 C  CE2 . TRP A 1 273 ? 34.020 51.900 206.400 1.00 15.00 ? 305 TRP A CE2 1 
ATOM   2219 C  CE3 . TRP A 1 273 ? 36.220 52.570 206.960 1.00 15.00 ? 305 TRP A CE3 1 
ATOM   2220 C  CZ2 . TRP A 1 273 ? 34.090 50.860 207.300 1.00 15.00 ? 305 TRP A CZ2 1 
ATOM   2221 C  CZ3 . TRP A 1 273 ? 36.300 51.530 207.870 1.00 15.00 ? 305 TRP A CZ3 1 
ATOM   2222 C  CH2 . TRP A 1 273 ? 35.240 50.680 208.040 1.00 15.00 ? 305 TRP A CH2 1 
ATOM   2223 N  N   . LEU A 1 274 ? 36.180 57.980 204.140 1.00 15.00 ? 306 LEU A N   1 
ATOM   2224 C  CA  . LEU A 1 274 ? 37.220 58.910 203.700 1.00 15.00 ? 306 LEU A CA  1 
ATOM   2225 C  C   . LEU A 1 274 ? 37.710 59.710 204.890 1.00 15.00 ? 306 LEU A C   1 
ATOM   2226 O  O   . LEU A 1 274 ? 38.900 59.930 205.100 1.00 15.00 ? 306 LEU A O   1 
ATOM   2227 C  CB  . LEU A 1 274 ? 36.670 59.860 202.640 1.00 15.00 ? 306 LEU A CB  1 
ATOM   2228 C  CG  . LEU A 1 274 ? 37.580 60.910 202.020 1.00 15.00 ? 306 LEU A CG  1 
ATOM   2229 C  CD1 . LEU A 1 274 ? 37.390 60.980 200.520 1.00 15.00 ? 306 LEU A CD1 1 
ATOM   2230 C  CD2 . LEU A 1 274 ? 37.260 62.250 202.630 1.00 15.00 ? 306 LEU A CD2 1 
ATOM   2231 N  N   . ARG A 1 275 ? 36.770 60.160 205.710 1.00 15.00 ? 307 ARG A N   1 
ATOM   2232 C  CA  . ARG A 1 275 ? 37.080 60.900 206.910 1.00 15.00 ? 307 ARG A CA  1 
ATOM   2233 C  C   . ARG A 1 275 ? 37.920 60.020 207.820 1.00 15.00 ? 307 ARG A C   1 
ATOM   2234 O  O   . ARG A 1 275 ? 38.970 60.450 208.280 1.00 15.00 ? 307 ARG A O   1 
ATOM   2235 C  CB  . ARG A 1 275 ? 35.760 61.330 207.560 1.00 15.00 ? 307 ARG A CB  1 
ATOM   2236 C  CG  . ARG A 1 275 ? 35.210 62.500 206.760 1.00 15.00 ? 307 ARG A CG  1 
ATOM   2237 C  CD  . ARG A 1 275 ? 33.690 62.700 206.730 1.00 15.00 ? 307 ARG A CD  1 
ATOM   2238 N  NE  . ARG A 1 275 ? 33.070 63.270 207.920 1.00 15.00 ? 307 ARG A NE  1 
ATOM   2239 C  CZ  . ARG A 1 275 ? 32.150 64.250 207.850 1.00 15.00 ? 307 ARG A CZ  1 
ATOM   2240 N  NH1 . ARG A 1 275 ? 31.750 64.790 206.700 1.00 15.00 ? 307 ARG A NH1 1 
ATOM   2241 N  NH2 . ARG A 1 275 ? 31.570 64.650 208.990 1.00 15.00 ? 307 ARG A NH2 1 
ATOM   2242 N  N   . GLU A 1 276 ? 37.530 58.770 208.020 1.00 15.00 ? 308 GLU A N   1 
ATOM   2243 C  CA  . GLU A 1 276 ? 38.300 57.830 208.790 1.00 15.00 ? 308 GLU A CA  1 
ATOM   2244 C  C   . GLU A 1 276 ? 39.690 57.620 208.260 1.00 15.00 ? 308 GLU A C   1 
ATOM   2245 O  O   . GLU A 1 276 ? 40.610 57.460 209.060 1.00 15.00 ? 308 GLU A O   1 
ATOM   2246 C  CB  . GLU A 1 276 ? 37.590 56.520 208.830 1.00 15.00 ? 308 GLU A CB  1 
ATOM   2247 C  CG  . GLU A 1 276 ? 38.280 55.450 209.650 1.00 15.00 ? 308 GLU A CG  1 
ATOM   2248 C  CD  . GLU A 1 276 ? 38.550 55.730 211.120 1.00 15.00 ? 308 GLU A CD  1 
ATOM   2249 O  OE1 . GLU A 1 276 ? 38.060 56.700 211.680 1.00 15.00 ? 308 GLU A OE1 1 
ATOM   2250 O  OE2 . GLU A 1 276 ? 39.260 54.940 211.710 1.00 15.00 ? 308 GLU A OE2 1 
ATOM   2251 N  N   . HIS A 1 277 ? 39.900 57.630 206.950 1.00 15.00 ? 309 HIS A N   1 
ATOM   2252 C  CA  . HIS A 1 277 ? 41.230 57.440 206.390 1.00 15.00 ? 309 HIS A CA  1 
ATOM   2253 C  C   . HIS A 1 277 ? 42.100 58.610 206.790 1.00 15.00 ? 309 HIS A C   1 
ATOM   2254 O  O   . HIS A 1 277 ? 43.140 58.430 207.420 1.00 15.00 ? 309 HIS A O   1 
ATOM   2255 C  CB  . HIS A 1 277 ? 41.130 57.360 204.910 1.00 15.00 ? 309 HIS A CB  1 
ATOM   2256 C  CG  . HIS A 1 277 ? 42.470 57.170 204.250 1.00 15.00 ? 309 HIS A CG  1 
ATOM   2257 N  ND1 . HIS A 1 277 ? 43.250 58.200 203.730 1.00 15.00 ? 309 HIS A ND1 1 
ATOM   2258 C  CD2 . HIS A 1 277 ? 43.070 55.940 204.070 1.00 15.00 ? 309 HIS A CD2 1 
ATOM   2259 C  CE1 . HIS A 1 277 ? 44.320 57.570 203.210 1.00 15.00 ? 309 HIS A CE1 1 
ATOM   2260 N  NE2 . HIS A 1 277 ? 44.240 56.290 203.380 1.00 15.00 ? 309 HIS A NE2 1 
ATOM   2261 N  N   . GLN A 1 278 ? 41.650 59.820 206.510 1.00 15.00 ? 310 GLN A N   1 
ATOM   2262 C  CA  . GLN A 1 278 ? 42.370 61.000 206.910 1.00 15.00 ? 310 GLN A CA  1 
ATOM   2263 C  C   . GLN A 1 278 ? 42.790 61.020 208.360 1.00 15.00 ? 310 GLN A C   1 
ATOM   2264 O  O   . GLN A 1 278 ? 43.950 61.270 208.670 1.00 15.00 ? 310 GLN A O   1 
ATOM   2265 C  CB  . GLN A 1 278 ? 41.500 62.180 206.660 1.00 15.00 ? 310 GLN A CB  1 
ATOM   2266 C  CG  . GLN A 1 278 ? 41.970 62.960 205.490 1.00 15.00 ? 310 GLN A CG  1 
ATOM   2267 C  CD  . GLN A 1 278 ? 41.970 62.210 204.180 1.00 15.00 ? 310 GLN A CD  1 
ATOM   2268 O  OE1 . GLN A 1 278 ? 42.450 61.100 203.990 1.00 15.00 ? 310 GLN A OE1 1 
ATOM   2269 N  NE2 . GLN A 1 278 ? 41.430 62.890 203.200 1.00 15.00 ? 310 GLN A NE2 1 
ATOM   2270 N  N   . ARG A 1 279 ? 41.860 60.690 209.230 1.00 15.00 ? 311 ARG A N   1 
ATOM   2271 C  CA  . ARG A 1 279 ? 42.090 60.660 210.650 1.00 15.00 ? 311 ARG A CA  1 
ATOM   2272 C  C   . ARG A 1 279 ? 43.250 59.760 210.960 1.00 15.00 ? 311 ARG A C   1 
ATOM   2273 O  O   . ARG A 1 279 ? 44.220 60.200 211.580 1.00 15.00 ? 311 ARG A O   1 
ATOM   2274 C  CB  . ARG A 1 279 ? 40.880 60.150 211.360 1.00 15.00 ? 311 ARG A CB  1 
ATOM   2275 C  CG  . ARG A 1 279 ? 41.020 60.250 212.860 1.00 15.00 ? 311 ARG A CG  1 
ATOM   2276 C  CD  . ARG A 1 279 ? 39.790 59.670 213.490 1.00 15.00 ? 311 ARG A CD  1 
ATOM   2277 N  NE  . ARG A 1 279 ? 39.810 58.230 213.420 1.00 15.00 ? 311 ARG A NE  1 
ATOM   2278 C  CZ  . ARG A 1 279 ? 40.200 57.510 214.470 1.00 15.00 ? 311 ARG A CZ  1 
ATOM   2279 N  NH1 . ARG A 1 279 ? 40.590 58.050 215.630 1.00 15.00 ? 311 ARG A NH1 1 
ATOM   2280 N  NH2 . ARG A 1 279 ? 40.170 56.190 214.370 1.00 15.00 ? 311 ARG A NH2 1 
ATOM   2281 N  N   . VAL A 1 280 ? 43.170 58.530 210.460 1.00 15.00 ? 312 VAL A N   1 
ATOM   2282 C  CA  . VAL A 1 280 ? 44.210 57.560 210.730 1.00 15.00 ? 312 VAL A CA  1 
ATOM   2283 C  C   . VAL A 1 280 ? 45.520 58.100 210.190 1.00 15.00 ? 312 VAL A C   1 
ATOM   2284 O  O   . VAL A 1 280 ? 46.490 58.070 210.950 1.00 15.00 ? 312 VAL A O   1 
ATOM   2285 C  CB  . VAL A 1 280 ? 43.870 56.220 210.090 1.00 15.00 ? 312 VAL A CB  1 
ATOM   2286 C  CG1 . VAL A 1 280 ? 44.990 55.230 210.240 1.00 15.00 ? 312 VAL A CG1 1 
ATOM   2287 C  CG2 . VAL A 1 280 ? 42.710 55.620 210.850 1.00 15.00 ? 312 VAL A CG2 1 
ATOM   2288 N  N   . CYS A 1 281 ? 45.570 58.670 208.980 1.00 15.00 ? 313 CYS A N   1 
ATOM   2289 C  CA  . CYS A 1 281 ? 46.790 59.240 208.470 1.00 15.00 ? 313 CYS A CA  1 
ATOM   2290 C  C   . CYS A 1 281 ? 47.400 60.150 209.500 1.00 15.00 ? 313 CYS A C   1 
ATOM   2291 O  O   . CYS A 1 281 ? 48.530 59.920 209.900 1.00 15.00 ? 313 CYS A O   1 
ATOM   2292 C  CB  . CYS A 1 281 ? 46.550 60.040 207.250 1.00 15.00 ? 313 CYS A CB  1 
ATOM   2293 S  SG  . CYS A 1 281 ? 46.330 58.980 205.820 1.00 15.00 ? 313 CYS A SG  1 
ATOM   2294 N  N   . ASP A 1 282 ? 46.650 61.070 210.090 1.00 15.00 ? 314 ASP A N   1 
ATOM   2295 C  CA  . ASP A 1 282 ? 47.230 61.990 211.030 1.00 15.00 ? 314 ASP A CA  1 
ATOM   2296 C  C   . ASP A 1 282 ? 47.770 61.330 212.270 1.00 15.00 ? 314 ASP A C   1 
ATOM   2297 O  O   . ASP A 1 282 ? 48.840 61.750 212.730 1.00 15.00 ? 314 ASP A O   1 
ATOM   2298 C  CB  . ASP A 1 282 ? 46.220 63.040 211.440 1.00 15.00 ? 314 ASP A CB  1 
ATOM   2299 C  CG  . ASP A 1 282 ? 45.980 64.030 210.310 1.00 15.00 ? 314 ASP A CG  1 
ATOM   2300 O  OD1 . ASP A 1 282 ? 46.930 64.510 209.690 1.00 15.00 ? 314 ASP A OD1 1 
ATOM   2301 O  OD2 . ASP A 1 282 ? 44.820 64.330 210.040 1.00 15.00 ? 314 ASP A OD2 1 
ATOM   2302 N  N   . LEU A 1 283 ? 47.160 60.280 212.790 1.00 15.00 ? 315 LEU A N   1 
ATOM   2303 C  CA  . LEU A 1 283 ? 47.690 59.680 214.000 1.00 15.00 ? 315 LEU A CA  1 
ATOM   2304 C  C   . LEU A 1 283 ? 49.020 59.050 213.680 1.00 15.00 ? 315 LEU A C   1 
ATOM   2305 O  O   . LEU A 1 283 ? 49.990 59.190 214.420 1.00 15.00 ? 315 LEU A O   1 
ATOM   2306 C  CB  . LEU A 1 283 ? 46.820 58.590 214.540 1.00 15.00 ? 315 LEU A CB  1 
ATOM   2307 C  CG  . LEU A 1 283 ? 45.350 58.850 214.660 1.00 15.00 ? 315 LEU A CG  1 
ATOM   2308 C  CD1 . LEU A 1 283 ? 44.740 57.720 215.460 1.00 15.00 ? 315 LEU A CD1 1 
ATOM   2309 C  CD2 . LEU A 1 283 ? 45.090 60.160 215.360 1.00 15.00 ? 315 LEU A CD2 1 
ATOM   2310 N  N   . LEU A 1 284 ? 49.050 58.420 212.510 1.00 15.00 ? 316 LEU A N   1 
ATOM   2311 C  CA  . LEU A 1 284 ? 50.240 57.770 212.040 1.00 15.00 ? 316 LEU A CA  1 
ATOM   2312 C  C   . LEU A 1 284 ? 51.310 58.820 211.780 1.00 15.00 ? 316 LEU A C   1 
ATOM   2313 O  O   . LEU A 1 284 ? 52.440 58.600 212.200 1.00 15.00 ? 316 LEU A O   1 
ATOM   2314 C  CB  . LEU A 1 284 ? 49.900 57.000 210.790 1.00 15.00 ? 316 LEU A CB  1 
ATOM   2315 C  CG  . LEU A 1 284 ? 49.930 55.480 210.780 1.00 15.00 ? 316 LEU A CG  1 
ATOM   2316 C  CD1 . LEU A 1 284 ? 49.730 54.880 212.150 1.00 15.00 ? 316 LEU A CD1 1 
ATOM   2317 C  CD2 . LEU A 1 284 ? 48.830 55.030 209.860 1.00 15.00 ? 316 LEU A CD2 1 
ATOM   2318 N  N   . LYS A 1 285 ? 50.990 59.980 211.190 1.00 15.00 ? 317 LYS A N   1 
ATOM   2319 C  CA  . LYS A 1 285 ? 51.950 61.040 210.920 1.00 15.00 ? 317 LYS A CA  1 
ATOM   2320 C  C   . LYS A 1 285 ? 52.560 61.490 212.240 1.00 15.00 ? 317 LYS A C   1 
ATOM   2321 O  O   . LYS A 1 285 ? 53.770 61.620 212.400 1.00 15.00 ? 317 LYS A O   1 
ATOM   2322 C  CB  . LYS A 1 285 ? 51.230 62.220 210.250 1.00 15.00 ? 317 LYS A CB  1 
ATOM   2323 C  CG  . LYS A 1 285 ? 52.020 63.490 209.890 1.00 15.00 ? 317 LYS A CG  1 
ATOM   2324 C  CD  . LYS A 1 285 ? 52.910 63.320 208.650 1.00 15.00 ? 317 LYS A CD  1 
ATOM   2325 C  CE  . LYS A 1 285 ? 53.760 64.540 208.180 1.00 15.00 ? 317 LYS A CE  1 
ATOM   2326 N  NZ  . LYS A 1 285 ? 52.990 65.720 207.780 1.00 15.00 ? 317 LYS A NZ  1 
ATOM   2327 N  N   . ALA A 1 286 ? 51.700 61.640 213.240 1.00 15.00 ? 318 ALA A N   1 
ATOM   2328 C  CA  . ALA A 1 286 ? 52.120 62.070 214.550 1.00 15.00 ? 318 ALA A CA  1 
ATOM   2329 C  C   . ALA A 1 286 ? 53.100 61.120 215.180 1.00 15.00 ? 318 ALA A C   1 
ATOM   2330 O  O   . ALA A 1 286 ? 53.990 61.530 215.910 1.00 15.00 ? 318 ALA A O   1 
ATOM   2331 C  CB  . ALA A 1 286 ? 50.930 62.160 215.460 1.00 15.00 ? 318 ALA A CB  1 
ATOM   2332 N  N   . GLU A 1 287 ? 52.900 59.840 214.910 1.00 15.00 ? 319 GLU A N   1 
ATOM   2333 C  CA  . GLU A 1 287 ? 53.740 58.800 215.460 1.00 15.00 ? 319 GLU A CA  1 
ATOM   2334 C  C   . GLU A 1 287 ? 55.080 58.690 214.780 1.00 15.00 ? 319 GLU A C   1 
ATOM   2335 O  O   . GLU A 1 287 ? 56.110 58.490 215.430 1.00 15.00 ? 319 GLU A O   1 
ATOM   2336 C  CB  . GLU A 1 287 ? 53.020 57.470 215.350 1.00 15.00 ? 319 GLU A CB  1 
ATOM   2337 C  CG  . GLU A 1 287 ? 53.400 56.490 216.460 1.00 15.00 ? 319 GLU A CG  1 
ATOM   2338 C  CD  . GLU A 1 287 ? 53.050 56.940 217.890 1.00 15.00 ? 319 GLU A CD  1 
ATOM   2339 O  OE1 . GLU A 1 287 ? 52.250 57.890 218.060 1.00 15.00 ? 319 GLU A OE1 1 
ATOM   2340 O  OE2 . GLU A 1 287 ? 53.560 56.320 218.840 1.00 15.00 ? 319 GLU A OE2 1 
ATOM   2341 N  N   . HIS A 1 288 ? 55.070 58.800 213.460 1.00 15.00 ? 320 HIS A N   1 
ATOM   2342 C  CA  . HIS A 1 288 ? 56.260 58.590 212.690 1.00 15.00 ? 320 HIS A CA  1 
ATOM   2343 C  C   . HIS A 1 288 ? 56.510 59.790 211.780 1.00 15.00 ? 320 HIS A C   1 
ATOM   2344 O  O   . HIS A 1 288 ? 56.240 59.750 210.570 1.00 15.00 ? 320 HIS A O   1 
ATOM   2345 C  CB  . HIS A 1 288 ? 56.120 57.310 211.850 1.00 15.00 ? 320 HIS A CB  1 
ATOM   2346 C  CG  . HIS A 1 288 ? 55.630 56.000 212.460 1.00 15.00 ? 320 HIS A CG  1 
ATOM   2347 N  ND1 . HIS A 1 288 ? 54.450 55.360 212.110 1.00 15.00 ? 320 HIS A ND1 1 
ATOM   2348 C  CD2 . HIS A 1 288 ? 56.310 55.280 213.440 1.00 15.00 ? 320 HIS A CD2 1 
ATOM   2349 C  CE1 . HIS A 1 288 ? 54.410 54.270 212.900 1.00 15.00 ? 320 HIS A CE1 1 
ATOM   2350 N  NE2 . HIS A 1 288 ? 55.460 54.190 213.670 1.00 15.00 ? 320 HIS A NE2 1 
ATOM   2351 N  N   . PRO A 1 289 ? 57.120 60.870 212.260 1.00 15.00 ? 321 PRO A N   1 
ATOM   2352 C  CA  . PRO A 1 289 ? 57.430 62.060 211.460 1.00 15.00 ? 321 PRO A CA  1 
ATOM   2353 C  C   . PRO A 1 289 ? 58.300 61.820 210.240 1.00 15.00 ? 321 PRO A C   1 
ATOM   2354 O  O   . PRO A 1 289 ? 58.430 62.670 209.370 1.00 15.00 ? 321 PRO A O   1 
ATOM   2355 C  CB  . PRO A 1 289 ? 58.060 63.000 212.450 1.00 15.00 ? 321 PRO A CB  1 
ATOM   2356 C  CG  . PRO A 1 289 ? 58.710 62.040 213.420 1.00 15.00 ? 321 PRO A CG  1 
ATOM   2357 C  CD  . PRO A 1 289 ? 57.600 61.030 213.620 1.00 15.00 ? 321 PRO A CD  1 
ATOM   2358 N  N   . THR A 1 290 ? 58.940 60.670 210.170 1.00 15.00 ? 322 THR A N   1 
ATOM   2359 C  CA  . THR A 1 290 ? 59.780 60.250 209.070 1.00 15.00 ? 322 THR A CA  1 
ATOM   2360 C  C   . THR A 1 290 ? 59.060 59.750 207.820 1.00 15.00 ? 322 THR A C   1 
ATOM   2361 O  O   . THR A 1 290 ? 59.510 59.950 206.700 1.00 15.00 ? 322 THR A O   1 
ATOM   2362 C  CB  . THR A 1 290 ? 60.690 59.130 209.530 1.00 15.00 ? 322 THR A CB  1 
ATOM   2363 O  OG1 . THR A 1 290 ? 60.430 58.830 210.920 1.00 15.00 ? 322 THR A OG1 1 
ATOM   2364 C  CG2 . THR A 1 290 ? 62.100 59.530 209.200 1.00 15.00 ? 322 THR A CG2 1 
ATOM   2365 N  N   . TRP A 1 291 ? 57.910 59.120 208.100 1.00 15.00 ? 323 TRP A N   1 
ATOM   2366 C  CA  . TRP A 1 291 ? 57.190 58.280 207.180 1.00 15.00 ? 323 TRP A CA  1 
ATOM   2367 C  C   . TRP A 1 291 ? 57.010 58.730 205.750 1.00 15.00 ? 323 TRP A C   1 
ATOM   2368 O  O   . TRP A 1 291 ? 57.290 57.920 204.860 1.00 15.00 ? 323 TRP A O   1 
ATOM   2369 C  CB  . TRP A 1 291 ? 55.830 57.980 207.790 1.00 15.00 ? 323 TRP A CB  1 
ATOM   2370 C  CG  . TRP A 1 291 ? 55.570 56.590 208.380 1.00 15.00 ? 323 TRP A CG  1 
ATOM   2371 C  CD1 . TRP A 1 291 ? 54.270 56.150 208.530 1.00 15.00 ? 323 TRP A CD1 1 
ATOM   2372 C  CD2 . TRP A 1 291 ? 56.450 55.660 208.810 1.00 15.00 ? 323 TRP A CD2 1 
ATOM   2373 N  NE1 . TRP A 1 291 ? 54.320 54.950 209.050 1.00 15.00 ? 323 TRP A NE1 1 
ATOM   2374 C  CE2 . TRP A 1 291 ? 55.600 54.650 209.220 1.00 15.00 ? 323 TRP A CE2 1 
ATOM   2375 C  CE3 . TRP A 1 291 ? 57.800 55.500 208.910 1.00 15.00 ? 323 TRP A CE3 1 
ATOM   2376 C  CZ2 . TRP A 1 291 ? 56.060 53.460 209.740 1.00 15.00 ? 323 TRP A CZ2 1 
ATOM   2377 C  CZ3 . TRP A 1 291 ? 58.290 54.310 209.430 1.00 15.00 ? 323 TRP A CZ3 1 
ATOM   2378 C  CH2 . TRP A 1 291 ? 57.430 53.300 209.840 1.00 15.00 ? 323 TRP A CH2 1 
ATOM   2379 N  N   . GLY A 1 292 ? 56.580 59.950 205.430 1.00 15.00 ? 324 GLY A N   1 
ATOM   2380 C  CA  . GLY A 1 292 ? 56.380 60.270 204.010 1.00 15.00 ? 324 GLY A CA  1 
ATOM   2381 C  C   . GLY A 1 292 ? 55.040 59.760 203.470 1.00 15.00 ? 324 GLY A C   1 
ATOM   2382 O  O   . GLY A 1 292 ? 54.390 58.880 204.060 1.00 15.00 ? 324 GLY A O   1 
ATOM   2383 N  N   . ASP A 1 293 ? 54.560 60.260 202.320 1.00 15.00 ? 325 ASP A N   1 
ATOM   2384 C  CA  . ASP A 1 293 ? 53.190 59.980 201.900 1.00 15.00 ? 325 ASP A CA  1 
ATOM   2385 C  C   . ASP A 1 293 ? 52.810 58.550 201.600 1.00 15.00 ? 325 ASP A C   1 
ATOM   2386 O  O   . ASP A 1 293 ? 51.840 58.070 202.180 1.00 15.00 ? 325 ASP A O   1 
ATOM   2387 C  CB  . ASP A 1 293 ? 52.860 60.830 200.680 1.00 15.00 ? 325 ASP A CB  1 
ATOM   2388 C  CG  . ASP A 1 293 ? 51.510 60.570 200.030 1.00 15.00 ? 325 ASP A CG  1 
ATOM   2389 O  OD1 . ASP A 1 293 ? 50.470 60.940 200.560 1.00 15.00 ? 325 ASP A OD1 1 
ATOM   2390 O  OD2 . ASP A 1 293 ? 51.520 59.990 198.950 1.00 15.00 ? 325 ASP A OD2 1 
ATOM   2391 N  N   . GLU A 1 294 ? 53.530 57.880 200.720 1.00 15.00 ? 326 GLU A N   1 
ATOM   2392 C  CA  . GLU A 1 294 ? 53.190 56.530 200.330 1.00 15.00 ? 326 GLU A CA  1 
ATOM   2393 C  C   . GLU A 1 294 ? 53.040 55.630 201.530 1.00 15.00 ? 326 GLU A C   1 
ATOM   2394 O  O   . GLU A 1 294 ? 52.030 54.940 201.610 1.00 15.00 ? 326 GLU A O   1 
ATOM   2395 C  CB  . GLU A 1 294 ? 54.240 55.940 199.450 1.00 15.00 ? 326 GLU A CB  1 
ATOM   2396 C  CG  . GLU A 1 294 ? 53.830 54.610 198.850 1.00 15.00 ? 326 GLU A CG  1 
ATOM   2397 C  CD  . GLU A 1 294 ? 52.980 54.660 197.590 1.00 15.00 ? 326 GLU A CD  1 
ATOM   2398 O  OE1 . GLU A 1 294 ? 52.790 55.740 197.000 1.00 15.00 ? 326 GLU A OE1 1 
ATOM   2399 O  OE2 . GLU A 1 294 ? 52.520 53.600 197.180 1.00 15.00 ? 326 GLU A OE2 1 
ATOM   2400 N  N   . GLN A 1 295 ? 53.970 55.660 202.490 1.00 15.00 ? 327 GLN A N   1 
ATOM   2401 C  CA  . GLN A 1 295 ? 53.880 54.730 203.610 1.00 15.00 ? 327 GLN A CA  1 
ATOM   2402 C  C   . GLN A 1 295 ? 52.720 55.080 204.500 1.00 15.00 ? 327 GLN A C   1 
ATOM   2403 O  O   . GLN A 1 295 ? 52.060 54.180 205.030 1.00 15.00 ? 327 GLN A O   1 
ATOM   2404 C  CB  . GLN A 1 295 ? 55.170 54.730 204.430 1.00 15.00 ? 327 GLN A CB  1 
ATOM   2405 C  CG  . GLN A 1 295 ? 55.080 53.640 205.490 1.00 15.00 ? 327 GLN A CG  1 
ATOM   2406 C  CD  . GLN A 1 295 ? 56.390 53.170 206.080 1.00 15.00 ? 327 GLN A CD  1 
ATOM   2407 O  OE1 . GLN A 1 295 ? 57.440 53.770 205.930 1.00 15.00 ? 327 GLN A OE1 1 
ATOM   2408 N  NE2 . GLN A 1 295 ? 56.370 52.050 206.780 1.00 15.00 ? 327 GLN A NE2 1 
ATOM   2409 N  N   . LEU A 1 296 ? 52.390 56.360 204.660 1.00 15.00 ? 328 LEU A N   1 
ATOM   2410 C  CA  . LEU A 1 296 ? 51.230 56.720 205.450 1.00 15.00 ? 328 LEU A CA  1 
ATOM   2411 C  C   . LEU A 1 296 ? 49.960 56.210 204.780 1.00 15.00 ? 328 LEU A C   1 
ATOM   2412 O  O   . LEU A 1 296 ? 49.160 55.530 205.430 1.00 15.00 ? 328 LEU A O   1 
ATOM   2413 C  CB  . LEU A 1 296 ? 51.220 58.230 205.610 1.00 15.00 ? 328 LEU A CB  1 
ATOM   2414 C  CG  . LEU A 1 296 ? 52.240 58.740 206.590 1.00 15.00 ? 328 LEU A CG  1 
ATOM   2415 C  CD1 . LEU A 1 296 ? 52.520 60.180 206.310 1.00 15.00 ? 328 LEU A CD1 1 
ATOM   2416 C  CD2 . LEU A 1 296 ? 51.740 58.510 207.990 1.00 15.00 ? 328 LEU A CD2 1 
ATOM   2417 N  N   . PHE A 1 297 ? 49.850 56.400 203.470 1.00 15.00 ? 329 PHE A N   1 
ATOM   2418 C  CA  . PHE A 1 297 ? 48.740 55.900 202.700 1.00 15.00 ? 329 PHE A CA  1 
ATOM   2419 C  C   . PHE A 1 297 ? 48.540 54.410 202.850 1.00 15.00 ? 329 PHE A C   1 
ATOM   2420 O  O   . PHE A 1 297 ? 47.510 53.950 203.330 1.00 15.00 ? 329 PHE A O   1 
ATOM   2421 C  CB  . PHE A 1 297 ? 48.970 56.190 201.260 1.00 15.00 ? 329 PHE A CB  1 
ATOM   2422 C  CG  . PHE A 1 297 ? 47.870 55.650 200.390 1.00 15.00 ? 329 PHE A CG  1 
ATOM   2423 C  CD1 . PHE A 1 297 ? 46.600 56.180 200.510 1.00 15.00 ? 329 PHE A CD1 1 
ATOM   2424 C  CD2 . PHE A 1 297 ? 48.150 54.670 199.500 1.00 15.00 ? 329 PHE A CD2 1 
ATOM   2425 C  CE1 . PHE A 1 297 ? 45.610 55.720 199.700 1.00 15.00 ? 329 PHE A CE1 1 
ATOM   2426 C  CE2 . PHE A 1 297 ? 47.140 54.210 198.700 1.00 15.00 ? 329 PHE A CE2 1 
ATOM   2427 C  CZ  . PHE A 1 297 ? 45.880 54.740 198.800 1.00 15.00 ? 329 PHE A CZ  1 
ATOM   2428 N  N   . GLN A 1 298 ? 49.540 53.640 202.460 1.00 15.00 ? 330 GLN A N   1 
ATOM   2429 C  CA  . GLN A 1 298 ? 49.500 52.190 202.550 1.00 15.00 ? 330 GLN A CA  1 
ATOM   2430 C  C   . GLN A 1 298 ? 49.260 51.720 203.970 1.00 15.00 ? 330 GLN A C   1 
ATOM   2431 O  O   . GLN A 1 298 ? 48.380 50.870 204.150 1.00 15.00 ? 330 GLN A O   1 
ATOM   2432 C  CB  . GLN A 1 298 ? 50.790 51.610 202.010 1.00 15.00 ? 330 GLN A CB  1 
ATOM   2433 C  CG  . GLN A 1 298 ? 50.980 51.880 200.520 1.00 15.00 ? 330 GLN A CG  1 
ATOM   2434 C  CD  . GLN A 1 298 ? 49.990 51.160 199.620 1.00 15.00 ? 330 GLN A CD  1 
ATOM   2435 O  OE1 . GLN A 1 298 ? 49.400 50.140 199.980 1.00 15.00 ? 330 GLN A OE1 1 
ATOM   2436 N  NE2 . GLN A 1 298 ? 49.790 51.630 198.400 1.00 15.00 ? 330 GLN A NE2 1 
ATOM   2437 N  N   . THR A 1 299 ? 49.880 52.290 205.010 1.00 15.00 ? 331 THR A N   1 
ATOM   2438 C  CA  . THR A 1 299 ? 49.640 51.810 206.350 1.00 15.00 ? 331 THR A CA  1 
ATOM   2439 C  C   . THR A 1 299 ? 48.220 52.150 206.720 1.00 15.00 ? 331 THR A C   1 
ATOM   2440 O  O   . THR A 1 299 ? 47.570 51.370 207.410 1.00 15.00 ? 331 THR A O   1 
ATOM   2441 C  CB  . THR A 1 299 ? 50.540 52.450 207.380 1.00 15.00 ? 331 THR A CB  1 
ATOM   2442 O  OG1 . THR A 1 299 ? 51.890 52.320 206.930 1.00 15.00 ? 331 THR A OG1 1 
ATOM   2443 C  CG2 . THR A 1 299 ? 50.420 51.760 208.720 1.00 15.00 ? 331 THR A CG2 1 
ATOM   2444 N  N   . ALA A 1 300 ? 47.660 53.250 206.230 1.00 15.00 ? 332 ALA A N   1 
ATOM   2445 C  CA  . ALA A 1 300 ? 46.280 53.570 206.530 1.00 15.00 ? 332 ALA A CA  1 
ATOM   2446 C  C   . ALA A 1 300 ? 45.330 52.560 205.880 1.00 15.00 ? 332 ALA A C   1 
ATOM   2447 O  O   . ALA A 1 300 ? 44.440 52.060 206.580 1.00 15.00 ? 332 ALA A O   1 
ATOM   2448 C  CB  . ALA A 1 300 ? 45.970 54.950 206.020 1.00 15.00 ? 332 ALA A CB  1 
ATOM   2449 N  N   . LYS A 1 301 ? 45.560 52.150 204.620 1.00 15.00 ? 333 LYS A N   1 
ATOM   2450 C  CA  . LYS A 1 301 ? 44.730 51.180 203.930 1.00 15.00 ? 333 LYS A CA  1 
ATOM   2451 C  C   . LYS A 1 301 ? 44.720 49.920 204.760 1.00 15.00 ? 333 LYS A C   1 
ATOM   2452 O  O   . LYS A 1 301 ? 43.660 49.350 204.980 1.00 15.00 ? 333 LYS A O   1 
ATOM   2453 C  CB  . LYS A 1 301 ? 45.280 50.880 202.540 1.00 15.00 ? 333 LYS A CB  1 
ATOM   2454 C  CG  . LYS A 1 301 ? 44.440 49.940 201.660 1.00 15.00 ? 333 LYS A CG  1 
ATOM   2455 C  CD  . LYS A 1 301 ? 44.710 50.070 200.140 1.00 15.00 ? 333 LYS A CD  1 
ATOM   2456 C  CE  . LYS A 1 301 ? 43.760 49.210 199.330 1.00 15.00 ? 333 LYS A CE  1 
ATOM   2457 N  NZ  . LYS A 1 301 ? 43.710 49.670 197.960 1.00 15.00 ? 333 LYS A NZ  1 
ATOM   2458 N  N   . LEU A 1 302 ? 45.840 49.510 205.310 1.00 15.00 ? 334 LEU A N   1 
ATOM   2459 C  CA  . LEU A 1 302 ? 45.880 48.340 206.160 1.00 15.00 ? 334 LEU A CA  1 
ATOM   2460 C  C   . LEU A 1 302 ? 45.060 48.540 207.420 1.00 15.00 ? 334 LEU A C   1 
ATOM   2461 O  O   . LEU A 1 302 ? 44.310 47.640 207.760 1.00 15.00 ? 334 LEU A O   1 
ATOM   2462 C  CB  . LEU A 1 302 ? 47.320 48.030 206.490 1.00 15.00 ? 334 LEU A CB  1 
ATOM   2463 C  CG  . LEU A 1 302 ? 48.130 47.100 205.610 1.00 15.00 ? 334 LEU A CG  1 
ATOM   2464 C  CD1 . LEU A 1 302 ? 48.000 47.410 204.140 1.00 15.00 ? 334 LEU A CD1 1 
ATOM   2465 C  CD2 . LEU A 1 302 ? 49.570 47.260 206.020 1.00 15.00 ? 334 LEU A CD2 1 
ATOM   2466 N  N   . ILE A 1 303 ? 45.100 49.680 208.120 1.00 15.00 ? 335 ILE A N   1 
ATOM   2467 C  CA  . ILE A 1 303 ? 44.330 49.850 209.340 1.00 15.00 ? 335 ILE A CA  1 
ATOM   2468 C  C   . ILE A 1 303 ? 42.870 49.750 208.980 1.00 15.00 ? 335 ILE A C   1 
ATOM   2469 O  O   . ILE A 1 303 ? 42.130 49.010 209.620 1.00 15.00 ? 335 ILE A O   1 
ATOM   2470 C  CB  . ILE A 1 303 ? 44.460 51.230 210.010 1.00 15.00 ? 335 ILE A CB  1 
ATOM   2471 C  CG1 . ILE A 1 303 ? 45.880 51.710 210.160 1.00 15.00 ? 335 ILE A CG1 1 
ATOM   2472 C  CG2 . ILE A 1 303 ? 43.810 51.100 211.370 1.00 15.00 ? 335 ILE A CG2 1 
ATOM   2473 C  CD1 . ILE A 1 303 ? 46.740 50.880 211.080 1.00 15.00 ? 335 ILE A CD1 1 
ATOM   2474 N  N   . LEU A 1 304 ? 42.450 50.460 207.940 1.00 15.00 ? 336 LEU A N   1 
ATOM   2475 C  CA  . LEU A 1 304 ? 41.050 50.500 207.600 1.00 15.00 ? 336 LEU A CA  1 
ATOM   2476 C  C   . LEU A 1 304 ? 40.560 49.170 207.130 1.00 15.00 ? 336 LEU A C   1 
ATOM   2477 O  O   . LEU A 1 304 ? 39.420 48.850 207.440 1.00 15.00 ? 336 LEU A O   1 
ATOM   2478 C  CB  . LEU A 1 304 ? 40.770 51.490 206.520 1.00 15.00 ? 336 LEU A CB  1 
ATOM   2479 C  CG  . LEU A 1 304 ? 40.410 52.870 206.990 1.00 15.00 ? 336 LEU A CG  1 
ATOM   2480 C  CD1 . LEU A 1 304 ? 41.580 53.540 207.670 1.00 15.00 ? 336 LEU A CD1 1 
ATOM   2481 C  CD2 . LEU A 1 304 ? 40.020 53.700 205.800 1.00 15.00 ? 336 LEU A CD2 1 
ATOM   2482 N  N   . ILE A 1 305 ? 41.360 48.370 206.460 1.00 15.00 ? 337 ILE A N   1 
ATOM   2483 C  CA  . ILE A 1 305 ? 40.930 47.030 206.120 1.00 15.00 ? 337 ILE A CA  1 
ATOM   2484 C  C   . ILE A 1 305 ? 40.730 46.330 207.440 1.00 15.00 ? 337 ILE A C   1 
ATOM   2485 O  O   . ILE A 1 305 ? 39.640 45.810 207.660 1.00 15.00 ? 337 ILE A O   1 
ATOM   2486 C  CB  . ILE A 1 305 ? 41.990 46.290 205.290 1.00 15.00 ? 337 ILE A CB  1 
ATOM   2487 C  CG1 . ILE A 1 305 ? 42.100 46.890 203.910 1.00 15.00 ? 337 ILE A CG1 1 
ATOM   2488 C  CG2 . ILE A 1 305 ? 41.580 44.850 205.090 1.00 15.00 ? 337 ILE A CG2 1 
ATOM   2489 C  CD1 . ILE A 1 305 ? 43.290 46.410 203.070 1.00 15.00 ? 337 ILE A CD1 1 
ATOM   2490 N  N   . GLY A 1 306 ? 41.650 46.370 208.390 1.00 15.00 ? 338 GLY A N   1 
ATOM   2491 C  CA  . GLY A 1 306 ? 41.490 45.730 209.690 1.00 15.00 ? 338 GLY A CA  1 
ATOM   2492 C  C   . GLY A 1 306 ? 40.220 46.150 210.400 1.00 15.00 ? 338 GLY A C   1 
ATOM   2493 O  O   . GLY A 1 306 ? 39.510 45.340 210.980 1.00 15.00 ? 338 GLY A O   1 
ATOM   2494 N  N   . GLU A 1 307 ? 39.870 47.420 210.280 1.00 15.00 ? 339 GLU A N   1 
ATOM   2495 C  CA  . GLU A 1 307 ? 38.660 47.940 210.870 1.00 15.00 ? 339 GLU A CA  1 
ATOM   2496 C  C   . GLU A 1 307 ? 37.460 47.330 210.210 1.00 15.00 ? 339 GLU A C   1 
ATOM   2497 O  O   . GLU A 1 307 ? 36.690 46.680 210.900 1.00 15.00 ? 339 GLU A O   1 
ATOM   2498 C  CB  . GLU A 1 307 ? 38.570 49.430 210.730 1.00 15.00 ? 339 GLU A CB  1 
ATOM   2499 C  CG  . GLU A 1 307 ? 39.600 50.120 211.600 1.00 15.00 ? 339 GLU A CG  1 
ATOM   2500 C  CD  . GLU A 1 307 ? 39.450 51.630 211.590 1.00 15.00 ? 339 GLU A CD  1 
ATOM   2501 O  OE1 . GLU A 1 307 ? 39.690 52.240 210.550 1.00 15.00 ? 339 GLU A OE1 1 
ATOM   2502 O  OE2 . GLU A 1 307 ? 39.090 52.210 212.620 1.00 15.00 ? 339 GLU A OE2 1 
ATOM   2503 N  N   . THR A 1 308 ? 37.330 47.470 208.890 1.00 15.00 ? 340 THR A N   1 
ATOM   2504 C  CA  . THR A 1 308 ? 36.230 46.910 208.150 1.00 15.00 ? 340 THR A CA  1 
ATOM   2505 C  C   . THR A 1 308 ? 35.980 45.460 208.490 1.00 15.00 ? 340 THR A C   1 
ATOM   2506 O  O   . THR A 1 308 ? 34.860 45.060 208.800 1.00 15.00 ? 340 THR A O   1 
ATOM   2507 C  CB  . THR A 1 308 ? 36.490 47.010 206.670 1.00 15.00 ? 340 THR A CB  1 
ATOM   2508 O  OG1 . THR A 1 308 ? 36.810 48.370 206.430 1.00 15.00 ? 340 THR A OG1 1 
ATOM   2509 C  CG2 . THR A 1 308 ? 35.310 46.690 205.800 1.00 15.00 ? 340 THR A CG2 1 
ATOM   2510 N  N   . ILE A 1 309 ? 37.010 44.650 208.550 1.00 15.00 ? 341 ILE A N   1 
ATOM   2511 C  CA  . ILE A 1 309 ? 36.830 43.230 208.780 1.00 15.00 ? 341 ILE A CA  1 
ATOM   2512 C  C   . ILE A 1 309 ? 36.530 42.960 210.250 1.00 15.00 ? 341 ILE A C   1 
ATOM   2513 O  O   . ILE A 1 309 ? 35.970 41.910 210.550 1.00 15.00 ? 341 ILE A O   1 
ATOM   2514 C  CB  . ILE A 1 309 ? 38.120 42.600 208.160 1.00 15.00 ? 341 ILE A CB  1 
ATOM   2515 C  CG1 . ILE A 1 309 ? 37.890 41.180 207.730 1.00 15.00 ? 341 ILE A CG1 1 
ATOM   2516 C  CG2 . ILE A 1 309 ? 39.230 42.670 209.160 1.00 15.00 ? 341 ILE A CG2 1 
ATOM   2517 C  CD1 . ILE A 1 309 ? 37.840 40.100 208.820 1.00 15.00 ? 341 ILE A CD1 1 
ATOM   2518 N  N   . LYS A 1 310 ? 36.810 43.840 211.200 1.00 15.00 ? 342 LYS A N   1 
ATOM   2519 C  CA  . LYS A 1 310 ? 36.390 43.610 212.570 1.00 15.00 ? 342 LYS A CA  1 
ATOM   2520 C  C   . LYS A 1 310 ? 34.900 43.920 212.700 1.00 15.00 ? 342 LYS A C   1 
ATOM   2521 O  O   . LYS A 1 310 ? 34.130 43.110 213.220 1.00 15.00 ? 342 LYS A O   1 
ATOM   2522 C  CB  . LYS A 1 310 ? 37.110 44.490 213.540 1.00 15.00 ? 342 LYS A CB  1 
ATOM   2523 C  CG  . LYS A 1 310 ? 36.740 44.080 214.960 1.00 15.00 ? 342 LYS A CG  1 
ATOM   2524 C  CD  . LYS A 1 310 ? 37.180 45.140 215.930 1.00 15.00 ? 342 LYS A CD  1 
ATOM   2525 C  CE  . LYS A 1 310 ? 36.860 44.730 217.360 1.00 15.00 ? 342 LYS A CE  1 
ATOM   2526 N  NZ  . LYS A 1 310 ? 37.630 43.560 217.780 1.00 15.00 ? 342 LYS A NZ  1 
ATOM   2527 N  N   . ILE A 1 311 ? 34.500 45.110 212.240 1.00 15.00 ? 343 ILE A N   1 
ATOM   2528 C  CA  . ILE A 1 311 ? 33.130 45.580 212.290 1.00 15.00 ? 343 ILE A CA  1 
ATOM   2529 C  C   . ILE A 1 311 ? 32.210 44.590 211.630 1.00 15.00 ? 343 ILE A C   1 
ATOM   2530 O  O   . ILE A 1 311 ? 31.110 44.340 212.130 1.00 15.00 ? 343 ILE A O   1 
ATOM   2531 C  CB  . ILE A 1 311 ? 33.040 46.950 211.600 1.00 15.00 ? 343 ILE A CB  1 
ATOM   2532 C  CG1 . ILE A 1 311 ? 33.610 47.960 212.560 1.00 15.00 ? 343 ILE A CG1 1 
ATOM   2533 C  CG2 . ILE A 1 311 ? 31.630 47.350 211.240 1.00 15.00 ? 343 ILE A CG2 1 
ATOM   2534 C  CD1 . ILE A 1 311 ? 33.580 49.420 212.080 1.00 15.00 ? 343 ILE A CD1 1 
ATOM   2535 N  N   . VAL A 1 312 ? 32.650 43.980 210.540 1.00 15.00 ? 344 VAL A N   1 
ATOM   2536 C  CA  . VAL A 1 312 ? 31.830 43.000 209.880 1.00 15.00 ? 344 VAL A CA  1 
ATOM   2537 C  C   . VAL A 1 312 ? 31.660 41.800 210.780 1.00 15.00 ? 344 VAL A C   1 
ATOM   2538 O  O   . VAL A 1 312 ? 30.510 41.410 210.980 1.00 15.00 ? 344 VAL A O   1 
ATOM   2539 C  CB  . VAL A 1 312 ? 32.480 42.590 208.550 1.00 15.00 ? 344 VAL A CB  1 
ATOM   2540 C  CG1 . VAL A 1 312 ? 31.800 41.390 207.930 1.00 15.00 ? 344 VAL A CG1 1 
ATOM   2541 C  CG2 . VAL A 1 312 ? 32.280 43.710 207.550 1.00 15.00 ? 344 VAL A CG2 1 
ATOM   2542 N  N   . ILE A 1 313 ? 32.680 41.240 211.400 1.00 15.00 ? 345 ILE A N   1 
ATOM   2543 C  CA  . ILE A 1 313 ? 32.470 40.050 212.190 1.00 15.00 ? 345 ILE A CA  1 
ATOM   2544 C  C   . ILE A 1 313 ? 31.730 40.370 213.480 1.00 15.00 ? 345 ILE A C   1 
ATOM   2545 O  O   . ILE A 1 313 ? 30.650 39.840 213.720 1.00 15.00 ? 345 ILE A O   1 
ATOM   2546 C  CB  . ILE A 1 313 ? 33.850 39.380 212.450 1.00 15.00 ? 345 ILE A CB  1 
ATOM   2547 C  CG1 . ILE A 1 313 ? 34.250 38.720 211.160 1.00 15.00 ? 345 ILE A CG1 1 
ATOM   2548 C  CG2 . ILE A 1 313 ? 33.810 38.320 213.550 1.00 15.00 ? 345 ILE A CG2 1 
ATOM   2549 C  CD1 . ILE A 1 313 ? 35.690 38.240 211.090 1.00 15.00 ? 345 ILE A CD1 1 
ATOM   2550 N  N   . GLU A 1 314 ? 32.230 41.280 214.280 1.00 15.00 ? 346 GLU A N   1 
ATOM   2551 C  CA  . GLU A 1 314 ? 31.630 41.490 215.570 1.00 15.00 ? 346 GLU A CA  1 
ATOM   2552 C  C   . GLU A 1 314 ? 30.330 42.290 215.570 1.00 15.00 ? 346 GLU A C   1 
ATOM   2553 O  O   . GLU A 1 314 ? 29.570 42.190 216.520 1.00 15.00 ? 346 GLU A O   1 
ATOM   2554 C  CB  . GLU A 1 314 ? 32.690 42.130 216.440 1.00 15.00 ? 346 GLU A CB  1 
ATOM   2555 C  CG  . GLU A 1 314 ? 33.890 41.210 216.650 1.00 15.00 ? 346 GLU A CG  1 
ATOM   2556 C  CD  . GLU A 1 314 ? 34.760 41.460 217.890 1.00 15.00 ? 346 GLU A CD  1 
ATOM   2557 O  OE1 . GLU A 1 314 ? 34.240 41.850 218.920 1.00 15.00 ? 346 GLU A OE1 1 
ATOM   2558 O  OE2 . GLU A 1 314 ? 35.960 41.230 217.850 1.00 15.00 ? 346 GLU A OE2 1 
ATOM   2559 N  N   . GLU A 1 315 ? 30.000 43.080 214.560 1.00 15.00 ? 347 GLU A N   1 
ATOM   2560 C  CA  . GLU A 1 315 ? 28.760 43.820 214.600 1.00 15.00 ? 347 GLU A CA  1 
ATOM   2561 C  C   . GLU A 1 315 ? 27.830 43.450 213.460 1.00 15.00 ? 347 GLU A C   1 
ATOM   2562 O  O   . GLU A 1 315 ? 26.720 43.000 213.730 1.00 15.00 ? 347 GLU A O   1 
ATOM   2563 C  CB  . GLU A 1 315 ? 29.060 45.300 214.560 1.00 15.00 ? 347 GLU A CB  1 
ATOM   2564 C  CG  . GLU A 1 315 ? 29.450 45.850 215.920 1.00 15.00 ? 347 GLU A CG  1 
ATOM   2565 C  CD  . GLU A 1 315 ? 29.850 47.320 215.920 1.00 15.00 ? 347 GLU A CD  1 
ATOM   2566 O  OE1 . GLU A 1 315 ? 30.780 47.650 215.190 1.00 15.00 ? 347 GLU A OE1 1 
ATOM   2567 O  OE2 . GLU A 1 315 ? 29.260 48.130 216.630 1.00 15.00 ? 347 GLU A OE2 1 
ATOM   2568 N  N   . TYR A 1 316 ? 28.200 43.540 212.180 1.00 15.00 ? 348 TYR A N   1 
ATOM   2569 C  CA  . TYR A 1 316 ? 27.330 43.230 211.070 1.00 15.00 ? 348 TYR A CA  1 
ATOM   2570 C  C   . TYR A 1 316 ? 26.860 41.810 211.120 1.00 15.00 ? 348 TYR A C   1 
ATOM   2571 O  O   . TYR A 1 316 ? 25.660 41.600 211.220 1.00 15.00 ? 348 TYR A O   1 
ATOM   2572 C  CB  . TYR A 1 316 ? 28.070 43.490 209.800 1.00 15.00 ? 348 TYR A CB  1 
ATOM   2573 C  CG  . TYR A 1 316 ? 27.470 43.180 208.440 1.00 15.00 ? 348 TYR A CG  1 
ATOM   2574 C  CD1 . TYR A 1 316 ? 27.620 41.930 207.880 1.00 15.00 ? 348 TYR A CD1 1 
ATOM   2575 C  CD2 . TYR A 1 316 ? 26.910 44.190 207.700 1.00 15.00 ? 348 TYR A CD2 1 
ATOM   2576 C  CE1 . TYR A 1 316 ? 27.230 41.690 206.580 1.00 15.00 ? 348 TYR A CE1 1 
ATOM   2577 C  CE2 . TYR A 1 316 ? 26.520 43.950 206.400 1.00 15.00 ? 348 TYR A CE2 1 
ATOM   2578 C  CZ  . TYR A 1 316 ? 26.690 42.710 205.850 1.00 15.00 ? 348 TYR A CZ  1 
ATOM   2579 O  OH  . TYR A 1 316 ? 26.380 42.510 204.530 1.00 15.00 ? 348 TYR A OH  1 
ATOM   2580 N  N   . VAL A 1 317 ? 27.730 40.810 211.100 1.00 15.00 ? 349 VAL A N   1 
ATOM   2581 C  CA  . VAL A 1 317 ? 27.330 39.400 211.150 1.00 15.00 ? 349 VAL A CA  1 
ATOM   2582 C  C   . VAL A 1 317 ? 26.650 39.040 212.480 1.00 15.00 ? 349 VAL A C   1 
ATOM   2583 O  O   . VAL A 1 317 ? 25.770 38.170 212.550 1.00 15.00 ? 349 VAL A O   1 
ATOM   2584 C  CB  . VAL A 1 317 ? 28.580 38.540 210.880 1.00 15.00 ? 349 VAL A CB  1 
ATOM   2585 C  CG1 . VAL A 1 317 ? 28.330 37.050 211.010 1.00 15.00 ? 349 VAL A CG1 1 
ATOM   2586 C  CG2 . VAL A 1 317 ? 29.010 38.810 209.460 1.00 15.00 ? 349 VAL A CG2 1 
ATOM   2587 N  N   . GLN A 1 318 ? 27.010 39.700 213.570 1.00 15.00 ? 350 GLN A N   1 
ATOM   2588 C  CA  . GLN A 1 318 ? 26.360 39.460 214.840 1.00 15.00 ? 350 GLN A CA  1 
ATOM   2589 C  C   . GLN A 1 318 ? 24.940 39.990 214.740 1.00 15.00 ? 350 GLN A C   1 
ATOM   2590 O  O   . GLN A 1 318 ? 24.050 39.400 215.340 1.00 15.00 ? 350 GLN A O   1 
ATOM   2591 C  CB  . GLN A 1 318 ? 27.130 40.160 215.940 1.00 15.00 ? 350 GLN A CB  1 
ATOM   2592 C  CG  . GLN A 1 318 ? 26.690 39.900 217.380 1.00 15.00 ? 350 GLN A CG  1 
ATOM   2593 C  CD  . GLN A 1 318 ? 27.090 38.550 217.930 1.00 15.00 ? 350 GLN A CD  1 
ATOM   2594 O  OE1 . GLN A 1 318 ? 28.230 38.360 218.350 1.00 15.00 ? 350 GLN A OE1 1 
ATOM   2595 N  NE2 . GLN A 1 318 ? 26.220 37.570 218.040 1.00 15.00 ? 350 GLN A NE2 1 
ATOM   2596 N  N   . GLN A 1 319 ? 24.660 41.060 213.980 1.00 15.00 ? 351 GLN A N   1 
ATOM   2597 C  CA  . GLN A 1 319 ? 23.300 41.540 213.840 1.00 15.00 ? 351 GLN A CA  1 
ATOM   2598 C  C   . GLN A 1 319 ? 22.520 40.560 213.010 1.00 15.00 ? 351 GLN A C   1 
ATOM   2599 O  O   . GLN A 1 319 ? 21.540 40.060 213.550 1.00 15.00 ? 351 GLN A O   1 
ATOM   2600 C  CB  . GLN A 1 319 ? 23.170 42.850 213.100 1.00 15.00 ? 351 GLN A CB  1 
ATOM   2601 C  CG  . GLN A 1 319 ? 22.190 43.780 213.810 1.00 15.00 ? 351 GLN A CG  1 
ATOM   2602 C  CD  . GLN A 1 319 ? 20.790 43.230 214.030 1.00 15.00 ? 351 GLN A CD  1 
ATOM   2603 O  OE1 . GLN A 1 319 ? 20.040 43.030 213.070 1.00 15.00 ? 351 GLN A OE1 1 
ATOM   2604 N  NE2 . GLN A 1 319 ? 20.390 42.960 215.270 1.00 15.00 ? 351 GLN A NE2 1 
ATOM   2605 N  N   . LEU A 1 320 ? 22.900 40.220 211.780 1.00 15.00 ? 352 LEU A N   1 
ATOM   2606 C  CA  . LEU A 1 320 ? 22.030 39.290 211.100 1.00 15.00 ? 352 LEU A CA  1 
ATOM   2607 C  C   . LEU A 1 320 ? 22.120 37.840 211.500 1.00 15.00 ? 352 LEU A C   1 
ATOM   2608 O  O   . LEU A 1 320 ? 21.270 37.090 211.040 1.00 15.00 ? 352 LEU A O   1 
ATOM   2609 C  CB  . LEU A 1 320 ? 22.190 39.390 209.580 1.00 15.00 ? 352 LEU A CB  1 
ATOM   2610 C  CG  . LEU A 1 320 ? 23.430 39.340 208.750 1.00 15.00 ? 352 LEU A CG  1 
ATOM   2611 C  CD1 . LEU A 1 320 ? 24.230 38.100 208.920 1.00 15.00 ? 352 LEU A CD1 1 
ATOM   2612 C  CD2 . LEU A 1 320 ? 22.950 39.360 207.330 1.00 15.00 ? 352 LEU A CD2 1 
ATOM   2613 N  N   . SER A 1 321 ? 23.040 37.330 212.300 1.00 15.00 ? 353 SER A N   1 
ATOM   2614 C  CA  . SER A 1 321 ? 22.920 35.940 212.690 1.00 15.00 ? 353 SER A CA  1 
ATOM   2615 C  C   . SER A 1 321 ? 21.890 35.820 213.800 1.00 15.00 ? 353 SER A C   1 
ATOM   2616 O  O   . SER A 1 321 ? 21.080 34.900 213.860 1.00 15.00 ? 353 SER A O   1 
ATOM   2617 C  CB  . SER A 1 321 ? 24.250 35.410 213.180 1.00 15.00 ? 353 SER A CB  1 
ATOM   2618 O  OG  . SER A 1 321 ? 24.780 36.150 214.270 1.00 15.00 ? 353 SER A OG  1 
ATOM   2619 N  N   . GLY A 1 322 ? 22.000 36.790 214.720 1.00 15.00 ? 354 GLY A N   1 
ATOM   2620 C  CA  . GLY A 1 322 ? 21.150 36.910 215.890 1.00 15.00 ? 354 GLY A CA  1 
ATOM   2621 C  C   . GLY A 1 322 ? 21.520 35.890 216.960 1.00 15.00 ? 354 GLY A C   1 
ATOM   2622 O  O   . GLY A 1 322 ? 20.710 35.570 217.830 1.00 15.00 ? 354 GLY A O   1 
ATOM   2623 N  N   . TYR A 1 323 ? 22.740 35.370 216.890 1.00 15.00 ? 355 TYR A N   1 
ATOM   2624 C  CA  . TYR A 1 323 ? 23.190 34.380 217.840 1.00 15.00 ? 355 TYR A CA  1 
ATOM   2625 C  C   . TYR A 1 323 ? 23.520 35.080 219.140 1.00 15.00 ? 355 TYR A C   1 
ATOM   2626 O  O   . TYR A 1 323 ? 23.940 36.240 219.150 1.00 15.00 ? 355 TYR A O   1 
ATOM   2627 C  CB  . TYR A 1 323 ? 24.470 33.680 217.380 1.00 15.00 ? 355 TYR A CB  1 
ATOM   2628 C  CG  . TYR A 1 323 ? 24.440 32.920 216.060 1.00 15.00 ? 355 TYR A CG  1 
ATOM   2629 C  CD1 . TYR A 1 323 ? 23.310 32.780 215.290 1.00 15.00 ? 355 TYR A CD1 1 
ATOM   2630 C  CD2 . TYR A 1 323 ? 25.620 32.330 215.630 1.00 15.00 ? 355 TYR A CD2 1 
ATOM   2631 C  CE1 . TYR A 1 323 ? 23.350 32.070 214.110 1.00 15.00 ? 355 TYR A CE1 1 
ATOM   2632 C  CE2 . TYR A 1 323 ? 25.660 31.620 214.460 1.00 15.00 ? 355 TYR A CE2 1 
ATOM   2633 C  CZ  . TYR A 1 323 ? 24.530 31.490 213.690 1.00 15.00 ? 355 TYR A CZ  1 
ATOM   2634 O  OH  . TYR A 1 323 ? 24.570 30.780 212.510 1.00 15.00 ? 355 TYR A OH  1 
ATOM   2635 N  N   . PHE A 1 324 ? 23.350 34.390 220.260 1.00 15.00 ? 356 PHE A N   1 
ATOM   2636 C  CA  . PHE A 1 324 ? 23.760 34.960 221.520 1.00 15.00 ? 356 PHE A CA  1 
ATOM   2637 C  C   . PHE A 1 324 ? 25.230 34.670 221.750 1.00 15.00 ? 356 PHE A C   1 
ATOM   2638 O  O   . PHE A 1 324 ? 25.800 35.110 222.740 1.00 15.00 ? 356 PHE A O   1 
ATOM   2639 C  CB  . PHE A 1 324 ? 22.930 34.380 222.630 1.00 15.00 ? 356 PHE A CB  1 
ATOM   2640 C  CG  . PHE A 1 324 ? 21.450 34.740 222.520 1.00 15.00 ? 356 PHE A CG  1 
ATOM   2641 C  CD1 . PHE A 1 324 ? 21.060 36.060 222.310 1.00 15.00 ? 356 PHE A CD1 1 
ATOM   2642 C  CD2 . PHE A 1 324 ? 20.490 33.740 222.600 1.00 15.00 ? 356 PHE A CD2 1 
ATOM   2643 C  CE1 . PHE A 1 324 ? 19.720 36.360 222.190 1.00 15.00 ? 356 PHE A CE1 1 
ATOM   2644 C  CE2 . PHE A 1 324 ? 19.150 34.050 222.470 1.00 15.00 ? 356 PHE A CE2 1 
ATOM   2645 C  CZ  . PHE A 1 324 ? 18.770 35.360 222.270 1.00 15.00 ? 356 PHE A CZ  1 
ATOM   2646 N  N   . LEU A 1 325 ? 25.880 33.890 220.880 1.00 15.00 ? 357 LEU A N   1 
ATOM   2647 C  CA  . LEU A 1 325 ? 27.310 33.690 220.990 1.00 15.00 ? 357 LEU A CA  1 
ATOM   2648 C  C   . LEU A 1 325 ? 27.930 35.040 220.650 1.00 15.00 ? 357 LEU A C   1 
ATOM   2649 O  O   . LEU A 1 325 ? 27.460 35.700 219.720 1.00 15.00 ? 357 LEU A O   1 
ATOM   2650 C  CB  . LEU A 1 325 ? 27.760 32.640 219.990 1.00 15.00 ? 357 LEU A CB  1 
ATOM   2651 C  CG  . LEU A 1 325 ? 29.240 32.330 219.920 1.00 15.00 ? 357 LEU A CG  1 
ATOM   2652 C  CD1 . LEU A 1 325 ? 29.810 31.940 221.270 1.00 15.00 ? 357 LEU A CD1 1 
ATOM   2653 C  CD2 . LEU A 1 325 ? 29.420 31.220 218.940 1.00 15.00 ? 357 LEU A CD2 1 
ATOM   2654 N  N   . GLN A 1 326 ? 28.910 35.510 221.390 1.00 15.00 ? 358 GLN A N   1 
ATOM   2655 C  CA  . GLN A 1 326 ? 29.560 36.750 221.050 1.00 15.00 ? 358 GLN A CA  1 
ATOM   2656 C  C   . GLN A 1 326 ? 30.660 36.380 220.090 1.00 15.00 ? 358 GLN A C   1 
ATOM   2657 O  O   . GLN A 1 326 ? 31.630 35.740 220.450 1.00 15.00 ? 358 GLN A O   1 
ATOM   2658 C  CB  . GLN A 1 326 ? 30.200 37.390 222.240 1.00 15.00 ? 358 GLN A CB  1 
ATOM   2659 C  CG  . GLN A 1 326 ? 30.080 38.890 222.060 1.00 15.00 ? 358 GLN A CG  1 
ATOM   2660 C  CD  . GLN A 1 326 ? 28.620 39.290 222.280 1.00 15.00 ? 358 GLN A CD  1 
ATOM   2661 O  OE1 . GLN A 1 326 ? 28.160 39.470 223.420 1.00 15.00 ? 358 GLN A OE1 1 
ATOM   2662 N  NE2 . GLN A 1 326 ? 27.780 39.410 221.250 1.00 15.00 ? 358 GLN A NE2 1 
ATOM   2663 N  N   . LEU A 1 327 ? 30.470 36.750 218.840 1.00 15.00 ? 359 LEU A N   1 
ATOM   2664 C  CA  . LEU A 1 327 ? 31.430 36.450 217.810 1.00 15.00 ? 359 LEU A CA  1 
ATOM   2665 C  C   . LEU A 1 327 ? 32.660 37.310 218.020 1.00 15.00 ? 359 LEU A C   1 
ATOM   2666 O  O   . LEU A 1 327 ? 32.500 38.400 218.580 1.00 15.00 ? 359 LEU A O   1 
ATOM   2667 C  CB  . LEU A 1 327 ? 30.810 36.750 216.450 1.00 15.00 ? 359 LEU A CB  1 
ATOM   2668 C  CG  . LEU A 1 327 ? 29.520 36.060 216.050 1.00 15.00 ? 359 LEU A CG  1 
ATOM   2669 C  CD1 . LEU A 1 327 ? 29.280 36.370 214.600 1.00 15.00 ? 359 LEU A CD1 1 
ATOM   2670 C  CD2 . LEU A 1 327 ? 29.600 34.560 216.210 1.00 15.00 ? 359 LEU A CD2 1 
ATOM   2671 N  N   . LYS A 1 328 ? 33.870 36.890 217.630 1.00 15.00 ? 360 LYS A N   1 
ATOM   2672 C  CA  . LYS A 1 328 ? 35.030 37.760 217.710 1.00 15.00 ? 360 LYS A CA  1 
ATOM   2673 C  C   . LYS A 1 328 ? 35.970 37.590 216.540 1.00 15.00 ? 360 LYS A C   1 
ATOM   2674 O  O   . LYS A 1 328 ? 36.150 36.510 215.990 1.00 15.00 ? 360 LYS A O   1 
ATOM   2675 C  CB  . LYS A 1 328 ? 35.870 37.550 218.990 1.00 15.00 ? 360 LYS A CB  1 
ATOM   2676 C  CG  . LYS A 1 328 ? 36.650 36.240 219.090 1.00 15.00 ? 360 LYS A CG  1 
ATOM   2677 C  CD  . LYS A 1 328 ? 37.330 35.990 220.420 1.00 15.00 ? 360 LYS A CD  1 
ATOM   2678 C  CE  . LYS A 1 328 ? 38.420 36.990 220.740 1.00 15.00 ? 360 LYS A CE  1 
ATOM   2679 N  NZ  . LYS A 1 328 ? 39.340 36.380 221.680 1.00 15.00 ? 360 LYS A NZ  1 
ATOM   2680 N  N   . PHE A 1 329 ? 36.550 38.690 216.140 1.00 15.00 ? 361 PHE A N   1 
ATOM   2681 C  CA  . PHE A 1 329 ? 37.550 38.680 215.130 1.00 15.00 ? 361 PHE A CA  1 
ATOM   2682 C  C   . PHE A 1 329 ? 38.880 38.580 215.840 1.00 15.00 ? 361 PHE A C   1 
ATOM   2683 O  O   . PHE A 1 329 ? 39.380 39.570 216.370 1.00 15.00 ? 361 PHE A O   1 
ATOM   2684 C  CB  . PHE A 1 329 ? 37.420 39.960 214.360 1.00 15.00 ? 361 PHE A CB  1 
ATOM   2685 C  CG  . PHE A 1 329 ? 38.560 40.240 213.410 1.00 15.00 ? 361 PHE A CG  1 
ATOM   2686 C  CD1 . PHE A 1 329 ? 38.850 39.360 212.390 1.00 15.00 ? 361 PHE A CD1 1 
ATOM   2687 C  CD2 . PHE A 1 329 ? 39.290 41.380 213.580 1.00 15.00 ? 361 PHE A CD2 1 
ATOM   2688 C  CE1 . PHE A 1 329 ? 39.890 39.630 211.540 1.00 15.00 ? 361 PHE A CE1 1 
ATOM   2689 C  CE2 . PHE A 1 329 ? 40.320 41.640 212.720 1.00 15.00 ? 361 PHE A CE2 1 
ATOM   2690 C  CZ  . PHE A 1 329 ? 40.620 40.780 211.700 1.00 15.00 ? 361 PHE A CZ  1 
ATOM   2691 N  N   . ASP A 1 330 ? 39.450 37.380 215.920 1.00 15.00 ? 362 ASP A N   1 
ATOM   2692 C  CA  . ASP A 1 330 ? 40.780 37.230 216.460 1.00 15.00 ? 362 ASP A CA  1 
ATOM   2693 C  C   . ASP A 1 330 ? 41.450 36.310 215.480 1.00 15.00 ? 362 ASP A C   1 
ATOM   2694 O  O   . ASP A 1 330 ? 41.240 35.100 215.540 1.00 15.00 ? 362 ASP A O   1 
ATOM   2695 C  CB  . ASP A 1 330 ? 40.790 36.570 217.830 1.00 15.00 ? 362 ASP A CB  1 
ATOM   2696 C  CG  . ASP A 1 330 ? 42.160 36.490 218.510 1.00 15.00 ? 362 ASP A CG  1 
ATOM   2697 O  OD1 . ASP A 1 330 ? 43.110 37.130 218.030 1.00 15.00 ? 362 ASP A OD1 1 
ATOM   2698 O  OD2 . ASP A 1 330 ? 42.260 35.790 219.530 1.00 15.00 ? 362 ASP A OD2 1 
ATOM   2699 N  N   . PRO A 1 331 ? 42.270 36.810 214.550 1.00 15.00 ? 363 PRO A N   1 
ATOM   2700 C  CA  . PRO A 1 331 ? 42.940 36.040 213.520 1.00 15.00 ? 363 PRO A CA  1 
ATOM   2701 C  C   . PRO A 1 331 ? 43.730 34.890 214.100 1.00 15.00 ? 363 PRO A C   1 
ATOM   2702 O  O   . PRO A 1 331 ? 43.870 33.830 213.480 1.00 15.00 ? 363 PRO A O   1 
ATOM   2703 C  CB  . PRO A 1 331 ? 43.790 37.030 212.790 1.00 15.00 ? 363 PRO A CB  1 
ATOM   2704 C  CG  . PRO A 1 331 ? 42.940 38.250 212.860 1.00 15.00 ? 363 PRO A CG  1 
ATOM   2705 C  CD  . PRO A 1 331 ? 42.500 38.210 214.300 1.00 15.00 ? 363 PRO A CD  1 
ATOM   2706 N  N   . GLU A 1 332 ? 44.170 35.080 215.350 1.00 15.00 ? 364 GLU A N   1 
ATOM   2707 C  CA  . GLU A 1 332 ? 44.960 34.090 216.020 1.00 15.00 ? 364 GLU A CA  1 
ATOM   2708 C  C   . GLU A 1 332 ? 44.230 32.790 216.260 1.00 15.00 ? 364 GLU A C   1 
ATOM   2709 O  O   . GLU A 1 332 ? 44.880 31.770 216.460 1.00 15.00 ? 364 GLU A O   1 
ATOM   2710 C  CB  . GLU A 1 332 ? 45.440 34.610 217.350 1.00 15.00 ? 364 GLU A CB  1 
ATOM   2711 C  CG  . GLU A 1 332 ? 46.380 35.770 217.100 1.00 15.00 ? 364 GLU A CG  1 
ATOM   2712 C  CD  . GLU A 1 332 ? 47.170 36.360 218.270 1.00 15.00 ? 364 GLU A CD  1 
ATOM   2713 O  OE1 . GLU A 1 332 ? 46.870 36.080 219.440 1.00 15.00 ? 364 GLU A OE1 1 
ATOM   2714 O  OE2 . GLU A 1 332 ? 48.100 37.120 217.980 1.00 15.00 ? 364 GLU A OE2 1 
ATOM   2715 N  N   . LEU A 1 333 ? 42.900 32.730 216.180 1.00 15.00 ? 365 LEU A N   1 
ATOM   2716 C  CA  . LEU A 1 333 ? 42.210 31.460 216.370 1.00 15.00 ? 365 LEU A CA  1 
ATOM   2717 C  C   . LEU A 1 333 ? 42.590 30.520 215.240 1.00 15.00 ? 365 LEU A C   1 
ATOM   2718 O  O   . LEU A 1 333 ? 42.630 29.300 215.410 1.00 15.00 ? 365 LEU A O   1 
ATOM   2719 C  CB  . LEU A 1 333 ? 40.730 31.710 216.370 1.00 15.00 ? 365 LEU A CB  1 
ATOM   2720 C  CG  . LEU A 1 333 ? 40.230 32.630 217.450 1.00 15.00 ? 365 LEU A CG  1 
ATOM   2721 C  CD1 . LEU A 1 333 ? 38.850 33.140 217.090 1.00 15.00 ? 365 LEU A CD1 1 
ATOM   2722 C  CD2 . LEU A 1 333 ? 40.230 31.900 218.770 1.00 15.00 ? 365 LEU A CD2 1 
ATOM   2723 N  N   . LEU A 1 334 ? 42.960 31.060 214.090 1.00 15.00 ? 366 LEU A N   1 
ATOM   2724 C  CA  . LEU A 1 334 ? 43.300 30.210 212.990 1.00 15.00 ? 366 LEU A CA  1 
ATOM   2725 C  C   . LEU A 1 334 ? 44.750 29.870 212.820 1.00 15.00 ? 366 LEU A C   1 
ATOM   2726 O  O   . LEU A 1 334 ? 45.070 29.040 211.980 1.00 15.00 ? 366 LEU A O   1 
ATOM   2727 C  CB  . LEU A 1 334 ? 42.750 30.870 211.770 1.00 15.00 ? 366 LEU A CB  1 
ATOM   2728 C  CG  . LEU A 1 334 ? 41.540 30.200 211.160 1.00 15.00 ? 366 LEU A CG  1 
ATOM   2729 C  CD1 . LEU A 1 334 ? 40.730 29.410 212.150 1.00 15.00 ? 366 LEU A CD1 1 
ATOM   2730 C  CD2 . LEU A 1 334 ? 40.730 31.300 210.570 1.00 15.00 ? 366 LEU A CD2 1 
ATOM   2731 N  N   . PHE A 1 335 ? 45.640 30.370 213.670 1.00 15.00 ? 367 PHE A N   1 
ATOM   2732 C  CA  . PHE A 1 335 ? 47.050 30.100 213.500 1.00 15.00 ? 367 PHE A CA  1 
ATOM   2733 C  C   . PHE A 1 335 ? 47.400 28.670 213.780 1.00 15.00 ? 367 PHE A C   1 
ATOM   2734 O  O   . PHE A 1 335 ? 48.490 28.200 213.440 1.00 15.00 ? 367 PHE A O   1 
ATOM   2735 C  CB  . PHE A 1 335 ? 47.900 30.960 214.400 1.00 15.00 ? 367 PHE A CB  1 
ATOM   2736 C  CG  . PHE A 1 335 ? 47.910 32.430 214.050 1.00 15.00 ? 367 PHE A CG  1 
ATOM   2737 C  CD1 . PHE A 1 335 ? 47.160 32.950 213.010 1.00 15.00 ? 367 PHE A CD1 1 
ATOM   2738 C  CD2 . PHE A 1 335 ? 48.670 33.280 214.800 1.00 15.00 ? 367 PHE A CD2 1 
ATOM   2739 C  CE1 . PHE A 1 335 ? 47.170 34.310 212.730 1.00 15.00 ? 367 PHE A CE1 1 
ATOM   2740 C  CE2 . PHE A 1 335 ? 48.670 34.630 214.530 1.00 15.00 ? 367 PHE A CE2 1 
ATOM   2741 C  CZ  . PHE A 1 335 ? 47.920 35.150 213.500 1.00 15.00 ? 367 PHE A CZ  1 
ATOM   2742 N  N   . GLY A 1 336 ? 46.520 27.920 214.430 1.00 15.00 ? 368 GLY A N   1 
ATOM   2743 C  CA  . GLY A 1 336 ? 46.780 26.500 214.640 1.00 15.00 ? 368 GLY A CA  1 
ATOM   2744 C  C   . GLY A 1 336 ? 46.110 25.620 213.580 1.00 15.00 ? 368 GLY A C   1 
ATOM   2745 O  O   . GLY A 1 336 ? 46.360 24.410 213.530 1.00 15.00 ? 368 GLY A O   1 
ATOM   2746 N  N   . ALA A 1 337 ? 45.290 26.220 212.710 1.00 15.00 ? 369 ALA A N   1 
ATOM   2747 C  CA  . ALA A 1 337 ? 44.500 25.490 211.740 1.00 15.00 ? 369 ALA A CA  1 
ATOM   2748 C  C   . ALA A 1 337 ? 45.230 25.350 210.450 1.00 15.00 ? 369 ALA A C   1 
ATOM   2749 O  O   . ALA A 1 337 ? 46.290 25.940 210.230 1.00 15.00 ? 369 ALA A O   1 
ATOM   2750 C  CB  . ALA A 1 337 ? 43.200 26.190 211.440 1.00 15.00 ? 369 ALA A CB  1 
ATOM   2751 N  N   . GLN A 1 338 ? 44.690 24.520 209.580 1.00 15.00 ? 370 GLN A N   1 
ATOM   2752 C  CA  . GLN A 1 338 ? 45.240 24.380 208.260 1.00 15.00 ? 370 GLN A CA  1 
ATOM   2753 C  C   . GLN A 1 338 ? 44.250 25.240 207.510 1.00 15.00 ? 370 GLN A C   1 
ATOM   2754 O  O   . GLN A 1 338 ? 43.110 24.850 207.270 1.00 15.00 ? 370 GLN A O   1 
ATOM   2755 C  CB  . GLN A 1 338 ? 45.160 22.950 207.800 1.00 15.00 ? 370 GLN A CB  1 
ATOM   2756 C  CG  . GLN A 1 338 ? 46.070 22.060 208.620 1.00 15.00 ? 370 GLN A CG  1 
ATOM   2757 C  CD  . GLN A 1 338 ? 46.120 20.660 208.040 1.00 15.00 ? 370 GLN A CD  1 
ATOM   2758 O  OE1 . GLN A 1 338 ? 45.110 19.960 208.080 1.00 15.00 ? 370 GLN A OE1 1 
ATOM   2759 N  NE2 . GLN A 1 338 ? 47.240 20.210 207.490 1.00 15.00 ? 370 GLN A NE2 1 
ATOM   2760 N  N   . PHE A 1 339 ? 44.660 26.450 207.260 1.00 15.00 ? 371 PHE A N   1 
ATOM   2761 C  CA  . PHE A 1 339 ? 43.790 27.390 206.600 1.00 15.00 ? 371 PHE A CA  1 
ATOM   2762 C  C   . PHE A 1 339 ? 44.680 27.960 205.520 1.00 15.00 ? 371 PHE A C   1 
ATOM   2763 O  O   . PHE A 1 339 ? 45.890 28.090 205.670 1.00 15.00 ? 371 PHE A O   1 
ATOM   2764 C  CB  . PHE A 1 339 ? 43.350 28.440 207.600 1.00 15.00 ? 371 PHE A CB  1 
ATOM   2765 C  CG  . PHE A 1 339 ? 42.320 29.440 207.120 1.00 15.00 ? 371 PHE A CG  1 
ATOM   2766 C  CD1 . PHE A 1 339 ? 41.080 29.040 206.710 1.00 15.00 ? 371 PHE A CD1 1 
ATOM   2767 C  CD2 . PHE A 1 339 ? 42.630 30.780 207.110 1.00 15.00 ? 371 PHE A CD2 1 
ATOM   2768 C  CE1 . PHE A 1 339 ? 40.160 29.990 206.310 1.00 15.00 ? 371 PHE A CE1 1 
ATOM   2769 C  CE2 . PHE A 1 339 ? 41.700 31.710 206.700 1.00 15.00 ? 371 PHE A CE2 1 
ATOM   2770 C  CZ  . PHE A 1 339 ? 40.460 31.320 206.300 1.00 15.00 ? 371 PHE A CZ  1 
ATOM   2771 N  N   . GLN A 1 340 ? 44.070 28.250 204.400 1.00 15.00 ? 372 GLN A N   1 
ATOM   2772 C  CA  . GLN A 1 340 ? 44.790 28.860 203.310 1.00 15.00 ? 372 GLN A CA  1 
ATOM   2773 C  C   . GLN A 1 340 ? 44.340 30.290 203.380 1.00 15.00 ? 372 GLN A C   1 
ATOM   2774 O  O   . GLN A 1 340 ? 43.170 30.550 203.650 1.00 15.00 ? 372 GLN A O   1 
ATOM   2775 C  CB  . GLN A 1 340 ? 44.370 28.260 202.000 1.00 15.00 ? 372 GLN A CB  1 
ATOM   2776 C  CG  . GLN A 1 340 ? 45.010 26.940 201.720 1.00 15.00 ? 372 GLN A CG  1 
ATOM   2777 C  CD  . GLN A 1 340 ? 46.490 27.070 201.460 1.00 15.00 ? 372 GLN A CD  1 
ATOM   2778 O  OE1 . GLN A 1 340 ? 46.950 27.810 200.600 1.00 15.00 ? 372 GLN A OE1 1 
ATOM   2779 N  NE2 . GLN A 1 340 ? 47.270 26.340 202.230 1.00 15.00 ? 372 GLN A NE2 1 
ATOM   2780 N  N   . TYR A 1 341 ? 45.240 31.240 203.200 1.00 15.00 ? 373 TYR A N   1 
ATOM   2781 C  CA  . TYR A 1 341 ? 44.870 32.640 203.230 1.00 15.00 ? 373 TYR A CA  1 
ATOM   2782 C  C   . TYR A 1 341 ? 44.720 33.210 201.820 1.00 15.00 ? 373 TYR A C   1 
ATOM   2783 O  O   . TYR A 1 341 ? 45.600 33.930 201.350 1.00 15.00 ? 373 TYR A O   1 
ATOM   2784 C  CB  . TYR A 1 341 ? 45.940 33.380 204.040 1.00 15.00 ? 373 TYR A CB  1 
ATOM   2785 C  CG  . TYR A 1 341 ? 45.820 33.170 205.540 1.00 15.00 ? 373 TYR A CG  1 
ATOM   2786 C  CD1 . TYR A 1 341 ? 44.830 33.840 206.230 1.00 15.00 ? 373 TYR A CD1 1 
ATOM   2787 C  CD2 . TYR A 1 341 ? 46.660 32.330 206.220 1.00 15.00 ? 373 TYR A CD2 1 
ATOM   2788 C  CE1 . TYR A 1 341 ? 44.670 33.670 207.590 1.00 15.00 ? 373 TYR A CE1 1 
ATOM   2789 C  CE2 . TYR A 1 341 ? 46.490 32.160 207.580 1.00 15.00 ? 373 TYR A CE2 1 
ATOM   2790 C  CZ  . TYR A 1 341 ? 45.500 32.830 208.270 1.00 15.00 ? 373 TYR A CZ  1 
ATOM   2791 O  OH  . TYR A 1 341 ? 45.350 32.670 209.640 1.00 15.00 ? 373 TYR A OH  1 
ATOM   2792 N  N   . ARG A 1 342 ? 43.680 32.880 201.050 1.00 15.00 ? 374 ARG A N   1 
ATOM   2793 C  CA  . ARG A 1 342 ? 43.420 33.500 199.750 1.00 15.00 ? 374 ARG A CA  1 
ATOM   2794 C  C   . ARG A 1 342 ? 41.920 33.390 199.480 1.00 15.00 ? 374 ARG A C   1 
ATOM   2795 O  O   . ARG A 1 342 ? 41.290 32.490 200.040 1.00 15.00 ? 374 ARG A O   1 
ATOM   2796 C  CB  . ARG A 1 342 ? 44.170 32.820 198.590 1.00 15.00 ? 374 ARG A CB  1 
ATOM   2797 C  CG  . ARG A 1 342 ? 44.010 31.330 198.340 1.00 15.00 ? 374 ARG A CG  1 
ATOM   2798 C  CD  . ARG A 1 342 ? 44.480 30.970 196.930 1.00 15.00 ? 374 ARG A CD  1 
ATOM   2799 N  NE  . ARG A 1 342 ? 45.910 30.720 196.740 1.00 15.00 ? 374 ARG A NE  1 
ATOM   2800 C  CZ  . ARG A 1 342 ? 46.610 31.380 195.800 1.00 15.00 ? 374 ARG A CZ  1 
ATOM   2801 N  NH1 . ARG A 1 342 ? 46.050 32.330 195.030 1.00 15.00 ? 374 ARG A NH1 1 
ATOM   2802 N  NH2 . ARG A 1 342 ? 47.870 31.020 195.520 1.00 15.00 ? 374 ARG A NH2 1 
ATOM   2803 N  N   . ASN A 1 343 ? 41.290 34.240 198.670 1.00 15.00 ? 375 ASN A N   1 
ATOM   2804 C  CA  . ASN A 1 343 ? 39.860 34.130 198.430 1.00 15.00 ? 375 ASN A CA  1 
ATOM   2805 C  C   . ASN A 1 343 ? 39.540 34.410 196.970 1.00 15.00 ? 375 ASN A C   1 
ATOM   2806 O  O   . ASN A 1 343 ? 40.330 35.060 196.300 1.00 15.00 ? 375 ASN A O   1 
ATOM   2807 C  CB  . ASN A 1 343 ? 39.090 35.120 199.300 1.00 15.00 ? 375 ASN A CB  1 
ATOM   2808 C  CG  . ASN A 1 343 ? 37.600 34.820 199.300 1.00 15.00 ? 375 ASN A CG  1 
ATOM   2809 O  OD1 . ASN A 1 343 ? 36.750 35.700 199.250 1.00 15.00 ? 375 ASN A OD1 1 
ATOM   2810 N  ND2 . ASN A 1 343 ? 37.130 33.580 199.360 1.00 15.00 ? 375 ASN A ND2 1 
ATOM   2811 N  N   . ARG A 1 344 ? 38.460 33.860 196.430 1.00 15.00 ? 376 ARG A N   1 
ATOM   2812 C  CA  . ARG A 1 344 ? 38.070 34.110 195.050 1.00 15.00 ? 376 ARG A CA  1 
ATOM   2813 C  C   . ARG A 1 344 ? 36.560 34.230 195.160 1.00 15.00 ? 376 ARG A C   1 
ATOM   2814 O  O   . ARG A 1 344 ? 35.950 33.190 195.490 1.00 15.00 ? 376 ARG A O   1 
ATOM   2815 C  CB  . ARG A 1 344 ? 38.450 32.920 194.190 1.00 15.00 ? 376 ARG A CB  1 
ATOM   2816 C  CG  . ARG A 1 344 ? 38.340 33.130 192.700 1.00 15.00 ? 376 ARG A CG  1 
ATOM   2817 C  CD  . ARG A 1 344 ? 39.510 33.930 192.170 1.00 15.00 ? 376 ARG A CD  1 
ATOM   2818 N  NE  . ARG A 1 344 ? 40.380 33.120 191.340 1.00 15.00 ? 376 ARG A NE  1 
ATOM   2819 C  CZ  . ARG A 1 344 ? 41.660 32.920 191.660 1.00 15.00 ? 376 ARG A CZ  1 
ATOM   2820 N  NH1 . ARG A 1 344 ? 42.240 33.440 192.750 1.00 15.00 ? 376 ARG A NH1 1 
ATOM   2821 N  NH2 . ARG A 1 344 ? 42.390 32.130 190.880 1.00 15.00 ? 376 ARG A NH2 1 
ATOM   2822 N  N   . ILE A 1 345 ? 35.880 35.390 194.990 1.00 15.00 ? 377 ILE A N   1 
ATOM   2823 C  CA  . ILE A 1 345 ? 34.460 35.420 195.270 1.00 15.00 ? 377 ILE A CA  1 
ATOM   2824 C  C   . ILE A 1 345 ? 33.750 34.760 194.110 1.00 15.00 ? 377 ILE A C   1 
ATOM   2825 O  O   . ILE A 1 345 ? 34.040 34.960 192.940 1.00 15.00 ? 377 ILE A O   1 
ATOM   2826 C  CB  . ILE A 1 345 ? 33.820 36.850 195.510 1.00 15.00 ? 377 ILE A CB  1 
ATOM   2827 C  CG1 . ILE A 1 345 ? 33.840 37.780 194.330 1.00 15.00 ? 377 ILE A CG1 1 
ATOM   2828 C  CG2 . ILE A 1 345 ? 34.560 37.420 196.710 1.00 15.00 ? 377 ILE A CG2 1 
ATOM   2829 C  CD1 . ILE A 1 345 ? 35.120 38.580 194.030 1.00 15.00 ? 377 ILE A CD1 1 
ATOM   2830 N  N   . ALA A 1 346 ? 32.920 33.830 194.550 1.00 15.00 ? 378 ALA A N   1 
ATOM   2831 C  CA  . ALA A 1 346 ? 32.150 32.980 193.700 1.00 15.00 ? 378 ALA A CA  1 
ATOM   2832 C  C   . ALA A 1 346 ? 30.890 33.580 193.130 1.00 15.00 ? 378 ALA A C   1 
ATOM   2833 O  O   . ALA A 1 346 ? 30.160 34.280 193.830 1.00 15.00 ? 378 ALA A O   1 
ATOM   2834 C  CB  . ALA A 1 346 ? 31.750 31.750 194.450 1.00 15.00 ? 378 ALA A CB  1 
ATOM   2835 N  N   . MET A 1 347 ? 30.540 33.220 191.910 1.00 15.00 ? 379 MET A N   1 
ATOM   2836 C  CA  . MET A 1 347 ? 29.330 33.720 191.270 1.00 15.00 ? 379 MET A CA  1 
ATOM   2837 C  C   . MET A 1 347 ? 28.080 33.400 192.060 1.00 15.00 ? 379 MET A C   1 
ATOM   2838 O  O   . MET A 1 347 ? 27.150 34.200 192.100 1.00 15.00 ? 379 MET A O   1 
ATOM   2839 C  CB  . MET A 1 347 ? 29.200 33.150 189.880 1.00 15.00 ? 379 MET A CB  1 
ATOM   2840 C  CG  . MET A 1 347 ? 29.320 31.640 189.850 1.00 15.00 ? 379 MET A CG  1 
ATOM   2841 S  SD  . MET A 1 347 ? 29.070 31.000 188.190 1.00 15.00 ? 379 MET A SD  1 
ATOM   2842 C  CE  . MET A 1 347 ? 30.660 31.410 187.540 1.00 15.00 ? 379 MET A CE  1 
ATOM   2843 N  N   . GLU A 1 348 ? 28.070 32.260 192.730 1.00 15.00 ? 380 GLU A N   1 
ATOM   2844 C  CA  . GLU A 1 348 ? 26.920 31.870 193.510 1.00 15.00 ? 380 GLU A CA  1 
ATOM   2845 C  C   . GLU A 1 348 ? 26.850 32.810 194.670 1.00 15.00 ? 380 GLU A C   1 
ATOM   2846 O  O   . GLU A 1 348 ? 25.760 33.290 194.950 1.00 15.00 ? 380 GLU A O   1 
ATOM   2847 C  CB  . GLU A 1 348 ? 27.010 30.520 194.130 1.00 15.00 ? 380 GLU A CB  1 
ATOM   2848 C  CG  . GLU A 1 348 ? 27.060 29.480 193.080 1.00 15.00 ? 380 GLU A CG  1 
ATOM   2849 C  CD  . GLU A 1 348 ? 28.450 28.970 192.820 1.00 15.00 ? 380 GLU A CD  1 
ATOM   2850 O  OE1 . GLU A 1 348 ? 29.400 29.750 192.790 1.00 15.00 ? 380 GLU A OE1 1 
ATOM   2851 O  OE2 . GLU A 1 348 ? 28.610 27.760 192.640 1.00 15.00 ? 380 GLU A OE2 1 
ATOM   2852 N  N   . PHE A 1 349 ? 27.970 33.150 195.290 1.00 15.00 ? 381 PHE A N   1 
ATOM   2853 C  CA  . PHE A 1 349 ? 27.970 34.070 196.400 1.00 15.00 ? 381 PHE A CA  1 
ATOM   2854 C  C   . PHE A 1 349 ? 27.430 35.420 195.940 1.00 15.00 ? 381 PHE A C   1 
ATOM   2855 O  O   . PHE A 1 349 ? 26.770 36.110 196.710 1.00 15.00 ? 381 PHE A O   1 
ATOM   2856 C  CB  . PHE A 1 349 ? 29.370 34.230 196.930 1.00 15.00 ? 381 PHE A CB  1 
ATOM   2857 C  CG  . PHE A 1 349 ? 29.500 35.080 198.180 1.00 15.00 ? 381 PHE A CG  1 
ATOM   2858 C  CD1 . PHE A 1 349 ? 28.560 35.010 199.180 1.00 15.00 ? 381 PHE A CD1 1 
ATOM   2859 C  CD2 . PHE A 1 349 ? 30.580 35.920 198.300 1.00 15.00 ? 381 PHE A CD2 1 
ATOM   2860 C  CE1 . PHE A 1 349 ? 28.710 35.770 200.300 1.00 15.00 ? 381 PHE A CE1 1 
ATOM   2861 C  CE2 . PHE A 1 349 ? 30.720 36.680 199.440 1.00 15.00 ? 381 PHE A CE2 1 
ATOM   2862 C  CZ  . PHE A 1 349 ? 29.780 36.600 200.430 1.00 15.00 ? 381 PHE A CZ  1 
ATOM   2863 N  N   . ASN A 1 350 ? 27.640 35.800 194.700 1.00 15.00 ? 382 ASN A N   1 
ATOM   2864 C  CA  . ASN A 1 350 ? 27.080 37.020 194.180 1.00 15.00 ? 382 ASN A CA  1 
ATOM   2865 C  C   . ASN A 1 350 ? 25.570 36.880 194.100 1.00 15.00 ? 382 ASN A C   1 
ATOM   2866 O  O   . ASN A 1 350 ? 24.880 37.780 194.570 1.00 15.00 ? 382 ASN A O   1 
ATOM   2867 C  CB  . ASN A 1 350 ? 27.700 37.250 192.840 1.00 15.00 ? 382 ASN A CB  1 
ATOM   2868 C  CG  . ASN A 1 350 ? 27.140 38.440 192.120 1.00 15.00 ? 382 ASN A CG  1 
ATOM   2869 O  OD1 . ASN A 1 350 ? 25.980 38.440 191.760 1.00 15.00 ? 382 ASN A OD1 1 
ATOM   2870 N  ND2 . ASN A 1 350 ? 27.890 39.450 191.800 1.00 15.00 ? 382 ASN A ND2 1 
ATOM   2871 N  N   . GLN A 1 351 ? 25.000 35.790 193.610 1.00 15.00 ? 383 GLN A N   1 
ATOM   2872 C  CA  . GLN A 1 351 ? 23.550 35.620 193.550 1.00 15.00 ? 383 GLN A CA  1 
ATOM   2873 C  C   . GLN A 1 351 ? 22.910 35.730 194.930 1.00 15.00 ? 383 GLN A C   1 
ATOM   2874 O  O   . GLN A 1 351 ? 21.940 36.440 195.190 1.00 15.00 ? 383 GLN A O   1 
ATOM   2875 C  CB  . GLN A 1 351 ? 23.200 34.260 192.990 1.00 15.00 ? 383 GLN A CB  1 
ATOM   2876 C  CG  . GLN A 1 351 ? 23.850 33.890 191.680 1.00 15.00 ? 383 GLN A CG  1 
ATOM   2877 C  CD  . GLN A 1 351 ? 23.100 34.400 190.470 1.00 15.00 ? 383 GLN A CD  1 
ATOM   2878 O  OE1 . GLN A 1 351 ? 22.020 33.920 190.150 1.00 15.00 ? 383 GLN A OE1 1 
ATOM   2879 N  NE2 . GLN A 1 351 ? 23.610 35.360 189.720 1.00 15.00 ? 383 GLN A NE2 1 
ATOM   2880 N  N   . LEU A 1 352 ? 23.470 35.040 195.890 1.00 15.00 ? 384 LEU A N   1 
ATOM   2881 C  CA  . LEU A 1 352 ? 22.990 35.010 197.250 1.00 15.00 ? 384 LEU A CA  1 
ATOM   2882 C  C   . LEU A 1 352 ? 23.020 36.350 197.940 1.00 15.00 ? 384 LEU A C   1 
ATOM   2883 O  O   . LEU A 1 352 ? 22.200 36.640 198.800 1.00 15.00 ? 384 LEU A O   1 
ATOM   2884 C  CB  . LEU A 1 352 ? 23.840 33.980 197.940 1.00 15.00 ? 384 LEU A CB  1 
ATOM   2885 C  CG  . LEU A 1 352 ? 23.860 33.700 199.410 1.00 15.00 ? 384 LEU A CG  1 
ATOM   2886 C  CD1 . LEU A 1 352 ? 24.280 32.260 199.570 1.00 15.00 ? 384 LEU A CD1 1 
ATOM   2887 C  CD2 . LEU A 1 352 ? 24.830 34.590 200.130 1.00 15.00 ? 384 LEU A CD2 1 
ATOM   2888 N  N   . TYR A 1 353 ? 23.960 37.220 197.600 1.00 15.00 ? 385 TYR A N   1 
ATOM   2889 C  CA  . TYR A 1 353 ? 23.980 38.510 198.250 1.00 15.00 ? 385 TYR A CA  1 
ATOM   2890 C  C   . TYR A 1 353 ? 23.100 39.440 197.480 1.00 15.00 ? 385 TYR A C   1 
ATOM   2891 O  O   . TYR A 1 353 ? 23.120 40.630 197.730 1.00 15.00 ? 385 TYR A O   1 
ATOM   2892 C  CB  . TYR A 1 353 ? 25.380 39.060 198.300 1.00 15.00 ? 385 TYR A CB  1 
ATOM   2893 C  CG  . TYR A 1 353 ? 25.860 39.320 199.720 1.00 15.00 ? 385 TYR A CG  1 
ATOM   2894 C  CD1 . TYR A 1 353 ? 25.570 40.490 200.400 1.00 15.00 ? 385 TYR A CD1 1 
ATOM   2895 C  CD2 . TYR A 1 353 ? 26.660 38.390 200.340 1.00 15.00 ? 385 TYR A CD2 1 
ATOM   2896 C  CE1 . TYR A 1 353 ? 26.060 40.730 201.660 1.00 15.00 ? 385 TYR A CE1 1 
ATOM   2897 C  CE2 . TYR A 1 353 ? 27.150 38.620 201.610 1.00 15.00 ? 385 TYR A CE2 1 
ATOM   2898 C  CZ  . TYR A 1 353 ? 26.850 39.780 202.250 1.00 15.00 ? 385 TYR A CZ  1 
ATOM   2899 O  OH  . TYR A 1 353 ? 27.360 39.990 203.510 1.00 15.00 ? 385 TYR A OH  1 
ATOM   2900 N  N   . HIS A 1 354 ? 22.270 38.990 196.550 1.00 15.00 ? 386 HIS A N   1 
ATOM   2901 C  CA  . HIS A 1 354 ? 21.330 39.840 195.850 1.00 15.00 ? 386 HIS A CA  1 
ATOM   2902 C  C   . HIS A 1 354 ? 20.150 40.240 196.690 1.00 15.00 ? 386 HIS A C   1 
ATOM   2903 O  O   . HIS A 1 354 ? 19.020 40.340 196.190 1.00 15.00 ? 386 HIS A O   1 
ATOM   2904 C  CB  . HIS A 1 354 ? 20.790 39.150 194.660 1.00 15.00 ? 386 HIS A CB  1 
ATOM   2905 C  CG  . HIS A 1 354 ? 21.650 39.690 193.600 1.00 15.00 ? 386 HIS A CG  1 
ATOM   2906 N  ND1 . HIS A 1 354 ? 22.820 39.100 193.180 1.00 15.00 ? 386 HIS A ND1 1 
ATOM   2907 C  CD2 . HIS A 1 354 ? 21.350 40.850 192.920 1.00 15.00 ? 386 HIS A CD2 1 
ATOM   2908 C  CE1 . HIS A 1 354 ? 23.210 39.900 192.190 1.00 15.00 ? 386 HIS A CE1 1 
ATOM   2909 N  NE2 . HIS A 1 354 ? 22.400 40.900 192.020 1.00 15.00 ? 386 HIS A NE2 1 
ATOM   2910 N  N   . TRP A 1 355 ? 20.370 40.570 197.950 1.00 15.00 ? 387 TRP A N   1 
ATOM   2911 C  CA  . TRP A 1 355 ? 19.250 40.760 198.790 1.00 15.00 ? 387 TRP A CA  1 
ATOM   2912 C  C   . TRP A 1 355 ? 18.710 42.190 199.010 1.00 15.00 ? 387 TRP A C   1 
ATOM   2913 O  O   . TRP A 1 355 ? 18.690 42.860 200.030 1.00 15.00 ? 387 TRP A O   1 
ATOM   2914 C  CB  . TRP A 1 355 ? 19.650 39.930 200.040 1.00 15.00 ? 387 TRP A CB  1 
ATOM   2915 C  CG  . TRP A 1 355 ? 20.760 40.230 201.020 1.00 15.00 ? 387 TRP A CG  1 
ATOM   2916 C  CD1 . TRP A 1 355 ? 21.060 41.500 201.420 1.00 15.00 ? 387 TRP A CD1 1 
ATOM   2917 C  CD2 . TRP A 1 355 ? 21.440 39.300 201.750 1.00 15.00 ? 387 TRP A CD2 1 
ATOM   2918 N  NE1 . TRP A 1 355 ? 21.920 41.380 202.410 1.00 15.00 ? 387 TRP A NE1 1 
ATOM   2919 C  CE2 . TRP A 1 355 ? 22.170 40.100 202.630 1.00 15.00 ? 387 TRP A CE2 1 
ATOM   2920 C  CE3 . TRP A 1 355 ? 21.570 37.950 201.810 1.00 15.00 ? 387 TRP A CE3 1 
ATOM   2921 C  CZ2 . TRP A 1 355 ? 23.010 39.640 203.600 1.00 15.00 ? 387 TRP A CZ2 1 
ATOM   2922 C  CZ3 . TRP A 1 355 ? 22.410 37.460 202.790 1.00 15.00 ? 387 TRP A CZ3 1 
ATOM   2923 C  CH2 . TRP A 1 355 ? 23.130 38.280 203.660 1.00 15.00 ? 387 TRP A CH2 1 
ATOM   2924 N  N   . HIS A 1 356 ? 18.040 42.480 197.900 1.00 15.00 ? 388 HIS A N   1 
ATOM   2925 C  CA  . HIS A 1 356 ? 17.270 43.690 197.690 1.00 15.00 ? 388 HIS A CA  1 
ATOM   2926 C  C   . HIS A 1 356 ? 15.980 43.820 198.490 1.00 15.00 ? 388 HIS A C   1 
ATOM   2927 O  O   . HIS A 1 356 ? 15.550 44.960 198.630 1.00 15.00 ? 388 HIS A O   1 
ATOM   2928 C  CB  . HIS A 1 356 ? 16.950 43.790 196.230 1.00 15.00 ? 388 HIS A CB  1 
ATOM   2929 C  CG  . HIS A 1 356 ? 18.190 43.980 195.380 1.00 15.00 ? 388 HIS A CG  1 
ATOM   2930 N  ND1 . HIS A 1 356 ? 18.980 42.950 194.880 1.00 15.00 ? 388 HIS A ND1 1 
ATOM   2931 C  CD2 . HIS A 1 356 ? 18.730 45.230 195.050 1.00 15.00 ? 388 HIS A CD2 1 
ATOM   2932 C  CE1 . HIS A 1 356 ? 20.000 43.610 194.290 1.00 15.00 ? 388 HIS A CE1 1 
ATOM   2933 N  NE2 . HIS A 1 356 ? 19.900 44.910 194.360 1.00 15.00 ? 388 HIS A NE2 1 
ATOM   2934 N  N   . PRO A 1 357 ? 15.300 42.800 199.030 1.00 15.00 ? 389 PRO A N   1 
ATOM   2935 C  CA  . PRO A 1 357 ? 14.190 42.950 199.960 1.00 15.00 ? 389 PRO A CA  1 
ATOM   2936 C  C   . PRO A 1 357 ? 14.400 43.880 201.150 1.00 15.00 ? 389 PRO A C   1 
ATOM   2937 O  O   . PRO A 1 357 ? 13.460 44.260 201.820 1.00 15.00 ? 389 PRO A O   1 
ATOM   2938 C  CB  . PRO A 1 357 ? 13.890 41.560 200.410 1.00 15.00 ? 389 PRO A CB  1 
ATOM   2939 C  CG  . PRO A 1 357 ? 14.120 40.770 199.180 1.00 15.00 ? 389 PRO A CG  1 
ATOM   2940 C  CD  . PRO A 1 357 ? 15.380 41.390 198.650 1.00 15.00 ? 389 PRO A CD  1 
ATOM   2941 N  N   . LEU A 1 358 ? 15.650 44.190 201.490 1.00 15.00 ? 390 LEU A N   1 
ATOM   2942 C  CA  . LEU A 1 358 ? 15.920 45.080 202.590 1.00 15.00 ? 390 LEU A CA  1 
ATOM   2943 C  C   . LEU A 1 358 ? 15.440 46.480 202.290 1.00 15.00 ? 390 LEU A C   1 
ATOM   2944 O  O   . LEU A 1 358 ? 15.000 47.180 203.200 1.00 15.00 ? 390 LEU A O   1 
ATOM   2945 C  CB  . LEU A 1 358 ? 17.410 45.140 202.880 1.00 15.00 ? 390 LEU A CB  1 
ATOM   2946 C  CG  . LEU A 1 358 ? 18.120 43.960 203.480 1.00 15.00 ? 390 LEU A CG  1 
ATOM   2947 C  CD1 . LEU A 1 358 ? 19.570 44.290 203.590 1.00 15.00 ? 390 LEU A CD1 1 
ATOM   2948 C  CD2 . LEU A 1 358 ? 17.630 43.670 204.880 1.00 15.00 ? 390 LEU A CD2 1 
ATOM   2949 N  N   . MET A 1 359 ? 15.480 46.880 201.010 1.00 15.00 ? 391 MET A N   1 
ATOM   2950 C  CA  . MET A 1 359 ? 15.120 48.230 200.660 1.00 15.00 ? 391 MET A CA  1 
ATOM   2951 C  C   . MET A 1 359 ? 13.650 48.450 200.920 1.00 15.00 ? 391 MET A C   1 
ATOM   2952 O  O   . MET A 1 359 ? 12.870 47.560 200.620 1.00 15.00 ? 391 MET A O   1 
ATOM   2953 C  CB  . MET A 1 359 ? 15.410 48.520 199.210 1.00 15.00 ? 391 MET A CB  1 
ATOM   2954 C  CG  . MET A 1 359 ? 16.880 48.550 198.940 1.00 15.00 ? 391 MET A CG  1 
ATOM   2955 S  SD  . MET A 1 359 ? 17.870 49.370 200.220 1.00 15.00 ? 391 MET A SD  1 
ATOM   2956 C  CE  . MET A 1 359 ? 17.550 51.040 199.800 1.00 15.00 ? 391 MET A CE  1 
ATOM   2957 N  N   . PRO A 1 360 ? 13.270 49.580 201.530 1.00 15.00 ? 392 PRO A N   1 
ATOM   2958 C  CA  . PRO A 1 360 ? 11.940 49.830 202.060 1.00 15.00 ? 392 PRO A CA  1 
ATOM   2959 C  C   . PRO A 1 360 ? 10.990 50.430 201.020 1.00 15.00 ? 392 PRO A C   1 
ATOM   2960 O  O   . PRO A 1 360 ? 11.250 50.360 199.820 1.00 15.00 ? 392 PRO A O   1 
ATOM   2961 C  CB  . PRO A 1 360 ? 12.260 50.710 203.230 1.00 15.00 ? 392 PRO A CB  1 
ATOM   2962 C  CG  . PRO A 1 360 ? 13.270 51.660 202.620 1.00 15.00 ? 392 PRO A CG  1 
ATOM   2963 C  CD  . PRO A 1 360 ? 14.120 50.740 201.770 1.00 15.00 ? 392 PRO A CD  1 
ATOM   2964 N  N   . ASP A 1 361 ? 9.870  51.040 201.380 1.00 15.00 ? 393 ASP A N   1 
ATOM   2965 C  CA  . ASP A 1 361 ? 8.970  51.580 200.380 1.00 15.00 ? 393 ASP A CA  1 
ATOM   2966 C  C   . ASP A 1 361 ? 9.330  53.030 200.090 1.00 15.00 ? 393 ASP A C   1 
ATOM   2967 O  O   . ASP A 1 361 ? 9.180  53.530 198.970 1.00 15.00 ? 393 ASP A O   1 
ATOM   2968 C  CB  . ASP A 1 361 ? 7.520  51.480 200.870 1.00 15.00 ? 393 ASP A CB  1 
ATOM   2969 C  CG  . ASP A 1 361 ? 6.960  50.080 201.210 1.00 15.00 ? 393 ASP A CG  1 
ATOM   2970 O  OD1 . ASP A 1 361 ? 7.260  49.080 200.530 1.00 15.00 ? 393 ASP A OD1 1 
ATOM   2971 O  OD2 . ASP A 1 361 ? 6.170  50.020 202.170 1.00 15.00 ? 393 ASP A OD2 1 
ATOM   2972 N  N   . SER A 1 362 ? 9.800  53.720 201.110 1.00 15.00 ? 394 SER A N   1 
ATOM   2973 C  CA  . SER A 1 362 ? 10.210 55.100 200.990 1.00 15.00 ? 394 SER A CA  1 
ATOM   2974 C  C   . SER A 1 362 ? 11.250 55.320 202.060 1.00 15.00 ? 394 SER A C   1 
ATOM   2975 O  O   . SER A 1 362 ? 11.440 54.460 202.940 1.00 15.00 ? 394 SER A O   1 
ATOM   2976 C  CB  . SER A 1 362 ? 8.990  55.990 201.190 1.00 15.00 ? 394 SER A CB  1 
ATOM   2977 O  OG  . SER A 1 362 ? 8.200  55.530 202.290 1.00 15.00 ? 394 SER A OG  1 
ATOM   2978 N  N   . PHE A 1 363 ? 11.940 56.450 202.000 1.00 15.00 ? 395 PHE A N   1 
ATOM   2979 C  CA  . PHE A 1 363 ? 13.060 56.720 202.860 1.00 15.00 ? 395 PHE A CA  1 
ATOM   2980 C  C   . PHE A 1 363 ? 12.700 57.870 203.750 1.00 15.00 ? 395 PHE A C   1 
ATOM   2981 O  O   . PHE A 1 363 ? 12.640 59.000 203.260 1.00 15.00 ? 395 PHE A O   1 
ATOM   2982 C  CB  . PHE A 1 363 ? 14.230 57.040 201.970 1.00 15.00 ? 395 PHE A CB  1 
ATOM   2983 C  CG  . PHE A 1 363 ? 14.560 55.880 201.040 1.00 15.00 ? 395 PHE A CG  1 
ATOM   2984 C  CD1 . PHE A 1 363 ? 15.340 54.850 201.510 1.00 15.00 ? 395 PHE A CD1 1 
ATOM   2985 C  CD2 . PHE A 1 363 ? 14.060 55.870 199.760 1.00 15.00 ? 395 PHE A CD2 1 
ATOM   2986 C  CE1 . PHE A 1 363 ? 15.620 53.800 200.680 1.00 15.00 ? 395 PHE A CE1 1 
ATOM   2987 C  CE2 . PHE A 1 363 ? 14.350 54.810 198.940 1.00 15.00 ? 395 PHE A CE2 1 
ATOM   2988 C  CZ  . PHE A 1 363 ? 15.140 53.790 199.410 1.00 15.00 ? 395 PHE A CZ  1 
ATOM   2989 N  N   . ARG A 1 364 ? 12.440 57.630 205.030 1.00 15.00 ? 396 ARG A N   1 
ATOM   2990 C  CA  . ARG A 1 364 ? 12.070 58.700 205.910 1.00 15.00 ? 396 ARG A CA  1 
ATOM   2991 C  C   . ARG A 1 364 ? 13.280 59.310 206.570 1.00 15.00 ? 396 ARG A C   1 
ATOM   2992 O  O   . ARG A 1 364 ? 13.800 58.760 207.550 1.00 15.00 ? 396 ARG A O   1 
ATOM   2993 C  CB  . ARG A 1 364 ? 11.110 58.220 207.000 1.00 15.00 ? 396 ARG A CB  1 
ATOM   2994 C  CG  . ARG A 1 364 ? 10.300 59.390 207.610 1.00 15.00 ? 396 ARG A CG  1 
ATOM   2995 C  CD  . ARG A 1 364 ? 9.080  59.030 208.490 1.00 15.00 ? 396 ARG A CD  1 
ATOM   2996 N  NE  . ARG A 1 364 ? 8.040  58.250 207.790 1.00 15.00 ? 396 ARG A NE  1 
ATOM   2997 C  CZ  . ARG A 1 364 ? 8.050  56.890 207.690 1.00 15.00 ? 396 ARG A CZ  1 
ATOM   2998 N  NH1 . ARG A 1 364 ? 9.020  56.140 208.240 1.00 15.00 ? 396 ARG A NH1 1 
ATOM   2999 N  NH2 . ARG A 1 364 ? 7.090  56.260 206.980 1.00 15.00 ? 396 ARG A NH2 1 
ATOM   3000 N  N   . VAL A 1 365 ? 13.800 60.400 206.040 1.00 15.00 ? 397 VAL A N   1 
ATOM   3001 C  CA  . VAL A 1 365 ? 14.850 61.030 206.800 1.00 15.00 ? 397 VAL A CA  1 
ATOM   3002 C  C   . VAL A 1 365 ? 14.170 62.210 207.450 1.00 15.00 ? 397 VAL A C   1 
ATOM   3003 O  O   . VAL A 1 365 ? 13.300 62.880 206.900 1.00 15.00 ? 397 VAL A O   1 
ATOM   3004 C  CB  . VAL A 1 365 ? 16.050 61.510 205.930 1.00 15.00 ? 397 VAL A CB  1 
ATOM   3005 C  CG1 . VAL A 1 365 ? 15.750 62.620 204.980 1.00 15.00 ? 397 VAL A CG1 1 
ATOM   3006 C  CG2 . VAL A 1 365 ? 17.060 62.110 206.880 1.00 15.00 ? 397 VAL A CG2 1 
ATOM   3007 N  N   . GLY A 1 366 ? 14.570 62.450 208.690 1.00 15.00 ? 398 GLY A N   1 
ATOM   3008 C  CA  . GLY A 1 366 ? 13.950 63.490 209.470 1.00 15.00 ? 398 GLY A CA  1 
ATOM   3009 C  C   . GLY A 1 366 ? 12.520 63.000 209.700 1.00 15.00 ? 398 GLY A C   1 
ATOM   3010 O  O   . GLY A 1 366 ? 12.300 61.800 209.880 1.00 15.00 ? 398 GLY A O   1 
ATOM   3011 N  N   . PRO A 1 367 ? 11.540 63.900 209.690 1.00 15.00 ? 399 PRO A N   1 
ATOM   3012 C  CA  . PRO A 1 367 ? 10.140 63.540 209.590 1.00 15.00 ? 399 PRO A CA  1 
ATOM   3013 C  C   . PRO A 1 367 ? 9.610  63.670 208.160 1.00 15.00 ? 399 PRO A C   1 
ATOM   3014 O  O   . PRO A 1 367 ? 8.440  64.050 208.030 1.00 15.00 ? 399 PRO A O   1 
ATOM   3015 C  CB  . PRO A 1 367 ? 9.510  64.460 210.610 1.00 15.00 ? 399 PRO A CB  1 
ATOM   3016 C  CG  . PRO A 1 367 ? 10.220 65.770 210.320 1.00 15.00 ? 399 PRO A CG  1 
ATOM   3017 C  CD  . PRO A 1 367 ? 11.660 65.290 210.170 1.00 15.00 ? 399 PRO A CD  1 
ATOM   3018 N  N   . GLN A 1 368 ? 10.340 63.420 207.070 1.00 15.00 ? 400 GLN A N   1 
ATOM   3019 C  CA  . GLN A 1 368 ? 9.730  63.490 205.740 1.00 15.00 ? 400 GLN A CA  1 
ATOM   3020 C  C   . GLN A 1 368 ? 10.140 62.260 204.990 1.00 15.00 ? 400 GLN A C   1 
ATOM   3021 O  O   . GLN A 1 368 ? 11.320 61.880 205.030 1.00 15.00 ? 400 GLN A O   1 
ATOM   3022 C  CB  . GLN A 1 368 ? 10.140 64.740 204.920 1.00 15.00 ? 400 GLN A CB  1 
ATOM   3023 C  CG  . GLN A 1 368 ? 11.570 65.260 204.960 1.00 15.00 ? 400 GLN A CG  1 
ATOM   3024 C  CD  . GLN A 1 368 ? 12.050 65.790 206.330 1.00 15.00 ? 400 GLN A CD  1 
ATOM   3025 O  OE1 . GLN A 1 368 ? 11.220 66.120 207.190 1.00 15.00 ? 400 GLN A OE1 1 
ATOM   3026 N  NE2 . GLN A 1 368 ? 13.350 65.890 206.650 1.00 15.00 ? 400 GLN A NE2 1 
ATOM   3027 N  N   . ASP A 1 369 ? 9.160  61.540 204.420 1.00 15.00 ? 401 ASP A N   1 
ATOM   3028 C  CA  . ASP A 1 369 ? 9.430  60.370 203.600 1.00 15.00 ? 401 ASP A CA  1 
ATOM   3029 C  C   . ASP A 1 369 ? 9.940  60.820 202.240 1.00 15.00 ? 401 ASP A C   1 
ATOM   3030 O  O   . ASP A 1 369 ? 9.480  61.860 201.760 1.00 15.00 ? 401 ASP A O   1 
ATOM   3031 C  CB  . ASP A 1 369 ? 8.200  59.520 203.300 1.00 15.00 ? 401 ASP A CB  1 
ATOM   3032 C  CG  . ASP A 1 369 ? 7.900  58.440 204.330 1.00 15.00 ? 401 ASP A CG  1 
ATOM   3033 O  OD1 . ASP A 1 369 ? 8.810  57.670 204.670 1.00 15.00 ? 401 ASP A OD1 1 
ATOM   3034 O  OD2 . ASP A 1 369 ? 6.740  58.340 204.760 1.00 15.00 ? 401 ASP A OD2 1 
ATOM   3035 N  N   . TYR A 1 370 ? 10.860 60.110 201.620 1.00 15.00 ? 402 TYR A N   1 
ATOM   3036 C  CA  . TYR A 1 370 ? 11.310 60.460 200.290 1.00 15.00 ? 402 TYR A CA  1 
ATOM   3037 C  C   . TYR A 1 370 ? 10.960 59.290 199.450 1.00 15.00 ? 402 TYR A C   1 
ATOM   3038 O  O   . TYR A 1 370 ? 11.000 58.140 199.920 1.00 15.00 ? 402 TYR A O   1 
ATOM   3039 C  CB  . TYR A 1 370 ? 12.780 60.640 200.190 1.00 15.00 ? 402 TYR A CB  1 
ATOM   3040 C  CG  . TYR A 1 370 ? 13.140 61.970 200.770 1.00 15.00 ? 402 TYR A CG  1 
ATOM   3041 C  CD1 . TYR A 1 370 ? 13.060 63.090 199.980 1.00 15.00 ? 402 TYR A CD1 1 
ATOM   3042 C  CD2 . TYR A 1 370 ? 13.500 62.040 202.090 1.00 15.00 ? 402 TYR A CD2 1 
ATOM   3043 C  CE1 . TYR A 1 370 ? 13.340 64.320 200.530 1.00 15.00 ? 402 TYR A CE1 1 
ATOM   3044 C  CE2 . TYR A 1 370 ? 13.780 63.270 202.620 1.00 15.00 ? 402 TYR A CE2 1 
ATOM   3045 C  CZ  . TYR A 1 370 ? 13.700 64.400 201.850 1.00 15.00 ? 402 TYR A CZ  1 
ATOM   3046 O  OH  . TYR A 1 370 ? 13.990 65.610 202.430 1.00 15.00 ? 402 TYR A OH  1 
ATOM   3047 N  N   . SER A 1 371 ? 10.620 59.550 198.210 1.00 15.00 ? 403 SER A N   1 
ATOM   3048 C  CA  . SER A 1 371 ? 10.320 58.470 197.320 1.00 15.00 ? 403 SER A CA  1 
ATOM   3049 C  C   . SER A 1 371 ? 11.620 57.940 196.760 1.00 15.00 ? 403 SER A C   1 
ATOM   3050 O  O   . SER A 1 371 ? 12.650 58.630 196.830 1.00 15.00 ? 403 SER A O   1 
ATOM   3051 C  CB  . SER A 1 371 ? 9.420  58.990 196.230 1.00 15.00 ? 403 SER A CB  1 
ATOM   3052 O  OG  . SER A 1 371 ? 10.070 59.910 195.340 1.00 15.00 ? 403 SER A OG  1 
ATOM   3053 N  N   . TYR A 1 372 ? 11.610 56.770 196.140 1.00 15.00 ? 404 TYR A N   1 
ATOM   3054 C  CA  . TYR A 1 372 ? 12.780 56.290 195.420 1.00 15.00 ? 404 TYR A CA  1 
ATOM   3055 C  C   . TYR A 1 372 ? 13.120 57.310 194.360 1.00 15.00 ? 404 TYR A C   1 
ATOM   3056 O  O   . TYR A 1 372 ? 14.300 57.600 194.210 1.00 15.00 ? 404 TYR A O   1 
ATOM   3057 C  CB  . TYR A 1 372 ? 12.550 55.010 194.690 1.00 15.00 ? 404 TYR A CB  1 
ATOM   3058 C  CG  . TYR A 1 372 ? 12.630 53.830 195.610 1.00 15.00 ? 404 TYR A CG  1 
ATOM   3059 C  CD1 . TYR A 1 372 ? 11.640 53.590 196.540 1.00 15.00 ? 404 TYR A CD1 1 
ATOM   3060 C  CD2 . TYR A 1 372 ? 13.700 53.000 195.480 1.00 15.00 ? 404 TYR A CD2 1 
ATOM   3061 C  CE1 . TYR A 1 372 ? 11.730 52.490 197.340 1.00 15.00 ? 404 TYR A CE1 1 
ATOM   3062 C  CE2 . TYR A 1 372 ? 13.780 51.900 196.270 1.00 15.00 ? 404 TYR A CE2 1 
ATOM   3063 C  CZ  . TYR A 1 372 ? 12.810 51.650 197.200 1.00 15.00 ? 404 TYR A CZ  1 
ATOM   3064 O  OH  . TYR A 1 372 ? 12.930 50.530 197.980 1.00 15.00 ? 404 TYR A OH  1 
ATOM   3065 N  N   . GLU A 1 373 ? 12.140 57.920 193.710 1.00 15.00 ? 405 GLU A N   1 
ATOM   3066 C  CA  . GLU A 1 373 ? 12.470 58.900 192.700 1.00 15.00 ? 405 GLU A CA  1 
ATOM   3067 C  C   . GLU A 1 373 ? 12.940 60.210 193.310 1.00 15.00 ? 405 GLU A C   1 
ATOM   3068 O  O   . GLU A 1 373 ? 13.240 61.170 192.600 1.00 15.00 ? 405 GLU A O   1 
ATOM   3069 C  CB  . GLU A 1 373 ? 11.270 59.130 191.750 1.00 15.00 ? 405 GLU A CB  1 
ATOM   3070 C  CG  . GLU A 1 373 ? 9.820  59.030 192.210 1.00 15.00 ? 405 GLU A CG  1 
ATOM   3071 C  CD  . GLU A 1 373 ? 9.320  57.600 192.380 1.00 15.00 ? 405 GLU A CD  1 
ATOM   3072 O  OE1 . GLU A 1 373 ? 9.280  56.860 191.390 1.00 15.00 ? 405 GLU A OE1 1 
ATOM   3073 O  OE2 . GLU A 1 373 ? 8.970  57.220 193.490 1.00 15.00 ? 405 GLU A OE2 1 
ATOM   3074 N  N   . GLN A 1 374 ? 12.960 60.340 194.620 1.00 15.00 ? 406 GLN A N   1 
ATOM   3075 C  CA  . GLN A 1 374 ? 13.630 61.470 195.210 1.00 15.00 ? 406 GLN A CA  1 
ATOM   3076 C  C   . GLN A 1 374 ? 14.990 61.040 195.770 1.00 15.00 ? 406 GLN A C   1 
ATOM   3077 O  O   . GLN A 1 374 ? 15.960 61.810 195.810 1.00 15.00 ? 406 GLN A O   1 
ATOM   3078 C  CB  . GLN A 1 374 ? 12.810 62.040 196.320 1.00 15.00 ? 406 GLN A CB  1 
ATOM   3079 C  CG  . GLN A 1 374 ? 11.590 62.750 195.800 1.00 15.00 ? 406 GLN A CG  1 
ATOM   3080 C  CD  . GLN A 1 374 ? 10.660 63.130 196.930 1.00 15.00 ? 406 GLN A CD  1 
ATOM   3081 O  OE1 . GLN A 1 374 ? 10.240 62.300 197.730 1.00 15.00 ? 406 GLN A OE1 1 
ATOM   3082 N  NE2 . GLN A 1 374 ? 10.320 64.400 197.080 1.00 15.00 ? 406 GLN A NE2 1 
ATOM   3083 N  N   . PHE A 1 375 ? 15.080 59.790 196.210 1.00 15.00 ? 407 PHE A N   1 
ATOM   3084 C  CA  . PHE A 1 375 ? 16.260 59.290 196.850 1.00 15.00 ? 407 PHE A CA  1 
ATOM   3085 C  C   . PHE A 1 375 ? 17.330 59.000 195.820 1.00 15.00 ? 407 PHE A C   1 
ATOM   3086 O  O   . PHE A 1 375 ? 18.410 59.590 195.850 1.00 15.00 ? 407 PHE A O   1 
ATOM   3087 C  CB  . PHE A 1 375 ? 15.890 58.050 197.620 1.00 15.00 ? 407 PHE A CB  1 
ATOM   3088 C  CG  . PHE A 1 375 ? 16.850 57.670 198.730 1.00 15.00 ? 407 PHE A CG  1 
ATOM   3089 C  CD1 . PHE A 1 375 ? 17.020 58.530 199.800 1.00 15.00 ? 407 PHE A CD1 1 
ATOM   3090 C  CD2 . PHE A 1 375 ? 17.500 56.450 198.680 1.00 15.00 ? 407 PHE A CD2 1 
ATOM   3091 C  CE1 . PHE A 1 375 ? 17.860 58.170 200.830 1.00 15.00 ? 407 PHE A CE1 1 
ATOM   3092 C  CE2 . PHE A 1 375 ? 18.330 56.090 199.710 1.00 15.00 ? 407 PHE A CE2 1 
ATOM   3093 C  CZ  . PHE A 1 375 ? 18.500 56.950 200.790 1.00 15.00 ? 407 PHE A CZ  1 
ATOM   3094 N  N   . LEU A 1 376 ? 17.040 58.120 194.880 1.00 15.00 ? 408 LEU A N   1 
ATOM   3095 C  CA  . LEU A 1 376 ? 18.030 57.700 193.920 1.00 15.00 ? 408 LEU A CA  1 
ATOM   3096 C  C   . LEU A 1 376 ? 18.430 58.890 193.080 1.00 15.00 ? 408 LEU A C   1 
ATOM   3097 O  O   . LEU A 1 376 ? 17.600 59.670 192.620 1.00 15.00 ? 408 LEU A O   1 
ATOM   3098 C  CB  . LEU A 1 376 ? 17.480 56.590 193.030 1.00 15.00 ? 408 LEU A CB  1 
ATOM   3099 C  CG  . LEU A 1 376 ? 16.750 55.410 193.700 1.00 15.00 ? 408 LEU A CG  1 
ATOM   3100 C  CD1 . LEU A 1 376 ? 16.450 54.380 192.650 1.00 15.00 ? 408 LEU A CD1 1 
ATOM   3101 C  CD2 . LEU A 1 376 ? 17.600 54.790 194.790 1.00 15.00 ? 408 LEU A CD2 1 
ATOM   3102 N  N   . PHE A 1 377 ? 19.750 59.010 193.020 1.00 15.00 ? 409 PHE A N   1 
ATOM   3103 C  CA  . PHE A 1 377 ? 20.540 60.040 192.360 1.00 15.00 ? 409 PHE A CA  1 
ATOM   3104 C  C   . PHE A 1 377 ? 20.490 61.400 193.020 1.00 15.00 ? 409 PHE A C   1 
ATOM   3105 O  O   . PHE A 1 377 ? 21.070 62.360 192.500 1.00 15.00 ? 409 PHE A O   1 
ATOM   3106 C  CB  . PHE A 1 377 ? 20.100 60.190 190.900 1.00 15.00 ? 409 PHE A CB  1 
ATOM   3107 C  CG  . PHE A 1 377 ? 20.090 58.860 190.180 1.00 15.00 ? 409 PHE A CG  1 
ATOM   3108 C  CD1 . PHE A 1 377 ? 21.280 58.180 189.960 1.00 15.00 ? 409 PHE A CD1 1 
ATOM   3109 C  CD2 . PHE A 1 377 ? 18.870 58.330 189.760 1.00 15.00 ? 409 PHE A CD2 1 
ATOM   3110 C  CE1 . PHE A 1 377 ? 21.250 56.950 189.330 1.00 15.00 ? 409 PHE A CE1 1 
ATOM   3111 C  CE2 . PHE A 1 377 ? 18.850 57.090 189.130 1.00 15.00 ? 409 PHE A CE2 1 
ATOM   3112 C  CZ  . PHE A 1 377 ? 20.040 56.410 188.910 1.00 15.00 ? 409 PHE A CZ  1 
ATOM   3113 N  N   . ASN A 1 378 ? 19.860 61.570 194.190 1.00 15.00 ? 410 ASN A N   1 
ATOM   3114 C  CA  . ASN A 1 378 ? 19.750 62.880 194.810 1.00 15.00 ? 410 ASN A CA  1 
ATOM   3115 C  C   . ASN A 1 378 ? 21.130 63.320 195.230 1.00 15.00 ? 410 ASN A C   1 
ATOM   3116 O  O   . ASN A 1 378 ? 21.750 62.750 196.130 1.00 15.00 ? 410 ASN A O   1 
ATOM   3117 C  CB  . ASN A 1 378 ? 18.820 62.800 196.000 1.00 15.00 ? 410 ASN A CB  1 
ATOM   3118 C  CG  . ASN A 1 378 ? 18.440 64.180 196.510 1.00 15.00 ? 410 ASN A CG  1 
ATOM   3119 O  OD1 . ASN A 1 378 ? 19.330 64.910 196.950 1.00 15.00 ? 410 ASN A OD1 1 
ATOM   3120 N  ND2 . ASN A 1 378 ? 17.180 64.600 196.470 1.00 15.00 ? 410 ASN A ND2 1 
ATOM   3121 N  N   . THR A 1 379 ? 21.650 64.310 194.530 1.00 15.00 ? 411 THR A N   1 
ATOM   3122 C  CA  . THR A 1 379 ? 23.000 64.770 194.770 1.00 15.00 ? 411 THR A CA  1 
ATOM   3123 C  C   . THR A 1 379 ? 23.220 65.650 195.990 1.00 15.00 ? 411 THR A C   1 
ATOM   3124 O  O   . THR A 1 379 ? 24.300 65.700 196.600 1.00 15.00 ? 411 THR A O   1 
ATOM   3125 C  CB  . THR A 1 379 ? 23.510 65.510 193.540 1.00 15.00 ? 411 THR A CB  1 
ATOM   3126 O  OG1 . THR A 1 379 ? 22.870 64.960 192.400 1.00 15.00 ? 411 THR A OG1 1 
ATOM   3127 C  CG2 . THR A 1 379 ? 25.000 65.310 193.370 1.00 15.00 ? 411 THR A CG2 1 
ATOM   3128 N  N   . SER A 1 380 ? 22.180 66.340 196.420 1.00 15.00 ? 412 SER A N   1 
ATOM   3129 C  CA  . SER A 1 380 ? 22.320 67.230 197.540 1.00 15.00 ? 412 SER A CA  1 
ATOM   3130 C  C   . SER A 1 380 ? 22.040 66.650 198.900 1.00 15.00 ? 412 SER A C   1 
ATOM   3131 O  O   . SER A 1 380 ? 22.650 67.090 199.870 1.00 15.00 ? 412 SER A O   1 
ATOM   3132 C  CB  . SER A 1 380 ? 21.430 68.420 197.290 1.00 15.00 ? 412 SER A CB  1 
ATOM   3133 O  OG  . SER A 1 380 ? 20.300 68.010 196.530 1.00 15.00 ? 412 SER A OG  1 
ATOM   3134 N  N   . MET A 1 381 ? 21.190 65.630 198.990 1.00 15.00 ? 413 MET A N   1 
ATOM   3135 C  CA  . MET A 1 381 ? 20.740 65.130 200.280 1.00 15.00 ? 413 MET A CA  1 
ATOM   3136 C  C   . MET A 1 381 ? 21.800 64.920 201.330 1.00 15.00 ? 413 MET A C   1 
ATOM   3137 O  O   . MET A 1 381 ? 21.640 65.350 202.480 1.00 15.00 ? 413 MET A O   1 
ATOM   3138 C  CB  . MET A 1 381 ? 20.000 63.830 200.090 1.00 15.00 ? 413 MET A CB  1 
ATOM   3139 C  CG  . MET A 1 381 ? 19.010 63.720 201.220 1.00 15.00 ? 413 MET A CG  1 
ATOM   3140 S  SD  . MET A 1 381 ? 18.100 62.170 201.210 1.00 15.00 ? 413 MET A SD  1 
ATOM   3141 C  CE  . MET A 1 381 ? 17.200 62.320 199.690 1.00 15.00 ? 413 MET A CE  1 
ATOM   3142 N  N   . LEU A 1 382 ? 22.940 64.380 200.910 1.00 15.00 ? 414 LEU A N   1 
ATOM   3143 C  CA  . LEU A 1 382 ? 24.050 64.120 201.820 1.00 15.00 ? 414 LEU A CA  1 
ATOM   3144 C  C   . LEU A 1 382 ? 24.590 65.390 202.430 1.00 15.00 ? 414 LEU A C   1 
ATOM   3145 O  O   . LEU A 1 382 ? 24.740 65.530 203.650 1.00 15.00 ? 414 LEU A O   1 
ATOM   3146 C  CB  . LEU A 1 382 ? 25.180 63.420 201.100 1.00 15.00 ? 414 LEU A CB  1 
ATOM   3147 C  CG  . LEU A 1 382 ? 26.400 63.100 201.940 1.00 15.00 ? 414 LEU A CG  1 
ATOM   3148 C  CD1 . LEU A 1 382 ? 26.050 62.120 203.030 1.00 15.00 ? 414 LEU A CD1 1 
ATOM   3149 C  CD2 . LEU A 1 382 ? 27.450 62.510 201.040 1.00 15.00 ? 414 LEU A CD2 1 
ATOM   3150 N  N   . VAL A 1 383 ? 24.840 66.340 201.540 1.00 15.00 ? 415 VAL A N   1 
ATOM   3151 C  CA  . VAL A 1 383 ? 25.440 67.600 201.910 1.00 15.00 ? 415 VAL A CA  1 
ATOM   3152 C  C   . VAL A 1 383 ? 24.450 68.410 202.720 1.00 15.00 ? 415 VAL A C   1 
ATOM   3153 O  O   . VAL A 1 383 ? 24.830 69.150 203.630 1.00 15.00 ? 415 VAL A O   1 
ATOM   3154 C  CB  . VAL A 1 383 ? 25.850 68.340 200.630 1.00 15.00 ? 415 VAL A CB  1 
ATOM   3155 C  CG1 . VAL A 1 383 ? 26.660 69.560 201.030 1.00 15.00 ? 415 VAL A CG1 1 
ATOM   3156 C  CG2 . VAL A 1 383 ? 26.650 67.440 199.690 1.00 15.00 ? 415 VAL A CG2 1 
ATOM   3157 N  N   . ASP A 1 384 ? 23.180 68.250 202.360 1.00 15.00 ? 416 ASP A N   1 
ATOM   3158 C  CA  . ASP A 1 384 ? 22.110 68.950 203.030 1.00 15.00 ? 416 ASP A CA  1 
ATOM   3159 C  C   . ASP A 1 384 ? 21.890 68.470 204.430 1.00 15.00 ? 416 ASP A C   1 
ATOM   3160 O  O   . ASP A 1 384 ? 21.680 69.310 205.300 1.00 15.00 ? 416 ASP A O   1 
ATOM   3161 C  CB  . ASP A 1 384 ? 20.770 68.800 202.350 1.00 15.00 ? 416 ASP A CB  1 
ATOM   3162 C  CG  . ASP A 1 384 ? 20.610 69.450 200.980 1.00 15.00 ? 416 ASP A CG  1 
ATOM   3163 O  OD1 . ASP A 1 384 ? 21.340 70.400 200.650 1.00 15.00 ? 416 ASP A OD1 1 
ATOM   3164 O  OD2 . ASP A 1 384 ? 19.720 68.990 200.250 1.00 15.00 ? 416 ASP A OD2 1 
ATOM   3165 N  N   . TYR A 1 385 ? 21.870 67.170 204.710 1.00 15.00 ? 417 TYR A N   1 
ATOM   3166 C  CA  . TYR A 1 385 ? 21.590 66.740 206.060 1.00 15.00 ? 417 TYR A CA  1 
ATOM   3167 C  C   . TYR A 1 385 ? 22.840 66.540 206.880 1.00 15.00 ? 417 TYR A C   1 
ATOM   3168 O  O   . TYR A 1 385 ? 22.830 66.690 208.100 1.00 15.00 ? 417 TYR A O   1 
ATOM   3169 C  CB  . TYR A 1 385 ? 20.790 65.430 206.050 1.00 15.00 ? 417 TYR A CB  1 
ATOM   3170 C  CG  . TYR A 1 385 ? 19.350 65.610 205.610 1.00 15.00 ? 417 TYR A CG  1 
ATOM   3171 C  CD1 . TYR A 1 385 ? 19.050 65.700 204.270 1.00 15.00 ? 417 TYR A CD1 1 
ATOM   3172 C  CD2 . TYR A 1 385 ? 18.340 65.740 206.560 1.00 15.00 ? 417 TYR A CD2 1 
ATOM   3173 C  CE1 . TYR A 1 385 ? 17.750 65.950 203.880 1.00 15.00 ? 417 TYR A CE1 1 
ATOM   3174 C  CE2 . TYR A 1 385 ? 17.040 65.980 206.170 1.00 15.00 ? 417 TYR A CE2 1 
ATOM   3175 C  CZ  . TYR A 1 385 ? 16.760 66.080 204.830 1.00 15.00 ? 417 TYR A CZ  1 
ATOM   3176 O  OH  . TYR A 1 385 ? 15.470 66.360 204.430 1.00 15.00 ? 417 TYR A OH  1 
ATOM   3177 N  N   . GLY A 1 386 ? 23.920 66.170 206.180 1.00 15.00 ? 418 GLY A N   1 
ATOM   3178 C  CA  . GLY A 1 386 ? 25.190 65.910 206.810 1.00 15.00 ? 418 GLY A CA  1 
ATOM   3179 C  C   . GLY A 1 386 ? 25.200 64.530 207.440 1.00 15.00 ? 418 GLY A C   1 
ATOM   3180 O  O   . GLY A 1 386 ? 24.200 64.060 207.990 1.00 15.00 ? 418 GLY A O   1 
ATOM   3181 N  N   . VAL A 1 387 ? 26.370 63.880 207.380 1.00 15.00 ? 419 VAL A N   1 
ATOM   3182 C  CA  . VAL A 1 387 ? 26.570 62.520 207.890 1.00 15.00 ? 419 VAL A CA  1 
ATOM   3183 C  C   . VAL A 1 387 ? 25.840 62.210 209.210 1.00 15.00 ? 419 VAL A C   1 
ATOM   3184 O  O   . VAL A 1 387 ? 25.100 61.220 209.260 1.00 15.00 ? 419 VAL A O   1 
ATOM   3185 C  CB  . VAL A 1 387 ? 28.090 62.290 208.020 1.00 15.00 ? 419 VAL A CB  1 
ATOM   3186 C  CG1 . VAL A 1 387 ? 28.720 63.440 208.780 1.00 15.00 ? 419 VAL A CG1 1 
ATOM   3187 C  CG2 . VAL A 1 387 ? 28.380 61.000 208.760 1.00 15.00 ? 419 VAL A CG2 1 
ATOM   3188 N  N   . GLU A 1 388 ? 25.930 63.110 210.190 1.00 15.00 ? 420 GLU A N   1 
ATOM   3189 C  CA  . GLU A 1 388 ? 25.310 62.940 211.500 1.00 15.00 ? 420 GLU A CA  1 
ATOM   3190 C  C   . GLU A 1 388 ? 23.820 62.600 211.400 1.00 15.00 ? 420 GLU A C   1 
ATOM   3191 O  O   . GLU A 1 388 ? 23.360 61.580 211.910 1.00 15.00 ? 420 GLU A O   1 
ATOM   3192 C  CB  . GLU A 1 388 ? 25.380 64.210 212.370 1.00 15.00 ? 420 GLU A CB  1 
ATOM   3193 C  CG  . GLU A 1 388 ? 26.690 64.900 212.710 1.00 15.00 ? 420 GLU A CG  1 
ATOM   3194 C  CD  . GLU A 1 388 ? 27.420 65.600 211.570 1.00 15.00 ? 420 GLU A CD  1 
ATOM   3195 O  OE1 . GLU A 1 388 ? 26.780 66.030 210.590 1.00 15.00 ? 420 GLU A OE1 1 
ATOM   3196 O  OE2 . GLU A 1 388 ? 28.660 65.720 211.660 1.00 15.00 ? 420 GLU A OE2 1 
ATOM   3197 N  N   . ALA A 1 389 ? 23.090 63.440 210.660 1.00 15.00 ? 421 ALA A N   1 
ATOM   3198 C  CA  . ALA A 1 389 ? 21.650 63.290 210.560 1.00 15.00 ? 421 ALA A CA  1 
ATOM   3199 C  C   . ALA A 1 389 ? 21.250 61.990 209.860 1.00 15.00 ? 421 ALA A C   1 
ATOM   3200 O  O   . ALA A 1 389 ? 20.470 61.180 210.380 1.00 15.00 ? 421 ALA A O   1 
ATOM   3201 C  CB  . ALA A 1 389 ? 21.060 64.440 209.770 1.00 15.00 ? 421 ALA A CB  1 
ATOM   3202 N  N   . LEU A 1 390 ? 21.840 61.760 208.690 1.00 15.00 ? 422 LEU A N   1 
ATOM   3203 C  CA  . LEU A 1 390 ? 21.460 60.600 207.910 1.00 15.00 ? 422 LEU A CA  1 
ATOM   3204 C  C   . LEU A 1 390 ? 21.760 59.330 208.650 1.00 15.00 ? 422 LEU A C   1 
ATOM   3205 O  O   . LEU A 1 390 ? 20.910 58.450 208.640 1.00 15.00 ? 422 LEU A O   1 
ATOM   3206 C  CB  . LEU A 1 390 ? 22.160 60.660 206.600 1.00 15.00 ? 422 LEU A CB  1 
ATOM   3207 C  CG  . LEU A 1 390 ? 21.420 61.580 205.680 1.00 15.00 ? 422 LEU A CG  1 
ATOM   3208 C  CD1 . LEU A 1 390 ? 22.340 62.080 204.610 1.00 15.00 ? 422 LEU A CD1 1 
ATOM   3209 C  CD2 . LEU A 1 390 ? 20.250 60.860 205.070 1.00 15.00 ? 422 LEU A CD2 1 
ATOM   3210 N  N   . VAL A 1 391 ? 22.870 59.250 209.370 1.00 15.00 ? 423 VAL A N   1 
ATOM   3211 C  CA  . VAL A 1 391 ? 23.150 58.070 210.150 1.00 15.00 ? 423 VAL A CA  1 
ATOM   3212 C  C   . VAL A 1 391 ? 22.010 57.800 211.110 1.00 15.00 ? 423 VAL A C   1 
ATOM   3213 O  O   . VAL A 1 391 ? 21.520 56.680 211.150 1.00 15.00 ? 423 VAL A O   1 
ATOM   3214 C  CB  . VAL A 1 391 ? 24.430 58.240 210.950 1.00 15.00 ? 423 VAL A CB  1 
ATOM   3215 C  CG1 . VAL A 1 391 ? 24.610 57.150 211.970 1.00 15.00 ? 423 VAL A CG1 1 
ATOM   3216 C  CG2 . VAL A 1 391 ? 25.580 58.130 209.990 1.00 15.00 ? 423 VAL A CG2 1 
ATOM   3217 N  N   . ASP A 1 392 ? 21.520 58.820 211.800 1.00 15.00 ? 424 ASP A N   1 
ATOM   3218 C  CA  . ASP A 1 392 ? 20.460 58.650 212.770 1.00 15.00 ? 424 ASP A CA  1 
ATOM   3219 C  C   . ASP A 1 392 ? 19.180 58.160 212.140 1.00 15.00 ? 424 ASP A C   1 
ATOM   3220 O  O   . ASP A 1 392 ? 18.430 57.330 212.680 1.00 15.00 ? 424 ASP A O   1 
ATOM   3221 C  CB  . ASP A 1 392 ? 20.200 59.990 213.490 1.00 15.00 ? 424 ASP A CB  1 
ATOM   3222 C  CG  . ASP A 1 392 ? 19.140 59.970 214.600 1.00 15.00 ? 424 ASP A CG  1 
ATOM   3223 O  OD1 . ASP A 1 392 ? 17.950 59.930 214.270 1.00 15.00 ? 424 ASP A OD1 1 
ATOM   3224 O  OD2 . ASP A 1 392 ? 19.510 60.010 215.780 1.00 15.00 ? 424 ASP A OD2 1 
ATOM   3225 N  N   . ALA A 1 393 ? 18.910 58.700 210.960 1.00 15.00 ? 425 ALA A N   1 
ATOM   3226 C  CA  . ALA A 1 393 ? 17.700 58.350 210.260 1.00 15.00 ? 425 ALA A CA  1 
ATOM   3227 C  C   . ALA A 1 393 ? 17.690 56.900 209.820 1.00 15.00 ? 425 ALA A C   1 
ATOM   3228 O  O   . ALA A 1 393 ? 16.820 56.100 210.160 1.00 15.00 ? 425 ALA A O   1 
ATOM   3229 C  CB  . ALA A 1 393 ? 17.580 59.250 209.060 1.00 15.00 ? 425 ALA A CB  1 
ATOM   3230 N  N   . PHE A 1 394 ? 18.770 56.540 209.140 1.00 15.00 ? 426 PHE A N   1 
ATOM   3231 C  CA  . PHE A 1 394 ? 18.900 55.200 208.620 1.00 15.00 ? 426 PHE A CA  1 
ATOM   3232 C  C   . PHE A 1 394 ? 19.000 54.250 209.790 1.00 15.00 ? 426 PHE A C   1 
ATOM   3233 O  O   . PHE A 1 394 ? 18.570 53.110 209.670 1.00 15.00 ? 426 PHE A O   1 
ATOM   3234 C  CB  . PHE A 1 394 ? 20.150 55.080 207.760 1.00 15.00 ? 426 PHE A CB  1 
ATOM   3235 C  CG  . PHE A 1 394 ? 20.150 55.910 206.470 1.00 15.00 ? 426 PHE A CG  1 
ATOM   3236 C  CD1 . PHE A 1 394 ? 18.990 56.240 205.820 1.00 15.00 ? 426 PHE A CD1 1 
ATOM   3237 C  CD2 . PHE A 1 394 ? 21.350 56.340 205.960 1.00 15.00 ? 426 PHE A CD2 1 
ATOM   3238 C  CE1 . PHE A 1 394 ? 19.040 56.990 204.660 1.00 15.00 ? 426 PHE A CE1 1 
ATOM   3239 C  CE2 . PHE A 1 394 ? 21.400 57.080 204.810 1.00 15.00 ? 426 PHE A CE2 1 
ATOM   3240 C  CZ  . PHE A 1 394 ? 20.240 57.410 204.150 1.00 15.00 ? 426 PHE A CZ  1 
ATOM   3241 N  N   . SER A 1 395 ? 19.520 54.700 210.930 1.00 15.00 ? 427 SER A N   1 
ATOM   3242 C  CA  . SER A 1 395 ? 19.620 53.830 212.070 1.00 15.00 ? 427 SER A CA  1 
ATOM   3243 C  C   . SER A 1 395 ? 18.270 53.520 212.680 1.00 15.00 ? 427 SER A C   1 
ATOM   3244 O  O   . SER A 1 395 ? 18.140 52.530 213.410 1.00 15.00 ? 427 SER A O   1 
ATOM   3245 C  CB  . SER A 1 395 ? 20.480 54.440 213.150 1.00 15.00 ? 427 SER A CB  1 
ATOM   3246 O  OG  . SER A 1 395 ? 21.880 54.460 212.860 1.00 15.00 ? 427 SER A OG  1 
ATOM   3247 N  N   . ARG A 1 396 ? 17.260 54.360 212.420 1.00 15.00 ? 428 ARG A N   1 
ATOM   3248 C  CA  . ARG A 1 396 ? 15.940 54.120 212.980 1.00 15.00 ? 428 ARG A CA  1 
ATOM   3249 C  C   . ARG A 1 396 ? 14.980 53.440 212.030 1.00 15.00 ? 428 ARG A C   1 
ATOM   3250 O  O   . ARG A 1 396 ? 14.140 52.670 212.510 1.00 15.00 ? 428 ARG A O   1 
ATOM   3251 C  CB  . ARG A 1 396 ? 15.280 55.410 213.420 1.00 15.00 ? 428 ARG A CB  1 
ATOM   3252 C  CG  . ARG A 1 396 ? 16.080 56.230 214.400 1.00 15.00 ? 428 ARG A CG  1 
ATOM   3253 C  CD  . ARG A 1 396 ? 15.280 57.440 214.780 1.00 15.00 ? 428 ARG A CD  1 
ATOM   3254 N  NE  . ARG A 1 396 ? 16.120 58.330 215.550 1.00 15.00 ? 428 ARG A NE  1 
ATOM   3255 C  CZ  . ARG A 1 396 ? 16.390 58.130 216.840 1.00 15.00 ? 428 ARG A CZ  1 
ATOM   3256 N  NH1 . ARG A 1 396 ? 15.880 57.090 217.520 1.00 15.00 ? 428 ARG A NH1 1 
ATOM   3257 N  NH2 . ARG A 1 396 ? 17.290 58.920 217.440 1.00 15.00 ? 428 ARG A NH2 1 
ATOM   3258 N  N   . GLN A 1 397 ? 15.020 53.670 210.710 1.00 15.00 ? 429 GLN A N   1 
ATOM   3259 C  CA  . GLN A 1 397 ? 14.060 53.010 209.830 1.00 15.00 ? 429 GLN A CA  1 
ATOM   3260 C  C   . GLN A 1 397 ? 14.340 51.530 209.650 1.00 15.00 ? 429 GLN A C   1 
ATOM   3261 O  O   . GLN A 1 397 ? 15.490 51.180 209.400 1.00 15.00 ? 429 GLN A O   1 
ATOM   3262 C  CB  . GLN A 1 397 ? 14.060 53.700 208.480 1.00 15.00 ? 429 GLN A CB  1 
ATOM   3263 C  CG  . GLN A 1 397 ? 12.920 53.150 207.640 1.00 15.00 ? 429 GLN A CG  1 
ATOM   3264 C  CD  . GLN A 1 397 ? 12.620 53.910 206.360 1.00 15.00 ? 429 GLN A CD  1 
ATOM   3265 O  OE1 . GLN A 1 397 ? 13.090 55.020 206.070 1.00 15.00 ? 429 GLN A OE1 1 
ATOM   3266 N  NE2 . GLN A 1 397 ? 11.770 53.270 205.570 1.00 15.00 ? 429 GLN A NE2 1 
ATOM   3267 N  N   . PRO A 1 398 ? 13.390 50.600 209.780 1.00 15.00 ? 430 PRO A N   1 
ATOM   3268 C  CA  . PRO A 1 398 ? 13.620 49.170 209.640 1.00 15.00 ? 430 PRO A CA  1 
ATOM   3269 C  C   . PRO A 1 398 ? 13.780 48.730 208.200 1.00 15.00 ? 430 PRO A C   1 
ATOM   3270 O  O   . PRO A 1 398 ? 13.150 49.310 207.310 1.00 15.00 ? 430 PRO A O   1 
ATOM   3271 C  CB  . PRO A 1 398 ? 12.440 48.500 210.290 1.00 15.00 ? 430 PRO A CB  1 
ATOM   3272 C  CG  . PRO A 1 398 ? 11.920 49.590 211.200 1.00 15.00 ? 430 PRO A CG  1 
ATOM   3273 C  CD  . PRO A 1 398 ? 12.060 50.810 210.320 1.00 15.00 ? 430 PRO A CD  1 
ATOM   3274 N  N   . ALA A 1 399 ? 14.610 47.720 208.000 1.00 15.00 ? 431 ALA A N   1 
ATOM   3275 C  CA  . ALA A 1 399 ? 14.870 47.160 206.700 1.00 15.00 ? 431 ALA A CA  1 
ATOM   3276 C  C   . ALA A 1 399 ? 13.920 45.990 206.490 1.00 15.00 ? 431 ALA A C   1 
ATOM   3277 O  O   . ALA A 1 399 ? 13.460 45.410 207.480 1.00 15.00 ? 431 ALA A O   1 
ATOM   3278 C  CB  . ALA A 1 399 ? 16.300 46.680 206.660 1.00 15.00 ? 431 ALA A CB  1 
ATOM   3279 N  N   . GLY A 1 400 ? 13.620 45.590 205.270 1.00 15.00 ? 432 GLY A N   1 
ATOM   3280 C  CA  . GLY A 1 400 ? 12.680 44.510 205.040 1.00 15.00 ? 432 GLY A CA  1 
ATOM   3281 C  C   . GLY A 1 400 ? 13.190 43.110 205.300 1.00 15.00 ? 432 GLY A C   1 
ATOM   3282 O  O   . GLY A 1 400 ? 14.400 42.870 205.420 1.00 15.00 ? 432 GLY A O   1 
ATOM   3283 N  N   . ARG A 1 401 ? 12.270 42.160 205.400 1.00 15.00 ? 433 ARG A N   1 
ATOM   3284 C  CA  . ARG A 1 401 ? 12.620 40.760 205.570 1.00 15.00 ? 433 ARG A CA  1 
ATOM   3285 C  C   . ARG A 1 401 ? 13.260 40.300 204.280 1.00 15.00 ? 433 ARG A C   1 
ATOM   3286 O  O   . ARG A 1 401 ? 12.840 40.720 203.200 1.00 15.00 ? 433 ARG A O   1 
ATOM   3287 C  CB  . ARG A 1 401 ? 11.400 39.870 205.790 1.00 15.00 ? 433 ARG A CB  1 
ATOM   3288 C  CG  . ARG A 1 401 ? 11.510 39.080 207.090 1.00 15.00 ? 433 ARG A CG  1 
ATOM   3289 C  CD  . ARG A 1 401 ? 11.210 37.580 206.990 1.00 15.00 ? 433 ARG A CD  1 
ATOM   3290 N  NE  . ARG A 1 401 ? 9.800  37.170 207.010 1.00 15.00 ? 433 ARG A NE  1 
ATOM   3291 C  CZ  . ARG A 1 401 ? 9.000  37.070 205.910 1.00 15.00 ? 433 ARG A CZ  1 
ATOM   3292 N  NH1 . ARG A 1 401 ? 9.380  37.340 204.640 1.00 15.00 ? 433 ARG A NH1 1 
ATOM   3293 N  NH2 . ARG A 1 401 ? 7.750  36.610 206.100 1.00 15.00 ? 433 ARG A NH2 1 
ATOM   3294 N  N   . ILE A 1 402 ? 14.250 39.430 204.320 1.00 15.00 ? 434 ILE A N   1 
ATOM   3295 C  CA  . ILE A 1 402 ? 14.900 39.030 203.090 1.00 15.00 ? 434 ILE A CA  1 
ATOM   3296 C  C   . ILE A 1 402 ? 14.210 37.780 202.560 1.00 15.00 ? 434 ILE A C   1 
ATOM   3297 O  O   . ILE A 1 402 ? 13.690 37.740 201.440 1.00 15.00 ? 434 ILE A O   1 
ATOM   3298 C  CB  . ILE A 1 402 ? 16.370 38.830 203.430 1.00 15.00 ? 434 ILE A CB  1 
ATOM   3299 C  CG1 . ILE A 1 402 ? 17.020 40.170 203.600 1.00 15.00 ? 434 ILE A CG1 1 
ATOM   3300 C  CG2 . ILE A 1 402 ? 17.040 38.040 202.350 1.00 15.00 ? 434 ILE A CG2 1 
ATOM   3301 C  CD1 . ILE A 1 402 ? 18.500 40.090 204.000 1.00 15.00 ? 434 ILE A CD1 1 
ATOM   3302 N  N   . GLY A 1 403 ? 14.210 36.780 203.440 1.00 15.00 ? 435 GLY A N   1 
ATOM   3303 C  CA  . GLY A 1 403 ? 13.690 35.470 203.130 1.00 15.00 ? 435 GLY A CA  1 
ATOM   3304 C  C   . GLY A 1 403 ? 12.190 35.470 203.170 1.00 15.00 ? 435 GLY A C   1 
ATOM   3305 O  O   . GLY A 1 403 ? 11.570 36.480 203.520 1.00 15.00 ? 435 GLY A O   1 
ATOM   3306 N  N   . GLY A 1 404 ? 11.560 34.360 202.790 1.00 15.00 ? 436 GLY A N   1 
ATOM   3307 C  CA  . GLY A 1 404 ? 10.120 34.290 202.870 1.00 15.00 ? 436 GLY A CA  1 
ATOM   3308 C  C   . GLY A 1 404 ? 9.440  34.640 201.550 1.00 15.00 ? 436 GLY A C   1 
ATOM   3309 O  O   . GLY A 1 404 ? 8.390  34.070 201.260 1.00 15.00 ? 436 GLY A O   1 
ATOM   3310 N  N   . GLY A 1 405 ? 9.970  35.530 200.720 1.00 15.00 ? 437 GLY A N   1 
ATOM   3311 C  CA  . GLY A 1 405 ? 9.300  35.850 199.470 1.00 15.00 ? 437 GLY A CA  1 
ATOM   3312 C  C   . GLY A 1 405 ? 8.290  36.990 199.630 1.00 15.00 ? 437 GLY A C   1 
ATOM   3313 O  O   . GLY A 1 405 ? 7.970  37.450 200.720 1.00 15.00 ? 437 GLY A O   1 
ATOM   3314 N  N   . ARG A 1 406 ? 7.860  37.490 198.460 1.00 15.00 ? 438 ARG A N   1 
ATOM   3315 C  CA  . ARG A 1 406 ? 6.910  38.570 198.290 1.00 15.00 ? 438 ARG A CA  1 
ATOM   3316 C  C   . ARG A 1 406 ? 7.280  39.900 198.950 1.00 15.00 ? 438 ARG A C   1 
ATOM   3317 O  O   . ARG A 1 406 ? 6.430  40.710 199.370 1.00 15.00 ? 438 ARG A O   1 
ATOM   3318 C  CB  . ARG A 1 406 ? 5.550  38.060 198.800 1.00 15.00 ? 438 ARG A CB  1 
ATOM   3319 C  CG  . ARG A 1 406 ? 4.310  38.510 198.020 1.00 15.00 ? 438 ARG A CG  1 
ATOM   3320 C  CD  . ARG A 1 406 ? 4.110  37.630 196.810 1.00 15.00 ? 438 ARG A CD  1 
ATOM   3321 N  NE  . ARG A 1 406 ? 3.610  36.280 197.100 1.00 15.00 ? 438 ARG A NE  1 
ATOM   3322 C  CZ  . ARG A 1 406 ? 2.480  35.830 196.520 1.00 15.00 ? 438 ARG A CZ  1 
ATOM   3323 N  NH1 . ARG A 1 406 ? 1.770  36.620 195.680 1.00 15.00 ? 438 ARG A NH1 1 
ATOM   3324 N  NH2 . ARG A 1 406 ? 2.060  34.560 196.730 1.00 15.00 ? 438 ARG A NH2 1 
ATOM   3325 N  N   . ASN A 1 407 ? 8.580  40.230 198.890 1.00 15.00 ? 439 ASN A N   1 
ATOM   3326 C  CA  . ASN A 1 407 ? 9.050  41.420 199.570 1.00 15.00 ? 439 ASN A CA  1 
ATOM   3327 C  C   . ASN A 1 407 ? 10.010 42.320 198.790 1.00 15.00 ? 439 ASN A C   1 
ATOM   3328 O  O   . ASN A 1 407 ? 10.540 43.290 199.310 1.00 15.00 ? 439 ASN A O   1 
ATOM   3329 C  CB  . ASN A 1 407 ? 9.660  40.960 200.880 1.00 15.00 ? 439 ASN A CB  1 
ATOM   3330 C  CG  . ASN A 1 407 ? 9.700  42.090 201.900 1.00 15.00 ? 439 ASN A CG  1 
ATOM   3331 O  OD1 . ASN A 1 407 ? 8.700  42.610 202.380 1.00 15.00 ? 439 ASN A OD1 1 
ATOM   3332 N  ND2 . ASN A 1 407 ? 10.900 42.500 202.290 1.00 15.00 ? 439 ASN A ND2 1 
ATOM   3333 N  N   . ILE A 1 408 ? 10.250 42.130 197.500 1.00 15.00 ? 440 ILE A N   1 
ATOM   3334 C  CA  . ILE A 1 408 ? 11.140 42.990 196.730 1.00 15.00 ? 440 ILE A CA  1 
ATOM   3335 C  C   . ILE A 1 408 ? 10.300 44.170 196.270 1.00 15.00 ? 440 ILE A C   1 
ATOM   3336 O  O   . ILE A 1 408 ? 9.400  43.940 195.460 1.00 15.00 ? 440 ILE A O   1 
ATOM   3337 C  CB  . ILE A 1 408 ? 11.700 42.220 195.530 1.00 15.00 ? 440 ILE A CB  1 
ATOM   3338 C  CG1 . ILE A 1 408 ? 12.440 41.000 196.030 1.00 15.00 ? 440 ILE A CG1 1 
ATOM   3339 C  CG2 . ILE A 1 408 ? 12.600 43.120 194.710 1.00 15.00 ? 440 ILE A CG2 1 
ATOM   3340 C  CD1 . ILE A 1 408 ? 13.250 40.260 194.990 1.00 15.00 ? 440 ILE A CD1 1 
ATOM   3341 N  N   . ASP A 1 409 ? 10.470 45.390 196.760 1.00 15.00 ? 441 ASP A N   1 
ATOM   3342 C  CA  . ASP A 1 409 ? 9.690  46.550 196.290 1.00 15.00 ? 441 ASP A CA  1 
ATOM   3343 C  C   . ASP A 1 409 ? 9.770  46.730 194.780 1.00 15.00 ? 441 ASP A C   1 
ATOM   3344 O  O   . ASP A 1 409 ? 10.860 46.780 194.210 1.00 15.00 ? 441 ASP A O   1 
ATOM   3345 C  CB  . ASP A 1 409 ? 10.180 47.840 197.010 1.00 15.00 ? 441 ASP A CB  1 
ATOM   3346 C  CG  . ASP A 1 409 ? 9.800  49.190 196.390 1.00 15.00 ? 441 ASP A CG  1 
ATOM   3347 O  OD1 . ASP A 1 409 ? 10.420 49.560 195.410 1.00 15.00 ? 441 ASP A OD1 1 
ATOM   3348 O  OD2 . ASP A 1 409 ? 8.920  49.900 196.880 1.00 15.00 ? 441 ASP A OD2 1 
ATOM   3349 N  N   . HIS A 1 410 ? 8.660  47.010 194.110 1.00 15.00 ? 442 HIS A N   1 
ATOM   3350 C  CA  . HIS A 1 410 ? 8.640  47.070 192.650 1.00 15.00 ? 442 HIS A CA  1 
ATOM   3351 C  C   . HIS A 1 410 ? 9.690  47.900 191.950 1.00 15.00 ? 442 HIS A C   1 
ATOM   3352 O  O   . HIS A 1 410 ? 10.160 47.490 190.890 1.00 15.00 ? 442 HIS A O   1 
ATOM   3353 C  CB  . HIS A 1 410 ? 7.290  47.560 192.160 1.00 15.00 ? 442 HIS A CB  1 
ATOM   3354 C  CG  . HIS A 1 410 ? 6.920  49.010 192.480 1.00 15.00 ? 442 HIS A CG  1 
ATOM   3355 N  ND1 . HIS A 1 410 ? 7.090  50.100 191.610 1.00 15.00 ? 442 HIS A ND1 1 
ATOM   3356 C  CD2 . HIS A 1 410 ? 6.330  49.400 193.680 1.00 15.00 ? 442 HIS A CD2 1 
ATOM   3357 C  CE1 . HIS A 1 410 ? 6.600  51.150 192.290 1.00 15.00 ? 442 HIS A CE1 1 
ATOM   3358 N  NE2 . HIS A 1 410 ? 6.170  50.780 193.470 1.00 15.00 ? 442 HIS A NE2 1 
ATOM   3359 N  N   . HIS A 1 411 ? 10.110 49.020 192.560 1.00 15.00 ? 443 HIS A N   1 
ATOM   3360 C  CA  . HIS A 1 411 ? 11.120 49.880 191.950 1.00 15.00 ? 443 HIS A CA  1 
ATOM   3361 C  C   . HIS A 1 411 ? 12.400 49.150 191.600 1.00 15.00 ? 443 HIS A C   1 
ATOM   3362 O  O   . HIS A 1 411 ? 13.050 49.460 190.610 1.00 15.00 ? 443 HIS A O   1 
ATOM   3363 C  CB  . HIS A 1 411 ? 11.530 51.020 192.840 1.00 15.00 ? 443 HIS A CB  1 
ATOM   3364 C  CG  . HIS A 1 411 ? 10.530 52.110 193.170 1.00 15.00 ? 443 HIS A CG  1 
ATOM   3365 N  ND1 . HIS A 1 411 ? 10.490 53.340 192.520 1.00 15.00 ? 443 HIS A ND1 1 
ATOM   3366 C  CD2 . HIS A 1 411 ? 9.570  52.040 194.180 1.00 15.00 ? 443 HIS A CD2 1 
ATOM   3367 C  CE1 . HIS A 1 411 ? 9.490  54.000 193.140 1.00 15.00 ? 443 HIS A CE1 1 
ATOM   3368 N  NE2 . HIS A 1 411 ? 8.970  53.290 194.100 1.00 15.00 ? 443 HIS A NE2 1 
ATOM   3369 N  N   . ILE A 1 412 ? 12.790 48.160 192.410 1.00 15.00 ? 444 ILE A N   1 
ATOM   3370 C  CA  . ILE A 1 412 ? 14.000 47.430 192.150 1.00 15.00 ? 444 ILE A CA  1 
ATOM   3371 C  C   . ILE A 1 412 ? 13.670 45.990 191.750 1.00 15.00 ? 444 ILE A C   1 
ATOM   3372 O  O   . ILE A 1 412 ? 14.580 45.240 191.460 1.00 15.00 ? 444 ILE A O   1 
ATOM   3373 C  CB  . ILE A 1 412 ? 14.900 47.500 193.420 1.00 15.00 ? 444 ILE A CB  1 
ATOM   3374 C  CG1 . ILE A 1 412 ? 14.260 46.910 194.650 1.00 15.00 ? 444 ILE A CG1 1 
ATOM   3375 C  CG2 . ILE A 1 412 ? 15.130 48.960 193.720 1.00 15.00 ? 444 ILE A CG2 1 
ATOM   3376 C  CD1 . ILE A 1 412 ? 15.140 46.970 195.900 1.00 15.00 ? 444 ILE A CD1 1 
ATOM   3377 N  N   . LEU A 1 413 ? 12.400 45.570 191.590 1.00 15.00 ? 445 LEU A N   1 
ATOM   3378 C  CA  . LEU A 1 413 ? 12.020 44.190 191.280 1.00 15.00 ? 445 LEU A CA  1 
ATOM   3379 C  C   . LEU A 1 413 ? 12.630 43.650 190.010 1.00 15.00 ? 445 LEU A C   1 
ATOM   3380 O  O   . LEU A 1 413 ? 12.900 42.450 189.870 1.00 15.00 ? 445 LEU A O   1 
ATOM   3381 C  CB  . LEU A 1 413 ? 10.480 44.090 191.200 1.00 15.00 ? 445 LEU A CB  1 
ATOM   3382 C  CG  . LEU A 1 413 ? 9.590  42.840 191.090 1.00 15.00 ? 445 LEU A CG  1 
ATOM   3383 C  CD1 . LEU A 1 413 ? 9.400  42.480 189.650 1.00 15.00 ? 445 LEU A CD1 1 
ATOM   3384 C  CD2 . LEU A 1 413 ? 10.180 41.700 191.880 1.00 15.00 ? 445 LEU A CD2 1 
ATOM   3385 N  N   . HIS A 1 414 ? 12.900 44.570 189.080 1.00 15.00 ? 446 HIS A N   1 
ATOM   3386 C  CA  . HIS A 1 414 ? 13.530 44.210 187.830 1.00 15.00 ? 446 HIS A CA  1 
ATOM   3387 C  C   . HIS A 1 414 ? 14.880 43.550 188.030 1.00 15.00 ? 446 HIS A C   1 
ATOM   3388 O  O   . HIS A 1 414 ? 15.230 42.630 187.290 1.00 15.00 ? 446 HIS A O   1 
ATOM   3389 C  CB  . HIS A 1 414 ? 13.750 45.430 186.960 1.00 15.00 ? 446 HIS A CB  1 
ATOM   3390 C  CG  . HIS A 1 414 ? 14.780 46.430 187.430 1.00 15.00 ? 446 HIS A CG  1 
ATOM   3391 N  ND1 . HIS A 1 414 ? 14.660 47.280 188.540 1.00 15.00 ? 446 HIS A ND1 1 
ATOM   3392 C  CD2 . HIS A 1 414 ? 15.980 46.640 186.750 1.00 15.00 ? 446 HIS A CD2 1 
ATOM   3393 C  CE1 . HIS A 1 414 ? 15.800 48.010 188.520 1.00 15.00 ? 446 HIS A CE1 1 
ATOM   3394 N  NE2 . HIS A 1 414 ? 16.560 47.670 187.510 1.00 15.00 ? 446 HIS A NE2 1 
ATOM   3395 N  N   . VAL A 1 415 ? 15.610 43.980 189.060 1.00 15.00 ? 447 VAL A N   1 
ATOM   3396 C  CA  . VAL A 1 415 ? 16.930 43.440 189.360 1.00 15.00 ? 447 VAL A CA  1 
ATOM   3397 C  C   . VAL A 1 415 ? 16.820 41.950 189.620 1.00 15.00 ? 447 VAL A C   1 
ATOM   3398 O  O   . VAL A 1 415 ? 17.460 41.150 188.940 1.00 15.00 ? 447 VAL A O   1 
ATOM   3399 C  CB  . VAL A 1 415 ? 17.500 44.160 190.590 1.00 15.00 ? 447 VAL A CB  1 
ATOM   3400 C  CG1 . VAL A 1 415 ? 18.870 43.640 190.920 1.00 15.00 ? 447 VAL A CG1 1 
ATOM   3401 C  CG2 . VAL A 1 415 ? 17.620 45.620 190.280 1.00 15.00 ? 447 VAL A CG2 1 
ATOM   3402 N  N   . ALA A 1 416 ? 15.920 41.540 190.520 1.00 15.00 ? 448 ALA A N   1 
ATOM   3403 C  CA  . ALA A 1 416 ? 15.710 40.130 190.790 1.00 15.00 ? 448 ALA A CA  1 
ATOM   3404 C  C   . ALA A 1 416 ? 15.390 39.360 189.510 1.00 15.00 ? 448 ALA A C   1 
ATOM   3405 O  O   . ALA A 1 416 ? 15.870 38.250 189.300 1.00 15.00 ? 448 ALA A O   1 
ATOM   3406 C  CB  . ALA A 1 416 ? 14.590 40.000 191.760 1.00 15.00 ? 448 ALA A CB  1 
ATOM   3407 N  N   . VAL A 1 417 ? 14.660 40.000 188.600 1.00 15.00 ? 449 VAL A N   1 
ATOM   3408 C  CA  . VAL A 1 417 ? 14.400 39.390 187.310 1.00 15.00 ? 449 VAL A CA  1 
ATOM   3409 C  C   . VAL A 1 417 ? 15.730 39.190 186.600 1.00 15.00 ? 449 VAL A C   1 
ATOM   3410 O  O   . VAL A 1 417 ? 15.980 38.070 186.130 1.00 15.00 ? 449 VAL A O   1 
ATOM   3411 C  CB  . VAL A 1 417 ? 13.480 40.270 186.440 1.00 15.00 ? 449 VAL A CB  1 
ATOM   3412 C  CG1 . VAL A 1 417 ? 13.280 39.680 185.060 1.00 15.00 ? 449 VAL A CG1 1 
ATOM   3413 C  CG2 . VAL A 1 417 ? 12.120 40.340 187.080 1.00 15.00 ? 449 VAL A CG2 1 
ATOM   3414 N  N   . ASP A 1 418 ? 16.620 40.170 186.520 1.00 15.00 ? 450 ASP A N   1 
ATOM   3415 C  CA  . ASP A 1 418 ? 17.900 39.980 185.850 1.00 15.00 ? 450 ASP A CA  1 
ATOM   3416 C  C   . ASP A 1 418 ? 18.760 38.920 186.510 1.00 15.00 ? 450 ASP A C   1 
ATOM   3417 O  O   . ASP A 1 418 ? 19.500 38.210 185.830 1.00 15.00 ? 450 ASP A O   1 
ATOM   3418 C  CB  . ASP A 1 418 ? 18.720 41.250 185.830 1.00 15.00 ? 450 ASP A CB  1 
ATOM   3419 C  CG  . ASP A 1 418 ? 18.080 42.410 185.080 1.00 15.00 ? 450 ASP A CG  1 
ATOM   3420 O  OD1 . ASP A 1 418 ? 17.730 42.270 183.900 1.00 15.00 ? 450 ASP A OD1 1 
ATOM   3421 O  OD2 . ASP A 1 418 ? 17.940 43.480 185.680 1.00 15.00 ? 450 ASP A OD2 1 
ATOM   3422 N  N   . VAL A 1 419 ? 18.660 38.780 187.840 1.00 15.00 ? 451 VAL A N   1 
ATOM   3423 C  CA  . VAL A 1 419 ? 19.390 37.780 188.590 1.00 15.00 ? 451 VAL A CA  1 
ATOM   3424 C  C   . VAL A 1 419 ? 19.010 36.400 188.140 1.00 15.00 ? 451 VAL A C   1 
ATOM   3425 O  O   . VAL A 1 419 ? 19.900 35.610 187.820 1.00 15.00 ? 451 VAL A O   1 
ATOM   3426 C  CB  . VAL A 1 419 ? 19.090 37.890 190.060 1.00 15.00 ? 451 VAL A CB  1 
ATOM   3427 C  CG1 . VAL A 1 419 ? 19.750 36.820 190.880 1.00 15.00 ? 451 VAL A CG1 1 
ATOM   3428 C  CG2 . VAL A 1 419 ? 19.640 39.220 190.480 1.00 15.00 ? 451 VAL A CG2 1 
ATOM   3429 N  N   . ILE A 1 420 ? 17.720 36.120 188.070 1.00 15.00 ? 452 ILE A N   1 
ATOM   3430 C  CA  . ILE A 1 420 ? 17.240 34.810 187.650 1.00 15.00 ? 452 ILE A CA  1 
ATOM   3431 C  C   . ILE A 1 420 ? 17.750 34.580 186.240 1.00 15.00 ? 452 ILE A C   1 
ATOM   3432 O  O   . ILE A 1 420 ? 18.280 33.510 185.950 1.00 15.00 ? 452 ILE A O   1 
ATOM   3433 C  CB  . ILE A 1 420 ? 15.680 34.780 187.730 1.00 15.00 ? 452 ILE A CB  1 
ATOM   3434 C  CG1 . ILE A 1 420 ? 15.230 34.970 189.160 1.00 15.00 ? 452 ILE A CG1 1 
ATOM   3435 C  CG2 . ILE A 1 420 ? 15.150 33.440 187.260 1.00 15.00 ? 452 ILE A CG2 1 
ATOM   3436 C  CD1 . ILE A 1 420 ? 13.770 35.440 189.230 1.00 15.00 ? 452 ILE A CD1 1 
ATOM   3437 N  N   . LYS A 1 421 ? 17.690 35.550 185.340 1.00 15.00 ? 453 LYS A N   1 
ATOM   3438 C  CA  . LYS A 1 421 ? 18.200 35.350 184.000 1.00 15.00 ? 453 LYS A CA  1 
ATOM   3439 C  C   . LYS A 1 421 ? 19.710 35.120 183.980 1.00 15.00 ? 453 LYS A C   1 
ATOM   3440 O  O   . LYS A 1 421 ? 20.240 34.370 183.150 1.00 15.00 ? 453 LYS A O   1 
ATOM   3441 C  CB  . LYS A 1 421 ? 17.890 36.550 183.150 1.00 15.00 ? 453 LYS A CB  1 
ATOM   3442 C  CG  . LYS A 1 421 ? 16.400 36.780 183.050 1.00 15.00 ? 453 LYS A CG  1 
ATOM   3443 C  CD  . LYS A 1 421 ? 16.080 38.110 182.380 1.00 15.00 ? 453 LYS A CD  1 
ATOM   3444 C  CE  . LYS A 1 421 ? 15.520 37.860 180.990 1.00 15.00 ? 453 LYS A CE  1 
ATOM   3445 N  NZ  . LYS A 1 421 ? 15.220 39.140 180.360 1.00 15.00 ? 453 LYS A NZ  1 
ATOM   3446 N  N   . GLU A 1 422 ? 20.460 35.700 184.900 1.00 15.00 ? 454 GLU A N   1 
ATOM   3447 C  CA  . GLU A 1 422 ? 21.890 35.480 184.940 1.00 15.00 ? 454 GLU A CA  1 
ATOM   3448 C  C   . GLU A 1 422 ? 22.080 34.070 185.450 1.00 15.00 ? 454 GLU A C   1 
ATOM   3449 O  O   . GLU A 1 422 ? 22.890 33.380 184.840 1.00 15.00 ? 454 GLU A O   1 
ATOM   3450 C  CB  . GLU A 1 422 ? 22.480 36.500 185.850 1.00 15.00 ? 454 GLU A CB  1 
ATOM   3451 C  CG  . GLU A 1 422 ? 23.940 36.770 185.560 1.00 15.00 ? 454 GLU A CG  1 
ATOM   3452 C  CD  . GLU A 1 422 ? 24.500 37.850 186.490 1.00 15.00 ? 454 GLU A CD  1 
ATOM   3453 O  OE1 . GLU A 1 422 ? 24.260 39.030 186.200 1.00 15.00 ? 454 GLU A OE1 1 
ATOM   3454 O  OE2 . GLU A 1 422 ? 25.160 37.490 187.490 1.00 15.00 ? 454 GLU A OE2 1 
ATOM   3455 N  N   . SER A 1 423 ? 21.370 33.570 186.470 1.00 15.00 ? 455 SER A N   1 
ATOM   3456 C  CA  . SER A 1 423 ? 21.430 32.180 186.910 1.00 15.00 ? 455 SER A CA  1 
ATOM   3457 C  C   . SER A 1 423 ? 21.350 31.260 185.710 1.00 15.00 ? 455 SER A C   1 
ATOM   3458 O  O   . SER A 1 423 ? 22.060 30.270 185.580 1.00 15.00 ? 455 SER A O   1 
ATOM   3459 C  CB  . SER A 1 423 ? 20.260 31.740 187.790 1.00 15.00 ? 455 SER A CB  1 
ATOM   3460 O  OG  . SER A 1 423 ? 20.290 32.010 189.180 1.00 15.00 ? 455 SER A OG  1 
ATOM   3461 N  N   . ARG A 1 424 ? 20.490 31.670 184.790 1.00 15.00 ? 456 ARG A N   1 
ATOM   3462 C  CA  . ARG A 1 424 ? 20.280 30.930 183.590 1.00 15.00 ? 456 ARG A CA  1 
ATOM   3463 C  C   . ARG A 1 424 ? 21.410 30.980 182.600 1.00 15.00 ? 456 ARG A C   1 
ATOM   3464 O  O   . ARG A 1 424 ? 21.740 29.930 182.060 1.00 15.00 ? 456 ARG A O   1 
ATOM   3465 C  CB  . ARG A 1 424 ? 18.980 31.390 182.920 1.00 15.00 ? 456 ARG A CB  1 
ATOM   3466 C  CG  . ARG A 1 424 ? 17.650 30.940 183.560 1.00 15.00 ? 456 ARG A CG  1 
ATOM   3467 C  CD  . ARG A 1 424 ? 17.770 29.460 183.930 1.00 15.00 ? 456 ARG A CD  1 
ATOM   3468 N  NE  . ARG A 1 424 ? 18.550 28.590 183.020 1.00 15.00 ? 456 ARG A NE  1 
ATOM   3469 C  CZ  . ARG A 1 424 ? 19.480 27.670 183.420 1.00 15.00 ? 456 ARG A CZ  1 
ATOM   3470 N  NH1 . ARG A 1 424 ? 19.810 27.450 184.730 1.00 15.00 ? 456 ARG A NH1 1 
ATOM   3471 N  NH2 . ARG A 1 424 ? 20.090 26.940 182.460 1.00 15.00 ? 456 ARG A NH2 1 
ATOM   3472 N  N   . VAL A 1 425 ? 22.040 32.130 182.360 1.00 15.00 ? 457 VAL A N   1 
ATOM   3473 C  CA  . VAL A 1 425 ? 23.180 32.240 181.430 1.00 15.00 ? 457 VAL A CA  1 
ATOM   3474 C  C   . VAL A 1 425 ? 24.340 31.440 181.970 1.00 15.00 ? 457 VAL A C   1 
ATOM   3475 O  O   . VAL A 1 425 ? 25.030 30.710 181.260 1.00 15.00 ? 457 VAL A O   1 
ATOM   3476 C  CB  . VAL A 1 425 ? 23.570 33.710 181.290 1.00 15.00 ? 457 VAL A CB  1 
ATOM   3477 C  CG1 . VAL A 1 425 ? 24.850 33.910 180.510 1.00 15.00 ? 457 VAL A CG1 1 
ATOM   3478 C  CG2 . VAL A 1 425 ? 22.450 34.390 180.540 1.00 15.00 ? 457 VAL A CG2 1 
ATOM   3479 N  N   . LEU A 1 426 ? 24.530 31.610 183.210 1.00 15.00 ? 458 LEU A N   1 
ATOM   3480 C  CA  . LEU A 1 426 ? 25.510 31.010 184.130 1.00 15.00 ? 458 LEU A CA  1 
ATOM   3481 C  C   . LEU A 1 426 ? 25.320 29.500 184.190 1.00 15.00 ? 458 LEU A C   1 
ATOM   3482 O  O   . LEU A 1 426 ? 26.240 28.750 184.540 1.00 15.00 ? 458 LEU A O   1 
ATOM   3483 C  CB  . LEU A 1 426 ? 25.310 31.560 185.540 1.00 15.00 ? 458 LEU A CB  1 
ATOM   3484 C  CG  . LEU A 1 426 ? 26.430 32.490 185.990 1.00 15.00 ? 458 LEU A CG  1 
ATOM   3485 C  CD1 . LEU A 1 426 ? 26.530 33.760 185.150 1.00 15.00 ? 458 LEU A CD1 1 
ATOM   3486 C  CD2 . LEU A 1 426 ? 26.270 32.970 187.440 1.00 15.00 ? 458 LEU A CD2 1 
ATOM   3487 N  N   . ARG A 1 427 ? 24.120 29.080 183.850 1.00 15.00 ? 459 ARG A N   1 
ATOM   3488 C  CA  . ARG A 1 427 ? 23.760 27.660 183.860 1.00 15.00 ? 459 ARG A CA  1 
ATOM   3489 C  C   . ARG A 1 427 ? 23.950 27.060 185.260 1.00 15.00 ? 459 ARG A C   1 
ATOM   3490 O  O   . ARG A 1 427 ? 24.290 25.880 185.410 1.00 15.00 ? 459 ARG A O   1 
ATOM   3491 C  CB  . ARG A 1 427 ? 24.670 26.840 182.940 1.00 15.00 ? 459 ARG A CB  1 
ATOM   3492 C  CG  . ARG A 1 427 ? 24.740 27.350 181.500 1.00 15.00 ? 459 ARG A CG  1 
ATOM   3493 C  CD  . ARG A 1 427 ? 24.520 26.230 180.480 1.00 15.00 ? 459 ARG A CD  1 
ATOM   3494 N  NE  . ARG A 1 427 ? 23.110 25.880 180.350 1.00 15.00 ? 459 ARG A NE  1 
ATOM   3495 C  CZ  . ARG A 1 427 ? 22.630 24.650 180.160 1.00 15.00 ? 459 ARG A CZ  1 
ATOM   3496 N  NH1 . ARG A 1 427 ? 23.430 23.580 180.080 1.00 15.00 ? 459 ARG A NH1 1 
ATOM   3497 N  NH2 . ARG A 1 427 ? 21.320 24.370 180.050 1.00 15.00 ? 459 ARG A NH2 1 
ATOM   3498 N  N   . LEU A 1 428 ? 23.760 27.890 186.280 1.00 15.00 ? 460 LEU A N   1 
ATOM   3499 C  CA  . LEU A 1 428 ? 23.900 27.430 187.670 1.00 15.00 ? 460 LEU A CA  1 
ATOM   3500 C  C   . LEU A 1 428 ? 23.070 26.170 187.860 1.00 15.00 ? 460 LEU A C   1 
ATOM   3501 O  O   . LEU A 1 428 ? 21.970 26.040 187.300 1.00 15.00 ? 460 LEU A O   1 
ATOM   3502 C  CB  . LEU A 1 428 ? 23.380 28.490 188.650 1.00 15.00 ? 460 LEU A CB  1 
ATOM   3503 C  CG  . LEU A 1 428 ? 24.350 29.650 188.870 1.00 15.00 ? 460 LEU A CG  1 
ATOM   3504 C  CD1 . LEU A 1 428 ? 23.890 30.600 189.980 1.00 15.00 ? 460 LEU A CD1 1 
ATOM   3505 C  CD2 . LEU A 1 428 ? 25.760 29.200 189.270 1.00 15.00 ? 460 LEU A CD2 1 
ATOM   3506 N  N   . GLN A 1 429 ? 23.600 25.260 188.630 1.00 15.00 ? 461 GLN A N   1 
ATOM   3507 C  CA  . GLN A 1 429 ? 22.910 24.000 188.880 1.00 15.00 ? 461 GLN A CA  1 
ATOM   3508 C  C   . GLN A 1 429 ? 21.670 24.250 189.710 1.00 15.00 ? 461 GLN A C   1 
ATOM   3509 O  O   . GLN A 1 429 ? 21.390 25.390 190.120 1.00 15.00 ? 461 GLN A O   1 
ATOM   3510 C  CB  . GLN A 1 429 ? 23.830 23.020 189.610 1.00 15.00 ? 461 GLN A CB  1 
ATOM   3511 C  CG  . GLN A 1 429 ? 24.590 22.140 188.630 1.00 15.00 ? 461 GLN A CG  1 
ATOM   3512 C  CD  . GLN A 1 429 ? 25.330 20.980 189.290 1.00 15.00 ? 461 GLN A CD  1 
ATOM   3513 O  OE1 . GLN A 1 429 ? 24.810 20.390 190.240 1.00 15.00 ? 461 GLN A OE1 1 
ATOM   3514 N  NE2 . GLN A 1 429 ? 26.510 20.620 188.840 1.00 15.00 ? 461 GLN A NE2 1 
ATOM   3515 N  N   . PRO A 1 430 ? 20.890 23.210 189.980 1.00 15.00 ? 462 PRO A N   1 
ATOM   3516 C  CA  . PRO A 1 430 ? 19.700 23.370 190.770 1.00 15.00 ? 462 PRO A CA  1 
ATOM   3517 C  C   . PRO A 1 430 ? 20.080 23.950 192.100 1.00 15.00 ? 462 PRO A C   1 
ATOM   3518 O  O   . PRO A 1 430 ? 21.260 24.380 192.260 1.00 15.00 ? 462 PRO A O   1 
ATOM   3519 C  CB  . PRO A 1 430 ? 19.150 21.970 190.870 1.00 15.00 ? 462 PRO A CB  1 
ATOM   3520 C  CG  . PRO A 1 430 ? 20.080 21.050 190.080 1.00 15.00 ? 462 PRO A CG  1 
ATOM   3521 C  CD  . PRO A 1 430 ? 21.180 21.870 189.510 1.00 15.00 ? 462 PRO A CD  1 
ATOM   3522 N  N   . PHE A 1 431 ? 19.130 24.190 192.800 1.00 15.00 ? 463 PHE A N   1 
ATOM   3523 C  CA  . PHE A 1 431 ? 19.220 24.750 194.140 1.00 15.00 ? 463 PHE A CA  1 
ATOM   3524 C  C   . PHE A 1 431 ? 19.730 23.670 195.090 1.00 15.00 ? 463 PHE A C   1 
ATOM   3525 O  O   . PHE A 1 431 ? 20.780 23.830 195.730 1.00 15.00 ? 463 PHE A O   1 
ATOM   3526 C  CB  . PHE A 1 431 ? 17.800 25.180 194.530 1.00 15.00 ? 463 PHE A CB  1 
ATOM   3527 C  CG  . PHE A 1 431 ? 17.630 25.740 195.940 1.00 15.00 ? 463 PHE A CG  1 
ATOM   3528 C  CD1 . PHE A 1 431 ? 17.800 24.920 197.060 1.00 15.00 ? 463 PHE A CD1 1 
ATOM   3529 C  CD2 . PHE A 1 431 ? 17.280 27.090 196.100 1.00 15.00 ? 463 PHE A CD2 1 
ATOM   3530 C  CE1 . PHE A 1 431 ? 17.610 25.450 198.340 1.00 15.00 ? 463 PHE A CE1 1 
ATOM   3531 C  CE2 . PHE A 1 431 ? 17.100 27.610 197.380 1.00 15.00 ? 463 PHE A CE2 1 
ATOM   3532 C  CZ  . PHE A 1 431 ? 17.260 26.790 198.500 1.00 15.00 ? 463 PHE A CZ  1 
ATOM   3533 N  N   . ASN A 1 432 ? 18.940 22.620 195.100 1.00 15.00 ? 464 ASN A N   1 
ATOM   3534 C  CA  . ASN A 1 432 ? 19.150 21.450 195.960 1.00 15.00 ? 464 ASN A CA  1 
ATOM   3535 C  C   . ASN A 1 432 ? 20.530 20.850 195.760 1.00 15.00 ? 464 ASN A C   1 
ATOM   3536 O  O   . ASN A 1 432 ? 21.190 20.420 196.710 1.00 15.00 ? 464 ASN A O   1 
ATOM   3537 C  CB  . ASN A 1 432 ? 18.100 20.400 195.680 1.00 15.00 ? 464 ASN A CB  1 
ATOM   3538 C  CG  . ASN A 1 432 ? 17.320 20.050 196.940 1.00 15.00 ? 464 ASN A CG  1 
ATOM   3539 O  OD1 . ASN A 1 432 ? 17.690 20.500 198.030 1.00 15.00 ? 464 ASN A OD1 1 
ATOM   3540 N  ND2 . ASN A 1 432 ? 16.260 19.270 196.870 1.00 15.00 ? 464 ASN A ND2 1 
ATOM   3541 N  N   . GLU A 1 433 ? 20.990 20.770 194.530 1.00 15.00 ? 465 GLU A N   1 
ATOM   3542 C  CA  . GLU A 1 433 ? 22.330 20.240 194.320 1.00 15.00 ? 465 GLU A CA  1 
ATOM   3543 C  C   . GLU A 1 433 ? 23.260 21.020 195.260 1.00 15.00 ? 465 GLU A C   1 
ATOM   3544 O  O   . GLU A 1 433 ? 24.140 20.440 195.920 1.00 15.00 ? 465 GLU A O   1 
ATOM   3545 C  CB  . GLU A 1 433 ? 22.750 20.390 192.860 1.00 15.00 ? 465 GLU A CB  1 
ATOM   3546 C  CG  . GLU A 1 433 ? 21.890 19.560 191.890 1.00 15.00 ? 465 GLU A CG  1 
ATOM   3547 C  CD  . GLU A 1 433 ? 21.740 18.080 192.300 1.00 15.00 ? 465 GLU A CD  1 
ATOM   3548 O  OE1 . GLU A 1 433 ? 22.780 17.400 192.650 1.00 15.00 ? 465 GLU A OE1 1 
ATOM   3549 O  OE2 . GLU A 1 433 ? 20.580 17.520 192.280 1.00 15.00 ? 465 GLU A OE2 1 
ATOM   3550 N  N   . TYR A 1 434 ? 23.020 22.320 195.300 1.00 15.00 ? 466 TYR A N   1 
ATOM   3551 C  CA  . TYR A 1 434 ? 23.790 23.250 196.150 1.00 15.00 ? 466 TYR A CA  1 
ATOM   3552 C  C   . TYR A 1 434 ? 23.480 23.000 197.620 1.00 15.00 ? 466 TYR A C   1 
ATOM   3553 O  O   . TYR A 1 434 ? 24.300 23.280 198.500 1.00 15.00 ? 466 TYR A O   1 
ATOM   3554 C  CB  . TYR A 1 434 ? 23.440 24.700 195.820 1.00 15.00 ? 466 TYR A CB  1 
ATOM   3555 C  CG  . TYR A 1 434 ? 24.260 25.240 194.670 1.00 15.00 ? 466 TYR A CG  1 
ATOM   3556 C  CD1 . TYR A 1 434 ? 25.590 25.640 194.880 1.00 15.00 ? 466 TYR A CD1 1 
ATOM   3557 C  CD2 . TYR A 1 434 ? 23.690 25.330 193.400 1.00 15.00 ? 466 TYR A CD2 1 
ATOM   3558 C  CE1 . TYR A 1 434 ? 26.340 26.120 193.810 1.00 15.00 ? 466 TYR A CE1 1 
ATOM   3559 C  CE2 . TYR A 1 434 ? 24.450 25.810 192.320 1.00 15.00 ? 466 TYR A CE2 1 
ATOM   3560 C  CZ  . TYR A 1 434 ? 25.780 26.200 192.530 1.00 15.00 ? 466 TYR A CZ  1 
ATOM   3561 O  OH  . TYR A 1 434 ? 26.510 26.660 191.480 1.00 15.00 ? 466 TYR A OH  1 
ATOM   3562 N  N   . ARG A 1 435 ? 22.300 22.480 197.850 1.00 15.00 ? 467 ARG A N   1 
ATOM   3563 C  CA  . ARG A 1 435 ? 21.850 22.150 199.210 1.00 15.00 ? 467 ARG A CA  1 
ATOM   3564 C  C   . ARG A 1 435 ? 22.690 20.990 199.730 1.00 15.00 ? 467 ARG A C   1 
ATOM   3565 O  O   . ARG A 1 435 ? 23.260 21.060 200.820 1.00 15.00 ? 467 ARG A O   1 
ATOM   3566 C  CB  . ARG A 1 435 ? 20.370 21.780 199.210 1.00 15.00 ? 467 ARG A CB  1 
ATOM   3567 C  CG  . ARG A 1 435 ? 19.530 22.770 200.020 1.00 15.00 ? 467 ARG A CG  1 
ATOM   3568 C  CD  . ARG A 1 435 ? 18.250 22.160 200.570 1.00 15.00 ? 467 ARG A CD  1 
ATOM   3569 N  NE  . ARG A 1 435 ? 17.610 23.010 201.580 1.00 15.00 ? 467 ARG A NE  1 
ATOM   3570 C  CZ  . ARG A 1 435 ? 17.620 22.750 202.890 1.00 15.00 ? 467 ARG A CZ  1 
ATOM   3571 N  NH1 . ARG A 1 435 ? 18.230 21.660 203.380 1.00 15.00 ? 467 ARG A NH1 1 
ATOM   3572 N  NH2 . ARG A 1 435 ? 17.050 23.540 203.820 1.00 15.00 ? 467 ARG A NH2 1 
ATOM   3573 N  N   . LYS A 1 436 ? 22.730 19.940 198.920 1.00 15.00 ? 468 LYS A N   1 
ATOM   3574 C  CA  . LYS A 1 436 ? 23.500 18.740 199.230 1.00 15.00 ? 468 LYS A CA  1 
ATOM   3575 C  C   . LYS A 1 436 ? 24.950 19.130 199.550 1.00 15.00 ? 468 LYS A C   1 
ATOM   3576 O  O   . LYS A 1 436 ? 25.590 18.540 200.430 1.00 15.00 ? 468 LYS A O   1 
ATOM   3577 C  CB  . LYS A 1 436 ? 23.520 17.790 198.030 1.00 15.00 ? 468 LYS A CB  1 
ATOM   3578 C  CG  . LYS A 1 436 ? 22.130 17.450 197.480 1.00 15.00 ? 468 LYS A CG  1 
ATOM   3579 C  CD  . LYS A 1 436 ? 22.170 16.330 196.440 1.00 15.00 ? 468 LYS A CD  1 
ATOM   3580 C  CE  . LYS A 1 436 ? 20.970 16.350 195.480 1.00 15.00 ? 468 LYS A CE  1 
ATOM   3581 N  NZ  . LYS A 1 436 ? 21.120 15.410 194.360 1.00 15.00 ? 468 LYS A NZ  1 
ATOM   3582 N  N   . ARG A 1 437 ? 25.430 19.970 198.560 1.00 15.00 ? 469 ARG A N   1 
ATOM   3583 C  CA  . ARG A 1 437 ? 26.800 20.430 198.500 1.00 15.00 ? 469 ARG A CA  1 
ATOM   3584 C  C   . ARG A 1 437 ? 27.210 21.160 199.760 1.00 15.00 ? 469 ARG A C   1 
ATOM   3585 O  O   . ARG A 1 437 ? 28.300 20.970 200.280 1.00 15.00 ? 469 ARG A O   1 
ATOM   3586 C  CB  . ARG A 1 437 ? 26.850 21.290 197.250 1.00 15.00 ? 469 ARG A CB  1 
ATOM   3587 C  CG  . ARG A 1 437 ? 28.090 22.050 196.890 1.00 15.00 ? 469 ARG A CG  1 
ATOM   3588 C  CD  . ARG A 1 437 ? 29.300 21.160 196.930 1.00 15.00 ? 469 ARG A CD  1 
ATOM   3589 N  NE  . ARG A 1 437 ? 30.110 21.660 198.030 1.00 15.00 ? 469 ARG A NE  1 
ATOM   3590 C  CZ  . ARG A 1 437 ? 31.400 21.940 197.870 1.00 15.00 ? 469 ARG A CZ  1 
ATOM   3591 N  NH1 . ARG A 1 437 ? 32.010 21.770 196.700 1.00 15.00 ? 469 ARG A NH1 1 
ATOM   3592 N  NH2 . ARG A 1 437 ? 32.060 22.510 198.870 1.00 15.00 ? 469 ARG A NH2 1 
ATOM   3593 N  N   . PHE A 1 438 ? 26.300 21.970 200.300 1.00 15.00 ? 470 PHE A N   1 
ATOM   3594 C  CA  . PHE A 1 438 ? 26.550 22.690 201.530 1.00 15.00 ? 470 PHE A CA  1 
ATOM   3595 C  C   . PHE A 1 438 ? 26.150 21.920 202.770 1.00 15.00 ? 470 PHE A C   1 
ATOM   3596 O  O   . PHE A 1 438 ? 25.890 22.480 203.850 1.00 15.00 ? 470 PHE A O   1 
ATOM   3597 C  CB  . PHE A 1 438 ? 25.830 24.010 201.460 1.00 15.00 ? 470 PHE A CB  1 
ATOM   3598 C  CG  . PHE A 1 438 ? 26.670 24.940 200.620 1.00 15.00 ? 470 PHE A CG  1 
ATOM   3599 C  CD1 . PHE A 1 438 ? 27.680 25.650 201.210 1.00 15.00 ? 470 PHE A CD1 1 
ATOM   3600 C  CD2 . PHE A 1 438 ? 26.420 25.090 199.270 1.00 15.00 ? 470 PHE A CD2 1 
ATOM   3601 C  CE1 . PHE A 1 438 ? 28.450 26.520 200.470 1.00 15.00 ? 470 PHE A CE1 1 
ATOM   3602 C  CE2 . PHE A 1 438 ? 27.200 25.970 198.540 1.00 15.00 ? 470 PHE A CE2 1 
ATOM   3603 C  CZ  . PHE A 1 438 ? 28.210 26.680 199.140 1.00 15.00 ? 470 PHE A CZ  1 
ATOM   3604 N  N   . GLY A 1 439 ? 26.100 20.610 202.630 1.00 15.00 ? 471 GLY A N   1 
ATOM   3605 C  CA  . GLY A 1 439 ? 25.910 19.730 203.760 1.00 15.00 ? 471 GLY A CA  1 
ATOM   3606 C  C   . GLY A 1 439 ? 24.480 19.600 204.210 1.00 15.00 ? 471 GLY A C   1 
ATOM   3607 O  O   . GLY A 1 439 ? 24.230 19.060 205.290 1.00 15.00 ? 471 GLY A O   1 
ATOM   3608 N  N   . MET A 1 440 ? 23.520 20.060 203.400 1.00 15.00 ? 472 MET A N   1 
ATOM   3609 C  CA  . MET A 1 440 ? 22.120 19.970 203.750 1.00 15.00 ? 472 MET A CA  1 
ATOM   3610 C  C   . MET A 1 440 ? 21.450 18.860 202.940 1.00 15.00 ? 472 MET A C   1 
ATOM   3611 O  O   . MET A 1 440 ? 21.970 18.300 201.980 1.00 15.00 ? 472 MET A O   1 
ATOM   3612 C  CB  . MET A 1 440 ? 21.460 21.300 203.480 1.00 15.00 ? 472 MET A CB  1 
ATOM   3613 C  CG  . MET A 1 440 ? 22.050 22.410 204.290 1.00 15.00 ? 472 MET A CG  1 
ATOM   3614 S  SD  . MET A 1 440 ? 21.730 23.990 203.490 1.00 15.00 ? 472 MET A SD  1 
ATOM   3615 C  CE  . MET A 1 440 ? 20.360 24.360 204.530 1.00 15.00 ? 472 MET A CE  1 
ATOM   3616 N  N   . LYS A 1 441 ? 20.210 18.620 203.300 1.00 15.00 ? 473 LYS A N   1 
ATOM   3617 C  CA  . LYS A 1 441 ? 19.390 17.540 202.790 1.00 15.00 ? 473 LYS A CA  1 
ATOM   3618 C  C   . LYS A 1 441 ? 18.390 18.160 201.840 1.00 15.00 ? 473 LYS A C   1 
ATOM   3619 O  O   . LYS A 1 441 ? 17.840 19.200 202.180 1.00 15.00 ? 473 LYS A O   1 
ATOM   3620 C  CB  . LYS A 1 441 ? 18.700 16.850 203.980 1.00 15.00 ? 473 LYS A CB  1 
ATOM   3621 C  CG  . LYS A 1 441 ? 18.090 17.790 205.070 1.00 15.00 ? 473 LYS A CG  1 
ATOM   3622 C  CD  . LYS A 1 441 ? 19.090 18.430 206.080 1.00 15.00 ? 473 LYS A CD  1 
ATOM   3623 C  CE  . LYS A 1 441 ? 18.500 19.570 206.960 1.00 15.00 ? 473 LYS A CE  1 
ATOM   3624 N  NZ  . LYS A 1 441 ? 18.120 20.750 206.190 1.00 15.00 ? 473 LYS A NZ  1 
ATOM   3625 N  N   . PRO A 1 442 ? 18.130 17.620 200.660 1.00 15.00 ? 474 PRO A N   1 
ATOM   3626 C  CA  . PRO A 1 442 ? 17.240 18.220 199.680 1.00 15.00 ? 474 PRO A CA  1 
ATOM   3627 C  C   . PRO A 1 442 ? 15.750 18.230 200.030 1.00 15.00 ? 474 PRO A C   1 
ATOM   3628 O  O   . PRO A 1 442 ? 15.190 17.360 200.730 1.00 15.00 ? 474 PRO A O   1 
ATOM   3629 C  CB  . PRO A 1 442 ? 17.580 17.470 198.430 1.00 15.00 ? 474 PRO A CB  1 
ATOM   3630 C  CG  . PRO A 1 442 ? 17.920 16.110 198.940 1.00 15.00 ? 474 PRO A CG  1 
ATOM   3631 C  CD  . PRO A 1 442 ? 18.760 16.410 200.150 1.00 15.00 ? 474 PRO A CD  1 
ATOM   3632 N  N   . TYR A 1 443 ? 15.080 19.260 199.530 1.00 15.00 ? 475 TYR A N   1 
ATOM   3633 C  CA  . TYR A 1 443 ? 13.660 19.370 199.740 1.00 15.00 ? 475 TYR A CA  1 
ATOM   3634 C  C   . TYR A 1 443 ? 12.940 18.340 198.890 1.00 15.00 ? 475 TYR A C   1 
ATOM   3635 O  O   . TYR A 1 443 ? 13.320 18.060 197.750 1.00 15.00 ? 475 TYR A O   1 
ATOM   3636 C  CB  . TYR A 1 443 ? 13.180 20.750 199.400 1.00 15.00 ? 475 TYR A CB  1 
ATOM   3637 C  CG  . TYR A 1 443 ? 13.560 21.750 200.480 1.00 15.00 ? 475 TYR A CG  1 
ATOM   3638 C  CD1 . TYR A 1 443 ? 13.370 21.410 201.790 1.00 15.00 ? 475 TYR A CD1 1 
ATOM   3639 C  CD2 . TYR A 1 443 ? 14.030 23.000 200.150 1.00 15.00 ? 475 TYR A CD2 1 
ATOM   3640 C  CE1 . TYR A 1 443 ? 13.660 22.310 202.790 1.00 15.00 ? 475 TYR A CE1 1 
ATOM   3641 C  CE2 . TYR A 1 443 ? 14.320 23.910 201.150 1.00 15.00 ? 475 TYR A CE2 1 
ATOM   3642 C  CZ  . TYR A 1 443 ? 14.120 23.550 202.470 1.00 15.00 ? 475 TYR A CZ  1 
ATOM   3643 O  OH  . TYR A 1 443 ? 14.360 24.450 203.490 1.00 15.00 ? 475 TYR A OH  1 
ATOM   3644 N  N   . THR A 1 444 ? 11.910 17.740 199.480 1.00 15.00 ? 476 THR A N   1 
ATOM   3645 C  CA  . THR A 1 444 ? 11.130 16.720 198.800 1.00 15.00 ? 476 THR A CA  1 
ATOM   3646 C  C   . THR A 1 444 ? 9.900  17.290 198.110 1.00 15.00 ? 476 THR A C   1 
ATOM   3647 O  O   . THR A 1 444 ? 9.260  16.620 197.300 1.00 15.00 ? 476 THR A O   1 
ATOM   3648 C  CB  . THR A 1 444 ? 10.770 15.680 199.860 1.00 15.00 ? 476 THR A CB  1 
ATOM   3649 O  OG1 . THR A 1 444 ? 10.260 16.370 201.000 1.00 15.00 ? 476 THR A OG1 1 
ATOM   3650 C  CG2 . THR A 1 444 ? 11.960 14.850 200.270 1.00 15.00 ? 476 THR A CG2 1 
ATOM   3651 N  N   . SER A 1 445 ? 9.570  18.550 198.370 1.00 15.00 ? 477 SER A N   1 
ATOM   3652 C  CA  . SER A 1 445 ? 8.370  19.130 197.830 1.00 15.00 ? 477 SER A CA  1 
ATOM   3653 C  C   . SER A 1 445 ? 8.510  20.630 197.920 1.00 15.00 ? 477 SER A C   1 
ATOM   3654 O  O   . SER A 1 445 ? 9.250  21.130 198.770 1.00 15.00 ? 477 SER A O   1 
ATOM   3655 C  CB  . SER A 1 445 ? 7.210  18.690 198.680 1.00 15.00 ? 477 SER A CB  1 
ATOM   3656 O  OG  . SER A 1 445 ? 7.500  19.000 200.040 1.00 15.00 ? 477 SER A OG  1 
ATOM   3657 N  N   . PHE A 1 446 ? 7.800  21.310 197.160 1.00 15.00 ? 478 PHE A N   1 
ATOM   3658 C  CA  . PHE A 1 446 ? 7.850  22.770 197.340 1.00 15.00 ? 478 PHE A CA  1 
ATOM   3659 C  C   . PHE A 1 446 ? 7.240  23.150 198.690 1.00 15.00 ? 478 PHE A C   1 
ATOM   3660 O  O   . PHE A 1 446 ? 7.630  24.150 199.300 1.00 15.00 ? 478 PHE A O   1 
ATOM   3661 C  CB  . PHE A 1 446 ? 7.090  23.450 196.210 1.00 15.00 ? 478 PHE A CB  1 
ATOM   3662 C  CG  . PHE A 1 446 ? 7.840  23.390 194.890 1.00 15.00 ? 478 PHE A CG  1 
ATOM   3663 C  CD1 . PHE A 1 446 ? 7.700  22.260 194.070 1.00 15.00 ? 478 PHE A CD1 1 
ATOM   3664 C  CD2 . PHE A 1 446 ? 8.670  24.440 194.510 1.00 15.00 ? 478 PHE A CD2 1 
ATOM   3665 C  CE1 . PHE A 1 446 ? 8.400  22.190 192.860 1.00 15.00 ? 478 PHE A CE1 1 
ATOM   3666 C  CE2 . PHE A 1 446 ? 9.380  24.370 193.300 1.00 15.00 ? 478 PHE A CE2 1 
ATOM   3667 C  CZ  . PHE A 1 446 ? 9.240  23.250 192.480 1.00 15.00 ? 478 PHE A CZ  1 
ATOM   3668 N  N   . GLN A 1 447 ? 6.290  22.330 199.100 1.00 15.00 ? 479 GLN A N   1 
ATOM   3669 C  CA  . GLN A 1 447 ? 5.550  22.510 200.360 1.00 15.00 ? 479 GLN A CA  1 
ATOM   3670 C  C   . GLN A 1 447 ? 6.510  22.490 201.560 1.00 15.00 ? 479 GLN A C   1 
ATOM   3671 O  O   . GLN A 1 447 ? 6.260  23.130 202.590 1.00 15.00 ? 479 GLN A O   1 
ATOM   3672 C  CB  . GLN A 1 447 ? 4.530  21.380 200.540 1.00 15.00 ? 479 GLN A CB  1 
ATOM   3673 C  CG  . GLN A 1 447 ? 3.540  21.270 199.380 1.00 15.00 ? 479 GLN A CG  1 
ATOM   3674 C  CD  . GLN A 1 447 ? 2.120  20.930 199.820 1.00 15.00 ? 479 GLN A CD  1 
ATOM   3675 O  OE1 . GLN A 1 447 ? 1.910  19.920 200.500 1.00 15.00 ? 479 GLN A OE1 1 
ATOM   3676 N  NE2 . GLN A 1 447 ? 1.110  21.710 199.480 1.00 15.00 ? 479 GLN A NE2 1 
ATOM   3677 N  N   . GLU A 1 448 ? 7.590  21.750 201.400 1.00 15.00 ? 480 GLU A N   1 
ATOM   3678 C  CA  . GLU A 1 448 ? 8.640  21.610 202.430 1.00 15.00 ? 480 GLU A CA  1 
ATOM   3679 C  C   . GLU A 1 448 ? 9.540  22.840 202.400 1.00 15.00 ? 480 GLU A C   1 
ATOM   3680 O  O   . GLU A 1 448 ? 10.010 23.310 203.450 1.00 15.00 ? 480 GLU A O   1 
ATOM   3681 C  CB  . GLU A 1 448 ? 9.470  20.360 202.150 1.00 15.00 ? 480 GLU A CB  1 
ATOM   3682 C  CG  . GLU A 1 448 ? 10.340 19.930 203.330 1.00 15.00 ? 480 GLU A CG  1 
ATOM   3683 C  CD  . GLU A 1 448 ? 10.900 18.510 203.150 1.00 15.00 ? 480 GLU A CD  1 
ATOM   3684 O  OE1 . GLU A 1 448 ? 10.230 17.500 203.570 1.00 15.00 ? 480 GLU A OE1 1 
ATOM   3685 O  OE2 . GLU A 1 448 ? 12.050 18.340 202.590 1.00 15.00 ? 480 GLU A OE2 1 
ATOM   3686 N  N   . LEU A 1 449 ? 9.720  23.280 201.180 1.00 15.00 ? 481 LEU A N   1 
ATOM   3687 C  CA  . LEU A 1 449 ? 10.540 24.440 200.810 1.00 15.00 ? 481 LEU A CA  1 
ATOM   3688 C  C   . LEU A 1 449 ? 9.920  25.710 201.400 1.00 15.00 ? 481 LEU A C   1 
ATOM   3689 O  O   . LEU A 1 449 ? 10.490 26.350 202.300 1.00 15.00 ? 481 LEU A O   1 
ATOM   3690 C  CB  . LEU A 1 449 ? 10.560 24.540 199.280 1.00 15.00 ? 481 LEU A CB  1 
ATOM   3691 C  CG  . LEU A 1 449 ? 11.610 25.500 198.720 1.00 15.00 ? 481 LEU A CG  1 
ATOM   3692 C  CD1 . LEU A 1 449 ? 11.180 26.130 197.390 1.00 15.00 ? 481 LEU A CD1 1 
ATOM   3693 C  CD2 . LEU A 1 449 ? 11.910 26.660 199.660 1.00 15.00 ? 481 LEU A CD2 1 
ATOM   3694 N  N   . THR A 1 450 ? 8.760  26.050 200.850 1.00 15.00 ? 482 THR A N   1 
ATOM   3695 C  CA  . THR A 1 450 ? 8.000  27.230 201.260 1.00 15.00 ? 482 THR A CA  1 
ATOM   3696 C  C   . THR A 1 450 ? 7.530  27.060 202.710 1.00 15.00 ? 482 THR A C   1 
ATOM   3697 O  O   . THR A 1 450 ? 8.040  27.710 203.640 1.00 15.00 ? 482 THR A O   1 
ATOM   3698 C  CB  . THR A 1 450 ? 6.850  27.460 200.280 1.00 15.00 ? 482 THR A CB  1 
ATOM   3699 O  OG1 . THR A 1 450 ? 5.850  26.470 200.450 1.00 15.00 ? 482 THR A OG1 1 
ATOM   3700 C  CG2 . THR A 1 450 ? 7.290  27.410 198.810 1.00 15.00 ? 482 THR A CG2 1 
ATOM   3701 N  N   . GLY A 1 451 ? 6.560  26.200 202.930 1.00 15.00 ? 483 GLY A N   1 
ATOM   3702 C  CA  . GLY A 1 451 ? 6.060  25.950 204.300 1.00 15.00 ? 483 GLY A CA  1 
ATOM   3703 C  C   . GLY A 1 451 ? 4.600  26.340 204.410 1.00 15.00 ? 483 GLY A C   1 
ATOM   3704 O  O   . GLY A 1 451 ? 4.070  26.530 205.520 1.00 15.00 ? 483 GLY A O   1 
ATOM   3705 N  N   . GLU A 1 452 ? 4.020  26.450 203.250 1.00 15.00 ? 484 GLU A N   1 
ATOM   3706 C  CA  . GLU A 1 452 ? 2.610  26.750 203.070 1.00 15.00 ? 484 GLU A CA  1 
ATOM   3707 C  C   . GLU A 1 452 ? 2.180  25.960 201.840 1.00 15.00 ? 484 GLU A C   1 
ATOM   3708 O  O   . GLU A 1 452 ? 2.960  25.170 201.280 1.00 15.00 ? 484 GLU A O   1 
ATOM   3709 C  CB  . GLU A 1 452 ? 2.410  28.250 202.930 1.00 15.00 ? 484 GLU A CB  1 
ATOM   3710 C  CG  . GLU A 1 452 ? 3.380  28.900 201.960 1.00 15.00 ? 484 GLU A CG  1 
ATOM   3711 C  CD  . GLU A 1 452 ? 2.820  28.960 200.550 1.00 15.00 ? 484 GLU A CD  1 
ATOM   3712 O  OE1 . GLU A 1 452 ? 1.910  29.830 200.250 1.00 15.00 ? 484 GLU A OE1 1 
ATOM   3713 O  OE2 . GLU A 1 452 ? 3.250  28.130 199.660 1.00 15.00 ? 484 GLU A OE2 1 
ATOM   3714 N  N   . LYS A 1 453 ? 0.960  26.160 201.400 1.00 15.00 ? 485 LYS A N   1 
ATOM   3715 C  CA  . LYS A 1 453 ? 0.420  25.350 200.300 1.00 15.00 ? 485 LYS A CA  1 
ATOM   3716 C  C   . LYS A 1 453 ? 0.130  26.150 199.020 1.00 15.00 ? 485 LYS A C   1 
ATOM   3717 O  O   . LYS A 1 453 ? 0.350  25.660 197.910 1.00 15.00 ? 485 LYS A O   1 
ATOM   3718 C  CB  . LYS A 1 453 ? -0.870 24.680 200.740 1.00 15.00 ? 485 LYS A CB  1 
ATOM   3719 C  CG  . LYS A 1 453 ? -0.610 23.500 201.690 1.00 15.00 ? 485 LYS A CG  1 
ATOM   3720 C  CD  . LYS A 1 453 ? -1.870 22.680 201.960 1.00 15.00 ? 485 LYS A CD  1 
ATOM   3721 C  CE  . LYS A 1 453 ? -1.560 21.300 202.550 1.00 15.00 ? 485 LYS A CE  1 
ATOM   3722 N  NZ  . LYS A 1 453 ? -0.710 20.480 201.670 1.00 15.00 ? 485 LYS A NZ  1 
ATOM   3723 N  N   . GLU A 1 454 ? -0.360 27.360 199.150 1.00 15.00 ? 486 GLU A N   1 
ATOM   3724 C  CA  . GLU A 1 454 ? -0.700 28.140 197.950 1.00 15.00 ? 486 GLU A CA  1 
ATOM   3725 C  C   . GLU A 1 454 ? 0.550  28.380 197.100 1.00 15.00 ? 486 GLU A C   1 
ATOM   3726 O  O   . GLU A 1 454 ? 0.630  27.920 195.940 1.00 15.00 ? 486 GLU A O   1 
ATOM   3727 C  CB  . GLU A 1 454 ? -1.330 29.490 198.300 1.00 15.00 ? 486 GLU A CB  1 
ATOM   3728 C  CG  . GLU A 1 454 ? -2.160 30.040 197.140 1.00 15.00 ? 486 GLU A CG  1 
ATOM   3729 C  CD  . GLU A 1 454 ? -3.090 31.190 197.540 1.00 15.00 ? 486 GLU A CD  1 
ATOM   3730 O  OE1 . GLU A 1 454 ? -3.340 31.420 198.780 1.00 15.00 ? 486 GLU A OE1 1 
ATOM   3731 O  OE2 . GLU A 1 454 ? -3.610 31.930 196.630 1.00 15.00 ? 486 GLU A OE2 1 
ATOM   3732 N  N   . MET A 1 455 ? 1.590  29.090 197.400 1.00 15.00 ? 487 MET A N   1 
ATOM   3733 C  CA  . MET A 1 455 ? 2.720  29.380 196.540 1.00 15.00 ? 487 MET A CA  1 
ATOM   3734 C  C   . MET A 1 455 ? 3.390  28.110 196.090 1.00 15.00 ? 487 MET A C   1 
ATOM   3735 O  O   . MET A 1 455 ? 3.670  27.940 194.910 1.00 15.00 ? 487 MET A O   1 
ATOM   3736 C  CB  . MET A 1 455 ? 3.770  30.170 197.220 1.00 15.00 ? 487 MET A CB  1 
ATOM   3737 C  CG  . MET A 1 455 ? 3.460  31.610 197.230 1.00 15.00 ? 487 MET A CG  1 
ATOM   3738 S  SD  . MET A 1 455 ? 4.960  32.470 197.760 1.00 15.00 ? 487 MET A SD  1 
ATOM   3739 C  CE  . MET A 1 455 ? 4.830  32.380 199.530 1.00 15.00 ? 487 MET A CE  1 
ATOM   3740 N  N   . ALA A 1 456 ? 3.580  27.220 197.060 1.00 15.00 ? 488 ALA A N   1 
ATOM   3741 C  CA  . ALA A 1 456 ? 4.220  25.950 196.820 1.00 15.00 ? 488 ALA A CA  1 
ATOM   3742 C  C   . ALA A 1 456 ? 3.550  25.260 195.660 1.00 15.00 ? 488 ALA A C   1 
ATOM   3743 O  O   . ALA A 1 456 ? 4.220  24.870 194.720 1.00 15.00 ? 488 ALA A O   1 
ATOM   3744 C  CB  . ALA A 1 456 ? 4.090  25.090 198.050 1.00 15.00 ? 488 ALA A CB  1 
ATOM   3745 N  N   . ALA A 1 457 ? 2.230  25.230 195.680 1.00 15.00 ? 489 ALA A N   1 
ATOM   3746 C  CA  . ALA A 1 457 ? 1.440  24.580 194.670 1.00 15.00 ? 489 ALA A CA  1 
ATOM   3747 C  C   . ALA A 1 457 ? 1.620  25.190 193.290 1.00 15.00 ? 489 ALA A C   1 
ATOM   3748 O  O   . ALA A 1 457 ? 1.810  24.480 192.310 1.00 15.00 ? 489 ALA A O   1 
ATOM   3749 C  CB  . ALA A 1 457 ? -0.020 24.670 195.040 1.00 15.00 ? 489 ALA A CB  1 
ATOM   3750 N  N   . GLU A 1 458 ? 1.640  26.520 193.190 1.00 15.00 ? 490 GLU A N   1 
ATOM   3751 C  CA  . GLU A 1 458 ? 1.810  27.160 191.900 1.00 15.00 ? 490 GLU A CA  1 
ATOM   3752 C  C   . GLU A 1 458 ? 3.230  27.000 191.400 1.00 15.00 ? 490 GLU A C   1 
ATOM   3753 O  O   . GLU A 1 458 ? 3.500  26.820 190.210 1.00 15.00 ? 490 GLU A O   1 
ATOM   3754 C  CB  . GLU A 1 458 ? 1.470  28.590 192.050 1.00 15.00 ? 490 GLU A CB  1 
ATOM   3755 C  CG  . GLU A 1 458 ? 1.420  29.340 190.730 1.00 15.00 ? 490 GLU A CG  1 
ATOM   3756 C  CD  . GLU A 1 458 ? 0.990  30.800 190.870 1.00 15.00 ? 490 GLU A CD  1 
ATOM   3757 O  OE1 . GLU A 1 458 ? 0.830  31.300 192.000 1.00 15.00 ? 490 GLU A OE1 1 
ATOM   3758 O  OE2 . GLU A 1 458 ? 0.820  31.430 189.820 1.00 15.00 ? 490 GLU A OE2 1 
ATOM   3759 N  N   . LEU A 1 459 ? 4.150  27.020 192.350 1.00 15.00 ? 491 LEU A N   1 
ATOM   3760 C  CA  . LEU A 1 459 ? 5.570  26.910 192.130 1.00 15.00 ? 491 LEU A CA  1 
ATOM   3761 C  C   . LEU A 1 459 ? 5.810  25.540 191.540 1.00 15.00 ? 491 LEU A C   1 
ATOM   3762 O  O   . LEU A 1 459 ? 6.530  25.390 190.570 1.00 15.00 ? 491 LEU A O   1 
ATOM   3763 C  CB  . LEU A 1 459 ? 6.240  27.080 193.470 1.00 15.00 ? 491 LEU A CB  1 
ATOM   3764 C  CG  . LEU A 1 459 ? 7.580  27.720 193.600 1.00 15.00 ? 491 LEU A CG  1 
ATOM   3765 C  CD1 . LEU A 1 459 ? 7.700  28.980 192.770 1.00 15.00 ? 491 LEU A CD1 1 
ATOM   3766 C  CD2 . LEU A 1 459 ? 7.730  28.040 195.060 1.00 15.00 ? 491 LEU A CD2 1 
ATOM   3767 N  N   . GLU A 1 460 ? 5.110  24.550 192.090 1.00 15.00 ? 492 GLU A N   1 
ATOM   3768 C  CA  . GLU A 1 460 ? 5.190  23.190 191.620 1.00 15.00 ? 492 GLU A CA  1 
ATOM   3769 C  C   . GLU A 1 460 ? 4.680  23.130 190.210 1.00 15.00 ? 492 GLU A C   1 
ATOM   3770 O  O   . GLU A 1 460 ? 5.330  22.580 189.330 1.00 15.00 ? 492 GLU A O   1 
ATOM   3771 C  CB  . GLU A 1 460 ? 4.360  22.330 192.510 1.00 15.00 ? 492 GLU A CB  1 
ATOM   3772 C  CG  . GLU A 1 460 ? 4.540  20.890 192.110 1.00 15.00 ? 492 GLU A CG  1 
ATOM   3773 C  CD  . GLU A 1 460 ? 3.980  19.880 193.110 1.00 15.00 ? 492 GLU A CD  1 
ATOM   3774 O  OE1 . GLU A 1 460 ? 2.770  19.620 193.060 1.00 15.00 ? 492 GLU A OE1 1 
ATOM   3775 O  OE2 . GLU A 1 460 ? 4.770  19.360 193.930 1.00 15.00 ? 492 GLU A OE2 1 
ATOM   3776 N  N   . GLU A 1 461 ? 3.550  23.760 189.970 1.00 15.00 ? 493 GLU A N   1 
ATOM   3777 C  CA  . GLU A 1 461 ? 2.940  23.830 188.650 1.00 15.00 ? 493 GLU A CA  1 
ATOM   3778 C  C   . GLU A 1 461 ? 3.900  24.450 187.650 1.00 15.00 ? 493 GLU A C   1 
ATOM   3779 O  O   . GLU A 1 461 ? 3.970  23.990 186.510 1.00 15.00 ? 493 GLU A O   1 
ATOM   3780 C  CB  . GLU A 1 461 ? 1.670  24.650 188.810 1.00 15.00 ? 493 GLU A CB  1 
ATOM   3781 C  CG  . GLU A 1 461 ? 0.880  25.090 187.580 1.00 15.00 ? 493 GLU A CG  1 
ATOM   3782 C  CD  . GLU A 1 461 ? -0.240 26.100 187.950 1.00 15.00 ? 493 GLU A CD  1 
ATOM   3783 O  OE1 . GLU A 1 461 ? -1.360 25.640 188.330 1.00 15.00 ? 493 GLU A OE1 1 
ATOM   3784 O  OE2 . GLU A 1 461 ? -0.010 27.330 187.850 1.00 15.00 ? 493 GLU A OE2 1 
ATOM   3785 N  N   . LEU A 1 462 ? 4.660  25.450 188.070 1.00 15.00 ? 494 LEU A N   1 
ATOM   3786 C  CA  . LEU A 1 462 ? 5.630  26.070 187.210 1.00 15.00 ? 494 LEU A CA  1 
ATOM   3787 C  C   . LEU A 1 462 ? 6.920  25.290 186.990 1.00 15.00 ? 494 LEU A C   1 
ATOM   3788 O  O   . LEU A 1 462 ? 7.310  25.060 185.850 1.00 15.00 ? 494 LEU A O   1 
ATOM   3789 C  CB  . LEU A 1 462 ? 5.940  27.410 187.780 1.00 15.00 ? 494 LEU A CB  1 
ATOM   3790 C  CG  . LEU A 1 462 ? 5.000  28.470 187.300 1.00 15.00 ? 494 LEU A CG  1 
ATOM   3791 C  CD1 . LEU A 1 462 ? 5.060  29.670 188.190 1.00 15.00 ? 494 LEU A CD1 1 
ATOM   3792 C  CD2 . LEU A 1 462 ? 5.380  28.830 185.890 1.00 15.00 ? 494 LEU A CD2 1 
ATOM   3793 N  N   . TYR A 1 463 ? 7.640  24.900 188.050 1.00 15.00 ? 495 TYR A N   1 
ATOM   3794 C  CA  . TYR A 1 463 ? 8.920  24.250 187.900 1.00 15.00 ? 495 TYR A CA  1 
ATOM   3795 C  C   . TYR A 1 463 ? 8.840  22.810 187.480 1.00 15.00 ? 495 TYR A C   1 
ATOM   3796 O  O   . TYR A 1 463 ? 9.720  22.270 186.800 1.00 15.00 ? 495 TYR A O   1 
ATOM   3797 C  CB  . TYR A 1 463 ? 9.690  24.400 189.190 1.00 15.00 ? 495 TYR A CB  1 
ATOM   3798 C  CG  . TYR A 1 463 ? 10.480 25.700 189.150 1.00 15.00 ? 495 TYR A CG  1 
ATOM   3799 C  CD1 . TYR A 1 463 ? 11.340 25.950 188.100 1.00 15.00 ? 495 TYR A CD1 1 
ATOM   3800 C  CD2 . TYR A 1 463 ? 10.330 26.650 190.130 1.00 15.00 ? 495 TYR A CD2 1 
ATOM   3801 C  CE1 . TYR A 1 463 ? 12.030 27.130 188.010 1.00 15.00 ? 495 TYR A CE1 1 
ATOM   3802 C  CE2 . TYR A 1 463 ? 11.030 27.840 190.050 1.00 15.00 ? 495 TYR A CE2 1 
ATOM   3803 C  CZ  . TYR A 1 463 ? 11.880 28.070 188.990 1.00 15.00 ? 495 TYR A CZ  1 
ATOM   3804 O  OH  . TYR A 1 463 ? 12.570 29.260 188.890 1.00 15.00 ? 495 TYR A OH  1 
ATOM   3805 N  N   . GLY A 1 464 ? 7.770  22.140 187.850 1.00 15.00 ? 496 GLY A N   1 
ATOM   3806 C  CA  . GLY A 1 464 ? 7.620  20.760 187.460 1.00 15.00 ? 496 GLY A CA  1 
ATOM   3807 C  C   . GLY A 1 464 ? 8.220  19.850 188.510 1.00 15.00 ? 496 GLY A C   1 
ATOM   3808 O  O   . GLY A 1 464 ? 7.570  18.890 188.900 1.00 15.00 ? 496 GLY A O   1 
ATOM   3809 N  N   . ASP A 1 465 ? 9.410  20.100 189.040 1.00 15.00 ? 497 ASP A N   1 
ATOM   3810 C  CA  . ASP A 1 465 ? 9.990  19.190 190.020 1.00 15.00 ? 497 ASP A CA  1 
ATOM   3811 C  C   . ASP A 1 465 ? 10.650 19.960 191.160 1.00 15.00 ? 497 ASP A C   1 
ATOM   3812 O  O   . ASP A 1 465 ? 11.280 20.980 190.870 1.00 15.00 ? 497 ASP A O   1 
ATOM   3813 C  CB  . ASP A 1 465 ? 11.010 18.340 189.310 1.00 15.00 ? 497 ASP A CB  1 
ATOM   3814 C  CG  . ASP A 1 465 ? 11.230 17.010 189.990 1.00 15.00 ? 497 ASP A CG  1 
ATOM   3815 O  OD1 . ASP A 1 465 ? 11.600 16.980 191.180 1.00 15.00 ? 497 ASP A OD1 1 
ATOM   3816 O  OD2 . ASP A 1 465 ? 11.030 16.010 189.300 1.00 15.00 ? 497 ASP A OD2 1 
ATOM   3817 N  N   . ILE A 1 466 ? 10.590 19.580 192.450 1.00 15.00 ? 498 ILE A N   1 
ATOM   3818 C  CA  . ILE A 1 466 ? 11.290 20.380 193.460 1.00 15.00 ? 498 ILE A CA  1 
ATOM   3819 C  C   . ILE A 1 466 ? 12.790 20.370 193.160 1.00 15.00 ? 498 ILE A C   1 
ATOM   3820 O  O   . ILE A 1 466 ? 13.480 21.400 193.230 1.00 15.00 ? 498 ILE A O   1 
ATOM   3821 C  CB  . ILE A 1 466 ? 10.980 19.820 194.880 1.00 15.00 ? 498 ILE A CB  1 
ATOM   3822 C  CG1 . ILE A 1 466 ? 11.730 20.610 195.960 1.00 15.00 ? 498 ILE A CG1 1 
ATOM   3823 C  CG2 . ILE A 1 466 ? 11.310 18.350 194.930 1.00 15.00 ? 498 ILE A CG2 1 
ATOM   3824 C  CD1 . ILE A 1 466 ? 11.380 22.100 196.050 1.00 15.00 ? 498 ILE A CD1 1 
ATOM   3825 N  N   . ASP A 1 467 ? 13.240 19.240 192.600 1.00 15.00 ? 499 ASP A N   1 
ATOM   3826 C  CA  . ASP A 1 467 ? 14.610 19.060 192.190 1.00 15.00 ? 499 ASP A CA  1 
ATOM   3827 C  C   . ASP A 1 467 ? 14.980 19.900 190.970 1.00 15.00 ? 499 ASP A C   1 
ATOM   3828 O  O   . ASP A 1 467 ? 16.020 19.620 190.380 1.00 15.00 ? 499 ASP A O   1 
ATOM   3829 C  CB  . ASP A 1 467 ? 14.890 17.570 191.890 1.00 15.00 ? 499 ASP A CB  1 
ATOM   3830 C  CG  . ASP A 1 467 ? 15.310 16.720 193.100 1.00 15.00 ? 499 ASP A CG  1 
ATOM   3831 O  OD1 . ASP A 1 467 ? 16.470 16.810 193.520 1.00 15.00 ? 499 ASP A OD1 1 
ATOM   3832 O  OD2 . ASP A 1 467 ? 14.490 15.950 193.610 1.00 15.00 ? 499 ASP A OD2 1 
ATOM   3833 N  N   . ALA A 1 468 ? 14.180 20.900 190.550 1.00 15.00 ? 500 ALA A N   1 
ATOM   3834 C  CA  . ALA A 1 468 ? 14.470 21.800 189.450 1.00 15.00 ? 500 ALA A CA  1 
ATOM   3835 C  C   . ALA A 1 468 ? 14.270 23.270 189.860 1.00 15.00 ? 500 ALA A C   1 
ATOM   3836 O  O   . ALA A 1 468 ? 14.190 24.200 189.040 1.00 15.00 ? 500 ALA A O   1 
ATOM   3837 C  CB  . ALA A 1 468 ? 13.560 21.510 188.280 1.00 15.00 ? 500 ALA A CB  1 
ATOM   3838 N  N   . LEU A 1 469 ? 14.190 23.520 191.170 1.00 15.00 ? 501 LEU A N   1 
ATOM   3839 C  CA  . LEU A 1 469 ? 14.040 24.880 191.650 1.00 15.00 ? 501 LEU A CA  1 
ATOM   3840 C  C   . LEU A 1 469 ? 15.380 25.600 191.450 1.00 15.00 ? 501 LEU A C   1 
ATOM   3841 O  O   . LEU A 1 469 ? 16.460 25.150 191.830 1.00 15.00 ? 501 LEU A O   1 
ATOM   3842 C  CB  . LEU A 1 469 ? 13.650 24.800 193.120 1.00 15.00 ? 501 LEU A CB  1 
ATOM   3843 C  CG  . LEU A 1 469 ? 13.430 26.090 193.860 1.00 15.00 ? 501 LEU A CG  1 
ATOM   3844 C  CD1 . LEU A 1 469 ? 12.340 26.960 193.280 1.00 15.00 ? 501 LEU A CD1 1 
ATOM   3845 C  CD2 . LEU A 1 469 ? 13.030 25.690 195.240 1.00 15.00 ? 501 LEU A CD2 1 
ATOM   3846 N  N   . GLU A 1 470 ? 15.320 26.720 190.740 1.00 15.00 ? 502 GLU A N   1 
ATOM   3847 C  CA  . GLU A 1 470 ? 16.500 27.540 190.470 1.00 15.00 ? 502 GLU A CA  1 
ATOM   3848 C  C   . GLU A 1 470 ? 17.190 28.000 191.760 1.00 15.00 ? 502 GLU A C   1 
ATOM   3849 O  O   . GLU A 1 470 ? 16.490 28.210 192.760 1.00 15.00 ? 502 GLU A O   1 
ATOM   3850 C  CB  . GLU A 1 470 ? 16.040 28.750 189.650 1.00 15.00 ? 502 GLU A CB  1 
ATOM   3851 C  CG  . GLU A 1 470 ? 15.400 28.410 188.320 1.00 15.00 ? 502 GLU A CG  1 
ATOM   3852 C  CD  . GLU A 1 470 ? 15.820 29.340 187.200 1.00 15.00 ? 502 GLU A CD  1 
ATOM   3853 O  OE1 . GLU A 1 470 ? 17.040 29.440 187.010 1.00 15.00 ? 502 GLU A OE1 1 
ATOM   3854 O  OE2 . GLU A 1 470 ? 14.960 29.940 186.530 1.00 15.00 ? 502 GLU A OE2 1 
ATOM   3855 N  N   . PHE A 1 471 ? 18.520 28.190 191.830 1.00 15.00 ? 503 PHE A N   1 
ATOM   3856 C  CA  . PHE A 1 471 ? 19.200 28.620 193.050 1.00 15.00 ? 503 PHE A CA  1 
ATOM   3857 C  C   . PHE A 1 471 ? 18.690 29.920 193.680 1.00 15.00 ? 503 PHE A C   1 
ATOM   3858 O  O   . PHE A 1 471 ? 18.250 29.900 194.830 1.00 15.00 ? 503 PHE A O   1 
ATOM   3859 C  CB  . PHE A 1 471 ? 20.700 28.760 192.790 1.00 15.00 ? 503 PHE A CB  1 
ATOM   3860 C  CG  . PHE A 1 471 ? 21.610 29.150 193.950 1.00 15.00 ? 503 PHE A CG  1 
ATOM   3861 C  CD1 . PHE A 1 471 ? 21.900 28.250 194.950 1.00 15.00 ? 503 PHE A CD1 1 
ATOM   3862 C  CD2 . PHE A 1 471 ? 22.180 30.420 193.960 1.00 15.00 ? 503 PHE A CD2 1 
ATOM   3863 C  CE1 . PHE A 1 471 ? 22.750 28.620 195.960 1.00 15.00 ? 503 PHE A CE1 1 
ATOM   3864 C  CE2 . PHE A 1 471 ? 23.040 30.780 194.970 1.00 15.00 ? 503 PHE A CE2 1 
ATOM   3865 C  CZ  . PHE A 1 471 ? 23.320 29.880 195.960 1.00 15.00 ? 503 PHE A CZ  1 
ATOM   3866 N  N   . TYR A 1 472 ? 18.720 31.060 192.990 1.00 15.00 ? 504 TYR A N   1 
ATOM   3867 C  CA  . TYR A 1 472 ? 18.240 32.270 193.640 1.00 15.00 ? 504 TYR A CA  1 
ATOM   3868 C  C   . TYR A 1 472 ? 16.770 32.230 194.040 1.00 15.00 ? 504 TYR A C   1 
ATOM   3869 O  O   . TYR A 1 472 ? 16.530 32.570 195.200 1.00 15.00 ? 504 TYR A O   1 
ATOM   3870 C  CB  . TYR A 1 472 ? 18.510 33.460 192.750 1.00 15.00 ? 504 TYR A CB  1 
ATOM   3871 C  CG  . TYR A 1 472 ? 18.070 34.800 193.320 1.00 15.00 ? 504 TYR A CG  1 
ATOM   3872 C  CD1 . TYR A 1 472 ? 18.760 35.400 194.350 1.00 15.00 ? 504 TYR A CD1 1 
ATOM   3873 C  CD2 . TYR A 1 472 ? 16.990 35.440 192.750 1.00 15.00 ? 504 TYR A CD2 1 
ATOM   3874 C  CE1 . TYR A 1 472 ? 18.390 36.650 194.790 1.00 15.00 ? 504 TYR A CE1 1 
ATOM   3875 C  CE2 . TYR A 1 472 ? 16.610 36.690 193.190 1.00 15.00 ? 504 TYR A CE2 1 
ATOM   3876 C  CZ  . TYR A 1 472 ? 17.330 37.280 194.200 1.00 15.00 ? 504 TYR A CZ  1 
ATOM   3877 O  OH  . TYR A 1 472 ? 16.980 38.560 194.590 1.00 15.00 ? 504 TYR A OH  1 
ATOM   3878 N  N   . PRO A 1 473 ? 15.760 31.850 193.220 1.00 15.00 ? 505 PRO A N   1 
ATOM   3879 C  CA  . PRO A 1 473 ? 14.370 31.780 193.630 1.00 15.00 ? 505 PRO A CA  1 
ATOM   3880 C  C   . PRO A 1 473 ? 14.240 31.000 194.910 1.00 15.00 ? 505 PRO A C   1 
ATOM   3881 O  O   . PRO A 1 473 ? 13.750 31.520 195.910 1.00 15.00 ? 505 PRO A O   1 
ATOM   3882 C  CB  . PRO A 1 473 ? 13.670 31.150 192.470 1.00 15.00 ? 505 PRO A CB  1 
ATOM   3883 C  CG  . PRO A 1 473 ? 14.430 31.720 191.320 1.00 15.00 ? 505 PRO A CG  1 
ATOM   3884 C  CD  . PRO A 1 473 ? 15.850 31.550 191.800 1.00 15.00 ? 505 PRO A CD  1 
ATOM   3885 N  N   . GLY A 1 474 ? 14.800 29.790 194.950 1.00 15.00 ? 506 GLY A N   1 
ATOM   3886 C  CA  . GLY A 1 474 ? 14.690 28.930 196.110 1.00 15.00 ? 506 GLY A CA  1 
ATOM   3887 C  C   . GLY A 1 474 ? 15.240 29.570 197.370 1.00 15.00 ? 506 GLY A C   1 
ATOM   3888 O  O   . GLY A 1 474 ? 14.660 29.470 198.450 1.00 15.00 ? 506 GLY A O   1 
ATOM   3889 N  N   . LEU A 1 475 ? 16.330 30.290 197.210 1.00 15.00 ? 507 LEU A N   1 
ATOM   3890 C  CA  . LEU A 1 475 ? 16.990 30.960 198.310 1.00 15.00 ? 507 LEU A CA  1 
ATOM   3891 C  C   . LEU A 1 475 ? 16.090 32.000 198.980 1.00 15.00 ? 507 LEU A C   1 
ATOM   3892 O  O   . LEU A 1 475 ? 15.960 32.060 200.200 1.00 15.00 ? 507 LEU A O   1 
ATOM   3893 C  CB  . LEU A 1 475 ? 18.210 31.580 197.730 1.00 15.00 ? 507 LEU A CB  1 
ATOM   3894 C  CG  . LEU A 1 475 ? 19.490 31.600 198.470 1.00 15.00 ? 507 LEU A CG  1 
ATOM   3895 C  CD1 . LEU A 1 475 ? 19.930 30.240 198.960 1.00 15.00 ? 507 LEU A CD1 1 
ATOM   3896 C  CD2 . LEU A 1 475 ? 20.510 32.090 197.480 1.00 15.00 ? 507 LEU A CD2 1 
ATOM   3897 N  N   . LEU A 1 476 ? 15.450 32.790 198.130 1.00 15.00 ? 508 LEU A N   1 
ATOM   3898 C  CA  . LEU A 1 476 ? 14.560 33.840 198.560 1.00 15.00 ? 508 LEU A CA  1 
ATOM   3899 C  C   . LEU A 1 476 ? 13.160 33.390 198.980 1.00 15.00 ? 508 LEU A C   1 
ATOM   3900 O  O   . LEU A 1 476 ? 12.500 34.020 199.820 1.00 15.00 ? 508 LEU A O   1 
ATOM   3901 C  CB  . LEU A 1 476 ? 14.510 34.820 197.430 1.00 15.00 ? 508 LEU A CB  1 
ATOM   3902 C  CG  . LEU A 1 476 ? 15.020 36.190 197.770 1.00 15.00 ? 508 LEU A CG  1 
ATOM   3903 C  CD1 . LEU A 1 476 ? 16.470 36.200 198.200 1.00 15.00 ? 508 LEU A CD1 1 
ATOM   3904 C  CD2 . LEU A 1 476 ? 14.840 37.020 196.530 1.00 15.00 ? 508 LEU A CD2 1 
ATOM   3905 N  N   . LEU A 1 477 ? 12.670 32.300 198.390 1.00 15.00 ? 509 LEU A N   1 
ATOM   3906 C  CA  . LEU A 1 477 ? 11.340 31.780 198.680 1.00 15.00 ? 509 LEU A CA  1 
ATOM   3907 C  C   . LEU A 1 477 ? 11.310 30.750 199.780 1.00 15.00 ? 509 LEU A C   1 
ATOM   3908 O  O   . LEU A 1 477 ? 10.230 30.310 200.160 1.00 15.00 ? 509 LEU A O   1 
ATOM   3909 C  CB  . LEU A 1 477 ? 10.750 31.170 197.410 1.00 15.00 ? 509 LEU A CB  1 
ATOM   3910 C  CG  . LEU A 1 477 ? 10.440 32.080 196.200 1.00 15.00 ? 509 LEU A CG  1 
ATOM   3911 C  CD1 . LEU A 1 477 ? 9.920  31.240 195.060 1.00 15.00 ? 509 LEU A CD1 1 
ATOM   3912 C  CD2 . LEU A 1 477 ? 9.400  33.130 196.570 1.00 15.00 ? 509 LEU A CD2 1 
ATOM   3913 N  N   . GLU A 1 478 ? 12.430 30.280 200.330 1.00 15.00 ? 510 GLU A N   1 
ATOM   3914 C  CA  . GLU A 1 478 ? 12.450 29.330 201.440 1.00 15.00 ? 510 GLU A CA  1 
ATOM   3915 C  C   . GLU A 1 478 ? 11.940 29.940 202.730 1.00 15.00 ? 510 GLU A C   1 
ATOM   3916 O  O   . GLU A 1 478 ? 12.050 31.150 202.960 1.00 15.00 ? 510 GLU A O   1 
ATOM   3917 C  CB  . GLU A 1 478 ? 13.870 28.850 201.630 1.00 15.00 ? 510 GLU A CB  1 
ATOM   3918 C  CG  . GLU A 1 478 ? 14.140 27.870 202.760 1.00 15.00 ? 510 GLU A CG  1 
ATOM   3919 C  CD  . GLU A 1 478 ? 15.630 27.590 202.960 1.00 15.00 ? 510 GLU A CD  1 
ATOM   3920 O  OE1 . GLU A 1 478 ? 16.380 28.510 203.300 1.00 15.00 ? 510 GLU A OE1 1 
ATOM   3921 O  OE2 . GLU A 1 478 ? 16.030 26.450 202.760 1.00 15.00 ? 510 GLU A OE2 1 
ATOM   3922 N  N   . LYS A 1 479 ? 11.410 29.090 203.580 1.00 15.00 ? 511 LYS A N   1 
ATOM   3923 C  CA  . LYS A 1 479 ? 10.840 29.550 204.820 1.00 15.00 ? 511 LYS A CA  1 
ATOM   3924 C  C   . LYS A 1 479 ? 11.850 30.100 205.770 1.00 15.00 ? 511 LYS A C   1 
ATOM   3925 O  O   . LYS A 1 479 ? 12.900 29.520 206.010 1.00 15.00 ? 511 LYS A O   1 
ATOM   3926 C  CB  . LYS A 1 479 ? 10.090 28.430 205.500 1.00 15.00 ? 511 LYS A CB  1 
ATOM   3927 C  CG  . LYS A 1 479 ? 10.860 27.200 205.900 1.00 15.00 ? 511 LYS A CG  1 
ATOM   3928 C  CD  . LYS A 1 479 ? 9.890  26.040 205.770 1.00 15.00 ? 511 LYS A CD  1 
ATOM   3929 C  CE  . LYS A 1 479 ? 10.400 24.760 206.400 1.00 15.00 ? 511 LYS A CE  1 
ATOM   3930 N  NZ  . LYS A 1 479 ? 11.730 24.440 205.910 1.00 15.00 ? 511 LYS A NZ  1 
ATOM   3931 N  N   . CYS A 1 480 ? 11.530 31.270 206.280 1.00 15.00 ? 512 CYS A N   1 
ATOM   3932 C  CA  . CYS A 1 480 ? 12.410 31.890 207.240 1.00 15.00 ? 512 CYS A CA  1 
ATOM   3933 C  C   . CYS A 1 480 ? 12.470 31.060 208.490 1.00 15.00 ? 512 CYS A C   1 
ATOM   3934 O  O   . CYS A 1 480 ? 11.560 30.290 208.820 1.00 15.00 ? 512 CYS A O   1 
ATOM   3935 C  CB  . CYS A 1 480 ? 11.930 33.270 207.610 1.00 15.00 ? 512 CYS A CB  1 
ATOM   3936 S  SG  . CYS A 1 480 ? 12.310 34.340 206.210 1.00 15.00 ? 512 CYS A SG  1 
ATOM   3937 N  N   . HIS A 1 481 ? 13.640 31.130 209.120 1.00 15.00 ? 513 HIS A N   1 
ATOM   3938 C  CA  . HIS A 1 481 ? 13.860 30.490 210.410 1.00 15.00 ? 513 HIS A CA  1 
ATOM   3939 C  C   . HIS A 1 481 ? 12.930 31.230 211.340 1.00 15.00 ? 513 HIS A C   1 
ATOM   3940 O  O   . HIS A 1 481 ? 12.820 32.440 211.150 1.00 15.00 ? 513 HIS A O   1 
ATOM   3941 C  CB  . HIS A 1 481 ? 15.250 30.710 210.930 1.00 15.00 ? 513 HIS A CB  1 
ATOM   3942 C  CG  . HIS A 1 481 ? 16.240 29.600 210.700 1.00 15.00 ? 513 HIS A CG  1 
ATOM   3943 N  ND1 . HIS A 1 481 ? 16.030 28.270 211.070 1.00 15.00 ? 513 HIS A ND1 1 
ATOM   3944 C  CD2 . HIS A 1 481 ? 17.490 29.790 210.120 1.00 15.00 ? 513 HIS A CD2 1 
ATOM   3945 C  CE1 . HIS A 1 481 ? 17.170 27.640 210.690 1.00 15.00 ? 513 HIS A CE1 1 
ATOM   3946 N  NE2 . HIS A 1 481 ? 18.010 28.490 210.150 1.00 15.00 ? 513 HIS A NE2 1 
ATOM   3947 N  N   . PRO A 1 482 ? 12.280 30.570 212.320 1.00 15.00 ? 514 PRO A N   1 
ATOM   3948 C  CA  . PRO A 1 482 ? 11.490 31.140 213.410 1.00 15.00 ? 514 PRO A CA  1 
ATOM   3949 C  C   . PRO A 1 482 ? 11.100 32.580 213.220 1.00 15.00 ? 514 PRO A C   1 
ATOM   3950 O  O   . PRO A 1 482 ? 10.080 32.840 212.560 1.00 15.00 ? 514 PRO A O   1 
ATOM   3951 C  CB  . PRO A 1 482 ? 12.380 30.860 214.570 1.00 15.00 ? 514 PRO A CB  1 
ATOM   3952 C  CG  . PRO A 1 482 ? 12.850 29.450 214.230 1.00 15.00 ? 514 PRO A CG  1 
ATOM   3953 C  CD  . PRO A 1 482 ? 12.560 29.220 212.740 1.00 15.00 ? 514 PRO A CD  1 
ATOM   3954 N  N   . ASN A 1 483 ? 11.910 33.520 213.680 1.00 15.00 ? 515 ASN A N   1 
ATOM   3955 C  CA  . ASN A 1 483 ? 11.550 34.910 213.450 1.00 15.00 ? 515 ASN A CA  1 
ATOM   3956 C  C   . ASN A 1 483 ? 12.830 35.610 213.080 1.00 15.00 ? 515 ASN A C   1 
ATOM   3957 O  O   . ASN A 1 483 ? 13.380 36.490 213.750 1.00 15.00 ? 515 ASN A O   1 
ATOM   3958 C  CB  . ASN A 1 483 ? 10.900 35.500 214.700 1.00 15.00 ? 515 ASN A CB  1 
ATOM   3959 C  CG  . ASN A 1 483 ? 11.600 35.130 215.990 1.00 15.00 ? 515 ASN A CG  1 
ATOM   3960 O  OD1 . ASN A 1 483 ? 11.180 34.170 216.660 1.00 15.00 ? 515 ASN A OD1 1 
ATOM   3961 N  ND2 . ASN A 1 483 ? 12.690 35.810 216.380 1.00 15.00 ? 515 ASN A ND2 1 
ATOM   3962 N  N   . SER A 1 484 ? 13.270 35.170 211.910 1.00 15.00 ? 516 SER A N   1 
ATOM   3963 C  CA  . SER A 1 484 ? 14.540 35.560 211.390 1.00 15.00 ? 516 SER A CA  1 
ATOM   3964 C  C   . SER A 1 484 ? 14.370 36.140 210.010 1.00 15.00 ? 516 SER A C   1 
ATOM   3965 O  O   . SER A 1 484 ? 13.340 35.960 209.360 1.00 15.00 ? 516 SER A O   1 
ATOM   3966 C  CB  . SER A 1 484 ? 15.390 34.300 211.430 1.00 15.00 ? 516 SER A CB  1 
ATOM   3967 O  OG  . SER A 1 484 ? 15.140 33.510 212.620 1.00 15.00 ? 516 SER A OG  1 
ATOM   3968 N  N   . ILE A 1 485 ? 15.390 36.860 209.580 1.00 15.00 ? 517 ILE A N   1 
ATOM   3969 C  CA  . ILE A 1 485 ? 15.380 37.560 208.320 1.00 15.00 ? 517 ILE A CA  1 
ATOM   3970 C  C   . ILE A 1 485 ? 15.470 36.640 207.120 1.00 15.00 ? 517 ILE A C   1 
ATOM   3971 O  O   . ILE A 1 485 ? 15.050 37.020 206.040 1.00 15.00 ? 517 ILE A O   1 
ATOM   3972 C  CB  . ILE A 1 485 ? 16.540 38.590 208.410 1.00 15.00 ? 517 ILE A CB  1 
ATOM   3973 C  CG1 . ILE A 1 485 ? 16.370 39.540 207.260 1.00 15.00 ? 517 ILE A CG1 1 
ATOM   3974 C  CG2 . ILE A 1 485 ? 17.910 37.950 208.470 1.00 15.00 ? 517 ILE A CG2 1 
ATOM   3975 C  CD1 . ILE A 1 485 ? 17.260 40.780 207.350 1.00 15.00 ? 517 ILE A CD1 1 
ATOM   3976 N  N   . PHE A 1 486 ? 15.990 35.440 207.250 1.00 15.00 ? 518 PHE A N   1 
ATOM   3977 C  CA  . PHE A 1 486 ? 16.030 34.490 206.160 1.00 15.00 ? 518 PHE A CA  1 
ATOM   3978 C  C   . PHE A 1 486 ? 16.020 33.130 206.770 1.00 15.00 ? 518 PHE A C   1 
ATOM   3979 O  O   . PHE A 1 486 ? 15.880 33.030 207.980 1.00 15.00 ? 518 PHE A O   1 
ATOM   3980 C  CB  . PHE A 1 486 ? 17.270 34.660 205.280 1.00 15.00 ? 518 PHE A CB  1 
ATOM   3981 C  CG  . PHE A 1 486 ? 18.570 35.190 205.890 1.00 15.00 ? 518 PHE A CG  1 
ATOM   3982 C  CD1 . PHE A 1 486 ? 19.170 34.580 206.970 1.00 15.00 ? 518 PHE A CD1 1 
ATOM   3983 C  CD2 . PHE A 1 486 ? 19.160 36.310 205.310 1.00 15.00 ? 518 PHE A CD2 1 
ATOM   3984 C  CE1 . PHE A 1 486 ? 20.360 35.110 207.450 1.00 15.00 ? 518 PHE A CE1 1 
ATOM   3985 C  CE2 . PHE A 1 486 ? 20.340 36.820 205.800 1.00 15.00 ? 518 PHE A CE2 1 
ATOM   3986 C  CZ  . PHE A 1 486 ? 20.940 36.220 206.870 1.00 15.00 ? 518 PHE A CZ  1 
ATOM   3987 N  N   . GLY A 1 487 ? 16.140 32.060 206.010 1.00 15.00 ? 519 GLY A N   1 
ATOM   3988 C  CA  . GLY A 1 487 ? 16.070 30.720 206.550 1.00 15.00 ? 519 GLY A CA  1 
ATOM   3989 C  C   . GLY A 1 487 ? 17.330 29.930 206.270 1.00 15.00 ? 519 GLY A C   1 
ATOM   3990 O  O   . GLY A 1 487 ? 18.220 30.410 205.570 1.00 15.00 ? 519 GLY A O   1 
ATOM   3991 N  N   . GLU A 1 488 ? 17.340 28.700 206.760 1.00 15.00 ? 520 GLU A N   1 
ATOM   3992 C  CA  . GLU A 1 488 ? 18.430 27.750 206.680 1.00 15.00 ? 520 GLU A CA  1 
ATOM   3993 C  C   . GLU A 1 488 ? 19.460 27.920 205.570 1.00 15.00 ? 520 GLU A C   1 
ATOM   3994 O  O   . GLU A 1 488 ? 20.620 28.230 205.850 1.00 15.00 ? 520 GLU A O   1 
ATOM   3995 C  CB  . GLU A 1 488 ? 17.800 26.380 206.600 1.00 15.00 ? 520 GLU A CB  1 
ATOM   3996 C  CG  . GLU A 1 488 ? 18.410 25.370 207.550 1.00 15.00 ? 520 GLU A CG  1 
ATOM   3997 C  CD  . GLU A 1 488 ? 17.900 23.940 207.400 1.00 15.00 ? 520 GLU A CD  1 
ATOM   3998 O  OE1 . GLU A 1 488 ? 17.340 23.580 206.370 1.00 15.00 ? 520 GLU A OE1 1 
ATOM   3999 O  OE2 . GLU A 1 488 ? 18.070 23.150 208.330 1.00 15.00 ? 520 GLU A OE2 1 
ATOM   4000 N  N   . SER A 1 489 ? 19.080 27.780 204.300 1.00 15.00 ? 521 SER A N   1 
ATOM   4001 C  CA  . SER A 1 489 ? 20.000 27.890 203.190 1.00 15.00 ? 521 SER A CA  1 
ATOM   4002 C  C   . SER A 1 489 ? 20.800 29.170 203.110 1.00 15.00 ? 521 SER A C   1 
ATOM   4003 O  O   . SER A 1 489 ? 21.990 29.120 202.820 1.00 15.00 ? 521 SER A O   1 
ATOM   4004 C  CB  . SER A 1 489 ? 19.200 27.700 201.930 1.00 15.00 ? 521 SER A CB  1 
ATOM   4005 O  OG  . SER A 1 489 ? 18.570 26.440 202.070 1.00 15.00 ? 521 SER A OG  1 
ATOM   4006 N  N   . MET A 1 490 ? 20.230 30.320 203.420 1.00 15.00 ? 522 MET A N   1 
ATOM   4007 C  CA  . MET A 1 490 ? 20.990 31.550 203.350 1.00 15.00 ? 522 MET A CA  1 
ATOM   4008 C  C   . MET A 1 490 ? 22.180 31.500 204.310 1.00 15.00 ? 522 MET A C   1 
ATOM   4009 O  O   . MET A 1 490 ? 23.280 31.900 203.970 1.00 15.00 ? 522 MET A O   1 
ATOM   4010 C  CB  . MET A 1 490 ? 20.090 32.690 203.710 1.00 15.00 ? 522 MET A CB  1 
ATOM   4011 C  CG  . MET A 1 490 ? 20.630 34.020 203.290 1.00 15.00 ? 522 MET A CG  1 
ATOM   4012 S  SD  . MET A 1 490 ? 20.410 34.140 201.510 1.00 15.00 ? 522 MET A SD  1 
ATOM   4013 C  CE  . MET A 1 490 ? 19.170 35.370 201.330 1.00 15.00 ? 522 MET A CE  1 
ATOM   4014 N  N   . ILE A 1 491 ? 22.000 30.930 205.490 1.00 15.00 ? 523 ILE A N   1 
ATOM   4015 C  CA  . ILE A 1 491 ? 23.040 30.860 206.490 1.00 15.00 ? 523 ILE A CA  1 
ATOM   4016 C  C   . ILE A 1 491 ? 23.990 29.750 206.120 1.00 15.00 ? 523 ILE A C   1 
ATOM   4017 O  O   . ILE A 1 491 ? 25.170 30.010 205.990 1.00 15.00 ? 523 ILE A O   1 
ATOM   4018 C  CB  . ILE A 1 491 ? 22.390 30.600 207.860 1.00 15.00 ? 523 ILE A CB  1 
ATOM   4019 C  CG1 . ILE A 1 491 ? 21.750 31.900 208.310 1.00 15.00 ? 523 ILE A CG1 1 
ATOM   4020 C  CG2 . ILE A 1 491 ? 23.390 30.150 208.900 1.00 15.00 ? 523 ILE A CG2 1 
ATOM   4021 C  CD1 . ILE A 1 491 ? 20.880 31.830 209.590 1.00 15.00 ? 523 ILE A CD1 1 
ATOM   4022 N  N   . GLU A 1 492 ? 23.550 28.530 205.860 1.00 15.00 ? 524 GLU A N   1 
ATOM   4023 C  CA  . GLU A 1 492 ? 24.470 27.440 205.550 1.00 15.00 ? 524 GLU A CA  1 
ATOM   4024 C  C   . GLU A 1 492 ? 25.250 27.600 204.260 1.00 15.00 ? 524 GLU A C   1 
ATOM   4025 O  O   . GLU A 1 492 ? 26.360 27.090 204.180 1.00 15.00 ? 524 GLU A O   1 
ATOM   4026 C  CB  . GLU A 1 492 ? 23.720 26.140 205.480 1.00 15.00 ? 524 GLU A CB  1 
ATOM   4027 C  CG  . GLU A 1 492 ? 22.950 25.810 206.740 1.00 15.00 ? 524 GLU A CG  1 
ATOM   4028 C  CD  . GLU A 1 492 ? 23.810 25.680 207.990 1.00 15.00 ? 524 GLU A CD  1 
ATOM   4029 O  OE1 . GLU A 1 492 ? 24.490 24.680 208.150 1.00 15.00 ? 524 GLU A OE1 1 
ATOM   4030 O  OE2 . GLU A 1 492 ? 23.770 26.600 208.800 1.00 15.00 ? 524 GLU A OE2 1 
ATOM   4031 N  N   . MET A 1 493 ? 24.720 28.270 203.240 1.00 15.00 ? 525 MET A N   1 
ATOM   4032 C  CA  . MET A 1 493 ? 25.440 28.490 202.010 1.00 15.00 ? 525 MET A CA  1 
ATOM   4033 C  C   . MET A 1 493 ? 26.180 29.800 202.100 1.00 15.00 ? 525 MET A C   1 
ATOM   4034 O  O   . MET A 1 493 ? 27.310 29.910 201.650 1.00 15.00 ? 525 MET A O   1 
ATOM   4035 C  CB  . MET A 1 493 ? 24.510 28.580 200.820 1.00 15.00 ? 525 MET A CB  1 
ATOM   4036 C  CG  . MET A 1 493 ? 23.740 27.320 200.600 1.00 15.00 ? 525 MET A CG  1 
ATOM   4037 S  SD  . MET A 1 493 ? 22.660 27.410 199.160 1.00 15.00 ? 525 MET A SD  1 
ATOM   4038 C  CE  . MET A 1 493 ? 21.920 25.850 199.550 1.00 15.00 ? 525 MET A CE  1 
ATOM   4039 N  N   . GLY A 1 494 ? 25.610 30.830 202.700 1.00 15.00 ? 526 GLY A N   1 
ATOM   4040 C  CA  . GLY A 1 494 ? 26.230 32.140 202.710 1.00 15.00 ? 526 GLY A CA  1 
ATOM   4041 C  C   . GLY A 1 494 ? 27.360 32.190 203.670 1.00 15.00 ? 526 GLY A C   1 
ATOM   4042 O  O   . GLY A 1 494 ? 28.420 32.690 203.320 1.00 15.00 ? 526 GLY A O   1 
ATOM   4043 N  N   . ALA A 1 495 ? 27.190 31.600 204.840 1.00 15.00 ? 527 ALA A N   1 
ATOM   4044 C  CA  . ALA A 1 495 ? 28.160 31.760 205.890 1.00 15.00 ? 527 ALA A CA  1 
ATOM   4045 C  C   . ALA A 1 495 ? 29.540 31.340 205.480 1.00 15.00 ? 527 ALA A C   1 
ATOM   4046 O  O   . ALA A 1 495 ? 30.400 32.200 205.590 1.00 15.00 ? 527 ALA A O   1 
ATOM   4047 C  CB  . ALA A 1 495 ? 27.780 30.970 207.100 1.00 15.00 ? 527 ALA A CB  1 
ATOM   4048 N  N   . PRO A 1 496 ? 29.860 30.160 204.920 1.00 15.00 ? 528 PRO A N   1 
ATOM   4049 C  CA  . PRO A 1 496 ? 31.210 29.840 204.480 1.00 15.00 ? 528 PRO A CA  1 
ATOM   4050 C  C   . PRO A 1 496 ? 31.790 30.770 203.450 1.00 15.00 ? 528 PRO A C   1 
ATOM   4051 O  O   . PRO A 1 496 ? 32.920 31.210 203.640 1.00 15.00 ? 528 PRO A O   1 
ATOM   4052 C  CB  . PRO A 1 496 ? 31.120 28.410 204.010 1.00 15.00 ? 528 PRO A CB  1 
ATOM   4053 C  CG  . PRO A 1 496 ? 29.690 28.220 203.670 1.00 15.00 ? 528 PRO A CG  1 
ATOM   4054 C  CD  . PRO A 1 496 ? 28.990 29.000 204.760 1.00 15.00 ? 528 PRO A CD  1 
ATOM   4055 N  N   . PHE A 1 497 ? 31.070 31.160 202.410 1.00 15.00 ? 529 PHE A N   1 
ATOM   4056 C  CA  . PHE A 1 497 ? 31.580 32.130 201.480 1.00 15.00 ? 529 PHE A CA  1 
ATOM   4057 C  C   . PHE A 1 497 ? 32.010 33.380 202.210 1.00 15.00 ? 529 PHE A C   1 
ATOM   4058 O  O   . PHE A 1 497 ? 33.100 33.890 201.930 1.00 15.00 ? 529 PHE A O   1 
ATOM   4059 C  CB  . PHE A 1 497 ? 30.540 32.530 200.490 1.00 15.00 ? 529 PHE A CB  1 
ATOM   4060 C  CG  . PHE A 1 497 ? 30.150 31.530 199.420 1.00 15.00 ? 529 PHE A CG  1 
ATOM   4061 C  CD1 . PHE A 1 497 ? 31.060 31.120 198.470 1.00 15.00 ? 529 PHE A CD1 1 
ATOM   4062 C  CD2 . PHE A 1 497 ? 28.850 31.060 199.380 1.00 15.00 ? 529 PHE A CD2 1 
ATOM   4063 C  CE1 . PHE A 1 497 ? 30.670 30.240 197.480 1.00 15.00 ? 529 PHE A CE1 1 
ATOM   4064 C  CE2 . PHE A 1 497 ? 28.470 30.180 198.390 1.00 15.00 ? 529 PHE A CE2 1 
ATOM   4065 C  CZ  . PHE A 1 497 ? 29.380 29.770 197.440 1.00 15.00 ? 529 PHE A CZ  1 
ATOM   4066 N  N   . SER A 1 498 ? 31.240 33.840 203.210 1.00 15.00 ? 530 SER A N   1 
ATOM   4067 C  CA  . SER A 1 498 ? 31.580 35.020 203.950 1.00 15.00 ? 530 SER A CA  1 
ATOM   4068 C  C   . SER A 1 498 ? 32.770 34.900 204.890 1.00 15.00 ? 530 SER A C   1 
ATOM   4069 O  O   . SER A 1 498 ? 33.660 35.750 204.860 1.00 15.00 ? 530 SER A O   1 
ATOM   4070 C  CB  . SER A 1 498 ? 30.390 35.490 204.740 1.00 15.00 ? 530 SER A CB  1 
ATOM   4071 O  OG  . SER A 1 498 ? 30.110 36.840 204.360 1.00 15.00 ? 530 SER A OG  1 
ATOM   4072 N  N   . LEU A 1 499 ? 32.880 33.840 205.690 1.00 15.00 ? 531 LEU A N   1 
ATOM   4073 C  CA  . LEU A 1 499 ? 34.000 33.720 206.610 1.00 15.00 ? 531 LEU A CA  1 
ATOM   4074 C  C   . LEU A 1 499 ? 35.330 33.420 205.950 1.00 15.00 ? 531 LEU A C   1 
ATOM   4075 O  O   . LEU A 1 499 ? 36.350 33.890 206.440 1.00 15.00 ? 531 LEU A O   1 
ATOM   4076 C  CB  . LEU A 1 499 ? 33.640 32.670 207.640 1.00 15.00 ? 531 LEU A CB  1 
ATOM   4077 C  CG  . LEU A 1 499 ? 32.550 33.130 208.610 1.00 15.00 ? 531 LEU A CG  1 
ATOM   4078 C  CD1 . LEU A 1 499 ? 32.310 32.060 209.620 1.00 15.00 ? 531 LEU A CD1 1 
ATOM   4079 C  CD2 . LEU A 1 499 ? 32.960 34.380 209.370 1.00 15.00 ? 531 LEU A CD2 1 
ATOM   4080 N  N   . LYS A 1 500 ? 35.360 32.740 204.820 1.00 15.00 ? 532 LYS A N   1 
ATOM   4081 C  CA  . LYS A 1 500 ? 36.600 32.550 204.100 1.00 15.00 ? 532 LYS A CA  1 
ATOM   4082 C  C   . LYS A 1 500 ? 37.020 33.900 203.570 1.00 15.00 ? 532 LYS A C   1 
ATOM   4083 O  O   . LYS A 1 500 ? 38.170 34.260 203.740 1.00 15.00 ? 532 LYS A O   1 
ATOM   4084 C  CB  . LYS A 1 500 ? 36.450 31.640 202.910 1.00 15.00 ? 532 LYS A CB  1 
ATOM   4085 C  CG  . LYS A 1 500 ? 37.780 31.270 202.240 1.00 15.00 ? 532 LYS A CG  1 
ATOM   4086 C  CD  . LYS A 1 500 ? 38.640 30.390 203.140 1.00 15.00 ? 532 LYS A CD  1 
ATOM   4087 C  CE  . LYS A 1 500 ? 39.740 29.670 202.370 1.00 15.00 ? 532 LYS A CE  1 
ATOM   4088 N  NZ  . LYS A 1 500 ? 40.270 28.530 203.110 1.00 15.00 ? 532 LYS A NZ  1 
ATOM   4089 N  N   . GLY A 1 501 ? 36.160 34.710 202.960 1.00 15.00 ? 533 GLY A N   1 
ATOM   4090 C  CA  . GLY A 1 501 ? 36.560 36.010 202.450 1.00 15.00 ? 533 GLY A CA  1 
ATOM   4091 C  C   . GLY A 1 501 ? 37.120 36.980 203.480 1.00 15.00 ? 533 GLY A C   1 
ATOM   4092 O  O   . GLY A 1 501 ? 37.900 37.900 203.200 1.00 15.00 ? 533 GLY A O   1 
ATOM   4093 N  N   . LEU A 1 502 ? 36.640 36.800 204.700 1.00 15.00 ? 534 LEU A N   1 
ATOM   4094 C  CA  . LEU A 1 502 ? 37.060 37.620 205.800 1.00 15.00 ? 534 LEU A CA  1 
ATOM   4095 C  C   . LEU A 1 502 ? 38.350 37.090 206.340 1.00 15.00 ? 534 LEU A C   1 
ATOM   4096 O  O   . LEU A 1 502 ? 39.360 37.780 206.260 1.00 15.00 ? 534 LEU A O   1 
ATOM   4097 C  CB  . LEU A 1 502 ? 35.970 37.610 206.830 1.00 15.00 ? 534 LEU A CB  1 
ATOM   4098 C  CG  . LEU A 1 502 ? 35.040 38.810 206.880 1.00 15.00 ? 534 LEU A CG  1 
ATOM   4099 C  CD1 . LEU A 1 502 ? 34.610 39.300 205.530 1.00 15.00 ? 534 LEU A CD1 1 
ATOM   4100 C  CD2 . LEU A 1 502 ? 33.830 38.380 207.620 1.00 15.00 ? 534 LEU A CD2 1 
ATOM   4101 N  N   . LEU A 1 503 ? 38.380 35.860 206.820 1.00 15.00 ? 535 LEU A N   1 
ATOM   4102 C  CA  . LEU A 1 503 ? 39.610 35.390 207.380 1.00 15.00 ? 535 LEU A CA  1 
ATOM   4103 C  C   . LEU A 1 503 ? 40.670 34.950 206.420 1.00 15.00 ? 535 LEU A C   1 
ATOM   4104 O  O   . LEU A 1 503 ? 41.840 34.860 206.750 1.00 15.00 ? 535 LEU A O   1 
ATOM   4105 C  CB  . LEU A 1 503 ? 39.260 34.320 208.340 1.00 15.00 ? 535 LEU A CB  1 
ATOM   4106 C  CG  . LEU A 1 503 ? 38.970 35.130 209.550 1.00 15.00 ? 535 LEU A CG  1 
ATOM   4107 C  CD1 . LEU A 1 503 ? 37.560 34.850 209.940 1.00 15.00 ? 535 LEU A CD1 1 
ATOM   4108 C  CD2 . LEU A 1 503 ? 40.010 34.880 210.620 1.00 15.00 ? 535 LEU A CD2 1 
ATOM   4109 N  N   . GLY A 1 504 ? 40.330 34.800 205.180 1.00 15.00 ? 536 GLY A N   1 
ATOM   4110 C  CA  . GLY A 1 504 ? 41.300 34.460 204.170 1.00 15.00 ? 536 GLY A CA  1 
ATOM   4111 C  C   . GLY A 1 504 ? 41.900 35.740 203.630 1.00 15.00 ? 536 GLY A C   1 
ATOM   4112 O  O   . GLY A 1 504 ? 42.320 35.820 202.480 1.00 15.00 ? 536 GLY A O   1 
ATOM   4113 N  N   . ASN A 1 505 ? 41.970 36.790 204.440 1.00 15.00 ? 537 ASN A N   1 
ATOM   4114 C  CA  . ASN A 1 505 ? 42.470 38.050 203.950 1.00 15.00 ? 537 ASN A CA  1 
ATOM   4115 C  C   . ASN A 1 505 ? 43.930 38.030 204.350 1.00 15.00 ? 537 ASN A C   1 
ATOM   4116 O  O   . ASN A 1 505 ? 44.170 37.690 205.510 1.00 15.00 ? 537 ASN A O   1 
ATOM   4117 C  CB  . ASN A 1 505 ? 41.750 39.200 204.640 1.00 15.00 ? 537 ASN A CB  1 
ATOM   4118 C  CG  . ASN A 1 505 ? 42.190 40.530 204.080 1.00 15.00 ? 537 ASN A CG  1 
ATOM   4119 O  OD1 . ASN A 1 505 ? 43.350 40.900 204.150 1.00 15.00 ? 537 ASN A OD1 1 
ATOM   4120 N  ND2 . ASN A 1 505 ? 41.320 41.300 203.490 1.00 15.00 ? 537 ASN A ND2 1 
ATOM   4121 N  N   . PRO A 1 506 ? 44.940 38.380 203.550 1.00 15.00 ? 538 PRO A N   1 
ATOM   4122 C  CA  . PRO A 1 506 ? 46.340 38.320 203.910 1.00 15.00 ? 538 PRO A CA  1 
ATOM   4123 C  C   . PRO A 1 506 ? 46.650 38.940 205.250 1.00 15.00 ? 538 PRO A C   1 
ATOM   4124 O  O   . PRO A 1 506 ? 47.480 38.420 205.980 1.00 15.00 ? 538 PRO A O   1 
ATOM   4125 C  CB  . PRO A 1 506 ? 47.030 39.000 202.800 1.00 15.00 ? 538 PRO A CB  1 
ATOM   4126 C  CG  . PRO A 1 506 ? 45.980 39.920 202.310 1.00 15.00 ? 538 PRO A CG  1 
ATOM   4127 C  CD  . PRO A 1 506 ? 44.820 38.970 202.240 1.00 15.00 ? 538 PRO A CD  1 
ATOM   4128 N  N   . ILE A 1 507 ? 45.960 40.010 205.630 1.00 15.00 ? 539 ILE A N   1 
ATOM   4129 C  CA  . ILE A 1 507 ? 46.160 40.650 206.900 1.00 15.00 ? 539 ILE A CA  1 
ATOM   4130 C  C   . ILE A 1 507 ? 46.030 39.700 208.060 1.00 15.00 ? 539 ILE A C   1 
ATOM   4131 O  O   . ILE A 1 507 ? 46.760 39.810 209.030 1.00 15.00 ? 539 ILE A O   1 
ATOM   4132 C  CB  . ILE A 1 507 ? 45.150 41.830 206.960 1.00 15.00 ? 539 ILE A CB  1 
ATOM   4133 C  CG1 . ILE A 1 507 ? 46.060 43.010 206.900 1.00 15.00 ? 539 ILE A CG1 1 
ATOM   4134 C  CG2 . ILE A 1 507 ? 44.200 41.910 208.160 1.00 15.00 ? 539 ILE A CG2 1 
ATOM   4135 C  CD1 . ILE A 1 507 ? 46.610 43.260 205.490 1.00 15.00 ? 539 ILE A CD1 1 
ATOM   4136 N  N   . CYS A 1 508 ? 45.140 38.720 207.970 1.00 15.00 ? 540 CYS A N   1 
ATOM   4137 C  CA  . CYS A 1 508 ? 44.940 37.770 209.030 1.00 15.00 ? 540 CYS A CA  1 
ATOM   4138 C  C   . CYS A 1 508 ? 46.030 36.740 209.070 1.00 15.00 ? 540 CYS A C   1 
ATOM   4139 O  O   . CYS A 1 508 ? 45.980 35.870 209.940 1.00 15.00 ? 540 CYS A O   1 
ATOM   4140 C  CB  . CYS A 1 508 ? 43.660 37.040 208.840 1.00 15.00 ? 540 CYS A CB  1 
ATOM   4141 S  SG  . CYS A 1 508 ? 42.280 38.170 208.900 1.00 15.00 ? 540 CYS A SG  1 
ATOM   4142 N  N   . SER A 1 509 ? 47.010 36.760 208.160 1.00 15.00 ? 541 SER A N   1 
ATOM   4143 C  CA  . SER A 1 509 ? 47.980 35.700 208.150 1.00 15.00 ? 541 SER A CA  1 
ATOM   4144 C  C   . SER A 1 509 ? 48.980 35.940 209.260 1.00 15.00 ? 541 SER A C   1 
ATOM   4145 O  O   . SER A 1 509 ? 49.220 37.100 209.600 1.00 15.00 ? 541 SER A O   1 
ATOM   4146 C  CB  . SER A 1 509 ? 48.660 35.660 206.810 1.00 15.00 ? 541 SER A CB  1 
ATOM   4147 O  OG  . SER A 1 509 ? 49.510 36.760 206.590 1.00 15.00 ? 541 SER A OG  1 
ATOM   4148 N  N   . PRO A 1 510 ? 49.620 34.910 209.840 1.00 15.00 ? 542 PRO A N   1 
ATOM   4149 C  CA  . PRO A 1 510 ? 50.630 35.060 210.870 1.00 15.00 ? 542 PRO A CA  1 
ATOM   4150 C  C   . PRO A 1 510 ? 51.730 35.970 210.380 1.00 15.00 ? 542 PRO A C   1 
ATOM   4151 O  O   . PRO A 1 510 ? 52.300 36.750 211.140 1.00 15.00 ? 542 PRO A O   1 
ATOM   4152 C  CB  . PRO A 1 510 ? 51.100 33.670 211.110 1.00 15.00 ? 542 PRO A CB  1 
ATOM   4153 C  CG  . PRO A 1 510 ? 49.950 32.820 210.710 1.00 15.00 ? 542 PRO A CG  1 
ATOM   4154 C  CD  . PRO A 1 510 ? 49.530 33.520 209.450 1.00 15.00 ? 542 PRO A CD  1 
ATOM   4155 N  N   . GLU A 1 511 ? 52.000 35.910 209.070 1.00 15.00 ? 543 GLU A N   1 
ATOM   4156 C  CA  . GLU A 1 511 ? 53.000 36.750 208.480 1.00 15.00 ? 543 GLU A CA  1 
ATOM   4157 C  C   . GLU A 1 511 ? 52.660 38.230 208.600 1.00 15.00 ? 543 GLU A C   1 
ATOM   4158 O  O   . GLU A 1 511 ? 53.560 39.040 208.760 1.00 15.00 ? 543 GLU A O   1 
ATOM   4159 C  CB  . GLU A 1 511 ? 53.140 36.330 207.030 1.00 15.00 ? 543 GLU A CB  1 
ATOM   4160 C  CG  . GLU A 1 511 ? 54.280 37.010 206.290 1.00 15.00 ? 543 GLU A CG  1 
ATOM   4161 C  CD  . GLU A 1 511 ? 55.580 36.790 207.020 1.00 15.00 ? 543 GLU A CD  1 
ATOM   4162 O  OE1 . GLU A 1 511 ? 56.000 35.630 207.120 1.00 15.00 ? 543 GLU A OE1 1 
ATOM   4163 O  OE2 . GLU A 1 511 ? 56.150 37.760 207.520 1.00 15.00 ? 543 GLU A OE2 1 
ATOM   4164 N  N   . TYR A 1 512 ? 51.400 38.620 208.540 1.00 15.00 ? 544 TYR A N   1 
ATOM   4165 C  CA  . TYR A 1 512 ? 51.060 40.020 208.510 1.00 15.00 ? 544 TYR A CA  1 
ATOM   4166 C  C   . TYR A 1 512 ? 50.490 40.530 209.790 1.00 15.00 ? 544 TYR A C   1 
ATOM   4167 O  O   . TYR A 1 512 ? 50.670 41.700 210.070 1.00 15.00 ? 544 TYR A O   1 
ATOM   4168 C  CB  . TYR A 1 512 ? 50.040 40.340 207.470 1.00 15.00 ? 544 TYR A CB  1 
ATOM   4169 C  CG  . TYR A 1 512 ? 50.430 40.330 206.010 1.00 15.00 ? 544 TYR A CG  1 
ATOM   4170 C  CD1 . TYR A 1 512 ? 51.570 39.720 205.540 1.00 15.00 ? 544 TYR A CD1 1 
ATOM   4171 C  CD2 . TYR A 1 512 ? 49.590 40.970 205.150 1.00 15.00 ? 544 TYR A CD2 1 
ATOM   4172 C  CE1 . TYR A 1 512 ? 51.860 39.770 204.200 1.00 15.00 ? 544 TYR A CE1 1 
ATOM   4173 C  CE2 . TYR A 1 512 ? 49.880 41.010 203.810 1.00 15.00 ? 544 TYR A CE2 1 
ATOM   4174 C  CZ  . TYR A 1 512 ? 51.010 40.420 203.350 1.00 15.00 ? 544 TYR A CZ  1 
ATOM   4175 O  OH  . TYR A 1 512 ? 51.300 40.530 202.010 1.00 15.00 ? 544 TYR A OH  1 
ATOM   4176 N  N   . TRP A 1 513 ? 49.760 39.750 210.560 1.00 15.00 ? 545 TRP A N   1 
ATOM   4177 C  CA  . TRP A 1 513 ? 49.080 40.290 211.710 1.00 15.00 ? 545 TRP A CA  1 
ATOM   4178 C  C   . TRP A 1 513 ? 50.040 40.420 212.860 1.00 15.00 ? 545 TRP A C   1 
ATOM   4179 O  O   . TRP A 1 513 ? 50.060 39.640 213.820 1.00 15.00 ? 545 TRP A O   1 
ATOM   4180 C  CB  . TRP A 1 513 ? 47.920 39.390 212.060 1.00 15.00 ? 545 TRP A CB  1 
ATOM   4181 C  CG  . TRP A 1 513 ? 46.720 40.140 212.640 1.00 15.00 ? 545 TRP A CG  1 
ATOM   4182 C  CD1 . TRP A 1 513 ? 45.940 41.080 211.950 1.00 15.00 ? 545 TRP A CD1 1 
ATOM   4183 C  CD2 . TRP A 1 513 ? 46.260 39.960 213.890 1.00 15.00 ? 545 TRP A CD2 1 
ATOM   4184 N  NE1 . TRP A 1 513 ? 44.990 41.460 212.790 1.00 15.00 ? 545 TRP A NE1 1 
ATOM   4185 C  CE2 . TRP A 1 513 ? 45.170 40.810 213.930 1.00 15.00 ? 545 TRP A CE2 1 
ATOM   4186 C  CE3 . TRP A 1 513 ? 46.690 39.170 214.920 1.00 15.00 ? 545 TRP A CE3 1 
ATOM   4187 C  CZ2 . TRP A 1 513 ? 44.420 40.900 215.060 1.00 15.00 ? 545 TRP A CZ2 1 
ATOM   4188 C  CZ3 . TRP A 1 513 ? 45.940 39.260 216.060 1.00 15.00 ? 545 TRP A CZ3 1 
ATOM   4189 C  CH2 . TRP A 1 513 ? 44.830 40.100 216.120 1.00 15.00 ? 545 TRP A CH2 1 
ATOM   4190 N  N   . LYS A 1 514 ? 50.850 41.440 212.720 1.00 15.00 ? 546 LYS A N   1 
ATOM   4191 C  CA  . LYS A 1 514 ? 51.910 41.800 213.640 1.00 15.00 ? 546 LYS A CA  1 
ATOM   4192 C  C   . LYS A 1 514 ? 51.660 43.270 213.820 1.00 15.00 ? 546 LYS A C   1 
ATOM   4193 O  O   . LYS A 1 514 ? 51.170 43.930 212.910 1.00 15.00 ? 546 LYS A O   1 
ATOM   4194 C  CB  . LYS A 1 514 ? 53.290 41.690 213.050 1.00 15.00 ? 546 LYS A CB  1 
ATOM   4195 C  CG  . LYS A 1 514 ? 53.780 40.340 212.570 1.00 15.00 ? 546 LYS A CG  1 
ATOM   4196 C  CD  . LYS A 1 514 ? 55.040 40.640 211.770 1.00 15.00 ? 546 LYS A CD  1 
ATOM   4197 C  CE  . LYS A 1 514 ? 55.610 39.400 211.100 1.00 15.00 ? 546 LYS A CE  1 
ATOM   4198 N  NZ  . LYS A 1 514 ? 56.170 38.490 212.070 1.00 15.00 ? 546 LYS A NZ  1 
ATOM   4199 N  N   . ALA A 1 515 ? 52.060 43.860 214.940 1.00 15.00 ? 547 ALA A N   1 
ATOM   4200 C  CA  . ALA A 1 515 ? 51.810 45.270 215.170 1.00 15.00 ? 547 ALA A CA  1 
ATOM   4201 C  C   . ALA A 1 515 ? 52.480 46.210 214.200 1.00 15.00 ? 547 ALA A C   1 
ATOM   4202 O  O   . ALA A 1 515 ? 51.950 47.270 213.880 1.00 15.00 ? 547 ALA A O   1 
ATOM   4203 C  CB  . ALA A 1 515 ? 52.260 45.650 216.560 1.00 15.00 ? 547 ALA A CB  1 
ATOM   4204 N  N   . SER A 1 516 ? 53.630 45.850 213.670 1.00 15.00 ? 548 SER A N   1 
ATOM   4205 C  CA  . SER A 1 516 ? 54.370 46.730 212.780 1.00 15.00 ? 548 SER A CA  1 
ATOM   4206 C  C   . SER A 1 516 ? 53.670 47.010 211.470 1.00 15.00 ? 548 SER A C   1 
ATOM   4207 O  O   . SER A 1 516 ? 53.820 48.110 210.940 1.00 15.00 ? 548 SER A O   1 
ATOM   4208 C  CB  . SER A 1 516 ? 55.720 46.130 212.510 1.00 15.00 ? 548 SER A CB  1 
ATOM   4209 O  OG  . SER A 1 516 ? 55.530 44.750 212.250 1.00 15.00 ? 548 SER A OG  1 
ATOM   4210 N  N   . THR A 1 517 ? 52.900 46.040 210.980 1.00 15.00 ? 549 THR A N   1 
ATOM   4211 C  CA  . THR A 1 517 ? 52.140 46.150 209.740 1.00 15.00 ? 549 THR A CA  1 
ATOM   4212 C  C   . THR A 1 517 ? 51.270 47.390 209.760 1.00 15.00 ? 549 THR A C   1 
ATOM   4213 O  O   . THR A 1 517 ? 51.230 48.180 208.830 1.00 15.00 ? 549 THR A O   1 
ATOM   4214 C  CB  . THR A 1 517 ? 51.320 44.880 209.650 1.00 15.00 ? 549 THR A CB  1 
ATOM   4215 O  OG1 . THR A 1 517 ? 52.280 43.850 209.870 1.00 15.00 ? 549 THR A OG1 1 
ATOM   4216 C  CG2 . THR A 1 517 ? 50.610 44.690 208.350 1.00 15.00 ? 549 THR A CG2 1 
ATOM   4217 N  N   . PHE A 1 518 ? 50.700 47.580 210.950 1.00 15.00 ? 550 PHE A N   1 
ATOM   4218 C  CA  . PHE A 1 518 ? 49.800 48.670 211.210 1.00 15.00 ? 550 PHE A CA  1 
ATOM   4219 C  C   . PHE A 1 518 ? 50.490 49.920 211.700 1.00 15.00 ? 550 PHE A C   1 
ATOM   4220 O  O   . PHE A 1 518 ? 49.860 50.960 211.890 1.00 15.00 ? 550 PHE A O   1 
ATOM   4221 C  CB  . PHE A 1 518 ? 48.800 48.160 212.200 1.00 15.00 ? 550 PHE A CB  1 
ATOM   4222 C  CG  . PHE A 1 518 ? 47.970 47.070 211.580 1.00 15.00 ? 550 PHE A CG  1 
ATOM   4223 C  CD1 . PHE A 1 518 ? 47.020 47.370 210.630 1.00 15.00 ? 550 PHE A CD1 1 
ATOM   4224 C  CD2 . PHE A 1 518 ? 48.180 45.760 211.950 1.00 15.00 ? 550 PHE A CD2 1 
ATOM   4225 C  CE1 . PHE A 1 518 ? 46.310 46.350 210.040 1.00 15.00 ? 550 PHE A CE1 1 
ATOM   4226 C  CE2 . PHE A 1 518 ? 47.460 44.740 211.360 1.00 15.00 ? 550 PHE A CE2 1 
ATOM   4227 C  CZ  . PHE A 1 518 ? 46.520 45.040 210.410 1.00 15.00 ? 550 PHE A CZ  1 
ATOM   4228 N  N   . GLY A 1 519 ? 51.790 49.860 211.910 1.00 15.00 ? 551 GLY A N   1 
ATOM   4229 C  CA  . GLY A 1 519 ? 52.570 51.010 212.370 1.00 15.00 ? 551 GLY A CA  1 
ATOM   4230 C  C   . GLY A 1 519 ? 52.700 51.070 213.880 1.00 15.00 ? 551 GLY A C   1 
ATOM   4231 O  O   . GLY A 1 519 ? 52.660 52.140 214.490 1.00 15.00 ? 551 GLY A O   1 
ATOM   4232 N  N   . GLY A 1 520 ? 52.830 49.940 214.540 1.00 15.00 ? 552 GLY A N   1 
ATOM   4233 C  CA  . GLY A 1 520 ? 53.030 49.940 215.970 1.00 15.00 ? 552 GLY A CA  1 
ATOM   4234 C  C   . GLY A 1 520 ? 51.720 49.810 216.690 1.00 15.00 ? 552 GLY A C   1 
ATOM   4235 O  O   . GLY A 1 520 ? 50.680 49.810 216.040 1.00 15.00 ? 552 GLY A O   1 
ATOM   4236 N  N   . GLU A 1 521 ? 51.710 49.710 218.010 1.00 15.00 ? 553 GLU A N   1 
ATOM   4237 C  CA  . GLU A 1 521 ? 50.480 49.530 218.770 1.00 15.00 ? 553 GLU A CA  1 
ATOM   4238 C  C   . GLU A 1 521 ? 49.340 50.460 218.420 1.00 15.00 ? 553 GLU A C   1 
ATOM   4239 O  O   . GLU A 1 521 ? 48.200 50.020 218.360 1.00 15.00 ? 553 GLU A O   1 
ATOM   4240 C  CB  . GLU A 1 521 ? 50.700 49.710 220.250 1.00 15.00 ? 553 GLU A CB  1 
ATOM   4241 C  CG  . GLU A 1 521 ? 51.680 48.760 220.920 1.00 15.00 ? 553 GLU A CG  1 
ATOM   4242 C  CD  . GLU A 1 521 ? 51.310 47.270 220.910 1.00 15.00 ? 553 GLU A CD  1 
ATOM   4243 O  OE1 . GLU A 1 521 ? 50.110 46.930 220.930 1.00 15.00 ? 553 GLU A OE1 1 
ATOM   4244 O  OE2 . GLU A 1 521 ? 52.260 46.460 220.900 1.00 15.00 ? 553 GLU A OE2 1 
ATOM   4245 N  N   . VAL A 1 522 ? 49.620 51.730 218.130 1.00 15.00 ? 554 VAL A N   1 
ATOM   4246 C  CA  . VAL A 1 522 ? 48.640 52.760 217.800 1.00 15.00 ? 554 VAL A CA  1 
ATOM   4247 C  C   . VAL A 1 522 ? 47.730 52.270 216.710 1.00 15.00 ? 554 VAL A C   1 
ATOM   4248 O  O   . VAL A 1 522 ? 46.530 52.110 216.920 1.00 15.00 ? 554 VAL A O   1 
ATOM   4249 C  CB  . VAL A 1 522 ? 49.330 54.060 217.300 1.00 15.00 ? 554 VAL A CB  1 
ATOM   4250 C  CG1 . VAL A 1 522 ? 48.250 55.100 217.040 1.00 15.00 ? 554 VAL A CG1 1 
ATOM   4251 C  CG2 . VAL A 1 522 ? 50.350 54.570 218.310 1.00 15.00 ? 554 VAL A CG2 1 
ATOM   4252 N  N   . GLY A 1 523 ? 48.350 51.950 215.580 1.00 15.00 ? 555 GLY A N   1 
ATOM   4253 C  CA  . GLY A 1 523 ? 47.620 51.510 214.430 1.00 15.00 ? 555 GLY A CA  1 
ATOM   4254 C  C   . GLY A 1 523 ? 46.920 50.210 214.730 1.00 15.00 ? 555 GLY A C   1 
ATOM   4255 O  O   . GLY A 1 523 ? 45.700 50.080 214.570 1.00 15.00 ? 555 GLY A O   1 
ATOM   4256 N  N   . PHE A 1 524 ? 47.670 49.280 215.300 1.00 15.00 ? 556 PHE A N   1 
ATOM   4257 C  CA  . PHE A 1 524 ? 47.160 47.960 215.570 1.00 15.00 ? 556 PHE A CA  1 
ATOM   4258 C  C   . PHE A 1 524 ? 45.980 47.970 216.510 1.00 15.00 ? 556 PHE A C   1 
ATOM   4259 O  O   . PHE A 1 524 ? 45.040 47.190 216.350 1.00 15.00 ? 556 PHE A O   1 
ATOM   4260 C  CB  . PHE A 1 524 ? 48.260 47.130 216.160 1.00 15.00 ? 556 PHE A CB  1 
ATOM   4261 C  CG  . PHE A 1 524 ? 48.040 45.640 216.070 1.00 15.00 ? 556 PHE A CG  1 
ATOM   4262 C  CD1 . PHE A 1 524 ? 47.400 45.090 214.990 1.00 15.00 ? 556 PHE A CD1 1 
ATOM   4263 C  CD2 . PHE A 1 524 ? 48.520 44.840 217.080 1.00 15.00 ? 556 PHE A CD2 1 
ATOM   4264 C  CE1 . PHE A 1 524 ? 47.260 43.730 214.890 1.00 15.00 ? 556 PHE A CE1 1 
ATOM   4265 C  CE2 . PHE A 1 524 ? 48.370 43.480 216.970 1.00 15.00 ? 556 PHE A CE2 1 
ATOM   4266 C  CZ  . PHE A 1 524 ? 47.740 42.930 215.890 1.00 15.00 ? 556 PHE A CZ  1 
ATOM   4267 N  N   . ASN A 1 525 ? 45.940 48.880 217.460 1.00 15.00 ? 557 ASN A N   1 
ATOM   4268 C  CA  . ASN A 1 525 ? 44.830 48.940 218.380 1.00 15.00 ? 557 ASN A CA  1 
ATOM   4269 C  C   . ASN A 1 525 ? 43.640 49.560 217.710 1.00 15.00 ? 557 ASN A C   1 
ATOM   4270 O  O   . ASN A 1 525 ? 42.530 49.120 218.020 1.00 15.00 ? 557 ASN A O   1 
ATOM   4271 C  CB  . ASN A 1 525 ? 45.150 49.760 219.590 1.00 15.00 ? 557 ASN A CB  1 
ATOM   4272 C  CG  . ASN A 1 525 ? 45.930 48.920 220.600 1.00 15.00 ? 557 ASN A CG  1 
ATOM   4273 O  OD1 . ASN A 1 525 ? 45.820 49.170 221.800 1.00 15.00 ? 557 ASN A OD1 1 
ATOM   4274 N  ND2 . ASN A 1 525 ? 46.770 47.950 220.250 1.00 15.00 ? 557 ASN A ND2 1 
ATOM   4275 N  N   . LEU A 1 526 ? 43.830 50.480 216.740 1.00 15.00 ? 558 LEU A N   1 
ATOM   4276 C  CA  . LEU A 1 526 ? 42.720 51.030 216.010 1.00 15.00 ? 558 LEU A CA  1 
ATOM   4277 C  C   . LEU A 1 526 ? 41.990 49.880 215.320 1.00 15.00 ? 558 LEU A C   1 
ATOM   4278 O  O   . LEU A 1 526 ? 40.770 49.830 215.440 1.00 15.00 ? 558 LEU A O   1 
ATOM   4279 C  CB  . LEU A 1 526 ? 43.190 52.030 214.980 1.00 15.00 ? 558 LEU A CB  1 
ATOM   4280 C  CG  . LEU A 1 526 ? 43.970 53.230 215.480 1.00 15.00 ? 558 LEU A CG  1 
ATOM   4281 C  CD1 . LEU A 1 526 ? 44.330 54.100 214.330 1.00 15.00 ? 558 LEU A CD1 1 
ATOM   4282 C  CD2 . LEU A 1 526 ? 43.140 54.080 216.410 1.00 15.00 ? 558 LEU A CD2 1 
ATOM   4283 N  N   . VAL A 1 527 ? 42.640 48.870 214.710 1.00 15.00 ? 559 VAL A N   1 
ATOM   4284 C  CA  . VAL A 1 527 ? 41.870 47.790 214.100 1.00 15.00 ? 559 VAL A CA  1 
ATOM   4285 C  C   . VAL A 1 527 ? 41.310 46.920 215.190 1.00 15.00 ? 559 VAL A C   1 
ATOM   4286 O  O   . VAL A 1 527 ? 40.210 46.440 215.070 1.00 15.00 ? 559 VAL A O   1 
ATOM   4287 C  CB  . VAL A 1 527 ? 42.680 46.850 213.100 1.00 15.00 ? 559 VAL A CB  1 
ATOM   4288 C  CG1 . VAL A 1 527 ? 43.620 47.690 212.270 1.00 15.00 ? 559 VAL A CG1 1 
ATOM   4289 C  CG2 . VAL A 1 527 ? 43.480 45.780 213.790 1.00 15.00 ? 559 VAL A CG2 1 
ATOM   4290 N  N   . LYS A 1 528 ? 42.000 46.740 216.300 1.00 15.00 ? 560 LYS A N   1 
ATOM   4291 C  CA  . LYS A 1 528 ? 41.530 45.870 217.360 1.00 15.00 ? 560 LYS A CA  1 
ATOM   4292 C  C   . LYS A 1 528 ? 40.390 46.340 218.220 1.00 15.00 ? 560 LYS A C   1 
ATOM   4293 O  O   . LYS A 1 528 ? 39.890 45.580 219.040 1.00 15.00 ? 560 LYS A O   1 
ATOM   4294 C  CB  . LYS A 1 528 ? 42.690 45.550 218.250 1.00 15.00 ? 560 LYS A CB  1 
ATOM   4295 C  CG  . LYS A 1 528 ? 43.560 44.430 217.720 1.00 15.00 ? 560 LYS A CG  1 
ATOM   4296 C  CD  . LYS A 1 528 ? 44.770 44.400 218.620 1.00 15.00 ? 560 LYS A CD  1 
ATOM   4297 C  CE  . LYS A 1 528 ? 45.330 43.000 218.620 1.00 15.00 ? 560 LYS A CE  1 
ATOM   4298 N  NZ  . LYS A 1 528 ? 46.530 42.980 219.430 1.00 15.00 ? 560 LYS A NZ  1 
ATOM   4299 N  N   . THR A 1 529 ? 40.020 47.610 218.130 1.00 15.00 ? 561 THR A N   1 
ATOM   4300 C  CA  . THR A 1 529 ? 38.890 48.080 218.880 1.00 15.00 ? 561 THR A CA  1 
ATOM   4301 C  C   . THR A 1 529 ? 37.890 48.790 217.990 1.00 15.00 ? 561 THR A C   1 
ATOM   4302 O  O   . THR A 1 529 ? 36.990 49.440 218.510 1.00 15.00 ? 561 THR A O   1 
ATOM   4303 C  CB  . THR A 1 529 ? 39.370 49.040 220.000 1.00 15.00 ? 561 THR A CB  1 
ATOM   4304 O  OG1 . THR A 1 529 ? 40.410 49.870 219.510 1.00 15.00 ? 561 THR A OG1 1 
ATOM   4305 C  CG2 . THR A 1 529 ? 39.830 48.250 221.200 1.00 15.00 ? 561 THR A CG2 1 
ATOM   4306 N  N   . ALA A 1 530 ? 37.980 48.680 216.660 1.00 15.00 ? 562 ALA A N   1 
ATOM   4307 C  CA  . ALA A 1 530 ? 37.110 49.400 215.750 1.00 15.00 ? 562 ALA A CA  1 
ATOM   4308 C  C   . ALA A 1 530 ? 35.660 49.110 216.060 1.00 15.00 ? 562 ALA A C   1 
ATOM   4309 O  O   . ALA A 1 530 ? 35.320 47.980 216.430 1.00 15.00 ? 562 ALA A O   1 
ATOM   4310 C  CB  . ALA A 1 530 ? 37.380 48.990 214.320 1.00 15.00 ? 562 ALA A CB  1 
ATOM   4311 N  N   . THR A 1 531 ? 34.790 50.110 215.990 1.00 15.00 ? 563 THR A N   1 
ATOM   4312 C  CA  . THR A 1 531 ? 33.400 49.920 216.320 1.00 15.00 ? 563 THR A CA  1 
ATOM   4313 C  C   . THR A 1 531 ? 32.610 50.860 215.460 1.00 15.00 ? 563 THR A C   1 
ATOM   4314 O  O   . THR A 1 531 ? 33.080 51.970 215.230 1.00 15.00 ? 563 THR A O   1 
ATOM   4315 C  CB  . THR A 1 531 ? 33.260 50.190 217.820 1.00 15.00 ? 563 THR A CB  1 
ATOM   4316 O  OG1 . THR A 1 531 ? 33.270 48.850 218.300 1.00 15.00 ? 563 THR A OG1 1 
ATOM   4317 C  CG2 . THR A 1 531 ? 32.040 50.940 218.350 1.00 15.00 ? 563 THR A CG2 1 
ATOM   4318 N  N   . LEU A 1 532 ? 31.400 50.460 215.050 1.00 15.00 ? 564 LEU A N   1 
ATOM   4319 C  CA  . LEU A 1 532 ? 30.610 51.250 214.120 1.00 15.00 ? 564 LEU A CA  1 
ATOM   4320 C  C   . LEU A 1 532 ? 30.370 52.620 214.720 1.00 15.00 ? 564 LEU A C   1 
ATOM   4321 O  O   . LEU A 1 532 ? 30.620 53.620 214.050 1.00 15.00 ? 564 LEU A O   1 
ATOM   4322 C  CB  . LEU A 1 532 ? 29.280 50.610 213.820 1.00 15.00 ? 564 LEU A CB  1 
ATOM   4323 C  CG  . LEU A 1 532 ? 28.390 51.400 212.870 1.00 15.00 ? 564 LEU A CG  1 
ATOM   4324 C  CD1 . LEU A 1 532 ? 29.020 51.540 211.490 1.00 15.00 ? 564 LEU A CD1 1 
ATOM   4325 C  CD2 . LEU A 1 532 ? 27.070 50.690 212.780 1.00 15.00 ? 564 LEU A CD2 1 
ATOM   4326 N  N   . LYS A 1 533 ? 29.990 52.620 216.000 1.00 15.00 ? 565 LYS A N   1 
ATOM   4327 C  CA  . LYS A 1 533 ? 29.820 53.890 216.680 1.00 15.00 ? 565 LYS A CA  1 
ATOM   4328 C  C   . LYS A 1 533 ? 31.130 54.680 216.600 1.00 15.00 ? 565 LYS A C   1 
ATOM   4329 O  O   . LYS A 1 533 ? 31.110 55.820 216.150 1.00 15.00 ? 565 LYS A O   1 
ATOM   4330 C  CB  . LYS A 1 533 ? 29.450 53.680 218.130 1.00 15.00 ? 565 LYS A CB  1 
ATOM   4331 C  CG  . LYS A 1 533 ? 29.000 55.000 218.730 1.00 15.00 ? 565 LYS A CG  1 
ATOM   4332 C  CD  . LYS A 1 533 ? 28.610 54.860 220.190 1.00 15.00 ? 565 LYS A CD  1 
ATOM   4333 C  CE  . LYS A 1 533 ? 27.440 55.830 220.450 1.00 15.00 ? 565 LYS A CE  1 
ATOM   4334 N  NZ  . LYS A 1 533 ? 26.990 55.830 221.850 1.00 15.00 ? 565 LYS A NZ  1 
ATOM   4335 N  N   . LYS A 1 534 ? 32.290 54.100 216.890 1.00 15.00 ? 566 LYS A N   1 
ATOM   4336 C  CA  . LYS A 1 534 ? 33.530 54.840 216.830 1.00 15.00 ? 566 LYS A CA  1 
ATOM   4337 C  C   . LYS A 1 534 ? 33.760 55.350 215.420 1.00 15.00 ? 566 LYS A C   1 
ATOM   4338 O  O   . LYS A 1 534 ? 34.080 56.520 215.260 1.00 15.00 ? 566 LYS A O   1 
ATOM   4339 C  CB  . LYS A 1 534 ? 34.710 53.970 217.220 1.00 15.00 ? 566 LYS A CB  1 
ATOM   4340 C  CG  . LYS A 1 534 ? 34.860 53.720 218.710 1.00 15.00 ? 566 LYS A CG  1 
ATOM   4341 C  CD  . LYS A 1 534 ? 36.050 52.770 219.020 1.00 15.00 ? 566 LYS A CD  1 
ATOM   4342 C  CE  . LYS A 1 534 ? 37.460 53.300 218.680 1.00 15.00 ? 566 LYS A CE  1 
ATOM   4343 N  NZ  . LYS A 1 534 ? 38.450 52.230 218.540 1.00 15.00 ? 566 LYS A NZ  1 
ATOM   4344 N  N   . LEU A 1 535 ? 33.450 54.550 214.410 1.00 15.00 ? 567 LEU A N   1 
ATOM   4345 C  CA  . LEU A 1 535 ? 33.700 54.920 213.040 1.00 15.00 ? 567 LEU A CA  1 
ATOM   4346 C  C   . LEU A 1 535 ? 32.930 56.160 212.670 1.00 15.00 ? 567 LEU A C   1 
ATOM   4347 O  O   . LEU A 1 535 ? 33.460 57.110 212.090 1.00 15.00 ? 567 LEU A O   1 
ATOM   4348 C  CB  . LEU A 1 535 ? 33.300 53.750 212.180 1.00 15.00 ? 567 LEU A CB  1 
ATOM   4349 C  CG  . LEU A 1 535 ? 33.250 53.980 210.700 1.00 15.00 ? 567 LEU A CG  1 
ATOM   4350 C  CD1 . LEU A 1 535 ? 34.650 54.140 210.150 1.00 15.00 ? 567 LEU A CD1 1 
ATOM   4351 C  CD2 . LEU A 1 535 ? 32.580 52.810 210.040 1.00 15.00 ? 567 LEU A CD2 1 
ATOM   4352 N  N   . VAL A 1 536 ? 31.660 56.170 213.060 1.00 15.00 ? 568 VAL A N   1 
ATOM   4353 C  CA  . VAL A 1 536 ? 30.810 57.280 212.700 1.00 15.00 ? 568 VAL A CA  1 
ATOM   4354 C  C   . VAL A 1 536 ? 31.050 58.450 213.620 1.00 15.00 ? 568 VAL A C   1 
ATOM   4355 O  O   . VAL A 1 536 ? 31.270 59.580 213.180 1.00 15.00 ? 568 VAL A O   1 
ATOM   4356 C  CB  . VAL A 1 536 ? 29.330 56.910 212.770 1.00 15.00 ? 568 VAL A CB  1 
ATOM   4357 C  CG1 . VAL A 1 536 ? 28.470 58.100 212.410 1.00 15.00 ? 568 VAL A CG1 1 
ATOM   4358 C  CG2 . VAL A 1 536 ? 29.060 55.820 211.770 1.00 15.00 ? 568 VAL A CG2 1 
ATOM   4359 N  N   . CYS A 1 537 ? 31.000 58.220 214.910 1.00 15.00 ? 569 CYS A N   1 
ATOM   4360 C  CA  . CYS A 1 537 ? 31.100 59.320 215.820 1.00 15.00 ? 569 CYS A CA  1 
ATOM   4361 C  C   . CYS A 1 537 ? 32.420 60.010 215.880 1.00 15.00 ? 569 CYS A C   1 
ATOM   4362 O  O   . CYS A 1 537 ? 32.420 61.240 216.000 1.00 15.00 ? 569 CYS A O   1 
ATOM   4363 C  CB  . CYS A 1 537 ? 30.670 58.850 217.170 1.00 15.00 ? 569 CYS A CB  1 
ATOM   4364 S  SG  . CYS A 1 537 ? 28.870 58.900 216.950 1.00 15.00 ? 569 CYS A SG  1 
ATOM   4365 N  N   . LEU A 1 538 ? 33.560 59.350 215.690 1.00 15.00 ? 570 LEU A N   1 
ATOM   4366 C  CA  . LEU A 1 538 ? 34.830 60.070 215.670 1.00 15.00 ? 570 LEU A CA  1 
ATOM   4367 C  C   . LEU A 1 538 ? 35.030 60.850 214.390 1.00 15.00 ? 570 LEU A C   1 
ATOM   4368 O  O   . LEU A 1 538 ? 36.060 61.510 214.210 1.00 15.00 ? 570 LEU A O   1 
ATOM   4369 C  CB  . LEU A 1 538 ? 36.020 59.130 215.800 1.00 15.00 ? 570 LEU A CB  1 
ATOM   4370 C  CG  . LEU A 1 538 ? 36.490 58.810 217.210 1.00 15.00 ? 570 LEU A CG  1 
ATOM   4371 C  CD1 . LEU A 1 538 ? 35.510 57.910 217.920 1.00 15.00 ? 570 LEU A CD1 1 
ATOM   4372 C  CD2 . LEU A 1 538 ? 37.810 58.060 217.120 1.00 15.00 ? 570 LEU A CD2 1 
ATOM   4373 N  N   . ASN A 1 539 ? 34.110 60.810 213.450 1.00 15.00 ? 571 ASN A N   1 
ATOM   4374 C  CA  . ASN A 1 539 ? 34.300 61.540 212.230 1.00 15.00 ? 571 ASN A CA  1 
ATOM   4375 C  C   . ASN A 1 539 ? 33.140 62.460 211.940 1.00 15.00 ? 571 ASN A C   1 
ATOM   4376 O  O   . ASN A 1 539 ? 32.980 62.970 210.830 1.00 15.00 ? 571 ASN A O   1 
ATOM   4377 C  CB  . ASN A 1 539 ? 34.520 60.540 211.090 1.00 15.00 ? 571 ASN A CB  1 
ATOM   4378 C  CG  . ASN A 1 539 ? 35.900 59.890 211.070 1.00 15.00 ? 571 ASN A CG  1 
ATOM   4379 O  OD1 . ASN A 1 539 ? 36.060 58.830 210.490 1.00 15.00 ? 571 ASN A OD1 1 
ATOM   4380 N  ND2 . ASN A 1 539 ? 36.980 60.380 211.650 1.00 15.00 ? 571 ASN A ND2 1 
ATOM   4381 N  N   . THR A 1 540 ? 32.370 62.750 212.970 1.00 15.00 ? 572 THR A N   1 
ATOM   4382 C  CA  . THR A 1 540 ? 31.170 63.530 212.830 1.00 15.00 ? 572 THR A CA  1 
ATOM   4383 C  C   . THR A 1 540 ? 31.250 64.610 213.920 1.00 15.00 ? 572 THR A C   1 
ATOM   4384 O  O   . THR A 1 540 ? 31.900 64.340 214.930 1.00 15.00 ? 572 THR A O   1 
ATOM   4385 C  CB  . THR A 1 540 ? 30.060 62.470 212.970 1.00 15.00 ? 572 THR A CB  1 
ATOM   4386 O  OG1 . THR A 1 540 ? 28.930 62.970 212.300 1.00 15.00 ? 572 THR A OG1 1 
ATOM   4387 C  CG2 . THR A 1 540 ? 29.700 62.150 214.390 1.00 15.00 ? 572 THR A CG2 1 
ATOM   4388 N  N   . LYS A 1 541 ? 30.670 65.820 213.820 1.00 15.00 ? 573 LYS A N   1 
ATOM   4389 C  CA  . LYS A 1 541 ? 30.800 66.740 214.950 1.00 15.00 ? 573 LYS A CA  1 
ATOM   4390 C  C   . LYS A 1 541 ? 29.890 66.370 216.090 1.00 15.00 ? 573 LYS A C   1 
ATOM   4391 O  O   . LYS A 1 541 ? 30.000 66.970 217.150 1.00 15.00 ? 573 LYS A O   1 
ATOM   4392 C  CB  . LYS A 1 541 ? 30.430 68.200 214.710 1.00 15.00 ? 573 LYS A CB  1 
ATOM   4393 C  CG  . LYS A 1 541 ? 30.990 68.890 213.500 1.00 15.00 ? 573 LYS A CG  1 
ATOM   4394 C  CD  . LYS A 1 541 ? 29.950 68.620 212.430 1.00 15.00 ? 573 LYS A CD  1 
ATOM   4395 C  CE  . LYS A 1 541 ? 28.580 69.280 212.780 1.00 15.00 ? 573 LYS A CE  1 
ATOM   4396 N  NZ  . LYS A 1 541 ? 27.480 68.760 211.980 1.00 15.00 ? 573 LYS A NZ  1 
ATOM   4397 N  N   . THR A 1 542 ? 28.950 65.440 215.950 1.00 15.00 ? 574 THR A N   1 
ATOM   4398 C  CA  . THR A 1 542 ? 28.100 65.130 217.080 1.00 15.00 ? 574 THR A CA  1 
ATOM   4399 C  C   . THR A 1 542 ? 27.580 63.710 216.860 1.00 15.00 ? 574 THR A C   1 
ATOM   4400 O  O   . THR A 1 542 ? 27.210 63.340 215.740 1.00 15.00 ? 574 THR A O   1 
ATOM   4401 C  CB  . THR A 1 542 ? 27.020 66.210 217.120 1.00 15.00 ? 574 THR A CB  1 
ATOM   4402 O  OG1 . THR A 1 542 ? 26.250 65.830 218.240 1.00 15.00 ? 574 THR A OG1 1 
ATOM   4403 C  CG2 . THR A 1 542 ? 26.170 66.380 215.870 1.00 15.00 ? 574 THR A CG2 1 
ATOM   4404 N  N   . CYS A 1 543 ? 27.540 62.920 217.920 1.00 15.00 ? 575 CYS A N   1 
ATOM   4405 C  CA  . CYS A 1 543 ? 27.220 61.520 217.800 1.00 15.00 ? 575 CYS A CA  1 
ATOM   4406 C  C   . CYS A 1 543 ? 25.720 61.270 217.740 1.00 15.00 ? 575 CYS A C   1 
ATOM   4407 O  O   . CYS A 1 543 ? 25.010 61.640 218.680 1.00 15.00 ? 575 CYS A O   1 
ATOM   4408 C  CB  . CYS A 1 543 ? 27.830 60.830 218.980 1.00 15.00 ? 575 CYS A CB  1 
ATOM   4409 S  SG  . CYS A 1 543 ? 27.920 59.050 218.740 1.00 15.00 ? 575 CYS A SG  1 
ATOM   4410 N  N   . PRO A 1 544 ? 25.170 60.720 216.670 1.00 15.00 ? 576 PRO A N   1 
ATOM   4411 C  CA  . PRO A 1 544 ? 23.780 60.340 216.580 1.00 15.00 ? 576 PRO A CA  1 
ATOM   4412 C  C   . PRO A 1 544 ? 23.570 58.970 217.160 1.00 15.00 ? 576 PRO A C   1 
ATOM   4413 O  O   . PRO A 1 544 ? 24.450 58.410 217.800 1.00 15.00 ? 576 PRO A O   1 
ATOM   4414 C  CB  . PRO A 1 544 ? 23.510 60.420 215.120 1.00 15.00 ? 576 PRO A CB  1 
ATOM   4415 C  CG  . PRO A 1 544 ? 24.760 59.830 214.550 1.00 15.00 ? 576 PRO A CG  1 
ATOM   4416 C  CD  . PRO A 1 544 ? 25.820 60.530 215.390 1.00 15.00 ? 576 PRO A CD  1 
ATOM   4417 N  N   . TYR A 1 545 ? 22.390 58.390 216.940 1.00 15.00 ? 577 TYR A N   1 
ATOM   4418 C  CA  . TYR A 1 545 ? 22.130 57.020 217.360 1.00 15.00 ? 577 TYR A CA  1 
ATOM   4419 C  C   . TYR A 1 545 ? 22.840 56.290 216.240 1.00 15.00 ? 577 TYR A C   1 
ATOM   4420 O  O   . TYR A 1 545 ? 22.580 56.650 215.090 1.00 15.00 ? 577 TYR A O   1 
ATOM   4421 C  CB  . TYR A 1 545 ? 20.640 56.700 217.340 1.00 15.00 ? 577 TYR A CB  1 
ATOM   4422 C  CG  . TYR A 1 545 ? 20.300 55.220 217.510 1.00 15.00 ? 577 TYR A CG  1 
ATOM   4423 C  CD1 . TYR A 1 545 ? 20.430 54.590 218.730 1.00 15.00 ? 577 TYR A CD1 1 
ATOM   4424 C  CD2 . TYR A 1 545 ? 19.870 54.490 216.430 1.00 15.00 ? 577 TYR A CD2 1 
ATOM   4425 C  CE1 . TYR A 1 545 ? 20.140 53.240 218.860 1.00 15.00 ? 577 TYR A CE1 1 
ATOM   4426 C  CE2 . TYR A 1 545 ? 19.580 53.150 216.540 1.00 15.00 ? 577 TYR A CE2 1 
ATOM   4427 C  CZ  . TYR A 1 545 ? 19.730 52.530 217.760 1.00 15.00 ? 577 TYR A CZ  1 
ATOM   4428 O  OH  . TYR A 1 545 ? 19.490 51.180 217.870 1.00 15.00 ? 577 TYR A OH  1 
ATOM   4429 N  N   . VAL A 1 546 ? 23.750 55.350 216.500 1.00 15.00 ? 578 VAL A N   1 
ATOM   4430 C  CA  . VAL A 1 546 ? 24.370 54.660 215.390 1.00 15.00 ? 578 VAL A CA  1 
ATOM   4431 C  C   . VAL A 1 546 ? 24.250 53.200 215.730 1.00 15.00 ? 578 VAL A C   1 
ATOM   4432 O  O   . VAL A 1 546 ? 24.750 52.780 216.770 1.00 15.00 ? 578 VAL A O   1 
ATOM   4433 C  CB  . VAL A 1 546 ? 25.850 54.930 215.220 1.00 15.00 ? 578 VAL A CB  1 
ATOM   4434 C  CG1 . VAL A 1 546 ? 26.200 54.380 213.840 1.00 15.00 ? 578 VAL A CG1 1 
ATOM   4435 C  CG2 . VAL A 1 546 ? 26.220 56.390 215.370 1.00 15.00 ? 578 VAL A CG2 1 
ATOM   4436 N  N   . SER A 1 547 ? 23.600 52.430 214.860 1.00 15.00 ? 579 SER A N   1 
ATOM   4437 C  CA  . SER A 1 547 ? 23.420 51.020 215.120 1.00 15.00 ? 579 SER A CA  1 
ATOM   4438 C  C   . SER A 1 547 ? 22.980 50.310 213.860 1.00 15.00 ? 579 SER A C   1 
ATOM   4439 O  O   . SER A 1 547 ? 22.520 50.910 212.890 1.00 15.00 ? 579 SER A O   1 
ATOM   4440 C  CB  . SER A 1 547 ? 22.390 50.820 216.200 1.00 15.00 ? 579 SER A CB  1 
ATOM   4441 O  OG  . SER A 1 547 ? 22.270 49.470 216.570 1.00 15.00 ? 579 SER A OG  1 
ATOM   4442 N  N   . PHE A 1 548 ? 23.160 49.000 213.870 1.00 15.00 ? 580 PHE A N   1 
ATOM   4443 C  CA  . PHE A 1 548 ? 22.670 48.160 212.810 1.00 15.00 ? 580 PHE A CA  1 
ATOM   4444 C  C   . PHE A 1 548 ? 21.270 47.680 213.180 1.00 15.00 ? 580 PHE A C   1 
ATOM   4445 O  O   . PHE A 1 548 ? 20.530 47.090 212.400 1.00 15.00 ? 580 PHE A O   1 
ATOM   4446 C  CB  . PHE A 1 548 ? 23.610 46.990 212.630 1.00 15.00 ? 580 PHE A CB  1 
ATOM   4447 C  CG  . PHE A 1 548 ? 24.890 47.280 211.850 1.00 15.00 ? 580 PHE A CG  1 
ATOM   4448 C  CD1 . PHE A 1 548 ? 24.900 48.200 210.820 1.00 15.00 ? 580 PHE A CD1 1 
ATOM   4449 C  CD2 . PHE A 1 548 ? 26.050 46.610 212.160 1.00 15.00 ? 580 PHE A CD2 1 
ATOM   4450 C  CE1 . PHE A 1 548 ? 26.050 48.440 210.100 1.00 15.00 ? 580 PHE A CE1 1 
ATOM   4451 C  CE2 . PHE A 1 548 ? 27.190 46.850 211.430 1.00 15.00 ? 580 PHE A CE2 1 
ATOM   4452 C  CZ  . PHE A 1 548 ? 27.200 47.760 210.400 1.00 15.00 ? 580 PHE A CZ  1 
ATOM   4453 N  N   . HIS A 1 549 ? 20.920 48.020 214.410 1.00 15.00 ? 581 HIS A N   1 
ATOM   4454 C  CA  . HIS A 1 549 ? 19.730 47.610 215.110 1.00 15.00 ? 581 HIS A CA  1 
ATOM   4455 C  C   . HIS A 1 549 ? 18.780 48.790 215.180 1.00 15.00 ? 581 HIS A C   1 
ATOM   4456 O  O   . HIS A 1 549 ? 19.170 49.950 215.330 1.00 15.00 ? 581 HIS A O   1 
ATOM   4457 C  CB  . HIS A 1 549 ? 20.130 47.230 216.490 1.00 15.00 ? 581 HIS A CB  1 
ATOM   4458 C  CG  . HIS A 1 549 ? 19.140 46.420 217.270 1.00 15.00 ? 581 HIS A CG  1 
ATOM   4459 N  ND1 . HIS A 1 549 ? 17.840 46.060 216.870 1.00 15.00 ? 581 HIS A ND1 1 
ATOM   4460 C  CD2 . HIS A 1 549 ? 19.560 45.720 218.400 1.00 15.00 ? 581 HIS A CD2 1 
ATOM   4461 C  CE1 . HIS A 1 549 ? 17.520 45.050 217.720 1.00 15.00 ? 581 HIS A CE1 1 
ATOM   4462 N  NE2 . HIS A 1 549 ? 18.480 44.830 218.590 1.00 15.00 ? 581 HIS A NE2 1 
ATOM   4463 N  N   . VAL A 1 550 ? 17.520 48.470 215.070 1.00 15.00 ? 582 VAL A N   1 
ATOM   4464 C  CA  . VAL A 1 550 ? 16.490 49.450 215.230 1.00 15.00 ? 582 VAL A CA  1 
ATOM   4465 C  C   . VAL A 1 550 ? 16.320 49.610 216.740 1.00 15.00 ? 582 VAL A C   1 
ATOM   4466 O  O   . VAL A 1 550 ? 16.400 48.650 217.520 1.00 15.00 ? 582 VAL A O   1 
ATOM   4467 C  CB  . VAL A 1 550 ? 15.280 48.900 214.470 1.00 15.00 ? 582 VAL A CB  1 
ATOM   4468 C  CG1 . VAL A 1 550 ? 13.990 48.920 215.230 1.00 15.00 ? 582 VAL A CG1 1 
ATOM   4469 C  CG2 . VAL A 1 550 ? 15.120 49.810 213.280 1.00 15.00 ? 582 VAL A CG2 1 
ATOM   4470 N  N   . PRO A 1 551 ? 16.160 50.860 217.160 1.00 15.00 ? 583 PRO A N   1 
ATOM   4471 C  CA  . PRO A 1 551 ? 16.170 51.240 218.550 1.00 15.00 ? 583 PRO A CA  1 
ATOM   4472 C  C   . PRO A 1 551 ? 15.200 50.570 219.500 1.00 15.00 ? 583 PRO A C   1 
ATOM   4473 O  O   . PRO A 1 551 ? 14.130 50.090 219.150 1.00 15.00 ? 583 PRO A O   1 
ATOM   4474 C  CB  . PRO A 1 551 ? 15.980 52.740 218.500 1.00 15.00 ? 583 PRO A CB  1 
ATOM   4475 C  CG  . PRO A 1 551 ? 15.250 52.970 217.210 1.00 15.00 ? 583 PRO A CG  1 
ATOM   4476 C  CD  . PRO A 1 551 ? 16.020 52.030 216.320 1.00 15.00 ? 583 PRO A CD  1 
ATOM   4477 N  N   . ASP A 1 552 ? 15.750 50.640 220.720 1.00 15.00 ? 584 ASP A N   1 
ATOM   4478 C  CA  . ASP A 1 552 ? 15.260 50.200 222.020 1.00 15.00 ? 584 ASP A CA  1 
ATOM   4479 C  C   . ASP A 1 552 ? 14.510 48.880 222.230 1.00 15.00 ? 584 ASP A C   1 
ATOM   4480 O  O   . ASP A 1 552 ? 14.130 48.550 223.360 1.00 15.00 ? 584 ASP A O   1 
ATOM   4481 C  CB  . ASP A 1 552 ? 14.400 51.350 222.690 1.00 15.00 ? 584 ASP A CB  1 
ATOM   4482 C  CG  . ASP A 1 552 ? 12.940 51.600 222.230 1.00 15.00 ? 584 ASP A CG  1 
ATOM   4483 O  OD1 . ASP A 1 552 ? 12.790 52.280 221.210 1.00 15.00 ? 584 ASP A OD1 1 
ATOM   4484 O  OD2 . ASP A 1 552 ? 11.990 51.160 222.900 1.00 15.00 ? 584 ASP A OD2 1 
ATOM   4485 N  N   . PRO A 1 553 ? 14.400 48.010 221.210 1.00 15.00 ? 585 PRO A N   1 
ATOM   4486 C  CA  . PRO A 1 553 ? 13.100 47.590 220.660 1.00 15.00 ? 585 PRO A CA  1 
ATOM   4487 C  C   . PRO A 1 553 ? 11.900 48.520 220.950 1.00 15.00 ? 585 PRO A C   1 
ATOM   4488 O  O   . PRO A 1 553 ? 11.350 48.640 222.070 1.00 15.00 ? 585 PRO A O   1 
ATOM   4489 C  CB  . PRO A 1 553 ? 12.980 46.130 221.210 1.00 15.00 ? 585 PRO A CB  1 
ATOM   4490 C  CG  . PRO A 1 553 ? 14.410 45.710 221.680 1.00 15.00 ? 585 PRO A CG  1 
ATOM   4491 C  CD  . PRO A 1 553 ? 15.300 46.850 221.100 1.00 15.00 ? 585 PRO A CD  1 
ATOM   4492 N  N   . ARG A 1 554 ? 11.630 49.300 219.880 1.00 15.00 ? 586 ARG A N   1 
ATOM   4493 C  CA  . ARG A 1 554 ? 10.470 50.170 219.840 1.00 15.00 ? 586 ARG A CA  1 
ATOM   4494 C  C   . ARG A 1 554 ? 9.250  49.370 219.300 1.00 15.00 ? 586 ARG A C   1 
ATOM   4495 O  O   . ARG A 1 554 ? 8.140  49.540 219.850 1.00 15.00 ? 586 ARG A O   1 
ATOM   4496 C  CB  . ARG A 1 554 ? 10.790 51.400 218.920 1.00 15.00 ? 586 ARG A CB  1 
ATOM   4497 C  CG  . ARG A 1 554 ? 9.880  52.660 219.080 1.00 15.00 ? 586 ARG A CG  1 
ATOM   4498 C  CD  . ARG A 1 554 ? 9.890  53.370 220.460 1.00 15.00 ? 586 ARG A CD  1 
ATOM   4499 N  NE  . ARG A 1 554 ? 9.510  52.430 221.530 1.00 15.00 ? 586 ARG A NE  1 
ATOM   4500 C  CZ  . ARG A 1 554 ? 8.280  52.410 222.110 1.00 15.00 ? 586 ARG A CZ  1 
ATOM   4501 N  NH1 . ARG A 1 554 ? 7.310  53.310 221.820 1.00 15.00 ? 586 ARG A NH1 1 
ATOM   4502 N  NH2 . ARG A 1 554 ? 8.060  51.470 223.070 1.00 15.00 ? 586 ARG A NH2 1 
ATOM   4503 O  OXT . ARG A 1 554 ? 9.430  48.540 218.370 1.00 15.00 ? 586 ARG A OXT 1 
ATOM   4504 N  N   . VAL B 1 1   ? 72.690 58.370 211.720 1.00 15.00 ? 33  VAL B N   1 
ATOM   4505 C  CA  . VAL B 1 1   ? 71.330 58.840 212.000 1.00 15.00 ? 33  VAL B CA  1 
ATOM   4506 C  C   . VAL B 1 1   ? 70.570 57.800 211.180 1.00 15.00 ? 33  VAL B C   1 
ATOM   4507 O  O   . VAL B 1 1   ? 71.100 57.380 210.150 1.00 15.00 ? 33  VAL B O   1 
ATOM   4508 C  CB  . VAL B 1 1   ? 71.000 60.310 211.460 1.00 15.00 ? 33  VAL B CB  1 
ATOM   4509 C  CG1 . VAL B 1 1   ? 69.750 60.880 212.170 1.00 15.00 ? 33  VAL B CG1 1 
ATOM   4510 C  CG2 . VAL B 1 1   ? 72.140 61.300 211.760 1.00 15.00 ? 33  VAL B CG2 1 
ATOM   4511 N  N   . ASN B 1 2   ? 69.370 57.440 211.620 1.00 15.00 ? 34  ASN B N   1 
ATOM   4512 C  CA  . ASN B 1 2   ? 68.500 56.410 211.060 1.00 15.00 ? 34  ASN B CA  1 
ATOM   4513 C  C   . ASN B 1 2   ? 69.000 55.100 211.630 1.00 15.00 ? 34  ASN B C   1 
ATOM   4514 O  O   . ASN B 1 2   ? 69.980 54.500 211.180 1.00 15.00 ? 34  ASN B O   1 
ATOM   4515 C  CB  . ASN B 1 2   ? 68.490 56.180 209.520 1.00 15.00 ? 34  ASN B CB  1 
ATOM   4516 C  CG  . ASN B 1 2   ? 67.320 55.280 209.130 1.00 15.00 ? 34  ASN B CG  1 
ATOM   4517 O  OD1 . ASN B 1 2   ? 67.020 54.250 209.730 1.00 15.00 ? 34  ASN B OD1 1 
ATOM   4518 N  ND2 . ASN B 1 2   ? 66.500 55.660 208.160 1.00 15.00 ? 34  ASN B ND2 1 
ATOM   4519 N  N   . PRO B 1 3   ? 68.340 54.670 212.710 1.00 15.00 ? 35  PRO B N   1 
ATOM   4520 C  CA  . PRO B 1 3   ? 68.720 53.510 213.490 1.00 15.00 ? 35  PRO B CA  1 
ATOM   4521 C  C   . PRO B 1 3   ? 68.720 52.250 212.650 1.00 15.00 ? 35  PRO B C   1 
ATOM   4522 O  O   . PRO B 1 3   ? 69.620 51.420 212.740 1.00 15.00 ? 35  PRO B O   1 
ATOM   4523 C  CB  . PRO B 1 3   ? 67.730 53.480 214.590 1.00 15.00 ? 35  PRO B CB  1 
ATOM   4524 C  CG  . PRO B 1 3   ? 67.180 54.880 214.650 1.00 15.00 ? 35  PRO B CG  1 
ATOM   4525 C  CD  . PRO B 1 3   ? 67.080 55.210 213.190 1.00 15.00 ? 35  PRO B CD  1 
ATOM   4526 N  N   . CYS B 1 4   ? 67.740 52.120 211.750 1.00 15.00 ? 36  CYS B N   1 
ATOM   4527 C  CA  . CYS B 1 4   ? 67.600 50.920 210.960 1.00 15.00 ? 36  CYS B CA  1 
ATOM   4528 C  C   . CYS B 1 4   ? 68.790 50.710 210.030 1.00 15.00 ? 36  CYS B C   1 
ATOM   4529 O  O   . CYS B 1 4   ? 68.950 49.590 209.570 1.00 15.00 ? 36  CYS B O   1 
ATOM   4530 C  CB  . CYS B 1 4   ? 66.260 51.010 210.240 1.00 15.00 ? 36  CYS B CB  1 
ATOM   4531 S  SG  . CYS B 1 4   ? 64.860 51.100 211.420 1.00 15.00 ? 36  CYS B SG  1 
ATOM   4532 N  N   . CYS B 1 5   ? 69.700 51.680 209.820 1.00 15.00 ? 37  CYS B N   1 
ATOM   4533 C  CA  . CYS B 1 5   ? 70.910 51.460 209.060 1.00 15.00 ? 37  CYS B CA  1 
ATOM   4534 C  C   . CYS B 1 5   ? 71.880 50.490 209.720 1.00 15.00 ? 37  CYS B C   1 
ATOM   4535 O  O   . CYS B 1 5   ? 72.770 49.910 209.090 1.00 15.00 ? 37  CYS B O   1 
ATOM   4536 C  CB  . CYS B 1 5   ? 71.650 52.740 208.870 1.00 15.00 ? 37  CYS B CB  1 
ATOM   4537 S  SG  . CYS B 1 5   ? 70.800 53.810 207.710 1.00 15.00 ? 37  CYS B SG  1 
ATOM   4538 N  N   . TYR B 1 6   ? 71.720 50.290 211.030 1.00 15.00 ? 38  TYR B N   1 
ATOM   4539 C  CA  . TYR B 1 6   ? 72.580 49.420 211.800 1.00 15.00 ? 38  TYR B CA  1 
ATOM   4540 C  C   . TYR B 1 6   ? 72.050 48.020 211.830 1.00 15.00 ? 38  TYR B C   1 
ATOM   4541 O  O   . TYR B 1 6   ? 72.580 47.170 212.540 1.00 15.00 ? 38  TYR B O   1 
ATOM   4542 C  CB  . TYR B 1 6   ? 72.720 49.910 213.240 1.00 15.00 ? 38  TYR B CB  1 
ATOM   4543 C  CG  . TYR B 1 6   ? 73.420 51.230 213.300 1.00 15.00 ? 38  TYR B CG  1 
ATOM   4544 C  CD1 . TYR B 1 6   ? 72.690 52.400 213.140 1.00 15.00 ? 38  TYR B CD1 1 
ATOM   4545 C  CD2 . TYR B 1 6   ? 74.790 51.280 213.410 1.00 15.00 ? 38  TYR B CD2 1 
ATOM   4546 C  CE1 . TYR B 1 6   ? 73.330 53.620 213.080 1.00 15.00 ? 38  TYR B CE1 1 
ATOM   4547 C  CE2 . TYR B 1 6   ? 75.440 52.500 213.350 1.00 15.00 ? 38  TYR B CE2 1 
ATOM   4548 C  CZ  . TYR B 1 6   ? 74.700 53.680 213.180 1.00 15.00 ? 38  TYR B CZ  1 
ATOM   4549 O  OH  . TYR B 1 6   ? 75.330 54.910 213.060 1.00 15.00 ? 38  TYR B OH  1 
ATOM   4550 N  N   . TYR B 1 7   ? 70.970 47.760 211.090 1.00 15.00 ? 39  TYR B N   1 
ATOM   4551 C  CA  . TYR B 1 7   ? 70.330 46.460 211.040 1.00 15.00 ? 39  TYR B CA  1 
ATOM   4552 C  C   . TYR B 1 7   ? 70.120 45.870 212.430 1.00 15.00 ? 39  TYR B C   1 
ATOM   4553 O  O   . TYR B 1 7   ? 70.510 44.760 212.750 1.00 15.00 ? 39  TYR B O   1 
ATOM   4554 C  CB  . TYR B 1 7   ? 71.190 45.530 210.130 1.00 15.00 ? 39  TYR B CB  1 
ATOM   4555 C  CG  . TYR B 1 7   ? 71.480 46.080 208.740 1.00 15.00 ? 39  TYR B CG  1 
ATOM   4556 C  CD1 . TYR B 1 7   ? 70.530 46.790 208.030 1.00 15.00 ? 39  TYR B CD1 1 
ATOM   4557 C  CD2 . TYR B 1 7   ? 72.720 45.910 208.190 1.00 15.00 ? 39  TYR B CD2 1 
ATOM   4558 C  CE1 . TYR B 1 7   ? 70.800 47.330 206.800 1.00 15.00 ? 39  TYR B CE1 1 
ATOM   4559 C  CE2 . TYR B 1 7   ? 73.010 46.450 206.950 1.00 15.00 ? 39  TYR B CE2 1 
ATOM   4560 C  CZ  . TYR B 1 7   ? 72.060 47.160 206.270 1.00 15.00 ? 39  TYR B CZ  1 
ATOM   4561 O  OH  . TYR B 1 7   ? 72.370 47.770 205.070 1.00 15.00 ? 39  TYR B OH  1 
ATOM   4562 N  N   . PRO B 1 8   ? 69.460 46.610 213.340 1.00 15.00 ? 40  PRO B N   1 
ATOM   4563 C  CA  . PRO B 1 8   ? 69.430 46.340 214.770 1.00 15.00 ? 40  PRO B CA  1 
ATOM   4564 C  C   . PRO B 1 8   ? 68.680 45.090 215.200 1.00 15.00 ? 40  PRO B C   1 
ATOM   4565 O  O   . PRO B 1 8   ? 69.050 44.410 216.160 1.00 15.00 ? 40  PRO B O   1 
ATOM   4566 C  CB  . PRO B 1 8   ? 68.820 47.550 215.390 1.00 15.00 ? 40  PRO B CB  1 
ATOM   4567 C  CG  . PRO B 1 8   ? 68.850 48.570 214.290 1.00 15.00 ? 40  PRO B CG  1 
ATOM   4568 C  CD  . PRO B 1 8   ? 68.600 47.740 213.070 1.00 15.00 ? 40  PRO B CD  1 
ATOM   4569 N  N   . CYS B 1 9   ? 67.600 44.780 214.470 1.00 15.00 ? 41  CYS B N   1 
ATOM   4570 C  CA  . CYS B 1 9   ? 66.690 43.710 214.820 1.00 15.00 ? 41  CYS B CA  1 
ATOM   4571 C  C   . CYS B 1 9   ? 67.130 42.410 214.170 1.00 15.00 ? 41  CYS B C   1 
ATOM   4572 O  O   . CYS B 1 9   ? 67.150 42.190 212.950 1.00 15.00 ? 41  CYS B O   1 
ATOM   4573 C  CB  . CYS B 1 9   ? 65.310 44.080 214.360 1.00 15.00 ? 41  CYS B CB  1 
ATOM   4574 S  SG  . CYS B 1 9   ? 64.850 45.800 214.660 1.00 15.00 ? 41  CYS B SG  1 
ATOM   4575 N  N   . GLN B 1 10  ? 67.530 41.620 215.150 1.00 15.00 ? 42  GLN B N   1 
ATOM   4576 C  CA  . GLN B 1 10  ? 68.040 40.270 214.930 1.00 15.00 ? 42  GLN B CA  1 
ATOM   4577 C  C   . GLN B 1 10  ? 66.910 39.310 214.660 1.00 15.00 ? 42  GLN B C   1 
ATOM   4578 O  O   . GLN B 1 10  ? 65.740 39.680 214.770 1.00 15.00 ? 42  GLN B O   1 
ATOM   4579 C  CB  . GLN B 1 10  ? 68.810 39.810 216.170 1.00 15.00 ? 42  GLN B CB  1 
ATOM   4580 C  CG  . GLN B 1 10  ? 69.910 40.730 216.690 1.00 15.00 ? 42  GLN B CG  1 
ATOM   4581 C  CD  . GLN B 1 10  ? 70.880 41.110 215.590 1.00 15.00 ? 42  GLN B CD  1 
ATOM   4582 O  OE1 . GLN B 1 10  ? 71.500 40.220 214.980 1.00 15.00 ? 42  GLN B OE1 1 
ATOM   4583 N  NE2 . GLN B 1 10  ? 71.030 42.390 215.270 1.00 15.00 ? 42  GLN B NE2 1 
ATOM   4584 N  N   . HIS B 1 11  ? 67.210 38.050 214.300 1.00 15.00 ? 43  HIS B N   1 
ATOM   4585 C  CA  . HIS B 1 11  ? 66.220 36.990 214.060 1.00 15.00 ? 43  HIS B CA  1 
ATOM   4586 C  C   . HIS B 1 11  ? 64.920 37.380 213.360 1.00 15.00 ? 43  HIS B C   1 
ATOM   4587 O  O   . HIS B 1 11  ? 63.790 37.020 213.700 1.00 15.00 ? 43  HIS B O   1 
ATOM   4588 C  CB  . HIS B 1 11  ? 65.860 36.330 215.370 1.00 15.00 ? 43  HIS B CB  1 
ATOM   4589 C  CG  . HIS B 1 11  ? 67.110 35.870 216.060 1.00 15.00 ? 43  HIS B CG  1 
ATOM   4590 N  ND1 . HIS B 1 11  ? 67.670 36.530 217.150 1.00 15.00 ? 43  HIS B ND1 1 
ATOM   4591 C  CD2 . HIS B 1 11  ? 67.910 34.840 215.590 1.00 15.00 ? 43  HIS B CD2 1 
ATOM   4592 C  CE1 . HIS B 1 11  ? 68.860 35.940 217.310 1.00 15.00 ? 43  HIS B CE1 1 
ATOM   4593 N  NE2 . HIS B 1 11  ? 69.000 34.960 216.460 1.00 15.00 ? 43  HIS B NE2 1 
ATOM   4594 N  N   . GLN B 1 12  ? 65.180 38.190 212.340 1.00 15.00 ? 44  GLN B N   1 
ATOM   4595 C  CA  . GLN B 1 12  ? 64.230 38.760 211.410 1.00 15.00 ? 44  GLN B CA  1 
ATOM   4596 C  C   . GLN B 1 12  ? 63.050 39.520 212.050 1.00 15.00 ? 44  GLN B C   1 
ATOM   4597 O  O   . GLN B 1 12  ? 61.940 39.570 211.540 1.00 15.00 ? 44  GLN B O   1 
ATOM   4598 C  CB  . GLN B 1 12  ? 63.740 37.620 210.470 1.00 15.00 ? 44  GLN B CB  1 
ATOM   4599 C  CG  . GLN B 1 12  ? 62.760 36.560 210.990 1.00 15.00 ? 44  GLN B CG  1 
ATOM   4600 C  CD  . GLN B 1 12  ? 62.600 35.370 210.050 1.00 15.00 ? 44  GLN B CD  1 
ATOM   4601 O  OE1 . GLN B 1 12  ? 63.400 34.440 210.100 1.00 15.00 ? 44  GLN B OE1 1 
ATOM   4602 N  NE2 . GLN B 1 12  ? 61.600 35.340 209.180 1.00 15.00 ? 44  GLN B NE2 1 
ATOM   4603 N  N   . GLY B 1 13  ? 63.340 40.160 213.170 1.00 15.00 ? 45  GLY B N   1 
ATOM   4604 C  CA  . GLY B 1 13  ? 62.380 41.070 213.740 1.00 15.00 ? 45  GLY B CA  1 
ATOM   4605 C  C   . GLY B 1 13  ? 62.360 42.280 212.830 1.00 15.00 ? 45  GLY B C   1 
ATOM   4606 O  O   . GLY B 1 13  ? 63.310 42.490 212.070 1.00 15.00 ? 45  GLY B O   1 
ATOM   4607 N  N   . ILE B 1 14  ? 61.360 43.140 212.870 1.00 15.00 ? 46  ILE B N   1 
ATOM   4608 C  CA  . ILE B 1 14  ? 61.350 44.230 211.910 1.00 15.00 ? 46  ILE B CA  1 
ATOM   4609 C  C   . ILE B 1 14  ? 61.500 45.610 212.540 1.00 15.00 ? 46  ILE B C   1 
ATOM   4610 O  O   . ILE B 1 14  ? 60.810 45.990 213.480 1.00 15.00 ? 46  ILE B O   1 
ATOM   4611 C  CB  . ILE B 1 14  ? 60.050 44.000 211.010 1.00 15.00 ? 46  ILE B CB  1 
ATOM   4612 C  CG1 . ILE B 1 14  ? 59.550 45.340 210.460 1.00 15.00 ? 46  ILE B CG1 1 
ATOM   4613 C  CG2 . ILE B 1 14  ? 58.940 43.290 211.760 1.00 15.00 ? 46  ILE B CG2 1 
ATOM   4614 C  CD1 . ILE B 1 14  ? 60.340 45.980 209.270 1.00 15.00 ? 46  ILE B CD1 1 
ATOM   4615 N  N   . CYS B 1 15  ? 62.470 46.360 212.010 1.00 15.00 ? 47  CYS B N   1 
ATOM   4616 C  CA  . CYS B 1 15  ? 62.860 47.680 212.510 1.00 15.00 ? 47  CYS B CA  1 
ATOM   4617 C  C   . CYS B 1 15  ? 61.930 48.750 212.000 1.00 15.00 ? 47  CYS B C   1 
ATOM   4618 O  O   . CYS B 1 15  ? 62.000 49.180 210.840 1.00 15.00 ? 47  CYS B O   1 
ATOM   4619 C  CB  . CYS B 1 15  ? 64.290 48.010 212.060 1.00 15.00 ? 47  CYS B CB  1 
ATOM   4620 S  SG  . CYS B 1 15  ? 65.090 49.520 212.660 1.00 15.00 ? 47  CYS B SG  1 
ATOM   4621 N  N   . VAL B 1 16  ? 60.990 49.140 212.840 1.00 15.00 ? 48  VAL B N   1 
ATOM   4622 C  CA  . VAL B 1 16  ? 60.150 50.260 212.480 1.00 15.00 ? 48  VAL B CA  1 
ATOM   4623 C  C   . VAL B 1 16  ? 60.730 51.490 213.170 1.00 15.00 ? 48  VAL B C   1 
ATOM   4624 O  O   . VAL B 1 16  ? 61.050 51.570 214.370 1.00 15.00 ? 48  VAL B O   1 
ATOM   4625 C  CB  . VAL B 1 16  ? 58.660 49.950 212.900 1.00 15.00 ? 48  VAL B CB  1 
ATOM   4626 C  CG1 . VAL B 1 16  ? 58.540 49.460 214.320 1.00 15.00 ? 48  VAL B CG1 1 
ATOM   4627 C  CG2 . VAL B 1 16  ? 57.860 51.220 212.650 1.00 15.00 ? 48  VAL B CG2 1 
ATOM   4628 N  N   . ARG B 1 17  ? 60.960 52.440 212.280 1.00 15.00 ? 49  ARG B N   1 
ATOM   4629 C  CA  . ARG B 1 17  ? 61.520 53.720 212.630 1.00 15.00 ? 49  ARG B CA  1 
ATOM   4630 C  C   . ARG B 1 17  ? 60.450 54.510 213.340 1.00 15.00 ? 49  ARG B C   1 
ATOM   4631 O  O   . ARG B 1 17  ? 59.350 54.680 212.810 1.00 15.00 ? 49  ARG B O   1 
ATOM   4632 C  CB  . ARG B 1 17  ? 61.950 54.370 211.340 1.00 15.00 ? 49  ARG B CB  1 
ATOM   4633 C  CG  . ARG B 1 17  ? 63.320 54.970 211.460 1.00 15.00 ? 49  ARG B CG  1 
ATOM   4634 C  CD  . ARG B 1 17  ? 63.150 56.310 212.120 1.00 15.00 ? 49  ARG B CD  1 
ATOM   4635 N  NE  . ARG B 1 17  ? 64.200 57.290 211.860 1.00 15.00 ? 49  ARG B NE  1 
ATOM   4636 C  CZ  . ARG B 1 17  ? 64.700 57.560 210.650 1.00 15.00 ? 49  ARG B CZ  1 
ATOM   4637 N  NH1 . ARG B 1 17  ? 64.350 56.970 209.500 1.00 15.00 ? 49  ARG B NH1 1 
ATOM   4638 N  NH2 . ARG B 1 17  ? 65.510 58.620 210.550 1.00 15.00 ? 49  ARG B NH2 1 
ATOM   4639 N  N   . PHE B 1 18  ? 60.710 54.960 214.540 1.00 15.00 ? 50  PHE B N   1 
ATOM   4640 C  CA  . PHE B 1 18  ? 59.720 55.770 215.210 1.00 15.00 ? 50  PHE B CA  1 
ATOM   4641 C  C   . PHE B 1 18  ? 60.140 57.240 215.220 1.00 15.00 ? 50  PHE B C   1 
ATOM   4642 O  O   . PHE B 1 18  ? 61.040 57.640 214.480 1.00 15.00 ? 50  PHE B O   1 
ATOM   4643 C  CB  . PHE B 1 18  ? 59.520 55.260 216.630 1.00 15.00 ? 50  PHE B CB  1 
ATOM   4644 C  CG  . PHE B 1 18  ? 58.370 54.260 216.660 1.00 15.00 ? 50  PHE B CG  1 
ATOM   4645 C  CD1 . PHE B 1 18  ? 58.550 52.970 216.200 1.00 15.00 ? 50  PHE B CD1 1 
ATOM   4646 C  CD2 . PHE B 1 18  ? 57.130 54.650 217.130 1.00 15.00 ? 50  PHE B CD2 1 
ATOM   4647 C  CE1 . PHE B 1 18  ? 57.500 52.080 216.230 1.00 15.00 ? 50  PHE B CE1 1 
ATOM   4648 C  CE2 . PHE B 1 18  ? 56.080 53.760 217.140 1.00 15.00 ? 50  PHE B CE2 1 
ATOM   4649 C  CZ  . PHE B 1 18  ? 56.260 52.470 216.690 1.00 15.00 ? 50  PHE B CZ  1 
ATOM   4650 N  N   . GLY B 1 19  ? 59.490 58.080 216.020 1.00 15.00 ? 51  GLY B N   1 
ATOM   4651 C  CA  . GLY B 1 19  ? 59.690 59.520 215.990 1.00 15.00 ? 51  GLY B CA  1 
ATOM   4652 C  C   . GLY B 1 19  ? 61.100 60.030 215.760 1.00 15.00 ? 51  GLY B C   1 
ATOM   4653 O  O   . GLY B 1 19  ? 61.910 60.050 216.690 1.00 15.00 ? 51  GLY B O   1 
ATOM   4654 N  N   . LEU B 1 20  ? 61.440 60.370 214.520 1.00 15.00 ? 52  LEU B N   1 
ATOM   4655 C  CA  . LEU B 1 20  ? 62.700 61.040 214.220 1.00 15.00 ? 52  LEU B CA  1 
ATOM   4656 C  C   . LEU B 1 20  ? 63.980 60.300 214.630 1.00 15.00 ? 52  LEU B C   1 
ATOM   4657 O  O   . LEU B 1 20  ? 64.590 59.540 213.870 1.00 15.00 ? 52  LEU B O   1 
ATOM   4658 C  CB  . LEU B 1 20  ? 62.670 62.440 214.890 1.00 15.00 ? 52  LEU B CB  1 
ATOM   4659 C  CG  . LEU B 1 20  ? 63.350 63.670 214.300 1.00 15.00 ? 52  LEU B CG  1 
ATOM   4660 C  CD1 . LEU B 1 20  ? 64.590 63.300 213.460 1.00 15.00 ? 52  LEU B CD1 1 
ATOM   4661 C  CD2 . LEU B 1 20  ? 62.330 64.420 213.440 1.00 15.00 ? 52  LEU B CD2 1 
ATOM   4662 N  N   . ASP B 1 21  ? 64.390 60.550 215.870 1.00 15.00 ? 53  ASP B N   1 
ATOM   4663 C  CA  . ASP B 1 21  ? 65.630 60.040 216.390 1.00 15.00 ? 53  ASP B CA  1 
ATOM   4664 C  C   . ASP B 1 21  ? 65.560 58.600 216.830 1.00 15.00 ? 53  ASP B C   1 
ATOM   4665 O  O   . ASP B 1 21  ? 66.620 58.000 217.010 1.00 15.00 ? 53  ASP B O   1 
ATOM   4666 C  CB  . ASP B 1 21  ? 66.050 60.920 217.570 1.00 15.00 ? 53  ASP B CB  1 
ATOM   4667 C  CG  . ASP B 1 21  ? 65.250 60.730 218.890 1.00 15.00 ? 53  ASP B CG  1 
ATOM   4668 O  OD1 . ASP B 1 21  ? 64.030 60.490 218.860 1.00 15.00 ? 53  ASP B OD1 1 
ATOM   4669 O  OD2 . ASP B 1 21  ? 65.870 60.830 219.960 1.00 15.00 ? 53  ASP B OD2 1 
ATOM   4670 N  N   . ARG B 1 22  ? 64.370 58.010 217.100 1.00 15.00 ? 54  ARG B N   1 
ATOM   4671 C  CA  . ARG B 1 22  ? 64.370 56.670 217.670 1.00 15.00 ? 54  ARG B CA  1 
ATOM   4672 C  C   . ARG B 1 22  ? 63.750 55.630 216.740 1.00 15.00 ? 54  ARG B C   1 
ATOM   4673 O  O   . ARG B 1 22  ? 63.290 55.990 215.640 1.00 15.00 ? 54  ARG B O   1 
ATOM   4674 C  CB  . ARG B 1 22  ? 63.640 56.720 219.050 1.00 15.00 ? 54  ARG B CB  1 
ATOM   4675 C  CG  . ARG B 1 22  ? 62.250 57.390 219.120 1.00 15.00 ? 54  ARG B CG  1 
ATOM   4676 C  CD  . ARG B 1 22  ? 61.500 57.210 220.470 1.00 15.00 ? 54  ARG B CD  1 
ATOM   4677 N  NE  . ARG B 1 22  ? 61.340 55.790 220.880 1.00 15.00 ? 54  ARG B NE  1 
ATOM   4678 C  CZ  . ARG B 1 22  ? 60.170 55.070 220.860 1.00 15.00 ? 54  ARG B CZ  1 
ATOM   4679 N  NH1 . ARG B 1 22  ? 58.990 55.580 220.440 1.00 15.00 ? 54  ARG B NH1 1 
ATOM   4680 N  NH2 . ARG B 1 22  ? 60.200 53.780 221.280 1.00 15.00 ? 54  ARG B NH2 1 
ATOM   4681 N  N   . TYR B 1 23  ? 63.750 54.330 217.140 1.00 15.00 ? 55  TYR B N   1 
ATOM   4682 C  CA  . TYR B 1 23  ? 63.220 53.210 216.340 1.00 15.00 ? 55  TYR B CA  1 
ATOM   4683 C  C   . TYR B 1 23  ? 62.680 52.150 217.310 1.00 15.00 ? 55  TYR B C   1 
ATOM   4684 O  O   . TYR B 1 23  ? 62.810 52.330 218.520 1.00 15.00 ? 55  TYR B O   1 
ATOM   4685 C  CB  . TYR B 1 23  ? 64.340 52.600 215.500 1.00 15.00 ? 55  TYR B CB  1 
ATOM   4686 C  CG  . TYR B 1 23  ? 65.280 51.720 216.320 1.00 15.00 ? 55  TYR B CG  1 
ATOM   4687 C  CD1 . TYR B 1 23  ? 65.900 52.250 217.450 1.00 15.00 ? 55  TYR B CD1 1 
ATOM   4688 C  CD2 . TYR B 1 23  ? 65.470 50.390 216.010 1.00 15.00 ? 55  TYR B CD2 1 
ATOM   4689 C  CE1 . TYR B 1 23  ? 66.680 51.450 218.240 1.00 15.00 ? 55  TYR B CE1 1 
ATOM   4690 C  CE2 . TYR B 1 23  ? 66.260 49.600 216.810 1.00 15.00 ? 55  TYR B CE2 1 
ATOM   4691 C  CZ  . TYR B 1 23  ? 66.850 50.140 217.920 1.00 15.00 ? 55  TYR B CZ  1 
ATOM   4692 O  OH  . TYR B 1 23  ? 67.640 49.360 218.740 1.00 15.00 ? 55  TYR B OH  1 
ATOM   4693 N  N   . GLN B 1 24  ? 62.140 51.040 216.790 1.00 15.00 ? 56  GLN B N   1 
ATOM   4694 C  CA  . GLN B 1 24  ? 61.660 49.910 217.570 1.00 15.00 ? 56  GLN B CA  1 
ATOM   4695 C  C   . GLN B 1 24  ? 61.740 48.620 216.770 1.00 15.00 ? 56  GLN B C   1 
ATOM   4696 O  O   . GLN B 1 24  ? 61.500 48.630 215.560 1.00 15.00 ? 56  GLN B O   1 
ATOM   4697 C  CB  . GLN B 1 24  ? 60.230 50.080 217.990 1.00 15.00 ? 56  GLN B CB  1 
ATOM   4698 C  CG  . GLN B 1 24  ? 60.130 50.800 219.310 1.00 15.00 ? 56  GLN B CG  1 
ATOM   4699 C  CD  . GLN B 1 24  ? 58.700 50.930 219.800 1.00 15.00 ? 56  GLN B CD  1 
ATOM   4700 O  OE1 . GLN B 1 24  ? 58.050 49.960 220.220 1.00 15.00 ? 56  GLN B OE1 1 
ATOM   4701 N  NE2 . GLN B 1 24  ? 58.160 52.150 219.770 1.00 15.00 ? 56  GLN B NE2 1 
ATOM   4702 N  N   . CYS B 1 25  ? 62.110 47.500 217.400 1.00 15.00 ? 57  CYS B N   1 
ATOM   4703 C  CA  . CYS B 1 25  ? 62.130 46.220 216.720 1.00 15.00 ? 57  CYS B CA  1 
ATOM   4704 C  C   . CYS B 1 25  ? 60.860 45.470 217.010 1.00 15.00 ? 57  CYS B C   1 
ATOM   4705 O  O   . CYS B 1 25  ? 60.510 45.280 218.180 1.00 15.00 ? 57  CYS B O   1 
ATOM   4706 C  CB  . CYS B 1 25  ? 63.240 45.330 217.180 1.00 15.00 ? 57  CYS B CB  1 
ATOM   4707 S  SG  . CYS B 1 25  ? 64.840 45.930 216.660 1.00 15.00 ? 57  CYS B SG  1 
ATOM   4708 N  N   . ASP B 1 26  ? 60.150 45.000 216.000 1.00 15.00 ? 58  ASP B N   1 
ATOM   4709 C  CA  . ASP B 1 26  ? 58.970 44.220 216.260 1.00 15.00 ? 58  ASP B CA  1 
ATOM   4710 C  C   . ASP B 1 26  ? 59.330 42.750 216.250 1.00 15.00 ? 58  ASP B C   1 
ATOM   4711 O  O   . ASP B 1 26  ? 59.470 42.160 215.190 1.00 15.00 ? 58  ASP B O   1 
ATOM   4712 C  CB  . ASP B 1 26  ? 57.930 44.490 215.200 1.00 15.00 ? 58  ASP B CB  1 
ATOM   4713 C  CG  . ASP B 1 26  ? 56.630 43.710 215.400 1.00 15.00 ? 58  ASP B CG  1 
ATOM   4714 O  OD1 . ASP B 1 26  ? 56.280 43.410 216.540 1.00 15.00 ? 58  ASP B OD1 1 
ATOM   4715 O  OD2 . ASP B 1 26  ? 55.970 43.420 214.420 1.00 15.00 ? 58  ASP B OD2 1 
ATOM   4716 N  N   . CYS B 1 27  ? 59.490 42.130 217.400 1.00 15.00 ? 59  CYS B N   1 
ATOM   4717 C  CA  . CYS B 1 27  ? 59.850 40.720 217.470 1.00 15.00 ? 59  CYS B CA  1 
ATOM   4718 C  C   . CYS B 1 27  ? 58.630 39.810 217.480 1.00 15.00 ? 59  CYS B C   1 
ATOM   4719 O  O   . CYS B 1 27  ? 58.690 38.740 218.100 1.00 15.00 ? 59  CYS B O   1 
ATOM   4720 C  CB  . CYS B 1 27  ? 60.640 40.420 218.720 1.00 15.00 ? 59  CYS B CB  1 
ATOM   4721 S  SG  . CYS B 1 27  ? 61.750 41.780 219.200 1.00 15.00 ? 59  CYS B SG  1 
ATOM   4722 N  N   . THR B 1 28  ? 57.500 40.160 216.840 1.00 15.00 ? 60  THR B N   1 
ATOM   4723 C  CA  . THR B 1 28  ? 56.320 39.330 216.960 1.00 15.00 ? 60  THR B CA  1 
ATOM   4724 C  C   . THR B 1 28  ? 56.600 37.990 216.340 1.00 15.00 ? 60  THR B C   1 
ATOM   4725 O  O   . THR B 1 28  ? 57.120 37.860 215.230 1.00 15.00 ? 60  THR B O   1 
ATOM   4726 C  CB  . THR B 1 28  ? 55.150 40.050 216.310 1.00 15.00 ? 60  THR B CB  1 
ATOM   4727 O  OG1 . THR B 1 28  ? 54.930 41.200 217.120 1.00 15.00 ? 60  THR B OG1 1 
ATOM   4728 C  CG2 . THR B 1 28  ? 53.860 39.270 216.270 1.00 15.00 ? 60  THR B CG2 1 
ATOM   4729 N  N   . ARG B 1 29  ? 56.440 37.040 217.260 1.00 15.00 ? 61  ARG B N   1 
ATOM   4730 C  CA  . ARG B 1 29  ? 56.710 35.630 217.080 1.00 15.00 ? 61  ARG B CA  1 
ATOM   4731 C  C   . ARG B 1 29  ? 57.950 35.300 216.240 1.00 15.00 ? 61  ARG B C   1 
ATOM   4732 O  O   . ARG B 1 29  ? 57.950 34.620 215.220 1.00 15.00 ? 61  ARG B O   1 
ATOM   4733 C  CB  . ARG B 1 29  ? 55.420 34.950 216.530 1.00 15.00 ? 61  ARG B CB  1 
ATOM   4734 C  CG  . ARG B 1 29  ? 54.850 35.230 215.140 1.00 15.00 ? 61  ARG B CG  1 
ATOM   4735 C  CD  . ARG B 1 29  ? 53.460 34.620 214.960 1.00 15.00 ? 61  ARG B CD  1 
ATOM   4736 N  NE  . ARG B 1 29  ? 52.420 35.400 215.610 1.00 15.00 ? 61  ARG B NE  1 
ATOM   4737 C  CZ  . ARG B 1 29  ? 51.890 36.510 215.060 1.00 15.00 ? 61  ARG B CZ  1 
ATOM   4738 N  NH1 . ARG B 1 29  ? 52.270 36.960 213.870 1.00 15.00 ? 61  ARG B NH1 1 
ATOM   4739 N  NH2 . ARG B 1 29  ? 50.960 37.200 215.740 1.00 15.00 ? 61  ARG B NH2 1 
ATOM   4740 N  N   . THR B 1 30  ? 59.070 35.820 216.760 1.00 15.00 ? 62  THR B N   1 
ATOM   4741 C  CA  . THR B 1 30  ? 60.390 35.520 216.210 1.00 15.00 ? 62  THR B CA  1 
ATOM   4742 C  C   . THR B 1 30  ? 61.090 34.440 217.030 1.00 15.00 ? 62  THR B C   1 
ATOM   4743 O  O   . THR B 1 30  ? 62.080 33.820 216.630 1.00 15.00 ? 62  THR B O   1 
ATOM   4744 C  CB  . THR B 1 30  ? 61.220 36.760 216.210 1.00 15.00 ? 62  THR B CB  1 
ATOM   4745 O  OG1 . THR B 1 30  ? 61.220 37.170 217.570 1.00 15.00 ? 62  THR B OG1 1 
ATOM   4746 C  CG2 . THR B 1 30  ? 60.700 37.870 215.320 1.00 15.00 ? 62  THR B CG2 1 
ATOM   4747 N  N   . GLY B 1 31  ? 60.580 34.230 218.240 1.00 15.00 ? 63  GLY B N   1 
ATOM   4748 C  CA  . GLY B 1 31  ? 61.170 33.300 219.160 1.00 15.00 ? 63  GLY B CA  1 
ATOM   4749 C  C   . GLY B 1 31  ? 62.060 34.040 220.150 1.00 15.00 ? 63  GLY B C   1 
ATOM   4750 O  O   . GLY B 1 31  ? 62.440 33.460 221.180 1.00 15.00 ? 63  GLY B O   1 
ATOM   4751 N  N   . TYR B 1 32  ? 62.390 35.290 219.880 1.00 15.00 ? 64  TYR B N   1 
ATOM   4752 C  CA  . TYR B 1 32  ? 63.260 36.090 220.720 1.00 15.00 ? 64  TYR B CA  1 
ATOM   4753 C  C   . TYR B 1 32  ? 62.500 37.280 221.250 1.00 15.00 ? 64  TYR B C   1 
ATOM   4754 O  O   . TYR B 1 32  ? 61.450 37.650 220.730 1.00 15.00 ? 64  TYR B O   1 
ATOM   4755 C  CB  . TYR B 1 32  ? 64.460 36.590 219.920 1.00 15.00 ? 64  TYR B CB  1 
ATOM   4756 C  CG  . TYR B 1 32  ? 65.390 35.500 219.490 1.00 15.00 ? 64  TYR B CG  1 
ATOM   4757 C  CD1 . TYR B 1 32  ? 65.010 34.660 218.470 1.00 15.00 ? 64  TYR B CD1 1 
ATOM   4758 C  CD2 . TYR B 1 32  ? 66.580 35.310 220.130 1.00 15.00 ? 64  TYR B CD2 1 
ATOM   4759 C  CE1 . TYR B 1 32  ? 65.830 33.630 218.080 1.00 15.00 ? 64  TYR B CE1 1 
ATOM   4760 C  CE2 . TYR B 1 32  ? 67.400 34.270 219.760 1.00 15.00 ? 64  TYR B CE2 1 
ATOM   4761 C  CZ  . TYR B 1 32  ? 67.010 33.450 218.740 1.00 15.00 ? 64  TYR B CZ  1 
ATOM   4762 O  OH  . TYR B 1 32  ? 67.840 32.410 218.350 1.00 15.00 ? 64  TYR B OH  1 
ATOM   4763 N  N   . SER B 1 33  ? 63.070 37.900 222.270 1.00 15.00 ? 65  SER B N   1 
ATOM   4764 C  CA  . SER B 1 33  ? 62.440 39.040 222.920 1.00 15.00 ? 65  SER B CA  1 
ATOM   4765 C  C   . SER B 1 33  ? 63.410 40.180 223.160 1.00 15.00 ? 65  SER B C   1 
ATOM   4766 O  O   . SER B 1 33  ? 64.590 40.110 222.800 1.00 15.00 ? 65  SER B O   1 
ATOM   4767 C  CB  . SER B 1 33  ? 61.840 38.520 224.240 1.00 15.00 ? 65  SER B CB  1 
ATOM   4768 O  OG  . SER B 1 33  ? 62.700 37.610 224.910 1.00 15.00 ? 65  SER B OG  1 
ATOM   4769 N  N   . GLY B 1 34  ? 62.880 41.250 223.730 1.00 15.00 ? 66  GLY B N   1 
ATOM   4770 C  CA  . GLY B 1 34  ? 63.670 42.390 224.120 1.00 15.00 ? 66  GLY B CA  1 
ATOM   4771 C  C   . GLY B 1 34  ? 63.990 43.300 222.940 1.00 15.00 ? 66  GLY B C   1 
ATOM   4772 O  O   . GLY B 1 34  ? 63.670 42.960 221.810 1.00 15.00 ? 66  GLY B O   1 
ATOM   4773 N  N   . PRO B 1 35  ? 64.670 44.420 223.150 1.00 15.00 ? 67  PRO B N   1 
ATOM   4774 C  CA  . PRO B 1 35  ? 64.650 45.570 222.260 1.00 15.00 ? 67  PRO B CA  1 
ATOM   4775 C  C   . PRO B 1 35  ? 65.300 45.370 220.910 1.00 15.00 ? 67  PRO B C   1 
ATOM   4776 O  O   . PRO B 1 35  ? 65.010 46.130 219.980 1.00 15.00 ? 67  PRO B O   1 
ATOM   4777 C  CB  . PRO B 1 35  ? 65.300 46.640 223.080 1.00 15.00 ? 67  PRO B CB  1 
ATOM   4778 C  CG  . PRO B 1 35  ? 66.350 45.860 223.800 1.00 15.00 ? 67  PRO B CG  1 
ATOM   4779 C  CD  . PRO B 1 35  ? 65.620 44.610 224.230 1.00 15.00 ? 67  PRO B CD  1 
ATOM   4780 N  N   . ASN B 1 36  ? 66.220 44.420 220.760 1.00 15.00 ? 68  ASN B N   1 
ATOM   4781 C  CA  . ASN B 1 36  ? 66.800 44.180 219.460 1.00 15.00 ? 68  ASN B CA  1 
ATOM   4782 C  C   . ASN B 1 36  ? 66.430 42.780 219.020 1.00 15.00 ? 68  ASN B C   1 
ATOM   4783 O  O   . ASN B 1 36  ? 66.980 42.290 218.050 1.00 15.00 ? 68  ASN B O   1 
ATOM   4784 C  CB  . ASN B 1 36  ? 68.350 44.370 219.520 1.00 15.00 ? 68  ASN B CB  1 
ATOM   4785 C  CG  . ASN B 1 36  ? 68.910 45.810 219.520 1.00 15.00 ? 68  ASN B CG  1 
ATOM   4786 O  OD1 . ASN B 1 36  ? 70.020 46.150 220.000 1.00 15.00 ? 68  ASN B OD1 1 
ATOM   4787 N  ND2 . ASN B 1 36  ? 68.140 46.780 219.020 1.00 15.00 ? 68  ASN B ND2 1 
ATOM   4788 N  N   . CYS B 1 37  ? 65.450 42.130 219.680 1.00 15.00 ? 69  CYS B N   1 
ATOM   4789 C  CA  . CYS B 1 37  ? 64.990 40.760 219.450 1.00 15.00 ? 69  CYS B CA  1 
ATOM   4790 C  C   . CYS B 1 37  ? 66.130 39.770 219.530 1.00 15.00 ? 69  CYS B C   1 
ATOM   4791 O  O   . CYS B 1 37  ? 66.530 39.100 218.580 1.00 15.00 ? 69  CYS B O   1 
ATOM   4792 C  CB  . CYS B 1 37  ? 64.340 40.570 218.120 1.00 15.00 ? 69  CYS B CB  1 
ATOM   4793 S  SG  . CYS B 1 37  ? 63.120 41.830 217.730 1.00 15.00 ? 69  CYS B SG  1 
ATOM   4794 N  N   . THR B 1 38  ? 66.620 39.610 220.750 1.00 15.00 ? 70  THR B N   1 
ATOM   4795 C  CA  . THR B 1 38  ? 67.830 38.850 221.000 1.00 15.00 ? 70  THR B CA  1 
ATOM   4796 C  C   . THR B 1 38  ? 67.780 37.880 222.180 1.00 15.00 ? 70  THR B C   1 
ATOM   4797 O  O   . THR B 1 38  ? 68.630 37.010 222.290 1.00 15.00 ? 70  THR B O   1 
ATOM   4798 C  CB  . THR B 1 38  ? 68.930 39.940 221.140 1.00 15.00 ? 70  THR B CB  1 
ATOM   4799 O  OG1 . THR B 1 38  ? 70.120 39.240 221.420 1.00 15.00 ? 70  THR B OG1 1 
ATOM   4800 C  CG2 . THR B 1 38  ? 68.620 41.030 222.180 1.00 15.00 ? 70  THR B CG2 1 
ATOM   4801 N  N   . ILE B 1 39  ? 66.810 37.950 223.080 1.00 15.00 ? 71  ILE B N   1 
ATOM   4802 C  CA  . ILE B 1 39  ? 66.820 37.070 224.230 1.00 15.00 ? 71  ILE B CA  1 
ATOM   4803 C  C   . ILE B 1 39  ? 65.970 35.890 223.810 1.00 15.00 ? 71  ILE B C   1 
ATOM   4804 O  O   . ILE B 1 39  ? 64.800 36.080 223.470 1.00 15.00 ? 71  ILE B O   1 
ATOM   4805 C  CB  . ILE B 1 39  ? 66.190 37.760 225.420 1.00 15.00 ? 71  ILE B CB  1 
ATOM   4806 C  CG1 . ILE B 1 39  ? 66.790 39.130 225.660 1.00 15.00 ? 71  ILE B CG1 1 
ATOM   4807 C  CG2 . ILE B 1 39  ? 66.430 36.900 226.630 1.00 15.00 ? 71  ILE B CG2 1 
ATOM   4808 C  CD1 . ILE B 1 39  ? 66.030 39.940 226.700 1.00 15.00 ? 71  ILE B CD1 1 
ATOM   4809 N  N   . PRO B 1 40  ? 66.500 34.680 223.760 1.00 15.00 ? 72  PRO B N   1 
ATOM   4810 C  CA  . PRO B 1 40  ? 65.820 33.510 223.240 1.00 15.00 ? 72  PRO B CA  1 
ATOM   4811 C  C   . PRO B 1 40  ? 64.770 32.940 224.180 1.00 15.00 ? 72  PRO B C   1 
ATOM   4812 O  O   . PRO B 1 40  ? 65.100 32.830 225.350 1.00 15.00 ? 72  PRO B O   1 
ATOM   4813 C  CB  . PRO B 1 40  ? 66.920 32.520 222.960 1.00 15.00 ? 72  PRO B CB  1 
ATOM   4814 C  CG  . PRO B 1 40  ? 68.200 33.330 223.070 1.00 15.00 ? 72  PRO B CG  1 
ATOM   4815 C  CD  . PRO B 1 40  ? 67.860 34.350 224.140 1.00 15.00 ? 72  PRO B CD  1 
ATOM   4816 N  N   . GLU B 1 41  ? 63.530 32.570 223.770 1.00 15.00 ? 73  GLU B N   1 
ATOM   4817 C  CA  . GLU B 1 41  ? 62.640 31.810 224.660 1.00 15.00 ? 73  GLU B CA  1 
ATOM   4818 C  C   . GLU B 1 41  ? 63.360 30.480 224.900 1.00 15.00 ? 73  GLU B C   1 
ATOM   4819 O  O   . GLU B 1 41  ? 64.120 30.030 224.040 1.00 15.00 ? 73  GLU B O   1 
ATOM   4820 C  CB  . GLU B 1 41  ? 61.300 31.440 224.060 1.00 15.00 ? 73  GLU B CB  1 
ATOM   4821 C  CG  . GLU B 1 41  ? 60.420 32.620 223.660 1.00 15.00 ? 73  GLU B CG  1 
ATOM   4822 C  CD  . GLU B 1 41  ? 59.230 32.270 222.740 1.00 15.00 ? 73  GLU B CD  1 
ATOM   4823 O  OE1 . GLU B 1 41  ? 59.240 31.230 222.060 1.00 15.00 ? 73  GLU B OE1 1 
ATOM   4824 O  OE2 . GLU B 1 41  ? 58.280 33.070 222.690 1.00 15.00 ? 73  GLU B OE2 1 
ATOM   4825 N  N   . ILE B 1 42  ? 63.100 29.790 226.020 1.00 15.00 ? 74  ILE B N   1 
ATOM   4826 C  CA  . ILE B 1 42  ? 63.860 28.580 226.280 1.00 15.00 ? 74  ILE B CA  1 
ATOM   4827 C  C   . ILE B 1 42  ? 63.800 27.510 225.180 1.00 15.00 ? 74  ILE B C   1 
ATOM   4828 O  O   . ILE B 1 42  ? 64.790 26.830 224.900 1.00 15.00 ? 74  ILE B O   1 
ATOM   4829 C  CB  . ILE B 1 42  ? 63.390 28.030 227.650 1.00 15.00 ? 74  ILE B CB  1 
ATOM   4830 C  CG1 . ILE B 1 42  ? 64.540 27.210 228.200 1.00 15.00 ? 74  ILE B CG1 1 
ATOM   4831 C  CG2 . ILE B 1 42  ? 62.150 27.150 227.570 1.00 15.00 ? 74  ILE B CG2 1 
ATOM   4832 C  CD1 . ILE B 1 42  ? 65.880 27.980 228.400 1.00 15.00 ? 74  ILE B CD1 1 
ATOM   4833 N  N   . TRP B 1 43  ? 62.660 27.450 224.500 1.00 15.00 ? 75  TRP B N   1 
ATOM   4834 C  CA  . TRP B 1 43  ? 62.520 26.540 223.370 1.00 15.00 ? 75  TRP B CA  1 
ATOM   4835 C  C   . TRP B 1 43  ? 63.400 26.990 222.220 1.00 15.00 ? 75  TRP B C   1 
ATOM   4836 O  O   . TRP B 1 43  ? 64.270 26.230 221.780 1.00 15.00 ? 75  TRP B O   1 
ATOM   4837 C  CB  . TRP B 1 43  ? 61.060 26.510 222.980 1.00 15.00 ? 75  TRP B CB  1 
ATOM   4838 C  CG  . TRP B 1 43  ? 60.380 25.430 223.800 1.00 15.00 ? 75  TRP B CG  1 
ATOM   4839 C  CD1 . TRP B 1 43  ? 60.050 25.610 225.130 1.00 15.00 ? 75  TRP B CD1 1 
ATOM   4840 C  CD2 . TRP B 1 43  ? 60.070 24.150 223.350 1.00 15.00 ? 75  TRP B CD2 1 
ATOM   4841 N  NE1 . TRP B 1 43  ? 59.540 24.470 225.540 1.00 15.00 ? 75  TRP B NE1 1 
ATOM   4842 C  CE2 . TRP B 1 43  ? 59.550 23.570 224.530 1.00 15.00 ? 75  TRP B CE2 1 
ATOM   4843 C  CE3 . TRP B 1 43  ? 60.170 23.430 222.160 1.00 15.00 ? 75  TRP B CE3 1 
ATOM   4844 C  CZ2 . TRP B 1 43  ? 59.100 22.250 224.510 1.00 15.00 ? 75  TRP B CZ2 1 
ATOM   4845 C  CZ3 . TRP B 1 43  ? 59.720 22.110 222.150 1.00 15.00 ? 75  TRP B CZ3 1 
ATOM   4846 C  CH2 . TRP B 1 43  ? 59.200 21.540 223.310 1.00 15.00 ? 75  TRP B CH2 1 
ATOM   4847 N  N   . THR B 1 44  ? 63.240 28.250 221.800 1.00 15.00 ? 76  THR B N   1 
ATOM   4848 C  CA  . THR B 1 44  ? 64.000 28.890 220.740 1.00 15.00 ? 76  THR B CA  1 
ATOM   4849 C  C   . THR B 1 44  ? 65.470 28.560 220.910 1.00 15.00 ? 76  THR B C   1 
ATOM   4850 O  O   . THR B 1 44  ? 66.110 27.950 220.050 1.00 15.00 ? 76  THR B O   1 
ATOM   4851 C  CB  . THR B 1 44  ? 63.780 30.390 220.840 1.00 15.00 ? 76  THR B CB  1 
ATOM   4852 O  OG1 . THR B 1 44  ? 62.370 30.580 220.960 1.00 15.00 ? 76  THR B OG1 1 
ATOM   4853 C  CG2 . THR B 1 44  ? 64.380 31.120 219.690 1.00 15.00 ? 76  THR B CG2 1 
ATOM   4854 N  N   . TRP B 1 45  ? 65.890 28.840 222.140 1.00 15.00 ? 77  TRP B N   1 
ATOM   4855 C  CA  . TRP B 1 45  ? 67.240 28.600 222.570 1.00 15.00 ? 77  TRP B CA  1 
ATOM   4856 C  C   . TRP B 1 45  ? 67.690 27.170 222.300 1.00 15.00 ? 77  TRP B C   1 
ATOM   4857 O  O   . TRP B 1 45  ? 68.600 26.900 221.500 1.00 15.00 ? 77  TRP B O   1 
ATOM   4858 C  CB  . TRP B 1 45  ? 67.330 28.930 224.070 1.00 15.00 ? 77  TRP B CB  1 
ATOM   4859 C  CG  . TRP B 1 45  ? 68.740 28.670 224.560 1.00 15.00 ? 77  TRP B CG  1 
ATOM   4860 C  CD1 . TRP B 1 45  ? 69.770 29.490 224.200 1.00 15.00 ? 77  TRP B CD1 1 
ATOM   4861 C  CD2 . TRP B 1 45  ? 69.150 27.580 225.290 1.00 15.00 ? 77  TRP B CD2 1 
ATOM   4862 N  NE1 . TRP B 1 45  ? 70.850 28.920 224.680 1.00 15.00 ? 77  TRP B NE1 1 
ATOM   4863 C  CE2 . TRP B 1 45  ? 70.520 27.780 225.340 1.00 15.00 ? 77  TRP B CE2 1 
ATOM   4864 C  CE3 . TRP B 1 45  ? 68.580 26.480 225.900 1.00 15.00 ? 77  TRP B CE3 1 
ATOM   4865 C  CZ2 . TRP B 1 45  ? 71.370 26.900 225.980 1.00 15.00 ? 77  TRP B CZ2 1 
ATOM   4866 C  CZ3 . TRP B 1 45  ? 69.420 25.590 226.540 1.00 15.00 ? 77  TRP B CZ3 1 
ATOM   4867 C  CH2 . TRP B 1 45  ? 70.800 25.790 226.580 1.00 15.00 ? 77  TRP B CH2 1 
ATOM   4868 N  N   . LEU B 1 46  ? 67.020 26.250 222.980 1.00 15.00 ? 78  LEU B N   1 
ATOM   4869 C  CA  . LEU B 1 46  ? 67.380 24.860 222.950 1.00 15.00 ? 78  LEU B CA  1 
ATOM   4870 C  C   . LEU B 1 46  ? 67.480 24.300 221.550 1.00 15.00 ? 78  LEU B C   1 
ATOM   4871 O  O   . LEU B 1 46  ? 68.430 23.590 221.200 1.00 15.00 ? 78  LEU B O   1 
ATOM   4872 C  CB  . LEU B 1 46  ? 66.360 24.130 223.760 1.00 15.00 ? 78  LEU B CB  1 
ATOM   4873 C  CG  . LEU B 1 46  ? 66.740 22.740 224.160 1.00 15.00 ? 78  LEU B CG  1 
ATOM   4874 C  CD1 . LEU B 1 46  ? 68.110 22.770 224.870 1.00 15.00 ? 78  LEU B CD1 1 
ATOM   4875 C  CD2 . LEU B 1 46  ? 65.650 22.170 225.050 1.00 15.00 ? 78  LEU B CD2 1 
ATOM   4876 N  N   . ARG B 1 47  ? 66.550 24.710 220.710 1.00 15.00 ? 79  ARG B N   1 
ATOM   4877 C  CA  . ARG B 1 47  ? 66.520 24.280 219.330 1.00 15.00 ? 79  ARG B CA  1 
ATOM   4878 C  C   . ARG B 1 47  ? 67.820 24.730 218.680 1.00 15.00 ? 79  ARG B C   1 
ATOM   4879 O  O   . ARG B 1 47  ? 68.640 23.910 218.260 1.00 15.00 ? 79  ARG B O   1 
ATOM   4880 C  CB  . ARG B 1 47  ? 65.310 24.910 218.680 1.00 15.00 ? 79  ARG B CB  1 
ATOM   4881 C  CG  . ARG B 1 47  ? 64.970 24.510 217.240 1.00 15.00 ? 79  ARG B CG  1 
ATOM   4882 C  CD  . ARG B 1 47  ? 63.640 25.270 216.910 1.00 15.00 ? 79  ARG B CD  1 
ATOM   4883 N  NE  . ARG B 1 47  ? 63.630 26.470 216.060 1.00 15.00 ? 79  ARG B NE  1 
ATOM   4884 C  CZ  . ARG B 1 47  ? 64.650 27.270 215.620 1.00 15.00 ? 79  ARG B CZ  1 
ATOM   4885 N  NH1 . ARG B 1 47  ? 65.960 27.100 215.930 1.00 15.00 ? 79  ARG B NH1 1 
ATOM   4886 N  NH2 . ARG B 1 47  ? 64.310 28.330 214.840 1.00 15.00 ? 79  ARG B NH2 1 
ATOM   4887 N  N   . THR B 1 48  ? 68.050 26.030 218.690 1.00 15.00 ? 80  THR B N   1 
ATOM   4888 C  CA  . THR B 1 48  ? 69.200 26.590 218.020 1.00 15.00 ? 80  THR B CA  1 
ATOM   4889 C  C   . THR B 1 48  ? 70.490 26.000 218.550 1.00 15.00 ? 80  THR B C   1 
ATOM   4890 O  O   . THR B 1 48  ? 71.380 25.670 217.750 1.00 15.00 ? 80  THR B O   1 
ATOM   4891 C  CB  . THR B 1 48  ? 69.230 28.090 218.200 1.00 15.00 ? 80  THR B CB  1 
ATOM   4892 O  OG1 . THR B 1 48  ? 67.870 28.530 218.160 1.00 15.00 ? 80  THR B OG1 1 
ATOM   4893 C  CG2 . THR B 1 48  ? 69.990 28.780 217.060 1.00 15.00 ? 80  THR B CG2 1 
ATOM   4894 N  N   . THR B 1 49  ? 70.610 25.790 219.860 1.00 15.00 ? 81  THR B N   1 
ATOM   4895 C  CA  . THR B 1 49  ? 71.850 25.270 220.390 1.00 15.00 ? 81  THR B CA  1 
ATOM   4896 C  C   . THR B 1 49  ? 72.070 23.830 219.990 1.00 15.00 ? 81  THR B C   1 
ATOM   4897 O  O   . THR B 1 49  ? 73.210 23.390 219.840 1.00 15.00 ? 81  THR B O   1 
ATOM   4898 C  CB  . THR B 1 49  ? 71.930 25.380 221.970 1.00 15.00 ? 81  THR B CB  1 
ATOM   4899 O  OG1 . THR B 1 49  ? 70.610 25.240 222.550 1.00 15.00 ? 81  THR B OG1 1 
ATOM   4900 C  CG2 . THR B 1 49  ? 72.560 26.720 222.340 1.00 15.00 ? 81  THR B CG2 1 
ATOM   4901 N  N   . LEU B 1 50  ? 70.980 23.060 219.790 1.00 15.00 ? 82  LEU B N   1 
ATOM   4902 C  CA  . LEU B 1 50  ? 71.140 21.690 219.400 1.00 15.00 ? 82  LEU B CA  1 
ATOM   4903 C  C   . LEU B 1 50  ? 71.260 21.530 217.890 1.00 15.00 ? 82  LEU B C   1 
ATOM   4904 O  O   . LEU B 1 50  ? 71.670 20.470 217.440 1.00 15.00 ? 82  LEU B O   1 
ATOM   4905 C  CB  . LEU B 1 50  ? 69.970 20.900 219.920 1.00 15.00 ? 82  LEU B CB  1 
ATOM   4906 C  CG  . LEU B 1 50  ? 70.030 20.320 221.330 1.00 15.00 ? 82  LEU B CG  1 
ATOM   4907 C  CD1 . LEU B 1 50  ? 70.770 21.250 222.290 1.00 15.00 ? 82  LEU B CD1 1 
ATOM   4908 C  CD2 . LEU B 1 50  ? 68.580 20.050 221.770 1.00 15.00 ? 82  LEU B CD2 1 
ATOM   4909 N  N   . ARG B 1 51  ? 70.890 22.550 217.100 1.00 15.00 ? 83  ARG B N   1 
ATOM   4910 C  CA  . ARG B 1 51  ? 70.960 22.440 215.640 1.00 15.00 ? 83  ARG B CA  1 
ATOM   4911 C  C   . ARG B 1 51  ? 72.400 22.140 215.180 1.00 15.00 ? 83  ARG B C   1 
ATOM   4912 O  O   . ARG B 1 51  ? 73.310 22.920 215.490 1.00 15.00 ? 83  ARG B O   1 
ATOM   4913 C  CB  . ARG B 1 51  ? 70.460 23.740 214.940 1.00 15.00 ? 83  ARG B CB  1 
ATOM   4914 C  CG  . ARG B 1 51  ? 68.930 23.960 214.860 1.00 15.00 ? 83  ARG B CG  1 
ATOM   4915 C  CD  . ARG B 1 51  ? 68.550 25.270 214.110 1.00 15.00 ? 83  ARG B CD  1 
ATOM   4916 N  NE  . ARG B 1 51  ? 67.220 25.200 213.500 1.00 15.00 ? 83  ARG B NE  1 
ATOM   4917 C  CZ  . ARG B 1 51  ? 66.670 26.220 212.790 1.00 15.00 ? 83  ARG B CZ  1 
ATOM   4918 N  NH1 . ARG B 1 51  ? 67.290 27.410 212.590 1.00 15.00 ? 83  ARG B NH1 1 
ATOM   4919 N  NH2 . ARG B 1 51  ? 65.460 26.040 212.250 1.00 15.00 ? 83  ARG B NH2 1 
ATOM   4920 N  N   . PRO B 1 52  ? 72.650 21.030 214.480 1.00 15.00 ? 84  PRO B N   1 
ATOM   4921 C  CA  . PRO B 1 52  ? 73.980 20.650 214.020 1.00 15.00 ? 84  PRO B CA  1 
ATOM   4922 C  C   . PRO B 1 52  ? 74.520 21.590 212.940 1.00 15.00 ? 84  PRO B C   1 
ATOM   4923 O  O   . PRO B 1 52  ? 73.730 22.280 212.270 1.00 15.00 ? 84  PRO B O   1 
ATOM   4924 C  CB  . PRO B 1 52  ? 73.800 19.230 213.550 1.00 15.00 ? 84  PRO B CB  1 
ATOM   4925 C  CG  . PRO B 1 52  ? 72.390 19.230 213.060 1.00 15.00 ? 84  PRO B CG  1 
ATOM   4926 C  CD  . PRO B 1 52  ? 71.670 20.020 214.130 1.00 15.00 ? 84  PRO B CD  1 
ATOM   4927 N  N   . SER B 1 53  ? 75.830 21.680 212.730 1.00 15.00 ? 85  SER B N   1 
ATOM   4928 C  CA  . SER B 1 53  ? 76.380 22.560 211.710 1.00 15.00 ? 85  SER B CA  1 
ATOM   4929 C  C   . SER B 1 53  ? 75.890 22.220 210.310 1.00 15.00 ? 85  SER B C   1 
ATOM   4930 O  O   . SER B 1 53  ? 75.870 21.030 209.960 1.00 15.00 ? 85  SER B O   1 
ATOM   4931 C  CB  . SER B 1 53  ? 77.890 22.490 211.760 1.00 15.00 ? 85  SER B CB  1 
ATOM   4932 O  OG  . SER B 1 53  ? 78.520 23.250 210.740 1.00 15.00 ? 85  SER B OG  1 
ATOM   4933 N  N   . PRO B 1 54  ? 75.500 23.160 209.440 1.00 15.00 ? 86  PRO B N   1 
ATOM   4934 C  CA  . PRO B 1 54  ? 75.160 22.950 208.050 1.00 15.00 ? 86  PRO B CA  1 
ATOM   4935 C  C   . PRO B 1 54  ? 76.220 22.150 207.310 1.00 15.00 ? 86  PRO B C   1 
ATOM   4936 O  O   . PRO B 1 54  ? 75.930 21.080 206.760 1.00 15.00 ? 86  PRO B O   1 
ATOM   4937 C  CB  . PRO B 1 54  ? 74.940 24.340 207.460 1.00 15.00 ? 86  PRO B CB  1 
ATOM   4938 C  CG  . PRO B 1 54  ? 75.380 25.280 208.530 1.00 15.00 ? 86  PRO B CG  1 
ATOM   4939 C  CD  . PRO B 1 54  ? 75.110 24.510 209.820 1.00 15.00 ? 86  PRO B CD  1 
ATOM   4940 N  N   . SER B 1 55  ? 77.450 22.600 207.380 1.00 15.00 ? 87  SER B N   1 
ATOM   4941 C  CA  . SER B 1 55  ? 78.580 21.920 206.790 1.00 15.00 ? 87  SER B CA  1 
ATOM   4942 C  C   . SER B 1 55  ? 78.610 20.450 207.220 1.00 15.00 ? 87  SER B C   1 
ATOM   4943 O  O   . SER B 1 55  ? 78.930 19.550 206.420 1.00 15.00 ? 87  SER B O   1 
ATOM   4944 C  CB  . SER B 1 55  ? 79.860 22.670 207.230 1.00 15.00 ? 87  SER B CB  1 
ATOM   4945 O  OG  . SER B 1 55  ? 79.580 24.030 207.600 1.00 15.00 ? 87  SER B OG  1 
ATOM   4946 N  N   . PHE B 1 56  ? 78.190 20.160 208.470 1.00 15.00 ? 88  PHE B N   1 
ATOM   4947 C  CA  . PHE B 1 56  ? 78.120 18.790 208.970 1.00 15.00 ? 88  PHE B CA  1 
ATOM   4948 C  C   . PHE B 1 56  ? 76.950 18.010 208.370 1.00 15.00 ? 88  PHE B C   1 
ATOM   4949 O  O   . PHE B 1 56  ? 77.140 16.880 207.910 1.00 15.00 ? 88  PHE B O   1 
ATOM   4950 C  CB  . PHE B 1 56  ? 78.010 18.880 210.490 1.00 15.00 ? 88  PHE B CB  1 
ATOM   4951 C  CG  . PHE B 1 56  ? 77.540 17.620 211.190 1.00 15.00 ? 88  PHE B CG  1 
ATOM   4952 C  CD1 . PHE B 1 56  ? 78.360 16.500 211.260 1.00 15.00 ? 88  PHE B CD1 1 
ATOM   4953 C  CD2 . PHE B 1 56  ? 76.280 17.590 211.740 1.00 15.00 ? 88  PHE B CD2 1 
ATOM   4954 C  CE1 . PHE B 1 56  ? 77.910 15.360 211.880 1.00 15.00 ? 88  PHE B CE1 1 
ATOM   4955 C  CE2 . PHE B 1 56  ? 75.840 16.440 212.370 1.00 15.00 ? 88  PHE B CE2 1 
ATOM   4956 C  CZ  . PHE B 1 56  ? 76.660 15.320 212.440 1.00 15.00 ? 88  PHE B CZ  1 
ATOM   4957 N  N   . ILE B 1 57  ? 75.750 18.600 208.340 1.00 15.00 ? 89  ILE B N   1 
ATOM   4958 C  CA  . ILE B 1 57  ? 74.560 17.950 207.800 1.00 15.00 ? 89  ILE B CA  1 
ATOM   4959 C  C   . ILE B 1 57  ? 74.870 17.530 206.370 1.00 15.00 ? 89  ILE B C   1 
ATOM   4960 O  O   . ILE B 1 57  ? 74.550 16.400 205.970 1.00 15.00 ? 89  ILE B O   1 
ATOM   4961 C  CB  . ILE B 1 57  ? 73.360 18.960 207.870 1.00 15.00 ? 89  ILE B CB  1 
ATOM   4962 C  CG1 . ILE B 1 57  ? 72.880 19.100 209.310 1.00 15.00 ? 89  ILE B CG1 1 
ATOM   4963 C  CG2 . ILE B 1 57  ? 72.190 18.470 207.030 1.00 15.00 ? 89  ILE B CG2 1 
ATOM   4964 C  CD1 . ILE B 1 57  ? 72.140 17.860 209.860 1.00 15.00 ? 89  ILE B CD1 1 
ATOM   4965 N  N   . HIS B 1 58  ? 75.590 18.380 205.640 1.00 15.00 ? 90  HIS B N   1 
ATOM   4966 C  CA  . HIS B 1 58  ? 75.970 18.100 204.270 1.00 15.00 ? 90  HIS B CA  1 
ATOM   4967 C  C   . HIS B 1 58  ? 76.750 16.810 204.180 1.00 15.00 ? 90  HIS B C   1 
ATOM   4968 O  O   . HIS B 1 58  ? 76.440 15.930 203.370 1.00 15.00 ? 90  HIS B O   1 
ATOM   4969 C  CB  . HIS B 1 58  ? 76.830 19.220 203.750 1.00 15.00 ? 90  HIS B CB  1 
ATOM   4970 C  CG  . HIS B 1 58  ? 77.090 19.150 202.250 1.00 15.00 ? 90  HIS B CG  1 
ATOM   4971 N  ND1 . HIS B 1 58  ? 76.180 19.530 201.270 1.00 15.00 ? 90  HIS B ND1 1 
ATOM   4972 C  CD2 . HIS B 1 58  ? 78.310 18.800 201.700 1.00 15.00 ? 90  HIS B CD2 1 
ATOM   4973 C  CE1 . HIS B 1 58  ? 76.870 19.460 200.110 1.00 15.00 ? 90  HIS B CE1 1 
ATOM   4974 N  NE2 . HIS B 1 58  ? 78.090 19.060 200.330 1.00 15.00 ? 90  HIS B NE2 1 
ATOM   4975 N  N   . PHE B 1 59  ? 77.720 16.660 205.080 1.00 15.00 ? 91  PHE B N   1 
ATOM   4976 C  CA  . PHE B 1 59  ? 78.490 15.460 205.100 1.00 15.00 ? 91  PHE B CA  1 
ATOM   4977 C  C   . PHE B 1 59  ? 77.610 14.270 205.420 1.00 15.00 ? 91  PHE B C   1 
ATOM   4978 O  O   . PHE B 1 59  ? 77.810 13.210 204.860 1.00 15.00 ? 91  PHE B O   1 
ATOM   4979 C  CB  . PHE B 1 59  ? 79.630 15.540 206.120 1.00 15.00 ? 91  PHE B CB  1 
ATOM   4980 C  CG  . PHE B 1 59  ? 80.470 14.270 206.010 1.00 15.00 ? 91  PHE B CG  1 
ATOM   4981 C  CD1 . PHE B 1 59  ? 80.870 13.780 204.750 1.00 15.00 ? 91  PHE B CD1 1 
ATOM   4982 C  CD2 . PHE B 1 59  ? 80.760 13.560 207.170 1.00 15.00 ? 91  PHE B CD2 1 
ATOM   4983 C  CE1 . PHE B 1 59  ? 81.540 12.580 204.620 1.00 15.00 ? 91  PHE B CE1 1 
ATOM   4984 C  CE2 . PHE B 1 59  ? 81.440 12.360 207.030 1.00 15.00 ? 91  PHE B CE2 1 
ATOM   4985 C  CZ  . PHE B 1 59  ? 81.820 11.890 205.780 1.00 15.00 ? 91  PHE B CZ  1 
ATOM   4986 N  N   . LEU B 1 60  ? 76.620 14.380 206.270 1.00 15.00 ? 92  LEU B N   1 
ATOM   4987 C  CA  . LEU B 1 60  ? 75.770 13.230 206.510 1.00 15.00 ? 92  LEU B CA  1 
ATOM   4988 C  C   . LEU B 1 60  ? 75.010 12.860 205.270 1.00 15.00 ? 92  LEU B C   1 
ATOM   4989 O  O   . LEU B 1 60  ? 74.880 11.670 204.980 1.00 15.00 ? 92  LEU B O   1 
ATOM   4990 C  CB  . LEU B 1 60  ? 74.800 13.560 207.590 1.00 15.00 ? 92  LEU B CB  1 
ATOM   4991 C  CG  . LEU B 1 60  ? 75.420 13.810 208.930 1.00 15.00 ? 92  LEU B CG  1 
ATOM   4992 C  CD1 . LEU B 1 60  ? 74.330 14.300 209.830 1.00 15.00 ? 92  LEU B CD1 1 
ATOM   4993 C  CD2 . LEU B 1 60  ? 76.080 12.560 209.480 1.00 15.00 ? 92  LEU B CD2 1 
ATOM   4994 N  N   . LEU B 1 61  ? 74.570 13.820 204.490 1.00 15.00 ? 93  LEU B N   1 
ATOM   4995 C  CA  . LEU B 1 61  ? 73.920 13.470 203.260 1.00 15.00 ? 93  LEU B CA  1 
ATOM   4996 C  C   . LEU B 1 61  ? 74.920 12.940 202.240 1.00 15.00 ? 93  LEU B C   1 
ATOM   4997 O  O   . LEU B 1 61  ? 74.470 12.550 201.170 1.00 15.00 ? 93  LEU B O   1 
ATOM   4998 C  CB  . LEU B 1 61  ? 73.200 14.660 202.680 1.00 15.00 ? 93  LEU B CB  1 
ATOM   4999 C  CG  . LEU B 1 61  ? 71.850 15.120 203.220 1.00 15.00 ? 93  LEU B CG  1 
ATOM   5000 C  CD1 . LEU B 1 61  ? 71.040 13.960 203.780 1.00 15.00 ? 93  LEU B CD1 1 
ATOM   5001 C  CD2 . LEU B 1 61  ? 72.080 16.130 204.270 1.00 15.00 ? 93  LEU B CD2 1 
ATOM   5002 N  N   . THR B 1 62  ? 76.240 12.950 202.530 1.00 15.00 ? 94  THR B N   1 
ATOM   5003 C  CA  . THR B 1 62  ? 77.300 12.390 201.700 1.00 15.00 ? 94  THR B CA  1 
ATOM   5004 C  C   . THR B 1 62  ? 78.360 11.570 202.510 1.00 15.00 ? 94  THR B C   1 
ATOM   5005 O  O   . THR B 1 62  ? 79.600 11.610 202.430 1.00 15.00 ? 94  THR B O   1 
ATOM   5006 C  CB  . THR B 1 62  ? 77.920 13.570 200.930 1.00 15.00 ? 94  THR B CB  1 
ATOM   5007 O  OG1 . THR B 1 62  ? 76.900 14.500 200.550 1.00 15.00 ? 94  THR B OG1 1 
ATOM   5008 C  CG2 . THR B 1 62  ? 78.570 13.030 199.680 1.00 15.00 ? 94  THR B CG2 1 
ATOM   5009 N  N   . HIS B 1 63  ? 77.720 10.830 203.400 1.00 15.00 ? 95  HIS B N   1 
ATOM   5010 C  CA  . HIS B 1 63  ? 78.320 9.840  204.290 1.00 15.00 ? 95  HIS B CA  1 
ATOM   5011 C  C   . HIS B 1 63  ? 77.940 8.530  203.620 1.00 15.00 ? 95  HIS B C   1 
ATOM   5012 O  O   . HIS B 1 63  ? 77.410 8.500  202.500 1.00 15.00 ? 95  HIS B O   1 
ATOM   5013 C  CB  . HIS B 1 63  ? 77.690 9.990  205.730 1.00 15.00 ? 95  HIS B CB  1 
ATOM   5014 C  CG  . HIS B 1 63  ? 77.580 9.050  206.990 1.00 15.00 ? 95  HIS B CG  1 
ATOM   5015 N  ND1 . HIS B 1 63  ? 76.400 8.950  207.780 1.00 15.00 ? 95  HIS B ND1 1 
ATOM   5016 C  CD2 . HIS B 1 63  ? 78.610 8.230  207.510 1.00 15.00 ? 95  HIS B CD2 1 
ATOM   5017 C  CE1 . HIS B 1 63  ? 76.730 8.060  208.750 1.00 15.00 ? 95  HIS B CE1 1 
ATOM   5018 N  NE2 . HIS B 1 63  ? 77.960 7.640  208.610 1.00 15.00 ? 95  HIS B NE2 1 
ATOM   5019 N  N   . GLY B 1 64  ? 78.080 7.380  204.280 1.00 15.00 ? 96  GLY B N   1 
ATOM   5020 C  CA  . GLY B 1 64  ? 77.940 6.070  203.660 1.00 15.00 ? 96  GLY B CA  1 
ATOM   5021 C  C   . GLY B 1 64  ? 76.680 5.680  202.920 1.00 15.00 ? 96  GLY B C   1 
ATOM   5022 O  O   . GLY B 1 64  ? 75.700 5.220  203.540 1.00 15.00 ? 96  GLY B O   1 
ATOM   5023 N  N   . ARG B 1 65  ? 76.760 5.760  201.590 1.00 15.00 ? 97  ARG B N   1 
ATOM   5024 C  CA  . ARG B 1 65  ? 75.700 5.320  200.680 1.00 15.00 ? 97  ARG B CA  1 
ATOM   5025 C  C   . ARG B 1 65  ? 75.020 4.020  201.110 1.00 15.00 ? 97  ARG B C   1 
ATOM   5026 O  O   . ARG B 1 65  ? 73.810 3.900  200.890 1.00 15.00 ? 97  ARG B O   1 
ATOM   5027 C  CB  . ARG B 1 65  ? 76.320 5.220  199.280 1.00 15.00 ? 97  ARG B CB  1 
ATOM   5028 C  CG  . ARG B 1 65  ? 75.460 4.600  198.150 1.00 15.00 ? 97  ARG B CG  1 
ATOM   5029 C  CD  . ARG B 1 65  ? 74.920 5.540  197.060 1.00 15.00 ? 97  ARG B CD  1 
ATOM   5030 N  NE  . ARG B 1 65  ? 73.610 6.160  197.330 1.00 15.00 ? 97  ARG B NE  1 
ATOM   5031 C  CZ  . ARG B 1 65  ? 72.830 6.680  196.340 1.00 15.00 ? 97  ARG B CZ  1 
ATOM   5032 N  NH1 . ARG B 1 65  ? 73.200 6.670  195.040 1.00 15.00 ? 97  ARG B NH1 1 
ATOM   5033 N  NH2 . ARG B 1 65  ? 71.680 7.310  196.640 1.00 15.00 ? 97  ARG B NH2 1 
ATOM   5034 N  N   . TRP B 1 66  ? 75.680 3.060  201.800 1.00 15.00 ? 98  TRP B N   1 
ATOM   5035 C  CA  . TRP B 1 66  ? 75.000 1.870  202.300 1.00 15.00 ? 98  TRP B CA  1 
ATOM   5036 C  C   . TRP B 1 66  ? 73.840 2.240  203.200 1.00 15.00 ? 98  TRP B C   1 
ATOM   5037 O  O   . TRP B 1 66  ? 72.700 1.850  202.910 1.00 15.00 ? 98  TRP B O   1 
ATOM   5038 C  CB  . TRP B 1 66  ? 75.920 0.940  203.140 1.00 15.00 ? 98  TRP B CB  1 
ATOM   5039 C  CG  . TRP B 1 66  ? 76.530 1.440  204.470 1.00 15.00 ? 98  TRP B CG  1 
ATOM   5040 C  CD1 . TRP B 1 66  ? 75.940 1.280  205.720 1.00 15.00 ? 98  TRP B CD1 1 
ATOM   5041 C  CD2 . TRP B 1 66  ? 77.750 2.060  204.560 1.00 15.00 ? 98  TRP B CD2 1 
ATOM   5042 N  NE1 . TRP B 1 66  ? 76.790 1.790  206.600 1.00 15.00 ? 98  TRP B NE1 1 
ATOM   5043 C  CE2 . TRP B 1 66  ? 77.870 2.270  205.940 1.00 15.00 ? 98  TRP B CE2 1 
ATOM   5044 C  CE3 . TRP B 1 66  ? 78.710 2.450  203.630 1.00 15.00 ? 98  TRP B CE3 1 
ATOM   5045 C  CZ2 . TRP B 1 66  ? 79.020 2.890  206.400 1.00 15.00 ? 98  TRP B CZ2 1 
ATOM   5046 C  CZ3 . TRP B 1 66  ? 79.870 3.060  204.120 1.00 15.00 ? 98  TRP B CZ3 1 
ATOM   5047 C  CH2 . TRP B 1 66  ? 80.010 3.280  205.490 1.00 15.00 ? 98  TRP B CH2 1 
ATOM   5048 N  N   . LEU B 1 67  ? 74.100 3.070  204.210 1.00 15.00 ? 99  LEU B N   1 
ATOM   5049 C  CA  . LEU B 1 67  ? 73.110 3.440  205.180 1.00 15.00 ? 99  LEU B CA  1 
ATOM   5050 C  C   . LEU B 1 67  ? 72.020 4.170  204.430 1.00 15.00 ? 99  LEU B C   1 
ATOM   5051 O  O   . LEU B 1 67  ? 70.820 3.890  204.640 1.00 15.00 ? 99  LEU B O   1 
ATOM   5052 C  CB  . LEU B 1 67  ? 73.730 4.340  206.240 1.00 15.00 ? 99  LEU B CB  1 
ATOM   5053 C  CG  . LEU B 1 67  ? 72.750 5.010  207.180 1.00 15.00 ? 99  LEU B CG  1 
ATOM   5054 C  CD1 . LEU B 1 67  ? 72.260 4.010  208.210 1.00 15.00 ? 99  LEU B CD1 1 
ATOM   5055 C  CD2 . LEU B 1 67  ? 73.400 6.210  207.850 1.00 15.00 ? 99  LEU B CD2 1 
ATOM   5056 N  N   . TRP B 1 68  ? 72.400 5.040  203.500 1.00 15.00 ? 100 TRP B N   1 
ATOM   5057 C  CA  . TRP B 1 68  ? 71.390 5.740  202.730 1.00 15.00 ? 100 TRP B CA  1 
ATOM   5058 C  C   . TRP B 1 68  ? 70.650 4.830  201.780 1.00 15.00 ? 100 TRP B C   1 
ATOM   5059 O  O   . TRP B 1 68  ? 69.500 5.150  201.480 1.00 15.00 ? 100 TRP B O   1 
ATOM   5060 C  CB  . TRP B 1 68  ? 72.030 6.880  201.960 1.00 15.00 ? 100 TRP B CB  1 
ATOM   5061 C  CG  . TRP B 1 68  ? 72.300 8.060  202.890 1.00 15.00 ? 100 TRP B CG  1 
ATOM   5062 C  CD1 . TRP B 1 68  ? 73.590 8.460  203.170 1.00 15.00 ? 100 TRP B CD1 1 
ATOM   5063 C  CD2 . TRP B 1 68  ? 71.360 8.820  203.550 1.00 15.00 ? 100 TRP B CD2 1 
ATOM   5064 N  NE1 . TRP B 1 68  ? 73.470 9.480  203.990 1.00 15.00 ? 100 TRP B NE1 1 
ATOM   5065 C  CE2 . TRP B 1 68  ? 72.170 9.720  204.250 1.00 15.00 ? 100 TRP B CE2 1 
ATOM   5066 C  CE3 . TRP B 1 68  ? 69.990 8.900  203.680 1.00 15.00 ? 100 TRP B CE3 1 
ATOM   5067 C  CZ2 . TRP B 1 68  ? 71.630 10.700 205.050 1.00 15.00 ? 100 TRP B CZ2 1 
ATOM   5068 C  CZ3 . TRP B 1 68  ? 69.450 9.870  204.490 1.00 15.00 ? 100 TRP B CZ3 1 
ATOM   5069 C  CH2 . TRP B 1 68  ? 70.260 10.760 205.180 1.00 15.00 ? 100 TRP B CH2 1 
ATOM   5070 N  N   . ASP B 1 69  ? 71.170 3.700  201.330 1.00 15.00 ? 101 ASP B N   1 
ATOM   5071 C  CA  . ASP B 1 69  ? 70.360 2.800  200.520 1.00 15.00 ? 101 ASP B CA  1 
ATOM   5072 C  C   . ASP B 1 69  ? 69.310 2.180  201.390 1.00 15.00 ? 101 ASP B C   1 
ATOM   5073 O  O   . ASP B 1 69  ? 68.170 2.050  200.940 1.00 15.00 ? 101 ASP B O   1 
ATOM   5074 C  CB  . ASP B 1 69  ? 71.170 1.660  199.970 1.00 15.00 ? 101 ASP B CB  1 
ATOM   5075 C  CG  . ASP B 1 69  ? 72.250 2.080  198.970 1.00 15.00 ? 101 ASP B CG  1 
ATOM   5076 O  OD1 . ASP B 1 69  ? 72.170 3.170  198.390 1.00 15.00 ? 101 ASP B OD1 1 
ATOM   5077 O  OD2 . ASP B 1 69  ? 73.160 1.260  198.790 1.00 15.00 ? 101 ASP B OD2 1 
ATOM   5078 N  N   . PHE B 1 70  ? 69.690 1.850  202.610 1.00 15.00 ? 102 PHE B N   1 
ATOM   5079 C  CA  . PHE B 1 70  ? 68.720 1.350  203.560 1.00 15.00 ? 102 PHE B CA  1 
ATOM   5080 C  C   . PHE B 1 70  ? 67.710 2.420  203.900 1.00 15.00 ? 102 PHE B C   1 
ATOM   5081 O  O   . PHE B 1 70  ? 66.510 2.150  203.820 1.00 15.00 ? 102 PHE B O   1 
ATOM   5082 C  CB  . PHE B 1 70  ? 69.420 0.910  204.820 1.00 15.00 ? 102 PHE B CB  1 
ATOM   5083 C  CG  . PHE B 1 70  ? 68.440 0.350  205.850 1.00 15.00 ? 102 PHE B CG  1 
ATOM   5084 C  CD1 . PHE B 1 70  ? 67.700 -0.790 205.590 1.00 15.00 ? 102 PHE B CD1 1 
ATOM   5085 C  CD2 . PHE B 1 70  ? 68.320 0.960  207.090 1.00 15.00 ? 102 PHE B CD2 1 
ATOM   5086 C  CE1 . PHE B 1 70  ? 66.860 -1.300 206.550 1.00 15.00 ? 102 PHE B CE1 1 
ATOM   5087 C  CE2 . PHE B 1 70  ? 67.470 0.430  208.050 1.00 15.00 ? 102 PHE B CE2 1 
ATOM   5088 C  CZ  . PHE B 1 70  ? 66.730 -0.700 207.790 1.00 15.00 ? 102 PHE B CZ  1 
ATOM   5089 N  N   . VAL B 1 71  ? 68.090 3.650  204.280 1.00 15.00 ? 103 VAL B N   1 
ATOM   5090 C  CA  . VAL B 1 71  ? 67.140 4.710  204.630 1.00 15.00 ? 103 VAL B CA  1 
ATOM   5091 C  C   . VAL B 1 71  ? 66.240 4.990  203.430 1.00 15.00 ? 103 VAL B C   1 
ATOM   5092 O  O   . VAL B 1 71  ? 65.020 5.080  203.590 1.00 15.00 ? 103 VAL B O   1 
ATOM   5093 C  CB  . VAL B 1 71  ? 67.920 5.950  205.090 1.00 15.00 ? 103 VAL B CB  1 
ATOM   5094 C  CG1 . VAL B 1 71  ? 67.080 7.200  205.140 1.00 15.00 ? 103 VAL B CG1 1 
ATOM   5095 C  CG2 . VAL B 1 71  ? 68.390 5.710  206.520 1.00 15.00 ? 103 VAL B CG2 1 
ATOM   5096 N  N   . ASN B 1 72  ? 66.790 5.030  202.230 1.00 15.00 ? 104 ASN B N   1 
ATOM   5097 C  CA  . ASN B 1 72  ? 65.970 5.210  201.050 1.00 15.00 ? 104 ASN B CA  1 
ATOM   5098 C  C   . ASN B 1 72  ? 65.000 4.080  200.840 1.00 15.00 ? 104 ASN B C   1 
ATOM   5099 O  O   . ASN B 1 72  ? 64.040 4.230  200.090 1.00 15.00 ? 104 ASN B O   1 
ATOM   5100 C  CB  . ASN B 1 72  ? 66.790 5.260  199.790 1.00 15.00 ? 104 ASN B CB  1 
ATOM   5101 C  CG  . ASN B 1 72  ? 67.600 6.530  199.690 1.00 15.00 ? 104 ASN B CG  1 
ATOM   5102 O  OD1 . ASN B 1 72  ? 67.320 7.540  200.340 1.00 15.00 ? 104 ASN B OD1 1 
ATOM   5103 N  ND2 . ASN B 1 72  ? 68.640 6.520  198.880 1.00 15.00 ? 104 ASN B ND2 1 
ATOM   5104 N  N   . ALA B 1 73  ? 65.200 2.920  201.450 1.00 15.00 ? 105 ALA B N   1 
ATOM   5105 C  CA  . ALA B 1 73  ? 64.300 1.790  201.240 1.00 15.00 ? 105 ALA B CA  1 
ATOM   5106 C  C   . ALA B 1 73  ? 63.190 1.690  202.270 1.00 15.00 ? 105 ALA B C   1 
ATOM   5107 O  O   . ALA B 1 73  ? 62.290 0.840  202.190 1.00 15.00 ? 105 ALA B O   1 
ATOM   5108 C  CB  . ALA B 1 73  ? 65.080 0.490  201.290 1.00 15.00 ? 105 ALA B CB  1 
ATOM   5109 N  N   . THR B 1 74  ? 63.280 2.560  203.260 1.00 15.00 ? 106 THR B N   1 
ATOM   5110 C  CA  . THR B 1 74  ? 62.290 2.540  204.300 1.00 15.00 ? 106 THR B CA  1 
ATOM   5111 C  C   . THR B 1 74  ? 61.440 3.770  204.100 1.00 15.00 ? 106 THR B C   1 
ATOM   5112 O  O   . THR B 1 74  ? 61.630 4.600  203.190 1.00 15.00 ? 106 THR B O   1 
ATOM   5113 C  CB  . THR B 1 74  ? 62.980 2.550  205.670 1.00 15.00 ? 106 THR B CB  1 
ATOM   5114 O  OG1 . THR B 1 74  ? 63.500 3.860  205.840 1.00 15.00 ? 106 THR B OG1 1 
ATOM   5115 C  CG2 . THR B 1 74  ? 64.130 1.570  205.800 1.00 15.00 ? 106 THR B CG2 1 
ATOM   5116 N  N   . PHE B 1 75  ? 60.510 3.960  205.040 1.00 15.00 ? 107 PHE B N   1 
ATOM   5117 C  CA  . PHE B 1 75  ? 59.710 5.150  205.060 1.00 15.00 ? 107 PHE B CA  1 
ATOM   5118 C  C   . PHE B 1 75  ? 60.520 6.360  205.510 1.00 15.00 ? 107 PHE B C   1 
ATOM   5119 O  O   . PHE B 1 75  ? 60.060 7.490  205.280 1.00 15.00 ? 107 PHE B O   1 
ATOM   5120 C  CB  . PHE B 1 75  ? 58.550 4.960  206.000 1.00 15.00 ? 107 PHE B CB  1 
ATOM   5121 C  CG  . PHE B 1 75  ? 59.000 4.600  207.400 1.00 15.00 ? 107 PHE B CG  1 
ATOM   5122 C  CD1 . PHE B 1 75  ? 59.240 5.600  208.340 1.00 15.00 ? 107 PHE B CD1 1 
ATOM   5123 C  CD2 . PHE B 1 75  ? 59.120 3.260  207.750 1.00 15.00 ? 107 PHE B CD2 1 
ATOM   5124 C  CE1 . PHE B 1 75  ? 59.620 5.250  209.630 1.00 15.00 ? 107 PHE B CE1 1 
ATOM   5125 C  CE2 . PHE B 1 75  ? 59.500 2.930  209.040 1.00 15.00 ? 107 PHE B CE2 1 
ATOM   5126 C  CZ  . PHE B 1 75  ? 59.750 3.920  209.990 1.00 15.00 ? 107 PHE B CZ  1 
ATOM   5127 N  N   . ILE B 1 76  ? 61.700 6.210  206.120 1.00 15.00 ? 108 ILE B N   1 
ATOM   5128 C  CA  . ILE B 1 76  ? 62.450 7.370  206.550 1.00 15.00 ? 108 ILE B CA  1 
ATOM   5129 C  C   . ILE B 1 76  ? 62.760 8.280  205.350 1.00 15.00 ? 108 ILE B C   1 
ATOM   5130 O  O   . ILE B 1 76  ? 62.810 9.490  205.540 1.00 15.00 ? 108 ILE B O   1 
ATOM   5131 C  CB  . ILE B 1 76  ? 63.750 6.940  207.240 1.00 15.00 ? 108 ILE B CB  1 
ATOM   5132 C  CG1 . ILE B 1 76  ? 63.420 5.940  208.320 1.00 15.00 ? 108 ILE B CG1 1 
ATOM   5133 C  CG2 . ILE B 1 76  ? 64.420 8.130  207.910 1.00 15.00 ? 108 ILE B CG2 1 
ATOM   5134 C  CD1 . ILE B 1 76  ? 64.640 5.280  208.950 1.00 15.00 ? 108 ILE B CD1 1 
ATOM   5135 N  N   . ARG B 1 77  ? 62.880 7.740  204.140 1.00 15.00 ? 109 ARG B N   1 
ATOM   5136 C  CA  . ARG B 1 77  ? 63.000 8.540  202.930 1.00 15.00 ? 109 ARG B CA  1 
ATOM   5137 C  C   . ARG B 1 77  ? 61.930 9.640  202.970 1.00 15.00 ? 109 ARG B C   1 
ATOM   5138 O  O   . ARG B 1 77  ? 62.210 10.830 203.000 1.00 15.00 ? 109 ARG B O   1 
ATOM   5139 C  CB  . ARG B 1 77  ? 62.760 7.690  201.690 1.00 15.00 ? 109 ARG B CB  1 
ATOM   5140 C  CG  . ARG B 1 77  ? 62.810 8.520  200.420 1.00 15.00 ? 109 ARG B CG  1 
ATOM   5141 C  CD  . ARG B 1 77  ? 62.190 7.800  199.260 1.00 15.00 ? 109 ARG B CD  1 
ATOM   5142 N  NE  . ARG B 1 77  ? 62.260 8.640  198.090 1.00 15.00 ? 109 ARG B NE  1 
ATOM   5143 C  CZ  . ARG B 1 77  ? 62.190 8.130  196.840 1.00 15.00 ? 109 ARG B CZ  1 
ATOM   5144 N  NH1 . ARG B 1 77  ? 62.030 6.820  196.630 1.00 15.00 ? 109 ARG B NH1 1 
ATOM   5145 N  NH2 . ARG B 1 77  ? 62.250 8.910  195.780 1.00 15.00 ? 109 ARG B NH2 1 
ATOM   5146 N  N   . ASP B 1 78  ? 60.690 9.190  203.160 1.00 15.00 ? 110 ASP B N   1 
ATOM   5147 C  CA  . ASP B 1 78  ? 59.530 10.060 203.210 1.00 15.00 ? 110 ASP B CA  1 
ATOM   5148 C  C   . ASP B 1 78  ? 59.590 10.970 204.390 1.00 15.00 ? 110 ASP B C   1 
ATOM   5149 O  O   . ASP B 1 78  ? 59.270 12.150 204.250 1.00 15.00 ? 110 ASP B O   1 
ATOM   5150 C  CB  . ASP B 1 78  ? 58.260 9.230  203.280 1.00 15.00 ? 110 ASP B CB  1 
ATOM   5151 C  CG  . ASP B 1 78  ? 57.790 8.630  201.960 1.00 15.00 ? 110 ASP B CG  1 
ATOM   5152 O  OD1 . ASP B 1 78  ? 58.540 7.880  201.340 1.00 15.00 ? 110 ASP B OD1 1 
ATOM   5153 O  OD2 . ASP B 1 78  ? 56.660 8.900  201.550 1.00 15.00 ? 110 ASP B OD2 1 
ATOM   5154 N  N   . THR B 1 79  ? 60.040 10.540 205.540 1.00 15.00 ? 111 THR B N   1 
ATOM   5155 C  CA  . THR B 1 79  ? 60.070 11.410 206.700 1.00 15.00 ? 111 THR B CA  1 
ATOM   5156 C  C   . THR B 1 79  ? 61.050 12.540 206.460 1.00 15.00 ? 111 THR B C   1 
ATOM   5157 O  O   . THR B 1 79  ? 60.690 13.700 206.610 1.00 15.00 ? 111 THR B O   1 
ATOM   5158 C  CB  . THR B 1 79  ? 60.480 10.640 207.940 1.00 15.00 ? 111 THR B CB  1 
ATOM   5159 O  OG1 . THR B 1 79  ? 59.490 9.630  208.170 1.00 15.00 ? 111 THR B OG1 1 
ATOM   5160 C  CG2 . THR B 1 79  ? 60.630 11.550 209.130 1.00 15.00 ? 111 THR B CG2 1 
ATOM   5161 N  N   . LEU B 1 80  ? 62.260 12.190 206.060 1.00 15.00 ? 112 LEU B N   1 
ATOM   5162 C  CA  . LEU B 1 80  ? 63.270 13.190 205.870 1.00 15.00 ? 112 LEU B CA  1 
ATOM   5163 C  C   . LEU B 1 80  ? 62.810 14.070 204.740 1.00 15.00 ? 112 LEU B C   1 
ATOM   5164 O  O   . LEU B 1 80  ? 62.880 15.280 204.870 1.00 15.00 ? 112 LEU B O   1 
ATOM   5165 C  CB  . LEU B 1 80  ? 64.590 12.530 205.530 1.00 15.00 ? 112 LEU B CB  1 
ATOM   5166 C  CG  . LEU B 1 80  ? 65.180 11.550 206.510 1.00 15.00 ? 112 LEU B CG  1 
ATOM   5167 C  CD1 . LEU B 1 80  ? 66.350 10.890 205.860 1.00 15.00 ? 112 LEU B CD1 1 
ATOM   5168 C  CD2 . LEU B 1 80  ? 65.610 12.220 207.780 1.00 15.00 ? 112 LEU B CD2 1 
ATOM   5169 N  N   . MET B 1 81  ? 62.200 13.530 203.680 1.00 15.00 ? 113 MET B N   1 
ATOM   5170 C  CA  . MET B 1 81  ? 61.740 14.340 202.570 1.00 15.00 ? 113 MET B CA  1 
ATOM   5171 C  C   . MET B 1 81  ? 60.680 15.320 203.030 1.00 15.00 ? 113 MET B C   1 
ATOM   5172 O  O   . MET B 1 81  ? 60.740 16.500 202.670 1.00 15.00 ? 113 MET B O   1 
ATOM   5173 C  CB  . MET B 1 81  ? 61.190 13.420 201.490 1.00 15.00 ? 113 MET B CB  1 
ATOM   5174 C  CG  . MET B 1 81  ? 60.910 14.140 200.190 1.00 15.00 ? 113 MET B CG  1 
ATOM   5175 S  SD  . MET B 1 81  ? 62.410 14.910 199.540 1.00 15.00 ? 113 MET B SD  1 
ATOM   5176 C  CE  . MET B 1 81  ? 61.900 16.510 199.020 1.00 15.00 ? 113 MET B CE  1 
ATOM   5177 N  N   . ARG B 1 82  ? 59.770 14.930 203.900 1.00 15.00 ? 114 ARG B N   1 
ATOM   5178 C  CA  . ARG B 1 82  ? 58.740 15.810 204.410 1.00 15.00 ? 114 ARG B CA  1 
ATOM   5179 C  C   . ARG B 1 82  ? 59.400 16.920 205.190 1.00 15.00 ? 114 ARG B C   1 
ATOM   5180 O  O   . ARG B 1 82  ? 59.110 18.100 205.050 1.00 15.00 ? 114 ARG B O   1 
ATOM   5181 C  CB  . ARG B 1 82  ? 57.810 15.120 205.360 1.00 15.00 ? 114 ARG B CB  1 
ATOM   5182 C  CG  . ARG B 1 82  ? 56.640 15.970 205.840 1.00 15.00 ? 114 ARG B CG  1 
ATOM   5183 C  CD  . ARG B 1 82  ? 56.110 15.550 207.210 1.00 15.00 ? 114 ARG B CD  1 
ATOM   5184 N  NE  . ARG B 1 82  ? 56.170 14.110 207.510 1.00 15.00 ? 114 ARG B NE  1 
ATOM   5185 C  CZ  . ARG B 1 82  ? 55.500 13.120 206.860 1.00 15.00 ? 114 ARG B CZ  1 
ATOM   5186 N  NH1 . ARG B 1 82  ? 54.670 13.370 205.830 1.00 15.00 ? 114 ARG B NH1 1 
ATOM   5187 N  NH2 . ARG B 1 82  ? 55.690 11.850 207.230 1.00 15.00 ? 114 ARG B NH2 1 
ATOM   5188 N  N   . LEU B 1 83  ? 60.290 16.480 206.030 1.00 15.00 ? 115 LEU B N   1 
ATOM   5189 C  CA  . LEU B 1 83  ? 61.000 17.380 206.870 1.00 15.00 ? 115 LEU B CA  1 
ATOM   5190 C  C   . LEU B 1 83  ? 61.840 18.340 206.070 1.00 15.00 ? 115 LEU B C   1 
ATOM   5191 O  O   . LEU B 1 83  ? 61.910 19.500 206.450 1.00 15.00 ? 115 LEU B O   1 
ATOM   5192 C  CB  . LEU B 1 83  ? 61.820 16.540 207.780 1.00 15.00 ? 115 LEU B CB  1 
ATOM   5193 C  CG  . LEU B 1 83  ? 62.590 17.220 208.860 1.00 15.00 ? 115 LEU B CG  1 
ATOM   5194 C  CD1 . LEU B 1 83  ? 62.460 16.370 210.110 1.00 15.00 ? 115 LEU B CD1 1 
ATOM   5195 C  CD2 . LEU B 1 83  ? 64.050 17.420 208.440 1.00 15.00 ? 115 LEU B CD2 1 
ATOM   5196 N  N   . VAL B 1 84  ? 62.470 17.980 204.960 1.00 15.00 ? 116 VAL B N   1 
ATOM   5197 C  CA  . VAL B 1 84  ? 63.240 18.920 204.170 1.00 15.00 ? 116 VAL B CA  1 
ATOM   5198 C  C   . VAL B 1 84  ? 62.290 19.980 203.690 1.00 15.00 ? 116 VAL B C   1 
ATOM   5199 O  O   . VAL B 1 84  ? 62.530 21.170 203.850 1.00 15.00 ? 116 VAL B O   1 
ATOM   5200 C  CB  . VAL B 1 84  ? 63.870 18.220 202.990 1.00 15.00 ? 116 VAL B CB  1 
ATOM   5201 C  CG1 . VAL B 1 84  ? 64.580 19.240 202.150 1.00 15.00 ? 116 VAL B CG1 1 
ATOM   5202 C  CG2 . VAL B 1 84  ? 64.890 17.210 203.450 1.00 15.00 ? 116 VAL B CG2 1 
ATOM   5203 N  N   . LEU B 1 85  ? 61.160 19.530 203.160 1.00 15.00 ? 117 LEU B N   1 
ATOM   5204 C  CA  . LEU B 1 85  ? 60.120 20.380 202.650 1.00 15.00 ? 117 LEU B CA  1 
ATOM   5205 C  C   . LEU B 1 85  ? 59.650 21.360 203.690 1.00 15.00 ? 117 LEU B C   1 
ATOM   5206 O  O   . LEU B 1 85  ? 59.730 22.570 203.440 1.00 15.00 ? 117 LEU B O   1 
ATOM   5207 C  CB  . LEU B 1 85  ? 58.980 19.500 202.240 1.00 15.00 ? 117 LEU B CB  1 
ATOM   5208 C  CG  . LEU B 1 85  ? 58.710 19.140 200.800 1.00 15.00 ? 117 LEU B CG  1 
ATOM   5209 C  CD1 . LEU B 1 85  ? 59.920 19.350 199.930 1.00 15.00 ? 117 LEU B CD1 1 
ATOM   5210 C  CD2 . LEU B 1 85  ? 58.240 17.720 200.780 1.00 15.00 ? 117 LEU B CD2 1 
ATOM   5211 N  N   . THR B 1 86  ? 59.270 20.950 204.880 1.00 15.00 ? 118 THR B N   1 
ATOM   5212 C  CA  . THR B 1 86  ? 58.680 21.860 205.850 1.00 15.00 ? 118 THR B CA  1 
ATOM   5213 C  C   . THR B 1 86  ? 59.650 22.890 206.340 1.00 15.00 ? 118 THR B C   1 
ATOM   5214 O  O   . THR B 1 86  ? 59.430 24.090 206.190 1.00 15.00 ? 118 THR B O   1 
ATOM   5215 C  CB  . THR B 1 86  ? 58.120 21.070 207.040 1.00 15.00 ? 118 THR B CB  1 
ATOM   5216 O  OG1 . THR B 1 86  ? 58.910 19.930 207.310 1.00 15.00 ? 118 THR B OG1 1 
ATOM   5217 C  CG2 . THR B 1 86  ? 56.730 20.590 206.700 1.00 15.00 ? 118 THR B CG2 1 
ATOM   5218 N  N   . VAL B 1 87  ? 60.770 22.360 206.810 1.00 15.00 ? 119 VAL B N   1 
ATOM   5219 C  CA  . VAL B 1 87  ? 61.860 23.110 207.370 1.00 15.00 ? 119 VAL B CA  1 
ATOM   5220 C  C   . VAL B 1 87  ? 62.400 24.120 206.390 1.00 15.00 ? 119 VAL B C   1 
ATOM   5221 O  O   . VAL B 1 87  ? 62.520 25.290 206.720 1.00 15.00 ? 119 VAL B O   1 
ATOM   5222 C  CB  . VAL B 1 87  ? 62.950 22.150 207.780 1.00 15.00 ? 119 VAL B CB  1 
ATOM   5223 C  CG1 . VAL B 1 87  ? 64.280 22.830 208.020 1.00 15.00 ? 119 VAL B CG1 1 
ATOM   5224 C  CG2 . VAL B 1 87  ? 62.510 21.510 209.070 1.00 15.00 ? 119 VAL B CG2 1 
ATOM   5225 N  N   . ARG B 1 88  ? 62.740 23.690 205.190 1.00 15.00 ? 120 ARG B N   1 
ATOM   5226 C  CA  . ARG B 1 88  ? 63.300 24.620 204.240 1.00 15.00 ? 120 ARG B CA  1 
ATOM   5227 C  C   . ARG B 1 88  ? 62.210 25.610 203.870 1.00 15.00 ? 120 ARG B C   1 
ATOM   5228 O  O   . ARG B 1 88  ? 62.460 26.800 204.000 1.00 15.00 ? 120 ARG B O   1 
ATOM   5229 C  CB  . ARG B 1 88  ? 63.790 23.820 203.040 1.00 15.00 ? 120 ARG B CB  1 
ATOM   5230 C  CG  . ARG B 1 88  ? 65.110 23.110 203.330 1.00 15.00 ? 120 ARG B CG  1 
ATOM   5231 C  CD  . ARG B 1 88  ? 66.190 23.990 202.740 1.00 15.00 ? 120 ARG B CD  1 
ATOM   5232 N  NE  . ARG B 1 88  ? 67.540 23.780 203.210 1.00 15.00 ? 120 ARG B NE  1 
ATOM   5233 C  CZ  . ARG B 1 88  ? 68.360 22.840 202.740 1.00 15.00 ? 120 ARG B CZ  1 
ATOM   5234 N  NH1 . ARG B 1 88  ? 68.100 21.910 201.760 1.00 15.00 ? 120 ARG B NH1 1 
ATOM   5235 N  NH2 . ARG B 1 88  ? 69.550 22.900 203.280 1.00 15.00 ? 120 ARG B NH2 1 
ATOM   5236 N  N   . SER B 1 89  ? 60.980 25.190 203.550 1.00 15.00 ? 121 SER B N   1 
ATOM   5237 C  CA  . SER B 1 89  ? 59.920 26.100 203.150 1.00 15.00 ? 121 SER B CA  1 
ATOM   5238 C  C   . SER B 1 89  ? 59.560 27.130 204.180 1.00 15.00 ? 121 SER B C   1 
ATOM   5239 O  O   . SER B 1 89  ? 59.110 28.200 203.810 1.00 15.00 ? 121 SER B O   1 
ATOM   5240 C  CB  . SER B 1 89  ? 58.640 25.410 202.870 1.00 15.00 ? 121 SER B CB  1 
ATOM   5241 O  OG  . SER B 1 89  ? 58.840 24.560 201.760 1.00 15.00 ? 121 SER B OG  1 
ATOM   5242 N  N   . ASN B 1 90  ? 59.740 26.880 205.470 1.00 15.00 ? 122 ASN B N   1 
ATOM   5243 C  CA  . ASN B 1 90  ? 59.330 27.860 206.430 1.00 15.00 ? 122 ASN B CA  1 
ATOM   5244 C  C   . ASN B 1 90  ? 60.120 29.130 206.360 1.00 15.00 ? 122 ASN B C   1 
ATOM   5245 O  O   . ASN B 1 90  ? 59.580 30.170 206.720 1.00 15.00 ? 122 ASN B O   1 
ATOM   5246 C  CB  . ASN B 1 90  ? 59.410 27.320 207.830 1.00 15.00 ? 122 ASN B CB  1 
ATOM   5247 C  CG  . ASN B 1 90  ? 58.260 26.380 208.180 1.00 15.00 ? 122 ASN B CG  1 
ATOM   5248 O  OD1 . ASN B 1 90  ? 58.290 25.790 209.260 1.00 15.00 ? 122 ASN B OD1 1 
ATOM   5249 N  ND2 . ASN B 1 90  ? 57.200 26.140 207.370 1.00 15.00 ? 122 ASN B ND2 1 
ATOM   5250 N  N   . LEU B 1 91  ? 61.330 29.110 205.820 1.00 15.00 ? 123 LEU B N   1 
ATOM   5251 C  CA  . LEU B 1 91  ? 62.110 30.310 205.740 1.00 15.00 ? 123 LEU B CA  1 
ATOM   5252 C  C   . LEU B 1 91  ? 61.600 31.340 204.740 1.00 15.00 ? 123 LEU B C   1 
ATOM   5253 O  O   . LEU B 1 91  ? 62.050 32.500 204.760 1.00 15.00 ? 123 LEU B O   1 
ATOM   5254 C  CB  . LEU B 1 91  ? 63.530 29.930 205.420 1.00 15.00 ? 123 LEU B CB  1 
ATOM   5255 C  CG  . LEU B 1 91  ? 64.250 29.290 206.600 1.00 15.00 ? 123 LEU B CG  1 
ATOM   5256 C  CD1 . LEU B 1 91  ? 65.480 28.540 206.150 1.00 15.00 ? 123 LEU B CD1 1 
ATOM   5257 C  CD2 . LEU B 1 91  ? 64.640 30.380 207.560 1.00 15.00 ? 123 LEU B CD2 1 
ATOM   5258 N  N   . ILE B 1 92  ? 60.680 31.020 203.840 1.00 15.00 ? 124 ILE B N   1 
ATOM   5259 C  CA  . ILE B 1 92  ? 60.190 31.990 202.890 1.00 15.00 ? 124 ILE B CA  1 
ATOM   5260 C  C   . ILE B 1 92  ? 58.800 32.470 203.310 1.00 15.00 ? 124 ILE B C   1 
ATOM   5261 O  O   . ILE B 1 92  ? 57.880 31.660 203.470 1.00 15.00 ? 124 ILE B O   1 
ATOM   5262 C  CB  . ILE B 1 92  ? 60.150 31.370 201.490 1.00 15.00 ? 124 ILE B CB  1 
ATOM   5263 C  CG1 . ILE B 1 92  ? 61.530 30.920 201.080 1.00 15.00 ? 124 ILE B CG1 1 
ATOM   5264 C  CG2 . ILE B 1 92  ? 59.620 32.380 200.490 1.00 15.00 ? 124 ILE B CG2 1 
ATOM   5265 C  CD1 . ILE B 1 92  ? 62.610 32.000 201.040 1.00 15.00 ? 124 ILE B CD1 1 
ATOM   5266 N  N   . PRO B 1 93  ? 58.580 33.780 203.540 1.00 15.00 ? 125 PRO B N   1 
ATOM   5267 C  CA  . PRO B 1 93  ? 57.310 34.350 203.950 1.00 15.00 ? 125 PRO B CA  1 
ATOM   5268 C  C   . PRO B 1 93  ? 56.120 34.100 203.050 1.00 15.00 ? 125 PRO B C   1 
ATOM   5269 O  O   . PRO B 1 93  ? 56.260 34.210 201.830 1.00 15.00 ? 125 PRO B O   1 
ATOM   5270 C  CB  . PRO B 1 93  ? 57.640 35.810 204.100 1.00 15.00 ? 125 PRO B CB  1 
ATOM   5271 C  CG  . PRO B 1 93  ? 58.710 36.020 203.070 1.00 15.00 ? 125 PRO B CG  1 
ATOM   5272 C  CD  . PRO B 1 93  ? 59.580 34.830 203.410 1.00 15.00 ? 125 PRO B CD  1 
ATOM   5273 N  N   . SER B 1 94  ? 54.940 33.730 203.550 1.00 15.00 ? 126 SER B N   1 
ATOM   5274 C  CA  . SER B 1 94  ? 53.780 33.650 202.690 1.00 15.00 ? 126 SER B CA  1 
ATOM   5275 C  C   . SER B 1 94  ? 52.600 34.100 203.500 1.00 15.00 ? 126 SER B C   1 
ATOM   5276 O  O   . SER B 1 94  ? 52.440 33.660 204.650 1.00 15.00 ? 126 SER B O   1 
ATOM   5277 C  CB  . SER B 1 94  ? 53.530 32.250 202.190 1.00 15.00 ? 126 SER B CB  1 
ATOM   5278 O  OG  . SER B 1 94  ? 53.880 32.270 200.820 1.00 15.00 ? 126 SER B OG  1 
ATOM   5279 N  N   . PRO B 1 95  ? 51.770 35.040 203.020 1.00 15.00 ? 127 PRO B N   1 
ATOM   5280 C  CA  . PRO B 1 95  ? 51.930 35.870 201.840 1.00 15.00 ? 127 PRO B CA  1 
ATOM   5281 C  C   . PRO B 1 95  ? 53.200 36.700 201.690 1.00 15.00 ? 127 PRO B C   1 
ATOM   5282 O  O   . PRO B 1 95  ? 53.940 36.810 202.660 1.00 15.00 ? 127 PRO B O   1 
ATOM   5283 C  CB  . PRO B 1 95  ? 50.670 36.690 201.840 1.00 15.00 ? 127 PRO B CB  1 
ATOM   5284 C  CG  . PRO B 1 95  ? 50.250 36.700 203.260 1.00 15.00 ? 127 PRO B CG  1 
ATOM   5285 C  CD  . PRO B 1 95  ? 50.480 35.260 203.600 1.00 15.00 ? 127 PRO B CD  1 
ATOM   5286 N  N   . PRO B 1 96  ? 53.550 37.250 200.520 1.00 15.00 ? 128 PRO B N   1 
ATOM   5287 C  CA  . PRO B 1 96  ? 54.780 37.990 200.270 1.00 15.00 ? 128 PRO B CA  1 
ATOM   5288 C  C   . PRO B 1 96  ? 54.880 39.210 201.140 1.00 15.00 ? 128 PRO B C   1 
ATOM   5289 O  O   . PRO B 1 96  ? 53.880 39.730 201.620 1.00 15.00 ? 128 PRO B O   1 
ATOM   5290 C  CB  . PRO B 1 96  ? 54.730 38.370 198.850 1.00 15.00 ? 128 PRO B CB  1 
ATOM   5291 C  CG  . PRO B 1 96  ? 53.880 37.300 198.270 1.00 15.00 ? 128 PRO B CG  1 
ATOM   5292 C  CD  . PRO B 1 96  ? 52.800 37.160 199.290 1.00 15.00 ? 128 PRO B CD  1 
ATOM   5293 N  N   . THR B 1 97  ? 56.080 39.700 201.340 1.00 15.00 ? 129 THR B N   1 
ATOM   5294 C  CA  . THR B 1 97  ? 56.200 40.880 202.150 1.00 15.00 ? 129 THR B CA  1 
ATOM   5295 C  C   . THR B 1 97  ? 56.530 42.140 201.340 1.00 15.00 ? 129 THR B C   1 
ATOM   5296 O  O   . THR B 1 97  ? 55.590 42.810 200.890 1.00 15.00 ? 129 THR B O   1 
ATOM   5297 C  CB  . THR B 1 97  ? 57.230 40.480 203.200 1.00 15.00 ? 129 THR B CB  1 
ATOM   5298 O  OG1 . THR B 1 97  ? 58.310 39.840 202.530 1.00 15.00 ? 129 THR B OG1 1 
ATOM   5299 C  CG2 . THR B 1 97  ? 56.630 39.600 204.250 1.00 15.00 ? 129 THR B CG2 1 
ATOM   5300 N  N   . TYR B 1 98  ? 57.810 42.430 201.060 1.00 15.00 ? 130 TYR B N   1 
ATOM   5301 C  CA  . TYR B 1 98  ? 58.260 43.690 200.480 1.00 15.00 ? 130 TYR B CA  1 
ATOM   5302 C  C   . TYR B 1 98  ? 58.510 43.700 198.970 1.00 15.00 ? 130 TYR B C   1 
ATOM   5303 O  O   . TYR B 1 98  ? 58.230 42.700 198.290 1.00 15.00 ? 130 TYR B O   1 
ATOM   5304 C  CB  . TYR B 1 98  ? 59.540 44.080 201.210 1.00 15.00 ? 130 TYR B CB  1 
ATOM   5305 C  CG  . TYR B 1 98  ? 59.550 43.860 202.720 1.00 15.00 ? 130 TYR B CG  1 
ATOM   5306 C  CD1 . TYR B 1 98  ? 59.070 44.830 203.590 1.00 15.00 ? 130 TYR B CD1 1 
ATOM   5307 C  CD2 . TYR B 1 98  ? 60.030 42.680 203.270 1.00 15.00 ? 130 TYR B CD2 1 
ATOM   5308 C  CE1 . TYR B 1 98  ? 59.070 44.650 204.970 1.00 15.00 ? 130 TYR B CE1 1 
ATOM   5309 C  CE2 . TYR B 1 98  ? 60.030 42.490 204.660 1.00 15.00 ? 130 TYR B CE2 1 
ATOM   5310 C  CZ  . TYR B 1 98  ? 59.540 43.470 205.510 1.00 15.00 ? 130 TYR B CZ  1 
ATOM   5311 O  OH  . TYR B 1 98  ? 59.510 43.310 206.900 1.00 15.00 ? 130 TYR B OH  1 
ATOM   5312 N  N   . ASN B 1 99  ? 59.000 44.790 198.380 1.00 15.00 ? 131 ASN B N   1 
ATOM   5313 C  CA  . ASN B 1 99  ? 59.380 44.910 196.970 1.00 15.00 ? 131 ASN B CA  1 
ATOM   5314 C  C   . ASN B 1 99  ? 60.200 46.180 196.770 1.00 15.00 ? 131 ASN B C   1 
ATOM   5315 O  O   . ASN B 1 99  ? 60.270 46.920 197.760 1.00 15.00 ? 131 ASN B O   1 
ATOM   5316 C  CB  . ASN B 1 99  ? 58.210 45.010 196.020 1.00 15.00 ? 131 ASN B CB  1 
ATOM   5317 C  CG  . ASN B 1 99  ? 57.280 46.170 196.290 1.00 15.00 ? 131 ASN B CG  1 
ATOM   5318 O  OD1 . ASN B 1 99  ? 57.610 47.330 196.150 1.00 15.00 ? 131 ASN B OD1 1 
ATOM   5319 N  ND2 . ASN B 1 99  ? 56.040 45.910 196.630 1.00 15.00 ? 131 ASN B ND2 1 
ATOM   5320 N  N   . ILE B 1 100 ? 60.830 46.560 195.630 1.00 15.00 ? 132 ILE B N   1 
ATOM   5321 C  CA  . ILE B 1 100 ? 61.660 47.780 195.580 1.00 15.00 ? 132 ILE B CA  1 
ATOM   5322 C  C   . ILE B 1 100 ? 60.980 49.040 196.080 1.00 15.00 ? 132 ILE B C   1 
ATOM   5323 O  O   . ILE B 1 100 ? 61.630 49.890 196.700 1.00 15.00 ? 132 ILE B O   1 
ATOM   5324 C  CB  . ILE B 1 100 ? 62.200 48.230 194.180 1.00 15.00 ? 132 ILE B CB  1 
ATOM   5325 C  CG1 . ILE B 1 100 ? 61.440 47.610 193.050 1.00 15.00 ? 132 ILE B CG1 1 
ATOM   5326 C  CG2 . ILE B 1 100 ? 63.670 47.930 194.130 1.00 15.00 ? 132 ILE B CG2 1 
ATOM   5327 C  CD1 . ILE B 1 100 ? 60.160 48.380 192.750 1.00 15.00 ? 132 ILE B CD1 1 
ATOM   5328 N  N   . ALA B 1 101 ? 59.680 49.150 195.800 1.00 15.00 ? 133 ALA B N   1 
ATOM   5329 C  CA  . ALA B 1 101 ? 58.920 50.320 196.170 1.00 15.00 ? 133 ALA B CA  1 
ATOM   5330 C  C   . ALA B 1 101 ? 58.610 50.290 197.630 1.00 15.00 ? 133 ALA B C   1 
ATOM   5331 O  O   . ALA B 1 101 ? 58.560 51.390 198.200 1.00 15.00 ? 133 ALA B O   1 
ATOM   5332 C  CB  . ALA B 1 101 ? 57.590 50.370 195.440 1.00 15.00 ? 133 ALA B CB  1 
ATOM   5333 N  N   . HIS B 1 102 ? 58.420 49.160 198.300 1.00 15.00 ? 134 HIS B N   1 
ATOM   5334 C  CA  . HIS B 1 102 ? 58.010 49.180 199.690 1.00 15.00 ? 134 HIS B CA  1 
ATOM   5335 C  C   . HIS B 1 102 ? 58.780 48.310 200.670 1.00 15.00 ? 134 HIS B C   1 
ATOM   5336 O  O   . HIS B 1 102 ? 58.770 47.080 200.580 1.00 15.00 ? 134 HIS B O   1 
ATOM   5337 C  CB  . HIS B 1 102 ? 56.520 48.800 199.830 1.00 15.00 ? 134 HIS B CB  1 
ATOM   5338 C  CG  . HIS B 1 102 ? 55.510 49.580 199.010 1.00 15.00 ? 134 HIS B CG  1 
ATOM   5339 N  ND1 . HIS B 1 102 ? 55.290 50.970 199.000 1.00 15.00 ? 134 HIS B ND1 1 
ATOM   5340 C  CD2 . HIS B 1 102 ? 54.620 48.960 198.140 1.00 15.00 ? 134 HIS B CD2 1 
ATOM   5341 C  CE1 . HIS B 1 102 ? 54.290 51.170 198.140 1.00 15.00 ? 134 HIS B CE1 1 
ATOM   5342 N  NE2 . HIS B 1 102 ? 53.870 50.050 197.660 1.00 15.00 ? 134 HIS B NE2 1 
ATOM   5343 N  N   . ASP B 1 103 ? 59.450 48.920 201.650 1.00 15.00 ? 135 ASP B N   1 
ATOM   5344 C  CA  . ASP B 1 103 ? 60.140 48.210 202.710 1.00 15.00 ? 135 ASP B CA  1 
ATOM   5345 C  C   . ASP B 1 103 ? 59.290 48.200 203.970 1.00 15.00 ? 135 ASP B C   1 
ATOM   5346 O  O   . ASP B 1 103 ? 59.690 48.560 205.080 1.00 15.00 ? 135 ASP B O   1 
ATOM   5347 C  CB  . ASP B 1 103 ? 61.490 48.900 202.960 1.00 15.00 ? 135 ASP B CB  1 
ATOM   5348 C  CG  . ASP B 1 103 ? 62.360 49.070 201.720 1.00 15.00 ? 135 ASP B CG  1 
ATOM   5349 O  OD1 . ASP B 1 103 ? 62.530 48.090 200.990 1.00 15.00 ? 135 ASP B OD1 1 
ATOM   5350 O  OD2 . ASP B 1 103 ? 62.860 50.160 201.480 1.00 15.00 ? 135 ASP B OD2 1 
ATOM   5351 N  N   . TYR B 1 104 ? 58.030 47.820 203.760 1.00 15.00 ? 136 TYR B N   1 
ATOM   5352 C  CA  . TYR B 1 104 ? 56.990 47.640 204.780 1.00 15.00 ? 136 TYR B CA  1 
ATOM   5353 C  C   . TYR B 1 104 ? 55.910 46.770 204.140 1.00 15.00 ? 136 TYR B C   1 
ATOM   5354 O  O   . TYR B 1 104 ? 55.950 46.600 202.920 1.00 15.00 ? 136 TYR B O   1 
ATOM   5355 C  CB  . TYR B 1 104 ? 56.340 48.950 205.190 1.00 15.00 ? 136 TYR B CB  1 
ATOM   5356 C  CG  . TYR B 1 104 ? 56.050 49.930 204.080 1.00 15.00 ? 136 TYR B CG  1 
ATOM   5357 C  CD1 . TYR B 1 104 ? 57.050 50.760 203.690 1.00 15.00 ? 136 TYR B CD1 1 
ATOM   5358 C  CD2 . TYR B 1 104 ? 54.810 50.040 203.500 1.00 15.00 ? 136 TYR B CD2 1 
ATOM   5359 C  CE1 . TYR B 1 104 ? 56.810 51.700 202.720 1.00 15.00 ? 136 TYR B CE1 1 
ATOM   5360 C  CE2 . TYR B 1 104 ? 54.570 50.980 202.530 1.00 15.00 ? 136 TYR B CE2 1 
ATOM   5361 C  CZ  . TYR B 1 104 ? 55.590 51.800 202.150 1.00 15.00 ? 136 TYR B CZ  1 
ATOM   5362 O  OH  . TYR B 1 104 ? 55.390 52.790 201.210 1.00 15.00 ? 136 TYR B OH  1 
ATOM   5363 N  N   . ILE B 1 105 ? 54.940 46.180 204.850 1.00 15.00 ? 137 ILE B N   1 
ATOM   5364 C  CA  . ILE B 1 105 ? 53.940 45.380 204.150 1.00 15.00 ? 137 ILE B CA  1 
ATOM   5365 C  C   . ILE B 1 105 ? 52.910 46.390 203.670 1.00 15.00 ? 137 ILE B C   1 
ATOM   5366 O  O   . ILE B 1 105 ? 52.630 47.370 204.380 1.00 15.00 ? 137 ILE B O   1 
ATOM   5367 C  CB  . ILE B 1 105 ? 53.180 44.360 205.050 1.00 15.00 ? 137 ILE B CB  1 
ATOM   5368 C  CG1 . ILE B 1 105 ? 54.030 43.420 205.930 1.00 15.00 ? 137 ILE B CG1 1 
ATOM   5369 C  CG2 . ILE B 1 105 ? 52.480 43.510 204.050 1.00 15.00 ? 137 ILE B CG2 1 
ATOM   5370 C  CD1 . ILE B 1 105 ? 54.620 44.000 207.240 1.00 15.00 ? 137 ILE B CD1 1 
ATOM   5371 N  N   . SER B 1 106 ? 52.360 46.200 202.490 1.00 15.00 ? 138 SER B N   1 
ATOM   5372 C  CA  . SER B 1 106 ? 51.350 47.100 202.010 1.00 15.00 ? 138 SER B CA  1 
ATOM   5373 C  C   . SER B 1 106 ? 50.420 46.270 201.160 1.00 15.00 ? 138 SER B C   1 
ATOM   5374 O  O   . SER B 1 106 ? 50.810 45.210 200.690 1.00 15.00 ? 138 SER B O   1 
ATOM   5375 C  CB  . SER B 1 106 ? 51.990 48.200 201.160 1.00 15.00 ? 138 SER B CB  1 
ATOM   5376 O  OG  . SER B 1 106 ? 52.280 47.880 199.800 1.00 15.00 ? 138 SER B OG  1 
ATOM   5377 N  N   . TRP B 1 107 ? 49.260 46.820 200.900 1.00 15.00 ? 139 TRP B N   1 
ATOM   5378 C  CA  . TRP B 1 107 ? 48.390 45.920 200.130 1.00 15.00 ? 139 TRP B CA  1 
ATOM   5379 C  C   . TRP B 1 107 ? 48.890 45.830 198.690 1.00 15.00 ? 139 TRP B C   1 
ATOM   5380 O  O   . TRP B 1 107 ? 48.740 44.790 198.030 1.00 15.00 ? 139 TRP B O   1 
ATOM   5381 C  CB  . TRP B 1 107 ? 46.960 46.440 200.110 1.00 15.00 ? 139 TRP B CB  1 
ATOM   5382 C  CG  . TRP B 1 107 ? 46.050 45.640 199.160 1.00 15.00 ? 139 TRP B CG  1 
ATOM   5383 C  CD1 . TRP B 1 107 ? 45.790 45.910 197.880 1.00 15.00 ? 139 TRP B CD1 1 
ATOM   5384 C  CD2 . TRP B 1 107 ? 45.350 44.470 199.530 1.00 15.00 ? 139 TRP B CD2 1 
ATOM   5385 N  NE1 . TRP B 1 107 ? 44.910 44.880 197.410 1.00 15.00 ? 139 TRP B NE1 1 
ATOM   5386 C  CE2 . TRP B 1 107 ? 44.670 44.050 198.390 1.00 15.00 ? 139 TRP B CE2 1 
ATOM   5387 C  CE3 . TRP B 1 107 ? 45.250 43.730 200.710 1.00 15.00 ? 139 TRP B CE3 1 
ATOM   5388 C  CZ2 . TRP B 1 107 ? 43.860 42.900 198.370 1.00 15.00 ? 139 TRP B CZ2 1 
ATOM   5389 C  CZ3 . TRP B 1 107 ? 44.430 42.580 200.680 1.00 15.00 ? 139 TRP B CZ3 1 
ATOM   5390 C  CH2 . TRP B 1 107 ? 43.770 42.180 199.570 1.00 15.00 ? 139 TRP B CH2 1 
ATOM   5391 N  N   . GLU B 1 108 ? 49.460 46.930 198.240 1.00 15.00 ? 140 GLU B N   1 
ATOM   5392 C  CA  . GLU B 1 108 ? 49.980 47.060 196.870 1.00 15.00 ? 140 GLU B CA  1 
ATOM   5393 C  C   . GLU B 1 108 ? 51.080 46.030 196.620 1.00 15.00 ? 140 GLU B C   1 
ATOM   5394 O  O   . GLU B 1 108 ? 51.050 45.310 195.610 1.00 15.00 ? 140 GLU B O   1 
ATOM   5395 C  CB  . GLU B 1 108 ? 50.550 48.470 196.660 1.00 15.00 ? 140 GLU B CB  1 
ATOM   5396 C  CG  . GLU B 1 108 ? 49.800 49.230 195.550 1.00 15.00 ? 140 GLU B CG  1 
ATOM   5397 C  CD  . GLU B 1 108 ? 50.100 48.680 194.160 1.00 15.00 ? 140 GLU B CD  1 
ATOM   5398 O  OE1 . GLU B 1 108 ? 51.320 48.570 193.750 1.00 15.00 ? 140 GLU B OE1 1 
ATOM   5399 O  OE2 . GLU B 1 108 ? 49.130 48.330 193.390 1.00 15.00 ? 140 GLU B OE2 1 
ATOM   5400 N  N   . SER B 1 109 ? 52.010 45.990 197.540 1.00 15.00 ? 141 SER B N   1 
ATOM   5401 C  CA  . SER B 1 109 ? 53.100 45.020 197.460 1.00 15.00 ? 141 SER B CA  1 
ATOM   5402 C  C   . SER B 1 109 ? 52.500 43.650 197.430 1.00 15.00 ? 141 SER B C   1 
ATOM   5403 O  O   . SER B 1 109 ? 53.070 42.690 196.870 1.00 15.00 ? 141 SER B O   1 
ATOM   5404 C  CB  . SER B 1 109 ? 54.010 45.140 198.680 1.00 15.00 ? 141 SER B CB  1 
ATOM   5405 O  OG  . SER B 1 109 ? 53.400 44.530 199.800 1.00 15.00 ? 141 SER B OG  1 
ATOM   5406 N  N   . PHE B 1 110 ? 51.330 43.570 198.030 1.00 15.00 ? 142 PHE B N   1 
ATOM   5407 C  CA  . PHE B 1 110 ? 50.650 42.310 198.110 1.00 15.00 ? 142 PHE B CA  1 
ATOM   5408 C  C   . PHE B 1 110 ? 49.910 41.920 196.840 1.00 15.00 ? 142 PHE B C   1 
ATOM   5409 O  O   . PHE B 1 110 ? 49.810 40.730 196.500 1.00 15.00 ? 142 PHE B O   1 
ATOM   5410 C  CB  . PHE B 1 110 ? 49.570 42.240 199.140 1.00 15.00 ? 142 PHE B CB  1 
ATOM   5411 C  CG  . PHE B 1 110 ? 49.010 40.860 198.970 1.00 15.00 ? 142 PHE B CG  1 
ATOM   5412 C  CD1 . PHE B 1 110 ? 48.320 40.560 197.800 1.00 15.00 ? 142 PHE B CD1 1 
ATOM   5413 C  CD2 . PHE B 1 110 ? 49.270 39.900 199.940 1.00 15.00 ? 142 PHE B CD2 1 
ATOM   5414 C  CE1 . PHE B 1 110 ? 47.890 39.260 197.580 1.00 15.00 ? 142 PHE B CE1 1 
ATOM   5415 C  CE2 . PHE B 1 110 ? 48.850 38.590 199.720 1.00 15.00 ? 142 PHE B CE2 1 
ATOM   5416 C  CZ  . PHE B 1 110 ? 48.160 38.270 198.530 1.00 15.00 ? 142 PHE B CZ  1 
ATOM   5417 N  N   . SER B 1 111 ? 49.390 42.910 196.140 1.00 15.00 ? 143 SER B N   1 
ATOM   5418 C  CA  . SER B 1 111 ? 48.640 42.670 194.900 1.00 15.00 ? 143 SER B CA  1 
ATOM   5419 C  C   . SER B 1 111 ? 49.470 43.160 193.700 1.00 15.00 ? 143 SER B C   1 
ATOM   5420 O  O   . SER B 1 111 ? 49.160 42.830 192.550 1.00 15.00 ? 143 SER B O   1 
ATOM   5421 C  CB  . SER B 1 111 ? 47.320 43.420 194.930 1.00 15.00 ? 143 SER B CB  1 
ATOM   5422 O  OG  . SER B 1 111 ? 47.440 44.620 195.690 1.00 15.00 ? 143 SER B OG  1 
ATOM   5423 N  N   . ASN B 1 112 ? 50.320 44.070 193.400 1.00 15.00 ? 144 ASN B N   1 
ATOM   5424 C  CA  . ASN B 1 112 ? 50.870 44.470 192.090 1.00 15.00 ? 144 ASN B CA  1 
ATOM   5425 C  C   . ASN B 1 112 ? 51.880 43.380 191.920 1.00 15.00 ? 144 ASN B C   1 
ATOM   5426 O  O   . ASN B 1 112 ? 52.900 43.330 192.590 1.00 15.00 ? 144 ASN B O   1 
ATOM   5427 C  CB  . ASN B 1 112 ? 51.600 45.820 192.080 1.00 15.00 ? 144 ASN B CB  1 
ATOM   5428 C  CG  . ASN B 1 112 ? 51.940 46.280 190.680 1.00 15.00 ? 144 ASN B CG  1 
ATOM   5429 O  OD1 . ASN B 1 112 ? 52.100 45.420 189.830 1.00 15.00 ? 144 ASN B OD1 1 
ATOM   5430 N  ND2 . ASN B 1 112 ? 52.090 47.560 190.300 1.00 15.00 ? 144 ASN B ND2 1 
ATOM   5431 N  N   . VAL B 1 113 ? 51.500 42.430 191.110 1.00 15.00 ? 145 VAL B N   1 
ATOM   5432 C  CA  . VAL B 1 113 ? 52.270 41.240 190.940 1.00 15.00 ? 145 VAL B CA  1 
ATOM   5433 C  C   . VAL B 1 113 ? 53.290 41.330 189.810 1.00 15.00 ? 145 VAL B C   1 
ATOM   5434 O  O   . VAL B 1 113 ? 53.870 40.350 189.360 1.00 15.00 ? 145 VAL B O   1 
ATOM   5435 C  CB  . VAL B 1 113 ? 51.180 40.150 190.810 1.00 15.00 ? 145 VAL B CB  1 
ATOM   5436 C  CG1 . VAL B 1 113 ? 50.500 40.260 189.480 1.00 15.00 ? 145 VAL B CG1 1 
ATOM   5437 C  CG2 . VAL B 1 113 ? 51.770 38.790 191.030 1.00 15.00 ? 145 VAL B CG2 1 
ATOM   5438 N  N   . SER B 1 114 ? 53.570 42.540 189.340 1.00 15.00 ? 146 SER B N   1 
ATOM   5439 C  CA  . SER B 1 114 ? 54.660 42.720 188.430 1.00 15.00 ? 146 SER B CA  1 
ATOM   5440 C  C   . SER B 1 114 ? 55.790 43.070 189.400 1.00 15.00 ? 146 SER B C   1 
ATOM   5441 O  O   . SER B 1 114 ? 56.450 44.070 189.190 1.00 15.00 ? 146 SER B O   1 
ATOM   5442 C  CB  . SER B 1 114 ? 54.330 43.890 187.510 1.00 15.00 ? 146 SER B CB  1 
ATOM   5443 O  OG  . SER B 1 114 ? 53.060 43.770 186.900 1.00 15.00 ? 146 SER B OG  1 
ATOM   5444 N  N   . TYR B 1 115 ? 56.170 42.340 190.450 1.00 15.00 ? 147 TYR B N   1 
ATOM   5445 C  CA  . TYR B 1 115 ? 57.100 42.980 191.360 1.00 15.00 ? 147 TYR B CA  1 
ATOM   5446 C  C   . TYR B 1 115 ? 58.310 42.350 191.980 1.00 15.00 ? 147 TYR B C   1 
ATOM   5447 O  O   . TYR B 1 115 ? 59.290 43.090 192.170 1.00 15.00 ? 147 TYR B O   1 
ATOM   5448 C  CB  . TYR B 1 115 ? 56.310 43.600 192.530 1.00 15.00 ? 147 TYR B CB  1 
ATOM   5449 C  CG  . TYR B 1 115 ? 56.200 45.140 192.590 1.00 15.00 ? 147 TYR B CG  1 
ATOM   5450 C  CD1 . TYR B 1 115 ? 56.870 45.980 191.730 1.00 15.00 ? 147 TYR B CD1 1 
ATOM   5451 C  CD2 . TYR B 1 115 ? 55.390 45.690 193.540 1.00 15.00 ? 147 TYR B CD2 1 
ATOM   5452 C  CE1 . TYR B 1 115 ? 56.710 47.340 191.850 1.00 15.00 ? 147 TYR B CE1 1 
ATOM   5453 C  CE2 . TYR B 1 115 ? 55.220 47.040 193.660 1.00 15.00 ? 147 TYR B CE2 1 
ATOM   5454 C  CZ  . TYR B 1 115 ? 55.880 47.870 192.810 1.00 15.00 ? 147 TYR B CZ  1 
ATOM   5455 O  OH  . TYR B 1 115 ? 55.680 49.230 192.910 1.00 15.00 ? 147 TYR B OH  1 
ATOM   5456 N  N   . TYR B 1 116 ? 58.280 41.050 192.240 1.00 15.00 ? 148 TYR B N   1 
ATOM   5457 C  CA  . TYR B 1 116 ? 59.390 40.380 192.920 1.00 15.00 ? 148 TYR B CA  1 
ATOM   5458 C  C   . TYR B 1 116 ? 59.490 40.810 194.390 1.00 15.00 ? 148 TYR B C   1 
ATOM   5459 O  O   . TYR B 1 116 ? 59.800 41.950 194.710 1.00 15.00 ? 148 TYR B O   1 
ATOM   5460 C  CB  . TYR B 1 116 ? 60.790 40.660 192.350 1.00 15.00 ? 148 TYR B CB  1 
ATOM   5461 C  CG  . TYR B 1 116 ? 61.200 40.150 190.980 1.00 15.00 ? 148 TYR B CG  1 
ATOM   5462 C  CD1 . TYR B 1 116 ? 61.220 38.810 190.700 1.00 15.00 ? 148 TYR B CD1 1 
ATOM   5463 C  CD2 . TYR B 1 116 ? 61.660 41.050 190.050 1.00 15.00 ? 148 TYR B CD2 1 
ATOM   5464 C  CE1 . TYR B 1 116 ? 61.720 38.380 189.490 1.00 15.00 ? 148 TYR B CE1 1 
ATOM   5465 C  CE2 . TYR B 1 116 ? 62.170 40.620 188.840 1.00 15.00 ? 148 TYR B CE2 1 
ATOM   5466 C  CZ  . TYR B 1 116 ? 62.200 39.280 188.560 1.00 15.00 ? 148 TYR B CZ  1 
ATOM   5467 O  OH  . TYR B 1 116 ? 62.700 38.830 187.360 1.00 15.00 ? 148 TYR B OH  1 
ATOM   5468 N  N   . THR B 1 117 ? 59.180 39.910 195.310 1.00 15.00 ? 149 THR B N   1 
ATOM   5469 C  CA  . THR B 1 117 ? 59.340 40.230 196.700 1.00 15.00 ? 149 THR B CA  1 
ATOM   5470 C  C   . THR B 1 117 ? 60.810 40.150 196.940 1.00 15.00 ? 149 THR B C   1 
ATOM   5471 O  O   . THR B 1 117 ? 61.570 39.550 196.170 1.00 15.00 ? 149 THR B O   1 
ATOM   5472 C  CB  . THR B 1 117 ? 58.540 39.240 197.530 1.00 15.00 ? 149 THR B CB  1 
ATOM   5473 O  OG1 . THR B 1 117 ? 57.280 39.870 197.450 1.00 15.00 ? 149 THR B OG1 1 
ATOM   5474 C  CG2 . THR B 1 117 ? 58.850 39.020 199.010 1.00 15.00 ? 149 THR B CG2 1 
ATOM   5475 N  N   . ARG B 1 118 ? 61.250 40.870 197.940 1.00 15.00 ? 150 ARG B N   1 
ATOM   5476 C  CA  . ARG B 1 118 ? 62.590 40.720 198.420 1.00 15.00 ? 150 ARG B CA  1 
ATOM   5477 C  C   . ARG B 1 118 ? 62.320 40.180 199.810 1.00 15.00 ? 150 ARG B C   1 
ATOM   5478 O  O   . ARG B 1 118 ? 61.260 40.450 200.360 1.00 15.00 ? 150 ARG B O   1 
ATOM   5479 C  CB  . ARG B 1 118 ? 63.300 42.020 198.490 1.00 15.00 ? 150 ARG B CB  1 
ATOM   5480 C  CG  . ARG B 1 118 ? 62.430 43.080 199.080 1.00 15.00 ? 150 ARG B CG  1 
ATOM   5481 C  CD  . ARG B 1 118 ? 63.190 44.280 199.500 1.00 15.00 ? 150 ARG B CD  1 
ATOM   5482 N  NE  . ARG B 1 118 ? 63.840 44.930 198.390 1.00 15.00 ? 150 ARG B NE  1 
ATOM   5483 C  CZ  . ARG B 1 118 ? 65.150 45.070 198.380 1.00 15.00 ? 150 ARG B CZ  1 
ATOM   5484 N  NH1 . ARG B 1 118 ? 65.950 44.630 199.370 1.00 15.00 ? 150 ARG B NH1 1 
ATOM   5485 N  NH2 . ARG B 1 118 ? 65.670 45.700 197.350 1.00 15.00 ? 150 ARG B NH2 1 
ATOM   5486 N  N   . ILE B 1 119 ? 63.160 39.360 200.390 1.00 15.00 ? 151 ILE B N   1 
ATOM   5487 C  CA  . ILE B 1 119 ? 62.840 38.910 201.730 1.00 15.00 ? 151 ILE B CA  1 
ATOM   5488 C  C   . ILE B 1 119 ? 63.450 39.780 202.820 1.00 15.00 ? 151 ILE B C   1 
ATOM   5489 O  O   . ILE B 1 119 ? 63.090 39.690 203.980 1.00 15.00 ? 151 ILE B O   1 
ATOM   5490 C  CB  . ILE B 1 119 ? 63.240 37.460 201.940 1.00 15.00 ? 151 ILE B CB  1 
ATOM   5491 C  CG1 . ILE B 1 119 ? 64.710 37.340 202.090 1.00 15.00 ? 151 ILE B CG1 1 
ATOM   5492 C  CG2 . ILE B 1 119 ? 62.800 36.610 200.750 1.00 15.00 ? 151 ILE B CG2 1 
ATOM   5493 C  CD1 . ILE B 1 119 ? 64.820 36.320 203.200 1.00 15.00 ? 151 ILE B CD1 1 
ATOM   5494 N  N   . LEU B 1 120 ? 64.430 40.600 202.430 1.00 15.00 ? 152 LEU B N   1 
ATOM   5495 C  CA  . LEU B 1 120 ? 65.040 41.540 203.330 1.00 15.00 ? 152 LEU B CA  1 
ATOM   5496 C  C   . LEU B 1 120 ? 64.940 42.870 202.620 1.00 15.00 ? 152 LEU B C   1 
ATOM   5497 O  O   . LEU B 1 120 ? 65.260 42.910 201.420 1.00 15.00 ? 152 LEU B O   1 
ATOM   5498 C  CB  . LEU B 1 120 ? 66.510 41.270 203.540 1.00 15.00 ? 152 LEU B CB  1 
ATOM   5499 C  CG  . LEU B 1 120 ? 66.960 40.280 204.590 1.00 15.00 ? 152 LEU B CG  1 
ATOM   5500 C  CD1 . LEU B 1 120 ? 68.480 40.250 204.650 1.00 15.00 ? 152 LEU B CD1 1 
ATOM   5501 C  CD2 . LEU B 1 120 ? 66.420 40.710 205.930 1.00 15.00 ? 152 LEU B CD2 1 
ATOM   5502 N  N   . PRO B 1 121 ? 64.530 43.960 203.270 1.00 15.00 ? 153 PRO B N   1 
ATOM   5503 C  CA  . PRO B 1 121 ? 64.410 45.300 202.750 1.00 15.00 ? 153 PRO B CA  1 
ATOM   5504 C  C   . PRO B 1 121 ? 65.680 45.940 202.240 1.00 15.00 ? 153 PRO B C   1 
ATOM   5505 O  O   . PRO B 1 121 ? 66.770 45.430 202.470 1.00 15.00 ? 153 PRO B O   1 
ATOM   5506 C  CB  . PRO B 1 121 ? 63.840 46.070 203.880 1.00 15.00 ? 153 PRO B CB  1 
ATOM   5507 C  CG  . PRO B 1 121 ? 64.470 45.410 205.060 1.00 15.00 ? 153 PRO B CG  1 
ATOM   5508 C  CD  . PRO B 1 121 ? 64.240 43.980 204.700 1.00 15.00 ? 153 PRO B CD  1 
ATOM   5509 N  N   . SER B 1 122 ? 65.530 47.090 201.610 1.00 15.00 ? 154 SER B N   1 
ATOM   5510 C  CA  . SER B 1 122 ? 66.640 47.820 201.050 1.00 15.00 ? 154 SER B CA  1 
ATOM   5511 C  C   . SER B 1 122 ? 67.540 48.340 202.140 1.00 15.00 ? 154 SER B C   1 
ATOM   5512 O  O   . SER B 1 122 ? 67.120 48.500 203.290 1.00 15.00 ? 154 SER B O   1 
ATOM   5513 C  CB  . SER B 1 122 ? 66.160 49.030 200.250 1.00 15.00 ? 154 SER B CB  1 
ATOM   5514 O  OG  . SER B 1 122 ? 64.870 48.870 199.650 1.00 15.00 ? 154 SER B OG  1 
ATOM   5515 N  N   . VAL B 1 123 ? 68.790 48.620 201.790 1.00 15.00 ? 155 VAL B N   1 
ATOM   5516 C  CA  . VAL B 1 123 ? 69.660 49.360 202.660 1.00 15.00 ? 155 VAL B CA  1 
ATOM   5517 C  C   . VAL B 1 123 ? 69.000 50.730 202.540 1.00 15.00 ? 155 VAL B C   1 
ATOM   5518 O  O   . VAL B 1 123 ? 68.770 51.220 201.430 1.00 15.00 ? 155 VAL B O   1 
ATOM   5519 C  CB  . VAL B 1 123 ? 71.070 49.420 202.090 1.00 15.00 ? 155 VAL B CB  1 
ATOM   5520 C  CG1 . VAL B 1 123 ? 71.960 50.290 202.940 1.00 15.00 ? 155 VAL B CG1 1 
ATOM   5521 C  CG2 . VAL B 1 123 ? 71.630 48.030 202.110 1.00 15.00 ? 155 VAL B CG2 1 
ATOM   5522 N  N   . PRO B 1 124 ? 68.550 51.330 203.620 1.00 15.00 ? 156 PRO B N   1 
ATOM   5523 C  CA  . PRO B 1 124 ? 67.880 52.600 203.630 1.00 15.00 ? 156 PRO B CA  1 
ATOM   5524 C  C   . PRO B 1 124 ? 68.730 53.610 202.920 1.00 15.00 ? 156 PRO B C   1 
ATOM   5525 O  O   . PRO B 1 124 ? 69.900 53.830 203.270 1.00 15.00 ? 156 PRO B O   1 
ATOM   5526 C  CB  . PRO B 1 124 ? 67.700 52.910 205.070 1.00 15.00 ? 156 PRO B CB  1 
ATOM   5527 C  CG  . PRO B 1 124 ? 67.500 51.530 205.640 1.00 15.00 ? 156 PRO B CG  1 
ATOM   5528 C  CD  . PRO B 1 124 ? 68.600 50.770 204.970 1.00 15.00 ? 156 PRO B CD  1 
ATOM   5529 N  N   . ARG B 1 125 ? 68.130 54.280 201.920 1.00 15.00 ? 157 ARG B N   1 
ATOM   5530 C  CA  . ARG B 1 125 ? 68.800 55.300 201.100 1.00 15.00 ? 157 ARG B CA  1 
ATOM   5531 C  C   . ARG B 1 125 ? 69.400 56.520 201.820 1.00 15.00 ? 157 ARG B C   1 
ATOM   5532 O  O   . ARG B 1 125 ? 69.950 57.400 201.180 1.00 15.00 ? 157 ARG B O   1 
ATOM   5533 C  CB  . ARG B 1 125 ? 67.810 55.760 200.030 1.00 15.00 ? 157 ARG B CB  1 
ATOM   5534 C  CG  . ARG B 1 125 ? 67.520 54.680 198.980 1.00 15.00 ? 157 ARG B CG  1 
ATOM   5535 C  CD  . ARG B 1 125 ? 66.340 54.950 198.010 1.00 15.00 ? 157 ARG B CD  1 
ATOM   5536 N  NE  . ARG B 1 125 ? 66.010 53.820 197.120 1.00 15.00 ? 157 ARG B NE  1 
ATOM   5537 C  CZ  . ARG B 1 125 ? 65.570 52.570 197.520 1.00 15.00 ? 157 ARG B CZ  1 
ATOM   5538 N  NH1 . ARG B 1 125 ? 65.390 52.190 198.810 1.00 15.00 ? 157 ARG B NH1 1 
ATOM   5539 N  NH2 . ARG B 1 125 ? 65.250 51.680 196.560 1.00 15.00 ? 157 ARG B NH2 1 
ATOM   5540 N  N   . ASP B 1 126 ? 69.340 56.570 203.140 1.00 15.00 ? 158 ASP B N   1 
ATOM   5541 C  CA  . ASP B 1 126 ? 69.880 57.650 203.940 1.00 15.00 ? 158 ASP B CA  1 
ATOM   5542 C  C   . ASP B 1 126 ? 70.980 57.110 204.860 1.00 15.00 ? 158 ASP B C   1 
ATOM   5543 O  O   . ASP B 1 126 ? 71.290 57.730 205.890 1.00 15.00 ? 158 ASP B O   1 
ATOM   5544 C  CB  . ASP B 1 126 ? 68.720 58.290 204.740 1.00 15.00 ? 158 ASP B CB  1 
ATOM   5545 C  CG  . ASP B 1 126 ? 67.830 57.380 205.630 1.00 15.00 ? 158 ASP B CG  1 
ATOM   5546 O  OD1 . ASP B 1 126 ? 68.170 56.210 205.870 1.00 15.00 ? 158 ASP B OD1 1 
ATOM   5547 O  OD2 . ASP B 1 126 ? 66.770 57.830 206.100 1.00 15.00 ? 158 ASP B OD2 1 
ATOM   5548 N  N   . CYS B 1 127 ? 71.520 55.930 204.570 1.00 15.00 ? 159 CYS B N   1 
ATOM   5549 C  CA  . CYS B 1 127 ? 72.610 55.410 205.380 1.00 15.00 ? 159 CYS B CA  1 
ATOM   5550 C  C   . CYS B 1 127 ? 73.930 56.050 204.990 1.00 15.00 ? 159 CYS B C   1 
ATOM   5551 O  O   . CYS B 1 127 ? 74.050 56.540 203.860 1.00 15.00 ? 159 CYS B O   1 
ATOM   5552 C  CB  . CYS B 1 127 ? 72.720 53.920 205.210 1.00 15.00 ? 159 CYS B CB  1 
ATOM   5553 S  SG  . CYS B 1 127 ? 71.280 53.080 205.880 1.00 15.00 ? 159 CYS B SG  1 
ATOM   5554 N  N   . PRO B 1 128 ? 74.910 56.170 205.890 1.00 15.00 ? 160 PRO B N   1 
ATOM   5555 C  CA  . PRO B 1 128 ? 76.260 56.570 205.580 1.00 15.00 ? 160 PRO B CA  1 
ATOM   5556 C  C   . PRO B 1 128 ? 76.920 55.740 204.490 1.00 15.00 ? 160 PRO B C   1 
ATOM   5557 O  O   . PRO B 1 128 ? 77.250 56.290 203.420 1.00 15.00 ? 160 PRO B O   1 
ATOM   5558 C  CB  . PRO B 1 128 ? 76.990 56.510 206.920 1.00 15.00 ? 160 PRO B CB  1 
ATOM   5559 C  CG  . PRO B 1 128 ? 76.160 55.570 207.740 1.00 15.00 ? 160 PRO B CG  1 
ATOM   5560 C  CD  . PRO B 1 128 ? 74.770 55.990 207.320 1.00 15.00 ? 160 PRO B CD  1 
ATOM   5561 N  N   . THR B 1 129 ? 77.150 54.430 204.670 1.00 15.00 ? 161 THR B N   1 
ATOM   5562 C  CA  . THR B 1 129 ? 77.750 53.710 203.580 1.00 15.00 ? 161 THR B CA  1 
ATOM   5563 C  C   . THR B 1 129 ? 76.570 53.320 202.730 1.00 15.00 ? 161 THR B C   1 
ATOM   5564 O  O   . THR B 1 129 ? 75.460 53.140 203.250 1.00 15.00 ? 161 THR B O   1 
ATOM   5565 C  CB  . THR B 1 129 ? 78.490 52.450 204.020 1.00 15.00 ? 161 THR B CB  1 
ATOM   5566 O  OG1 . THR B 1 129 ? 77.610 51.620 204.750 1.00 15.00 ? 161 THR B OG1 1 
ATOM   5567 C  CG2 . THR B 1 129 ? 79.680 52.810 204.830 1.00 15.00 ? 161 THR B CG2 1 
ATOM   5568 N  N   . PRO B 1 130 ? 76.760 53.090 201.450 1.00 15.00 ? 162 PRO B N   1 
ATOM   5569 C  CA  . PRO B 1 130 ? 75.800 52.410 200.600 1.00 15.00 ? 162 PRO B CA  1 
ATOM   5570 C  C   . PRO B 1 130 ? 75.450 51.010 201.070 1.00 15.00 ? 162 PRO B C   1 
ATOM   5571 O  O   . PRO B 1 130 ? 74.610 50.350 200.470 1.00 15.00 ? 162 PRO B O   1 
ATOM   5572 C  CB  . PRO B 1 130 ? 76.450 52.450 199.250 1.00 15.00 ? 162 PRO B CB  1 
ATOM   5573 C  CG  . PRO B 1 130 ? 77.910 52.540 199.580 1.00 15.00 ? 162 PRO B CG  1 
ATOM   5574 C  CD  . PRO B 1 130 ? 77.900 53.550 200.690 1.00 15.00 ? 162 PRO B CD  1 
ATOM   5575 N  N   . MET B 1 131 ? 76.080 50.490 202.130 1.00 15.00 ? 163 MET B N   1 
ATOM   5576 C  CA  . MET B 1 131 ? 75.730 49.200 202.620 1.00 15.00 ? 163 MET B CA  1 
ATOM   5577 C  C   . MET B 1 131 ? 75.220 49.300 204.040 1.00 15.00 ? 163 MET B C   1 
ATOM   5578 O  O   . MET B 1 131 ? 75.140 48.330 204.780 1.00 15.00 ? 163 MET B O   1 
ATOM   5579 C  CB  . MET B 1 131 ? 76.970 48.350 202.550 1.00 15.00 ? 163 MET B CB  1 
ATOM   5580 C  CG  . MET B 1 131 ? 76.610 46.990 202.020 1.00 15.00 ? 163 MET B CG  1 
ATOM   5581 S  SD  . MET B 1 131 ? 76.110 47.060 200.290 1.00 15.00 ? 163 MET B SD  1 
ATOM   5582 C  CE  . MET B 1 131 ? 76.730 45.470 199.860 1.00 15.00 ? 163 MET B CE  1 
ATOM   5583 N  N   . GLY B 1 132 ? 74.880 50.500 204.480 1.00 15.00 ? 164 GLY B N   1 
ATOM   5584 C  CA  . GLY B 1 132 ? 74.370 50.670 205.820 1.00 15.00 ? 164 GLY B CA  1 
ATOM   5585 C  C   . GLY B 1 132 ? 75.360 51.500 206.600 1.00 15.00 ? 164 GLY B C   1 
ATOM   5586 O  O   . GLY B 1 132 ? 75.510 52.700 206.410 1.00 15.00 ? 164 GLY B O   1 
ATOM   5587 N  N   . THR B 1 133 ? 76.060 50.800 207.450 1.00 15.00 ? 165 THR B N   1 
ATOM   5588 C  CA  . THR B 1 133 ? 77.020 51.460 208.290 1.00 15.00 ? 165 THR B CA  1 
ATOM   5589 C  C   . THR B 1 133 ? 78.470 51.190 207.970 1.00 15.00 ? 165 THR B C   1 
ATOM   5590 O  O   . THR B 1 133 ? 79.300 52.080 207.890 1.00 15.00 ? 165 THR B O   1 
ATOM   5591 C  CB  . THR B 1 133 ? 76.660 51.040 209.730 1.00 15.00 ? 165 THR B CB  1 
ATOM   5592 O  OG1 . THR B 1 133 ? 75.730 52.040 210.090 1.00 15.00 ? 165 THR B OG1 1 
ATOM   5593 C  CG2 . THR B 1 133 ? 77.800 50.930 210.750 1.00 15.00 ? 165 THR B CG2 1 
ATOM   5594 N  N   . LYS B 1 134 ? 78.760 49.910 207.790 1.00 15.00 ? 166 LYS B N   1 
ATOM   5595 C  CA  . LYS B 1 134 ? 80.130 49.520 207.630 1.00 15.00 ? 166 LYS B CA  1 
ATOM   5596 C  C   . LYS B 1 134 ? 80.470 49.560 206.160 1.00 15.00 ? 166 LYS B C   1 
ATOM   5597 O  O   . LYS B 1 134 ? 79.560 49.680 205.330 1.00 15.00 ? 166 LYS B O   1 
ATOM   5598 C  CB  . LYS B 1 134 ? 80.280 48.130 208.190 1.00 15.00 ? 166 LYS B CB  1 
ATOM   5599 C  CG  . LYS B 1 134 ? 80.140 48.050 209.700 1.00 15.00 ? 166 LYS B CG  1 
ATOM   5600 C  CD  . LYS B 1 134 ? 80.230 46.560 209.980 1.00 15.00 ? 166 LYS B CD  1 
ATOM   5601 C  CE  . LYS B 1 134 ? 80.480 46.170 211.430 1.00 15.00 ? 166 LYS B CE  1 
ATOM   5602 N  NZ  . LYS B 1 134 ? 80.810 44.750 211.510 1.00 15.00 ? 166 LYS B NZ  1 
ATOM   5603 N  N   . GLY B 1 135 ? 81.760 49.560 205.860 1.00 15.00 ? 167 GLY B N   1 
ATOM   5604 C  CA  . GLY B 1 135 ? 82.170 49.450 204.470 1.00 15.00 ? 167 GLY B CA  1 
ATOM   5605 C  C   . GLY B 1 135 ? 82.760 50.730 203.940 1.00 15.00 ? 167 GLY B C   1 
ATOM   5606 O  O   . GLY B 1 135 ? 82.770 51.770 204.610 1.00 15.00 ? 167 GLY B O   1 
ATOM   5607 N  N   . LYS B 1 136 ? 83.340 50.620 202.750 1.00 15.00 ? 168 LYS B N   1 
ATOM   5608 C  CA  . LYS B 1 136 ? 83.900 51.780 202.090 1.00 15.00 ? 168 LYS B CA  1 
ATOM   5609 C  C   . LYS B 1 136 ? 82.710 52.620 201.660 1.00 15.00 ? 168 LYS B C   1 
ATOM   5610 O  O   . LYS B 1 136 ? 81.610 52.170 201.340 1.00 15.00 ? 168 LYS B O   1 
ATOM   5611 C  CB  . LYS B 1 136 ? 84.700 51.450 200.840 1.00 15.00 ? 168 LYS B CB  1 
ATOM   5612 C  CG  . LYS B 1 136 ? 86.070 50.790 201.000 1.00 15.00 ? 168 LYS B CG  1 
ATOM   5613 C  CD  . LYS B 1 136 ? 87.180 51.800 201.330 1.00 15.00 ? 168 LYS B CD  1 
ATOM   5614 C  CE  . LYS B 1 136 ? 88.610 51.260 201.060 1.00 15.00 ? 168 LYS B CE  1 
ATOM   5615 N  NZ  . LYS B 1 136 ? 89.010 50.160 201.940 1.00 15.00 ? 168 LYS B NZ  1 
ATOM   5616 N  N   . LYS B 1 137 ? 83.040 53.890 201.690 1.00 15.00 ? 169 LYS B N   1 
ATOM   5617 C  CA  . LYS B 1 137 ? 82.150 54.980 201.330 1.00 15.00 ? 169 LYS B CA  1 
ATOM   5618 C  C   . LYS B 1 137 ? 81.530 54.890 199.950 1.00 15.00 ? 169 LYS B C   1 
ATOM   5619 O  O   . LYS B 1 137 ? 80.600 55.620 199.660 1.00 15.00 ? 169 LYS B O   1 
ATOM   5620 C  CB  . LYS B 1 137 ? 82.950 56.310 201.430 1.00 15.00 ? 169 LYS B CB  1 
ATOM   5621 C  CG  . LYS B 1 137 ? 84.110 56.590 200.390 1.00 15.00 ? 169 LYS B CG  1 
ATOM   5622 C  CD  . LYS B 1 137 ? 85.390 55.700 200.320 1.00 15.00 ? 169 LYS B CD  1 
ATOM   5623 C  CE  . LYS B 1 137 ? 86.380 55.820 201.510 1.00 15.00 ? 169 LYS B CE  1 
ATOM   5624 N  NZ  . LYS B 1 137 ? 85.860 55.190 202.720 1.00 15.00 ? 169 LYS B NZ  1 
ATOM   5625 N  N   . GLN B 1 138 ? 82.060 54.030 199.090 1.00 15.00 ? 170 GLN B N   1 
ATOM   5626 C  CA  . GLN B 1 138 ? 81.660 53.920 197.690 1.00 15.00 ? 170 GLN B CA  1 
ATOM   5627 C  C   . GLN B 1 138 ? 82.060 52.500 197.240 1.00 15.00 ? 170 GLN B C   1 
ATOM   5628 O  O   . GLN B 1 138 ? 83.220 52.120 197.470 1.00 15.00 ? 170 GLN B O   1 
ATOM   5629 C  CB  . GLN B 1 138 ? 82.410 55.030 196.990 1.00 15.00 ? 170 GLN B CB  1 
ATOM   5630 C  CG  . GLN B 1 138 ? 82.250 55.000 195.500 1.00 15.00 ? 170 GLN B CG  1 
ATOM   5631 C  CD  . GLN B 1 138 ? 83.600 55.240 194.820 1.00 15.00 ? 170 GLN B CD  1 
ATOM   5632 O  OE1 . GLN B 1 138 ? 83.940 56.390 194.520 1.00 15.00 ? 170 GLN B OE1 1 
ATOM   5633 N  NE2 . GLN B 1 138 ? 84.390 54.170 194.590 1.00 15.00 ? 170 GLN B NE2 1 
ATOM   5634 N  N   . LEU B 1 139 ? 81.180 51.700 196.620 1.00 15.00 ? 171 LEU B N   1 
ATOM   5635 C  CA  . LEU B 1 139 ? 81.550 50.300 196.370 1.00 15.00 ? 171 LEU B CA  1 
ATOM   5636 C  C   . LEU B 1 139 ? 82.530 50.080 195.240 1.00 15.00 ? 171 LEU B C   1 
ATOM   5637 O  O   . LEU B 1 139 ? 82.660 50.940 194.360 1.00 15.00 ? 171 LEU B O   1 
ATOM   5638 C  CB  . LEU B 1 139 ? 80.310 49.420 196.090 1.00 15.00 ? 171 LEU B CB  1 
ATOM   5639 C  CG  . LEU B 1 139 ? 79.280 49.030 197.140 1.00 15.00 ? 171 LEU B CG  1 
ATOM   5640 C  CD1 . LEU B 1 139 ? 79.880 48.950 198.530 1.00 15.00 ? 171 LEU B CD1 1 
ATOM   5641 C  CD2 . LEU B 1 139 ? 78.210 50.090 197.150 1.00 15.00 ? 171 LEU B CD2 1 
ATOM   5642 N  N   . PRO B 1 140 ? 83.260 48.960 195.300 1.00 15.00 ? 172 PRO B N   1 
ATOM   5643 C  CA  . PRO B 1 140 ? 84.130 48.450 194.240 1.00 15.00 ? 172 PRO B CA  1 
ATOM   5644 C  C   . PRO B 1 140 ? 83.570 48.560 192.860 1.00 15.00 ? 172 PRO B C   1 
ATOM   5645 O  O   . PRO B 1 140 ? 82.380 48.320 192.640 1.00 15.00 ? 172 PRO B O   1 
ATOM   5646 C  CB  . PRO B 1 140 ? 84.380 47.030 194.640 1.00 15.00 ? 172 PRO B CB  1 
ATOM   5647 C  CG  . PRO B 1 140 ? 84.520 47.130 196.120 1.00 15.00 ? 172 PRO B CG  1 
ATOM   5648 C  CD  . PRO B 1 140 ? 83.480 48.190 196.520 1.00 15.00 ? 172 PRO B CD  1 
ATOM   5649 N  N   . ASP B 1 141 ? 84.400 48.870 191.890 1.00 15.00 ? 173 ASP B N   1 
ATOM   5650 C  CA  . ASP B 1 141 ? 83.920 48.970 190.530 1.00 15.00 ? 173 ASP B CA  1 
ATOM   5651 C  C   . ASP B 1 141 ? 83.540 47.590 190.010 1.00 15.00 ? 173 ASP B C   1 
ATOM   5652 O  O   . ASP B 1 141 ? 84.390 46.730 189.840 1.00 15.00 ? 173 ASP B O   1 
ATOM   5653 C  CB  . ASP B 1 141 ? 85.000 49.600 189.680 1.00 15.00 ? 173 ASP B CB  1 
ATOM   5654 C  CG  . ASP B 1 141 ? 84.670 49.610 188.200 1.00 15.00 ? 173 ASP B CG  1 
ATOM   5655 O  OD1 . ASP B 1 141 ? 83.640 50.170 187.800 1.00 15.00 ? 173 ASP B OD1 1 
ATOM   5656 O  OD2 . ASP B 1 141 ? 85.450 49.020 187.470 1.00 15.00 ? 173 ASP B OD2 1 
ATOM   5657 N  N   . ALA B 1 142 ? 82.260 47.390 189.690 1.00 15.00 ? 174 ALA B N   1 
ATOM   5658 C  CA  . ALA B 1 142 ? 81.750 46.110 189.240 1.00 15.00 ? 174 ALA B CA  1 
ATOM   5659 C  C   . ALA B 1 142 ? 82.550 45.450 188.160 1.00 15.00 ? 174 ALA B C   1 
ATOM   5660 O  O   . ALA B 1 142 ? 82.960 44.290 188.280 1.00 15.00 ? 174 ALA B O   1 
ATOM   5661 C  CB  . ALA B 1 142 ? 80.330 46.240 188.720 1.00 15.00 ? 174 ALA B CB  1 
ATOM   5662 N  N   . GLU B 1 143 ? 82.850 46.260 187.150 1.00 15.00 ? 175 GLU B N   1 
ATOM   5663 C  CA  . GLU B 1 143 ? 83.650 45.870 186.020 1.00 15.00 ? 175 GLU B CA  1 
ATOM   5664 C  C   . GLU B 1 143 ? 84.910 45.180 186.500 1.00 15.00 ? 175 GLU B C   1 
ATOM   5665 O  O   . GLU B 1 143 ? 85.200 44.030 186.150 1.00 15.00 ? 175 GLU B O   1 
ATOM   5666 C  CB  . GLU B 1 143 ? 83.960 47.130 185.280 1.00 15.00 ? 175 GLU B CB  1 
ATOM   5667 C  CG  . GLU B 1 143 ? 84.920 47.030 184.140 1.00 15.00 ? 175 GLU B CG  1 
ATOM   5668 C  CD  . GLU B 1 143 ? 84.330 46.240 182.980 1.00 15.00 ? 175 GLU B CD  1 
ATOM   5669 O  OE1 . GLU B 1 143 ? 83.480 46.800 182.270 1.00 15.00 ? 175 GLU B OE1 1 
ATOM   5670 O  OE2 . GLU B 1 143 ? 84.730 45.090 182.820 1.00 15.00 ? 175 GLU B OE2 1 
ATOM   5671 N  N   . PHE B 1 144 ? 85.560 45.860 187.430 1.00 15.00 ? 176 PHE B N   1 
ATOM   5672 C  CA  . PHE B 1 144 ? 86.780 45.380 188.030 1.00 15.00 ? 176 PHE B CA  1 
ATOM   5673 C  C   . PHE B 1 144 ? 86.550 44.070 188.800 1.00 15.00 ? 176 PHE B C   1 
ATOM   5674 O  O   . PHE B 1 144 ? 87.120 43.090 188.380 1.00 15.00 ? 176 PHE B O   1 
ATOM   5675 C  CB  . PHE B 1 144 ? 87.330 46.480 188.930 1.00 15.00 ? 176 PHE B CB  1 
ATOM   5676 C  CG  . PHE B 1 144 ? 88.690 46.170 189.560 1.00 15.00 ? 176 PHE B CG  1 
ATOM   5677 C  CD1 . PHE B 1 144 ? 89.740 45.660 188.800 1.00 15.00 ? 176 PHE B CD1 1 
ATOM   5678 C  CD2 . PHE B 1 144 ? 88.880 46.360 190.920 1.00 15.00 ? 176 PHE B CD2 1 
ATOM   5679 C  CE1 . PHE B 1 144 ? 90.940 45.360 189.380 1.00 15.00 ? 176 PHE B CE1 1 
ATOM   5680 C  CE2 . PHE B 1 144 ? 90.110 46.050 191.490 1.00 15.00 ? 176 PHE B CE2 1 
ATOM   5681 C  CZ  . PHE B 1 144 ? 91.150 45.540 190.720 1.00 15.00 ? 176 PHE B CZ  1 
ATOM   5682 N  N   . LEU B 1 145 ? 85.690 43.960 189.820 1.00 15.00 ? 177 LEU B N   1 
ATOM   5683 C  CA  . LEU B 1 145 ? 85.520 42.720 190.570 1.00 15.00 ? 177 LEU B CA  1 
ATOM   5684 C  C   . LEU B 1 145 ? 85.280 41.500 189.690 1.00 15.00 ? 177 LEU B C   1 
ATOM   5685 O  O   . LEU B 1 145 ? 85.780 40.400 189.950 1.00 15.00 ? 177 LEU B O   1 
ATOM   5686 C  CB  . LEU B 1 145 ? 84.350 42.690 191.510 1.00 15.00 ? 177 LEU B CB  1 
ATOM   5687 C  CG  . LEU B 1 145 ? 84.310 43.620 192.660 1.00 15.00 ? 177 LEU B CG  1 
ATOM   5688 C  CD1 . LEU B 1 145 ? 83.270 44.640 192.370 1.00 15.00 ? 177 LEU B CD1 1 
ATOM   5689 C  CD2 . LEU B 1 145 ? 83.980 42.860 193.920 1.00 15.00 ? 177 LEU B CD2 1 
ATOM   5690 N  N   . SER B 1 146 ? 84.530 41.740 188.640 1.00 15.00 ? 178 SER B N   1 
ATOM   5691 C  CA  . SER B 1 146 ? 84.220 40.660 187.770 1.00 15.00 ? 178 SER B CA  1 
ATOM   5692 C  C   . SER B 1 146 ? 85.440 40.230 187.000 1.00 15.00 ? 178 SER B C   1 
ATOM   5693 O  O   . SER B 1 146 ? 85.750 39.050 187.030 1.00 15.00 ? 178 SER B O   1 
ATOM   5694 C  CB  . SER B 1 146 ? 83.130 41.110 186.870 1.00 15.00 ? 178 SER B CB  1 
ATOM   5695 O  OG  . SER B 1 146 ? 82.080 41.640 187.670 1.00 15.00 ? 178 SER B OG  1 
ATOM   5696 N  N   . ARG B 1 147 ? 86.210 41.160 186.410 1.00 15.00 ? 179 ARG B N   1 
ATOM   5697 C  CA  . ARG B 1 147 ? 87.410 40.770 185.670 1.00 15.00 ? 179 ARG B CA  1 
ATOM   5698 C  C   . ARG B 1 147 ? 88.470 40.140 186.580 1.00 15.00 ? 179 ARG B C   1 
ATOM   5699 O  O   . ARG B 1 147 ? 89.120 39.130 186.270 1.00 15.00 ? 179 ARG B O   1 
ATOM   5700 C  CB  . ARG B 1 147 ? 88.030 42.000 184.970 1.00 15.00 ? 179 ARG B CB  1 
ATOM   5701 C  CG  . ARG B 1 147 ? 87.230 42.730 183.890 1.00 15.00 ? 179 ARG B CG  1 
ATOM   5702 C  CD  . ARG B 1 147 ? 87.420 42.330 182.380 1.00 15.00 ? 179 ARG B CD  1 
ATOM   5703 N  NE  . ARG B 1 147 ? 86.350 42.950 181.570 1.00 15.00 ? 179 ARG B NE  1 
ATOM   5704 C  CZ  . ARG B 1 147 ? 85.680 42.380 180.520 1.00 15.00 ? 179 ARG B CZ  1 
ATOM   5705 N  NH1 . ARG B 1 147 ? 85.940 41.120 180.070 1.00 15.00 ? 179 ARG B NH1 1 
ATOM   5706 N  NH2 . ARG B 1 147 ? 84.630 43.060 179.980 1.00 15.00 ? 179 ARG B NH2 1 
ATOM   5707 N  N   . ARG B 1 148 ? 88.600 40.720 187.760 1.00 15.00 ? 180 ARG B N   1 
ATOM   5708 C  CA  . ARG B 1 148 ? 89.600 40.330 188.730 1.00 15.00 ? 180 ARG B CA  1 
ATOM   5709 C  C   . ARG B 1 148 ? 89.290 39.010 189.420 1.00 15.00 ? 180 ARG B C   1 
ATOM   5710 O  O   . ARG B 1 148 ? 90.180 38.190 189.640 1.00 15.00 ? 180 ARG B O   1 
ATOM   5711 C  CB  . ARG B 1 148 ? 89.690 41.510 189.700 1.00 15.00 ? 180 ARG B CB  1 
ATOM   5712 C  CG  . ARG B 1 148 ? 90.900 41.590 190.610 1.00 15.00 ? 180 ARG B CG  1 
ATOM   5713 C  CD  . ARG B 1 148 ? 92.160 41.860 189.800 1.00 15.00 ? 180 ARG B CD  1 
ATOM   5714 N  NE  . ARG B 1 148 ? 93.340 41.710 190.640 1.00 15.00 ? 180 ARG B NE  1 
ATOM   5715 C  CZ  . ARG B 1 148 ? 93.950 40.540 190.830 1.00 15.00 ? 180 ARG B CZ  1 
ATOM   5716 N  NH1 . ARG B 1 148 ? 93.540 39.400 190.240 1.00 15.00 ? 180 ARG B NH1 1 
ATOM   5717 N  NH2 . ARG B 1 148 ? 95.020 40.490 191.620 1.00 15.00 ? 180 ARG B NH2 1 
ATOM   5718 N  N   . PHE B 1 149 ? 88.050 38.780 189.790 1.00 15.00 ? 181 PHE B N   1 
ATOM   5719 C  CA  . PHE B 1 149 ? 87.710 37.580 190.550 1.00 15.00 ? 181 PHE B CA  1 
ATOM   5720 C  C   . PHE B 1 149 ? 86.730 36.660 189.890 1.00 15.00 ? 181 PHE B C   1 
ATOM   5721 O  O   . PHE B 1 149 ? 86.740 35.450 190.160 1.00 15.00 ? 181 PHE B O   1 
ATOM   5722 C  CB  . PHE B 1 149 ? 87.110 37.920 191.880 1.00 15.00 ? 181 PHE B CB  1 
ATOM   5723 C  CG  . PHE B 1 149 ? 87.960 38.770 192.780 1.00 15.00 ? 181 PHE B CG  1 
ATOM   5724 C  CD1 . PHE B 1 149 ? 87.940 40.140 192.660 1.00 15.00 ? 181 PHE B CD1 1 
ATOM   5725 C  CD2 . PHE B 1 149 ? 88.710 38.170 193.780 1.00 15.00 ? 181 PHE B CD2 1 
ATOM   5726 C  CE1 . PHE B 1 149 ? 88.660 40.920 193.550 1.00 15.00 ? 181 PHE B CE1 1 
ATOM   5727 C  CE2 . PHE B 1 149 ? 89.420 38.960 194.660 1.00 15.00 ? 181 PHE B CE2 1 
ATOM   5728 C  CZ  . PHE B 1 149 ? 89.390 40.340 194.550 1.00 15.00 ? 181 PHE B CZ  1 
ATOM   5729 N  N   . LEU B 1 150 ? 85.780 37.100 189.080 1.00 15.00 ? 182 LEU B N   1 
ATOM   5730 C  CA  . LEU B 1 150 ? 84.750 36.200 188.580 1.00 15.00 ? 182 LEU B CA  1 
ATOM   5731 C  C   . LEU B 1 150 ? 85.130 35.500 187.310 1.00 15.00 ? 182 LEU B C   1 
ATOM   5732 O  O   . LEU B 1 150 ? 84.750 34.350 187.090 1.00 15.00 ? 182 LEU B O   1 
ATOM   5733 C  CB  . LEU B 1 150 ? 83.480 36.980 188.380 1.00 15.00 ? 182 LEU B CB  1 
ATOM   5734 C  CG  . LEU B 1 150 ? 82.310 36.840 189.330 1.00 15.00 ? 182 LEU B CG  1 
ATOM   5735 C  CD1 . LEU B 1 150 ? 82.700 36.540 190.760 1.00 15.00 ? 182 LEU B CD1 1 
ATOM   5736 C  CD2 . LEU B 1 150 ? 81.560 38.130 189.200 1.00 15.00 ? 182 LEU B CD2 1 
ATOM   5737 N  N   . LEU B 1 151 ? 85.920 36.200 186.540 1.00 15.00 ? 183 LEU B N   1 
ATOM   5738 C  CA  . LEU B 1 151 ? 86.370 35.750 185.240 1.00 15.00 ? 183 LEU B CA  1 
ATOM   5739 C  C   . LEU B 1 151 ? 87.180 34.470 185.150 1.00 15.00 ? 183 LEU B C   1 
ATOM   5740 O  O   . LEU B 1 151 ? 88.160 34.240 185.860 1.00 15.00 ? 183 LEU B O   1 
ATOM   5741 C  CB  . LEU B 1 151 ? 87.160 36.900 184.670 1.00 15.00 ? 183 LEU B CB  1 
ATOM   5742 C  CG  . LEU B 1 151 ? 87.990 36.720 183.410 1.00 15.00 ? 183 LEU B CG  1 
ATOM   5743 C  CD1 . LEU B 1 151 ? 87.190 36.210 182.220 1.00 15.00 ? 183 LEU B CD1 1 
ATOM   5744 C  CD2 . LEU B 1 151 ? 88.560 38.070 183.080 1.00 15.00 ? 183 LEU B CD2 1 
ATOM   5745 N  N   . ARG B 1 152 ? 86.770 33.630 184.190 1.00 15.00 ? 184 ARG B N   1 
ATOM   5746 C  CA  . ARG B 1 152 ? 87.430 32.370 183.980 1.00 15.00 ? 184 ARG B CA  1 
ATOM   5747 C  C   . ARG B 1 152 ? 88.840 32.600 183.480 1.00 15.00 ? 184 ARG B C   1 
ATOM   5748 O  O   . ARG B 1 152 ? 89.080 33.260 182.460 1.00 15.00 ? 184 ARG B O   1 
ATOM   5749 C  CB  . ARG B 1 152 ? 86.720 31.550 182.960 1.00 15.00 ? 184 ARG B CB  1 
ATOM   5750 C  CG  . ARG B 1 152 ? 87.290 30.140 182.970 1.00 15.00 ? 184 ARG B CG  1 
ATOM   5751 C  CD  . ARG B 1 152 ? 86.190 29.110 183.140 1.00 15.00 ? 184 ARG B CD  1 
ATOM   5752 N  NE  . ARG B 1 152 ? 85.420 28.970 181.920 1.00 15.00 ? 184 ARG B NE  1 
ATOM   5753 C  CZ  . ARG B 1 152 ? 84.180 28.480 181.890 1.00 15.00 ? 184 ARG B CZ  1 
ATOM   5754 N  NH1 . ARG B 1 152 ? 83.510 28.070 182.980 1.00 15.00 ? 184 ARG B NH1 1 
ATOM   5755 N  NH2 . ARG B 1 152 ? 83.610 28.410 180.700 1.00 15.00 ? 184 ARG B NH2 1 
ATOM   5756 N  N   . ARG B 1 153 ? 89.710 32.030 184.300 1.00 15.00 ? 185 ARG B N   1 
ATOM   5757 C  CA  . ARG B 1 153 ? 91.140 32.020 184.020 1.00 15.00 ? 185 ARG B CA  1 
ATOM   5758 C  C   . ARG B 1 153 ? 91.470 30.720 183.270 1.00 15.00 ? 185 ARG B C   1 
ATOM   5759 O  O   . ARG B 1 153 ? 92.020 30.710 182.180 1.00 15.00 ? 185 ARG B O   1 
ATOM   5760 C  CB  . ARG B 1 153 ? 91.850 32.100 185.360 1.00 15.00 ? 185 ARG B CB  1 
ATOM   5761 C  CG  . ARG B 1 153 ? 93.100 32.950 185.420 1.00 15.00 ? 185 ARG B CG  1 
ATOM   5762 C  CD  . ARG B 1 153 ? 92.850 34.450 185.260 1.00 15.00 ? 185 ARG B CD  1 
ATOM   5763 N  NE  . ARG B 1 153 ? 91.990 35.060 186.290 1.00 15.00 ? 185 ARG B NE  1 
ATOM   5764 C  CZ  . ARG B 1 153 ? 91.840 36.390 186.360 1.00 15.00 ? 185 ARG B CZ  1 
ATOM   5765 N  NH1 . ARG B 1 153 ? 92.480 37.230 185.510 1.00 15.00 ? 185 ARG B NH1 1 
ATOM   5766 N  NH2 . ARG B 1 153 ? 90.970 36.930 187.210 1.00 15.00 ? 185 ARG B NH2 1 
ATOM   5767 N  N   . LYS B 1 154 ? 91.130 29.570 183.860 1.00 15.00 ? 186 LYS B N   1 
ATOM   5768 C  CA  . LYS B 1 154 ? 91.350 28.250 183.280 1.00 15.00 ? 186 LYS B CA  1 
ATOM   5769 C  C   . LYS B 1 154 ? 90.070 27.550 183.640 1.00 15.00 ? 186 LYS B C   1 
ATOM   5770 O  O   . LYS B 1 154 ? 89.630 27.740 184.770 1.00 15.00 ? 186 LYS B O   1 
ATOM   5771 C  CB  . LYS B 1 154 ? 92.470 27.450 183.950 1.00 15.00 ? 186 LYS B CB  1 
ATOM   5772 C  CG  . LYS B 1 154 ? 93.900 27.920 183.650 1.00 15.00 ? 186 LYS B CG  1 
ATOM   5773 C  CD  . LYS B 1 154 ? 94.360 29.170 184.430 1.00 15.00 ? 186 LYS B CD  1 
ATOM   5774 C  CE  . LYS B 1 154 ? 95.630 29.790 183.840 1.00 15.00 ? 186 LYS B CE  1 
ATOM   5775 N  NZ  . LYS B 1 154 ? 95.750 31.190 184.230 1.00 15.00 ? 186 LYS B NZ  1 
ATOM   5776 N  N   . PHE B 1 155 ? 89.470 26.750 182.750 1.00 15.00 ? 187 PHE B N   1 
ATOM   5777 C  CA  . PHE B 1 155 ? 88.190 26.110 183.020 1.00 15.00 ? 187 PHE B CA  1 
ATOM   5778 C  C   . PHE B 1 155 ? 88.210 25.120 184.150 1.00 15.00 ? 187 PHE B C   1 
ATOM   5779 O  O   . PHE B 1 155 ? 88.950 24.140 184.080 1.00 15.00 ? 187 PHE B O   1 
ATOM   5780 C  CB  . PHE B 1 155 ? 87.720 25.410 181.760 1.00 15.00 ? 187 PHE B CB  1 
ATOM   5781 C  CG  . PHE B 1 155 ? 86.520 24.500 181.940 1.00 15.00 ? 187 PHE B CG  1 
ATOM   5782 C  CD1 . PHE B 1 155 ? 85.260 25.040 182.060 1.00 15.00 ? 187 PHE B CD1 1 
ATOM   5783 C  CD2 . PHE B 1 155 ? 86.700 23.120 181.970 1.00 15.00 ? 187 PHE B CD2 1 
ATOM   5784 C  CE1 . PHE B 1 155 ? 84.170 24.200 182.220 1.00 15.00 ? 187 PHE B CE1 1 
ATOM   5785 C  CE2 . PHE B 1 155 ? 85.610 22.300 182.140 1.00 15.00 ? 187 PHE B CE2 1 
ATOM   5786 C  CZ  . PHE B 1 155 ? 84.350 22.820 182.250 1.00 15.00 ? 187 PHE B CZ  1 
ATOM   5787 N  N   . ILE B 1 156 ? 87.390 25.320 185.160 1.00 15.00 ? 188 ILE B N   1 
ATOM   5788 C  CA  . ILE B 1 156 ? 87.300 24.330 186.200 1.00 15.00 ? 188 ILE B CA  1 
ATOM   5789 C  C   . ILE B 1 156 ? 85.990 23.580 186.000 1.00 15.00 ? 188 ILE B C   1 
ATOM   5790 O  O   . ILE B 1 156 ? 84.920 24.180 186.140 1.00 15.00 ? 188 ILE B O   1 
ATOM   5791 C  CB  . ILE B 1 156 ? 87.290 24.970 187.580 1.00 15.00 ? 188 ILE B CB  1 
ATOM   5792 C  CG1 . ILE B 1 156 ? 88.380 26.020 187.740 1.00 15.00 ? 188 ILE B CG1 1 
ATOM   5793 C  CG2 . ILE B 1 156 ? 87.530 23.860 188.600 1.00 15.00 ? 188 ILE B CG2 1 
ATOM   5794 C  CD1 . ILE B 1 156 ? 88.110 26.940 188.970 1.00 15.00 ? 188 ILE B CD1 1 
ATOM   5795 N  N   . PRO B 1 157 ? 85.960 22.300 185.620 1.00 15.00 ? 189 PRO B N   1 
ATOM   5796 C  CA  . PRO B 1 157 ? 84.750 21.530 185.500 1.00 15.00 ? 189 PRO B CA  1 
ATOM   5797 C  C   . PRO B 1 157 ? 84.100 21.330 186.860 1.00 15.00 ? 189 PRO B C   1 
ATOM   5798 O  O   . PRO B 1 157 ? 84.770 21.450 187.880 1.00 15.00 ? 189 PRO B O   1 
ATOM   5799 C  CB  . PRO B 1 157 ? 85.190 20.240 184.870 1.00 15.00 ? 189 PRO B CB  1 
ATOM   5800 C  CG  . PRO B 1 157 ? 86.550 20.060 185.500 1.00 15.00 ? 189 PRO B CG  1 
ATOM   5801 C  CD  . PRO B 1 157 ? 87.120 21.460 185.380 1.00 15.00 ? 189 PRO B CD  1 
ATOM   5802 N  N   . ASP B 1 158 ? 82.800 21.070 186.900 1.00 15.00 ? 190 ASP B N   1 
ATOM   5803 C  CA  . ASP B 1 158 ? 82.170 20.770 188.150 1.00 15.00 ? 190 ASP B CA  1 
ATOM   5804 C  C   . ASP B 1 158 ? 82.520 19.350 188.540 1.00 15.00 ? 190 ASP B C   1 
ATOM   5805 O  O   . ASP B 1 158 ? 82.210 18.420 187.800 1.00 15.00 ? 190 ASP B O   1 
ATOM   5806 C  CB  . ASP B 1 158 ? 80.650 20.860 188.060 1.00 15.00 ? 190 ASP B CB  1 
ATOM   5807 C  CG  . ASP B 1 158 ? 79.970 20.090 189.200 1.00 15.00 ? 190 ASP B CG  1 
ATOM   5808 O  OD1 . ASP B 1 158 ? 80.260 20.310 190.370 1.00 15.00 ? 190 ASP B OD1 1 
ATOM   5809 O  OD2 . ASP B 1 158 ? 79.180 19.200 188.890 1.00 15.00 ? 190 ASP B OD2 1 
ATOM   5810 N  N   . PRO B 1 159 ? 83.020 19.170 189.760 1.00 15.00 ? 191 PRO B N   1 
ATOM   5811 C  CA  . PRO B 1 159 ? 83.320 17.890 190.340 1.00 15.00 ? 191 PRO B CA  1 
ATOM   5812 C  C   . PRO B 1 159 ? 82.170 16.930 190.440 1.00 15.00 ? 191 PRO B C   1 
ATOM   5813 O  O   . PRO B 1 159 ? 82.360 15.730 190.250 1.00 15.00 ? 191 PRO B O   1 
ATOM   5814 C  CB  . PRO B 1 159 ? 83.910 18.240 191.680 1.00 15.00 ? 191 PRO B CB  1 
ATOM   5815 C  CG  . PRO B 1 159 ? 83.370 19.610 191.960 1.00 15.00 ? 191 PRO B CG  1 
ATOM   5816 C  CD  . PRO B 1 159 ? 83.510 20.230 190.610 1.00 15.00 ? 191 PRO B CD  1 
ATOM   5817 N  N   . GLN B 1 160 ? 80.940 17.400 190.700 1.00 15.00 ? 192 GLN B N   1 
ATOM   5818 C  CA  . GLN B 1 160 ? 79.800 16.510 190.790 1.00 15.00 ? 192 GLN B CA  1 
ATOM   5819 C  C   . GLN B 1 160 ? 79.490 15.850 189.460 1.00 15.00 ? 192 GLN B C   1 
ATOM   5820 O  O   . GLN B 1 160 ? 78.800 14.840 189.400 1.00 15.00 ? 192 GLN B O   1 
ATOM   5821 C  CB  . GLN B 1 160 ? 78.590 17.280 191.270 1.00 15.00 ? 192 GLN B CB  1 
ATOM   5822 C  CG  . GLN B 1 160 ? 78.690 17.540 192.770 1.00 15.00 ? 192 GLN B CG  1 
ATOM   5823 C  CD  . GLN B 1 160 ? 77.630 18.460 193.360 1.00 15.00 ? 192 GLN B CD  1 
ATOM   5824 O  OE1 . GLN B 1 160 ? 77.980 19.450 194.000 1.00 15.00 ? 192 GLN B OE1 1 
ATOM   5825 N  NE2 . GLN B 1 160 ? 76.330 18.240 193.210 1.00 15.00 ? 192 GLN B NE2 1 
ATOM   5826 N  N   . GLY B 1 161 ? 80.010 16.390 188.360 1.00 15.00 ? 193 GLY B N   1 
ATOM   5827 C  CA  . GLY B 1 161 ? 79.900 15.760 187.060 1.00 15.00 ? 193 GLY B CA  1 
ATOM   5828 C  C   . GLY B 1 161 ? 78.660 16.150 186.310 1.00 15.00 ? 193 GLY B C   1 
ATOM   5829 O  O   . GLY B 1 161 ? 78.050 15.370 185.600 1.00 15.00 ? 193 GLY B O   1 
ATOM   5830 N  N   . THR B 1 162 ? 78.300 17.400 186.490 1.00 15.00 ? 194 THR B N   1 
ATOM   5831 C  CA  . THR B 1 162 ? 77.140 17.960 185.860 1.00 15.00 ? 194 THR B CA  1 
ATOM   5832 C  C   . THR B 1 162 ? 77.520 18.170 184.420 1.00 15.00 ? 194 THR B C   1 
ATOM   5833 O  O   . THR B 1 162 ? 78.670 18.420 184.090 1.00 15.00 ? 194 THR B O   1 
ATOM   5834 C  CB  . THR B 1 162 ? 76.860 19.230 186.600 1.00 15.00 ? 194 THR B CB  1 
ATOM   5835 O  OG1 . THR B 1 162 ? 76.680 18.820 187.950 1.00 15.00 ? 194 THR B OG1 1 
ATOM   5836 C  CG2 . THR B 1 162 ? 75.690 20.000 186.050 1.00 15.00 ? 194 THR B CG2 1 
ATOM   5837 N  N   . ASN B 1 163 ? 76.540 18.040 183.550 1.00 15.00 ? 195 ASN B N   1 
ATOM   5838 C  CA  . ASN B 1 163 ? 76.800 18.200 182.140 1.00 15.00 ? 195 ASN B CA  1 
ATOM   5839 C  C   . ASN B 1 163 ? 76.020 19.340 181.570 1.00 15.00 ? 195 ASN B C   1 
ATOM   5840 O  O   . ASN B 1 163 ? 75.300 20.040 182.290 1.00 15.00 ? 195 ASN B O   1 
ATOM   5841 C  CB  . ASN B 1 163 ? 76.440 16.940 181.420 1.00 15.00 ? 195 ASN B CB  1 
ATOM   5842 C  CG  . ASN B 1 163 ? 75.000 16.500 181.610 1.00 15.00 ? 195 ASN B CG  1 
ATOM   5843 O  OD1 . ASN B 1 163 ? 74.070 17.270 181.900 1.00 15.00 ? 195 ASN B OD1 1 
ATOM   5844 N  ND2 . ASN B 1 163 ? 74.770 15.220 181.470 1.00 15.00 ? 195 ASN B ND2 1 
ATOM   5845 N  N   . LEU B 1 164 ? 76.090 19.570 180.270 1.00 15.00 ? 196 LEU B N   1 
ATOM   5846 C  CA  . LEU B 1 164 ? 75.360 20.670 179.720 1.00 15.00 ? 196 LEU B CA  1 
ATOM   5847 C  C   . LEU B 1 164 ? 73.910 20.340 179.600 1.00 15.00 ? 196 LEU B C   1 
ATOM   5848 O  O   . LEU B 1 164 ? 73.120 21.290 179.560 1.00 15.00 ? 196 LEU B O   1 
ATOM   5849 C  CB  . LEU B 1 164 ? 75.870 21.090 178.340 1.00 15.00 ? 196 LEU B CB  1 
ATOM   5850 C  CG  . LEU B 1 164 ? 77.320 21.520 178.080 1.00 15.00 ? 196 LEU B CG  1 
ATOM   5851 C  CD1 . LEU B 1 164 ? 77.310 22.500 176.940 1.00 15.00 ? 196 LEU B CD1 1 
ATOM   5852 C  CD2 . LEU B 1 164 ? 77.930 22.230 179.260 1.00 15.00 ? 196 LEU B CD2 1 
ATOM   5853 N  N   . MET B 1 165 ? 73.440 19.100 179.580 1.00 15.00 ? 197 MET B N   1 
ATOM   5854 C  CA  . MET B 1 165 ? 71.990 18.820 179.550 1.00 15.00 ? 197 MET B CA  1 
ATOM   5855 C  C   . MET B 1 165 ? 71.350 19.480 180.750 1.00 15.00 ? 197 MET B C   1 
ATOM   5856 O  O   . MET B 1 165 ? 70.300 20.100 180.670 1.00 15.00 ? 197 MET B O   1 
ATOM   5857 C  CB  . MET B 1 165 ? 71.690 17.350 179.620 1.00 15.00 ? 197 MET B CB  1 
ATOM   5858 C  CG  . MET B 1 165 ? 71.240 16.700 178.350 1.00 15.00 ? 197 MET B CG  1 
ATOM   5859 S  SD  . MET B 1 165 ? 69.520 17.000 177.920 1.00 15.00 ? 197 MET B SD  1 
ATOM   5860 C  CE  . MET B 1 165 ? 69.830 18.030 176.510 1.00 15.00 ? 197 MET B CE  1 
ATOM   5861 N  N   . PHE B 1 166 ? 72.070 19.390 181.880 1.00 15.00 ? 198 PHE B N   1 
ATOM   5862 C  CA  . PHE B 1 166 ? 71.680 20.040 183.090 1.00 15.00 ? 198 PHE B CA  1 
ATOM   5863 C  C   . PHE B 1 166 ? 71.860 21.510 182.900 1.00 15.00 ? 198 PHE B C   1 
ATOM   5864 O  O   . PHE B 1 166 ? 70.900 22.220 183.180 1.00 15.00 ? 198 PHE B O   1 
ATOM   5865 C  CB  . PHE B 1 166 ? 72.560 19.600 184.200 1.00 15.00 ? 198 PHE B CB  1 
ATOM   5866 C  CG  . PHE B 1 166 ? 72.210 20.220 185.530 1.00 15.00 ? 198 PHE B CG  1 
ATOM   5867 C  CD1 . PHE B 1 166 ? 72.660 21.480 185.880 1.00 15.00 ? 198 PHE B CD1 1 
ATOM   5868 C  CD2 . PHE B 1 166 ? 71.500 19.500 186.450 1.00 15.00 ? 198 PHE B CD2 1 
ATOM   5869 C  CE1 . PHE B 1 166 ? 72.390 21.990 187.120 1.00 15.00 ? 198 PHE B CE1 1 
ATOM   5870 C  CE2 . PHE B 1 166 ? 71.250 20.020 187.690 1.00 15.00 ? 198 PHE B CE2 1 
ATOM   5871 C  CZ  . PHE B 1 166 ? 71.690 21.270 188.030 1.00 15.00 ? 198 PHE B CZ  1 
ATOM   5872 N  N   . ALA B 1 167 ? 72.990 22.020 182.450 1.00 15.00 ? 199 ALA B N   1 
ATOM   5873 C  CA  . ALA B 1 167 ? 73.180 23.450 182.310 1.00 15.00 ? 199 ALA B CA  1 
ATOM   5874 C  C   . ALA B 1 167 ? 72.050 24.100 181.570 1.00 15.00 ? 199 ALA B C   1 
ATOM   5875 O  O   . ALA B 1 167 ? 71.490 25.080 182.010 1.00 15.00 ? 199 ALA B O   1 
ATOM   5876 C  CB  . ALA B 1 167 ? 74.420 23.790 181.530 1.00 15.00 ? 199 ALA B CB  1 
ATOM   5877 N  N   . PHE B 1 168 ? 71.640 23.490 180.470 1.00 15.00 ? 200 PHE B N   1 
ATOM   5878 C  CA  . PHE B 1 168 ? 70.590 24.040 179.670 1.00 15.00 ? 200 PHE B CA  1 
ATOM   5879 C  C   . PHE B 1 168 ? 69.220 23.760 180.250 1.00 15.00 ? 200 PHE B C   1 
ATOM   5880 O  O   . PHE B 1 168 ? 68.370 24.640 180.130 1.00 15.00 ? 200 PHE B O   1 
ATOM   5881 C  CB  . PHE B 1 168 ? 70.690 23.500 178.260 1.00 15.00 ? 200 PHE B CB  1 
ATOM   5882 C  CG  . PHE B 1 168 ? 71.820 24.110 177.450 1.00 15.00 ? 200 PHE B CG  1 
ATOM   5883 C  CD1 . PHE B 1 168 ? 71.980 25.490 177.390 1.00 15.00 ? 200 PHE B CD1 1 
ATOM   5884 C  CD2 . PHE B 1 168 ? 72.700 23.300 176.760 1.00 15.00 ? 200 PHE B CD2 1 
ATOM   5885 C  CE1 . PHE B 1 168 ? 73.000 26.050 176.640 1.00 15.00 ? 200 PHE B CE1 1 
ATOM   5886 C  CE2 . PHE B 1 168 ? 73.720 23.870 176.030 1.00 15.00 ? 200 PHE B CE2 1 
ATOM   5887 C  CZ  . PHE B 1 168 ? 73.870 25.240 175.950 1.00 15.00 ? 200 PHE B CZ  1 
ATOM   5888 N  N   . PHE B 1 169 ? 68.960 22.670 180.950 1.00 15.00 ? 201 PHE B N   1 
ATOM   5889 C  CA  . PHE B 1 169 ? 67.680 22.450 181.580 1.00 15.00 ? 201 PHE B CA  1 
ATOM   5890 C  C   . PHE B 1 169 ? 67.460 23.590 182.530 1.00 15.00 ? 201 PHE B C   1 
ATOM   5891 O  O   . PHE B 1 169 ? 66.430 24.250 182.470 1.00 15.00 ? 201 PHE B O   1 
ATOM   5892 C  CB  . PHE B 1 169 ? 67.650 21.170 182.380 1.00 15.00 ? 201 PHE B CB  1 
ATOM   5893 C  CG  . PHE B 1 169 ? 66.260 20.860 182.890 1.00 15.00 ? 201 PHE B CG  1 
ATOM   5894 C  CD1 . PHE B 1 169 ? 65.370 20.190 182.080 1.00 15.00 ? 201 PHE B CD1 1 
ATOM   5895 C  CD2 . PHE B 1 169 ? 65.880 21.240 184.160 1.00 15.00 ? 201 PHE B CD2 1 
ATOM   5896 C  CE1 . PHE B 1 169 ? 64.110 19.910 182.530 1.00 15.00 ? 201 PHE B CE1 1 
ATOM   5897 C  CE2 . PHE B 1 169 ? 64.620 20.960 184.600 1.00 15.00 ? 201 PHE B CE2 1 
ATOM   5898 C  CZ  . PHE B 1 169 ? 63.730 20.290 183.790 1.00 15.00 ? 201 PHE B CZ  1 
ATOM   5899 N  N   . ALA B 1 170 ? 68.460 23.840 183.360 1.00 15.00 ? 202 ALA B N   1 
ATOM   5900 C  CA  . ALA B 1 170 ? 68.430 24.910 184.320 1.00 15.00 ? 202 ALA B CA  1 
ATOM   5901 C  C   . ALA B 1 170 ? 68.170 26.250 183.680 1.00 15.00 ? 202 ALA B C   1 
ATOM   5902 O  O   . ALA B 1 170 ? 67.460 27.070 184.240 1.00 15.00 ? 202 ALA B O   1 
ATOM   5903 C  CB  . ALA B 1 170 ? 69.740 25.030 185.050 1.00 15.00 ? 202 ALA B CB  1 
ATOM   5904 N  N   . GLN B 1 171 ? 68.720 26.490 182.500 1.00 15.00 ? 203 GLN B N   1 
ATOM   5905 C  CA  . GLN B 1 171 ? 68.540 27.770 181.850 1.00 15.00 ? 203 GLN B CA  1 
ATOM   5906 C  C   . GLN B 1 171 ? 67.090 27.850 181.460 1.00 15.00 ? 203 GLN B C   1 
ATOM   5907 O  O   . GLN B 1 171 ? 66.380 28.720 181.930 1.00 15.00 ? 203 GLN B O   1 
ATOM   5908 C  CB  . GLN B 1 171 ? 69.400 27.880 180.620 1.00 15.00 ? 203 GLN B CB  1 
ATOM   5909 C  CG  . GLN B 1 171 ? 69.490 29.320 180.170 1.00 15.00 ? 203 GLN B CG  1 
ATOM   5910 C  CD  . GLN B 1 171 ? 70.480 29.580 179.030 1.00 15.00 ? 203 GLN B CD  1 
ATOM   5911 O  OE1 . GLN B 1 171 ? 70.370 30.570 178.310 1.00 15.00 ? 203 GLN B OE1 1 
ATOM   5912 N  NE2 . GLN B 1 171 ? 71.490 28.760 178.800 1.00 15.00 ? 203 GLN B NE2 1 
ATOM   5913 N  N   . HIS B 1 172 ? 66.610 26.890 180.710 1.00 15.00 ? 204 HIS B N   1 
ATOM   5914 C  CA  . HIS B 1 172 ? 65.240 26.860 180.250 1.00 15.00 ? 204 HIS B CA  1 
ATOM   5915 C  C   . HIS B 1 172 ? 64.230 27.050 181.380 1.00 15.00 ? 204 HIS B C   1 
ATOM   5916 O  O   . HIS B 1 172 ? 63.420 27.980 181.350 1.00 15.00 ? 204 HIS B O   1 
ATOM   5917 C  CB  . HIS B 1 172 ? 65.040 25.530 179.560 1.00 15.00 ? 204 HIS B CB  1 
ATOM   5918 C  CG  . HIS B 1 172 ? 63.680 25.130 179.020 1.00 15.00 ? 204 HIS B CG  1 
ATOM   5919 N  ND1 . HIS B 1 172 ? 62.850 24.140 179.570 1.00 15.00 ? 204 HIS B ND1 1 
ATOM   5920 C  CD2 . HIS B 1 172 ? 63.140 25.700 177.870 1.00 15.00 ? 204 HIS B CD2 1 
ATOM   5921 C  CE1 . HIS B 1 172 ? 61.810 24.140 178.720 1.00 15.00 ? 204 HIS B CE1 1 
ATOM   5922 N  NE2 . HIS B 1 172 ? 61.950 24.990 177.740 1.00 15.00 ? 204 HIS B NE2 1 
ATOM   5923 N  N   . PHE B 1 173 ? 64.400 26.220 182.410 1.00 15.00 ? 205 PHE B N   1 
ATOM   5924 C  CA  . PHE B 1 173 ? 63.510 26.150 183.530 1.00 15.00 ? 205 PHE B CA  1 
ATOM   5925 C  C   . PHE B 1 173 ? 63.440 27.520 184.160 1.00 15.00 ? 205 PHE B C   1 
ATOM   5926 O  O   . PHE B 1 173 ? 62.420 28.160 184.150 1.00 15.00 ? 205 PHE B O   1 
ATOM   5927 C  CB  . PHE B 1 173 ? 64.050 25.140 184.490 1.00 15.00 ? 205 PHE B CB  1 
ATOM   5928 C  CG  . PHE B 1 173 ? 63.250 25.020 185.780 1.00 15.00 ? 205 PHE B CG  1 
ATOM   5929 C  CD1 . PHE B 1 173 ? 61.960 24.550 185.760 1.00 15.00 ? 205 PHE B CD1 1 
ATOM   5930 C  CD2 . PHE B 1 173 ? 63.830 25.370 186.980 1.00 15.00 ? 205 PHE B CD2 1 
ATOM   5931 C  CE1 . PHE B 1 173 ? 61.260 24.410 186.940 1.00 15.00 ? 205 PHE B CE1 1 
ATOM   5932 C  CE2 . PHE B 1 173 ? 63.130 25.240 188.150 1.00 15.00 ? 205 PHE B CE2 1 
ATOM   5933 C  CZ  . PHE B 1 173 ? 61.850 24.750 188.120 1.00 15.00 ? 205 PHE B CZ  1 
ATOM   5934 N  N   . THR B 1 174 ? 64.560 28.020 184.590 1.00 15.00 ? 206 THR B N   1 
ATOM   5935 C  CA  . THR B 1 174 ? 64.650 29.300 185.220 1.00 15.00 ? 206 THR B CA  1 
ATOM   5936 C  C   . THR B 1 174 ? 64.020 30.450 184.440 1.00 15.00 ? 206 THR B C   1 
ATOM   5937 O  O   . THR B 1 174 ? 63.360 31.330 185.000 1.00 15.00 ? 206 THR B O   1 
ATOM   5938 C  CB  . THR B 1 174 ? 66.120 29.380 185.430 1.00 15.00 ? 206 THR B CB  1 
ATOM   5939 O  OG1 . THR B 1 174 ? 66.290 28.510 186.530 1.00 15.00 ? 206 THR B OG1 1 
ATOM   5940 C  CG2 . THR B 1 174 ? 66.700 30.730 185.610 1.00 15.00 ? 206 THR B CG2 1 
ATOM   5941 N  N   . HIS B 1 175 ? 64.070 30.400 183.130 1.00 15.00 ? 207 HIS B N   1 
ATOM   5942 C  CA  . HIS B 1 175 ? 63.560 31.490 182.330 1.00 15.00 ? 207 HIS B CA  1 
ATOM   5943 C  C   . HIS B 1 175 ? 62.050 31.540 182.170 1.00 15.00 ? 207 HIS B C   1 
ATOM   5944 O  O   . HIS B 1 175 ? 61.540 32.300 181.360 1.00 15.00 ? 207 HIS B O   1 
ATOM   5945 C  CB  . HIS B 1 175 ? 64.260 31.430 180.990 1.00 15.00 ? 207 HIS B CB  1 
ATOM   5946 C  CG  . HIS B 1 175 ? 65.640 32.020 181.230 1.00 15.00 ? 207 HIS B CG  1 
ATOM   5947 N  ND1 . HIS B 1 175 ? 66.130 33.130 180.550 1.00 15.00 ? 207 HIS B ND1 1 
ATOM   5948 C  CD2 . HIS B 1 175 ? 66.570 31.590 182.160 1.00 15.00 ? 207 HIS B CD2 1 
ATOM   5949 C  CE1 . HIS B 1 175 ? 67.370 33.330 181.070 1.00 15.00 ? 207 HIS B CE1 1 
ATOM   5950 N  NE2 . HIS B 1 175 ? 67.640 32.470 181.990 1.00 15.00 ? 207 HIS B NE2 1 
ATOM   5951 N  N   . GLN B 1 176 ? 61.300 30.750 182.940 1.00 15.00 ? 208 GLN B N   1 
ATOM   5952 C  CA  . GLN B 1 176 ? 59.860 30.820 182.940 1.00 15.00 ? 208 GLN B CA  1 
ATOM   5953 C  C   . GLN B 1 176 ? 59.410 31.660 184.100 1.00 15.00 ? 208 GLN B C   1 
ATOM   5954 O  O   . GLN B 1 176 ? 58.240 32.020 184.160 1.00 15.00 ? 208 GLN B O   1 
ATOM   5955 C  CB  . GLN B 1 176 ? 59.230 29.460 183.060 1.00 15.00 ? 208 GLN B CB  1 
ATOM   5956 C  CG  . GLN B 1 176 ? 59.230 28.870 184.440 1.00 15.00 ? 208 GLN B CG  1 
ATOM   5957 C  CD  . GLN B 1 176 ? 58.830 27.430 184.430 1.00 15.00 ? 208 GLN B CD  1 
ATOM   5958 O  OE1 . GLN B 1 176 ? 59.590 26.540 184.730 1.00 15.00 ? 208 GLN B OE1 1 
ATOM   5959 N  NE2 . GLN B 1 176 ? 57.600 27.120 184.110 1.00 15.00 ? 208 GLN B NE2 1 
ATOM   5960 N  N   . PHE B 1 177 ? 60.250 31.860 185.100 1.00 15.00 ? 209 PHE B N   1 
ATOM   5961 C  CA  . PHE B 1 177 ? 59.860 32.730 186.190 1.00 15.00 ? 209 PHE B CA  1 
ATOM   5962 C  C   . PHE B 1 177 ? 60.780 33.920 186.360 1.00 15.00 ? 209 PHE B C   1 
ATOM   5963 O  O   . PHE B 1 177 ? 60.420 34.880 187.050 1.00 15.00 ? 209 PHE B O   1 
ATOM   5964 C  CB  . PHE B 1 177 ? 59.800 31.970 187.510 1.00 15.00 ? 209 PHE B CB  1 
ATOM   5965 C  CG  . PHE B 1 177 ? 60.800 30.910 187.860 1.00 15.00 ? 209 PHE B CG  1 
ATOM   5966 C  CD1 . PHE B 1 177 ? 62.000 31.240 188.430 1.00 15.00 ? 209 PHE B CD1 1 
ATOM   5967 C  CD2 . PHE B 1 177 ? 60.480 29.590 187.660 1.00 15.00 ? 209 PHE B CD2 1 
ATOM   5968 C  CE1 . PHE B 1 177 ? 62.880 30.230 188.800 1.00 15.00 ? 209 PHE B CE1 1 
ATOM   5969 C  CE2 . PHE B 1 177 ? 61.350 28.600 188.040 1.00 15.00 ? 209 PHE B CE2 1 
ATOM   5970 C  CZ  . PHE B 1 177 ? 62.550 28.920 188.610 1.00 15.00 ? 209 PHE B CZ  1 
ATOM   5971 N  N   . PHE B 1 178 ? 61.960 33.920 185.750 1.00 15.00 ? 210 PHE B N   1 
ATOM   5972 C  CA  . PHE B 1 178 ? 62.800 35.090 185.800 1.00 15.00 ? 210 PHE B CA  1 
ATOM   5973 C  C   . PHE B 1 178 ? 62.670 35.710 184.450 1.00 15.00 ? 210 PHE B C   1 
ATOM   5974 O  O   . PHE B 1 178 ? 63.030 35.110 183.430 1.00 15.00 ? 210 PHE B O   1 
ATOM   5975 C  CB  . PHE B 1 178 ? 64.190 34.670 186.060 1.00 15.00 ? 210 PHE B CB  1 
ATOM   5976 C  CG  . PHE B 1 178 ? 64.380 34.090 187.440 1.00 15.00 ? 210 PHE B CG  1 
ATOM   5977 C  CD1 . PHE B 1 178 ? 63.640 34.530 188.520 1.00 15.00 ? 210 PHE B CD1 1 
ATOM   5978 C  CD2 . PHE B 1 178 ? 65.320 33.110 187.610 1.00 15.00 ? 210 PHE B CD2 1 
ATOM   5979 C  CE1 . PHE B 1 178 ? 63.880 33.990 189.760 1.00 15.00 ? 210 PHE B CE1 1 
ATOM   5980 C  CE2 . PHE B 1 178 ? 65.560 32.580 188.860 1.00 15.00 ? 210 PHE B CE2 1 
ATOM   5981 C  CZ  . PHE B 1 178 ? 64.830 33.020 189.930 1.00 15.00 ? 210 PHE B CZ  1 
ATOM   5982 N  N   . LYS B 1 179 ? 62.010 36.850 184.430 1.00 15.00 ? 211 LYS B N   1 
ATOM   5983 C  CA  . LYS B 1 179 ? 61.850 37.600 183.200 1.00 15.00 ? 211 LYS B CA  1 
ATOM   5984 C  C   . LYS B 1 179 ? 61.820 39.040 183.660 1.00 15.00 ? 211 LYS B C   1 
ATOM   5985 O  O   . LYS B 1 179 ? 60.720 39.620 183.830 1.00 15.00 ? 211 LYS B O   1 
ATOM   5986 C  CB  . LYS B 1 179 ? 60.530 37.340 182.450 1.00 15.00 ? 211 LYS B CB  1 
ATOM   5987 C  CG  . LYS B 1 179 ? 60.240 36.050 181.680 1.00 15.00 ? 211 LYS B CG  1 
ATOM   5988 C  CD  . LYS B 1 179 ? 59.190 36.360 180.590 1.00 15.00 ? 211 LYS B CD  1 
ATOM   5989 C  CE  . LYS B 1 179 ? 58.570 35.160 179.890 1.00 15.00 ? 211 LYS B CE  1 
ATOM   5990 N  NZ  . LYS B 1 179 ? 57.730 35.600 178.790 1.00 15.00 ? 211 LYS B NZ  1 
ATOM   5991 N  N   . THR B 1 180 ? 62.960 39.660 183.970 1.00 15.00 ? 212 THR B N   1 
ATOM   5992 C  CA  . THR B 1 180 ? 62.970 41.030 184.400 1.00 15.00 ? 212 THR B CA  1 
ATOM   5993 C  C   . THR B 1 180 ? 62.490 41.900 183.260 1.00 15.00 ? 212 THR B C   1 
ATOM   5994 O  O   . THR B 1 180 ? 62.900 41.750 182.100 1.00 15.00 ? 212 THR B O   1 
ATOM   5995 C  CB  . THR B 1 180 ? 64.380 41.400 184.820 1.00 15.00 ? 212 THR B CB  1 
ATOM   5996 O  OG1 . THR B 1 180 ? 64.690 40.470 185.840 1.00 15.00 ? 212 THR B OG1 1 
ATOM   5997 C  CG2 . THR B 1 180 ? 64.530 42.810 185.370 1.00 15.00 ? 212 THR B CG2 1 
ATOM   5998 N  N   . SER B 1 181 ? 61.580 42.780 183.620 1.00 15.00 ? 213 SER B N   1 
ATOM   5999 C  CA  . SER B 1 181 ? 60.860 43.660 182.730 1.00 15.00 ? 213 SER B CA  1 
ATOM   6000 C  C   . SER B 1 181 ? 61.670 44.480 181.760 1.00 15.00 ? 213 SER B C   1 
ATOM   6001 O  O   . SER B 1 181 ? 61.230 44.750 180.610 1.00 15.00 ? 213 SER B O   1 
ATOM   6002 C  CB  . SER B 1 181 ? 60.010 44.630 183.520 1.00 15.00 ? 213 SER B CB  1 
ATOM   6003 O  OG  . SER B 1 181 ? 59.410 45.660 182.760 1.00 15.00 ? 213 SER B OG  1 
ATOM   6004 N  N   . GLY B 1 182 ? 62.830 44.970 182.200 1.00 15.00 ? 214 GLY B N   1 
ATOM   6005 C  CA  . GLY B 1 182 ? 63.620 45.820 181.330 1.00 15.00 ? 214 GLY B CA  1 
ATOM   6006 C  C   . GLY B 1 182 ? 62.840 47.120 181.220 1.00 15.00 ? 214 GLY B C   1 
ATOM   6007 O  O   . GLY B 1 182 ? 63.060 47.960 182.080 1.00 15.00 ? 214 GLY B O   1 
ATOM   6008 N  N   . LYS B 1 183 ? 61.850 47.230 180.310 1.00 15.00 ? 215 LYS B N   1 
ATOM   6009 C  CA  . LYS B 1 183 ? 61.090 48.470 180.130 1.00 15.00 ? 215 LYS B CA  1 
ATOM   6010 C  C   . LYS B 1 183 ? 60.480 49.110 181.400 1.00 15.00 ? 215 LYS B C   1 
ATOM   6011 O  O   . LYS B 1 183 ? 60.180 50.310 181.390 1.00 15.00 ? 215 LYS B O   1 
ATOM   6012 C  CB  . LYS B 1 183 ? 60.020 48.180 179.030 1.00 15.00 ? 215 LYS B CB  1 
ATOM   6013 C  CG  . LYS B 1 183 ? 58.510 48.370 179.280 1.00 15.00 ? 215 LYS B CG  1 
ATOM   6014 C  CD  . LYS B 1 183 ? 57.880 47.190 180.040 1.00 15.00 ? 215 LYS B CD  1 
ATOM   6015 C  CE  . LYS B 1 183 ? 57.960 45.850 179.260 1.00 15.00 ? 215 LYS B CE  1 
ATOM   6016 N  NZ  . LYS B 1 183 ? 57.500 44.720 180.070 1.00 15.00 ? 215 LYS B NZ  1 
ATOM   6017 N  N   . MET B 1 184 ? 60.240 48.350 182.480 1.00 15.00 ? 216 MET B N   1 
ATOM   6018 C  CA  . MET B 1 184 ? 59.840 48.970 183.740 1.00 15.00 ? 216 MET B CA  1 
ATOM   6019 C  C   . MET B 1 184 ? 61.040 49.130 184.680 1.00 15.00 ? 216 MET B C   1 
ATOM   6020 O  O   . MET B 1 184 ? 61.090 50.020 185.540 1.00 15.00 ? 216 MET B O   1 
ATOM   6021 C  CB  . MET B 1 184 ? 58.800 48.140 184.480 1.00 15.00 ? 216 MET B CB  1 
ATOM   6022 C  CG  . MET B 1 184 ? 57.410 48.170 183.880 1.00 15.00 ? 216 MET B CG  1 
ATOM   6023 S  SD  . MET B 1 184 ? 56.240 47.150 184.820 1.00 15.00 ? 216 MET B SD  1 
ATOM   6024 C  CE  . MET B 1 184 ? 56.400 45.590 183.980 1.00 15.00 ? 216 MET B CE  1 
ATOM   6025 N  N   . GLY B 1 185 ? 62.010 48.240 184.560 1.00 15.00 ? 217 GLY B N   1 
ATOM   6026 C  CA  . GLY B 1 185 ? 63.180 48.320 185.380 1.00 15.00 ? 217 GLY B CA  1 
ATOM   6027 C  C   . GLY B 1 185 ? 63.370 47.040 186.160 1.00 15.00 ? 217 GLY B C   1 
ATOM   6028 O  O   . GLY B 1 185 ? 62.780 46.010 185.840 1.00 15.00 ? 217 GLY B O   1 
ATOM   6029 N  N   . PRO B 1 186 ? 64.320 47.080 187.100 1.00 15.00 ? 218 PRO B N   1 
ATOM   6030 C  CA  . PRO B 1 186 ? 64.580 46.020 188.050 1.00 15.00 ? 218 PRO B CA  1 
ATOM   6031 C  C   . PRO B 1 186 ? 63.460 46.090 189.060 1.00 15.00 ? 218 PRO B C   1 
ATOM   6032 O  O   . PRO B 1 186 ? 62.950 47.180 189.360 1.00 15.00 ? 218 PRO B O   1 
ATOM   6033 C  CB  . PRO B 1 186 ? 65.940 46.370 188.570 1.00 15.00 ? 218 PRO B CB  1 
ATOM   6034 C  CG  . PRO B 1 186 ? 66.520 47.320 187.540 1.00 15.00 ? 218 PRO B CG  1 
ATOM   6035 C  CD  . PRO B 1 186 ? 65.300 48.150 187.250 1.00 15.00 ? 218 PRO B CD  1 
ATOM   6036 N  N   . GLY B 1 187 ? 63.200 44.940 189.680 1.00 15.00 ? 219 GLY B N   1 
ATOM   6037 C  CA  . GLY B 1 187 ? 61.910 44.720 190.330 1.00 15.00 ? 219 GLY B CA  1 
ATOM   6038 C  C   . GLY B 1 187 ? 61.130 44.310 189.080 1.00 15.00 ? 219 GLY B C   1 
ATOM   6039 O  O   . GLY B 1 187 ? 61.730 44.010 188.050 1.00 15.00 ? 219 GLY B O   1 
ATOM   6040 N  N   . PHE B 1 188 ? 59.820 44.230 189.040 1.00 15.00 ? 220 PHE B N   1 
ATOM   6041 C  CA  . PHE B 1 188 ? 59.110 43.960 187.780 1.00 15.00 ? 220 PHE B CA  1 
ATOM   6042 C  C   . PHE B 1 188 ? 59.390 42.720 186.940 1.00 15.00 ? 220 PHE B C   1 
ATOM   6043 O  O   . PHE B 1 188 ? 60.340 42.650 186.160 1.00 15.00 ? 220 PHE B O   1 
ATOM   6044 C  CB  . PHE B 1 188 ? 59.250 45.180 186.870 1.00 15.00 ? 220 PHE B CB  1 
ATOM   6045 C  CG  . PHE B 1 188 ? 58.870 46.440 187.600 1.00 15.00 ? 220 PHE B CG  1 
ATOM   6046 C  CD1 . PHE B 1 188 ? 57.550 46.710 187.870 1.00 15.00 ? 220 PHE B CD1 1 
ATOM   6047 C  CD2 . PHE B 1 188 ? 59.860 47.280 188.030 1.00 15.00 ? 220 PHE B CD2 1 
ATOM   6048 C  CE1 . PHE B 1 188 ? 57.220 47.830 188.570 1.00 15.00 ? 220 PHE B CE1 1 
ATOM   6049 C  CE2 . PHE B 1 188 ? 59.510 48.400 188.730 1.00 15.00 ? 220 PHE B CE2 1 
ATOM   6050 C  CZ  . PHE B 1 188 ? 58.200 48.680 189.000 1.00 15.00 ? 220 PHE B CZ  1 
ATOM   6051 N  N   . THR B 1 189 ? 58.540 41.720 187.100 1.00 15.00 ? 221 THR B N   1 
ATOM   6052 C  CA  . THR B 1 189 ? 58.600 40.510 186.340 1.00 15.00 ? 221 THR B CA  1 
ATOM   6053 C  C   . THR B 1 189 ? 57.480 40.710 185.380 1.00 15.00 ? 221 THR B C   1 
ATOM   6054 O  O   . THR B 1 189 ? 56.420 41.300 185.630 1.00 15.00 ? 221 THR B O   1 
ATOM   6055 C  CB  . THR B 1 189 ? 58.240 39.240 187.080 1.00 15.00 ? 221 THR B CB  1 
ATOM   6056 O  OG1 . THR B 1 189 ? 58.300 39.590 188.450 1.00 15.00 ? 221 THR B OG1 1 
ATOM   6057 C  CG2 . THR B 1 189 ? 59.140 38.070 186.800 1.00 15.00 ? 221 THR B CG2 1 
ATOM   6058 N  N   . LYS B 1 190 ? 57.830 40.190 184.210 1.00 15.00 ? 222 LYS B N   1 
ATOM   6059 C  CA  . LYS B 1 190 ? 56.890 40.070 183.120 1.00 15.00 ? 222 LYS B CA  1 
ATOM   6060 C  C   . LYS B 1 190 ? 56.290 38.660 183.230 1.00 15.00 ? 222 LYS B C   1 
ATOM   6061 O  O   . LYS B 1 190 ? 55.260 38.350 182.650 1.00 15.00 ? 222 LYS B O   1 
ATOM   6062 C  CB  . LYS B 1 190 ? 57.680 40.260 181.840 1.00 15.00 ? 222 LYS B CB  1 
ATOM   6063 C  CG  . LYS B 1 190 ? 56.820 40.510 180.640 1.00 15.00 ? 222 LYS B CG  1 
ATOM   6064 C  CD  . LYS B 1 190 ? 57.640 41.240 179.590 1.00 15.00 ? 222 LYS B CD  1 
ATOM   6065 C  CE  . LYS B 1 190 ? 56.780 41.560 178.350 1.00 15.00 ? 222 LYS B CE  1 
ATOM   6066 N  NZ  . LYS B 1 190 ? 55.700 42.520 178.620 1.00 15.00 ? 222 LYS B NZ  1 
ATOM   6067 N  N   . ALA B 1 191 ? 56.960 37.800 184.000 1.00 15.00 ? 223 ALA B N   1 
ATOM   6068 C  CA  . ALA B 1 191 ? 56.500 36.450 184.210 1.00 15.00 ? 223 ALA B CA  1 
ATOM   6069 C  C   . ALA B 1 191 ? 55.690 36.470 185.460 1.00 15.00 ? 223 ALA B C   1 
ATOM   6070 O  O   . ALA B 1 191 ? 56.110 36.050 186.550 1.00 15.00 ? 223 ALA B O   1 
ATOM   6071 C  CB  . ALA B 1 191 ? 57.650 35.500 184.420 1.00 15.00 ? 223 ALA B CB  1 
ATOM   6072 N  N   . LEU B 1 192 ? 54.500 37.060 185.290 1.00 15.00 ? 224 LEU B N   1 
ATOM   6073 C  CA  . LEU B 1 192 ? 53.520 37.110 186.350 1.00 15.00 ? 224 LEU B CA  1 
ATOM   6074 C  C   . LEU B 1 192 ? 53.050 35.670 186.480 1.00 15.00 ? 224 LEU B C   1 
ATOM   6075 O  O   . LEU B 1 192 ? 53.210 34.890 185.520 1.00 15.00 ? 224 LEU B O   1 
ATOM   6076 C  CB  . LEU B 1 192 ? 52.350 37.970 185.980 1.00 15.00 ? 224 LEU B CB  1 
ATOM   6077 C  CG  . LEU B 1 192 ? 52.730 39.350 185.520 1.00 15.00 ? 224 LEU B CG  1 
ATOM   6078 C  CD1 . LEU B 1 192 ? 52.630 39.440 184.020 1.00 15.00 ? 224 LEU B CD1 1 
ATOM   6079 C  CD2 . LEU B 1 192 ? 51.760 40.340 186.080 1.00 15.00 ? 224 LEU B CD2 1 
ATOM   6080 N  N   . GLY B 1 193 ? 52.490 35.210 187.570 1.00 15.00 ? 225 GLY B N   1 
ATOM   6081 C  CA  . GLY B 1 193 ? 52.250 33.760 187.650 1.00 15.00 ? 225 GLY B CA  1 
ATOM   6082 C  C   . GLY B 1 193 ? 53.350 33.130 188.470 1.00 15.00 ? 225 GLY B C   1 
ATOM   6083 O  O   . GLY B 1 193 ? 53.220 32.030 188.980 1.00 15.00 ? 225 GLY B O   1 
ATOM   6084 N  N   . HIS B 1 194 ? 54.490 33.810 188.440 1.00 15.00 ? 226 HIS B N   1 
ATOM   6085 C  CA  . HIS B 1 194 ? 55.510 33.650 189.470 1.00 15.00 ? 226 HIS B CA  1 
ATOM   6086 C  C   . HIS B 1 194 ? 56.030 32.310 189.860 1.00 15.00 ? 226 HIS B C   1 
ATOM   6087 O  O   . HIS B 1 194 ? 56.490 32.120 190.980 1.00 15.00 ? 226 HIS B O   1 
ATOM   6088 C  CB  . HIS B 1 194 ? 55.020 34.360 190.740 1.00 15.00 ? 226 HIS B CB  1 
ATOM   6089 C  CG  . HIS B 1 194 ? 55.270 35.840 190.700 1.00 15.00 ? 226 HIS B CG  1 
ATOM   6090 N  ND1 . HIS B 1 194 ? 54.800 36.760 189.770 1.00 15.00 ? 226 HIS B ND1 1 
ATOM   6091 C  CD2 . HIS B 1 194 ? 56.080 36.470 191.620 1.00 15.00 ? 226 HIS B CD2 1 
ATOM   6092 C  CE1 . HIS B 1 194 ? 55.330 37.930 190.140 1.00 15.00 ? 226 HIS B CE1 1 
ATOM   6093 N  NE2 . HIS B 1 194 ? 56.070 37.800 191.200 1.00 15.00 ? 226 HIS B NE2 1 
ATOM   6094 N  N   . GLY B 1 195 ? 56.030 31.380 188.940 1.00 15.00 ? 227 GLY B N   1 
ATOM   6095 C  CA  . GLY B 1 195 ? 56.530 30.080 189.290 1.00 15.00 ? 227 GLY B CA  1 
ATOM   6096 C  C   . GLY B 1 195 ? 56.480 29.210 188.070 1.00 15.00 ? 227 GLY B C   1 
ATOM   6097 O  O   . GLY B 1 195 ? 56.640 29.680 186.950 1.00 15.00 ? 227 GLY B O   1 
ATOM   6098 N  N   . VAL B 1 196 ? 56.150 27.940 188.320 1.00 15.00 ? 228 VAL B N   1 
ATOM   6099 C  CA  . VAL B 1 196 ? 56.120 26.990 187.250 1.00 15.00 ? 228 VAL B CA  1 
ATOM   6100 C  C   . VAL B 1 196 ? 54.790 27.020 186.500 1.00 15.00 ? 228 VAL B C   1 
ATOM   6101 O  O   . VAL B 1 196 ? 54.090 26.040 186.330 1.00 15.00 ? 228 VAL B O   1 
ATOM   6102 C  CB  . VAL B 1 196 ? 56.460 25.580 187.820 1.00 15.00 ? 228 VAL B CB  1 
ATOM   6103 C  CG1 . VAL B 1 196 ? 56.940 24.730 186.670 1.00 15.00 ? 228 VAL B CG1 1 
ATOM   6104 C  CG2 . VAL B 1 196 ? 57.590 25.590 188.830 1.00 15.00 ? 228 VAL B CG2 1 
ATOM   6105 N  N   . ASP B 1 197 ? 54.380 28.200 186.040 1.00 15.00 ? 229 ASP B N   1 
ATOM   6106 C  CA  . ASP B 1 197 ? 53.270 28.330 185.120 1.00 15.00 ? 229 ASP B CA  1 
ATOM   6107 C  C   . ASP B 1 197 ? 54.060 27.960 183.900 1.00 15.00 ? 229 ASP B C   1 
ATOM   6108 O  O   . ASP B 1 197 ? 55.110 28.580 183.730 1.00 15.00 ? 229 ASP B O   1 
ATOM   6109 C  CB  . ASP B 1 197 ? 52.770 29.810 185.020 1.00 15.00 ? 229 ASP B CB  1 
ATOM   6110 C  CG  . ASP B 1 197 ? 53.690 30.930 184.480 1.00 15.00 ? 229 ASP B CG  1 
ATOM   6111 O  OD1 . ASP B 1 197 ? 54.620 31.340 185.180 1.00 15.00 ? 229 ASP B OD1 1 
ATOM   6112 O  OD2 . ASP B 1 197 ? 53.480 31.400 183.350 1.00 15.00 ? 229 ASP B OD2 1 
ATOM   6113 N  N   . LEU B 1 198 ? 53.810 27.010 183.020 1.00 15.00 ? 230 LEU B N   1 
ATOM   6114 C  CA  . LEU B 1 198 ? 54.790 26.770 181.980 1.00 15.00 ? 230 LEU B CA  1 
ATOM   6115 C  C   . LEU B 1 198 ? 54.820 27.830 180.880 1.00 15.00 ? 230 LEU B C   1 
ATOM   6116 O  O   . LEU B 1 198 ? 54.940 27.550 179.680 1.00 15.00 ? 230 LEU B O   1 
ATOM   6117 C  CB  . LEU B 1 198 ? 54.550 25.400 181.430 1.00 15.00 ? 230 LEU B CB  1 
ATOM   6118 C  CG  . LEU B 1 198 ? 54.920 24.240 182.340 1.00 15.00 ? 230 LEU B CG  1 
ATOM   6119 C  CD1 . LEU B 1 198 ? 54.750 22.950 181.580 1.00 15.00 ? 230 LEU B CD1 1 
ATOM   6120 C  CD2 . LEU B 1 198 ? 56.360 24.320 182.730 1.00 15.00 ? 230 LEU B CD2 1 
ATOM   6121 N  N   . GLY B 1 199 ? 54.800 29.120 181.210 1.00 15.00 ? 231 GLY B N   1 
ATOM   6122 C  CA  . GLY B 1 199 ? 54.750 30.210 180.280 1.00 15.00 ? 231 GLY B CA  1 
ATOM   6123 C  C   . GLY B 1 199 ? 55.960 30.290 179.390 1.00 15.00 ? 231 GLY B C   1 
ATOM   6124 O  O   . GLY B 1 199 ? 56.000 31.130 178.500 1.00 15.00 ? 231 GLY B O   1 
ATOM   6125 N  N   . HIS B 1 200 ? 56.970 29.460 179.590 1.00 15.00 ? 232 HIS B N   1 
ATOM   6126 C  CA  . HIS B 1 200 ? 58.080 29.470 178.660 1.00 15.00 ? 232 HIS B CA  1 
ATOM   6127 C  C   . HIS B 1 200 ? 57.720 28.650 177.430 1.00 15.00 ? 232 HIS B C   1 
ATOM   6128 O  O   . HIS B 1 200 ? 58.240 28.920 176.350 1.00 15.00 ? 232 HIS B O   1 
ATOM   6129 C  CB  . HIS B 1 200 ? 59.340 28.920 179.330 1.00 15.00 ? 232 HIS B CB  1 
ATOM   6130 C  CG  . HIS B 1 200 ? 59.380 27.610 180.100 1.00 15.00 ? 232 HIS B CG  1 
ATOM   6131 N  ND1 . HIS B 1 200 ? 60.390 27.280 180.980 1.00 15.00 ? 232 HIS B ND1 1 
ATOM   6132 C  CD2 . HIS B 1 200 ? 58.490 26.580 179.930 1.00 15.00 ? 232 HIS B CD2 1 
ATOM   6133 C  CE1 . HIS B 1 200 ? 60.130 26.000 181.320 1.00 15.00 ? 232 HIS B CE1 1 
ATOM   6134 N  NE2 . HIS B 1 200 ? 59.070 25.570 180.720 1.00 15.00 ? 232 HIS B NE2 1 
ATOM   6135 N  N   . ILE B 1 201 ? 56.770 27.710 177.590 1.00 15.00 ? 233 ILE B N   1 
ATOM   6136 C  CA  . ILE B 1 201 ? 56.250 26.870 176.520 1.00 15.00 ? 233 ILE B CA  1 
ATOM   6137 C  C   . ILE B 1 201 ? 55.030 27.530 175.920 1.00 15.00 ? 233 ILE B C   1 
ATOM   6138 O  O   . ILE B 1 201 ? 54.870 27.530 174.710 1.00 15.00 ? 233 ILE B O   1 
ATOM   6139 C  CB  . ILE B 1 201 ? 55.840 25.470 177.050 1.00 15.00 ? 233 ILE B CB  1 
ATOM   6140 C  CG1 . ILE B 1 201 ? 57.070 24.730 177.520 1.00 15.00 ? 233 ILE B CG1 1 
ATOM   6141 C  CG2 . ILE B 1 201 ? 55.160 24.660 175.970 1.00 15.00 ? 233 ILE B CG2 1 
ATOM   6142 C  CD1 . ILE B 1 201 ? 56.760 23.570 178.470 1.00 15.00 ? 233 ILE B CD1 1 
ATOM   6143 N  N   . TYR B 1 202 ? 54.140 28.000 176.790 1.00 15.00 ? 234 TYR B N   1 
ATOM   6144 C  CA  . TYR B 1 202 ? 52.840 28.540 176.370 1.00 15.00 ? 234 TYR B CA  1 
ATOM   6145 C  C   . TYR B 1 202 ? 52.690 30.040 176.320 1.00 15.00 ? 234 TYR B C   1 
ATOM   6146 O  O   . TYR B 1 202 ? 51.790 30.490 175.630 1.00 15.00 ? 234 TYR B O   1 
ATOM   6147 C  CB  . TYR B 1 202 ? 51.720 28.040 177.250 1.00 15.00 ? 234 TYR B CB  1 
ATOM   6148 C  CG  . TYR B 1 202 ? 51.680 26.530 177.430 1.00 15.00 ? 234 TYR B CG  1 
ATOM   6149 C  CD1 . TYR B 1 202 ? 51.170 25.690 176.440 1.00 15.00 ? 234 TYR B CD1 1 
ATOM   6150 C  CD2 . TYR B 1 202 ? 52.160 26.000 178.590 1.00 15.00 ? 234 TYR B CD2 1 
ATOM   6151 C  CE1 . TYR B 1 202 ? 51.160 24.320 176.650 1.00 15.00 ? 234 TYR B CE1 1 
ATOM   6152 C  CE2 . TYR B 1 202 ? 52.150 24.630 178.790 1.00 15.00 ? 234 TYR B CE2 1 
ATOM   6153 C  CZ  . TYR B 1 202 ? 51.650 23.810 177.830 1.00 15.00 ? 234 TYR B CZ  1 
ATOM   6154 O  OH  . TYR B 1 202 ? 51.690 22.450 178.050 1.00 15.00 ? 234 TYR B OH  1 
ATOM   6155 N  N   . GLY B 1 203 ? 53.470 30.850 177.010 1.00 15.00 ? 235 GLY B N   1 
ATOM   6156 C  CA  . GLY B 1 203 ? 53.290 32.280 176.940 1.00 15.00 ? 235 GLY B CA  1 
ATOM   6157 C  C   . GLY B 1 203 ? 52.950 32.880 178.290 1.00 15.00 ? 235 GLY B C   1 
ATOM   6158 O  O   . GLY B 1 203 ? 52.270 32.290 179.120 1.00 15.00 ? 235 GLY B O   1 
ATOM   6159 N  N   . ASP B 1 204 ? 53.520 34.080 178.470 1.00 15.00 ? 236 ASP B N   1 
ATOM   6160 C  CA  . ASP B 1 204 ? 53.290 34.860 179.680 1.00 15.00 ? 236 ASP B CA  1 
ATOM   6161 C  C   . ASP B 1 204 ? 51.960 35.580 179.560 1.00 15.00 ? 236 ASP B C   1 
ATOM   6162 O  O   . ASP B 1 204 ? 51.390 36.000 180.560 1.00 15.00 ? 236 ASP B O   1 
ATOM   6163 C  CB  . ASP B 1 204 ? 54.400 35.910 179.890 1.00 15.00 ? 236 ASP B CB  1 
ATOM   6164 C  CG  . ASP B 1 204 ? 54.540 37.050 178.860 1.00 15.00 ? 236 ASP B CG  1 
ATOM   6165 O  OD1 . ASP B 1 204 ? 55.080 36.830 177.780 1.00 15.00 ? 236 ASP B OD1 1 
ATOM   6166 O  OD2 . ASP B 1 204 ? 54.110 38.170 179.180 1.00 15.00 ? 236 ASP B OD2 1 
ATOM   6167 N  N   . ASN B 1 205 ? 51.440 35.750 178.340 1.00 15.00 ? 237 ASN B N   1 
ATOM   6168 C  CA  . ASN B 1 205 ? 50.150 36.400 178.150 1.00 15.00 ? 237 ASN B CA  1 
ATOM   6169 C  C   . ASN B 1 205 ? 49.250 35.570 177.240 1.00 15.00 ? 237 ASN B C   1 
ATOM   6170 O  O   . ASN B 1 205 ? 49.670 35.110 176.190 1.00 15.00 ? 237 ASN B O   1 
ATOM   6171 C  CB  . ASN B 1 205 ? 50.330 37.790 177.540 1.00 15.00 ? 237 ASN B CB  1 
ATOM   6172 C  CG  . ASN B 1 205 ? 51.080 37.790 176.230 1.00 15.00 ? 237 ASN B CG  1 
ATOM   6173 O  OD1 . ASN B 1 205 ? 52.080 37.070 176.090 1.00 15.00 ? 237 ASN B OD1 1 
ATOM   6174 N  ND2 . ASN B 1 205 ? 50.690 38.540 175.220 1.00 15.00 ? 237 ASN B ND2 1 
ATOM   6175 N  N   . LEU B 1 206 ? 47.970 35.420 177.600 1.00 15.00 ? 238 LEU B N   1 
ATOM   6176 C  CA  . LEU B 1 206 ? 47.000 34.600 176.870 1.00 15.00 ? 238 LEU B CA  1 
ATOM   6177 C  C   . LEU B 1 206 ? 46.990 34.760 175.360 1.00 15.00 ? 238 LEU B C   1 
ATOM   6178 O  O   . LEU B 1 206 ? 46.990 33.780 174.640 1.00 15.00 ? 238 LEU B O   1 
ATOM   6179 C  CB  . LEU B 1 206 ? 45.600 34.880 177.330 1.00 15.00 ? 238 LEU B CB  1 
ATOM   6180 C  CG  . LEU B 1 206 ? 44.550 34.010 176.700 1.00 15.00 ? 238 LEU B CG  1 
ATOM   6181 C  CD1 . LEU B 1 206 ? 44.600 32.630 177.310 1.00 15.00 ? 238 LEU B CD1 1 
ATOM   6182 C  CD2 . LEU B 1 206 ? 43.200 34.640 176.910 1.00 15.00 ? 238 LEU B CD2 1 
ATOM   6183 N  N   . GLU B 1 207 ? 46.970 36.010 174.930 1.00 15.00 ? 239 GLU B N   1 
ATOM   6184 C  CA  . GLU B 1 207 ? 46.960 36.380 173.530 1.00 15.00 ? 239 GLU B CA  1 
ATOM   6185 C  C   . GLU B 1 207 ? 48.030 35.630 172.740 1.00 15.00 ? 239 GLU B C   1 
ATOM   6186 O  O   . GLU B 1 207 ? 47.720 35.100 171.690 1.00 15.00 ? 239 GLU B O   1 
ATOM   6187 C  CB  . GLU B 1 207 ? 47.170 37.880 173.470 1.00 15.00 ? 239 GLU B CB  1 
ATOM   6188 C  CG  . GLU B 1 207 ? 46.230 38.680 172.560 1.00 15.00 ? 239 GLU B CG  1 
ATOM   6189 C  CD  . GLU B 1 207 ? 46.480 38.530 171.040 1.00 15.00 ? 239 GLU B CD  1 
ATOM   6190 O  OE1 . GLU B 1 207 ? 47.420 39.200 170.560 1.00 15.00 ? 239 GLU B OE1 1 
ATOM   6191 O  OE2 . GLU B 1 207 ? 45.750 37.780 170.360 1.00 15.00 ? 239 GLU B OE2 1 
ATOM   6192 N  N   . ARG B 1 208 ? 49.250 35.480 173.290 1.00 15.00 ? 240 ARG B N   1 
ATOM   6193 C  CA  . ARG B 1 208 ? 50.360 34.760 172.680 1.00 15.00 ? 240 ARG B CA  1 
ATOM   6194 C  C   . ARG B 1 208 ? 50.070 33.270 172.790 1.00 15.00 ? 240 ARG B C   1 
ATOM   6195 O  O   . ARG B 1 208 ? 50.270 32.520 171.840 1.00 15.00 ? 240 ARG B O   1 
ATOM   6196 C  CB  . ARG B 1 208 ? 51.650 35.170 173.420 1.00 15.00 ? 240 ARG B CB  1 
ATOM   6197 C  CG  . ARG B 1 208 ? 52.960 34.390 173.250 1.00 15.00 ? 240 ARG B CG  1 
ATOM   6198 C  CD  . ARG B 1 208 ? 54.180 34.920 174.070 1.00 15.00 ? 240 ARG B CD  1 
ATOM   6199 N  NE  . ARG B 1 208 ? 55.160 35.640 173.260 1.00 15.00 ? 240 ARG B NE  1 
ATOM   6200 C  CZ  . ARG B 1 208 ? 56.110 35.030 172.520 1.00 15.00 ? 240 ARG B CZ  1 
ATOM   6201 N  NH1 . ARG B 1 208 ? 56.210 33.700 172.500 1.00 15.00 ? 240 ARG B NH1 1 
ATOM   6202 N  NH2 . ARG B 1 208 ? 56.930 35.760 171.740 1.00 15.00 ? 240 ARG B NH2 1 
ATOM   6203 N  N   . GLN B 1 209 ? 49.500 32.800 173.890 1.00 15.00 ? 241 GLN B N   1 
ATOM   6204 C  CA  . GLN B 1 209 ? 49.190 31.400 174.090 1.00 15.00 ? 241 GLN B CA  1 
ATOM   6205 C  C   . GLN B 1 209 ? 48.230 30.950 173.030 1.00 15.00 ? 241 GLN B C   1 
ATOM   6206 O  O   . GLN B 1 209 ? 48.320 29.820 172.550 1.00 15.00 ? 241 GLN B O   1 
ATOM   6207 C  CB  . GLN B 1 209 ? 48.620 31.250 175.490 1.00 15.00 ? 241 GLN B CB  1 
ATOM   6208 C  CG  . GLN B 1 209 ? 48.440 29.860 176.020 1.00 15.00 ? 241 GLN B CG  1 
ATOM   6209 C  CD  . GLN B 1 209 ? 46.970 29.590 176.220 1.00 15.00 ? 241 GLN B CD  1 
ATOM   6210 O  OE1 . GLN B 1 209 ? 46.410 29.630 177.310 1.00 15.00 ? 241 GLN B OE1 1 
ATOM   6211 N  NE2 . GLN B 1 209 ? 46.280 29.300 175.150 1.00 15.00 ? 241 GLN B NE2 1 
ATOM   6212 N  N   . TYR B 1 210 ? 47.310 31.800 172.600 1.00 15.00 ? 242 TYR B N   1 
ATOM   6213 C  CA  . TYR B 1 210 ? 46.380 31.470 171.550 1.00 15.00 ? 242 TYR B CA  1 
ATOM   6214 C  C   . TYR B 1 210 ? 47.070 31.460 170.200 1.00 15.00 ? 242 TYR B C   1 
ATOM   6215 O  O   . TYR B 1 210 ? 46.760 30.680 169.300 1.00 15.00 ? 242 TYR B O   1 
ATOM   6216 C  CB  . TYR B 1 210 ? 45.210 32.450 171.550 1.00 15.00 ? 242 TYR B CB  1 
ATOM   6217 C  CG  . TYR B 1 210 ? 44.120 32.170 172.590 1.00 15.00 ? 242 TYR B CG  1 
ATOM   6218 C  CD1 . TYR B 1 210 ? 44.190 31.110 173.460 1.00 15.00 ? 242 TYR B CD1 1 
ATOM   6219 C  CD2 . TYR B 1 210 ? 43.010 32.980 172.630 1.00 15.00 ? 242 TYR B CD2 1 
ATOM   6220 C  CE1 . TYR B 1 210 ? 43.170 30.860 174.360 1.00 15.00 ? 242 TYR B CE1 1 
ATOM   6221 C  CE2 . TYR B 1 210 ? 41.990 32.750 173.520 1.00 15.00 ? 242 TYR B CE2 1 
ATOM   6222 C  CZ  . TYR B 1 210 ? 42.070 31.690 174.380 1.00 15.00 ? 242 TYR B CZ  1 
ATOM   6223 O  OH  . TYR B 1 210 ? 41.030 31.430 175.260 1.00 15.00 ? 242 TYR B OH  1 
ATOM   6224 N  N   . GLN B 1 211 ? 48.060 32.330 170.060 1.00 15.00 ? 243 GLN B N   1 
ATOM   6225 C  CA  . GLN B 1 211 ? 48.880 32.340 168.870 1.00 15.00 ? 243 GLN B CA  1 
ATOM   6226 C  C   . GLN B 1 211 ? 49.730 31.100 168.670 1.00 15.00 ? 243 GLN B C   1 
ATOM   6227 O  O   . GLN B 1 211 ? 50.130 30.840 167.550 1.00 15.00 ? 243 GLN B O   1 
ATOM   6228 C  CB  . GLN B 1 211 ? 49.850 33.500 168.860 1.00 15.00 ? 243 GLN B CB  1 
ATOM   6229 C  CG  . GLN B 1 211 ? 49.230 34.640 168.160 1.00 15.00 ? 243 GLN B CG  1 
ATOM   6230 C  CD  . GLN B 1 211 ? 49.090 34.400 166.660 1.00 15.00 ? 243 GLN B CD  1 
ATOM   6231 O  OE1 . GLN B 1 211 ? 48.720 35.360 165.970 1.00 15.00 ? 243 GLN B OE1 1 
ATOM   6232 N  NE2 . GLN B 1 211 ? 49.360 33.280 166.000 1.00 15.00 ? 243 GLN B NE2 1 
ATOM   6233 N  N   . LEU B 1 212 ? 50.090 30.420 169.730 1.00 15.00 ? 244 LEU B N   1 
ATOM   6234 C  CA  . LEU B 1 212 ? 50.890 29.230 169.600 1.00 15.00 ? 244 LEU B CA  1 
ATOM   6235 C  C   . LEU B 1 212 ? 50.040 27.990 169.540 1.00 15.00 ? 244 LEU B C   1 
ATOM   6236 O  O   . LEU B 1 212 ? 50.580 26.900 169.320 1.00 15.00 ? 244 LEU B O   1 
ATOM   6237 C  CB  . LEU B 1 212 ? 51.790 29.110 170.780 1.00 15.00 ? 244 LEU B CB  1 
ATOM   6238 C  CG  . LEU B 1 212 ? 52.760 30.200 170.980 1.00 15.00 ? 244 LEU B CG  1 
ATOM   6239 C  CD1 . LEU B 1 212 ? 53.230 30.140 172.390 1.00 15.00 ? 244 LEU B CD1 1 
ATOM   6240 C  CD2 . LEU B 1 212 ? 53.850 30.100 169.970 1.00 15.00 ? 244 LEU B CD2 1 
ATOM   6241 N  N   . ARG B 1 213 ? 48.730 28.090 169.780 1.00 15.00 ? 245 ARG B N   1 
ATOM   6242 C  CA  . ARG B 1 213 ? 47.880 26.930 169.800 1.00 15.00 ? 245 ARG B CA  1 
ATOM   6243 C  C   . ARG B 1 213 ? 47.300 26.590 168.450 1.00 15.00 ? 245 ARG B C   1 
ATOM   6244 O  O   . ARG B 1 213 ? 46.990 27.420 167.610 1.00 15.00 ? 245 ARG B O   1 
ATOM   6245 C  CB  . ARG B 1 213 ? 46.720 27.100 170.710 1.00 15.00 ? 245 ARG B CB  1 
ATOM   6246 C  CG  . ARG B 1 213 ? 47.150 26.950 172.130 1.00 15.00 ? 245 ARG B CG  1 
ATOM   6247 C  CD  . ARG B 1 213 ? 45.990 27.410 172.900 1.00 15.00 ? 245 ARG B CD  1 
ATOM   6248 N  NE  . ARG B 1 213 ? 44.930 26.440 172.970 1.00 15.00 ? 245 ARG B NE  1 
ATOM   6249 C  CZ  . ARG B 1 213 ? 43.870 26.670 173.730 1.00 15.00 ? 245 ARG B CZ  1 
ATOM   6250 N  NH1 . ARG B 1 213 ? 43.760 27.790 174.420 1.00 15.00 ? 245 ARG B NH1 1 
ATOM   6251 N  NH2 . ARG B 1 213 ? 42.920 25.760 173.820 1.00 15.00 ? 245 ARG B NH2 1 
ATOM   6252 N  N   . LEU B 1 214 ? 47.170 25.290 168.280 1.00 15.00 ? 246 LEU B N   1 
ATOM   6253 C  CA  . LEU B 1 214 ? 46.620 24.820 167.050 1.00 15.00 ? 246 LEU B CA  1 
ATOM   6254 C  C   . LEU B 1 214 ? 45.110 24.970 167.020 1.00 15.00 ? 246 LEU B C   1 
ATOM   6255 O  O   . LEU B 1 214 ? 44.510 25.250 165.990 1.00 15.00 ? 246 LEU B O   1 
ATOM   6256 C  CB  . LEU B 1 214 ? 46.960 23.380 166.870 1.00 15.00 ? 246 LEU B CB  1 
ATOM   6257 C  CG  . LEU B 1 214 ? 46.580 22.740 165.580 1.00 15.00 ? 246 LEU B CG  1 
ATOM   6258 C  CD1 . LEU B 1 214 ? 47.210 23.470 164.400 1.00 15.00 ? 246 LEU B CD1 1 
ATOM   6259 C  CD2 . LEU B 1 214 ? 47.030 21.300 165.600 1.00 15.00 ? 246 LEU B CD2 1 
ATOM   6260 N  N   . PHE B 1 215 ? 44.550 24.760 168.200 1.00 15.00 ? 247 PHE B N   1 
ATOM   6261 C  CA  . PHE B 1 215 ? 43.110 24.710 168.410 1.00 15.00 ? 247 PHE B CA  1 
ATOM   6262 C  C   . PHE B 1 215 ? 42.500 23.500 167.720 1.00 15.00 ? 247 PHE B C   1 
ATOM   6263 O  O   . PHE B 1 215 ? 41.380 23.500 167.210 1.00 15.00 ? 247 PHE B O   1 
ATOM   6264 C  CB  . PHE B 1 215 ? 42.410 25.980 167.900 1.00 15.00 ? 247 PHE B CB  1 
ATOM   6265 C  CG  . PHE B 1 215 ? 42.680 27.180 168.780 1.00 15.00 ? 247 PHE B CG  1 
ATOM   6266 C  CD1 . PHE B 1 215 ? 42.370 27.150 170.110 1.00 15.00 ? 247 PHE B CD1 1 
ATOM   6267 C  CD2 . PHE B 1 215 ? 43.290 28.280 168.230 1.00 15.00 ? 247 PHE B CD2 1 
ATOM   6268 C  CE1 . PHE B 1 215 ? 42.670 28.220 170.920 1.00 15.00 ? 247 PHE B CE1 1 
ATOM   6269 C  CE2 . PHE B 1 215 ? 43.580 29.340 169.040 1.00 15.00 ? 247 PHE B CE2 1 
ATOM   6270 C  CZ  . PHE B 1 215 ? 43.280 29.320 170.380 1.00 15.00 ? 247 PHE B CZ  1 
ATOM   6271 N  N   . LYS B 1 216 ? 43.210 22.360 167.810 1.00 15.00 ? 248 LYS B N   1 
ATOM   6272 C  CA  . LYS B 1 216 ? 42.730 21.060 167.350 1.00 15.00 ? 248 LYS B CA  1 
ATOM   6273 C  C   . LYS B 1 216 ? 43.340 20.070 168.330 1.00 15.00 ? 248 LYS B C   1 
ATOM   6274 O  O   . LYS B 1 216 ? 44.510 20.180 168.660 1.00 15.00 ? 248 LYS B O   1 
ATOM   6275 C  CB  . LYS B 1 216 ? 43.250 20.660 166.000 1.00 15.00 ? 248 LYS B CB  1 
ATOM   6276 C  CG  . LYS B 1 216 ? 42.450 21.110 164.810 1.00 15.00 ? 248 LYS B CG  1 
ATOM   6277 C  CD  . LYS B 1 216 ? 42.940 20.370 163.540 1.00 15.00 ? 248 LYS B CD  1 
ATOM   6278 C  CE  . LYS B 1 216 ? 42.540 18.870 163.450 1.00 15.00 ? 248 LYS B CE  1 
ATOM   6279 N  NZ  . LYS B 1 216 ? 43.180 17.970 164.420 1.00 15.00 ? 248 LYS B NZ  1 
ATOM   6280 N  N   . ASP B 1 217 ? 42.550 19.140 168.850 1.00 15.00 ? 249 ASP B N   1 
ATOM   6281 C  CA  . ASP B 1 217 ? 42.970 18.140 169.830 1.00 15.00 ? 249 ASP B CA  1 
ATOM   6282 C  C   . ASP B 1 217 ? 43.750 18.670 171.030 1.00 15.00 ? 249 ASP B C   1 
ATOM   6283 O  O   . ASP B 1 217 ? 44.440 17.890 171.690 1.00 15.00 ? 249 ASP B O   1 
ATOM   6284 C  CB  . ASP B 1 217 ? 43.810 17.080 169.140 1.00 15.00 ? 249 ASP B CB  1 
ATOM   6285 C  CG  . ASP B 1 217 ? 43.120 16.280 168.040 1.00 15.00 ? 249 ASP B CG  1 
ATOM   6286 O  OD1 . ASP B 1 217 ? 42.420 16.880 167.200 1.00 15.00 ? 249 ASP B OD1 1 
ATOM   6287 O  OD2 . ASP B 1 217 ? 43.300 15.060 168.010 1.00 15.00 ? 249 ASP B OD2 1 
ATOM   6288 N  N   . GLY B 1 218 ? 43.660 19.950 171.380 1.00 15.00 ? 250 GLY B N   1 
ATOM   6289 C  CA  . GLY B 1 218 ? 44.380 20.530 172.510 1.00 15.00 ? 250 GLY B CA  1 
ATOM   6290 C  C   . GLY B 1 218 ? 45.820 20.850 172.150 1.00 15.00 ? 250 GLY B C   1 
ATOM   6291 O  O   . GLY B 1 218 ? 46.640 21.260 172.970 1.00 15.00 ? 250 GLY B O   1 
ATOM   6292 N  N   . LYS B 1 219 ? 46.140 20.730 170.900 1.00 15.00 ? 251 LYS B N   1 
ATOM   6293 C  CA  . LYS B 1 219 ? 47.500 20.850 170.470 1.00 15.00 ? 251 LYS B CA  1 
ATOM   6294 C  C   . LYS B 1 219 ? 47.920 22.280 170.220 1.00 15.00 ? 251 LYS B C   1 
ATOM   6295 O  O   . LYS B 1 219 ? 47.140 23.230 170.100 1.00 15.00 ? 251 LYS B O   1 
ATOM   6296 C  CB  . LYS B 1 219 ? 47.630 19.910 169.260 1.00 15.00 ? 251 LYS B CB  1 
ATOM   6297 C  CG  . LYS B 1 219 ? 47.970 18.530 169.850 1.00 15.00 ? 251 LYS B CG  1 
ATOM   6298 C  CD  . LYS B 1 219 ? 47.430 17.210 169.300 1.00 15.00 ? 251 LYS B CD  1 
ATOM   6299 C  CE  . LYS B 1 219 ? 47.850 16.820 167.900 1.00 15.00 ? 251 LYS B CE  1 
ATOM   6300 N  NZ  . LYS B 1 219 ? 47.540 15.430 167.650 1.00 15.00 ? 251 LYS B NZ  1 
ATOM   6301 N  N   . LEU B 1 220 ? 49.260 22.280 170.220 1.00 15.00 ? 252 LEU B N   1 
ATOM   6302 C  CA  . LEU B 1 220 ? 50.160 23.400 170.040 1.00 15.00 ? 252 LEU B CA  1 
ATOM   6303 C  C   . LEU B 1 220 ? 50.570 23.390 168.580 1.00 15.00 ? 252 LEU B C   1 
ATOM   6304 O  O   . LEU B 1 220 ? 50.660 22.310 168.000 1.00 15.00 ? 252 LEU B O   1 
ATOM   6305 C  CB  . LEU B 1 220 ? 51.300 23.160 170.970 1.00 15.00 ? 252 LEU B CB  1 
ATOM   6306 C  CG  . LEU B 1 220 ? 51.830 24.180 171.900 1.00 15.00 ? 252 LEU B CG  1 
ATOM   6307 C  CD1 . LEU B 1 220 ? 50.740 24.960 172.570 1.00 15.00 ? 252 LEU B CD1 1 
ATOM   6308 C  CD2 . LEU B 1 220 ? 52.630 23.430 172.920 1.00 15.00 ? 252 LEU B CD2 1 
ATOM   6309 N  N   . LYS B 1 221 ? 50.820 24.520 167.940 1.00 15.00 ? 253 LYS B N   1 
ATOM   6310 C  CA  . LYS B 1 221 ? 51.160 24.560 166.520 1.00 15.00 ? 253 LYS B CA  1 
ATOM   6311 C  C   . LYS B 1 221 ? 52.560 24.040 166.350 1.00 15.00 ? 253 LYS B C   1 
ATOM   6312 O  O   . LYS B 1 221 ? 53.330 24.030 167.330 1.00 15.00 ? 253 LYS B O   1 
ATOM   6313 C  CB  . LYS B 1 221 ? 51.120 25.960 165.990 1.00 15.00 ? 253 LYS B CB  1 
ATOM   6314 C  CG  . LYS B 1 221 ? 49.790 26.620 165.670 1.00 15.00 ? 253 LYS B CG  1 
ATOM   6315 C  CD  . LYS B 1 221 ? 50.110 28.120 165.670 1.00 15.00 ? 253 LYS B CD  1 
ATOM   6316 C  CE  . LYS B 1 221 ? 49.000 28.980 165.120 1.00 15.00 ? 253 LYS B CE  1 
ATOM   6317 N  NZ  . LYS B 1 221 ? 48.950 28.810 163.690 1.00 15.00 ? 253 LYS B NZ  1 
ATOM   6318 N  N   . TYR B 1 222 ? 52.940 23.600 165.160 1.00 15.00 ? 254 TYR B N   1 
ATOM   6319 C  CA  . TYR B 1 222 ? 54.300 23.170 164.900 1.00 15.00 ? 254 TYR B CA  1 
ATOM   6320 C  C   . TYR B 1 222 ? 54.520 23.160 163.410 1.00 15.00 ? 254 TYR B C   1 
ATOM   6321 O  O   . TYR B 1 222 ? 53.600 23.490 162.650 1.00 15.00 ? 254 TYR B O   1 
ATOM   6322 C  CB  . TYR B 1 222 ? 54.590 21.770 165.410 1.00 15.00 ? 254 TYR B CB  1 
ATOM   6323 C  CG  . TYR B 1 222 ? 53.630 20.720 164.950 1.00 15.00 ? 254 TYR B CG  1 
ATOM   6324 C  CD1 . TYR B 1 222 ? 53.730 20.130 163.700 1.00 15.00 ? 254 TYR B CD1 1 
ATOM   6325 C  CD2 . TYR B 1 222 ? 52.640 20.340 165.810 1.00 15.00 ? 254 TYR B CD2 1 
ATOM   6326 C  CE1 . TYR B 1 222 ? 52.830 19.170 163.330 1.00 15.00 ? 254 TYR B CE1 1 
ATOM   6327 C  CE2 . TYR B 1 222 ? 51.730 19.360 165.460 1.00 15.00 ? 254 TYR B CE2 1 
ATOM   6328 C  CZ  . TYR B 1 222 ? 51.820 18.780 164.220 1.00 15.00 ? 254 TYR B CZ  1 
ATOM   6329 O  OH  . TYR B 1 222 ? 50.910 17.780 163.880 1.00 15.00 ? 254 TYR B OH  1 
ATOM   6330 N  N   . GLN B 1 223 ? 55.750 22.770 163.040 1.00 15.00 ? 255 GLN B N   1 
ATOM   6331 C  CA  . GLN B 1 223 ? 56.170 22.640 161.670 1.00 15.00 ? 255 GLN B CA  1 
ATOM   6332 C  C   . GLN B 1 223 ? 56.950 21.330 161.590 1.00 15.00 ? 255 GLN B C   1 
ATOM   6333 O  O   . GLN B 1 223 ? 57.400 20.780 162.610 1.00 15.00 ? 255 GLN B O   1 
ATOM   6334 C  CB  . GLN B 1 223 ? 57.070 23.810 161.260 1.00 15.00 ? 255 GLN B CB  1 
ATOM   6335 C  CG  . GLN B 1 223 ? 58.480 23.890 161.820 1.00 15.00 ? 255 GLN B CG  1 
ATOM   6336 C  CD  . GLN B 1 223 ? 59.180 25.120 161.230 1.00 15.00 ? 255 GLN B CD  1 
ATOM   6337 O  OE1 . GLN B 1 223 ? 59.460 25.160 160.040 1.00 15.00 ? 255 GLN B OE1 1 
ATOM   6338 N  NE2 . GLN B 1 223 ? 59.480 26.140 162.020 1.00 15.00 ? 255 GLN B NE2 1 
ATOM   6339 N  N   . MET B 1 224 ? 57.090 20.820 160.380 1.00 15.00 ? 256 MET B N   1 
ATOM   6340 C  CA  . MET B 1 224 ? 57.700 19.520 160.140 1.00 15.00 ? 256 MET B CA  1 
ATOM   6341 C  C   . MET B 1 224 ? 58.920 19.700 159.240 1.00 15.00 ? 256 MET B C   1 
ATOM   6342 O  O   . MET B 1 224 ? 58.790 20.030 158.050 1.00 15.00 ? 256 MET B O   1 
ATOM   6343 C  CB  . MET B 1 224 ? 56.690 18.600 159.490 1.00 15.00 ? 256 MET B CB  1 
ATOM   6344 C  CG  . MET B 1 224 ? 57.020 17.160 159.780 1.00 15.00 ? 256 MET B CG  1 
ATOM   6345 S  SD  . MET B 1 224 ? 56.100 16.720 161.260 1.00 15.00 ? 256 MET B SD  1 
ATOM   6346 C  CE  . MET B 1 224 ? 55.960 14.970 160.990 1.00 15.00 ? 256 MET B CE  1 
ATOM   6347 N  N   . LEU B 1 225 ? 60.110 19.530 159.830 1.00 15.00 ? 257 LEU B N   1 
ATOM   6348 C  CA  . LEU B 1 225 ? 61.340 19.700 159.100 1.00 15.00 ? 257 LEU B CA  1 
ATOM   6349 C  C   . LEU B 1 225 ? 62.070 18.390 159.140 1.00 15.00 ? 257 LEU B C   1 
ATOM   6350 O  O   . LEU B 1 225 ? 62.250 17.760 160.210 1.00 15.00 ? 257 LEU B O   1 
ATOM   6351 C  CB  . LEU B 1 225 ? 62.150 20.810 159.750 1.00 15.00 ? 257 LEU B CB  1 
ATOM   6352 C  CG  . LEU B 1 225 ? 62.130 22.190 159.080 1.00 15.00 ? 257 LEU B CG  1 
ATOM   6353 C  CD1 . LEU B 1 225 ? 60.740 22.610 158.680 1.00 15.00 ? 257 LEU B CD1 1 
ATOM   6354 C  CD2 . LEU B 1 225 ? 62.660 23.170 160.090 1.00 15.00 ? 257 LEU B CD2 1 
ATOM   6355 N  N   . ASN B 1 226 ? 62.490 17.980 157.940 1.00 15.00 ? 258 ASN B N   1 
ATOM   6356 C  CA  . ASN B 1 226 ? 63.120 16.690 157.690 1.00 15.00 ? 258 ASN B CA  1 
ATOM   6357 C  C   . ASN B 1 226 ? 62.130 15.660 158.260 1.00 15.00 ? 258 ASN B C   1 
ATOM   6358 O  O   . ASN B 1 226 ? 60.960 15.730 157.910 1.00 15.00 ? 258 ASN B O   1 
ATOM   6359 C  CB  . ASN B 1 226 ? 64.500 16.600 158.380 1.00 15.00 ? 258 ASN B CB  1 
ATOM   6360 C  CG  . ASN B 1 226 ? 65.520 17.610 157.820 1.00 15.00 ? 258 ASN B CG  1 
ATOM   6361 O  OD1 . ASN B 1 226 ? 65.510 17.960 156.630 1.00 15.00 ? 258 ASN B OD1 1 
ATOM   6362 N  ND2 . ASN B 1 226 ? 66.430 18.140 158.650 1.00 15.00 ? 258 ASN B ND2 1 
ATOM   6363 N  N   . GLY B 1 227 ? 62.470 14.740 159.140 1.00 15.00 ? 259 GLY B N   1 
ATOM   6364 C  CA  . GLY B 1 227 ? 61.430 13.850 159.640 1.00 15.00 ? 259 GLY B CA  1 
ATOM   6365 C  C   . GLY B 1 227 ? 60.660 14.480 160.770 1.00 15.00 ? 259 GLY B C   1 
ATOM   6366 O  O   . GLY B 1 227 ? 59.450 14.250 160.900 1.00 15.00 ? 259 GLY B O   1 
ATOM   6367 N  N   . GLU B 1 228 ? 61.270 15.350 161.560 1.00 15.00 ? 260 GLU B N   1 
ATOM   6368 C  CA  . GLU B 1 228 ? 60.620 15.680 162.800 1.00 15.00 ? 260 GLU B CA  1 
ATOM   6369 C  C   . GLU B 1 228 ? 59.780 16.950 162.960 1.00 15.00 ? 260 GLU B C   1 
ATOM   6370 O  O   . GLU B 1 228 ? 59.720 17.850 162.120 1.00 15.00 ? 260 GLU B O   1 
ATOM   6371 C  CB  . GLU B 1 228 ? 61.690 15.600 163.850 1.00 15.00 ? 260 GLU B CB  1 
ATOM   6372 C  CG  . GLU B 1 228 ? 61.960 14.130 164.170 1.00 15.00 ? 260 GLU B CG  1 
ATOM   6373 C  CD  . GLU B 1 228 ? 63.450 13.850 164.230 1.00 15.00 ? 260 GLU B CD  1 
ATOM   6374 O  OE1 . GLU B 1 228 ? 64.080 14.120 165.260 1.00 15.00 ? 260 GLU B OE1 1 
ATOM   6375 O  OE2 . GLU B 1 228 ? 63.970 13.390 163.210 1.00 15.00 ? 260 GLU B OE2 1 
ATOM   6376 N  N   . VAL B 1 229 ? 59.190 16.920 164.150 1.00 15.00 ? 261 VAL B N   1 
ATOM   6377 C  CA  . VAL B 1 229 ? 58.270 17.930 164.650 1.00 15.00 ? 261 VAL B CA  1 
ATOM   6378 C  C   . VAL B 1 229 ? 59.110 19.030 165.260 1.00 15.00 ? 261 VAL B C   1 
ATOM   6379 O  O   . VAL B 1 229 ? 59.810 18.740 166.240 1.00 15.00 ? 261 VAL B O   1 
ATOM   6380 C  CB  . VAL B 1 229 ? 57.340 17.320 165.750 1.00 15.00 ? 261 VAL B CB  1 
ATOM   6381 C  CG1 . VAL B 1 229 ? 56.010 18.030 165.680 1.00 15.00 ? 261 VAL B CG1 1 
ATOM   6382 C  CG2 . VAL B 1 229 ? 57.160 15.790 165.600 1.00 15.00 ? 261 VAL B CG2 1 
ATOM   6383 N  N   . TYR B 1 230 ? 59.160 20.240 164.750 1.00 15.00 ? 262 TYR B N   1 
ATOM   6384 C  CA  . TYR B 1 230 ? 59.940 21.310 165.350 1.00 15.00 ? 262 TYR B CA  1 
ATOM   6385 C  C   . TYR B 1 230 ? 58.980 22.470 165.610 1.00 15.00 ? 262 TYR B C   1 
ATOM   6386 O  O   . TYR B 1 230 ? 57.930 22.490 164.970 1.00 15.00 ? 262 TYR B O   1 
ATOM   6387 C  CB  . TYR B 1 230 ? 61.050 21.720 164.380 1.00 15.00 ? 262 TYR B CB  1 
ATOM   6388 C  CG  . TYR B 1 230 ? 62.190 20.720 164.420 1.00 15.00 ? 262 TYR B CG  1 
ATOM   6389 C  CD1 . TYR B 1 230 ? 62.970 20.670 165.550 1.00 15.00 ? 262 TYR B CD1 1 
ATOM   6390 C  CD2 . TYR B 1 230 ? 62.400 19.820 163.400 1.00 15.00 ? 262 TYR B CD2 1 
ATOM   6391 C  CE1 . TYR B 1 230 ? 63.940 19.710 165.680 1.00 15.00 ? 262 TYR B CE1 1 
ATOM   6392 C  CE2 . TYR B 1 230 ? 63.380 18.860 163.530 1.00 15.00 ? 262 TYR B CE2 1 
ATOM   6393 C  CZ  . TYR B 1 230 ? 64.130 18.800 164.670 1.00 15.00 ? 262 TYR B CZ  1 
ATOM   6394 O  OH  . TYR B 1 230 ? 65.060 17.790 164.880 1.00 15.00 ? 262 TYR B OH  1 
ATOM   6395 N  N   . PRO B 1 231 ? 59.170 23.430 166.510 1.00 15.00 ? 263 PRO B N   1 
ATOM   6396 C  CA  . PRO B 1 231 ? 58.260 24.560 166.760 1.00 15.00 ? 263 PRO B CA  1 
ATOM   6397 C  C   . PRO B 1 231 ? 57.780 25.240 165.500 1.00 15.00 ? 263 PRO B C   1 
ATOM   6398 O  O   . PRO B 1 231 ? 58.500 25.200 164.520 1.00 15.00 ? 263 PRO B O   1 
ATOM   6399 C  CB  . PRO B 1 231 ? 59.050 25.450 167.660 1.00 15.00 ? 263 PRO B CB  1 
ATOM   6400 C  CG  . PRO B 1 231 ? 59.810 24.460 168.490 1.00 15.00 ? 263 PRO B CG  1 
ATOM   6401 C  CD  . PRO B 1 231 ? 60.290 23.480 167.430 1.00 15.00 ? 263 PRO B CD  1 
ATOM   6402 N  N   . PRO B 1 232 ? 56.630 25.910 165.370 1.00 15.00 ? 264 PRO B N   1 
ATOM   6403 C  CA  . PRO B 1 232 ? 56.220 26.550 164.150 1.00 15.00 ? 264 PRO B CA  1 
ATOM   6404 C  C   . PRO B 1 232 ? 57.140 27.720 163.830 1.00 15.00 ? 264 PRO B C   1 
ATOM   6405 O  O   . PRO B 1 232 ? 57.960 28.120 164.660 1.00 15.00 ? 264 PRO B O   1 
ATOM   6406 C  CB  . PRO B 1 232 ? 54.800 26.950 164.410 1.00 15.00 ? 264 PRO B CB  1 
ATOM   6407 C  CG  . PRO B 1 232 ? 54.810 27.290 165.870 1.00 15.00 ? 264 PRO B CG  1 
ATOM   6408 C  CD  . PRO B 1 232 ? 55.700 26.210 166.450 1.00 15.00 ? 264 PRO B CD  1 
ATOM   6409 N  N   . SER B 1 233 ? 57.050 28.270 162.630 1.00 15.00 ? 265 SER B N   1 
ATOM   6410 C  CA  . SER B 1 233 ? 57.850 29.430 162.310 1.00 15.00 ? 265 SER B CA  1 
ATOM   6411 C  C   . SER B 1 233 ? 57.110 30.690 162.750 1.00 15.00 ? 265 SER B C   1 
ATOM   6412 O  O   . SER B 1 233 ? 55.880 30.630 162.850 1.00 15.00 ? 265 SER B O   1 
ATOM   6413 C  CB  . SER B 1 233 ? 58.060 29.470 160.820 1.00 15.00 ? 265 SER B CB  1 
ATOM   6414 O  OG  . SER B 1 233 ? 56.760 29.370 160.230 1.00 15.00 ? 265 SER B OG  1 
ATOM   6415 N  N   . VAL B 1 234 ? 57.760 31.830 162.930 1.00 15.00 ? 266 VAL B N   1 
ATOM   6416 C  CA  . VAL B 1 234 ? 57.070 33.100 163.260 1.00 15.00 ? 266 VAL B CA  1 
ATOM   6417 C  C   . VAL B 1 234 ? 56.120 33.510 162.130 1.00 15.00 ? 266 VAL B C   1 
ATOM   6418 O  O   . VAL B 1 234 ? 55.240 34.350 162.240 1.00 15.00 ? 266 VAL B O   1 
ATOM   6419 C  CB  . VAL B 1 234 ? 58.170 34.170 163.540 1.00 15.00 ? 266 VAL B CB  1 
ATOM   6420 C  CG1 . VAL B 1 234 ? 57.650 35.580 163.730 1.00 15.00 ? 266 VAL B CG1 1 
ATOM   6421 C  CG2 . VAL B 1 234 ? 58.790 33.790 164.860 1.00 15.00 ? 266 VAL B CG2 1 
ATOM   6422 N  N   . GLU B 1 235 ? 56.330 32.820 161.000 1.00 15.00 ? 267 GLU B N   1 
ATOM   6423 C  CA  . GLU B 1 235 ? 55.460 32.860 159.840 1.00 15.00 ? 267 GLU B CA  1 
ATOM   6424 C  C   . GLU B 1 235 ? 54.070 32.290 160.150 1.00 15.00 ? 267 GLU B C   1 
ATOM   6425 O  O   . GLU B 1 235 ? 53.030 32.850 159.810 1.00 15.00 ? 267 GLU B O   1 
ATOM   6426 C  CB  . GLU B 1 235 ? 56.140 32.030 158.760 1.00 15.00 ? 267 GLU B CB  1 
ATOM   6427 C  CG  . GLU B 1 235 ? 56.500 32.760 157.470 1.00 15.00 ? 267 GLU B CG  1 
ATOM   6428 C  CD  . GLU B 1 235 ? 55.310 33.050 156.570 1.00 15.00 ? 267 GLU B CD  1 
ATOM   6429 O  OE1 . GLU B 1 235 ? 54.700 32.080 156.060 1.00 15.00 ? 267 GLU B OE1 1 
ATOM   6430 O  OE2 . GLU B 1 235 ? 55.020 34.240 156.380 1.00 15.00 ? 267 GLU B OE2 1 
ATOM   6431 N  N   . GLU B 1 236 ? 54.040 31.130 160.810 1.00 15.00 ? 268 GLU B N   1 
ATOM   6432 C  CA  . GLU B 1 236 ? 52.790 30.490 161.160 1.00 15.00 ? 268 GLU B CA  1 
ATOM   6433 C  C   . GLU B 1 236 ? 52.220 30.910 162.510 1.00 15.00 ? 268 GLU B C   1 
ATOM   6434 O  O   . GLU B 1 236 ? 51.060 30.630 162.780 1.00 15.00 ? 268 GLU B O   1 
ATOM   6435 C  CB  . GLU B 1 236 ? 52.990 28.970 161.160 1.00 15.00 ? 268 GLU B CB  1 
ATOM   6436 C  CG  . GLU B 1 236 ? 53.280 28.380 159.760 1.00 15.00 ? 268 GLU B CG  1 
ATOM   6437 C  CD  . GLU B 1 236 ? 52.220 28.710 158.670 1.00 15.00 ? 268 GLU B CD  1 
ATOM   6438 O  OE1 . GLU B 1 236 ? 51.040 28.330 158.840 1.00 15.00 ? 268 GLU B OE1 1 
ATOM   6439 O  OE2 . GLU B 1 236 ? 52.590 29.340 157.650 1.00 15.00 ? 268 GLU B OE2 1 
ATOM   6440 N  N   . ALA B 1 237 ? 53.010 31.520 163.380 1.00 15.00 ? 269 ALA B N   1 
ATOM   6441 C  CA  . ALA B 1 237 ? 52.500 32.010 164.650 1.00 15.00 ? 269 ALA B CA  1 
ATOM   6442 C  C   . ALA B 1 237 ? 53.240 33.320 164.870 1.00 15.00 ? 269 ALA B C   1 
ATOM   6443 O  O   . ALA B 1 237 ? 54.380 33.280 165.330 1.00 15.00 ? 269 ALA B O   1 
ATOM   6444 C  CB  . ALA B 1 237 ? 52.860 31.000 165.750 1.00 15.00 ? 269 ALA B CB  1 
ATOM   6445 N  N   . PRO B 1 238 ? 52.680 34.480 164.550 1.00 15.00 ? 270 PRO B N   1 
ATOM   6446 C  CA  . PRO B 1 238 ? 53.250 35.820 164.770 1.00 15.00 ? 270 PRO B CA  1 
ATOM   6447 C  C   . PRO B 1 238 ? 54.000 36.090 166.050 1.00 15.00 ? 270 PRO B C   1 
ATOM   6448 O  O   . PRO B 1 238 ? 55.110 36.640 166.070 1.00 15.00 ? 270 PRO B O   1 
ATOM   6449 C  CB  . PRO B 1 238 ? 52.080 36.720 164.600 1.00 15.00 ? 270 PRO B CB  1 
ATOM   6450 C  CG  . PRO B 1 238 ? 51.570 36.090 163.320 1.00 15.00 ? 270 PRO B CG  1 
ATOM   6451 C  CD  . PRO B 1 238 ? 51.580 34.600 163.630 1.00 15.00 ? 270 PRO B CD  1 
ATOM   6452 N  N   . VAL B 1 239 ? 53.320 35.750 167.140 1.00 15.00 ? 271 VAL B N   1 
ATOM   6453 C  CA  . VAL B 1 239 ? 53.870 35.750 168.490 1.00 15.00 ? 271 VAL B CA  1 
ATOM   6454 C  C   . VAL B 1 239 ? 54.930 36.780 168.980 1.00 15.00 ? 271 VAL B C   1 
ATOM   6455 O  O   . VAL B 1 239 ? 54.680 37.350 170.040 1.00 15.00 ? 271 VAL B O   1 
ATOM   6456 C  CB  . VAL B 1 239 ? 54.260 34.260 168.600 1.00 15.00 ? 271 VAL B CB  1 
ATOM   6457 C  CG1 . VAL B 1 239 ? 55.720 34.000 168.330 1.00 15.00 ? 271 VAL B CG1 1 
ATOM   6458 C  CG2 . VAL B 1 239 ? 53.770 33.830 169.950 1.00 15.00 ? 271 VAL B CG2 1 
ATOM   6459 N  N   . LEU B 1 240 ? 56.070 37.020 168.340 1.00 15.00 ? 272 LEU B N   1 
ATOM   6460 C  CA  . LEU B 1 240 ? 57.110 38.020 168.580 1.00 15.00 ? 272 LEU B CA  1 
ATOM   6461 C  C   . LEU B 1 240 ? 58.480 37.390 168.420 1.00 15.00 ? 272 LEU B C   1 
ATOM   6462 O  O   . LEU B 1 240 ? 58.940 37.390 167.260 1.00 15.00 ? 272 LEU B O   1 
ATOM   6463 C  CB  . LEU B 1 240 ? 57.160 38.660 169.960 1.00 15.00 ? 272 LEU B CB  1 
ATOM   6464 C  CG  . LEU B 1 240 ? 58.160 39.810 169.950 1.00 15.00 ? 272 LEU B CG  1 
ATOM   6465 C  CD1 . LEU B 1 240 ? 57.660 40.920 169.030 1.00 15.00 ? 272 LEU B CD1 1 
ATOM   6466 C  CD2 . LEU B 1 240 ? 58.370 40.290 171.360 1.00 15.00 ? 272 LEU B CD2 1 
ATOM   6467 N  N   . MET B 1 241 ? 59.110 36.810 169.460 1.00 15.00 ? 273 MET B N   1 
ATOM   6468 C  CA  . MET B 1 241 ? 60.490 36.330 169.390 1.00 15.00 ? 273 MET B CA  1 
ATOM   6469 C  C   . MET B 1 241 ? 61.540 37.440 169.210 1.00 15.00 ? 273 MET B C   1 
ATOM   6470 O  O   . MET B 1 241 ? 61.420 38.370 168.420 1.00 15.00 ? 273 MET B O   1 
ATOM   6471 C  CB  . MET B 1 241 ? 60.700 35.330 168.250 1.00 15.00 ? 273 MET B CB  1 
ATOM   6472 C  CG  . MET B 1 241 ? 59.880 34.090 168.390 1.00 15.00 ? 273 MET B CG  1 
ATOM   6473 S  SD  . MET B 1 241 ? 60.480 33.220 169.840 1.00 15.00 ? 273 MET B SD  1 
ATOM   6474 C  CE  . MET B 1 241 ? 59.050 33.350 170.860 1.00 15.00 ? 273 MET B CE  1 
ATOM   6475 N  N   . HIS B 1 242 ? 62.590 37.360 170.020 1.00 15.00 ? 274 HIS B N   1 
ATOM   6476 C  CA  . HIS B 1 242 ? 63.700 38.280 169.900 1.00 15.00 ? 274 HIS B CA  1 
ATOM   6477 C  C   . HIS B 1 242 ? 64.660 37.560 168.980 1.00 15.00 ? 274 HIS B C   1 
ATOM   6478 O  O   . HIS B 1 242 ? 65.060 36.440 169.280 1.00 15.00 ? 274 HIS B O   1 
ATOM   6479 C  CB  . HIS B 1 242 ? 64.380 38.490 171.220 1.00 15.00 ? 274 HIS B CB  1 
ATOM   6480 C  CG  . HIS B 1 242 ? 63.560 39.450 172.020 1.00 15.00 ? 274 HIS B CG  1 
ATOM   6481 N  ND1 . HIS B 1 242 ? 63.040 39.190 173.300 1.00 15.00 ? 274 HIS B ND1 1 
ATOM   6482 C  CD2 . HIS B 1 242 ? 63.190 40.720 171.550 1.00 15.00 ? 274 HIS B CD2 1 
ATOM   6483 C  CE1 . HIS B 1 242 ? 62.350 40.330 173.600 1.00 15.00 ? 274 HIS B CE1 1 
ATOM   6484 N  NE2 . HIS B 1 242 ? 62.430 41.200 172.620 1.00 15.00 ? 274 HIS B NE2 1 
ATOM   6485 N  N   . TYR B 1 243 ? 64.990 38.110 167.830 1.00 15.00 ? 275 TYR B N   1 
ATOM   6486 C  CA  . TYR B 1 243 ? 65.950 37.490 166.940 1.00 15.00 ? 275 TYR B CA  1 
ATOM   6487 C  C   . TYR B 1 243 ? 66.800 38.650 166.450 1.00 15.00 ? 275 TYR B C   1 
ATOM   6488 O  O   . TYR B 1 243 ? 66.290 39.770 166.370 1.00 15.00 ? 275 TYR B O   1 
ATOM   6489 C  CB  . TYR B 1 243 ? 65.260 36.810 165.770 1.00 15.00 ? 275 TYR B CB  1 
ATOM   6490 C  CG  . TYR B 1 243 ? 65.070 35.310 165.970 1.00 15.00 ? 275 TYR B CG  1 
ATOM   6491 C  CD1 . TYR B 1 243 ? 66.090 34.450 165.640 1.00 15.00 ? 275 TYR B CD1 1 
ATOM   6492 C  CD2 . TYR B 1 243 ? 63.890 34.780 166.430 1.00 15.00 ? 275 TYR B CD2 1 
ATOM   6493 C  CE1 . TYR B 1 243 ? 65.930 33.090 165.750 1.00 15.00 ? 275 TYR B CE1 1 
ATOM   6494 C  CE2 . TYR B 1 243 ? 63.710 33.410 166.540 1.00 15.00 ? 275 TYR B CE2 1 
ATOM   6495 C  CZ  . TYR B 1 243 ? 64.740 32.570 166.200 1.00 15.00 ? 275 TYR B CZ  1 
ATOM   6496 O  OH  . TYR B 1 243 ? 64.570 31.190 166.220 1.00 15.00 ? 275 TYR B OH  1 
ATOM   6497 N  N   . PRO B 1 244 ? 68.100 38.490 166.200 1.00 15.00 ? 276 PRO B N   1 
ATOM   6498 C  CA  . PRO B 1 244 ? 68.950 39.550 165.720 1.00 15.00 ? 276 PRO B CA  1 
ATOM   6499 C  C   . PRO B 1 244 ? 68.420 39.980 164.370 1.00 15.00 ? 276 PRO B C   1 
ATOM   6500 O  O   . PRO B 1 244 ? 68.080 39.190 163.480 1.00 15.00 ? 276 PRO B O   1 
ATOM   6501 C  CB  . PRO B 1 244 ? 70.310 38.940 165.630 1.00 15.00 ? 276 PRO B CB  1 
ATOM   6502 C  CG  . PRO B 1 244 ? 69.990 37.490 165.320 1.00 15.00 ? 276 PRO B CG  1 
ATOM   6503 C  CD  . PRO B 1 244 ? 68.830 37.240 166.280 1.00 15.00 ? 276 PRO B CD  1 
ATOM   6504 N  N   . ARG B 1 245 ? 68.170 41.290 164.450 1.00 15.00 ? 277 ARG B N   1 
ATOM   6505 C  CA  . ARG B 1 245 ? 67.690 42.120 163.370 1.00 15.00 ? 277 ARG B CA  1 
ATOM   6506 C  C   . ARG B 1 245 ? 68.140 41.580 162.030 1.00 15.00 ? 277 ARG B C   1 
ATOM   6507 O  O   . ARG B 1 245 ? 69.310 41.270 161.860 1.00 15.00 ? 277 ARG B O   1 
ATOM   6508 C  CB  . ARG B 1 245 ? 68.220 43.510 163.650 1.00 15.00 ? 277 ARG B CB  1 
ATOM   6509 C  CG  . ARG B 1 245 ? 67.760 44.740 162.880 1.00 15.00 ? 277 ARG B CG  1 
ATOM   6510 C  CD  . ARG B 1 245 ? 66.290 45.050 163.180 1.00 15.00 ? 277 ARG B CD  1 
ATOM   6511 N  NE  . ARG B 1 245 ? 65.390 44.380 162.250 1.00 15.00 ? 277 ARG B NE  1 
ATOM   6512 C  CZ  . ARG B 1 245 ? 64.430 45.050 161.570 1.00 15.00 ? 277 ARG B CZ  1 
ATOM   6513 N  NH1 . ARG B 1 245 ? 64.250 46.380 161.740 1.00 15.00 ? 277 ARG B NH1 1 
ATOM   6514 N  NH2 . ARG B 1 245 ? 63.670 44.390 160.680 1.00 15.00 ? 277 ARG B NH2 1 
ATOM   6515 N  N   . GLY B 1 246 ? 67.240 41.360 161.080 1.00 15.00 ? 278 GLY B N   1 
ATOM   6516 C  CA  . GLY B 1 246 ? 67.720 40.880 159.800 1.00 15.00 ? 278 GLY B CA  1 
ATOM   6517 C  C   . GLY B 1 246 ? 67.520 39.380 159.660 1.00 15.00 ? 278 GLY B C   1 
ATOM   6518 O  O   . GLY B 1 246 ? 67.700 38.840 158.570 1.00 15.00 ? 278 GLY B O   1 
ATOM   6519 N  N   . ILE B 1 247 ? 67.200 38.670 160.750 1.00 15.00 ? 279 ILE B N   1 
ATOM   6520 C  CA  . ILE B 1 247 ? 66.770 37.290 160.600 1.00 15.00 ? 279 ILE B CA  1 
ATOM   6521 C  C   . ILE B 1 247 ? 65.280 37.360 160.230 1.00 15.00 ? 279 ILE B C   1 
ATOM   6522 O  O   . ILE B 1 247 ? 64.540 38.290 160.610 1.00 15.00 ? 279 ILE B O   1 
ATOM   6523 C  CB  . ILE B 1 247 ? 67.010 36.500 161.890 1.00 15.00 ? 279 ILE B CB  1 
ATOM   6524 C  CG1 . ILE B 1 247 ? 68.510 36.430 162.120 1.00 15.00 ? 279 ILE B CG1 1 
ATOM   6525 C  CG2 . ILE B 1 247 ? 66.470 35.080 161.810 1.00 15.00 ? 279 ILE B CG2 1 
ATOM   6526 C  CD1 . ILE B 1 247 ? 69.310 36.090 160.840 1.00 15.00 ? 279 ILE B CD1 1 
ATOM   6527 N  N   . PRO B 1 248 ? 64.910 36.470 159.300 1.00 15.00 ? 280 PRO B N   1 
ATOM   6528 C  CA  . PRO B 1 248 ? 63.580 36.460 158.710 1.00 15.00 ? 280 PRO B CA  1 
ATOM   6529 C  C   . PRO B 1 248 ? 62.590 35.500 159.370 1.00 15.00 ? 280 PRO B C   1 
ATOM   6530 O  O   . PRO B 1 248 ? 62.940 34.350 159.740 1.00 15.00 ? 280 PRO B O   1 
ATOM   6531 C  CB  . PRO B 1 248 ? 63.850 36.140 157.250 1.00 15.00 ? 280 PRO B CB  1 
ATOM   6532 C  CG  . PRO B 1 248 ? 64.970 35.110 157.360 1.00 15.00 ? 280 PRO B CG  1 
ATOM   6533 C  CD  . PRO B 1 248 ? 65.850 35.690 158.460 1.00 15.00 ? 280 PRO B CD  1 
ATOM   6534 N  N   . PRO B 1 249 ? 61.320 35.920 159.410 1.00 15.00 ? 281 PRO B N   1 
ATOM   6535 C  CA  . PRO B 1 249 ? 60.230 35.210 160.100 1.00 15.00 ? 281 PRO B CA  1 
ATOM   6536 C  C   . PRO B 1 249 ? 60.220 33.690 159.990 1.00 15.00 ? 281 PRO B C   1 
ATOM   6537 O  O   . PRO B 1 249 ? 60.040 32.930 160.950 1.00 15.00 ? 281 PRO B O   1 
ATOM   6538 C  CB  . PRO B 1 249 ? 58.990 35.870 159.530 1.00 15.00 ? 281 PRO B CB  1 
ATOM   6539 C  CG  . PRO B 1 249 ? 59.420 37.300 159.360 1.00 15.00 ? 281 PRO B CG  1 
ATOM   6540 C  CD  . PRO B 1 249 ? 60.840 37.160 158.810 1.00 15.00 ? 281 PRO B CD  1 
ATOM   6541 N  N   . GLN B 1 250 ? 60.510 33.270 158.770 1.00 15.00 ? 282 GLN B N   1 
ATOM   6542 C  CA  . GLN B 1 250 ? 60.450 31.920 158.310 1.00 15.00 ? 282 GLN B CA  1 
ATOM   6543 C  C   . GLN B 1 250 ? 61.490 31.090 158.990 1.00 15.00 ? 282 GLN B C   1 
ATOM   6544 O  O   . GLN B 1 250 ? 61.230 29.930 159.340 1.00 15.00 ? 282 GLN B O   1 
ATOM   6545 C  CB  . GLN B 1 250 ? 60.730 31.850 156.830 1.00 15.00 ? 282 GLN B CB  1 
ATOM   6546 C  CG  . GLN B 1 250 ? 59.890 32.860 156.010 1.00 15.00 ? 282 GLN B CG  1 
ATOM   6547 C  CD  . GLN B 1 250 ? 60.560 34.240 155.790 1.00 15.00 ? 282 GLN B CD  1 
ATOM   6548 O  OE1 . GLN B 1 250 ? 60.970 34.950 156.720 1.00 15.00 ? 282 GLN B OE1 1 
ATOM   6549 N  NE2 . GLN B 1 250 ? 60.690 34.660 154.520 1.00 15.00 ? 282 GLN B NE2 1 
ATOM   6550 N  N   . SER B 1 251 ? 62.630 31.720 159.180 1.00 15.00 ? 283 SER B N   1 
ATOM   6551 C  CA  . SER B 1 251 ? 63.750 31.040 159.800 1.00 15.00 ? 283 SER B CA  1 
ATOM   6552 C  C   . SER B 1 251 ? 63.740 31.150 161.300 1.00 15.00 ? 283 SER B C   1 
ATOM   6553 O  O   . SER B 1 251 ? 64.570 30.570 162.000 1.00 15.00 ? 283 SER B O   1 
ATOM   6554 C  CB  . SER B 1 251 ? 65.000 31.630 159.210 1.00 15.00 ? 283 SER B CB  1 
ATOM   6555 O  OG  . SER B 1 251 ? 64.840 31.720 157.800 1.00 15.00 ? 283 SER B OG  1 
ATOM   6556 N  N   . GLN B 1 252 ? 62.790 31.920 161.800 1.00 15.00 ? 284 GLN B N   1 
ATOM   6557 C  CA  . GLN B 1 252 ? 62.650 32.070 163.230 1.00 15.00 ? 284 GLN B CA  1 
ATOM   6558 C  C   . GLN B 1 252 ? 61.680 31.010 163.740 1.00 15.00 ? 284 GLN B C   1 
ATOM   6559 O  O   . GLN B 1 252 ? 60.770 30.630 162.990 1.00 15.00 ? 284 GLN B O   1 
ATOM   6560 C  CB  . GLN B 1 252 ? 62.130 33.450 163.500 1.00 15.00 ? 284 GLN B CB  1 
ATOM   6561 C  CG  . GLN B 1 252 ? 63.120 34.490 163.040 1.00 15.00 ? 284 GLN B CG  1 
ATOM   6562 C  CD  . GLN B 1 252 ? 62.590 35.910 163.190 1.00 15.00 ? 284 GLN B CD  1 
ATOM   6563 O  OE1 . GLN B 1 252 ? 62.680 36.720 162.270 1.00 15.00 ? 284 GLN B OE1 1 
ATOM   6564 N  NE2 . GLN B 1 252 ? 61.990 36.280 164.310 1.00 15.00 ? 284 GLN B NE2 1 
ATOM   6565 N  N   . MET B 1 253 ? 61.850 30.470 164.940 1.00 15.00 ? 285 MET B N   1 
ATOM   6566 C  CA  . MET B 1 253 ? 60.890 29.510 165.440 1.00 15.00 ? 285 MET B CA  1 
ATOM   6567 C  C   . MET B 1 253 ? 60.150 30.210 166.550 1.00 15.00 ? 285 MET B C   1 
ATOM   6568 O  O   . MET B 1 253 ? 60.740 31.010 167.290 1.00 15.00 ? 285 MET B O   1 
ATOM   6569 C  CB  . MET B 1 253 ? 61.580 28.260 166.000 1.00 15.00 ? 285 MET B CB  1 
ATOM   6570 C  CG  . MET B 1 253 ? 62.190 27.530 164.820 1.00 15.00 ? 285 MET B CG  1 
ATOM   6571 S  SD  . MET B 1 253 ? 62.590 25.780 165.090 1.00 15.00 ? 285 MET B SD  1 
ATOM   6572 C  CE  . MET B 1 253 ? 63.900 26.010 166.250 1.00 15.00 ? 285 MET B CE  1 
ATOM   6573 N  N   . ALA B 1 254 ? 58.840 29.970 166.610 1.00 15.00 ? 286 ALA B N   1 
ATOM   6574 C  CA  . ALA B 1 254 ? 57.930 30.580 167.570 1.00 15.00 ? 286 ALA B CA  1 
ATOM   6575 C  C   . ALA B 1 254 ? 57.740 29.690 168.780 1.00 15.00 ? 286 ALA B C   1 
ATOM   6576 O  O   . ALA B 1 254 ? 57.340 28.520 168.670 1.00 15.00 ? 286 ALA B O   1 
ATOM   6577 C  CB  . ALA B 1 254 ? 56.620 30.810 166.880 1.00 15.00 ? 286 ALA B CB  1 
ATOM   6578 N  N   . VAL B 1 255 ? 58.020 30.200 169.980 1.00 15.00 ? 287 VAL B N   1 
ATOM   6579 C  CA  . VAL B 1 255 ? 58.100 29.290 171.090 1.00 15.00 ? 287 VAL B CA  1 
ATOM   6580 C  C   . VAL B 1 255 ? 57.350 29.510 172.370 1.00 15.00 ? 287 VAL B C   1 
ATOM   6581 O  O   . VAL B 1 255 ? 56.820 28.510 172.850 1.00 15.00 ? 287 VAL B O   1 
ATOM   6582 C  CB  . VAL B 1 255 ? 59.630 29.100 171.320 1.00 15.00 ? 287 VAL B CB  1 
ATOM   6583 C  CG1 . VAL B 1 255 ? 60.140 29.000 172.740 1.00 15.00 ? 287 VAL B CG1 1 
ATOM   6584 C  CG2 . VAL B 1 255 ? 59.880 27.750 170.710 1.00 15.00 ? 287 VAL B CG2 1 
ATOM   6585 N  N   . GLY B 1 256 ? 57.290 30.700 172.950 1.00 15.00 ? 288 GLY B N   1 
ATOM   6586 C  CA  . GLY B 1 256 ? 56.610 30.830 174.230 1.00 15.00 ? 288 GLY B CA  1 
ATOM   6587 C  C   . GLY B 1 256 ? 57.360 31.840 175.050 1.00 15.00 ? 288 GLY B C   1 
ATOM   6588 O  O   . GLY B 1 256 ? 56.820 32.890 175.430 1.00 15.00 ? 288 GLY B O   1 
ATOM   6589 N  N   . GLN B 1 257 ? 58.630 31.510 175.320 1.00 15.00 ? 289 GLN B N   1 
ATOM   6590 C  CA  . GLN B 1 257 ? 59.560 32.460 175.930 1.00 15.00 ? 289 GLN B CA  1 
ATOM   6591 C  C   . GLN B 1 257 ? 60.290 33.140 174.770 1.00 15.00 ? 289 GLN B C   1 
ATOM   6592 O  O   . GLN B 1 257 ? 61.000 32.520 173.970 1.00 15.00 ? 289 GLN B O   1 
ATOM   6593 C  CB  . GLN B 1 257 ? 60.550 31.730 176.800 1.00 15.00 ? 289 GLN B CB  1 
ATOM   6594 C  CG  . GLN B 1 257 ? 60.890 32.360 178.140 1.00 15.00 ? 289 GLN B CG  1 
ATOM   6595 C  CD  . GLN B 1 257 ? 61.590 33.700 178.140 1.00 15.00 ? 289 GLN B CD  1 
ATOM   6596 O  OE1 . GLN B 1 257 ? 61.590 34.440 177.160 1.00 15.00 ? 289 GLN B OE1 1 
ATOM   6597 N  NE2 . GLN B 1 257 ? 62.230 34.050 179.260 1.00 15.00 ? 289 GLN B NE2 1 
ATOM   6598 N  N   . GLU B 1 258 ? 60.180 34.460 174.660 1.00 15.00 ? 290 GLU B N   1 
ATOM   6599 C  CA  . GLU B 1 258 ? 60.670 35.160 173.470 1.00 15.00 ? 290 GLU B CA  1 
ATOM   6600 C  C   . GLU B 1 258 ? 62.180 35.130 173.240 1.00 15.00 ? 290 GLU B C   1 
ATOM   6601 O  O   . GLU B 1 258 ? 62.680 35.270 172.110 1.00 15.00 ? 290 GLU B O   1 
ATOM   6602 C  CB  . GLU B 1 258 ? 60.190 36.620 173.480 1.00 15.00 ? 290 GLU B CB  1 
ATOM   6603 C  CG  . GLU B 1 258 ? 60.250 37.430 174.780 1.00 15.00 ? 290 GLU B CG  1 
ATOM   6604 C  CD  . GLU B 1 258 ? 59.120 37.210 175.810 1.00 15.00 ? 290 GLU B CD  1 
ATOM   6605 O  OE1 . GLU B 1 258 ? 58.130 36.500 175.550 1.00 15.00 ? 290 GLU B OE1 1 
ATOM   6606 O  OE2 . GLU B 1 258 ? 59.250 37.780 176.900 1.00 15.00 ? 290 GLU B OE2 1 
ATOM   6607 N  N   . VAL B 1 259 ? 62.920 34.920 174.310 1.00 15.00 ? 291 VAL B N   1 
ATOM   6608 C  CA  . VAL B 1 259 ? 64.370 34.890 174.270 1.00 15.00 ? 291 VAL B CA  1 
ATOM   6609 C  C   . VAL B 1 259 ? 64.950 33.640 173.660 1.00 15.00 ? 291 VAL B C   1 
ATOM   6610 O  O   . VAL B 1 259 ? 66.010 33.700 173.040 1.00 15.00 ? 291 VAL B O   1 
ATOM   6611 C  CB  . VAL B 1 259 ? 64.760 35.100 175.710 1.00 15.00 ? 291 VAL B CB  1 
ATOM   6612 C  CG1 . VAL B 1 259 ? 66.140 34.590 176.100 1.00 15.00 ? 291 VAL B CG1 1 
ATOM   6613 C  CG2 . VAL B 1 259 ? 64.690 36.610 175.860 1.00 15.00 ? 291 VAL B CG2 1 
ATOM   6614 N  N   . PHE B 1 260 ? 64.270 32.520 173.710 1.00 15.00 ? 292 PHE B N   1 
ATOM   6615 C  CA  . PHE B 1 260 ? 64.870 31.250 173.350 1.00 15.00 ? 292 PHE B CA  1 
ATOM   6616 C  C   . PHE B 1 260 ? 65.460 31.080 171.970 1.00 15.00 ? 292 PHE B C   1 
ATOM   6617 O  O   . PHE B 1 260 ? 66.010 30.030 171.700 1.00 15.00 ? 292 PHE B O   1 
ATOM   6618 C  CB  . PHE B 1 260 ? 63.850 30.160 173.630 1.00 15.00 ? 292 PHE B CB  1 
ATOM   6619 C  CG  . PHE B 1 260 ? 63.540 29.920 175.110 1.00 15.00 ? 292 PHE B CG  1 
ATOM   6620 C  CD1 . PHE B 1 260 ? 64.070 30.700 176.130 1.00 15.00 ? 292 PHE B CD1 1 
ATOM   6621 C  CD2 . PHE B 1 260 ? 62.700 28.890 175.470 1.00 15.00 ? 292 PHE B CD2 1 
ATOM   6622 C  CE1 . PHE B 1 260 ? 63.760 30.450 177.450 1.00 15.00 ? 292 PHE B CE1 1 
ATOM   6623 C  CE2 . PHE B 1 260 ? 62.390 28.660 176.790 1.00 15.00 ? 292 PHE B CE2 1 
ATOM   6624 C  CZ  . PHE B 1 260 ? 62.920 29.420 177.780 1.00 15.00 ? 292 PHE B CZ  1 
ATOM   6625 N  N   . GLY B 1 261 ? 65.360 32.090 171.090 1.00 15.00 ? 293 GLY B N   1 
ATOM   6626 C  CA  . GLY B 1 261 ? 66.050 32.080 169.810 1.00 15.00 ? 293 GLY B CA  1 
ATOM   6627 C  C   . GLY B 1 261 ? 67.580 32.110 170.020 1.00 15.00 ? 293 GLY B C   1 
ATOM   6628 O  O   . GLY B 1 261 ? 68.340 31.420 169.320 1.00 15.00 ? 293 GLY B O   1 
ATOM   6629 N  N   . LEU B 1 262 ? 68.140 32.700 170.990 1.00 15.00 ? 294 LEU B N   1 
ATOM   6630 C  CA  . LEU B 1 262 ? 69.460 33.040 171.540 1.00 15.00 ? 294 LEU B CA  1 
ATOM   6631 C  C   . LEU B 1 262 ? 70.410 31.850 171.380 1.00 15.00 ? 294 LEU B C   1 
ATOM   6632 O  O   . LEU B 1 262 ? 71.550 32.000 170.910 1.00 15.00 ? 294 LEU B O   1 
ATOM   6633 C  CB  . LEU B 1 262 ? 69.310 33.450 173.000 1.00 15.00 ? 294 LEU B CB  1 
ATOM   6634 C  CG  . LEU B 1 262 ? 70.640 33.740 173.730 1.00 15.00 ? 294 LEU B CG  1 
ATOM   6635 C  CD1 . LEU B 1 262 ? 71.540 34.720 172.990 1.00 15.00 ? 294 LEU B CD1 1 
ATOM   6636 C  CD2 . LEU B 1 262 ? 70.440 34.340 175.120 1.00 15.00 ? 294 LEU B CD2 1 
ATOM   6637 N  N   . LEU B 1 263 ? 69.950 30.660 171.760 1.00 15.00 ? 295 LEU B N   1 
ATOM   6638 C  CA  . LEU B 1 263 ? 70.780 29.430 171.630 1.00 15.00 ? 295 LEU B CA  1 
ATOM   6639 C  C   . LEU B 1 263 ? 69.990 28.190 171.290 1.00 15.00 ? 295 LEU B C   1 
ATOM   6640 O  O   . LEU B 1 263 ? 68.780 28.100 171.530 1.00 15.00 ? 295 LEU B O   1 
ATOM   6641 C  CB  . LEU B 1 263 ? 71.430 28.980 172.940 1.00 15.00 ? 295 LEU B CB  1 
ATOM   6642 C  CG  . LEU B 1 263 ? 72.030 30.070 173.810 1.00 15.00 ? 295 LEU B CG  1 
ATOM   6643 C  CD1 . LEU B 1 263 ? 71.020 30.640 174.810 1.00 15.00 ? 295 LEU B CD1 1 
ATOM   6644 C  CD2 . LEU B 1 263 ? 73.200 29.560 174.670 1.00 15.00 ? 295 LEU B CD2 1 
ATOM   6645 N  N   . PRO B 1 264 ? 70.680 27.170 170.720 1.00 15.00 ? 296 PRO B N   1 
ATOM   6646 C  CA  . PRO B 1 264 ? 70.080 25.880 170.480 1.00 15.00 ? 296 PRO B CA  1 
ATOM   6647 C  C   . PRO B 1 264 ? 69.640 25.320 171.800 1.00 15.00 ? 296 PRO B C   1 
ATOM   6648 O  O   . PRO B 1 264 ? 68.510 24.770 171.890 1.00 15.00 ? 296 PRO B O   1 
ATOM   6649 C  CB  . PRO B 1 264 ? 71.200 25.080 169.840 1.00 15.00 ? 296 PRO B CB  1 
ATOM   6650 C  CG  . PRO B 1 264 ? 72.410 25.980 169.740 1.00 15.00 ? 296 PRO B CG  1 
ATOM   6651 C  CD  . PRO B 1 264 ? 72.070 27.320 170.300 1.00 15.00 ? 296 PRO B CD  1 
ATOM   6652 N  N   . GLY B 1 265 ? 70.530 25.460 172.770 1.00 15.00 ? 297 GLY B N   1 
ATOM   6653 C  CA  . GLY B 1 265 ? 70.270 24.990 174.130 1.00 15.00 ? 297 GLY B CA  1 
ATOM   6654 C  C   . GLY B 1 265 ? 68.800 25.220 174.450 1.00 15.00 ? 297 GLY B C   1 
ATOM   6655 O  O   . GLY B 1 265 ? 68.020 24.260 174.570 1.00 15.00 ? 297 GLY B O   1 
ATOM   6656 N  N   . LEU B 1 266 ? 68.440 26.470 174.560 1.00 15.00 ? 298 LEU B N   1 
ATOM   6657 C  CA  . LEU B 1 266 ? 67.080 26.870 174.900 1.00 15.00 ? 298 LEU B CA  1 
ATOM   6658 C  C   . LEU B 1 266 ? 66.050 26.240 173.920 1.00 15.00 ? 298 LEU B C   1 
ATOM   6659 O  O   . LEU B 1 266 ? 65.020 25.710 174.330 1.00 15.00 ? 298 LEU B O   1 
ATOM   6660 C  CB  . LEU B 1 266 ? 66.950 28.400 174.870 1.00 15.00 ? 298 LEU B CB  1 
ATOM   6661 C  CG  . LEU B 1 266 ? 66.610 29.000 176.250 1.00 15.00 ? 298 LEU B CG  1 
ATOM   6662 C  CD1 . LEU B 1 266 ? 66.860 28.010 177.390 1.00 15.00 ? 298 LEU B CD1 1 
ATOM   6663 C  CD2 . LEU B 1 266 ? 67.430 30.240 176.590 1.00 15.00 ? 298 LEU B CD2 1 
ATOM   6664 N  N   . MET B 1 267 ? 66.370 26.280 172.620 1.00 15.00 ? 299 MET B N   1 
ATOM   6665 C  CA  . MET B 1 267 ? 65.450 25.760 171.570 1.00 15.00 ? 299 MET B CA  1 
ATOM   6666 C  C   . MET B 1 267 ? 65.260 24.220 171.650 1.00 15.00 ? 299 MET B C   1 
ATOM   6667 O  O   . MET B 1 267 ? 64.130 23.710 171.500 1.00 15.00 ? 299 MET B O   1 
ATOM   6668 C  CB  . MET B 1 267 ? 65.980 26.090 170.170 1.00 15.00 ? 299 MET B CB  1 
ATOM   6669 C  CG  . MET B 1 267 ? 65.440 27.410 169.620 1.00 15.00 ? 299 MET B CG  1 
ATOM   6670 S  SD  . MET B 1 267 ? 63.660 27.510 169.650 1.00 15.00 ? 299 MET B SD  1 
ATOM   6671 C  CE  . MET B 1 267 ? 63.130 29.140 169.160 1.00 15.00 ? 299 MET B CE  1 
ATOM   6672 N  N   . LEU B 1 268 ? 66.350 23.520 171.880 1.00 15.00 ? 300 LEU B N   1 
ATOM   6673 C  CA  . LEU B 1 268 ? 66.350 22.050 171.980 1.00 15.00 ? 300 LEU B CA  1 
ATOM   6674 C  C   . LEU B 1 268 ? 65.210 21.580 172.910 1.00 15.00 ? 300 LEU B C   1 
ATOM   6675 O  O   . LEU B 1 268 ? 64.330 20.800 172.510 1.00 15.00 ? 300 LEU B O   1 
ATOM   6676 C  CB  . LEU B 1 268 ? 67.670 21.570 172.570 1.00 15.00 ? 300 LEU B CB  1 
ATOM   6677 C  CG  . LEU B 1 268 ? 67.980 20.090 172.300 1.00 15.00 ? 300 LEU B CG  1 
ATOM   6678 C  CD1 . LEU B 1 268 ? 69.100 19.530 173.190 1.00 15.00 ? 300 LEU B CD1 1 
ATOM   6679 C  CD2 . LEU B 1 268 ? 66.780 19.170 172.520 1.00 15.00 ? 300 LEU B CD2 1 
ATOM   6680 N  N   . TYR B 1 269 ? 65.280 22.110 174.110 1.00 15.00 ? 301 TYR B N   1 
ATOM   6681 C  CA  . TYR B 1 269 ? 64.350 21.770 175.190 1.00 15.00 ? 301 TYR B CA  1 
ATOM   6682 C  C   . TYR B 1 269 ? 62.900 22.160 174.850 1.00 15.00 ? 301 TYR B C   1 
ATOM   6683 O  O   . TYR B 1 269 ? 61.960 21.400 175.060 1.00 15.00 ? 301 TYR B O   1 
ATOM   6684 C  CB  . TYR B 1 269 ? 64.790 22.450 176.490 1.00 15.00 ? 301 TYR B CB  1 
ATOM   6685 C  CG  . TYR B 1 269 ? 65.630 21.500 177.350 1.00 15.00 ? 301 TYR B CG  1 
ATOM   6686 C  CD1 . TYR B 1 269 ? 65.030 20.380 177.940 1.00 15.00 ? 301 TYR B CD1 1 
ATOM   6687 C  CD2 . TYR B 1 269 ? 67.000 21.730 177.530 1.00 15.00 ? 301 TYR B CD2 1 
ATOM   6688 C  CE1 . TYR B 1 269 ? 65.780 19.510 178.720 1.00 15.00 ? 301 TYR B CE1 1 
ATOM   6689 C  CE2 . TYR B 1 269 ? 67.750 20.870 178.310 1.00 15.00 ? 301 TYR B CE2 1 
ATOM   6690 C  CZ  . TYR B 1 269 ? 67.150 19.750 178.910 1.00 15.00 ? 301 TYR B CZ  1 
ATOM   6691 O  OH  . TYR B 1 269 ? 67.890 18.910 179.670 1.00 15.00 ? 301 TYR B OH  1 
ATOM   6692 N  N   . ALA B 1 270 ? 62.720 23.360 174.320 1.00 15.00 ? 302 ALA B N   1 
ATOM   6693 C  CA  . ALA B 1 270 ? 61.380 23.840 173.960 1.00 15.00 ? 302 ALA B CA  1 
ATOM   6694 C  C   . ALA B 1 270 ? 60.780 22.920 172.880 1.00 15.00 ? 302 ALA B C   1 
ATOM   6695 O  O   . ALA B 1 270 ? 59.580 22.600 172.910 1.00 15.00 ? 302 ALA B O   1 
ATOM   6696 C  CB  . ALA B 1 270 ? 61.450 25.260 173.400 1.00 15.00 ? 302 ALA B CB  1 
ATOM   6697 N  N   . THR B 1 271 ? 61.630 22.320 172.020 1.00 15.00 ? 303 THR B N   1 
ATOM   6698 C  CA  . THR B 1 271 ? 61.190 21.320 171.070 1.00 15.00 ? 303 THR B CA  1 
ATOM   6699 C  C   . THR B 1 271 ? 60.740 20.100 171.840 1.00 15.00 ? 303 THR B C   1 
ATOM   6700 O  O   . THR B 1 271 ? 59.600 19.710 171.660 1.00 15.00 ? 303 THR B O   1 
ATOM   6701 C  CB  . THR B 1 271 ? 62.320 21.000 170.120 1.00 15.00 ? 303 THR B CB  1 
ATOM   6702 O  OG1 . THR B 1 271 ? 62.530 22.200 169.420 1.00 15.00 ? 303 THR B OG1 1 
ATOM   6703 C  CG2 . THR B 1 271 ? 62.050 19.930 169.120 1.00 15.00 ? 303 THR B CG2 1 
ATOM   6704 N  N   . ILE B 1 272 ? 61.540 19.550 172.780 1.00 15.00 ? 304 ILE B N   1 
ATOM   6705 C  CA  . ILE B 1 272 ? 61.150 18.350 173.520 1.00 15.00 ? 304 ILE B CA  1 
ATOM   6706 C  C   . ILE B 1 272 ? 59.810 18.610 174.190 1.00 15.00 ? 304 ILE B C   1 
ATOM   6707 O  O   . ILE B 1 272 ? 58.860 17.910 173.880 1.00 15.00 ? 304 ILE B O   1 
ATOM   6708 C  CB  . ILE B 1 272 ? 62.150 17.950 174.640 1.00 15.00 ? 304 ILE B CB  1 
ATOM   6709 C  CG1 . ILE B 1 272 ? 63.530 17.750 174.080 1.00 15.00 ? 304 ILE B CG1 1 
ATOM   6710 C  CG2 . ILE B 1 272 ? 61.700 16.630 175.270 1.00 15.00 ? 304 ILE B CG2 1 
ATOM   6711 C  CD1 . ILE B 1 272 ? 64.600 17.360 175.110 1.00 15.00 ? 304 ILE B CD1 1 
ATOM   6712 N  N   . TRP B 1 273 ? 59.670 19.660 174.980 1.00 15.00 ? 305 TRP B N   1 
ATOM   6713 C  CA  . TRP B 1 273 ? 58.410 19.910 175.630 1.00 15.00 ? 305 TRP B CA  1 
ATOM   6714 C  C   . TRP B 1 273 ? 57.250 20.170 174.670 1.00 15.00 ? 305 TRP B C   1 
ATOM   6715 O  O   . TRP B 1 273 ? 56.130 19.850 175.060 1.00 15.00 ? 305 TRP B O   1 
ATOM   6716 C  CB  . TRP B 1 273 ? 58.580 21.070 176.580 1.00 15.00 ? 305 TRP B CB  1 
ATOM   6717 C  CG  . TRP B 1 273 ? 59.360 20.720 177.820 1.00 15.00 ? 305 TRP B CG  1 
ATOM   6718 C  CD1 . TRP B 1 273 ? 60.610 21.230 177.960 1.00 15.00 ? 305 TRP B CD1 1 
ATOM   6719 C  CD2 . TRP B 1 273 ? 58.980 19.960 178.910 1.00 15.00 ? 305 TRP B CD2 1 
ATOM   6720 N  NE1 . TRP B 1 273 ? 61.020 20.810 179.110 1.00 15.00 ? 305 TRP B NE1 1 
ATOM   6721 C  CE2 . TRP B 1 273 ? 60.090 20.050 179.710 1.00 15.00 ? 305 TRP B CE2 1 
ATOM   6722 C  CE3 . TRP B 1 273 ? 57.900 19.220 179.350 1.00 15.00 ? 305 TRP B CE3 1 
ATOM   6723 C  CZ2 . TRP B 1 273 ? 60.150 19.430 180.930 1.00 15.00 ? 305 TRP B CZ2 1 
ATOM   6724 C  CZ3 . TRP B 1 273 ? 57.950 18.580 180.580 1.00 15.00 ? 305 TRP B CZ3 1 
ATOM   6725 C  CH2 . TRP B 1 273 ? 59.070 18.680 181.360 1.00 15.00 ? 305 TRP B CH2 1 
ATOM   6726 N  N   . LEU B 1 274 ? 57.410 20.670 173.450 1.00 15.00 ? 306 LEU B N   1 
ATOM   6727 C  CA  . LEU B 1 274 ? 56.280 20.810 172.520 1.00 15.00 ? 306 LEU B CA  1 
ATOM   6728 C  C   . LEU B 1 274 ? 55.840 19.440 172.060 1.00 15.00 ? 306 LEU B C   1 
ATOM   6729 O  O   . LEU B 1 274 ? 54.660 19.110 171.990 1.00 15.00 ? 306 LEU B O   1 
ATOM   6730 C  CB  . LEU B 1 274 ? 56.690 21.640 171.310 1.00 15.00 ? 306 LEU B CB  1 
ATOM   6731 C  CG  . LEU B 1 274 ? 55.680 21.940 170.220 1.00 15.00 ? 306 LEU B CG  1 
ATOM   6732 C  CD1 . LEU B 1 274 ? 55.750 23.390 169.780 1.00 15.00 ? 306 LEU B CD1 1 
ATOM   6733 C  CD2 . LEU B 1 274 ? 55.960 21.050 169.040 1.00 15.00 ? 306 LEU B CD2 1 
ATOM   6734 N  N   . ARG B 1 275 ? 56.810 18.590 171.750 1.00 15.00 ? 307 ARG B N   1 
ATOM   6735 C  CA  . ARG B 1 275 ? 56.540 17.230 171.330 1.00 15.00 ? 307 ARG B CA  1 
ATOM   6736 C  C   . ARG B 1 275 ? 55.830 16.510 172.460 1.00 15.00 ? 307 ARG B C   1 
ATOM   6737 O  O   . ARG B 1 275 ? 54.790 15.900 172.230 1.00 15.00 ? 307 ARG B O   1 
ATOM   6738 C  CB  . ARG B 1 275 ? 57.880 16.580 170.970 1.00 15.00 ? 307 ARG B CB  1 
ATOM   6739 C  CG  . ARG B 1 275 ? 58.300 17.110 169.610 1.00 15.00 ? 307 ARG B CG  1 
ATOM   6740 C  CD  . ARG B 1 275 ? 59.800 17.180 169.290 1.00 15.00 ? 307 ARG B CD  1 
ATOM   6741 N  NE  . ARG B 1 275 ? 60.470 15.920 168.970 1.00 15.00 ? 307 ARG B NE  1 
ATOM   6742 C  CZ  . ARG B 1 275 ? 61.320 15.810 167.930 1.00 15.00 ? 307 ARG B CZ  1 
ATOM   6743 N  NH1 . ARG B 1 275 ? 61.600 16.820 167.110 1.00 15.00 ? 307 ARG B NH1 1 
ATOM   6744 N  NH2 . ARG B 1 275 ? 61.960 14.640 167.770 1.00 15.00 ? 307 ARG B NH2 1 
ATOM   6745 N  N   . GLU B 1 276 ? 56.310 16.640 173.690 1.00 15.00 ? 308 GLU B N   1 
ATOM   6746 C  CA  . GLU B 1 276 ? 55.650 16.070 174.840 1.00 15.00 ? 308 GLU B CA  1 
ATOM   6747 C  C   . GLU B 1 276 ? 54.240 16.550 175.030 1.00 15.00 ? 308 GLU B C   1 
ATOM   6748 O  O   . GLU B 1 276 ? 53.400 15.760 175.440 1.00 15.00 ? 308 GLU B O   1 
ATOM   6749 C  CB  . GLU B 1 276 ? 56.440 16.390 176.070 1.00 15.00 ? 308 GLU B CB  1 
ATOM   6750 C  CG  . GLU B 1 276 ? 55.880 15.810 177.350 1.00 15.00 ? 308 GLU B CG  1 
ATOM   6751 C  CD  . GLU B 1 276 ? 55.710 14.300 177.440 1.00 15.00 ? 308 GLU B CD  1 
ATOM   6752 O  OE1 . GLU B 1 276 ? 56.180 13.550 176.590 1.00 15.00 ? 308 GLU B OE1 1 
ATOM   6753 O  OE2 . GLU B 1 276 ? 55.090 13.870 178.400 1.00 15.00 ? 308 GLU B OE2 1 
ATOM   6754 N  N   . HIS B 1 277 ? 53.940 17.810 174.730 1.00 15.00 ? 309 HIS B N   1 
ATOM   6755 C  CA  . HIS B 1 277 ? 52.580 18.320 174.880 1.00 15.00 ? 309 HIS B CA  1 
ATOM   6756 C  C   . HIS B 1 277 ? 51.680 17.600 173.900 1.00 15.00 ? 309 HIS B C   1 
ATOM   6757 O  O   . HIS B 1 277 ? 50.700 16.970 174.300 1.00 15.00 ? 309 HIS B O   1 
ATOM   6758 C  CB  . HIS B 1 277 ? 52.570 19.780 174.600 1.00 15.00 ? 309 HIS B CB  1 
ATOM   6759 C  CG  . HIS B 1 277 ? 51.200 20.380 174.730 1.00 15.00 ? 309 HIS B CG  1 
ATOM   6760 N  ND1 . HIS B 1 277 ? 50.330 20.600 173.670 1.00 15.00 ? 309 HIS B ND1 1 
ATOM   6761 C  CD2 . HIS B 1 277 ? 50.660 20.820 175.930 1.00 15.00 ? 309 HIS B CD2 1 
ATOM   6762 C  CE1 . HIS B 1 277 ? 49.260 21.190 174.240 1.00 15.00 ? 309 HIS B CE1 1 
ATOM   6763 N  NE2 . HIS B 1 277 ? 49.430 21.330 175.520 1.00 15.00 ? 309 HIS B NE2 1 
ATOM   6764 N  N   . GLN B 1 278 ? 52.030 17.610 172.630 1.00 15.00 ? 310 GLN B N   1 
ATOM   6765 C  CA  . GLN B 1 278 ? 51.270 16.900 171.640 1.00 15.00 ? 310 GLN B CA  1 
ATOM   6766 C  C   . GLN B 1 278 ? 50.960 15.460 171.990 1.00 15.00 ? 310 GLN B C   1 
ATOM   6767 O  O   . GLN B 1 278 ? 49.820 15.030 171.910 1.00 15.00 ? 310 GLN B O   1 
ATOM   6768 C  CB  . GLN B 1 278 ? 52.050 16.910 170.370 1.00 15.00 ? 310 GLN B CB  1 
ATOM   6769 C  CG  . GLN B 1 278 ? 51.450 17.830 169.370 1.00 15.00 ? 310 GLN B CG  1 
ATOM   6770 C  CD  . GLN B 1 278 ? 51.390 19.280 169.790 1.00 15.00 ? 310 GLN B CD  1 
ATOM   6771 O  OE1 . GLN B 1 278 ? 50.970 19.700 170.860 1.00 15.00 ? 310 GLN B OE1 1 
ATOM   6772 N  NE2 . GLN B 1 278 ? 51.820 20.100 168.860 1.00 15.00 ? 310 GLN B NE2 1 
ATOM   6773 N  N   . ARG B 1 279 ? 51.970 14.750 172.440 1.00 15.00 ? 311 ARG B N   1 
ATOM   6774 C  CA  . ARG B 1 279 ? 51.850 13.370 172.820 1.00 15.00 ? 311 ARG B CA  1 
ATOM   6775 C  C   . ARG B 1 279 ? 50.770 13.220 173.850 1.00 15.00 ? 311 ARG B C   1 
ATOM   6776 O  O   . ARG B 1 279 ? 49.830 12.450 173.640 1.00 15.00 ? 311 ARG B O   1 
ATOM   6777 C  CB  . ARG B 1 279 ? 53.140 12.870 173.390 1.00 15.00 ? 311 ARG B CB  1 
ATOM   6778 C  CG  . ARG B 1 279 ? 53.110 11.390 173.650 1.00 15.00 ? 311 ARG B CG  1 
ATOM   6779 C  CD  . ARG B 1 279 ? 54.410 10.990 174.270 1.00 15.00 ? 311 ARG B CD  1 
ATOM   6780 N  NE  . ARG B 1 279 ? 54.470 11.400 175.650 1.00 15.00 ? 311 ARG B NE  1 
ATOM   6781 C  CZ  . ARG B 1 279 ? 54.210 10.530 176.620 1.00 15.00 ? 311 ARG B CZ  1 
ATOM   6782 N  NH1 . ARG B 1 279 ? 53.880 9.250  176.400 1.00 15.00 ? 311 ARG B NH1 1 
ATOM   6783 N  NH2 . ARG B 1 279 ? 54.310 10.940 177.880 1.00 15.00 ? 311 ARG B NH2 1 
ATOM   6784 N  N   . VAL B 1 280 ? 50.890 14.000 174.920 1.00 15.00 ? 312 VAL B N   1 
ATOM   6785 C  CA  . VAL B 1 280 ? 49.930 13.910 176.000 1.00 15.00 ? 312 VAL B CA  1 
ATOM   6786 C  C   . VAL B 1 280 ? 48.560 14.220 175.450 1.00 15.00 ? 312 VAL B C   1 
ATOM   6787 O  O   . VAL B 1 280 ? 47.650 13.440 175.730 1.00 15.00 ? 312 VAL B O   1 
ATOM   6788 C  CB  . VAL B 1 280 ? 50.300 14.870 177.130 1.00 15.00 ? 312 VAL B CB  1 
ATOM   6789 C  CG1 . VAL B 1 280 ? 49.260 14.890 178.210 1.00 15.00 ? 312 VAL B CG1 1 
ATOM   6790 C  CG2 . VAL B 1 280 ? 51.550 14.340 177.800 1.00 15.00 ? 312 VAL B CG2 1 
ATOM   6791 N  N   . CYS B 1 281 ? 48.380 15.260 174.620 1.00 15.00 ? 313 CYS B N   1 
ATOM   6792 C  CA  . CYS B 1 281 ? 47.100 15.540 174.040 1.00 15.00 ? 313 CYS B CA  1 
ATOM   6793 C  C   . CYS B 1 281 ? 46.510 14.290 173.450 1.00 15.00 ? 313 CYS B C   1 
ATOM   6794 O  O   . CYS B 1 281 ? 45.430 13.890 173.850 1.00 15.00 ? 313 CYS B O   1 
ATOM   6795 C  CB  . CYS B 1 281 ? 47.200 16.550 172.960 1.00 15.00 ? 313 CYS B CB  1 
ATOM   6796 S  SG  . CYS B 1 281 ? 47.370 18.200 173.640 1.00 15.00 ? 313 CYS B SG  1 
ATOM   6797 N  N   . ASP B 1 282 ? 47.250 13.550 172.640 1.00 15.00 ? 314 ASP B N   1 
ATOM   6798 C  CA  . ASP B 1 282 ? 46.690 12.380 172.010 1.00 15.00 ? 314 ASP B CA  1 
ATOM   6799 C  C   . ASP B 1 282 ? 46.280 11.310 172.980 1.00 15.00 ? 314 ASP B C   1 
ATOM   6800 O  O   . ASP B 1 282 ? 45.220 10.700 172.760 1.00 15.00 ? 314 ASP B O   1 
ATOM   6801 C  CB  . ASP B 1 282 ? 47.660 11.790 171.010 1.00 15.00 ? 314 ASP B CB  1 
ATOM   6802 C  CG  . ASP B 1 282 ? 47.750 12.670 169.770 1.00 15.00 ? 314 ASP B CG  1 
ATOM   6803 O  OD1 . ASP B 1 282 ? 46.730 13.100 169.230 1.00 15.00 ? 314 ASP B OD1 1 
ATOM   6804 O  OD2 . ASP B 1 282 ? 48.870 12.920 169.330 1.00 15.00 ? 314 ASP B OD2 1 
ATOM   6805 N  N   . LEU B 1 283 ? 46.990 11.090 174.070 1.00 15.00 ? 315 LEU B N   1 
ATOM   6806 C  CA  . LEU B 1 283 ? 46.590 10.030 174.980 1.00 15.00 ? 315 LEU B CA  1 
ATOM   6807 C  C   . LEU B 1 283 ? 45.280 10.410 175.610 1.00 15.00 ? 315 LEU B C   1 
ATOM   6808 O  O   . LEU B 1 283 ? 44.360 9.600  175.720 1.00 15.00 ? 315 LEU B O   1 
ATOM   6809 C  CB  . LEU B 1 283 ? 47.560 9.810  176.090 1.00 15.00 ? 315 LEU B CB  1 
ATOM   6810 C  CG  . LEU B 1 283 ? 49.020 9.720  175.760 1.00 15.00 ? 315 LEU B CG  1 
ATOM   6811 C  CD1 . LEU B 1 283 ? 49.750 9.250  177.000 1.00 15.00 ? 315 LEU B CD1 1 
ATOM   6812 C  CD2 . LEU B 1 283 ? 49.250 8.750  174.630 1.00 15.00 ? 315 LEU B CD2 1 
ATOM   6813 N  N   . LEU B 1 284 ? 45.200 11.690 175.950 1.00 15.00 ? 316 LEU B N   1 
ATOM   6814 C  CA  . LEU B 1 284 ? 44.020 12.230 176.560 1.00 15.00 ? 316 LEU B CA  1 
ATOM   6815 C  C   . LEU B 1 284 ? 42.870 12.170 175.570 1.00 15.00 ? 316 LEU B C   1 
ATOM   6816 O  O   . LEU B 1 284 ? 41.790 11.750 175.960 1.00 15.00 ? 316 LEU B O   1 
ATOM   6817 C  CB  . LEU B 1 284 ? 44.310 13.650 176.990 1.00 15.00 ? 316 LEU B CB  1 
ATOM   6818 C  CG  . LEU B 1 284 ? 44.370 14.020 178.460 1.00 15.00 ? 316 LEU B CG  1 
ATOM   6819 C  CD1 . LEU B 1 284 ? 44.700 12.850 179.350 1.00 15.00 ? 316 LEU B CD1 1 
ATOM   6820 C  CD2 . LEU B 1 284 ? 45.420 15.080 178.600 1.00 15.00 ? 316 LEU B CD2 1 
ATOM   6821 N  N   . LYS B 1 285 ? 43.070 12.480 174.280 1.00 15.00 ? 317 LYS B N   1 
ATOM   6822 C  CA  . LYS B 1 285 ? 42.040 12.440 173.260 1.00 15.00 ? 317 LYS B CA  1 
ATOM   6823 C  C   . LYS B 1 285 ? 41.500 11.010 173.180 1.00 15.00 ? 317 LYS B C   1 
ATOM   6824 O  O   . LYS B 1 285 ? 40.300 10.760 173.180 1.00 15.00 ? 317 LYS B O   1 
ATOM   6825 C  CB  . LYS B 1 285 ? 42.630 12.850 171.910 1.00 15.00 ? 317 LYS B CB  1 
ATOM   6826 C  CG  . LYS B 1 285 ? 41.740 12.850 170.650 1.00 15.00 ? 317 LYS B CG  1 
ATOM   6827 C  CD  . LYS B 1 285 ? 40.770 14.040 170.590 1.00 15.00 ? 317 LYS B CD  1 
ATOM   6828 C  CE  . LYS B 1 285 ? 39.820 14.150 169.360 1.00 15.00 ? 317 LYS B CE  1 
ATOM   6829 N  NZ  . LYS B 1 285 ? 40.490 14.300 168.070 1.00 15.00 ? 317 LYS B NZ  1 
ATOM   6830 N  N   . ALA B 1 286 ? 42.420 10.060 173.200 1.00 15.00 ? 318 ALA B N   1 
ATOM   6831 C  CA  . ALA B 1 286 ? 42.080 8.660  173.120 1.00 15.00 ? 318 ALA B CA  1 
ATOM   6832 C  C   . ALA B 1 286 ? 41.210 8.220  174.270 1.00 15.00 ? 318 ALA B C   1 
ATOM   6833 O  O   . ALA B 1 286 ? 40.350 7.360  174.110 1.00 15.00 ? 318 ALA B O   1 
ATOM   6834 C  CB  . ALA B 1 286 ? 43.330 7.830  173.160 1.00 15.00 ? 318 ALA B CB  1 
ATOM   6835 N  N   . GLU B 1 287 ? 41.460 8.800  175.430 1.00 15.00 ? 319 GLU B N   1 
ATOM   6836 C  CA  . GLU B 1 287 ? 40.730 8.470  176.630 1.00 15.00 ? 319 GLU B CA  1 
ATOM   6837 C  C   . GLU B 1 287 ? 39.350 9.070  176.680 1.00 15.00 ? 319 GLU B C   1 
ATOM   6838 O  O   . GLU B 1 287 ? 38.390 8.430  177.100 1.00 15.00 ? 319 GLU B O   1 
ATOM   6839 C  CB  . GLU B 1 287 ? 41.520 8.930  177.840 1.00 15.00 ? 319 GLU B CB  1 
ATOM   6840 C  CG  . GLU B 1 287 ? 41.280 8.070  179.080 1.00 15.00 ? 319 GLU B CG  1 
ATOM   6841 C  CD  . GLU B 1 287 ? 41.710 6.590  178.950 1.00 15.00 ? 319 GLU B CD  1 
ATOM   6842 O  OE1 . GLU B 1 287 ? 42.460 6.250  178.010 1.00 15.00 ? 319 GLU B OE1 1 
ATOM   6843 O  OE2 . GLU B 1 287 ? 41.310 5.790  179.810 1.00 15.00 ? 319 GLU B OE2 1 
ATOM   6844 N  N   . HIS B 1 288 ? 39.250 10.330 176.260 1.00 15.00 ? 320 HIS B N   1 
ATOM   6845 C  CA  . HIS B 1 288 ? 38.020 11.050 176.380 1.00 15.00 ? 320 HIS B CA  1 
ATOM   6846 C  C   . HIS B 1 288 ? 37.640 11.630 175.020 1.00 15.00 ? 320 HIS B C   1 
ATOM   6847 O  O   . HIS B 1 288 ? 37.820 12.830 174.750 1.00 15.00 ? 320 HIS B O   1 
ATOM   6848 C  CB  . HIS B 1 288 ? 38.180 12.180 177.410 1.00 15.00 ? 320 HIS B CB  1 
ATOM   6849 C  CG  . HIS B 1 288 ? 38.790 11.930 178.780 1.00 15.00 ? 320 HIS B CG  1 
ATOM   6850 N  ND1 . HIS B 1 288 ? 39.970 12.490 179.230 1.00 15.00 ? 320 HIS B ND1 1 
ATOM   6851 C  CD2 . HIS B 1 288 ? 38.230 11.110 179.760 1.00 15.00 ? 320 HIS B CD2 1 
ATOM   6852 C  CE1 . HIS B 1 288 ? 40.140 11.990 180.470 1.00 15.00 ? 320 HIS B CE1 1 
ATOM   6853 N  NE2 . HIS B 1 288 ? 39.160 11.200 180.810 1.00 15.00 ? 320 HIS B NE2 1 
ATOM   6854 N  N   . PRO B 1 289 ? 37.000 10.870 174.130 1.00 15.00 ? 321 PRO B N   1 
ATOM   6855 C  CA  . PRO B 1 289 ? 36.560 11.350 172.810 1.00 15.00 ? 321 PRO B CA  1 
ATOM   6856 C  C   . PRO B 1 289 ? 35.620 12.540 172.830 1.00 15.00 ? 321 PRO B C   1 
ATOM   6857 O  O   . PRO B 1 289 ? 35.370 13.170 171.810 1.00 15.00 ? 321 PRO B O   1 
ATOM   6858 C  CB  . PRO B 1 289 ? 35.950 10.130 172.180 1.00 15.00 ? 321 PRO B CB  1 
ATOM   6859 C  CG  . PRO B 1 289 ? 35.430 9.380  173.390 1.00 15.00 ? 321 PRO B CG  1 
ATOM   6860 C  CD  . PRO B 1 289 ? 36.610 9.490  174.330 1.00 15.00 ? 321 PRO B CD  1 
ATOM   6861 N  N   . THR B 1 290 ? 35.040 12.840 173.970 1.00 15.00 ? 322 THR B N   1 
ATOM   6862 C  CA  . THR B 1 290 ? 34.150 13.960 174.190 1.00 15.00 ? 322 THR B CA  1 
ATOM   6863 C  C   . THR B 1 290 ? 34.800 15.330 174.320 1.00 15.00 ? 322 THR B C   1 
ATOM   6864 O  O   . THR B 1 290 ? 34.260 16.340 173.900 1.00 15.00 ? 322 THR B O   1 
ATOM   6865 C  CB  . THR B 1 290 ? 33.350 13.730 175.450 1.00 15.00 ? 322 THR B CB  1 
ATOM   6866 O  OG1 . THR B 1 290 ? 33.730 12.470 176.040 1.00 15.00 ? 322 THR B OG1 1 
ATOM   6867 C  CG2 . THR B 1 290 ? 31.890 13.870 175.090 1.00 15.00 ? 322 THR B CG2 1 
ATOM   6868 N  N   . TRP B 1 291 ? 36.010 15.280 174.910 1.00 15.00 ? 323 TRP B N   1 
ATOM   6869 C  CA  . TRP B 1 291 ? 36.700 16.410 175.460 1.00 15.00 ? 323 TRP B CA  1 
ATOM   6870 C  C   . TRP B 1 291 ? 36.750 17.700 174.670 1.00 15.00 ? 323 TRP B C   1 
ATOM   6871 O  O   . TRP B 1 291 ? 36.450 18.740 175.270 1.00 15.00 ? 323 TRP B O   1 
ATOM   6872 C  CB  . TRP B 1 291 ? 38.120 15.970 175.790 1.00 15.00 ? 323 TRP B CB  1 
ATOM   6873 C  CG  . TRP B 1 291 ? 38.510 15.750 177.250 1.00 15.00 ? 323 TRP B CG  1 
ATOM   6874 C  CD1 . TRP B 1 291 ? 39.840 15.780 177.620 1.00 15.00 ? 323 TRP B CD1 1 
ATOM   6875 C  CD2 . TRP B 1 291 ? 37.720 15.500 178.320 1.00 15.00 ? 323 TRP B CD2 1 
ATOM   6876 N  NE1 . TRP B 1 291 ? 39.900 15.560 178.910 1.00 15.00 ? 323 TRP B NE1 1 
ATOM   6877 C  CE2 . TRP B 1 291 ? 38.660 15.400 179.330 1.00 15.00 ? 323 TRP B CE2 1 
ATOM   6878 C  CE3 . TRP B 1 291 ? 36.390 15.360 178.600 1.00 15.00 ? 323 TRP B CE3 1 
ATOM   6879 C  CZ2 . TRP B 1 291 ? 38.310 15.150 180.640 1.00 15.00 ? 323 TRP B CZ2 1 
ATOM   6880 C  CZ3 . TRP B 1 291 ? 36.010 15.110 179.910 1.00 15.00 ? 323 TRP B CZ3 1 
ATOM   6881 C  CH2 . TRP B 1 291 ? 36.960 15.010 180.920 1.00 15.00 ? 323 TRP B CH2 1 
ATOM   6882 N  N   . GLY B 1 292 ? 37.080 17.750 173.380 1.00 15.00 ? 324 GLY B N   1 
ATOM   6883 C  CA  . GLY B 1 292 ? 37.150 19.060 172.720 1.00 15.00 ? 324 GLY B CA  1 
ATOM   6884 C  C   . GLY B 1 292 ? 38.480 19.780 172.990 1.00 15.00 ? 324 GLY B C   1 
ATOM   6885 O  O   . GLY B 1 292 ? 39.220 19.460 173.930 1.00 15.00 ? 324 GLY B O   1 
ATOM   6886 N  N   . ASP B 1 293 ? 38.840 20.810 172.200 1.00 15.00 ? 325 ASP B N   1 
ATOM   6887 C  CA  . ASP B 1 293 ? 40.190 21.360 172.270 1.00 15.00 ? 325 ASP B CA  1 
ATOM   6888 C  C   . ASP B 1 293 ? 40.630 22.010 173.560 1.00 15.00 ? 325 ASP B C   1 
ATOM   6889 O  O   . ASP B 1 293 ? 41.670 21.620 174.090 1.00 15.00 ? 325 ASP B O   1 
ATOM   6890 C  CB  . ASP B 1 293 ? 40.370 22.360 171.140 1.00 15.00 ? 325 ASP B CB  1 
ATOM   6891 C  CG  . ASP B 1 293 ? 41.680 23.130 171.130 1.00 15.00 ? 325 ASP B CG  1 
ATOM   6892 O  OD1 . ASP B 1 293 ? 42.740 22.590 170.820 1.00 15.00 ? 325 ASP B OD1 1 
ATOM   6893 O  OD2 . ASP B 1 293 ? 41.630 24.320 171.440 1.00 15.00 ? 325 ASP B OD2 1 
ATOM   6894 N  N   . GLU B 1 294 ? 39.890 22.990 174.060 1.00 15.00 ? 326 GLU B N   1 
ATOM   6895 C  CA  . GLU B 1 294 ? 40.280 23.710 175.250 1.00 15.00 ? 326 GLU B CA  1 
ATOM   6896 C  C   . GLU B 1 294 ? 40.570 22.770 176.390 1.00 15.00 ? 326 GLU B C   1 
ATOM   6897 O  O   . GLU B 1 294 ? 41.620 22.910 177.000 1.00 15.00 ? 326 GLU B O   1 
ATOM   6898 C  CB  . GLU B 1 294 ? 39.200 24.640 175.690 1.00 15.00 ? 326 GLU B CB  1 
ATOM   6899 C  CG  . GLU B 1 294 ? 39.640 25.560 176.810 1.00 15.00 ? 326 GLU B CG  1 
ATOM   6900 C  CD  . GLU B 1 294 ? 40.390 26.820 176.400 1.00 15.00 ? 326 GLU B CD  1 
ATOM   6901 O  OE1 . GLU B 1 294 ? 40.470 27.150 175.200 1.00 15.00 ? 326 GLU B OE1 1 
ATOM   6902 O  OE2 . GLU B 1 294 ? 40.880 27.500 177.300 1.00 15.00 ? 326 GLU B OE2 1 
ATOM   6903 N  N   . GLN B 1 295 ? 39.710 21.770 176.660 1.00 15.00 ? 327 GLN B N   1 
ATOM   6904 C  CA  . GLN B 1 295 ? 39.940 20.920 177.810 1.00 15.00 ? 327 GLN B CA  1 
ATOM   6905 C  C   . GLN B 1 295 ? 41.140 20.040 177.590 1.00 15.00 ? 327 GLN B C   1 
ATOM   6906 O  O   . GLN B 1 295 ? 41.890 19.780 178.540 1.00 15.00 ? 327 GLN B O   1 
ATOM   6907 C  CB  . GLN B 1 295 ? 38.720 20.040 178.100 1.00 15.00 ? 327 GLN B CB  1 
ATOM   6908 C  CG  . GLN B 1 295 ? 38.950 19.280 179.400 1.00 15.00 ? 327 GLN B CG  1 
ATOM   6909 C  CD  . GLN B 1 295 ? 37.720 18.750 180.090 1.00 15.00 ? 327 GLN B CD  1 
ATOM   6910 O  OE1 . GLN B 1 295 ? 36.630 18.690 179.550 1.00 15.00 ? 327 GLN B OE1 1 
ATOM   6911 N  NE2 . GLN B 1 295 ? 37.860 18.340 181.340 1.00 15.00 ? 327 GLN B NE2 1 
ATOM   6912 N  N   . LEU B 1 296 ? 41.410 19.600 176.360 1.00 15.00 ? 328 LEU B N   1 
ATOM   6913 C  CA  . LEU B 1 296 ? 42.600 18.810 176.110 1.00 15.00 ? 328 LEU B CA  1 
ATOM   6914 C  C   . LEU B 1 296 ? 43.840 19.660 176.350 1.00 15.00 ? 328 LEU B C   1 
ATOM   6915 O  O   . LEU B 1 296 ? 44.730 19.240 177.110 1.00 15.00 ? 328 LEU B O   1 
ATOM   6916 C  CB  . LEU B 1 296 ? 42.530 18.300 174.690 1.00 15.00 ? 328 LEU B CB  1 
ATOM   6917 C  CG  . LEU B 1 296 ? 41.560 17.170 174.500 1.00 15.00 ? 328 LEU B CG  1 
ATOM   6918 C  CD1 . LEU B 1 296 ? 41.170 17.080 173.060 1.00 15.00 ? 328 LEU B CD1 1 
ATOM   6919 C  CD2 . LEU B 1 296 ? 42.180 15.890 175.010 1.00 15.00 ? 328 LEU B CD2 1 
ATOM   6920 N  N   . PHE B 1 297 ? 43.840 20.890 175.860 1.00 15.00 ? 329 PHE B N   1 
ATOM   6921 C  CA  . PHE B 1 297 ? 44.920 21.820 176.080 1.00 15.00 ? 329 PHE B CA  1 
ATOM   6922 C  C   . PHE B 1 297 ? 45.220 22.040 177.540 1.00 15.00 ? 329 PHE B C   1 
ATOM   6923 O  O   . PHE B 1 297 ? 46.310 21.750 178.020 1.00 15.00 ? 329 PHE B O   1 
ATOM   6924 C  CB  . PHE B 1 297 ? 44.570 23.130 175.480 1.00 15.00 ? 329 PHE B CB  1 
ATOM   6925 C  CG  . PHE B 1 297 ? 45.630 24.170 175.710 1.00 15.00 ? 329 PHE B CG  1 
ATOM   6926 C  CD1 . PHE B 1 297 ? 46.870 24.000 175.130 1.00 15.00 ? 329 PHE B CD1 1 
ATOM   6927 C  CD2 . PHE B 1 297 ? 45.340 25.250 176.470 1.00 15.00 ? 329 PHE B CD2 1 
ATOM   6928 C  CE1 . PHE B 1 297 ? 47.820 24.960 175.310 1.00 15.00 ? 329 PHE B CE1 1 
ATOM   6929 C  CE2 . PHE B 1 297 ? 46.310 26.190 176.660 1.00 15.00 ? 329 PHE B CE2 1 
ATOM   6930 C  CZ  . PHE B 1 297 ? 47.540 26.050 176.070 1.00 15.00 ? 329 PHE B CZ  1 
ATOM   6931 N  N   . GLN B 1 298 ? 44.240 22.550 178.270 1.00 15.00 ? 330 GLN B N   1 
ATOM   6932 C  CA  . GLN B 1 298 ? 44.370 22.810 179.690 1.00 15.00 ? 330 GLN B CA  1 
ATOM   6933 C  C   . GLN B 1 298 ? 44.750 21.560 180.460 1.00 15.00 ? 330 GLN B C   1 
ATOM   6934 O  O   . GLN B 1 298 ? 45.690 21.640 181.260 1.00 15.00 ? 330 GLN B O   1 
ATOM   6935 C  CB  . GLN B 1 298 ? 43.080 23.390 180.230 1.00 15.00 ? 330 GLN B CB  1 
ATOM   6936 C  CG  . GLN B 1 298 ? 42.770 24.760 179.630 1.00 15.00 ? 330 GLN B CG  1 
ATOM   6937 C  CD  . GLN B 1 298 ? 43.730 25.860 180.040 1.00 15.00 ? 330 GLN B CD  1 
ATOM   6938 O  OE1 . GLN B 1 298 ? 44.400 25.790 181.070 1.00 15.00 ? 330 GLN B OE1 1 
ATOM   6939 N  NE2 . GLN B 1 298 ? 43.810 26.950 179.290 1.00 15.00 ? 330 GLN B NE2 1 
ATOM   6940 N  N   . THR B 1 299 ? 44.170 20.380 180.200 1.00 15.00 ? 331 THR B N   1 
ATOM   6941 C  CA  . THR B 1 299 ? 44.540 19.210 180.960 1.00 15.00 ? 331 THR B CA  1 
ATOM   6942 C  C   . THR B 1 299 ? 45.960 18.850 180.610 1.00 15.00 ? 331 THR B C   1 
ATOM   6943 O  O   . THR B 1 299 ? 46.710 18.400 181.480 1.00 15.00 ? 331 THR B O   1 
ATOM   6944 C  CB  . THR B 1 299 ? 43.690 18.000 180.650 1.00 15.00 ? 331 THR B CB  1 
ATOM   6945 O  OG1 . THR B 1 299 ? 42.320 18.390 180.770 1.00 15.00 ? 331 THR B OG1 1 
ATOM   6946 C  CG2 . THR B 1 299 ? 43.950 16.870 181.620 1.00 15.00 ? 331 THR B CG2 1 
ATOM   6947 N  N   . ALA B 1 300 ? 46.420 19.090 179.390 1.00 15.00 ? 332 ALA B N   1 
ATOM   6948 C  CA  . ALA B 1 300 ? 47.800 18.810 179.040 1.00 15.00 ? 332 ALA B CA  1 
ATOM   6949 C  C   . ALA B 1 300 ? 48.750 19.740 179.800 1.00 15.00 ? 332 ALA B C   1 
ATOM   6950 O  O   . ALA B 1 300 ? 49.720 19.230 180.380 1.00 15.00 ? 332 ALA B O   1 
ATOM   6951 C  CB  . ALA B 1 300 ? 47.980 18.990 177.560 1.00 15.00 ? 332 ALA B CB  1 
ATOM   6952 N  N   . LYS B 1 301 ? 48.450 21.040 179.920 1.00 15.00 ? 333 LYS B N   1 
ATOM   6953 C  CA  . LYS B 1 301 ? 49.290 21.990 180.640 1.00 15.00 ? 333 LYS B CA  1 
ATOM   6954 C  C   . LYS B 1 301 ? 49.430 21.490 182.050 1.00 15.00 ? 333 LYS B C   1 
ATOM   6955 O  O   . LYS B 1 301 ? 50.540 21.470 182.570 1.00 15.00 ? 333 LYS B O   1 
ATOM   6956 C  CB  . LYS B 1 301 ? 48.650 23.380 180.640 1.00 15.00 ? 333 LYS B CB  1 
ATOM   6957 C  CG  . LYS B 1 301 ? 49.480 24.500 181.280 1.00 15.00 ? 333 LYS B CG  1 
ATOM   6958 C  CD  . LYS B 1 301 ? 49.090 25.930 180.820 1.00 15.00 ? 333 LYS B CD  1 
ATOM   6959 C  CE  . LYS B 1 301 ? 50.020 26.980 181.400 1.00 15.00 ? 333 LYS B CE  1 
ATOM   6960 N  NZ  . LYS B 1 301 ? 49.940 28.200 180.620 1.00 15.00 ? 333 LYS B NZ  1 
ATOM   6961 N  N   . LEU B 1 302 ? 48.380 20.990 182.660 1.00 15.00 ? 334 LEU B N   1 
ATOM   6962 C  CA  . LEU B 1 302 ? 48.480 20.440 184.000 1.00 15.00 ? 334 LEU B CA  1 
ATOM   6963 C  C   . LEU B 1 302 ? 49.380 19.220 184.040 1.00 15.00 ? 334 LEU B C   1 
ATOM   6964 O  O   . LEU B 1 302 ? 50.200 19.150 184.930 1.00 15.00 ? 334 LEU B O   1 
ATOM   6965 C  CB  . LEU B 1 302 ? 47.090 20.110 184.480 1.00 15.00 ? 334 LEU B CB  1 
ATOM   6966 C  CG  . LEU B 1 302 ? 46.270 21.140 185.240 1.00 15.00 ? 334 LEU B CG  1 
ATOM   6967 C  CD1 . LEU B 1 302 ? 46.270 22.490 184.590 1.00 15.00 ? 334 LEU B CD1 1 
ATOM   6968 C  CD2 . LEU B 1 302 ? 44.860 20.620 185.290 1.00 15.00 ? 334 LEU B CD2 1 
ATOM   6969 N  N   . ILE B 1 303 ? 49.320 18.260 183.100 1.00 15.00 ? 335 ILE B N   1 
ATOM   6970 C  CA  . ILE B 1 303 ? 50.170 17.090 183.160 1.00 15.00 ? 335 ILE B CA  1 
ATOM   6971 C  C   . ILE B 1 303 ? 51.600 17.550 183.060 1.00 15.00 ? 335 ILE B C   1 
ATOM   6972 O  O   . ILE B 1 303 ? 52.430 17.150 183.870 1.00 15.00 ? 335 ILE B O   1 
ATOM   6973 C  CB  . ILE B 1 303 ? 50.010 16.100 181.990 1.00 15.00 ? 335 ILE B CB  1 
ATOM   6974 C  CG1 . ILE B 1 303 ? 48.580 15.760 181.670 1.00 15.00 ? 335 ILE B CG1 1 
ATOM   6975 C  CG2 . ILE B 1 303 ? 50.760 14.850 182.380 1.00 15.00 ? 335 ILE B CG2 1 
ATOM   6976 C  CD1 . ILE B 1 303 ? 47.840 15.010 182.750 1.00 15.00 ? 335 ILE B CD1 1 
ATOM   6977 N  N   . LEU B 1 304 ? 51.900 18.410 182.100 1.00 15.00 ? 336 LEU B N   1 
ATOM   6978 C  CA  . LEU B 1 304 ? 53.260 18.810 181.880 1.00 15.00 ? 336 LEU B CA  1 
ATOM   6979 C  C   . LEU B 1 304 ? 53.800 19.610 183.020 1.00 15.00 ? 336 LEU B C   1 
ATOM   6980 O  O   . LEU B 1 304 ? 54.970 19.460 183.310 1.00 15.00 ? 336 LEU B O   1 
ATOM   6981 C  CB  . LEU B 1 304 ? 53.400 19.640 180.640 1.00 15.00 ? 336 LEU B CB  1 
ATOM   6982 C  CG  . LEU B 1 304 ? 53.710 18.870 179.390 1.00 15.00 ? 336 LEU B CG  1 
ATOM   6983 C  CD1 . LEU B 1 304 ? 52.560 17.990 178.990 1.00 15.00 ? 336 LEU B CD1 1 
ATOM   6984 C  CD2 . LEU B 1 304 ? 53.960 19.850 178.270 1.00 15.00 ? 336 LEU B CD2 1 
ATOM   6985 N  N   . ILE B 1 305 ? 53.000 20.410 183.700 1.00 15.00 ? 337 ILE B N   1 
ATOM   6986 C  CA  . ILE B 1 305 ? 53.480 21.080 184.880 1.00 15.00 ? 337 ILE B CA  1 
ATOM   6987 C  C   . ILE B 1 305 ? 53.820 19.980 185.860 1.00 15.00 ? 337 ILE B C   1 
ATOM   6988 O  O   . ILE B 1 305 ? 54.950 19.960 186.330 1.00 15.00 ? 337 ILE B O   1 
ATOM   6989 C  CB  . ILE B 1 305 ? 52.410 22.000 185.490 1.00 15.00 ? 337 ILE B CB  1 
ATOM   6990 C  CG1 . ILE B 1 305 ? 52.160 23.190 184.590 1.00 15.00 ? 337 ILE B CG1 1 
ATOM   6991 C  CG2 . ILE B 1 305 ? 52.880 22.560 186.800 1.00 15.00 ? 337 ILE B CG2 1 
ATOM   6992 C  CD1 . ILE B 1 305 ? 50.940 24.050 184.950 1.00 15.00 ? 337 ILE B CD1 1 
ATOM   6993 N  N   . GLY B 1 306 ? 52.970 19.000 186.110 1.00 15.00 ? 338 GLY B N   1 
ATOM   6994 C  CA  . GLY B 1 306 ? 53.270 17.900 187.020 1.00 15.00 ? 338 GLY B CA  1 
ATOM   6995 C  C   . GLY B 1 306 ? 54.560 17.180 186.680 1.00 15.00 ? 338 GLY B C   1 
ATOM   6996 O  O   . GLY B 1 306 ? 55.360 16.860 187.550 1.00 15.00 ? 338 GLY B O   1 
ATOM   6997 N  N   . GLU B 1 307 ? 54.820 17.020 185.400 1.00 15.00 ? 339 GLU B N   1 
ATOM   6998 C  CA  . GLU B 1 307 ? 56.040 16.390 184.940 1.00 15.00 ? 339 GLU B CA  1 
ATOM   6999 C  C   . GLU B 1 307 ? 57.220 17.250 185.290 1.00 15.00 ? 339 GLU B C   1 
ATOM   7000 O  O   . GLU B 1 307 ? 58.080 16.780 186.020 1.00 15.00 ? 339 GLU B O   1 
ATOM   7001 C  CB  . GLU B 1 307 ? 56.030 16.180 183.460 1.00 15.00 ? 339 GLU B CB  1 
ATOM   7002 C  CG  . GLU B 1 307 ? 55.030 15.110 183.070 1.00 15.00 ? 339 GLU B CG  1 
ATOM   7003 C  CD  . GLU B 1 307 ? 55.090 14.770 181.590 1.00 15.00 ? 339 GLU B CD  1 
ATOM   7004 O  OE1 . GLU B 1 307 ? 54.740 15.620 180.780 1.00 15.00 ? 339 GLU B OE1 1 
ATOM   7005 O  OE2 . GLU B 1 307 ? 55.490 13.650 181.240 1.00 15.00 ? 339 GLU B OE2 1 
ATOM   7006 N  N   . THR B 1 308 ? 57.240 18.500 184.830 1.00 15.00 ? 340 THR B N   1 
ATOM   7007 C  CA  . THR B 1 308 ? 58.320 19.420 185.120 1.00 15.00 ? 340 THR B CA  1 
ATOM   7008 C  C   . THR B 1 308 ? 58.680 19.450 186.590 1.00 15.00 ? 340 THR B C   1 
ATOM   7009 O  O   . THR B 1 308 ? 59.840 19.310 186.960 1.00 15.00 ? 340 THR B O   1 
ATOM   7010 C  CB  . THR B 1 308 ? 57.940 20.810 184.700 1.00 15.00 ? 340 THR B CB  1 
ATOM   7011 O  OG1 . THR B 1 308 ? 57.520 20.700 183.350 1.00 15.00 ? 340 THR B OG1 1 
ATOM   7012 C  CG2 . THR B 1 308 ? 59.070 21.800 184.710 1.00 15.00 ? 340 THR B CG2 1 
ATOM   7013 N  N   . ILE B 1 309 ? 57.710 19.520 187.460 1.00 15.00 ? 341 ILE B N   1 
ATOM   7014 C  CA  . ILE B 1 309 ? 57.990 19.650 188.880 1.00 15.00 ? 341 ILE B CA  1 
ATOM   7015 C  C   . ILE B 1 309 ? 58.410 18.310 189.460 1.00 15.00 ? 341 ILE B C   1 
ATOM   7016 O  O   . ILE B 1 309 ? 59.050 18.300 190.510 1.00 15.00 ? 341 ILE B O   1 
ATOM   7017 C  CB  . ILE B 1 309 ? 56.690 20.330 189.440 1.00 15.00 ? 341 ILE B CB  1 
ATOM   7018 C  CG1 . ILE B 1 309 ? 56.970 21.100 190.700 1.00 15.00 ? 341 ILE B CG1 1 
ATOM   7019 C  CG2 . ILE B 1 309 ? 55.660 19.270 189.690 1.00 15.00 ? 341 ILE B CG2 1 
ATOM   7020 C  CD1 . ILE B 1 309 ? 57.170 20.300 192.000 1.00 15.00 ? 341 ILE B CD1 1 
ATOM   7021 N  N   . LYS B 1 310 ? 58.150 17.160 188.850 1.00 15.00 ? 342 LYS B N   1 
ATOM   7022 C  CA  . LYS B 1 310 ? 58.690 15.910 189.360 1.00 15.00 ? 342 LYS B CA  1 
ATOM   7023 C  C   . LYS B 1 310 ? 60.160 15.800 188.980 1.00 15.00 ? 342 LYS B C   1 
ATOM   7024 O  O   . LYS B 1 310 ? 61.010 15.530 189.830 1.00 15.00 ? 342 LYS B O   1 
ATOM   7025 C  CB  . LYS B 1 310 ? 57.990 14.720 188.790 1.00 15.00 ? 342 LYS B CB  1 
ATOM   7026 C  CG  . LYS B 1 310 ? 58.490 13.460 189.490 1.00 15.00 ? 342 LYS B CG  1 
ATOM   7027 C  CD  . LYS B 1 310 ? 58.060 12.240 188.730 1.00 15.00 ? 342 LYS B CD  1 
ATOM   7028 C  CE  . LYS B 1 310 ? 58.510 10.970 189.440 1.00 15.00 ? 342 LYS B CE  1 
ATOM   7029 N  NZ  . LYS B 1 310 ? 57.850 10.800 190.730 1.00 15.00 ? 342 LYS B NZ  1 
ATOM   7030 N  N   . ILE B 1 311 ? 60.450 15.980 187.690 1.00 15.00 ? 343 ILE B N   1 
ATOM   7031 C  CA  . ILE B 1 311 ? 61.790 15.900 187.140 1.00 15.00 ? 343 ILE B CA  1 
ATOM   7032 C  C   . ILE B 1 311 ? 62.720 16.830 187.880 1.00 15.00 ? 343 ILE B C   1 
ATOM   7033 O  O   . ILE B 1 311 ? 63.870 16.470 188.150 1.00 15.00 ? 343 ILE B O   1 
ATOM   7034 C  CB  . ILE B 1 311 ? 61.750 16.250 185.650 1.00 15.00 ? 343 ILE B CB  1 
ATOM   7035 C  CG1 . ILE B 1 311 ? 61.190 15.050 184.940 1.00 15.00 ? 343 ILE B CG1 1 
ATOM   7036 C  CG2 . ILE B 1 311 ? 63.100 16.590 185.070 1.00 15.00 ? 343 ILE B CG2 1 
ATOM   7037 C  CD1 . ILE B 1 311 ? 61.100 15.170 183.410 1.00 15.00 ? 343 ILE B CD1 1 
ATOM   7038 N  N   . VAL B 1 312 ? 62.230 18.010 188.250 1.00 15.00 ? 344 VAL B N   1 
ATOM   7039 C  CA  . VAL B 1 312 ? 63.060 18.930 188.980 1.00 15.00 ? 344 VAL B CA  1 
ATOM   7040 C  C   . VAL B 1 312 ? 63.370 18.360 190.340 1.00 15.00 ? 344 VAL B C   1 
ATOM   7041 O  O   . VAL B 1 312 ? 64.550 18.320 190.680 1.00 15.00 ? 344 VAL B O   1 
ATOM   7042 C  CB  . VAL B 1 312 ? 62.340 20.280 189.120 1.00 15.00 ? 344 VAL B CB  1 
ATOM   7043 C  CG1 . VAL B 1 312 ? 63.040 21.210 190.080 1.00 15.00 ? 344 VAL B CG1 1 
ATOM   7044 C  CG2 . VAL B 1 312 ? 62.390 21.000 187.780 1.00 15.00 ? 344 VAL B CG2 1 
ATOM   7045 N  N   . ILE B 1 313 ? 62.430 17.830 191.110 1.00 15.00 ? 345 ILE B N   1 
ATOM   7046 C  CA  . ILE B 1 313 ? 62.770 17.360 192.430 1.00 15.00 ? 345 ILE B CA  1 
ATOM   7047 C  C   . ILE B 1 313 ? 63.590 16.080 192.370 1.00 15.00 ? 345 ILE B C   1 
ATOM   7048 O  O   . ILE B 1 313 ? 64.710 16.030 192.850 1.00 15.00 ? 345 ILE B O   1 
ATOM   7049 C  CB  . ILE B 1 313 ? 61.460 17.190 193.240 1.00 15.00 ? 345 ILE B CB  1 
ATOM   7050 C  CG1 . ILE B 1 313 ? 61.000 18.570 193.610 1.00 15.00 ? 345 ILE B CG1 1 
ATOM   7051 C  CG2 . ILE B 1 313 ? 61.640 16.380 194.530 1.00 15.00 ? 345 ILE B CG2 1 
ATOM   7052 C  CD1 . ILE B 1 313 ? 59.590 18.670 194.170 1.00 15.00 ? 345 ILE B CD1 1 
ATOM   7053 N  N   . GLU B 1 314 ? 63.090 15.050 191.710 1.00 15.00 ? 346 GLU B N   1 
ATOM   7054 C  CA  . GLU B 1 314 ? 63.780 13.790 191.760 1.00 15.00 ? 346 GLU B CA  1 
ATOM   7055 C  C   . GLU B 1 314 ? 65.020 13.680 190.890 1.00 15.00 ? 346 GLU B C   1 
ATOM   7056 O  O   . GLU B 1 314 ? 65.860 12.820 191.150 1.00 15.00 ? 346 GLU B O   1 
ATOM   7057 C  CB  . GLU B 1 314 ? 62.750 12.730 191.420 1.00 15.00 ? 346 GLU B CB  1 
ATOM   7058 C  CG  . GLU B 1 314 ? 61.620 12.680 192.460 1.00 15.00 ? 346 GLU B CG  1 
ATOM   7059 C  CD  . GLU B 1 314 ? 60.840 11.360 192.570 1.00 15.00 ? 346 GLU B CD  1 
ATOM   7060 O  OE1 . GLU B 1 314 ? 61.410 10.300 192.390 1.00 15.00 ? 346 GLU B OE1 1 
ATOM   7061 O  OE2 . GLU B 1 314 ? 59.650 11.390 192.870 1.00 15.00 ? 346 GLU B OE2 1 
ATOM   7062 N  N   . GLU B 1 315 ? 65.230 14.490 189.860 1.00 15.00 ? 347 GLU B N   1 
ATOM   7063 C  CA  . GLU B 1 315 ? 66.420 14.340 189.060 1.00 15.00 ? 347 GLU B CA  1 
ATOM   7064 C  C   . GLU B 1 315 ? 67.280 15.590 189.080 1.00 15.00 ? 347 GLU B C   1 
ATOM   7065 O  O   . GLU B 1 315 ? 68.430 15.500 189.500 1.00 15.00 ? 347 GLU B O   1 
ATOM   7066 C  CB  . GLU B 1 315 ? 66.030 14.010 187.640 1.00 15.00 ? 347 GLU B CB  1 
ATOM   7067 C  CG  . GLU B 1 315 ? 65.710 12.540 187.450 1.00 15.00 ? 347 GLU B CG  1 
ATOM   7068 C  CD  . GLU B 1 315 ? 65.230 12.160 186.060 1.00 15.00 ? 347 GLU B CD  1 
ATOM   7069 O  OE1 . GLU B 1 315 ? 64.230 12.740 185.640 1.00 15.00 ? 347 GLU B OE1 1 
ATOM   7070 O  OE2 . GLU B 1 315 ? 65.820 11.320 185.390 1.00 15.00 ? 347 GLU B OE2 1 
ATOM   7071 N  N   . TYR B 1 316 ? 66.810 16.790 188.720 1.00 15.00 ? 348 TYR B N   1 
ATOM   7072 C  CA  . TYR B 1 316 ? 67.610 17.990 188.700 1.00 15.00 ? 348 TYR B CA  1 
ATOM   7073 C  C   . TYR B 1 316 ? 68.170 18.310 190.050 1.00 15.00 ? 348 TYR B C   1 
ATOM   7074 O  O   . TYR B 1 316 ? 69.380 18.330 190.190 1.00 15.00 ? 348 TYR B O   1 
ATOM   7075 C  CB  . TYR B 1 316 ? 66.770 19.110 188.200 1.00 15.00 ? 348 TYR B CB  1 
ATOM   7076 C  CG  . TYR B 1 316 ? 67.280 20.540 188.140 1.00 15.00 ? 348 TYR B CG  1 
ATOM   7077 C  CD1 . TYR B 1 316 ? 67.160 21.370 189.230 1.00 15.00 ? 348 TYR B CD1 1 
ATOM   7078 C  CD2 . TYR B 1 316 ? 67.720 21.050 186.950 1.00 15.00 ? 348 TYR B CD2 1 
ATOM   7079 C  CE1 . TYR B 1 316 ? 67.470 22.710 189.130 1.00 15.00 ? 348 TYR B CE1 1 
ATOM   7080 C  CE2 . TYR B 1 316 ? 68.030 22.390 186.840 1.00 15.00 ? 348 TYR B CE2 1 
ATOM   7081 C  CZ  . TYR B 1 316 ? 67.890 23.210 187.930 1.00 15.00 ? 348 TYR B CZ  1 
ATOM   7082 O  OH  . TYR B 1 316 ? 68.110 24.560 187.790 1.00 15.00 ? 348 TYR B OH  1 
ATOM   7083 N  N   . VAL B 1 317 ? 67.360 18.510 191.080 1.00 15.00 ? 349 VAL B N   1 
ATOM   7084 C  CA  . VAL B 1 317 ? 67.850 18.830 192.430 1.00 15.00 ? 349 VAL B CA  1 
ATOM   7085 C  C   . VAL B 1 317 ? 68.650 17.660 193.040 1.00 15.00 ? 349 VAL B C   1 
ATOM   7086 O  O   . VAL B 1 317 ? 69.580 17.850 193.830 1.00 15.00 ? 349 VAL B O   1 
ATOM   7087 C  CB  . VAL B 1 317 ? 66.640 19.220 193.290 1.00 15.00 ? 349 VAL B CB  1 
ATOM   7088 C  CG1 . VAL B 1 317 ? 66.980 19.460 194.750 1.00 15.00 ? 349 VAL B CG1 1 
ATOM   7089 C  CG2 . VAL B 1 317 ? 66.080 20.510 192.730 1.00 15.00 ? 349 VAL B CG2 1 
ATOM   7090 N  N   . GLN B 1 318 ? 68.330 16.430 192.680 1.00 15.00 ? 350 GLN B N   1 
ATOM   7091 C  CA  . GLN B 1 318 ? 69.090 15.290 193.160 1.00 15.00 ? 350 GLN B CA  1 
ATOM   7092 C  C   . GLN B 1 318 ? 70.460 15.350 192.520 1.00 15.00 ? 350 GLN B C   1 
ATOM   7093 O  O   . GLN B 1 318 ? 71.430 14.960 193.160 1.00 15.00 ? 350 GLN B O   1 
ATOM   7094 C  CB  . GLN B 1 318 ? 68.360 14.010 192.800 1.00 15.00 ? 350 GLN B CB  1 
ATOM   7095 C  CG  . GLN B 1 318 ? 68.920 12.710 193.350 1.00 15.00 ? 350 GLN B CG  1 
ATOM   7096 C  CD  . GLN B 1 318 ? 68.650 12.470 194.820 1.00 15.00 ? 350 GLN B CD  1 
ATOM   7097 O  OE1 . GLN B 1 318 ? 67.550 12.040 195.190 1.00 15.00 ? 350 GLN B OE1 1 
ATOM   7098 N  NE2 . GLN B 1 318 ? 69.580 12.650 195.730 1.00 15.00 ? 350 GLN B NE2 1 
ATOM   7099 N  N   . GLN B 1 319 ? 70.620 15.840 191.280 1.00 15.00 ? 351 GLN B N   1 
ATOM   7100 C  CA  . GLN B 1 319 ? 71.930 15.940 190.680 1.00 15.00 ? 351 GLN B CA  1 
ATOM   7101 C  C   . GLN B 1 319 ? 72.710 17.030 191.370 1.00 15.00 ? 351 GLN B C   1 
ATOM   7102 O  O   . GLN B 1 319 ? 73.750 16.680 191.910 1.00 15.00 ? 351 GLN B O   1 
ATOM   7103 C  CB  . GLN B 1 319 ? 71.930 16.360 189.230 1.00 15.00 ? 351 GLN B CB  1 
ATOM   7104 C  CG  . GLN B 1 319 ? 72.900 15.500 188.420 1.00 15.00 ? 351 GLN B CG  1 
ATOM   7105 C  CD  . GLN B 1 319 ? 74.350 15.500 188.890 1.00 15.00 ? 351 GLN B CD  1 
ATOM   7106 O  OE1 . GLN B 1 319 ? 75.030 16.530 188.810 1.00 15.00 ? 351 GLN B OE1 1 
ATOM   7107 N  NE2 . GLN B 1 319 ? 74.850 14.390 189.420 1.00 15.00 ? 351 GLN B NE2 1 
ATOM   7108 N  N   . LEU B 1 320 ? 72.260 18.280 191.450 1.00 15.00 ? 352 LEU B N   1 
ATOM   7109 C  CA  . LEU B 1 320 ? 73.130 19.210 192.120 1.00 15.00 ? 352 LEU B CA  1 
ATOM   7110 C  C   . LEU B 1 320 ? 73.150 19.170 193.630 1.00 15.00 ? 352 LEU B C   1 
ATOM   7111 O  O   . LEU B 1 320 ? 74.010 19.840 194.180 1.00 15.00 ? 352 LEU B O   1 
ATOM   7112 C  CB  . LEU B 1 320 ? 72.850 20.650 191.680 1.00 15.00 ? 352 LEU B CB  1 
ATOM   7113 C  CG  . LEU B 1 320 ? 71.550 21.400 191.630 1.00 15.00 ? 352 LEU B CG  1 
ATOM   7114 C  CD1 . LEU B 1 320 ? 70.840 21.480 192.930 1.00 15.00 ? 352 LEU B CD1 1 
ATOM   7115 C  CD2 . LEU B 1 320 ? 71.920 22.800 191.240 1.00 15.00 ? 352 LEU B CD2 1 
ATOM   7116 N  N   . SER B 1 321 ? 72.330 18.460 194.380 1.00 15.00 ? 353 SER B N   1 
ATOM   7117 C  CA  . SER B 1 321 ? 72.560 18.420 195.810 1.00 15.00 ? 353 SER B CA  1 
ATOM   7118 C  C   . SER B 1 321 ? 73.680 17.430 196.110 1.00 15.00 ? 353 SER B C   1 
ATOM   7119 O  O   . SER B 1 321 ? 74.540 17.640 196.950 1.00 15.00 ? 353 SER B O   1 
ATOM   7120 C  CB  . SER B 1 321 ? 71.300 17.990 196.540 1.00 15.00 ? 353 SER B CB  1 
ATOM   7121 O  OG  . SER B 1 321 ? 70.810 16.730 196.110 1.00 15.00 ? 353 SER B OG  1 
ATOM   7122 N  N   . GLY B 1 322 ? 73.580 16.300 195.390 1.00 15.00 ? 354 GLY B N   1 
ATOM   7123 C  CA  . GLY B 1 322 ? 74.500 15.190 195.480 1.00 15.00 ? 354 GLY B CA  1 
ATOM   7124 C  C   . GLY B 1 322 ? 74.280 14.370 196.750 1.00 15.00 ? 354 GLY B C   1 
ATOM   7125 O  O   . GLY B 1 322 ? 75.170 13.650 197.200 1.00 15.00 ? 354 GLY B O   1 
ATOM   7126 N  N   . TYR B 1 323 ? 73.090 14.490 197.330 1.00 15.00 ? 355 TYR B N   1 
ATOM   7127 C  CA  . TYR B 1 323 ? 72.770 13.780 198.550 1.00 15.00 ? 355 TYR B CA  1 
ATOM   7128 C  C   . TYR B 1 323 ? 72.500 12.340 198.200 1.00 15.00 ? 355 TYR B C   1 
ATOM   7129 O  O   . TYR B 1 323 ? 72.010 12.020 197.110 1.00 15.00 ? 355 TYR B O   1 
ATOM   7130 C  CB  . TYR B 1 323 ? 71.500 14.320 199.210 1.00 15.00 ? 355 TYR B CB  1 
ATOM   7131 C  CG  . TYR B 1 323 ? 71.480 15.780 199.640 1.00 15.00 ? 355 TYR B CG  1 
ATOM   7132 C  CD1 . TYR B 1 323 ? 72.550 16.630 199.510 1.00 15.00 ? 355 TYR B CD1 1 
ATOM   7133 C  CD2 . TYR B 1 323 ? 70.310 16.270 200.200 1.00 15.00 ? 355 TYR B CD2 1 
ATOM   7134 C  CE1 . TYR B 1 323 ? 72.470 17.940 199.920 1.00 15.00 ? 355 TYR B CE1 1 
ATOM   7135 C  CE2 . TYR B 1 323 ? 70.220 17.570 200.620 1.00 15.00 ? 355 TYR B CE2 1 
ATOM   7136 C  CZ  . TYR B 1 323 ? 71.300 18.420 200.480 1.00 15.00 ? 355 TYR B CZ  1 
ATOM   7137 O  OH  . TYR B 1 323 ? 71.210 19.730 200.890 1.00 15.00 ? 355 TYR B OH  1 
ATOM   7138 N  N   . PHE B 1 324 ? 72.790 11.420 199.110 1.00 15.00 ? 356 PHE B N   1 
ATOM   7139 C  CA  . PHE B 1 324 ? 72.440 10.040 198.890 1.00 15.00 ? 356 PHE B CA  1 
ATOM   7140 C  C   . PHE B 1 324 ? 71.020 9.800  199.330 1.00 15.00 ? 356 PHE B C   1 
ATOM   7141 O  O   . PHE B 1 324 ? 70.500 8.700  199.180 1.00 15.00 ? 356 PHE B O   1 
ATOM   7142 C  CB  . PHE B 1 324 ? 73.390 9.150  199.650 1.00 15.00 ? 356 PHE B CB  1 
ATOM   7143 C  CG  . PHE B 1 324 ? 74.830 9.260  199.160 1.00 15.00 ? 356 PHE B CG  1 
ATOM   7144 C  CD1 . PHE B 1 324 ? 75.130 9.170  197.800 1.00 15.00 ? 356 PHE B CD1 1 
ATOM   7145 C  CD2 . PHE B 1 324 ? 75.850 9.480  200.080 1.00 15.00 ? 356 PHE B CD2 1 
ATOM   7146 C  CE1 . PHE B 1 324 ? 76.430 9.300  197.380 1.00 15.00 ? 356 PHE B CE1 1 
ATOM   7147 C  CE2 . PHE B 1 324 ? 77.160 9.610  199.640 1.00 15.00 ? 356 PHE B CE2 1 
ATOM   7148 C  CZ  . PHE B 1 324 ? 77.440 9.510  198.300 1.00 15.00 ? 356 PHE B CZ  1 
ATOM   7149 N  N   . LEU B 1 325 ? 70.350 10.790 199.940 1.00 15.00 ? 357 LEU B N   1 
ATOM   7150 C  CA  . LEU B 1 325 ? 68.950 10.650 200.260 1.00 15.00 ? 357 LEU B CA  1 
ATOM   7151 C  C   . LEU B 1 325 ? 68.220 10.620 198.920 1.00 15.00 ? 357 LEU B C   1 
ATOM   7152 O  O   . LEU B 1 325 ? 68.580 11.390 198.030 1.00 15.00 ? 357 LEU B O   1 
ATOM   7153 C  CB  . LEU B 1 325 ? 68.490 11.840 201.080 1.00 15.00 ? 357 LEU B CB  1 
ATOM   7154 C  CG  . LEU B 1 325 ? 67.030 11.900 201.480 1.00 15.00 ? 357 LEU B CG  1 
ATOM   7155 C  CD1 . LEU B 1 325 ? 66.580 10.650 202.210 1.00 15.00 ? 357 LEU B CD1 1 
ATOM   7156 C  CD2 . LEU B 1 325 ? 66.840 13.100 202.340 1.00 15.00 ? 357 LEU B CD2 1 
ATOM   7157 N  N   . GLN B 1 326 ? 67.280 9.740  198.710 1.00 15.00 ? 358 GLN B N   1 
ATOM   7158 C  CA  . GLN B 1 326 ? 66.530 9.730  197.480 1.00 15.00 ? 358 GLN B CA  1 
ATOM   7159 C  C   . GLN B 1 326 ? 65.380 10.680 197.700 1.00 15.00 ? 358 GLN B C   1 
ATOM   7160 O  O   . GLN B 1 326 ? 64.480 10.430 198.480 1.00 15.00 ? 358 GLN B O   1 
ATOM   7161 C  CB  . GLN B 1 326 ? 65.940 8.390  197.190 1.00 15.00 ? 358 GLN B CB  1 
ATOM   7162 C  CG  . GLN B 1 326 ? 65.960 8.210  195.680 1.00 15.00 ? 358 GLN B CG  1 
ATOM   7163 C  CD  . GLN B 1 326 ? 67.410 7.990  195.240 1.00 15.00 ? 358 GLN B CD  1 
ATOM   7164 O  OE1 . GLN B 1 326 ? 67.940 6.870  195.290 1.00 15.00 ? 358 GLN B OE1 1 
ATOM   7165 N  NE2 . GLN B 1 326 ? 68.160 9.010  194.820 1.00 15.00 ? 358 GLN B NE2 1 
ATOM   7166 N  N   . LEU B 1 327 ? 65.460 11.820 197.030 1.00 15.00 ? 359 LEU B N   1 
ATOM   7167 C  CA  . LEU B 1 327 ? 64.440 12.830 197.160 1.00 15.00 ? 359 LEU B CA  1 
ATOM   7168 C  C   . LEU B 1 327 ? 63.180 12.350 196.460 1.00 15.00 ? 359 LEU B C   1 
ATOM   7169 O  O   . LEU B 1 327 ? 63.320 11.560 195.530 1.00 15.00 ? 359 LEU B O   1 
ATOM   7170 C  CB  . LEU B 1 327 ? 64.940 14.120 196.500 1.00 15.00 ? 359 LEU B CB  1 
ATOM   7171 C  CG  . LEU B 1 327 ? 66.240 14.740 196.980 1.00 15.00 ? 359 LEU B CG  1 
ATOM   7172 C  CD1 . LEU B 1 327 ? 66.350 16.090 196.320 1.00 15.00 ? 359 LEU B CD1 1 
ATOM   7173 C  CD2 . LEU B 1 327 ? 66.260 14.940 198.470 1.00 15.00 ? 359 LEU B CD2 1 
ATOM   7174 N  N   . LYS B 1 328 ? 61.970 12.760 196.870 1.00 15.00 ? 360 LYS B N   1 
ATOM   7175 C  CA  . LYS B 1 328 ? 60.770 12.410 196.130 1.00 15.00 ? 360 LYS B CA  1 
ATOM   7176 C  C   . LYS B 1 328 ? 59.760 13.520 196.100 1.00 15.00 ? 360 LYS B C   1 
ATOM   7177 O  O   . LYS B 1 328 ? 59.600 14.310 197.030 1.00 15.00 ? 360 LYS B O   1 
ATOM   7178 C  CB  . LYS B 1 328 ? 60.050 11.170 196.700 1.00 15.00 ? 360 LYS B CB  1 
ATOM   7179 C  CG  . LYS B 1 328 ? 59.360 11.340 198.050 1.00 15.00 ? 360 LYS B CG  1 
ATOM   7180 C  CD  . LYS B 1 328 ? 58.790 10.070 198.660 1.00 15.00 ? 360 LYS B CD  1 
ATOM   7181 C  CE  . LYS B 1 328 ? 57.670 9.450  197.850 1.00 15.00 ? 360 LYS B CE  1 
ATOM   7182 N  NZ  . LYS B 1 328 ? 56.860 8.630  198.730 1.00 15.00 ? 360 LYS B NZ  1 
ATOM   7183 N  N   . PHE B 1 329 ? 59.090 13.620 194.980 1.00 15.00 ? 361 PHE B N   1 
ATOM   7184 C  CA  . PHE B 1 329 ? 58.020 14.540 194.830 1.00 15.00 ? 361 PHE B CA  1 
ATOM   7185 C  C   . PHE B 1 329 ? 56.750 13.800 195.190 1.00 15.00 ? 361 PHE B C   1 
ATOM   7186 O  O   . PHE B 1 329 ? 56.240 13.020 194.400 1.00 15.00 ? 361 PHE B O   1 
ATOM   7187 C  CB  . PHE B 1 329 ? 58.010 14.990 193.400 1.00 15.00 ? 361 PHE B CB  1 
ATOM   7188 C  CG  . PHE B 1 329 ? 56.790 15.770 192.990 1.00 15.00 ? 361 PHE B CG  1 
ATOM   7189 C  CD1 . PHE B 1 329 ? 56.480 16.960 193.630 1.00 15.00 ? 361 PHE B CD1 1 
ATOM   7190 C  CD2 . PHE B 1 329 ? 56.010 15.290 191.980 1.00 15.00 ? 361 PHE B CD2 1 
ATOM   7191 C  CE1 . PHE B 1 329 ? 55.360 17.650 193.250 1.00 15.00 ? 361 PHE B CE1 1 
ATOM   7192 C  CE2 . PHE B 1 329 ? 54.900 16.010 191.610 1.00 15.00 ? 361 PHE B CE2 1 
ATOM   7193 C  CZ  . PHE B 1 329 ? 54.580 17.180 192.220 1.00 15.00 ? 361 PHE B CZ  1 
ATOM   7194 N  N   . ASP B 1 330 ? 56.260 13.970 196.420 1.00 15.00 ? 362 ASP B N   1 
ATOM   7195 C  CA  . ASP B 1 330 ? 54.990 13.410 196.790 1.00 15.00 ? 362 ASP B CA  1 
ATOM   7196 C  C   . ASP B 1 330 ? 54.300 14.540 197.500 1.00 15.00 ? 362 ASP B C   1 
ATOM   7197 O  O   . ASP B 1 330 ? 54.590 14.780 198.670 1.00 15.00 ? 362 ASP B O   1 
ATOM   7198 C  CB  . ASP B 1 330 ? 55.120 12.230 197.750 1.00 15.00 ? 362 ASP B CB  1 
ATOM   7199 C  CG  . ASP B 1 330 ? 53.810 11.510 198.090 1.00 15.00 ? 362 ASP B CG  1 
ATOM   7200 O  OD1 . ASP B 1 330 ? 52.790 11.770 197.430 1.00 15.00 ? 362 ASP B OD1 1 
ATOM   7201 O  OD2 . ASP B 1 330 ? 53.830 10.690 199.020 1.00 15.00 ? 362 ASP B OD2 1 
ATOM   7202 N  N   . PRO B 1 331 ? 53.390 15.270 196.860 1.00 15.00 ? 363 PRO B N   1 
ATOM   7203 C  CA  . PRO B 1 331 ? 52.690 16.410 197.420 1.00 15.00 ? 363 PRO B CA  1 
ATOM   7204 C  C   . PRO B 1 331 ? 52.010 16.080 198.730 1.00 15.00 ? 363 PRO B C   1 
ATOM   7205 O  O   . PRO B 1 331 ? 51.890 16.920 199.620 1.00 15.00 ? 363 PRO B O   1 
ATOM   7206 C  CB  . PRO B 1 331 ? 51.730 16.830 196.350 1.00 15.00 ? 363 PRO B CB  1 
ATOM   7207 C  CG  . PRO B 1 331 ? 52.510 16.520 195.120 1.00 15.00 ? 363 PRO B CG  1 
ATOM   7208 C  CD  . PRO B 1 331 ? 53.060 15.160 195.470 1.00 15.00 ? 363 PRO B CD  1 
ATOM   7209 N  N   . GLU B 1 332 ? 51.660 14.800 198.870 1.00 15.00 ? 364 GLU B N   1 
ATOM   7210 C  CA  . GLU B 1 332 ? 50.980 14.340 200.050 1.00 15.00 ? 364 GLU B CA  1 
ATOM   7211 C  C   . GLU B 1 332 ? 51.800 14.460 201.310 1.00 15.00 ? 364 GLU B C   1 
ATOM   7212 O  O   . GLU B 1 332 ? 51.230 14.470 202.390 1.00 15.00 ? 364 GLU B O   1 
ATOM   7213 C  CB  . GLU B 1 332 ? 50.570 12.890 199.890 1.00 15.00 ? 364 GLU B CB  1 
ATOM   7214 C  CG  . GLU B 1 332 ? 49.550 12.800 198.780 1.00 15.00 ? 364 GLU B CG  1 
ATOM   7215 C  CD  . GLU B 1 332 ? 48.820 11.480 198.540 1.00 15.00 ? 364 GLU B CD  1 
ATOM   7216 O  OE1 . GLU B 1 332 ? 49.220 10.430 199.060 1.00 15.00 ? 364 GLU B OE1 1 
ATOM   7217 O  OE2 . GLU B 1 332 ? 47.820 11.530 197.810 1.00 15.00 ? 364 GLU B OE2 1 
ATOM   7218 N  N   . LEU B 1 333 ? 53.120 14.630 201.250 1.00 15.00 ? 365 LEU B N   1 
ATOM   7219 C  CA  . LEU B 1 333 ? 53.900 14.790 202.470 1.00 15.00 ? 365 LEU B CA  1 
ATOM   7220 C  C   . LEU B 1 333 ? 53.490 16.080 203.150 1.00 15.00 ? 365 LEU B C   1 
ATOM   7221 O  O   . LEU B 1 333 ? 53.540 16.210 204.370 1.00 15.00 ? 365 LEU B O   1 
ATOM   7222 C  CB  . LEU B 1 333 ? 55.360 14.810 202.120 1.00 15.00 ? 365 LEU B CB  1 
ATOM   7223 C  CG  . LEU B 1 333 ? 55.880 13.580 201.440 1.00 15.00 ? 365 LEU B CG  1 
ATOM   7224 C  CD1 . LEU B 1 333 ? 57.200 13.880 200.760 1.00 15.00 ? 365 LEU B CD1 1 
ATOM   7225 C  CD2 . LEU B 1 333 ? 56.030 12.470 202.460 1.00 15.00 ? 365 LEU B CD2 1 
ATOM   7226 N  N   . LEU B 1 334 ? 53.010 17.050 202.380 1.00 15.00 ? 366 LEU B N   1 
ATOM   7227 C  CA  . LEU B 1 334 ? 52.640 18.300 202.970 1.00 15.00 ? 366 LEU B CA  1 
ATOM   7228 C  C   . LEU B 1 334 ? 51.200 18.460 203.370 1.00 15.00 ? 366 LEU B C   1 
ATOM   7229 O  O   . LEU B 1 334 ? 50.870 19.450 204.010 1.00 15.00 ? 366 LEU B O   1 
ATOM   7230 C  CB  . LEU B 1 334 ? 53.050 19.350 202.010 1.00 15.00 ? 366 LEU B CB  1 
ATOM   7231 C  CG  . LEU B 1 334 ? 54.250 20.180 202.420 1.00 15.00 ? 366 LEU B CG  1 
ATOM   7232 C  CD1 . LEU B 1 334 ? 55.180 19.450 203.360 1.00 15.00 ? 366 LEU B CD1 1 
ATOM   7233 C  CD2 . LEU B 1 334 ? 54.950 20.530 201.160 1.00 15.00 ? 366 LEU B CD2 1 
ATOM   7234 N  N   . PHE B 1 335 ? 50.350 17.460 203.150 1.00 15.00 ? 367 PHE B N   1 
ATOM   7235 C  CA  . PHE B 1 335 ? 48.950 17.610 203.480 1.00 15.00 ? 367 PHE B CA  1 
ATOM   7236 C  C   . PHE B 1 335 ? 48.710 17.660 204.960 1.00 15.00 ? 367 PHE B C   1 
ATOM   7237 O  O   . PHE B 1 335 ? 47.620 18.030 205.420 1.00 15.00 ? 367 PHE B O   1 
ATOM   7238 C  CB  . PHE B 1 335 ? 48.120 16.480 202.920 1.00 15.00 ? 367 PHE B CB  1 
ATOM   7239 C  CG  . PHE B 1 335 ? 48.000 16.470 201.420 1.00 15.00 ? 367 PHE B CG  1 
ATOM   7240 C  CD1 . PHE B 1 335 ? 48.630 17.400 200.610 1.00 15.00 ? 367 PHE B CD1 1 
ATOM   7241 C  CD2 . PHE B 1 335 ? 47.240 15.490 200.830 1.00 15.00 ? 367 PHE B CD2 1 
ATOM   7242 C  CE1 . PHE B 1 335 ? 48.520 17.340 199.230 1.00 15.00 ? 367 PHE B CE1 1 
ATOM   7243 C  CE2 . PHE B 1 335 ? 47.140 15.430 199.460 1.00 15.00 ? 367 PHE B CE2 1 
ATOM   7244 C  CZ  . PHE B 1 335 ? 47.780 16.350 198.650 1.00 15.00 ? 367 PHE B CZ  1 
ATOM   7245 N  N   . GLY B 1 336 ? 49.680 17.260 205.770 1.00 15.00 ? 368 GLY B N   1 
ATOM   7246 C  CA  . GLY B 1 336 ? 49.520 17.380 207.220 1.00 15.00 ? 368 GLY B CA  1 
ATOM   7247 C  C   . GLY B 1 336 ? 50.160 18.650 207.770 1.00 15.00 ? 368 GLY B C   1 
ATOM   7248 O  O   . GLY B 1 336 ? 49.980 18.980 208.950 1.00 15.00 ? 368 GLY B O   1 
ATOM   7249 N  N   . ALA B 1 337 ? 50.870 19.400 206.930 1.00 15.00 ? 369 ALA B N   1 
ATOM   7250 C  CA  . ALA B 1 337 ? 51.630 20.560 207.350 1.00 15.00 ? 369 ALA B CA  1 
ATOM   7251 C  C   . ALA B 1 337 ? 50.810 21.800 207.240 1.00 15.00 ? 369 ALA B C   1 
ATOM   7252 O  O   . ALA B 1 337 ? 49.710 21.810 206.690 1.00 15.00 ? 369 ALA B O   1 
ATOM   7253 C  CB  . ALA B 1 337 ? 52.860 20.760 206.500 1.00 15.00 ? 369 ALA B CB  1 
ATOM   7254 N  N   . GLN B 1 338 ? 51.340 22.880 207.800 1.00 15.00 ? 370 GLN B N   1 
ATOM   7255 C  CA  . GLN B 1 338 ? 50.700 24.160 207.660 1.00 15.00 ? 370 GLN B CA  1 
ATOM   7256 C  C   . GLN B 1 338 ? 51.580 24.740 206.580 1.00 15.00 ? 370 GLN B C   1 
ATOM   7257 O  O   . GLN B 1 338 ? 52.720 25.130 206.820 1.00 15.00 ? 370 GLN B O   1 
ATOM   7258 C  CB  . GLN B 1 338 ? 50.830 24.950 208.940 1.00 15.00 ? 370 GLN B CB  1 
ATOM   7259 C  CG  . GLN B 1 338 ? 50.040 24.310 210.060 1.00 15.00 ? 370 GLN B CG  1 
ATOM   7260 C  CD  . GLN B 1 338 ? 50.030 25.210 211.290 1.00 15.00 ? 370 GLN B CD  1 
ATOM   7261 O  OE1 . GLN B 1 338 ? 51.080 25.400 211.900 1.00 15.00 ? 370 GLN B OE1 1 
ATOM   7262 N  NE2 . GLN B 1 338 ? 48.900 25.780 211.680 1.00 15.00 ? 370 GLN B NE2 1 
ATOM   7263 N  N   . PHE B 1 339 ? 51.080 24.670 205.380 1.00 15.00 ? 371 PHE B N   1 
ATOM   7264 C  CA  . PHE B 1 339 ? 51.840 25.130 204.250 1.00 15.00 ? 371 PHE B CA  1 
ATOM   7265 C  C   . PHE B 1 339 ? 50.840 25.990 203.510 1.00 15.00 ? 371 PHE B C   1 
ATOM   7266 O  O   . PHE B 1 339 ? 49.640 25.750 203.510 1.00 15.00 ? 371 PHE B O   1 
ATOM   7267 C  CB  . PHE B 1 339 ? 52.290 23.940 203.430 1.00 15.00 ? 371 PHE B CB  1 
ATOM   7268 C  CG  . PHE B 1 339 ? 53.220 24.230 202.270 1.00 15.00 ? 371 PHE B CG  1 
ATOM   7269 C  CD1 . PHE B 1 339 ? 54.450 24.790 202.470 1.00 15.00 ? 371 PHE B CD1 1 
ATOM   7270 C  CD2 . PHE B 1 339 ? 52.830 23.900 200.990 1.00 15.00 ? 371 PHE B CD2 1 
ATOM   7271 C  CE1 . PHE B 1 339 ? 55.270 25.010 201.390 1.00 15.00 ? 371 PHE B CE1 1 
ATOM   7272 C  CE2 . PHE B 1 339 ? 53.670 24.130 199.930 1.00 15.00 ? 371 PHE B CE2 1 
ATOM   7273 C  CZ  . PHE B 1 339 ? 54.900 24.680 200.120 1.00 15.00 ? 371 PHE B CZ  1 
ATOM   7274 N  N   . GLN B 1 340 ? 51.340 27.050 202.920 1.00 15.00 ? 372 GLN B N   1 
ATOM   7275 C  CA  . GLN B 1 340 ? 50.510 27.910 202.130 1.00 15.00 ? 372 GLN B CA  1 
ATOM   7276 C  C   . GLN B 1 340 ? 50.880 27.530 200.730 1.00 15.00 ? 372 GLN B C   1 
ATOM   7277 O  O   . GLN B 1 340 ? 52.050 27.280 200.450 1.00 15.00 ? 372 GLN B O   1 
ATOM   7278 C  CB  . GLN B 1 340 ? 50.860 29.350 202.370 1.00 15.00 ? 372 GLN B CB  1 
ATOM   7279 C  CG  . GLN B 1 340 ? 50.280 29.900 203.630 1.00 15.00 ? 372 GLN B CG  1 
ATOM   7280 C  CD  . GLN B 1 340 ? 48.780 30.030 203.560 1.00 15.00 ? 372 GLN B CD  1 
ATOM   7281 O  OE1 . GLN B 1 340 ? 48.220 30.660 202.680 1.00 15.00 ? 372 GLN B OE1 1 
ATOM   7282 N  NE2 . GLN B 1 340 ? 48.110 29.420 204.510 1.00 15.00 ? 372 GLN B NE2 1 
ATOM   7283 N  N   . TYR B 1 341 ? 49.910 27.430 199.830 1.00 15.00 ? 373 TYR B N   1 
ATOM   7284 C  CA  . TYR B 1 341 ? 50.200 27.080 198.450 1.00 15.00 ? 373 TYR B CA  1 
ATOM   7285 C  C   . TYR B 1 341 ? 50.210 28.320 197.560 1.00 15.00 ? 373 TYR B C   1 
ATOM   7286 O  O   . TYR B 1 341 ? 49.250 28.560 196.820 1.00 15.00 ? 373 TYR B O   1 
ATOM   7287 C  CB  . TYR B 1 341 ? 49.150 26.060 198.010 1.00 15.00 ? 373 TYR B CB  1 
ATOM   7288 C  CG  . TYR B 1 341 ? 49.390 24.660 198.550 1.00 15.00 ? 373 TYR B CG  1 
ATOM   7289 C  CD1 . TYR B 1 341 ? 50.390 23.890 197.990 1.00 15.00 ? 373 TYR B CD1 1 
ATOM   7290 C  CD2 . TYR B 1 341 ? 48.660 24.160 199.590 1.00 15.00 ? 373 TYR B CD2 1 
ATOM   7291 C  CE1 . TYR B 1 341 ? 50.660 22.620 198.460 1.00 15.00 ? 373 TYR B CE1 1 
ATOM   7292 C  CE2 . TYR B 1 341 ? 48.940 22.890 200.060 1.00 15.00 ? 373 TYR B CE2 1 
ATOM   7293 C  CZ  . TYR B 1 341 ? 49.940 22.120 199.500 1.00 15.00 ? 373 TYR B CZ  1 
ATOM   7294 O  OH  . TYR B 1 341 ? 50.200 20.840 199.960 1.00 15.00 ? 373 TYR B OH  1 
ATOM   7295 N  N   . ARG B 1 342 ? 51.200 29.210 197.620 1.00 15.00 ? 374 ARG B N   1 
ATOM   7296 C  CA  . ARG B 1 342 ? 51.330 30.340 196.700 1.00 15.00 ? 374 ARG B CA  1 
ATOM   7297 C  C   . ARG B 1 342 ? 52.810 30.710 196.630 1.00 15.00 ? 374 ARG B C   1 
ATOM   7298 O  O   . ARG B 1 342 ? 53.530 30.420 197.580 1.00 15.00 ? 374 ARG B O   1 
ATOM   7299 C  CB  . ARG B 1 342 ? 50.540 31.580 197.140 1.00 15.00 ? 374 ARG B CB  1 
ATOM   7300 C  CG  . ARG B 1 342 ? 50.760 32.190 198.510 1.00 15.00 ? 374 ARG B CG  1 
ATOM   7301 C  CD  . ARG B 1 342 ? 50.210 33.610 198.570 1.00 15.00 ? 374 ARG B CD  1 
ATOM   7302 N  NE  . ARG B 1 342 ? 48.790 33.770 198.870 1.00 15.00 ? 374 ARG B NE  1 
ATOM   7303 C  CZ  . ARG B 1 342 ? 47.980 34.490 198.070 1.00 15.00 ? 374 ARG B CZ  1 
ATOM   7304 N  NH1 . ARG B 1 342 ? 48.430 35.040 196.920 1.00 15.00 ? 374 ARG B NH1 1 
ATOM   7305 N  NH2 . ARG B 1 342 ? 46.730 34.770 198.450 1.00 15.00 ? 374 ARG B NH2 1 
ATOM   7306 N  N   . ASN B 1 343 ? 53.320 31.330 195.560 1.00 15.00 ? 375 ASN B N   1 
ATOM   7307 C  CA  . ASN B 1 343 ? 54.740 31.680 195.510 1.00 15.00 ? 375 ASN B CA  1 
ATOM   7308 C  C   . ASN B 1 343 ? 54.930 33.040 194.870 1.00 15.00 ? 375 ASN B C   1 
ATOM   7309 O  O   . ASN B 1 343 ? 54.050 33.490 194.140 1.00 15.00 ? 375 ASN B O   1 
ATOM   7310 C  CB  . ASN B 1 343 ? 55.510 30.640 194.690 1.00 15.00 ? 375 ASN B CB  1 
ATOM   7311 C  CG  . ASN B 1 343 ? 57.010 30.800 194.870 1.00 15.00 ? 375 ASN B CG  1 
ATOM   7312 O  OD1 . ASN B 1 343 ? 57.800 30.690 193.940 1.00 15.00 ? 375 ASN B OD1 1 
ATOM   7313 N  ND2 . ASN B 1 343 ? 57.560 31.070 196.050 1.00 15.00 ? 375 ASN B ND2 1 
ATOM   7314 N  N   . ARG B 1 344 ? 55.990 33.760 195.190 1.00 15.00 ? 376 ARG B N   1 
ATOM   7315 C  CA  . ARG B 1 344 ? 56.260 35.060 194.600 1.00 15.00 ? 376 ARG B CA  1 
ATOM   7316 C  C   . ARG B 1 344 ? 57.770 35.020 194.390 1.00 15.00 ? 376 ARG B C   1 
ATOM   7317 O  O   . ARG B 1 344 ? 58.460 34.980 195.430 1.00 15.00 ? 376 ARG B O   1 
ATOM   7318 C  CB  . ARG B 1 344 ? 55.890 36.160 195.580 1.00 15.00 ? 376 ARG B CB  1 
ATOM   7319 C  CG  . ARG B 1 344 ? 55.880 37.560 195.020 1.00 15.00 ? 376 ARG B CG  1 
ATOM   7320 C  CD  . ARG B 1 344 ? 54.630 37.810 194.210 1.00 15.00 ? 376 ARG B CD  1 
ATOM   7321 N  NE  . ARG B 1 344 ? 53.750 38.760 194.870 1.00 15.00 ? 376 ARG B NE  1 
ATOM   7322 C  CZ  . ARG B 1 344 ? 52.510 38.420 195.230 1.00 15.00 ? 376 ARG B CZ  1 
ATOM   7323 N  NH1 . ARG B 1 344 ? 51.980 37.210 195.030 1.00 15.00 ? 376 ARG B NH1 1 
ATOM   7324 N  NH2 . ARG B 1 344 ? 51.770 39.320 195.870 1.00 15.00 ? 376 ARG B NH2 1 
ATOM   7325 N  N   . ILE B 1 345 ? 58.360 34.940 193.180 1.00 15.00 ? 377 ILE B N   1 
ATOM   7326 C  CA  . ILE B 1 345 ? 59.800 34.750 193.110 1.00 15.00 ? 377 ILE B CA  1 
ATOM   7327 C  C   . ILE B 1 345 ? 60.460 36.070 193.420 1.00 15.00 ? 377 ILE B C   1 
ATOM   7328 O  O   . ILE B 1 345 ? 60.070 37.140 192.980 1.00 15.00 ? 377 ILE B O   1 
ATOM   7329 C  CB  . ILE B 1 345 ? 60.370 34.210 191.730 1.00 15.00 ? 377 ILE B CB  1 
ATOM   7330 C  CG1 . ILE B 1 345 ? 60.200 35.130 190.550 1.00 15.00 ? 377 ILE B CG1 1 
ATOM   7331 C  CG2 . ILE B 1 345 ? 59.690 32.870 191.510 1.00 15.00 ? 377 ILE B CG2 1 
ATOM   7332 C  CD1 . ILE B 1 345 ? 58.860 35.160 189.800 1.00 15.00 ? 377 ILE B CD1 1 
ATOM   7333 N  N   . ALA B 1 346 ? 61.370 35.920 194.360 1.00 15.00 ? 378 ALA B N   1 
ATOM   7334 C  CA  . ALA B 1 346 ? 62.120 36.990 194.930 1.00 15.00 ? 378 ALA B CA  1 
ATOM   7335 C  C   . ALA B 1 346 ? 63.300 37.470 194.120 1.00 15.00 ? 378 ALA B C   1 
ATOM   7336 O  O   . ALA B 1 346 ? 64.040 36.670 193.550 1.00 15.00 ? 378 ALA B O   1 
ATOM   7337 C  CB  . ALA B 1 346 ? 62.650 36.580 196.270 1.00 15.00 ? 378 ALA B CB  1 
ATOM   7338 N  N   . MET B 1 347 ? 63.580 38.760 194.160 1.00 15.00 ? 379 MET B N   1 
ATOM   7339 C  CA  . MET B 1 347 ? 64.700 39.330 193.430 1.00 15.00 ? 379 MET B CA  1 
ATOM   7340 C  C   . MET B 1 347 ? 66.030 38.720 193.830 1.00 15.00 ? 379 MET B C   1 
ATOM   7341 O  O   . MET B 1 347 ? 66.910 38.540 193.000 1.00 15.00 ? 379 MET B O   1 
ATOM   7342 C  CB  . MET B 1 347 ? 64.760 40.820 193.650 1.00 15.00 ? 379 MET B CB  1 
ATOM   7343 C  CG  . MET B 1 347 ? 64.730 41.210 195.110 1.00 15.00 ? 379 MET B CG  1 
ATOM   7344 S  SD  . MET B 1 347 ? 64.890 42.980 195.330 1.00 15.00 ? 379 MET B SD  1 
ATOM   7345 C  CE  . MET B 1 347 ? 63.240 43.420 194.900 1.00 15.00 ? 379 MET B CE  1 
ATOM   7346 N  N   . GLU B 1 348 ? 66.150 38.340 195.090 1.00 15.00 ? 380 GLU B N   1 
ATOM   7347 C  CA  . GLU B 1 348 ? 67.380 37.750 195.570 1.00 15.00 ? 380 GLU B CA  1 
ATOM   7348 C  C   . GLU B 1 348 ? 67.480 36.400 194.920 1.00 15.00 ? 380 GLU B C   1 
ATOM   7349 O  O   . GLU B 1 348 ? 68.560 36.080 194.440 1.00 15.00 ? 380 GLU B O   1 
ATOM   7350 C  CB  . GLU B 1 348 ? 67.420 37.460 197.030 1.00 15.00 ? 380 GLU B CB  1 
ATOM   7351 C  CG  . GLU B 1 348 ? 67.350 38.720 197.790 1.00 15.00 ? 380 GLU B CG  1 
ATOM   7352 C  CD  . GLU B 1 348 ? 65.980 39.020 198.330 1.00 15.00 ? 380 GLU B CD  1 
ATOM   7353 O  OE1 . GLU B 1 348 ? 64.980 38.800 197.640 1.00 15.00 ? 380 GLU B OE1 1 
ATOM   7354 O  OE2 . GLU B 1 348 ? 65.880 39.470 199.470 1.00 15.00 ? 380 GLU B OE2 1 
ATOM   7355 N  N   . PHE B 1 349 ? 66.390 35.650 194.820 1.00 15.00 ? 381 PHE B N   1 
ATOM   7356 C  CA  . PHE B 1 349 ? 66.420 34.360 194.190 1.00 15.00 ? 381 PHE B CA  1 
ATOM   7357 C  C   . PHE B 1 349 ? 66.840 34.510 192.730 1.00 15.00 ? 381 PHE B C   1 
ATOM   7358 O  O   . PHE B 1 349 ? 67.520 33.640 192.190 1.00 15.00 ? 381 PHE B O   1 
ATOM   7359 C  CB  . PHE B 1 349 ? 65.060 33.720 194.270 1.00 15.00 ? 381 PHE B CB  1 
ATOM   7360 C  CG  . PHE B 1 349 ? 64.970 32.300 193.740 1.00 15.00 ? 381 PHE B CG  1 
ATOM   7361 C  CD1 . PHE B 1 349 ? 65.990 31.400 193.970 1.00 15.00 ? 381 PHE B CD1 1 
ATOM   7362 C  CD2 . PHE B 1 349 ? 63.860 31.920 193.040 1.00 15.00 ? 381 PHE B CD2 1 
ATOM   7363 C  CE1 . PHE B 1 349 ? 65.880 30.130 193.510 1.00 15.00 ? 381 PHE B CE1 1 
ATOM   7364 C  CE2 . PHE B 1 349 ? 63.760 30.630 192.580 1.00 15.00 ? 381 PHE B CE2 1 
ATOM   7365 C  CZ  . PHE B 1 349 ? 64.770 29.740 192.820 1.00 15.00 ? 381 PHE B CZ  1 
ATOM   7366 N  N   . ASN B 1 350 ? 66.520 35.610 192.090 1.00 15.00 ? 382 ASN B N   1 
ATOM   7367 C  CA  . ASN B 1 350 ? 66.970 35.860 190.740 1.00 15.00 ? 382 ASN B CA  1 
ATOM   7368 C  C   . ASN B 1 350 ? 68.470 36.060 190.750 1.00 15.00 ? 382 ASN B C   1 
ATOM   7369 O  O   . ASN B 1 350 ? 69.140 35.430 189.930 1.00 15.00 ? 382 ASN B O   1 
ATOM   7370 C  CB  . ASN B 1 350 ? 66.230 37.070 190.250 1.00 15.00 ? 382 ASN B CB  1 
ATOM   7371 C  CG  . ASN B 1 350 ? 66.670 37.510 188.890 1.00 15.00 ? 382 ASN B CG  1 
ATOM   7372 O  OD1 . ASN B 1 350 ? 67.790 37.930 188.720 1.00 15.00 ? 382 ASN B OD1 1 
ATOM   7373 N  ND2 . ASN B 1 350 ? 65.840 37.540 187.890 1.00 15.00 ? 382 ASN B ND2 1 
ATOM   7374 N  N   . GLN B 1 351 ? 69.070 36.830 191.650 1.00 15.00 ? 383 GLN B N   1 
ATOM   7375 C  CA  . GLN B 1 351 ? 70.520 37.010 191.690 1.00 15.00 ? 383 GLN B CA  1 
ATOM   7376 C  C   . GLN B 1 351 ? 71.250 35.680 191.850 1.00 15.00 ? 383 GLN B C   1 
ATOM   7377 O  O   . GLN B 1 351 ? 72.190 35.320 191.150 1.00 15.00 ? 383 GLN B O   1 
ATOM   7378 C  CB  . GLN B 1 351 ? 70.900 37.900 192.850 1.00 15.00 ? 383 GLN B CB  1 
ATOM   7379 C  CG  . GLN B 1 351 ? 70.180 39.220 192.950 1.00 15.00 ? 383 GLN B CG  1 
ATOM   7380 C  CD  . GLN B 1 351 ? 70.800 40.310 192.110 1.00 15.00 ? 383 GLN B CD  1 
ATOM   7381 O  OE1 . GLN B 1 351 ? 71.880 40.800 192.420 1.00 15.00 ? 383 GLN B OE1 1 
ATOM   7382 N  NE2 . GLN B 1 351 ? 70.180 40.780 191.050 1.00 15.00 ? 383 GLN B NE2 1 
ATOM   7383 N  N   . LEU B 1 352 ? 70.810 34.890 192.790 1.00 15.00 ? 384 LEU B N   1 
ATOM   7384 C  CA  . LEU B 1 352 ? 71.390 33.600 193.100 1.00 15.00 ? 384 LEU B CA  1 
ATOM   7385 C  C   . LEU B 1 352 ? 71.330 32.610 191.970 1.00 15.00 ? 384 LEU B C   1 
ATOM   7386 O  O   . LEU B 1 352 ? 72.190 31.760 191.820 1.00 15.00 ? 384 LEU B O   1 
ATOM   7387 C  CB  . LEU B 1 352 ? 70.650 33.130 194.330 1.00 15.00 ? 384 LEU B CB  1 
ATOM   7388 C  CG  . LEU B 1 352 ? 70.760 31.770 194.940 1.00 15.00 ? 384 LEU B CG  1 
ATOM   7389 C  CD1 . LEU B 1 352 ? 70.440 31.930 196.410 1.00 15.00 ? 384 LEU B CD1 1 
ATOM   7390 C  CD2 . LEU B 1 352 ? 69.800 30.800 194.320 1.00 15.00 ? 384 LEU B CD2 1 
ATOM   7391 N  N   . TYR B 1 353 ? 70.320 32.680 191.110 1.00 15.00 ? 385 TYR B N   1 
ATOM   7392 C  CA  . TYR B 1 353 ? 70.270 31.740 190.020 1.00 15.00 ? 385 TYR B CA  1 
ATOM   7393 C  C   . TYR B 1 353 ? 71.030 32.320 188.870 1.00 15.00 ? 385 TYR B C   1 
ATOM   7394 O  O   . TYR B 1 353 ? 70.960 31.790 187.780 1.00 15.00 ? 385 TYR B O   1 
ATOM   7395 C  CB  . TYR B 1 353 ? 68.850 31.480 189.600 1.00 15.00 ? 385 TYR B CB  1 
ATOM   7396 C  CG  . TYR B 1 353 ? 68.460 30.010 189.720 1.00 15.00 ? 385 TYR B CG  1 
ATOM   7397 C  CD1 . TYR B 1 353 ? 68.730 29.090 188.720 1.00 15.00 ? 385 TYR B CD1 1 
ATOM   7398 C  CD2 . TYR B 1 353 ? 67.760 29.580 190.830 1.00 15.00 ? 385 TYR B CD2 1 
ATOM   7399 C  CE1 . TYR B 1 353 ? 68.320 27.780 188.820 1.00 15.00 ? 385 TYR B CE1 1 
ATOM   7400 C  CE2 . TYR B 1 353 ? 67.360 28.270 190.940 1.00 15.00 ? 385 TYR B CE2 1 
ATOM   7401 C  CZ  . TYR B 1 353 ? 67.640 27.390 189.940 1.00 15.00 ? 385 TYR B CZ  1 
ATOM   7402 O  OH  . TYR B 1 353 ? 67.210 26.090 190.070 1.00 15.00 ? 385 TYR B OH  1 
ATOM   7403 N  N   . HIS B 1 354 ? 71.810 33.370 189.030 1.00 15.00 ? 386 HIS B N   1 
ATOM   7404 C  CA  . HIS B 1 354 ? 72.650 33.900 187.970 1.00 15.00 ? 386 HIS B CA  1 
ATOM   7405 C  C   . HIS B 1 354 ? 73.860 33.060 187.690 1.00 15.00 ? 386 HIS B C   1 
ATOM   7406 O  O   . HIS B 1 354 ? 74.940 33.590 187.390 1.00 15.00 ? 386 HIS B O   1 
ATOM   7407 C  CB  . HIS B 1 354 ? 73.140 35.250 188.320 1.00 15.00 ? 386 HIS B CB  1 
ATOM   7408 C  CG  . HIS B 1 354 ? 72.170 36.100 187.610 1.00 15.00 ? 386 HIS B CG  1 
ATOM   7409 N  ND1 . HIS B 1 354 ? 71.010 36.580 188.170 1.00 15.00 ? 386 HIS B ND1 1 
ATOM   7410 C  CD2 . HIS B 1 354 ? 72.350 36.500 186.300 1.00 15.00 ? 386 HIS B CD2 1 
ATOM   7411 C  CE1 . HIS B 1 354 ? 70.500 37.330 187.190 1.00 15.00 ? 386 HIS B CE1 1 
ATOM   7412 N  NE2 . HIS B 1 354 ? 71.230 37.300 186.120 1.00 15.00 ? 386 HIS B NE2 1 
ATOM   7413 N  N   . TRP B 1 355 ? 73.720 31.750 187.680 1.00 15.00 ? 387 TRP B N   1 
ATOM   7414 C  CA  . TRP B 1 355 ? 74.880 30.960 187.610 1.00 15.00 ? 387 TRP B CA  1 
ATOM   7415 C  C   . TRP B 1 355 ? 75.350 30.430 186.230 1.00 15.00 ? 387 TRP B C   1 
ATOM   7416 O  O   . TRP B 1 355 ? 75.410 29.290 185.820 1.00 15.00 ? 387 TRP B O   1 
ATOM   7417 C  CB  . TRP B 1 355 ? 74.630 29.920 188.730 1.00 15.00 ? 387 TRP B CB  1 
ATOM   7418 C  CG  . TRP B 1 355 ? 73.580 28.830 188.760 1.00 15.00 ? 387 TRP B CG  1 
ATOM   7419 C  CD1 . TRP B 1 355 ? 73.230 28.120 187.640 1.00 15.00 ? 387 TRP B CD1 1 
ATOM   7420 C  CD2 . TRP B 1 355 ? 73.010 28.310 189.880 1.00 15.00 ? 387 TRP B CD2 1 
ATOM   7421 N  NE1 . TRP B 1 355 ? 72.460 27.140 188.050 1.00 15.00 ? 387 TRP B NE1 1 
ATOM   7422 C  CE2 . TRP B 1 355 ? 72.300 27.220 189.360 1.00 15.00 ? 387 TRP B CE2 1 
ATOM   7423 C  CE3 . TRP B 1 355 ? 72.970 28.560 191.210 1.00 15.00 ? 387 TRP B CE3 1 
ATOM   7424 C  CZ2 . TRP B 1 355 ? 71.570 26.340 190.100 1.00 15.00 ? 387 TRP B CZ2 1 
ATOM   7425 C  CZ3 . TRP B 1 355 ? 72.230 27.680 191.980 1.00 15.00 ? 387 TRP B CZ3 1 
ATOM   7426 C  CH2 . TRP B 1 355 ? 71.530 26.600 191.440 1.00 15.00 ? 387 TRP B CH2 1 
ATOM   7427 N  N   . HIS B 1 356 ? 75.920 31.480 185.640 1.00 15.00 ? 388 HIS B N   1 
ATOM   7428 C  CA  . HIS B 1 356 ? 76.600 31.440 184.360 1.00 15.00 ? 388 HIS B CA  1 
ATOM   7429 C  C   . HIS B 1 356 ? 77.930 30.710 184.320 1.00 15.00 ? 388 HIS B C   1 
ATOM   7430 O  O   . HIS B 1 356 ? 78.300 30.330 183.220 1.00 15.00 ? 388 HIS B O   1 
ATOM   7431 C  CB  . HIS B 1 356 ? 76.800 32.850 183.900 1.00 15.00 ? 388 HIS B CB  1 
ATOM   7432 C  CG  . HIS B 1 356 ? 75.490 33.560 183.610 1.00 15.00 ? 388 HIS B CG  1 
ATOM   7433 N  ND1 . HIS B 1 356 ? 74.730 34.240 184.550 1.00 15.00 ? 388 HIS B ND1 1 
ATOM   7434 C  CD2 . HIS B 1 356 ? 74.850 33.550 182.360 1.00 15.00 ? 388 HIS B CD2 1 
ATOM   7435 C  CE1 . HIS B 1 356 ? 73.630 34.590 183.850 1.00 15.00 ? 388 HIS B CE1 1 
ATOM   7436 N  NE2 . HIS B 1 356 ? 73.660 34.220 182.600 1.00 15.00 ? 388 HIS B NE2 1 
ATOM   7437 N  N   . PRO B 1 357 ? 78.710 30.470 185.390 1.00 15.00 ? 389 PRO B N   1 
ATOM   7438 C  CA  . PRO B 1 357 ? 79.880 29.600 185.370 1.00 15.00 ? 389 PRO B CA  1 
ATOM   7439 C  C   . PRO B 1 357 ? 79.700 28.210 184.770 1.00 15.00 ? 389 PRO B C   1 
ATOM   7440 O  O   . PRO B 1 357 ? 80.670 27.530 184.480 1.00 15.00 ? 389 PRO B O   1 
ATOM   7441 C  CB  . PRO B 1 357 ? 80.290 29.510 186.800 1.00 15.00 ? 389 PRO B CB  1 
ATOM   7442 C  CG  . PRO B 1 357 ? 80.020 30.880 187.300 1.00 15.00 ? 389 PRO B CG  1 
ATOM   7443 C  CD  . PRO B 1 357 ? 78.690 31.170 186.670 1.00 15.00 ? 389 PRO B CD  1 
ATOM   7444 N  N   . LEU B 1 358 ? 78.460 27.730 184.640 1.00 15.00 ? 390 LEU B N   1 
ATOM   7445 C  CA  . LEU B 1 358 ? 78.230 26.440 184.060 1.00 15.00 ? 390 LEU B CA  1 
ATOM   7446 C  C   . LEU B 1 358 ? 78.600 26.420 182.590 1.00 15.00 ? 390 LEU B C   1 
ATOM   7447 O  O   . LEU B 1 358 ? 79.060 25.400 182.090 1.00 15.00 ? 390 LEU B O   1 
ATOM   7448 C  CB  . LEU B 1 358 ? 76.760 26.060 184.180 1.00 15.00 ? 390 LEU B CB  1 
ATOM   7449 C  CG  . LEU B 1 358 ? 76.170 25.710 185.520 1.00 15.00 ? 390 LEU B CG  1 
ATOM   7450 C  CD1 . LEU B 1 358 ? 74.710 25.440 185.330 1.00 15.00 ? 390 LEU B CD1 1 
ATOM   7451 C  CD2 . LEU B 1 358 ? 76.780 24.450 186.090 1.00 15.00 ? 390 LEU B CD2 1 
ATOM   7452 N  N   . MET B 1 359 ? 78.440 27.570 181.910 1.00 15.00 ? 391 MET B N   1 
ATOM   7453 C  CA  . MET B 1 359 ? 78.690 27.600 180.490 1.00 15.00 ? 391 MET B CA  1 
ATOM   7454 C  C   . MET B 1 359 ? 80.160 27.390 180.230 1.00 15.00 ? 391 MET B C   1 
ATOM   7455 O  O   . MET B 1 359 ? 80.970 27.940 180.960 1.00 15.00 ? 391 MET B O   1 
ATOM   7456 C  CB  . MET B 1 359 ? 78.270 28.920 179.890 1.00 15.00 ? 391 MET B CB  1 
ATOM   7457 C  CG  . MET B 1 359 ? 76.790 29.090 179.910 1.00 15.00 ? 391 MET B CG  1 
ATOM   7458 S  SD  . MET B 1 359 ? 75.850 27.600 179.490 1.00 15.00 ? 391 MET B SD  1 
ATOM   7459 C  CE  . MET B 1 359 ? 76.040 27.630 177.750 1.00 15.00 ? 391 MET B CE  1 
ATOM   7460 N  N   . PRO B 1 360 ? 80.520 26.550 179.250 1.00 15.00 ? 392 PRO B N   1 
ATOM   7461 C  CA  . PRO B 1 360 ? 81.860 26.050 179.030 1.00 15.00 ? 392 PRO B CA  1 
ATOM   7462 C  C   . PRO B 1 360 ? 82.700 26.970 178.130 1.00 15.00 ? 392 PRO B C   1 
ATOM   7463 O  O   . PRO B 1 360 ? 82.350 28.140 177.940 1.00 15.00 ? 392 PRO B O   1 
ATOM   7464 C  CB  . PRO B 1 360 ? 81.580 24.690 178.470 1.00 15.00 ? 392 PRO B CB  1 
ATOM   7465 C  CG  . PRO B 1 360 ? 80.470 25.000 177.480 1.00 15.00 ? 392 PRO B CG  1 
ATOM   7466 C  CD  . PRO B 1 360 ? 79.620 25.990 178.240 1.00 15.00 ? 392 PRO B CD  1 
ATOM   7467 N  N   . ASP B 1 361 ? 83.800 26.550 177.540 1.00 15.00 ? 393 ASP B N   1 
ATOM   7468 C  CA  . ASP B 1 361 ? 84.590 27.440 176.710 1.00 15.00 ? 393 ASP B CA  1 
ATOM   7469 C  C   . ASP B 1 361 ? 84.120 27.350 175.270 1.00 15.00 ? 393 ASP B C   1 
ATOM   7470 O  O   . ASP B 1 361 ? 84.160 28.330 174.510 1.00 15.00 ? 393 ASP B O   1 
ATOM   7471 C  CB  . ASP B 1 361 ? 86.080 27.070 176.810 1.00 15.00 ? 393 ASP B CB  1 
ATOM   7472 C  CG  . ASP B 1 361 ? 86.740 27.110 178.210 1.00 15.00 ? 393 ASP B CG  1 
ATOM   7473 O  OD1 . ASP B 1 361 ? 86.450 27.990 179.040 1.00 15.00 ? 393 ASP B OD1 1 
ATOM   7474 O  OD2 . ASP B 1 361 ? 87.600 26.240 178.430 1.00 15.00 ? 393 ASP B OD2 1 
ATOM   7475 N  N   . SER B 1 362 ? 83.690 26.170 174.870 1.00 15.00 ? 394 SER B N   1 
ATOM   7476 C  CA  . SER B 1 362 ? 83.190 25.930 173.540 1.00 15.00 ? 394 SER B CA  1 
ATOM   7477 C  C   . SER B 1 362 ? 82.220 24.780 173.650 1.00 15.00 ? 394 SER B C   1 
ATOM   7478 O  O   . SER B 1 362 ? 82.150 24.120 174.710 1.00 15.00 ? 394 SER B O   1 
ATOM   7479 C  CB  . SER B 1 362 ? 84.370 25.600 172.630 1.00 15.00 ? 394 SER B CB  1 
ATOM   7480 O  OG  . SER B 1 362 ? 85.270 24.690 173.270 1.00 15.00 ? 394 SER B OG  1 
ATOM   7481 N  N   . PHE B 1 363 ? 81.470 24.530 172.600 1.00 15.00 ? 395 PHE B N   1 
ATOM   7482 C  CA  . PHE B 1 363 ? 80.400 23.570 172.620 1.00 15.00 ? 395 PHE B CA  1 
ATOM   7483 C  C   . PHE B 1 363 ? 80.760 22.450 171.690 1.00 15.00 ? 395 PHE B C   1 
ATOM   7484 O  O   . PHE B 1 363 ? 80.710 22.660 170.470 1.00 15.00 ? 395 PHE B O   1 
ATOM   7485 C  CB  . PHE B 1 363 ? 79.150 24.280 172.190 1.00 15.00 ? 395 PHE B CB  1 
ATOM   7486 C  CG  . PHE B 1 363 ? 78.820 25.440 173.120 1.00 15.00 ? 395 PHE B CG  1 
ATOM   7487 C  CD1 . PHE B 1 363 ? 78.140 25.190 174.290 1.00 15.00 ? 395 PHE B CD1 1 
ATOM   7488 C  CD2 . PHE B 1 363 ? 79.220 26.720 172.790 1.00 15.00 ? 395 PHE B CD2 1 
ATOM   7489 C  CE1 . PHE B 1 363 ? 77.860 26.230 175.130 1.00 15.00 ? 395 PHE B CE1 1 
ATOM   7490 C  CE2 . PHE B 1 363 ? 78.930 27.750 173.650 1.00 15.00 ? 395 PHE B CE2 1 
ATOM   7491 C  CZ  . PHE B 1 363 ? 78.240 27.490 174.810 1.00 15.00 ? 395 PHE B CZ  1 
ATOM   7492 N  N   . ARG B 1 364 ? 81.130 21.280 172.200 1.00 15.00 ? 396 ARG B N   1 
ATOM   7493 C  CA  . ARG B 1 364 ? 81.500 20.200 171.340 1.00 15.00 ? 396 ARG B CA  1 
ATOM   7494 C  C   . ARG B 1 364 ? 80.300 19.340 170.990 1.00 15.00 ? 396 ARG B C   1 
ATOM   7495 O  O   . ARG B 1 364 ? 79.890 18.490 171.800 1.00 15.00 ? 396 ARG B O   1 
ATOM   7496 C  CB  . ARG B 1 364 ? 82.560 19.310 171.990 1.00 15.00 ? 396 ARG B CB  1 
ATOM   7497 C  CG  . ARG B 1 364 ? 83.340 18.490 170.940 1.00 15.00 ? 396 ARG B CG  1 
ATOM   7498 C  CD  . ARG B 1 364 ? 84.650 17.790 171.400 1.00 15.00 ? 396 ARG B CD  1 
ATOM   7499 N  NE  . ARG B 1 364 ? 85.680 18.720 171.910 1.00 15.00 ? 396 ARG B NE  1 
ATOM   7500 C  CZ  . ARG B 1 364 ? 85.740 19.140 173.210 1.00 15.00 ? 396 ARG B CZ  1 
ATOM   7501 N  NH1 . ARG B 1 364 ? 84.860 18.730 174.140 1.00 15.00 ? 396 ARG B NH1 1 
ATOM   7502 N  NH2 . ARG B 1 364 ? 86.680 20.030 173.580 1.00 15.00 ? 396 ARG B NH2 1 
ATOM   7503 N  N   . VAL B 1 365 ? 79.680 19.560 169.850 1.00 15.00 ? 397 VAL B N   1 
ATOM   7504 C  CA  . VAL B 1 365 ? 78.660 18.610 169.500 1.00 15.00 ? 397 VAL B CA  1 
ATOM   7505 C  C   . VAL B 1 365 ? 79.310 17.740 168.460 1.00 15.00 ? 397 VAL B C   1 
ATOM   7506 O  O   . VAL B 1 365 ? 80.100 18.170 167.610 1.00 15.00 ? 397 VAL B O   1 
ATOM   7507 C  CB  . VAL B 1 365 ? 77.370 19.270 168.920 1.00 15.00 ? 397 VAL B CB  1 
ATOM   7508 C  CG1 . VAL B 1 365 ? 77.530 19.950 167.600 1.00 15.00 ? 397 VAL B CG1 1 
ATOM   7509 C  CG2 . VAL B 1 365 ? 76.400 18.150 168.640 1.00 15.00 ? 397 VAL B CG2 1 
ATOM   7510 N  N   . GLY B 1 366 ? 78.990 16.460 168.540 1.00 15.00 ? 398 GLY B N   1 
ATOM   7511 C  CA  . GLY B 1 366 ? 79.610 15.490 167.670 1.00 15.00 ? 398 GLY B CA  1 
ATOM   7512 C  C   . GLY B 1 366 ? 81.080 15.470 168.090 1.00 15.00 ? 398 GLY B C   1 
ATOM   7513 O  O   . GLY B 1 366 ? 81.380 15.600 169.280 1.00 15.00 ? 398 GLY B O   1 
ATOM   7514 N  N   . PRO B 1 367 ? 82.000 15.320 167.140 1.00 15.00 ? 399 PRO B N   1 
ATOM   7515 C  CA  . PRO B 1 367 ? 83.400 15.590 167.360 1.00 15.00 ? 399 PRO B CA  1 
ATOM   7516 C  C   . PRO B 1 367 ? 83.820 16.970 166.860 1.00 15.00 ? 399 PRO B C   1 
ATOM   7517 O  O   . PRO B 1 367 ? 84.950 17.080 166.380 1.00 15.00 ? 399 PRO B O   1 
ATOM   7518 C  CB  . PRO B 1 367 ? 84.050 14.420 166.660 1.00 15.00 ? 399 PRO B CB  1 
ATOM   7519 C  CG  . PRO B 1 367 ? 83.250 14.340 165.380 1.00 15.00 ? 399 PRO B CG  1 
ATOM   7520 C  CD  . PRO B 1 367 ? 81.830 14.520 165.920 1.00 15.00 ? 399 PRO B CD  1 
ATOM   7521 N  N   . GLN B 1 368 ? 83.020 18.050 166.910 1.00 15.00 ? 400 GLN B N   1 
ATOM   7522 C  CA  . GLN B 1 368 ? 83.530 19.360 166.480 1.00 15.00 ? 400 GLN B CA  1 
ATOM   7523 C  C   . GLN B 1 368 ? 83.140 20.350 167.530 1.00 15.00 ? 400 GLN B C   1 
ATOM   7524 O  O   . GLN B 1 368 ? 81.990 20.330 168.000 1.00 15.00 ? 400 GLN B O   1 
ATOM   7525 C  CB  . GLN B 1 368 ? 82.980 19.830 165.110 1.00 15.00 ? 400 GLN B CB  1 
ATOM   7526 C  CG  . GLN B 1 368 ? 81.530 19.580 164.720 1.00 15.00 ? 400 GLN B CG  1 
ATOM   7527 C  CD  . GLN B 1 368 ? 81.120 18.100 164.560 1.00 15.00 ? 400 GLN B CD  1 
ATOM   7528 O  OE1 . GLN B 1 368 ? 82.000 17.240 164.380 1.00 15.00 ? 400 GLN B OE1 1 
ATOM   7529 N  NE2 . GLN B 1 368 ? 79.850 17.690 164.640 1.00 15.00 ? 400 GLN B NE2 1 
ATOM   7530 N  N   . ASP B 1 369 ? 84.110 21.130 168.020 1.00 15.00 ? 401 ASP B N   1 
ATOM   7531 C  CA  . ASP B 1 369 ? 83.850 22.190 168.980 1.00 15.00 ? 401 ASP B CA  1 
ATOM   7532 C  C   . ASP B 1 369 ? 83.210 23.370 168.270 1.00 15.00 ? 401 ASP B C   1 
ATOM   7533 O  O   . ASP B 1 369 ? 83.570 23.620 167.110 1.00 15.00 ? 401 ASP B O   1 
ATOM   7534 C  CB  . ASP B 1 369 ? 85.100 22.760 169.640 1.00 15.00 ? 401 ASP B CB  1 
ATOM   7535 C  CG  . ASP B 1 369 ? 85.540 22.040 170.910 1.00 15.00 ? 401 ASP B CG  1 
ATOM   7536 O  OD1 . ASP B 1 369 ? 84.710 21.840 171.800 1.00 15.00 ? 401 ASP B OD1 1 
ATOM   7537 O  OD2 . ASP B 1 369 ? 86.740 21.710 171.020 1.00 15.00 ? 401 ASP B OD2 1 
ATOM   7538 N  N   . TYR B 1 370 ? 82.290 24.090 168.880 1.00 15.00 ? 402 TYR B N   1 
ATOM   7539 C  CA  . TYR B 1 370 ? 81.730 25.270 168.260 1.00 15.00 ? 402 TYR B CA  1 
ATOM   7540 C  C   . TYR B 1 370 ? 82.080 26.380 169.170 1.00 15.00 ? 402 TYR B C   1 
ATOM   7541 O  O   . TYR B 1 370 ? 82.140 26.200 170.400 1.00 15.00 ? 402 TYR B O   1 
ATOM   7542 C  CB  . TYR B 1 370 ? 80.240 25.240 168.170 1.00 15.00 ? 402 TYR B CB  1 
ATOM   7543 C  CG  . TYR B 1 370 ? 79.850 24.340 167.050 1.00 15.00 ? 402 TYR B CG  1 
ATOM   7544 C  CD1 . TYR B 1 370 ? 79.800 24.840 165.770 1.00 15.00 ? 402 TYR B CD1 1 
ATOM   7545 C  CD2 . TYR B 1 370 ? 79.590 23.020 167.320 1.00 15.00 ? 402 TYR B CD2 1 
ATOM   7546 C  CE1 . TYR B 1 370 ? 79.490 24.000 164.730 1.00 15.00 ? 402 TYR B CE1 1 
ATOM   7547 C  CE2 . TYR B 1 370 ? 79.270 22.190 166.270 1.00 15.00 ? 402 TYR B CE2 1 
ATOM   7548 C  CZ  . TYR B 1 370 ? 79.230 22.680 164.990 1.00 15.00 ? 402 TYR B CZ  1 
ATOM   7549 O  OH  . TYR B 1 370 ? 78.910 21.810 163.970 1.00 15.00 ? 402 TYR B OH  1 
ATOM   7550 N  N   . SER B 1 371 ? 82.310 27.540 168.600 1.00 15.00 ? 403 SER B N   1 
ATOM   7551 C  CA  . SER B 1 371 ? 82.610 28.680 169.420 1.00 15.00 ? 403 SER B CA  1 
ATOM   7552 C  C   . SER B 1 371 ? 81.300 29.270 169.900 1.00 15.00 ? 403 SER B C   1 
ATOM   7553 O  O   . SER B 1 371 ? 80.240 28.980 169.330 1.00 15.00 ? 403 SER B O   1 
ATOM   7554 C  CB  . SER B 1 371 ? 83.390 29.670 168.590 1.00 15.00 ? 403 SER B CB  1 
ATOM   7555 O  OG  . SER B 1 371 ? 82.620 30.270 167.540 1.00 15.00 ? 403 SER B OG  1 
ATOM   7556 N  N   . TYR B 1 372 ? 81.340 30.150 170.890 1.00 15.00 ? 404 TYR B N   1 
ATOM   7557 C  CA  . TYR B 1 372 ? 80.150 30.900 171.270 1.00 15.00 ? 404 TYR B CA  1 
ATOM   7558 C  C   . TYR B 1 372 ? 79.670 31.660 170.060 1.00 15.00 ? 404 TYR B C   1 
ATOM   7559 O  O   . TYR B 1 372 ? 78.460 31.670 169.840 1.00 15.00 ? 404 TYR B O   1 
ATOM   7560 C  CB  . TYR B 1 372 ? 80.400 31.920 172.330 1.00 15.00 ? 404 TYR B CB  1 
ATOM   7561 C  CG  . TYR B 1 372 ? 80.460 31.310 173.690 1.00 15.00 ? 404 TYR B CG  1 
ATOM   7562 C  CD1 . TYR B 1 372 ? 81.520 30.520 174.070 1.00 15.00 ? 404 TYR B CD1 1 
ATOM   7563 C  CD2 . TYR B 1 372 ? 79.430 31.570 174.550 1.00 15.00 ? 404 TYR B CD2 1 
ATOM   7564 C  CE1 . TYR B 1 372 ? 81.560 30.010 175.330 1.00 15.00 ? 404 TYR B CE1 1 
ATOM   7565 C  CE2 . TYR B 1 372 ? 79.480 31.060 175.800 1.00 15.00 ? 404 TYR B CE2 1 
ATOM   7566 C  CZ  . TYR B 1 372 ? 80.530 30.280 176.190 1.00 15.00 ? 404 TYR B CZ  1 
ATOM   7567 O  OH  . TYR B 1 372 ? 80.530 29.780 177.470 1.00 15.00 ? 404 TYR B OH  1 
ATOM   7568 N  N   . GLU B 1 373 ? 80.560 32.200 169.250 1.00 15.00 ? 405 GLU B N   1 
ATOM   7569 C  CA  . GLU B 1 373 ? 80.090 32.930 168.080 1.00 15.00 ? 405 GLU B CA  1 
ATOM   7570 C  C   . GLU B 1 373 ? 79.590 32.000 166.990 1.00 15.00 ? 405 GLU B C   1 
ATOM   7571 O  O   . GLU B 1 373 ? 79.190 32.440 165.920 1.00 15.00 ? 405 GLU B O   1 
ATOM   7572 C  CB  . GLU B 1 373 ? 81.200 33.870 167.550 1.00 15.00 ? 405 GLU B CB  1 
ATOM   7573 C  CG  . GLU B 1 373 ? 82.690 33.530 167.640 1.00 15.00 ? 405 GLU B CG  1 
ATOM   7574 C  CD  . GLU B 1 373 ? 83.280 33.740 169.030 1.00 15.00 ? 405 GLU B CD  1 
ATOM   7575 O  OE1 . GLU B 1 373 ? 83.290 34.870 169.510 1.00 15.00 ? 405 GLU B OE1 1 
ATOM   7576 O  OE2 . GLU B 1 373 ? 83.740 32.770 169.630 1.00 15.00 ? 405 GLU B OE2 1 
ATOM   7577 N  N   . GLN B 1 374 ? 79.660 30.700 167.180 1.00 15.00 ? 406 GLN B N   1 
ATOM   7578 C  CA  . GLN B 1 374 ? 78.980 29.820 166.270 1.00 15.00 ? 406 GLN B CA  1 
ATOM   7579 C  C   . GLN B 1 374 ? 77.690 29.300 166.920 1.00 15.00 ? 406 GLN B C   1 
ATOM   7580 O  O   . GLN B 1 374 ? 76.680 29.020 166.260 1.00 15.00 ? 406 GLN B O   1 
ATOM   7581 C  CB  . GLN B 1 374 ? 79.840 28.650 165.910 1.00 15.00 ? 406 GLN B CB  1 
ATOM   7582 C  CG  . GLN B 1 374 ? 80.970 29.060 165.010 1.00 15.00 ? 406 GLN B CG  1 
ATOM   7583 C  CD  . GLN B 1 374 ? 81.960 27.930 164.840 1.00 15.00 ? 406 GLN B CD  1 
ATOM   7584 O  OE1 . GLN B 1 374 ? 82.490 27.370 165.800 1.00 15.00 ? 406 GLN B OE1 1 
ATOM   7585 N  NE2 . GLN B 1 374 ? 82.240 27.500 163.620 1.00 15.00 ? 406 GLN B NE2 1 
ATOM   7586 N  N   . PHE B 1 375 ? 77.710 29.160 168.240 1.00 15.00 ? 407 PHE B N   1 
ATOM   7587 C  CA  . PHE B 1 375 ? 76.610 28.590 168.960 1.00 15.00 ? 407 PHE B CA  1 
ATOM   7588 C  C   . PHE B 1 375 ? 75.480 29.600 169.090 1.00 15.00 ? 407 PHE B C   1 
ATOM   7589 O  O   . PHE B 1 375 ? 74.380 29.360 168.600 1.00 15.00 ? 407 PHE B O   1 
ATOM   7590 C  CB  . PHE B 1 375 ? 77.110 28.160 170.320 1.00 15.00 ? 407 PHE B CB  1 
ATOM   7591 C  CG  . PHE B 1 375 ? 76.260 27.120 171.020 1.00 15.00 ? 407 PHE B CG  1 
ATOM   7592 C  CD1 . PHE B 1 375 ? 76.120 25.870 170.450 1.00 15.00 ? 407 PHE B CD1 1 
ATOM   7593 C  CD2 . PHE B 1 375 ? 75.680 27.420 172.240 1.00 15.00 ? 407 PHE B CD2 1 
ATOM   7594 C  CE1 . PHE B 1 375 ? 75.380 24.910 171.100 1.00 15.00 ? 407 PHE B CE1 1 
ATOM   7595 C  CE2 . PHE B 1 375 ? 74.950 26.460 172.890 1.00 15.00 ? 407 PHE B CE2 1 
ATOM   7596 C  CZ  . PHE B 1 375 ? 74.820 25.200 172.320 1.00 15.00 ? 407 PHE B CZ  1 
ATOM   7597 N  N   . LEU B 1 376 ? 75.760 30.730 169.700 1.00 15.00 ? 408 LEU B N   1 
ATOM   7598 C  CA  . LEU B 1 376 ? 74.720 31.710 169.950 1.00 15.00 ? 408 LEU B CA  1 
ATOM   7599 C  C   . LEU B 1 376 ? 74.190 32.210 168.630 1.00 15.00 ? 408 LEU B C   1 
ATOM   7600 O  O   . LEU B 1 376 ? 74.940 32.520 167.710 1.00 15.00 ? 408 LEU B O   1 
ATOM   7601 C  CB  . LEU B 1 376 ? 75.270 32.870 170.780 1.00 15.00 ? 408 LEU B CB  1 
ATOM   7602 C  CG  . LEU B 1 376 ? 76.120 32.540 172.030 1.00 15.00 ? 408 LEU B CG  1 
ATOM   7603 C  CD1 . LEU B 1 376 ? 76.400 33.820 172.760 1.00 15.00 ? 408 LEU B CD1 1 
ATOM   7604 C  CD2 . LEU B 1 376 ? 75.390 31.580 172.950 1.00 15.00 ? 408 LEU B CD2 1 
ATOM   7605 N  N   . PHE B 1 377 ? 72.870 32.170 168.600 1.00 15.00 ? 409 PHE B N   1 
ATOM   7606 C  CA  . PHE B 1 377 ? 71.970 32.510 167.510 1.00 15.00 ? 409 PHE B CA  1 
ATOM   7607 C  C   . PHE B 1 377 ? 71.990 31.550 166.340 1.00 15.00 ? 409 PHE B C   1 
ATOM   7608 O  O   . PHE B 1 377 ? 71.310 31.790 165.330 1.00 15.00 ? 409 PHE B O   1 
ATOM   7609 C  CB  . PHE B 1 377 ? 72.290 33.920 166.990 1.00 15.00 ? 409 PHE B CB  1 
ATOM   7610 C  CG  . PHE B 1 377 ? 72.320 34.930 168.110 1.00 15.00 ? 409 PHE B CG  1 
ATOM   7611 C  CD1 . PHE B 1 377 ? 71.160 35.240 168.810 1.00 15.00 ? 409 PHE B CD1 1 
ATOM   7612 C  CD2 . PHE B 1 377 ? 73.540 35.540 168.430 1.00 15.00 ? 409 PHE B CD2 1 
ATOM   7613 C  CE1 . PHE B 1 377 ? 71.220 36.150 169.850 1.00 15.00 ? 409 PHE B CE1 1 
ATOM   7614 C  CE2 . PHE B 1 377 ? 73.580 36.450 169.490 1.00 15.00 ? 409 PHE B CE2 1 
ATOM   7615 C  CZ  . PHE B 1 377 ? 72.420 36.750 170.180 1.00 15.00 ? 409 PHE B CZ  1 
ATOM   7616 N  N   . ASN B 1 378 ? 72.690 30.410 166.400 1.00 15.00 ? 410 ASN B N   1 
ATOM   7617 C  CA  . ASN B 1 378 ? 72.770 29.510 165.270 1.00 15.00 ? 410 ASN B CA  1 
ATOM   7618 C  C   . ASN B 1 378 ? 71.400 28.910 165.050 1.00 15.00 ? 410 ASN B C   1 
ATOM   7619 O  O   . ASN B 1 378 ? 70.890 28.140 165.860 1.00 15.00 ? 410 ASN B O   1 
ATOM   7620 C  CB  . ASN B 1 378 ? 73.790 28.430 165.560 1.00 15.00 ? 410 ASN B CB  1 
ATOM   7621 C  CG  . ASN B 1 378 ? 74.120 27.630 164.310 1.00 15.00 ? 410 ASN B CG  1 
ATOM   7622 O  OD1 . ASN B 1 378 ? 73.230 26.970 163.770 1.00 15.00 ? 410 ASN B OD1 1 
ATOM   7623 N  ND2 . ASN B 1 378 ? 75.350 27.640 163.800 1.00 15.00 ? 410 ASN B ND2 1 
ATOM   7624 N  N   . THR B 1 379 ? 70.770 29.330 163.960 1.00 15.00 ? 411 THR B N   1 
ATOM   7625 C  CA  . THR B 1 379 ? 69.420 28.900 163.680 1.00 15.00 ? 411 THR B CA  1 
ATOM   7626 C  C   . THR B 1 379 ? 69.240 27.500 163.130 1.00 15.00 ? 411 THR B C   1 
ATOM   7627 O  O   . THR B 1 379 ? 68.210 26.830 163.300 1.00 15.00 ? 411 THR B O   1 
ATOM   7628 C  CB  . THR B 1 379 ? 68.770 29.890 162.710 1.00 15.00 ? 411 THR B CB  1 
ATOM   7629 O  OG1 . THR B 1 379 ? 69.360 31.160 162.930 1.00 15.00 ? 411 THR B OG1 1 
ATOM   7630 C  CG2 . THR B 1 379 ? 67.290 30.010 162.980 1.00 15.00 ? 411 THR B CG2 1 
ATOM   7631 N  N   . SER B 1 380 ? 70.270 26.980 162.480 1.00 15.00 ? 412 SER B N   1 
ATOM   7632 C  CA  . SER B 1 380 ? 70.160 25.670 161.890 1.00 15.00 ? 412 SER B CA  1 
ATOM   7633 C  C   . SER B 1 380 ? 70.570 24.510 162.750 1.00 15.00 ? 412 SER B C   1 
ATOM   7634 O  O   . SER B 1 380 ? 70.010 23.430 162.590 1.00 15.00 ? 412 SER B O   1 
ATOM   7635 C  CB  . SER B 1 380 ? 70.950 25.680 160.610 1.00 15.00 ? 412 SER B CB  1 
ATOM   7636 O  OG  . SER B 1 380 ? 72.050 26.580 160.740 1.00 15.00 ? 412 SER B OG  1 
ATOM   7637 N  N   . MET B 1 381 ? 71.490 24.710 163.690 1.00 15.00 ? 413 MET B N   1 
ATOM   7638 C  CA  . MET B 1 381 ? 72.060 23.610 164.450 1.00 15.00 ? 413 MET B CA  1 
ATOM   7639 C  C   . MET B 1 381 ? 71.100 22.580 164.980 1.00 15.00 ? 413 MET B C   1 
ATOM   7640 O  O   . MET B 1 381 ? 71.320 21.370 164.820 1.00 15.00 ? 413 MET B O   1 
ATOM   7641 C  CB  . MET B 1 381 ? 72.860 24.150 165.610 1.00 15.00 ? 413 MET B CB  1 
ATOM   7642 C  CG  . MET B 1 381 ? 73.940 23.140 165.900 1.00 15.00 ? 413 MET B CG  1 
ATOM   7643 S  SD  . MET B 1 381 ? 74.930 23.570 167.330 1.00 15.00 ? 413 MET B SD  1 
ATOM   7644 C  CE  . MET B 1 381 ? 75.710 25.060 166.760 1.00 15.00 ? 413 MET B CE  1 
ATOM   7645 N  N   . LEU B 1 382 ? 69.960 23.050 165.490 1.00 15.00 ? 414 LEU B N   1 
ATOM   7646 C  CA  . LEU B 1 382 ? 68.940 22.160 166.040 1.00 15.00 ? 414 LEU B CA  1 
ATOM   7647 C  C   . LEU B 1 382 ? 68.370 21.240 164.990 1.00 15.00 ? 414 LEU B C   1 
ATOM   7648 O  O   . LEU B 1 382 ? 68.310 20.010 165.150 1.00 15.00 ? 414 LEU B O   1 
ATOM   7649 C  CB  . LEU B 1 382 ? 67.800 22.960 166.630 1.00 15.00 ? 414 LEU B CB  1 
ATOM   7650 C  CG  . LEU B 1 382 ? 66.670 22.150 167.230 1.00 15.00 ? 414 LEU B CG  1 
ATOM   7651 C  CD1 . LEU B 1 382 ? 67.160 21.350 168.410 1.00 15.00 ? 414 LEU B CD1 1 
ATOM   7652 C  CD2 . LEU B 1 382 ? 65.590 23.100 167.670 1.00 15.00 ? 414 LEU B CD2 1 
ATOM   7653 N  N   . VAL B 1 383 ? 68.000 21.860 163.880 1.00 15.00 ? 415 VAL B N   1 
ATOM   7654 C  CA  . VAL B 1 383 ? 67.360 21.160 162.790 1.00 15.00 ? 415 VAL B CA  1 
ATOM   7655 C  C   . VAL B 1 383 ? 68.360 20.240 162.120 1.00 15.00 ? 415 VAL B C   1 
ATOM   7656 O  O   . VAL B 1 383 ? 68.000 19.160 161.640 1.00 15.00 ? 415 VAL B O   1 
ATOM   7657 C  CB  . VAL B 1 383 ? 66.810 22.200 161.800 1.00 15.00 ? 415 VAL B CB  1 
ATOM   7658 C  CG1 . VAL B 1 383 ? 65.960 21.480 160.770 1.00 15.00 ? 415 VAL B CG1 1 
ATOM   7659 C  CG2 . VAL B 1 383 ? 66.000 23.280 162.520 1.00 15.00 ? 415 VAL B CG2 1 
ATOM   7660 N  N   . ASP B 1 384 ? 69.600 20.710 162.090 1.00 15.00 ? 416 ASP B N   1 
ATOM   7661 C  CA  . ASP B 1 384 ? 70.680 19.950 161.490 1.00 15.00 ? 416 ASP B CA  1 
ATOM   7662 C  C   . ASP B 1 384 ? 71.030 18.720 162.270 1.00 15.00 ? 416 ASP B C   1 
ATOM   7663 O  O   . ASP B 1 384 ? 71.250 17.690 161.640 1.00 15.00 ? 416 ASP B O   1 
ATOM   7664 C  CB  . ASP B 1 384 ? 71.970 20.730 161.380 1.00 15.00 ? 416 ASP B CB  1 
ATOM   7665 C  CG  . ASP B 1 384 ? 71.980 21.910 160.410 1.00 15.00 ? 416 ASP B CG  1 
ATOM   7666 O  OD1 . ASP B 1 384 ? 71.180 21.960 159.470 1.00 15.00 ? 416 ASP B OD1 1 
ATOM   7667 O  OD2 . ASP B 1 384 ? 72.840 22.780 160.620 1.00 15.00 ? 416 ASP B OD2 1 
ATOM   7668 N  N   . TYR B 1 385 ? 71.150 18.760 163.590 1.00 15.00 ? 417 TYR B N   1 
ATOM   7669 C  CA  . TYR B 1 385 ? 71.550 17.570 164.300 1.00 15.00 ? 417 TYR B CA  1 
ATOM   7670 C  C   . TYR B 1 385 ? 70.380 16.750 164.780 1.00 15.00 ? 417 TYR B C   1 
ATOM   7671 O  O   . TYR B 1 385 ? 70.470 15.530 164.920 1.00 15.00 ? 417 TYR B O   1 
ATOM   7672 C  CB  . TYR B 1 385 ? 72.430 17.940 165.510 1.00 15.00 ? 417 TYR B CB  1 
ATOM   7673 C  CG  . TYR B 1 385 ? 73.820 18.410 165.120 1.00 15.00 ? 417 TYR B CG  1 
ATOM   7674 C  CD1 . TYR B 1 385 ? 74.010 19.710 164.700 1.00 15.00 ? 417 TYR B CD1 1 
ATOM   7675 C  CD2 . TYR B 1 385 ? 74.880 17.520 165.140 1.00 15.00 ? 417 TYR B CD2 1 
ATOM   7676 C  CE1 . TYR B 1 385 ? 75.260 20.100 164.270 1.00 15.00 ? 417 TYR B CE1 1 
ATOM   7677 C  CE2 . TYR B 1 385 ? 76.130 17.920 164.720 1.00 15.00 ? 417 TYR B CE2 1 
ATOM   7678 C  CZ  . TYR B 1 385 ? 76.310 19.210 164.290 1.00 15.00 ? 417 TYR B CZ  1 
ATOM   7679 O  OH  . TYR B 1 385 ? 77.540 19.600 163.830 1.00 15.00 ? 417 TYR B OH  1 
ATOM   7680 N  N   . GLY B 1 386 ? 69.280 17.460 165.060 1.00 15.00 ? 418 GLY B N   1 
ATOM   7681 C  CA  . GLY B 1 386 ? 68.070 16.830 165.550 1.00 15.00 ? 418 GLY B CA  1 
ATOM   7682 C  C   . GLY B 1 386 ? 68.190 16.550 167.040 1.00 15.00 ? 418 GLY B C   1 
ATOM   7683 O  O   . GLY B 1 386 ? 69.260 16.190 167.550 1.00 15.00 ? 418 GLY B O   1 
ATOM   7684 N  N   . VAL B 1 387 ? 67.060 16.690 167.740 1.00 15.00 ? 419 VAL B N   1 
ATOM   7685 C  CA  . VAL B 1 387 ? 66.980 16.510 169.200 1.00 15.00 ? 419 VAL B CA  1 
ATOM   7686 C  C   . VAL B 1 387 ? 67.830 15.350 169.750 1.00 15.00 ? 419 VAL B C   1 
ATOM   7687 O  O   . VAL B 1 387 ? 68.630 15.580 170.670 1.00 15.00 ? 419 VAL B O   1 
ATOM   7688 C  CB  . VAL B 1 387 ? 65.490 16.350 169.570 1.00 15.00 ? 419 VAL B CB  1 
ATOM   7689 C  CG1 . VAL B 1 387 ? 64.860 15.300 168.680 1.00 15.00 ? 419 VAL B CG1 1 
ATOM   7690 C  CG2 . VAL B 1 387 ? 65.340 15.930 171.010 1.00 15.00 ? 419 VAL B CG2 1 
ATOM   7691 N  N   . GLU B 1 388 ? 67.760 14.180 169.120 1.00 15.00 ? 420 GLU B N   1 
ATOM   7692 C  CA  . GLU B 1 388 ? 68.480 12.990 169.540 1.00 15.00 ? 420 GLU B CA  1 
ATOM   7693 C  C   . GLU B 1 388 ? 69.980 13.250 169.730 1.00 15.00 ? 420 GLU B C   1 
ATOM   7694 O  O   . GLU B 1 388 ? 70.540 13.030 170.810 1.00 15.00 ? 420 GLU B O   1 
ATOM   7695 C  CB  . GLU B 1 388 ? 68.400 11.840 168.520 1.00 15.00 ? 420 GLU B CB  1 
ATOM   7696 C  CG  . GLU B 1 388 ? 67.080 11.270 168.030 1.00 15.00 ? 420 GLU B CG  1 
ATOM   7697 C  CD  . GLU B 1 388 ? 66.230 12.160 167.140 1.00 15.00 ? 420 GLU B CD  1 
ATOM   7698 O  OE1 . GLU B 1 388 ? 66.770 13.050 166.440 1.00 15.00 ? 420 GLU B OE1 1 
ATOM   7699 O  OE2 . GLU B 1 388 ? 65.000 11.970 167.140 1.00 15.00 ? 420 GLU B OE2 1 
ATOM   7700 N  N   . ALA B 1 389 ? 70.600 13.810 168.690 1.00 15.00 ? 421 ALA B N   1 
ATOM   7701 C  CA  . ALA B 1 389 ? 72.040 14.030 168.700 1.00 15.00 ? 421 ALA B CA  1 
ATOM   7702 C  C   . ALA B 1 389 ? 72.460 15.040 169.770 1.00 15.00 ? 421 ALA B C   1 
ATOM   7703 O  O   . ALA B 1 389 ? 73.320 14.780 170.620 1.00 15.00 ? 421 ALA B O   1 
ATOM   7704 C  CB  . ALA B 1 389 ? 72.490 14.560 167.360 1.00 15.00 ? 421 ALA B CB  1 
ATOM   7705 N  N   . LEU B 1 390 ? 71.800 16.200 169.760 1.00 15.00 ? 422 LEU B N   1 
ATOM   7706 C  CA  . LEU B 1 390 ? 72.190 17.250 170.680 1.00 15.00 ? 422 LEU B CA  1 
ATOM   7707 C  C   . LEU B 1 390 ? 72.020 16.820 172.100 1.00 15.00 ? 422 LEU B C   1 
ATOM   7708 O  O   . LEU B 1 390 ? 72.920 17.090 172.890 1.00 15.00 ? 422 LEU B O   1 
ATOM   7709 C  CB  . LEU B 1 390 ? 71.390 18.470 170.360 1.00 15.00 ? 422 LEU B CB  1 
ATOM   7710 C  CG  . LEU B 1 390 ? 72.000 19.180 169.200 1.00 15.00 ? 422 LEU B CG  1 
ATOM   7711 C  CD1 . LEU B 1 390 ? 70.970 20.050 168.540 1.00 15.00 ? 422 LEU B CD1 1 
ATOM   7712 C  CD2 . LEU B 1 390 ? 73.160 20.010 169.670 1.00 15.00 ? 422 LEU B CD2 1 
ATOM   7713 N  N   . VAL B 1 391 ? 70.970 16.080 172.430 1.00 15.00 ? 423 VAL B N   1 
ATOM   7714 C  CA  . VAL B 1 391 ? 70.820 15.590 173.780 1.00 15.00 ? 423 VAL B CA  1 
ATOM   7715 C  C   . VAL B 1 391 ? 72.050 14.790 174.180 1.00 15.00 ? 423 VAL B C   1 
ATOM   7716 O  O   . VAL B 1 391 ? 72.600 15.040 175.240 1.00 15.00 ? 423 VAL B O   1 
ATOM   7717 C  CB  . VAL B 1 391 ? 69.600 14.690 173.900 1.00 15.00 ? 423 VAL B CB  1 
ATOM   7718 C  CG1 . VAL B 1 391 ? 69.560 13.960 175.210 1.00 15.00 ? 423 VAL B CG1 1 
ATOM   7719 C  CG2 . VAL B 1 391 ? 68.390 15.580 173.870 1.00 15.00 ? 423 VAL B CG2 1 
ATOM   7720 N  N   . ASP B 1 392 ? 72.520 13.900 173.320 1.00 15.00 ? 424 ASP B N   1 
ATOM   7721 C  CA  . ASP B 1 392 ? 73.660 13.070 173.630 1.00 15.00 ? 424 ASP B CA  1 
ATOM   7722 C  C   . ASP B 1 392 ? 74.920 13.870 173.860 1.00 15.00 ? 424 ASP B C   1 
ATOM   7723 O  O   . ASP B 1 392 ? 75.750 13.590 174.730 1.00 15.00 ? 424 ASP B O   1 
ATOM   7724 C  CB  . ASP B 1 392 ? 73.900 12.060 172.480 1.00 15.00 ? 424 ASP B CB  1 
ATOM   7725 C  CG  . ASP B 1 392 ? 75.030 11.050 172.680 1.00 15.00 ? 424 ASP B CG  1 
ATOM   7726 O  OD1 . ASP B 1 392 ? 76.200 11.450 172.550 1.00 15.00 ? 424 ASP B OD1 1 
ATOM   7727 O  OD2 . ASP B 1 392 ? 74.750 9.880  172.940 1.00 15.00 ? 424 ASP B OD2 1 
ATOM   7728 N  N   . ALA B 1 393 ? 75.070 14.900 173.040 1.00 15.00 ? 425 ALA B N   1 
ATOM   7729 C  CA  . ALA B 1 393 ? 76.240 15.730 173.120 1.00 15.00 ? 425 ALA B CA  1 
ATOM   7730 C  C   . ALA B 1 393 ? 76.300 16.510 174.420 1.00 15.00 ? 425 ALA B C   1 
ATOM   7731 O  O   . ALA B 1 393 ? 77.240 16.420 175.210 1.00 15.00 ? 425 ALA B O   1 
ATOM   7732 C  CB  . ALA B 1 393 ? 76.210 16.690 171.960 1.00 15.00 ? 425 ALA B CB  1 
ATOM   7733 N  N   . PHE B 1 394 ? 75.200 17.190 174.700 1.00 15.00 ? 426 PHE B N   1 
ATOM   7734 C  CA  . PHE B 1 394 ? 75.110 18.000 175.880 1.00 15.00 ? 426 PHE B CA  1 
ATOM   7735 C  C   . PHE B 1 394 ? 75.150 17.090 177.090 1.00 15.00 ? 426 PHE B C   1 
ATOM   7736 O  O   . PHE B 1 394 ? 75.640 17.500 178.130 1.00 15.00 ? 426 PHE B O   1 
ATOM   7737 C  CB  . PHE B 1 394 ? 73.810 18.790 175.890 1.00 15.00 ? 426 PHE B CB  1 
ATOM   7738 C  CG  . PHE B 1 394 ? 73.660 19.840 174.790 1.00 15.00 ? 426 PHE B CG  1 
ATOM   7739 C  CD1 . PHE B 1 394 ? 74.750 20.460 174.230 1.00 15.00 ? 426 PHE B CD1 1 
ATOM   7740 C  CD2 . PHE B 1 394 ? 72.400 20.170 174.340 1.00 15.00 ? 426 PHE B CD2 1 
ATOM   7741 C  CE1 . PHE B 1 394 ? 74.570 21.410 173.230 1.00 15.00 ? 426 PHE B CE1 1 
ATOM   7742 C  CE2 . PHE B 1 394 ? 72.220 21.100 173.360 1.00 15.00 ? 426 PHE B CE2 1 
ATOM   7743 C  CZ  . PHE B 1 394 ? 73.310 21.730 172.800 1.00 15.00 ? 426 PHE B CZ  1 
ATOM   7744 N  N   . SER B 1 395 ? 74.690 15.850 176.960 1.00 15.00 ? 427 SER B N   1 
ATOM   7745 C  CA  . SER B 1 395 ? 74.730 14.940 178.070 1.00 15.00 ? 427 SER B CA  1 
ATOM   7746 C  C   . SER B 1 395 ? 76.140 14.510 178.410 1.00 15.00 ? 427 SER B C   1 
ATOM   7747 O  O   . SER B 1 395 ? 76.380 14.040 179.530 1.00 15.00 ? 427 SER B O   1 
ATOM   7748 C  CB  . SER B 1 395 ? 73.920 13.700 177.800 1.00 15.00 ? 427 SER B CB  1 
ATOM   7749 O  OG  . SER B 1 395 ? 72.500 13.890 177.820 1.00 15.00 ? 427 SER B OG  1 
ATOM   7750 N  N   . ARG B 1 396 ? 77.080 14.620 177.460 1.00 15.00 ? 428 ARG B N   1 
ATOM   7751 C  CA  . ARG B 1 396 ? 78.450 14.210 177.730 1.00 15.00 ? 428 ARG B CA  1 
ATOM   7752 C  C   . ARG B 1 396 ? 79.370 15.350 178.090 1.00 15.00 ? 428 ARG B C   1 
ATOM   7753 O  O   . ARG B 1 396 ? 80.290 15.120 178.890 1.00 15.00 ? 428 ARG B O   1 
ATOM   7754 C  CB  . ARG B 1 396 ? 79.060 13.510 176.530 1.00 15.00 ? 428 ARG B CB  1 
ATOM   7755 C  CG  . ARG B 1 396 ? 78.290 12.320 176.020 1.00 15.00 ? 428 ARG B CG  1 
ATOM   7756 C  CD  . ARG B 1 396 ? 79.040 11.710 174.880 1.00 15.00 ? 428 ARG B CD  1 
ATOM   7757 N  NE  . ARG B 1 396 ? 78.210 10.700 174.260 1.00 15.00 ? 428 ARG B NE  1 
ATOM   7758 C  CZ  . ARG B 1 396 ? 78.050 9.480  174.780 1.00 15.00 ? 428 ARG B CZ  1 
ATOM   7759 N  NH1 . ARG B 1 396 ? 78.670 9.100  175.910 1.00 15.00 ? 428 ARG B NH1 1 
ATOM   7760 N  NH2 . ARG B 1 396 ? 77.150 8.660  174.220 1.00 15.00 ? 428 ARG B NH2 1 
ATOM   7761 N  N   . GLN B 1 397 ? 79.220 16.570 177.560 1.00 15.00 ? 429 GLN B N   1 
ATOM   7762 C  CA  . GLN B 1 397 ? 80.150 17.640 177.920 1.00 15.00 ? 429 GLN B CA  1 
ATOM   7763 C  C   . GLN B 1 397 ? 79.940 18.150 179.340 1.00 15.00 ? 429 GLN B C   1 
ATOM   7764 O  O   . GLN B 1 397 ? 78.800 18.410 179.700 1.00 15.00 ? 429 GLN B O   1 
ATOM   7765 C  CB  . GLN B 1 397 ? 80.010 18.780 176.940 1.00 15.00 ? 429 GLN B CB  1 
ATOM   7766 C  CG  . GLN B 1 397 ? 81.110 19.790 177.190 1.00 15.00 ? 429 GLN B CG  1 
ATOM   7767 C  CD  . GLN B 1 397 ? 81.270 20.870 176.130 1.00 15.00 ? 429 GLN B CD  1 
ATOM   7768 O  OE1 . GLN B 1 397 ? 80.710 20.860 175.020 1.00 15.00 ? 429 GLN B OE1 1 
ATOM   7769 N  NE2 . GLN B 1 397 ? 82.090 21.840 176.500 1.00 15.00 ? 429 GLN B NE2 1 
ATOM   7770 N  N   . PRO B 1 398 ? 80.950 18.300 180.200 1.00 15.00 ? 430 PRO B N   1 
ATOM   7771 C  CA  . PRO B 1 398 ? 80.800 18.760 181.570 1.00 15.00 ? 430 PRO B CA  1 
ATOM   7772 C  C   . PRO B 1 398 ? 80.560 20.260 181.670 1.00 15.00 ? 430 PRO B C   1 
ATOM   7773 O  O   . PRO B 1 398 ? 81.080 21.020 180.850 1.00 15.00 ? 430 PRO B O   1 
ATOM   7774 C  CB  . PRO B 1 398 ? 82.060 18.360 182.280 1.00 15.00 ? 430 PRO B CB  1 
ATOM   7775 C  CG  . PRO B 1 398 ? 82.580 17.250 181.400 1.00 15.00 ? 430 PRO B CG  1 
ATOM   7776 C  CD  . PRO B 1 398 ? 82.310 17.810 180.020 1.00 15.00 ? 430 PRO B CD  1 
ATOM   7777 N  N   . ALA B 1 399 ? 79.780 20.640 182.660 1.00 15.00 ? 431 ALA B N   1 
ATOM   7778 C  CA  . ALA B 1 399 ? 79.460 22.020 182.920 1.00 15.00 ? 431 ALA B CA  1 
ATOM   7779 C  C   . ALA B 1 399 ? 80.450 22.560 183.940 1.00 15.00 ? 431 ALA B C   1 
ATOM   7780 O  O   . ALA B 1 399 ? 81.020 21.760 184.690 1.00 15.00 ? 431 ALA B O   1 
ATOM   7781 C  CB  . ALA B 1 399 ? 78.060 22.090 183.490 1.00 15.00 ? 431 ALA B CB  1 
ATOM   7782 N  N   . GLY B 1 400 ? 80.690 23.850 184.010 1.00 15.00 ? 432 GLY B N   1 
ATOM   7783 C  CA  . GLY B 1 400 ? 81.670 24.390 184.940 1.00 15.00 ? 432 GLY B CA  1 
ATOM   7784 C  C   . GLY B 1 400 ? 81.260 24.440 186.390 1.00 15.00 ? 432 GLY B C   1 
ATOM   7785 O  O   . GLY B 1 400 ? 80.080 24.310 186.750 1.00 15.00 ? 432 GLY B O   1 
ATOM   7786 N  N   . ARG B 1 401 ? 82.240 24.630 187.270 1.00 15.00 ? 433 ARG B N   1 
ATOM   7787 C  CA  . ARG B 1 401 ? 81.990 24.770 188.690 1.00 15.00 ? 433 ARG B CA  1 
ATOM   7788 C  C   . ARG B 1 401 ? 81.280 26.100 188.880 1.00 15.00 ? 433 ARG B C   1 
ATOM   7789 O  O   . ARG B 1 401 ? 81.600 27.070 188.190 1.00 15.00 ? 433 ARG B O   1 
ATOM   7790 C  CB  . ARG B 1 401 ? 83.270 24.850 189.510 1.00 15.00 ? 433 ARG B CB  1 
ATOM   7791 C  CG  . ARG B 1 401 ? 83.310 23.770 190.590 1.00 15.00 ? 433 ARG B CG  1 
ATOM   7792 C  CD  . ARG B 1 401 ? 83.690 24.240 192.000 1.00 15.00 ? 433 ARG B CD  1 
ATOM   7793 N  NE  . ARG B 1 401 ? 85.120 24.400 192.290 1.00 15.00 ? 433 ARG B NE  1 
ATOM   7794 C  CZ  . ARG B 1 401 ? 85.840 25.540 192.070 1.00 15.00 ? 433 ARG B CZ  1 
ATOM   7795 N  NH1 . ARG B 1 401 ? 85.350 26.680 191.540 1.00 15.00 ? 433 ARG B NH1 1 
ATOM   7796 N  NH2 . ARG B 1 401 ? 87.130 25.540 192.470 1.00 15.00 ? 433 ARG B NH2 1 
ATOM   7797 N  N   . ILE B 1 402 ? 80.350 26.210 189.810 1.00 15.00 ? 434 ILE B N   1 
ATOM   7798 C  CA  . ILE B 1 402 ? 79.640 27.460 189.960 1.00 15.00 ? 434 ILE B CA  1 
ATOM   7799 C  C   . ILE B 1 402 ? 80.360 28.310 191.000 1.00 15.00 ? 434 ILE B C   1 
ATOM   7800 O  O   . ILE B 1 402 ? 80.800 29.440 190.730 1.00 15.00 ? 434 ILE B O   1 
ATOM   7801 C  CB  . ILE B 1 402 ? 78.210 27.090 190.340 1.00 15.00 ? 434 ILE B CB  1 
ATOM   7802 C  CG1 . ILE B 1 402 ? 77.500 26.570 189.130 1.00 15.00 ? 434 ILE B CG1 1 
ATOM   7803 C  CG2 . ILE B 1 402 ? 77.510 28.290 190.910 1.00 15.00 ? 434 ILE B CG2 1 
ATOM   7804 C  CD1 . ILE B 1 402 ? 76.060 26.110 189.420 1.00 15.00 ? 434 ILE B CD1 1 
ATOM   7805 N  N   . GLY B 1 403 ? 80.490 27.700 192.170 1.00 15.00 ? 435 GLY B N   1 
ATOM   7806 C  CA  . GLY B 1 403 ? 81.060 28.340 193.330 1.00 15.00 ? 435 GLY B CA  1 
ATOM   7807 C  C   . GLY B 1 403 ? 82.550 28.390 193.220 1.00 15.00 ? 435 GLY B C   1 
ATOM   7808 O  O   . GLY B 1 403 ? 83.140 27.850 192.280 1.00 15.00 ? 435 GLY B O   1 
ATOM   7809 N  N   . GLY B 1 404 ? 83.220 29.060 194.160 1.00 15.00 ? 436 GLY B N   1 
ATOM   7810 C  CA  . GLY B 1 404 ? 84.660 29.080 194.140 1.00 15.00 ? 436 GLY B CA  1 
ATOM   7811 C  C   . GLY B 1 404 ? 85.220 30.320 193.440 1.00 15.00 ? 436 GLY B C   1 
ATOM   7812 O  O   . GLY B 1 404 ? 86.280 30.800 193.850 1.00 15.00 ? 436 GLY B O   1 
ATOM   7813 N  N   . GLY B 1 405 ? 84.580 30.880 192.420 1.00 15.00 ? 437 GLY B N   1 
ATOM   7814 C  CA  . GLY B 1 405 ? 85.130 32.050 191.770 1.00 15.00 ? 437 GLY B CA  1 
ATOM   7815 C  C   . GLY B 1 405 ? 86.080 31.690 190.630 1.00 15.00 ? 437 GLY B C   1 
ATOM   7816 O  O   . GLY B 1 405 ? 86.450 30.540 190.410 1.00 15.00 ? 437 GLY B O   1 
ATOM   7817 N  N   . ARG B 1 406 ? 86.390 32.730 189.840 1.00 15.00 ? 438 ARG B N   1 
ATOM   7818 C  CA  . ARG B 1 406 ? 87.260 32.690 188.680 1.00 15.00 ? 438 ARG B CA  1 
ATOM   7819 C  C   . ARG B 1 406 ? 86.860 31.710 187.570 1.00 15.00 ? 438 ARG B C   1 
ATOM   7820 O  O   . ARG B 1 406 ? 87.690 31.160 186.820 1.00 15.00 ? 438 ARG B O   1 
ATOM   7821 C  CB  . ARG B 1 406 ? 88.680 32.400 189.190 1.00 15.00 ? 438 ARG B CB  1 
ATOM   7822 C  CG  . ARG B 1 406 ? 89.830 33.120 188.480 1.00 15.00 ? 438 ARG B CG  1 
ATOM   7823 C  CD  . ARG B 1 406 ? 89.990 34.510 189.030 1.00 15.00 ? 438 ARG B CD  1 
ATOM   7824 N  NE  . ARG B 1 406 ? 90.590 34.580 190.370 1.00 15.00 ? 438 ARG B NE  1 
ATOM   7825 C  CZ  . ARG B 1 406 ? 91.700 35.320 190.580 1.00 15.00 ? 438 ARG B CZ  1 
ATOM   7826 N  NH1 . ARG B 1 406 ? 92.300 35.990 189.570 1.00 15.00 ? 438 ARG B NH1 1 
ATOM   7827 N  NH2 . ARG B 1 406 ? 92.210 35.440 191.830 1.00 15.00 ? 438 ARG B NH2 1 
ATOM   7828 N  N   . ASN B 1 407 ? 85.540 31.610 187.340 1.00 15.00 ? 439 ASN B N   1 
ATOM   7829 C  CA  . ASN B 1 407 ? 85.060 30.640 186.380 1.00 15.00 ? 439 ASN B CA  1 
ATOM   7830 C  C   . ASN B 1 407 ? 83.990 31.130 185.390 1.00 15.00 ? 439 ASN B C   1 
ATOM   7831 O  O   . ASN B 1 407 ? 83.440 30.360 184.620 1.00 15.00 ? 439 ASN B O   1 
ATOM   7832 C  CB  . ASN B 1 407 ? 84.570 29.450 187.180 1.00 15.00 ? 439 ASN B CB  1 
ATOM   7833 C  CG  . ASN B 1 407 ? 84.540 28.190 186.320 1.00 15.00 ? 439 ASN B CG  1 
ATOM   7834 O  OD1 . ASN B 1 407 ? 85.540 27.660 185.850 1.00 15.00 ? 439 ASN B OD1 1 
ATOM   7835 N  ND2 . ASN B 1 407 ? 83.350 27.640 186.110 1.00 15.00 ? 439 ASN B ND2 1 
ATOM   7836 N  N   . ILE B 1 408 ? 83.660 32.410 185.300 1.00 15.00 ? 440 ILE B N   1 
ATOM   7837 C  CA  . ILE B 1 408 ? 82.670 32.900 184.350 1.00 15.00 ? 440 ILE B CA  1 
ATOM   7838 C  C   . ILE B 1 408 ? 83.400 33.110 183.030 1.00 15.00 ? 440 ILE B C   1 
ATOM   7839 O  O   . ILE B 1 408 ? 84.250 34.010 183.000 1.00 15.00 ? 440 ILE B O   1 
ATOM   7840 C  CB  . ILE B 1 408 ? 82.070 34.210 184.860 1.00 15.00 ? 440 ILE B CB  1 
ATOM   7841 C  CG1 . ILE B 1 408 ? 81.440 33.980 186.210 1.00 15.00 ? 440 ILE B CG1 1 
ATOM   7842 C  CG2 . ILE B 1 408 ? 81.060 34.740 183.860 1.00 15.00 ? 440 ILE B CG2 1 
ATOM   7843 C  CD1 . ILE B 1 408 ? 80.600 35.110 186.750 1.00 15.00 ? 440 ILE B CD1 1 
ATOM   7844 N  N   . ASP B 1 409 ? 83.190 32.340 181.980 1.00 15.00 ? 441 ASP B N   1 
ATOM   7845 C  CA  . ASP B 1 409 ? 83.870 32.560 180.690 1.00 15.00 ? 441 ASP B CA  1 
ATOM   7846 C  C   . ASP B 1 409 ? 83.660 33.980 180.160 1.00 15.00 ? 441 ASP B C   1 
ATOM   7847 O  O   . ASP B 1 409 ? 82.530 34.450 180.060 1.00 15.00 ? 441 ASP B O   1 
ATOM   7848 C  CB  . ASP B 1 409 ? 83.360 31.530 179.640 1.00 15.00 ? 441 ASP B CB  1 
ATOM   7849 C  CG  . ASP B 1 409 ? 83.610 31.830 178.160 1.00 15.00 ? 441 ASP B CG  1 
ATOM   7850 O  OD1 . ASP B 1 409 ? 82.890 32.650 177.620 1.00 15.00 ? 441 ASP B OD1 1 
ATOM   7851 O  OD2 . ASP B 1 409 ? 84.480 31.230 177.520 1.00 15.00 ? 441 ASP B OD2 1 
ATOM   7852 N  N   . HIS B 1 410 ? 84.700 34.620 179.650 1.00 15.00 ? 442 HIS B N   1 
ATOM   7853 C  CA  . HIS B 1 410 ? 84.610 36.030 179.250 1.00 15.00 ? 442 HIS B CA  1 
ATOM   7854 C  C   . HIS B 1 410 ? 83.460 36.450 178.360 1.00 15.00 ? 442 HIS B C   1 
ATOM   7855 O  O   . HIS B 1 410 ? 82.940 37.540 178.550 1.00 15.00 ? 442 HIS B O   1 
ATOM   7856 C  CB  . HIS B 1 410 ? 85.890 36.460 178.560 1.00 15.00 ? 442 HIS B CB  1 
ATOM   7857 C  CG  . HIS B 1 410 ? 86.190 35.830 177.200 1.00 15.00 ? 442 HIS B CG  1 
ATOM   7858 N  ND1 . HIS B 1 410 ? 85.890 36.400 175.950 1.00 15.00 ? 442 HIS B ND1 1 
ATOM   7859 C  CD2 . HIS B 1 410 ? 86.850 34.610 177.060 1.00 15.00 ? 442 HIS B CD2 1 
ATOM   7860 C  CE1 . HIS B 1 410 ? 86.370 35.520 175.060 1.00 15.00 ? 442 HIS B CE1 1 
ATOM   7861 N  NE2 . HIS B 1 410 ? 86.910 34.490 175.660 1.00 15.00 ? 442 HIS B NE2 1 
ATOM   7862 N  N   . HIS B 1 411 ? 83.020 35.560 177.450 1.00 15.00 ? 443 HIS B N   1 
ATOM   7863 C  CA  . HIS B 1 411 ? 81.920 35.890 176.550 1.00 15.00 ? 443 HIS B CA  1 
ATOM   7864 C  C   . HIS B 1 411 ? 80.660 36.330 177.270 1.00 15.00 ? 443 HIS B C   1 
ATOM   7865 O  O   . HIS B 1 411 ? 79.920 37.170 176.790 1.00 15.00 ? 443 HIS B O   1 
ATOM   7866 C  CB  . HIS B 1 411 ? 81.510 34.730 175.680 1.00 15.00 ? 443 HIS B CB  1 
ATOM   7867 C  CG  . HIS B 1 411 ? 82.470 34.210 174.630 1.00 15.00 ? 443 HIS B CG  1 
ATOM   7868 N  ND1 . HIS B 1 411 ? 82.380 34.550 173.280 1.00 15.00 ? 443 HIS B ND1 1 
ATOM   7869 C  CD2 . HIS B 1 411 ? 83.500 33.300 174.860 1.00 15.00 ? 443 HIS B CD2 1 
ATOM   7870 C  CE1 . HIS B 1 411 ? 83.390 33.850 172.710 1.00 15.00 ? 443 HIS B CE1 1 
ATOM   7871 N  NE2 . HIS B 1 411 ? 84.020 33.120 173.590 1.00 15.00 ? 443 HIS B NE2 1 
ATOM   7872 N  N   . ILE B 1 412 ? 80.390 35.760 178.450 1.00 15.00 ? 444 ILE B N   1 
ATOM   7873 C  CA  . ILE B 1 412 ? 79.210 36.110 179.190 1.00 15.00 ? 444 ILE B CA  1 
ATOM   7874 C  C   . ILE B 1 412 ? 79.600 36.860 180.470 1.00 15.00 ? 444 ILE B C   1 
ATOM   7875 O  O   . ILE B 1 412 ? 78.710 37.270 181.190 1.00 15.00 ? 444 ILE B O   1 
ATOM   7876 C  CB  . ILE B 1 412 ? 78.410 34.810 179.490 1.00 15.00 ? 444 ILE B CB  1 
ATOM   7877 C  CG1 . ILE B 1 412 ? 79.170 33.800 180.300 1.00 15.00 ? 444 ILE B CG1 1 
ATOM   7878 C  CG2 . ILE B 1 412 ? 78.120 34.160 178.160 1.00 15.00 ? 444 ILE B CG2 1 
ATOM   7879 C  CD1 . ILE B 1 412 ? 78.390 32.520 180.600 1.00 15.00 ? 444 ILE B CD1 1 
ATOM   7880 N  N   . LEU B 1 413 ? 80.870 37.190 180.740 1.00 15.00 ? 445 LEU B N   1 
ATOM   7881 C  CA  . LEU B 1 413 ? 81.310 37.840 181.980 1.00 15.00 ? 445 LEU B CA  1 
ATOM   7882 C  C   . LEU B 1 413 ? 80.640 39.170 182.250 1.00 15.00 ? 445 LEU B C   1 
ATOM   7883 O  O   . LEU B 1 413 ? 80.430 39.570 183.400 1.00 15.00 ? 445 LEU B O   1 
ATOM   7884 C  CB  . LEU B 1 413 ? 82.840 38.040 181.940 1.00 15.00 ? 445 LEU B CB  1 
ATOM   7885 C  CG  . LEU B 1 413 ? 83.800 38.490 183.060 1.00 15.00 ? 445 LEU B CG  1 
ATOM   7886 C  CD1 . LEU B 1 413 ? 83.900 39.990 183.050 1.00 15.00 ? 445 LEU B CD1 1 
ATOM   7887 C  CD2 . LEU B 1 413 ? 83.340 37.960 184.390 1.00 15.00 ? 445 LEU B CD2 1 
ATOM   7888 N  N   . HIS B 1 414 ? 80.250 39.830 181.160 1.00 15.00 ? 446 HIS B N   1 
ATOM   7889 C  CA  . HIS B 1 414 ? 79.550 41.090 181.260 1.00 15.00 ? 446 HIS B CA  1 
ATOM   7890 C  C   . HIS B 1 414 ? 78.260 40.980 182.050 1.00 15.00 ? 446 HIS B C   1 
ATOM   7891 O  O   . HIS B 1 414 ? 77.910 41.890 182.800 1.00 15.00 ? 446 HIS B O   1 
ATOM   7892 C  CB  . HIS B 1 414 ? 79.190 41.630 179.890 1.00 15.00 ? 446 HIS B CB  1 
ATOM   7893 C  CG  . HIS B 1 414 ? 78.140 40.880 179.110 1.00 15.00 ? 446 HIS B CG  1 
ATOM   7894 N  ND1 . HIS B 1 414 ? 78.290 39.610 178.540 1.00 15.00 ? 446 HIS B ND1 1 
ATOM   7895 C  CD2 . HIS B 1 414 ? 76.880 41.420 178.840 1.00 15.00 ? 446 HIS B CD2 1 
ATOM   7896 C  CE1 . HIS B 1 414 ? 77.110 39.380 177.910 1.00 15.00 ? 446 HIS B CE1 1 
ATOM   7897 N  NE2 . HIS B 1 414 ? 76.300 40.400 178.060 1.00 15.00 ? 446 HIS B NE2 1 
ATOM   7898 N  N   . VAL B 1 415 ? 77.580 39.830 181.930 1.00 15.00 ? 447 VAL B N   1 
ATOM   7899 C  CA  . VAL B 1 415 ? 76.320 39.590 182.630 1.00 15.00 ? 447 VAL B CA  1 
ATOM   7900 C  C   . VAL B 1 415 ? 76.540 39.700 184.120 1.00 15.00 ? 447 VAL B C   1 
ATOM   7901 O  O   . VAL B 1 415 ? 75.900 40.520 184.790 1.00 15.00 ? 447 VAL B O   1 
ATOM   7902 C  CB  . VAL B 1 415 ? 75.810 38.200 182.260 1.00 15.00 ? 447 VAL B CB  1 
ATOM   7903 C  CG1 . VAL B 1 415 ? 74.500 37.920 182.940 1.00 15.00 ? 447 VAL B CG1 1 
ATOM   7904 C  CG2 . VAL B 1 415 ? 75.580 38.140 180.780 1.00 15.00 ? 447 VAL B CG2 1 
ATOM   7905 N  N   . ALA B 1 416 ? 77.530 38.980 184.660 1.00 15.00 ? 448 ALA B N   1 
ATOM   7906 C  CA  . ALA B 1 416 ? 77.840 39.070 186.080 1.00 15.00 ? 448 ALA B CA  1 
ATOM   7907 C  C   . ALA B 1 416 ? 78.110 40.510 186.500 1.00 15.00 ? 448 ALA B C   1 
ATOM   7908 O  O   . ALA B 1 416 ? 77.680 40.950 187.560 1.00 15.00 ? 448 ALA B O   1 
ATOM   7909 C  CB  . ALA B 1 416 ? 79.040 38.230 186.340 1.00 15.00 ? 448 ALA B CB  1 
ATOM   7910 N  N   . VAL B 1 417 ? 78.730 41.290 185.610 1.00 15.00 ? 449 VAL B N   1 
ATOM   7911 C  CA  . VAL B 1 417 ? 78.930 42.700 185.880 1.00 15.00 ? 449 VAL B CA  1 
ATOM   7912 C  C   . VAL B 1 417 ? 77.570 43.350 186.010 1.00 15.00 ? 449 VAL B C   1 
ATOM   7913 O  O   . VAL B 1 417 ? 77.350 44.060 187.000 1.00 15.00 ? 449 VAL B O   1 
ATOM   7914 C  CB  . VAL B 1 417 ? 79.730 43.380 184.750 1.00 15.00 ? 449 VAL B CB  1 
ATOM   7915 C  CG1 . VAL B 1 417 ? 79.860 44.870 184.990 1.00 15.00 ? 449 VAL B CG1 1 
ATOM   7916 C  CG2 . VAL B 1 417 ? 81.130 42.830 184.730 1.00 15.00 ? 449 VAL B CG2 1 
ATOM   7917 N  N   . ASP B 1 418 ? 76.620 43.150 185.110 1.00 15.00 ? 450 ASP B N   1 
ATOM   7918 C  CA  . ASP B 1 418 ? 75.300 43.770 185.230 1.00 15.00 ? 450 ASP B CA  1 
ATOM   7919 C  C   . ASP B 1 418 ? 74.560 43.330 186.480 1.00 15.00 ? 450 ASP B C   1 
ATOM   7920 O  O   . ASP B 1 418 ? 73.810 44.110 187.060 1.00 15.00 ? 450 ASP B O   1 
ATOM   7921 C  CB  . ASP B 1 418 ? 74.410 43.430 184.060 1.00 15.00 ? 450 ASP B CB  1 
ATOM   7922 C  CG  . ASP B 1 418 ? 74.920 43.920 182.710 1.00 15.00 ? 450 ASP B CG  1 
ATOM   7923 O  OD1 . ASP B 1 418 ? 75.190 45.120 182.540 1.00 15.00 ? 450 ASP B OD1 1 
ATOM   7924 O  OD2 . ASP B 1 418 ? 75.040 43.090 181.800 1.00 15.00 ? 450 ASP B OD2 1 
ATOM   7925 N  N   . VAL B 1 419 ? 74.770 42.080 186.920 1.00 15.00 ? 451 VAL B N   1 
ATOM   7926 C  CA  . VAL B 1 419 ? 74.160 41.550 188.120 1.00 15.00 ? 451 VAL B CA  1 
ATOM   7927 C  C   . VAL B 1 419 ? 74.580 42.340 189.320 1.00 15.00 ? 451 VAL B C   1 
ATOM   7928 O  O   . VAL B 1 419 ? 73.720 42.780 190.080 1.00 15.00 ? 451 VAL B O   1 
ATOM   7929 C  CB  . VAL B 1 419 ? 74.560 40.110 188.330 1.00 15.00 ? 451 VAL B CB  1 
ATOM   7930 C  CG1 . VAL B 1 419 ? 74.030 39.540 189.610 1.00 15.00 ? 451 VAL B CG1 1 
ATOM   7931 C  CG2 . VAL B 1 419 ? 73.960 39.360 187.180 1.00 15.00 ? 451 VAL B CG2 1 
ATOM   7932 N  N   . ILE B 1 420 ? 75.880 42.550 189.480 1.00 15.00 ? 452 ILE B N   1 
ATOM   7933 C  CA  . ILE B 1 420 ? 76.400 43.290 190.610 1.00 15.00 ? 452 ILE B CA  1 
ATOM   7934 C  C   . ILE B 1 420 ? 75.800 44.690 190.550 1.00 15.00 ? 452 ILE B C   1 
ATOM   7935 O  O   . ILE B 1 420 ? 75.320 45.190 191.550 1.00 15.00 ? 452 ILE B O   1 
ATOM   7936 C  CB  . ILE B 1 420 ? 77.960 43.310 190.540 1.00 15.00 ? 452 ILE B CB  1 
ATOM   7937 C  CG1 . ILE B 1 420 ? 78.510 41.910 190.660 1.00 15.00 ? 452 ILE B CG1 1 
ATOM   7938 C  CG2 . ILE B 1 420 ? 78.530 44.120 191.690 1.00 15.00 ? 452 ILE B CG2 1 
ATOM   7939 C  CD1 . ILE B 1 420 ? 79.940 41.820 190.110 1.00 15.00 ? 452 ILE B CD1 1 
ATOM   7940 N  N   . LYS B 1 421 ? 75.740 45.330 189.390 1.00 15.00 ? 453 LYS B N   1 
ATOM   7941 C  CA  . LYS B 1 421 ? 75.140 46.650 189.310 1.00 15.00 ? 453 LYS B CA  1 
ATOM   7942 C  C   . LYS B 1 421 ? 73.650 46.630 189.640 1.00 15.00 ? 453 LYS B C   1 
ATOM   7943 O  O   . LYS B 1 421 ? 73.100 47.580 190.210 1.00 15.00 ? 453 LYS B O   1 
ATOM   7944 C  CB  . LYS B 1 421 ? 75.310 47.200 187.920 1.00 15.00 ? 453 LYS B CB  1 
ATOM   7945 C  CG  . LYS B 1 421 ? 76.780 47.330 187.560 1.00 15.00 ? 453 LYS B CG  1 
ATOM   7946 C  CD  . LYS B 1 421 ? 76.960 47.680 186.090 1.00 15.00 ? 453 LYS B CD  1 
ATOM   7947 C  CE  . LYS B 1 421 ? 77.430 49.120 185.970 1.00 15.00 ? 453 LYS B CE  1 
ATOM   7948 N  NZ  . LYS B 1 421 ? 77.610 49.450 184.560 1.00 15.00 ? 453 LYS B NZ  1 
ATOM   7949 N  N   . GLU B 1 422 ? 72.940 45.560 189.350 1.00 15.00 ? 454 GLU B N   1 
ATOM   7950 C  CA  . GLU B 1 422 ? 71.530 45.490 189.680 1.00 15.00 ? 454 GLU B CA  1 
ATOM   7951 C  C   . GLU B 1 422 ? 71.460 45.320 191.180 1.00 15.00 ? 454 GLU B C   1 
ATOM   7952 O  O   . GLU B 1 422 ? 70.650 46.030 191.770 1.00 15.00 ? 454 GLU B O   1 
ATOM   7953 C  CB  . GLU B 1 422 ? 70.950 44.330 188.950 1.00 15.00 ? 454 GLU B CB  1 
ATOM   7954 C  CG  . GLU B 1 422 ? 69.460 44.460 188.730 1.00 15.00 ? 454 GLU B CG  1 
ATOM   7955 C  CD  . GLU B 1 422 ? 68.910 43.270 187.940 1.00 15.00 ? 454 GLU B CD  1 
ATOM   7956 O  OE1 . GLU B 1 422 ? 69.050 43.280 186.710 1.00 15.00 ? 454 GLU B OE1 1 
ATOM   7957 O  OE2 . GLU B 1 422 ? 68.350 42.340 188.580 1.00 15.00 ? 454 GLU B OE2 1 
ATOM   7958 N  N   . SER B 1 423 ? 72.280 44.490 191.850 1.00 15.00 ? 455 SER B N   1 
ATOM   7959 C  CA  . SER B 1 423 ? 72.330 44.390 193.310 1.00 15.00 ? 455 SER B CA  1 
ATOM   7960 C  C   . SER B 1 423 ? 72.380 45.780 193.910 1.00 15.00 ? 455 SER B C   1 
ATOM   7961 O  O   . SER B 1 423 ? 71.720 46.100 194.890 1.00 15.00 ? 455 SER B O   1 
ATOM   7962 C  CB  . SER B 1 423 ? 73.590 43.710 193.850 1.00 15.00 ? 455 SER B CB  1 
ATOM   7963 O  OG  . SER B 1 423 ? 73.650 42.300 193.920 1.00 15.00 ? 455 SER B OG  1 
ATOM   7964 N  N   . ARG B 1 424 ? 73.140 46.620 193.230 1.00 15.00 ? 456 ARG B N   1 
ATOM   7965 C  CA  . ARG B 1 424 ? 73.300 47.980 193.650 1.00 15.00 ? 456 ARG B CA  1 
ATOM   7966 C  C   . ARG B 1 424 ? 72.100 48.860 193.460 1.00 15.00 ? 456 ARG B C   1 
ATOM   7967 O  O   . ARG B 1 424 ? 71.790 49.610 194.380 1.00 15.00 ? 456 ARG B O   1 
ATOM   7968 C  CB  . ARG B 1 424 ? 74.520 48.590 192.950 1.00 15.00 ? 456 ARG B CB  1 
ATOM   7969 C  CG  . ARG B 1 424 ? 75.920 48.160 193.440 1.00 15.00 ? 456 ARG B CG  1 
ATOM   7970 C  CD  . ARG B 1 424 ? 75.910 48.140 194.970 1.00 15.00 ? 456 ARG B CD  1 
ATOM   7971 N  NE  . ARG B 1 424 ? 75.120 49.190 195.660 1.00 15.00 ? 456 ARG B NE  1 
ATOM   7972 C  CZ  . ARG B 1 424 ? 74.280 48.970 196.710 1.00 15.00 ? 456 ARG B CZ  1 
ATOM   7973 N  NH1 . ARG B 1 424 ? 74.060 47.730 197.260 1.00 15.00 ? 456 ARG B NH1 1 
ATOM   7974 N  NH2 . ARG B 1 424 ? 73.640 50.030 197.240 1.00 15.00 ? 456 ARG B NH2 1 
ATOM   7975 N  N   . VAL B 1 425 ? 71.390 48.780 192.340 1.00 15.00 ? 457 VAL B N   1 
ATOM   7976 C  CA  . VAL B 1 425 ? 70.180 49.590 192.100 1.00 15.00 ? 457 VAL B CA  1 
ATOM   7977 C  C   . VAL B 1 425 ? 69.110 49.190 193.090 1.00 15.00 ? 457 VAL B C   1 
ATOM   7978 O  O   . VAL B 1 425 ? 68.410 50.010 193.680 1.00 15.00 ? 457 VAL B O   1 
ATOM   7979 C  CB  . VAL B 1 425 ? 69.690 49.350 190.670 1.00 15.00 ? 457 VAL B CB  1 
ATOM   7980 C  CG1 . VAL B 1 425 ? 68.340 49.980 190.390 1.00 15.00 ? 457 VAL B CG1 1 
ATOM   7981 C  CG2 . VAL B 1 425 ? 70.710 49.980 189.750 1.00 15.00 ? 457 VAL B CG2 1 
ATOM   7982 N  N   . LEU B 1 426 ? 69.000 47.930 193.230 1.00 15.00 ? 458 LEU B N   1 
ATOM   7983 C  CA  . LEU B 1 426 ? 68.130 47.130 194.100 1.00 15.00 ? 458 LEU B CA  1 
ATOM   7984 C  C   . LEU B 1 426 ? 68.420 47.440 195.560 1.00 15.00 ? 458 LEU B C   1 
ATOM   7985 O  O   . LEU B 1 426 ? 67.570 47.230 196.440 1.00 15.00 ? 458 LEU B O   1 
ATOM   7986 C  CB  . LEU B 1 426 ? 68.400 45.640 193.880 1.00 15.00 ? 458 LEU B CB  1 
ATOM   7987 C  CG  . LEU B 1 426 ? 67.270 44.920 193.170 1.00 15.00 ? 458 LEU B CG  1 
ATOM   7988 C  CD1 . LEU B 1 426 ? 67.030 45.420 191.750 1.00 15.00 ? 458 LEU B CD1 1 
ATOM   7989 C  CD2 . LEU B 1 426 ? 67.510 43.410 193.030 1.00 15.00 ? 458 LEU B CD2 1 
ATOM   7990 N  N   . ARG B 1 427 ? 69.610 47.940 195.800 1.00 15.00 ? 459 ARG B N   1 
ATOM   7991 C  CA  . ARG B 1 427 ? 70.050 48.290 197.150 1.00 15.00 ? 459 ARG B CA  1 
ATOM   7992 C  C   . ARG B 1 427 ? 70.000 47.070 198.070 1.00 15.00 ? 459 ARG B C   1 
ATOM   7993 O  O   . ARG B 1 427 ? 69.750 47.180 199.280 1.00 15.00 ? 459 ARG B O   1 
ATOM   7994 C  CB  . ARG B 1 427 ? 69.130 49.320 197.800 1.00 15.00 ? 459 ARG B CB  1 
ATOM   7995 C  CG  . ARG B 1 427 ? 68.920 50.590 196.970 1.00 15.00 ? 459 ARG B CG  1 
ATOM   7996 C  CD  . ARG B 1 427 ? 69.130 51.860 197.800 1.00 15.00 ? 459 ARG B CD  1 
ATOM   7997 N  NE  . ARG B 1 427 ? 70.540 52.160 198.000 1.00 15.00 ? 459 ARG B NE  1 
ATOM   7998 C  CZ  . ARG B 1 427 ? 71.080 52.660 199.120 1.00 15.00 ? 459 ARG B CZ  1 
ATOM   7999 N  NH1 . ARG B 1 427 ? 70.340 52.950 200.200 1.00 15.00 ? 459 ARG B NH1 1 
ATOM   8000 N  NH2 . ARG B 1 427 ? 72.390 52.910 199.260 1.00 15.00 ? 459 ARG B NH2 1 
ATOM   8001 N  N   . LEU B 1 428 ? 70.220 45.890 197.490 1.00 15.00 ? 460 LEU B N   1 
ATOM   8002 C  CA  . LEU B 1 428 ? 70.210 44.640 198.280 1.00 15.00 ? 460 LEU B CA  1 
ATOM   8003 C  C   . LEU B 1 428 ? 71.130 44.810 199.480 1.00 15.00 ? 460 LEU B C   1 
ATOM   8004 O  O   . LEU B 1 428 ? 72.190 45.450 199.390 1.00 15.00 ? 460 LEU B O   1 
ATOM   8005 C  CB  . LEU B 1 428 ? 70.740 43.470 197.440 1.00 15.00 ? 460 LEU B CB  1 
ATOM   8006 C  CG  . LEU B 1 428 ? 69.720 42.920 196.440 1.00 15.00 ? 460 LEU B CG  1 
ATOM   8007 C  CD1 . LEU B 1 428 ? 70.210 41.650 195.740 1.00 15.00 ? 460 LEU B CD1 1 
ATOM   8008 C  CD2 . LEU B 1 428 ? 68.380 42.560 197.070 1.00 15.00 ? 460 LEU B CD2 1 
ATOM   8009 N  N   . GLN B 1 429 ? 70.710 44.250 200.580 1.00 15.00 ? 461 GLN B N   1 
ATOM   8010 C  CA  . GLN B 1 429 ? 71.490 44.350 201.810 1.00 15.00 ? 461 GLN B CA  1 
ATOM   8011 C  C   . GLN B 1 429 ? 72.780 43.560 201.670 1.00 15.00 ? 461 GLN B C   1 
ATOM   8012 O  O   . GLN B 1 429 ? 73.020 42.900 200.640 1.00 15.00 ? 461 GLN B O   1 
ATOM   8013 C  CB  . GLN B 1 429 ? 70.690 43.820 203.000 1.00 15.00 ? 461 GLN B CB  1 
ATOM   8014 C  CG  . GLN B 1 429 ? 69.910 44.930 203.680 1.00 15.00 ? 461 GLN B CG  1 
ATOM   8015 C  CD  . GLN B 1 429 ? 69.300 44.530 205.010 1.00 15.00 ? 461 GLN B CD  1 
ATOM   8016 O  OE1 . GLN B 1 429 ? 69.920 43.780 205.770 1.00 15.00 ? 461 GLN B OE1 1 
ATOM   8017 N  NE2 . GLN B 1 429 ? 68.110 44.980 205.350 1.00 15.00 ? 461 GLN B NE2 1 
ATOM   8018 N  N   . PRO B 1 430 ? 73.630 43.590 202.680 1.00 15.00 ? 462 PRO B N   1 
ATOM   8019 C  CA  . PRO B 1 430 ? 74.870 42.850 202.620 1.00 15.00 ? 462 PRO B CA  1 
ATOM   8020 C  C   . PRO B 1 430 ? 74.560 41.400 202.400 1.00 15.00 ? 462 PRO B C   1 
ATOM   8021 O  O   . PRO B 1 430 ? 73.370 41.080 202.110 1.00 15.00 ? 462 PRO B O   1 
ATOM   8022 C  CB  . PRO B 1 430 ? 75.510 43.120 203.960 1.00 15.00 ? 462 PRO B CB  1 
ATOM   8023 C  CG  . PRO B 1 430 ? 74.580 44.050 204.730 1.00 15.00 ? 462 PRO B CG  1 
ATOM   8024 C  CD  . PRO B 1 430 ? 73.390 44.350 203.890 1.00 15.00 ? 462 PRO B CD  1 
ATOM   8025 N  N   . PHE B 1 431 ? 75.540 40.720 202.260 1.00 15.00 ? 463 PHE B N   1 
ATOM   8026 C  CA  . PHE B 1 431 ? 75.520 39.290 202.030 1.00 15.00 ? 463 PHE B CA  1 
ATOM   8027 C  C   . PHE B 1 431 ? 75.150 38.590 203.340 1.00 15.00 ? 463 PHE B C   1 
ATOM   8028 O  O   . PHE B 1 431 ? 74.140 37.870 203.420 1.00 15.00 ? 463 PHE B O   1 
ATOM   8029 C  CB  . PHE B 1 431 ? 76.930 38.890 201.600 1.00 15.00 ? 463 PHE B CB  1 
ATOM   8030 C  CG  . PHE B 1 431 ? 77.180 37.400 201.370 1.00 15.00 ? 463 PHE B CG  1 
ATOM   8031 C  CD1 . PHE B 1 431 ? 77.140 36.500 202.440 1.00 15.00 ? 463 PHE B CD1 1 
ATOM   8032 C  CD2 . PHE B 1 431 ? 77.460 36.940 200.080 1.00 15.00 ? 463 PHE B CD2 1 
ATOM   8033 C  CE1 . PHE B 1 431 ? 77.390 35.140 202.220 1.00 15.00 ? 463 PHE B CE1 1 
ATOM   8034 C  CE2 . PHE B 1 431 ? 77.700 35.590 199.860 1.00 15.00 ? 463 PHE B CE2 1 
ATOM   8035 C  CZ  . PHE B 1 431 ? 77.670 34.690 200.930 1.00 15.00 ? 463 PHE B CZ  1 
ATOM   8036 N  N   . ASN B 1 432 ? 75.990 38.880 204.300 1.00 15.00 ? 464 ASN B N   1 
ATOM   8037 C  CA  . ASN B 1 432 ? 75.920 38.310 205.650 1.00 15.00 ? 464 ASN B CA  1 
ATOM   8038 C  C   . ASN B 1 432 ? 74.570 38.570 206.290 1.00 15.00 ? 464 ASN B C   1 
ATOM   8039 O  O   . ASN B 1 432 ? 74.010 37.710 206.980 1.00 15.00 ? 464 ASN B O   1 
ATOM   8040 C  CB  . ASN B 1 432 ? 77.010 38.900 206.530 1.00 15.00 ? 464 ASN B CB  1 
ATOM   8041 C  CG  . ASN B 1 432 ? 77.900 37.810 207.100 1.00 15.00 ? 464 ASN B CG  1 
ATOM   8042 O  OD1 . ASN B 1 432 ? 77.590 36.620 206.950 1.00 15.00 ? 464 ASN B OD1 1 
ATOM   8043 N  ND2 . ASN B 1 432 ? 78.990 38.120 207.760 1.00 15.00 ? 464 ASN B ND2 1 
ATOM   8044 N  N   . GLU B 1 433 ? 74.020 39.750 206.120 1.00 15.00 ? 465 GLU B N   1 
ATOM   8045 C  CA  . GLU B 1 433 ? 72.700 40.010 206.680 1.00 15.00 ? 465 GLU B CA  1 
ATOM   8046 C  C   . GLU B 1 433 ? 71.800 38.850 206.220 1.00 15.00 ? 465 GLU B C   1 
ATOM   8047 O  O   . GLU B 1 433 ? 71.010 38.300 207.000 1.00 15.00 ? 465 GLU B O   1 
ATOM   8048 C  CB  . GLU B 1 433 ? 72.170 41.360 206.230 1.00 15.00 ? 465 GLU B CB  1 
ATOM   8049 C  CG  . GLU B 1 433 ? 73.000 42.550 206.740 1.00 15.00 ? 465 GLU B CG  1 
ATOM   8050 C  CD  . GLU B 1 433 ? 73.270 42.510 208.260 1.00 15.00 ? 465 GLU B CD  1 
ATOM   8051 O  OE1 . GLU B 1 433 ? 72.300 42.280 209.080 1.00 15.00 ? 465 GLU B OE1 1 
ATOM   8052 O  OE2 . GLU B 1 433 ? 74.450 42.740 208.710 1.00 15.00 ? 465 GLU B OE2 1 
ATOM   8053 N  N   . TYR B 1 434 ? 71.970 38.520 204.950 1.00 15.00 ? 466 TYR B N   1 
ATOM   8054 C  CA  . TYR B 1 434 ? 71.210 37.430 204.300 1.00 15.00 ? 466 TYR B CA  1 
ATOM   8055 C  C   . TYR B 1 434 ? 71.640 36.080 204.870 1.00 15.00 ? 466 TYR B C   1 
ATOM   8056 O  O   . TYR B 1 434 ? 70.880 35.110 204.860 1.00 15.00 ? 466 TYR B O   1 
ATOM   8057 C  CB  . TYR B 1 434 ? 71.450 37.420 202.790 1.00 15.00 ? 466 TYR B CB  1 
ATOM   8058 C  CG  . TYR B 1 434 ? 70.510 38.360 202.060 1.00 15.00 ? 466 TYR B CG  1 
ATOM   8059 C  CD1 . TYR B 1 434 ? 69.180 37.980 201.830 1.00 15.00 ? 466 TYR B CD1 1 
ATOM   8060 C  CD2 . TYR B 1 434 ? 70.980 39.600 201.640 1.00 15.00 ? 466 TYR B CD2 1 
ATOM   8061 C  CE1 . TYR B 1 434 ? 68.320 38.860 201.170 1.00 15.00 ? 466 TYR B CE1 1 
ATOM   8062 C  CE2 . TYR B 1 434 ? 70.110 40.490 200.980 1.00 15.00 ? 466 TYR B CE2 1 
ATOM   8063 C  CZ  . TYR B 1 434 ? 68.780 40.120 200.750 1.00 15.00 ? 466 TYR B CZ  1 
ATOM   8064 O  OH  . TYR B 1 434 ? 67.950 40.980 200.110 1.00 15.00 ? 466 TYR B OH  1 
ATOM   8065 N  N   . ARG B 1 435 ? 72.860 36.050 205.330 1.00 15.00 ? 467 ARG B N   1 
ATOM   8066 C  CA  . ARG B 1 435 ? 73.430 34.840 205.940 1.00 15.00 ? 467 ARG B CA  1 
ATOM   8067 C  C   . ARG B 1 435 ? 72.710 34.560 207.250 1.00 15.00 ? 467 ARG B C   1 
ATOM   8068 O  O   . ARG B 1 435 ? 72.220 33.450 207.480 1.00 15.00 ? 467 ARG B O   1 
ATOM   8069 C  CB  . ARG B 1 435 ? 74.930 35.010 206.190 1.00 15.00 ? 467 ARG B CB  1 
ATOM   8070 C  CG  . ARG B 1 435 ? 75.770 34.040 205.350 1.00 15.00 ? 467 ARG B CG  1 
ATOM   8071 C  CD  . ARG B 1 435 ? 77.120 33.730 205.980 1.00 15.00 ? 467 ARG B CD  1 
ATOM   8072 N  NE  . ARG B 1 435 ? 77.780 32.580 205.340 1.00 15.00 ? 467 ARG B NE  1 
ATOM   8073 C  CZ  . ARG B 1 435 ? 77.890 31.380 205.900 1.00 15.00 ? 467 ARG B CZ  1 
ATOM   8074 N  NH1 . ARG B 1 435 ? 77.380 31.130 207.120 1.00 15.00 ? 467 ARG B NH1 1 
ATOM   8075 N  NH2 . ARG B 1 435 ? 78.480 30.320 205.310 1.00 15.00 ? 467 ARG B NH2 1 
ATOM   8076 N  N   . LYS B 1 436 ? 72.670 35.590 208.080 1.00 15.00 ? 468 LYS B N   1 
ATOM   8077 C  CA  . LYS B 1 436 ? 72.000 35.540 209.370 1.00 15.00 ? 468 LYS B CA  1 
ATOM   8078 C  C   . LYS B 1 436 ? 70.550 35.050 209.180 1.00 15.00 ? 468 LYS B C   1 
ATOM   8079 O  O   . LYS B 1 436 ? 70.020 34.300 210.010 1.00 15.00 ? 468 LYS B O   1 
ATOM   8080 C  CB  . LYS B 1 436 ? 71.940 36.920 210.020 1.00 15.00 ? 468 LYS B CB  1 
ATOM   8081 C  CG  . LYS B 1 436 ? 73.310 37.620 210.110 1.00 15.00 ? 468 LYS B CG  1 
ATOM   8082 C  CD  . LYS B 1 436 ? 73.250 38.890 210.960 1.00 15.00 ? 468 LYS B CD  1 
ATOM   8083 C  CE  . LYS B 1 436 ? 74.380 39.890 210.620 1.00 15.00 ? 468 LYS B CE  1 
ATOM   8084 N  NZ  . LYS B 1 436 ? 74.200 41.190 211.280 1.00 15.00 ? 468 LYS B NZ  1 
ATOM   8085 N  N   . ARG B 1 437 ? 69.950 35.780 208.170 1.00 15.00 ? 469 ARG B N   1 
ATOM   8086 C  CA  . ARG B 1 437 ? 68.560 35.650 207.810 1.00 15.00 ? 469 ARG B CA  1 
ATOM   8087 C  C   . ARG B 1 437 ? 68.200 34.230 207.430 1.00 15.00 ? 469 ARG B C   1 
ATOM   8088 O  O   . ARG B 1 437 ? 67.160 33.700 207.820 1.00 15.00 ? 469 ARG B O   1 
ATOM   8089 C  CB  . ARG B 1 437 ? 68.360 36.650 206.690 1.00 15.00 ? 469 ARG B CB  1 
ATOM   8090 C  CG  . ARG B 1 437 ? 67.060 36.740 205.960 1.00 15.00 ? 469 ARG B CG  1 
ATOM   8091 C  CD  . ARG B 1 437 ? 65.910 36.850 206.930 1.00 15.00 ? 469 ARG B CD  1 
ATOM   8092 N  NE  . ARG B 1 437 ? 65.150 35.610 206.760 1.00 15.00 ? 469 ARG B NE  1 
ATOM   8093 C  CZ  . ARG B 1 437 ? 63.840 35.630 206.550 1.00 15.00 ? 469 ARG B CZ  1 
ATOM   8094 N  NH1 . ARG B 1 437 ? 63.160 36.760 206.490 1.00 15.00 ? 469 ARG B NH1 1 
ATOM   8095 N  NH2 . ARG B 1 437 ? 63.220 34.480 206.280 1.00 15.00 ? 469 ARG B NH2 1 
ATOM   8096 N  N   . PHE B 1 438 ? 69.100 33.560 206.700 1.00 15.00 ? 470 PHE B N   1 
ATOM   8097 C  CA  . PHE B 1 438 ? 68.900 32.180 206.310 1.00 15.00 ? 470 PHE B CA  1 
ATOM   8098 C  C   . PHE B 1 438 ? 69.440 31.190 207.320 1.00 15.00 ? 470 PHE B C   1 
ATOM   8099 O  O   . PHE B 1 438 ? 69.740 30.020 207.010 1.00 15.00 ? 470 PHE B O   1 
ATOM   8100 C  CB  . PHE B 1 438 ? 69.530 31.980 204.960 1.00 15.00 ? 470 PHE B CB  1 
ATOM   8101 C  CG  . PHE B 1 438 ? 68.580 32.520 203.930 1.00 15.00 ? 470 PHE B CG  1 
ATOM   8102 C  CD1 . PHE B 1 438 ? 67.570 31.720 203.460 1.00 15.00 ? 470 PHE B CD1 1 
ATOM   8103 C  CD2 . PHE B 1 438 ? 68.710 33.810 203.450 1.00 15.00 ? 470 PHE B CD2 1 
ATOM   8104 C  CE1 . PHE B 1 438 ? 66.700 32.190 202.500 1.00 15.00 ? 470 PHE B CE1 1 
ATOM   8105 C  CE2 . PHE B 1 438 ? 67.830 34.260 202.480 1.00 15.00 ? 470 PHE B CE2 1 
ATOM   8106 C  CZ  . PHE B 1 438 ? 66.830 33.450 202.010 1.00 15.00 ? 470 PHE B CZ  1 
ATOM   8107 N  N   . GLY B 1 439 ? 69.550 31.640 208.550 1.00 15.00 ? 471 GLY B N   1 
ATOM   8108 C  CA  . GLY B 1 439 ? 69.880 30.770 209.660 1.00 15.00 ? 471 GLY B CA  1 
ATOM   8109 C  C   . GLY B 1 439 ? 71.340 30.450 209.780 1.00 15.00 ? 471 GLY B C   1 
ATOM   8110 O  O   . GLY B 1 439 ? 71.710 29.540 210.540 1.00 15.00 ? 471 GLY B O   1 
ATOM   8111 N  N   . MET B 1 440 ? 72.210 31.180 209.070 1.00 15.00 ? 472 MET B N   1 
ATOM   8112 C  CA  . MET B 1 440 ? 73.640 30.940 209.130 1.00 15.00 ? 472 MET B CA  1 
ATOM   8113 C  C   . MET B 1 440 ? 74.310 32.030 209.970 1.00 15.00 ? 472 MET B C   1 
ATOM   8114 O  O   . MET B 1 440 ? 73.750 33.060 210.330 1.00 15.00 ? 472 MET B O   1 
ATOM   8115 C  CB  . MET B 1 440 ? 74.190 30.920 207.730 1.00 15.00 ? 472 MET B CB  1 
ATOM   8116 C  CG  . MET B 1 440 ? 73.600 29.840 206.890 1.00 15.00 ? 472 MET B CG  1 
ATOM   8117 S  SD  . MET B 1 440 ? 73.770 30.260 205.150 1.00 15.00 ? 472 MET B SD  1 
ATOM   8118 C  CE  . MET B 1 440 ? 75.190 29.240 204.930 1.00 15.00 ? 472 MET B CE  1 
ATOM   8119 N  N   . LYS B 1 441 ? 75.580 31.810 210.190 1.00 15.00 ? 473 LYS B N   1 
ATOM   8120 C  CA  . LYS B 1 441 ? 76.430 32.610 211.060 1.00 15.00 ? 473 LYS B CA  1 
ATOM   8121 C  C   . LYS B 1 441 ? 77.310 33.440 210.160 1.00 15.00 ? 473 LYS B C   1 
ATOM   8122 O  O   . LYS B 1 441 ? 77.820 32.900 209.190 1.00 15.00 ? 473 LYS B O   1 
ATOM   8123 C  CB  . LYS B 1 441 ? 77.240 31.660 211.950 1.00 15.00 ? 473 LYS B CB  1 
ATOM   8124 C  CG  . LYS B 1 441 ? 77.880 30.420 211.250 1.00 15.00 ? 473 LYS B CG  1 
ATOM   8125 C  CD  . LYS B 1 441 ? 76.920 29.230 210.940 1.00 15.00 ? 473 LYS B CD  1 
ATOM   8126 C  CE  . LYS B 1 441 ? 77.500 28.140 210.000 1.00 15.00 ? 473 LYS B CE  1 
ATOM   8127 N  NZ  . LYS B 1 441 ? 77.750 28.630 208.650 1.00 15.00 ? 473 LYS B NZ  1 
ATOM   8128 N  N   . PRO B 1 442 ? 77.520 34.730 210.390 1.00 15.00 ? 474 PRO B N   1 
ATOM   8129 C  CA  . PRO B 1 442 ? 78.290 35.590 209.510 1.00 15.00 ? 474 PRO B CA  1 
ATOM   8130 C  C   . PRO B 1 442 ? 79.800 35.340 209.470 1.00 15.00 ? 474 PRO B C   1 
ATOM   8131 O  O   . PRO B 1 442 ? 80.460 34.900 210.430 1.00 15.00 ? 474 PRO B O   1 
ATOM   8132 C  CB  . PRO B 1 442 ? 77.910 36.960 209.970 1.00 15.00 ? 474 PRO B CB  1 
ATOM   8133 C  CG  . PRO B 1 442 ? 77.690 36.770 211.430 1.00 15.00 ? 474 PRO B CG  1 
ATOM   8134 C  CD  . PRO B 1 442 ? 76.920 35.480 211.490 1.00 15.00 ? 474 PRO B CD  1 
ATOM   8135 N  N   . TYR B 1 443 ? 80.370 35.620 208.300 1.00 15.00 ? 475 TYR B N   1 
ATOM   8136 C  CA  . TYR B 1 443 ? 81.790 35.470 208.140 1.00 15.00 ? 475 TYR B CA  1 
ATOM   8137 C  C   . TYR B 1 443 ? 82.510 36.580 208.880 1.00 15.00 ? 475 TYR B C   1 
ATOM   8138 O  O   . TYR B 1 443 ? 82.060 37.730 208.920 1.00 15.00 ? 475 TYR B O   1 
ATOM   8139 C  CB  . TYR B 1 443 ? 82.160 35.500 206.680 1.00 15.00 ? 475 TYR B CB  1 
ATOM   8140 C  CG  . TYR B 1 443 ? 81.810 34.190 206.000 1.00 15.00 ? 475 TYR B CG  1 
ATOM   8141 C  CD1 . TYR B 1 443 ? 82.110 33.010 206.620 1.00 15.00 ? 475 TYR B CD1 1 
ATOM   8142 C  CD2 . TYR B 1 443 ? 81.240 34.180 204.740 1.00 15.00 ? 475 TYR B CD2 1 
ATOM   8143 C  CE1 . TYR B 1 443 ? 81.850 31.810 206.000 1.00 15.00 ? 475 TYR B CE1 1 
ATOM   8144 C  CE2 . TYR B 1 443 ? 80.970 32.980 204.120 1.00 15.00 ? 475 TYR B CE2 1 
ATOM   8145 C  CZ  . TYR B 1 443 ? 81.290 31.800 204.760 1.00 15.00 ? 475 TYR B CZ  1 
ATOM   8146 O  OH  . TYR B 1 443 ? 81.070 30.580 204.140 1.00 15.00 ? 475 TYR B OH  1 
ATOM   8147 N  N   . THR B 1 444 ? 83.610 36.210 209.520 1.00 15.00 ? 476 THR B N   1 
ATOM   8148 C  CA  . THR B 1 444 ? 84.400 37.160 210.300 1.00 15.00 ? 476 THR B CA  1 
ATOM   8149 C  C   . THR B 1 444 ? 85.540 37.770 209.490 1.00 15.00 ? 476 THR B C   1 
ATOM   8150 O  O   . THR B 1 444 ? 86.150 38.750 209.900 1.00 15.00 ? 476 THR B O   1 
ATOM   8151 C  CB  . THR B 1 444 ? 84.900 36.400 211.520 1.00 15.00 ? 476 THR B CB  1 
ATOM   8152 O  OG1 . THR B 1 444 ? 85.450 35.160 211.080 1.00 15.00 ? 476 THR B OG1 1 
ATOM   8153 C  CG2 . THR B 1 444 ? 83.790 36.130 212.510 1.00 15.00 ? 476 THR B CG2 1 
ATOM   8154 N  N   . SER B 1 445 ? 85.810 37.230 208.300 1.00 15.00 ? 477 SER B N   1 
ATOM   8155 C  CA  . SER B 1 445 ? 86.930 37.690 207.520 1.00 15.00 ? 477 SER B CA  1 
ATOM   8156 C  C   . SER B 1 445 ? 86.710 37.240 206.100 1.00 15.00 ? 477 SER B C   1 
ATOM   8157 O  O   . SER B 1 445 ? 86.000 36.250 205.870 1.00 15.00 ? 477 SER B O   1 
ATOM   8158 C  CB  . SER B 1 445 ? 88.170 37.040 208.060 1.00 15.00 ? 477 SER B CB  1 
ATOM   8159 O  OG  . SER B 1 445 ? 87.970 35.630 208.100 1.00 15.00 ? 477 SER B OG  1 
ATOM   8160 N  N   . PHE B 1 446 ? 87.320 37.850 205.210 1.00 15.00 ? 478 PHE B N   1 
ATOM   8161 C  CA  . PHE B 1 446 ? 87.190 37.330 203.840 1.00 15.00 ? 478 PHE B CA  1 
ATOM   8162 C  C   . PHE B 1 446 ? 87.880 35.960 203.740 1.00 15.00 ? 478 PHE B C   1 
ATOM   8163 O  O   . PHE B 1 446 ? 87.480 35.110 202.950 1.00 15.00 ? 478 PHE B O   1 
ATOM   8164 C  CB  . PHE B 1 446 ? 87.820 38.300 202.860 1.00 15.00 ? 478 PHE B CB  1 
ATOM   8165 C  CG  . PHE B 1 446 ? 86.980 39.550 202.670 1.00 15.00 ? 478 PHE B CG  1 
ATOM   8166 C  CD1 . PHE B 1 446 ? 87.130 40.630 203.560 1.00 15.00 ? 478 PHE B CD1 1 
ATOM   8167 C  CD2 . PHE B 1 446 ? 86.060 39.620 201.620 1.00 15.00 ? 478 PHE B CD2 1 
ATOM   8168 C  CE1 . PHE B 1 446 ? 86.340 41.770 203.400 1.00 15.00 ? 478 PHE B CE1 1 
ATOM   8169 C  CE2 . PHE B 1 446 ? 85.270 40.770 201.460 1.00 15.00 ? 478 PHE B CE2 1 
ATOM   8170 C  CZ  . PHE B 1 446 ? 85.420 41.840 202.340 1.00 15.00 ? 478 PHE B CZ  1 
ATOM   8171 N  N   . GLN B 1 447 ? 88.900 35.820 204.560 1.00 15.00 ? 479 GLN B N   1 
ATOM   8172 C  CA  . GLN B 1 447 ? 89.720 34.600 204.630 1.00 15.00 ? 479 GLN B CA  1 
ATOM   8173 C  C   . GLN B 1 447 ? 88.860 33.380 205.000 1.00 15.00 ? 479 GLN B C   1 
ATOM   8174 O  O   . GLN B 1 447 ? 89.150 32.240 204.600 1.00 15.00 ? 479 GLN B O   1 
ATOM   8175 C  CB  . GLN B 1 447 ? 90.820 34.750 205.690 1.00 15.00 ? 479 GLN B CB  1 
ATOM   8176 C  CG  . GLN B 1 447 ? 91.730 35.960 205.450 1.00 15.00 ? 479 GLN B CG  1 
ATOM   8177 C  CD  . GLN B 1 447 ? 93.190 35.700 205.770 1.00 15.00 ? 479 GLN B CD  1 
ATOM   8178 O  OE1 . GLN B 1 447 ? 93.510 35.290 206.890 1.00 15.00 ? 479 GLN B OE1 1 
ATOM   8179 N  NE2 . GLN B 1 447 ? 94.130 35.900 204.860 1.00 15.00 ? 479 GLN B NE2 1 
ATOM   8180 N  N   . GLU B 1 448 ? 87.820 33.650 205.760 1.00 15.00 ? 480 GLU B N   1 
ATOM   8181 C  CA  . GLU B 1 448 ? 86.860 32.620 206.220 1.00 15.00 ? 480 GLU B CA  1 
ATOM   8182 C  C   . GLU B 1 448 ? 85.890 32.310 205.090 1.00 15.00 ? 480 GLU B C   1 
ATOM   8183 O  O   . GLU B 1 448 ? 85.470 31.150 204.910 1.00 15.00 ? 480 GLU B O   1 
ATOM   8184 C  CB  . GLU B 1 448 ? 86.080 33.140 207.430 1.00 15.00 ? 480 GLU B CB  1 
ATOM   8185 C  CG  . GLU B 1 448 ? 85.330 32.050 208.180 1.00 15.00 ? 480 GLU B CG  1 
ATOM   8186 C  CD  . GLU B 1 448 ? 84.850 32.530 209.560 1.00 15.00 ? 480 GLU B CD  1 
ATOM   8187 O  OE1 . GLU B 1 448 ? 85.610 32.400 210.590 1.00 15.00 ? 480 GLU B OE1 1 
ATOM   8188 O  OE2 . GLU B 1 448 ? 83.670 33.050 209.680 1.00 15.00 ? 480 GLU B OE2 1 
ATOM   8189 N  N   . LEU B 1 449 ? 85.590 33.370 204.390 1.00 15.00 ? 481 LEU B N   1 
ATOM   8190 C  CA  . LEU B 1 449 ? 84.680 33.410 203.240 1.00 15.00 ? 481 LEU B CA  1 
ATOM   8191 C  C   . LEU B 1 449 ? 85.260 32.570 202.100 1.00 15.00 ? 481 LEU B C   1 
ATOM   8192 O  O   . LEU B 1 449 ? 84.720 31.510 201.730 1.00 15.00 ? 481 LEU B O   1 
ATOM   8193 C  CB  . LEU B 1 449 ? 84.540 34.860 202.780 1.00 15.00 ? 481 LEU B CB  1 
ATOM   8194 C  CG  . LEU B 1 449 ? 83.390 35.120 201.800 1.00 15.00 ? 481 LEU B CG  1 
ATOM   8195 C  CD1 . LEU B 1 449 ? 83.680 36.280 200.850 1.00 15.00 ? 481 LEU B CD1 1 
ATOM   8196 C  CD2 . LEU B 1 449 ? 83.090 33.910 200.920 1.00 15.00 ? 481 LEU B CD2 1 
ATOM   8197 N  N   . THR B 1 450 ? 86.360 33.090 201.550 1.00 15.00 ? 482 THR B N   1 
ATOM   8198 C  CA  . THR B 1 450 ? 87.070 32.450 200.450 1.00 15.00 ? 482 THR B CA  1 
ATOM   8199 C  C   . THR B 1 450 ? 87.660 31.120 200.920 1.00 15.00 ? 482 THR B C   1 
ATOM   8200 O  O   . THR B 1 450 ? 87.180 30.030 200.540 1.00 15.00 ? 482 THR B O   1 
ATOM   8201 C  CB  . THR B 1 450 ? 88.130 33.420 199.910 1.00 15.00 ? 482 THR B CB  1 
ATOM   8202 O  OG1 . THR B 1 450 ? 89.200 33.550 200.830 1.00 15.00 ? 482 THR B OG1 1 
ATOM   8203 C  CG2 . THR B 1 450 ? 87.580 34.830 199.650 1.00 15.00 ? 482 THR B CG2 1 
ATOM   8204 N  N   . GLY B 1 451 ? 88.690 31.160 201.730 1.00 15.00 ? 483 GLY B N   1 
ATOM   8205 C  CA  . GLY B 1 451 ? 89.310 29.930 202.250 1.00 15.00 ? 483 GLY B CA  1 
ATOM   8206 C  C   . GLY B 1 451 ? 90.750 29.810 201.790 1.00 15.00 ? 483 GLY B C   1 
ATOM   8207 O  O   . GLY B 1 451 ? 91.350 28.720 201.830 1.00 15.00 ? 483 GLY B O   1 
ATOM   8208 N  N   . GLU B 1 452 ? 91.230 30.940 201.370 1.00 15.00 ? 484 GLU B N   1 
ATOM   8209 C  CA  . GLU B 1 452 ? 92.600 31.130 200.930 1.00 15.00 ? 484 GLU B CA  1 
ATOM   8210 C  C   . GLU B 1 452 ? 92.980 32.540 201.370 1.00 15.00 ? 484 GLU B C   1 
ATOM   8211 O  O   . GLU B 1 452 ? 92.210 33.220 202.070 1.00 15.00 ? 484 GLU B O   1 
ATOM   8212 C  CB  . GLU B 1 452 ? 92.700 30.920 199.430 1.00 15.00 ? 484 GLU B CB  1 
ATOM   8213 C  CG  . GLU B 1 452 ? 91.620 31.650 198.640 1.00 15.00 ? 484 GLU B CG  1 
ATOM   8214 C  CD  . GLU B 1 452 ? 92.070 33.030 198.210 1.00 15.00 ? 484 GLU B CD  1 
ATOM   8215 O  OE1 . GLU B 1 452 ? 92.900 33.170 197.230 1.00 15.00 ? 484 GLU B OE1 1 
ATOM   8216 O  OE2 . GLU B 1 452 ? 91.630 34.070 198.840 1.00 15.00 ? 484 GLU B OE2 1 
ATOM   8217 N  N   . LYS B 1 453 ? 94.150 32.990 200.980 1.00 15.00 ? 485 LYS B N   1 
ATOM   8218 C  CA  . LYS B 1 453 ? 94.660 34.280 201.470 1.00 15.00 ? 485 LYS B CA  1 
ATOM   8219 C  C   . LYS B 1 453 ? 94.800 35.340 200.370 1.00 15.00 ? 485 LYS B C   1 
ATOM   8220 O  O   . LYS B 1 453 ? 94.530 36.520 200.610 1.00 15.00 ? 485 LYS B O   1 
ATOM   8221 C  CB  . LYS B 1 453 ? 96.010 34.090 202.130 1.00 15.00 ? 485 LYS B CB  1 
ATOM   8222 C  CG  . LYS B 1 453 ? 95.900 33.430 203.510 1.00 15.00 ? 485 LYS B CG  1 
ATOM   8223 C  CD  . LYS B 1 453 ? 97.220 33.440 204.270 1.00 15.00 ? 485 LYS B CD  1 
ATOM   8224 C  CE  . LYS B 1 453 ? 97.040 33.180 205.770 1.00 15.00 ? 485 LYS B CE  1 
ATOM   8225 N  NZ  . LYS B 1 453 ? 96.170 34.180 206.430 1.00 15.00 ? 485 LYS B NZ  1 
ATOM   8226 N  N   . GLU B 1 454 ? 95.230 34.960 199.200 1.00 15.00 ? 486 GLU B N   1 
ATOM   8227 C  CA  . GLU B 1 454 ? 95.430 35.960 198.130 1.00 15.00 ? 486 GLU B CA  1 
ATOM   8228 C  C   . GLU B 1 454 ? 94.110 36.650 197.800 1.00 15.00 ? 486 GLU B C   1 
ATOM   8229 O  O   . GLU B 1 454 ? 93.970 37.880 197.980 1.00 15.00 ? 486 GLU B O   1 
ATOM   8230 C  CB  . GLU B 1 454 ? 96.000 35.330 196.860 1.00 15.00 ? 486 GLU B CB  1 
ATOM   8231 C  CG  . GLU B 1 454 ? 96.710 36.370 195.990 1.00 15.00 ? 486 GLU B CG  1 
ATOM   8232 C  CD  . GLU B 1 454 ? 97.600 35.770 194.900 1.00 15.00 ? 486 GLU B CD  1 
ATOM   8233 O  OE1 . GLU B 1 454 ? 97.920 34.520 194.950 1.00 15.00 ? 486 GLU B OE1 1 
ATOM   8234 O  OE2 . GLU B 1 454 ? 98.000 36.500 193.930 1.00 15.00 ? 486 GLU B OE2 1 
ATOM   8235 N  N   . MET B 1 455 ? 93.050 36.130 197.260 1.00 15.00 ? 487 MET B N   1 
ATOM   8236 C  CA  . MET B 1 455 ? 91.850 36.830 196.860 1.00 15.00 ? 487 MET B CA  1 
ATOM   8237 C  C   . MET B 1 455 ? 91.220 37.530 198.040 1.00 15.00 ? 487 MET B C   1 
ATOM   8238 O  O   . MET B 1 455 ? 90.860 38.690 197.950 1.00 15.00 ? 487 MET B O   1 
ATOM   8239 C  CB  . MET B 1 455 ? 90.800 35.920 196.330 1.00 15.00 ? 487 MET B CB  1 
ATOM   8240 C  CG  . MET B 1 455 ? 91.030 35.580 194.920 1.00 15.00 ? 487 MET B CG  1 
ATOM   8241 S  SD  . MET B 1 455 ? 89.520 34.770 194.320 1.00 15.00 ? 487 MET B SD  1 
ATOM   8242 C  CE  . MET B 1 455 ? 89.790 33.090 194.810 1.00 15.00 ? 487 MET B CE  1 
ATOM   8243 N  N   . ALA B 1 456 ? 91.160 36.790 199.140 1.00 15.00 ? 488 ALA B N   1 
ATOM   8244 C  CA  . ALA B 1 456 ? 90.580 37.280 200.360 1.00 15.00 ? 488 ALA B CA  1 
ATOM   8245 C  C   . ALA B 1 456 ? 91.200 38.610 200.710 1.00 15.00 ? 488 ALA B C   1 
ATOM   8246 O  O   . ALA B 1 456 ? 90.480 39.580 200.920 1.00 15.00 ? 488 ALA B O   1 
ATOM   8247 C  CB  . ALA B 1 456 ? 90.850 36.310 201.470 1.00 15.00 ? 488 ALA B CB  1 
ATOM   8248 N  N   . ALA B 1 457 ? 92.520 38.680 200.640 1.00 15.00 ? 489 ALA B N   1 
ATOM   8249 C  CA  . ALA B 1 457 ? 93.270 39.860 200.980 1.00 15.00 ? 489 ALA B CA  1 
ATOM   8250 C  C   . ALA B 1 457 ? 92.950 41.040 200.080 1.00 15.00 ? 489 ALA B C   1 
ATOM   8251 O  O   . ALA B 1 457 ? 92.730 42.150 200.550 1.00 15.00 ? 489 ALA B O   1 
ATOM   8252 C  CB  . ALA B 1 457 ? 94.740 39.560 200.870 1.00 15.00 ? 489 ALA B CB  1 
ATOM   8253 N  N   . GLU B 1 458 ? 92.840 40.820 198.770 1.00 15.00 ? 490 GLU B N   1 
ATOM   8254 C  CA  . GLU B 1 458 ? 92.540 41.910 197.860 1.00 15.00 ? 490 GLU B CA  1 
ATOM   8255 C  C   . GLU B 1 458 ? 91.090 42.350 198.000 1.00 15.00 ? 490 GLU B C   1 
ATOM   8256 O  O   . GLU B 1 458 ? 90.750 43.530 197.920 1.00 15.00 ? 490 GLU B O   1 
ATOM   8257 C  CB  . GLU B 1 458 ? 92.800 41.440 196.480 1.00 15.00 ? 490 GLU B CB  1 
ATOM   8258 C  CG  . GLU B 1 458 ? 92.710 42.540 195.440 1.00 15.00 ? 490 GLU B CG  1 
ATOM   8259 C  CD  . GLU B 1 458 ? 93.060 42.080 194.030 1.00 15.00 ? 490 GLU B CD  1 
ATOM   8260 O  OE1 . GLU B 1 458 ? 93.270 40.880 193.790 1.00 15.00 ? 490 GLU B OE1 1 
ATOM   8261 O  OE2 . GLU B 1 458 ? 93.110 42.960 193.160 1.00 15.00 ? 490 GLU B OE2 1 
ATOM   8262 N  N   . LEU B 1 459 ? 90.250 41.370 198.270 1.00 15.00 ? 491 LEU B N   1 
ATOM   8263 C  CA  . LEU B 1 459 ? 88.820 41.520 198.440 1.00 15.00 ? 491 LEU B CA  1 
ATOM   8264 C  C   . LEU B 1 459 ? 88.620 42.410 199.640 1.00 15.00 ? 491 LEU B C   1 
ATOM   8265 O  O   . LEU B 1 459 ? 87.840 43.340 199.620 1.00 15.00 ? 491 LEU B O   1 
ATOM   8266 C  CB  . LEU B 1 459 ? 88.250 40.140 198.640 1.00 15.00 ? 491 LEU B CB  1 
ATOM   8267 C  CG  . LEU B 1 459 ? 86.890 39.790 198.150 1.00 15.00 ? 491 LEU B CG  1 
ATOM   8268 C  CD1 . LEU B 1 459 ? 86.630 40.280 196.740 1.00 15.00 ? 491 LEU B CD1 1 
ATOM   8269 C  CD2 . LEU B 1 459 ? 86.830 38.290 198.190 1.00 15.00 ? 491 LEU B CD2 1 
ATOM   8270 N  N   . GLU B 1 460 ? 89.420 42.150 200.680 1.00 15.00 ? 492 GLU B N   1 
ATOM   8271 C  CA  . GLU B 1 460 ? 89.390 42.930 201.890 1.00 15.00 ? 492 GLU B CA  1 
ATOM   8272 C  C   . GLU B 1 460 ? 89.790 44.340 201.580 1.00 15.00 ? 492 GLU B C   1 
ATOM   8273 O  O   . GLU B 1 460 ? 89.110 45.280 201.960 1.00 15.00 ? 492 GLU B O   1 
ATOM   8274 C  CB  . GLU B 1 460 ? 90.330 42.320 202.870 1.00 15.00 ? 492 GLU B CB  1 
ATOM   8275 C  CG  . GLU B 1 460 ? 90.210 43.040 204.190 1.00 15.00 ? 492 GLU B CG  1 
ATOM   8276 C  CD  . GLU B 1 460 ? 90.900 42.340 205.360 1.00 15.00 ? 492 GLU B CD  1 
ATOM   8277 O  OE1 . GLU B 1 460 ? 92.120 42.530 205.510 1.00 15.00 ? 492 GLU B OE1 1 
ATOM   8278 O  OE2 . GLU B 1 460 ? 90.210 41.630 206.120 1.00 15.00 ? 492 GLU B OE2 1 
ATOM   8279 N  N   . GLU B 1 461 ? 90.860 44.490 200.830 1.00 15.00 ? 493 GLU B N   1 
ATOM   8280 C  CA  . GLU B 1 461 ? 91.370 45.790 200.410 1.00 15.00 ? 493 GLU B CA  1 
ATOM   8281 C  C   . GLU B 1 461 ? 90.300 46.550 199.650 1.00 15.00 ? 493 GLU B C   1 
ATOM   8282 O  O   . GLU B 1 461 ? 90.170 47.760 199.830 1.00 15.00 ? 493 GLU B O   1 
ATOM   8283 C  CB  . GLU B 1 461 ? 92.590 45.510 199.560 1.00 15.00 ? 493 GLU B CB  1 
ATOM   8284 C  CG  . GLU B 1 461 ? 93.260 46.640 198.780 1.00 15.00 ? 493 GLU B CG  1 
ATOM   8285 C  CD  . GLU B 1 461 ? 94.340 46.110 197.800 1.00 15.00 ? 493 GLU B CD  1 
ATOM   8286 O  OE1 . GLU B 1 461 ? 95.510 45.920 198.250 1.00 15.00 ? 493 GLU B OE1 1 
ATOM   8287 O  OE2 . GLU B 1 461 ? 94.030 45.900 196.610 1.00 15.00 ? 493 GLU B OE2 1 
ATOM   8288 N  N   . LEU B 1 462 ? 89.510 45.860 198.830 1.00 15.00 ? 494 LEU B N   1 
ATOM   8289 C  CA  . LEU B 1 462 ? 88.450 46.490 198.100 1.00 15.00 ? 494 LEU B CA  1 
ATOM   8290 C  C   . LEU B 1 462 ? 87.190 46.810 198.910 1.00 15.00 ? 494 LEU B C   1 
ATOM   8291 O  O   . LEU B 1 462 ? 86.730 47.950 198.890 1.00 15.00 ? 494 LEU B O   1 
ATOM   8292 C  CB  . LEU B 1 462 ? 88.100 45.600 196.960 1.00 15.00 ? 494 LEU B CB  1 
ATOM   8293 C  CG  . LEU B 1 462 ? 88.940 45.870 195.750 1.00 15.00 ? 494 LEU B CG  1 
ATOM   8294 C  CD1 . LEU B 1 462 ? 88.870 44.710 194.800 1.00 15.00 ? 494 LEU B CD1 1 
ATOM   8295 C  CD2 . LEU B 1 462 ? 88.430 47.120 195.100 1.00 15.00 ? 494 LEU B CD2 1 
ATOM   8296 N  N   . TYR B 1 463 ? 86.580 45.840 199.590 1.00 15.00 ? 495 TYR B N   1 
ATOM   8297 C  CA  . TYR B 1 463 ? 85.330 46.060 200.280 1.00 15.00 ? 495 TYR B CA  1 
ATOM   8298 C  C   . TYR B 1 463 ? 85.470 46.820 201.570 1.00 15.00 ? 495 TYR B C   1 
ATOM   8299 O  O   . TYR B 1 463 ? 84.570 47.550 202.000 1.00 15.00 ? 495 TYR B O   1 
ATOM   8300 C  CB  . TYR B 1 463 ? 84.650 44.730 200.490 1.00 15.00 ? 495 TYR B CB  1 
ATOM   8301 C  CG  . TYR B 1 463 ? 83.790 44.410 199.280 1.00 15.00 ? 495 TYR B CG  1 
ATOM   8302 C  CD1 . TYR B 1 463 ? 82.840 45.320 198.860 1.00 15.00 ? 495 TYR B CD1 1 
ATOM   8303 C  CD2 . TYR B 1 463 ? 83.950 43.240 198.580 1.00 15.00 ? 495 TYR B CD2 1 
ATOM   8304 C  CE1 . TYR B 1 463 ? 82.070 45.080 197.750 1.00 15.00 ? 495 TYR B CE1 1 
ATOM   8305 C  CE2 . TYR B 1 463 ? 83.180 43.000 197.460 1.00 15.00 ? 495 TYR B CE2 1 
ATOM   8306 C  CZ  . TYR B 1 463 ? 82.240 43.920 197.050 1.00 15.00 ? 495 TYR B CZ  1 
ATOM   8307 O  OH  . TYR B 1 463 ? 81.470 43.690 195.930 1.00 15.00 ? 495 TYR B OH  1 
ATOM   8308 N  N   . GLY B 1 464 ? 86.600 46.680 202.230 1.00 15.00 ? 496 GLY B N   1 
ATOM   8309 C  CA  . GLY B 1 464 ? 86.800 47.400 203.460 1.00 15.00 ? 496 GLY B CA  1 
ATOM   8310 C  C   . GLY B 1 464 ? 86.340 46.560 204.630 1.00 15.00 ? 496 GLY B C   1 
ATOM   8311 O  O   . GLY B 1 464 ? 87.070 46.450 205.610 1.00 15.00 ? 496 GLY B O   1 
ATOM   8312 N  N   . ASP B 1 465 ? 85.180 45.920 204.600 1.00 15.00 ? 497 ASP B N   1 
ATOM   8313 C  CA  . ASP B 1 465 ? 84.730 45.150 205.760 1.00 15.00 ? 497 ASP B CA  1 
ATOM   8314 C  C   . ASP B 1 465 ? 84.110 43.820 205.330 1.00 15.00 ? 497 ASP B C   1 
ATOM   8315 O  O   . ASP B 1 465 ? 83.400 43.820 204.320 1.00 15.00 ? 497 ASP B O   1 
ATOM   8316 C  CB  . ASP B 1 465 ? 83.710 45.980 206.500 1.00 15.00 ? 497 ASP B CB  1 
ATOM   8317 C  CG  . ASP B 1 465 ? 83.620 45.630 207.960 1.00 15.00 ? 497 ASP B CG  1 
ATOM   8318 O  OD1 . ASP B 1 465 ? 83.340 44.460 208.300 1.00 15.00 ? 497 ASP B OD1 1 
ATOM   8319 O  OD2 . ASP B 1 465 ? 83.830 46.550 208.750 1.00 15.00 ? 497 ASP B OD2 1 
ATOM   8320 N  N   . ILE B 1 466 ? 84.290 42.670 206.000 1.00 15.00 ? 498 ILE B N   1 
ATOM   8321 C  CA  . ILE B 1 466 ? 83.620 41.460 205.510 1.00 15.00 ? 498 ILE B CA  1 
ATOM   8322 C  C   . ILE B 1 466 ? 82.100 41.660 205.560 1.00 15.00 ? 498 ILE B C   1 
ATOM   8323 O  O   . ILE B 1 466 ? 81.360 41.310 204.630 1.00 15.00 ? 498 ILE B O   1 
ATOM   8324 C  CB  . ILE B 1 466 ? 84.070 40.230 206.360 1.00 15.00 ? 498 ILE B CB  1 
ATOM   8325 C  CG1 . ILE B 1 466 ? 83.360 38.950 205.910 1.00 15.00 ? 498 ILE B CG1 1 
ATOM   8326 C  CG2 . ILE B 1 466 ? 83.830 40.510 207.820 1.00 15.00 ? 498 ILE B CG2 1 
ATOM   8327 C  CD1 . ILE B 1 466 ? 83.620 38.530 204.460 1.00 15.00 ? 498 ILE B CD1 1 
ATOM   8328 N  N   . ASP B 1 467 ? 81.680 42.450 206.560 1.00 15.00 ? 499 ASP B N   1 
ATOM   8329 C  CA  . ASP B 1 467 ? 80.300 42.810 206.740 1.00 15.00 ? 499 ASP B CA  1 
ATOM   8330 C  C   . ASP B 1 467 ? 79.790 43.770 205.670 1.00 15.00 ? 499 ASP B C   1 
ATOM   8331 O  O   . ASP B 1 467 ? 78.730 44.340 205.880 1.00 15.00 ? 499 ASP B O   1 
ATOM   8332 C  CB  . ASP B 1 467 ? 80.090 43.440 208.140 1.00 15.00 ? 499 ASP B CB  1 
ATOM   8333 C  CG  . ASP B 1 467 ? 79.810 42.440 209.280 1.00 15.00 ? 499 ASP B CG  1 
ATOM   8334 O  OD1 . ASP B 1 467 ? 78.680 41.940 209.380 1.00 15.00 ? 499 ASP B OD1 1 
ATOM   8335 O  OD2 . ASP B 1 467 ? 80.710 42.180 210.080 1.00 15.00 ? 499 ASP B OD2 1 
ATOM   8336 N  N   . ALA B 1 468 ? 80.490 43.980 204.540 1.00 15.00 ? 500 ALA B N   1 
ATOM   8337 C  CA  . ALA B 1 468 ? 80.070 44.820 203.440 1.00 15.00 ? 500 ALA B CA  1 
ATOM   8338 C  C   . ALA B 1 468 ? 80.210 44.080 202.090 1.00 15.00 ? 500 ALA B C   1 
ATOM   8339 O  O   . ALA B 1 468 ? 80.170 44.660 200.990 1.00 15.00 ? 500 ALA B O   1 
ATOM   8340 C  CB  . ALA B 1 468 ? 80.900 46.070 203.370 1.00 15.00 ? 500 ALA B CB  1 
ATOM   8341 N  N   . LEU B 1 469 ? 80.370 42.750 202.150 1.00 15.00 ? 501 LEU B N   1 
ATOM   8342 C  CA  . LEU B 1 469 ? 80.480 41.970 200.930 1.00 15.00 ? 501 LEU B CA  1 
ATOM   8343 C  C   . LEU B 1 469 ? 79.090 41.920 200.290 1.00 15.00 ? 501 LEU B C   1 
ATOM   8344 O  O   . LEU B 1 469 ? 78.070 41.590 200.900 1.00 15.00 ? 501 LEU B O   1 
ATOM   8345 C  CB  . LEU B 1 469 ? 80.980 40.590 201.320 1.00 15.00 ? 501 LEU B CB  1 
ATOM   8346 C  CG  . LEU B 1 469 ? 81.180 39.580 200.230 1.00 15.00 ? 501 LEU B CG  1 
ATOM   8347 C  CD1 . LEU B 1 469 ? 82.170 40.000 199.170 1.00 15.00 ? 501 LEU B CD1 1 
ATOM   8348 C  CD2 . LEU B 1 469 ? 81.710 38.360 200.910 1.00 15.00 ? 501 LEU B CD2 1 
ATOM   8349 N  N   . GLU B 1 470 ? 79.030 42.340 199.030 1.00 15.00 ? 502 GLU B N   1 
ATOM   8350 C  CA  . GLU B 1 470 ? 77.780 42.340 198.260 1.00 15.00 ? 502 GLU B CA  1 
ATOM   8351 C  C   . GLU B 1 470 ? 77.170 40.940 198.170 1.00 15.00 ? 502 GLU B C   1 
ATOM   8352 O  O   . GLU B 1 470 ? 77.920 39.960 198.150 1.00 15.00 ? 502 GLU B O   1 
ATOM   8353 C  CB  . GLU B 1 470 ? 78.110 42.870 196.860 1.00 15.00 ? 502 GLU B CB  1 
ATOM   8354 C  CG  . GLU B 1 470 ? 78.660 44.280 196.830 1.00 15.00 ? 502 GLU B CG  1 
ATOM   8355 C  CD  . GLU B 1 470 ? 78.110 45.120 195.700 1.00 15.00 ? 502 GLU B CD  1 
ATOM   8356 O  OE1 . GLU B 1 470 ? 76.870 45.210 195.650 1.00 15.00 ? 502 GLU B OE1 1 
ATOM   8357 O  OE2 . GLU B 1 470 ? 78.880 45.680 194.900 1.00 15.00 ? 502 GLU B OE2 1 
ATOM   8358 N  N   . PHE B 1 471 ? 75.840 40.750 198.110 1.00 15.00 ? 503 PHE B N   1 
ATOM   8359 C  CA  . PHE B 1 471 ? 75.220 39.420 198.030 1.00 15.00 ? 503 PHE B CA  1 
ATOM   8360 C  C   . PHE B 1 471 ? 75.700 38.530 196.870 1.00 15.00 ? 503 PHE B C   1 
ATOM   8361 O  O   . PHE B 1 471 ? 76.230 37.450 197.130 1.00 15.00 ? 503 PHE B O   1 
ATOM   8362 C  CB  . PHE B 1 471 ? 73.700 39.550 197.940 1.00 15.00 ? 503 PHE B CB  1 
ATOM   8363 C  CG  . PHE B 1 471 ? 72.860 38.280 197.900 1.00 15.00 ? 503 PHE B CG  1 
ATOM   8364 C  CD1 . PHE B 1 471 ? 72.700 37.510 199.030 1.00 15.00 ? 503 PHE B CD1 1 
ATOM   8365 C  CD2 . PHE B 1 471 ? 72.220 37.930 196.720 1.00 15.00 ? 503 PHE B CD2 1 
ATOM   8366 C  CE1 . PHE B 1 471 ? 71.910 36.390 198.980 1.00 15.00 ? 503 PHE B CE1 1 
ATOM   8367 C  CE2 . PHE B 1 471 ? 71.420 36.820 196.670 1.00 15.00 ? 503 PHE B CE2 1 
ATOM   8368 C  CZ  . PHE B 1 471 ? 71.270 36.060 197.800 1.00 15.00 ? 503 PHE B CZ  1 
ATOM   8369 N  N   . TYR B 1 472 ? 75.550 38.930 195.610 1.00 15.00 ? 504 TYR B N   1 
ATOM   8370 C  CA  . TYR B 1 472 ? 76.010 38.030 194.550 1.00 15.00 ? 504 TYR B CA  1 
ATOM   8371 C  C   . TYR B 1 472 ? 77.500 37.740 194.570 1.00 15.00 ? 504 TYR B C   1 
ATOM   8372 O  O   . TYR B 1 472 ? 77.810 36.550 194.500 1.00 15.00 ? 504 TYR B O   1 
ATOM   8373 C  CB  . TYR B 1 472 ? 75.600 38.600 193.210 1.00 15.00 ? 504 TYR B CB  1 
ATOM   8374 C  CG  . TYR B 1 472 ? 76.000 37.750 192.010 1.00 15.00 ? 504 TYR B CG  1 
ATOM   8375 C  CD1 . TYR B 1 472 ? 75.360 36.570 191.720 1.00 15.00 ? 504 TYR B CD1 1 
ATOM   8376 C  CD2 . TYR B 1 472 ? 77.000 38.210 191.180 1.00 15.00 ? 504 TYR B CD2 1 
ATOM   8377 C  CE1 . TYR B 1 472 ? 75.680 35.870 190.590 1.00 15.00 ? 504 TYR B CE1 1 
ATOM   8378 C  CE2 . TYR B 1 472 ? 77.330 37.510 190.040 1.00 15.00 ? 504 TYR B CE2 1 
ATOM   8379 C  CZ  . TYR B 1 472 ? 76.660 36.350 189.760 1.00 15.00 ? 504 TYR B CZ  1 
ATOM   8380 O  OH  . TYR B 1 472 ? 76.960 35.690 188.580 1.00 15.00 ? 504 TYR B OH  1 
ATOM   8381 N  N   . PRO B 1 473 ? 78.470 38.690 194.670 1.00 15.00 ? 505 PRO B N   1 
ATOM   8382 C  CA  . PRO B 1 473 ? 79.890 38.390 194.730 1.00 15.00 ? 505 PRO B CA  1 
ATOM   8383 C  C   . PRO B 1 473 ? 80.160 37.340 195.780 1.00 15.00 ? 505 PRO B C   1 
ATOM   8384 O  O   . PRO B 1 473 ? 80.690 36.280 195.470 1.00 15.00 ? 505 PRO B O   1 
ATOM   8385 C  CB  . PRO B 1 473 ? 80.540 39.700 195.020 1.00 15.00 ? 505 PRO B CB  1 
ATOM   8386 C  CG  . PRO B 1 473 ? 79.660 40.640 194.260 1.00 15.00 ? 505 PRO B CG  1 
ATOM   8387 C  CD  . PRO B 1 473 ? 78.290 40.130 194.640 1.00 15.00 ? 505 PRO B CD  1 
ATOM   8388 N  N   . GLY B 1 474 ? 79.680 37.560 197.000 1.00 15.00 ? 506 GLY B N   1 
ATOM   8389 C  CA  . GLY B 1 474 ? 79.930 36.650 198.100 1.00 15.00 ? 506 GLY B CA  1 
ATOM   8390 C  C   . GLY B 1 474 ? 79.430 35.240 197.820 1.00 15.00 ? 506 GLY B C   1 
ATOM   8391 O  O   . GLY B 1 474 ? 80.100 34.250 198.120 1.00 15.00 ? 506 GLY B O   1 
ATOM   8392 N  N   . LEU B 1 475 ? 78.290 35.160 197.160 1.00 15.00 ? 507 LEU B N   1 
ATOM   8393 C  CA  . LEU B 1 475 ? 77.680 33.890 196.820 1.00 15.00 ? 507 LEU B CA  1 
ATOM   8394 C  C   . LEU B 1 475 ? 78.560 33.050 195.900 1.00 15.00 ? 507 LEU B C   1 
ATOM   8395 O  O   . LEU B 1 475 ? 78.780 31.860 196.120 1.00 15.00 ? 507 LEU B O   1 
ATOM   8396 C  CB  . LEU B 1 475 ? 76.390 34.240 196.180 1.00 15.00 ? 507 LEU B CB  1 
ATOM   8397 C  CG  . LEU B 1 475 ? 75.170 33.440 196.430 1.00 15.00 ? 507 LEU B CG  1 
ATOM   8398 C  CD1 . LEU B 1 475 ? 74.850 33.260 197.890 1.00 15.00 ? 507 LEU B CD1 1 
ATOM   8399 C  CD2 . LEU B 1 475 ? 74.050 34.220 195.800 1.00 15.00 ? 507 LEU B CD2 1 
ATOM   8400 N  N   . LEU B 1 476 ? 79.090 33.720 194.890 1.00 15.00 ? 508 LEU B N   1 
ATOM   8401 C  CA  . LEU B 1 476 ? 79.950 33.110 193.900 1.00 15.00 ? 508 LEU B CA  1 
ATOM   8402 C  C   . LEU B 1 476 ? 81.400 32.890 194.330 1.00 15.00 ? 508 LEU B C   1 
ATOM   8403 O  O   . LEU B 1 476 ? 82.080 31.960 193.870 1.00 15.00 ? 508 LEU B O   1 
ATOM   8404 C  CB  . LEU B 1 476 ? 79.850 33.970 192.690 1.00 15.00 ? 508 LEU B CB  1 
ATOM   8405 C  CG  . LEU B 1 476 ? 79.290 33.290 191.480 1.00 15.00 ? 508 LEU B CG  1 
ATOM   8406 C  CD1 . LEU B 1 476 ? 77.880 32.780 191.680 1.00 15.00 ? 508 LEU B CD1 1 
ATOM   8407 C  CD2 . LEU B 1 476 ? 79.330 34.300 190.370 1.00 15.00 ? 508 LEU B CD2 1 
ATOM   8408 N  N   . LEU B 1 477 ? 81.910 33.750 195.210 1.00 15.00 ? 509 LEU B N   1 
ATOM   8409 C  CA  . LEU B 1 477 ? 83.280 33.670 195.690 1.00 15.00 ? 509 LEU B CA  1 
ATOM   8410 C  C   . LEU B 1 477 ? 83.460 32.850 196.940 1.00 15.00 ? 509 LEU B C   1 
ATOM   8411 O  O   . LEU B 1 477 ? 84.590 32.650 197.370 1.00 15.00 ? 509 LEU B O   1 
ATOM   8412 C  CB  . LEU B 1 477 ? 83.810 35.080 195.940 1.00 15.00 ? 509 LEU B CB  1 
ATOM   8413 C  CG  . LEU B 1 477 ? 83.970 36.060 194.750 1.00 15.00 ? 509 LEU B CG  1 
ATOM   8414 C  CD1 . LEU B 1 477 ? 84.460 37.390 195.250 1.00 15.00 ? 509 LEU B CD1 1 
ATOM   8415 C  CD2 . LEU B 1 477 ? 84.980 35.510 193.740 1.00 15.00 ? 509 LEU B CD2 1 
ATOM   8416 N  N   . GLU B 1 478 ? 82.410 32.370 197.610 1.00 15.00 ? 510 GLU B N   1 
ATOM   8417 C  CA  . GLU B 1 478 ? 82.530 31.520 198.790 1.00 15.00 ? 510 GLU B CA  1 
ATOM   8418 C  C   . GLU B 1 478 ? 83.100 30.150 198.460 1.00 15.00 ? 510 GLU B C   1 
ATOM   8419 O  O   . GLU B 1 478 ? 82.930 29.630 197.350 1.00 15.00 ? 510 GLU B O   1 
ATOM   8420 C  CB  . GLU B 1 478 ? 81.160 31.360 199.410 1.00 15.00 ? 510 GLU B CB  1 
ATOM   8421 C  CG  . GLU B 1 478 ? 81.030 30.490 200.640 1.00 15.00 ? 510 GLU B CG  1 
ATOM   8422 C  CD  . GLU B 1 478 ? 79.580 30.270 201.070 1.00 15.00 ? 510 GLU B CD  1 
ATOM   8423 O  OE1 . GLU B 1 478 ? 78.810 29.680 200.320 1.00 15.00 ? 510 GLU B OE1 1 
ATOM   8424 O  OE2 . GLU B 1 478 ? 79.240 30.710 202.160 1.00 15.00 ? 510 GLU B OE2 1 
ATOM   8425 N  N   . LYS B 1 479 ? 83.740 29.560 199.450 1.00 15.00 ? 511 LYS B N   1 
ATOM   8426 C  CA  . LYS B 1 479 ? 84.370 28.280 199.250 1.00 15.00 ? 511 LYS B CA  1 
ATOM   8427 C  C   . LYS B 1 479 ? 83.410 27.170 199.010 1.00 15.00 ? 511 LYS B C   1 
ATOM   8428 O  O   . LYS B 1 479 ? 82.410 27.010 199.710 1.00 15.00 ? 511 LYS B O   1 
ATOM   8429 C  CB  . LYS B 1 479 ? 85.240 27.930 200.430 1.00 15.00 ? 511 LYS B CB  1 
ATOM   8430 C  CG  . LYS B 1 479 ? 84.580 27.790 201.780 1.00 15.00 ? 511 LYS B CG  1 
ATOM   8431 C  CD  . LYS B 1 479 ? 85.600 28.250 202.800 1.00 15.00 ? 511 LYS B CD  1 
ATOM   8432 C  CE  . LYS B 1 479 ? 85.220 27.920 204.230 1.00 15.00 ? 511 LYS B CE  1 
ATOM   8433 N  NZ  . LYS B 1 479 ? 83.870 28.390 204.520 1.00 15.00 ? 511 LYS B NZ  1 
ATOM   8434 N  N   . CYS B 1 480 ? 83.690 26.420 197.970 1.00 15.00 ? 512 CYS B N   1 
ATOM   8435 C  CA  . CYS B 1 480 ? 82.850 25.290 197.660 1.00 15.00 ? 512 CYS B CA  1 
ATOM   8436 C  C   . CYS B 1 480 ? 82.940 24.270 198.760 1.00 15.00 ? 512 CYS B C   1 
ATOM   8437 O  O   . CYS B 1 480 ? 83.910 24.190 199.520 1.00 15.00 ? 512 CYS B O   1 
ATOM   8438 C  CB  . CYS B 1 480 ? 83.280 24.630 196.380 1.00 15.00 ? 512 CYS B CB  1 
ATOM   8439 S  SG  . CYS B 1 480 ? 82.730 25.700 195.040 1.00 15.00 ? 512 CYS B SG  1 
ATOM   8440 N  N   . HIS B 1 481 ? 81.820 23.570 198.930 1.00 15.00 ? 513 HIS B N   1 
ATOM   8441 C  CA  . HIS B 1 481 ? 81.730 22.460 199.870 1.00 15.00 ? 513 HIS B CA  1 
ATOM   8442 C  C   . HIS B 1 481 ? 82.680 21.440 199.300 1.00 15.00 ? 513 HIS B C   1 
ATOM   8443 O  O   . HIS B 1 481 ? 82.710 21.340 198.080 1.00 15.00 ? 513 HIS B O   1 
ATOM   8444 C  CB  . HIS B 1 481 ? 80.370 21.820 199.890 1.00 15.00 ? 513 HIS B CB  1 
ATOM   8445 C  CG  . HIS B 1 481 ? 79.440 22.250 200.980 1.00 15.00 ? 513 HIS B CG  1 
ATOM   8446 N  ND1 . HIS B 1 481 ? 79.750 22.220 202.340 1.00 15.00 ? 513 HIS B ND1 1 
ATOM   8447 C  CD2 . HIS B 1 481 ? 78.140 22.700 200.760 1.00 15.00 ? 513 HIS B CD2 1 
ATOM   8448 C  CE1 . HIS B 1 481 ? 78.630 22.680 202.950 1.00 15.00 ? 513 HIS B CE1 1 
ATOM   8449 N  NE2 . HIS B 1 481 ? 77.700 22.950 202.060 1.00 15.00 ? 513 HIS B NE2 1 
ATOM   8450 N  N   . PRO B 1 482 ? 83.440 20.680 200.120 1.00 15.00 ? 514 PRO B N   1 
ATOM   8451 C  CA  . PRO B 1 482 ? 84.280 19.540 199.760 1.00 15.00 ? 514 PRO B CA  1 
ATOM   8452 C  C   . PRO B 1 482 ? 84.570 19.400 198.290 1.00 15.00 ? 514 PRO B C   1 
ATOM   8453 O  O   . PRO B 1 482 ? 85.520 20.040 197.810 1.00 15.00 ? 514 PRO B O   1 
ATOM   8454 C  CB  . PRO B 1 482 ? 83.490 18.430 200.370 1.00 15.00 ? 514 PRO B CB  1 
ATOM   8455 C  CG  . PRO B 1 482 ? 83.090 19.070 201.700 1.00 15.00 ? 514 PRO B CG  1 
ATOM   8456 C  CD  . PRO B 1 482 ? 83.280 20.580 201.550 1.00 15.00 ? 514 PRO B CD  1 
ATOM   8457 N  N   . ASN B 1 483 ? 83.740 18.680 197.550 1.00 15.00 ? 515 ASN B N   1 
ATOM   8458 C  CA  . ASN B 1 483 ? 84.000 18.600 196.120 1.00 15.00 ? 515 ASN B CA  1 
ATOM   8459 C  C   . ASN B 1 483 ? 82.650 18.710 195.460 1.00 15.00 ? 515 ASN B C   1 
ATOM   8460 O  O   . ASN B 1 483 ? 82.100 17.820 194.800 1.00 15.00 ? 515 ASN B O   1 
ATOM   8461 C  CB  . ASN B 1 483 ? 84.700 17.280 195.800 1.00 15.00 ? 515 ASN B CB  1 
ATOM   8462 C  CG  . ASN B 1 483 ? 84.120 16.080 196.510 1.00 15.00 ? 515 ASN B CG  1 
ATOM   8463 O  OD1 . ASN B 1 483 ? 84.650 15.680 197.560 1.00 15.00 ? 515 ASN B OD1 1 
ATOM   8464 N  ND2 . ASN B 1 483 ? 83.030 15.470 196.020 1.00 15.00 ? 515 ASN B ND2 1 
ATOM   8465 N  N   . SER B 1 484 ? 82.150 19.930 195.640 1.00 15.00 ? 516 SER B N   1 
ATOM   8466 C  CA  . SER B 1 484 ? 80.830 20.260 195.240 1.00 15.00 ? 516 SER B CA  1 
ATOM   8467 C  C   . SER B 1 484 ? 80.860 21.470 194.340 1.00 15.00 ? 516 SER B C   1 
ATOM   8468 O  O   . SER B 1 484 ? 81.840 22.200 194.280 1.00 15.00 ? 516 SER B O   1 
ATOM   8469 C  CB  . SER B 1 484 ? 80.060 20.470 196.530 1.00 15.00 ? 516 SER B CB  1 
ATOM   8470 O  OG  . SER B 1 484 ? 80.440 19.520 197.560 1.00 15.00 ? 516 SER B OG  1 
ATOM   8471 N  N   . ILE B 1 485 ? 79.770 21.660 193.620 1.00 15.00 ? 517 ILE B N   1 
ATOM   8472 C  CA  . ILE B 1 485 ? 79.640 22.710 192.640 1.00 15.00 ? 517 ILE B CA  1 
ATOM   8473 C  C   . ILE B 1 485 ? 79.520 24.090 193.260 1.00 15.00 ? 517 ILE B C   1 
ATOM   8474 O  O   . ILE B 1 485 ? 79.830 25.070 192.610 1.00 15.00 ? 517 ILE B O   1 
ATOM   8475 C  CB  . ILE B 1 485 ? 78.430 22.310 191.760 1.00 15.00 ? 517 ILE B CB  1 
ATOM   8476 C  CG1 . ILE B 1 485 ? 78.460 23.210 190.550 1.00 15.00 ? 517 ILE B CG1 1 
ATOM   8477 C  CG2 . ILE B 1 485 ? 77.110 22.320 192.490 1.00 15.00 ? 517 ILE B CG2 1 
ATOM   8478 C  CD1 . ILE B 1 485 ? 77.500 22.770 189.440 1.00 15.00 ? 517 ILE B CD1 1 
ATOM   8479 N  N   . PHE B 1 486 ? 79.080 24.220 194.500 1.00 15.00 ? 518 PHE B N   1 
ATOM   8480 C  CA  . PHE B 1 486 ? 79.010 25.500 195.160 1.00 15.00 ? 518 PHE B CA  1 
ATOM   8481 C  C   . PHE B 1 486 ? 79.150 25.230 196.620 1.00 15.00 ? 518 PHE B C   1 
ATOM   8482 O  O   . PHE B 1 486 ? 79.390 24.090 196.990 1.00 15.00 ? 518 PHE B O   1 
ATOM   8483 C  CB  . PHE B 1 486 ? 77.700 26.240 194.890 1.00 15.00 ? 518 PHE B CB  1 
ATOM   8484 C  CG  . PHE B 1 486 ? 76.420 25.440 194.610 1.00 15.00 ? 518 PHE B CG  1 
ATOM   8485 C  CD1 . PHE B 1 486 ? 75.940 24.510 195.500 1.00 15.00 ? 518 PHE B CD1 1 
ATOM   8486 C  CD2 . PHE B 1 486 ? 75.730 25.700 193.440 1.00 15.00 ? 518 PHE B CD2 1 
ATOM   8487 C  CE1 . PHE B 1 486 ? 74.760 23.850 195.190 1.00 15.00 ? 518 PHE B CE1 1 
ATOM   8488 C  CE2 . PHE B 1 486 ? 74.560 25.040 193.150 1.00 15.00 ? 518 PHE B CE2 1 
ATOM   8489 C  CZ  . PHE B 1 486 ? 74.080 24.110 194.020 1.00 15.00 ? 518 PHE B CZ  1 
ATOM   8490 N  N   . GLY B 1 487 ? 79.040 26.220 197.490 1.00 15.00 ? 519 GLY B N   1 
ATOM   8491 C  CA  . GLY B 1 487 ? 79.230 26.020 198.910 1.00 15.00 ? 519 GLY B CA  1 
ATOM   8492 C  C   . GLY B 1 487 ? 78.000 26.400 199.710 1.00 15.00 ? 519 GLY B C   1 
ATOM   8493 O  O   . GLY B 1 487 ? 77.030 26.920 199.150 1.00 15.00 ? 519 GLY B O   1 
ATOM   8494 N  N   . GLU B 1 488 ? 78.100 26.220 201.020 1.00 15.00 ? 520 GLU B N   1 
ATOM   8495 C  CA  . GLU B 1 488 ? 77.070 26.460 202.000 1.00 15.00 ? 520 GLU B CA  1 
ATOM   8496 C  C   . GLU B 1 488 ? 75.950 27.440 201.650 1.00 15.00 ? 520 GLU B C   1 
ATOM   8497 O  O   . GLU B 1 488 ? 74.800 27.020 201.510 1.00 15.00 ? 520 GLU B O   1 
ATOM   8498 C  CB  . GLU B 1 488 ? 77.770 26.900 203.260 1.00 15.00 ? 520 GLU B CB  1 
ATOM   8499 C  CG  . GLU B 1 488 ? 77.290 26.190 204.510 1.00 15.00 ? 520 GLU B CG  1 
ATOM   8500 C  CD  . GLU B 1 488 ? 77.870 26.700 205.820 1.00 15.00 ? 520 GLU B CD  1 
ATOM   8501 O  OE1 . GLU B 1 488 ? 78.380 27.820 205.890 1.00 15.00 ? 520 GLU B OE1 1 
ATOM   8502 O  OE2 . GLU B 1 488 ? 77.820 25.980 206.820 1.00 15.00 ? 520 GLU B OE2 1 
ATOM   8503 N  N   . SER B 1 489 ? 76.240 28.720 201.460 1.00 15.00 ? 521 SER B N   1 
ATOM   8504 C  CA  . SER B 1 489 ? 75.230 29.720 201.170 1.00 15.00 ? 521 SER B CA  1 
ATOM   8505 C  C   . SER B 1 489 ? 74.350 29.440 199.970 1.00 15.00 ? 521 SER B C   1 
ATOM   8506 O  O   . SER B 1 489 ? 73.150 29.670 200.040 1.00 15.00 ? 521 SER B O   1 
ATOM   8507 C  CB  . SER B 1 489 ? 75.950 31.030 201.000 1.00 15.00 ? 521 SER B CB  1 
ATOM   8508 O  OG  . SER B 1 489 ? 76.660 31.230 202.200 1.00 15.00 ? 521 SER B OG  1 
ATOM   8509 N  N   . MET B 1 490 ? 74.880 28.900 198.880 1.00 15.00 ? 522 MET B N   1 
ATOM   8510 C  CA  . MET B 1 490 ? 74.040 28.630 197.730 1.00 15.00 ? 522 MET B CA  1 
ATOM   8511 C  C   . MET B 1 490 ? 72.930 27.640 198.090 1.00 15.00 ? 522 MET B C   1 
ATOM   8512 O  O   . MET B 1 490 ? 71.790 27.810 197.710 1.00 15.00 ? 522 MET B O   1 
ATOM   8513 C  CB  . MET B 1 490 ? 74.900 28.060 196.640 1.00 15.00 ? 522 MET B CB  1 
ATOM   8514 C  CG  . MET B 1 490 ? 74.250 28.120 195.300 1.00 15.00 ? 522 MET B CG  1 
ATOM   8515 S  SD  . MET B 1 490 ? 74.330 29.830 194.750 1.00 15.00 ? 522 MET B SD  1 
ATOM   8516 C  CE  . MET B 1 490 ? 75.470 29.790 193.420 1.00 15.00 ? 522 MET B CE  1 
ATOM   8517 N  N   . ILE B 1 491 ? 73.230 26.650 198.910 1.00 15.00 ? 523 ILE B N   1 
ATOM   8518 C  CA  . ILE B 1 491 ? 72.280 25.630 199.290 1.00 15.00 ? 523 ILE B CA  1 
ATOM   8519 C  C   . ILE B 1 491 ? 71.370 26.200 200.350 1.00 15.00 ? 523 ILE B C   1 
ATOM   8520 O  O   . ILE B 1 491 ? 70.170 26.200 200.160 1.00 15.00 ? 523 ILE B O   1 
ATOM   8521 C  CB  . ILE B 1 491 ? 73.040 24.410 199.810 1.00 15.00 ? 523 ILE B CB  1 
ATOM   8522 C  CG1 . ILE B 1 491 ? 73.640 23.700 198.610 1.00 15.00 ? 523 ILE B CG1 1 
ATOM   8523 C  CG2 . ILE B 1 491 ? 72.150 23.450 200.570 1.00 15.00 ? 523 ILE B CG2 1 
ATOM   8524 C  CD1 . ILE B 1 491 ? 74.600 22.520 198.910 1.00 15.00 ? 523 ILE B CD1 1 
ATOM   8525 N  N   . GLU B 1 492 ? 71.860 26.770 201.440 1.00 15.00 ? 524 GLU B N   1 
ATOM   8526 C  CA  . GLU B 1 492 ? 70.990 27.280 202.490 1.00 15.00 ? 524 GLU B CA  1 
ATOM   8527 C  C   . GLU B 1 492 ? 70.100 28.440 202.100 1.00 15.00 ? 524 GLU B C   1 
ATOM   8528 O  O   . GLU B 1 492 ? 69.020 28.580 202.650 1.00 15.00 ? 524 GLU B O   1 
ATOM   8529 C  CB  . GLU B 1 492 ? 71.810 27.700 203.680 1.00 15.00 ? 524 GLU B CB  1 
ATOM   8530 C  CG  . GLU B 1 492 ? 72.690 26.600 204.240 1.00 15.00 ? 524 GLU B CG  1 
ATOM   8531 C  CD  . GLU B 1 492 ? 71.930 25.370 204.720 1.00 15.00 ? 524 GLU B CD  1 
ATOM   8532 O  OE1 . GLU B 1 492 ? 71.330 25.410 205.780 1.00 15.00 ? 524 GLU B OE1 1 
ATOM   8533 O  OE2 . GLU B 1 492 ? 71.980 24.370 204.020 1.00 15.00 ? 524 GLU B OE2 1 
ATOM   8534 N  N   . MET B 1 493 ? 70.520 29.300 201.170 1.00 15.00 ? 525 MET B N   1 
ATOM   8535 C  CA  . MET B 1 493 ? 69.690 30.400 200.720 1.00 15.00 ? 525 MET B CA  1 
ATOM   8536 C  C   . MET B 1 493 ? 68.890 29.960 199.530 1.00 15.00 ? 525 MET B C   1 
ATOM   8537 O  O   . MET B 1 493 ? 67.720 30.300 199.400 1.00 15.00 ? 525 MET B O   1 
ATOM   8538 C  CB  . MET B 1 493 ? 70.520 31.590 200.280 1.00 15.00 ? 525 MET B CB  1 
ATOM   8539 C  CG  . MET B 1 493 ? 71.350 32.150 201.400 1.00 15.00 ? 525 MET B CG  1 
ATOM   8540 S  SD  . MET B 1 493 ? 72.310 33.580 200.890 1.00 15.00 ? 525 MET B SD  1 
ATOM   8541 C  CE  . MET B 1 493 ? 73.170 33.620 202.440 1.00 15.00 ? 525 MET B CE  1 
ATOM   8542 N  N   . GLY B 1 494 ? 69.440 29.160 198.630 1.00 15.00 ? 526 GLY B N   1 
ATOM   8543 C  CA  . GLY B 1 494 ? 68.740 28.800 197.410 1.00 15.00 ? 526 GLY B CA  1 
ATOM   8544 C  C   . GLY B 1 494 ? 67.690 27.800 197.670 1.00 15.00 ? 526 GLY B C   1 
ATOM   8545 O  O   . GLY B 1 494 ? 66.580 27.950 197.180 1.00 15.00 ? 526 GLY B O   1 
ATOM   8546 N  N   . ALA B 1 495 ? 67.980 26.810 198.500 1.00 15.00 ? 527 ALA B N   1 
ATOM   8547 C  CA  . ALA B 1 495 ? 67.080 25.700 198.660 1.00 15.00 ? 527 ALA B CA  1 
ATOM   8548 C  C   . ALA B 1 495 ? 65.700 26.120 199.080 1.00 15.00 ? 527 ALA B C   1 
ATOM   8549 O  O   . ALA B 1 495 ? 64.800 25.750 198.340 1.00 15.00 ? 527 ALA B O   1 
ATOM   8550 C  CB  . ALA B 1 495 ? 67.600 24.740 199.680 1.00 15.00 ? 527 ALA B CB  1 
ATOM   8551 N  N   . PRO B 1 496 ? 65.410 26.920 200.120 1.00 15.00 ? 528 PRO B N   1 
ATOM   8552 C  CA  . PRO B 1 496 ? 64.060 27.340 200.430 1.00 15.00 ? 528 PRO B CA  1 
ATOM   8553 C  C   . PRO B 1 496 ? 63.350 28.090 199.330 1.00 15.00 ? 528 PRO B C   1 
ATOM   8554 O  O   . PRO B 1 496 ? 62.210 27.730 199.030 1.00 15.00 ? 528 PRO B O   1 
ATOM   8555 C  CB  . PRO B 1 496 ? 64.190 28.150 201.700 1.00 15.00 ? 528 PRO B CB  1 
ATOM   8556 C  CG  . PRO B 1 496 ? 65.600 28.610 201.690 1.00 15.00 ? 528 PRO B CG  1 
ATOM   8557 C  CD  . PRO B 1 496 ? 66.340 27.400 201.140 1.00 15.00 ? 528 PRO B CD  1 
ATOM   8558 N  N   . PHE B 1 497 ? 63.960 29.040 198.650 1.00 15.00 ? 529 PHE B N   1 
ATOM   8559 C  CA  . PHE B 1 497 ? 63.330 29.680 197.530 1.00 15.00 ? 529 PHE B CA  1 
ATOM   8560 C  C   . PHE B 1 497 ? 62.880 28.650 196.520 1.00 15.00 ? 529 PHE B C   1 
ATOM   8561 O  O   . PHE B 1 497 ? 61.740 28.740 196.050 1.00 15.00 ? 529 PHE B O   1 
ATOM   8562 C  CB  . PHE B 1 497 ? 64.260 30.610 196.830 1.00 15.00 ? 529 PHE B CB  1 
ATOM   8563 C  CG  . PHE B 1 497 ? 64.630 31.910 197.520 1.00 15.00 ? 529 PHE B CG  1 
ATOM   8564 C  CD1 . PHE B 1 497 ? 63.680 32.870 197.770 1.00 15.00 ? 529 PHE B CD1 1 
ATOM   8565 C  CD2 . PHE B 1 497 ? 65.950 32.140 197.870 1.00 15.00 ? 529 PHE B CD2 1 
ATOM   8566 C  CE1 . PHE B 1 497 ? 64.040 34.070 198.360 1.00 15.00 ? 529 PHE B CE1 1 
ATOM   8567 C  CE2 . PHE B 1 497 ? 66.310 33.330 198.460 1.00 15.00 ? 529 PHE B CE2 1 
ATOM   8568 C  CZ  . PHE B 1 497 ? 65.350 34.290 198.710 1.00 15.00 ? 529 PHE B CZ  1 
ATOM   8569 N  N   . SER B 1 498 ? 63.690 27.620 196.250 1.00 15.00 ? 530 SER B N   1 
ATOM   8570 C  CA  . SER B 1 498 ? 63.340 26.600 195.310 1.00 15.00 ? 530 SER B CA  1 
ATOM   8571 C  C   . SER B 1 498 ? 62.230 25.650 195.740 1.00 15.00 ? 530 SER B C   1 
ATOM   8572 O  O   . SER B 1 498 ? 61.290 25.420 194.970 1.00 15.00 ? 530 SER B O   1 
ATOM   8573 C  CB  . SER B 1 498 ? 64.550 25.790 194.950 1.00 15.00 ? 530 SER B CB  1 
ATOM   8574 O  OG  . SER B 1 498 ? 64.720 25.850 193.530 1.00 15.00 ? 530 SER B OG  1 
ATOM   8575 N  N   . LEU B 1 499 ? 62.250 25.120 196.960 1.00 15.00 ? 531 LEU B N   1 
ATOM   8576 C  CA  . LEU B 1 499 ? 61.210 24.190 197.370 1.00 15.00 ? 531 LEU B CA  1 
ATOM   8577 C  C   . LEU B 1 499 ? 59.850 24.820 197.610 1.00 15.00 ? 531 LEU B C   1 
ATOM   8578 O  O   . LEU B 1 499 ? 58.840 24.180 197.350 1.00 15.00 ? 531 LEU B O   1 
ATOM   8579 C  CB  . LEU B 1 499 ? 61.700 23.460 198.610 1.00 15.00 ? 531 LEU B CB  1 
ATOM   8580 C  CG  . LEU B 1 499 ? 62.840 22.480 198.310 1.00 15.00 ? 531 LEU B CG  1 
ATOM   8581 C  CD1 . LEU B 1 499 ? 63.210 21.770 199.560 1.00 15.00 ? 531 LEU B CD1 1 
ATOM   8582 C  CD2 . LEU B 1 499 ? 62.410 21.420 197.300 1.00 15.00 ? 531 LEU B CD2 1 
ATOM   8583 N  N   . LYS B 1 500 ? 59.780 26.080 198.010 1.00 15.00 ? 532 LYS B N   1 
ATOM   8584 C  CA  . LYS B 1 500 ? 58.500 26.750 198.120 1.00 15.00 ? 532 LYS B CA  1 
ATOM   8585 C  C   . LYS B 1 500 ? 57.960 26.920 196.720 1.00 15.00 ? 532 LYS B C   1 
ATOM   8586 O  O   . LYS B 1 500 ? 56.810 26.600 196.500 1.00 15.00 ? 532 LYS B O   1 
ATOM   8587 C  CB  . LYS B 1 500 ? 58.610 28.130 198.710 1.00 15.00 ? 532 LYS B CB  1 
ATOM   8588 C  CG  . LYS B 1 500 ? 57.260 28.790 199.010 1.00 15.00 ? 532 LYS B CG  1 
ATOM   8589 C  CD  . LYS B 1 500 ? 56.530 28.080 200.140 1.00 15.00 ? 532 LYS B CD  1 
ATOM   8590 C  CE  . LYS B 1 500 ? 55.420 28.930 200.740 1.00 15.00 ? 532 LYS B CE  1 
ATOM   8591 N  NZ  . LYS B 1 500 ? 55.010 28.450 202.060 1.00 15.00 ? 532 LYS B NZ  1 
ATOM   8592 N  N   . GLY B 1 501 ? 58.720 27.360 195.720 1.00 15.00 ? 533 GLY B N   1 
ATOM   8593 C  CA  . GLY B 1 501 ? 58.210 27.530 194.380 1.00 15.00 ? 533 GLY B CA  1 
ATOM   8594 C  C   . GLY B 1 501 ? 57.670 26.260 193.720 1.00 15.00 ? 533 GLY B C   1 
ATOM   8595 O  O   . GLY B 1 501 ? 56.820 26.270 192.820 1.00 15.00 ? 533 GLY B O   1 
ATOM   8596 N  N   . LEU B 1 502 ? 58.250 25.150 194.140 1.00 15.00 ? 534 LEU B N   1 
ATOM   8597 C  CA  . LEU B 1 502 ? 57.870 23.860 193.640 1.00 15.00 ? 534 LEU B CA  1 
ATOM   8598 C  C   . LEU B 1 502 ? 56.660 23.390 194.370 1.00 15.00 ? 534 LEU B C   1 
ATOM   8599 O  O   . LEU B 1 502 ? 55.600 23.240 193.760 1.00 15.00 ? 534 LEU B O   1 
ATOM   8600 C  CB  . LEU B 1 502 ? 59.030 22.930 193.800 1.00 15.00 ? 534 LEU B CB  1 
ATOM   8601 C  CG  . LEU B 1 502 ? 59.890 22.650 192.580 1.00 15.00 ? 534 LEU B CG  1 
ATOM   8602 C  CD1 . LEU B 1 502 ? 60.190 23.870 191.760 1.00 15.00 ? 534 LEU B CD1 1 
ATOM   8603 C  CD2 . LEU B 1 502 ? 61.170 22.110 193.080 1.00 15.00 ? 534 LEU B CD2 1 
ATOM   8604 N  N   . LEU B 1 503 ? 56.740 23.220 195.680 1.00 15.00 ? 535 LEU B N   1 
ATOM   8605 C  CA  . LEU B 1 503 ? 55.580 22.710 196.360 1.00 15.00 ? 535 LEU B CA  1 
ATOM   8606 C  C   . LEU B 1 503 ? 54.480 23.690 196.640 1.00 15.00 ? 535 LEU B C   1 
ATOM   8607 O  O   . LEU B 1 503 ? 53.350 23.320 196.900 1.00 15.00 ? 535 LEU B O   1 
ATOM   8608 C  CB  . LEU B 1 503 ? 56.060 22.060 197.600 1.00 15.00 ? 535 LEU B CB  1 
ATOM   8609 C  CG  . LEU B 1 503 ? 56.400 20.710 197.070 1.00 15.00 ? 535 LEU B CG  1 
ATOM   8610 C  CD1 . LEU B 1 503 ? 57.850 20.480 197.330 1.00 15.00 ? 535 LEU B CD1 1 
ATOM   8611 C  CD2 . LEU B 1 503 ? 55.460 19.670 197.640 1.00 15.00 ? 535 LEU B CD2 1 
ATOM   8612 N  N   . GLY B 1 504 ? 54.730 24.950 196.470 1.00 15.00 ? 536 GLY B N   1 
ATOM   8613 C  CA  . GLY B 1 504 ? 53.710 25.950 196.640 1.00 15.00 ? 536 GLY B CA  1 
ATOM   8614 C  C   . GLY B 1 504 ? 53.000 26.130 195.320 1.00 15.00 ? 536 GLY B C   1 
ATOM   8615 O  O   . GLY B 1 504 ? 52.490 27.200 195.000 1.00 15.00 ? 536 GLY B O   1 
ATOM   8616 N  N   . ASN B 1 505 ? 52.930 25.090 194.490 1.00 15.00 ? 537 ASN B N   1 
ATOM   8617 C  CA  . ASN B 1 505 ? 52.320 25.240 193.200 1.00 15.00 ? 537 ASN B CA  1 
ATOM   8618 C  C   . ASN B 1 505 ? 50.900 24.770 193.420 1.00 15.00 ? 537 ASN B C   1 
ATOM   8619 O  O   . ASN B 1 505 ? 50.760 23.710 194.040 1.00 15.00 ? 537 ASN B O   1 
ATOM   8620 C  CB  . ASN B 1 505 ? 53.020 24.340 192.190 1.00 15.00 ? 537 ASN B CB  1 
ATOM   8621 C  CG  . ASN B 1 505 ? 52.460 24.540 190.800 1.00 15.00 ? 537 ASN B CG  1 
ATOM   8622 O  OD1 . ASN B 1 505 ? 51.290 24.310 190.550 1.00 15.00 ? 537 ASN B OD1 1 
ATOM   8623 N  ND2 . ASN B 1 505 ? 53.230 24.970 189.850 1.00 15.00 ? 537 ASN B ND2 1 
ATOM   8624 N  N   . PRO B 1 506 ? 49.810 25.400 192.970 1.00 15.00 ? 538 PRO B N   1 
ATOM   8625 C  CA  . PRO B 1 506 ? 48.450 24.980 193.220 1.00 15.00 ? 538 PRO B CA  1 
ATOM   8626 C  C   . PRO B 1 506 ? 48.200 23.520 192.950 1.00 15.00 ? 538 PRO B C   1 
ATOM   8627 O  O   . PRO B 1 506 ? 47.460 22.890 193.690 1.00 15.00 ? 538 PRO B O   1 
ATOM   8628 C  CB  . PRO B 1 506 ? 47.640 25.860 192.350 1.00 15.00 ? 538 PRO B CB  1 
ATOM   8629 C  CG  . PRO B 1 506 ? 48.590 26.170 191.270 1.00 15.00 ? 538 PRO B CG  1 
ATOM   8630 C  CD  . PRO B 1 506 ? 49.800 26.540 192.080 1.00 15.00 ? 538 PRO B CD  1 
ATOM   8631 N  N   . ILE B 1 507 ? 48.850 22.940 191.950 1.00 15.00 ? 539 ILE B N   1 
ATOM   8632 C  CA  . ILE B 1 507 ? 48.710 21.540 191.650 1.00 15.00 ? 539 ILE B CA  1 
ATOM   8633 C  C   . ILE B 1 507 ? 48.980 20.650 192.830 1.00 15.00 ? 539 ILE B C   1 
ATOM   8634 O  O   . ILE B 1 507 ? 48.320 19.640 193.000 1.00 15.00 ? 539 ILE B O   1 
ATOM   8635 C  CB  . ILE B 1 507 ? 49.650 21.260 190.440 1.00 15.00 ? 539 ILE B CB  1 
ATOM   8636 C  CG1 . ILE B 1 507 ? 48.670 20.980 189.350 1.00 15.00 ? 539 ILE B CG1 1 
ATOM   8637 C  CG2 . ILE B 1 507 ? 50.680 20.130 190.570 1.00 15.00 ? 539 ILE B CG2 1 
ATOM   8638 C  CD1 . ILE B 1 507 ? 48.000 22.260 188.820 1.00 15.00 ? 539 ILE B CD1 1 
ATOM   8639 N  N   . CYS B 1 508 ? 49.920 21.020 193.690 1.00 15.00 ? 540 CYS B N   1 
ATOM   8640 C  CA  . CYS B 1 508 ? 50.260 20.230 194.840 1.00 15.00 ? 540 CYS B CA  1 
ATOM   8641 C  C   . CYS B 1 508 ? 49.240 20.380 195.930 1.00 15.00 ? 540 CYS B C   1 
ATOM   8642 O  O   . CYS B 1 508 ? 49.400 19.740 196.980 1.00 15.00 ? 540 CYS B O   1 
ATOM   8643 C  CB  . CYS B 1 508 ? 51.560 20.670 195.410 1.00 15.00 ? 540 CYS B CB  1 
ATOM   8644 S  SG  . CYS B 1 508 ? 52.870 20.420 194.220 1.00 15.00 ? 540 CYS B SG  1 
ATOM   8645 N  N   . SER B 1 509 ? 48.190 21.200 195.780 1.00 15.00 ? 541 SER B N   1 
ATOM   8646 C  CA  . SER B 1 509 ? 47.290 21.400 196.870 1.00 15.00 ? 541 SER B CA  1 
ATOM   8647 C  C   . SER B 1 509 ? 46.360 20.210 196.980 1.00 15.00 ? 541 SER B C   1 
ATOM   8648 O  O   . SER B 1 509 ? 46.080 19.590 195.950 1.00 15.00 ? 541 SER B O   1 
ATOM   8649 C  CB  . SER B 1 509 ? 46.510 22.670 196.650 1.00 15.00 ? 541 SER B CB  1 
ATOM   8650 O  OG  . SER B 1 509 ? 45.590 22.570 195.600 1.00 15.00 ? 541 SER B OG  1 
ATOM   8651 N  N   . PRO B 1 510 ? 45.830 19.860 198.160 1.00 15.00 ? 542 PRO B N   1 
ATOM   8652 C  CA  . PRO B 1 510 ? 44.890 18.760 198.330 1.00 15.00 ? 542 PRO B CA  1 
ATOM   8653 C  C   . PRO B 1 510 ? 43.710 18.960 197.420 1.00 15.00 ? 542 PRO B C   1 
ATOM   8654 O  O   . PRO B 1 510 ? 43.150 18.000 196.880 1.00 15.00 ? 542 PRO B O   1 
ATOM   8655 C  CB  . PRO B 1 510 ? 44.530 18.830 199.770 1.00 15.00 ? 542 PRO B CB  1 
ATOM   8656 C  CG  . PRO B 1 510 ? 45.690 19.490 200.410 1.00 15.00 ? 542 PRO B CG  1 
ATOM   8657 C  CD  . PRO B 1 510 ? 45.970 20.570 199.410 1.00 15.00 ? 542 PRO B CD  1 
ATOM   8658 N  N   . GLU B 1 511 ? 43.340 20.220 197.190 1.00 15.00 ? 543 GLU B N   1 
ATOM   8659 C  CA  . GLU B 1 511 ? 42.250 20.540 196.310 1.00 15.00 ? 543 GLU B CA  1 
ATOM   8660 C  C   . GLU B 1 511 ? 42.510 20.090 194.880 1.00 15.00 ? 543 GLU B C   1 
ATOM   8661 O  O   . GLU B 1 511 ? 41.580 19.690 194.200 1.00 15.00 ? 543 GLU B O   1 
ATOM   8662 C  CB  . GLU B 1 511 ? 42.030 22.030 196.390 1.00 15.00 ? 543 GLU B CB  1 
ATOM   8663 C  CG  . GLU B 1 511 ? 40.800 22.520 195.640 1.00 15.00 ? 543 GLU B CG  1 
ATOM   8664 C  CD  . GLU B 1 511 ? 39.570 21.790 196.130 1.00 15.00 ? 543 GLU B CD  1 
ATOM   8665 O  OE1 . GLU B 1 511 ? 39.230 21.950 197.310 1.00 15.00 ? 543 GLU B OE1 1 
ATOM   8666 O  OE2 . GLU B 1 511 ? 38.990 21.040 195.350 1.00 15.00 ? 543 GLU B OE2 1 
ATOM   8667 N  N   . TYR B 1 512 ? 43.740 20.130 194.390 1.00 15.00 ? 544 TYR B N   1 
ATOM   8668 C  CA  . TYR B 1 512 ? 43.990 19.840 193.000 1.00 15.00 ? 544 TYR B CA  1 
ATOM   8669 C  C   . TYR B 1 512 ? 44.630 18.510 192.770 1.00 15.00 ? 544 TYR B C   1 
ATOM   8670 O  O   . TYR B 1 512 ? 44.400 17.950 191.710 1.00 15.00 ? 544 TYR B O   1 
ATOM   8671 C  CB  . TYR B 1 512 ? 44.910 20.830 192.370 1.00 15.00 ? 544 TYR B CB  1 
ATOM   8672 C  CG  . TYR B 1 512 ? 44.410 22.230 192.070 1.00 15.00 ? 544 TYR B CG  1 
ATOM   8673 C  CD1 . TYR B 1 512 ? 43.280 22.760 192.640 1.00 15.00 ? 544 TYR B CD1 1 
ATOM   8674 C  CD2 . TYR B 1 512 ? 45.150 22.960 191.190 1.00 15.00 ? 544 TYR B CD2 1 
ATOM   8675 C  CE1 . TYR B 1 512 ? 42.890 24.030 192.300 1.00 15.00 ? 544 TYR B CE1 1 
ATOM   8676 C  CE2 . TYR B 1 512 ? 44.760 24.230 190.850 1.00 15.00 ? 544 TYR B CE2 1 
ATOM   8677 C  CZ  . TYR B 1 512 ? 43.630 24.750 191.400 1.00 15.00 ? 544 TYR B CZ  1 
ATOM   8678 O  OH  . TYR B 1 512 ? 43.240 26.010 191.010 1.00 15.00 ? 544 TYR B OH  1 
ATOM   8679 N  N   . TRP B 1 513 ? 45.460 18.000 193.650 1.00 15.00 ? 545 TRP B N   1 
ATOM   8680 C  CA  . TRP B 1 513 ? 46.190 16.790 193.340 1.00 15.00 ? 545 TRP B CA  1 
ATOM   8681 C  C   . TRP B 1 513 ? 45.310 15.590 193.560 1.00 15.00 ? 545 TRP B C   1 
ATOM   8682 O  O   . TRP B 1 513 ? 45.410 14.840 194.540 1.00 15.00 ? 545 TRP B O   1 
ATOM   8683 C  CB  . TRP B 1 513 ? 47.420 16.740 194.210 1.00 15.00 ? 545 TRP B CB  1 
ATOM   8684 C  CG  . TRP B 1 513 ? 48.620 16.060 193.530 1.00 15.00 ? 545 TRP B CG  1 
ATOM   8685 C  CD1 . TRP B 1 513 ? 49.280 16.560 192.390 1.00 15.00 ? 545 TRP B CD1 1 
ATOM   8686 C  CD2 . TRP B 1 513 ? 49.180 14.920 193.960 1.00 15.00 ? 545 TRP B CD2 1 
ATOM   8687 N  NE1 . TRP B 1 513 ? 50.270 15.710 192.150 1.00 15.00 ? 545 TRP B NE1 1 
ATOM   8688 C  CE2 . TRP B 1 513 ? 50.220 14.750 193.060 1.00 15.00 ? 545 TRP B CE2 1 
ATOM   8689 C  CE3 . TRP B 1 513 ? 48.870 14.090 195.000 1.00 15.00 ? 545 TRP B CE3 1 
ATOM   8690 C  CZ2 . TRP B 1 513 ? 51.040 13.670 193.180 1.00 15.00 ? 545 TRP B CZ2 1 
ATOM   8691 C  CZ3 . TRP B 1 513 ? 49.700 13.010 195.120 1.00 15.00 ? 545 TRP B CZ3 1 
ATOM   8692 C  CH2 . TRP B 1 513 ? 50.760 12.810 194.240 1.00 15.00 ? 545 TRP B CH2 1 
ATOM   8693 N  N   . LYS B 1 514 ? 44.430 15.430 192.600 1.00 15.00 ? 546 LYS B N   1 
ATOM   8694 C  CA  . LYS B 1 514 ? 43.430 14.390 192.540 1.00 15.00 ? 546 LYS B CA  1 
ATOM   8695 C  C   . LYS B 1 514 ? 43.600 13.880 191.140 1.00 15.00 ? 546 LYS B C   1 
ATOM   8696 O  O   . LYS B 1 514 ? 43.980 14.640 190.250 1.00 15.00 ? 546 LYS B O   1 
ATOM   8697 C  CB  . LYS B 1 514 ? 42.010 14.910 192.620 1.00 15.00 ? 546 LYS B CB  1 
ATOM   8698 C  CG  . LYS B 1 514 ? 41.570 15.670 193.850 1.00 15.00 ? 546 LYS B CG  1 
ATOM   8699 C  CD  . LYS B 1 514 ? 40.240 16.300 193.470 1.00 15.00 ? 546 LYS B CD  1 
ATOM   8700 C  CE  . LYS B 1 514 ? 39.690 17.210 194.550 1.00 15.00 ? 546 LYS B CE  1 
ATOM   8701 N  NZ  . LYS B 1 514 ? 39.260 16.460 195.710 1.00 15.00 ? 546 LYS B NZ  1 
ATOM   8702 N  N   . ALA B 1 515 ? 43.250 12.630 190.860 1.00 15.00 ? 547 ALA B N   1 
ATOM   8703 C  CA  . ALA B 1 515 ? 43.430 12.090 189.530 1.00 15.00 ? 547 ALA B CA  1 
ATOM   8704 C  C   . ALA B 1 515 ? 42.640 12.770 188.440 1.00 15.00 ? 547 ALA B C   1 
ATOM   8705 O  O   . ALA B 1 515 ? 43.080 12.850 187.300 1.00 15.00 ? 547 ALA B O   1 
ATOM   8706 C  CB  . ALA B 1 515 ? 43.070 10.620 189.520 1.00 15.00 ? 547 ALA B CB  1 
ATOM   8707 N  N   . SER B 1 516 ? 41.470 13.300 188.750 1.00 15.00 ? 548 SER B N   1 
ATOM   8708 C  CA  . SER B 1 516 ? 40.620 13.910 187.750 1.00 15.00 ? 548 SER B CA  1 
ATOM   8709 C  C   . SER B 1 516 ? 41.200 15.150 187.120 1.00 15.00 ? 548 SER B C   1 
ATOM   8710 O  O   . SER B 1 516 ? 40.950 15.390 185.940 1.00 15.00 ? 548 SER B O   1 
ATOM   8711 C  CB  . SER B 1 516 ? 39.290 14.230 188.370 1.00 15.00 ? 548 SER B CB  1 
ATOM   8712 O  OG  . SER B 1 516 ? 39.540 14.820 189.630 1.00 15.00 ? 548 SER B OG  1 
ATOM   8713 N  N   . THR B 1 517 ? 41.990 15.900 187.890 1.00 15.00 ? 549 THR B N   1 
ATOM   8714 C  CA  . THR B 1 517 ? 42.640 17.120 187.430 1.00 15.00 ? 549 THR B CA  1 
ATOM   8715 C  C   . THR B 1 517 ? 43.440 16.860 186.170 1.00 15.00 ? 549 THR B C   1 
ATOM   8716 O  O   . THR B 1 517 ? 43.360 17.570 185.180 1.00 15.00 ? 549 THR B O   1 
ATOM   8717 C  CB  . THR B 1 517 ? 43.530 17.560 188.580 1.00 15.00 ? 549 THR B CB  1 
ATOM   8718 O  OG1 . THR B 1 517 ? 42.650 17.540 189.700 1.00 15.00 ? 549 THR B OG1 1 
ATOM   8719 C  CG2 . THR B 1 517 ? 44.150 18.910 188.410 1.00 15.00 ? 549 THR B CG2 1 
ATOM   8720 N  N   . PHE B 1 518 ? 44.080 15.690 186.220 1.00 15.00 ? 550 PHE B N   1 
ATOM   8721 C  CA  . PHE B 1 518 ? 44.930 15.230 185.160 1.00 15.00 ? 550 PHE B CA  1 
ATOM   8722 C  C   . PHE B 1 518 ? 44.210 14.420 184.110 1.00 15.00 ? 550 PHE B C   1 
ATOM   8723 O  O   . PHE B 1 518 ? 44.790 14.030 183.100 1.00 15.00 ? 550 PHE B O   1 
ATOM   8724 C  CB  . PHE B 1 518 ? 46.030 14.460 185.810 1.00 15.00 ? 550 PHE B CB  1 
ATOM   8725 C  CG  . PHE B 1 518 ? 46.880 15.360 186.650 1.00 15.00 ? 550 PHE B CG  1 
ATOM   8726 C  CD1 . PHE B 1 518 ? 47.740 16.270 186.070 1.00 15.00 ? 550 PHE B CD1 1 
ATOM   8727 C  CD2 . PHE B 1 518 ? 46.780 15.310 188.030 1.00 15.00 ? 550 PHE B CD2 1 
ATOM   8728 C  CE1 . PHE B 1 518 ? 48.460 17.130 186.870 1.00 15.00 ? 550 PHE B CE1 1 
ATOM   8729 C  CE2 . PHE B 1 518 ? 47.510 16.160 188.820 1.00 15.00 ? 550 PHE B CE2 1 
ATOM   8730 C  CZ  . PHE B 1 518 ? 48.360 17.070 188.240 1.00 15.00 ? 550 PHE B CZ  1 
ATOM   8731 N  N   . GLY B 1 519 ? 42.940 14.150 184.320 1.00 15.00 ? 551 GLY B N   1 
ATOM   8732 C  CA  . GLY B 1 519 ? 42.120 13.390 183.370 1.00 15.00 ? 551 GLY B CA  1 
ATOM   8733 C  C   . GLY B 1 519 ? 42.110 11.900 183.670 1.00 15.00 ? 551 GLY B C   1 
ATOM   8734 O  O   . GLY B 1 519 ? 42.130 11.060 182.780 1.00 15.00 ? 551 GLY B O   1 
ATOM   8735 N  N   . GLY B 1 520 ? 42.090 11.530 184.930 1.00 15.00 ? 552 GLY B N   1 
ATOM   8736 C  CA  . GLY B 1 520 ? 42.000 10.130 185.280 1.00 15.00 ? 552 GLY B CA  1 
ATOM   8737 C  C   . GLY B 1 520 ? 43.370 9.540  185.480 1.00 15.00 ? 552 GLY B C   1 
ATOM   8738 O  O   . GLY B 1 520 ? 44.350 10.230 185.250 1.00 15.00 ? 552 GLY B O   1 
ATOM   8739 N  N   . GLU B 1 521 ? 43.480 8.280  185.880 1.00 15.00 ? 553 GLU B N   1 
ATOM   8740 C  CA  . GLU B 1 521 ? 44.770 7.660  186.140 1.00 15.00 ? 553 GLU B CA  1 
ATOM   8741 C  C   . GLU B 1 521 ? 45.830 7.850  185.070 1.00 15.00 ? 553 GLU B C   1 
ATOM   8742 O  O   . GLU B 1 521 ? 46.980 8.080  185.400 1.00 15.00 ? 553 GLU B O   1 
ATOM   8743 C  CB  . GLU B 1 521 ? 44.650 6.170  186.330 1.00 15.00 ? 553 GLU B CB  1 
ATOM   8744 C  CG  . GLU B 1 521 ? 43.790 5.690  187.480 1.00 15.00 ? 553 GLU B CG  1 
ATOM   8745 C  CD  . GLU B 1 521 ? 44.240 6.080  188.900 1.00 15.00 ? 553 GLU B CD  1 
ATOM   8746 O  OE1 . GLU B 1 521 ? 45.460 6.210  189.140 1.00 15.00 ? 553 GLU B OE1 1 
ATOM   8747 O  OE2 . GLU B 1 521 ? 43.340 6.220  189.750 1.00 15.00 ? 553 GLU B OE2 1 
ATOM   8748 N  N   . VAL B 1 522 ? 45.450 7.810  183.800 1.00 15.00 ? 554 VAL B N   1 
ATOM   8749 C  CA  . VAL B 1 522 ? 46.340 7.940  182.650 1.00 15.00 ? 554 VAL B CA  1 
ATOM   8750 C  C   . VAL B 1 522 ? 47.190 9.170  182.800 1.00 15.00 ? 554 VAL B C   1 
ATOM   8751 O  O   . VAL B 1 522 ? 48.410 9.070  182.910 1.00 15.00 ? 554 VAL B O   1 
ATOM   8752 C  CB  . VAL B 1 522 ? 45.540 8.070  181.320 1.00 15.00 ? 554 VAL B CB  1 
ATOM   8753 C  CG1 . VAL B 1 522 ? 46.530 8.140  180.170 1.00 15.00 ? 554 VAL B CG1 1 
ATOM   8754 C  CG2 . VAL B 1 522 ? 44.570 6.910  181.140 1.00 15.00 ? 554 VAL B CG2 1 
ATOM   8755 N  N   . GLY B 1 523 ? 46.510 10.300 182.890 1.00 15.00 ? 555 GLY B N   1 
ATOM   8756 C  CA  . GLY B 1 523 ? 47.180 11.560 182.990 1.00 15.00 ? 555 GLY B CA  1 
ATOM   8757 C  C   . GLY B 1 523 ? 47.970 11.620 184.270 1.00 15.00 ? 555 GLY B C   1 
ATOM   8758 O  O   . GLY B 1 523 ? 49.180 11.880 184.270 1.00 15.00 ? 555 GLY B O   1 
ATOM   8759 N  N   . PHE B 1 524 ? 47.330 11.250 185.360 1.00 15.00 ? 556 PHE B N   1 
ATOM   8760 C  CA  . PHE B 1 524 ? 47.930 11.330 186.660 1.00 15.00 ? 556 PHE B CA  1 
ATOM   8761 C  C   . PHE B 1 524 ? 49.180 10.490 186.790 1.00 15.00 ? 556 PHE B C   1 
ATOM   8762 O  O   . PHE B 1 524 ? 50.150 10.880 187.430 1.00 15.00 ? 556 PHE B O   1 
ATOM   8763 C  CB  . PHE B 1 524 ? 46.930 10.890 187.690 1.00 15.00 ? 556 PHE B CB  1 
ATOM   8764 C  CG  . PHE B 1 524 ? 47.230 11.350 189.100 1.00 15.00 ? 556 PHE B CG  1 
ATOM   8765 C  CD1 . PHE B 1 524 ? 47.820 12.570 189.330 1.00 15.00 ? 556 PHE B CD1 1 
ATOM   8766 C  CD2 . PHE B 1 524 ? 46.880 10.530 190.150 1.00 15.00 ? 556 PHE B CD2 1 
ATOM   8767 C  CE1 . PHE B 1 524 ? 48.030 13.000 190.610 1.00 15.00 ? 556 PHE B CE1 1 
ATOM   8768 C  CE2 . PHE B 1 524 ? 47.100 10.970 191.430 1.00 15.00 ? 556 PHE B CE2 1 
ATOM   8769 C  CZ  . PHE B 1 524 ? 47.680 12.190 191.660 1.00 15.00 ? 556 PHE B CZ  1 
ATOM   8770 N  N   . ASN B 1 525 ? 49.230 9.350  186.120 1.00 15.00 ? 557 ASN B N   1 
ATOM   8771 C  CA  . ASN B 1 525 ? 50.400 8.510  186.200 1.00 15.00 ? 557 ASN B CA  1 
ATOM   8772 C  C   . ASN B 1 525 ? 51.500 9.080  185.350 1.00 15.00 ? 557 ASN B C   1 
ATOM   8773 O  O   . ASN B 1 525 ? 52.660 8.950  185.760 1.00 15.00 ? 557 ASN B O   1 
ATOM   8774 C  CB  . ASN B 1 525 ? 50.130 7.120  185.710 1.00 15.00 ? 557 ASN B CB  1 
ATOM   8775 C  CG  . ASN B 1 525 ? 49.480 6.300  186.820 1.00 15.00 ? 557 ASN B CG  1 
ATOM   8776 O  OD1 . ASN B 1 525 ? 49.660 5.080  186.850 1.00 15.00 ? 557 ASN B OD1 1 
ATOM   8777 N  ND2 . ASN B 1 525 ? 48.670 6.820  187.740 1.00 15.00 ? 557 ASN B ND2 1 
ATOM   8778 N  N   . LEU B 1 526 ? 51.180 9.790  184.240 1.00 15.00 ? 558 LEU B N   1 
ATOM   8779 C  CA  . LEU B 1 526 ? 52.200 10.430 183.460 1.00 15.00 ? 558 LEU B CA  1 
ATOM   8780 C  C   . LEU B 1 526 ? 52.940 11.420 184.350 1.00 15.00 ? 558 LEU B C   1 
ATOM   8781 O  O   . LEU B 1 526 ? 54.170 11.390 184.340 1.00 15.00 ? 558 LEU B O   1 
ATOM   8782 C  CB  . LEU B 1 526 ? 51.600 11.170 182.280 1.00 15.00 ? 558 LEU B CB  1 
ATOM   8783 C  CG  . LEU B 1 526 ? 50.790 10.350 181.290 1.00 15.00 ? 558 LEU B CG  1 
ATOM   8784 C  CD1 . LEU B 1 526 ? 50.290 11.240 180.210 1.00 15.00 ? 558 LEU B CD1 1 
ATOM   8785 C  CD2 . LEU B 1 526 ? 51.630 9.290  180.630 1.00 15.00 ? 558 LEU B CD2 1 
ATOM   8786 N  N   . VAL B 1 527 ? 52.310 12.210 185.240 1.00 15.00 ? 559 VAL B N   1 
ATOM   8787 C  CA  . VAL B 1 527 ? 53.100 13.110 186.090 1.00 15.00 ? 559 VAL B CA  1 
ATOM   8788 C  C   . VAL B 1 527 ? 53.790 12.290 187.140 1.00 15.00 ? 559 VAL B C   1 
ATOM   8789 O  O   . VAL B 1 527 ? 54.900 12.590 187.500 1.00 15.00 ? 559 VAL B O   1 
ATOM   8790 C  CB  . VAL B 1 527 ? 52.270 14.260 186.820 1.00 15.00 ? 559 VAL B CB  1 
ATOM   8791 C  CG1 . VAL B 1 527 ? 51.220 14.800 185.890 1.00 15.00 ? 559 VAL B CG1 1 
ATOM   8792 C  CG2 . VAL B 1 527 ? 51.590 13.790 188.080 1.00 15.00 ? 559 VAL B CG2 1 
ATOM   8793 N  N   . LYS B 1 528 ? 53.200 11.220 187.630 1.00 15.00 ? 560 LYS B N   1 
ATOM   8794 C  CA  . LYS B 1 528 ? 53.790 10.430 188.680 1.00 15.00 ? 560 LYS B CA  1 
ATOM   8795 C  C   . LYS B 1 528 ? 54.970 9.550  188.340 1.00 15.00 ? 560 LYS B C   1 
ATOM   8796 O  O   . LYS B 1 528 ? 55.570 8.960  189.230 1.00 15.00 ? 560 LYS B O   1 
ATOM   8797 C  CB  . LYS B 1 528 ? 52.730 9.570  189.290 1.00 15.00 ? 560 LYS B CB  1 
ATOM   8798 C  CG  . LYS B 1 528 ? 51.890 10.300 190.320 1.00 15.00 ? 560 LYS B CG  1 
ATOM   8799 C  CD  . LYS B 1 528 ? 50.750 9.370  190.650 1.00 15.00 ? 560 LYS B CD  1 
ATOM   8800 C  CE  . LYS B 1 528 ? 50.280 9.670  192.050 1.00 15.00 ? 560 LYS B CE  1 
ATOM   8801 N  NZ  . LYS B 1 528 ? 49.140 8.820  192.350 1.00 15.00 ? 560 LYS B NZ  1 
ATOM   8802 N  N   . THR B 1 529 ? 55.250 9.350  187.060 1.00 15.00 ? 561 THR B N   1 
ATOM   8803 C  CA  . THR B 1 529 ? 56.400 8.580  186.700 1.00 15.00 ? 561 THR B CA  1 
ATOM   8804 C  C   . THR B 1 529 ? 57.290 9.330  185.730 1.00 15.00 ? 561 THR B C   1 
ATOM   8805 O  O   . THR B 1 529 ? 58.190 8.730  185.150 1.00 15.00 ? 561 THR B O   1 
ATOM   8806 C  CB  . THR B 1 529 ? 55.950 7.240  186.070 1.00 15.00 ? 561 THR B CB  1 
ATOM   8807 O  OG1 . THR B 1 529 ? 54.830 7.450  185.220 1.00 15.00 ? 561 THR B OG1 1 
ATOM   8808 C  CG2 . THR B 1 529 ? 55.630 6.240  187.150 1.00 15.00 ? 561 THR B CG2 1 
ATOM   8809 N  N   . ALA B 1 530 ? 57.110 10.640 185.530 1.00 15.00 ? 562 ALA B N   1 
ATOM   8810 C  CA  . ALA B 1 530 ? 57.860 11.410 184.550 1.00 15.00 ? 562 ALA B CA  1 
ATOM   8811 C  C   . ALA B 1 530 ? 59.350 11.260 184.790 1.00 15.00 ? 562 ALA B C   1 
ATOM   8812 O  O   . ALA B 1 530 ? 59.780 11.190 185.950 1.00 15.00 ? 562 ALA B O   1 
ATOM   8813 C  CB  . ALA B 1 530 ? 57.510 12.870 184.630 1.00 15.00 ? 562 ALA B CB  1 
ATOM   8814 N  N   . THR B 1 531 ? 60.150 11.140 183.740 1.00 15.00 ? 563 THR B N   1 
ATOM   8815 C  CA  . THR B 1 531 ? 61.570 10.950 183.900 1.00 15.00 ? 563 THR B CA  1 
ATOM   8816 C  C   . THR B 1 531 ? 62.230 11.600 182.730 1.00 15.00 ? 563 THR B C   1 
ATOM   8817 O  O   . THR B 1 531 ? 61.680 11.530 181.630 1.00 15.00 ? 563 THR B O   1 
ATOM   8818 C  CB  . THR B 1 531 ? 61.800 9.440  183.980 1.00 15.00 ? 563 THR B CB  1 
ATOM   8819 O  OG1 . THR B 1 531 ? 61.910 9.290  185.390 1.00 15.00 ? 563 THR B OG1 1 
ATOM   8820 C  CG2 . THR B 1 531 ? 63.010 8.820  183.280 1.00 15.00 ? 563 THR B CG2 1 
ATOM   8821 N  N   . LEU B 1 532 ? 63.430 12.170 182.930 1.00 15.00 ? 564 LEU B N   1 
ATOM   8822 C  CA  . LEU B 1 532 ? 64.100 12.930 181.880 1.00 15.00 ? 564 LEU B CA  1 
ATOM   8823 C  C   . LEU B 1 532 ? 64.300 12.030 180.680 1.00 15.00 ? 564 LEU B C   1 
ATOM   8824 O  O   . LEU B 1 532 ? 63.940 12.430 179.570 1.00 15.00 ? 564 LEU B O   1 
ATOM   8825 C  CB  . LEU B 1 532 ? 65.440 13.450 182.330 1.00 15.00 ? 564 LEU B CB  1 
ATOM   8826 C  CG  . LEU B 1 532 ? 66.210 14.230 181.280 1.00 15.00 ? 564 LEU B CG  1 
ATOM   8827 C  CD1 . LEU B 1 532 ? 65.470 15.500 180.870 1.00 15.00 ? 564 LEU B CD1 1 
ATOM   8828 C  CD2 . LEU B 1 532 ? 67.560 14.570 181.850 1.00 15.00 ? 564 LEU B CD2 1 
ATOM   8829 N  N   . LYS B 1 533 ? 64.780 10.810 180.950 1.00 15.00 ? 565 LYS B N   1 
ATOM   8830 C  CA  . LYS B 1 533 ? 64.920 9.860  179.870 1.00 15.00 ? 565 LYS B CA  1 
ATOM   8831 C  C   . LYS B 1 533 ? 63.560 9.670  179.180 1.00 15.00 ? 565 LYS B C   1 
ATOM   8832 O  O   . LYS B 1 533 ? 63.480 9.840  177.970 1.00 15.00 ? 565 LYS B O   1 
ATOM   8833 C  CB  . LYS B 1 533 ? 65.410 8.530  180.380 1.00 15.00 ? 565 LYS B CB  1 
ATOM   8834 C  CG  . LYS B 1 533 ? 65.830 7.660  179.210 1.00 15.00 ? 565 LYS B CG  1 
ATOM   8835 C  CD  . LYS B 1 533 ? 66.330 6.300  179.650 1.00 15.00 ? 565 LYS B CD  1 
ATOM   8836 C  CE  . LYS B 1 533 ? 67.460 5.880  178.690 1.00 15.00 ? 565 LYS B CE  1 
ATOM   8837 N  NZ  . LYS B 1 533 ? 68.010 4.550  178.980 1.00 15.00 ? 565 LYS B NZ  1 
ATOM   8838 N  N   . LYS B 1 534 ? 62.470 9.460  179.900 1.00 15.00 ? 566 LYS B N   1 
ATOM   8839 C  CA  . LYS B 1 534 ? 61.180 9.270  179.260 1.00 15.00 ? 566 LYS B CA  1 
ATOM   8840 C  C   . LYS B 1 534 ? 60.820 10.500 178.450 1.00 15.00 ? 566 LYS B C   1 
ATOM   8841 O  O   . LYS B 1 534 ? 60.420 10.360 177.310 1.00 15.00 ? 566 LYS B O   1 
ATOM   8842 C  CB  . LYS B 1 534 ? 60.090 9.030  180.280 1.00 15.00 ? 566 LYS B CB  1 
ATOM   8843 C  CG  . LYS B 1 534 ? 60.070 7.640  180.890 1.00 15.00 ? 566 LYS B CG  1 
ATOM   8844 C  CD  . LYS B 1 534 ? 58.960 7.490  181.970 1.00 15.00 ? 566 LYS B CD  1 
ATOM   8845 C  CE  . LYS B 1 534 ? 57.500 7.610  181.480 1.00 15.00 ? 566 LYS B CE  1 
ATOM   8846 N  NZ  . LYS B 1 534 ? 56.570 7.950  182.560 1.00 15.00 ? 566 LYS B NZ  1 
ATOM   8847 N  N   . LEU B 1 535 ? 61.100 11.690 178.970 1.00 15.00 ? 567 LEU B N   1 
ATOM   8848 C  CA  . LEU B 1 535 ? 60.730 12.920 178.310 1.00 15.00 ? 567 LEU B CA  1 
ATOM   8849 C  C   . LEU B 1 535 ? 61.390 13.020 176.960 1.00 15.00 ? 567 LEU B C   1 
ATOM   8850 O  O   . LEU B 1 535 ? 60.760 13.330 175.950 1.00 15.00 ? 567 LEU B O   1 
ATOM   8851 C  CB  . LEU B 1 535 ? 61.130 14.050 179.210 1.00 15.00 ? 567 LEU B CB  1 
ATOM   8852 C  CG  . LEU B 1 535 ? 61.050 15.430 178.640 1.00 15.00 ? 567 LEU B CG  1 
ATOM   8853 C  CD1 . LEU B 1 535 ? 59.610 15.850 178.460 1.00 15.00 ? 567 LEU B CD1 1 
ATOM   8854 C  CD2 . LEU B 1 535 ? 61.740 16.390 179.570 1.00 15.00 ? 567 LEU B CD2 1 
ATOM   8855 N  N   . VAL B 1 536 ? 62.680 12.720 176.950 1.00 15.00 ? 568 VAL B N   1 
ATOM   8856 C  CA  . VAL B 1 536 ? 63.440 12.850 175.720 1.00 15.00 ? 568 VAL B CA  1 
ATOM   8857 C  C   . VAL B 1 536 ? 63.200 11.670 174.820 1.00 15.00 ? 568 VAL B C   1 
ATOM   8858 O  O   . VAL B 1 536 ? 62.880 11.810 173.640 1.00 15.00 ? 568 VAL B O   1 
ATOM   8859 C  CB  . VAL B 1 536 ? 64.940 12.960 175.990 1.00 15.00 ? 568 VAL B CB  1 
ATOM   8860 C  CG1 . VAL B 1 536 ? 65.690 13.070 174.680 1.00 15.00 ? 568 VAL B CG1 1 
ATOM   8861 C  CG2 . VAL B 1 536 ? 65.200 14.200 176.790 1.00 15.00 ? 568 VAL B CG2 1 
ATOM   8862 N  N   . CYS B 1 537 ? 63.360 10.470 175.340 1.00 15.00 ? 569 CYS B N   1 
ATOM   8863 C  CA  . CYS B 1 537 ? 63.260 9.320  174.500 1.00 15.00 ? 569 CYS B CA  1 
ATOM   8864 C  C   . CYS B 1 537 ? 61.910 9.020  173.940 1.00 15.00 ? 569 CYS B C   1 
ATOM   8865 O  O   . CYS B 1 537 ? 61.850 8.610  172.780 1.00 15.00 ? 569 CYS B O   1 
ATOM   8866 C  CB  . CYS B 1 537 ? 63.820 8.150  175.240 1.00 15.00 ? 569 CYS B CB  1 
ATOM   8867 S  SG  . CYS B 1 537 ? 65.590 8.460  175.000 1.00 15.00 ? 569 CYS B SG  1 
ATOM   8868 N  N   . LEU B 1 538 ? 60.800 9.300  174.620 1.00 15.00 ? 570 LEU B N   1 
ATOM   8869 C  CA  . LEU B 1 538 ? 59.490 9.070  174.020 1.00 15.00 ? 570 LEU B CA  1 
ATOM   8870 C  C   . LEU B 1 538 ? 59.150 10.110 172.980 1.00 15.00 ? 570 LEU B C   1 
ATOM   8871 O  O   . LEU B 1 538 ? 58.070 10.070 172.370 1.00 15.00 ? 570 LEU B O   1 
ATOM   8872 C  CB  . LEU B 1 538 ? 58.370 9.100  175.050 1.00 15.00 ? 570 LEU B CB  1 
ATOM   8873 C  CG  . LEU B 1 538 ? 58.030 7.780  175.720 1.00 15.00 ? 570 LEU B CG  1 
ATOM   8874 C  CD1 . LEU B 1 538 ? 59.110 7.370  176.690 1.00 15.00 ? 570 LEU B CD1 1 
ATOM   8875 C  CD2 . LEU B 1 538 ? 56.750 7.970  176.530 1.00 15.00 ? 570 LEU B CD2 1 
ATOM   8876 N  N   . ASN B 1 539 ? 60.000 11.090 172.730 1.00 15.00 ? 571 ASN B N   1 
ATOM   8877 C  CA  . ASN B 1 539 ? 59.670 12.090 171.750 1.00 15.00 ? 571 ASN B CA  1 
ATOM   8878 C  C   . ASN B 1 539 ? 60.750 12.220 170.700 1.00 15.00 ? 571 ASN B C   1 
ATOM   8879 O  O   . ASN B 1 539 ? 60.800 13.180 169.930 1.00 15.00 ? 571 ASN B O   1 
ATOM   8880 C  CB  . ASN B 1 539 ? 59.430 13.420 172.470 1.00 15.00 ? 571 ASN B CB  1 
ATOM   8881 C  CG  . ASN B 1 539 ? 58.090 13.510 173.200 1.00 15.00 ? 571 ASN B CG  1 
ATOM   8882 O  OD1 . ASN B 1 539 ? 57.950 14.320 174.100 1.00 15.00 ? 571 ASN B OD1 1 
ATOM   8883 N  ND2 . ASN B 1 539 ? 57.030 12.770 172.940 1.00 15.00 ? 571 ASN B ND2 1 
ATOM   8884 N  N   . THR B 1 540 ? 61.580 11.190 170.600 1.00 15.00 ? 572 THR B N   1 
ATOM   8885 C  CA  . THR B 1 540 ? 62.720 11.210 169.720 1.00 15.00 ? 572 THR B CA  1 
ATOM   8886 C  C   . THR B 1 540 ? 62.650 9.890  168.940 1.00 15.00 ? 572 THR B C   1 
ATOM   8887 O  O   . THR B 1 540 ? 62.100 8.940  169.480 1.00 15.00 ? 572 THR B O   1 
ATOM   8888 C  CB  . THR B 1 540 ? 63.890 11.400 170.700 1.00 15.00 ? 572 THR B CB  1 
ATOM   8889 O  OG1 . THR B 1 540 ? 64.940 11.990 169.970 1.00 15.00 ? 572 THR B OG1 1 
ATOM   8890 C  CG2 . THR B 1 540 ? 64.380 10.120 171.310 1.00 15.00 ? 572 THR B CG2 1 
ATOM   8891 N  N   . LYS B 1 541 ? 63.150 9.740  167.700 1.00 15.00 ? 573 LYS B N   1 
ATOM   8892 C  CA  . LYS B 1 541 ? 63.050 8.410  167.080 1.00 15.00 ? 573 LYS B CA  1 
ATOM   8893 C  C   . LYS B 1 541 ? 64.060 7.450  167.640 1.00 15.00 ? 573 LYS B C   1 
ATOM   8894 O  O   . LYS B 1 541 ? 64.000 6.270  167.310 1.00 15.00 ? 573 LYS B O   1 
ATOM   8895 C  CB  . LYS B 1 541 ? 63.310 8.320  165.580 1.00 15.00 ? 573 LYS B CB  1 
ATOM   8896 C  CG  . LYS B 1 541 ? 62.630 9.300  164.670 1.00 15.00 ? 573 LYS B CG  1 
ATOM   8897 C  CD  . LYS B 1 541 ? 63.600 10.460 164.600 1.00 15.00 ? 573 LYS B CD  1 
ATOM   8898 C  CE  . LYS B 1 541 ? 64.950 10.040 163.940 1.00 15.00 ? 573 LYS B CE  1 
ATOM   8899 N  NZ  . LYS B 1 541 ? 66.010 11.010 164.180 1.00 15.00 ? 573 LYS B NZ  1 
ATOM   8900 N  N   . THR B 1 542 ? 65.050 7.860  168.430 1.00 15.00 ? 574 THR B N   1 
ATOM   8901 C  CA  . THR B 1 542 ? 65.990 6.890  168.930 1.00 15.00 ? 574 THR B CA  1 
ATOM   8902 C  C   . THR B 1 542 ? 66.580 7.480  170.220 1.00 15.00 ? 574 THR B C   1 
ATOM   8903 O  O   . THR B 1 542 ? 66.890 8.670  170.290 1.00 15.00 ? 574 THR B O   1 
ATOM   8904 C  CB  . THR B 1 542 ? 67.010 6.660  167.810 1.00 15.00 ? 574 THR B CB  1 
ATOM   8905 O  OG1 . THR B 1 542 ? 67.880 5.710  168.390 1.00 15.00 ? 574 THR B OG1 1 
ATOM   8906 C  CG2 . THR B 1 542 ? 67.750 7.880  167.290 1.00 15.00 ? 574 THR B CG2 1 
ATOM   8907 N  N   . CYS B 1 543 ? 66.750 6.640  171.230 1.00 15.00 ? 575 CYS B N   1 
ATOM   8908 C  CA  . CYS B 1 543 ? 67.140 7.110  172.540 1.00 15.00 ? 575 CYS B CA  1 
ATOM   8909 C  C   . CYS B 1 543 ? 68.640 7.310  172.650 1.00 15.00 ? 575 CYS B C   1 
ATOM   8910 O  O   . CYS B 1 543 ? 69.400 6.360  172.460 1.00 15.00 ? 575 CYS B O   1 
ATOM   8911 C  CB  . CYS B 1 543 ? 66.660 6.090  173.530 1.00 15.00 ? 575 CYS B CB  1 
ATOM   8912 S  SG  . CYS B 1 543 ? 66.660 6.740  175.200 1.00 15.00 ? 575 CYS B SG  1 
ATOM   8913 N  N   . PRO B 1 544 ? 69.140 8.510  172.890 1.00 15.00 ? 576 PRO B N   1 
ATOM   8914 C  CA  . PRO B 1 544 ? 70.540 8.770  173.130 1.00 15.00 ? 576 PRO B CA  1 
ATOM   8915 C  C   . PRO B 1 544 ? 70.880 8.550  174.580 1.00 15.00 ? 576 PRO B C   1 
ATOM   8916 O  O   . PRO B 1 544 ? 70.080 8.010  175.340 1.00 15.00 ? 576 PRO B O   1 
ATOM   8917 C  CB  . PRO B 1 544 ? 70.700 10.190 172.690 1.00 15.00 ? 576 PRO B CB  1 
ATOM   8918 C  CG  . PRO B 1 544 ? 69.450 10.810 173.230 1.00 15.00 ? 576 PRO B CG  1 
ATOM   8919 C  CD  . PRO B 1 544 ? 68.410 9.760  172.820 1.00 15.00 ? 576 PRO B CD  1 
ATOM   8920 N  N   . TYR B 1 545 ? 72.070 8.970  175.000 1.00 15.00 ? 577 TYR B N   1 
ATOM   8921 C  CA  . TYR B 1 545 ? 72.440 8.910  176.410 1.00 15.00 ? 577 TYR B CA  1 
ATOM   8922 C  C   . TYR B 1 545 ? 71.690 10.130 176.910 1.00 15.00 ? 577 TYR B C   1 
ATOM   8923 O  O   . TYR B 1 545 ? 71.850 11.170 176.270 1.00 15.00 ? 577 TYR B O   1 
ATOM   8924 C  CB  . TYR B 1 545 ? 73.940 9.090  176.600 1.00 15.00 ? 577 TYR B CB  1 
ATOM   8925 C  CG  . TYR B 1 545 ? 74.380 9.300  178.050 1.00 15.00 ? 577 TYR B CG  1 
ATOM   8926 C  CD1 . TYR B 1 545 ? 74.380 8.260  178.960 1.00 15.00 ? 577 TYR B CD1 1 
ATOM   8927 C  CD2 . TYR B 1 545 ? 74.770 10.550 178.470 1.00 15.00 ? 577 TYR B CD2 1 
ATOM   8928 C  CE1 . TYR B 1 545 ? 74.760 8.470  180.270 1.00 15.00 ? 577 TYR B CE1 1 
ATOM   8929 C  CE2 . TYR B 1 545 ? 75.150 10.780 179.780 1.00 15.00 ? 577 TYR B CE2 1 
ATOM   8930 C  CZ  . TYR B 1 545 ? 75.130 9.730  180.670 1.00 15.00 ? 577 TYR B CZ  1 
ATOM   8931 O  OH  . TYR B 1 545 ? 75.460 9.960  181.990 1.00 15.00 ? 577 TYR B OH  1 
ATOM   8932 N  N   . VAL B 1 546 ? 70.860 10.040 177.950 1.00 15.00 ? 578 VAL B N   1 
ATOM   8933 C  CA  . VAL B 1 546 ? 70.200 11.250 178.400 1.00 15.00 ? 578 VAL B CA  1 
ATOM   8934 C  C   . VAL B 1 546 ? 70.440 11.270 179.890 1.00 15.00 ? 578 VAL B C   1 
ATOM   8935 O  O   . VAL B 1 546 ? 70.040 10.340 180.580 1.00 15.00 ? 578 VAL B O   1 
ATOM   8936 C  CB  . VAL B 1 546 ? 68.700 11.260 178.220 1.00 15.00 ? 578 VAL B CB  1 
ATOM   8937 C  CG1 . VAL B 1 546 ? 68.280 12.710 178.450 1.00 15.00 ? 578 VAL B CG1 1 
ATOM   8938 C  CG2 . VAL B 1 546 ? 68.260 10.750 176.860 1.00 15.00 ? 578 VAL B CG2 1 
ATOM   8939 N  N   . SER B 1 547 ? 71.060 12.340 180.380 1.00 15.00 ? 579 SER B N   1 
ATOM   8940 C  CA  . SER B 1 547 ? 71.350 12.430 181.800 1.00 15.00 ? 579 SER B CA  1 
ATOM   8941 C  C   . SER B 1 547 ? 71.730 13.850 182.160 1.00 15.00 ? 579 SER B C   1 
ATOM   8942 O  O   . SER B 1 547 ? 72.080 14.680 181.310 1.00 15.00 ? 579 SER B O   1 
ATOM   8943 C  CB  . SER B 1 547 ? 72.460 11.500 182.170 1.00 15.00 ? 579 SER B CB  1 
ATOM   8944 O  OG  . SER B 1 547 ? 72.690 11.470 183.550 1.00 15.00 ? 579 SER B OG  1 
ATOM   8945 N  N   . PHE B 1 548 ? 71.630 14.140 183.440 1.00 15.00 ? 580 PHE B N   1 
ATOM   8946 C  CA  . PHE B 1 548 ? 72.090 15.400 183.970 1.00 15.00 ? 580 PHE B CA  1 
ATOM   8947 C  C   . PHE B 1 548 ? 73.540 15.240 184.420 1.00 15.00 ? 580 PHE B C   1 
ATOM   8948 O  O   . PHE B 1 548 ? 74.250 16.180 184.750 1.00 15.00 ? 580 PHE B O   1 
ATOM   8949 C  CB  . PHE B 1 548 ? 71.210 15.800 185.140 1.00 15.00 ? 580 PHE B CB  1 
ATOM   8950 C  CG  . PHE B 1 548 ? 69.860 16.410 184.770 1.00 15.00 ? 580 PHE B CG  1 
ATOM   8951 C  CD1 . PHE B 1 548 ? 69.720 17.190 183.640 1.00 15.00 ? 580 PHE B CD1 1 
ATOM   8952 C  CD2 . PHE B 1 548 ? 68.770 16.200 185.580 1.00 15.00 ? 580 PHE B CD2 1 
ATOM   8953 C  CE1 . PHE B 1 548 ? 68.510 17.760 183.320 1.00 15.00 ? 580 PHE B CE1 1 
ATOM   8954 C  CE2 . PHE B 1 548 ? 67.570 16.780 185.260 1.00 15.00 ? 580 PHE B CE2 1 
ATOM   8955 C  CZ  . PHE B 1 548 ? 67.420 17.570 184.140 1.00 15.00 ? 580 PHE B CZ  1 
ATOM   8956 N  N   . HIS B 1 549 ? 73.960 13.990 184.350 1.00 15.00 ? 581 HIS B N   1 
ATOM   8957 C  CA  . HIS B 1 549 ? 75.220 13.470 184.820 1.00 15.00 ? 581 HIS B CA  1 
ATOM   8958 C  C   . HIS B 1 549 ? 76.100 13.180 183.620 1.00 15.00 ? 581 HIS B C   1 
ATOM   8959 O  O   . HIS B 1 549 ? 75.660 12.740 182.560 1.00 15.00 ? 581 HIS B O   1 
ATOM   8960 C  CB  . HIS B 1 549 ? 74.950 12.200 185.540 1.00 15.00 ? 581 HIS B CB  1 
ATOM   8961 C  CG  . HIS B 1 549 ? 76.040 11.700 186.440 1.00 15.00 ? 581 HIS B CG  1 
ATOM   8962 N  ND1 . HIS B 1 549 ? 77.330 12.250 186.590 1.00 15.00 ? 581 HIS B ND1 1 
ATOM   8963 C  CD2 . HIS B 1 549 ? 75.750 10.750 187.410 1.00 15.00 ? 581 HIS B CD2 1 
ATOM   8964 C  CE1 . HIS B 1 549 ? 77.770 11.690 187.750 1.00 15.00 ? 581 HIS B CE1 1 
ATOM   8965 N  NE2 . HIS B 1 549 ? 76.890 10.840 188.240 1.00 15.00 ? 581 HIS B NE2 1 
ATOM   8966 N  N   . VAL B 1 550 ? 77.370 13.440 183.810 1.00 15.00 ? 582 VAL B N   1 
ATOM   8967 C  CA  . VAL B 1 550 ? 78.350 13.110 182.820 1.00 15.00 ? 582 VAL B CA  1 
ATOM   8968 C  C   . VAL B 1 550 ? 78.620 11.620 183.010 1.00 15.00 ? 582 VAL B C   1 
ATOM   8969 O  O   . VAL B 1 550 ? 78.660 11.090 184.130 1.00 15.00 ? 582 VAL B O   1 
ATOM   8970 C  CB  . VAL B 1 550 ? 79.530 14.050 183.090 1.00 15.00 ? 582 VAL B CB  1 
ATOM   8971 C  CG1 . VAL B 1 550 ? 80.870 13.380 183.150 1.00 15.00 ? 582 VAL B CG1 1 
ATOM   8972 C  CG2 . VAL B 1 550 ? 79.540 14.990 181.910 1.00 15.00 ? 582 VAL B CG2 1 
ATOM   8973 N  N   . PRO B 1 551 ? 78.740 10.920 181.880 1.00 15.00 ? 583 PRO B N   1 
ATOM   8974 C  CA  . PRO B 1 551 ? 78.810 9.480  181.840 1.00 15.00 ? 583 PRO B CA  1 
ATOM   8975 C  C   . PRO B 1 551 ? 79.880 8.780  182.640 1.00 15.00 ? 583 PRO B C   1 
ATOM   8976 O  O   . PRO B 1 551 ? 80.950 9.300  182.940 1.00 15.00 ? 583 PRO B O   1 
ATOM   8977 C  CB  . PRO B 1 551 ? 78.900 9.190  180.360 1.00 15.00 ? 583 PRO B CB  1 
ATOM   8978 C  CG  . PRO B 1 551 ? 79.520 10.420 179.780 1.00 15.00 ? 583 PRO B CG  1 
ATOM   8979 C  CD  . PRO B 1 551 ? 78.740 11.470 180.540 1.00 15.00 ? 583 PRO B CD  1 
ATOM   8980 N  N   . ASP B 1 552 ? 79.420 7.550  182.900 1.00 15.00 ? 584 ASP B N   1 
ATOM   8981 C  CA  . ASP B 1 552 ? 80.040 6.420  183.590 1.00 15.00 ? 584 ASP B CA  1 
ATOM   8982 C  C   . ASP B 1 552 ? 80.880 6.580  184.860 1.00 15.00 ? 584 ASP B C   1 
ATOM   8983 O  O   . ASP B 1 552 ? 81.360 5.580  185.420 1.00 15.00 ? 584 ASP B O   1 
ATOM   8984 C  CB  . ASP B 1 552 ? 80.870 5.550  182.570 1.00 15.00 ? 584 ASP B CB  1 
ATOM   8985 C  CG  . ASP B 1 552 ? 82.280 6.020  182.110 1.00 15.00 ? 584 ASP B CG  1 
ATOM   8986 O  OD1 . ASP B 1 552 ? 82.310 6.860  181.200 1.00 15.00 ? 584 ASP B OD1 1 
ATOM   8987 O  OD2 . ASP B 1 552 ? 83.300 5.530  182.620 1.00 15.00 ? 584 ASP B OD2 1 
ATOM   8988 N  N   . PRO B 1 553 ? 80.960 7.780  185.460 1.00 15.00 ? 585 PRO B N   1 
ATOM   8989 C  CA  . PRO B 1 553 ? 82.240 8.490  185.640 1.00 15.00 ? 585 PRO B CA  1 
ATOM   8990 C  C   . PRO B 1 553 ? 83.400 8.060  184.710 1.00 15.00 ? 585 PRO B C   1 
ATOM   8991 O  O   . PRO B 1 553 ? 84.020 6.980  184.820 1.00 15.00 ? 585 PRO B O   1 
ATOM   8992 C  CB  . PRO B 1 553 ? 82.490 8.310  187.170 1.00 15.00 ? 585 PRO B CB  1 
ATOM   8993 C  CG  . PRO B 1 553 ? 81.120 7.870  187.800 1.00 15.00 ? 585 PRO B CG  1 
ATOM   8994 C  CD  . PRO B 1 553 ? 80.130 8.110  186.630 1.00 15.00 ? 585 PRO B CD  1 
ATOM   8995 N  N   . ARG B 1 554 ? 83.540 8.920  183.690 1.00 15.00 ? 586 ARG B N   1 
ATOM   8996 C  CA  . ARG B 1 554 ? 84.640 8.820  182.750 1.00 15.00 ? 586 ARG B CA  1 
ATOM   8997 C  C   . ARG B 1 554 ? 85.860 9.610  183.300 1.00 15.00 ? 586 ARG B C   1 
ATOM   8998 O  O   . ARG B 1 554 ? 87.000 9.100  183.180 1.00 15.00 ? 586 ARG B O   1 
ATOM   8999 C  CB  . ARG B 1 554 ? 84.180 9.400  181.360 1.00 15.00 ? 586 ARG B CB  1 
ATOM   9000 C  CG  . ARG B 1 554 ? 85.020 9.000  180.110 1.00 15.00 ? 586 ARG B CG  1 
ATOM   9001 C  CD  . ARG B 1 554 ? 85.070 7.490  179.750 1.00 15.00 ? 586 ARG B CD  1 
ATOM   9002 N  NE  . ARG B 1 554 ? 85.590 6.700  180.880 1.00 15.00 ? 586 ARG B NE  1 
ATOM   9003 C  CZ  . ARG B 1 554 ? 86.860 6.220  180.940 1.00 15.00 ? 586 ARG B CZ  1 
ATOM   9004 N  NH1 . ARG B 1 554 ? 87.750 6.340  179.930 1.00 15.00 ? 586 ARG B NH1 1 
ATOM   9005 N  NH2 . ARG B 1 554 ? 87.210 5.520  182.060 1.00 15.00 ? 586 ARG B NH2 1 
ATOM   9006 O  OXT . ARG B 1 554 ? 85.660 10.700 183.900 1.00 15.00 ? 586 ARG B OXT 1 
HETATM 9007 C  CHA . HEM C 2 .   ? 23.110 44.870 191.760 1.00 15.00 ? 601 HEM A CHA 1 
HETATM 9008 C  CHB . HEM C 2 .   ? 23.130 44.090 196.460 1.00 15.00 ? 601 HEM A CHB 1 
HETATM 9009 C  CHC . HEM C 2 .   ? 20.290 47.890 197.100 1.00 15.00 ? 601 HEM A CHC 1 
HETATM 9010 C  CHD . HEM C 2 .   ? 19.850 48.310 192.380 1.00 15.00 ? 601 HEM A CHD 1 
HETATM 9011 C  C1A . HEM C 2 .   ? 23.470 44.400 193.000 1.00 15.00 ? 601 HEM A C1A 1 
HETATM 9012 C  C2A . HEM C 2 .   ? 24.500 43.390 193.270 1.00 15.00 ? 601 HEM A C2A 1 
HETATM 9013 C  C3A . HEM C 2 .   ? 24.420 43.130 194.580 1.00 15.00 ? 601 HEM A C3A 1 
HETATM 9014 C  C4A . HEM C 2 .   ? 23.410 44.000 195.130 1.00 15.00 ? 601 HEM A C4A 1 
HETATM 9015 C  CMA . HEM C 2 .   ? 25.250 42.090 195.290 1.00 15.00 ? 601 HEM A CMA 1 
HETATM 9016 C  CAA . HEM C 2 .   ? 25.510 42.750 192.300 1.00 15.00 ? 601 HEM A CAA 1 
HETATM 9017 C  CBA . HEM C 2 .   ? 26.670 43.650 191.820 1.00 15.00 ? 601 HEM A CBA 1 
HETATM 9018 C  CGA . HEM C 2 .   ? 27.500 43.120 190.630 1.00 15.00 ? 601 HEM A CGA 1 
HETATM 9019 O  O1A . HEM C 2 .   ? 27.730 43.840 189.670 1.00 15.00 ? 601 HEM A O1A 1 
HETATM 9020 O  O2A . HEM C 2 .   ? 27.960 41.980 190.660 1.00 15.00 ? 601 HEM A O2A 1 
HETATM 9021 C  C1B . HEM C 2 .   ? 22.330 45.050 197.040 1.00 15.00 ? 601 HEM A C1B 1 
HETATM 9022 C  C2B . HEM C 2 .   ? 22.160 45.180 198.470 1.00 15.00 ? 601 HEM A C2B 1 
HETATM 9023 C  C3B . HEM C 2 .   ? 21.380 46.270 198.630 1.00 15.00 ? 601 HEM A C3B 1 
HETATM 9024 C  C4B . HEM C 2 .   ? 21.060 46.790 197.320 1.00 15.00 ? 601 HEM A C4B 1 
HETATM 9025 C  CMB . HEM C 2 .   ? 22.750 44.290 199.570 1.00 15.00 ? 601 HEM A CMB 1 
HETATM 9026 C  CAB . HEM C 2 .   ? 21.020 46.830 199.840 1.00 15.00 ? 601 HEM A CAB 1 
HETATM 9027 C  CBB . HEM C 2 .   ? 19.800 46.470 200.540 1.00 15.00 ? 601 HEM A CBB 1 
HETATM 9028 C  C1C . HEM C 2 .   ? 19.990 48.400 195.870 1.00 15.00 ? 601 HEM A C1C 1 
HETATM 9029 C  C2C . HEM C 2 .   ? 19.110 49.560 195.640 1.00 15.00 ? 601 HEM A C2C 1 
HETATM 9030 C  C3C . HEM C 2 .   ? 18.980 49.630 194.320 1.00 15.00 ? 601 HEM A C3C 1 
HETATM 9031 C  C4C . HEM C 2 .   ? 19.740 48.550 193.730 1.00 15.00 ? 601 HEM A C4C 1 
HETATM 9032 C  CMC . HEM C 2 .   ? 18.470 50.540 196.610 1.00 15.00 ? 601 HEM A CMC 1 
HETATM 9033 C  CAC . HEM C 2 .   ? 18.220 50.580 193.670 1.00 15.00 ? 601 HEM A CAC 1 
HETATM 9034 C  CBC . HEM C 2 .   ? 18.830 51.730 193.050 1.00 15.00 ? 601 HEM A CBC 1 
HETATM 9035 C  C1D . HEM C 2 .   ? 20.670 47.380 191.790 1.00 15.00 ? 601 HEM A C1D 1 
HETATM 9036 C  C2D . HEM C 2 .   ? 20.940 47.320 190.360 1.00 15.00 ? 601 HEM A C2D 1 
HETATM 9037 C  C3D . HEM C 2 .   ? 21.890 46.390 190.190 1.00 15.00 ? 601 HEM A C3D 1 
HETATM 9038 C  C4D . HEM C 2 .   ? 22.170 45.850 191.510 1.00 15.00 ? 601 HEM A C4D 1 
HETATM 9039 C  CMD . HEM C 2 .   ? 20.330 48.190 189.270 1.00 15.00 ? 601 HEM A CMD 1 
HETATM 9040 C  CAD . HEM C 2 .   ? 22.690 46.160 188.910 1.00 15.00 ? 601 HEM A CAD 1 
HETATM 9041 C  CBD . HEM C 2 .   ? 21.950 45.600 187.680 1.00 15.00 ? 601 HEM A CBD 1 
HETATM 9042 C  CGD . HEM C 2 .   ? 21.560 44.110 187.650 1.00 15.00 ? 601 HEM A CGD 1 
HETATM 9043 O  O1D . HEM C 2 .   ? 21.980 43.310 188.520 1.00 15.00 ? 601 HEM A O1D 1 
HETATM 9044 O  O2D . HEM C 2 .   ? 20.840 43.750 186.710 1.00 15.00 ? 601 HEM A O2D 1 
HETATM 9045 N  NA  . HEM C 2 .   ? 22.840 44.810 194.160 1.00 15.00 ? 601 HEM A NA  1 
HETATM 9046 N  NB  . HEM C 2 .   ? 21.650 46.040 196.340 1.00 15.00 ? 601 HEM A NB  1 
HETATM 9047 N  NC  . HEM C 2 .   ? 20.380 47.810 194.680 1.00 15.00 ? 601 HEM A NC  1 
HETATM 9048 N  ND  . HEM C 2 .   ? 21.440 46.490 192.490 1.00 15.00 ? 601 HEM A ND  1 
HETATM 9049 FE FE  . HEM C 2 .   ? 21.540 46.280 194.390 1.00 15.00 ? 601 HEM A FE  1 
HETATM 9050 C  CHA . HEM D 2 .   ? 70.270 36.560 182.270 1.00 15.00 ? 601 HEM B CHA 1 
HETATM 9051 C  CHB . HEM D 2 .   ? 70.650 32.190 184.130 1.00 15.00 ? 601 HEM B CHB 1 
HETATM 9052 C  CHC . HEM D 2 .   ? 73.300 30.830 180.380 1.00 15.00 ? 601 HEM B CHC 1 
HETATM 9053 C  CHD . HEM D 2 .   ? 73.350 35.330 178.830 1.00 15.00 ? 601 HEM B CHD 1 
HETATM 9054 C  C1A . HEM D 2 .   ? 70.030 35.450 183.040 1.00 15.00 ? 601 HEM B C1A 1 
HETATM 9055 C  C2A . HEM D 2 .   ? 69.090 35.370 184.160 1.00 15.00 ? 601 HEM B C2A 1 
HETATM 9056 C  C3A . HEM D 2 .   ? 69.280 34.170 184.710 1.00 15.00 ? 601 HEM B C3A 1 
HETATM 9057 C  C4A . HEM D 2 .   ? 70.270 33.490 183.920 1.00 15.00 ? 601 HEM B C4A 1 
HETATM 9058 C  CMA . HEM D 2 .   ? 68.570 33.680 185.950 1.00 15.00 ? 601 HEM B CMA 1 
HETATM 9059 C  CAA . HEM D 2 .   ? 68.050 36.410 184.630 1.00 15.00 ? 601 HEM B CAA 1 
HETATM 9060 C  CBA . HEM D 2 .   ? 66.800 36.590 183.730 1.00 15.00 ? 601 HEM B CBA 1 
HETATM 9061 C  CGA . HEM D 2 .   ? 65.920 37.820 184.030 1.00 15.00 ? 601 HEM B CGA 1 
HETATM 9062 O  O1A . HEM D 2 .   ? 65.570 38.560 183.130 1.00 15.00 ? 601 HEM B O1A 1 
HETATM 9063 O  O2A . HEM D 2 .   ? 65.530 38.030 185.180 1.00 15.00 ? 601 HEM B O2A 1 
HETATM 9064 C  C1B . HEM D 2 .   ? 71.430 31.450 183.270 1.00 15.00 ? 601 HEM B C1B 1 
HETATM 9065 C  C2B . HEM D 2 .   ? 71.700 30.040 183.470 1.00 15.00 ? 601 HEM B C2B 1 
HETATM 9066 C  C3B . HEM D 2 .   ? 72.420 29.670 182.390 1.00 15.00 ? 601 HEM B C3B 1 
HETATM 9067 C  C4B . HEM D 2 .   ? 72.610 30.840 181.550 1.00 15.00 ? 601 HEM B C4B 1 
HETATM 9068 C  CMB . HEM D 2 .   ? 71.250 29.150 184.630 1.00 15.00 ? 601 HEM B CMB 1 
HETATM 9069 C  CAB . HEM D 2 .   ? 72.840 28.390 182.100 1.00 15.00 ? 601 HEM B CAB 1 
HETATM 9070 C  CBB . HEM D 2 .   ? 74.130 27.870 182.520 1.00 15.00 ? 601 HEM B CBB 1 
HETATM 9071 C  C1C . HEM D 2 .   ? 73.470 31.920 179.570 1.00 15.00 ? 601 HEM B C1C 1 
HETATM 9072 C  C2C . HEM D 2 .   ? 74.260 31.920 178.330 1.00 15.00 ? 601 HEM B C2C 1 
HETATM 9073 C  C3C . HEM D 2 .   ? 74.290 33.190 177.940 1.00 15.00 ? 601 HEM B C3C 1 
HETATM 9074 C  C4C . HEM D 2 .   ? 73.550 33.970 178.910 1.00 15.00 ? 601 HEM B C4C 1 
HETATM 9075 C  CMC . HEM D 2 .   ? 74.910 30.780 177.560 1.00 15.00 ? 601 HEM B CMC 1 
HETATM 9076 C  CAC . HEM D 2 .   ? 74.940 33.640 176.810 1.00 15.00 ? 601 HEM B CAC 1 
HETATM 9077 C  CBC . HEM D 2 .   ? 74.220 33.930 175.600 1.00 15.00 ? 601 HEM B CBC 1 
HETATM 9078 C  C1D . HEM D 2 .   ? 72.550 36.080 179.660 1.00 15.00 ? 601 HEM B C1D 1 
HETATM 9079 C  C2D . HEM D 2 .   ? 72.180 37.460 179.400 1.00 15.00 ? 601 HEM B C2D 1 
HETATM 9080 C  C3D . HEM D 2 .   ? 71.270 37.790 180.340 1.00 15.00 ? 601 HEM B C3D 1 
HETATM 9081 C  C4D . HEM D 2 .   ? 71.130 36.630 181.190 1.00 15.00 ? 601 HEM B C4D 1 
HETATM 9082 C  CMD . HEM D 2 .   ? 72.650 38.350 178.260 1.00 15.00 ? 601 HEM B CMD 1 
HETATM 9083 C  CAD . HEM D 2 .   ? 70.400 39.040 180.320 1.00 15.00 ? 601 HEM B CAD 1 
HETATM 9084 C  CBD . HEM D 2 .   ? 71.070 40.410 180.520 1.00 15.00 ? 601 HEM B CBD 1 
HETATM 9085 C  CGD . HEM D 2 .   ? 71.550 40.820 181.930 1.00 15.00 ? 601 HEM B CGD 1 
HETATM 9086 O  O1D . HEM D 2 .   ? 71.240 40.140 182.940 1.00 15.00 ? 601 HEM B O1D 1 
HETATM 9087 O  O2D . HEM D 2 .   ? 72.220 41.860 182.000 1.00 15.00 ? 601 HEM B O2D 1 
HETATM 9088 N  NA  . HEM D 2 .   ? 70.720 34.270 182.870 1.00 15.00 ? 601 HEM B NA  1 
HETATM 9089 N  NB  . HEM D 2 .   ? 72.000 31.930 182.100 1.00 15.00 ? 601 HEM B NB  1 
HETATM 9090 N  NC  . HEM D 2 .   ? 73.030 33.190 179.900 1.00 15.00 ? 601 HEM B NC  1 
HETATM 9091 N  ND  . HEM D 2 .   ? 71.890 35.570 180.740 1.00 15.00 ? 601 HEM B ND  1 
HETATM 9092 FE FE  . HEM D 2 .   ? 71.940 33.770 181.400 1.00 15.00 ? 601 HEM B FE  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   33  33  VAL VAL A . n 
A 1 2   ASN 2   34  34  ASN ASN A . n 
A 1 3   PRO 3   35  35  PRO PRO A . n 
A 1 4   CYS 4   36  36  CYS CYS A . n 
A 1 5   CYS 5   37  37  CYS CYS A . n 
A 1 6   TYR 6   38  38  TYR TYR A . n 
A 1 7   TYR 7   39  39  TYR TYR A . n 
A 1 8   PRO 8   40  40  PRO PRO A . n 
A 1 9   CYS 9   41  41  CYS CYS A . n 
A 1 10  GLN 10  42  42  GLN GLN A . n 
A 1 11  HIS 11  43  43  HIS HIS A . n 
A 1 12  GLN 12  44  44  GLN GLN A . n 
A 1 13  GLY 13  45  45  GLY GLY A . n 
A 1 14  ILE 14  46  46  ILE ILE A . n 
A 1 15  CYS 15  47  47  CYS CYS A . n 
A 1 16  VAL 16  48  48  VAL VAL A . n 
A 1 17  ARG 17  49  49  ARG ARG A . n 
A 1 18  PHE 18  50  50  PHE PHE A . n 
A 1 19  GLY 19  51  51  GLY GLY A . n 
A 1 20  LEU 20  52  52  LEU LEU A . n 
A 1 21  ASP 21  53  53  ASP ASP A . n 
A 1 22  ARG 22  54  54  ARG ARG A . n 
A 1 23  TYR 23  55  55  TYR TYR A . n 
A 1 24  GLN 24  56  56  GLN GLN A . n 
A 1 25  CYS 25  57  57  CYS CYS A . n 
A 1 26  ASP 26  58  58  ASP ASP A . n 
A 1 27  CYS 27  59  59  CYS CYS A . n 
A 1 28  THR 28  60  60  THR THR A . n 
A 1 29  ARG 29  61  61  ARG ARG A . n 
A 1 30  THR 30  62  62  THR THR A . n 
A 1 31  GLY 31  63  63  GLY GLY A . n 
A 1 32  TYR 32  64  64  TYR TYR A . n 
A 1 33  SER 33  65  65  SER SER A . n 
A 1 34  GLY 34  66  66  GLY GLY A . n 
A 1 35  PRO 35  67  67  PRO PRO A . n 
A 1 36  ASN 36  68  68  ASN ASN A . n 
A 1 37  CYS 37  69  69  CYS CYS A . n 
A 1 38  THR 38  70  70  THR THR A . n 
A 1 39  ILE 39  71  71  ILE ILE A . n 
A 1 40  PRO 40  72  72  PRO PRO A . n 
A 1 41  GLU 41  73  73  GLU GLU A . n 
A 1 42  ILE 42  74  74  ILE ILE A . n 
A 1 43  TRP 43  75  75  TRP TRP A . n 
A 1 44  THR 44  76  76  THR THR A . n 
A 1 45  TRP 45  77  77  TRP TRP A . n 
A 1 46  LEU 46  78  78  LEU LEU A . n 
A 1 47  ARG 47  79  79  ARG ARG A . n 
A 1 48  THR 48  80  80  THR THR A . n 
A 1 49  THR 49  81  81  THR THR A . n 
A 1 50  LEU 50  82  82  LEU LEU A . n 
A 1 51  ARG 51  83  83  ARG ARG A . n 
A 1 52  PRO 52  84  84  PRO PRO A . n 
A 1 53  SER 53  85  85  SER SER A . n 
A 1 54  PRO 54  86  86  PRO PRO A . n 
A 1 55  SER 55  87  87  SER SER A . n 
A 1 56  PHE 56  88  88  PHE PHE A . n 
A 1 57  ILE 57  89  89  ILE ILE A . n 
A 1 58  HIS 58  90  90  HIS HIS A . n 
A 1 59  PHE 59  91  91  PHE PHE A . n 
A 1 60  LEU 60  92  92  LEU LEU A . n 
A 1 61  LEU 61  93  93  LEU LEU A . n 
A 1 62  THR 62  94  94  THR THR A . n 
A 1 63  HIS 63  95  95  HIS HIS A . n 
A 1 64  GLY 64  96  96  GLY GLY A . n 
A 1 65  ARG 65  97  97  ARG ARG A . n 
A 1 66  TRP 66  98  98  TRP TRP A . n 
A 1 67  LEU 67  99  99  LEU LEU A . n 
A 1 68  TRP 68  100 100 TRP TRP A . n 
A 1 69  ASP 69  101 101 ASP ASP A . n 
A 1 70  PHE 70  102 102 PHE PHE A . n 
A 1 71  VAL 71  103 103 VAL VAL A . n 
A 1 72  ASN 72  104 104 ASN ASN A . n 
A 1 73  ALA 73  105 105 ALA ALA A . n 
A 1 74  THR 74  106 106 THR THR A . n 
A 1 75  PHE 75  107 107 PHE PHE A . n 
A 1 76  ILE 76  108 108 ILE ILE A . n 
A 1 77  ARG 77  109 109 ARG ARG A . n 
A 1 78  ASP 78  110 110 ASP ASP A . n 
A 1 79  THR 79  111 111 THR THR A . n 
A 1 80  LEU 80  112 112 LEU LEU A . n 
A 1 81  MET 81  113 113 MET MET A . n 
A 1 82  ARG 82  114 114 ARG ARG A . n 
A 1 83  LEU 83  115 115 LEU LEU A . n 
A 1 84  VAL 84  116 116 VAL VAL A . n 
A 1 85  LEU 85  117 117 LEU LEU A . n 
A 1 86  THR 86  118 118 THR THR A . n 
A 1 87  VAL 87  119 119 VAL VAL A . n 
A 1 88  ARG 88  120 120 ARG ARG A . n 
A 1 89  SER 89  121 121 SER SER A . n 
A 1 90  ASN 90  122 122 ASN ASN A . n 
A 1 91  LEU 91  123 123 LEU LEU A . n 
A 1 92  ILE 92  124 124 ILE ILE A . n 
A 1 93  PRO 93  125 125 PRO PRO A . n 
A 1 94  SER 94  126 126 SER SER A . n 
A 1 95  PRO 95  127 127 PRO PRO A . n 
A 1 96  PRO 96  128 128 PRO PRO A . n 
A 1 97  THR 97  129 129 THR THR A . n 
A 1 98  TYR 98  130 130 TYR TYR A . n 
A 1 99  ASN 99  131 131 ASN ASN A . n 
A 1 100 ILE 100 132 132 ILE ILE A . n 
A 1 101 ALA 101 133 133 ALA ALA A . n 
A 1 102 HIS 102 134 134 HIS HIS A . n 
A 1 103 ASP 103 135 135 ASP ASP A . n 
A 1 104 TYR 104 136 136 TYR TYR A . n 
A 1 105 ILE 105 137 137 ILE ILE A . n 
A 1 106 SER 106 138 138 SER SER A . n 
A 1 107 TRP 107 139 139 TRP TRP A . n 
A 1 108 GLU 108 140 140 GLU GLU A . n 
A 1 109 SER 109 141 141 SER SER A . n 
A 1 110 PHE 110 142 142 PHE PHE A . n 
A 1 111 SER 111 143 143 SER SER A . n 
A 1 112 ASN 112 144 144 ASN ASN A . n 
A 1 113 VAL 113 145 145 VAL VAL A . n 
A 1 114 SER 114 146 146 SER SER A . n 
A 1 115 TYR 115 147 147 TYR TYR A . n 
A 1 116 TYR 116 148 148 TYR TYR A . n 
A 1 117 THR 117 149 149 THR THR A . n 
A 1 118 ARG 118 150 150 ARG ARG A . n 
A 1 119 ILE 119 151 151 ILE ILE A . n 
A 1 120 LEU 120 152 152 LEU LEU A . n 
A 1 121 PRO 121 153 153 PRO PRO A . n 
A 1 122 SER 122 154 154 SER SER A . n 
A 1 123 VAL 123 155 155 VAL VAL A . n 
A 1 124 PRO 124 156 156 PRO PRO A . n 
A 1 125 ARG 125 157 157 ARG ARG A . n 
A 1 126 ASP 126 158 158 ASP ASP A . n 
A 1 127 CYS 127 159 159 CYS CYS A . n 
A 1 128 PRO 128 160 160 PRO PRO A . n 
A 1 129 THR 129 161 161 THR THR A . n 
A 1 130 PRO 130 162 162 PRO PRO A . n 
A 1 131 MET 131 163 163 MET MET A . n 
A 1 132 GLY 132 164 164 GLY GLY A . n 
A 1 133 THR 133 165 165 THR THR A . n 
A 1 134 LYS 134 166 166 LYS LYS A . n 
A 1 135 GLY 135 167 167 GLY GLY A . n 
A 1 136 LYS 136 168 168 LYS LYS A . n 
A 1 137 LYS 137 169 169 LYS LYS A . n 
A 1 138 GLN 138 170 170 GLN GLN A . n 
A 1 139 LEU 139 171 171 LEU LEU A . n 
A 1 140 PRO 140 172 172 PRO PRO A . n 
A 1 141 ASP 141 173 173 ASP ASP A . n 
A 1 142 ALA 142 174 174 ALA ALA A . n 
A 1 143 GLU 143 175 175 GLU GLU A . n 
A 1 144 PHE 144 176 176 PHE PHE A . n 
A 1 145 LEU 145 177 177 LEU LEU A . n 
A 1 146 SER 146 178 178 SER SER A . n 
A 1 147 ARG 147 179 179 ARG ARG A . n 
A 1 148 ARG 148 180 180 ARG ARG A . n 
A 1 149 PHE 149 181 181 PHE PHE A . n 
A 1 150 LEU 150 182 182 LEU LEU A . n 
A 1 151 LEU 151 183 183 LEU LEU A . n 
A 1 152 ARG 152 184 184 ARG ARG A . n 
A 1 153 ARG 153 185 185 ARG ARG A . n 
A 1 154 LYS 154 186 186 LYS LYS A . n 
A 1 155 PHE 155 187 187 PHE PHE A . n 
A 1 156 ILE 156 188 188 ILE ILE A . n 
A 1 157 PRO 157 189 189 PRO PRO A . n 
A 1 158 ASP 158 190 190 ASP ASP A . n 
A 1 159 PRO 159 191 191 PRO PRO A . n 
A 1 160 GLN 160 192 192 GLN GLN A . n 
A 1 161 GLY 161 193 193 GLY GLY A . n 
A 1 162 THR 162 194 194 THR THR A . n 
A 1 163 ASN 163 195 195 ASN ASN A . n 
A 1 164 LEU 164 196 196 LEU LEU A . n 
A 1 165 MET 165 197 197 MET MET A . n 
A 1 166 PHE 166 198 198 PHE PHE A . n 
A 1 167 ALA 167 199 199 ALA ALA A . n 
A 1 168 PHE 168 200 200 PHE PHE A . n 
A 1 169 PHE 169 201 201 PHE PHE A . n 
A 1 170 ALA 170 202 202 ALA ALA A . n 
A 1 171 GLN 171 203 203 GLN GLN A . n 
A 1 172 HIS 172 204 204 HIS HIS A . n 
A 1 173 PHE 173 205 205 PHE PHE A . n 
A 1 174 THR 174 206 206 THR THR A . n 
A 1 175 HIS 175 207 207 HIS HIS A . n 
A 1 176 GLN 176 208 208 GLN GLN A . n 
A 1 177 PHE 177 209 209 PHE PHE A . n 
A 1 178 PHE 178 210 210 PHE PHE A . n 
A 1 179 LYS 179 211 211 LYS LYS A . n 
A 1 180 THR 180 212 212 THR THR A . n 
A 1 181 SER 181 213 213 SER SER A . n 
A 1 182 GLY 182 214 214 GLY GLY A . n 
A 1 183 LYS 183 215 215 LYS LYS A . n 
A 1 184 MET 184 216 216 MET MET A . n 
A 1 185 GLY 185 217 217 GLY GLY A . n 
A 1 186 PRO 186 218 218 PRO PRO A . n 
A 1 187 GLY 187 219 219 GLY GLY A . n 
A 1 188 PHE 188 220 220 PHE PHE A . n 
A 1 189 THR 189 221 221 THR THR A . n 
A 1 190 LYS 190 222 222 LYS LYS A . n 
A 1 191 ALA 191 223 223 ALA ALA A . n 
A 1 192 LEU 192 224 224 LEU LEU A . n 
A 1 193 GLY 193 225 225 GLY GLY A . n 
A 1 194 HIS 194 226 226 HIS HIS A . n 
A 1 195 GLY 195 227 227 GLY GLY A . n 
A 1 196 VAL 196 228 228 VAL VAL A . n 
A 1 197 ASP 197 229 229 ASP ASP A . n 
A 1 198 LEU 198 230 230 LEU LEU A . n 
A 1 199 GLY 199 231 231 GLY GLY A . n 
A 1 200 HIS 200 232 232 HIS HIS A . n 
A 1 201 ILE 201 233 233 ILE ILE A . n 
A 1 202 TYR 202 234 234 TYR TYR A . n 
A 1 203 GLY 203 235 235 GLY GLY A . n 
A 1 204 ASP 204 236 236 ASP ASP A . n 
A 1 205 ASN 205 237 237 ASN ASN A . n 
A 1 206 LEU 206 238 238 LEU LEU A . n 
A 1 207 GLU 207 239 239 GLU GLU A . n 
A 1 208 ARG 208 240 240 ARG ARG A . n 
A 1 209 GLN 209 241 241 GLN GLN A . n 
A 1 210 TYR 210 242 242 TYR TYR A . n 
A 1 211 GLN 211 243 243 GLN GLN A . n 
A 1 212 LEU 212 244 244 LEU LEU A . n 
A 1 213 ARG 213 245 245 ARG ARG A . n 
A 1 214 LEU 214 246 246 LEU LEU A . n 
A 1 215 PHE 215 247 247 PHE PHE A . n 
A 1 216 LYS 216 248 248 LYS LYS A . n 
A 1 217 ASP 217 249 249 ASP ASP A . n 
A 1 218 GLY 218 250 250 GLY GLY A . n 
A 1 219 LYS 219 251 251 LYS LYS A . n 
A 1 220 LEU 220 252 252 LEU LEU A . n 
A 1 221 LYS 221 253 253 LYS LYS A . n 
A 1 222 TYR 222 254 254 TYR TYR A . n 
A 1 223 GLN 223 255 255 GLN GLN A . n 
A 1 224 MET 224 256 256 MET MET A . n 
A 1 225 LEU 225 257 257 LEU LEU A . n 
A 1 226 ASN 226 258 258 ASN ASN A . n 
A 1 227 GLY 227 259 259 GLY GLY A . n 
A 1 228 GLU 228 260 260 GLU GLU A . n 
A 1 229 VAL 229 261 261 VAL VAL A . n 
A 1 230 TYR 230 262 262 TYR TYR A . n 
A 1 231 PRO 231 263 263 PRO PRO A . n 
A 1 232 PRO 232 264 264 PRO PRO A . n 
A 1 233 SER 233 265 265 SER SER A . n 
A 1 234 VAL 234 266 266 VAL VAL A . n 
A 1 235 GLU 235 267 267 GLU GLU A . n 
A 1 236 GLU 236 268 268 GLU GLU A . n 
A 1 237 ALA 237 269 269 ALA ALA A . n 
A 1 238 PRO 238 270 270 PRO PRO A . n 
A 1 239 VAL 239 271 271 VAL VAL A . n 
A 1 240 LEU 240 272 272 LEU LEU A . n 
A 1 241 MET 241 273 273 MET MET A . n 
A 1 242 HIS 242 274 274 HIS HIS A . n 
A 1 243 TYR 243 275 275 TYR TYR A . n 
A 1 244 PRO 244 276 276 PRO PRO A . n 
A 1 245 ARG 245 277 277 ARG ARG A . n 
A 1 246 GLY 246 278 278 GLY GLY A . n 
A 1 247 ILE 247 279 279 ILE ILE A . n 
A 1 248 PRO 248 280 280 PRO PRO A . n 
A 1 249 PRO 249 281 281 PRO PRO A . n 
A 1 250 GLN 250 282 282 GLN GLN A . n 
A 1 251 SER 251 283 283 SER SER A . n 
A 1 252 GLN 252 284 284 GLN GLN A . n 
A 1 253 MET 253 285 285 MET MET A . n 
A 1 254 ALA 254 286 286 ALA ALA A . n 
A 1 255 VAL 255 287 287 VAL VAL A . n 
A 1 256 GLY 256 288 288 GLY GLY A . n 
A 1 257 GLN 257 289 289 GLN GLN A . n 
A 1 258 GLU 258 290 290 GLU GLU A . n 
A 1 259 VAL 259 291 291 VAL VAL A . n 
A 1 260 PHE 260 292 292 PHE PHE A . n 
A 1 261 GLY 261 293 293 GLY GLY A . n 
A 1 262 LEU 262 294 294 LEU LEU A . n 
A 1 263 LEU 263 295 295 LEU LEU A . n 
A 1 264 PRO 264 296 296 PRO PRO A . n 
A 1 265 GLY 265 297 297 GLY GLY A . n 
A 1 266 LEU 266 298 298 LEU LEU A . n 
A 1 267 MET 267 299 299 MET MET A . n 
A 1 268 LEU 268 300 300 LEU LEU A . n 
A 1 269 TYR 269 301 301 TYR TYR A . n 
A 1 270 ALA 270 302 302 ALA ALA A . n 
A 1 271 THR 271 303 303 THR THR A . n 
A 1 272 ILE 272 304 304 ILE ILE A . n 
A 1 273 TRP 273 305 305 TRP TRP A . n 
A 1 274 LEU 274 306 306 LEU LEU A . n 
A 1 275 ARG 275 307 307 ARG ARG A . n 
A 1 276 GLU 276 308 308 GLU GLU A . n 
A 1 277 HIS 277 309 309 HIS HIS A . n 
A 1 278 GLN 278 310 310 GLN GLN A . n 
A 1 279 ARG 279 311 311 ARG ARG A . n 
A 1 280 VAL 280 312 312 VAL VAL A . n 
A 1 281 CYS 281 313 313 CYS CYS A . n 
A 1 282 ASP 282 314 314 ASP ASP A . n 
A 1 283 LEU 283 315 315 LEU LEU A . n 
A 1 284 LEU 284 316 316 LEU LEU A . n 
A 1 285 LYS 285 317 317 LYS LYS A . n 
A 1 286 ALA 286 318 318 ALA ALA A . n 
A 1 287 GLU 287 319 319 GLU GLU A . n 
A 1 288 HIS 288 320 320 HIS HIS A . n 
A 1 289 PRO 289 321 321 PRO PRO A . n 
A 1 290 THR 290 322 322 THR THR A . n 
A 1 291 TRP 291 323 323 TRP TRP A . n 
A 1 292 GLY 292 324 324 GLY GLY A . n 
A 1 293 ASP 293 325 325 ASP ASP A . n 
A 1 294 GLU 294 326 326 GLU GLU A . n 
A 1 295 GLN 295 327 327 GLN GLN A . n 
A 1 296 LEU 296 328 328 LEU LEU A . n 
A 1 297 PHE 297 329 329 PHE PHE A . n 
A 1 298 GLN 298 330 330 GLN GLN A . n 
A 1 299 THR 299 331 331 THR THR A . n 
A 1 300 ALA 300 332 332 ALA ALA A . n 
A 1 301 LYS 301 333 333 LYS LYS A . n 
A 1 302 LEU 302 334 334 LEU LEU A . n 
A 1 303 ILE 303 335 335 ILE ILE A . n 
A 1 304 LEU 304 336 336 LEU LEU A . n 
A 1 305 ILE 305 337 337 ILE ILE A . n 
A 1 306 GLY 306 338 338 GLY GLY A . n 
A 1 307 GLU 307 339 339 GLU GLU A . n 
A 1 308 THR 308 340 340 THR THR A . n 
A 1 309 ILE 309 341 341 ILE ILE A . n 
A 1 310 LYS 310 342 342 LYS LYS A . n 
A 1 311 ILE 311 343 343 ILE ILE A . n 
A 1 312 VAL 312 344 344 VAL VAL A . n 
A 1 313 ILE 313 345 345 ILE ILE A . n 
A 1 314 GLU 314 346 346 GLU GLU A . n 
A 1 315 GLU 315 347 347 GLU GLU A . n 
A 1 316 TYR 316 348 348 TYR TYR A . n 
A 1 317 VAL 317 349 349 VAL VAL A . n 
A 1 318 GLN 318 350 350 GLN GLN A . n 
A 1 319 GLN 319 351 351 GLN GLN A . n 
A 1 320 LEU 320 352 352 LEU LEU A . n 
A 1 321 SER 321 353 353 SER SER A . n 
A 1 322 GLY 322 354 354 GLY GLY A . n 
A 1 323 TYR 323 355 355 TYR TYR A . n 
A 1 324 PHE 324 356 356 PHE PHE A . n 
A 1 325 LEU 325 357 357 LEU LEU A . n 
A 1 326 GLN 326 358 358 GLN GLN A . n 
A 1 327 LEU 327 359 359 LEU LEU A . n 
A 1 328 LYS 328 360 360 LYS LYS A . n 
A 1 329 PHE 329 361 361 PHE PHE A . n 
A 1 330 ASP 330 362 362 ASP ASP A . n 
A 1 331 PRO 331 363 363 PRO PRO A . n 
A 1 332 GLU 332 364 364 GLU GLU A . n 
A 1 333 LEU 333 365 365 LEU LEU A . n 
A 1 334 LEU 334 366 366 LEU LEU A . n 
A 1 335 PHE 335 367 367 PHE PHE A . n 
A 1 336 GLY 336 368 368 GLY GLY A . n 
A 1 337 ALA 337 369 369 ALA ALA A . n 
A 1 338 GLN 338 370 370 GLN GLN A . n 
A 1 339 PHE 339 371 371 PHE PHE A . n 
A 1 340 GLN 340 372 372 GLN GLN A . n 
A 1 341 TYR 341 373 373 TYR TYR A . n 
A 1 342 ARG 342 374 374 ARG ARG A . n 
A 1 343 ASN 343 375 375 ASN ASN A . n 
A 1 344 ARG 344 376 376 ARG ARG A . n 
A 1 345 ILE 345 377 377 ILE ILE A . n 
A 1 346 ALA 346 378 378 ALA ALA A . n 
A 1 347 MET 347 379 379 MET MET A . n 
A 1 348 GLU 348 380 380 GLU GLU A . n 
A 1 349 PHE 349 381 381 PHE PHE A . n 
A 1 350 ASN 350 382 382 ASN ASN A . n 
A 1 351 GLN 351 383 383 GLN GLN A . n 
A 1 352 LEU 352 384 384 LEU LEU A . n 
A 1 353 TYR 353 385 385 TYR TYR A . n 
A 1 354 HIS 354 386 386 HIS HIS A . n 
A 1 355 TRP 355 387 387 TRP TRP A . n 
A 1 356 HIS 356 388 388 HIS HIS A . n 
A 1 357 PRO 357 389 389 PRO PRO A . n 
A 1 358 LEU 358 390 390 LEU LEU A . n 
A 1 359 MET 359 391 391 MET MET A . n 
A 1 360 PRO 360 392 392 PRO PRO A . n 
A 1 361 ASP 361 393 393 ASP ASP A . n 
A 1 362 SER 362 394 394 SER SER A . n 
A 1 363 PHE 363 395 395 PHE PHE A . n 
A 1 364 ARG 364 396 396 ARG ARG A . n 
A 1 365 VAL 365 397 397 VAL VAL A . n 
A 1 366 GLY 366 398 398 GLY GLY A . n 
A 1 367 PRO 367 399 399 PRO PRO A . n 
A 1 368 GLN 368 400 400 GLN GLN A . n 
A 1 369 ASP 369 401 401 ASP ASP A . n 
A 1 370 TYR 370 402 402 TYR TYR A . n 
A 1 371 SER 371 403 403 SER SER A . n 
A 1 372 TYR 372 404 404 TYR TYR A . n 
A 1 373 GLU 373 405 405 GLU GLU A . n 
A 1 374 GLN 374 406 406 GLN GLN A . n 
A 1 375 PHE 375 407 407 PHE PHE A . n 
A 1 376 LEU 376 408 408 LEU LEU A . n 
A 1 377 PHE 377 409 409 PHE PHE A . n 
A 1 378 ASN 378 410 410 ASN ASN A . n 
A 1 379 THR 379 411 411 THR THR A . n 
A 1 380 SER 380 412 412 SER SER A . n 
A 1 381 MET 381 413 413 MET MET A . n 
A 1 382 LEU 382 414 414 LEU LEU A . n 
A 1 383 VAL 383 415 415 VAL VAL A . n 
A 1 384 ASP 384 416 416 ASP ASP A . n 
A 1 385 TYR 385 417 417 TYR TYR A . n 
A 1 386 GLY 386 418 418 GLY GLY A . n 
A 1 387 VAL 387 419 419 VAL VAL A . n 
A 1 388 GLU 388 420 420 GLU GLU A . n 
A 1 389 ALA 389 421 421 ALA ALA A . n 
A 1 390 LEU 390 422 422 LEU LEU A . n 
A 1 391 VAL 391 423 423 VAL VAL A . n 
A 1 392 ASP 392 424 424 ASP ASP A . n 
A 1 393 ALA 393 425 425 ALA ALA A . n 
A 1 394 PHE 394 426 426 PHE PHE A . n 
A 1 395 SER 395 427 427 SER SER A . n 
A 1 396 ARG 396 428 428 ARG ARG A . n 
A 1 397 GLN 397 429 429 GLN GLN A . n 
A 1 398 PRO 398 430 430 PRO PRO A . n 
A 1 399 ALA 399 431 431 ALA ALA A . n 
A 1 400 GLY 400 432 432 GLY GLY A . n 
A 1 401 ARG 401 433 433 ARG ARG A . n 
A 1 402 ILE 402 434 434 ILE ILE A . n 
A 1 403 GLY 403 435 435 GLY GLY A . n 
A 1 404 GLY 404 436 436 GLY GLY A . n 
A 1 405 GLY 405 437 437 GLY GLY A . n 
A 1 406 ARG 406 438 438 ARG ARG A . n 
A 1 407 ASN 407 439 439 ASN ASN A . n 
A 1 408 ILE 408 440 440 ILE ILE A . n 
A 1 409 ASP 409 441 441 ASP ASP A . n 
A 1 410 HIS 410 442 442 HIS HIS A . n 
A 1 411 HIS 411 443 443 HIS HIS A . n 
A 1 412 ILE 412 444 444 ILE ILE A . n 
A 1 413 LEU 413 445 445 LEU LEU A . n 
A 1 414 HIS 414 446 446 HIS HIS A . n 
A 1 415 VAL 415 447 447 VAL VAL A . n 
A 1 416 ALA 416 448 448 ALA ALA A . n 
A 1 417 VAL 417 449 449 VAL VAL A . n 
A 1 418 ASP 418 450 450 ASP ASP A . n 
A 1 419 VAL 419 451 451 VAL VAL A . n 
A 1 420 ILE 420 452 452 ILE ILE A . n 
A 1 421 LYS 421 453 453 LYS LYS A . n 
A 1 422 GLU 422 454 454 GLU GLU A . n 
A 1 423 SER 423 455 455 SER SER A . n 
A 1 424 ARG 424 456 456 ARG ARG A . n 
A 1 425 VAL 425 457 457 VAL VAL A . n 
A 1 426 LEU 426 458 458 LEU LEU A . n 
A 1 427 ARG 427 459 459 ARG ARG A . n 
A 1 428 LEU 428 460 460 LEU LEU A . n 
A 1 429 GLN 429 461 461 GLN GLN A . n 
A 1 430 PRO 430 462 462 PRO PRO A . n 
A 1 431 PHE 431 463 463 PHE PHE A . n 
A 1 432 ASN 432 464 464 ASN ASN A . n 
A 1 433 GLU 433 465 465 GLU GLU A . n 
A 1 434 TYR 434 466 466 TYR TYR A . n 
A 1 435 ARG 435 467 467 ARG ARG A . n 
A 1 436 LYS 436 468 468 LYS LYS A . n 
A 1 437 ARG 437 469 469 ARG ARG A . n 
A 1 438 PHE 438 470 470 PHE PHE A . n 
A 1 439 GLY 439 471 471 GLY GLY A . n 
A 1 440 MET 440 472 472 MET MET A . n 
A 1 441 LYS 441 473 473 LYS LYS A . n 
A 1 442 PRO 442 474 474 PRO PRO A . n 
A 1 443 TYR 443 475 475 TYR TYR A . n 
A 1 444 THR 444 476 476 THR THR A . n 
A 1 445 SER 445 477 477 SER SER A . n 
A 1 446 PHE 446 478 478 PHE PHE A . n 
A 1 447 GLN 447 479 479 GLN GLN A . n 
A 1 448 GLU 448 480 480 GLU GLU A . n 
A 1 449 LEU 449 481 481 LEU LEU A . n 
A 1 450 THR 450 482 482 THR THR A . n 
A 1 451 GLY 451 483 483 GLY GLY A . n 
A 1 452 GLU 452 484 484 GLU GLU A . n 
A 1 453 LYS 453 485 485 LYS LYS A . n 
A 1 454 GLU 454 486 486 GLU GLU A . n 
A 1 455 MET 455 487 487 MET MET A . n 
A 1 456 ALA 456 488 488 ALA ALA A . n 
A 1 457 ALA 457 489 489 ALA ALA A . n 
A 1 458 GLU 458 490 490 GLU GLU A . n 
A 1 459 LEU 459 491 491 LEU LEU A . n 
A 1 460 GLU 460 492 492 GLU GLU A . n 
A 1 461 GLU 461 493 493 GLU GLU A . n 
A 1 462 LEU 462 494 494 LEU LEU A . n 
A 1 463 TYR 463 495 495 TYR TYR A . n 
A 1 464 GLY 464 496 496 GLY GLY A . n 
A 1 465 ASP 465 497 497 ASP ASP A . n 
A 1 466 ILE 466 498 498 ILE ILE A . n 
A 1 467 ASP 467 499 499 ASP ASP A . n 
A 1 468 ALA 468 500 500 ALA ALA A . n 
A 1 469 LEU 469 501 501 LEU LEU A . n 
A 1 470 GLU 470 502 502 GLU GLU A . n 
A 1 471 PHE 471 503 503 PHE PHE A . n 
A 1 472 TYR 472 504 504 TYR TYR A . n 
A 1 473 PRO 473 505 505 PRO PRO A . n 
A 1 474 GLY 474 506 506 GLY GLY A . n 
A 1 475 LEU 475 507 507 LEU LEU A . n 
A 1 476 LEU 476 508 508 LEU LEU A . n 
A 1 477 LEU 477 509 509 LEU LEU A . n 
A 1 478 GLU 478 510 510 GLU GLU A . n 
A 1 479 LYS 479 511 511 LYS LYS A . n 
A 1 480 CYS 480 512 512 CYS CYS A . n 
A 1 481 HIS 481 513 513 HIS HIS A . n 
A 1 482 PRO 482 514 514 PRO PRO A . n 
A 1 483 ASN 483 515 515 ASN ASN A . n 
A 1 484 SER 484 516 516 SER SER A . n 
A 1 485 ILE 485 517 517 ILE ILE A . n 
A 1 486 PHE 486 518 518 PHE PHE A . n 
A 1 487 GLY 487 519 519 GLY GLY A . n 
A 1 488 GLU 488 520 520 GLU GLU A . n 
A 1 489 SER 489 521 521 SER SER A . n 
A 1 490 MET 490 522 522 MET MET A . n 
A 1 491 ILE 491 523 523 ILE ILE A . n 
A 1 492 GLU 492 524 524 GLU GLU A . n 
A 1 493 MET 493 525 525 MET MET A . n 
A 1 494 GLY 494 526 526 GLY GLY A . n 
A 1 495 ALA 495 527 527 ALA ALA A . n 
A 1 496 PRO 496 528 528 PRO PRO A . n 
A 1 497 PHE 497 529 529 PHE PHE A . n 
A 1 498 SER 498 530 530 SER SER A . n 
A 1 499 LEU 499 531 531 LEU LEU A . n 
A 1 500 LYS 500 532 532 LYS LYS A . n 
A 1 501 GLY 501 533 533 GLY GLY A . n 
A 1 502 LEU 502 534 534 LEU LEU A . n 
A 1 503 LEU 503 535 535 LEU LEU A . n 
A 1 504 GLY 504 536 536 GLY GLY A . n 
A 1 505 ASN 505 537 537 ASN ASN A . n 
A 1 506 PRO 506 538 538 PRO PRO A . n 
A 1 507 ILE 507 539 539 ILE ILE A . n 
A 1 508 CYS 508 540 540 CYS CYS A . n 
A 1 509 SER 509 541 541 SER SER A . n 
A 1 510 PRO 510 542 542 PRO PRO A . n 
A 1 511 GLU 511 543 543 GLU GLU A . n 
A 1 512 TYR 512 544 544 TYR TYR A . n 
A 1 513 TRP 513 545 545 TRP TRP A . n 
A 1 514 LYS 514 546 546 LYS LYS A . n 
A 1 515 ALA 515 547 547 ALA ALA A . n 
A 1 516 SER 516 548 548 SER SER A . n 
A 1 517 THR 517 549 549 THR THR A . n 
A 1 518 PHE 518 550 550 PHE PHE A . n 
A 1 519 GLY 519 551 551 GLY GLY A . n 
A 1 520 GLY 520 552 552 GLY GLY A . n 
A 1 521 GLU 521 553 553 GLU GLU A . n 
A 1 522 VAL 522 554 554 VAL VAL A . n 
A 1 523 GLY 523 555 555 GLY GLY A . n 
A 1 524 PHE 524 556 556 PHE PHE A . n 
A 1 525 ASN 525 557 557 ASN ASN A . n 
A 1 526 LEU 526 558 558 LEU LEU A . n 
A 1 527 VAL 527 559 559 VAL VAL A . n 
A 1 528 LYS 528 560 560 LYS LYS A . n 
A 1 529 THR 529 561 561 THR THR A . n 
A 1 530 ALA 530 562 562 ALA ALA A . n 
A 1 531 THR 531 563 563 THR THR A . n 
A 1 532 LEU 532 564 564 LEU LEU A . n 
A 1 533 LYS 533 565 565 LYS LYS A . n 
A 1 534 LYS 534 566 566 LYS LYS A . n 
A 1 535 LEU 535 567 567 LEU LEU A . n 
A 1 536 VAL 536 568 568 VAL VAL A . n 
A 1 537 CYS 537 569 569 CYS CYS A . n 
A 1 538 LEU 538 570 570 LEU LEU A . n 
A 1 539 ASN 539 571 571 ASN ASN A . n 
A 1 540 THR 540 572 572 THR THR A . n 
A 1 541 LYS 541 573 573 LYS LYS A . n 
A 1 542 THR 542 574 574 THR THR A . n 
A 1 543 CYS 543 575 575 CYS CYS A . n 
A 1 544 PRO 544 576 576 PRO PRO A . n 
A 1 545 TYR 545 577 577 TYR TYR A . n 
A 1 546 VAL 546 578 578 VAL VAL A . n 
A 1 547 SER 547 579 579 SER SER A . n 
A 1 548 PHE 548 580 580 PHE PHE A . n 
A 1 549 HIS 549 581 581 HIS HIS A . n 
A 1 550 VAL 550 582 582 VAL VAL A . n 
A 1 551 PRO 551 583 583 PRO PRO A . n 
A 1 552 ASP 552 584 584 ASP ASP A . n 
A 1 553 PRO 553 585 585 PRO PRO A . n 
A 1 554 ARG 554 586 586 ARG ARG A . n 
B 1 1   VAL 1   33  33  VAL VAL B . n 
B 1 2   ASN 2   34  34  ASN ASN B . n 
B 1 3   PRO 3   35  35  PRO PRO B . n 
B 1 4   CYS 4   36  36  CYS CYS B . n 
B 1 5   CYS 5   37  37  CYS CYS B . n 
B 1 6   TYR 6   38  38  TYR TYR B . n 
B 1 7   TYR 7   39  39  TYR TYR B . n 
B 1 8   PRO 8   40  40  PRO PRO B . n 
B 1 9   CYS 9   41  41  CYS CYS B . n 
B 1 10  GLN 10  42  42  GLN GLN B . n 
B 1 11  HIS 11  43  43  HIS HIS B . n 
B 1 12  GLN 12  44  44  GLN GLN B . n 
B 1 13  GLY 13  45  45  GLY GLY B . n 
B 1 14  ILE 14  46  46  ILE ILE B . n 
B 1 15  CYS 15  47  47  CYS CYS B . n 
B 1 16  VAL 16  48  48  VAL VAL B . n 
B 1 17  ARG 17  49  49  ARG ARG B . n 
B 1 18  PHE 18  50  50  PHE PHE B . n 
B 1 19  GLY 19  51  51  GLY GLY B . n 
B 1 20  LEU 20  52  52  LEU LEU B . n 
B 1 21  ASP 21  53  53  ASP ASP B . n 
B 1 22  ARG 22  54  54  ARG ARG B . n 
B 1 23  TYR 23  55  55  TYR TYR B . n 
B 1 24  GLN 24  56  56  GLN GLN B . n 
B 1 25  CYS 25  57  57  CYS CYS B . n 
B 1 26  ASP 26  58  58  ASP ASP B . n 
B 1 27  CYS 27  59  59  CYS CYS B . n 
B 1 28  THR 28  60  60  THR THR B . n 
B 1 29  ARG 29  61  61  ARG ARG B . n 
B 1 30  THR 30  62  62  THR THR B . n 
B 1 31  GLY 31  63  63  GLY GLY B . n 
B 1 32  TYR 32  64  64  TYR TYR B . n 
B 1 33  SER 33  65  65  SER SER B . n 
B 1 34  GLY 34  66  66  GLY GLY B . n 
B 1 35  PRO 35  67  67  PRO PRO B . n 
B 1 36  ASN 36  68  68  ASN ASN B . n 
B 1 37  CYS 37  69  69  CYS CYS B . n 
B 1 38  THR 38  70  70  THR THR B . n 
B 1 39  ILE 39  71  71  ILE ILE B . n 
B 1 40  PRO 40  72  72  PRO PRO B . n 
B 1 41  GLU 41  73  73  GLU GLU B . n 
B 1 42  ILE 42  74  74  ILE ILE B . n 
B 1 43  TRP 43  75  75  TRP TRP B . n 
B 1 44  THR 44  76  76  THR THR B . n 
B 1 45  TRP 45  77  77  TRP TRP B . n 
B 1 46  LEU 46  78  78  LEU LEU B . n 
B 1 47  ARG 47  79  79  ARG ARG B . n 
B 1 48  THR 48  80  80  THR THR B . n 
B 1 49  THR 49  81  81  THR THR B . n 
B 1 50  LEU 50  82  82  LEU LEU B . n 
B 1 51  ARG 51  83  83  ARG ARG B . n 
B 1 52  PRO 52  84  84  PRO PRO B . n 
B 1 53  SER 53  85  85  SER SER B . n 
B 1 54  PRO 54  86  86  PRO PRO B . n 
B 1 55  SER 55  87  87  SER SER B . n 
B 1 56  PHE 56  88  88  PHE PHE B . n 
B 1 57  ILE 57  89  89  ILE ILE B . n 
B 1 58  HIS 58  90  90  HIS HIS B . n 
B 1 59  PHE 59  91  91  PHE PHE B . n 
B 1 60  LEU 60  92  92  LEU LEU B . n 
B 1 61  LEU 61  93  93  LEU LEU B . n 
B 1 62  THR 62  94  94  THR THR B . n 
B 1 63  HIS 63  95  95  HIS HIS B . n 
B 1 64  GLY 64  96  96  GLY GLY B . n 
B 1 65  ARG 65  97  97  ARG ARG B . n 
B 1 66  TRP 66  98  98  TRP TRP B . n 
B 1 67  LEU 67  99  99  LEU LEU B . n 
B 1 68  TRP 68  100 100 TRP TRP B . n 
B 1 69  ASP 69  101 101 ASP ASP B . n 
B 1 70  PHE 70  102 102 PHE PHE B . n 
B 1 71  VAL 71  103 103 VAL VAL B . n 
B 1 72  ASN 72  104 104 ASN ASN B . n 
B 1 73  ALA 73  105 105 ALA ALA B . n 
B 1 74  THR 74  106 106 THR THR B . n 
B 1 75  PHE 75  107 107 PHE PHE B . n 
B 1 76  ILE 76  108 108 ILE ILE B . n 
B 1 77  ARG 77  109 109 ARG ARG B . n 
B 1 78  ASP 78  110 110 ASP ASP B . n 
B 1 79  THR 79  111 111 THR THR B . n 
B 1 80  LEU 80  112 112 LEU LEU B . n 
B 1 81  MET 81  113 113 MET MET B . n 
B 1 82  ARG 82  114 114 ARG ARG B . n 
B 1 83  LEU 83  115 115 LEU LEU B . n 
B 1 84  VAL 84  116 116 VAL VAL B . n 
B 1 85  LEU 85  117 117 LEU LEU B . n 
B 1 86  THR 86  118 118 THR THR B . n 
B 1 87  VAL 87  119 119 VAL VAL B . n 
B 1 88  ARG 88  120 120 ARG ARG B . n 
B 1 89  SER 89  121 121 SER SER B . n 
B 1 90  ASN 90  122 122 ASN ASN B . n 
B 1 91  LEU 91  123 123 LEU LEU B . n 
B 1 92  ILE 92  124 124 ILE ILE B . n 
B 1 93  PRO 93  125 125 PRO PRO B . n 
B 1 94  SER 94  126 126 SER SER B . n 
B 1 95  PRO 95  127 127 PRO PRO B . n 
B 1 96  PRO 96  128 128 PRO PRO B . n 
B 1 97  THR 97  129 129 THR THR B . n 
B 1 98  TYR 98  130 130 TYR TYR B . n 
B 1 99  ASN 99  131 131 ASN ASN B . n 
B 1 100 ILE 100 132 132 ILE ILE B . n 
B 1 101 ALA 101 133 133 ALA ALA B . n 
B 1 102 HIS 102 134 134 HIS HIS B . n 
B 1 103 ASP 103 135 135 ASP ASP B . n 
B 1 104 TYR 104 136 136 TYR TYR B . n 
B 1 105 ILE 105 137 137 ILE ILE B . n 
B 1 106 SER 106 138 138 SER SER B . n 
B 1 107 TRP 107 139 139 TRP TRP B . n 
B 1 108 GLU 108 140 140 GLU GLU B . n 
B 1 109 SER 109 141 141 SER SER B . n 
B 1 110 PHE 110 142 142 PHE PHE B . n 
B 1 111 SER 111 143 143 SER SER B . n 
B 1 112 ASN 112 144 144 ASN ASN B . n 
B 1 113 VAL 113 145 145 VAL VAL B . n 
B 1 114 SER 114 146 146 SER SER B . n 
B 1 115 TYR 115 147 147 TYR TYR B . n 
B 1 116 TYR 116 148 148 TYR TYR B . n 
B 1 117 THR 117 149 149 THR THR B . n 
B 1 118 ARG 118 150 150 ARG ARG B . n 
B 1 119 ILE 119 151 151 ILE ILE B . n 
B 1 120 LEU 120 152 152 LEU LEU B . n 
B 1 121 PRO 121 153 153 PRO PRO B . n 
B 1 122 SER 122 154 154 SER SER B . n 
B 1 123 VAL 123 155 155 VAL VAL B . n 
B 1 124 PRO 124 156 156 PRO PRO B . n 
B 1 125 ARG 125 157 157 ARG ARG B . n 
B 1 126 ASP 126 158 158 ASP ASP B . n 
B 1 127 CYS 127 159 159 CYS CYS B . n 
B 1 128 PRO 128 160 160 PRO PRO B . n 
B 1 129 THR 129 161 161 THR THR B . n 
B 1 130 PRO 130 162 162 PRO PRO B . n 
B 1 131 MET 131 163 163 MET MET B . n 
B 1 132 GLY 132 164 164 GLY GLY B . n 
B 1 133 THR 133 165 165 THR THR B . n 
B 1 134 LYS 134 166 166 LYS LYS B . n 
B 1 135 GLY 135 167 167 GLY GLY B . n 
B 1 136 LYS 136 168 168 LYS LYS B . n 
B 1 137 LYS 137 169 169 LYS LYS B . n 
B 1 138 GLN 138 170 170 GLN GLN B . n 
B 1 139 LEU 139 171 171 LEU LEU B . n 
B 1 140 PRO 140 172 172 PRO PRO B . n 
B 1 141 ASP 141 173 173 ASP ASP B . n 
B 1 142 ALA 142 174 174 ALA ALA B . n 
B 1 143 GLU 143 175 175 GLU GLU B . n 
B 1 144 PHE 144 176 176 PHE PHE B . n 
B 1 145 LEU 145 177 177 LEU LEU B . n 
B 1 146 SER 146 178 178 SER SER B . n 
B 1 147 ARG 147 179 179 ARG ARG B . n 
B 1 148 ARG 148 180 180 ARG ARG B . n 
B 1 149 PHE 149 181 181 PHE PHE B . n 
B 1 150 LEU 150 182 182 LEU LEU B . n 
B 1 151 LEU 151 183 183 LEU LEU B . n 
B 1 152 ARG 152 184 184 ARG ARG B . n 
B 1 153 ARG 153 185 185 ARG ARG B . n 
B 1 154 LYS 154 186 186 LYS LYS B . n 
B 1 155 PHE 155 187 187 PHE PHE B . n 
B 1 156 ILE 156 188 188 ILE ILE B . n 
B 1 157 PRO 157 189 189 PRO PRO B . n 
B 1 158 ASP 158 190 190 ASP ASP B . n 
B 1 159 PRO 159 191 191 PRO PRO B . n 
B 1 160 GLN 160 192 192 GLN GLN B . n 
B 1 161 GLY 161 193 193 GLY GLY B . n 
B 1 162 THR 162 194 194 THR THR B . n 
B 1 163 ASN 163 195 195 ASN ASN B . n 
B 1 164 LEU 164 196 196 LEU LEU B . n 
B 1 165 MET 165 197 197 MET MET B . n 
B 1 166 PHE 166 198 198 PHE PHE B . n 
B 1 167 ALA 167 199 199 ALA ALA B . n 
B 1 168 PHE 168 200 200 PHE PHE B . n 
B 1 169 PHE 169 201 201 PHE PHE B . n 
B 1 170 ALA 170 202 202 ALA ALA B . n 
B 1 171 GLN 171 203 203 GLN GLN B . n 
B 1 172 HIS 172 204 204 HIS HIS B . n 
B 1 173 PHE 173 205 205 PHE PHE B . n 
B 1 174 THR 174 206 206 THR THR B . n 
B 1 175 HIS 175 207 207 HIS HIS B . n 
B 1 176 GLN 176 208 208 GLN GLN B . n 
B 1 177 PHE 177 209 209 PHE PHE B . n 
B 1 178 PHE 178 210 210 PHE PHE B . n 
B 1 179 LYS 179 211 211 LYS LYS B . n 
B 1 180 THR 180 212 212 THR THR B . n 
B 1 181 SER 181 213 213 SER SER B . n 
B 1 182 GLY 182 214 214 GLY GLY B . n 
B 1 183 LYS 183 215 215 LYS LYS B . n 
B 1 184 MET 184 216 216 MET MET B . n 
B 1 185 GLY 185 217 217 GLY GLY B . n 
B 1 186 PRO 186 218 218 PRO PRO B . n 
B 1 187 GLY 187 219 219 GLY GLY B . n 
B 1 188 PHE 188 220 220 PHE PHE B . n 
B 1 189 THR 189 221 221 THR THR B . n 
B 1 190 LYS 190 222 222 LYS LYS B . n 
B 1 191 ALA 191 223 223 ALA ALA B . n 
B 1 192 LEU 192 224 224 LEU LEU B . n 
B 1 193 GLY 193 225 225 GLY GLY B . n 
B 1 194 HIS 194 226 226 HIS HIS B . n 
B 1 195 GLY 195 227 227 GLY GLY B . n 
B 1 196 VAL 196 228 228 VAL VAL B . n 
B 1 197 ASP 197 229 229 ASP ASP B . n 
B 1 198 LEU 198 230 230 LEU LEU B . n 
B 1 199 GLY 199 231 231 GLY GLY B . n 
B 1 200 HIS 200 232 232 HIS HIS B . n 
B 1 201 ILE 201 233 233 ILE ILE B . n 
B 1 202 TYR 202 234 234 TYR TYR B . n 
B 1 203 GLY 203 235 235 GLY GLY B . n 
B 1 204 ASP 204 236 236 ASP ASP B . n 
B 1 205 ASN 205 237 237 ASN ASN B . n 
B 1 206 LEU 206 238 238 LEU LEU B . n 
B 1 207 GLU 207 239 239 GLU GLU B . n 
B 1 208 ARG 208 240 240 ARG ARG B . n 
B 1 209 GLN 209 241 241 GLN GLN B . n 
B 1 210 TYR 210 242 242 TYR TYR B . n 
B 1 211 GLN 211 243 243 GLN GLN B . n 
B 1 212 LEU 212 244 244 LEU LEU B . n 
B 1 213 ARG 213 245 245 ARG ARG B . n 
B 1 214 LEU 214 246 246 LEU LEU B . n 
B 1 215 PHE 215 247 247 PHE PHE B . n 
B 1 216 LYS 216 248 248 LYS LYS B . n 
B 1 217 ASP 217 249 249 ASP ASP B . n 
B 1 218 GLY 218 250 250 GLY GLY B . n 
B 1 219 LYS 219 251 251 LYS LYS B . n 
B 1 220 LEU 220 252 252 LEU LEU B . n 
B 1 221 LYS 221 253 253 LYS LYS B . n 
B 1 222 TYR 222 254 254 TYR TYR B . n 
B 1 223 GLN 223 255 255 GLN GLN B . n 
B 1 224 MET 224 256 256 MET MET B . n 
B 1 225 LEU 225 257 257 LEU LEU B . n 
B 1 226 ASN 226 258 258 ASN ASN B . n 
B 1 227 GLY 227 259 259 GLY GLY B . n 
B 1 228 GLU 228 260 260 GLU GLU B . n 
B 1 229 VAL 229 261 261 VAL VAL B . n 
B 1 230 TYR 230 262 262 TYR TYR B . n 
B 1 231 PRO 231 263 263 PRO PRO B . n 
B 1 232 PRO 232 264 264 PRO PRO B . n 
B 1 233 SER 233 265 265 SER SER B . n 
B 1 234 VAL 234 266 266 VAL VAL B . n 
B 1 235 GLU 235 267 267 GLU GLU B . n 
B 1 236 GLU 236 268 268 GLU GLU B . n 
B 1 237 ALA 237 269 269 ALA ALA B . n 
B 1 238 PRO 238 270 270 PRO PRO B . n 
B 1 239 VAL 239 271 271 VAL VAL B . n 
B 1 240 LEU 240 272 272 LEU LEU B . n 
B 1 241 MET 241 273 273 MET MET B . n 
B 1 242 HIS 242 274 274 HIS HIS B . n 
B 1 243 TYR 243 275 275 TYR TYR B . n 
B 1 244 PRO 244 276 276 PRO PRO B . n 
B 1 245 ARG 245 277 277 ARG ARG B . n 
B 1 246 GLY 246 278 278 GLY GLY B . n 
B 1 247 ILE 247 279 279 ILE ILE B . n 
B 1 248 PRO 248 280 280 PRO PRO B . n 
B 1 249 PRO 249 281 281 PRO PRO B . n 
B 1 250 GLN 250 282 282 GLN GLN B . n 
B 1 251 SER 251 283 283 SER SER B . n 
B 1 252 GLN 252 284 284 GLN GLN B . n 
B 1 253 MET 253 285 285 MET MET B . n 
B 1 254 ALA 254 286 286 ALA ALA B . n 
B 1 255 VAL 255 287 287 VAL VAL B . n 
B 1 256 GLY 256 288 288 GLY GLY B . n 
B 1 257 GLN 257 289 289 GLN GLN B . n 
B 1 258 GLU 258 290 290 GLU GLU B . n 
B 1 259 VAL 259 291 291 VAL VAL B . n 
B 1 260 PHE 260 292 292 PHE PHE B . n 
B 1 261 GLY 261 293 293 GLY GLY B . n 
B 1 262 LEU 262 294 294 LEU LEU B . n 
B 1 263 LEU 263 295 295 LEU LEU B . n 
B 1 264 PRO 264 296 296 PRO PRO B . n 
B 1 265 GLY 265 297 297 GLY GLY B . n 
B 1 266 LEU 266 298 298 LEU LEU B . n 
B 1 267 MET 267 299 299 MET MET B . n 
B 1 268 LEU 268 300 300 LEU LEU B . n 
B 1 269 TYR 269 301 301 TYR TYR B . n 
B 1 270 ALA 270 302 302 ALA ALA B . n 
B 1 271 THR 271 303 303 THR THR B . n 
B 1 272 ILE 272 304 304 ILE ILE B . n 
B 1 273 TRP 273 305 305 TRP TRP B . n 
B 1 274 LEU 274 306 306 LEU LEU B . n 
B 1 275 ARG 275 307 307 ARG ARG B . n 
B 1 276 GLU 276 308 308 GLU GLU B . n 
B 1 277 HIS 277 309 309 HIS HIS B . n 
B 1 278 GLN 278 310 310 GLN GLN B . n 
B 1 279 ARG 279 311 311 ARG ARG B . n 
B 1 280 VAL 280 312 312 VAL VAL B . n 
B 1 281 CYS 281 313 313 CYS CYS B . n 
B 1 282 ASP 282 314 314 ASP ASP B . n 
B 1 283 LEU 283 315 315 LEU LEU B . n 
B 1 284 LEU 284 316 316 LEU LEU B . n 
B 1 285 LYS 285 317 317 LYS LYS B . n 
B 1 286 ALA 286 318 318 ALA ALA B . n 
B 1 287 GLU 287 319 319 GLU GLU B . n 
B 1 288 HIS 288 320 320 HIS HIS B . n 
B 1 289 PRO 289 321 321 PRO PRO B . n 
B 1 290 THR 290 322 322 THR THR B . n 
B 1 291 TRP 291 323 323 TRP TRP B . n 
B 1 292 GLY 292 324 324 GLY GLY B . n 
B 1 293 ASP 293 325 325 ASP ASP B . n 
B 1 294 GLU 294 326 326 GLU GLU B . n 
B 1 295 GLN 295 327 327 GLN GLN B . n 
B 1 296 LEU 296 328 328 LEU LEU B . n 
B 1 297 PHE 297 329 329 PHE PHE B . n 
B 1 298 GLN 298 330 330 GLN GLN B . n 
B 1 299 THR 299 331 331 THR THR B . n 
B 1 300 ALA 300 332 332 ALA ALA B . n 
B 1 301 LYS 301 333 333 LYS LYS B . n 
B 1 302 LEU 302 334 334 LEU LEU B . n 
B 1 303 ILE 303 335 335 ILE ILE B . n 
B 1 304 LEU 304 336 336 LEU LEU B . n 
B 1 305 ILE 305 337 337 ILE ILE B . n 
B 1 306 GLY 306 338 338 GLY GLY B . n 
B 1 307 GLU 307 339 339 GLU GLU B . n 
B 1 308 THR 308 340 340 THR THR B . n 
B 1 309 ILE 309 341 341 ILE ILE B . n 
B 1 310 LYS 310 342 342 LYS LYS B . n 
B 1 311 ILE 311 343 343 ILE ILE B . n 
B 1 312 VAL 312 344 344 VAL VAL B . n 
B 1 313 ILE 313 345 345 ILE ILE B . n 
B 1 314 GLU 314 346 346 GLU GLU B . n 
B 1 315 GLU 315 347 347 GLU GLU B . n 
B 1 316 TYR 316 348 348 TYR TYR B . n 
B 1 317 VAL 317 349 349 VAL VAL B . n 
B 1 318 GLN 318 350 350 GLN GLN B . n 
B 1 319 GLN 319 351 351 GLN GLN B . n 
B 1 320 LEU 320 352 352 LEU LEU B . n 
B 1 321 SER 321 353 353 SER SER B . n 
B 1 322 GLY 322 354 354 GLY GLY B . n 
B 1 323 TYR 323 355 355 TYR TYR B . n 
B 1 324 PHE 324 356 356 PHE PHE B . n 
B 1 325 LEU 325 357 357 LEU LEU B . n 
B 1 326 GLN 326 358 358 GLN GLN B . n 
B 1 327 LEU 327 359 359 LEU LEU B . n 
B 1 328 LYS 328 360 360 LYS LYS B . n 
B 1 329 PHE 329 361 361 PHE PHE B . n 
B 1 330 ASP 330 362 362 ASP ASP B . n 
B 1 331 PRO 331 363 363 PRO PRO B . n 
B 1 332 GLU 332 364 364 GLU GLU B . n 
B 1 333 LEU 333 365 365 LEU LEU B . n 
B 1 334 LEU 334 366 366 LEU LEU B . n 
B 1 335 PHE 335 367 367 PHE PHE B . n 
B 1 336 GLY 336 368 368 GLY GLY B . n 
B 1 337 ALA 337 369 369 ALA ALA B . n 
B 1 338 GLN 338 370 370 GLN GLN B . n 
B 1 339 PHE 339 371 371 PHE PHE B . n 
B 1 340 GLN 340 372 372 GLN GLN B . n 
B 1 341 TYR 341 373 373 TYR TYR B . n 
B 1 342 ARG 342 374 374 ARG ARG B . n 
B 1 343 ASN 343 375 375 ASN ASN B . n 
B 1 344 ARG 344 376 376 ARG ARG B . n 
B 1 345 ILE 345 377 377 ILE ILE B . n 
B 1 346 ALA 346 378 378 ALA ALA B . n 
B 1 347 MET 347 379 379 MET MET B . n 
B 1 348 GLU 348 380 380 GLU GLU B . n 
B 1 349 PHE 349 381 381 PHE PHE B . n 
B 1 350 ASN 350 382 382 ASN ASN B . n 
B 1 351 GLN 351 383 383 GLN GLN B . n 
B 1 352 LEU 352 384 384 LEU LEU B . n 
B 1 353 TYR 353 385 385 TYR TYR B . n 
B 1 354 HIS 354 386 386 HIS HIS B . n 
B 1 355 TRP 355 387 387 TRP TRP B . n 
B 1 356 HIS 356 388 388 HIS HIS B . n 
B 1 357 PRO 357 389 389 PRO PRO B . n 
B 1 358 LEU 358 390 390 LEU LEU B . n 
B 1 359 MET 359 391 391 MET MET B . n 
B 1 360 PRO 360 392 392 PRO PRO B . n 
B 1 361 ASP 361 393 393 ASP ASP B . n 
B 1 362 SER 362 394 394 SER SER B . n 
B 1 363 PHE 363 395 395 PHE PHE B . n 
B 1 364 ARG 364 396 396 ARG ARG B . n 
B 1 365 VAL 365 397 397 VAL VAL B . n 
B 1 366 GLY 366 398 398 GLY GLY B . n 
B 1 367 PRO 367 399 399 PRO PRO B . n 
B 1 368 GLN 368 400 400 GLN GLN B . n 
B 1 369 ASP 369 401 401 ASP ASP B . n 
B 1 370 TYR 370 402 402 TYR TYR B . n 
B 1 371 SER 371 403 403 SER SER B . n 
B 1 372 TYR 372 404 404 TYR TYR B . n 
B 1 373 GLU 373 405 405 GLU GLU B . n 
B 1 374 GLN 374 406 406 GLN GLN B . n 
B 1 375 PHE 375 407 407 PHE PHE B . n 
B 1 376 LEU 376 408 408 LEU LEU B . n 
B 1 377 PHE 377 409 409 PHE PHE B . n 
B 1 378 ASN 378 410 410 ASN ASN B . n 
B 1 379 THR 379 411 411 THR THR B . n 
B 1 380 SER 380 412 412 SER SER B . n 
B 1 381 MET 381 413 413 MET MET B . n 
B 1 382 LEU 382 414 414 LEU LEU B . n 
B 1 383 VAL 383 415 415 VAL VAL B . n 
B 1 384 ASP 384 416 416 ASP ASP B . n 
B 1 385 TYR 385 417 417 TYR TYR B . n 
B 1 386 GLY 386 418 418 GLY GLY B . n 
B 1 387 VAL 387 419 419 VAL VAL B . n 
B 1 388 GLU 388 420 420 GLU GLU B . n 
B 1 389 ALA 389 421 421 ALA ALA B . n 
B 1 390 LEU 390 422 422 LEU LEU B . n 
B 1 391 VAL 391 423 423 VAL VAL B . n 
B 1 392 ASP 392 424 424 ASP ASP B . n 
B 1 393 ALA 393 425 425 ALA ALA B . n 
B 1 394 PHE 394 426 426 PHE PHE B . n 
B 1 395 SER 395 427 427 SER SER B . n 
B 1 396 ARG 396 428 428 ARG ARG B . n 
B 1 397 GLN 397 429 429 GLN GLN B . n 
B 1 398 PRO 398 430 430 PRO PRO B . n 
B 1 399 ALA 399 431 431 ALA ALA B . n 
B 1 400 GLY 400 432 432 GLY GLY B . n 
B 1 401 ARG 401 433 433 ARG ARG B . n 
B 1 402 ILE 402 434 434 ILE ILE B . n 
B 1 403 GLY 403 435 435 GLY GLY B . n 
B 1 404 GLY 404 436 436 GLY GLY B . n 
B 1 405 GLY 405 437 437 GLY GLY B . n 
B 1 406 ARG 406 438 438 ARG ARG B . n 
B 1 407 ASN 407 439 439 ASN ASN B . n 
B 1 408 ILE 408 440 440 ILE ILE B . n 
B 1 409 ASP 409 441 441 ASP ASP B . n 
B 1 410 HIS 410 442 442 HIS HIS B . n 
B 1 411 HIS 411 443 443 HIS HIS B . n 
B 1 412 ILE 412 444 444 ILE ILE B . n 
B 1 413 LEU 413 445 445 LEU LEU B . n 
B 1 414 HIS 414 446 446 HIS HIS B . n 
B 1 415 VAL 415 447 447 VAL VAL B . n 
B 1 416 ALA 416 448 448 ALA ALA B . n 
B 1 417 VAL 417 449 449 VAL VAL B . n 
B 1 418 ASP 418 450 450 ASP ASP B . n 
B 1 419 VAL 419 451 451 VAL VAL B . n 
B 1 420 ILE 420 452 452 ILE ILE B . n 
B 1 421 LYS 421 453 453 LYS LYS B . n 
B 1 422 GLU 422 454 454 GLU GLU B . n 
B 1 423 SER 423 455 455 SER SER B . n 
B 1 424 ARG 424 456 456 ARG ARG B . n 
B 1 425 VAL 425 457 457 VAL VAL B . n 
B 1 426 LEU 426 458 458 LEU LEU B . n 
B 1 427 ARG 427 459 459 ARG ARG B . n 
B 1 428 LEU 428 460 460 LEU LEU B . n 
B 1 429 GLN 429 461 461 GLN GLN B . n 
B 1 430 PRO 430 462 462 PRO PRO B . n 
B 1 431 PHE 431 463 463 PHE PHE B . n 
B 1 432 ASN 432 464 464 ASN ASN B . n 
B 1 433 GLU 433 465 465 GLU GLU B . n 
B 1 434 TYR 434 466 466 TYR TYR B . n 
B 1 435 ARG 435 467 467 ARG ARG B . n 
B 1 436 LYS 436 468 468 LYS LYS B . n 
B 1 437 ARG 437 469 469 ARG ARG B . n 
B 1 438 PHE 438 470 470 PHE PHE B . n 
B 1 439 GLY 439 471 471 GLY GLY B . n 
B 1 440 MET 440 472 472 MET MET B . n 
B 1 441 LYS 441 473 473 LYS LYS B . n 
B 1 442 PRO 442 474 474 PRO PRO B . n 
B 1 443 TYR 443 475 475 TYR TYR B . n 
B 1 444 THR 444 476 476 THR THR B . n 
B 1 445 SER 445 477 477 SER SER B . n 
B 1 446 PHE 446 478 478 PHE PHE B . n 
B 1 447 GLN 447 479 479 GLN GLN B . n 
B 1 448 GLU 448 480 480 GLU GLU B . n 
B 1 449 LEU 449 481 481 LEU LEU B . n 
B 1 450 THR 450 482 482 THR THR B . n 
B 1 451 GLY 451 483 483 GLY GLY B . n 
B 1 452 GLU 452 484 484 GLU GLU B . n 
B 1 453 LYS 453 485 485 LYS LYS B . n 
B 1 454 GLU 454 486 486 GLU GLU B . n 
B 1 455 MET 455 487 487 MET MET B . n 
B 1 456 ALA 456 488 488 ALA ALA B . n 
B 1 457 ALA 457 489 489 ALA ALA B . n 
B 1 458 GLU 458 490 490 GLU GLU B . n 
B 1 459 LEU 459 491 491 LEU LEU B . n 
B 1 460 GLU 460 492 492 GLU GLU B . n 
B 1 461 GLU 461 493 493 GLU GLU B . n 
B 1 462 LEU 462 494 494 LEU LEU B . n 
B 1 463 TYR 463 495 495 TYR TYR B . n 
B 1 464 GLY 464 496 496 GLY GLY B . n 
B 1 465 ASP 465 497 497 ASP ASP B . n 
B 1 466 ILE 466 498 498 ILE ILE B . n 
B 1 467 ASP 467 499 499 ASP ASP B . n 
B 1 468 ALA 468 500 500 ALA ALA B . n 
B 1 469 LEU 469 501 501 LEU LEU B . n 
B 1 470 GLU 470 502 502 GLU GLU B . n 
B 1 471 PHE 471 503 503 PHE PHE B . n 
B 1 472 TYR 472 504 504 TYR TYR B . n 
B 1 473 PRO 473 505 505 PRO PRO B . n 
B 1 474 GLY 474 506 506 GLY GLY B . n 
B 1 475 LEU 475 507 507 LEU LEU B . n 
B 1 476 LEU 476 508 508 LEU LEU B . n 
B 1 477 LEU 477 509 509 LEU LEU B . n 
B 1 478 GLU 478 510 510 GLU GLU B . n 
B 1 479 LYS 479 511 511 LYS LYS B . n 
B 1 480 CYS 480 512 512 CYS CYS B . n 
B 1 481 HIS 481 513 513 HIS HIS B . n 
B 1 482 PRO 482 514 514 PRO PRO B . n 
B 1 483 ASN 483 515 515 ASN ASN B . n 
B 1 484 SER 484 516 516 SER SER B . n 
B 1 485 ILE 485 517 517 ILE ILE B . n 
B 1 486 PHE 486 518 518 PHE PHE B . n 
B 1 487 GLY 487 519 519 GLY GLY B . n 
B 1 488 GLU 488 520 520 GLU GLU B . n 
B 1 489 SER 489 521 521 SER SER B . n 
B 1 490 MET 490 522 522 MET MET B . n 
B 1 491 ILE 491 523 523 ILE ILE B . n 
B 1 492 GLU 492 524 524 GLU GLU B . n 
B 1 493 MET 493 525 525 MET MET B . n 
B 1 494 GLY 494 526 526 GLY GLY B . n 
B 1 495 ALA 495 527 527 ALA ALA B . n 
B 1 496 PRO 496 528 528 PRO PRO B . n 
B 1 497 PHE 497 529 529 PHE PHE B . n 
B 1 498 SER 498 530 530 SER SER B . n 
B 1 499 LEU 499 531 531 LEU LEU B . n 
B 1 500 LYS 500 532 532 LYS LYS B . n 
B 1 501 GLY 501 533 533 GLY GLY B . n 
B 1 502 LEU 502 534 534 LEU LEU B . n 
B 1 503 LEU 503 535 535 LEU LEU B . n 
B 1 504 GLY 504 536 536 GLY GLY B . n 
B 1 505 ASN 505 537 537 ASN ASN B . n 
B 1 506 PRO 506 538 538 PRO PRO B . n 
B 1 507 ILE 507 539 539 ILE ILE B . n 
B 1 508 CYS 508 540 540 CYS CYS B . n 
B 1 509 SER 509 541 541 SER SER B . n 
B 1 510 PRO 510 542 542 PRO PRO B . n 
B 1 511 GLU 511 543 543 GLU GLU B . n 
B 1 512 TYR 512 544 544 TYR TYR B . n 
B 1 513 TRP 513 545 545 TRP TRP B . n 
B 1 514 LYS 514 546 546 LYS LYS B . n 
B 1 515 ALA 515 547 547 ALA ALA B . n 
B 1 516 SER 516 548 548 SER SER B . n 
B 1 517 THR 517 549 549 THR THR B . n 
B 1 518 PHE 518 550 550 PHE PHE B . n 
B 1 519 GLY 519 551 551 GLY GLY B . n 
B 1 520 GLY 520 552 552 GLY GLY B . n 
B 1 521 GLU 521 553 553 GLU GLU B . n 
B 1 522 VAL 522 554 554 VAL VAL B . n 
B 1 523 GLY 523 555 555 GLY GLY B . n 
B 1 524 PHE 524 556 556 PHE PHE B . n 
B 1 525 ASN 525 557 557 ASN ASN B . n 
B 1 526 LEU 526 558 558 LEU LEU B . n 
B 1 527 VAL 527 559 559 VAL VAL B . n 
B 1 528 LYS 528 560 560 LYS LYS B . n 
B 1 529 THR 529 561 561 THR THR B . n 
B 1 530 ALA 530 562 562 ALA ALA B . n 
B 1 531 THR 531 563 563 THR THR B . n 
B 1 532 LEU 532 564 564 LEU LEU B . n 
B 1 533 LYS 533 565 565 LYS LYS B . n 
B 1 534 LYS 534 566 566 LYS LYS B . n 
B 1 535 LEU 535 567 567 LEU LEU B . n 
B 1 536 VAL 536 568 568 VAL VAL B . n 
B 1 537 CYS 537 569 569 CYS CYS B . n 
B 1 538 LEU 538 570 570 LEU LEU B . n 
B 1 539 ASN 539 571 571 ASN ASN B . n 
B 1 540 THR 540 572 572 THR THR B . n 
B 1 541 LYS 541 573 573 LYS LYS B . n 
B 1 542 THR 542 574 574 THR THR B . n 
B 1 543 CYS 543 575 575 CYS CYS B . n 
B 1 544 PRO 544 576 576 PRO PRO B . n 
B 1 545 TYR 545 577 577 TYR TYR B . n 
B 1 546 VAL 546 578 578 VAL VAL B . n 
B 1 547 SER 547 579 579 SER SER B . n 
B 1 548 PHE 548 580 580 PHE PHE B . n 
B 1 549 HIS 549 581 581 HIS HIS B . n 
B 1 550 VAL 550 582 582 VAL VAL B . n 
B 1 551 PRO 551 583 583 PRO PRO B . n 
B 1 552 ASP 552 584 584 ASP ASP B . n 
B 1 553 PRO 553 585 585 PRO PRO B . n 
B 1 554 ARG 554 586 586 ARG ARG B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HEM 1 601 601 HEM HEM A . 
D 2 HEM 1 601 601 HEM HEM B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7140  ? 
1 MORE         -66   ? 
1 'SSA (A^2)'  41010 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 356 ? A HIS 388 ? 1_555 FE ? C HEM . ? A HEM 601 ? 1_555 NA ? C HEM . ? A HEM 601 ? 1_555 91.5  ? 
2  NE2 ? A HIS 356 ? A HIS 388 ? 1_555 FE ? C HEM . ? A HEM 601 ? 1_555 NB ? C HEM . ? A HEM 601 ? 1_555 88.8  ? 
3  NA  ? C HEM .   ? A HEM 601 ? 1_555 FE ? C HEM . ? A HEM 601 ? 1_555 NB ? C HEM . ? A HEM 601 ? 1_555 89.3  ? 
4  NE2 ? A HIS 356 ? A HIS 388 ? 1_555 FE ? C HEM . ? A HEM 601 ? 1_555 NC ? C HEM . ? A HEM 601 ? 1_555 92.8  ? 
5  NA  ? C HEM .   ? A HEM 601 ? 1_555 FE ? C HEM . ? A HEM 601 ? 1_555 NC ? C HEM . ? A HEM 601 ? 1_555 175.3 ? 
6  NB  ? C HEM .   ? A HEM 601 ? 1_555 FE ? C HEM . ? A HEM 601 ? 1_555 NC ? C HEM . ? A HEM 601 ? 1_555 88.9  ? 
7  NE2 ? A HIS 356 ? A HIS 388 ? 1_555 FE ? C HEM . ? A HEM 601 ? 1_555 ND ? C HEM . ? A HEM 601 ? 1_555 90.9  ? 
8  NA  ? C HEM .   ? A HEM 601 ? 1_555 FE ? C HEM . ? A HEM 601 ? 1_555 ND ? C HEM . ? A HEM 601 ? 1_555 90.0  ? 
9  NB  ? C HEM .   ? A HEM 601 ? 1_555 FE ? C HEM . ? A HEM 601 ? 1_555 ND ? C HEM . ? A HEM 601 ? 1_555 179.3 ? 
10 NC  ? C HEM .   ? A HEM 601 ? 1_555 FE ? C HEM . ? A HEM 601 ? 1_555 ND ? C HEM . ? A HEM 601 ? 1_555 91.8  ? 
11 NE2 ? B HIS 356 ? B HIS 388 ? 1_555 FE ? D HEM . ? B HEM 601 ? 1_555 NA ? D HEM . ? B HEM 601 ? 1_555 91.5  ? 
12 NE2 ? B HIS 356 ? B HIS 388 ? 1_555 FE ? D HEM . ? B HEM 601 ? 1_555 NB ? D HEM . ? B HEM 601 ? 1_555 88.4  ? 
13 NA  ? D HEM .   ? B HEM 601 ? 1_555 FE ? D HEM . ? B HEM 601 ? 1_555 NB ? D HEM . ? B HEM 601 ? 1_555 89.5  ? 
14 NE2 ? B HIS 356 ? B HIS 388 ? 1_555 FE ? D HEM . ? B HEM 601 ? 1_555 NC ? D HEM . ? B HEM 601 ? 1_555 92.6  ? 
15 NA  ? D HEM .   ? B HEM 601 ? 1_555 FE ? D HEM . ? B HEM 601 ? 1_555 NC ? D HEM . ? B HEM 601 ? 1_555 175.5 ? 
16 NB  ? D HEM .   ? B HEM 601 ? 1_555 FE ? D HEM . ? B HEM 601 ? 1_555 NC ? D HEM . ? B HEM 601 ? 1_555 88.8  ? 
17 NE2 ? B HIS 356 ? B HIS 388 ? 1_555 FE ? D HEM . ? B HEM 601 ? 1_555 ND ? D HEM . ? B HEM 601 ? 1_555 90.9  ? 
18 NA  ? D HEM .   ? B HEM 601 ? 1_555 FE ? D HEM . ? B HEM 601 ? 1_555 ND ? D HEM . ? B HEM 601 ? 1_555 90.1  ? 
19 NB  ? D HEM .   ? B HEM 601 ? 1_555 FE ? D HEM . ? B HEM 601 ? 1_555 ND ? D HEM . ? B HEM 601 ? 1_555 179.3 ? 
20 NC  ? D HEM .   ? B HEM 601 ? 1_555 FE ? D HEM . ? B HEM 601 ? 1_555 ND ? D HEM . ? B HEM 601 ? 1_555 91.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1995-03-31 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
loop_
_pdbx_database_remark.id 
_pdbx_database_remark.text 
650 
;HELIX
HELIX -- THE NOMENCLATURE FOR THE HELICES 1 - 19 IS BASED
ON THE TOPOLOGICAL AND SPATIAL EQUIVALENCE OF SECONDARY
STRUCTURE BETWEEN PROSTAGLANDIN H SYNTHASE AND
MYELO-PEROXIDASE (ZENG AND FENNA, 1992).  HELICES
IDENTIFIED WITH A LETTER A - E HAVE NO EQUIVALENT IN
MYELOPEROXIDASE.
;
700 
;SHEET
SHEET -- ONLY A SMALL REGION OF BETA-SHEET IS OBSERVED IN
THE EGF-LIKE MODULE (RESIDUES 33 - 72) ALTHOUGH THE EXACT
HYDROGEN BONDING SCHEME IS NOT UNEQUIVOCAL AT THE PRESENT
RESOLUTION.
;
# 
_pdbx_entry_details.entry_id             1PRH 
_pdbx_entry_details.compound_details     
;RESIDUES ASN 68, ASN 144 AND ASN 410 ARE GLYCOSYLATED AND
THE FIRST 1 - 2 SUGARS ARE VISIBLE IN THE MAP(S).
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   
;COX -- THE CYCLOOXYGENASE ACTIVE SITE IS LOCATED
WITHIN A LONG HYDROPHOBIC CHANNEL AT A REGION DEFINED BY
RESIDUES ARG 120, SER 530 (SITE OF ASPIRIN ACETYLATION),
TYR 385, AND GLU 524.

THE CRYSTALS CONTAIN A NON-STEROIDAL ANTI-INFLAMMATORY DRUG
FLURBIPROFEN AND THE DRUG BINDING SITE HAS BEEN IDENTIFIED
(SEE D. PICOT, P.J. LOLL AND R.M. GARAVITO, 1994), ALTHOUGH
REGULARIZED AND REFINED COORDINATES FOR THE PROTEIN-BOUND
DRUG ARE NOT YET AVAILABLE.
;
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CG A HIS 95 ? ? CD2 A HIS 95 ? ? 1.421 1.354 0.067 0.009 N 
2 1 CG B HIS 95 ? ? CD2 B HIS 95 ? ? 1.416 1.354 0.062 0.009 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1   1 NE  A ARG 49  ? ? CZ  A ARG 49  ? ? NH1 A ARG 49  ? ? 125.88 120.30 5.58   0.50 N 
2   1 NE  A ARG 49  ? ? CZ  A ARG 49  ? ? NH2 A ARG 49  ? ? 117.29 120.30 -3.01  0.50 N 
3   1 CD1 A TRP 75  ? ? CG  A TRP 75  ? ? CD2 A TRP 75  ? ? 112.25 106.30 5.95   0.80 N 
4   1 CE2 A TRP 75  ? ? CD2 A TRP 75  ? ? CG  A TRP 75  ? ? 101.02 107.30 -6.28  0.80 N 
5   1 CD1 A TRP 77  ? ? CG  A TRP 77  ? ? CD2 A TRP 77  ? ? 113.16 106.30 6.86   0.80 N 
6   1 CE2 A TRP 77  ? ? CD2 A TRP 77  ? ? CG  A TRP 77  ? ? 101.65 107.30 -5.65  0.80 N 
7   1 NE  A ARG 79  ? ? CZ  A ARG 79  ? ? NH1 A ARG 79  ? ? 125.12 120.30 4.82   0.50 N 
8   1 NE  A ARG 79  ? ? CZ  A ARG 79  ? ? NH2 A ARG 79  ? ? 116.57 120.30 -3.73  0.50 N 
9   1 CA  A HIS 95  ? ? CB  A HIS 95  ? ? CG  A HIS 95  ? ? 134.80 113.60 21.20  1.70 N 
10  1 CD1 A TRP 98  ? ? CG  A TRP 98  ? ? CD2 A TRP 98  ? ? 111.62 106.30 5.32   0.80 N 
11  1 CE2 A TRP 98  ? ? CD2 A TRP 98  ? ? CG  A TRP 98  ? ? 102.21 107.30 -5.09  0.80 N 
12  1 CD1 A TRP 100 ? ? CG  A TRP 100 ? ? CD2 A TRP 100 ? ? 112.44 106.30 6.14   0.80 N 
13  1 CE2 A TRP 100 ? ? CD2 A TRP 100 ? ? CG  A TRP 100 ? ? 101.60 107.30 -5.70  0.80 N 
14  1 CG  A TRP 100 ? ? CD2 A TRP 100 ? ? CE3 A TRP 100 ? ? 139.42 133.90 5.52   0.90 N 
15  1 NE  A ARG 120 ? ? CZ  A ARG 120 ? ? NH1 A ARG 120 ? ? 127.50 120.30 7.20   0.50 N 
16  1 NE  A ARG 120 ? ? CZ  A ARG 120 ? ? NH2 A ARG 120 ? ? 112.53 120.30 -7.77  0.50 N 
17  1 CA  A SER 143 ? ? C   A SER 143 ? ? N   A ASN 144 ? ? 140.38 117.20 23.18  2.20 Y 
18  1 O   A SER 143 ? ? C   A SER 143 ? ? N   A ASN 144 ? ? 97.61  122.70 -25.09 1.60 Y 
19  1 CA  A THR 149 ? ? CB  A THR 149 ? ? CG2 A THR 149 ? ? 121.04 112.40 8.64   1.40 N 
20  1 NE  A ARG 150 ? ? CZ  A ARG 150 ? ? NH2 A ARG 150 ? ? 116.71 120.30 -3.59  0.50 N 
21  1 NE  A ARG 157 ? ? CZ  A ARG 157 ? ? NH1 A ARG 157 ? ? 124.71 120.30 4.41   0.50 N 
22  1 NE  A ARG 184 ? ? CZ  A ARG 184 ? ? NH1 A ARG 184 ? ? 123.65 120.30 3.35   0.50 N 
23  1 NE  A ARG 184 ? ? CZ  A ARG 184 ? ? NH2 A ARG 184 ? ? 116.29 120.30 -4.01  0.50 N 
24  1 N   A GLY 219 ? ? CA  A GLY 219 ? ? C   A GLY 219 ? ? 97.64  113.10 -15.46 2.50 N 
25  1 CB  A TYR 254 ? ? CG  A TYR 254 ? ? CD2 A TYR 254 ? ? 117.39 121.00 -3.61  0.60 N 
26  1 C   A GLY 293 ? ? N   A LEU 294 ? ? CA  A LEU 294 ? ? 142.38 121.70 20.68  2.50 Y 
27  1 CD1 A TRP 305 ? ? CG  A TRP 305 ? ? CD2 A TRP 305 ? ? 112.58 106.30 6.28   0.80 N 
28  1 CB  A TRP 305 ? ? CG  A TRP 305 ? ? CD1 A TRP 305 ? ? 118.39 127.00 -8.61  1.30 N 
29  1 CE2 A TRP 305 ? ? CD2 A TRP 305 ? ? CG  A TRP 305 ? ? 101.24 107.30 -6.06  0.80 N 
30  1 CG  A TRP 305 ? ? CD2 A TRP 305 ? ? CE3 A TRP 305 ? ? 139.95 133.90 6.05   0.90 N 
31  1 NE  A ARG 311 ? ? CZ  A ARG 311 ? ? NH1 A ARG 311 ? ? 123.43 120.30 3.13   0.50 N 
32  1 CE2 A TRP 323 ? ? CD2 A TRP 323 ? ? CG  A TRP 323 ? ? 101.36 107.30 -5.94  0.80 N 
33  1 CA  A LEU 352 ? ? CB  A LEU 352 ? ? CG  A LEU 352 ? ? 129.51 115.30 14.21  2.30 N 
34  1 NE  A ARG 376 ? ? CZ  A ARG 376 ? ? NH1 A ARG 376 ? ? 123.52 120.30 3.22   0.50 N 
35  1 CA  A HIS 386 ? ? CB  A HIS 386 ? ? CG  A HIS 386 ? ? 101.28 113.60 -12.32 1.70 N 
36  1 CA  A TRP 387 ? ? CB  A TRP 387 ? ? CG  A TRP 387 ? ? 127.25 113.70 13.55  1.90 N 
37  1 CD1 A TRP 387 ? ? CG  A TRP 387 ? ? CD2 A TRP 387 ? ? 111.59 106.30 5.29   0.80 N 
38  1 CE2 A TRP 387 ? ? CD2 A TRP 387 ? ? CG  A TRP 387 ? ? 101.97 107.30 -5.33  0.80 N 
39  1 NE  A ARG 433 ? ? CZ  A ARG 433 ? ? NH1 A ARG 433 ? ? 125.29 120.30 4.99   0.50 N 
40  1 NE  A ARG 433 ? ? CZ  A ARG 433 ? ? NH2 A ARG 433 ? ? 117.14 120.30 -3.16  0.50 N 
41  1 CA  A LEU 445 ? ? CB  A LEU 445 ? ? CG  A LEU 445 ? ? 129.26 115.30 13.96  2.30 N 
42  1 NE  A ARG 456 ? ? CZ  A ARG 456 ? ? NH1 A ARG 456 ? ? 123.50 120.30 3.20   0.50 N 
43  1 NE  A ARG 459 ? ? CZ  A ARG 459 ? ? NH2 A ARG 459 ? ? 123.67 120.30 3.37   0.50 N 
44  1 NE  A ARG 467 ? ? CZ  A ARG 467 ? ? NH2 A ARG 467 ? ? 124.05 120.30 3.75   0.50 N 
45  1 O   A GLU 486 ? ? C   A GLU 486 ? ? N   A MET 487 ? ? 111.43 122.70 -11.27 1.60 Y 
46  1 CA  A LEU 535 ? ? CB  A LEU 535 ? ? CG  A LEU 535 ? ? 100.40 115.30 -14.90 2.30 N 
47  1 CB  A TYR 544 ? ? CG  A TYR 544 ? ? CD2 A TYR 544 ? ? 116.60 121.00 -4.40  0.60 N 
48  1 CE2 A TRP 545 ? ? CD2 A TRP 545 ? ? CG  A TRP 545 ? ? 102.38 107.30 -4.92  0.80 N 
49  1 CA  A CYS 569 ? ? CB  A CYS 569 ? ? SG  A CYS 569 ? ? 99.64  114.00 -14.36 1.80 N 
50  1 CB  A HIS 581 ? ? CG  A HIS 581 ? ? CD2 A HIS 581 ? ? 119.63 129.70 -10.07 1.60 N 
51  1 NE  A ARG 586 ? ? CZ  A ARG 586 ? ? NH2 A ARG 586 ? ? 117.19 120.30 -3.11  0.50 N 
52  1 NE  B ARG 49  ? ? CZ  B ARG 49  ? ? NH1 B ARG 49  ? ? 126.20 120.30 5.90   0.50 N 
53  1 NE  B ARG 49  ? ? CZ  B ARG 49  ? ? NH2 B ARG 49  ? ? 117.01 120.30 -3.29  0.50 N 
54  1 NE  B ARG 54  ? ? CZ  B ARG 54  ? ? NH1 B ARG 54  ? ? 123.36 120.30 3.06   0.50 N 
55  1 CD1 B TRP 75  ? ? CG  B TRP 75  ? ? CD2 B TRP 75  ? ? 112.19 106.30 5.89   0.80 N 
56  1 CE2 B TRP 75  ? ? CD2 B TRP 75  ? ? CG  B TRP 75  ? ? 100.91 107.30 -6.39  0.80 N 
57  1 CD1 B TRP 77  ? ? CG  B TRP 77  ? ? CD2 B TRP 77  ? ? 113.04 106.30 6.74   0.80 N 
58  1 CE2 B TRP 77  ? ? CD2 B TRP 77  ? ? CG  B TRP 77  ? ? 101.52 107.30 -5.78  0.80 N 
59  1 NE  B ARG 79  ? ? CZ  B ARG 79  ? ? NH1 B ARG 79  ? ? 124.94 120.30 4.64   0.50 N 
60  1 NE  B ARG 79  ? ? CZ  B ARG 79  ? ? NH2 B ARG 79  ? ? 116.99 120.30 -3.31  0.50 N 
61  1 NE  B ARG 83  ? ? CZ  B ARG 83  ? ? NH1 B ARG 83  ? ? 123.39 120.30 3.09   0.50 N 
62  1 CA  B HIS 95  ? ? CB  B HIS 95  ? ? CG  B HIS 95  ? ? 134.46 113.60 20.86  1.70 N 
63  1 CD1 B TRP 98  ? ? CG  B TRP 98  ? ? CD2 B TRP 98  ? ? 111.73 106.30 5.43   0.80 N 
64  1 CE2 B TRP 98  ? ? CD2 B TRP 98  ? ? CG  B TRP 98  ? ? 102.04 107.30 -5.26  0.80 N 
65  1 CD1 B TRP 100 ? ? CG  B TRP 100 ? ? CD2 B TRP 100 ? ? 112.40 106.30 6.10   0.80 N 
66  1 CE2 B TRP 100 ? ? CD2 B TRP 100 ? ? CG  B TRP 100 ? ? 101.52 107.30 -5.78  0.80 N 
67  1 NE  B ARG 120 ? ? CZ  B ARG 120 ? ? NH1 B ARG 120 ? ? 127.70 120.30 7.40   0.50 N 
68  1 NE  B ARG 120 ? ? CZ  B ARG 120 ? ? NH2 B ARG 120 ? ? 112.44 120.30 -7.86  0.50 N 
69  1 CA  B SER 143 ? ? C   B SER 143 ? ? N   B ASN 144 ? ? 140.05 117.20 22.85  2.20 Y 
70  1 O   B SER 143 ? ? C   B SER 143 ? ? N   B ASN 144 ? ? 97.94  122.70 -24.76 1.60 Y 
71  1 CA  B THR 149 ? ? CB  B THR 149 ? ? CG2 B THR 149 ? ? 121.07 112.40 8.67   1.40 N 
72  1 NE  B ARG 150 ? ? CZ  B ARG 150 ? ? NH1 B ARG 150 ? ? 123.39 120.30 3.09   0.50 N 
73  1 NE  B ARG 150 ? ? CZ  B ARG 150 ? ? NH2 B ARG 150 ? ? 116.75 120.30 -3.55  0.50 N 
74  1 NE  B ARG 157 ? ? CZ  B ARG 157 ? ? NH1 B ARG 157 ? ? 124.74 120.30 4.44   0.50 N 
75  1 NE  B ARG 184 ? ? CZ  B ARG 184 ? ? NH1 B ARG 184 ? ? 123.89 120.30 3.59   0.50 N 
76  1 NE  B ARG 184 ? ? CZ  B ARG 184 ? ? NH2 B ARG 184 ? ? 116.16 120.30 -4.14  0.50 N 
77  1 N   B GLY 219 ? ? CA  B GLY 219 ? ? C   B GLY 219 ? ? 97.30  113.10 -15.80 2.50 N 
78  1 C   B GLY 293 ? ? N   B LEU 294 ? ? CA  B LEU 294 ? ? 142.35 121.70 20.65  2.50 Y 
79  1 CG  B MET 299 ? ? SD  B MET 299 ? ? CE  B MET 299 ? ? 110.09 100.20 9.89   1.60 N 
80  1 CD1 B TRP 305 ? ? CG  B TRP 305 ? ? CD2 B TRP 305 ? ? 112.24 106.30 5.94   0.80 N 
81  1 CB  B TRP 305 ? ? CG  B TRP 305 ? ? CD1 B TRP 305 ? ? 118.33 127.00 -8.67  1.30 N 
82  1 CE2 B TRP 305 ? ? CD2 B TRP 305 ? ? CG  B TRP 305 ? ? 101.62 107.30 -5.68  0.80 N 
83  1 CG  B TRP 305 ? ? CD2 B TRP 305 ? ? CE3 B TRP 305 ? ? 139.54 133.90 5.64   0.90 N 
84  1 NE  B ARG 311 ? ? CZ  B ARG 311 ? ? NH1 B ARG 311 ? ? 123.63 120.30 3.33   0.50 N 
85  1 NE1 B TRP 323 ? ? CE2 B TRP 323 ? ? CD2 B TRP 323 ? ? 113.43 107.30 6.13   1.00 N 
86  1 CE2 B TRP 323 ? ? CD2 B TRP 323 ? ? CG  B TRP 323 ? ? 101.18 107.30 -6.12  0.80 N 
87  1 CA  B LEU 352 ? ? CB  B LEU 352 ? ? CG  B LEU 352 ? ? 129.60 115.30 14.30  2.30 N 
88  1 NE  B ARG 376 ? ? CZ  B ARG 376 ? ? NH1 B ARG 376 ? ? 123.96 120.30 3.66   0.50 N 
89  1 CA  B HIS 386 ? ? CB  B HIS 386 ? ? CG  B HIS 386 ? ? 101.23 113.60 -12.37 1.70 N 
90  1 CA  B TRP 387 ? ? CB  B TRP 387 ? ? CG  B TRP 387 ? ? 127.58 113.70 13.88  1.90 N 
91  1 CD1 B TRP 387 ? ? CG  B TRP 387 ? ? CD2 B TRP 387 ? ? 111.57 106.30 5.27   0.80 N 
92  1 CE2 B TRP 387 ? ? CD2 B TRP 387 ? ? CG  B TRP 387 ? ? 101.78 107.30 -5.52  0.80 N 
93  1 NE  B ARG 433 ? ? CZ  B ARG 433 ? ? NH1 B ARG 433 ? ? 125.23 120.30 4.93   0.50 N 
94  1 NE  B ARG 433 ? ? CZ  B ARG 433 ? ? NH2 B ARG 433 ? ? 117.11 120.30 -3.19  0.50 N 
95  1 CA  B LEU 445 ? ? CB  B LEU 445 ? ? CG  B LEU 445 ? ? 129.49 115.30 14.19  2.30 N 
96  1 NE  B ARG 456 ? ? CZ  B ARG 456 ? ? NH1 B ARG 456 ? ? 123.56 120.30 3.26   0.50 N 
97  1 NE  B ARG 459 ? ? CZ  B ARG 459 ? ? NH2 B ARG 459 ? ? 123.40 120.30 3.10   0.50 N 
98  1 NE  B ARG 467 ? ? CZ  B ARG 467 ? ? NH2 B ARG 467 ? ? 124.16 120.30 3.86   0.50 N 
99  1 O   B GLU 486 ? ? C   B GLU 486 ? ? N   B MET 487 ? ? 111.24 122.70 -11.46 1.60 Y 
100 1 CA  B LEU 535 ? ? CB  B LEU 535 ? ? CG  B LEU 535 ? ? 100.02 115.30 -15.28 2.30 N 
101 1 CB  B TYR 544 ? ? CG  B TYR 544 ? ? CD2 B TYR 544 ? ? 116.33 121.00 -4.67  0.60 N 
102 1 CD1 B TRP 545 ? ? CG  B TRP 545 ? ? CD2 B TRP 545 ? ? 111.44 106.30 5.14   0.80 N 
103 1 CE2 B TRP 545 ? ? CD2 B TRP 545 ? ? CE3 B TRP 545 ? ? 126.17 118.70 7.47   1.20 N 
104 1 CE2 B TRP 545 ? ? CD2 B TRP 545 ? ? CG  B TRP 545 ? ? 102.09 107.30 -5.21  0.80 N 
105 1 CA  B CYS 569 ? ? CB  B CYS 569 ? ? SG  B CYS 569 ? ? 99.59  114.00 -14.41 1.80 N 
106 1 CB  B HIS 581 ? ? CG  B HIS 581 ? ? CD2 B HIS 581 ? ? 119.72 129.70 -9.98  1.60 N 
107 1 NE  B ARG 586 ? ? CZ  B ARG 586 ? ? NH1 B ARG 586 ? ? 123.44 120.30 3.14   0.50 N 
108 1 NE  B ARG 586 ? ? CZ  B ARG 586 ? ? NH2 B ARG 586 ? ? 117.16 120.30 -3.14  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 34  ? ? 82.76   96.74   
2  1 HIS A 43  ? ? 38.65   43.26   
3  1 PHE A 50  ? ? -105.68 -166.90 
4  1 LEU A 52  ? ? 58.69   -88.16  
5  1 CYS A 59  ? ? -89.46  31.28   
6  1 ARG A 61  ? ? 38.89   58.47   
7  1 HIS A 95  ? ? -103.27 -166.38 
8  1 THR A 129 ? ? -107.00 -85.83  
9  1 ASP A 135 ? ? -100.03 48.95   
10 1 SER A 146 ? ? -92.69  54.32   
11 1 TYR A 147 ? ? -136.76 -31.40  
12 1 TYR A 148 ? ? 69.00   110.73  
13 1 ARG A 157 ? ? -58.33  2.85    
14 1 PRO A 162 ? ? -58.63  -3.58   
15 1 PHE A 220 ? ? 57.29   98.75   
16 1 LEU A 230 ? ? -74.47  45.75   
17 1 ASP A 249 ? ? 47.86   21.58   
18 1 ASN A 258 ? ? 54.19   -126.51 
19 1 PRO A 263 ? ? -46.85  153.49  
20 1 VAL A 271 ? ? 33.37   -51.76  
21 1 LEU A 272 ? ? 137.66  -88.87  
22 1 MET A 273 ? ? 66.03   132.96  
23 1 ARG A 277 ? ? -29.43  126.79  
24 1 PHE A 292 ? ? -58.14  -2.39   
25 1 HIS A 386 ? ? -74.37  41.41   
26 1 PRO A 389 ? ? -49.32  -18.84  
27 1 PRO A 399 ? ? -98.43  34.18   
28 1 PRO A 462 ? ? -57.68  175.96  
29 1 THR A 482 ? ? -64.95  -72.62  
30 1 PRO A 514 ? ? 15.62   -90.37  
31 1 GLU A 520 ? ? -22.96  -64.84  
32 1 ASP A 584 ? ? 40.24   6.74    
33 1 PRO A 585 ? ? 20.32   100.34  
34 1 ASN B 34  ? ? 82.42   96.45   
35 1 HIS B 43  ? ? 38.41   43.46   
36 1 PHE B 50  ? ? -105.63 -166.66 
37 1 LEU B 52  ? ? 58.69   -88.33  
38 1 CYS B 59  ? ? -89.19  31.16   
39 1 ARG B 61  ? ? 38.39   58.77   
40 1 HIS B 95  ? ? -103.26 -166.51 
41 1 ARG B 97  ? ? -39.96  -30.44  
42 1 THR B 129 ? ? -107.05 -86.04  
43 1 ASP B 135 ? ? -99.98  49.20   
44 1 SER B 146 ? ? -93.08  54.56   
45 1 TYR B 147 ? ? -136.70 -31.40  
46 1 TYR B 148 ? ? 69.37   110.40  
47 1 ARG B 157 ? ? -58.21  2.92    
48 1 PRO B 162 ? ? -58.42  -4.11   
49 1 PHE B 220 ? ? 57.07   98.73   
50 1 LEU B 230 ? ? -74.24  45.64   
51 1 ASP B 249 ? ? 48.54   21.37   
52 1 ASN B 258 ? ? 54.00   -126.15 
53 1 PRO B 263 ? ? -46.05  153.38  
54 1 VAL B 271 ? ? 34.19   -52.48  
55 1 LEU B 272 ? ? 137.90  -89.11  
56 1 MET B 273 ? ? 66.29   132.86  
57 1 ARG B 277 ? ? -28.67  127.01  
58 1 PHE B 292 ? ? -57.79  -2.98   
59 1 TYR B 373 ? ? -100.37 72.26   
60 1 HIS B 386 ? ? -74.29  41.31   
61 1 PRO B 399 ? ? -98.39  34.65   
62 1 PRO B 462 ? ? -57.95  175.94  
63 1 THR B 482 ? ? -65.32  -72.19  
64 1 PRO B 514 ? ? 15.00   -89.99  
65 1 GLU B 520 ? ? -23.12  -64.83  
66 1 ASP B 584 ? ? 40.75   6.71    
67 1 PRO B 585 ? ? 20.37   100.19  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 ASP A 584 ? ? PRO A 585 ? ? -119.46 
2 1 ASP B 584 ? ? PRO B 585 ? ? -119.58 
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 SER A 143 ? ? 11.80 
2 1 SER B 143 ? ? 11.70 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'PROTOPORPHYRIN IX CONTAINING FE' 
_pdbx_entity_nonpoly.comp_id     HEM 
#