data_1PRX
# 
_entry.id   1PRX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1PRX         pdb_00001prx 10.2210/pdb1prx/pdb 
WWPDB D_1000175816 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1PRX 
_pdbx_database_status.recvd_initial_deposition_date   1998-04-03 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Choi, H.-J.' 1 
'Kang, S.W.'  2 
'Yang, C.-H.' 3 
'Rhee, S.G.'  4 
'Ryu, S.-E.'  5 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of a novel human peroxidase enzyme at 2.0 A resolution.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            5 
_citation.page_first                400 
_citation.page_last                 406 
_citation.year                      1998 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9587003 
_citation.pdbx_database_id_DOI      10.1038/nsb0598-400 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Choi, H.J.' 1 ? 
primary 'Kang, S.W.' 2 ? 
primary 'Yang, C.H.' 3 ? 
primary 'Rhee, S.G.' 4 ? 
primary 'Ryu, S.E.'  5 ? 
# 
_cell.entry_id           1PRX 
_cell.length_a           47.850 
_cell.length_b           75.170 
_cell.length_c           63.300 
_cell.angle_alpha        90.00 
_cell.angle_beta         110.21 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1PRX 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man HORF6 25067.904 2   ? C91S ? ? 
2 water   nat water 18.015    112 ? ?    ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPV(CSO)TTELGRAAKLAPEFAKRNVKLIALSIDSV
EDHLAWSKDINAYNSEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRN
FDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHL
AWSKDINAYNSEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEI
LRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   GLY n 
1 4   GLY n 
1 5   LEU n 
1 6   LEU n 
1 7   LEU n 
1 8   GLY n 
1 9   ASP n 
1 10  VAL n 
1 11  ALA n 
1 12  PRO n 
1 13  ASN n 
1 14  PHE n 
1 15  GLU n 
1 16  ALA n 
1 17  ASN n 
1 18  THR n 
1 19  THR n 
1 20  VAL n 
1 21  GLY n 
1 22  ARG n 
1 23  ILE n 
1 24  ARG n 
1 25  PHE n 
1 26  HIS n 
1 27  ASP n 
1 28  PHE n 
1 29  LEU n 
1 30  GLY n 
1 31  ASP n 
1 32  SER n 
1 33  TRP n 
1 34  GLY n 
1 35  ILE n 
1 36  LEU n 
1 37  PHE n 
1 38  SER n 
1 39  HIS n 
1 40  PRO n 
1 41  ARG n 
1 42  ASP n 
1 43  PHE n 
1 44  THR n 
1 45  PRO n 
1 46  VAL n 
1 47  CSO n 
1 48  THR n 
1 49  THR n 
1 50  GLU n 
1 51  LEU n 
1 52  GLY n 
1 53  ARG n 
1 54  ALA n 
1 55  ALA n 
1 56  LYS n 
1 57  LEU n 
1 58  ALA n 
1 59  PRO n 
1 60  GLU n 
1 61  PHE n 
1 62  ALA n 
1 63  LYS n 
1 64  ARG n 
1 65  ASN n 
1 66  VAL n 
1 67  LYS n 
1 68  LEU n 
1 69  ILE n 
1 70  ALA n 
1 71  LEU n 
1 72  SER n 
1 73  ILE n 
1 74  ASP n 
1 75  SER n 
1 76  VAL n 
1 77  GLU n 
1 78  ASP n 
1 79  HIS n 
1 80  LEU n 
1 81  ALA n 
1 82  TRP n 
1 83  SER n 
1 84  LYS n 
1 85  ASP n 
1 86  ILE n 
1 87  ASN n 
1 88  ALA n 
1 89  TYR n 
1 90  ASN n 
1 91  SER n 
1 92  GLU n 
1 93  GLU n 
1 94  PRO n 
1 95  THR n 
1 96  GLU n 
1 97  LYS n 
1 98  LEU n 
1 99  PRO n 
1 100 PHE n 
1 101 PRO n 
1 102 ILE n 
1 103 ILE n 
1 104 ASP n 
1 105 ASP n 
1 106 ARG n 
1 107 ASN n 
1 108 ARG n 
1 109 GLU n 
1 110 LEU n 
1 111 ALA n 
1 112 ILE n 
1 113 LEU n 
1 114 LEU n 
1 115 GLY n 
1 116 MET n 
1 117 LEU n 
1 118 ASP n 
1 119 PRO n 
1 120 ALA n 
1 121 GLU n 
1 122 LYS n 
1 123 ASP n 
1 124 GLU n 
1 125 LYS n 
1 126 GLY n 
1 127 MET n 
1 128 PRO n 
1 129 VAL n 
1 130 THR n 
1 131 ALA n 
1 132 ARG n 
1 133 VAL n 
1 134 VAL n 
1 135 PHE n 
1 136 VAL n 
1 137 PHE n 
1 138 GLY n 
1 139 PRO n 
1 140 ASP n 
1 141 LYS n 
1 142 LYS n 
1 143 LEU n 
1 144 LYS n 
1 145 LEU n 
1 146 SER n 
1 147 ILE n 
1 148 LEU n 
1 149 TYR n 
1 150 PRO n 
1 151 ALA n 
1 152 THR n 
1 153 THR n 
1 154 GLY n 
1 155 ARG n 
1 156 ASN n 
1 157 PHE n 
1 158 ASP n 
1 159 GLU n 
1 160 ILE n 
1 161 LEU n 
1 162 ARG n 
1 163 VAL n 
1 164 VAL n 
1 165 ILE n 
1 166 SER n 
1 167 LEU n 
1 168 GLN n 
1 169 LEU n 
1 170 THR n 
1 171 ALA n 
1 172 GLU n 
1 173 LYS n 
1 174 ARG n 
1 175 VAL n 
1 176 ALA n 
1 177 THR n 
1 178 PRO n 
1 179 VAL n 
1 180 ASP n 
1 181 TRP n 
1 182 LYS n 
1 183 ASP n 
1 184 GLY n 
1 185 ASP n 
1 186 SER n 
1 187 VAL n 
1 188 MET n 
1 189 VAL n 
1 190 LEU n 
1 191 PRO n 
1 192 THR n 
1 193 ILE n 
1 194 PRO n 
1 195 GLU n 
1 196 GLU n 
1 197 GLU n 
1 198 ALA n 
1 199 LYS n 
1 200 LYS n 
1 201 LEU n 
1 202 PHE n 
1 203 PRO n 
1 204 LYS n 
1 205 GLY n 
1 206 VAL n 
1 207 PHE n 
1 208 THR n 
1 209 LYS n 
1 210 GLU n 
1 211 LEU n 
1 212 PRO n 
1 213 SER n 
1 214 GLY n 
1 215 LYS n 
1 216 LYS n 
1 217 TYR n 
1 218 LEU n 
1 219 ARG n 
1 220 TYR n 
1 221 THR n 
1 222 PRO n 
1 223 GLN n 
1 224 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PRDX6_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P30041 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;PGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLA
WSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEIL
RVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1PRX A 2 ? 224 ? P30041 1 ? 223 ? 2 224 
2 1 1PRX B 2 ? 224 ? P30041 1 ? 223 ? 2 224 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1PRX CSO A 47 ? UNP P30041 CYS 46 'modified residue'    47 1 
1 1PRX SER A 91 ? UNP P30041 CYS 90 'engineered mutation' 91 2 
2 1PRX CSO B 47 ? UNP P30041 CYS 46 'modified residue'    47 3 
2 1PRX SER B 91 ? UNP P30041 CYS 90 'engineered mutation' 91 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CSO 'L-peptide linking' n S-HYDROXYCYSTEINE ? 'C3 H7 N O3 S'   137.158 
CYS 'L-peptide linking' y CYSTEINE          ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1PRX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   8 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.13 
_exptl_crystal.density_percent_sol   42.23 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 6.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           295 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   1996-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1PRX 
_reflns.observed_criterion_sigma_I   1. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             8.00 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   24439 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         93.7 
_reflns.pdbx_Rmerge_I_obs            0.0700000 
_reflns.pdbx_Rsym_value              0.0700000 
_reflns.pdbx_netI_over_sigmaI        17.0 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.0 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.0 
_reflns_shell.d_res_low              2.25 
_reflns_shell.percent_possible_all   91.4 
_reflns_shell.Rmerge_I_obs           0.1890000 
_reflns_shell.pdbx_Rsym_value        0.1890000 
_reflns_shell.meanI_over_sigI_obs    6.1 
_reflns_shell.pdbx_redundancy        3.0 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1PRX 
_refine.ls_number_reflns_obs                     23097 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               10000000.00 
_refine.pdbx_data_cutoff_low_absF                0.00000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            2.0 
_refine.ls_percent_reflns_obs                    93.7 
_refine.ls_R_factor_obs                          0.1910000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1910000 
_refine.ls_R_factor_R_free                       0.2590000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1287 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               20.91 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MULTIPLE ISOMORPHOUS REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3574 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             112 
_refine_hist.number_atoms_total               3686 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.011 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.525 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      24.79 ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.346 ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.25 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  ? 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  ? 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 ?            ?            'X-RAY DIFFRACTION' 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.999880 
_struct_ncs_oper.matrix[1][2]   -0.015230 
_struct_ncs_oper.matrix[1][3]   0.003410 
_struct_ncs_oper.matrix[2][1]   -0.015400 
_struct_ncs_oper.matrix[2][2]   0.927060 
_struct_ncs_oper.matrix[2][3]   -0.374590 
_struct_ncs_oper.matrix[3][1]   0.002550 
_struct_ncs_oper.matrix[3][2]   -0.374600 
_struct_ncs_oper.matrix[3][3]   -0.927180 
_struct_ncs_oper.vector[1]      55.74726 
_struct_ncs_oper.vector[2]      7.07527 
_struct_ncs_oper.vector[3]      34.79962 
# 
_struct.entry_id                  1PRX 
_struct.title                     'HORF6 A NOVEL HUMAN PEROXIDASE ENZYME' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1PRX 
_struct_keywords.pdbx_keywords   ANTIOXIDANT 
_struct_keywords.text            'PEROXIREDOXIN, HORF6, HYDROGEN PEROXIDE, REDOX REGULATION, CELLULAR SIGNALING, ANTIOXIDANT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PHE A 25  ? LEU A 29  ? PHE A 25  LEU A 29  1 ? 5  
HELX_P HELX_P2  2  PRO A 45  ? ARG A 64  ? PRO A 45  ARG A 64  5 ? 20 
HELX_P HELX_P3  3  VAL A 76  ? TYR A 89  ? VAL A 76  TYR A 89  1 ? 14 
HELX_P HELX_P4  4  GLU A 109 ? LEU A 113 ? GLU A 109 LEU A 113 1 ? 5  
HELX_P HELX_P5  5  PHE A 157 ? LYS A 173 ? PHE A 157 LYS A 173 1 ? 17 
HELX_P HELX_P6  6  GLU A 195 ? LEU A 201 ? GLU A 195 LEU A 201 1 ? 7  
HELX_P HELX_P7  7  PHE B 25  ? LEU B 29  ? PHE B 25  LEU B 29  1 ? 5  
HELX_P HELX_P8  8  PRO B 45  ? ARG B 64  ? PRO B 45  ARG B 64  5 ? 20 
HELX_P HELX_P9  9  VAL B 76  ? TYR B 89  ? VAL B 76  TYR B 89  1 ? 14 
HELX_P HELX_P10 10 GLU B 109 ? LEU B 113 ? GLU B 109 LEU B 113 1 ? 5  
HELX_P HELX_P11 11 PHE B 157 ? LYS B 173 ? PHE B 157 LYS B 173 1 ? 17 
HELX_P HELX_P12 12 GLU B 195 ? LEU B 201 ? GLU B 195 LEU B 201 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? A VAL 46 C ? ? ? 1_555 A CSO 47 N ? ? A VAL 46 A CSO 47 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale2 covale both ? A CSO 47 C ? ? ? 1_555 A THR 48 N ? ? A CSO 47 A THR 48 1_555 ? ? ? ? ? ? ? 1.333 ? ? 
covale3 covale both ? B VAL 46 C ? ? ? 1_555 B CSO 47 N ? ? B VAL 46 B CSO 47 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale4 covale both ? B CSO 47 C ? ? ? 1_555 B THR 48 N ? ? B CSO 47 B THR 48 1_555 ? ? ? ? ? ? ? 1.333 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 2 ? 
D ? 5 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 15  ? THR A 18  ? GLU A 15  THR A 18  
A 2 GLY A 21  ? ARG A 24  ? GLY A 21  ARG A 24  
B 1 LEU A 143 ? LEU A 148 ? LEU A 143 LEU A 148 
B 2 VAL A 133 ? PHE A 137 ? VAL A 133 PHE A 137 
B 3 TRP A 33  ? HIS A 39  ? TRP A 33  HIS A 39  
B 4 VAL A 66  ? SER A 72  ? VAL A 66  SER A 72  
B 5 ILE A 102 ? ASP A 104 ? ILE A 102 ASP A 104 
C 1 GLU B 15  ? THR B 18  ? GLU B 15  THR B 18  
C 2 GLY B 21  ? ARG B 24  ? GLY B 21  ARG B 24  
D 1 LEU B 143 ? LEU B 148 ? LEU B 143 LEU B 148 
D 2 VAL B 133 ? PHE B 137 ? VAL B 133 PHE B 137 
D 3 TRP B 33  ? HIS B 39  ? TRP B 33  HIS B 39  
D 4 VAL B 66  ? SER B 72  ? VAL B 66  SER B 72  
D 5 ILE B 102 ? ASP B 104 ? ILE B 102 ASP B 104 
E 1 VAL B 206 ? THR B 208 ? VAL B 206 THR B 208 
E 2 ARG B 219 ? THR B 221 ? ARG B 219 THR B 221 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ALA A 16  ? O ALA A 16  N ILE A 23  ? N ILE A 23  
B 1 2 O LYS A 144 ? O LYS A 144 N VAL A 136 ? N VAL A 136 
B 2 3 O PHE A 135 ? O PHE A 135 N LEU A 36  ? N LEU A 36  
B 3 4 O TRP A 33  ? O TRP A 33  N LYS A 67  ? N LYS A 67  
B 4 5 O ALA A 70  ? O ALA A 70  N ILE A 103 ? N ILE A 103 
C 1 2 O ALA B 16  ? O ALA B 16  N ILE B 23  ? N ILE B 23  
D 1 2 O LYS B 144 ? O LYS B 144 N VAL B 136 ? N VAL B 136 
D 2 3 O PHE B 135 ? O PHE B 135 N LEU B 36  ? N LEU B 36  
D 3 4 O TRP B 33  ? O TRP B 33  N LYS B 67  ? N LYS B 67  
D 4 5 O ALA B 70  ? O ALA B 70  N ILE B 103 ? N ILE B 103 
E 1 2 O PHE B 207 ? O PHE B 207 N TYR B 220 ? N TYR B 220 
# 
_database_PDB_matrix.entry_id          1PRX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1PRX 
_atom_sites.fract_transf_matrix[1][1]   0.020899 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.007693 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013303 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016834 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LEU A 1 5   ? 32.059 -0.999  16.377  1.00 24.60 ? 5    LEU A N   1 
ATOM   2    C CA  . LEU A 1 5   ? 33.418 -0.856  16.982  1.00 24.95 ? 5    LEU A CA  1 
ATOM   3    C C   . LEU A 1 5   ? 33.313 0.181   18.090  1.00 22.61 ? 5    LEU A C   1 
ATOM   4    O O   . LEU A 1 5   ? 32.427 1.041   18.054  1.00 26.72 ? 5    LEU A O   1 
ATOM   5    C CB  . LEU A 1 5   ? 34.448 -0.346  15.952  1.00 24.96 ? 5    LEU A CB  1 
ATOM   6    C CG  . LEU A 1 5   ? 34.529 -0.772  14.483  1.00 22.82 ? 5    LEU A CG  1 
ATOM   7    C CD1 . LEU A 1 5   ? 35.725 -0.076  13.856  1.00 20.75 ? 5    LEU A CD1 1 
ATOM   8    C CD2 . LEU A 1 5   ? 34.664 -2.259  14.330  1.00 26.75 ? 5    LEU A CD2 1 
ATOM   9    N N   . LEU A 1 6   ? 34.162 0.059   19.099  1.00 20.58 ? 6    LEU A N   1 
ATOM   10   C CA  . LEU A 1 6   ? 34.197 1.013   20.188  1.00 19.45 ? 6    LEU A CA  1 
ATOM   11   C C   . LEU A 1 6   ? 35.363 1.948   19.862  1.00 18.25 ? 6    LEU A C   1 
ATOM   12   O O   . LEU A 1 6   ? 36.113 1.718   18.902  1.00 15.60 ? 6    LEU A O   1 
ATOM   13   C CB  . LEU A 1 6   ? 34.466 0.301   21.517  1.00 20.93 ? 6    LEU A CB  1 
ATOM   14   C CG  . LEU A 1 6   ? 33.461 -0.735  22.029  1.00 25.59 ? 6    LEU A CG  1 
ATOM   15   C CD1 . LEU A 1 6   ? 33.958 -1.321  23.361  1.00 24.78 ? 6    LEU A CD1 1 
ATOM   16   C CD2 . LEU A 1 6   ? 32.084 -0.103  22.199  1.00 27.08 ? 6    LEU A CD2 1 
ATOM   17   N N   . LEU A 1 7   ? 35.480 3.040   20.606  1.00 18.47 ? 7    LEU A N   1 
ATOM   18   C CA  . LEU A 1 7   ? 36.590 3.955   20.377  1.00 19.46 ? 7    LEU A CA  1 
ATOM   19   C C   . LEU A 1 7   ? 37.876 3.179   20.674  1.00 21.65 ? 7    LEU A C   1 
ATOM   20   O O   . LEU A 1 7   ? 37.951 2.482   21.690  1.00 23.86 ? 7    LEU A O   1 
ATOM   21   C CB  . LEU A 1 7   ? 36.483 5.168   21.296  1.00 15.55 ? 7    LEU A CB  1 
ATOM   22   C CG  . LEU A 1 7   ? 35.338 6.134   20.994  1.00 15.01 ? 7    LEU A CG  1 
ATOM   23   C CD1 . LEU A 1 7   ? 35.316 7.256   22.023  1.00 12.93 ? 7    LEU A CD1 1 
ATOM   24   C CD2 . LEU A 1 7   ? 35.515 6.690   19.604  1.00 11.72 ? 7    LEU A CD2 1 
ATOM   25   N N   . GLY A 1 8   ? 38.868 3.276   19.789  1.00 21.19 ? 8    GLY A N   1 
ATOM   26   C CA  . GLY A 1 8   ? 40.115 2.564   20.002  1.00 19.29 ? 8    GLY A CA  1 
ATOM   27   C C   . GLY A 1 8   ? 40.202 1.237   19.275  1.00 21.90 ? 8    GLY A C   1 
ATOM   28   O O   . GLY A 1 8   ? 41.295 0.660   19.160  1.00 25.48 ? 8    GLY A O   1 
ATOM   29   N N   . ASP A 1 9   ? 39.071 0.755   18.764  1.00 20.09 ? 9    ASP A N   1 
ATOM   30   C CA  . ASP A 1 9   ? 39.027 -0.513  18.030  1.00 17.89 ? 9    ASP A CA  1 
ATOM   31   C C   . ASP A 1 9   ? 39.746 -0.352  16.719  1.00 15.99 ? 9    ASP A C   1 
ATOM   32   O O   . ASP A 1 9   ? 39.587 0.664   16.044  1.00 17.77 ? 9    ASP A O   1 
ATOM   33   C CB  . ASP A 1 9   ? 37.582 -0.933  17.731  1.00 15.05 ? 9    ASP A CB  1 
ATOM   34   C CG  . ASP A 1 9   ? 36.907 -1.625  18.904  1.00 19.52 ? 9    ASP A CG  1 
ATOM   35   O OD1 . ASP A 1 9   ? 37.467 -1.631  20.006  1.00 17.30 ? 9    ASP A OD1 1 
ATOM   36   O OD2 . ASP A 1 9   ? 35.779 -2.145  18.723  1.00 24.49 ? 9    ASP A OD2 1 
ATOM   37   N N   . VAL A 1 10  ? 40.508 -1.369  16.348  1.00 15.72 ? 10   VAL A N   1 
ATOM   38   C CA  . VAL A 1 10  ? 41.248 -1.359  15.094  1.00 17.93 ? 10   VAL A CA  1 
ATOM   39   C C   . VAL A 1 10  ? 40.301 -1.705  13.959  1.00 18.49 ? 10   VAL A C   1 
ATOM   40   O O   . VAL A 1 10  ? 39.503 -2.632  14.079  1.00 18.50 ? 10   VAL A O   1 
ATOM   41   C CB  . VAL A 1 10  ? 42.398 -2.394  15.110  1.00 19.57 ? 10   VAL A CB  1 
ATOM   42   C CG1 . VAL A 1 10  ? 43.162 -2.364  13.788  1.00 19.65 ? 10   VAL A CG1 1 
ATOM   43   C CG2 . VAL A 1 10  ? 43.339 -2.104  16.260  1.00 17.72 ? 10   VAL A CG2 1 
ATOM   44   N N   . ALA A 1 11  ? 40.383 -0.941  12.873  1.00 18.24 ? 11   ALA A N   1 
ATOM   45   C CA  . ALA A 1 11  ? 39.552 -1.169  11.700  1.00 17.12 ? 11   ALA A CA  1 
ATOM   46   C C   . ALA A 1 11  ? 39.910 -2.510  11.069  1.00 22.91 ? 11   ALA A C   1 
ATOM   47   O O   . ALA A 1 11  ? 41.057 -2.975  11.159  1.00 20.18 ? 11   ALA A O   1 
ATOM   48   C CB  . ALA A 1 11  ? 39.771 -0.065  10.672  1.00 11.35 ? 11   ALA A CB  1 
ATOM   49   N N   . PRO A 1 12  ? 38.910 -3.180  10.455  1.00 24.42 ? 12   PRO A N   1 
ATOM   50   C CA  . PRO A 1 12  ? 39.097 -4.467  9.792   1.00 24.37 ? 12   PRO A CA  1 
ATOM   51   C C   . PRO A 1 12  ? 39.880 -4.199  8.520   1.00 23.15 ? 12   PRO A C   1 
ATOM   52   O O   . PRO A 1 12  ? 39.645 -3.188  7.860   1.00 27.37 ? 12   PRO A O   1 
ATOM   53   C CB  . PRO A 1 12  ? 37.658 -4.878  9.452   1.00 21.68 ? 12   PRO A CB  1 
ATOM   54   C CG  . PRO A 1 12  ? 36.856 -4.222  10.528  1.00 26.30 ? 12   PRO A CG  1 
ATOM   55   C CD  . PRO A 1 12  ? 37.473 -2.856  10.557  1.00 28.70 ? 12   PRO A CD  1 
ATOM   56   N N   . ASN A 1 13  ? 40.833 -5.060  8.193   1.00 22.99 ? 13   ASN A N   1 
ATOM   57   C CA  . ASN A 1 13  ? 41.604 -4.859  6.973   1.00 24.24 ? 13   ASN A CA  1 
ATOM   58   C C   . ASN A 1 13  ? 40.943 -5.676  5.871   1.00 20.89 ? 13   ASN A C   1 
ATOM   59   O O   . ASN A 1 13  ? 41.492 -6.655  5.380   1.00 25.40 ? 13   ASN A O   1 
ATOM   60   C CB  . ASN A 1 13  ? 43.061 -5.269  7.156   1.00 24.60 ? 13   ASN A CB  1 
ATOM   61   C CG  . ASN A 1 13  ? 43.939 -4.843  5.986   1.00 28.27 ? 13   ASN A CG  1 
ATOM   62   O OD1 . ASN A 1 13  ? 43.486 -4.106  5.118   1.00 32.23 ? 13   ASN A OD1 1 
ATOM   63   N ND2 . ASN A 1 13  ? 45.190 -5.277  5.980   1.00 33.08 ? 13   ASN A ND2 1 
ATOM   64   N N   . PHE A 1 14  ? 39.752 -5.258  5.480   1.00 21.77 ? 14   PHE A N   1 
ATOM   65   C CA  . PHE A 1 14  ? 39.030 -5.963  4.450   1.00 19.75 ? 14   PHE A CA  1 
ATOM   66   C C   . PHE A 1 14  ? 39.466 -5.582  3.045   1.00 21.15 ? 14   PHE A C   1 
ATOM   67   O O   . PHE A 1 14  ? 40.091 -4.546  2.833   1.00 18.01 ? 14   PHE A O   1 
ATOM   68   C CB  . PHE A 1 14  ? 37.514 -5.719  4.600   1.00 20.80 ? 14   PHE A CB  1 
ATOM   69   C CG  . PHE A 1 14  ? 37.129 -4.266  4.518   1.00 19.07 ? 14   PHE A CG  1 
ATOM   70   C CD1 . PHE A 1 14  ? 37.099 -3.606  3.290   1.00 19.05 ? 14   PHE A CD1 1 
ATOM   71   C CD2 . PHE A 1 14  ? 36.828 -3.555  5.665   1.00 23.83 ? 14   PHE A CD2 1 
ATOM   72   C CE1 . PHE A 1 14  ? 36.776 -2.263  3.214   1.00 19.75 ? 14   PHE A CE1 1 
ATOM   73   C CE2 . PHE A 1 14  ? 36.500 -2.203  5.599   1.00 24.71 ? 14   PHE A CE2 1 
ATOM   74   C CZ  . PHE A 1 14  ? 36.476 -1.560  4.367   1.00 22.20 ? 14   PHE A CZ  1 
ATOM   75   N N   . GLU A 1 15  ? 39.138 -6.456  2.100   1.00 23.52 ? 15   GLU A N   1 
ATOM   76   C CA  . GLU A 1 15  ? 39.420 -6.218  0.698   1.00 24.91 ? 15   GLU A CA  1 
ATOM   77   C C   . GLU A 1 15  ? 38.035 -5.978  0.102   1.00 22.13 ? 15   GLU A C   1 
ATOM   78   O O   . GLU A 1 15  ? 37.084 -6.694  0.418   1.00 25.79 ? 15   GLU A O   1 
ATOM   79   C CB  . GLU A 1 15  ? 40.076 -7.432  0.046   1.00 24.58 ? 15   GLU A CB  1 
ATOM   80   C CG  . GLU A 1 15  ? 40.412 -7.192  -1.410  1.00 28.67 ? 15   GLU A CG  1 
ATOM   81   C CD  . GLU A 1 15  ? 41.240 -8.288  -2.009  1.00 32.10 ? 15   GLU A CD  1 
ATOM   82   O OE1 . GLU A 1 15  ? 42.149 -8.786  -1.309  1.00 35.36 ? 15   GLU A OE1 1 
ATOM   83   O OE2 . GLU A 1 15  ? 40.993 -8.644  -3.184  1.00 33.72 ? 15   GLU A OE2 1 
ATOM   84   N N   . ALA A 1 16  ? 37.902 -4.957  -0.726  1.00 19.24 ? 16   ALA A N   1 
ATOM   85   C CA  . ALA A 1 16  ? 36.614 -4.658  -1.313  1.00 17.93 ? 16   ALA A CA  1 
ATOM   86   C C   . ALA A 1 16  ? 36.815 -4.128  -2.703  1.00 17.05 ? 16   ALA A C   1 
ATOM   87   O O   . ALA A 1 16  ? 37.908 -3.684  -3.059  1.00 17.67 ? 16   ALA A O   1 
ATOM   88   C CB  . ALA A 1 16  ? 35.893 -3.623  -0.472  1.00 16.05 ? 16   ALA A CB  1 
ATOM   89   N N   . ASN A 1 17  ? 35.786 -4.237  -3.525  1.00 14.16 ? 17   ASN A N   1 
ATOM   90   C CA  . ASN A 1 17  ? 35.898 -3.704  -4.860  1.00 13.65 ? 17   ASN A CA  1 
ATOM   91   C C   . ASN A 1 17  ? 35.320 -2.323  -4.734  1.00 14.88 ? 17   ASN A C   1 
ATOM   92   O O   . ASN A 1 17  ? 34.403 -2.112  -3.951  1.00 12.87 ? 17   ASN A O   1 
ATOM   93   C CB  . ASN A 1 17  ? 35.097 -4.523  -5.848  1.00 18.52 ? 17   ASN A CB  1 
ATOM   94   C CG  . ASN A 1 17  ? 35.295 -4.061  -7.270  1.00 23.01 ? 17   ASN A CG  1 
ATOM   95   O OD1 . ASN A 1 17  ? 34.401 -4.192  -8.091  1.00 31.94 ? 17   ASN A OD1 1 
ATOM   96   N ND2 . ASN A 1 17  ? 36.472 -3.519  -7.572  1.00 22.66 ? 17   ASN A ND2 1 
ATOM   97   N N   . THR A 1 18  ? 35.905 -1.360  -5.427  1.00 14.67 ? 18   THR A N   1 
ATOM   98   C CA  . THR A 1 18  ? 35.416 -0.001  -5.349  1.00 18.27 ? 18   THR A CA  1 
ATOM   99   C C   . THR A 1 18  ? 35.344 0.539   -6.757  1.00 18.47 ? 18   THR A C   1 
ATOM   100  O O   . THR A 1 18  ? 35.668 -0.163  -7.712  1.00 20.85 ? 18   THR A O   1 
ATOM   101  C CB  . THR A 1 18  ? 36.358 0.902   -4.522  1.00 16.71 ? 18   THR A CB  1 
ATOM   102  O OG1 . THR A 1 18  ? 37.474 1.296   -5.331  1.00 21.70 ? 18   THR A OG1 1 
ATOM   103  C CG2 . THR A 1 18  ? 36.860 0.172   -3.301  1.00 10.86 ? 18   THR A CG2 1 
ATOM   104  N N   . THR A 1 19  ? 34.919 1.794   -6.869  1.00 20.54 ? 19   THR A N   1 
ATOM   105  C CA  . THR A 1 19  ? 34.811 2.491   -8.146  1.00 19.14 ? 19   THR A CA  1 
ATOM   106  C C   . THR A 1 19  ? 36.190 2.687   -8.821  1.00 21.96 ? 19   THR A C   1 
ATOM   107  O O   . THR A 1 19  ? 36.253 2.881   -10.042 1.00 20.43 ? 19   THR A O   1 
ATOM   108  C CB  . THR A 1 19  ? 34.148 3.863   -7.945  1.00 17.75 ? 19   THR A CB  1 
ATOM   109  O OG1 . THR A 1 19  ? 34.686 4.461   -6.760  1.00 20.21 ? 19   THR A OG1 1 
ATOM   110  C CG2 . THR A 1 19  ? 32.652 3.715   -7.783  1.00 10.81 ? 19   THR A CG2 1 
ATOM   111  N N   . VAL A 1 20  ? 37.276 2.586   -8.042  1.00 18.83 ? 20   VAL A N   1 
ATOM   112  C CA  . VAL A 1 20  ? 38.648 2.764   -8.563  1.00 20.48 ? 20   VAL A CA  1 
ATOM   113  C C   . VAL A 1 20  ? 39.514 1.493   -8.547  1.00 19.87 ? 20   VAL A C   1 
ATOM   114  O O   . VAL A 1 20  ? 40.738 1.558   -8.728  1.00 22.12 ? 20   VAL A O   1 
ATOM   115  C CB  . VAL A 1 20  ? 39.421 3.912   -7.822  1.00 19.71 ? 20   VAL A CB  1 
ATOM   116  C CG1 . VAL A 1 20  ? 38.654 5.211   -7.899  1.00 15.20 ? 20   VAL A CG1 1 
ATOM   117  C CG2 . VAL A 1 20  ? 39.693 3.542   -6.375  1.00 17.57 ? 20   VAL A CG2 1 
ATOM   118  N N   . GLY A 1 21  ? 38.879 0.345   -8.345  1.00 20.41 ? 21   GLY A N   1 
ATOM   119  C CA  . GLY A 1 21  ? 39.612 -0.905  -8.318  1.00 19.44 ? 21   GLY A CA  1 
ATOM   120  C C   . GLY A 1 21  ? 39.559 -1.528  -6.946  1.00 17.82 ? 21   GLY A C   1 
ATOM   121  O O   . GLY A 1 21  ? 38.970 -0.946  -6.035  1.00 14.48 ? 21   GLY A O   1 
ATOM   122  N N   . ARG A 1 22  ? 40.089 -2.741  -6.815  1.00 18.68 ? 22   ARG A N   1 
ATOM   123  C CA  . ARG A 1 22  ? 40.101 -3.427  -5.528  1.00 21.45 ? 22   ARG A CA  1 
ATOM   124  C C   . ARG A 1 22  ? 41.102 -2.778  -4.606  1.00 22.50 ? 22   ARG A C   1 
ATOM   125  O O   . ARG A 1 22  ? 42.147 -2.304  -5.055  1.00 24.59 ? 22   ARG A O   1 
ATOM   126  C CB  . ARG A 1 22  ? 40.440 -4.906  -5.686  1.00 26.68 ? 22   ARG A CB  1 
ATOM   127  C CG  . ARG A 1 22  ? 39.268 -5.703  -6.173  1.00 34.39 ? 22   ARG A CG  1 
ATOM   128  C CD  . ARG A 1 22  ? 39.382 -7.184  -5.899  1.00 41.53 ? 22   ARG A CD  1 
ATOM   129  N NE  . ARG A 1 22  ? 38.255 -7.859  -6.539  1.00 51.46 ? 22   ARG A NE  1 
ATOM   130  C CZ  . ARG A 1 22  ? 37.136 -8.224  -5.920  1.00 52.72 ? 22   ARG A CZ  1 
ATOM   131  N NH1 . ARG A 1 22  ? 36.990 -8.009  -4.617  1.00 54.40 ? 22   ARG A NH1 1 
ATOM   132  N NH2 . ARG A 1 22  ? 36.115 -8.687  -6.633  1.00 55.36 ? 22   ARG A NH2 1 
ATOM   133  N N   . ILE A 1 23  ? 40.777 -2.766  -3.317  1.00 21.78 ? 23   ILE A N   1 
ATOM   134  C CA  . ILE A 1 23  ? 41.632 -2.162  -2.298  1.00 19.04 ? 23   ILE A CA  1 
ATOM   135  C C   . ILE A 1 23  ? 41.618 -3.036  -1.042  1.00 19.98 ? 23   ILE A C   1 
ATOM   136  O O   . ILE A 1 23  ? 40.697 -3.834  -0.838  1.00 18.41 ? 23   ILE A O   1 
ATOM   137  C CB  . ILE A 1 23  ? 41.125 -0.740  -1.856  1.00 18.71 ? 23   ILE A CB  1 
ATOM   138  C CG1 . ILE A 1 23  ? 39.839 -0.865  -1.033  1.00 16.96 ? 23   ILE A CG1 1 
ATOM   139  C CG2 . ILE A 1 23  ? 40.869 0.161   -3.063  1.00 16.89 ? 23   ILE A CG2 1 
ATOM   140  C CD1 . ILE A 1 23  ? 39.598 0.301   -0.117  1.00 23.26 ? 23   ILE A CD1 1 
ATOM   141  N N   . ARG A 1 24  ? 42.661 -2.890  -0.228  1.00 21.35 ? 24   ARG A N   1 
ATOM   142  C CA  . ARG A 1 24  ? 42.792 -3.589  1.040   1.00 20.78 ? 24   ARG A CA  1 
ATOM   143  C C   . ARG A 1 24  ? 42.687 -2.393  1.973   1.00 19.04 ? 24   ARG A C   1 
ATOM   144  O O   . ARG A 1 24  ? 43.472 -1.465  1.864   1.00 19.22 ? 24   ARG A O   1 
ATOM   145  C CB  . ARG A 1 24  ? 44.160 -4.240  1.150   1.00 26.32 ? 24   ARG A CB  1 
ATOM   146  C CG  . ARG A 1 24  ? 44.261 -5.247  2.262   1.00 34.36 ? 24   ARG A CG  1 
ATOM   147  C CD  . ARG A 1 24  ? 43.442 -6.473  1.945   1.00 44.25 ? 24   ARG A CD  1 
ATOM   148  N NE  . ARG A 1 24  ? 43.546 -7.475  3.007   1.00 54.59 ? 24   ARG A NE  1 
ATOM   149  C CZ  . ARG A 1 24  ? 43.052 -8.709  2.931   1.00 56.35 ? 24   ARG A CZ  1 
ATOM   150  N NH1 . ARG A 1 24  ? 42.411 -9.111  1.835   1.00 57.94 ? 24   ARG A NH1 1 
ATOM   151  N NH2 . ARG A 1 24  ? 43.183 -9.534  3.963   1.00 61.38 ? 24   ARG A NH2 1 
ATOM   152  N N   . PHE A 1 25  ? 41.720 -2.396  2.880   1.00 20.17 ? 25   PHE A N   1 
ATOM   153  C CA  . PHE A 1 25  ? 41.509 -1.239  3.736   1.00 20.42 ? 25   PHE A CA  1 
ATOM   154  C C   . PHE A 1 25  ? 42.710 -0.580  4.398   1.00 20.08 ? 25   PHE A C   1 
ATOM   155  O O   . PHE A 1 25  ? 42.902 0.628   4.264   1.00 20.33 ? 25   PHE A O   1 
ATOM   156  C CB  . PHE A 1 25  ? 40.412 -1.492  4.772   1.00 22.08 ? 25   PHE A CB  1 
ATOM   157  C CG  . PHE A 1 25  ? 39.810 -0.223  5.321   1.00 19.41 ? 25   PHE A CG  1 
ATOM   158  C CD1 . PHE A 1 25  ? 39.364 0.781   4.454   1.00 17.59 ? 25   PHE A CD1 1 
ATOM   159  C CD2 . PHE A 1 25  ? 39.702 -0.019  6.690   1.00 16.60 ? 25   PHE A CD2 1 
ATOM   160  C CE1 . PHE A 1 25  ? 38.823 1.966   4.946   1.00 15.23 ? 25   PHE A CE1 1 
ATOM   161  C CE2 . PHE A 1 25  ? 39.159 1.164   7.191   1.00 17.90 ? 25   PHE A CE2 1 
ATOM   162  C CZ  . PHE A 1 25  ? 38.718 2.160   6.317   1.00 15.22 ? 25   PHE A CZ  1 
ATOM   163  N N   . HIS A 1 26  ? 43.531 -1.348  5.098   1.00 20.48 ? 26   HIS A N   1 
ATOM   164  C CA  . HIS A 1 26  ? 44.679 -0.745  5.766   1.00 19.50 ? 26   HIS A CA  1 
ATOM   165  C C   . HIS A 1 26  ? 45.680 -0.192  4.773   1.00 19.72 ? 26   HIS A C   1 
ATOM   166  O O   . HIS A 1 26  ? 46.323 0.813   5.041   1.00 22.04 ? 26   HIS A O   1 
ATOM   167  C CB  . HIS A 1 26  ? 45.322 -1.716  6.745   1.00 21.71 ? 26   HIS A CB  1 
ATOM   168  C CG  . HIS A 1 26  ? 44.463 -2.013  7.935   1.00 23.64 ? 26   HIS A CG  1 
ATOM   169  N ND1 . HIS A 1 26  ? 44.970 -2.526  9.113   1.00 21.72 ? 26   HIS A ND1 1 
ATOM   170  C CD2 . HIS A 1 26  ? 43.134 -1.855  8.138   1.00 25.51 ? 26   HIS A CD2 1 
ATOM   171  C CE1 . HIS A 1 26  ? 43.990 -2.669  9.987   1.00 22.46 ? 26   HIS A CE1 1 
ATOM   172  N NE2 . HIS A 1 26  ? 42.867 -2.269  9.418   1.00 28.33 ? 26   HIS A NE2 1 
ATOM   173  N N   . ASP A 1 27  ? 45.750 -0.793  3.594   1.00 20.81 ? 27   ASP A N   1 
ATOM   174  C CA  . ASP A 1 27  ? 46.657 -0.315  2.565   1.00 23.19 ? 27   ASP A CA  1 
ATOM   175  C C   . ASP A 1 27  ? 46.150 1.025   2.050   1.00 22.28 ? 27   ASP A C   1 
ATOM   176  O O   . ASP A 1 27  ? 46.927 1.970   1.872   1.00 21.19 ? 27   ASP A O   1 
ATOM   177  C CB  . ASP A 1 27  ? 46.768 -1.327  1.418   1.00 24.14 ? 27   ASP A CB  1 
ATOM   178  C CG  . ASP A 1 27  ? 47.645 -2.539  1.771   1.00 32.71 ? 27   ASP A CG  1 
ATOM   179  O OD1 . ASP A 1 27  ? 47.785 -2.898  2.967   1.00 35.15 ? 27   ASP A OD1 1 
ATOM   180  O OD2 . ASP A 1 27  ? 48.188 -3.155  0.832   1.00 43.31 ? 27   ASP A OD2 1 
ATOM   181  N N   . PHE A 1 28  ? 44.839 1.113   1.838   1.00 19.86 ? 28   PHE A N   1 
ATOM   182  C CA  . PHE A 1 28  ? 44.214 2.340   1.356   1.00 18.02 ? 28   PHE A CA  1 
ATOM   183  C C   . PHE A 1 28  ? 44.494 3.506   2.299   1.00 16.56 ? 28   PHE A C   1 
ATOM   184  O O   . PHE A 1 28  ? 44.807 4.623   1.859   1.00 20.09 ? 28   PHE A O   1 
ATOM   185  C CB  . PHE A 1 28  ? 42.696 2.159   1.196   1.00 17.11 ? 28   PHE A CB  1 
ATOM   186  C CG  . PHE A 1 28  ? 41.966 3.444   0.875   1.00 17.29 ? 28   PHE A CG  1 
ATOM   187  C CD1 . PHE A 1 28  ? 42.053 4.004   -0.393  1.00 15.10 ? 28   PHE A CD1 1 
ATOM   188  C CD2 . PHE A 1 28  ? 41.250 4.127   1.863   1.00 16.01 ? 28   PHE A CD2 1 
ATOM   189  C CE1 . PHE A 1 28  ? 41.447 5.222   -0.674  1.00 17.17 ? 28   PHE A CE1 1 
ATOM   190  C CE2 . PHE A 1 28  ? 40.639 5.352   1.589   1.00 12.87 ? 28   PHE A CE2 1 
ATOM   191  C CZ  . PHE A 1 28  ? 40.741 5.897   0.322   1.00 15.25 ? 28   PHE A CZ  1 
ATOM   192  N N   . LEU A 1 29  ? 44.352 3.248   3.592   1.00 17.52 ? 29   LEU A N   1 
ATOM   193  C CA  . LEU A 1 29  ? 44.578 4.256   4.612   1.00 21.15 ? 29   LEU A CA  1 
ATOM   194  C C   . LEU A 1 29  ? 46.055 4.678   4.701   1.00 23.90 ? 29   LEU A C   1 
ATOM   195  O O   . LEU A 1 29  ? 46.371 5.871   4.674   1.00 26.18 ? 29   LEU A O   1 
ATOM   196  C CB  . LEU A 1 29  ? 44.076 3.756   5.977   1.00 22.03 ? 29   LEU A CB  1 
ATOM   197  C CG  . LEU A 1 29  ? 42.565 3.552   6.181   1.00 21.85 ? 29   LEU A CG  1 
ATOM   198  C CD1 . LEU A 1 29  ? 42.292 3.311   7.652   1.00 19.40 ? 29   LEU A CD1 1 
ATOM   199  C CD2 . LEU A 1 29  ? 41.786 4.773   5.721   1.00 20.40 ? 29   LEU A CD2 1 
ATOM   200  N N   . GLY A 1 30  ? 46.958 3.704   4.745   1.00 23.71 ? 30   GLY A N   1 
ATOM   201  C CA  . GLY A 1 30  ? 48.373 4.018   4.838   1.00 21.76 ? 30   GLY A CA  1 
ATOM   202  C C   . GLY A 1 30  ? 48.733 4.720   6.133   1.00 20.60 ? 30   GLY A C   1 
ATOM   203  O O   . GLY A 1 30  ? 48.429 4.218   7.217   1.00 23.98 ? 30   GLY A O   1 
ATOM   204  N N   . ASP A 1 31  ? 49.388 5.874   6.015   1.00 21.82 ? 31   ASP A N   1 
ATOM   205  C CA  . ASP A 1 31  ? 49.795 6.672   7.174   1.00 22.95 ? 31   ASP A CA  1 
ATOM   206  C C   . ASP A 1 31  ? 48.967 7.945   7.250   1.00 18.42 ? 31   ASP A C   1 
ATOM   207  O O   . ASP A 1 31  ? 49.440 8.987   7.714   1.00 17.23 ? 31   ASP A O   1 
ATOM   208  C CB  . ASP A 1 31  ? 51.279 7.030   7.074   1.00 29.42 ? 31   ASP A CB  1 
ATOM   209  C CG  . ASP A 1 31  ? 52.170 5.803   7.053   1.00 38.85 ? 31   ASP A CG  1 
ATOM   210  O OD1 . ASP A 1 31  ? 52.103 5.000   8.015   1.00 44.10 ? 31   ASP A OD1 1 
ATOM   211  O OD2 . ASP A 1 31  ? 52.903 5.616   6.054   1.00 43.57 ? 31   ASP A OD2 1 
ATOM   212  N N   . SER A 1 32  ? 47.728 7.850   6.778   1.00 17.10 ? 32   SER A N   1 
ATOM   213  C CA  . SER A 1 32  ? 46.822 8.978   6.768   1.00 15.96 ? 32   SER A CA  1 
ATOM   214  C C   . SER A 1 32  ? 45.631 8.689   7.666   1.00 17.63 ? 32   SER A C   1 
ATOM   215  O O   . SER A 1 32  ? 45.439 7.549   8.115   1.00 18.29 ? 32   SER A O   1 
ATOM   216  C CB  . SER A 1 32  ? 46.308 9.220   5.347   1.00 16.02 ? 32   SER A CB  1 
ATOM   217  O OG  . SER A 1 32  ? 47.325 9.032   4.381   1.00 22.27 ? 32   SER A OG  1 
ATOM   218  N N   . TRP A 1 33  ? 44.883 9.744   7.990   1.00 17.13 ? 33   TRP A N   1 
ATOM   219  C CA  . TRP A 1 33  ? 43.654 9.608   8.759   1.00 12.06 ? 33   TRP A CA  1 
ATOM   220  C C   . TRP A 1 33  ? 42.643 9.182   7.681   1.00 14.44 ? 33   TRP A C   1 
ATOM   221  O O   . TRP A 1 33  ? 42.874 9.402   6.483   1.00 11.40 ? 33   TRP A O   1 
ATOM   222  C CB  . TRP A 1 33  ? 43.222 10.955  9.342   1.00 9.70  ? 33   TRP A CB  1 
ATOM   223  C CG  . TRP A 1 33  ? 44.030 11.395  10.506  1.00 9.16  ? 33   TRP A CG  1 
ATOM   224  C CD1 . TRP A 1 33  ? 45.301 11.872  10.480  1.00 9.36  ? 33   TRP A CD1 1 
ATOM   225  C CD2 . TRP A 1 33  ? 43.621 11.398  11.882  1.00 13.91 ? 33   TRP A CD2 1 
ATOM   226  N NE1 . TRP A 1 33  ? 45.719 12.173  11.757  1.00 11.27 ? 33   TRP A NE1 1 
ATOM   227  C CE2 . TRP A 1 33  ? 44.711 11.892  12.638  1.00 10.59 ? 33   TRP A CE2 1 
ATOM   228  C CE3 . TRP A 1 33  ? 42.444 11.041  12.553  1.00 14.58 ? 33   TRP A CE3 1 
ATOM   229  C CZ2 . TRP A 1 33  ? 44.658 12.032  14.018  1.00 9.66  ? 33   TRP A CZ2 1 
ATOM   230  C CZ3 . TRP A 1 33  ? 42.392 11.183  13.933  1.00 14.96 ? 33   TRP A CZ3 1 
ATOM   231  C CH2 . TRP A 1 33  ? 43.495 11.676  14.649  1.00 10.66 ? 33   TRP A CH2 1 
ATOM   232  N N   . GLY A 1 34  ? 41.532 8.585   8.082   1.00 12.11 ? 34   GLY A N   1 
ATOM   233  C CA  . GLY A 1 34  ? 40.558 8.188   7.088   1.00 11.67 ? 34   GLY A CA  1 
ATOM   234  C C   . GLY A 1 34  ? 39.142 8.295   7.602   1.00 13.21 ? 34   GLY A C   1 
ATOM   235  O O   . GLY A 1 34  ? 38.882 7.981   8.758   1.00 14.47 ? 34   GLY A O   1 
ATOM   236  N N   . ILE A 1 35  ? 38.238 8.802   6.775   1.00 13.16 ? 35   ILE A N   1 
ATOM   237  C CA  . ILE A 1 35  ? 36.831 8.900   7.166   1.00 16.30 ? 35   ILE A CA  1 
ATOM   238  C C   . ILE A 1 35  ? 36.049 8.022   6.199   1.00 15.68 ? 35   ILE A C   1 
ATOM   239  O O   . ILE A 1 35  ? 36.220 8.130   4.977   1.00 12.43 ? 35   ILE A O   1 
ATOM   240  C CB  . ILE A 1 35  ? 36.276 10.341  7.086   1.00 16.05 ? 35   ILE A CB  1 
ATOM   241  C CG1 . ILE A 1 35  ? 37.141 11.295  7.911   1.00 15.19 ? 35   ILE A CG1 1 
ATOM   242  C CG2 . ILE A 1 35  ? 34.850 10.376  7.628   1.00 8.02  ? 35   ILE A CG2 1 
ATOM   243  C CD1 . ILE A 1 35  ? 36.836 12.753  7.676   1.00 19.19 ? 35   ILE A CD1 1 
ATOM   244  N N   . LEU A 1 36  ? 35.240 7.126   6.757   1.00 13.33 ? 36   LEU A N   1 
ATOM   245  C CA  . LEU A 1 36  ? 34.416 6.201   5.983   1.00 15.36 ? 36   LEU A CA  1 
ATOM   246  C C   . LEU A 1 36  ? 32.957 6.628   6.134   1.00 13.59 ? 36   LEU A C   1 
ATOM   247  O O   . LEU A 1 36  ? 32.433 6.607   7.248   1.00 15.80 ? 36   LEU A O   1 
ATOM   248  C CB  . LEU A 1 36  ? 34.597 4.778   6.531   1.00 14.07 ? 36   LEU A CB  1 
ATOM   249  C CG  . LEU A 1 36  ? 34.295 3.550   5.679   1.00 16.53 ? 36   LEU A CG  1 
ATOM   250  C CD1 . LEU A 1 36  ? 34.747 2.327   6.447   1.00 18.09 ? 36   LEU A CD1 1 
ATOM   251  C CD2 . LEU A 1 36  ? 32.833 3.452   5.348   1.00 20.07 ? 36   LEU A CD2 1 
ATOM   252  N N   . PHE A 1 37  ? 32.331 7.041   5.028   1.00 11.81 ? 37   PHE A N   1 
ATOM   253  C CA  . PHE A 1 37  ? 30.924 7.483   4.999   1.00 13.18 ? 37   PHE A CA  1 
ATOM   254  C C   . PHE A 1 37  ? 30.038 6.348   4.500   1.00 9.88  ? 37   PHE A C   1 
ATOM   255  O O   . PHE A 1 37  ? 30.147 5.950   3.345   1.00 14.89 ? 37   PHE A O   1 
ATOM   256  C CB  . PHE A 1 37  ? 30.717 8.668   4.032   1.00 9.38  ? 37   PHE A CB  1 
ATOM   257  C CG  . PHE A 1 37  ? 31.599 9.851   4.295   1.00 11.60 ? 37   PHE A CG  1 
ATOM   258  C CD1 . PHE A 1 37  ? 31.273 10.780  5.284   1.00 15.24 ? 37   PHE A CD1 1 
ATOM   259  C CD2 . PHE A 1 37  ? 32.737 10.061  3.527   1.00 15.53 ? 37   PHE A CD2 1 
ATOM   260  C CE1 . PHE A 1 37  ? 32.071 11.910  5.508   1.00 17.54 ? 37   PHE A CE1 1 
ATOM   261  C CE2 . PHE A 1 37  ? 33.542 11.177  3.733   1.00 17.68 ? 37   PHE A CE2 1 
ATOM   262  C CZ  . PHE A 1 37  ? 33.209 12.108  4.730   1.00 19.77 ? 37   PHE A CZ  1 
ATOM   263  N N   . SER A 1 38  ? 29.103 5.897   5.322   1.00 10.14 ? 38   SER A N   1 
ATOM   264  C CA  . SER A 1 38  ? 28.213 4.812   4.933   1.00 11.58 ? 38   SER A CA  1 
ATOM   265  C C   . SER A 1 38  ? 26.878 5.312   4.412   1.00 13.27 ? 38   SER A C   1 
ATOM   266  O O   . SER A 1 38  ? 26.353 6.318   4.895   1.00 14.90 ? 38   SER A O   1 
ATOM   267  C CB  . SER A 1 38  ? 27.989 3.880   6.115   1.00 9.49  ? 38   SER A CB  1 
ATOM   268  O OG  . SER A 1 38  ? 29.224 3.378   6.576   1.00 14.38 ? 38   SER A OG  1 
ATOM   269  N N   . HIS A 1 39  ? 26.364 4.629   3.395   1.00 11.93 ? 39   HIS A N   1 
ATOM   270  C CA  . HIS A 1 39  ? 25.090 4.974   2.768   1.00 11.02 ? 39   HIS A CA  1 
ATOM   271  C C   . HIS A 1 39  ? 24.289 3.694   2.552   1.00 14.21 ? 39   HIS A C   1 
ATOM   272  O O   . HIS A 1 39  ? 24.846 2.669   2.144   1.00 14.13 ? 39   HIS A O   1 
ATOM   273  C CB  . HIS A 1 39  ? 25.329 5.717   1.448   1.00 12.01 ? 39   HIS A CB  1 
ATOM   274  C CG  . HIS A 1 39  ? 26.011 7.043   1.627   1.00 17.48 ? 39   HIS A CG  1 
ATOM   275  N ND1 . HIS A 1 39  ? 25.325 8.193   1.962   1.00 16.11 ? 39   HIS A ND1 1 
ATOM   276  C CD2 . HIS A 1 39  ? 27.324 7.373   1.630   1.00 13.09 ? 39   HIS A CD2 1 
ATOM   277  C CE1 . HIS A 1 39  ? 26.187 9.171   2.176   1.00 15.45 ? 39   HIS A CE1 1 
ATOM   278  N NE2 . HIS A 1 39  ? 27.405 8.703   1.982   1.00 16.32 ? 39   HIS A NE2 1 
ATOM   279  N N   . PRO A 1 40  ? 22.971 3.729   2.832   1.00 15.63 ? 40   PRO A N   1 
ATOM   280  C CA  . PRO A 1 40  ? 22.107 2.559   2.667   1.00 14.18 ? 40   PRO A CA  1 
ATOM   281  C C   . PRO A 1 40  ? 21.922 2.133   1.229   1.00 14.70 ? 40   PRO A C   1 
ATOM   282  O O   . PRO A 1 40  ? 21.742 0.951   0.966   1.00 18.66 ? 40   PRO A O   1 
ATOM   283  C CB  . PRO A 1 40  ? 20.764 3.026   3.242   1.00 12.70 ? 40   PRO A CB  1 
ATOM   284  C CG  . PRO A 1 40  ? 21.104 4.165   4.111   1.00 16.82 ? 40   PRO A CG  1 
ATOM   285  C CD  . PRO A 1 40  ? 22.181 4.866   3.329   1.00 10.88 ? 40   PRO A CD  1 
ATOM   286  N N   . ARG A 1 41  ? 21.975 3.086   0.298   1.00 15.05 ? 41   ARG A N   1 
ATOM   287  C CA  . ARG A 1 41  ? 21.755 2.763   -1.112  1.00 17.37 ? 41   ARG A CA  1 
ATOM   288  C C   . ARG A 1 41  ? 22.062 3.924   -2.059  1.00 12.56 ? 41   ARG A C   1 
ATOM   289  O O   . ARG A 1 41  ? 22.054 5.088   -1.651  1.00 15.41 ? 41   ARG A O   1 
ATOM   290  C CB  . ARG A 1 41  ? 20.284 2.342   -1.288  1.00 18.31 ? 41   ARG A CB  1 
ATOM   291  C CG  . ARG A 1 41  ? 19.871 2.008   -2.713  1.00 23.33 ? 41   ARG A CG  1 
ATOM   292  C CD  . ARG A 1 41  ? 18.537 1.327   -2.760  1.00 21.74 ? 41   ARG A CD  1 
ATOM   293  N NE  . ARG A 1 41  ? 18.602 0.003   -2.159  1.00 23.43 ? 41   ARG A NE  1 
ATOM   294  C CZ  . ARG A 1 41  ? 17.557 -0.633  -1.640  1.00 26.86 ? 41   ARG A CZ  1 
ATOM   295  N NH1 . ARG A 1 41  ? 16.348 -0.063  -1.646  1.00 29.52 ? 41   ARG A NH1 1 
ATOM   296  N NH2 . ARG A 1 41  ? 17.732 -1.817  -1.072  1.00 26.42 ? 41   ARG A NH2 1 
ATOM   297  N N   . ASP A 1 42  ? 22.316 3.590   -3.320  1.00 13.49 ? 42   ASP A N   1 
ATOM   298  C CA  . ASP A 1 42  ? 22.584 4.574   -4.371  1.00 11.69 ? 42   ASP A CA  1 
ATOM   299  C C   . ASP A 1 42  ? 21.289 5.245   -4.847  1.00 14.96 ? 42   ASP A C   1 
ATOM   300  O O   . ASP A 1 42  ? 20.197 4.678   -4.740  1.00 14.60 ? 42   ASP A O   1 
ATOM   301  C CB  . ASP A 1 42  ? 23.219 3.903   -5.593  1.00 13.20 ? 42   ASP A CB  1 
ATOM   302  C CG  . ASP A 1 42  ? 24.654 3.474   -5.370  1.00 14.89 ? 42   ASP A CG  1 
ATOM   303  O OD1 . ASP A 1 42  ? 25.134 3.376   -4.214  1.00 13.14 ? 42   ASP A OD1 1 
ATOM   304  O OD2 . ASP A 1 42  ? 25.324 3.225   -6.390  1.00 12.02 ? 42   ASP A OD2 1 
ATOM   305  N N   . PHE A 1 43  ? 21.437 6.425   -5.447  1.00 15.65 ? 43   PHE A N   1 
ATOM   306  C CA  . PHE A 1 43  ? 20.314 7.205   -5.977  1.00 13.72 ? 43   PHE A CA  1 
ATOM   307  C C   . PHE A 1 43  ? 19.288 7.537   -4.904  1.00 14.83 ? 43   PHE A C   1 
ATOM   308  O O   . PHE A 1 43  ? 18.085 7.322   -5.065  1.00 13.02 ? 43   PHE A O   1 
ATOM   309  C CB  . PHE A 1 43  ? 19.652 6.481   -7.160  1.00 11.05 ? 43   PHE A CB  1 
ATOM   310  C CG  . PHE A 1 43  ? 20.615 6.128   -8.270  1.00 13.88 ? 43   PHE A CG  1 
ATOM   311  C CD1 . PHE A 1 43  ? 21.129 7.116   -9.102  1.00 9.91  ? 43   PHE A CD1 1 
ATOM   312  C CD2 . PHE A 1 43  ? 21.017 4.807   -8.471  1.00 10.61 ? 43   PHE A CD2 1 
ATOM   313  C CE1 . PHE A 1 43  ? 22.025 6.801   -10.112 1.00 12.68 ? 43   PHE A CE1 1 
ATOM   314  C CE2 . PHE A 1 43  ? 21.912 4.482   -9.477  1.00 8.93  ? 43   PHE A CE2 1 
ATOM   315  C CZ  . PHE A 1 43  ? 22.418 5.475   -10.299 1.00 11.17 ? 43   PHE A CZ  1 
ATOM   316  N N   . THR A 1 44  ? 19.806 8.041   -3.786  1.00 13.74 ? 44   THR A N   1 
ATOM   317  C CA  . THR A 1 44  ? 19.021 8.435   -2.638  1.00 12.50 ? 44   THR A CA  1 
ATOM   318  C C   . THR A 1 44  ? 19.262 9.929   -2.491  1.00 12.84 ? 44   THR A C   1 
ATOM   319  O O   . THR A 1 44  ? 20.381 10.400  -2.646  1.00 13.75 ? 44   THR A O   1 
ATOM   320  C CB  . THR A 1 44  ? 19.464 7.664   -1.383  1.00 14.24 ? 44   THR A CB  1 
ATOM   321  O OG1 . THR A 1 44  ? 20.892 7.595   -1.346  1.00 22.82 ? 44   THR A OG1 1 
ATOM   322  C CG2 . THR A 1 44  ? 18.890 6.256   -1.377  1.00 13.50 ? 44   THR A CG2 1 
ATOM   323  N N   . PRO A 1 45  ? 18.223 10.687  -2.115  1.00 12.89 ? 45   PRO A N   1 
ATOM   324  C CA  . PRO A 1 45  ? 18.347 12.138  -1.966  1.00 12.10 ? 45   PRO A CA  1 
ATOM   325  C C   . PRO A 1 45  ? 19.353 12.728  -0.959  1.00 11.43 ? 45   PRO A C   1 
ATOM   326  O O   . PRO A 1 45  ? 20.224 13.507  -1.345  1.00 11.83 ? 45   PRO A O   1 
ATOM   327  C CB  . PRO A 1 45  ? 16.892 12.575  -1.715  1.00 16.15 ? 45   PRO A CB  1 
ATOM   328  C CG  . PRO A 1 45  ? 16.276 11.391  -1.055  1.00 8.08  ? 45   PRO A CG  1 
ATOM   329  C CD  . PRO A 1 45  ? 16.849 10.233  -1.825  1.00 10.07 ? 45   PRO A CD  1 
ATOM   330  N N   . VAL A 1 46  ? 19.220 12.396  0.316   1.00 11.86 ? 46   VAL A N   1 
ATOM   331  C CA  . VAL A 1 46  ? 20.123 12.924  1.344   1.00 13.91 ? 46   VAL A CA  1 
ATOM   332  C C   . VAL A 1 46  ? 21.563 12.469  1.123   1.00 13.50 ? 46   VAL A C   1 
ATOM   333  O O   . VAL A 1 46  ? 22.485 13.271  1.205   1.00 15.76 ? 46   VAL A O   1 
ATOM   334  C CB  . VAL A 1 46  ? 19.640 12.564  2.778   1.00 14.12 ? 46   VAL A CB  1 
ATOM   335  C CG1 . VAL A 1 46  ? 20.672 12.985  3.834   1.00 8.59  ? 46   VAL A CG1 1 
ATOM   336  C CG2 . VAL A 1 46  ? 18.294 13.241  3.061   1.00 10.68 ? 46   VAL A CG2 1 
HETATM 337  N N   . CSO A 1 47  ? 21.740 11.188  0.820   1.00 13.88 ? 47   CSO A N   1 
HETATM 338  C CA  . CSO A 1 47  ? 23.065 10.635  0.566   1.00 14.88 ? 47   CSO A CA  1 
HETATM 339  C CB  . CSO A 1 47  ? 22.979 9.122   0.325   1.00 18.84 ? 47   CSO A CB  1 
HETATM 340  S SG  . CSO A 1 47  ? 22.370 8.149   1.753   1.00 20.02 ? 47   CSO A SG  1 
HETATM 341  C C   . CSO A 1 47  ? 23.740 11.327  -0.620  1.00 11.90 ? 47   CSO A C   1 
HETATM 342  O O   . CSO A 1 47  ? 24.940 11.578  -0.576  1.00 14.60 ? 47   CSO A O   1 
HETATM 343  O OD  . CSO A 1 47  ? 20.716 8.566   1.747   1.00 16.88 ? 47   CSO A OD  1 
ATOM   344  N N   . THR A 1 48  ? 22.983 11.638  -1.672  1.00 10.81 ? 48   THR A N   1 
ATOM   345  C CA  . THR A 1 48  ? 23.555 12.334  -2.828  1.00 12.66 ? 48   THR A CA  1 
ATOM   346  C C   . THR A 1 48  ? 24.060 13.739  -2.450  1.00 12.05 ? 48   THR A C   1 
ATOM   347  O O   . THR A 1 48  ? 25.132 14.165  -2.900  1.00 12.00 ? 48   THR A O   1 
ATOM   348  C CB  . THR A 1 48  ? 22.535 12.465  -3.992  1.00 13.57 ? 48   THR A CB  1 
ATOM   349  O OG1 . THR A 1 48  ? 22.173 11.165  -4.453  1.00 15.78 ? 48   THR A OG1 1 
ATOM   350  C CG2 . THR A 1 48  ? 23.123 13.249  -5.167  1.00 10.53 ? 48   THR A CG2 1 
ATOM   351  N N   . THR A 1 49  ? 23.323 14.441  -1.596  1.00 11.68 ? 49   THR A N   1 
ATOM   352  C CA  . THR A 1 49  ? 23.738 15.781  -1.206  1.00 9.12  ? 49   THR A CA  1 
ATOM   353  C C   . THR A 1 49  ? 25.007 15.732  -0.368  1.00 10.97 ? 49   THR A C   1 
ATOM   354  O O   . THR A 1 49  ? 25.912 16.543  -0.563  1.00 12.79 ? 49   THR A O   1 
ATOM   355  C CB  . THR A 1 49  ? 22.609 16.550  -0.482  1.00 7.05  ? 49   THR A CB  1 
ATOM   356  O OG1 . THR A 1 49  ? 22.379 15.987  0.820   1.00 11.13 ? 49   THR A OG1 1 
ATOM   357  C CG2 . THR A 1 49  ? 21.317 16.485  -1.295  1.00 8.05  ? 49   THR A CG2 1 
ATOM   358  N N   . GLU A 1 50  ? 25.102 14.740  0.514   1.00 13.56 ? 50   GLU A N   1 
ATOM   359  C CA  . GLU A 1 50  ? 26.279 14.574  1.374   1.00 14.30 ? 50   GLU A CA  1 
ATOM   360  C C   . GLU A 1 50  ? 27.527 14.217  0.588   1.00 14.28 ? 50   GLU A C   1 
ATOM   361  O O   . GLU A 1 50  ? 28.624 14.700  0.892   1.00 15.49 ? 50   GLU A O   1 
ATOM   362  C CB  . GLU A 1 50  ? 26.034 13.497  2.431   1.00 12.56 ? 50   GLU A CB  1 
ATOM   363  C CG  . GLU A 1 50  ? 24.871 13.779  3.357   1.00 11.27 ? 50   GLU A CG  1 
ATOM   364  C CD  . GLU A 1 50  ? 24.498 12.592  4.195   1.00 6.52  ? 50   GLU A CD  1 
ATOM   365  O OE1 . GLU A 1 50  ? 24.694 11.437  3.768   1.00 14.49 ? 50   GLU A OE1 1 
ATOM   366  O OE2 . GLU A 1 50  ? 23.992 12.783  5.306   1.00 12.58 ? 50   GLU A OE2 1 
ATOM   367  N N   . LEU A 1 51  ? 27.364 13.335  -0.392  1.00 13.00 ? 51   LEU A N   1 
ATOM   368  C CA  . LEU A 1 51  ? 28.470 12.901  -1.236  1.00 12.19 ? 51   LEU A CA  1 
ATOM   369  C C   . LEU A 1 51  ? 28.934 14.044  -2.120  1.00 9.74  ? 51   LEU A C   1 
ATOM   370  O O   . LEU A 1 51  ? 30.126 14.180  -2.396  1.00 8.56  ? 51   LEU A O   1 
ATOM   371  C CB  . LEU A 1 51  ? 28.056 11.676  -2.054  1.00 13.71 ? 51   LEU A CB  1 
ATOM   372  C CG  . LEU A 1 51  ? 28.680 10.349  -1.609  1.00 19.52 ? 51   LEU A CG  1 
ATOM   373  C CD1 . LEU A 1 51  ? 28.993 10.336  -0.125  1.00 18.98 ? 51   LEU A CD1 1 
ATOM   374  C CD2 . LEU A 1 51  ? 27.782 9.199   -1.988  1.00 18.07 ? 51   LEU A CD2 1 
ATOM   375  N N   . GLY A 1 52  ? 27.990 14.882  -2.539  1.00 12.64 ? 52   GLY A N   1 
ATOM   376  C CA  . GLY A 1 52  ? 28.331 16.034  -3.349  1.00 11.10 ? 52   GLY A CA  1 
ATOM   377  C C   . GLY A 1 52  ? 29.150 17.034  -2.538  1.00 13.79 ? 52   GLY A C   1 
ATOM   378  O O   . GLY A 1 52  ? 30.094 17.641  -3.056  1.00 12.03 ? 52   GLY A O   1 
ATOM   379  N N   . ARG A 1 53  ? 28.776 17.220  -1.270  1.00 9.44  ? 53   ARG A N   1 
ATOM   380  C CA  . ARG A 1 53  ? 29.477 18.131  -0.370  1.00 11.56 ? 53   ARG A CA  1 
ATOM   381  C C   . ARG A 1 53  ? 30.864 17.579  -0.016  1.00 9.52  ? 53   ARG A C   1 
ATOM   382  O O   . ARG A 1 53  ? 31.811 18.336  0.162   1.00 9.82  ? 53   ARG A O   1 
ATOM   383  C CB  . ARG A 1 53  ? 28.644 18.349  0.901   1.00 14.50 ? 53   ARG A CB  1 
ATOM   384  C CG  . ARG A 1 53  ? 29.213 19.372  1.882   1.00 15.40 ? 53   ARG A CG  1 
ATOM   385  C CD  . ARG A 1 53  ? 29.171 20.752  1.285   1.00 15.18 ? 53   ARG A CD  1 
ATOM   386  N NE  . ARG A 1 53  ? 29.806 21.751  2.134   1.00 18.91 ? 53   ARG A NE  1 
ATOM   387  C CZ  . ARG A 1 53  ? 30.671 22.659  1.688   1.00 26.09 ? 53   ARG A CZ  1 
ATOM   388  N NH1 . ARG A 1 53  ? 31.000 22.679  0.402   1.00 26.57 ? 53   ARG A NH1 1 
ATOM   389  N NH2 . ARG A 1 53  ? 31.241 23.521  2.524   1.00 29.06 ? 53   ARG A NH2 1 
ATOM   390  N N   . ALA A 1 54  ? 30.978 16.259  0.099   1.00 13.12 ? 54   ALA A N   1 
ATOM   391  C CA  . ALA A 1 54  ? 32.252 15.613  0.416   1.00 11.61 ? 54   ALA A CA  1 
ATOM   392  C C   . ALA A 1 54  ? 33.231 15.819  -0.742  1.00 12.81 ? 54   ALA A C   1 
ATOM   393  O O   . ALA A 1 54  ? 34.422 16.050  -0.526  1.00 13.82 ? 54   ALA A O   1 
ATOM   394  C CB  . ALA A 1 54  ? 32.042 14.121  0.671   1.00 6.66  ? 54   ALA A CB  1 
ATOM   395  N N   . ALA A 1 55  ? 32.713 15.749  -1.966  1.00 11.93 ? 55   ALA A N   1 
ATOM   396  C CA  . ALA A 1 55  ? 33.509 15.940  -3.176  1.00 12.17 ? 55   ALA A CA  1 
ATOM   397  C C   . ALA A 1 55  ? 34.093 17.357  -3.253  1.00 12.52 ? 55   ALA A C   1 
ATOM   398  O O   . ALA A 1 55  ? 35.257 17.534  -3.602  1.00 13.21 ? 55   ALA A O   1 
ATOM   399  C CB  . ALA A 1 55  ? 32.657 15.623  -4.435  1.00 10.50 ? 55   ALA A CB  1 
ATOM   400  N N   . LYS A 1 56  ? 33.291 18.360  -2.906  1.00 15.64 ? 56   LYS A N   1 
ATOM   401  C CA  . LYS A 1 56  ? 33.749 19.748  -2.933  1.00 18.15 ? 56   LYS A CA  1 
ATOM   402  C C   . LYS A 1 56  ? 34.712 20.040  -1.794  1.00 20.46 ? 56   LYS A C   1 
ATOM   403  O O   . LYS A 1 56  ? 35.566 20.917  -1.901  1.00 24.57 ? 56   LYS A O   1 
ATOM   404  C CB  . LYS A 1 56  ? 32.565 20.713  -2.831  1.00 18.34 ? 56   LYS A CB  1 
ATOM   405  C CG  . LYS A 1 56  ? 31.525 20.516  -3.905  1.00 27.04 ? 56   LYS A CG  1 
ATOM   406  C CD  . LYS A 1 56  ? 31.946 21.102  -5.225  1.00 35.89 ? 56   LYS A CD  1 
ATOM   407  C CE  . LYS A 1 56  ? 31.871 22.609  -5.192  1.00 41.85 ? 56   LYS A CE  1 
ATOM   408  N NZ  . LYS A 1 56  ? 32.095 23.191  -6.547  1.00 52.18 ? 56   LYS A NZ  1 
ATOM   409  N N   . LEU A 1 57  ? 34.576 19.298  -0.704  1.00 17.29 ? 57   LEU A N   1 
ATOM   410  C CA  . LEU A 1 57  ? 35.403 19.504  0.473   1.00 16.28 ? 57   LEU A CA  1 
ATOM   411  C C   . LEU A 1 57  ? 36.663 18.635  0.559   1.00 15.94 ? 57   LEU A C   1 
ATOM   412  O O   . LEU A 1 57  ? 37.521 18.878  1.418   1.00 17.27 ? 57   LEU A O   1 
ATOM   413  C CB  . LEU A 1 57  ? 34.544 19.291  1.716   1.00 16.91 ? 57   LEU A CB  1 
ATOM   414  C CG  . LEU A 1 57  ? 34.538 20.383  2.774   1.00 25.61 ? 57   LEU A CG  1 
ATOM   415  C CD1 . LEU A 1 57  ? 34.581 21.781  2.135   1.00 23.73 ? 57   LEU A CD1 1 
ATOM   416  C CD2 . LEU A 1 57  ? 33.303 20.187  3.650   1.00 22.44 ? 57   LEU A CD2 1 
ATOM   417  N N   . ALA A 1 58  ? 36.791 17.650  -0.333  1.00 13.13 ? 58   ALA A N   1 
ATOM   418  C CA  . ALA A 1 58  ? 37.944 16.738  -0.349  1.00 16.92 ? 58   ALA A CA  1 
ATOM   419  C C   . ALA A 1 58  ? 39.324 17.426  -0.185  1.00 18.12 ? 58   ALA A C   1 
ATOM   420  O O   . ALA A 1 58  ? 40.171 16.937  0.567   1.00 15.85 ? 58   ALA A O   1 
ATOM   421  C CB  . ALA A 1 58  ? 37.916 15.845  -1.589  1.00 16.05 ? 58   ALA A CB  1 
ATOM   422  N N   . PRO A 1 59  ? 39.562 18.569  -0.872  1.00 17.69 ? 59   PRO A N   1 
ATOM   423  C CA  . PRO A 1 59  ? 40.824 19.312  -0.780  1.00 16.32 ? 59   PRO A CA  1 
ATOM   424  C C   . PRO A 1 59  ? 41.149 19.759  0.637   1.00 15.17 ? 59   PRO A C   1 
ATOM   425  O O   . PRO A 1 59  ? 42.310 19.744  1.042   1.00 16.18 ? 59   PRO A O   1 
ATOM   426  C CB  . PRO A 1 59  ? 40.559 20.517  -1.659  1.00 15.20 ? 59   PRO A CB  1 
ATOM   427  C CG  . PRO A 1 59  ? 39.761 19.937  -2.739  1.00 17.34 ? 59   PRO A CG  1 
ATOM   428  C CD  . PRO A 1 59  ? 38.766 19.090  -1.995  1.00 19.99 ? 59   PRO A CD  1 
ATOM   429  N N   . GLU A 1 60  ? 40.121 20.158  1.385   1.00 14.85 ? 60   GLU A N   1 
ATOM   430  C CA  . GLU A 1 60  ? 40.299 20.615  2.763   1.00 14.71 ? 60   GLU A CA  1 
ATOM   431  C C   . GLU A 1 60  ? 40.751 19.502  3.690   1.00 15.86 ? 60   GLU A C   1 
ATOM   432  O O   . GLU A 1 60  ? 41.481 19.728  4.671   1.00 17.23 ? 60   GLU A O   1 
ATOM   433  C CB  . GLU A 1 60  ? 39.008 21.233  3.292   1.00 21.20 ? 60   GLU A CB  1 
ATOM   434  C CG  . GLU A 1 60  ? 38.750 22.632  2.777   1.00 30.56 ? 60   GLU A CG  1 
ATOM   435  C CD  . GLU A 1 60  ? 39.924 23.557  3.031   1.00 37.36 ? 60   GLU A CD  1 
ATOM   436  O OE1 . GLU A 1 60  ? 40.363 23.671  4.204   1.00 37.85 ? 60   GLU A OE1 1 
ATOM   437  O OE2 . GLU A 1 60  ? 40.426 24.152  2.050   1.00 43.82 ? 60   GLU A OE2 1 
ATOM   438  N N   . PHE A 1 61  ? 40.275 18.300  3.408   1.00 12.03 ? 61   PHE A N   1 
ATOM   439  C CA  . PHE A 1 61  ? 40.640 17.155  4.208   1.00 13.31 ? 61   PHE A CA  1 
ATOM   440  C C   . PHE A 1 61  ? 42.007 16.621  3.793   1.00 12.23 ? 61   PHE A C   1 
ATOM   441  O O   . PHE A 1 61  ? 42.814 16.266  4.652   1.00 11.42 ? 61   PHE A O   1 
ATOM   442  C CB  . PHE A 1 61  ? 39.573 16.058  4.091   1.00 16.07 ? 61   PHE A CB  1 
ATOM   443  C CG  . PHE A 1 61  ? 38.291 16.355  4.845   1.00 20.61 ? 61   PHE A CG  1 
ATOM   444  C CD1 . PHE A 1 61  ? 38.216 16.170  6.230   1.00 17.52 ? 61   PHE A CD1 1 
ATOM   445  C CD2 . PHE A 1 61  ? 37.142 16.770  4.160   1.00 18.47 ? 61   PHE A CD2 1 
ATOM   446  C CE1 . PHE A 1 61  ? 37.009 16.389  6.922   1.00 18.10 ? 61   PHE A CE1 1 
ATOM   447  C CE2 . PHE A 1 61  ? 35.942 16.989  4.836   1.00 20.56 ? 61   PHE A CE2 1 
ATOM   448  C CZ  . PHE A 1 61  ? 35.870 16.798  6.222   1.00 16.74 ? 61   PHE A CZ  1 
ATOM   449  N N   . ALA A 1 62  ? 42.265 16.586  2.482   1.00 13.04 ? 62   ALA A N   1 
ATOM   450  C CA  . ALA A 1 62  ? 43.531 16.082  1.922   1.00 12.28 ? 62   ALA A CA  1 
ATOM   451  C C   . ALA A 1 62  ? 44.767 16.824  2.440   1.00 12.46 ? 62   ALA A C   1 
ATOM   452  O O   . ALA A 1 62  ? 45.763 16.201  2.821   1.00 11.29 ? 62   ALA A O   1 
ATOM   453  C CB  . ALA A 1 62  ? 43.489 16.121  0.395   1.00 9.42  ? 62   ALA A CB  1 
ATOM   454  N N   . LYS A 1 63  ? 44.699 18.154  2.469   1.00 13.66 ? 63   LYS A N   1 
ATOM   455  C CA  . LYS A 1 63  ? 45.802 18.961  2.972   1.00 13.57 ? 63   LYS A CA  1 
ATOM   456  C C   . LYS A 1 63  ? 46.014 18.662  4.455   1.00 16.01 ? 63   LYS A C   1 
ATOM   457  O O   . LYS A 1 63  ? 47.009 19.058  5.033   1.00 19.91 ? 63   LYS A O   1 
ATOM   458  C CB  . LYS A 1 63  ? 45.511 20.449  2.782   1.00 18.74 ? 63   LYS A CB  1 
ATOM   459  C CG  . LYS A 1 63  ? 44.383 20.969  3.644   1.00 24.49 ? 63   LYS A CG  1 
ATOM   460  C CD  . LYS A 1 63  ? 43.791 22.247  3.086   1.00 34.51 ? 63   LYS A CD  1 
ATOM   461  C CE  . LYS A 1 63  ? 44.718 23.434  3.240   1.00 40.22 ? 63   LYS A CE  1 
ATOM   462  N NZ  . LYS A 1 63  ? 44.896 23.845  4.668   1.00 47.86 ? 63   LYS A NZ  1 
ATOM   463  N N   . ARG A 1 64  ? 45.046 18.007  5.084   1.00 16.91 ? 64   ARG A N   1 
ATOM   464  C CA  . ARG A 1 64  ? 45.154 17.649  6.486   1.00 15.99 ? 64   ARG A CA  1 
ATOM   465  C C   . ARG A 1 64  ? 45.479 16.171  6.669   1.00 16.78 ? 64   ARG A C   1 
ATOM   466  O O   . ARG A 1 64  ? 45.292 15.620  7.757   1.00 14.48 ? 64   ARG A O   1 
ATOM   467  C CB  . ARG A 1 64  ? 43.876 18.006  7.244   1.00 19.82 ? 64   ARG A CB  1 
ATOM   468  C CG  . ARG A 1 64  ? 43.747 19.486  7.530   1.00 21.21 ? 64   ARG A CG  1 
ATOM   469  C CD  . ARG A 1 64  ? 42.536 19.774  8.384   1.00 20.76 ? 64   ARG A CD  1 
ATOM   470  N NE  . ARG A 1 64  ? 42.495 21.179  8.776   1.00 23.72 ? 64   ARG A NE  1 
ATOM   471  C CZ  . ARG A 1 64  ? 42.111 22.172  7.981   1.00 25.48 ? 64   ARG A CZ  1 
ATOM   472  N NH1 . ARG A 1 64  ? 41.718 21.917  6.727   1.00 28.74 ? 64   ARG A NH1 1 
ATOM   473  N NH2 . ARG A 1 64  ? 42.157 23.423  8.434   1.00 26.37 ? 64   ARG A NH2 1 
ATOM   474  N N   . ASN A 1 65  ? 45.941 15.523  5.600   1.00 12.87 ? 65   ASN A N   1 
ATOM   475  C CA  . ASN A 1 65  ? 46.319 14.113  5.660   1.00 12.07 ? 65   ASN A CA  1 
ATOM   476  C C   . ASN A 1 65  ? 45.124 13.232  6.017   1.00 11.66 ? 65   ASN A C   1 
ATOM   477  O O   . ASN A 1 65  ? 45.250 12.250  6.753   1.00 12.20 ? 65   ASN A O   1 
ATOM   478  C CB  . ASN A 1 65  ? 47.468 13.942  6.669   1.00 15.22 ? 65   ASN A CB  1 
ATOM   479  C CG  . ASN A 1 65  ? 48.132 12.580  6.599   1.00 14.16 ? 65   ASN A CG  1 
ATOM   480  O OD1 . ASN A 1 65  ? 48.389 12.050  5.523   1.00 15.26 ? 65   ASN A OD1 1 
ATOM   481  N ND2 . ASN A 1 65  ? 48.479 12.036  7.762   1.00 14.72 ? 65   ASN A ND2 1 
ATOM   482  N N   . VAL A 1 66  ? 43.951 13.625  5.528   1.00 11.99 ? 66   VAL A N   1 
ATOM   483  C CA  . VAL A 1 66  ? 42.728 12.866  5.752   1.00 12.65 ? 66   VAL A CA  1 
ATOM   484  C C   . VAL A 1 66  ? 42.180 12.361  4.411   1.00 15.22 ? 66   VAL A C   1 
ATOM   485  O O   . VAL A 1 66  ? 41.814 13.153  3.546   1.00 14.73 ? 66   VAL A O   1 
ATOM   486  C CB  . VAL A 1 66  ? 41.642 13.702  6.464   1.00 7.29  ? 66   VAL A CB  1 
ATOM   487  C CG1 . VAL A 1 66  ? 40.354 12.926  6.519   1.00 6.28  ? 66   VAL A CG1 1 
ATOM   488  C CG2 . VAL A 1 66  ? 42.095 14.059  7.861   1.00 2.00  ? 66   VAL A CG2 1 
ATOM   489  N N   . LYS A 1 67  ? 42.171 11.040  4.237   1.00 15.55 ? 67   LYS A N   1 
ATOM   490  C CA  . LYS A 1 67  ? 41.649 10.420  3.030   1.00 14.81 ? 67   LYS A CA  1 
ATOM   491  C C   . LYS A 1 67  ? 40.153 10.140  3.186   1.00 16.77 ? 67   LYS A C   1 
ATOM   492  O O   . LYS A 1 67  ? 39.700 9.690   4.237   1.00 17.86 ? 67   LYS A O   1 
ATOM   493  C CB  . LYS A 1 67  ? 42.371 9.097   2.760   1.00 17.62 ? 67   LYS A CB  1 
ATOM   494  C CG  . LYS A 1 67  ? 43.799 9.239   2.278   1.00 19.29 ? 67   LYS A CG  1 
ATOM   495  C CD  . LYS A 1 67  ? 44.387 7.888   1.963   1.00 19.49 ? 67   LYS A CD  1 
ATOM   496  C CE  . LYS A 1 67  ? 45.812 8.011   1.440   1.00 26.81 ? 67   LYS A CE  1 
ATOM   497  N NZ  . LYS A 1 67  ? 46.395 6.673   1.128   1.00 24.25 ? 67   LYS A NZ  1 
ATOM   498  N N   . LEU A 1 68  ? 39.389 10.375  2.132   1.00 16.87 ? 68   LEU A N   1 
ATOM   499  C CA  . LEU A 1 68  ? 37.954 10.130  2.170   1.00 17.43 ? 68   LEU A CA  1 
ATOM   500  C C   . LEU A 1 68  ? 37.595 8.847   1.430   1.00 14.83 ? 68   LEU A C   1 
ATOM   501  O O   . LEU A 1 68  ? 38.203 8.521   0.411   1.00 12.43 ? 68   LEU A O   1 
ATOM   502  C CB  . LEU A 1 68  ? 37.212 11.306  1.522   1.00 17.89 ? 68   LEU A CB  1 
ATOM   503  C CG  . LEU A 1 68  ? 36.640 12.456  2.349   1.00 20.69 ? 68   LEU A CG  1 
ATOM   504  C CD1 . LEU A 1 68  ? 37.392 12.686  3.647   1.00 18.17 ? 68   LEU A CD1 1 
ATOM   505  C CD2 . LEU A 1 68  ? 36.625 13.702  1.487   1.00 13.29 ? 68   LEU A CD2 1 
ATOM   506  N N   . ILE A 1 69  ? 36.583 8.141   1.921   1.00 12.76 ? 69   ILE A N   1 
ATOM   507  C CA  . ILE A 1 69  ? 36.122 6.922   1.271   1.00 11.62 ? 69   ILE A CA  1 
ATOM   508  C C   . ILE A 1 69  ? 34.648 6.693   1.629   1.00 12.41 ? 69   ILE A C   1 
ATOM   509  O O   . ILE A 1 69  ? 34.230 6.969   2.750   1.00 12.39 ? 69   ILE A O   1 
ATOM   510  C CB  . ILE A 1 69  ? 37.030 5.699   1.639   1.00 7.95  ? 69   ILE A CB  1 
ATOM   511  C CG1 . ILE A 1 69  ? 36.692 4.504   0.758   1.00 5.00  ? 69   ILE A CG1 1 
ATOM   512  C CG2 . ILE A 1 69  ? 36.917 5.335   3.104   1.00 9.16  ? 69   ILE A CG2 1 
ATOM   513  C CD1 . ILE A 1 69  ? 37.647 3.344   0.962   1.00 11.76 ? 69   ILE A CD1 1 
ATOM   514  N N   . ALA A 1 70  ? 33.848 6.270   0.654   1.00 13.84 ? 70   ALA A N   1 
ATOM   515  C CA  . ALA A 1 70  ? 32.422 6.016   0.881   1.00 15.65 ? 70   ALA A CA  1 
ATOM   516  C C   . ALA A 1 70  ? 32.078 4.548   0.646   1.00 13.35 ? 70   ALA A C   1 
ATOM   517  O O   . ALA A 1 70  ? 32.769 3.848   -0.081  1.00 13.51 ? 70   ALA A O   1 
ATOM   518  C CB  . ALA A 1 70  ? 31.561 6.907   -0.025  1.00 6.28  ? 70   ALA A CB  1 
ATOM   519  N N   . LEU A 1 71  ? 31.015 4.086   1.290   1.00 17.02 ? 71   LEU A N   1 
ATOM   520  C CA  . LEU A 1 71  ? 30.541 2.719   1.147   1.00 15.44 ? 71   LEU A CA  1 
ATOM   521  C C   . LEU A 1 71  ? 29.049 2.841   0.937   1.00 14.36 ? 71   LEU A C   1 
ATOM   522  O O   . LEU A 1 71  ? 28.390 3.632   1.602   1.00 12.03 ? 71   LEU A O   1 
ATOM   523  C CB  . LEU A 1 71  ? 30.827 1.896   2.417   1.00 16.32 ? 71   LEU A CB  1 
ATOM   524  C CG  . LEU A 1 71  ? 30.226 0.484   2.565   1.00 13.83 ? 71   LEU A CG  1 
ATOM   525  C CD1 . LEU A 1 71  ? 31.064 -0.338  3.510   1.00 19.64 ? 71   LEU A CD1 1 
ATOM   526  C CD2 . LEU A 1 71  ? 28.802 0.520   3.064   1.00 13.85 ? 71   LEU A CD2 1 
ATOM   527  N N   . SER A 1 72  ? 28.527 2.093   -0.022  1.00 14.30 ? 72   SER A N   1 
ATOM   528  C CA  . SER A 1 72  ? 27.103 2.116   -0.299  1.00 15.22 ? 72   SER A CA  1 
ATOM   529  C C   . SER A 1 72  ? 26.731 0.715   -0.689  1.00 13.57 ? 72   SER A C   1 
ATOM   530  O O   . SER A 1 72  ? 27.500 0.022   -1.356  1.00 18.15 ? 72   SER A O   1 
ATOM   531  C CB  . SER A 1 72  ? 26.758 3.092   -1.427  1.00 14.32 ? 72   SER A CB  1 
ATOM   532  O OG  . SER A 1 72  ? 25.350 3.269   -1.513  1.00 9.96  ? 72   SER A OG  1 
ATOM   533  N N   . ILE A 1 73  ? 25.558 0.289   -0.249  1.00 15.78 ? 73   ILE A N   1 
ATOM   534  C CA  . ILE A 1 73  ? 25.081 -1.053  -0.531  1.00 16.35 ? 73   ILE A CA  1 
ATOM   535  C C   . ILE A 1 73  ? 24.472 -1.166  -1.922  1.00 17.52 ? 73   ILE A C   1 
ATOM   536  O O   . ILE A 1 73  ? 23.267 -1.162  -2.081  1.00 22.90 ? 73   ILE A O   1 
ATOM   537  C CB  . ILE A 1 73  ? 24.114 -1.531  0.580   1.00 12.85 ? 73   ILE A CB  1 
ATOM   538  C CG1 . ILE A 1 73  ? 24.807 -1.358  1.942   1.00 14.03 ? 73   ILE A CG1 1 
ATOM   539  C CG2 . ILE A 1 73  ? 23.743 -2.978  0.373   1.00 11.60 ? 73   ILE A CG2 1 
ATOM   540  C CD1 . ILE A 1 73  ? 24.067 -1.941  3.126   1.00 17.58 ? 73   ILE A CD1 1 
ATOM   541  N N   . ASP A 1 74  ? 25.341 -1.245  -2.925  1.00 17.42 ? 74   ASP A N   1 
ATOM   542  C CA  . ASP A 1 74  ? 24.946 -1.366  -4.326  1.00 17.43 ? 74   ASP A CA  1 
ATOM   543  C C   . ASP A 1 74  ? 26.168 -1.724  -5.156  1.00 17.22 ? 74   ASP A C   1 
ATOM   544  O O   . ASP A 1 74  ? 27.293 -1.695  -4.656  1.00 15.51 ? 74   ASP A O   1 
ATOM   545  C CB  . ASP A 1 74  ? 24.337 -0.059  -4.859  1.00 16.78 ? 74   ASP A CB  1 
ATOM   546  C CG  . ASP A 1 74  ? 22.813 -0.052  -4.810  1.00 18.04 ? 74   ASP A CG  1 
ATOM   547  O OD1 . ASP A 1 74  ? 22.174 -1.102  -5.044  1.00 22.61 ? 74   ASP A OD1 1 
ATOM   548  O OD2 . ASP A 1 74  ? 22.237 1.010   -4.514  1.00 18.77 ? 74   ASP A OD2 1 
ATOM   549  N N   . SER A 1 75  ? 25.935 -2.061  -6.420  1.00 20.14 ? 75   SER A N   1 
ATOM   550  C CA  . SER A 1 75  ? 26.987 -2.439  -7.369  1.00 21.15 ? 75   SER A CA  1 
ATOM   551  C C   . SER A 1 75  ? 27.961 -1.319  -7.713  1.00 18.74 ? 75   SER A C   1 
ATOM   552  O O   . SER A 1 75  ? 27.610 -0.136  -7.658  1.00 18.95 ? 75   SER A O   1 
ATOM   553  C CB  . SER A 1 75  ? 26.348 -2.925  -8.681  1.00 20.77 ? 75   SER A CB  1 
ATOM   554  O OG  . SER A 1 75  ? 25.962 -4.285  -8.592  1.00 37.09 ? 75   SER A OG  1 
ATOM   555  N N   . VAL A 1 76  ? 29.186 -1.681  -8.082  1.00 16.56 ? 76   VAL A N   1 
ATOM   556  C CA  . VAL A 1 76  ? 30.159 -0.676  -8.492  1.00 16.27 ? 76   VAL A CA  1 
ATOM   557  C C   . VAL A 1 76  ? 29.632 -0.028  -9.778  1.00 15.14 ? 76   VAL A C   1 
ATOM   558  O O   . VAL A 1 76  ? 29.819 1.164   -9.997  1.00 14.82 ? 76   VAL A O   1 
ATOM   559  C CB  . VAL A 1 76  ? 31.600 -1.260  -8.676  1.00 13.56 ? 76   VAL A CB  1 
ATOM   560  C CG1 . VAL A 1 76  ? 31.604 -2.393  -9.644  1.00 19.95 ? 76   VAL A CG1 1 
ATOM   561  C CG2 . VAL A 1 76  ? 32.543 -0.191  -9.150  1.00 16.73 ? 76   VAL A CG2 1 
ATOM   562  N N   . GLU A 1 77  ? 28.909 -0.785  -10.599 1.00 18.13 ? 77   GLU A N   1 
ATOM   563  C CA  . GLU A 1 77  ? 28.337 -0.215  -11.819 1.00 19.58 ? 77   GLU A CA  1 
ATOM   564  C C   . GLU A 1 77  ? 27.377 0.923   -11.474 1.00 17.61 ? 77   GLU A C   1 
ATOM   565  O O   . GLU A 1 77  ? 27.432 1.999   -12.072 1.00 15.96 ? 77   GLU A O   1 
ATOM   566  C CB  . GLU A 1 77  ? 27.609 -1.279  -12.635 1.00 26.84 ? 77   GLU A CB  1 
ATOM   567  C CG  . GLU A 1 77  ? 28.460 -1.940  -13.698 1.00 41.01 ? 77   GLU A CG  1 
ATOM   568  C CD  . GLU A 1 77  ? 27.624 -2.421  -14.885 1.00 53.64 ? 77   GLU A CD  1 
ATOM   569  O OE1 . GLU A 1 77  ? 26.970 -1.571  -15.538 1.00 58.70 ? 77   GLU A OE1 1 
ATOM   570  O OE2 . GLU A 1 77  ? 27.617 -3.642  -15.173 1.00 60.05 ? 77   GLU A OE2 1 
ATOM   571  N N   . ASP A 1 78  ? 26.517 0.689   -10.485 1.00 18.48 ? 78   ASP A N   1 
ATOM   572  C CA  . ASP A 1 78  ? 25.565 1.697   -10.039 1.00 18.98 ? 78   ASP A CA  1 
ATOM   573  C C   . ASP A 1 78  ? 26.297 2.856   -9.408  1.00 16.65 ? 78   ASP A C   1 
ATOM   574  O O   . ASP A 1 78  ? 25.930 4.011   -9.622  1.00 16.76 ? 78   ASP A O   1 
ATOM   575  C CB  . ASP A 1 78  ? 24.574 1.109   -9.052  1.00 19.09 ? 78   ASP A CB  1 
ATOM   576  C CG  . ASP A 1 78  ? 23.424 0.407   -9.738  1.00 27.72 ? 78   ASP A CG  1 
ATOM   577  O OD1 . ASP A 1 78  ? 23.174 0.675   -10.941 1.00 32.76 ? 78   ASP A OD1 1 
ATOM   578  O OD2 . ASP A 1 78  ? 22.760 -0.405  -9.074  1.00 25.17 ? 78   ASP A OD2 1 
ATOM   579  N N   . HIS A 1 79  ? 27.346 2.541   -8.646  1.00 17.69 ? 79   HIS A N   1 
ATOM   580  C CA  . HIS A 1 79  ? 28.169 3.561   -8.000  1.00 12.20 ? 79   HIS A CA  1 
ATOM   581  C C   . HIS A 1 79  ? 28.683 4.525   -9.064  1.00 11.72 ? 79   HIS A C   1 
ATOM   582  O O   . HIS A 1 79  ? 28.651 5.733   -8.867  1.00 15.78 ? 79   HIS A O   1 
ATOM   583  C CB  . HIS A 1 79  ? 29.367 2.937   -7.270  1.00 8.44  ? 79   HIS A CB  1 
ATOM   584  C CG  . HIS A 1 79  ? 29.013 2.216   -6.003  1.00 11.03 ? 79   HIS A CG  1 
ATOM   585  N ND1 . HIS A 1 79  ? 27.753 2.242   -5.448  1.00 10.23 ? 79   HIS A ND1 1 
ATOM   586  C CD2 . HIS A 1 79  ? 29.761 1.437   -5.189  1.00 11.79 ? 79   HIS A CD2 1 
ATOM   587  C CE1 . HIS A 1 79  ? 27.739 1.513   -4.350  1.00 11.22 ? 79   HIS A CE1 1 
ATOM   588  N NE2 . HIS A 1 79  ? 28.946 1.012   -4.170  1.00 10.02 ? 79   HIS A NE2 1 
ATOM   589  N N   . LEU A 1 80  ? 29.107 3.983   -10.206 1.00 11.17 ? 80   LEU A N   1 
ATOM   590  C CA  . LEU A 1 80  ? 29.637 4.791   -11.303 1.00 13.14 ? 80   LEU A CA  1 
ATOM   591  C C   . LEU A 1 80  ? 28.568 5.686   -11.912 1.00 15.23 ? 80   LEU A C   1 
ATOM   592  O O   . LEU A 1 80  ? 28.794 6.871   -12.159 1.00 18.32 ? 80   LEU A O   1 
ATOM   593  C CB  . LEU A 1 80  ? 30.265 3.892   -12.378 1.00 15.80 ? 80   LEU A CB  1 
ATOM   594  C CG  . LEU A 1 80  ? 31.569 3.186   -11.968 1.00 17.35 ? 80   LEU A CG  1 
ATOM   595  C CD1 . LEU A 1 80  ? 31.976 2.131   -12.984 1.00 18.87 ? 80   LEU A CD1 1 
ATOM   596  C CD2 . LEU A 1 80  ? 32.675 4.207   -11.795 1.00 16.19 ? 80   LEU A CD2 1 
ATOM   597  N N   . ALA A 1 81  ? 27.384 5.128   -12.129 1.00 16.42 ? 81   ALA A N   1 
ATOM   598  C CA  . ALA A 1 81  ? 26.300 5.910   -12.701 1.00 15.52 ? 81   ALA A CA  1 
ATOM   599  C C   . ALA A 1 81  ? 25.851 6.977   -11.703 1.00 16.78 ? 81   ALA A C   1 
ATOM   600  O O   . ALA A 1 81  ? 25.585 8.121   -12.085 1.00 18.96 ? 81   ALA A O   1 
ATOM   601  C CB  . ALA A 1 81  ? 25.141 4.999   -13.079 1.00 15.41 ? 81   ALA A CB  1 
ATOM   602  N N   . TRP A 1 82  ? 25.837 6.614   -10.419 1.00 15.61 ? 82   TRP A N   1 
ATOM   603  C CA  . TRP A 1 82  ? 25.438 7.520   -9.341  1.00 12.35 ? 82   TRP A CA  1 
ATOM   604  C C   . TRP A 1 82  ? 26.424 8.671   -9.220  1.00 11.80 ? 82   TRP A C   1 
ATOM   605  O O   . TRP A 1 82  ? 26.065 9.769   -8.790  1.00 15.09 ? 82   TRP A O   1 
ATOM   606  C CB  . TRP A 1 82  ? 25.357 6.763   -8.010  1.00 11.52 ? 82   TRP A CB  1 
ATOM   607  C CG  . TRP A 1 82  ? 24.738 7.562   -6.878  1.00 13.28 ? 82   TRP A CG  1 
ATOM   608  C CD1 . TRP A 1 82  ? 23.802 8.558   -6.990  1.00 15.21 ? 82   TRP A CD1 1 
ATOM   609  C CD2 . TRP A 1 82  ? 24.969 7.387   -5.471  1.00 10.35 ? 82   TRP A CD2 1 
ATOM   610  N NE1 . TRP A 1 82  ? 23.432 8.999   -5.742  1.00 15.67 ? 82   TRP A NE1 1 
ATOM   611  C CE2 . TRP A 1 82  ? 24.130 8.297   -4.794  1.00 10.91 ? 82   TRP A CE2 1 
ATOM   612  C CE3 . TRP A 1 82  ? 25.796 6.542   -4.719  1.00 9.60  ? 82   TRP A CE3 1 
ATOM   613  C CZ2 . TRP A 1 82  ? 24.088 8.379   -3.401  1.00 12.48 ? 82   TRP A CZ2 1 
ATOM   614  C CZ3 . TRP A 1 82  ? 25.751 6.625   -3.338  1.00 7.53  ? 82   TRP A CZ3 1 
ATOM   615  C CH2 . TRP A 1 82  ? 24.903 7.535   -2.693  1.00 11.05 ? 82   TRP A CH2 1 
ATOM   616  N N   . SER A 1 83  ? 27.669 8.423   -9.604  1.00 13.54 ? 83   SER A N   1 
ATOM   617  C CA  . SER A 1 83  ? 28.707 9.442   -9.545  1.00 13.96 ? 83   SER A CA  1 
ATOM   618  C C   . SER A 1 83  ? 28.478 10.581  -10.530 1.00 13.05 ? 83   SER A C   1 
ATOM   619  O O   . SER A 1 83  ? 28.815 11.734  -10.255 1.00 10.05 ? 83   SER A O   1 
ATOM   620  C CB  . SER A 1 83  ? 30.065 8.795   -9.753  1.00 11.86 ? 83   SER A CB  1 
ATOM   621  O OG  . SER A 1 83  ? 30.296 7.934   -8.671  1.00 16.04 ? 83   SER A OG  1 
ATOM   622  N N   . LYS A 1 84  ? 27.859 10.264  -11.659 1.00 13.88 ? 84   LYS A N   1 
ATOM   623  C CA  . LYS A 1 84  ? 27.558 11.281  -12.645 1.00 13.47 ? 84   LYS A CA  1 
ATOM   624  C C   . LYS A 1 84  ? 26.498 12.210  -12.061 1.00 13.63 ? 84   LYS A C   1 
ATOM   625  O O   . LYS A 1 84  ? 26.560 13.420  -12.252 1.00 12.65 ? 84   LYS A O   1 
ATOM   626  C CB  . LYS A 1 84  ? 27.086 10.634  -13.940 1.00 13.58 ? 84   LYS A CB  1 
ATOM   627  C CG  . LYS A 1 84  ? 28.112 9.669   -14.500 1.00 20.70 ? 84   LYS A CG  1 
ATOM   628  C CD  . LYS A 1 84  ? 27.928 9.442   -15.978 1.00 33.21 ? 84   LYS A CD  1 
ATOM   629  C CE  . LYS A 1 84  ? 26.545 8.902   -16.287 1.00 41.65 ? 84   LYS A CE  1 
ATOM   630  N NZ  . LYS A 1 84  ? 26.421 8.534   -17.728 1.00 46.28 ? 84   LYS A NZ  1 
ATOM   631  N N   . ASP A 1 85  ? 25.536 11.635  -11.341 1.00 13.12 ? 85   ASP A N   1 
ATOM   632  C CA  . ASP A 1 85  ? 24.477 12.406  -10.682 1.00 15.73 ? 85   ASP A CA  1 
ATOM   633  C C   . ASP A 1 85  ? 25.079 13.289  -9.598  1.00 12.22 ? 85   ASP A C   1 
ATOM   634  O O   . ASP A 1 85  ? 24.710 14.455  -9.451  1.00 15.04 ? 85   ASP A O   1 
ATOM   635  C CB  . ASP A 1 85  ? 23.428 11.479  -10.043 1.00 18.30 ? 85   ASP A CB  1 
ATOM   636  C CG  . ASP A 1 85  ? 22.427 10.925  -11.043 1.00 16.50 ? 85   ASP A CG  1 
ATOM   637  O OD1 . ASP A 1 85  ? 22.602 11.098  -12.268 1.00 21.76 ? 85   ASP A OD1 1 
ATOM   638  O OD2 . ASP A 1 85  ? 21.443 10.303  -10.596 1.00 18.14 ? 85   ASP A OD2 1 
ATOM   639  N N   . ILE A 1 86  ? 25.982 12.716  -8.811  1.00 14.79 ? 86   ILE A N   1 
ATOM   640  C CA  . ILE A 1 86  ? 26.660 13.448  -7.747  1.00 15.17 ? 86   ILE A CA  1 
ATOM   641  C C   . ILE A 1 86  ? 27.421 14.668  -8.314  1.00 18.13 ? 86   ILE A C   1 
ATOM   642  O O   . ILE A 1 86  ? 27.395 15.746  -7.715  1.00 16.71 ? 86   ILE A O   1 
ATOM   643  C CB  . ILE A 1 86  ? 27.597 12.505  -6.941  1.00 11.83 ? 86   ILE A CB  1 
ATOM   644  C CG1 . ILE A 1 86  ? 26.748 11.497  -6.154  1.00 11.74 ? 86   ILE A CG1 1 
ATOM   645  C CG2 . ILE A 1 86  ? 28.471 13.304  -6.003  1.00 11.09 ? 86   ILE A CG2 1 
ATOM   646  C CD1 . ILE A 1 86  ? 27.494 10.287  -5.664  1.00 4.11  ? 86   ILE A CD1 1 
ATOM   647  N N   . ASN A 1 87  ? 28.074 14.502  -9.470  1.00 14.26 ? 87   ASN A N   1 
ATOM   648  C CA  . ASN A 1 87  ? 28.791 15.598  -10.124 1.00 10.78 ? 87   ASN A CA  1 
ATOM   649  C C   . ASN A 1 87  ? 27.813 16.640  -10.629 1.00 9.01  ? 87   ASN A C   1 
ATOM   650  O O   . ASN A 1 87  ? 28.050 17.837  -10.511 1.00 11.76 ? 87   ASN A O   1 
ATOM   651  C CB  . ASN A 1 87  ? 29.603 15.087  -11.307 1.00 13.47 ? 87   ASN A CB  1 
ATOM   652  C CG  . ASN A 1 87  ? 30.978 14.647  -10.910 1.00 14.93 ? 87   ASN A CG  1 
ATOM   653  O OD1 . ASN A 1 87  ? 31.427 13.563  -11.272 1.00 18.28 ? 87   ASN A OD1 1 
ATOM   654  N ND2 . ASN A 1 87  ? 31.661 15.479  -10.153 1.00 16.26 ? 87   ASN A ND2 1 
ATOM   655  N N   . ALA A 1 88  ? 26.721 16.170  -11.219 1.00 13.33 ? 88   ALA A N   1 
ATOM   656  C CA  . ALA A 1 88  ? 25.675 17.036  -11.745 1.00 14.74 ? 88   ALA A CA  1 
ATOM   657  C C   . ALA A 1 88  ? 25.036 17.820  -10.614 1.00 14.57 ? 88   ALA A C   1 
ATOM   658  O O   . ALA A 1 88  ? 24.631 18.965  -10.804 1.00 15.11 ? 88   ALA A O   1 
ATOM   659  C CB  . ALA A 1 88  ? 24.619 16.213  -12.485 1.00 14.59 ? 88   ALA A CB  1 
ATOM   660  N N   . TYR A 1 89  ? 24.924 17.194  -9.448  1.00 12.92 ? 89   TYR A N   1 
ATOM   661  C CA  . TYR A 1 89  ? 24.362 17.849  -8.275  1.00 16.42 ? 89   TYR A CA  1 
ATOM   662  C C   . TYR A 1 89  ? 25.257 19.049  -7.914  1.00 15.52 ? 89   TYR A C   1 
ATOM   663  O O   . TYR A 1 89  ? 24.760 20.086  -7.474  1.00 17.20 ? 89   TYR A O   1 
ATOM   664  C CB  . TYR A 1 89  ? 24.256 16.860  -7.093  1.00 14.75 ? 89   TYR A CB  1 
ATOM   665  C CG  . TYR A 1 89  ? 24.104 17.527  -5.730  1.00 15.62 ? 89   TYR A CG  1 
ATOM   666  C CD1 . TYR A 1 89  ? 22.852 17.950  -5.268  1.00 16.13 ? 89   TYR A CD1 1 
ATOM   667  C CD2 . TYR A 1 89  ? 25.220 17.776  -4.923  1.00 10.33 ? 89   TYR A CD2 1 
ATOM   668  C CE1 . TYR A 1 89  ? 22.718 18.615  -4.038  1.00 10.52 ? 89   TYR A CE1 1 
ATOM   669  C CE2 . TYR A 1 89  ? 25.096 18.435  -3.698  1.00 12.69 ? 89   TYR A CE2 1 
ATOM   670  C CZ  . TYR A 1 89  ? 23.842 18.856  -3.262  1.00 13.98 ? 89   TYR A CZ  1 
ATOM   671  O OH  . TYR A 1 89  ? 23.724 19.538  -2.065  1.00 15.40 ? 89   TYR A OH  1 
ATOM   672  N N   . ASN A 1 90  ? 26.564 18.895  -8.120  1.00 17.67 ? 90   ASN A N   1 
ATOM   673  C CA  . ASN A 1 90  ? 27.555 19.946  -7.838  1.00 18.02 ? 90   ASN A CA  1 
ATOM   674  C C   . ASN A 1 90  ? 27.714 20.874  -9.015  1.00 20.41 ? 90   ASN A C   1 
ATOM   675  O O   . ASN A 1 90  ? 28.583 21.739  -9.007  1.00 23.01 ? 90   ASN A O   1 
ATOM   676  C CB  . ASN A 1 90  ? 28.923 19.336  -7.554  1.00 16.47 ? 90   ASN A CB  1 
ATOM   677  C CG  . ASN A 1 90  ? 29.019 18.764  -6.186  1.00 17.14 ? 90   ASN A CG  1 
ATOM   678  O OD1 . ASN A 1 90  ? 28.302 19.192  -5.277  1.00 18.52 ? 90   ASN A OD1 1 
ATOM   679  N ND2 . ASN A 1 90  ? 29.921 17.822  -5.999  1.00 15.42 ? 90   ASN A ND2 1 
ATOM   680  N N   . SER A 1 91  ? 26.887 20.672  -10.033 1.00 23.11 ? 91   SER A N   1 
ATOM   681  C CA  . SER A 1 91  ? 26.925 21.460  -11.249 1.00 25.31 ? 91   SER A CA  1 
ATOM   682  C C   . SER A 1 91  ? 28.254 21.354  -11.966 1.00 27.59 ? 91   SER A C   1 
ATOM   683  O O   . SER A 1 91  ? 28.717 22.318  -12.563 1.00 28.84 ? 91   SER A O   1 
ATOM   684  C CB  . SER A 1 91  ? 26.585 22.919  -10.966 1.00 27.13 ? 91   SER A CB  1 
ATOM   685  O OG  . SER A 1 91  ? 25.236 23.031  -10.560 1.00 35.53 ? 91   SER A OG  1 
ATOM   686  N N   . GLU A 1 92  ? 28.885 20.191  -11.874 1.00 29.75 ? 92   GLU A N   1 
ATOM   687  C CA  . GLU A 1 92  ? 30.142 19.957  -12.568 1.00 35.43 ? 92   GLU A CA  1 
ATOM   688  C C   . GLU A 1 92  ? 29.833 18.983  -13.705 1.00 35.10 ? 92   GLU A C   1 
ATOM   689  O O   . GLU A 1 92  ? 28.718 18.450  -13.767 1.00 35.15 ? 92   GLU A O   1 
ATOM   690  C CB  . GLU A 1 92  ? 31.191 19.371  -11.615 1.00 39.54 ? 92   GLU A CB  1 
ATOM   691  C CG  . GLU A 1 92  ? 32.189 20.405  -11.079 1.00 53.49 ? 92   GLU A CG  1 
ATOM   692  C CD  . GLU A 1 92  ? 32.019 20.708  -9.593  1.00 62.13 ? 92   GLU A CD  1 
ATOM   693  O OE1 . GLU A 1 92  ? 31.801 19.762  -8.808  1.00 68.57 ? 92   GLU A OE1 1 
ATOM   694  O OE2 . GLU A 1 92  ? 32.128 21.898  -9.195  1.00 70.33 ? 92   GLU A OE2 1 
ATOM   695  N N   . GLU A 1 93  ? 30.779 18.784  -14.624 1.00 34.78 ? 93   GLU A N   1 
ATOM   696  C CA  . GLU A 1 93  ? 30.577 17.852  -15.735 1.00 32.26 ? 93   GLU A CA  1 
ATOM   697  C C   . GLU A 1 93  ? 30.236 16.495  -15.131 1.00 29.78 ? 93   GLU A C   1 
ATOM   698  O O   . GLU A 1 93  ? 30.941 16.000  -14.248 1.00 25.67 ? 93   GLU A O   1 
ATOM   699  C CB  . GLU A 1 93  ? 31.832 17.741  -16.606 1.00 40.41 ? 93   GLU A CB  1 
ATOM   700  C CG  . GLU A 1 93  ? 32.063 18.907  -17.580 1.00 54.53 ? 93   GLU A CG  1 
ATOM   701  C CD  . GLU A 1 93  ? 32.812 20.093  -16.967 1.00 65.91 ? 93   GLU A CD  1 
ATOM   702  O OE1 . GLU A 1 93  ? 34.070 20.068  -16.960 1.00 67.22 ? 93   GLU A OE1 1 
ATOM   703  O OE2 . GLU A 1 93  ? 32.148 21.061  -16.519 1.00 69.77 ? 93   GLU A OE2 1 
ATOM   704  N N   . PRO A 1 94  ? 29.126 15.892  -15.570 1.00 30.91 ? 94   PRO A N   1 
ATOM   705  C CA  . PRO A 1 94  ? 28.669 14.591  -15.073 1.00 30.75 ? 94   PRO A CA  1 
ATOM   706  C C   . PRO A 1 94  ? 29.498 13.361  -15.465 1.00 29.65 ? 94   PRO A C   1 
ATOM   707  O O   . PRO A 1 94  ? 29.010 12.475  -16.171 1.00 31.34 ? 94   PRO A O   1 
ATOM   708  C CB  . PRO A 1 94  ? 27.234 14.521  -15.600 1.00 31.33 ? 94   PRO A CB  1 
ATOM   709  C CG  . PRO A 1 94  ? 27.327 15.257  -16.909 1.00 32.08 ? 94   PRO A CG  1 
ATOM   710  C CD  . PRO A 1 94  ? 28.167 16.455  -16.541 1.00 33.11 ? 94   PRO A CD  1 
ATOM   711  N N   . THR A 1 95  ? 30.733 13.292  -14.976 1.00 29.94 ? 95   THR A N   1 
ATOM   712  C CA  . THR A 1 95  ? 31.600 12.152  -15.250 1.00 26.73 ? 95   THR A CA  1 
ATOM   713  C C   . THR A 1 95  ? 31.460 11.207  -14.058 1.00 24.00 ? 95   THR A C   1 
ATOM   714  O O   . THR A 1 95  ? 30.816 11.538  -13.072 1.00 22.33 ? 95   THR A O   1 
ATOM   715  C CB  . THR A 1 95  ? 33.096 12.577  -15.383 1.00 25.57 ? 95   THR A CB  1 
ATOM   716  O OG1 . THR A 1 95  ? 33.590 13.025  -14.118 1.00 31.76 ? 95   THR A OG1 1 
ATOM   717  C CG2 . THR A 1 95  ? 33.248 13.708  -16.386 1.00 33.00 ? 95   THR A CG2 1 
ATOM   718  N N   . GLU A 1 96  ? 32.036 10.016  -14.155 1.00 25.00 ? 96   GLU A N   1 
ATOM   719  C CA  . GLU A 1 96  ? 31.978 9.073   -13.043 1.00 24.36 ? 96   GLU A CA  1 
ATOM   720  C C   . GLU A 1 96  ? 33.215 9.280   -12.189 1.00 25.97 ? 96   GLU A C   1 
ATOM   721  O O   . GLU A 1 96  ? 33.548 8.440   -11.374 1.00 31.63 ? 96   GLU A O   1 
ATOM   722  C CB  . GLU A 1 96  ? 31.957 7.646   -13.561 1.00 23.47 ? 96   GLU A CB  1 
ATOM   723  C CG  . GLU A 1 96  ? 30.876 7.390   -14.570 1.00 28.68 ? 96   GLU A CG  1 
ATOM   724  C CD  . GLU A 1 96  ? 31.245 6.278   -15.518 1.00 38.84 ? 96   GLU A CD  1 
ATOM   725  O OE1 . GLU A 1 96  ? 32.455 6.129   -15.818 1.00 47.22 ? 96   GLU A OE1 1 
ATOM   726  O OE2 . GLU A 1 96  ? 30.326 5.568   -15.976 1.00 40.55 ? 96   GLU A OE2 1 
ATOM   727  N N   . LYS A 1 97  ? 33.918 10.386  -12.423 1.00 26.27 ? 97   LYS A N   1 
ATOM   728  C CA  . LYS A 1 97  ? 35.131 10.723  -11.682 1.00 28.24 ? 97   LYS A CA  1 
ATOM   729  C C   . LYS A 1 97  ? 34.834 11.502  -10.394 1.00 26.03 ? 97   LYS A C   1 
ATOM   730  O O   . LYS A 1 97  ? 34.405 12.654  -10.446 1.00 26.03 ? 97   LYS A O   1 
ATOM   731  C CB  . LYS A 1 97  ? 36.055 11.570  -12.563 1.00 27.78 ? 97   LYS A CB  1 
ATOM   732  C CG  . LYS A 1 97  ? 37.160 10.813  -13.258 1.00 34.97 ? 97   LYS A CG  1 
ATOM   733  C CD  . LYS A 1 97  ? 38.287 10.454  -12.295 1.00 39.31 ? 97   LYS A CD  1 
ATOM   734  C CE  . LYS A 1 97  ? 38.980 11.689  -11.713 1.00 40.03 ? 97   LYS A CE  1 
ATOM   735  N NZ  . LYS A 1 97  ? 39.781 12.461  -12.712 1.00 40.28 ? 97   LYS A NZ  1 
ATOM   736  N N   . LEU A 1 98  ? 35.137 10.905  -9.248  1.00 23.19 ? 98   LEU A N   1 
ATOM   737  C CA  . LEU A 1 98  ? 34.925 11.557  -7.959  1.00 19.41 ? 98   LEU A CA  1 
ATOM   738  C C   . LEU A 1 98  ? 36.291 11.623  -7.277  1.00 19.80 ? 98   LEU A C   1 
ATOM   739  O O   . LEU A 1 98  ? 37.194 10.862  -7.625  1.00 18.34 ? 98   LEU A O   1 
ATOM   740  C CB  . LEU A 1 98  ? 33.957 10.720  -7.119  1.00 19.68 ? 98   LEU A CB  1 
ATOM   741  C CG  . LEU A 1 98  ? 32.626 11.325  -6.665  1.00 19.86 ? 98   LEU A CG  1 
ATOM   742  C CD1 . LEU A 1 98  ? 32.036 12.226  -7.723  1.00 9.94  ? 98   LEU A CD1 1 
ATOM   743  C CD2 . LEU A 1 98  ? 31.677 10.196  -6.311  1.00 17.87 ? 98   LEU A CD2 1 
ATOM   744  N N   . PRO A 1 99  ? 36.479 12.546  -6.320  1.00 16.92 ? 99   PRO A N   1 
ATOM   745  C CA  . PRO A 1 99  ? 37.795 12.594  -5.679  1.00 16.21 ? 99   PRO A CA  1 
ATOM   746  C C   . PRO A 1 99  ? 38.040 11.504  -4.635  1.00 16.13 ? 99   PRO A C   1 
ATOM   747  O O   . PRO A 1 99  ? 39.058 11.523  -3.966  1.00 14.79 ? 99   PRO A O   1 
ATOM   748  C CB  . PRO A 1 99  ? 37.831 13.999  -5.070  1.00 15.84 ? 99   PRO A CB  1 
ATOM   749  C CG  . PRO A 1 99  ? 36.414 14.265  -4.765  1.00 13.54 ? 99   PRO A CG  1 
ATOM   750  C CD  . PRO A 1 99  ? 35.690 13.743  -5.979  1.00 16.06 ? 99   PRO A CD  1 
ATOM   751  N N   . PHE A 1 100 ? 37.107 10.565  -4.500  1.00 15.79 ? 100  PHE A N   1 
ATOM   752  C CA  . PHE A 1 100 ? 37.245 9.480   -3.536  1.00 15.96 ? 100  PHE A CA  1 
ATOM   753  C C   . PHE A 1 100 ? 36.472 8.273   -4.065  1.00 18.32 ? 100  PHE A C   1 
ATOM   754  O O   . PHE A 1 100 ? 35.524 8.441   -4.834  1.00 19.53 ? 100  PHE A O   1 
ATOM   755  C CB  . PHE A 1 100 ? 36.719 9.904   -2.154  1.00 12.90 ? 100  PHE A CB  1 
ATOM   756  C CG  . PHE A 1 100 ? 35.304 10.415  -2.168  1.00 17.17 ? 100  PHE A CG  1 
ATOM   757  C CD1 . PHE A 1 100 ? 34.224 9.528   -2.184  1.00 15.88 ? 100  PHE A CD1 1 
ATOM   758  C CD2 . PHE A 1 100 ? 35.047 11.783  -2.167  1.00 16.67 ? 100  PHE A CD2 1 
ATOM   759  C CE1 . PHE A 1 100 ? 32.908 10.001  -2.199  1.00 18.74 ? 100  PHE A CE1 1 
ATOM   760  C CE2 . PHE A 1 100 ? 33.730 12.269  -2.183  1.00 15.91 ? 100  PHE A CE2 1 
ATOM   761  C CZ  . PHE A 1 100 ? 32.664 11.379  -2.198  1.00 17.32 ? 100  PHE A CZ  1 
ATOM   762  N N   . PRO A 1 101 ? 36.877 7.046   -3.669  1.00 15.92 ? 101  PRO A N   1 
ATOM   763  C CA  . PRO A 1 101 ? 36.189 5.834   -4.128  1.00 16.69 ? 101  PRO A CA  1 
ATOM   764  C C   . PRO A 1 101 ? 34.928 5.490   -3.350  1.00 14.70 ? 101  PRO A C   1 
ATOM   765  O O   . PRO A 1 101 ? 34.704 5.979   -2.231  1.00 13.38 ? 101  PRO A O   1 
ATOM   766  C CB  . PRO A 1 101 ? 37.250 4.751   -3.938  1.00 13.64 ? 101  PRO A CB  1 
ATOM   767  C CG  . PRO A 1 101 ? 37.972 5.215   -2.727  1.00 14.37 ? 101  PRO A CG  1 
ATOM   768  C CD  . PRO A 1 101 ? 38.106 6.703   -2.927  1.00 13.34 ? 101  PRO A CD  1 
ATOM   769  N N   . ILE A 1 102 ? 34.060 4.721   -4.000  1.00 14.69 ? 102  ILE A N   1 
ATOM   770  C CA  . ILE A 1 102 ? 32.839 4.236   -3.361  1.00 13.39 ? 102  ILE A CA  1 
ATOM   771  C C   . ILE A 1 102 ? 32.914 2.716   -3.368  1.00 13.82 ? 102  ILE A C   1 
ATOM   772  O O   . ILE A 1 102 ? 32.997 2.083   -4.430  1.00 15.47 ? 102  ILE A O   1 
ATOM   773  C CB  . ILE A 1 102 ? 31.535 4.674   -4.065  1.00 9.97  ? 102  ILE A CB  1 
ATOM   774  C CG1 . ILE A 1 102 ? 31.504 6.184   -4.271  1.00 10.13 ? 102  ILE A CG1 1 
ATOM   775  C CG2 . ILE A 1 102 ? 30.348 4.304   -3.199  1.00 8.07  ? 102  ILE A CG2 1 
ATOM   776  C CD1 . ILE A 1 102 ? 30.202 6.681   -4.893  1.00 16.10 ? 102  ILE A CD1 1 
ATOM   777  N N   . ILE A 1 103 ? 32.896 2.136   -2.178  1.00 14.96 ? 103  ILE A N   1 
ATOM   778  C CA  . ILE A 1 103 ? 32.975 0.705   -2.019  1.00 13.48 ? 103  ILE A CA  1 
ATOM   779  C C   . ILE A 1 103 ? 31.669 0.018   -2.392  1.00 19.51 ? 103  ILE A C   1 
ATOM   780  O O   . ILE A 1 103 ? 30.571 0.487   -2.064  1.00 16.06 ? 103  ILE A O   1 
ATOM   781  C CB  . ILE A 1 103 ? 33.331 0.351   -0.570  1.00 15.70 ? 103  ILE A CB  1 
ATOM   782  C CG1 . ILE A 1 103 ? 34.687 0.957   -0.192  1.00 13.63 ? 103  ILE A CG1 1 
ATOM   783  C CG2 . ILE A 1 103 ? 33.327 -1.140  -0.387  1.00 11.86 ? 103  ILE A CG2 1 
ATOM   784  C CD1 . ILE A 1 103 ? 34.927 1.005   1.303   1.00 17.88 ? 103  ILE A CD1 1 
ATOM   785  N N   . ASP A 1 104 ? 31.804 -1.086  -3.109  1.00 19.32 ? 104  ASP A N   1 
ATOM   786  C CA  . ASP A 1 104 ? 30.679 -1.898  -3.526  1.00 20.54 ? 104  ASP A CA  1 
ATOM   787  C C   . ASP A 1 104 ? 30.386 -2.838  -2.355  1.00 18.97 ? 104  ASP A C   1 
ATOM   788  O O   . ASP A 1 104 ? 31.246 -3.627  -1.953  1.00 16.32 ? 104  ASP A O   1 
ATOM   789  C CB  . ASP A 1 104 ? 31.087 -2.708  -4.767  1.00 21.17 ? 104  ASP A CB  1 
ATOM   790  C CG  . ASP A 1 104 ? 30.027 -3.703  -5.218  1.00 20.72 ? 104  ASP A CG  1 
ATOM   791  O OD1 . ASP A 1 104 ? 29.380 -4.378  -4.383  1.00 22.13 ? 104  ASP A OD1 1 
ATOM   792  O OD2 . ASP A 1 104 ? 29.855 -3.830  -6.446  1.00 20.58 ? 104  ASP A OD2 1 
ATOM   793  N N   . ASP A 1 105 ? 29.206 -2.702  -1.763  1.00 18.93 ? 105  ASP A N   1 
ATOM   794  C CA  . ASP A 1 105 ? 28.817 -3.593  -0.674  1.00 17.29 ? 105  ASP A CA  1 
ATOM   795  C C   . ASP A 1 105 ? 27.446 -4.156  -1.043  1.00 19.82 ? 105  ASP A C   1 
ATOM   796  O O   . ASP A 1 105 ? 26.583 -4.373  -0.189  1.00 17.50 ? 105  ASP A O   1 
ATOM   797  C CB  . ASP A 1 105 ? 28.771 -2.864  0.671   1.00 13.89 ? 105  ASP A CB  1 
ATOM   798  C CG  . ASP A 1 105 ? 28.736 -3.820  1.845   1.00 13.29 ? 105  ASP A CG  1 
ATOM   799  O OD1 . ASP A 1 105 ? 29.216 -4.971  1.709   1.00 14.91 ? 105  ASP A OD1 1 
ATOM   800  O OD2 . ASP A 1 105 ? 28.223 -3.437  2.915   1.00 10.99 ? 105  ASP A OD2 1 
ATOM   801  N N   . ARG A 1 106 ? 27.262 -4.383  -2.342  1.00 18.76 ? 106  ARG A N   1 
ATOM   802  C CA  . ARG A 1 106 ? 26.023 -4.918  -2.875  1.00 19.05 ? 106  ARG A CA  1 
ATOM   803  C C   . ARG A 1 106 ? 25.693 -6.194  -2.121  1.00 21.06 ? 106  ARG A C   1 
ATOM   804  O O   . ARG A 1 106 ? 24.538 -6.506  -1.874  1.00 24.47 ? 106  ARG A O   1 
ATOM   805  C CB  . ARG A 1 106 ? 26.198 -5.238  -4.357  1.00 18.28 ? 106  ARG A CB  1 
ATOM   806  C CG  . ARG A 1 106 ? 24.913 -5.701  -5.038  1.00 26.28 ? 106  ARG A CG  1 
ATOM   807  C CD  . ARG A 1 106 ? 25.195 -6.517  -6.303  1.00 28.39 ? 106  ARG A CD  1 
ATOM   808  N NE  . ARG A 1 106 ? 26.053 -7.681  -6.033  1.00 33.07 ? 106  ARG A NE  1 
ATOM   809  C CZ  . ARG A 1 106 ? 25.685 -8.745  -5.322  1.00 29.53 ? 106  ARG A CZ  1 
ATOM   810  N NH1 . ARG A 1 106 ? 24.466 -8.803  -4.793  1.00 35.39 ? 106  ARG A NH1 1 
ATOM   811  N NH2 . ARG A 1 106 ? 26.549 -9.721  -5.098  1.00 27.03 ? 106  ARG A NH2 1 
ATOM   812  N N   . ASN A 1 107 ? 26.735 -6.921  -1.748  1.00 26.69 ? 107  ASN A N   1 
ATOM   813  C CA  . ASN A 1 107 ? 26.593 -8.184  -1.041  1.00 27.27 ? 107  ASN A CA  1 
ATOM   814  C C   . ASN A 1 107 ? 26.265 -8.029  0.450   1.00 26.57 ? 107  ASN A C   1 
ATOM   815  O O   . ASN A 1 107 ? 25.887 -8.993  1.102   1.00 24.62 ? 107  ASN A O   1 
ATOM   816  C CB  . ASN A 1 107 ? 27.870 -9.010  -1.215  1.00 31.45 ? 107  ASN A CB  1 
ATOM   817  C CG  . ASN A 1 107 ? 27.608 -10.496 -1.149  1.00 35.85 ? 107  ASN A CG  1 
ATOM   818  O OD1 . ASN A 1 107 ? 26.585 -10.970 -1.648  1.00 41.17 ? 107  ASN A OD1 1 
ATOM   819  N ND2 . ASN A 1 107 ? 28.509 -11.237 -0.519  1.00 41.89 ? 107  ASN A ND2 1 
ATOM   820  N N   . ARG A 1 108 ? 26.448 -6.828  0.992   1.00 22.22 ? 108  ARG A N   1 
ATOM   821  C CA  . ARG A 1 108 ? 26.161 -6.536  2.403   1.00 20.80 ? 108  ARG A CA  1 
ATOM   822  C C   . ARG A 1 108 ? 27.138 -7.113  3.432   1.00 17.22 ? 108  ARG A C   1 
ATOM   823  O O   . ARG A 1 108 ? 26.935 -6.943  4.632   1.00 14.64 ? 108  ARG A O   1 
ATOM   824  C CB  . ARG A 1 108 ? 24.730 -6.942  2.771   1.00 22.03 ? 108  ARG A CB  1 
ATOM   825  C CG  . ARG A 1 108 ? 23.660 -6.265  1.933   1.00 19.06 ? 108  ARG A CG  1 
ATOM   826  C CD  . ARG A 1 108 ? 22.270 -6.595  2.456   1.00 22.51 ? 108  ARG A CD  1 
ATOM   827  N NE  . ARG A 1 108 ? 21.236 -5.845  1.749   1.00 21.86 ? 108  ARG A NE  1 
ATOM   828  C CZ  . ARG A 1 108 ? 20.047 -5.529  2.259   1.00 23.36 ? 108  ARG A CZ  1 
ATOM   829  N NH1 . ARG A 1 108 ? 19.722 -5.903  3.497   1.00 23.32 ? 108  ARG A NH1 1 
ATOM   830  N NH2 . ARG A 1 108 ? 19.196 -4.811  1.539   1.00 21.75 ? 108  ARG A NH2 1 
ATOM   831  N N   . GLU A 1 109 ? 28.231 -7.715  2.975   1.00 15.32 ? 109  GLU A N   1 
ATOM   832  C CA  . GLU A 1 109 ? 29.214 -8.290  3.888   1.00 18.53 ? 109  GLU A CA  1 
ATOM   833  C C   . GLU A 1 109 ? 29.904 -7.291  4.822   1.00 17.65 ? 109  GLU A C   1 
ATOM   834  O O   . GLU A 1 109 ? 30.062 -7.550  6.013   1.00 16.04 ? 109  GLU A O   1 
ATOM   835  C CB  . GLU A 1 109 ? 30.289 -9.019  3.104   1.00 20.60 ? 109  GLU A CB  1 
ATOM   836  C CG  . GLU A 1 109 ? 29.824 -10.271 2.411   1.00 33.17 ? 109  GLU A CG  1 
ATOM   837  C CD  . GLU A 1 109 ? 31.003 -11.133 1.993   1.00 39.35 ? 109  GLU A CD  1 
ATOM   838  O OE1 . GLU A 1 109 ? 32.061 -10.583 1.625   1.00 40.12 ? 109  GLU A OE1 1 
ATOM   839  O OE2 . GLU A 1 109 ? 30.875 -12.375 2.057   1.00 48.78 ? 109  GLU A OE2 1 
ATOM   840  N N   . LEU A 1 110 ? 30.344 -6.169  4.258   1.00 18.74 ? 110  LEU A N   1 
ATOM   841  C CA  . LEU A 1 110 ? 31.036 -5.104  4.994   1.00 20.04 ? 110  LEU A CA  1 
ATOM   842  C C   . LEU A 1 110 ? 30.158 -4.435  6.038   1.00 20.99 ? 110  LEU A C   1 
ATOM   843  O O   . LEU A 1 110 ? 30.642 -4.063  7.108   1.00 19.36 ? 110  LEU A O   1 
ATOM   844  C CB  . LEU A 1 110 ? 31.556 -4.037  4.028   1.00 21.01 ? 110  LEU A CB  1 
ATOM   845  C CG  . LEU A 1 110 ? 32.831 -4.272  3.211   1.00 28.83 ? 110  LEU A CG  1 
ATOM   846  C CD1 . LEU A 1 110 ? 32.944 -5.699  2.710   1.00 29.82 ? 110  LEU A CD1 1 
ATOM   847  C CD2 . LEU A 1 110 ? 32.833 -3.297  2.056   1.00 25.07 ? 110  LEU A CD2 1 
ATOM   848  N N   . ALA A 1 111 ? 28.886 -4.229  5.694   1.00 18.37 ? 111  ALA A N   1 
ATOM   849  C CA  . ALA A 1 111 ? 27.912 -3.614  6.596   1.00 18.64 ? 111  ALA A CA  1 
ATOM   850  C C   . ALA A 1 111 ? 27.786 -4.447  7.877   1.00 16.32 ? 111  ALA A C   1 
ATOM   851  O O   . ALA A 1 111 ? 27.792 -3.912  8.984   1.00 15.18 ? 111  ALA A O   1 
ATOM   852  C CB  . ALA A 1 111 ? 26.539 -3.480  5.898   1.00 15.48 ? 111  ALA A CB  1 
ATOM   853  N N   . ILE A 1 112 ? 27.715 -5.761  7.717   1.00 15.84 ? 112  ILE A N   1 
ATOM   854  C CA  . ILE A 1 112 ? 27.612 -6.676  8.855   1.00 17.07 ? 112  ILE A CA  1 
ATOM   855  C C   . ILE A 1 112 ? 28.938 -6.718  9.634   1.00 20.34 ? 112  ILE A C   1 
ATOM   856  O O   . ILE A 1 112 ? 28.957 -6.656  10.864  1.00 19.68 ? 112  ILE A O   1 
ATOM   857  C CB  . ILE A 1 112 ? 27.228 -8.093  8.359   1.00 14.30 ? 112  ILE A CB  1 
ATOM   858  C CG1 . ILE A 1 112 ? 25.814 -8.061  7.769   1.00 11.76 ? 112  ILE A CG1 1 
ATOM   859  C CG2 . ILE A 1 112 ? 27.365 -9.115  9.473   1.00 15.64 ? 112  ILE A CG2 1 
ATOM   860  C CD1 . ILE A 1 112 ? 25.435 -9.296  7.031   1.00 6.34  ? 112  ILE A CD1 1 
ATOM   861  N N   . LEU A 1 113 ? 30.044 -6.793  8.897   1.00 20.76 ? 113  LEU A N   1 
ATOM   862  C CA  . LEU A 1 113 ? 31.385 -6.827  9.474   1.00 18.17 ? 113  LEU A CA  1 
ATOM   863  C C   . LEU A 1 113 ? 31.642 -5.555  10.285  1.00 19.66 ? 113  LEU A C   1 
ATOM   864  O O   . LEU A 1 113 ? 32.238 -5.604  11.360  1.00 20.89 ? 113  LEU A O   1 
ATOM   865  C CB  . LEU A 1 113 ? 32.410 -6.961  8.338   1.00 21.56 ? 113  LEU A CB  1 
ATOM   866  C CG  . LEU A 1 113 ? 33.882 -7.349  8.543   1.00 22.12 ? 113  LEU A CG  1 
ATOM   867  C CD1 . LEU A 1 113 ? 34.743 -6.129  8.504   1.00 22.42 ? 113  LEU A CD1 1 
ATOM   868  C CD2 . LEU A 1 113 ? 34.081 -8.144  9.819   1.00 21.34 ? 113  LEU A CD2 1 
ATOM   869  N N   . LEU A 1 114 ? 31.173 -4.419  9.774   1.00 18.08 ? 114  LEU A N   1 
ATOM   870  C CA  . LEU A 1 114 ? 31.348 -3.140  10.456  1.00 17.71 ? 114  LEU A CA  1 
ATOM   871  C C   . LEU A 1 114 ? 30.300 -2.889  11.527  1.00 17.50 ? 114  LEU A C   1 
ATOM   872  O O   . LEU A 1 114 ? 30.319 -1.845  12.172  1.00 18.58 ? 114  LEU A O   1 
ATOM   873  C CB  . LEU A 1 114 ? 31.386 -1.995  9.449   1.00 14.16 ? 114  LEU A CB  1 
ATOM   874  C CG  . LEU A 1 114 ? 32.726 -1.910  8.704   1.00 15.35 ? 114  LEU A CG  1 
ATOM   875  C CD1 . LEU A 1 114 ? 32.633 -0.915  7.568   1.00 12.01 ? 114  LEU A CD1 1 
ATOM   876  C CD2 . LEU A 1 114 ? 33.832 -1.514  9.666   1.00 13.54 ? 114  LEU A CD2 1 
ATOM   877  N N   . GLY A 1 115 ? 29.369 -3.833  11.680  1.00 15.06 ? 115  GLY A N   1 
ATOM   878  C CA  . GLY A 1 115 ? 28.334 -3.751  12.703  1.00 17.03 ? 115  GLY A CA  1 
ATOM   879  C C   . GLY A 1 115 ? 27.211 -2.750  12.546  1.00 17.26 ? 115  GLY A C   1 
ATOM   880  O O   . GLY A 1 115 ? 26.691 -2.228  13.532  1.00 21.31 ? 115  GLY A O   1 
ATOM   881  N N   . MET A 1 116 ? 26.814 -2.474  11.318  1.00 18.73 ? 116  MET A N   1 
ATOM   882  C CA  . MET A 1 116 ? 25.741 -1.516  11.105  1.00 19.12 ? 116  MET A CA  1 
ATOM   883  C C   . MET A 1 116 ? 24.583 -2.132  10.339  1.00 17.50 ? 116  MET A C   1 
ATOM   884  O O   . MET A 1 116 ? 23.860 -1.441  9.612   1.00 19.93 ? 116  MET A O   1 
ATOM   885  C CB  . MET A 1 116 ? 26.280 -0.273  10.401  1.00 19.81 ? 116  MET A CB  1 
ATOM   886  C CG  . MET A 1 116 ? 27.237 -0.576  9.279   1.00 22.87 ? 116  MET A CG  1 
ATOM   887  S SD  . MET A 1 116 ? 27.774 0.905   8.468   1.00 20.35 ? 116  MET A SD  1 
ATOM   888  C CE  . MET A 1 116 ? 28.868 0.220   7.249   1.00 24.80 ? 116  MET A CE  1 
ATOM   889  N N   . LEU A 1 117 ? 24.409 -3.438  10.521  1.00 15.59 ? 117  LEU A N   1 
ATOM   890  C CA  . LEU A 1 117 ? 23.350 -4.179  9.861   1.00 15.82 ? 117  LEU A CA  1 
ATOM   891  C C   . LEU A 1 117 ? 23.207 -5.543  10.509  1.00 17.02 ? 117  LEU A C   1 
ATOM   892  O O   . LEU A 1 117 ? 24.176 -6.306  10.587  1.00 16.15 ? 117  LEU A O   1 
ATOM   893  C CB  . LEU A 1 117 ? 23.656 -4.368  8.374   1.00 15.45 ? 117  LEU A CB  1 
ATOM   894  C CG  . LEU A 1 117 ? 22.489 -4.915  7.551   1.00 20.25 ? 117  LEU A CG  1 
ATOM   895  C CD1 . LEU A 1 117 ? 21.724 -3.750  6.955   1.00 21.65 ? 117  LEU A CD1 1 
ATOM   896  C CD2 . LEU A 1 117 ? 22.977 -5.844  6.468   1.00 15.43 ? 117  LEU A CD2 1 
ATOM   897  N N   . ASP A 1 118 ? 21.995 -5.862  10.950  1.00 20.42 ? 118  ASP A N   1 
ATOM   898  C CA  . ASP A 1 118 ? 21.737 -7.155  11.571  1.00 23.89 ? 118  ASP A CA  1 
ATOM   899  C C   . ASP A 1 118 ? 22.067 -8.192  10.505  1.00 24.63 ? 118  ASP A C   1 
ATOM   900  O O   . ASP A 1 118 ? 21.756 -7.992  9.335   1.00 25.33 ? 118  ASP A O   1 
ATOM   901  C CB  . ASP A 1 118 ? 20.266 -7.275  11.960  1.00 29.40 ? 118  ASP A CB  1 
ATOM   902  C CG  . ASP A 1 118 ? 19.968 -8.558  12.706  1.00 35.07 ? 118  ASP A CG  1 
ATOM   903  O OD1 . ASP A 1 118 ? 19.692 -9.594  12.060  1.00 39.24 ? 118  ASP A OD1 1 
ATOM   904  O OD2 . ASP A 1 118 ? 20.034 -8.534  13.949  1.00 44.08 ? 118  ASP A OD2 1 
ATOM   905  N N   . PRO A 1 119 ? 22.737 -9.291  10.880  1.00 26.63 ? 119  PRO A N   1 
ATOM   906  C CA  . PRO A 1 119 ? 23.110 -10.353 9.942   1.00 29.64 ? 119  PRO A CA  1 
ATOM   907  C C   . PRO A 1 119 ? 22.085 -10.889 8.923   1.00 34.53 ? 119  PRO A C   1 
ATOM   908  O O   . PRO A 1 119 ? 22.302 -11.943 8.324   1.00 39.45 ? 119  PRO A O   1 
ATOM   909  C CB  . PRO A 1 119 ? 23.669 -11.427 10.865  1.00 29.20 ? 119  PRO A CB  1 
ATOM   910  C CG  . PRO A 1 119 ? 24.409 -10.607 11.863  1.00 27.10 ? 119  PRO A CG  1 
ATOM   911  C CD  . PRO A 1 119 ? 23.414 -9.493  12.174  1.00 27.18 ? 119  PRO A CD  1 
ATOM   912  N N   . ALA A 1 120 ? 20.970 -10.192 8.728   1.00 39.74 ? 120  ALA A N   1 
ATOM   913  C CA  . ALA A 1 120 ? 20.004 -10.580 7.703   1.00 40.27 ? 120  ALA A CA  1 
ATOM   914  C C   . ALA A 1 120 ? 20.434 -9.880  6.380   1.00 40.24 ? 120  ALA A C   1 
ATOM   915  O O   . ALA A 1 120 ? 19.788 -8.945  5.902   1.00 36.78 ? 120  ALA A O   1 
ATOM   916  C CB  . ALA A 1 120 ? 18.608 -10.153 8.116   1.00 39.41 ? 120  ALA A CB  1 
ATOM   917  N N   . GLU A 1 121 ? 21.530 -10.350 5.791   1.00 41.78 ? 121  GLU A N   1 
ATOM   918  C CA  . GLU A 1 121 ? 22.045 -9.753  4.564   1.00 45.56 ? 121  GLU A CA  1 
ATOM   919  C C   . GLU A 1 121 ? 21.352 -10.243 3.299   1.00 47.81 ? 121  GLU A C   1 
ATOM   920  O O   . GLU A 1 121 ? 21.717 -9.855  2.188   1.00 48.66 ? 121  GLU A O   1 
ATOM   921  C CB  . GLU A 1 121 ? 23.563 -9.986  4.428   1.00 49.91 ? 121  GLU A CB  1 
ATOM   922  C CG  . GLU A 1 121 ? 24.014 -11.456 4.369   1.00 48.33 ? 121  GLU A CG  1 
ATOM   923  C CD  . GLU A 1 121 ? 25.436 -11.636 3.801   1.00 52.65 ? 121  GLU A CD  1 
ATOM   924  O OE1 . GLU A 1 121 ? 26.422 -11.233 4.453   1.00 51.88 ? 121  GLU A OE1 1 
ATOM   925  O OE2 . GLU A 1 121 ? 25.577 -12.167 2.681   1.00 54.16 ? 121  GLU A OE2 1 
ATOM   926  N N   . LYS A 1 122 ? 20.322 -11.057 3.471   1.00 49.31 ? 122  LYS A N   1 
ATOM   927  C CA  . LYS A 1 122 ? 19.589 -11.636 2.351   1.00 50.34 ? 122  LYS A CA  1 
ATOM   928  C C   . LYS A 1 122 ? 18.373 -10.831 1.880   1.00 51.87 ? 122  LYS A C   1 
ATOM   929  O O   . LYS A 1 122 ? 17.918 -11.006 0.746   1.00 48.25 ? 122  LYS A O   1 
ATOM   930  C CB  . LYS A 1 122 ? 19.155 -13.057 2.730   1.00 50.56 ? 122  LYS A CB  1 
ATOM   931  C CG  . LYS A 1 122 ? 18.825 -13.962 1.561   1.00 46.99 ? 122  LYS A CG  1 
ATOM   932  C CD  . LYS A 1 122 ? 18.618 -15.404 2.017   1.00 44.77 ? 122  LYS A CD  1 
ATOM   933  C CE  . LYS A 1 122 ? 19.851 -15.948 2.725   1.00 44.72 ? 122  LYS A CE  1 
ATOM   934  N NZ  . LYS A 1 122 ? 19.811 -17.411 2.896   1.00 36.14 ? 122  LYS A NZ  1 
ATOM   935  N N   . ASP A 1 123 ? 17.874 -9.942  2.738   1.00 54.00 ? 123  ASP A N   1 
ATOM   936  C CA  . ASP A 1 123 ? 16.707 -9.131  2.420   1.00 57.67 ? 123  ASP A CA  1 
ATOM   937  C C   . ASP A 1 123 ? 16.801 -8.467  1.051   1.00 58.62 ? 123  ASP A C   1 
ATOM   938  O O   . ASP A 1 123 ? 17.655 -7.602  0.814   1.00 54.90 ? 123  ASP A O   1 
ATOM   939  C CB  . ASP A 1 123 ? 16.449 -8.087  3.515   1.00 60.98 ? 123  ASP A CB  1 
ATOM   940  C CG  . ASP A 1 123 ? 15.187 -7.266  3.262   1.00 68.10 ? 123  ASP A CG  1 
ATOM   941  O OD1 . ASP A 1 123 ? 14.344 -7.658  2.417   1.00 71.77 ? 123  ASP A OD1 1 
ATOM   942  O OD2 . ASP A 1 123 ? 15.036 -6.212  3.911   1.00 71.87 ? 123  ASP A OD2 1 
ATOM   943  N N   . GLU A 1 124 ? 15.882 -8.874  0.178   1.00 61.98 ? 124  GLU A N   1 
ATOM   944  C CA  . GLU A 1 124 ? 15.795 -8.397  -1.192  1.00 64.75 ? 124  GLU A CA  1 
ATOM   945  C C   . GLU A 1 124 ? 16.102 -6.915  -1.319  1.00 64.17 ? 124  GLU A C   1 
ATOM   946  O O   . GLU A 1 124 ? 16.947 -6.500  -2.116  1.00 68.84 ? 124  GLU A O   1 
ATOM   947  C CB  . GLU A 1 124 ? 14.401 -8.696  -1.755  1.00 69.56 ? 124  GLU A CB  1 
ATOM   948  C CG  . GLU A 1 124 ? 14.345 -8.789  -3.274  1.00 74.03 ? 124  GLU A CG  1 
ATOM   949  C CD  . GLU A 1 124 ? 15.354 -9.789  -3.818  1.00 78.22 ? 124  GLU A CD  1 
ATOM   950  O OE1 . GLU A 1 124 ? 15.164 -11.008 -3.616  1.00 81.54 ? 124  GLU A OE1 1 
ATOM   951  O OE2 . GLU A 1 124 ? 16.351 -9.351  -4.430  1.00 80.30 ? 124  GLU A OE2 1 
ATOM   952  N N   . LYS A 1 125 ? 15.426 -6.110  -0.516  1.00 60.78 ? 125  LYS A N   1 
ATOM   953  C CA  . LYS A 1 125 ? 15.640 -4.679  -0.552  1.00 57.29 ? 125  LYS A CA  1 
ATOM   954  C C   . LYS A 1 125 ? 15.509 -4.147  0.853   1.00 56.19 ? 125  LYS A C   1 
ATOM   955  O O   . LYS A 1 125 ? 16.517 -3.952  1.542   1.00 55.05 ? 125  LYS A O   1 
ATOM   956  C CB  . LYS A 1 125 ? 14.643 -3.987  -1.494  1.00 60.84 ? 125  LYS A CB  1 
ATOM   957  C CG  . LYS A 1 125 ? 14.985 -4.108  -2.984  1.00 65.39 ? 125  LYS A CG  1 
ATOM   958  C CD  . LYS A 1 125 ? 16.353 -3.485  -3.282  1.00 70.76 ? 125  LYS A CD  1 
ATOM   959  C CE  . LYS A 1 125 ? 16.738 -3.547  -4.761  1.00 71.93 ? 125  LYS A CE  1 
ATOM   960  N NZ  . LYS A 1 125 ? 18.082 -2.912  -5.035  1.00 73.80 ? 125  LYS A NZ  1 
ATOM   961  N N   . GLY A 1 126 ? 14.272 -3.864  1.251   1.00 54.32 ? 126  GLY A N   1 
ATOM   962  C CA  . GLY A 1 126 ? 13.998 -3.347  2.582   1.00 52.81 ? 126  GLY A CA  1 
ATOM   963  C C   . GLY A 1 126 ? 14.650 -2.020  2.926   1.00 50.31 ? 126  GLY A C   1 
ATOM   964  O O   . GLY A 1 126 ? 14.119 -1.282  3.761   1.00 55.72 ? 126  GLY A O   1 
ATOM   965  N N   . MET A 1 127 ? 15.732 -1.680  2.222   1.00 42.18 ? 127  MET A N   1 
ATOM   966  C CA  . MET A 1 127 ? 16.503 -0.467  2.450   1.00 35.74 ? 127  MET A CA  1 
ATOM   967  C C   . MET A 1 127 ? 17.302 -0.646  3.724   1.00 30.81 ? 127  MET A C   1 
ATOM   968  O O   . MET A 1 127 ? 16.749 -0.687  4.825   1.00 28.67 ? 127  MET A O   1 
ATOM   969  C CB  . MET A 1 127 ? 15.607 0.763   2.552   1.00 37.62 ? 127  MET A CB  1 
ATOM   970  C CG  . MET A 1 127 ? 15.690 1.670   1.354   1.00 38.60 ? 127  MET A CG  1 
ATOM   971  S SD  . MET A 1 127 ? 17.303 2.427   1.238   1.00 40.16 ? 127  MET A SD  1 
ATOM   972  C CE  . MET A 1 127 ? 17.097 3.847   2.343   1.00 39.11 ? 127  MET A CE  1 
ATOM   973  N N   . PRO A 1 128 ? 18.619 -0.810  3.584   1.00 26.78 ? 128  PRO A N   1 
ATOM   974  C CA  . PRO A 1 128 ? 19.568 -0.998  4.686   1.00 26.56 ? 128  PRO A CA  1 
ATOM   975  C C   . PRO A 1 128 ? 19.669 0.328   5.430   1.00 24.46 ? 128  PRO A C   1 
ATOM   976  O O   . PRO A 1 128 ? 20.735 0.946   5.474   1.00 21.98 ? 128  PRO A O   1 
ATOM   977  C CB  . PRO A 1 128 ? 20.877 -1.303  3.952   1.00 26.63 ? 128  PRO A CB  1 
ATOM   978  C CG  . PRO A 1 128 ? 20.452 -1.690  2.560   1.00 25.78 ? 128  PRO A CG  1 
ATOM   979  C CD  . PRO A 1 128 ? 19.326 -0.757  2.300   1.00 25.10 ? 128  PRO A CD  1 
ATOM   980  N N   . VAL A 1 129 ? 18.561 0.725   6.049   1.00 21.03 ? 129  VAL A N   1 
ATOM   981  C CA  . VAL A 1 129 ? 18.457 1.999   6.747   1.00 20.78 ? 129  VAL A CA  1 
ATOM   982  C C   . VAL A 1 129 ? 19.393 2.187   7.946   1.00 17.69 ? 129  VAL A C   1 
ATOM   983  O O   . VAL A 1 129 ? 19.702 3.308   8.317   1.00 22.61 ? 129  VAL A O   1 
ATOM   984  C CB  . VAL A 1 129 ? 16.954 2.311   7.089   1.00 24.00 ? 129  VAL A CB  1 
ATOM   985  C CG1 . VAL A 1 129 ? 16.422 1.389   8.174   1.00 21.35 ? 129  VAL A CG1 1 
ATOM   986  C CG2 . VAL A 1 129 ? 16.782 3.748   7.470   1.00 29.17 ? 129  VAL A CG2 1 
ATOM   987  N N   . THR A 1 130 ? 19.895 1.098   8.513   1.00 17.32 ? 130  THR A N   1 
ATOM   988  C CA  . THR A 1 130 ? 20.814 1.186   9.653   1.00 13.69 ? 130  THR A CA  1 
ATOM   989  C C   . THR A 1 130 ? 22.282 1.465   9.243   1.00 14.61 ? 130  THR A C   1 
ATOM   990  O O   . THR A 1 130 ? 23.088 1.915   10.060  1.00 13.62 ? 130  THR A O   1 
ATOM   991  C CB  . THR A 1 130 ? 20.756 -0.102  10.482  1.00 15.46 ? 130  THR A CB  1 
ATOM   992  O OG1 . THR A 1 130 ? 20.941 -1.228  9.616   1.00 11.74 ? 130  THR A OG1 1 
ATOM   993  C CG2 . THR A 1 130 ? 19.411 -0.223  11.177  1.00 14.61 ? 130  THR A CG2 1 
ATOM   994  N N   . ALA A 1 131 ? 22.616 1.228   7.970   1.00 14.69 ? 131  ALA A N   1 
ATOM   995  C CA  . ALA A 1 131 ? 23.980 1.442   7.458   1.00 15.66 ? 131  ALA A CA  1 
ATOM   996  C C   . ALA A 1 131 ? 24.245 2.922   7.158   1.00 14.46 ? 131  ALA A C   1 
ATOM   997  O O   . ALA A 1 131 ? 24.351 3.317   5.996   1.00 14.14 ? 131  ALA A O   1 
ATOM   998  C CB  . ALA A 1 131 ? 24.209 0.598   6.202   1.00 12.71 ? 131  ALA A CB  1 
ATOM   999  N N   . ARG A 1 132 ? 24.421 3.719   8.209   1.00 14.51 ? 132  ARG A N   1 
ATOM   1000 C CA  . ARG A 1 132 ? 24.632 5.160   8.067   1.00 13.00 ? 132  ARG A CA  1 
ATOM   1001 C C   . ARG A 1 132 ? 25.782 5.710   8.895   1.00 14.40 ? 132  ARG A C   1 
ATOM   1002 O O   . ARG A 1 132 ? 25.928 6.922   9.030   1.00 13.64 ? 132  ARG A O   1 
ATOM   1003 C CB  . ARG A 1 132 ? 23.345 5.892   8.461   1.00 9.75  ? 132  ARG A CB  1 
ATOM   1004 C CG  . ARG A 1 132 ? 22.338 5.980   7.348   1.00 4.49  ? 132  ARG A CG  1 
ATOM   1005 C CD  . ARG A 1 132 ? 22.763 7.032   6.355   1.00 4.22  ? 132  ARG A CD  1 
ATOM   1006 N NE  . ARG A 1 132 ? 22.671 8.369   6.939   1.00 10.26 ? 132  ARG A NE  1 
ATOM   1007 C CZ  . ARG A 1 132 ? 23.031 9.494   6.321   1.00 10.61 ? 132  ARG A CZ  1 
ATOM   1008 N NH1 . ARG A 1 132 ? 23.516 9.437   5.095   1.00 8.43  ? 132  ARG A NH1 1 
ATOM   1009 N NH2 . ARG A 1 132 ? 22.881 10.679  6.915   1.00 6.95  ? 132  ARG A NH2 1 
ATOM   1010 N N   . VAL A 1 133 ? 26.635 4.822   9.393   1.00 16.37 ? 133  VAL A N   1 
ATOM   1011 C CA  . VAL A 1 133 ? 27.758 5.237   10.227  1.00 16.87 ? 133  VAL A CA  1 
ATOM   1012 C C   . VAL A 1 133 ? 28.918 5.923   9.505   1.00 15.33 ? 133  VAL A C   1 
ATOM   1013 O O   . VAL A 1 133 ? 29.294 5.534   8.402   1.00 15.68 ? 133  VAL A O   1 
ATOM   1014 C CB  . VAL A 1 133 ? 28.342 4.041   11.032  1.00 15.50 ? 133  VAL A CB  1 
ATOM   1015 C CG1 . VAL A 1 133 ? 29.386 4.543   12.007  1.00 19.16 ? 133  VAL A CG1 1 
ATOM   1016 C CG2 . VAL A 1 133 ? 27.241 3.305   11.800  1.00 14.09 ? 133  VAL A CG2 1 
ATOM   1017 N N   . VAL A 1 134 ? 29.428 6.989   10.115  1.00 15.97 ? 134  VAL A N   1 
ATOM   1018 C CA  . VAL A 1 134 ? 30.602 7.704   9.609   1.00 16.34 ? 134  VAL A CA  1 
ATOM   1019 C C   . VAL A 1 134 ? 31.712 7.330   10.603  1.00 17.17 ? 134  VAL A C   1 
ATOM   1020 O O   . VAL A 1 134 ? 31.589 7.591   11.811  1.00 15.59 ? 134  VAL A O   1 
ATOM   1021 C CB  . VAL A 1 134 ? 30.431 9.241   9.639   1.00 16.06 ? 134  VAL A CB  1 
ATOM   1022 C CG1 . VAL A 1 134 ? 31.669 9.913   9.080   1.00 15.63 ? 134  VAL A CG1 1 
ATOM   1023 C CG2 . VAL A 1 134 ? 29.216 9.656   8.853   1.00 13.75 ? 134  VAL A CG2 1 
ATOM   1024 N N   . PHE A 1 135 ? 32.748 6.660   10.107  1.00 11.55 ? 135  PHE A N   1 
ATOM   1025 C CA  . PHE A 1 135 ? 33.876 6.234   10.930  1.00 9.75  ? 135  PHE A CA  1 
ATOM   1026 C C   . PHE A 1 135 ? 35.091 7.109   10.641  1.00 7.41  ? 135  PHE A C   1 
ATOM   1027 O O   . PHE A 1 135 ? 35.403 7.354   9.485   1.00 8.43  ? 135  PHE A O   1 
ATOM   1028 C CB  . PHE A 1 135 ? 34.284 4.798   10.580  1.00 10.59 ? 135  PHE A CB  1 
ATOM   1029 C CG  . PHE A 1 135 ? 33.212 3.771   10.797  1.00 11.20 ? 135  PHE A CG  1 
ATOM   1030 C CD1 . PHE A 1 135 ? 32.989 3.234   12.060  1.00 10.98 ? 135  PHE A CD1 1 
ATOM   1031 C CD2 . PHE A 1 135 ? 32.470 3.291   9.729   1.00 10.12 ? 135  PHE A CD2 1 
ATOM   1032 C CE1 . PHE A 1 135 ? 32.043 2.223   12.256  1.00 12.01 ? 135  PHE A CE1 1 
ATOM   1033 C CE2 . PHE A 1 135 ? 31.523 2.284   9.910   1.00 11.95 ? 135  PHE A CE2 1 
ATOM   1034 C CZ  . PHE A 1 135 ? 31.312 1.749   11.177  1.00 14.42 ? 135  PHE A CZ  1 
ATOM   1035 N N   . VAL A 1 136 ? 35.763 7.584   11.680  1.00 8.14  ? 136  VAL A N   1 
ATOM   1036 C CA  . VAL A 1 136 ? 36.983 8.377   11.508  1.00 8.75  ? 136  VAL A CA  1 
ATOM   1037 C C   . VAL A 1 136 ? 38.127 7.580   12.152  1.00 10.52 ? 136  VAL A C   1 
ATOM   1038 O O   . VAL A 1 136 ? 38.124 7.348   13.362  1.00 10.01 ? 136  VAL A O   1 
ATOM   1039 C CB  . VAL A 1 136 ? 36.902 9.773   12.194  1.00 11.39 ? 136  VAL A CB  1 
ATOM   1040 C CG1 . VAL A 1 136 ? 38.201 10.560  11.942  1.00 10.68 ? 136  VAL A CG1 1 
ATOM   1041 C CG2 . VAL A 1 136 ? 35.689 10.578  11.680  1.00 4.74  ? 136  VAL A CG2 1 
ATOM   1042 N N   . PHE A 1 137 ? 39.069 7.124   11.336  1.00 10.73 ? 137  PHE A N   1 
ATOM   1043 C CA  . PHE A 1 137 ? 40.206 6.348   11.815  1.00 11.13 ? 137  PHE A CA  1 
ATOM   1044 C C   . PHE A 1 137 ? 41.491 7.179   11.760  1.00 8.89  ? 137  PHE A C   1 
ATOM   1045 O O   . PHE A 1 137 ? 41.646 8.048   10.915  1.00 10.50 ? 137  PHE A O   1 
ATOM   1046 C CB  . PHE A 1 137 ? 40.399 5.084   10.955  1.00 11.88 ? 137  PHE A CB  1 
ATOM   1047 C CG  . PHE A 1 137 ? 39.183 4.179   10.882  1.00 14.86 ? 137  PHE A CG  1 
ATOM   1048 C CD1 . PHE A 1 137 ? 38.855 3.336   11.945  1.00 12.88 ? 137  PHE A CD1 1 
ATOM   1049 C CD2 . PHE A 1 137 ? 38.385 4.151   9.736   1.00 13.12 ? 137  PHE A CD2 1 
ATOM   1050 C CE1 . PHE A 1 137 ? 37.757 2.483   11.867  1.00 11.10 ? 137  PHE A CE1 1 
ATOM   1051 C CE2 . PHE A 1 137 ? 37.288 3.303   9.649   1.00 12.57 ? 137  PHE A CE2 1 
ATOM   1052 C CZ  . PHE A 1 137 ? 36.974 2.464   10.725  1.00 13.68 ? 137  PHE A CZ  1 
ATOM   1053 N N   . GLY A 1 138 ? 42.407 6.917   12.679  1.00 14.28 ? 138  GLY A N   1 
ATOM   1054 C CA  . GLY A 1 138 ? 43.673 7.631   12.690  1.00 14.92 ? 138  GLY A CA  1 
ATOM   1055 C C   . GLY A 1 138 ? 44.711 6.834   11.916  1.00 16.05 ? 138  GLY A C   1 
ATOM   1056 O O   . GLY A 1 138 ? 44.422 5.720   11.483  1.00 14.09 ? 138  GLY A O   1 
ATOM   1057 N N   . PRO A 1 139 ? 45.937 7.357   11.761  1.00 18.43 ? 139  PRO A N   1 
ATOM   1058 C CA  . PRO A 1 139 ? 47.028 6.693   11.038  1.00 19.68 ? 139  PRO A CA  1 
ATOM   1059 C C   . PRO A 1 139 ? 47.297 5.296   11.594  1.00 20.40 ? 139  PRO A C   1 
ATOM   1060 O O   . PRO A 1 139 ? 47.825 4.431   10.893  1.00 18.90 ? 139  PRO A O   1 
ATOM   1061 C CB  . PRO A 1 139 ? 48.217 7.617   11.294  1.00 14.26 ? 139  PRO A CB  1 
ATOM   1062 C CG  . PRO A 1 139 ? 47.581 8.949   11.427  1.00 18.51 ? 139  PRO A CG  1 
ATOM   1063 C CD  . PRO A 1 139 ? 46.380 8.659   12.288  1.00 17.43 ? 139  PRO A CD  1 
ATOM   1064 N N   . ASP A 1 140 ? 46.907 5.086   12.850  1.00 20.29 ? 140  ASP A N   1 
ATOM   1065 C CA  . ASP A 1 140 ? 47.075 3.810   13.542  1.00 19.18 ? 140  ASP A CA  1 
ATOM   1066 C C   . ASP A 1 140 ? 45.931 2.808   13.322  1.00 20.29 ? 140  ASP A C   1 
ATOM   1067 O O   . ASP A 1 140 ? 45.851 1.784   14.011  1.00 21.97 ? 140  ASP A O   1 
ATOM   1068 C CB  . ASP A 1 140 ? 47.254 4.060   15.047  1.00 20.62 ? 140  ASP A CB  1 
ATOM   1069 C CG  . ASP A 1 140 ? 46.074 4.804   15.675  1.00 21.40 ? 140  ASP A CG  1 
ATOM   1070 O OD1 . ASP A 1 140 ? 45.065 5.093   14.979  1.00 19.70 ? 140  ASP A OD1 1 
ATOM   1071 O OD2 . ASP A 1 140 ? 46.164 5.111   16.878  1.00 16.48 ? 140  ASP A OD2 1 
ATOM   1072 N N   . LYS A 1 141 ? 45.025 3.127   12.399  1.00 17.03 ? 141  LYS A N   1 
ATOM   1073 C CA  . LYS A 1 141 ? 43.876 2.275   12.047  1.00 12.88 ? 141  LYS A CA  1 
ATOM   1074 C C   . LYS A 1 141 ? 42.832 2.142   13.160  1.00 14.89 ? 141  LYS A C   1 
ATOM   1075 O O   . LYS A 1 141 ? 41.910 1.333   13.052  1.00 17.38 ? 141  LYS A O   1 
ATOM   1076 C CB  . LYS A 1 141 ? 44.340 0.875   11.612  1.00 15.35 ? 141  LYS A CB  1 
ATOM   1077 C CG  . LYS A 1 141 ? 45.538 0.843   10.671  1.00 19.31 ? 141  LYS A CG  1 
ATOM   1078 C CD  . LYS A 1 141 ? 45.294 1.595   9.379   1.00 16.21 ? 141  LYS A CD  1 
ATOM   1079 C CE  . LYS A 1 141 ? 46.573 1.688   8.537   1.00 21.21 ? 141  LYS A CE  1 
ATOM   1080 N NZ  . LYS A 1 141 ? 47.721 2.425   9.164   1.00 18.89 ? 141  LYS A NZ  1 
ATOM   1081 N N   . LYS A 1 142 ? 42.964 2.941   14.216  1.00 15.63 ? 142  LYS A N   1 
ATOM   1082 C CA  . LYS A 1 142 ? 42.020 2.896   15.339  1.00 16.77 ? 142  LYS A CA  1 
ATOM   1083 C C   . LYS A 1 142 ? 40.876 3.913   15.235  1.00 12.46 ? 142  LYS A C   1 
ATOM   1084 O O   . LYS A 1 142 ? 41.071 5.034   14.760  1.00 8.03  ? 142  LYS A O   1 
ATOM   1085 C CB  . LYS A 1 142 ? 42.764 3.084   16.663  1.00 16.25 ? 142  LYS A CB  1 
ATOM   1086 C CG  . LYS A 1 142 ? 43.645 1.912   17.028  1.00 24.03 ? 142  LYS A CG  1 
ATOM   1087 C CD  . LYS A 1 142 ? 44.506 2.205   18.245  1.00 25.11 ? 142  LYS A CD  1 
ATOM   1088 C CE  . LYS A 1 142 ? 45.276 0.963   18.650  1.00 31.65 ? 142  LYS A CE  1 
ATOM   1089 N NZ  . LYS A 1 142 ? 46.072 0.370   17.515  1.00 38.81 ? 142  LYS A NZ  1 
ATOM   1090 N N   . LEU A 1 143 ? 39.697 3.515   15.710  1.00 13.33 ? 143  LEU A N   1 
ATOM   1091 C CA  . LEU A 1 143 ? 38.514 4.364   15.679  1.00 12.55 ? 143  LEU A CA  1 
ATOM   1092 C C   . LEU A 1 143 ? 38.721 5.548   16.610  1.00 11.28 ? 143  LEU A C   1 
ATOM   1093 O O   . LEU A 1 143 ? 38.998 5.369   17.782  1.00 12.21 ? 143  LEU A O   1 
ATOM   1094 C CB  . LEU A 1 143 ? 37.289 3.572   16.141  1.00 15.91 ? 143  LEU A CB  1 
ATOM   1095 C CG  . LEU A 1 143 ? 35.926 3.665   15.433  1.00 15.04 ? 143  LEU A CG  1 
ATOM   1096 C CD1 . LEU A 1 143 ? 34.816 3.871   16.460  1.00 12.02 ? 143  LEU A CD1 1 
ATOM   1097 C CD2 . LEU A 1 143 ? 35.903 4.762   14.392  1.00 11.38 ? 143  LEU A CD2 1 
ATOM   1098 N N   . LYS A 1 144 ? 38.594 6.756   16.083  1.00 12.49 ? 144  LYS A N   1 
ATOM   1099 C CA  . LYS A 1 144 ? 38.766 7.953   16.899  1.00 13.81 ? 144  LYS A CA  1 
ATOM   1100 C C   . LYS A 1 144 ? 37.436 8.664   17.143  1.00 14.00 ? 144  LYS A C   1 
ATOM   1101 O O   . LYS A 1 144 ? 37.280 9.376   18.127  1.00 10.32 ? 144  LYS A O   1 
ATOM   1102 C CB  . LYS A 1 144 ? 39.728 8.930   16.210  1.00 13.47 ? 144  LYS A CB  1 
ATOM   1103 C CG  . LYS A 1 144 ? 41.151 8.408   16.031  1.00 13.54 ? 144  LYS A CG  1 
ATOM   1104 C CD  . LYS A 1 144 ? 41.743 8.049   17.383  1.00 17.38 ? 144  LYS A CD  1 
ATOM   1105 C CE  . LYS A 1 144 ? 43.215 7.697   17.296  1.00 15.77 ? 144  LYS A CE  1 
ATOM   1106 N NZ  . LYS A 1 144 ? 43.430 6.706   16.240  1.00 24.53 ? 144  LYS A NZ  1 
ATOM   1107 N N   . LEU A 1 145 ? 36.443 8.395   16.299  1.00 12.87 ? 145  LEU A N   1 
ATOM   1108 C CA  . LEU A 1 145 ? 35.167 9.103   16.401  1.00 13.88 ? 145  LEU A CA  1 
ATOM   1109 C C   . LEU A 1 145 ? 34.183 8.496   15.399  1.00 15.63 ? 145  LEU A C   1 
ATOM   1110 O O   . LEU A 1 145 ? 34.596 7.942   14.374  1.00 18.28 ? 145  LEU A O   1 
ATOM   1111 C CB  . LEU A 1 145 ? 35.472 10.570  16.026  1.00 12.06 ? 145  LEU A CB  1 
ATOM   1112 C CG  . LEU A 1 145 ? 34.658 11.837  15.747  1.00 13.89 ? 145  LEU A CG  1 
ATOM   1113 C CD1 . LEU A 1 145 ? 33.350 11.545  15.059  1.00 10.48 ? 145  LEU A CD1 1 
ATOM   1114 C CD2 . LEU A 1 145 ? 34.475 12.640  16.994  1.00 13.47 ? 145  LEU A CD2 1 
ATOM   1115 N N   . SER A 1 146 ? 32.893 8.532   15.722  1.00 16.01 ? 146  SER A N   1 
ATOM   1116 C CA  . SER A 1 146 ? 31.866 8.039   14.809  1.00 13.66 ? 146  SER A CA  1 
ATOM   1117 C C   . SER A 1 146 ? 30.585 8.846   15.016  1.00 14.51 ? 146  SER A C   1 
ATOM   1118 O O   . SER A 1 146 ? 30.359 9.432   16.077  1.00 14.46 ? 146  SER A O   1 
ATOM   1119 C CB  . SER A 1 146 ? 31.628 6.525   14.956  1.00 11.29 ? 146  SER A CB  1 
ATOM   1120 O OG  . SER A 1 146 ? 31.000 6.175   16.174  1.00 15.88 ? 146  SER A OG  1 
ATOM   1121 N N   . ILE A 1 147 ? 29.784 8.926   13.967  1.00 17.37 ? 147  ILE A N   1 
ATOM   1122 C CA  . ILE A 1 147 ? 28.527 9.675   13.983  1.00 18.11 ? 147  ILE A CA  1 
ATOM   1123 C C   . ILE A 1 147 ? 27.498 8.761   13.339  1.00 15.14 ? 147  ILE A C   1 
ATOM   1124 O O   . ILE A 1 147 ? 27.809 8.062   12.382  1.00 16.81 ? 147  ILE A O   1 
ATOM   1125 C CB  . ILE A 1 147 ? 28.698 10.990  13.166  1.00 17.99 ? 147  ILE A CB  1 
ATOM   1126 C CG1 . ILE A 1 147 ? 29.609 11.951  13.932  1.00 19.66 ? 147  ILE A CG1 1 
ATOM   1127 C CG2 . ILE A 1 147 ? 27.371 11.638  12.876  1.00 18.25 ? 147  ILE A CG2 1 
ATOM   1128 C CD1 . ILE A 1 147 ? 30.259 13.030  13.064  1.00 23.50 ? 147  ILE A CD1 1 
ATOM   1129 N N   . LEU A 1 148 ? 26.310 8.686   13.914  1.00 16.64 ? 148  LEU A N   1 
ATOM   1130 C CA  . LEU A 1 148 ? 25.278 7.824   13.355  1.00 14.23 ? 148  LEU A CA  1 
ATOM   1131 C C   . LEU A 1 148 ? 23.995 8.618   13.141  1.00 11.05 ? 148  LEU A C   1 
ATOM   1132 O O   . LEU A 1 148 ? 23.154 8.694   14.032  1.00 12.17 ? 148  LEU A O   1 
ATOM   1133 C CB  . LEU A 1 148 ? 25.008 6.644   14.292  1.00 13.58 ? 148  LEU A CB  1 
ATOM   1134 C CG  . LEU A 1 148 ? 24.602 5.278   13.722  1.00 15.96 ? 148  LEU A CG  1 
ATOM   1135 C CD1 . LEU A 1 148 ? 23.708 4.586   14.752  1.00 11.55 ? 148  LEU A CD1 1 
ATOM   1136 C CD2 . LEU A 1 148 ? 23.900 5.371   12.355  1.00 8.16  ? 148  LEU A CD2 1 
ATOM   1137 N N   . TYR A 1 149 ? 23.876 9.238   11.973  1.00 12.99 ? 149  TYR A N   1 
ATOM   1138 C CA  . TYR A 1 149 ? 22.699 10.019  11.624  1.00 13.01 ? 149  TYR A CA  1 
ATOM   1139 C C   . TYR A 1 149 ? 21.858 9.179   10.677  1.00 15.54 ? 149  TYR A C   1 
ATOM   1140 O O   . TYR A 1 149 ? 22.391 8.487   9.813   1.00 16.18 ? 149  TYR A O   1 
ATOM   1141 C CB  . TYR A 1 149 ? 23.080 11.320  10.900  1.00 9.14  ? 149  TYR A CB  1 
ATOM   1142 C CG  . TYR A 1 149 ? 23.676 12.442  11.735  1.00 9.38  ? 149  TYR A CG  1 
ATOM   1143 C CD1 . TYR A 1 149 ? 24.070 12.254  13.063  1.00 5.67  ? 149  TYR A CD1 1 
ATOM   1144 C CD2 . TYR A 1 149 ? 23.874 13.693  11.167  1.00 8.03  ? 149  TYR A CD2 1 
ATOM   1145 C CE1 . TYR A 1 149 ? 24.650 13.293  13.790  1.00 6.41  ? 149  TYR A CE1 1 
ATOM   1146 C CE2 . TYR A 1 149 ? 24.452 14.731  11.878  1.00 6.93  ? 149  TYR A CE2 1 
ATOM   1147 C CZ  . TYR A 1 149 ? 24.840 14.530  13.185  1.00 8.60  ? 149  TYR A CZ  1 
ATOM   1148 O OH  . TYR A 1 149 ? 25.441 15.564  13.860  1.00 10.47 ? 149  TYR A OH  1 
ATOM   1149 N N   . PRO A 1 150 ? 20.526 9.200   10.847  1.00 16.42 ? 150  PRO A N   1 
ATOM   1150 C CA  . PRO A 1 150 ? 19.636 8.430   9.978   1.00 14.21 ? 150  PRO A CA  1 
ATOM   1151 C C   . PRO A 1 150 ? 19.730 8.995   8.564   1.00 14.87 ? 150  PRO A C   1 
ATOM   1152 O O   . PRO A 1 150 ? 20.269 10.088  8.370   1.00 14.78 ? 150  PRO A O   1 
ATOM   1153 C CB  . PRO A 1 150 ? 18.263 8.669   10.610  1.00 11.77 ? 150  PRO A CB  1 
ATOM   1154 C CG  . PRO A 1 150 ? 18.412 10.016  11.233  1.00 16.09 ? 150  PRO A CG  1 
ATOM   1155 C CD  . PRO A 1 150 ? 19.761 9.915   11.879  1.00 13.51 ? 150  PRO A CD  1 
ATOM   1156 N N   . ALA A 1 151 ? 19.159 8.300   7.588   1.00 13.06 ? 151  ALA A N   1 
ATOM   1157 C CA  . ALA A 1 151 ? 19.238 8.715   6.190   1.00 14.98 ? 151  ALA A CA  1 
ATOM   1158 C C   . ALA A 1 151 ? 18.352 9.897   5.869   1.00 14.93 ? 151  ALA A C   1 
ATOM   1159 O O   . ALA A 1 151 ? 18.312 10.345  4.709   1.00 15.42 ? 151  ALA A O   1 
ATOM   1160 C CB  . ALA A 1 151 ? 18.887 7.531   5.269   1.00 19.71 ? 151  ALA A CB  1 
ATOM   1161 N N   . THR A 1 152 ? 17.573 10.325  6.861   1.00 13.93 ? 152  THR A N   1 
ATOM   1162 C CA  . THR A 1 152 ? 16.654 11.442  6.721   1.00 10.88 ? 152  THR A CA  1 
ATOM   1163 C C   . THR A 1 152 ? 17.211 12.723  7.316   1.00 13.14 ? 152  THR A C   1 
ATOM   1164 O O   . THR A 1 152 ? 16.608 13.784  7.158   1.00 14.49 ? 152  THR A O   1 
ATOM   1165 C CB  . THR A 1 152 ? 15.289 11.114  7.371   1.00 13.87 ? 152  THR A CB  1 
ATOM   1166 O OG1 . THR A 1 152 ? 15.509 10.442  8.617   1.00 17.26 ? 152  THR A OG1 1 
ATOM   1167 C CG2 . THR A 1 152 ? 14.471 10.209  6.456   1.00 14.62 ? 152  THR A CG2 1 
ATOM   1168 N N   . THR A 1 153 ? 18.366 12.621  7.975   1.00 13.44 ? 153  THR A N   1 
ATOM   1169 C CA  . THR A 1 153 ? 19.047 13.768  8.577   1.00 12.51 ? 153  THR A CA  1 
ATOM   1170 C C   . THR A 1 153 ? 20.440 13.897  7.983   1.00 13.07 ? 153  THR A C   1 
ATOM   1171 O O   . THR A 1 153 ? 21.372 13.201  8.406   1.00 11.62 ? 153  THR A O   1 
ATOM   1172 C CB  . THR A 1 153 ? 19.176 13.629  10.122  1.00 16.59 ? 153  THR A CB  1 
ATOM   1173 O OG1 . THR A 1 153 ? 17.876 13.678  10.704  1.00 20.11 ? 153  THR A OG1 1 
ATOM   1174 C CG2 . THR A 1 153 ? 19.992 14.769  10.708  1.00 15.28 ? 153  THR A CG2 1 
ATOM   1175 N N   . GLY A 1 154 ? 20.578 14.806  7.018   1.00 14.05 ? 154  GLY A N   1 
ATOM   1176 C CA  . GLY A 1 154 ? 21.855 15.025  6.366   1.00 14.98 ? 154  GLY A CA  1 
ATOM   1177 C C   . GLY A 1 154 ? 22.938 15.484  7.320   1.00 12.70 ? 154  GLY A C   1 
ATOM   1178 O O   . GLY A 1 154 ? 22.683 16.264  8.236   1.00 12.36 ? 154  GLY A O   1 
ATOM   1179 N N   . ARG A 1 155 ? 24.154 14.992  7.110   1.00 9.75  ? 155  ARG A N   1 
ATOM   1180 C CA  . ARG A 1 155 ? 25.266 15.365  7.964   1.00 8.36  ? 155  ARG A CA  1 
ATOM   1181 C C   . ARG A 1 155 ? 25.643 16.824  7.792   1.00 6.71  ? 155  ARG A C   1 
ATOM   1182 O O   . ARG A 1 155 ? 25.264 17.466  6.820   1.00 12.41 ? 155  ARG A O   1 
ATOM   1183 C CB  . ARG A 1 155 ? 26.485 14.477  7.683   1.00 3.86  ? 155  ARG A CB  1 
ATOM   1184 C CG  . ARG A 1 155 ? 26.276 13.020  8.082   1.00 5.17  ? 155  ARG A CG  1 
ATOM   1185 C CD  . ARG A 1 155 ? 26.820 12.106  6.998   1.00 7.42  ? 155  ARG A CD  1 
ATOM   1186 N NE  . ARG A 1 155 ? 26.562 10.685  7.246   1.00 12.39 ? 155  ARG A NE  1 
ATOM   1187 C CZ  . ARG A 1 155 ? 26.894 9.701   6.411   1.00 10.83 ? 155  ARG A CZ  1 
ATOM   1188 N NH1 . ARG A 1 155 ? 27.491 9.985   5.260   1.00 13.20 ? 155  ARG A NH1 1 
ATOM   1189 N NH2 . ARG A 1 155 ? 26.712 8.435   6.773   1.00 14.18 ? 155  ARG A NH2 1 
ATOM   1190 N N   . ASN A 1 156 ? 26.381 17.336  8.763   1.00 10.07 ? 156  ASN A N   1 
ATOM   1191 C CA  . ASN A 1 156 ? 26.880 18.700  8.759   1.00 12.30 ? 156  ASN A CA  1 
ATOM   1192 C C   . ASN A 1 156 ? 28.400 18.581  8.557   1.00 10.04 ? 156  ASN A C   1 
ATOM   1193 O O   . ASN A 1 156 ? 29.116 18.062  9.420   1.00 8.83  ? 156  ASN A O   1 
ATOM   1194 C CB  . ASN A 1 156 ? 26.552 19.357  10.106  1.00 12.96 ? 156  ASN A CB  1 
ATOM   1195 C CG  . ASN A 1 156 ? 27.227 20.696  10.292  1.00 11.29 ? 156  ASN A CG  1 
ATOM   1196 O OD1 . ASN A 1 156 ? 28.040 21.121  9.475   1.00 13.47 ? 156  ASN A OD1 1 
ATOM   1197 N ND2 . ASN A 1 156 ? 26.931 21.346  11.398  1.00 14.40 ? 156  ASN A ND2 1 
ATOM   1198 N N   . PHE A 1 157 ? 28.892 19.019  7.406   1.00 12.54 ? 157  PHE A N   1 
ATOM   1199 C CA  . PHE A 1 157 ? 30.319 18.934  7.122   1.00 13.55 ? 157  PHE A CA  1 
ATOM   1200 C C   . PHE A 1 157 ? 31.218 19.939  7.840   1.00 11.83 ? 157  PHE A C   1 
ATOM   1201 O O   . PHE A 1 157 ? 32.404 19.671  8.021   1.00 16.48 ? 157  PHE A O   1 
ATOM   1202 C CB  . PHE A 1 157 ? 30.576 18.880  5.615   1.00 11.98 ? 157  PHE A CB  1 
ATOM   1203 C CG  . PHE A 1 157 ? 30.463 17.494  5.053   1.00 12.20 ? 157  PHE A CG  1 
ATOM   1204 C CD1 . PHE A 1 157 ? 29.211 16.917  4.827   1.00 14.20 ? 157  PHE A CD1 1 
ATOM   1205 C CD2 . PHE A 1 157 ? 31.605 16.736  4.810   1.00 11.60 ? 157  PHE A CD2 1 
ATOM   1206 C CE1 . PHE A 1 157 ? 29.099 15.603  4.369   1.00 12.61 ? 157  PHE A CE1 1 
ATOM   1207 C CE2 . PHE A 1 157 ? 31.508 15.424  4.354   1.00 14.11 ? 157  PHE A CE2 1 
ATOM   1208 C CZ  . PHE A 1 157 ? 30.247 14.854  4.132   1.00 16.53 ? 157  PHE A CZ  1 
ATOM   1209 N N   . ASP A 1 158 ? 30.668 21.069  8.280   1.00 12.78 ? 158  ASP A N   1 
ATOM   1210 C CA  . ASP A 1 158 ? 31.463 22.038  9.038   1.00 13.12 ? 158  ASP A CA  1 
ATOM   1211 C C   . ASP A 1 158 ? 31.822 21.317  10.330  1.00 12.92 ? 158  ASP A C   1 
ATOM   1212 O O   . ASP A 1 158 ? 32.965 21.326  10.768  1.00 16.02 ? 158  ASP A O   1 
ATOM   1213 C CB  . ASP A 1 158 ? 30.654 23.281  9.399   1.00 10.94 ? 158  ASP A CB  1 
ATOM   1214 C CG  . ASP A 1 158 ? 30.447 24.222  8.226   1.00 21.67 ? 158  ASP A CG  1 
ATOM   1215 O OD1 . ASP A 1 158 ? 31.254 24.215  7.279   1.00 24.41 ? 158  ASP A OD1 1 
ATOM   1216 O OD2 . ASP A 1 158 ? 29.472 25.002  8.274   1.00 29.50 ? 158  ASP A OD2 1 
ATOM   1217 N N   . GLU A 1 159 ? 30.837 20.641  10.909  1.00 11.97 ? 159  GLU A N   1 
ATOM   1218 C CA  . GLU A 1 159 ? 31.049 19.898  12.142  1.00 14.35 ? 159  GLU A CA  1 
ATOM   1219 C C   . GLU A 1 159 ? 32.060 18.770  11.963  1.00 12.39 ? 159  GLU A C   1 
ATOM   1220 O O   . GLU A 1 159 ? 32.870 18.513  12.856  1.00 11.05 ? 159  GLU A O   1 
ATOM   1221 C CB  . GLU A 1 159 ? 29.721 19.346  12.676  1.00 10.32 ? 159  GLU A CB  1 
ATOM   1222 C CG  . GLU A 1 159 ? 29.837 18.520  13.955  1.00 12.91 ? 159  GLU A CG  1 
ATOM   1223 C CD  . GLU A 1 159 ? 30.345 19.300  15.169  1.00 12.84 ? 159  GLU A CD  1 
ATOM   1224 O OE1 . GLU A 1 159 ? 30.510 20.537  15.111  1.00 17.74 ? 159  GLU A OE1 1 
ATOM   1225 O OE2 . GLU A 1 159 ? 30.599 18.676  16.212  1.00 12.93 ? 159  GLU A OE2 1 
ATOM   1226 N N   . ILE A 1 160 ? 32.019 18.094  10.815  1.00 12.48 ? 160  ILE A N   1 
ATOM   1227 C CA  . ILE A 1 160 ? 32.952 17.002  10.574  1.00 13.16 ? 160  ILE A CA  1 
ATOM   1228 C C   . ILE A 1 160 ? 34.384 17.500  10.439  1.00 13.77 ? 160  ILE A C   1 
ATOM   1229 O O   . ILE A 1 160 ? 35.315 16.843  10.906  1.00 12.24 ? 160  ILE A O   1 
ATOM   1230 C CB  . ILE A 1 160 ? 32.560 16.128  9.357   1.00 11.48 ? 160  ILE A CB  1 
ATOM   1231 C CG1 . ILE A 1 160 ? 31.255 15.386  9.662   1.00 8.92  ? 160  ILE A CG1 1 
ATOM   1232 C CG2 . ILE A 1 160 ? 33.697 15.142  9.023   1.00 8.22  ? 160  ILE A CG2 1 
ATOM   1233 C CD1 . ILE A 1 160 ? 30.763 14.500  8.566   1.00 11.18 ? 160  ILE A CD1 1 
ATOM   1234 N N   . LEU A 1 161 ? 34.559 18.662  9.822   1.00 11.13 ? 161  LEU A N   1 
ATOM   1235 C CA  . LEU A 1 161 ? 35.888 19.228  9.673   1.00 14.27 ? 161  LEU A CA  1 
ATOM   1236 C C   . LEU A 1 161 ? 36.361 19.737  11.036  1.00 12.30 ? 161  LEU A C   1 
ATOM   1237 O O   . LEU A 1 161 ? 37.536 19.621  11.386  1.00 13.66 ? 161  LEU A O   1 
ATOM   1238 C CB  . LEU A 1 161 ? 35.872 20.377  8.672   1.00 17.52 ? 161  LEU A CB  1 
ATOM   1239 C CG  . LEU A 1 161 ? 36.947 20.323  7.579   1.00 27.39 ? 161  LEU A CG  1 
ATOM   1240 C CD1 . LEU A 1 161 ? 36.772 21.521  6.643   1.00 31.28 ? 161  LEU A CD1 1 
ATOM   1241 C CD2 . LEU A 1 161 ? 38.352 20.301  8.177   1.00 20.51 ? 161  LEU A CD2 1 
ATOM   1242 N N   . ARG A 1 162 ? 35.438 20.298  11.806  1.00 10.68 ? 162  ARG A N   1 
ATOM   1243 C CA  . ARG A 1 162 ? 35.760 20.828  13.116  1.00 11.97 ? 162  ARG A CA  1 
ATOM   1244 C C   . ARG A 1 162 ? 36.299 19.731  14.027  1.00 13.42 ? 162  ARG A C   1 
ATOM   1245 O O   . ARG A 1 162 ? 37.299 19.934  14.723  1.00 18.00 ? 162  ARG A O   1 
ATOM   1246 C CB  . ARG A 1 162 ? 34.520 21.498  13.725  1.00 15.11 ? 162  ARG A CB  1 
ATOM   1247 C CG  . ARG A 1 162 ? 34.701 22.032  15.128  1.00 12.10 ? 162  ARG A CG  1 
ATOM   1248 C CD  . ARG A 1 162 ? 33.435 21.812  15.970  1.00 15.53 ? 162  ARG A CD  1 
ATOM   1249 N NE  . ARG A 1 162 ? 33.778 21.913  17.384  1.00 18.60 ? 162  ARG A NE  1 
ATOM   1250 C CZ  . ARG A 1 162 ? 33.437 21.019  18.290  1.00 17.12 ? 162  ARG A CZ  1 
ATOM   1251 N NH1 . ARG A 1 162 ? 32.711 19.965  17.922  1.00 13.51 ? 162  ARG A NH1 1 
ATOM   1252 N NH2 . ARG A 1 162 ? 33.908 21.128  19.531  1.00 24.98 ? 162  ARG A NH2 1 
ATOM   1253 N N   . VAL A 1 163 ? 35.643 18.572  14.027  1.00 11.80 ? 163  VAL A N   1 
ATOM   1254 C CA  . VAL A 1 163 ? 36.073 17.450  14.858  1.00 11.58 ? 163  VAL A CA  1 
ATOM   1255 C C   . VAL A 1 163 ? 37.396 16.817  14.415  1.00 11.91 ? 163  VAL A C   1 
ATOM   1256 O O   . VAL A 1 163 ? 38.131 16.279  15.239  1.00 12.49 ? 163  VAL A O   1 
ATOM   1257 C CB  . VAL A 1 163 ? 34.958 16.344  15.029  1.00 10.15 ? 163  VAL A CB  1 
ATOM   1258 C CG1 . VAL A 1 163 ? 33.731 16.944  15.706  1.00 9.58  ? 163  VAL A CG1 1 
ATOM   1259 C CG2 . VAL A 1 163 ? 34.583 15.696  13.699  1.00 9.01  ? 163  VAL A CG2 1 
ATOM   1260 N N   . VAL A 1 164 ? 37.693 16.863  13.119  1.00 13.52 ? 164  VAL A N   1 
ATOM   1261 C CA  . VAL A 1 164 ? 38.941 16.308  12.597  1.00 14.31 ? 164  VAL A CA  1 
ATOM   1262 C C   . VAL A 1 164 ? 40.062 17.187  13.130  1.00 12.16 ? 164  VAL A C   1 
ATOM   1263 O O   . VAL A 1 164 ? 41.100 16.681  13.547  1.00 11.61 ? 164  VAL A O   1 
ATOM   1264 C CB  . VAL A 1 164 ? 38.941 16.269  11.039  1.00 16.25 ? 164  VAL A CB  1 
ATOM   1265 C CG1 . VAL A 1 164 ? 40.362 16.236  10.481  1.00 16.24 ? 164  VAL A CG1 1 
ATOM   1266 C CG2 . VAL A 1 164 ? 38.204 15.037  10.574  1.00 15.15 ? 164  VAL A CG2 1 
ATOM   1267 N N   . ILE A 1 165 ? 39.816 18.497  13.148  1.00 12.93 ? 165  ILE A N   1 
ATOM   1268 C CA  . ILE A 1 165 ? 40.773 19.476  13.659  1.00 14.31 ? 165  ILE A CA  1 
ATOM   1269 C C   . ILE A 1 165 ? 41.058 19.252  15.156  1.00 12.64 ? 165  ILE A C   1 
ATOM   1270 O O   . ILE A 1 165 ? 42.208 19.317  15.572  1.00 12.92 ? 165  ILE A O   1 
ATOM   1271 C CB  . ILE A 1 165 ? 40.288 20.928  13.361  1.00 14.10 ? 165  ILE A CB  1 
ATOM   1272 C CG1 . ILE A 1 165 ? 40.419 21.209  11.862  1.00 14.25 ? 165  ILE A CG1 1 
ATOM   1273 C CG2 . ILE A 1 165 ? 41.091 21.948  14.164  1.00 15.73 ? 165  ILE A CG2 1 
ATOM   1274 C CD1 . ILE A 1 165 ? 39.843 22.536  11.411  1.00 14.16 ? 165  ILE A CD1 1 
ATOM   1275 N N   . SER A 1 166 ? 40.025 18.968  15.960  1.00 8.52  ? 166  SER A N   1 
ATOM   1276 C CA  . SER A 1 166 ? 40.220 18.694  17.390  1.00 11.45 ? 166  SER A CA  1 
ATOM   1277 C C   . SER A 1 166 ? 41.042 17.421  17.576  1.00 7.97  ? 166  SER A C   1 
ATOM   1278 O O   . SER A 1 166 ? 41.980 17.386  18.365  1.00 14.82 ? 166  SER A O   1 
ATOM   1279 C CB  . SER A 1 166 ? 38.881 18.480  18.103  1.00 9.08  ? 166  SER A CB  1 
ATOM   1280 O OG  . SER A 1 166 ? 37.906 19.334  17.545  1.00 31.05 ? 166  SER A OG  1 
ATOM   1281 N N   . LEU A 1 167 ? 40.626 16.364  16.890  1.00 9.93  ? 167  LEU A N   1 
ATOM   1282 C CA  . LEU A 1 167 ? 41.282 15.063  16.935  1.00 9.76  ? 167  LEU A CA  1 
ATOM   1283 C C   . LEU A 1 167 ? 42.781 15.203  16.662  1.00 12.57 ? 167  LEU A C   1 
ATOM   1284 O O   . LEU A 1 167 ? 43.614 14.707  17.420  1.00 13.65 ? 167  LEU A O   1 
ATOM   1285 C CB  . LEU A 1 167 ? 40.632 14.137  15.900  1.00 13.87 ? 167  LEU A CB  1 
ATOM   1286 C CG  . LEU A 1 167 ? 39.575 13.086  16.293  1.00 13.56 ? 167  LEU A CG  1 
ATOM   1287 C CD1 . LEU A 1 167 ? 38.772 13.545  17.455  1.00 18.71 ? 167  LEU A CD1 1 
ATOM   1288 C CD2 . LEU A 1 167 ? 38.672 12.740  15.114  1.00 9.67  ? 167  LEU A CD2 1 
ATOM   1289 N N   . GLN A 1 168 ? 43.130 15.923  15.599  1.00 15.27 ? 168  GLN A N   1 
ATOM   1290 C CA  . GLN A 1 168 ? 44.534 16.122  15.244  1.00 13.84 ? 168  GLN A CA  1 
ATOM   1291 C C   . GLN A 1 168 ? 45.274 17.027  16.232  1.00 14.02 ? 168  GLN A C   1 
ATOM   1292 O O   . GLN A 1 168 ? 46.472 16.866  16.437  1.00 16.18 ? 168  GLN A O   1 
ATOM   1293 C CB  . GLN A 1 168 ? 44.658 16.646  13.818  1.00 14.40 ? 168  GLN A CB  1 
ATOM   1294 C CG  . GLN A 1 168 ? 44.058 15.696  12.783  1.00 12.29 ? 168  GLN A CG  1 
ATOM   1295 C CD  . GLN A 1 168 ? 44.348 16.115  11.352  1.00 9.58  ? 168  GLN A CD  1 
ATOM   1296 O OE1 . GLN A 1 168 ? 44.484 17.297  11.049  1.00 12.00 ? 168  GLN A OE1 1 
ATOM   1297 N NE2 . GLN A 1 168 ? 44.457 15.140  10.468  1.00 9.12  ? 168  GLN A NE2 1 
ATOM   1298 N N   . LEU A 1 169 ? 44.558 17.965  16.850  1.00 17.59 ? 169  LEU A N   1 
ATOM   1299 C CA  . LEU A 1 169 ? 45.132 18.858  17.867  1.00 16.71 ? 169  LEU A CA  1 
ATOM   1300 C C   . LEU A 1 169 ? 45.491 18.044  19.122  1.00 16.49 ? 169  LEU A C   1 
ATOM   1301 O O   . LEU A 1 169 ? 46.533 18.255  19.729  1.00 17.07 ? 169  LEU A O   1 
ATOM   1302 C CB  . LEU A 1 169 ? 44.122 19.935  18.271  1.00 18.03 ? 169  LEU A CB  1 
ATOM   1303 C CG  . LEU A 1 169 ? 44.482 21.415  18.141  1.00 23.43 ? 169  LEU A CG  1 
ATOM   1304 C CD1 . LEU A 1 169 ? 43.370 22.220  18.800  1.00 17.99 ? 169  LEU A CD1 1 
ATOM   1305 C CD2 . LEU A 1 169 ? 45.835 21.723  18.788  1.00 24.27 ? 169  LEU A CD2 1 
ATOM   1306 N N   . THR A 1 170 ? 44.599 17.147  19.524  1.00 13.93 ? 170  THR A N   1 
ATOM   1307 C CA  . THR A 1 170 ? 44.831 16.295  20.677  1.00 16.93 ? 170  THR A CA  1 
ATOM   1308 C C   . THR A 1 170 ? 46.004 15.344  20.415  1.00 17.97 ? 170  THR A C   1 
ATOM   1309 O O   . THR A 1 170 ? 46.876 15.167  21.265  1.00 15.30 ? 170  THR A O   1 
ATOM   1310 C CB  . THR A 1 170 ? 43.547 15.508  21.013  1.00 17.88 ? 170  THR A CB  1 
ATOM   1311 O OG1 . THR A 1 170 ? 42.513 16.443  21.332  1.00 19.88 ? 170  THR A OG1 1 
ATOM   1312 C CG2 . THR A 1 170 ? 43.766 14.561  22.188  1.00 18.84 ? 170  THR A CG2 1 
ATOM   1313 N N   . ALA A 1 171 ? 46.046 14.786  19.207  1.00 18.89 ? 171  ALA A N   1 
ATOM   1314 C CA  . ALA A 1 171 ? 47.104 13.873  18.797  1.00 18.23 ? 171  ALA A CA  1 
ATOM   1315 C C   . ALA A 1 171 ? 48.469 14.549  18.766  1.00 20.76 ? 171  ALA A C   1 
ATOM   1316 O O   . ALA A 1 171 ? 49.478 13.945  19.125  1.00 20.34 ? 171  ALA A O   1 
ATOM   1317 C CB  . ALA A 1 171 ? 46.794 13.294  17.421  1.00 11.88 ? 171  ALA A CB  1 
ATOM   1318 N N   . GLU A 1 172 ? 48.494 15.806  18.344  1.00 22.78 ? 172  GLU A N   1 
ATOM   1319 C CA  . GLU A 1 172 ? 49.751 16.516  18.223  1.00 22.84 ? 172  GLU A CA  1 
ATOM   1320 C C   . GLU A 1 172 ? 50.165 17.434  19.353  1.00 21.60 ? 172  GLU A C   1 
ATOM   1321 O O   . GLU A 1 172 ? 51.341 17.472  19.717  1.00 20.33 ? 172  GLU A O   1 
ATOM   1322 C CB  . GLU A 1 172 ? 49.787 17.269  16.894  1.00 28.86 ? 172  GLU A CB  1 
ATOM   1323 C CG  . GLU A 1 172 ? 49.843 16.351  15.674  1.00 38.88 ? 172  GLU A CG  1 
ATOM   1324 C CD  . GLU A 1 172 ? 49.787 17.112  14.359  1.00 47.27 ? 172  GLU A CD  1 
ATOM   1325 O OE1 . GLU A 1 172 ? 50.401 18.204  14.254  1.00 52.63 ? 172  GLU A OE1 1 
ATOM   1326 O OE2 . GLU A 1 172 ? 49.117 16.616  13.428  1.00 51.47 ? 172  GLU A OE2 1 
ATOM   1327 N N   . LYS A 1 173 ? 49.220 18.182  19.910  1.00 17.38 ? 173  LYS A N   1 
ATOM   1328 C CA  . LYS A 1 173 ? 49.560 19.119  20.973  1.00 15.01 ? 173  LYS A CA  1 
ATOM   1329 C C   . LYS A 1 173 ? 49.164 18.716  22.389  1.00 15.68 ? 173  LYS A C   1 
ATOM   1330 O O   . LYS A 1 173 ? 49.370 19.479  23.323  1.00 17.46 ? 173  LYS A O   1 
ATOM   1331 C CB  . LYS A 1 173 ? 48.994 20.494  20.655  1.00 15.03 ? 173  LYS A CB  1 
ATOM   1332 C CG  . LYS A 1 173 ? 49.248 20.967  19.235  1.00 21.81 ? 173  LYS A CG  1 
ATOM   1333 C CD  . LYS A 1 173 ? 50.713 21.255  18.969  1.00 30.89 ? 173  LYS A CD  1 
ATOM   1334 C CE  . LYS A 1 173 ? 50.887 22.032  17.660  1.00 38.55 ? 173  LYS A CE  1 
ATOM   1335 N NZ  . LYS A 1 173 ? 50.412 21.281  16.444  1.00 42.93 ? 173  LYS A NZ  1 
ATOM   1336 N N   . ARG A 1 174 ? 48.587 17.527  22.537  1.00 17.30 ? 174  ARG A N   1 
ATOM   1337 C CA  . ARG A 1 174 ? 48.149 17.006  23.834  1.00 18.82 ? 174  ARG A CA  1 
ATOM   1338 C C   . ARG A 1 174 ? 47.202 17.930  24.593  1.00 18.92 ? 174  ARG A C   1 
ATOM   1339 O O   . ARG A 1 174 ? 47.397 18.231  25.780  1.00 12.98 ? 174  ARG A O   1 
ATOM   1340 C CB  . ARG A 1 174 ? 49.347 16.603  24.697  1.00 20.05 ? 174  ARG A CB  1 
ATOM   1341 C CG  . ARG A 1 174 ? 50.158 15.481  24.074  1.00 25.03 ? 174  ARG A CG  1 
ATOM   1342 C CD  . ARG A 1 174 ? 50.645 14.488  25.113  1.00 25.96 ? 174  ARG A CD  1 
ATOM   1343 N NE  . ARG A 1 174 ? 51.739 15.042  25.896  1.00 24.91 ? 174  ARG A NE  1 
ATOM   1344 C CZ  . ARG A 1 174 ? 51.986 14.753  27.171  1.00 24.38 ? 174  ARG A CZ  1 
ATOM   1345 N NH1 . ARG A 1 174 ? 51.210 13.902  27.844  1.00 27.64 ? 174  ARG A NH1 1 
ATOM   1346 N NH2 . ARG A 1 174 ? 53.029 15.313  27.768  1.00 28.00 ? 174  ARG A NH2 1 
ATOM   1347 N N   . VAL A 1 175 ? 46.163 18.373  23.888  1.00 17.11 ? 175  VAL A N   1 
ATOM   1348 C CA  . VAL A 1 175 ? 45.154 19.246  24.470  1.00 18.03 ? 175  VAL A CA  1 
ATOM   1349 C C   . VAL A 1 175 ? 43.783 18.720  24.078  1.00 16.24 ? 175  VAL A C   1 
ATOM   1350 O O   . VAL A 1 175 ? 43.677 17.918  23.163  1.00 18.98 ? 175  VAL A O   1 
ATOM   1351 C CB  . VAL A 1 175 ? 45.303 20.706  23.977  1.00 20.77 ? 175  VAL A CB  1 
ATOM   1352 C CG1 . VAL A 1 175 ? 46.553 21.334  24.568  1.00 12.42 ? 175  VAL A CG1 1 
ATOM   1353 C CG2 . VAL A 1 175 ? 45.320 20.767  22.441  1.00 15.56 ? 175  VAL A CG2 1 
ATOM   1354 N N   . ALA A 1 176 ? 42.746 19.143  24.792  1.00 15.87 ? 176  ALA A N   1 
ATOM   1355 C CA  . ALA A 1 176 ? 41.378 18.721  24.501  1.00 13.83 ? 176  ALA A CA  1 
ATOM   1356 C C   . ALA A 1 176 ? 40.576 19.962  24.165  1.00 12.62 ? 176  ALA A C   1 
ATOM   1357 O O   . ALA A 1 176 ? 40.942 21.071  24.539  1.00 13.87 ? 176  ALA A O   1 
ATOM   1358 C CB  . ALA A 1 176 ? 40.767 18.008  25.692  1.00 9.49  ? 176  ALA A CB  1 
ATOM   1359 N N   . THR A 1 177 ? 39.504 19.788  23.416  1.00 12.35 ? 177  THR A N   1 
ATOM   1360 C CA  . THR A 1 177 ? 38.680 20.926  23.052  1.00 11.87 ? 177  THR A CA  1 
ATOM   1361 C C   . THR A 1 177 ? 37.374 20.887  23.850  1.00 11.36 ? 177  THR A C   1 
ATOM   1362 O O   . THR A 1 177 ? 36.741 19.844  23.958  1.00 10.10 ? 177  THR A O   1 
ATOM   1363 C CB  . THR A 1 177 ? 38.429 20.964  21.521  1.00 5.99  ? 177  THR A CB  1 
ATOM   1364 O OG1 . THR A 1 177 ? 37.911 19.699  21.085  1.00 9.11  ? 177  THR A OG1 1 
ATOM   1365 C CG2 . THR A 1 177 ? 39.747 21.231  20.770  1.00 6.24  ? 177  THR A CG2 1 
ATOM   1366 N N   . PRO A 1 178 ? 37.003 22.009  24.489  1.00 13.51 ? 178  PRO A N   1 
ATOM   1367 C CA  . PRO A 1 178 ? 35.773 22.122  25.296  1.00 13.67 ? 178  PRO A CA  1 
ATOM   1368 C C   . PRO A 1 178 ? 34.487 22.130  24.429  1.00 9.26  ? 178  PRO A C   1 
ATOM   1369 O O   . PRO A 1 178 ? 34.587 22.080  23.204  1.00 10.04 ? 178  PRO A O   1 
ATOM   1370 C CB  . PRO A 1 178 ? 35.998 23.449  26.031  1.00 12.04 ? 178  PRO A CB  1 
ATOM   1371 C CG  . PRO A 1 178 ? 36.784 24.264  25.028  1.00 9.52  ? 178  PRO A CG  1 
ATOM   1372 C CD  . PRO A 1 178 ? 37.786 23.261  24.527  1.00 13.60 ? 178  PRO A CD  1 
ATOM   1373 N N   . VAL A 1 179 ? 33.300 22.135  25.044  1.00 11.87 ? 179  VAL A N   1 
ATOM   1374 C CA  . VAL A 1 179 ? 32.034 22.184  24.272  1.00 13.44 ? 179  VAL A CA  1 
ATOM   1375 C C   . VAL A 1 179 ? 32.051 23.357  23.324  1.00 15.44 ? 179  VAL A C   1 
ATOM   1376 O O   . VAL A 1 179 ? 32.608 24.406  23.650  1.00 16.32 ? 179  VAL A O   1 
ATOM   1377 C CB  . VAL A 1 179 ? 30.740 22.519  25.095  1.00 12.63 ? 179  VAL A CB  1 
ATOM   1378 C CG1 . VAL A 1 179 ? 29.913 21.310  25.351  1.00 18.64 ? 179  VAL A CG1 1 
ATOM   1379 C CG2 . VAL A 1 179 ? 31.036 23.331  26.317  1.00 10.57 ? 179  VAL A CG2 1 
ATOM   1380 N N   . ASP A 1 180 ? 31.370 23.197  22.192  1.00 13.84 ? 180  ASP A N   1 
ATOM   1381 C CA  . ASP A 1 180 ? 31.244 24.260  21.195  1.00 13.49 ? 180  ASP A CA  1 
ATOM   1382 C C   . ASP A 1 180 ? 32.529 25.004  20.794  1.00 11.32 ? 180  ASP A C   1 
ATOM   1383 O O   . ASP A 1 180 ? 32.478 26.158  20.371  1.00 11.94 ? 180  ASP A O   1 
ATOM   1384 C CB  . ASP A 1 180 ? 30.190 25.266  21.685  1.00 13.95 ? 180  ASP A CB  1 
ATOM   1385 C CG  . ASP A 1 180 ? 28.819 24.618  21.941  1.00 13.36 ? 180  ASP A CG  1 
ATOM   1386 O OD1 . ASP A 1 180 ? 28.641 23.419  21.656  1.00 14.21 ? 180  ASP A OD1 1 
ATOM   1387 O OD2 . ASP A 1 180 ? 27.905 25.318  22.415  1.00 17.56 ? 180  ASP A OD2 1 
ATOM   1388 N N   . TRP A 1 181 ? 33.671 24.333  20.896  1.00 11.84 ? 181  TRP A N   1 
ATOM   1389 C CA  . TRP A 1 181 ? 34.952 24.935  20.550  1.00 10.93 ? 181  TRP A CA  1 
ATOM   1390 C C   . TRP A 1 181 ? 35.043 25.255  19.058  1.00 13.46 ? 181  TRP A C   1 
ATOM   1391 O O   . TRP A 1 181 ? 34.567 24.478  18.226  1.00 11.27 ? 181  TRP A O   1 
ATOM   1392 C CB  . TRP A 1 181 ? 36.095 23.982  20.952  1.00 12.00 ? 181  TRP A CB  1 
ATOM   1393 C CG  . TRP A 1 181 ? 37.475 24.386  20.458  1.00 12.08 ? 181  TRP A CG  1 
ATOM   1394 C CD1 . TRP A 1 181 ? 38.311 25.300  21.020  1.00 9.31  ? 181  TRP A CD1 1 
ATOM   1395 C CD2 . TRP A 1 181 ? 38.146 23.909  19.272  1.00 16.29 ? 181  TRP A CD2 1 
ATOM   1396 N NE1 . TRP A 1 181 ? 39.444 25.439  20.257  1.00 9.40  ? 181  TRP A NE1 1 
ATOM   1397 C CE2 . TRP A 1 181 ? 39.369 24.596  19.179  1.00 14.49 ? 181  TRP A CE2 1 
ATOM   1398 C CE3 . TRP A 1 181 ? 37.820 22.961  18.279  1.00 15.70 ? 181  TRP A CE3 1 
ATOM   1399 C CZ2 . TRP A 1 181 ? 40.284 24.371  18.128  1.00 12.78 ? 181  TRP A CZ2 1 
ATOM   1400 C CZ3 . TRP A 1 181 ? 38.730 22.739  17.239  1.00 10.13 ? 181  TRP A CZ3 1 
ATOM   1401 C CH2 . TRP A 1 181 ? 39.943 23.442  17.178  1.00 8.86  ? 181  TRP A CH2 1 
ATOM   1402 N N   . LYS A 1 182 ? 35.606 26.416  18.732  1.00 14.82 ? 182  LYS A N   1 
ATOM   1403 C CA  . LYS A 1 182 ? 35.818 26.824  17.342  1.00 18.58 ? 182  LYS A CA  1 
ATOM   1404 C C   . LYS A 1 182 ? 37.325 26.972  17.166  1.00 18.87 ? 182  LYS A C   1 
ATOM   1405 O O   . LYS A 1 182 ? 38.014 27.443  18.076  1.00 16.32 ? 182  LYS A O   1 
ATOM   1406 C CB  . LYS A 1 182 ? 35.154 28.163  17.023  1.00 20.52 ? 182  LYS A CB  1 
ATOM   1407 C CG  . LYS A 1 182 ? 33.668 28.086  16.729  1.00 32.15 ? 182  LYS A CG  1 
ATOM   1408 C CD  . LYS A 1 182 ? 32.824 28.113  17.993  1.00 41.16 ? 182  LYS A CD  1 
ATOM   1409 C CE  . LYS A 1 182 ? 31.346 27.873  17.678  1.00 46.26 ? 182  LYS A CE  1 
ATOM   1410 N NZ  . LYS A 1 182 ? 30.476 27.856  18.893  1.00 46.82 ? 182  LYS A NZ  1 
ATOM   1411 N N   . ASP A 1 183 ? 37.838 26.541  16.017  1.00 18.85 ? 183  ASP A N   1 
ATOM   1412 C CA  . ASP A 1 183 ? 39.266 26.630  15.725  1.00 22.24 ? 183  ASP A CA  1 
ATOM   1413 C C   . ASP A 1 183 ? 39.774 28.010  16.116  1.00 24.64 ? 183  ASP A C   1 
ATOM   1414 O O   . ASP A 1 183 ? 39.255 29.026  15.640  1.00 25.01 ? 183  ASP A O   1 
ATOM   1415 C CB  . ASP A 1 183 ? 39.506 26.387  14.231  1.00 27.64 ? 183  ASP A CB  1 
ATOM   1416 C CG  . ASP A 1 183 ? 40.985 26.270  13.873  1.00 27.55 ? 183  ASP A CG  1 
ATOM   1417 O OD1 . ASP A 1 183 ? 41.794 25.837  14.725  1.00 32.04 ? 183  ASP A OD1 1 
ATOM   1418 O OD2 . ASP A 1 183 ? 41.327 26.582  12.717  1.00 32.71 ? 183  ASP A OD2 1 
ATOM   1419 N N   . GLY A 1 184 ? 40.722 28.043  17.047  1.00 24.70 ? 184  GLY A N   1 
ATOM   1420 C CA  . GLY A 1 184 ? 41.267 29.309  17.496  1.00 20.86 ? 184  GLY A CA  1 
ATOM   1421 C C   . GLY A 1 184 ? 40.932 29.637  18.941  1.00 24.57 ? 184  GLY A C   1 
ATOM   1422 O O   . GLY A 1 184 ? 41.608 30.459  19.551  1.00 23.12 ? 184  GLY A O   1 
ATOM   1423 N N   . ASP A 1 185 ? 39.879 29.021  19.476  1.00 21.56 ? 185  ASP A N   1 
ATOM   1424 C CA  . ASP A 1 185 ? 39.467 29.245  20.862  1.00 19.19 ? 185  ASP A CA  1 
ATOM   1425 C C   . ASP A 1 185 ? 40.436 28.553  21.820  1.00 16.45 ? 185  ASP A C   1 
ATOM   1426 O O   . ASP A 1 185 ? 41.180 27.649  21.422  1.00 18.11 ? 185  ASP A O   1 
ATOM   1427 C CB  . ASP A 1 185 ? 38.062 28.673  21.121  1.00 19.55 ? 185  ASP A CB  1 
ATOM   1428 C CG  . ASP A 1 185 ? 36.941 29.465  20.447  1.00 25.14 ? 185  ASP A CG  1 
ATOM   1429 O OD1 . ASP A 1 185 ? 37.178 30.587  19.955  1.00 22.50 ? 185  ASP A OD1 1 
ATOM   1430 O OD2 . ASP A 1 185 ? 35.796 28.949  20.421  1.00 27.08 ? 185  ASP A OD2 1 
ATOM   1431 N N   . SER A 1 186 ? 40.383 28.944  23.091  1.00 17.61 ? 186  SER A N   1 
ATOM   1432 C CA  . SER A 1 186 ? 41.222 28.345  24.122  1.00 15.24 ? 186  SER A CA  1 
ATOM   1433 C C   . SER A 1 186 ? 40.931 26.861  24.207  1.00 14.33 ? 186  SER A C   1 
ATOM   1434 O O   . SER A 1 186 ? 39.802 26.426  24.013  1.00 15.04 ? 186  SER A O   1 
ATOM   1435 C CB  . SER A 1 186 ? 40.943 28.980  25.487  1.00 12.35 ? 186  SER A CB  1 
ATOM   1436 O OG  . SER A 1 186 ? 41.648 30.200  25.646  1.00 20.47 ? 186  SER A OG  1 
ATOM   1437 N N   . VAL A 1 187 ? 41.958 26.070  24.474  1.00 12.98 ? 187  VAL A N   1 
ATOM   1438 C CA  . VAL A 1 187 ? 41.766 24.639  24.596  1.00 11.25 ? 187  VAL A CA  1 
ATOM   1439 C C   . VAL A 1 187 ? 42.005 24.256  26.058  1.00 11.08 ? 187  VAL A C   1 
ATOM   1440 O O   . VAL A 1 187 ? 42.319 25.108  26.893  1.00 11.01 ? 187  VAL A O   1 
ATOM   1441 C CB  . VAL A 1 187 ? 42.680 23.852  23.607  1.00 10.86 ? 187  VAL A CB  1 
ATOM   1442 C CG1 . VAL A 1 187 ? 42.407 24.291  22.177  1.00 8.25  ? 187  VAL A CG1 1 
ATOM   1443 C CG2 . VAL A 1 187 ? 44.135 24.069  23.927  1.00 10.81 ? 187  VAL A CG2 1 
ATOM   1444 N N   . MET A 1 188 ? 41.852 22.985  26.384  1.00 8.80  ? 188  MET A N   1 
ATOM   1445 C CA  . MET A 1 188 ? 42.053 22.557  27.764  1.00 16.50 ? 188  MET A CA  1 
ATOM   1446 C C   . MET A 1 188 ? 43.234 21.608  27.842  1.00 15.24 ? 188  MET A C   1 
ATOM   1447 O O   . MET A 1 188 ? 43.526 20.905  26.879  1.00 16.74 ? 188  MET A O   1 
ATOM   1448 C CB  . MET A 1 188 ? 40.783 21.877  28.292  1.00 12.47 ? 188  MET A CB  1 
ATOM   1449 C CG  . MET A 1 188 ? 39.551 22.731  28.120  1.00 15.52 ? 188  MET A CG  1 
ATOM   1450 S SD  . MET A 1 188 ? 38.104 21.931  28.775  1.00 22.22 ? 188  MET A SD  1 
ATOM   1451 C CE  . MET A 1 188 ? 38.249 22.507  30.447  1.00 17.58 ? 188  MET A CE  1 
ATOM   1452 N N   . VAL A 1 189 ? 43.939 21.605  28.967  1.00 19.09 ? 189  VAL A N   1 
ATOM   1453 C CA  . VAL A 1 189 ? 45.077 20.702  29.104  1.00 20.22 ? 189  VAL A CA  1 
ATOM   1454 C C   . VAL A 1 189 ? 44.507 19.352  29.557  1.00 20.11 ? 189  VAL A C   1 
ATOM   1455 O O   . VAL A 1 189 ? 43.531 19.304  30.298  1.00 18.26 ? 189  VAL A O   1 
ATOM   1456 C CB  . VAL A 1 189 ? 46.219 21.261  30.059  1.00 19.25 ? 189  VAL A CB  1 
ATOM   1457 C CG1 . VAL A 1 189 ? 46.205 22.789  30.111  1.00 9.81  ? 189  VAL A CG1 1 
ATOM   1458 C CG2 . VAL A 1 189 ? 46.133 20.678  31.422  1.00 22.84 ? 189  VAL A CG2 1 
ATOM   1459 N N   . LEU A 1 190 ? 45.035 18.261  29.015  1.00 20.31 ? 190  LEU A N   1 
ATOM   1460 C CA  . LEU A 1 190 ? 44.541 16.943  29.375  1.00 21.67 ? 190  LEU A CA  1 
ATOM   1461 C C   . LEU A 1 190 ? 44.668 16.742  30.873  1.00 22.83 ? 190  LEU A C   1 
ATOM   1462 O O   . LEU A 1 190 ? 45.715 17.028  31.458  1.00 24.30 ? 190  LEU A O   1 
ATOM   1463 C CB  . LEU A 1 190 ? 45.303 15.866  28.618  1.00 20.91 ? 190  LEU A CB  1 
ATOM   1464 C CG  . LEU A 1 190 ? 45.237 15.962  27.093  1.00 19.51 ? 190  LEU A CG  1 
ATOM   1465 C CD1 . LEU A 1 190 ? 46.085 14.844  26.501  1.00 17.20 ? 190  LEU A CD1 1 
ATOM   1466 C CD2 . LEU A 1 190 ? 43.795 15.895  26.590  1.00 14.37 ? 190  LEU A CD2 1 
ATOM   1467 N N   . PRO A 1 191 ? 43.622 16.192  31.507  1.00 26.41 ? 191  PRO A N   1 
ATOM   1468 C CA  . PRO A 1 191 ? 43.637 15.967  32.957  1.00 28.06 ? 191  PRO A CA  1 
ATOM   1469 C C   . PRO A 1 191 ? 44.795 15.063  33.372  1.00 31.58 ? 191  PRO A C   1 
ATOM   1470 O O   . PRO A 1 191 ? 45.251 15.098  34.511  1.00 33.02 ? 191  PRO A O   1 
ATOM   1471 C CB  . PRO A 1 191 ? 42.274 15.325  33.210  1.00 24.53 ? 191  PRO A CB  1 
ATOM   1472 C CG  . PRO A 1 191 ? 42.030 14.552  31.947  1.00 24.20 ? 191  PRO A CG  1 
ATOM   1473 C CD  . PRO A 1 191 ? 42.457 15.531  30.884  1.00 25.82 ? 191  PRO A CD  1 
ATOM   1474 N N   . THR A 1 192 ? 45.293 14.298  32.407  1.00 34.90 ? 192  THR A N   1 
ATOM   1475 C CA  . THR A 1 192 ? 46.402 13.370  32.599  1.00 37.47 ? 192  THR A CA  1 
ATOM   1476 C C   . THR A 1 192 ? 47.709 14.091  32.961  1.00 35.31 ? 192  THR A C   1 
ATOM   1477 O O   . THR A 1 192 ? 48.458 13.640  33.832  1.00 36.25 ? 192  THR A O   1 
ATOM   1478 C CB  . THR A 1 192 ? 46.630 12.578  31.295  1.00 39.44 ? 192  THR A CB  1 
ATOM   1479 O OG1 . THR A 1 192 ? 45.380 12.040  30.845  1.00 46.99 ? 192  THR A OG1 1 
ATOM   1480 C CG2 . THR A 1 192 ? 47.634 11.451  31.511  1.00 45.52 ? 192  THR A CG2 1 
ATOM   1481 N N   . ILE A 1 193 ? 47.966 15.202  32.275  1.00 28.97 ? 193  ILE A N   1 
ATOM   1482 C CA  . ILE A 1 193 ? 49.170 15.985  32.468  1.00 23.28 ? 193  ILE A CA  1 
ATOM   1483 C C   . ILE A 1 193 ? 49.209 16.690  33.815  1.00 25.73 ? 193  ILE A C   1 
ATOM   1484 O O   . ILE A 1 193 ? 48.345 17.517  34.108  1.00 22.96 ? 193  ILE A O   1 
ATOM   1485 C CB  . ILE A 1 193 ? 49.294 17.041  31.374  1.00 22.85 ? 193  ILE A CB  1 
ATOM   1486 C CG1 . ILE A 1 193 ? 49.234 16.381  29.996  1.00 19.82 ? 193  ILE A CG1 1 
ATOM   1487 C CG2 . ILE A 1 193 ? 50.584 17.812  31.550  1.00 24.74 ? 193  ILE A CG2 1 
ATOM   1488 C CD1 . ILE A 1 193 ? 49.165 17.374  28.863  1.00 19.54 ? 193  ILE A CD1 1 
ATOM   1489 N N   . PRO A 1 194 ? 50.227 16.384  34.649  1.00 27.00 ? 194  PRO A N   1 
ATOM   1490 C CA  . PRO A 1 194 ? 50.435 16.963  35.983  1.00 27.20 ? 194  PRO A CA  1 
ATOM   1491 C C   . PRO A 1 194 ? 50.737 18.457  35.887  1.00 28.64 ? 194  PRO A C   1 
ATOM   1492 O O   . PRO A 1 194 ? 51.228 18.937  34.857  1.00 29.95 ? 194  PRO A O   1 
ATOM   1493 C CB  . PRO A 1 194 ? 51.657 16.204  36.502  1.00 25.53 ? 194  PRO A CB  1 
ATOM   1494 C CG  . PRO A 1 194 ? 51.607 14.925  35.777  1.00 26.27 ? 194  PRO A CG  1 
ATOM   1495 C CD  . PRO A 1 194 ? 51.236 15.349  34.384  1.00 27.03 ? 194  PRO A CD  1 
ATOM   1496 N N   . GLU A 1 195 ? 50.505 19.174  36.982  1.00 28.78 ? 195  GLU A N   1 
ATOM   1497 C CA  . GLU A 1 195 ? 50.718 20.623  37.049  1.00 32.05 ? 195  GLU A CA  1 
ATOM   1498 C C   . GLU A 1 195 ? 52.136 21.018  36.645  1.00 30.23 ? 195  GLU A C   1 
ATOM   1499 O O   . GLU A 1 195 ? 52.349 21.939  35.851  1.00 28.11 ? 195  GLU A O   1 
ATOM   1500 C CB  . GLU A 1 195 ? 50.427 21.108  38.467  1.00 39.26 ? 195  GLU A CB  1 
ATOM   1501 C CG  . GLU A 1 195 ? 50.452 22.618  38.632  1.00 50.93 ? 195  GLU A CG  1 
ATOM   1502 C CD  . GLU A 1 195 ? 50.490 23.047  40.091  1.00 57.03 ? 195  GLU A CD  1 
ATOM   1503 O OE1 . GLU A 1 195 ? 49.588 22.631  40.860  1.00 63.27 ? 195  GLU A OE1 1 
ATOM   1504 O OE2 . GLU A 1 195 ? 51.421 23.804  40.462  1.00 58.34 ? 195  GLU A OE2 1 
ATOM   1505 N N   . GLU A 1 196 ? 53.098 20.287  37.185  1.00 29.79 ? 196  GLU A N   1 
ATOM   1506 C CA  . GLU A 1 196 ? 54.511 20.497  36.921  1.00 30.11 ? 196  GLU A CA  1 
ATOM   1507 C C   . GLU A 1 196 ? 54.843 20.437  35.421  1.00 27.87 ? 196  GLU A C   1 
ATOM   1508 O O   . GLU A 1 196 ? 55.470 21.347  34.883  1.00 29.98 ? 196  GLU A O   1 
ATOM   1509 C CB  . GLU A 1 196 ? 55.324 19.449  37.688  1.00 34.18 ? 196  GLU A CB  1 
ATOM   1510 C CG  . GLU A 1 196 ? 55.183 19.510  39.218  1.00 43.27 ? 196  GLU A CG  1 
ATOM   1511 C CD  . GLU A 1 196 ? 53.808 19.071  39.756  1.00 47.63 ? 196  GLU A CD  1 
ATOM   1512 O OE1 . GLU A 1 196 ? 53.110 18.241  39.122  1.00 44.60 ? 196  GLU A OE1 1 
ATOM   1513 O OE2 . GLU A 1 196 ? 53.421 19.578  40.834  1.00 48.69 ? 196  GLU A OE2 1 
ATOM   1514 N N   . GLU A 1 197 ? 54.375 19.391  34.746  1.00 25.64 ? 197  GLU A N   1 
ATOM   1515 C CA  . GLU A 1 197 ? 54.620 19.199  33.317  1.00 22.03 ? 197  GLU A CA  1 
ATOM   1516 C C   . GLU A 1 197 ? 53.942 20.247  32.431  1.00 21.63 ? 197  GLU A C   1 
ATOM   1517 O O   . GLU A 1 197 ? 54.533 20.736  31.467  1.00 19.07 ? 197  GLU A O   1 
ATOM   1518 C CB  . GLU A 1 197 ? 54.160 17.802  32.898  1.00 20.93 ? 197  GLU A CB  1 
ATOM   1519 C CG  . GLU A 1 197 ? 54.400 17.485  31.423  1.00 25.49 ? 197  GLU A CG  1 
ATOM   1520 C CD  . GLU A 1 197 ? 54.047 16.058  31.049  1.00 28.01 ? 197  GLU A CD  1 
ATOM   1521 O OE1 . GLU A 1 197 ? 53.412 15.345  31.860  1.00 27.75 ? 197  GLU A OE1 1 
ATOM   1522 O OE2 . GLU A 1 197 ? 54.405 15.627  29.931  1.00 29.36 ? 197  GLU A OE2 1 
ATOM   1523 N N   . ALA A 1 198 ? 52.700 20.590  32.773  1.00 19.76 ? 198  ALA A N   1 
ATOM   1524 C CA  . ALA A 1 198 ? 51.913 21.558  32.021  1.00 16.32 ? 198  ALA A CA  1 
ATOM   1525 C C   . ALA A 1 198 ? 52.546 22.940  31.920  1.00 16.97 ? 198  ALA A C   1 
ATOM   1526 O O   . ALA A 1 198 ? 52.521 23.557  30.859  1.00 16.62 ? 198  ALA A O   1 
ATOM   1527 C CB  . ALA A 1 198 ? 50.503 21.657  32.598  1.00 17.40 ? 198  ALA A CB  1 
ATOM   1528 N N   . LYS A 1 199 ? 53.105 23.436  33.017  1.00 18.26 ? 199  LYS A N   1 
ATOM   1529 C CA  . LYS A 1 199 ? 53.739 24.754  33.004  1.00 21.70 ? 199  LYS A CA  1 
ATOM   1530 C C   . LYS A 1 199 ? 54.846 24.790  31.954  1.00 21.07 ? 199  LYS A C   1 
ATOM   1531 O O   . LYS A 1 199 ? 55.069 25.819  31.312  1.00 19.29 ? 199  LYS A O   1 
ATOM   1532 C CB  . LYS A 1 199 ? 54.333 25.085  34.382  1.00 28.06 ? 199  LYS A CB  1 
ATOM   1533 C CG  . LYS A 1 199 ? 53.295 25.300  35.488  1.00 40.76 ? 199  LYS A CG  1 
ATOM   1534 C CD  . LYS A 1 199 ? 53.935 25.559  36.858  1.00 48.82 ? 199  LYS A CD  1 
ATOM   1535 C CE  . LYS A 1 199 ? 54.664 24.321  37.381  1.00 53.44 ? 199  LYS A CE  1 
ATOM   1536 N NZ  . LYS A 1 199 ? 55.406 24.584  38.649  1.00 55.56 ? 199  LYS A NZ  1 
ATOM   1537 N N   . LYS A 1 200 ? 55.522 23.653  31.788  1.00 18.66 ? 200  LYS A N   1 
ATOM   1538 C CA  . LYS A 1 200 ? 56.624 23.514  30.843  1.00 19.83 ? 200  LYS A CA  1 
ATOM   1539 C C   . LYS A 1 200 ? 56.167 23.251  29.432  1.00 18.55 ? 200  LYS A C   1 
ATOM   1540 O O   . LYS A 1 200 ? 56.754 23.751  28.484  1.00 19.38 ? 200  LYS A O   1 
ATOM   1541 C CB  . LYS A 1 200 ? 57.561 22.387  31.291  1.00 22.65 ? 200  LYS A CB  1 
ATOM   1542 C CG  . LYS A 1 200 ? 58.252 22.652  32.624  1.00 29.07 ? 200  LYS A CG  1 
ATOM   1543 C CD  . LYS A 1 200 ? 58.795 24.093  32.682  1.00 37.28 ? 200  LYS A CD  1 
ATOM   1544 C CE  . LYS A 1 200 ? 59.750 24.420  31.505  1.00 40.89 ? 200  LYS A CE  1 
ATOM   1545 N NZ  . LYS A 1 200 ? 60.129 25.865  31.464  1.00 40.62 ? 200  LYS A NZ  1 
ATOM   1546 N N   . LEU A 1 201 ? 55.138 22.424  29.305  1.00 18.02 ? 201  LEU A N   1 
ATOM   1547 C CA  . LEU A 1 201 ? 54.581 22.079  28.012  1.00 15.54 ? 201  LEU A CA  1 
ATOM   1548 C C   . LEU A 1 201 ? 53.909 23.283  27.345  1.00 19.09 ? 201  LEU A C   1 
ATOM   1549 O O   . LEU A 1 201 ? 54.131 23.547  26.158  1.00 17.43 ? 201  LEU A O   1 
ATOM   1550 C CB  . LEU A 1 201 ? 53.559 20.954  28.166  1.00 15.07 ? 201  LEU A CB  1 
ATOM   1551 C CG  . LEU A 1 201 ? 53.793 19.638  27.433  1.00 17.60 ? 201  LEU A CG  1 
ATOM   1552 C CD1 . LEU A 1 201 ? 52.511 18.852  27.432  1.00 11.09 ? 201  LEU A CD1 1 
ATOM   1553 C CD2 . LEU A 1 201 ? 54.243 19.901  26.005  1.00 17.63 ? 201  LEU A CD2 1 
ATOM   1554 N N   . PHE A 1 202 ? 53.114 24.030  28.114  1.00 17.98 ? 202  PHE A N   1 
ATOM   1555 C CA  . PHE A 1 202 ? 52.380 25.180  27.573  1.00 18.90 ? 202  PHE A CA  1 
ATOM   1556 C C   . PHE A 1 202 ? 52.870 26.516  28.119  1.00 18.85 ? 202  PHE A C   1 
ATOM   1557 O O   . PHE A 1 202 ? 52.269 27.079  29.037  1.00 17.67 ? 202  PHE A O   1 
ATOM   1558 C CB  . PHE A 1 202 ? 50.881 25.013  27.853  1.00 18.54 ? 202  PHE A CB  1 
ATOM   1559 C CG  . PHE A 1 202 ? 50.333 23.686  27.412  1.00 17.31 ? 202  PHE A CG  1 
ATOM   1560 C CD1 . PHE A 1 202 ? 50.164 23.407  26.054  1.00 18.63 ? 202  PHE A CD1 1 
ATOM   1561 C CD2 . PHE A 1 202 ? 50.044 22.695  28.346  1.00 11.14 ? 202  PHE A CD2 1 
ATOM   1562 C CE1 . PHE A 1 202 ? 49.717 22.153  25.638  1.00 17.42 ? 202  PHE A CE1 1 
ATOM   1563 C CE2 . PHE A 1 202 ? 49.599 21.441  27.942  1.00 10.09 ? 202  PHE A CE2 1 
ATOM   1564 C CZ  . PHE A 1 202 ? 49.437 21.167  26.587  1.00 13.87 ? 202  PHE A CZ  1 
ATOM   1565 N N   . PRO A 1 203 ? 53.975 27.043  27.560  1.00 21.51 ? 203  PRO A N   1 
ATOM   1566 C CA  . PRO A 1 203 ? 54.562 28.314  27.985  1.00 21.62 ? 203  PRO A CA  1 
ATOM   1567 C C   . PRO A 1 203 ? 53.693 29.544  27.749  1.00 22.30 ? 203  PRO A C   1 
ATOM   1568 O O   . PRO A 1 203 ? 54.035 30.636  28.220  1.00 22.51 ? 203  PRO A O   1 
ATOM   1569 C CB  . PRO A 1 203 ? 55.866 28.374  27.177  1.00 23.21 ? 203  PRO A CB  1 
ATOM   1570 C CG  . PRO A 1 203 ? 55.527 27.654  25.949  1.00 21.22 ? 203  PRO A CG  1 
ATOM   1571 C CD  . PRO A 1 203 ? 54.777 26.455  26.473  1.00 18.63 ? 203  PRO A CD  1 
ATOM   1572 N N   . LYS A 1 204 ? 52.599 29.379  27.002  1.00 20.59 ? 204  LYS A N   1 
ATOM   1573 C CA  . LYS A 1 204 ? 51.688 30.486  26.727  1.00 18.11 ? 204  LYS A CA  1 
ATOM   1574 C C   . LYS A 1 204 ? 50.855 30.795  27.961  1.00 17.95 ? 204  LYS A C   1 
ATOM   1575 O O   . LYS A 1 204 ? 50.153 31.803  28.010  1.00 22.75 ? 204  LYS A O   1 
ATOM   1576 C CB  . LYS A 1 204 ? 50.763 30.166  25.558  1.00 17.73 ? 204  LYS A CB  1 
ATOM   1577 C CG  . LYS A 1 204 ? 51.402 30.262  24.191  1.00 17.59 ? 204  LYS A CG  1 
ATOM   1578 C CD  . LYS A 1 204 ? 50.341 30.063  23.144  1.00 17.89 ? 204  LYS A CD  1 
ATOM   1579 C CE  . LYS A 1 204 ? 50.883 30.228  21.759  1.00 21.36 ? 204  LYS A CE  1 
ATOM   1580 N NZ  . LYS A 1 204 ? 49.746 30.244  20.783  1.00 21.67 ? 204  LYS A NZ  1 
ATOM   1581 N N   . GLY A 1 205 ? 50.895 29.900  28.943  1.00 16.72 ? 205  GLY A N   1 
ATOM   1582 C CA  . GLY A 1 205 ? 50.154 30.129  30.167  1.00 17.47 ? 205  GLY A CA  1 
ATOM   1583 C C   . GLY A 1 205 ? 49.018 29.156  30.377  1.00 18.97 ? 205  GLY A C   1 
ATOM   1584 O O   . GLY A 1 205 ? 48.345 28.761  29.430  1.00 20.55 ? 205  GLY A O   1 
ATOM   1585 N N   . VAL A 1 206 ? 48.836 28.732  31.620  1.00 16.35 ? 206  VAL A N   1 
ATOM   1586 C CA  . VAL A 1 206 ? 47.766 27.813  31.962  1.00 21.02 ? 206  VAL A CA  1 
ATOM   1587 C C   . VAL A 1 206 ? 46.905 28.477  33.044  1.00 21.12 ? 206  VAL A C   1 
ATOM   1588 O O   . VAL A 1 206 ? 47.427 28.970  34.039  1.00 26.57 ? 206  VAL A O   1 
ATOM   1589 C CB  . VAL A 1 206 ? 48.320 26.448  32.458  1.00 20.64 ? 206  VAL A CB  1 
ATOM   1590 C CG1 . VAL A 1 206 ? 47.175 25.536  32.878  1.00 21.74 ? 206  VAL A CG1 1 
ATOM   1591 C CG2 . VAL A 1 206 ? 49.140 25.780  31.367  1.00 17.38 ? 206  VAL A CG2 1 
ATOM   1592 N N   . PHE A 1 207 ? 45.597 28.527  32.812  1.00 18.72 ? 207  PHE A N   1 
ATOM   1593 C CA  . PHE A 1 207 ? 44.646 29.126  33.741  1.00 18.29 ? 207  PHE A CA  1 
ATOM   1594 C C   . PHE A 1 207 ? 43.753 28.067  34.392  1.00 18.45 ? 207  PHE A C   1 
ATOM   1595 O O   . PHE A 1 207 ? 42.998 27.375  33.704  1.00 20.36 ? 207  PHE A O   1 
ATOM   1596 C CB  . PHE A 1 207 ? 43.768 30.136  32.996  1.00 20.93 ? 207  PHE A CB  1 
ATOM   1597 C CG  . PHE A 1 207 ? 42.646 30.687  33.823  1.00 19.02 ? 207  PHE A CG  1 
ATOM   1598 C CD1 . PHE A 1 207 ? 42.851 31.790  34.638  1.00 19.68 ? 207  PHE A CD1 1 
ATOM   1599 C CD2 . PHE A 1 207 ? 41.394 30.077  33.814  1.00 19.74 ? 207  PHE A CD2 1 
ATOM   1600 C CE1 . PHE A 1 207 ? 41.832 32.277  35.435  1.00 23.54 ? 207  PHE A CE1 1 
ATOM   1601 C CE2 . PHE A 1 207 ? 40.371 30.551  34.599  1.00 20.70 ? 207  PHE A CE2 1 
ATOM   1602 C CZ  . PHE A 1 207 ? 40.583 31.652  35.416  1.00 25.78 ? 207  PHE A CZ  1 
ATOM   1603 N N   . THR A 1 208 ? 43.815 27.963  35.715  1.00 18.89 ? 208  THR A N   1 
ATOM   1604 C CA  . THR A 1 208 ? 43.003 26.992  36.437  1.00 20.79 ? 208  THR A CA  1 
ATOM   1605 C C   . THR A 1 208 ? 41.775 27.695  37.005  1.00 25.40 ? 208  THR A C   1 
ATOM   1606 O O   . THR A 1 208 ? 41.901 28.570  37.862  1.00 30.27 ? 208  THR A O   1 
ATOM   1607 C CB  . THR A 1 208 ? 43.788 26.353  37.596  1.00 18.13 ? 208  THR A CB  1 
ATOM   1608 O OG1 . THR A 1 208 ? 45.023 25.819  37.102  1.00 21.12 ? 208  THR A OG1 1 
ATOM   1609 C CG2 . THR A 1 208 ? 42.976 25.236  38.250  1.00 13.96 ? 208  THR A CG2 1 
ATOM   1610 N N   . LYS A 1 209 ? 40.595 27.355  36.501  1.00 25.17 ? 209  LYS A N   1 
ATOM   1611 C CA  . LYS A 1 209 ? 39.386 27.975  37.005  1.00 27.52 ? 209  LYS A CA  1 
ATOM   1612 C C   . LYS A 1 209 ? 39.074 27.324  38.352  1.00 28.85 ? 209  LYS A C   1 
ATOM   1613 O O   . LYS A 1 209 ? 38.962 26.107  38.445  1.00 28.99 ? 209  LYS A O   1 
ATOM   1614 C CB  . LYS A 1 209 ? 38.235 27.784  36.017  1.00 28.22 ? 209  LYS A CB  1 
ATOM   1615 C CG  . LYS A 1 209 ? 36.945 28.486  36.424  1.00 28.34 ? 209  LYS A CG  1 
ATOM   1616 C CD  . LYS A 1 209 ? 36.040 28.731  35.221  1.00 35.47 ? 209  LYS A CD  1 
ATOM   1617 C CE  . LYS A 1 209 ? 34.692 29.348  35.611  1.00 35.95 ? 209  LYS A CE  1 
ATOM   1618 N NZ  . LYS A 1 209 ? 34.808 30.634  36.346  1.00 32.34 ? 209  LYS A NZ  1 
ATOM   1619 N N   . GLU A 1 210 ? 38.977 28.127  39.403  1.00 28.86 ? 210  GLU A N   1 
ATOM   1620 C CA  . GLU A 1 210 ? 38.686 27.574  40.718  1.00 32.19 ? 210  GLU A CA  1 
ATOM   1621 C C   . GLU A 1 210 ? 37.237 27.117  40.855  1.00 29.90 ? 210  GLU A C   1 
ATOM   1622 O O   . GLU A 1 210 ? 36.311 27.864  40.537  1.00 32.77 ? 210  GLU A O   1 
ATOM   1623 C CB  . GLU A 1 210 ? 39.055 28.571  41.817  1.00 35.93 ? 210  GLU A CB  1 
ATOM   1624 C CG  . GLU A 1 210 ? 40.548 28.653  42.074  1.00 43.83 ? 210  GLU A CG  1 
ATOM   1625 C CD  . GLU A 1 210 ? 41.189 27.277  42.256  1.00 51.55 ? 210  GLU A CD  1 
ATOM   1626 O OE1 . GLU A 1 210 ? 40.659 26.459  43.050  1.00 54.63 ? 210  GLU A OE1 1 
ATOM   1627 O OE2 . GLU A 1 210 ? 42.220 27.016  41.590  1.00 54.13 ? 210  GLU A OE2 1 
ATOM   1628 N N   . LEU A 1 211 ? 37.047 25.875  41.292  1.00 28.46 ? 211  LEU A N   1 
ATOM   1629 C CA  . LEU A 1 211 ? 35.712 25.314  41.461  1.00 25.02 ? 211  LEU A CA  1 
ATOM   1630 C C   . LEU A 1 211 ? 35.397 25.001  42.916  1.00 26.56 ? 211  LEU A C   1 
ATOM   1631 O O   . LEU A 1 211 ? 36.304 24.833  43.729  1.00 25.64 ? 211  LEU A O   1 
ATOM   1632 C CB  . LEU A 1 211 ? 35.552 24.035  40.636  1.00 24.55 ? 211  LEU A CB  1 
ATOM   1633 C CG  . LEU A 1 211 ? 35.366 24.098  39.118  1.00 24.99 ? 211  LEU A CG  1 
ATOM   1634 C CD1 . LEU A 1 211 ? 34.788 25.443  38.688  1.00 25.67 ? 211  LEU A CD1 1 
ATOM   1635 C CD2 . LEU A 1 211 ? 36.686 23.867  38.460  1.00 30.60 ? 211  LEU A CD2 1 
ATOM   1636 N N   . PRO A 1 212 ? 34.099 24.886  43.256  1.00 27.28 ? 212  PRO A N   1 
ATOM   1637 C CA  . PRO A 1 212 ? 33.633 24.582  44.612  1.00 27.48 ? 212  PRO A CA  1 
ATOM   1638 C C   . PRO A 1 212 ? 34.312 23.365  45.228  1.00 28.46 ? 212  PRO A C   1 
ATOM   1639 O O   . PRO A 1 212 ? 34.470 23.297  46.446  1.00 31.16 ? 212  PRO A O   1 
ATOM   1640 C CB  . PRO A 1 212 ? 32.144 24.312  44.399  1.00 24.65 ? 212  PRO A CB  1 
ATOM   1641 C CG  . PRO A 1 212 ? 31.807 25.286  43.352  1.00 28.24 ? 212  PRO A CG  1 
ATOM   1642 C CD  . PRO A 1 212 ? 32.948 25.138  42.371  1.00 25.69 ? 212  PRO A CD  1 
ATOM   1643 N N   . SER A 1 213 ? 34.732 22.423  44.389  1.00 25.79 ? 213  SER A N   1 
ATOM   1644 C CA  . SER A 1 213 ? 35.363 21.200  44.870  1.00 26.29 ? 213  SER A CA  1 
ATOM   1645 C C   . SER A 1 213 ? 36.855 21.292  45.232  1.00 26.57 ? 213  SER A C   1 
ATOM   1646 O O   . SER A 1 213 ? 37.422 20.363  45.822  1.00 27.48 ? 213  SER A O   1 
ATOM   1647 C CB  . SER A 1 213 ? 35.143 20.076  43.848  1.00 24.39 ? 213  SER A CB  1 
ATOM   1648 O OG  . SER A 1 213 ? 35.948 20.265  42.697  1.00 20.78 ? 213  SER A OG  1 
ATOM   1649 N N   . GLY A 1 214 ? 37.504 22.388  44.866  1.00 27.56 ? 214  GLY A N   1 
ATOM   1650 C CA  . GLY A 1 214 ? 38.923 22.511  45.160  1.00 30.80 ? 214  GLY A CA  1 
ATOM   1651 C C   . GLY A 1 214 ? 39.800 21.740  44.179  1.00 29.65 ? 214  GLY A C   1 
ATOM   1652 O O   . GLY A 1 214 ? 41.025 21.884  44.193  1.00 29.67 ? 214  GLY A O   1 
ATOM   1653 N N   . LYS A 1 215 ? 39.176 20.945  43.311  1.00 27.11 ? 215  LYS A N   1 
ATOM   1654 C CA  . LYS A 1 215 ? 39.915 20.179  42.317  1.00 25.61 ? 215  LYS A CA  1 
ATOM   1655 C C   . LYS A 1 215 ? 40.359 21.106  41.203  1.00 28.09 ? 215  LYS A C   1 
ATOM   1656 O O   . LYS A 1 215 ? 39.665 22.065  40.857  1.00 27.50 ? 215  LYS A O   1 
ATOM   1657 C CB  . LYS A 1 215 ? 39.079 19.029  41.774  1.00 19.86 ? 215  LYS A CB  1 
ATOM   1658 C CG  . LYS A 1 215 ? 38.728 18.027  42.848  1.00 22.01 ? 215  LYS A CG  1 
ATOM   1659 C CD  . LYS A 1 215 ? 38.067 16.797  42.289  1.00 25.65 ? 215  LYS A CD  1 
ATOM   1660 C CE  . LYS A 1 215 ? 37.674 15.857  43.405  1.00 28.85 ? 215  LYS A CE  1 
ATOM   1661 N NZ  . LYS A 1 215 ? 36.987 14.655  42.870  1.00 33.40 ? 215  LYS A NZ  1 
ATOM   1662 N N   . LYS A 1 216 ? 41.534 20.813  40.659  1.00 28.19 ? 216  LYS A N   1 
ATOM   1663 C CA  . LYS A 1 216 ? 42.122 21.626  39.613  1.00 25.99 ? 216  LYS A CA  1 
ATOM   1664 C C   . LYS A 1 216 ? 42.164 20.942  38.248  1.00 23.16 ? 216  LYS A C   1 
ATOM   1665 O O   . LYS A 1 216 ? 43.228 20.814  37.653  1.00 23.76 ? 216  LYS A O   1 
ATOM   1666 C CB  . LYS A 1 216 ? 43.527 22.047  40.055  1.00 31.74 ? 216  LYS A CB  1 
ATOM   1667 C CG  . LYS A 1 216 ? 43.537 22.952  41.293  1.00 38.03 ? 216  LYS A CG  1 
ATOM   1668 C CD  . LYS A 1 216 ? 44.928 23.134  41.854  1.00 41.36 ? 216  LYS A CD  1 
ATOM   1669 C CE  . LYS A 1 216 ? 45.440 21.837  42.468  1.00 50.33 ? 216  LYS A CE  1 
ATOM   1670 N NZ  . LYS A 1 216 ? 46.867 21.959  42.907  1.00 54.91 ? 216  LYS A NZ  1 
ATOM   1671 N N   . TYR A 1 217 ? 40.997 20.556  37.737  1.00 23.35 ? 217  TYR A N   1 
ATOM   1672 C CA  . TYR A 1 217 ? 40.886 19.889  36.441  1.00 17.11 ? 217  TYR A CA  1 
ATOM   1673 C C   . TYR A 1 217 ? 40.436 20.807  35.295  1.00 16.75 ? 217  TYR A C   1 
ATOM   1674 O O   . TYR A 1 217 ? 40.541 20.437  34.128  1.00 18.13 ? 217  TYR A O   1 
ATOM   1675 C CB  . TYR A 1 217 ? 39.952 18.688  36.548  1.00 18.06 ? 217  TYR A CB  1 
ATOM   1676 C CG  . TYR A 1 217 ? 38.557 19.055  36.986  1.00 17.62 ? 217  TYR A CG  1 
ATOM   1677 C CD1 . TYR A 1 217 ? 37.574 19.381  36.048  1.00 16.54 ? 217  TYR A CD1 1 
ATOM   1678 C CD2 . TYR A 1 217 ? 38.216 19.083  38.332  1.00 17.37 ? 217  TYR A CD2 1 
ATOM   1679 C CE1 . TYR A 1 217 ? 36.284 19.725  36.438  1.00 17.49 ? 217  TYR A CE1 1 
ATOM   1680 C CE2 . TYR A 1 217 ? 36.922 19.429  38.738  1.00 22.94 ? 217  TYR A CE2 1 
ATOM   1681 C CZ  . TYR A 1 217 ? 35.965 19.746  37.782  1.00 17.98 ? 217  TYR A CZ  1 
ATOM   1682 O OH  . TYR A 1 217 ? 34.692 20.071  38.153  1.00 19.17 ? 217  TYR A OH  1 
ATOM   1683 N N   . LEU A 1 218 ? 39.879 21.976  35.613  1.00 17.35 ? 218  LEU A N   1 
ATOM   1684 C CA  . LEU A 1 218 ? 39.452 22.905  34.564  1.00 18.75 ? 218  LEU A CA  1 
ATOM   1685 C C   . LEU A 1 218 ? 40.577 23.848  34.230  1.00 19.29 ? 218  LEU A C   1 
ATOM   1686 O O   . LEU A 1 218 ? 40.566 25.019  34.629  1.00 19.11 ? 218  LEU A O   1 
ATOM   1687 C CB  . LEU A 1 218 ? 38.240 23.747  34.959  1.00 18.26 ? 218  LEU A CB  1 
ATOM   1688 C CG  . LEU A 1 218 ? 36.829 23.261  34.642  1.00 26.05 ? 218  LEU A CG  1 
ATOM   1689 C CD1 . LEU A 1 218 ? 35.975 24.497  34.419  1.00 26.07 ? 218  LEU A CD1 1 
ATOM   1690 C CD2 . LEU A 1 218 ? 36.778 22.355  33.420  1.00 22.19 ? 218  LEU A CD2 1 
ATOM   1691 N N   . ARG A 1 219 ? 41.546 23.341  33.485  1.00 19.15 ? 219  ARG A N   1 
ATOM   1692 C CA  . ARG A 1 219 ? 42.688 24.143  33.094  1.00 18.11 ? 219  ARG A CA  1 
ATOM   1693 C C   . ARG A 1 219 ? 42.609 24.484  31.619  1.00 15.78 ? 219  ARG A C   1 
ATOM   1694 O O   . ARG A 1 219 ? 42.397 23.614  30.773  1.00 14.07 ? 219  ARG A O   1 
ATOM   1695 C CB  . ARG A 1 219 ? 43.972 23.382  33.396  1.00 19.46 ? 219  ARG A CB  1 
ATOM   1696 C CG  . ARG A 1 219 ? 44.142 23.046  34.857  1.00 15.59 ? 219  ARG A CG  1 
ATOM   1697 C CD  . ARG A 1 219 ? 45.379 22.203  35.058  1.00 17.38 ? 219  ARG A CD  1 
ATOM   1698 N NE  . ARG A 1 219 ? 45.205 20.853  34.517  1.00 21.23 ? 219  ARG A NE  1 
ATOM   1699 C CZ  . ARG A 1 219 ? 46.160 19.927  34.480  1.00 22.41 ? 219  ARG A CZ  1 
ATOM   1700 N NH1 . ARG A 1 219 ? 47.377 20.197  34.947  1.00 26.01 ? 219  ARG A NH1 1 
ATOM   1701 N NH2 . ARG A 1 219 ? 45.890 18.734  33.978  1.00 18.68 ? 219  ARG A NH2 1 
ATOM   1702 N N   . TYR A 1 220 ? 42.796 25.757  31.320  1.00 14.06 ? 220  TYR A N   1 
ATOM   1703 C CA  . TYR A 1 220 ? 42.748 26.251  29.958  1.00 13.79 ? 220  TYR A CA  1 
ATOM   1704 C C   . TYR A 1 220 ? 44.092 26.803  29.552  1.00 13.29 ? 220  TYR A C   1 
ATOM   1705 O O   . TYR A 1 220 ? 44.826 27.335  30.377  1.00 11.37 ? 220  TYR A O   1 
ATOM   1706 C CB  . TYR A 1 220 ? 41.752 27.397  29.857  1.00 12.95 ? 220  TYR A CB  1 
ATOM   1707 C CG  . TYR A 1 220 ? 40.321 27.003  30.067  1.00 22.22 ? 220  TYR A CG  1 
ATOM   1708 C CD1 . TYR A 1 220 ? 39.745 27.020  31.344  1.00 18.01 ? 220  TYR A CD1 1 
ATOM   1709 C CD2 . TYR A 1 220 ? 39.520 26.662  28.981  1.00 21.24 ? 220  TYR A CD2 1 
ATOM   1710 C CE1 . TYR A 1 220 ? 38.406 26.713  31.521  1.00 21.07 ? 220  TYR A CE1 1 
ATOM   1711 C CE2 . TYR A 1 220 ? 38.182 26.355  29.148  1.00 20.95 ? 220  TYR A CE2 1 
ATOM   1712 C CZ  . TYR A 1 220 ? 37.627 26.384  30.413  1.00 22.75 ? 220  TYR A CZ  1 
ATOM   1713 O OH  . TYR A 1 220 ? 36.283 26.113  30.544  1.00 25.44 ? 220  TYR A OH  1 
ATOM   1714 N N   . THR A 1 221 ? 44.357 26.765  28.257  1.00 13.98 ? 221  THR A N   1 
ATOM   1715 C CA  . THR A 1 221 ? 45.592 27.290  27.703  1.00 14.61 ? 221  THR A CA  1 
ATOM   1716 C C   . THR A 1 221 ? 45.288 27.659  26.244  1.00 17.52 ? 221  THR A C   1 
ATOM   1717 O O   . THR A 1 221 ? 44.473 26.993  25.589  1.00 16.11 ? 221  THR A O   1 
ATOM   1718 C CB  . THR A 1 221 ? 46.755 26.265  27.834  1.00 9.28  ? 221  THR A CB  1 
ATOM   1719 O OG1 . THR A 1 221 ? 47.967 26.885  27.420  1.00 12.43 ? 221  THR A OG1 1 
ATOM   1720 C CG2 . THR A 1 221 ? 46.506 25.003  27.017  1.00 2.99  ? 221  THR A CG2 1 
ATOM   1721 N N   . PRO A 1 222 ? 45.844 28.786  25.755  1.00 18.05 ? 222  PRO A N   1 
ATOM   1722 C CA  . PRO A 1 222 ? 45.610 29.231  24.371  1.00 18.35 ? 222  PRO A CA  1 
ATOM   1723 C C   . PRO A 1 222 ? 45.918 28.110  23.416  1.00 17.61 ? 222  PRO A C   1 
ATOM   1724 O O   . PRO A 1 222 ? 46.711 27.241  23.742  1.00 18.70 ? 222  PRO A O   1 
ATOM   1725 C CB  . PRO A 1 222 ? 46.608 30.374  24.203  1.00 18.56 ? 222  PRO A CB  1 
ATOM   1726 C CG  . PRO A 1 222 ? 46.694 30.940  25.590  1.00 19.06 ? 222  PRO A CG  1 
ATOM   1727 C CD  . PRO A 1 222 ? 46.783 29.691  26.438  1.00 17.26 ? 222  PRO A CD  1 
ATOM   1728 N N   . GLN A 1 223 ? 45.245 28.071  22.271  1.00 22.59 ? 223  GLN A N   1 
ATOM   1729 C CA  . GLN A 1 223 ? 45.519 27.015  21.303  1.00 24.23 ? 223  GLN A CA  1 
ATOM   1730 C C   . GLN A 1 223 ? 46.993 27.112  20.890  1.00 23.11 ? 223  GLN A C   1 
ATOM   1731 O O   . GLN A 1 223 ? 47.450 28.164  20.431  1.00 26.27 ? 223  GLN A O   1 
ATOM   1732 C CB  . GLN A 1 223 ? 44.612 27.145  20.084  1.00 21.94 ? 223  GLN A CB  1 
ATOM   1733 C CG  . GLN A 1 223 ? 44.851 26.054  19.062  1.00 25.96 ? 223  GLN A CG  1 
ATOM   1734 C CD  . GLN A 1 223 ? 43.892 26.117  17.903  1.00 27.44 ? 223  GLN A CD  1 
ATOM   1735 O OE1 . GLN A 1 223 ? 42.741 26.536  18.050  1.00 32.39 ? 223  GLN A OE1 1 
ATOM   1736 N NE2 . GLN A 1 223 ? 44.353 25.689  16.740  1.00 30.58 ? 223  GLN A NE2 1 
ATOM   1737 N N   . PRO A 1 224 ? 47.765 26.035  21.107  1.00 22.08 ? 224  PRO A N   1 
ATOM   1738 C CA  . PRO A 1 224 ? 49.190 26.006  20.761  1.00 25.57 ? 224  PRO A CA  1 
ATOM   1739 C C   . PRO A 1 224 ? 49.481 25.666  19.292  1.00 25.89 ? 224  PRO A C   1 
ATOM   1740 O O   . PRO A 1 224 ? 48.539 25.721  18.465  1.00 28.82 ? 224  PRO A O   1 
ATOM   1741 C CB  . PRO A 1 224 ? 49.744 24.950  21.718  1.00 23.52 ? 224  PRO A CB  1 
ATOM   1742 C CG  . PRO A 1 224 ? 48.644 23.957  21.755  1.00 27.04 ? 224  PRO A CG  1 
ATOM   1743 C CD  . PRO A 1 224 ? 47.370 24.799  21.808  1.00 23.07 ? 224  PRO A CD  1 
ATOM   1744 N N   . PRO B 1 2   ? 29.315 2.835   16.998  1.00 60.26 ? 2    PRO B N   1 
ATOM   1745 C CA  . PRO B 1 2   ? 28.716 3.707   18.032  1.00 59.31 ? 2    PRO B CA  1 
ATOM   1746 C C   . PRO B 1 2   ? 28.399 2.823   19.241  1.00 59.19 ? 2    PRO B C   1 
ATOM   1747 O O   . PRO B 1 2   ? 29.249 2.015   19.639  1.00 59.98 ? 2    PRO B O   1 
ATOM   1748 C CB  . PRO B 1 2   ? 27.435 4.280   17.434  1.00 59.91 ? 2    PRO B CB  1 
ATOM   1749 C CG  . PRO B 1 2   ? 27.741 4.211   15.925  1.00 60.69 ? 2    PRO B CG  1 
ATOM   1750 C CD  . PRO B 1 2   ? 28.510 2.869   15.771  1.00 58.74 ? 2    PRO B CD  1 
ATOM   1751 N N   . GLY B 1 3   ? 27.192 2.948   19.805  1.00 55.70 ? 3    GLY B N   1 
ATOM   1752 C CA  . GLY B 1 3   ? 26.790 2.121   20.929  1.00 50.39 ? 3    GLY B CA  1 
ATOM   1753 C C   . GLY B 1 3   ? 26.454 0.729   20.433  1.00 49.16 ? 3    GLY B C   1 
ATOM   1754 O O   . GLY B 1 3   ? 26.647 0.432   19.251  1.00 49.07 ? 3    GLY B O   1 
ATOM   1755 N N   . GLY B 1 4   ? 25.945 -0.122  21.318  1.00 47.54 ? 4    GLY B N   1 
ATOM   1756 C CA  . GLY B 1 4   ? 25.604 -1.476  20.908  1.00 43.03 ? 4    GLY B CA  1 
ATOM   1757 C C   . GLY B 1 4   ? 24.250 -1.590  20.234  1.00 41.28 ? 4    GLY B C   1 
ATOM   1758 O O   . GLY B 1 4   ? 23.867 -2.670  19.792  1.00 41.98 ? 4    GLY B O   1 
ATOM   1759 N N   . LEU B 1 5   ? 23.522 -0.480  20.161  1.00 37.58 ? 5    LEU B N   1 
ATOM   1760 C CA  . LEU B 1 5   ? 22.199 -0.458  19.552  1.00 31.92 ? 5    LEU B CA  1 
ATOM   1761 C C   . LEU B 1 5   ? 22.316 0.084   18.139  1.00 30.16 ? 5    LEU B C   1 
ATOM   1762 O O   . LEU B 1 5   ? 23.206 0.884   17.856  1.00 33.67 ? 5    LEU B O   1 
ATOM   1763 C CB  . LEU B 1 5   ? 21.258 0.456   20.344  1.00 30.35 ? 5    LEU B CB  1 
ATOM   1764 C CG  . LEU B 1 5   ? 21.055 0.285   21.850  1.00 27.22 ? 5    LEU B CG  1 
ATOM   1765 C CD1 . LEU B 1 5   ? 22.358 0.514   22.603  1.00 30.94 ? 5    LEU B CD1 1 
ATOM   1766 C CD2 . LEU B 1 5   ? 20.019 1.292   22.318  1.00 26.30 ? 5    LEU B CD2 1 
ATOM   1767 N N   . LEU B 1 6   ? 21.432 -0.365  17.256  1.00 26.29 ? 6    LEU B N   1 
ATOM   1768 C CA  . LEU B 1 6   ? 21.410 0.091   15.871  1.00 22.86 ? 6    LEU B CA  1 
ATOM   1769 C C   . LEU B 1 6   ? 20.262 1.086   15.772  1.00 21.03 ? 6    LEU B C   1 
ATOM   1770 O O   . LEU B 1 6   ? 19.513 1.265   16.733  1.00 21.59 ? 6    LEU B O   1 
ATOM   1771 C CB  . LEU B 1 6   ? 21.106 -1.075  14.913  1.00 26.83 ? 6    LEU B CB  1 
ATOM   1772 C CG  . LEU B 1 6   ? 21.991 -2.320  14.752  1.00 29.70 ? 6    LEU B CG  1 
ATOM   1773 C CD1 . LEU B 1 6   ? 21.348 -3.234  13.712  1.00 26.32 ? 6    LEU B CD1 1 
ATOM   1774 C CD2 . LEU B 1 6   ? 23.422 -1.952  14.337  1.00 24.43 ? 6    LEU B CD2 1 
ATOM   1775 N N   . LEU B 1 7   ? 20.132 1.747   14.627  1.00 17.94 ? 7    LEU B N   1 
ATOM   1776 C CA  . LEU B 1 7   ? 19.024 2.679   14.429  1.00 16.87 ? 7    LEU B CA  1 
ATOM   1777 C C   . LEU B 1 7   ? 17.774 1.810   14.393  1.00 16.37 ? 7    LEU B C   1 
ATOM   1778 O O   . LEU B 1 7   ? 17.768 0.763   13.756  1.00 16.48 ? 7    LEU B O   1 
ATOM   1779 C CB  . LEU B 1 7   ? 19.158 3.437   13.095  1.00 18.27 ? 7    LEU B CB  1 
ATOM   1780 C CG  . LEU B 1 7   ? 20.268 4.475   12.916  1.00 16.72 ? 7    LEU B CG  1 
ATOM   1781 C CD1 . LEU B 1 7   ? 20.207 5.118   11.535  1.00 12.36 ? 7    LEU B CD1 1 
ATOM   1782 C CD2 . LEU B 1 7   ? 20.121 5.529   13.988  1.00 20.41 ? 7    LEU B CD2 1 
ATOM   1783 N N   . GLY B 1 8   ? 16.738 2.214   15.114  1.00 19.00 ? 8    GLY B N   1 
ATOM   1784 C CA  . GLY B 1 8   ? 15.510 1.440   15.132  1.00 18.23 ? 8    GLY B CA  1 
ATOM   1785 C C   . GLY B 1 8   ? 15.395 0.553   16.358  1.00 21.61 ? 8    GLY B C   1 
ATOM   1786 O O   . GLY B 1 8   ? 14.303 0.056   16.663  1.00 22.32 ? 8    GLY B O   1 
ATOM   1787 N N   . ASP B 1 9   ? 16.504 0.360   17.071  1.00 17.73 ? 9    ASP B N   1 
ATOM   1788 C CA  . ASP B 1 9   ? 16.502 -0.474  18.270  1.00 21.40 ? 9    ASP B CA  1 
ATOM   1789 C C   . ASP B 1 9   ? 15.799 0.187   19.436  1.00 22.04 ? 9    ASP B C   1 
ATOM   1790 O O   . ASP B 1 9   ? 16.007 1.377   19.715  1.00 22.03 ? 9    ASP B O   1 
ATOM   1791 C CB  . ASP B 1 9   ? 17.923 -0.832  18.697  1.00 22.29 ? 9    ASP B CB  1 
ATOM   1792 C CG  . ASP B 1 9   ? 18.482 -2.019  17.941  1.00 27.67 ? 9    ASP B CG  1 
ATOM   1793 O OD1 . ASP B 1 9   ? 17.794 -2.566  17.049  1.00 26.30 ? 9    ASP B OD1 1 
ATOM   1794 O OD2 . ASP B 1 9   ? 19.631 -2.405  18.240  1.00 29.91 ? 9    ASP B OD2 1 
ATOM   1795 N N   . VAL B 1 10  ? 14.959 -0.581  20.116  1.00 20.62 ? 10   VAL B N   1 
ATOM   1796 C CA  . VAL B 1 10  ? 14.237 -0.064  21.270  1.00 22.61 ? 10   VAL B CA  1 
ATOM   1797 C C   . VAL B 1 10  ? 15.169 -0.084  22.491  1.00 18.37 ? 10   VAL B C   1 
ATOM   1798 O O   . VAL B 1 10  ? 15.877 -1.053  22.732  1.00 23.88 ? 10   VAL B O   1 
ATOM   1799 C CB  . VAL B 1 10  ? 12.881 -0.814  21.503  1.00 24.24 ? 10   VAL B CB  1 
ATOM   1800 C CG1 . VAL B 1 10  ? 13.043 -2.303  21.280  1.00 30.76 ? 10   VAL B CG1 1 
ATOM   1801 C CG2 . VAL B 1 10  ? 12.332 -0.527  22.904  1.00 23.34 ? 10   VAL B CG2 1 
ATOM   1802 N N   . ALA B 1 11  ? 15.221 1.037   23.196  1.00 22.44 ? 11   ALA B N   1 
ATOM   1803 C CA  . ALA B 1 11  ? 16.073 1.217   24.364  1.00 21.82 ? 11   ALA B CA  1 
ATOM   1804 C C   . ALA B 1 11  ? 15.816 0.243   25.500  1.00 24.98 ? 11   ALA B C   1 
ATOM   1805 O O   . ALA B 1 11  ? 14.668 -0.140  25.766  1.00 26.53 ? 11   ALA B O   1 
ATOM   1806 C CB  . ALA B 1 11  ? 15.929 2.637   24.888  1.00 14.66 ? 11   ALA B CB  1 
ATOM   1807 N N   . PRO B 1 12  ? 16.891 -0.152  26.204  1.00 27.36 ? 12   PRO B N   1 
ATOM   1808 C CA  . PRO B 1 12  ? 16.821 -1.071  27.340  1.00 25.99 ? 12   PRO B CA  1 
ATOM   1809 C C   . PRO B 1 12  ? 16.033 -0.350  28.433  1.00 25.42 ? 12   PRO B C   1 
ATOM   1810 O O   . PRO B 1 12  ? 16.303 0.821   28.726  1.00 26.37 ? 12   PRO B O   1 
ATOM   1811 C CB  . PRO B 1 12  ? 18.289 -1.208  27.749  1.00 25.74 ? 12   PRO B CB  1 
ATOM   1812 C CG  . PRO B 1 12  ? 19.019 -1.009  26.462  1.00 27.43 ? 12   PRO B CG  1 
ATOM   1813 C CD  . PRO B 1 12  ? 18.294 0.163   25.878  1.00 29.19 ? 12   PRO B CD  1 
ATOM   1814 N N   . ASN B 1 13  ? 15.026 -1.022  28.982  1.00 24.75 ? 13   ASN B N   1 
ATOM   1815 C CA  . ASN B 1 13  ? 14.196 -0.448  30.044  1.00 23.46 ? 13   ASN B CA  1 
ATOM   1816 C C   . ASN B 1 13  ? 14.883 -0.759  31.369  1.00 23.79 ? 13   ASN B C   1 
ATOM   1817 O O   . ASN B 1 13  ? 14.414 -1.578  32.155  1.00 27.58 ? 13   ASN B O   1 
ATOM   1818 C CB  . ASN B 1 13  ? 12.799 -1.075  29.999  1.00 22.15 ? 13   ASN B CB  1 
ATOM   1819 C CG  . ASN B 1 13  ? 11.789 -0.331  30.850  1.00 27.14 ? 13   ASN B CG  1 
ATOM   1820 O OD1 . ASN B 1 13  ? 12.098 0.691   31.466  1.00 23.68 ? 13   ASN B OD1 1 
ATOM   1821 N ND2 . ASN B 1 13  ? 10.553 -0.827  30.864  1.00 31.34 ? 13   ASN B ND2 1 
ATOM   1822 N N   . PHE B 1 14  ? 16.035 -0.147  31.583  1.00 22.02 ? 14   PHE B N   1 
ATOM   1823 C CA  . PHE B 1 14  ? 16.808 -0.389  32.789  1.00 20.01 ? 14   PHE B CA  1 
ATOM   1824 C C   . PHE B 1 14  ? 16.315 0.411   33.962  1.00 19.74 ? 14   PHE B C   1 
ATOM   1825 O O   . PHE B 1 14  ? 15.692 1.457   33.788  1.00 19.28 ? 14   PHE B O   1 
ATOM   1826 C CB  . PHE B 1 14  ? 18.291 -0.079  32.539  1.00 18.79 ? 14   PHE B CB  1 
ATOM   1827 C CG  . PHE B 1 14  ? 18.541 1.316   32.038  1.00 19.07 ? 14   PHE B CG  1 
ATOM   1828 C CD1 . PHE B 1 14  ? 18.677 2.374   32.929  1.00 15.12 ? 14   PHE B CD1 1 
ATOM   1829 C CD2 . PHE B 1 14  ? 18.633 1.567   30.667  1.00 17.62 ? 14   PHE B CD2 1 
ATOM   1830 C CE1 . PHE B 1 14  ? 18.900 3.659   32.473  1.00 12.66 ? 14   PHE B CE1 1 
ATOM   1831 C CE2 . PHE B 1 14  ? 18.858 2.849   30.198  1.00 16.46 ? 14   PHE B CE2 1 
ATOM   1832 C CZ  . PHE B 1 14  ? 18.992 3.901   31.109  1.00 16.44 ? 14   PHE B CZ  1 
ATOM   1833 N N   . GLU B 1 15  ? 16.626 -0.091  35.152  1.00 21.89 ? 15   GLU B N   1 
ATOM   1834 C CA  . GLU B 1 15  ? 16.262 0.539   36.415  1.00 26.26 ? 15   GLU B CA  1 
ATOM   1835 C C   . GLU B 1 15  ? 17.605 1.024   36.924  1.00 24.58 ? 15   GLU B C   1 
ATOM   1836 O O   . GLU B 1 15  ? 18.601 0.309   36.825  1.00 28.80 ? 15   GLU B O   1 
ATOM   1837 C CB  . GLU B 1 15  ? 15.676 -0.509  37.369  1.00 33.94 ? 15   GLU B CB  1 
ATOM   1838 C CG  . GLU B 1 15  ? 14.568 -0.008  38.327  1.00 47.88 ? 15   GLU B CG  1 
ATOM   1839 C CD  . GLU B 1 15  ? 15.080 0.703   39.588  1.00 52.79 ? 15   GLU B CD  1 
ATOM   1840 O OE1 . GLU B 1 15  ? 16.241 0.463   40.000  1.00 56.17 ? 15   GLU B OE1 1 
ATOM   1841 O OE2 . GLU B 1 15  ? 14.301 1.487   40.186  1.00 54.76 ? 15   GLU B OE2 1 
ATOM   1842 N N   . ALA B 1 16  ? 17.659 2.256   37.399  1.00 23.34 ? 16   ALA B N   1 
ATOM   1843 C CA  . ALA B 1 16  ? 18.910 2.808   37.883  1.00 20.59 ? 16   ALA B CA  1 
ATOM   1844 C C   . ALA B 1 16  ? 18.648 3.909   38.900  1.00 20.12 ? 16   ALA B C   1 
ATOM   1845 O O   . ALA B 1 16  ? 17.538 4.430   39.002  1.00 20.59 ? 16   ALA B O   1 
ATOM   1846 C CB  . ALA B 1 16  ? 19.734 3.345   36.710  1.00 17.73 ? 16   ALA B CB  1 
ATOM   1847 N N   . ASN B 1 17  ? 19.658 4.228   39.691  1.00 19.34 ? 17   ASN B N   1 
ATOM   1848 C CA  . ASN B 1 17  ? 19.523 5.269   40.678  1.00 21.10 ? 17   ASN B CA  1 
ATOM   1849 C C   . ASN B 1 17  ? 20.223 6.495   40.150  1.00 19.83 ? 17   ASN B C   1 
ATOM   1850 O O   . ASN B 1 17  ? 21.281 6.416   39.543  1.00 17.68 ? 17   ASN B O   1 
ATOM   1851 C CB  . ASN B 1 17  ? 20.130 4.847   42.012  1.00 27.58 ? 17   ASN B CB  1 
ATOM   1852 C CG  . ASN B 1 17  ? 19.911 5.880   43.097  1.00 29.87 ? 17   ASN B CG  1 
ATOM   1853 O OD1 . ASN B 1 17  ? 20.825 6.200   43.851  1.00 39.40 ? 17   ASN B OD1 1 
ATOM   1854 N ND2 . ASN B 1 17  ? 18.698 6.406   43.184  1.00 28.86 ? 17   ASN B ND2 1 
ATOM   1855 N N   . THR B 1 18  ? 19.604 7.641   40.359  1.00 22.81 ? 18   THR B N   1 
ATOM   1856 C CA  . THR B 1 18  ? 20.149 8.884   39.880  1.00 21.52 ? 18   THR B CA  1 
ATOM   1857 C C   . THR B 1 18  ? 20.189 9.878   41.037  1.00 23.23 ? 18   THR B C   1 
ATOM   1858 O O   . THR B 1 18  ? 19.779 9.572   42.166  1.00 24.06 ? 18   THR B O   1 
ATOM   1859 C CB  . THR B 1 18  ? 19.251 9.454   38.759  1.00 22.03 ? 18   THR B CB  1 
ATOM   1860 O OG1 . THR B 1 18  ? 18.006 9.858   39.324  1.00 20.29 ? 18   THR B OG1 1 
ATOM   1861 C CG2 . THR B 1 18  ? 18.969 8.412   37.664  1.00 19.81 ? 18   THR B CG2 1 
ATOM   1862 N N   . THR B 1 19  ? 20.629 11.088  40.718  1.00 23.51 ? 19   THR B N   1 
ATOM   1863 C CA  . THR B 1 19  ? 20.714 12.199  41.657  1.00 25.25 ? 19   THR B CA  1 
ATOM   1864 C C   . THR B 1 19  ? 19.322 12.581  42.143  1.00 25.35 ? 19   THR B C   1 
ATOM   1865 O O   . THR B 1 19  ? 19.180 13.184  43.210  1.00 27.41 ? 19   THR B O   1 
ATOM   1866 C CB  . THR B 1 19  ? 21.276 13.421  40.947  1.00 24.42 ? 19   THR B CB  1 
ATOM   1867 O OG1 . THR B 1 19  ? 20.658 13.511  39.653  1.00 22.51 ? 19   THR B OG1 1 
ATOM   1868 C CG2 . THR B 1 19  ? 22.786 13.297  40.788  1.00 25.18 ? 19   THR B CG2 1 
ATOM   1869 N N   . VAL B 1 20  ? 18.302 12.237  41.358  1.00 24.67 ? 20   VAL B N   1 
ATOM   1870 C CA  . VAL B 1 20  ? 16.917 12.547  41.709  1.00 27.43 ? 20   VAL B CA  1 
ATOM   1871 C C   . VAL B 1 20  ? 16.154 11.325  42.221  1.00 27.66 ? 20   VAL B C   1 
ATOM   1872 O O   . VAL B 1 20  ? 14.983 11.427  42.605  1.00 29.10 ? 20   VAL B O   1 
ATOM   1873 C CB  . VAL B 1 20  ? 16.148 13.157  40.513  1.00 27.30 ? 20   VAL B CB  1 
ATOM   1874 C CG1 . VAL B 1 20  ? 16.810 14.450  40.082  1.00 34.03 ? 20   VAL B CG1 1 
ATOM   1875 C CG2 . VAL B 1 20  ? 16.079 12.191  39.351  1.00 30.74 ? 20   VAL B CG2 1 
ATOM   1876 N N   . GLY B 1 21  ? 16.810 10.168  42.208  1.00 30.71 ? 21   GLY B N   1 
ATOM   1877 C CA  . GLY B 1 21  ? 16.163 8.966   42.687  1.00 27.58 ? 21   GLY B CA  1 
ATOM   1878 C C   . GLY B 1 21  ? 16.178 7.864   41.656  1.00 27.40 ? 21   GLY B C   1 
ATOM   1879 O O   . GLY B 1 21  ? 16.774 8.000   40.595  1.00 27.44 ? 21   GLY B O   1 
ATOM   1880 N N   . ARG B 1 22  ? 15.550 6.752   42.012  1.00 26.79 ? 22   ARG B N   1 
ATOM   1881 C CA  . ARG B 1 22  ? 15.441 5.568   41.173  1.00 31.05 ? 22   ARG B CA  1 
ATOM   1882 C C   . ARG B 1 22  ? 14.583 5.879   39.958  1.00 32.41 ? 22   ARG B C   1 
ATOM   1883 O O   . ARG B 1 22  ? 13.628 6.651   40.056  1.00 35.09 ? 22   ARG B O   1 
ATOM   1884 C CB  . ARG B 1 22  ? 14.786 4.418   41.954  1.00 35.79 ? 22   ARG B CB  1 
ATOM   1885 C CG  . ARG B 1 22  ? 15.372 4.152   43.354  1.00 46.90 ? 22   ARG B CG  1 
ATOM   1886 C CD  . ARG B 1 22  ? 14.766 5.026   44.506  1.00 52.01 ? 22   ARG B CD  1 
ATOM   1887 N NE  . ARG B 1 22  ? 13.714 5.982   44.095  1.00 51.05 ? 22   ARG B NE  1 
ATOM   1888 C CZ  . ARG B 1 22  ? 13.639 7.248   44.515  1.00 46.69 ? 22   ARG B CZ  1 
ATOM   1889 N NH1 . ARG B 1 22  ? 14.520 7.705   45.389  1.00 48.29 ? 22   ARG B NH1 1 
ATOM   1890 N NH2 . ARG B 1 22  ? 12.666 8.042   44.095  1.00 43.82 ? 22   ARG B NH2 1 
ATOM   1891 N N   . ILE B 1 23  ? 14.914 5.278   38.819  1.00 33.34 ? 23   ILE B N   1 
ATOM   1892 C CA  . ILE B 1 23  ? 14.154 5.491   37.593  1.00 31.05 ? 23   ILE B CA  1 
ATOM   1893 C C   . ILE B 1 23  ? 14.133 4.236   36.749  1.00 28.69 ? 23   ILE B C   1 
ATOM   1894 O O   . ILE B 1 23  ? 15.050 3.418   36.809  1.00 27.90 ? 23   ILE B O   1 
ATOM   1895 C CB  . ILE B 1 23  ? 14.765 6.603   36.671  1.00 30.67 ? 23   ILE B CB  1 
ATOM   1896 C CG1 . ILE B 1 23  ? 16.107 6.155   36.094  1.00 31.37 ? 23   ILE B CG1 1 
ATOM   1897 C CG2 . ILE B 1 23  ? 14.944 7.906   37.424  1.00 32.32 ? 23   ILE B CG2 1 
ATOM   1898 C CD1 . ILE B 1 23  ? 16.553 6.999   34.959  1.00 29.95 ? 23   ILE B CD1 1 
ATOM   1899 N N   . ARG B 1 24  ? 13.061 4.086   35.984  1.00 26.94 ? 24   ARG B N   1 
ATOM   1900 C CA  . ARG B 1 24  ? 12.927 2.984   35.045  1.00 29.39 ? 24   ARG B CA  1 
ATOM   1901 C C   . ARG B 1 24  ? 12.992 3.792   33.764  1.00 26.08 ? 24   ARG B C   1 
ATOM   1902 O O   . ARG B 1 24  ? 12.235 4.747   33.591  1.00 24.78 ? 24   ARG B O   1 
ATOM   1903 C CB  . ARG B 1 24  ? 11.579 2.287   35.185  1.00 35.56 ? 24   ARG B CB  1 
ATOM   1904 C CG  . ARG B 1 24  ? 11.378 1.621   36.534  1.00 45.62 ? 24   ARG B CG  1 
ATOM   1905 C CD  . ARG B 1 24  ? 10.193 0.691   36.503  1.00 49.82 ? 24   ARG B CD  1 
ATOM   1906 N NE  . ARG B 1 24  ? 10.399 -0.375  35.531  1.00 58.52 ? 24   ARG B NE  1 
ATOM   1907 C CZ  . ARG B 1 24  ? 9.424  -1.109  35.001  1.00 61.67 ? 24   ARG B CZ  1 
ATOM   1908 N NH1 . ARG B 1 24  ? 8.159  -0.888  35.342  1.00 64.92 ? 24   ARG B NH1 1 
ATOM   1909 N NH2 . ARG B 1 24  ? 9.721  -2.082  34.148  1.00 64.17 ? 24   ARG B NH2 1 
ATOM   1910 N N   . PHE B 1 25  ? 13.940 3.454   32.902  1.00 23.79 ? 25   PHE B N   1 
ATOM   1911 C CA  . PHE B 1 25  ? 14.156 4.199   31.681  1.00 19.61 ? 25   PHE B CA  1 
ATOM   1912 C C   . PHE B 1 25  ? 12.917 4.556   30.863  1.00 18.34 ? 25   PHE B C   1 
ATOM   1913 O O   . PHE B 1 25  ? 12.723 5.721   30.509  1.00 21.71 ? 25   PHE B O   1 
ATOM   1914 C CB  . PHE B 1 25  ? 15.204 3.505   30.814  1.00 21.43 ? 25   PHE B CB  1 
ATOM   1915 C CG  . PHE B 1 25  ? 15.856 4.420   29.813  1.00 18.26 ? 25   PHE B CG  1 
ATOM   1916 C CD1 . PHE B 1 25  ? 16.220 5.726   30.179  1.00 17.03 ? 25   PHE B CD1 1 
ATOM   1917 C CD2 . PHE B 1 25  ? 16.066 4.001   28.503  1.00 16.33 ? 25   PHE B CD2 1 
ATOM   1918 C CE1 . PHE B 1 25  ? 16.780 6.603   29.249  1.00 17.21 ? 25   PHE B CE1 1 
ATOM   1919 C CE2 . PHE B 1 25  ? 16.623 4.865   27.564  1.00 17.53 ? 25   PHE B CE2 1 
ATOM   1920 C CZ  . PHE B 1 25  ? 16.980 6.172   27.936  1.00 18.30 ? 25   PHE B CZ  1 
ATOM   1921 N N   . HIS B 1 26  ? 12.063 3.581   30.577  1.00 18.18 ? 26   HIS B N   1 
ATOM   1922 C CA  . HIS B 1 26  ? 10.877 3.866   29.783  1.00 17.98 ? 26   HIS B CA  1 
ATOM   1923 C C   . HIS B 1 26  ? 9.901  4.771   30.499  1.00 22.41 ? 26   HIS B C   1 
ATOM   1924 O O   . HIS B 1 26  ? 9.259  5.613   29.869  1.00 24.24 ? 26   HIS B O   1 
ATOM   1925 C CB  . HIS B 1 26  ? 10.183 2.589   29.354  1.00 18.53 ? 26   HIS B CB  1 
ATOM   1926 C CG  . HIS B 1 26  ? 10.927 1.827   28.309  1.00 17.38 ? 26   HIS B CG  1 
ATOM   1927 N ND1 . HIS B 1 26  ? 10.339 0.828   27.563  1.00 18.78 ? 26   HIS B ND1 1 
ATOM   1928 C CD2 . HIS B 1 26  ? 12.214 1.897   27.892  1.00 17.36 ? 26   HIS B CD2 1 
ATOM   1929 C CE1 . HIS B 1 26  ? 11.233 0.313   26.734  1.00 17.88 ? 26   HIS B CE1 1 
ATOM   1930 N NE2 . HIS B 1 26  ? 12.375 0.948   26.917  1.00 15.17 ? 26   HIS B NE2 1 
ATOM   1931 N N   . ASP B 1 27  ? 9.801  4.615   31.815  1.00 25.72 ? 27   ASP B N   1 
ATOM   1932 C CA  . ASP B 1 27  ? 8.908  5.451   32.604  1.00 28.17 ? 27   ASP B CA  1 
ATOM   1933 C C   . ASP B 1 27  ? 9.378  6.902   32.518  1.00 26.51 ? 27   ASP B C   1 
ATOM   1934 O O   . ASP B 1 27  ? 8.588  7.795   32.198  1.00 25.24 ? 27   ASP B O   1 
ATOM   1935 C CB  . ASP B 1 27  ? 8.866  4.971   34.060  1.00 31.71 ? 27   ASP B CB  1 
ATOM   1936 C CG  . ASP B 1 27  ? 8.375  3.521   34.197  1.00 38.24 ? 27   ASP B CG  1 
ATOM   1937 O OD1 . ASP B 1 27  ? 8.180  2.823   33.172  1.00 38.96 ? 27   ASP B OD1 1 
ATOM   1938 O OD2 . ASP B 1 27  ? 8.203  3.067   35.350  1.00 44.38 ? 27   ASP B OD2 1 
ATOM   1939 N N   . PHE B 1 28  ? 10.674 7.120   32.749  1.00 24.65 ? 28   PHE B N   1 
ATOM   1940 C CA  . PHE B 1 28  ? 11.284 8.455   32.690  1.00 22.39 ? 28   PHE B CA  1 
ATOM   1941 C C   . PHE B 1 28  ? 11.005 9.128   31.339  1.00 24.18 ? 28   PHE B C   1 
ATOM   1942 O O   . PHE B 1 28  ? 10.676 10.317  31.278  1.00 26.61 ? 28   PHE B O   1 
ATOM   1943 C CB  . PHE B 1 28  ? 12.808 8.362   32.925  1.00 21.49 ? 28   PHE B CB  1 
ATOM   1944 C CG  . PHE B 1 28  ? 13.559 9.642   32.607  1.00 20.83 ? 28   PHE B CG  1 
ATOM   1945 C CD1 . PHE B 1 28  ? 13.643 10.672  33.548  1.00 20.60 ? 28   PHE B CD1 1 
ATOM   1946 C CD2 . PHE B 1 28  ? 14.128 9.840   31.347  1.00 18.21 ? 28   PHE B CD2 1 
ATOM   1947 C CE1 . PHE B 1 28  ? 14.273 11.882  33.238  1.00 17.43 ? 28   PHE B CE1 1 
ATOM   1948 C CE2 . PHE B 1 28  ? 14.759 11.047  31.025  1.00 16.12 ? 28   PHE B CE2 1 
ATOM   1949 C CZ  . PHE B 1 28  ? 14.829 12.071  31.975  1.00 16.89 ? 28   PHE B CZ  1 
ATOM   1950 N N   . LEU B 1 29  ? 11.168 8.378   30.255  1.00 22.64 ? 29   LEU B N   1 
ATOM   1951 C CA  . LEU B 1 29  ? 10.932 8.922   28.932  1.00 26.07 ? 29   LEU B CA  1 
ATOM   1952 C C   . LEU B 1 29  ? 9.468  9.225   28.645  1.00 27.21 ? 29   LEU B C   1 
ATOM   1953 O O   . LEU B 1 29  ? 9.153  10.263  28.057  1.00 26.89 ? 29   LEU B O   1 
ATOM   1954 C CB  . LEU B 1 29  ? 11.481 7.988   27.861  1.00 27.01 ? 29   LEU B CB  1 
ATOM   1955 C CG  . LEU B 1 29  ? 13.002 7.869   27.880  1.00 29.60 ? 29   LEU B CG  1 
ATOM   1956 C CD1 . LEU B 1 29  ? 13.426 6.923   26.789  1.00 33.87 ? 29   LEU B CD1 1 
ATOM   1957 C CD2 . LEU B 1 29  ? 13.648 9.244   27.697  1.00 30.02 ? 29   LEU B CD2 1 
ATOM   1958 N N   . GLY B 1 30  ? 8.579  8.332   29.074  1.00 26.41 ? 30   GLY B N   1 
ATOM   1959 C CA  . GLY B 1 30  ? 7.158  8.515   28.832  1.00 22.36 ? 30   GLY B CA  1 
ATOM   1960 C C   . GLY B 1 30  ? 6.846  8.747   27.362  1.00 21.49 ? 30   GLY B C   1 
ATOM   1961 O O   . GLY B 1 30  ? 7.170  7.910   26.510  1.00 22.85 ? 30   GLY B O   1 
ATOM   1962 N N   . ASP B 1 31  ? 6.221  9.888   27.078  1.00 21.86 ? 31   ASP B N   1 
ATOM   1963 C CA  . ASP B 1 31  ? 5.844  10.285  25.725  1.00 21.85 ? 31   ASP B CA  1 
ATOM   1964 C C   . ASP B 1 31  ? 6.767  11.364  25.182  1.00 21.10 ? 31   ASP B C   1 
ATOM   1965 O O   . ASP B 1 31  ? 6.406  12.094  24.257  1.00 18.82 ? 31   ASP B O   1 
ATOM   1966 C CB  . ASP B 1 31  ? 4.417  10.841  25.695  1.00 28.81 ? 31   ASP B CB  1 
ATOM   1967 C CG  . ASP B 1 31  ? 3.366  9.799   26.024  1.00 34.27 ? 31   ASP B CG  1 
ATOM   1968 O OD1 . ASP B 1 31  ? 3.574  8.594   25.745  1.00 36.44 ? 31   ASP B OD1 1 
ATOM   1969 O OD2 . ASP B 1 31  ? 2.320  10.207  26.564  1.00 42.28 ? 31   ASP B OD2 1 
ATOM   1970 N N   . SER B 1 32  ? 7.942  11.498  25.778  1.00 21.07 ? 32   SER B N   1 
ATOM   1971 C CA  . SER B 1 32  ? 8.880  12.501  25.330  1.00 16.52 ? 32   SER B CA  1 
ATOM   1972 C C   . SER B 1 32  ? 10.057 11.892  24.593  1.00 18.53 ? 32   SER B C   1 
ATOM   1973 O O   . SER B 1 32  ? 10.307 10.673  24.666  1.00 15.92 ? 32   SER B O   1 
ATOM   1974 C CB  . SER B 1 32  ? 9.400  13.275  26.536  1.00 20.44 ? 32   SER B CB  1 
ATOM   1975 O OG  . SER B 1 32  ? 8.339  13.634  27.399  1.00 22.44 ? 32   SER B OG  1 
ATOM   1976 N N   . TRP B 1 33  ? 10.739 12.735  23.826  1.00 15.50 ? 33   TRP B N   1 
ATOM   1977 C CA  . TRP B 1 33  ? 11.954 12.317  23.147  1.00 17.02 ? 33   TRP B CA  1 
ATOM   1978 C C   . TRP B 1 33  ? 12.953 12.288  24.309  1.00 17.29 ? 33   TRP B C   1 
ATOM   1979 O O   . TRP B 1 33  ? 12.675 12.858  25.369  1.00 17.13 ? 33   TRP B O   1 
ATOM   1980 C CB  . TRP B 1 33  ? 12.386 13.358  22.104  1.00 12.20 ? 33   TRP B CB  1 
ATOM   1981 C CG  . TRP B 1 33  ? 11.569 13.317  20.850  1.00 13.13 ? 33   TRP B CG  1 
ATOM   1982 C CD1 . TRP B 1 33  ? 10.280 13.732  20.700  1.00 11.73 ? 33   TRP B CD1 1 
ATOM   1983 C CD2 . TRP B 1 33  ? 11.980 12.821  19.564  1.00 13.00 ? 33   TRP B CD2 1 
ATOM   1984 N NE1 . TRP B 1 33  ? 9.862  13.525  19.412  1.00 10.43 ? 33   TRP B NE1 1 
ATOM   1985 C CE2 . TRP B 1 33  ? 10.886 12.966  18.693  1.00 12.95 ? 33   TRP B CE2 1 
ATOM   1986 C CE3 . TRP B 1 33  ? 13.172 12.269  19.072  1.00 9.38  ? 33   TRP B CE3 1 
ATOM   1987 C CZ2 . TRP B 1 33  ? 10.941 12.578  17.348  1.00 13.25 ? 33   TRP B CZ2 1 
ATOM   1988 C CZ3 . TRP B 1 33  ? 13.222 11.886  17.743  1.00 6.31  ? 33   TRP B CZ3 1 
ATOM   1989 C CH2 . TRP B 1 33  ? 12.116 12.041  16.897  1.00 9.23  ? 33   TRP B CH2 1 
ATOM   1990 N N   . GLY B 1 34  ? 14.093 11.631  24.134  1.00 20.58 ? 34   GLY B N   1 
ATOM   1991 C CA  . GLY B 1 34  ? 15.067 11.575  25.214  1.00 16.88 ? 34   GLY B CA  1 
ATOM   1992 C C   . GLY B 1 34  ? 16.494 11.583  24.711  1.00 18.06 ? 34   GLY B C   1 
ATOM   1993 O O   . GLY B 1 34  ? 16.784 10.992  23.668  1.00 17.93 ? 34   GLY B O   1 
ATOM   1994 N N   . ILE B 1 35  ? 17.368 12.303  25.407  1.00 17.23 ? 35   ILE B N   1 
ATOM   1995 C CA  . ILE B 1 35  ? 18.785 12.368  25.043  1.00 16.17 ? 35   ILE B CA  1 
ATOM   1996 C C   . ILE B 1 35  ? 19.617 11.913  26.238  1.00 12.70 ? 35   ILE B C   1 
ATOM   1997 O O   . ILE B 1 35  ? 19.547 12.505  27.313  1.00 12.39 ? 35   ILE B O   1 
ATOM   1998 C CB  . ILE B 1 35  ? 19.234 13.793  24.621  1.00 12.88 ? 35   ILE B CB  1 
ATOM   1999 C CG1 . ILE B 1 35  ? 18.434 14.267  23.413  1.00 12.30 ? 35   ILE B CG1 1 
ATOM   2000 C CG2 . ILE B 1 35  ? 20.699 13.788  24.229  1.00 14.91 ? 35   ILE B CG2 1 
ATOM   2001 C CD1 . ILE B 1 35  ? 18.879 15.623  22.869  1.00 12.83 ? 35   ILE B CD1 1 
ATOM   2002 N N   . LEU B 1 36  ? 20.342 10.814  26.045  1.00 13.56 ? 36   LEU B N   1 
ATOM   2003 C CA  . LEU B 1 36  ? 21.210 10.222  27.061  1.00 14.59 ? 36   LEU B CA  1 
ATOM   2004 C C   . LEU B 1 36  ? 22.667 10.567  26.738  1.00 13.81 ? 36   LEU B C   1 
ATOM   2005 O O   . LEU B 1 36  ? 23.187 10.172  25.694  1.00 15.28 ? 36   LEU B O   1 
ATOM   2006 C CB  . LEU B 1 36  ? 21.020 8.697   27.074  1.00 12.79 ? 36   LEU B CB  1 
ATOM   2007 C CG  . LEU B 1 36  ? 21.932 7.839   27.961  1.00 17.28 ? 36   LEU B CG  1 
ATOM   2008 C CD1 . LEU B 1 36  ? 21.623 8.054   29.430  1.00 22.40 ? 36   LEU B CD1 1 
ATOM   2009 C CD2 . LEU B 1 36  ? 21.705 6.386   27.626  1.00 19.53 ? 36   LEU B CD2 1 
ATOM   2010 N N   . PHE B 1 37  ? 23.298 11.359  27.598  1.00 15.35 ? 37   PHE B N   1 
ATOM   2011 C CA  . PHE B 1 37  ? 24.695 11.757  27.403  1.00 15.95 ? 37   PHE B CA  1 
ATOM   2012 C C   . PHE B 1 37  ? 25.555 10.869  28.269  1.00 13.94 ? 37   PHE B C   1 
ATOM   2013 O O   . PHE B 1 37  ? 25.323 10.797  29.470  1.00 18.78 ? 37   PHE B O   1 
ATOM   2014 C CB  . PHE B 1 37  ? 24.935 13.207  27.856  1.00 11.99 ? 37   PHE B CB  1 
ATOM   2015 C CG  . PHE B 1 37  ? 24.126 14.234  27.115  1.00 15.51 ? 37   PHE B CG  1 
ATOM   2016 C CD1 . PHE B 1 37  ? 22.856 14.588  27.558  1.00 14.24 ? 37   PHE B CD1 1 
ATOM   2017 C CD2 . PHE B 1 37  ? 24.654 14.884  26.002  1.00 14.78 ? 37   PHE B CD2 1 
ATOM   2018 C CE1 . PHE B 1 37  ? 22.121 15.580  26.905  1.00 21.37 ? 37   PHE B CE1 1 
ATOM   2019 C CE2 . PHE B 1 37  ? 23.932 15.875  25.339  1.00 18.18 ? 37   PHE B CE2 1 
ATOM   2020 C CZ  . PHE B 1 37  ? 22.661 16.227  25.789  1.00 19.72 ? 37   PHE B CZ  1 
ATOM   2021 N N   . SER B 1 38  ? 26.573 10.248  27.687  1.00 16.44 ? 38   SER B N   1 
ATOM   2022 C CA  . SER B 1 38  ? 27.487 9.376   28.431  1.00 12.81 ? 38   SER B CA  1 
ATOM   2023 C C   . SER B 1 38  ? 28.820 10.063  28.710  1.00 12.49 ? 38   SER B C   1 
ATOM   2024 O O   . SER B 1 38  ? 29.325 10.829  27.881  1.00 10.76 ? 38   SER B O   1 
ATOM   2025 C CB  . SER B 1 38  ? 27.735 8.084   27.648  1.00 13.45 ? 38   SER B CB  1 
ATOM   2026 O OG  . SER B 1 38  ? 26.516 7.421   27.356  1.00 21.39 ? 38   SER B OG  1 
ATOM   2027 N N   . HIS B 1 39  ? 29.353 9.832   29.906  1.00 15.38 ? 39   HIS B N   1 
ATOM   2028 C CA  . HIS B 1 39  ? 30.635 10.407  30.339  1.00 14.73 ? 39   HIS B CA  1 
ATOM   2029 C C   . HIS B 1 39  ? 31.422 9.334   31.093  1.00 17.96 ? 39   HIS B C   1 
ATOM   2030 O O   . HIS B 1 39  ? 30.833 8.506   31.802  1.00 16.31 ? 39   HIS B O   1 
ATOM   2031 C CB  . HIS B 1 39  ? 30.404 11.616  31.251  1.00 11.26 ? 39   HIS B CB  1 
ATOM   2032 C CG  . HIS B 1 39  ? 29.597 12.698  30.612  1.00 13.44 ? 39   HIS B CG  1 
ATOM   2033 N ND1 . HIS B 1 39  ? 30.164 13.694  29.845  1.00 17.28 ? 39   HIS B ND1 1 
ATOM   2034 C CD2 . HIS B 1 39  ? 28.262 12.911  30.577  1.00 17.92 ? 39   HIS B CD2 1 
ATOM   2035 C CE1 . HIS B 1 39  ? 29.211 14.473  29.360  1.00 16.23 ? 39   HIS B CE1 1 
ATOM   2036 N NE2 . HIS B 1 39  ? 28.048 14.018  29.790  1.00 23.13 ? 39   HIS B NE2 1 
ATOM   2037 N N   . PRO B 1 40  ? 32.764 9.320   30.941  1.00 20.58 ? 40   PRO B N   1 
ATOM   2038 C CA  . PRO B 1 40  ? 33.620 8.332   31.616  1.00 18.14 ? 40   PRO B CA  1 
ATOM   2039 C C   . PRO B 1 40  ? 33.699 8.466   33.143  1.00 12.95 ? 40   PRO B C   1 
ATOM   2040 O O   . PRO B 1 40  ? 33.652 7.468   33.859  1.00 15.49 ? 40   PRO B O   1 
ATOM   2041 C CB  . PRO B 1 40  ? 34.995 8.569   30.975  1.00 19.22 ? 40   PRO B CB  1 
ATOM   2042 C CG  . PRO B 1 40  ? 34.661 9.123   29.624  1.00 27.27 ? 40   PRO B CG  1 
ATOM   2043 C CD  . PRO B 1 40  ? 33.541 10.090  29.956  1.00 23.09 ? 40   PRO B CD  1 
ATOM   2044 N N   . ARG B 1 41  ? 33.880 9.688   33.629  1.00 11.40 ? 41   ARG B N   1 
ATOM   2045 C CA  . ARG B 1 41  ? 33.992 9.939   35.058  1.00 14.80 ? 41   ARG B CA  1 
ATOM   2046 C C   . ARG B 1 41  ? 33.578 11.374  35.370  1.00 17.01 ? 41   ARG B C   1 
ATOM   2047 O O   . ARG B 1 41  ? 33.508 12.228  34.476  1.00 14.07 ? 41   ARG B O   1 
ATOM   2048 C CB  . ARG B 1 41  ? 35.446 9.756   35.523  1.00 21.35 ? 41   ARG B CB  1 
ATOM   2049 C CG  . ARG B 1 41  ? 35.975 8.331   35.560  1.00 30.76 ? 41   ARG B CG  1 
ATOM   2050 C CD  . ARG B 1 41  ? 35.307 7.494   36.641  1.00 39.98 ? 41   ARG B CD  1 
ATOM   2051 N NE  . ARG B 1 41  ? 35.865 6.142   36.714  1.00 50.16 ? 41   ARG B NE  1 
ATOM   2052 C CZ  . ARG B 1 41  ? 35.528 5.227   37.626  1.00 55.85 ? 41   ARG B CZ  1 
ATOM   2053 N NH1 . ARG B 1 41  ? 34.611 5.505   38.558  1.00 56.00 ? 41   ARG B NH1 1 
ATOM   2054 N NH2 . ARG B 1 41  ? 36.164 4.054   37.649  1.00 54.08 ? 41   ARG B NH2 1 
ATOM   2055 N N   . ASP B 1 42  ? 33.344 11.634  36.653  1.00 17.11 ? 42   ASP B N   1 
ATOM   2056 C CA  . ASP B 1 42  ? 32.983 12.959  37.143  1.00 14.92 ? 42   ASP B CA  1 
ATOM   2057 C C   . ASP B 1 42  ? 34.243 13.791  37.282  1.00 15.98 ? 42   ASP B C   1 
ATOM   2058 O O   . ASP B 1 42  ? 35.352 13.281  37.130  1.00 17.10 ? 42   ASP B O   1 
ATOM   2059 C CB  . ASP B 1 42  ? 32.342 12.863  38.520  1.00 12.83 ? 42   ASP B CB  1 
ATOM   2060 C CG  . ASP B 1 42  ? 30.963 12.250  38.494  1.00 18.31 ? 42   ASP B CG  1 
ATOM   2061 O OD1 . ASP B 1 42  ? 30.574 11.612  37.488  1.00 13.40 ? 42   ASP B OD1 1 
ATOM   2062 O OD2 . ASP B 1 42  ? 30.248 12.419  39.504  1.00 17.46 ? 42   ASP B OD2 1 
ATOM   2063 N N   . PHE B 1 43  ? 34.068 15.071  37.592  1.00 17.80 ? 43   PHE B N   1 
ATOM   2064 C CA  . PHE B 1 43  ? 35.187 16.004  37.768  1.00 18.82 ? 43   PHE B CA  1 
ATOM   2065 C C   . PHE B 1 43  ? 36.238 15.880  36.650  1.00 22.15 ? 43   PHE B C   1 
ATOM   2066 O O   . PHE B 1 43  ? 37.448 15.720  36.893  1.00 17.00 ? 43   PHE B O   1 
ATOM   2067 C CB  . PHE B 1 43  ? 35.832 15.806  39.146  1.00 14.37 ? 43   PHE B CB  1 
ATOM   2068 C CG  . PHE B 1 43  ? 34.853 15.846  40.285  1.00 13.37 ? 43   PHE B CG  1 
ATOM   2069 C CD1 . PHE B 1 43  ? 34.383 17.061  40.772  1.00 15.17 ? 43   PHE B CD1 1 
ATOM   2070 C CD2 . PHE B 1 43  ? 34.394 14.668  40.863  1.00 13.73 ? 43   PHE B CD2 1 
ATOM   2071 C CE1 . PHE B 1 43  ? 33.467 17.105  41.818  1.00 9.62  ? 43   PHE B CE1 1 
ATOM   2072 C CE2 . PHE B 1 43  ? 33.475 14.701  41.910  1.00 11.16 ? 43   PHE B CE2 1 
ATOM   2073 C CZ  . PHE B 1 43  ? 33.013 15.923  42.386  1.00 13.84 ? 43   PHE B CZ  1 
ATOM   2074 N N   . THR B 1 44  ? 35.760 15.967  35.418  1.00 22.87 ? 44   THR B N   1 
ATOM   2075 C CA  . THR B 1 44  ? 36.619 15.870  34.260  1.00 22.58 ? 44   THR B CA  1 
ATOM   2076 C C   . THR B 1 44  ? 36.335 17.079  33.365  1.00 21.85 ? 44   THR B C   1 
ATOM   2077 O O   . THR B 1 44  ? 35.183 17.438  33.138  1.00 22.01 ? 44   THR B O   1 
ATOM   2078 C CB  . THR B 1 44  ? 36.390 14.534  33.555  1.00 24.59 ? 44   THR B CB  1 
ATOM   2079 O OG1 . THR B 1 44  ? 37.357 14.362  32.511  1.00 40.27 ? 44   THR B OG1 1 
ATOM   2080 C CG2 . THR B 1 44  ? 34.979 14.439  33.037  1.00 25.68 ? 44   THR B CG2 1 
ATOM   2081 N N   . PRO B 1 45  ? 37.391 17.685  32.793  1.00 22.84 ? 45   PRO B N   1 
ATOM   2082 C CA  . PRO B 1 45  ? 37.331 18.869  31.920  1.00 22.76 ? 45   PRO B CA  1 
ATOM   2083 C C   . PRO B 1 45  ? 36.215 19.014  30.867  1.00 19.57 ? 45   PRO B C   1 
ATOM   2084 O O   . PRO B 1 45  ? 35.240 19.729  31.099  1.00 19.07 ? 45   PRO B O   1 
ATOM   2085 C CB  . PRO B 1 45  ? 38.750 18.940  31.326  1.00 22.35 ? 45   PRO B CB  1 
ATOM   2086 C CG  . PRO B 1 45  ? 39.304 17.547  31.532  1.00 20.84 ? 45   PRO B CG  1 
ATOM   2087 C CD  . PRO B 1 45  ? 38.775 17.184  32.879  1.00 22.72 ? 45   PRO B CD  1 
ATOM   2088 N N   . VAL B 1 46  ? 36.364 18.364  29.714  1.00 17.64 ? 46   VAL B N   1 
ATOM   2089 C CA  . VAL B 1 46  ? 35.369 18.475  28.640  1.00 15.40 ? 46   VAL B CA  1 
ATOM   2090 C C   . VAL B 1 46  ? 33.958 18.109  29.089  1.00 15.52 ? 46   VAL B C   1 
ATOM   2091 O O   . VAL B 1 46  ? 33.023 18.845  28.810  1.00 18.32 ? 46   VAL B O   1 
ATOM   2092 C CB  . VAL B 1 46  ? 35.769 17.660  27.368  1.00 12.90 ? 46   VAL B CB  1 
ATOM   2093 C CG1 . VAL B 1 46  ? 34.699 17.761  26.305  1.00 7.11  ? 46   VAL B CG1 1 
ATOM   2094 C CG2 . VAL B 1 46  ? 37.084 18.183  26.800  1.00 7.76  ? 46   VAL B CG2 1 
HETATM 2095 N N   . CSO B 1 47  ? 33.821 17.014  29.831  1.00 14.15 ? 47   CSO B N   1 
HETATM 2096 C CA  . CSO B 1 47  ? 32.517 16.573  30.303  1.00 16.54 ? 47   CSO B CA  1 
HETATM 2097 C CB  . CSO B 1 47  ? 32.630 15.262  31.074  1.00 17.74 ? 47   CSO B CB  1 
HETATM 2098 S SG  . CSO B 1 47  ? 33.151 13.832  30.073  1.00 23.94 ? 47   CSO B SG  1 
HETATM 2099 C C   . CSO B 1 47  ? 31.821 17.633  31.149  1.00 16.86 ? 47   CSO B C   1 
HETATM 2100 O O   . CSO B 1 47  ? 30.600 17.758  31.092  1.00 17.17 ? 47   CSO B O   1 
HETATM 2101 O OD  . CSO B 1 47  ? 34.900 14.411  29.939  1.00 27.67 ? 47   CSO B OD  1 
ATOM   2102 N N   . THR B 1 48  ? 32.601 18.381  31.929  1.00 16.70 ? 48   THR B N   1 
ATOM   2103 C CA  . THR B 1 48  ? 32.076 19.452  32.769  1.00 14.89 ? 48   THR B CA  1 
ATOM   2104 C C   . THR B 1 48  ? 31.545 20.593  31.887  1.00 16.21 ? 48   THR B C   1 
ATOM   2105 O O   . THR B 1 48  ? 30.453 21.128  32.134  1.00 15.24 ? 48   THR B O   1 
ATOM   2106 C CB  . THR B 1 48  ? 33.172 19.994  33.705  1.00 14.14 ? 48   THR B CB  1 
ATOM   2107 O OG1 . THR B 1 48  ? 33.577 18.958  34.616  1.00 17.28 ? 48   THR B OG1 1 
ATOM   2108 C CG2 . THR B 1 48  ? 32.671 21.205  34.482  1.00 16.62 ? 48   THR B CG2 1 
ATOM   2109 N N   . THR B 1 49  ? 32.300 20.956  30.848  1.00 13.55 ? 49   THR B N   1 
ATOM   2110 C CA  . THR B 1 49  ? 31.851 22.025  29.959  1.00 11.50 ? 49   THR B CA  1 
ATOM   2111 C C   . THR B 1 49  ? 30.577 21.600  29.211  1.00 11.66 ? 49   THR B C   1 
ATOM   2112 O O   . THR B 1 49  ? 29.702 22.426  28.962  1.00 13.70 ? 49   THR B O   1 
ATOM   2113 C CB  . THR B 1 49  ? 32.959 22.486  28.940  1.00 14.53 ? 49   THR B CB  1 
ATOM   2114 O OG1 . THR B 1 49  ? 33.297 21.427  28.035  1.00 14.87 ? 49   THR B OG1 1 
ATOM   2115 C CG2 . THR B 1 49  ? 34.227 22.950  29.663  1.00 14.38 ? 49   THR B CG2 1 
ATOM   2116 N N   . GLU B 1 50  ? 30.462 20.310  28.900  1.00 9.35  ? 50   GLU B N   1 
ATOM   2117 C CA  . GLU B 1 50  ? 29.314 19.772  28.169  1.00 10.36 ? 50   GLU B CA  1 
ATOM   2118 C C   . GLU B 1 50  ? 28.031 19.724  28.974  1.00 10.57 ? 50   GLU B C   1 
ATOM   2119 O O   . GLU B 1 50  ? 26.951 19.948  28.439  1.00 10.85 ? 50   GLU B O   1 
ATOM   2120 C CB  . GLU B 1 50  ? 29.631 18.372  27.628  1.00 9.43  ? 50   GLU B CB  1 
ATOM   2121 C CG  . GLU B 1 50  ? 30.724 18.333  26.523  1.00 13.92 ? 50   GLU B CG  1 
ATOM   2122 C CD  . GLU B 1 50  ? 31.140 16.925  26.138  1.00 7.83  ? 50   GLU B CD  1 
ATOM   2123 O OE1 . GLU B 1 50  ? 30.953 15.976  26.926  1.00 15.70 ? 50   GLU B OE1 1 
ATOM   2124 O OE2 . GLU B 1 50  ? 31.660 16.728  25.032  1.00 11.00 ? 50   GLU B OE2 1 
ATOM   2125 N N   . LEU B 1 51  ? 28.142 19.353  30.242  1.00 14.84 ? 51   LEU B N   1 
ATOM   2126 C CA  . LEU B 1 51  ? 26.983 19.285  31.130  1.00 16.27 ? 51   LEU B CA  1 
ATOM   2127 C C   . LEU B 1 51  ? 26.515 20.694  31.528  1.00 14.96 ? 51   LEU B C   1 
ATOM   2128 O O   . LEU B 1 51  ? 25.321 20.919  31.718  1.00 15.59 ? 51   LEU B O   1 
ATOM   2129 C CB  . LEU B 1 51  ? 27.308 18.423  32.353  1.00 14.17 ? 51   LEU B CB  1 
ATOM   2130 C CG  . LEU B 1 51  ? 26.605 17.061  32.434  1.00 21.08 ? 51   LEU B CG  1 
ATOM   2131 C CD1 . LEU B 1 51  ? 26.158 16.518  31.068  1.00 14.39 ? 51   LEU B CD1 1 
ATOM   2132 C CD2 . LEU B 1 51  ? 27.508 16.080  33.164  1.00 18.98 ? 51   LEU B CD2 1 
ATOM   2133 N N   . GLY B 1 52  ? 27.455 21.639  31.624  1.00 15.74 ? 52   GLY B N   1 
ATOM   2134 C CA  . GLY B 1 52  ? 27.112 23.014  31.957  1.00 13.59 ? 52   GLY B CA  1 
ATOM   2135 C C   . GLY B 1 52  ? 26.342 23.646  30.809  1.00 14.25 ? 52   GLY B C   1 
ATOM   2136 O O   . GLY B 1 52  ? 25.397 24.410  31.019  1.00 15.92 ? 52   GLY B O   1 
ATOM   2137 N N   . ARG B 1 53  ? 26.755 23.341  29.583  1.00 11.92 ? 53   ARG B N   1 
ATOM   2138 C CA  . ARG B 1 53  ? 26.080 23.853  28.390  1.00 10.85 ? 53   ARG B CA  1 
ATOM   2139 C C   . ARG B 1 53  ? 24.696 23.197  28.253  1.00 10.33 ? 53   ARG B C   1 
ATOM   2140 O O   . ARG B 1 53  ? 23.714 23.871  27.949  1.00 13.61 ? 53   ARG B O   1 
ATOM   2141 C CB  . ARG B 1 53  ? 26.923 23.576  27.144  1.00 9.89  ? 53   ARG B CB  1 
ATOM   2142 C CG  . ARG B 1 53  ? 26.299 24.063  25.859  1.00 11.52 ? 53   ARG B CG  1 
ATOM   2143 C CD  . ARG B 1 53  ? 26.058 25.552  25.942  1.00 16.58 ? 53   ARG B CD  1 
ATOM   2144 N NE  . ARG B 1 53  ? 25.556 26.102  24.683  1.00 22.54 ? 53   ARG B NE  1 
ATOM   2145 C CZ  . ARG B 1 53  ? 24.838 27.218  24.603  1.00 27.13 ? 53   ARG B CZ  1 
ATOM   2146 N NH1 . ARG B 1 53  ? 24.543 27.901  25.715  1.00 26.04 ? 53   ARG B NH1 1 
ATOM   2147 N NH2 . ARG B 1 53  ? 24.433 27.651  23.416  1.00 26.02 ? 53   ARG B NH2 1 
ATOM   2148 N N   . ALA B 1 54  ? 24.622 21.886  28.481  1.00 10.34 ? 54   ALA B N   1 
ATOM   2149 C CA  . ALA B 1 54  ? 23.358 21.158  28.400  1.00 12.08 ? 54   ALA B CA  1 
ATOM   2150 C C   . ALA B 1 54  ? 22.366 21.711  29.419  1.00 14.64 ? 54   ALA B C   1 
ATOM   2151 O O   . ALA B 1 54  ? 21.171 21.796  29.152  1.00 16.16 ? 54   ALA B O   1 
ATOM   2152 C CB  . ALA B 1 54  ? 23.580 19.669  28.632  1.00 7.50  ? 54   ALA B CB  1 
ATOM   2153 N N   . ALA B 1 55  ? 22.875 22.096  30.583  1.00 14.13 ? 55   ALA B N   1 
ATOM   2154 C CA  . ALA B 1 55  ? 22.054 22.663  31.638  1.00 16.54 ? 55   ALA B CA  1 
ATOM   2155 C C   . ALA B 1 55  ? 21.481 24.017  31.202  1.00 20.38 ? 55   ALA B C   1 
ATOM   2156 O O   . ALA B 1 55  ? 20.305 24.308  31.440  1.00 21.27 ? 55   ALA B O   1 
ATOM   2157 C CB  . ALA B 1 55  ? 22.874 22.813  32.919  1.00 12.86 ? 55   ALA B CB  1 
ATOM   2158 N N   . LYS B 1 56  ? 22.314 24.842  30.572  1.00 22.13 ? 56   LYS B N   1 
ATOM   2159 C CA  . LYS B 1 56  ? 21.884 26.155  30.093  1.00 23.93 ? 56   LYS B CA  1 
ATOM   2160 C C   . LYS B 1 56  ? 20.877 26.014  28.967  1.00 22.34 ? 56   LYS B C   1 
ATOM   2161 O O   . LYS B 1 56  ? 19.952 26.812  28.854  1.00 25.43 ? 56   LYS B O   1 
ATOM   2162 C CB  . LYS B 1 56  ? 23.075 26.972  29.574  1.00 24.40 ? 56   LYS B CB  1 
ATOM   2163 C CG  . LYS B 1 56  ? 24.030 27.505  30.641  1.00 33.96 ? 56   LYS B CG  1 
ATOM   2164 C CD  . LYS B 1 56  ? 23.590 28.834  31.263  1.00 39.35 ? 56   LYS B CD  1 
ATOM   2165 C CE  . LYS B 1 56  ? 22.492 28.670  32.313  1.00 41.87 ? 56   LYS B CE  1 
ATOM   2166 N NZ  . LYS B 1 56  ? 22.860 27.754  33.439  1.00 47.05 ? 56   LYS B NZ  1 
ATOM   2167 N N   . LEU B 1 57  ? 21.071 24.994  28.139  1.00 17.66 ? 57   LEU B N   1 
ATOM   2168 C CA  . LEU B 1 57  ? 20.210 24.745  26.994  1.00 16.69 ? 57   LEU B CA  1 
ATOM   2169 C C   . LEU B 1 57  ? 18.971 23.887  27.282  1.00 13.38 ? 57   LEU B C   1 
ATOM   2170 O O   . LEU B 1 57  ? 18.120 23.708  26.410  1.00 14.26 ? 57   LEU B O   1 
ATOM   2171 C CB  . LEU B 1 57  ? 21.051 24.122  25.882  1.00 16.71 ? 57   LEU B CB  1 
ATOM   2172 C CG  . LEU B 1 57  ? 21.092 24.820  24.527  1.00 17.26 ? 57   LEU B CG  1 
ATOM   2173 C CD1 . LEU B 1 57  ? 21.189 26.298  24.698  1.00 14.51 ? 57   LEU B CD1 1 
ATOM   2174 C CD2 . LEU B 1 57  ? 22.269 24.294  23.735  1.00 18.33 ? 57   LEU B CD2 1 
ATOM   2175 N N   . ALA B 1 58  ? 18.867 23.365  28.503  1.00 12.82 ? 58   ALA B N   1 
ATOM   2176 C CA  . ALA B 1 58  ? 17.740 22.522  28.898  1.00 15.22 ? 58   ALA B CA  1 
ATOM   2177 C C   . ALA B 1 58  ? 16.345 23.036  28.454  1.00 17.50 ? 58   ALA B C   1 
ATOM   2178 O O   . ALA B 1 58  ? 15.559 22.266  27.902  1.00 14.94 ? 58   ALA B O   1 
ATOM   2179 C CB  . ALA B 1 58  ? 17.776 22.252  30.394  1.00 10.50 ? 58   ALA B CB  1 
ATOM   2180 N N   . PRO B 1 59  ? 16.031 24.337  28.670  1.00 18.26 ? 59   PRO B N   1 
ATOM   2181 C CA  . PRO B 1 59  ? 14.742 24.922  28.278  1.00 17.26 ? 59   PRO B CA  1 
ATOM   2182 C C   . PRO B 1 59  ? 14.432 24.813  26.779  1.00 17.65 ? 59   PRO B C   1 
ATOM   2183 O O   . PRO B 1 59  ? 13.273 24.662  26.399  1.00 18.52 ? 59   PRO B O   1 
ATOM   2184 C CB  . PRO B 1 59  ? 14.899 26.384  28.686  1.00 17.15 ? 59   PRO B CB  1 
ATOM   2185 C CG  . PRO B 1 59  ? 15.775 26.310  29.864  1.00 19.90 ? 59   PRO B CG  1 
ATOM   2186 C CD  . PRO B 1 59  ? 16.821 25.328  29.426  1.00 20.31 ? 59   PRO B CD  1 
ATOM   2187 N N   . GLU B 1 60  ? 15.449 24.932  25.928  1.00 16.45 ? 60   GLU B N   1 
ATOM   2188 C CA  . GLU B 1 60  ? 15.230 24.822  24.490  1.00 16.85 ? 60   GLU B CA  1 
ATOM   2189 C C   . GLU B 1 60  ? 14.769 23.433  24.093  1.00 18.09 ? 60   GLU B C   1 
ATOM   2190 O O   . GLU B 1 60  ? 14.012 23.264  23.127  1.00 16.21 ? 60   GLU B O   1 
ATOM   2191 C CB  . GLU B 1 60  ? 16.491 25.178  23.719  1.00 20.37 ? 60   GLU B CB  1 
ATOM   2192 C CG  . GLU B 1 60  ? 16.695 26.662  23.582  1.00 30.87 ? 60   GLU B CG  1 
ATOM   2193 C CD  . GLU B 1 60  ? 15.445 27.369  23.091  1.00 33.55 ? 60   GLU B CD  1 
ATOM   2194 O OE1 . GLU B 1 60  ? 14.982 27.092  21.955  1.00 35.40 ? 60   GLU B OE1 1 
ATOM   2195 O OE2 . GLU B 1 60  ? 14.888 28.182  23.857  1.00 42.94 ? 60   GLU B OE2 1 
ATOM   2196 N N   . PHE B 1 61  ? 15.287 22.434  24.798  1.00 13.93 ? 61   PHE B N   1 
ATOM   2197 C CA  . PHE B 1 61  ? 14.929 21.047  24.553  1.00 16.05 ? 61   PHE B CA  1 
ATOM   2198 C C   . PHE B 1 61  ? 13.559 20.710  25.149  1.00 12.38 ? 61   PHE B C   1 
ATOM   2199 O O   . PHE B 1 61  ? 12.714 20.128  24.478  1.00 13.80 ? 61   PHE B O   1 
ATOM   2200 C CB  . PHE B 1 61  ? 16.020 20.109  25.109  1.00 15.97 ? 61   PHE B CB  1 
ATOM   2201 C CG  . PHE B 1 61  ? 17.306 20.125  24.302  1.00 20.74 ? 61   PHE B CG  1 
ATOM   2202 C CD1 . PHE B 1 61  ? 17.359 19.547  23.032  1.00 22.33 ? 61   PHE B CD1 1 
ATOM   2203 C CD2 . PHE B 1 61  ? 18.452 20.743  24.796  1.00 18.91 ? 61   PHE B CD2 1 
ATOM   2204 C CE1 . PHE B 1 61  ? 18.529 19.586  22.268  1.00 15.41 ? 61   PHE B CE1 1 
ATOM   2205 C CE2 . PHE B 1 61  ? 19.625 20.784  24.033  1.00 17.96 ? 61   PHE B CE2 1 
ATOM   2206 C CZ  . PHE B 1 61  ? 19.660 20.206  22.770  1.00 16.34 ? 61   PHE B CZ  1 
ATOM   2207 N N   . ALA B 1 62  ? 13.322 21.143  26.384  1.00 13.54 ? 62   ALA B N   1 
ATOM   2208 C CA  . ALA B 1 62  ? 12.071 20.878  27.082  1.00 13.42 ? 62   ALA B CA  1 
ATOM   2209 C C   . ALA B 1 62  ? 10.867 21.363  26.296  1.00 14.56 ? 62   ALA B C   1 
ATOM   2210 O O   . ALA B 1 62  ? 9.875  20.645  26.177  1.00 17.40 ? 62   ALA B O   1 
ATOM   2211 C CB  . ALA B 1 62  ? 12.093 21.498  28.475  1.00 12.94 ? 62   ALA B CB  1 
ATOM   2212 N N   . LYS B 1 63  ? 10.952 22.551  25.711  1.00 16.01 ? 63   LYS B N   1 
ATOM   2213 C CA  . LYS B 1 63  ? 9.829  23.043  24.934  1.00 14.57 ? 63   LYS B CA  1 
ATOM   2214 C C   . LYS B 1 63  ? 9.618  22.265  23.639  1.00 16.69 ? 63   LYS B C   1 
ATOM   2215 O O   . LYS B 1 63  ? 8.617  22.459  22.947  1.00 16.49 ? 63   LYS B O   1 
ATOM   2216 C CB  . LYS B 1 63  ? 9.935  24.537  24.675  1.00 14.80 ? 63   LYS B CB  1 
ATOM   2217 C CG  . LYS B 1 63  ? 10.911 25.009  23.630  1.00 14.88 ? 63   LYS B CG  1 
ATOM   2218 C CD  . LYS B 1 63  ? 10.424 26.412  23.273  1.00 23.81 ? 63   LYS B CD  1 
ATOM   2219 C CE  . LYS B 1 63  ? 11.523 27.422  22.990  1.00 33.65 ? 63   LYS B CE  1 
ATOM   2220 N NZ  . LYS B 1 63  ? 11.920 27.503  21.555  1.00 33.97 ? 63   LYS B NZ  1 
ATOM   2221 N N   . ARG B 1 64  ? 10.572 21.406  23.291  1.00 14.62 ? 64   ARG B N   1 
ATOM   2222 C CA  . ARG B 1 64  ? 10.449 20.567  22.103  1.00 13.02 ? 64   ARG B CA  1 
ATOM   2223 C C   . ARG B 1 64  ? 10.097 19.143  22.509  1.00 13.07 ? 64   ARG B C   1 
ATOM   2224 O O   . ARG B 1 64  ? 10.271 18.215  21.734  1.00 15.50 ? 64   ARG B O   1 
ATOM   2225 C CB  . ARG B 1 64  ? 11.732 20.582  21.274  1.00 15.02 ? 64   ARG B CB  1 
ATOM   2226 C CG  . ARG B 1 64  ? 11.909 21.867  20.514  1.00 18.45 ? 64   ARG B CG  1 
ATOM   2227 C CD  . ARG B 1 64  ? 13.228 21.949  19.778  1.00 22.86 ? 64   ARG B CD  1 
ATOM   2228 N NE  . ARG B 1 64  ? 13.247 23.146  18.943  1.00 21.62 ? 64   ARG B NE  1 
ATOM   2229 C CZ  . ARG B 1 64  ? 13.663 24.344  19.349  1.00 27.32 ? 64   ARG B CZ  1 
ATOM   2230 N NH1 . ARG B 1 64  ? 14.120 24.520  20.593  1.00 27.64 ? 64   ARG B NH1 1 
ATOM   2231 N NH2 . ARG B 1 64  ? 13.547 25.388  18.527  1.00 29.48 ? 64   ARG B NH2 1 
ATOM   2232 N N   . ASN B 1 65  ? 9.625  18.980  23.745  1.00 13.93 ? 65   ASN B N   1 
ATOM   2233 C CA  . ASN B 1 65  ? 9.227  17.686  24.282  1.00 12.32 ? 65   ASN B CA  1 
ATOM   2234 C C   . ASN B 1 65  ? 10.405 16.718  24.304  1.00 12.38 ? 65   ASN B C   1 
ATOM   2235 O O   . ASN B 1 65  ? 10.264 15.536  23.983  1.00 14.83 ? 65   ASN B O   1 
ATOM   2236 C CB  . ASN B 1 65  ? 8.068  17.121  23.451  1.00 12.42 ? 65   ASN B CB  1 
ATOM   2237 C CG  . ASN B 1 65  ? 7.411  15.923  24.100  1.00 13.99 ? 65   ASN B CG  1 
ATOM   2238 O OD1 . ASN B 1 65  ? 7.206  15.893  25.322  1.00 18.44 ? 65   ASN B OD1 1 
ATOM   2239 N ND2 . ASN B 1 65  ? 7.071  14.925  23.294  1.00 12.00 ? 65   ASN B ND2 1 
ATOM   2240 N N   . VAL B 1 66  ? 11.569 17.220  24.701  1.00 14.61 ? 66   VAL B N   1 
ATOM   2241 C CA  . VAL B 1 66  ? 12.777 16.404  24.756  1.00 13.34 ? 66   VAL B CA  1 
ATOM   2242 C C   . VAL B 1 66  ? 13.337 16.394  26.169  1.00 16.08 ? 66   VAL B C   1 
ATOM   2243 O O   . VAL B 1 66  ? 13.591 17.456  26.737  1.00 18.21 ? 66   VAL B O   1 
ATOM   2244 C CB  . VAL B 1 66  ? 13.875 16.956  23.821  1.00 10.47 ? 66   VAL B CB  1 
ATOM   2245 C CG1 . VAL B 1 66  ? 15.145 16.137  23.933  1.00 5.84  ? 66   VAL B CG1 1 
ATOM   2246 C CG2 . VAL B 1 66  ? 13.389 16.975  22.405  1.00 12.61 ? 66   VAL B CG2 1 
ATOM   2247 N N   . LYS B 1 67  ? 13.474 15.204  26.754  1.00 16.13 ? 67   LYS B N   1 
ATOM   2248 C CA  . LYS B 1 67  ? 14.039 15.069  28.095  1.00 17.04 ? 67   LYS B CA  1 
ATOM   2249 C C   . LYS B 1 67  ? 15.539 14.742  27.979  1.00 18.90 ? 67   LYS B C   1 
ATOM   2250 O O   . LYS B 1 67  ? 15.976 14.038  27.053  1.00 17.57 ? 67   LYS B O   1 
ATOM   2251 C CB  . LYS B 1 67  ? 13.296 14.001  28.902  1.00 15.25 ? 67   LYS B CB  1 
ATOM   2252 C CG  . LYS B 1 67  ? 11.869 14.399  29.275  1.00 15.77 ? 67   LYS B CG  1 
ATOM   2253 C CD  . LYS B 1 67  ? 11.146 13.282  30.004  1.00 20.40 ? 67   LYS B CD  1 
ATOM   2254 C CE  . LYS B 1 67  ? 9.712  13.672  30.337  1.00 27.89 ? 67   LYS B CE  1 
ATOM   2255 N NZ  . LYS B 1 67  ? 8.893  12.523  30.863  1.00 28.72 ? 67   LYS B NZ  1 
ATOM   2256 N N   . LEU B 1 68  ? 16.321 15.292  28.900  1.00 16.97 ? 68   LEU B N   1 
ATOM   2257 C CA  . LEU B 1 68  ? 17.768 15.106  28.932  1.00 14.40 ? 68   LEU B CA  1 
ATOM   2258 C C   . LEU B 1 68  ? 18.120 14.258  30.147  1.00 13.22 ? 68   LEU B C   1 
ATOM   2259 O O   . LEU B 1 68  ? 17.447 14.320  31.174  1.00 13.14 ? 68   LEU B O   1 
ATOM   2260 C CB  . LEU B 1 68  ? 18.457 16.477  29.048  1.00 13.60 ? 68   LEU B CB  1 
ATOM   2261 C CG  . LEU B 1 68  ? 19.024 17.247  27.850  1.00 19.15 ? 68   LEU B CG  1 
ATOM   2262 C CD1 . LEU B 1 68  ? 18.193 17.084  26.600  1.00 15.70 ? 68   LEU B CD1 1 
ATOM   2263 C CD2 . LEU B 1 68  ? 19.150 18.710  28.236  1.00 17.26 ? 68   LEU B CD2 1 
ATOM   2264 N N   . ILE B 1 69  ? 19.146 13.436  30.019  1.00 9.54  ? 69   ILE B N   1 
ATOM   2265 C CA  . ILE B 1 69  ? 19.589 12.611  31.134  1.00 11.96 ? 69   ILE B CA  1 
ATOM   2266 C C   . ILE B 1 69  ? 21.046 12.229  30.904  1.00 13.35 ? 69   ILE B C   1 
ATOM   2267 O O   . ILE B 1 69  ? 21.442 11.919  29.783  1.00 14.78 ? 69   ILE B O   1 
ATOM   2268 C CB  . ILE B 1 69  ? 18.681 11.362  31.353  1.00 14.00 ? 69   ILE B CB  1 
ATOM   2269 C CG1 . ILE B 1 69  ? 19.072 10.656  32.653  1.00 14.13 ? 69   ILE B CG1 1 
ATOM   2270 C CG2 . ILE B 1 69  ? 18.732 10.412  30.161  1.00 12.29 ? 69   ILE B CG2 1 
ATOM   2271 C CD1 . ILE B 1 69  ? 18.097 9.608   33.080  1.00 15.00 ? 69   ILE B CD1 1 
ATOM   2272 N N   . ALA B 1 70  ? 21.861 12.345  31.945  1.00 16.37 ? 70   ALA B N   1 
ATOM   2273 C CA  . ALA B 1 70  ? 23.281 12.024  31.837  1.00 15.56 ? 70   ALA B CA  1 
ATOM   2274 C C   . ALA B 1 70  ? 23.612 10.765  32.598  1.00 14.32 ? 70   ALA B C   1 
ATOM   2275 O O   . ALA B 1 70  ? 22.912 10.397  33.533  1.00 15.60 ? 70   ALA B O   1 
ATOM   2276 C CB  . ALA B 1 70  ? 24.137 13.183  32.344  1.00 7.20  ? 70   ALA B CB  1 
ATOM   2277 N N   . LEU B 1 71  ? 24.662 10.087  32.156  1.00 17.06 ? 71   LEU B N   1 
ATOM   2278 C CA  . LEU B 1 71  ? 25.147 8.876   32.791  1.00 17.52 ? 71   LEU B CA  1 
ATOM   2279 C C   . LEU B 1 71  ? 26.653 9.067   32.933  1.00 18.08 ? 71   LEU B C   1 
ATOM   2280 O O   . LEU B 1 71  ? 27.300 9.628   32.049  1.00 18.02 ? 71   LEU B O   1 
ATOM   2281 C CB  . LEU B 1 71  ? 24.833 7.647   31.931  1.00 17.32 ? 71   LEU B CB  1 
ATOM   2282 C CG  . LEU B 1 71  ? 25.341 6.279   32.407  1.00 15.39 ? 71   LEU B CG  1 
ATOM   2283 C CD1 . LEU B 1 71  ? 24.505 5.181   31.807  1.00 21.77 ? 71   LEU B CD1 1 
ATOM   2284 C CD2 . LEU B 1 71  ? 26.794 6.075   32.027  1.00 18.40 ? 71   LEU B CD2 1 
ATOM   2285 N N   . SER B 1 72  ? 27.189 8.684   34.082  1.00 16.93 ? 72   SER B N   1 
ATOM   2286 C CA  . SER B 1 72  ? 28.614 8.797   34.328  1.00 17.71 ? 72   SER B CA  1 
ATOM   2287 C C   . SER B 1 72  ? 28.996 7.667   35.250  1.00 18.89 ? 72   SER B C   1 
ATOM   2288 O O   . SER B 1 72  ? 28.216 7.282   36.127  1.00 23.52 ? 72   SER B O   1 
ATOM   2289 C CB  . SER B 1 72  ? 28.979 10.137  34.958  1.00 19.14 ? 72   SER B CB  1 
ATOM   2290 O OG  . SER B 1 72  ? 30.392 10.291  35.001  1.00 16.99 ? 72   SER B OG  1 
ATOM   2291 N N   . ILE B 1 73  ? 30.192 7.134   35.039  1.00 17.65 ? 73   ILE B N   1 
ATOM   2292 C CA  . ILE B 1 73  ? 30.697 6.023   35.821  1.00 16.74 ? 73   ILE B CA  1 
ATOM   2293 C C   . ILE B 1 73  ? 31.361 6.483   37.114  1.00 21.04 ? 73   ILE B C   1 
ATOM   2294 O O   . ILE B 1 73  ? 32.586 6.543   37.221  1.00 23.06 ? 73   ILE B O   1 
ATOM   2295 C CB  . ILE B 1 73  ? 31.602 5.127   34.943  1.00 18.17 ? 73   ILE B CB  1 
ATOM   2296 C CG1 . ILE B 1 73  ? 30.720 4.458   33.887  1.00 21.80 ? 73   ILE B CG1 1 
ATOM   2297 C CG2 . ILE B 1 73  ? 32.289 4.049   35.763  1.00 19.38 ? 73   ILE B CG2 1 
ATOM   2298 C CD1 . ILE B 1 73  ? 31.426 4.036   32.634  1.00 19.31 ? 73   ILE B CD1 1 
ATOM   2299 N N   . ASP B 1 74  ? 30.511 6.854   38.071  1.00 17.59 ? 74   ASP B N   1 
ATOM   2300 C CA  . ASP B 1 74  ? 30.900 7.308   39.411  1.00 19.66 ? 74   ASP B CA  1 
ATOM   2301 C C   . ASP B 1 74  ? 29.649 7.213   40.277  1.00 20.62 ? 74   ASP B C   1 
ATOM   2302 O O   . ASP B 1 74  ? 28.568 6.928   39.757  1.00 20.74 ? 74   ASP B O   1 
ATOM   2303 C CB  . ASP B 1 74  ? 31.436 8.745   39.400  1.00 18.71 ? 74   ASP B CB  1 
ATOM   2304 C CG  . ASP B 1 74  ? 32.965 8.800   39.382  1.00 20.32 ? 74   ASP B CG  1 
ATOM   2305 O OD1 . ASP B 1 74  ? 33.607 7.890   39.943  1.00 25.09 ? 74   ASP B OD1 1 
ATOM   2306 O OD2 . ASP B 1 74  ? 33.530 9.732   38.787  1.00 18.33 ? 74   ASP B OD2 1 
ATOM   2307 N N   . SER B 1 75  ? 29.775 7.441   41.582  1.00 23.78 ? 75   SER B N   1 
ATOM   2308 C CA  . SER B 1 75  ? 28.614 7.331   42.473  1.00 23.52 ? 75   SER B CA  1 
ATOM   2309 C C   . SER B 1 75  ? 27.717 8.565   42.504  1.00 21.89 ? 75   SER B C   1 
ATOM   2310 O O   . SER B 1 75  ? 28.093 9.626   42.009  1.00 22.58 ? 75   SER B O   1 
ATOM   2311 C CB  . SER B 1 75  ? 29.068 6.999   43.890  1.00 26.09 ? 75   SER B CB  1 
ATOM   2312 O OG  . SER B 1 75  ? 29.814 8.065   44.445  1.00 29.87 ? 75   SER B OG  1 
ATOM   2313 N N   . VAL B 1 76  ? 26.533 8.429   43.105  1.00 22.43 ? 76   VAL B N   1 
ATOM   2314 C CA  . VAL B 1 76  ? 25.601 9.546   43.202  1.00 20.99 ? 76   VAL B CA  1 
ATOM   2315 C C   . VAL B 1 76  ? 26.156 10.714  44.018  1.00 19.32 ? 76   VAL B C   1 
ATOM   2316 O O   . VAL B 1 76  ? 25.956 11.869  43.647  1.00 20.62 ? 76   VAL B O   1 
ATOM   2317 C CB  . VAL B 1 76  ? 24.235 9.118   43.768  1.00 23.81 ? 76   VAL B CB  1 
ATOM   2318 C CG1 . VAL B 1 76  ? 23.286 10.298  43.790  1.00 27.07 ? 76   VAL B CG1 1 
ATOM   2319 C CG2 . VAL B 1 76  ? 23.635 8.045   42.919  1.00 25.41 ? 76   VAL B CG2 1 
ATOM   2320 N N   . GLU B 1 77  ? 26.874 10.433  45.104  1.00 22.18 ? 77   GLU B N   1 
ATOM   2321 C CA  . GLU B 1 77  ? 27.440 11.517  45.917  1.00 22.44 ? 77   GLU B CA  1 
ATOM   2322 C C   . GLU B 1 77  ? 28.452 12.330  45.137  1.00 20.62 ? 77   GLU B C   1 
ATOM   2323 O O   . GLU B 1 77  ? 28.488 13.551  45.258  1.00 22.46 ? 77   GLU B O   1 
ATOM   2324 C CB  . GLU B 1 77  ? 28.020 11.009  47.235  1.00 26.16 ? 77   GLU B CB  1 
ATOM   2325 C CG  . GLU B 1 77  ? 26.944 10.661  48.274  1.00 34.00 ? 77   GLU B CG  1 
ATOM   2326 C CD  . GLU B 1 77  ? 25.945 11.810  48.569  1.00 41.28 ? 77   GLU B CD  1 
ATOM   2327 O OE1 . GLU B 1 77  ? 26.353 12.921  48.991  1.00 37.55 ? 77   GLU B OE1 1 
ATOM   2328 O OE2 . GLU B 1 77  ? 24.721 11.593  48.401  1.00 44.30 ? 77   GLU B OE2 1 
ATOM   2329 N N   . ASP B 1 78  ? 29.227 11.662  44.285  1.00 20.96 ? 78   ASP B N   1 
ATOM   2330 C CA  . ASP B 1 78  ? 30.192 12.345  43.432  1.00 19.13 ? 78   ASP B CA  1 
ATOM   2331 C C   . ASP B 1 78  ? 29.401 13.150  42.397  1.00 17.84 ? 78   ASP B C   1 
ATOM   2332 O O   . ASP B 1 78  ? 29.724 14.313  42.108  1.00 16.81 ? 78   ASP B O   1 
ATOM   2333 C CB  . ASP B 1 78  ? 31.110 11.339  42.742  1.00 23.17 ? 78   ASP B CB  1 
ATOM   2334 C CG  . ASP B 1 78  ? 32.220 10.845  43.644  1.00 27.15 ? 78   ASP B CG  1 
ATOM   2335 O OD1 . ASP B 1 78  ? 32.927 11.681  44.250  1.00 32.29 ? 78   ASP B OD1 1 
ATOM   2336 O OD2 . ASP B 1 78  ? 32.397 9.608   43.744  1.00 28.90 ? 78   ASP B OD2 1 
ATOM   2337 N N   . HIS B 1 79  ? 28.332 12.545  41.877  1.00 16.01 ? 79   HIS B N   1 
ATOM   2338 C CA  . HIS B 1 79  ? 27.469 13.228  40.910  1.00 14.20 ? 79   HIS B CA  1 
ATOM   2339 C C   . HIS B 1 79  ? 26.945 14.515  41.525  1.00 15.82 ? 79   HIS B C   1 
ATOM   2340 O O   . HIS B 1 79  ? 26.977 15.557  40.878  1.00 17.68 ? 79   HIS B O   1 
ATOM   2341 C CB  . HIS B 1 79  ? 26.269 12.371  40.508  1.00 14.39 ? 79   HIS B CB  1 
ATOM   2342 C CG  . HIS B 1 79  ? 26.610 11.210  39.633  1.00 14.21 ? 79   HIS B CG  1 
ATOM   2343 N ND1 . HIS B 1 79  ? 27.845 11.044  39.048  1.00 13.98 ? 79   HIS B ND1 1 
ATOM   2344 C CD2 . HIS B 1 79  ? 25.864 10.154  39.237  1.00 12.58 ? 79   HIS B CD2 1 
ATOM   2345 C CE1 . HIS B 1 79  ? 27.849 9.939   38.330  1.00 10.01 ? 79   HIS B CE1 1 
ATOM   2346 N NE2 . HIS B 1 79  ? 26.658 9.379   38.427  1.00 15.64 ? 79   HIS B NE2 1 
ATOM   2347 N N   . LEU B 1 80  ? 26.460 14.429  42.771  1.00 16.29 ? 80   LEU B N   1 
ATOM   2348 C CA  . LEU B 1 80  ? 25.925 15.594  43.482  1.00 17.47 ? 80   LEU B CA  1 
ATOM   2349 C C   . LEU B 1 80  ? 26.976 16.679  43.696  1.00 18.31 ? 80   LEU B C   1 
ATOM   2350 O O   . LEU B 1 80  ? 26.700 17.862  43.487  1.00 19.78 ? 80   LEU B O   1 
ATOM   2351 C CB  . LEU B 1 80  ? 25.317 15.174  44.821  1.00 18.96 ? 80   LEU B CB  1 
ATOM   2352 C CG  . LEU B 1 80  ? 24.045 14.334  44.710  1.00 19.29 ? 80   LEU B CG  1 
ATOM   2353 C CD1 . LEU B 1 80  ? 23.636 13.840  46.076  1.00 22.30 ? 80   LEU B CD1 1 
ATOM   2354 C CD2 . LEU B 1 80  ? 22.936 15.161  44.089  1.00 17.70 ? 80   LEU B CD2 1 
ATOM   2355 N N   . ALA B 1 81  ? 28.179 16.275  44.106  1.00 18.94 ? 81   ALA B N   1 
ATOM   2356 C CA  . ALA B 1 81  ? 29.277 17.211  44.326  1.00 17.78 ? 81   ALA B CA  1 
ATOM   2357 C C   . ALA B 1 81  ? 29.706 17.832  42.994  1.00 20.01 ? 81   ALA B C   1 
ATOM   2358 O O   . ALA B 1 81  ? 29.899 19.043  42.889  1.00 22.36 ? 81   ALA B O   1 
ATOM   2359 C CB  . ALA B 1 81  ? 30.446 16.500  44.978  1.00 17.95 ? 81   ALA B CB  1 
ATOM   2360 N N   . TRP B 1 82  ? 29.782 17.006  41.956  1.00 21.27 ? 82   TRP B N   1 
ATOM   2361 C CA  . TRP B 1 82  ? 30.167 17.477  40.628  1.00 20.12 ? 82   TRP B CA  1 
ATOM   2362 C C   . TRP B 1 82  ? 29.185 18.542  40.111  1.00 20.49 ? 82   TRP B C   1 
ATOM   2363 O O   . TRP B 1 82  ? 29.582 19.451  39.369  1.00 21.10 ? 82   TRP B O   1 
ATOM   2364 C CB  . TRP B 1 82  ? 30.249 16.296  39.659  1.00 16.68 ? 82   TRP B CB  1 
ATOM   2365 C CG  . TRP B 1 82  ? 30.896 16.608  38.320  1.00 16.79 ? 82   TRP B CG  1 
ATOM   2366 C CD1 . TRP B 1 82  ? 31.774 17.618  38.036  1.00 12.48 ? 82   TRP B CD1 1 
ATOM   2367 C CD2 . TRP B 1 82  ? 30.734 15.866  37.106  1.00 17.32 ? 82   TRP B CD2 1 
ATOM   2368 N NE1 . TRP B 1 82  ? 32.175 17.544  36.719  1.00 14.82 ? 82   TRP B NE1 1 
ATOM   2369 C CE2 . TRP B 1 82  ? 31.552 16.476  36.127  1.00 16.13 ? 82   TRP B CE2 1 
ATOM   2370 C CE3 . TRP B 1 82  ? 29.978 14.734  36.752  1.00 19.64 ? 82   TRP B CE3 1 
ATOM   2371 C CZ2 . TRP B 1 82  ? 31.638 15.992  34.815  1.00 13.68 ? 82   TRP B CZ2 1 
ATOM   2372 C CZ3 . TRP B 1 82  ? 30.069 14.254  35.439  1.00 20.41 ? 82   TRP B CZ3 1 
ATOM   2373 C CH2 . TRP B 1 82  ? 30.894 14.886  34.494  1.00 14.11 ? 82   TRP B CH2 1 
ATOM   2374 N N   . SER B 1 83  ? 27.917 18.446  40.517  1.00 21.33 ? 83   SER B N   1 
ATOM   2375 C CA  . SER B 1 83  ? 26.890 19.411  40.110  1.00 18.28 ? 83   SER B CA  1 
ATOM   2376 C C   . SER B 1 83  ? 27.153 20.819  40.621  1.00 16.38 ? 83   SER B C   1 
ATOM   2377 O O   . SER B 1 83  ? 26.798 21.793  39.960  1.00 18.04 ? 83   SER B O   1 
ATOM   2378 C CB  . SER B 1 83  ? 25.502 18.942  40.540  1.00 13.66 ? 83   SER B CB  1 
ATOM   2379 O OG  . SER B 1 83  ? 25.174 17.758  39.844  1.00 18.04 ? 83   SER B OG  1 
ATOM   2380 N N   . LYS B 1 84  ? 27.805 20.947  41.772  1.00 18.50 ? 84   LYS B N   1 
ATOM   2381 C CA  . LYS B 1 84  ? 28.111 22.278  42.297  1.00 16.06 ? 84   LYS B CA  1 
ATOM   2382 C C   . LYS B 1 84  ? 29.165 22.917  41.400  1.00 17.73 ? 84   LYS B C   1 
ATOM   2383 O O   . LYS B 1 84  ? 29.146 24.126  41.170  1.00 22.09 ? 84   LYS B O   1 
ATOM   2384 C CB  . LYS B 1 84  ? 28.633 22.192  43.727  1.00 15.43 ? 84   LYS B CB  1 
ATOM   2385 C CG  . LYS B 1 84  ? 27.795 21.328  44.644  1.00 15.37 ? 84   LYS B CG  1 
ATOM   2386 C CD  . LYS B 1 84  ? 27.948 21.777  46.081  1.00 22.43 ? 84   LYS B CD  1 
ATOM   2387 C CE  . LYS B 1 84  ? 29.410 21.937  46.466  1.00 31.33 ? 84   LYS B CE  1 
ATOM   2388 N NZ  . LYS B 1 84  ? 29.567 22.557  47.826  1.00 35.99 ? 84   LYS B NZ  1 
ATOM   2389 N N   . ASP B 1 85  ? 30.099 22.098  40.919  1.00 22.16 ? 85   ASP B N   1 
ATOM   2390 C CA  . ASP B 1 85  ? 31.160 22.543  40.011  1.00 21.91 ? 85   ASP B CA  1 
ATOM   2391 C C   . ASP B 1 85  ? 30.538 22.981  38.689  1.00 18.83 ? 85   ASP B C   1 
ATOM   2392 O O   . ASP B 1 85  ? 30.836 24.069  38.193  1.00 21.70 ? 85   ASP B O   1 
ATOM   2393 C CB  . ASP B 1 85  ? 32.189 21.419  39.779  1.00 20.71 ? 85   ASP B CB  1 
ATOM   2394 C CG  . ASP B 1 85  ? 33.222 21.321  40.901  1.00 23.57 ? 85   ASP B CG  1 
ATOM   2395 O OD1 . ASP B 1 85  ? 33.093 22.039  41.920  1.00 18.61 ? 85   ASP B OD1 1 
ATOM   2396 O OD2 . ASP B 1 85  ? 34.185 20.538  40.752  1.00 20.19 ? 85   ASP B OD2 1 
ATOM   2397 N N   . ILE B 1 86  ? 29.657 22.142  38.139  1.00 18.77 ? 86   ILE B N   1 
ATOM   2398 C CA  . ILE B 1 86  ? 28.939 22.439  36.893  1.00 16.66 ? 86   ILE B CA  1 
ATOM   2399 C C   . ILE B 1 86  ? 28.163 23.765  37.035  1.00 15.87 ? 86   ILE B C   1 
ATOM   2400 O O   . ILE B 1 86  ? 28.208 24.633  36.155  1.00 16.67 ? 86   ILE B O   1 
ATOM   2401 C CB  . ILE B 1 86  ? 27.946 21.305  36.540  1.00 21.15 ? 86   ILE B CB  1 
ATOM   2402 C CG1 . ILE B 1 86  ? 28.694 19.971  36.374  1.00 17.34 ? 86   ILE B CG1 1 
ATOM   2403 C CG2 . ILE B 1 86  ? 27.170 21.670  35.280  1.00 17.99 ? 86   ILE B CG2 1 
ATOM   2404 C CD1 . ILE B 1 86  ? 27.787 18.740  36.221  1.00 12.64 ? 86   ILE B CD1 1 
ATOM   2405 N N   . ASN B 1 87  ? 27.458 23.915  38.154  1.00 15.98 ? 87   ASN B N   1 
ATOM   2406 C CA  . ASN B 1 87  ? 26.708 25.135  38.441  1.00 16.50 ? 87   ASN B CA  1 
ATOM   2407 C C   . ASN B 1 87  ? 27.646 26.326  38.496  1.00 17.28 ? 87   ASN B C   1 
ATOM   2408 O O   . ASN B 1 87  ? 27.359 27.359  37.896  1.00 17.09 ? 87   ASN B O   1 
ATOM   2409 C CB  . ASN B 1 87  ? 25.945 25.027  39.773  1.00 16.06 ? 87   ASN B CB  1 
ATOM   2410 C CG  . ASN B 1 87  ? 24.605 24.314  39.624  1.00 16.73 ? 87   ASN B CG  1 
ATOM   2411 O OD1 . ASN B 1 87  ? 24.207 23.516  40.475  1.00 19.62 ? 87   ASN B OD1 1 
ATOM   2412 N ND2 . ASN B 1 87  ? 23.906 24.599  38.539  1.00 13.07 ? 87   ASN B ND2 1 
ATOM   2413 N N   . ALA B 1 88  ? 28.775 26.163  39.191  1.00 19.92 ? 88   ALA B N   1 
ATOM   2414 C CA  . ALA B 1 88  ? 29.786 27.215  39.340  1.00 21.16 ? 88   ALA B CA  1 
ATOM   2415 C C   . ALA B 1 88  ? 30.439 27.584  38.010  1.00 19.62 ? 88   ALA B C   1 
ATOM   2416 O O   . ALA B 1 88  ? 30.761 28.748  37.764  1.00 20.63 ? 88   ALA B O   1 
ATOM   2417 C CB  . ALA B 1 88  ? 30.833 26.799  40.340  1.00 21.55 ? 88   ALA B CB  1 
ATOM   2418 N N   . TYR B 1 89  ? 30.639 26.592  37.154  1.00 18.80 ? 89   TYR B N   1 
ATOM   2419 C CA  . TYR B 1 89  ? 31.210 26.836  35.841  1.00 21.23 ? 89   TYR B CA  1 
ATOM   2420 C C   . TYR B 1 89  ? 30.233 27.732  35.047  1.00 19.82 ? 89   TYR B C   1 
ATOM   2421 O O   . TYR B 1 89  ? 30.648 28.621  34.307  1.00 18.60 ? 89   TYR B O   1 
ATOM   2422 C CB  . TYR B 1 89  ? 31.458 25.497  35.129  1.00 22.02 ? 89   TYR B CB  1 
ATOM   2423 C CG  . TYR B 1 89  ? 31.637 25.610  33.631  1.00 23.48 ? 89   TYR B CG  1 
ATOM   2424 C CD1 . TYR B 1 89  ? 32.884 25.901  33.073  1.00 18.93 ? 89   TYR B CD1 1 
ATOM   2425 C CD2 . TYR B 1 89  ? 30.552 25.422  32.769  1.00 19.57 ? 89   TYR B CD2 1 
ATOM   2426 C CE1 . TYR B 1 89  ? 33.046 26.002  31.688  1.00 20.71 ? 89   TYR B CE1 1 
ATOM   2427 C CE2 . TYR B 1 89  ? 30.703 25.517  31.394  1.00 21.92 ? 89   TYR B CE2 1 
ATOM   2428 C CZ  . TYR B 1 89  ? 31.947 25.807  30.855  1.00 19.55 ? 89   TYR B CZ  1 
ATOM   2429 O OH  . TYR B 1 89  ? 32.078 25.887  29.484  1.00 21.79 ? 89   TYR B OH  1 
ATOM   2430 N N   . ASN B 1 90  ? 28.933 27.510  35.238  1.00 20.50 ? 90   ASN B N   1 
ATOM   2431 C CA  . ASN B 1 90  ? 27.898 28.296  34.561  1.00 22.78 ? 90   ASN B CA  1 
ATOM   2432 C C   . ASN B 1 90  ? 27.679 29.667  35.204  1.00 26.17 ? 90   ASN B C   1 
ATOM   2433 O O   . ASN B 1 90  ? 26.830 30.439  34.749  1.00 24.85 ? 90   ASN B O   1 
ATOM   2434 C CB  . ASN B 1 90  ? 26.560 27.541  34.550  1.00 20.82 ? 90   ASN B CB  1 
ATOM   2435 C CG  . ASN B 1 90  ? 26.451 26.529  33.419  1.00 14.71 ? 90   ASN B CG  1 
ATOM   2436 O OD1 . ASN B 1 90  ? 25.734 25.541  33.545  1.00 21.44 ? 90   ASN B OD1 1 
ATOM   2437 N ND2 . ASN B 1 90  ? 27.106 26.795  32.298  1.00 14.52 ? 90   ASN B ND2 1 
ATOM   2438 N N   . SER B 1 91  ? 28.469 29.969  36.233  1.00 31.40 ? 91   SER B N   1 
ATOM   2439 C CA  . SER B 1 91  ? 28.381 31.224  36.970  1.00 34.02 ? 91   SER B CA  1 
ATOM   2440 C C   . SER B 1 91  ? 27.040 31.269  37.676  1.00 34.43 ? 91   SER B C   1 
ATOM   2441 O O   . SER B 1 91  ? 26.370 32.298  37.707  1.00 35.63 ? 91   SER B O   1 
ATOM   2442 C CB  . SER B 1 91  ? 28.540 32.428  36.035  1.00 37.02 ? 91   SER B CB  1 
ATOM   2443 O OG  . SER B 1 91  ? 29.763 32.369  35.315  1.00 44.18 ? 91   SER B OG  1 
ATOM   2444 N N   . GLU B 1 92  ? 26.641 30.127  38.215  1.00 34.52 ? 92   GLU B N   1 
ATOM   2445 C CA  . GLU B 1 92  ? 25.380 30.022  38.928  1.00 38.01 ? 92   GLU B CA  1 
ATOM   2446 C C   . GLU B 1 92  ? 25.639 29.651  40.378  1.00 36.67 ? 92   GLU B C   1 
ATOM   2447 O O   . GLU B 1 92  ? 26.761 29.301  40.751  1.00 39.11 ? 92   GLU B O   1 
ATOM   2448 C CB  . GLU B 1 92  ? 24.498 28.945  38.286  1.00 40.32 ? 92   GLU B CB  1 
ATOM   2449 C CG  . GLU B 1 92  ? 23.220 29.456  37.655  1.00 48.25 ? 92   GLU B CG  1 
ATOM   2450 C CD  . GLU B 1 92  ? 23.406 29.888  36.220  1.00 53.60 ? 92   GLU B CD  1 
ATOM   2451 O OE1 . GLU B 1 92  ? 24.022 29.121  35.454  1.00 60.48 ? 92   GLU B OE1 1 
ATOM   2452 O OE2 . GLU B 1 92  ? 22.901 30.969  35.843  1.00 57.99 ? 92   GLU B OE2 1 
ATOM   2453 N N   . GLU B 1 93  ? 24.589 29.701  41.187  1.00 36.21 ? 93   GLU B N   1 
ATOM   2454 C CA  . GLU B 1 93  ? 24.689 29.338  42.586  1.00 38.49 ? 93   GLU B CA  1 
ATOM   2455 C C   . GLU B 1 93  ? 25.159 27.882  42.589  1.00 36.53 ? 93   GLU B C   1 
ATOM   2456 O O   . GLU B 1 93  ? 24.536 27.021  41.966  1.00 34.06 ? 93   GLU B O   1 
ATOM   2457 C CB  . GLU B 1 93  ? 23.308 29.445  43.232  1.00 41.06 ? 93   GLU B CB  1 
ATOM   2458 C CG  . GLU B 1 93  ? 23.290 30.058  44.612  1.00 49.73 ? 93   GLU B CG  1 
ATOM   2459 C CD  . GLU B 1 93  ? 21.974 29.790  45.334  1.00 58.25 ? 93   GLU B CD  1 
ATOM   2460 O OE1 . GLU B 1 93  ? 20.904 30.169  44.801  1.00 61.04 ? 93   GLU B OE1 1 
ATOM   2461 O OE2 . GLU B 1 93  ? 22.022 29.189  46.430  1.00 59.37 ? 93   GLU B OE2 1 
ATOM   2462 N N   . PRO B 1 94  ? 26.300 27.602  43.232  1.00 34.45 ? 94   PRO B N   1 
ATOM   2463 C CA  . PRO B 1 94  ? 26.855 26.249  43.301  1.00 30.72 ? 94   PRO B CA  1 
ATOM   2464 C C   . PRO B 1 94  ? 26.020 25.309  44.148  1.00 28.61 ? 94   PRO B C   1 
ATOM   2465 O O   . PRO B 1 94  ? 26.404 24.944  45.258  1.00 32.49 ? 94   PRO B O   1 
ATOM   2466 C CB  . PRO B 1 94  ? 28.240 26.482  43.901  1.00 32.53 ? 94   PRO B CB  1 
ATOM   2467 C CG  . PRO B 1 94  ? 28.006 27.639  44.799  1.00 35.29 ? 94   PRO B CG  1 
ATOM   2468 C CD  . PRO B 1 94  ? 27.164 28.556  43.942  1.00 35.57 ? 94   PRO B CD  1 
ATOM   2469 N N   . THR B 1 95  ? 24.884 24.911  43.595  1.00 27.01 ? 95   THR B N   1 
ATOM   2470 C CA  . THR B 1 95  ? 23.948 24.007  44.244  1.00 26.57 ? 95   THR B CA  1 
ATOM   2471 C C   . THR B 1 95  ? 24.151 22.582  43.704  1.00 24.64 ? 95   THR B C   1 
ATOM   2472 O O   . THR B 1 95  ? 24.879 22.373  42.734  1.00 22.97 ? 95   THR B O   1 
ATOM   2473 C CB  . THR B 1 95  ? 22.507 24.447  43.926  1.00 28.73 ? 95   THR B CB  1 
ATOM   2474 O OG1 . THR B 1 95  ? 22.357 25.834  44.238  1.00 37.81 ? 95   THR B OG1 1 
ATOM   2475 C CG2 . THR B 1 95  ? 21.495 23.643  44.728  1.00 36.36 ? 95   THR B CG2 1 
ATOM   2476 N N   . GLU B 1 96  ? 23.532 21.599  44.350  1.00 23.61 ? 96   GLU B N   1 
ATOM   2477 C CA  . GLU B 1 96  ? 23.626 20.224  43.892  1.00 27.97 ? 96   GLU B CA  1 
ATOM   2478 C C   . GLU B 1 96  ? 22.448 19.918  42.960  1.00 29.34 ? 96   GLU B C   1 
ATOM   2479 O O   . GLU B 1 96  ? 22.254 18.776  42.560  1.00 31.72 ? 96   GLU B O   1 
ATOM   2480 C CB  . GLU B 1 96  ? 23.591 19.247  45.065  1.00 29.99 ? 96   GLU B CB  1 
ATOM   2481 C CG  . GLU B 1 96  ? 24.700 19.398  46.091  1.00 36.56 ? 96   GLU B CG  1 
ATOM   2482 C CD  . GLU B 1 96  ? 24.615 18.349  47.194  1.00 40.01 ? 96   GLU B CD  1 
ATOM   2483 O OE1 . GLU B 1 96  ? 23.499 17.862  47.480  1.00 43.37 ? 96   GLU B OE1 1 
ATOM   2484 O OE2 . GLU B 1 96  ? 25.662 17.994  47.779  1.00 43.03 ? 96   GLU B OE2 1 
ATOM   2485 N N   . LYS B 1 97  ? 21.646 20.925  42.630  1.00 26.21 ? 97   LYS B N   1 
ATOM   2486 C CA  . LYS B 1 97  ? 20.508 20.690  41.758  1.00 25.36 ? 97   LYS B CA  1 
ATOM   2487 C C   . LYS B 1 97  ? 20.805 21.037  40.292  1.00 21.41 ? 97   LYS B C   1 
ATOM   2488 O O   . LYS B 1 97  ? 21.350 22.100  39.994  1.00 20.39 ? 97   LYS B O   1 
ATOM   2489 C CB  . LYS B 1 97  ? 19.286 21.454  42.283  1.00 29.78 ? 97   LYS B CB  1 
ATOM   2490 C CG  . LYS B 1 97  ? 17.973 20.937  41.722  1.00 44.47 ? 97   LYS B CG  1 
ATOM   2491 C CD  . LYS B 1 97  ? 16.772 21.299  42.595  1.00 53.39 ? 97   LYS B CD  1 
ATOM   2492 C CE  . LYS B 1 97  ? 15.545 20.432  42.260  1.00 58.39 ? 97   LYS B CE  1 
ATOM   2493 N NZ  . LYS B 1 97  ? 15.251 20.338  40.792  1.00 61.22 ? 97   LYS B NZ  1 
ATOM   2494 N N   . LEU B 1 98  ? 20.477 20.119  39.388  1.00 20.62 ? 98   LEU B N   1 
ATOM   2495 C CA  . LEU B 1 98  ? 20.690 20.309  37.951  1.00 20.10 ? 98   LEU B CA  1 
ATOM   2496 C C   . LEU B 1 98  ? 19.325 20.135  37.285  1.00 22.22 ? 98   LEU B C   1 
ATOM   2497 O O   . LEU B 1 98  ? 18.401 19.590  37.891  1.00 26.62 ? 98   LEU B O   1 
ATOM   2498 C CB  . LEU B 1 98  ? 21.663 19.251  37.421  1.00 17.05 ? 98   LEU B CB  1 
ATOM   2499 C CG  . LEU B 1 98  ? 22.908 19.632  36.610  1.00 20.88 ? 98   LEU B CG  1 
ATOM   2500 C CD1 . LEU B 1 98  ? 23.766 20.644  37.333  1.00 14.81 ? 98   LEU B CD1 1 
ATOM   2501 C CD2 . LEU B 1 98  ? 23.709 18.378  36.335  1.00 19.63 ? 98   LEU B CD2 1 
ATOM   2502 N N   . PRO B 1 99  ? 19.149 20.661  36.062  1.00 20.60 ? 99   PRO B N   1 
ATOM   2503 C CA  . PRO B 1 99  ? 17.851 20.505  35.399  1.00 18.84 ? 99   PRO B CA  1 
ATOM   2504 C C   . PRO B 1 99  ? 17.550 19.115  34.822  1.00 19.06 ? 99   PRO B C   1 
ATOM   2505 O O   . PRO B 1 99  ? 16.519 18.921  34.188  1.00 21.70 ? 99   PRO B O   1 
ATOM   2506 C CB  . PRO B 1 99  ? 17.880 21.588  34.319  1.00 20.15 ? 99   PRO B CB  1 
ATOM   2507 C CG  . PRO B 1 99  ? 19.319 21.719  34.004  1.00 21.34 ? 99   PRO B CG  1 
ATOM   2508 C CD  . PRO B 1 99  ? 19.973 21.663  35.365  1.00 17.28 ? 99   PRO B CD  1 
ATOM   2509 N N   . PHE B 1 100 ? 18.438 18.153  35.043  1.00 16.09 ? 100  PHE B N   1 
ATOM   2510 C CA  . PHE B 1 100 ? 18.242 16.795  34.557  1.00 13.54 ? 100  PHE B CA  1 
ATOM   2511 C C   . PHE B 1 100 ? 19.030 15.904  35.493  1.00 14.74 ? 100  PHE B C   1 
ATOM   2512 O O   . PHE B 1 100 ? 19.973 16.380  36.139  1.00 13.97 ? 100  PHE B O   1 
ATOM   2513 C CB  . PHE B 1 100 ? 18.745 16.650  33.109  1.00 13.95 ? 100  PHE B CB  1 
ATOM   2514 C CG  . PHE B 1 100 ? 20.128 17.170  32.893  1.00 10.39 ? 100  PHE B CG  1 
ATOM   2515 C CD1 . PHE B 1 100 ? 21.238 16.404  33.230  1.00 15.29 ? 100  PHE B CD1 1 
ATOM   2516 C CD2 . PHE B 1 100 ? 20.321 18.441  32.381  1.00 13.30 ? 100  PHE B CD2 1 
ATOM   2517 C CE1 . PHE B 1 100 ? 22.520 16.907  33.063  1.00 17.24 ? 100  PHE B CE1 1 
ATOM   2518 C CE2 . PHE B 1 100 ? 21.598 18.952  32.211  1.00 16.56 ? 100  PHE B CE2 1 
ATOM   2519 C CZ  . PHE B 1 100 ? 22.700 18.187  32.553  1.00 15.81 ? 100  PHE B CZ  1 
ATOM   2520 N N   . PRO B 1 101 ? 18.673 14.605  35.568  1.00 15.95 ? 101  PRO B N   1 
ATOM   2521 C CA  . PRO B 1 101 ? 19.360 13.646  36.442  1.00 15.92 ? 101  PRO B CA  1 
ATOM   2522 C C   . PRO B 1 101 ? 20.672 13.144  35.863  1.00 16.57 ? 101  PRO B C   1 
ATOM   2523 O O   . PRO B 1 101 ? 20.954 13.293  34.674  1.00 19.77 ? 101  PRO B O   1 
ATOM   2524 C CB  . PRO B 1 101 ? 18.370 12.467  36.528  1.00 15.99 ? 101  PRO B CB  1 
ATOM   2525 C CG  . PRO B 1 101 ? 17.087 12.961  35.872  1.00 16.69 ? 101  PRO B CG  1 
ATOM   2526 C CD  . PRO B 1 101 ? 17.572 13.940  34.847  1.00 16.41 ? 101  PRO B CD  1 
ATOM   2527 N N   . ILE B 1 102 ? 21.473 12.540  36.725  1.00 17.38 ? 102  ILE B N   1 
ATOM   2528 C CA  . ILE B 1 102 ? 22.735 11.941  36.320  1.00 15.53 ? 102  ILE B CA  1 
ATOM   2529 C C   . ILE B 1 102 ? 22.684 10.550  36.932  1.00 15.14 ? 102  ILE B C   1 
ATOM   2530 O O   . ILE B 1 102 ? 22.556 10.416  38.150  1.00 16.35 ? 102  ILE B O   1 
ATOM   2531 C CB  . ILE B 1 102 ? 23.961 12.698  36.864  1.00 10.60 ? 102  ILE B CB  1 
ATOM   2532 C CG1 . ILE B 1 102 ? 23.886 14.175  36.483  1.00 10.63 ? 102  ILE B CG1 1 
ATOM   2533 C CG2 . ILE B 1 102 ? 25.247 12.110  36.262  1.00 12.13 ? 102  ILE B CG2 1 
ATOM   2534 C CD1 . ILE B 1 102 ? 25.085 14.958  36.920  1.00 11.41 ? 102  ILE B CD1 1 
ATOM   2535 N N   . ILE B 1 103 ? 22.701 9.525   36.085  1.00 15.91 ? 103  ILE B N   1 
ATOM   2536 C CA  . ILE B 1 103 ? 22.644 8.133   36.522  1.00 15.64 ? 103  ILE B CA  1 
ATOM   2537 C C   . ILE B 1 103 ? 23.972 7.656   37.113  1.00 16.34 ? 103  ILE B C   1 
ATOM   2538 O O   . ILE B 1 103 ? 25.050 7.993   36.609  1.00 18.46 ? 103  ILE B O   1 
ATOM   2539 C CB  . ILE B 1 103 ? 22.269 7.195   35.350  1.00 15.90 ? 103  ILE B CB  1 
ATOM   2540 C CG1 . ILE B 1 103 ? 20.984 7.670   34.668  1.00 16.93 ? 103  ILE B CG1 1 
ATOM   2541 C CG2 . ILE B 1 103 ? 22.075 5.782   35.837  1.00 11.83 ? 103  ILE B CG2 1 
ATOM   2542 C CD1 . ILE B 1 103 ? 20.723 6.986   33.334  1.00 13.80 ? 103  ILE B CD1 1 
ATOM   2543 N N   . ASP B 1 104 ? 23.868 6.905   38.205  1.00 18.19 ? 104  ASP B N   1 
ATOM   2544 C CA  . ASP B 1 104 ? 24.992 6.312   38.919  1.00 19.20 ? 104  ASP B CA  1 
ATOM   2545 C C   . ASP B 1 104 ? 25.301 4.988   38.208  1.00 17.32 ? 104  ASP B C   1 
ATOM   2546 O O   . ASP B 1 104 ? 24.439 4.118   38.120  1.00 19.56 ? 104  ASP B O   1 
ATOM   2547 C CB  . ASP B 1 104 ? 24.566 6.048   40.381  1.00 21.08 ? 104  ASP B CB  1 
ATOM   2548 C CG  . ASP B 1 104 ? 25.638 5.346   41.226  1.00 22.97 ? 104  ASP B CG  1 
ATOM   2549 O OD1 . ASP B 1 104 ? 26.544 4.670   40.699  1.00 23.96 ? 104  ASP B OD1 1 
ATOM   2550 O OD2 . ASP B 1 104 ? 25.576 5.472   42.466  1.00 26.23 ? 104  ASP B OD2 1 
ATOM   2551 N N   . ASP B 1 105 ? 26.492 4.876   37.629  1.00 15.43 ? 105  ASP B N   1 
ATOM   2552 C CA  . ASP B 1 105 ? 26.887 3.638   36.958  1.00 19.78 ? 105  ASP B CA  1 
ATOM   2553 C C   . ASP B 1 105 ? 28.315 3.315   37.384  1.00 23.97 ? 105  ASP B C   1 
ATOM   2554 O O   . ASP B 1 105 ? 29.170 2.931   36.571  1.00 26.00 ? 105  ASP B O   1 
ATOM   2555 C CB  . ASP B 1 105 ? 26.792 3.771   35.436  1.00 14.27 ? 105  ASP B CB  1 
ATOM   2556 C CG  . ASP B 1 105 ? 26.868 2.434   34.725  1.00 19.96 ? 105  ASP B CG  1 
ATOM   2557 O OD1 . ASP B 1 105 ? 26.520 1.394   35.319  1.00 17.08 ? 105  ASP B OD1 1 
ATOM   2558 O OD2 . ASP B 1 105 ? 27.262 2.407   33.543  1.00 23.12 ? 105  ASP B OD2 1 
ATOM   2559 N N   . ARG B 1 106 ? 28.582 3.493   38.676  1.00 27.35 ? 106  ARG B N   1 
ATOM   2560 C CA  . ARG B 1 106 ? 29.912 3.231   39.209  1.00 29.49 ? 106  ARG B CA  1 
ATOM   2561 C C   . ARG B 1 106 ? 30.267 1.766   39.070  1.00 26.13 ? 106  ARG B C   1 
ATOM   2562 O O   . ARG B 1 106 ? 31.441 1.416   39.079  1.00 28.62 ? 106  ARG B O   1 
ATOM   2563 C CB  . ARG B 1 106 ? 30.041 3.714   40.668  1.00 33.75 ? 106  ARG B CB  1 
ATOM   2564 C CG  . ARG B 1 106 ? 30.045 2.630   41.732  1.00 45.37 ? 106  ARG B CG  1 
ATOM   2565 C CD  . ARG B 1 106 ? 28.661 2.382   42.293  1.00 53.37 ? 106  ARG B CD  1 
ATOM   2566 N NE  . ARG B 1 106 ? 28.270 3.424   43.239  1.00 58.45 ? 106  ARG B NE  1 
ATOM   2567 C CZ  . ARG B 1 106 ? 27.178 3.371   43.995  1.00 60.68 ? 106  ARG B CZ  1 
ATOM   2568 N NH1 . ARG B 1 106 ? 26.359 2.327   43.906  1.00 62.27 ? 106  ARG B NH1 1 
ATOM   2569 N NH2 . ARG B 1 106 ? 26.930 4.336   44.873  1.00 60.69 ? 106  ARG B NH2 1 
ATOM   2570 N N   . ASN B 1 107 ? 29.248 0.922   38.917  1.00 27.78 ? 107  ASN B N   1 
ATOM   2571 C CA  . ASN B 1 107 ? 29.441 -0.521  38.756  1.00 28.56 ? 107  ASN B CA  1 
ATOM   2572 C C   . ASN B 1 107 ? 29.702 -0.882  37.301  1.00 24.19 ? 107  ASN B C   1 
ATOM   2573 O O   . ASN B 1 107 ? 30.044 -2.023  37.017  1.00 23.31 ? 107  ASN B O   1 
ATOM   2574 C CB  . ASN B 1 107 ? 28.214 -1.318  39.225  1.00 37.32 ? 107  ASN B CB  1 
ATOM   2575 C CG  . ASN B 1 107 ? 27.927 -1.153  40.702  1.00 45.63 ? 107  ASN B CG  1 
ATOM   2576 O OD1 . ASN B 1 107 ? 28.835 -1.180  41.540  1.00 47.08 ? 107  ASN B OD1 1 
ATOM   2577 N ND2 . ASN B 1 107 ? 26.658 -0.952  41.033  1.00 51.29 ? 107  ASN B ND2 1 
ATOM   2578 N N   . ARG B 1 108 ? 29.473 0.072   36.393  1.00 23.65 ? 108  ARG B N   1 
ATOM   2579 C CA  . ARG B 1 108 ? 29.676 -0.096  34.950  1.00 20.73 ? 108  ARG B CA  1 
ATOM   2580 C C   . ARG B 1 108 ? 28.708 -1.084  34.296  1.00 24.47 ? 108  ARG B C   1 
ATOM   2581 O O   . ARG B 1 108 ? 28.956 -1.537  33.168  1.00 24.62 ? 108  ARG B O   1 
ATOM   2582 C CB  . ARG B 1 108 ? 31.114 -0.536  34.646  1.00 22.93 ? 108  ARG B CB  1 
ATOM   2583 C CG  . ARG B 1 108 ? 32.168 0.411   35.131  1.00 24.11 ? 108  ARG B CG  1 
ATOM   2584 C CD  . ARG B 1 108 ? 33.538 -0.203  35.035  1.00 28.58 ? 108  ARG B CD  1 
ATOM   2585 N NE  . ARG B 1 108 ? 34.525 0.746   35.539  1.00 35.66 ? 108  ARG B NE  1 
ATOM   2586 C CZ  . ARG B 1 108 ? 35.674 1.039   34.936  1.00 37.53 ? 108  ARG B CZ  1 
ATOM   2587 N NH1 . ARG B 1 108 ? 36.025 0.444   33.795  1.00 32.46 ? 108  ARG B NH1 1 
ATOM   2588 N NH2 . ARG B 1 108 ? 36.459 1.960   35.467  1.00 38.83 ? 108  ARG B NH2 1 
ATOM   2589 N N   . GLU B 1 109 ? 27.602 -1.399  34.970  1.00 21.09 ? 109  GLU B N   1 
ATOM   2590 C CA  . GLU B 1 109 ? 26.634 -2.347  34.427  1.00 20.49 ? 109  GLU B CA  1 
ATOM   2591 C C   . GLU B 1 109 ? 25.801 -1.760  33.299  1.00 15.78 ? 109  GLU B C   1 
ATOM   2592 O O   . GLU B 1 109 ? 25.427 -2.469  32.378  1.00 16.76 ? 109  GLU B O   1 
ATOM   2593 C CB  . GLU B 1 109 ? 25.721 -2.894  35.526  1.00 21.61 ? 109  GLU B CB  1 
ATOM   2594 C CG  . GLU B 1 109 ? 26.440 -3.712  36.590  1.00 27.24 ? 109  GLU B CG  1 
ATOM   2595 C CD  . GLU B 1 109 ? 25.504 -4.281  37.647  1.00 32.17 ? 109  GLU B CD  1 
ATOM   2596 O OE1 . GLU B 1 109 ? 24.356 -3.801  37.777  1.00 32.26 ? 109  GLU B OE1 1 
ATOM   2597 O OE2 . GLU B 1 109 ? 25.909 -5.229  38.359  1.00 37.02 ? 109  GLU B OE2 1 
ATOM   2598 N N   . LEU B 1 110 ? 25.531 -0.463  33.360  1.00 16.52 ? 110  LEU B N   1 
ATOM   2599 C CA  . LEU B 1 110 ? 24.749 0.203   32.322  1.00 19.83 ? 110  LEU B CA  1 
ATOM   2600 C C   . LEU B 1 110 ? 25.600 0.439   31.080  1.00 20.77 ? 110  LEU B C   1 
ATOM   2601 O O   . LEU B 1 110 ? 25.121 0.289   29.956  1.00 22.20 ? 110  LEU B O   1 
ATOM   2602 C CB  . LEU B 1 110 ? 24.185 1.532   32.837  1.00 24.07 ? 110  LEU B CB  1 
ATOM   2603 C CG  . LEU B 1 110 ? 22.767 1.598   33.433  1.00 28.93 ? 110  LEU B CG  1 
ATOM   2604 C CD1 . LEU B 1 110 ? 22.364 0.322   34.147  1.00 27.08 ? 110  LEU B CD1 1 
ATOM   2605 C CD2 . LEU B 1 110 ? 22.678 2.777   34.378  1.00 26.65 ? 110  LEU B CD2 1 
ATOM   2606 N N   . ALA B 1 111 ? 26.866 0.790   31.288  1.00 20.76 ? 111  ALA B N   1 
ATOM   2607 C CA  . ALA B 1 111 ? 27.808 1.034   30.201  1.00 18.59 ? 111  ALA B CA  1 
ATOM   2608 C C   . ALA B 1 111 ? 27.996 -0.239  29.382  1.00 19.55 ? 111  ALA B C   1 
ATOM   2609 O O   . ALA B 1 111 ? 28.274 -0.186  28.183  1.00 18.92 ? 111  ALA B O   1 
ATOM   2610 C CB  . ALA B 1 111 ? 29.151 1.506   30.768  1.00 20.77 ? 111  ALA B CB  1 
ATOM   2611 N N   . ILE B 1 112 ? 27.862 -1.382  30.044  1.00 19.02 ? 112  ILE B N   1 
ATOM   2612 C CA  . ILE B 1 112 ? 27.987 -2.681  29.392  1.00 19.95 ? 112  ILE B CA  1 
ATOM   2613 C C   . ILE B 1 112 ? 26.686 -2.994  28.655  1.00 19.29 ? 112  ILE B C   1 
ATOM   2614 O O   . ILE B 1 112 ? 26.705 -3.439  27.504  1.00 20.84 ? 112  ILE B O   1 
ATOM   2615 C CB  . ILE B 1 112 ? 28.301 -3.796  30.425  1.00 20.92 ? 112  ILE B CB  1 
ATOM   2616 C CG1 . ILE B 1 112 ? 29.654 -3.522  31.089  1.00 23.92 ? 112  ILE B CG1 1 
ATOM   2617 C CG2 . ILE B 1 112 ? 28.319 -5.172  29.757  1.00 22.94 ? 112  ILE B CG2 1 
ATOM   2618 C CD1 . ILE B 1 112 ? 30.057 -4.555  32.121  1.00 24.06 ? 112  ILE B CD1 1 
ATOM   2619 N N   . LEU B 1 113 ? 25.561 -2.711  29.308  1.00 20.47 ? 113  LEU B N   1 
ATOM   2620 C CA  . LEU B 1 113 ? 24.238 -2.938  28.734  1.00 19.52 ? 113  LEU B CA  1 
ATOM   2621 C C   . LEU B 1 113 ? 24.064 -2.145  27.438  1.00 20.95 ? 113  LEU B C   1 
ATOM   2622 O O   . LEU B 1 113 ? 23.611 -2.688  26.432  1.00 19.31 ? 113  LEU B O   1 
ATOM   2623 C CB  . LEU B 1 113 ? 23.160 -2.528  29.750  1.00 20.52 ? 113  LEU B CB  1 
ATOM   2624 C CG  . LEU B 1 113 ? 21.672 -2.529  29.363  1.00 22.87 ? 113  LEU B CG  1 
ATOM   2625 C CD1 . LEU B 1 113 ? 21.180 -3.922  28.962  1.00 19.67 ? 113  LEU B CD1 1 
ATOM   2626 C CD2 . LEU B 1 113 ? 20.859 -1.999  30.525  1.00 23.00 ? 113  LEU B CD2 1 
ATOM   2627 N N   . LEU B 1 114 ? 24.444 -0.867  27.476  1.00 18.20 ? 114  LEU B N   1 
ATOM   2628 C CA  . LEU B 1 114 ? 24.343 0.035   26.331  1.00 18.93 ? 114  LEU B CA  1 
ATOM   2629 C C   . LEU B 1 114 ? 25.453 -0.143  25.286  1.00 18.73 ? 114  LEU B C   1 
ATOM   2630 O O   . LEU B 1 114 ? 25.546 0.624   24.321  1.00 19.37 ? 114  LEU B O   1 
ATOM   2631 C CB  . LEU B 1 114 ? 24.284 1.490   26.805  1.00 15.50 ? 114  LEU B CB  1 
ATOM   2632 C CG  . LEU B 1 114 ? 23.005 1.923   27.530  1.00 19.29 ? 114  LEU B CG  1 
ATOM   2633 C CD1 . LEU B 1 114 ? 23.191 3.345   28.016  1.00 14.90 ? 114  LEU B CD1 1 
ATOM   2634 C CD2 . LEU B 1 114 ? 21.765 1.809   26.628  1.00 18.58 ? 114  LEU B CD2 1 
ATOM   2635 N N   . GLY B 1 115 ? 26.287 -1.154  25.497  1.00 17.73 ? 115  GLY B N   1 
ATOM   2636 C CA  . GLY B 1 115 ? 27.364 -1.475  24.580  1.00 19.99 ? 115  GLY B CA  1 
ATOM   2637 C C   . GLY B 1 115 ? 28.477 -0.474  24.351  1.00 21.54 ? 115  GLY B C   1 
ATOM   2638 O O   . GLY B 1 115 ? 28.952 -0.348  23.222  1.00 24.76 ? 115  GLY B O   1 
ATOM   2639 N N   . MET B 1 116 ? 28.906 0.235   25.390  1.00 20.78 ? 116  MET B N   1 
ATOM   2640 C CA  . MET B 1 116 ? 29.994 1.194   25.222  1.00 21.10 ? 116  MET B CA  1 
ATOM   2641 C C   . MET B 1 116 ? 31.146 0.928   26.182  1.00 21.70 ? 116  MET B C   1 
ATOM   2642 O O   . MET B 1 116 ? 31.829 1.848   26.624  1.00 23.59 ? 116  MET B O   1 
ATOM   2643 C CB  . MET B 1 116 ? 29.486 2.627   25.352  1.00 18.44 ? 116  MET B CB  1 
ATOM   2644 C CG  . MET B 1 116 ? 28.776 2.938   26.638  1.00 23.91 ? 116  MET B CG  1 
ATOM   2645 S SD  . MET B 1 116 ? 27.960 4.531   26.549  1.00 20.18 ? 116  MET B SD  1 
ATOM   2646 C CE  . MET B 1 116 ? 27.185 4.551   28.169  1.00 25.31 ? 116  MET B CE  1 
ATOM   2647 N N   . LEU B 1 117 ? 31.361 -0.346  26.489  1.00 22.99 ? 117  LEU B N   1 
ATOM   2648 C CA  . LEU B 1 117 ? 32.421 -0.743  27.394  1.00 24.67 ? 117  LEU B CA  1 
ATOM   2649 C C   . LEU B 1 117 ? 32.769 -2.213  27.194  1.00 28.06 ? 117  LEU B C   1 
ATOM   2650 O O   . LEU B 1 117 ? 31.871 -3.056  27.041  1.00 26.84 ? 117  LEU B O   1 
ATOM   2651 C CB  . LEU B 1 117 ? 31.984 -0.502  28.838  1.00 24.18 ? 117  LEU B CB  1 
ATOM   2652 C CG  . LEU B 1 117 ? 33.098 -0.617  29.872  1.00 27.23 ? 117  LEU B CG  1 
ATOM   2653 C CD1 . LEU B 1 117 ? 32.972 0.501   30.872  1.00 24.63 ? 117  LEU B CD1 1 
ATOM   2654 C CD2 . LEU B 1 117 ? 33.088 -1.983  30.538  1.00 27.46 ? 117  LEU B CD2 1 
ATOM   2655 N N   . ASP B 1 118 ? 34.073 -2.502  27.183  1.00 30.00 ? 118  ASP B N   1 
ATOM   2656 C CA  . ASP B 1 118 ? 34.602 -3.857  27.022  1.00 28.00 ? 118  ASP B CA  1 
ATOM   2657 C C   . ASP B 1 118 ? 35.229 -4.291  28.351  1.00 30.02 ? 118  ASP B C   1 
ATOM   2658 O O   . ASP B 1 118 ? 36.249 -3.743  28.775  1.00 30.91 ? 118  ASP B O   1 
ATOM   2659 C CB  . ASP B 1 118 ? 35.665 -3.879  25.916  1.00 23.81 ? 118  ASP B CB  1 
ATOM   2660 C CG  . ASP B 1 118 ? 36.181 -5.282  25.611  1.00 27.78 ? 118  ASP B CG  1 
ATOM   2661 O OD1 . ASP B 1 118 ? 36.007 -6.205  26.442  1.00 26.50 ? 118  ASP B OD1 1 
ATOM   2662 O OD2 . ASP B 1 118 ? 36.753 -5.480  24.515  1.00 23.57 ? 118  ASP B OD2 1 
ATOM   2663 N N   . PRO B 1 119 ? 34.626 -5.289  29.027  1.00 33.45 ? 119  PRO B N   1 
ATOM   2664 C CA  . PRO B 1 119 ? 35.132 -5.794  30.314  1.00 32.87 ? 119  PRO B CA  1 
ATOM   2665 C C   . PRO B 1 119 ? 36.544 -6.382  30.222  1.00 35.39 ? 119  PRO B C   1 
ATOM   2666 O O   . PRO B 1 119 ? 37.274 -6.417  31.211  1.00 36.78 ? 119  PRO B O   1 
ATOM   2667 C CB  . PRO B 1 119 ? 34.102 -6.857  30.689  1.00 33.68 ? 119  PRO B CB  1 
ATOM   2668 C CG  . PRO B 1 119 ? 32.831 -6.358  30.028  1.00 30.16 ? 119  PRO B CG  1 
ATOM   2669 C CD  . PRO B 1 119 ? 33.351 -5.943  28.678  1.00 33.59 ? 119  PRO B CD  1 
ATOM   2670 N N   . ALA B 1 120 ? 36.934 -6.830  29.030  1.00 35.92 ? 120  ALA B N   1 
ATOM   2671 C CA  . ALA B 1 120 ? 38.267 -7.392  28.822  1.00 36.92 ? 120  ALA B CA  1 
ATOM   2672 C C   . ALA B 1 120 ? 39.328 -6.296  28.698  1.00 37.99 ? 120  ALA B C   1 
ATOM   2673 O O   . ALA B 1 120 ? 40.487 -6.590  28.398  1.00 40.00 ? 120  ALA B O   1 
ATOM   2674 C CB  . ALA B 1 120 ? 38.290 -8.298  27.583  1.00 34.26 ? 120  ALA B CB  1 
ATOM   2675 N N   . GLU B 1 121 ? 38.926 -5.042  28.913  1.00 39.65 ? 121  GLU B N   1 
ATOM   2676 C CA  . GLU B 1 121 ? 39.836 -3.894  28.853  1.00 40.28 ? 121  GLU B CA  1 
ATOM   2677 C C   . GLU B 1 121 ? 40.109 -3.311  30.244  1.00 39.49 ? 121  GLU B C   1 
ATOM   2678 O O   . GLU B 1 121 ? 41.281 -2.944  30.500  1.00 38.83 ? 121  GLU B O   1 
ATOM   2679 C CB  . GLU B 1 121 ? 39.257 -2.797  27.969  1.00 42.29 ? 121  GLU B CB  1 
ATOM   2680 C CG  . GLU B 1 121 ? 40.163 -2.390  26.826  1.00 41.87 ? 121  GLU B CG  1 
ATOM   2681 C CD  . GLU B 1 121 ? 39.642 -2.864  25.489  1.00 45.08 ? 121  GLU B CD  1 
ATOM   2682 O OE1 . GLU B 1 121 ? 39.898 -4.036  25.127  1.00 46.21 ? 121  GLU B OE1 1 
ATOM   2683 O OE2 . GLU B 1 121 ? 38.970 -2.061  24.809  1.00 43.76 ? 121  GLU B OE2 1 
ATOM   2684 N N   . MET B 1 127 ? 40.109 5.970   33.346  1.00 42.93 ? 127  MET B N   1 
ATOM   2685 C CA  . MET B 1 127 ? 38.664 6.199   33.060  1.00 43.67 ? 127  MET B CA  1 
ATOM   2686 C C   . MET B 1 127 ? 38.210 5.394   31.843  1.00 38.75 ? 127  MET B C   1 
ATOM   2687 O O   . MET B 1 127 ? 38.957 5.249   30.881  1.00 40.02 ? 127  MET B O   1 
ATOM   2688 C CB  . MET B 1 127 ? 38.379 7.698   32.859  1.00 50.18 ? 127  MET B CB  1 
ATOM   2689 C CG  . MET B 1 127 ? 39.235 8.415   31.809  1.00 57.99 ? 127  MET B CG  1 
ATOM   2690 S SD  . MET B 1 127 ? 38.755 10.169  31.537  1.00 67.92 ? 127  MET B SD  1 
ATOM   2691 C CE  . MET B 1 127 ? 39.711 11.006  32.834  1.00 64.91 ? 127  MET B CE  1 
ATOM   2692 N N   . PRO B 1 128 ? 36.987 4.834   31.881  1.00 34.09 ? 128  PRO B N   1 
ATOM   2693 C CA  . PRO B 1 128 ? 36.506 4.054   30.734  1.00 28.48 ? 128  PRO B CA  1 
ATOM   2694 C C   . PRO B 1 128 ? 36.269 5.010   29.564  1.00 25.64 ? 128  PRO B C   1 
ATOM   2695 O O   . PRO B 1 128 ? 35.141 5.448   29.337  1.00 23.94 ? 128  PRO B O   1 
ATOM   2696 C CB  . PRO B 1 128 ? 35.177 3.478   31.238  1.00 29.10 ? 128  PRO B CB  1 
ATOM   2697 C CG  . PRO B 1 128 ? 35.277 3.568   32.745  1.00 28.65 ? 128  PRO B CG  1 
ATOM   2698 C CD  . PRO B 1 128 ? 35.982 4.867   32.957  1.00 30.48 ? 128  PRO B CD  1 
ATOM   2699 N N   . VAL B 1 129 ? 37.332 5.319   28.825  1.00 19.92 ? 129  VAL B N   1 
ATOM   2700 C CA  . VAL B 1 129 ? 37.257 6.248   27.699  1.00 21.05 ? 129  VAL B CA  1 
ATOM   2701 C C   . VAL B 1 129 ? 36.207 5.958   26.630  1.00 19.36 ? 129  VAL B C   1 
ATOM   2702 O O   . VAL B 1 129 ? 35.830 6.856   25.886  1.00 19.58 ? 129  VAL B O   1 
ATOM   2703 C CB  . VAL B 1 129 ? 38.625 6.416   27.009  1.00 21.28 ? 129  VAL B CB  1 
ATOM   2704 C CG1 . VAL B 1 129 ? 39.673 6.788   28.033  1.00 24.82 ? 129  VAL B CG1 1 
ATOM   2705 C CG2 . VAL B 1 129 ? 39.014 5.149   26.254  1.00 26.10 ? 129  VAL B CG2 1 
ATOM   2706 N N   . THR B 1 130 ? 35.728 4.718   26.564  1.00 17.90 ? 130  THR B N   1 
ATOM   2707 C CA  . THR B 1 130 ? 34.720 4.319   25.577  1.00 18.43 ? 130  THR B CA  1 
ATOM   2708 C C   . THR B 1 130 ? 33.282 4.759   25.914  1.00 16.04 ? 130  THR B C   1 
ATOM   2709 O O   . THR B 1 130 ? 32.434 4.856   25.033  1.00 14.59 ? 130  THR B O   1 
ATOM   2710 C CB  . THR B 1 130 ? 34.741 2.791   25.379  1.00 21.86 ? 130  THR B CB  1 
ATOM   2711 O OG1 . THR B 1 130 ? 34.823 2.150   26.664  1.00 22.42 ? 130  THR B OG1 1 
ATOM   2712 C CG2 . THR B 1 130 ? 35.932 2.378   24.528  1.00 23.57 ? 130  THR B CG2 1 
ATOM   2713 N N   . ALA B 1 131 ? 33.003 5.016   27.188  1.00 16.36 ? 131  ALA B N   1 
ATOM   2714 C CA  . ALA B 1 131 ? 31.666 5.430   27.592  1.00 15.68 ? 131  ALA B CA  1 
ATOM   2715 C C   . ALA B 1 131 ? 31.441 6.888   27.201  1.00 14.35 ? 131  ALA B C   1 
ATOM   2716 O O   . ALA B 1 131 ? 31.377 7.768   28.058  1.00 17.27 ? 131  ALA B O   1 
ATOM   2717 C CB  . ALA B 1 131 ? 31.493 5.239   29.100  1.00 14.34 ? 131  ALA B CB  1 
ATOM   2718 N N   . ARG B 1 132 ? 31.271 7.139   25.907  1.00 13.40 ? 132  ARG B N   1 
ATOM   2719 C CA  . ARG B 1 132 ? 31.090 8.499   25.426  1.00 11.19 ? 132  ARG B CA  1 
ATOM   2720 C C   . ARG B 1 132 ? 29.919 8.739   24.475  1.00 11.72 ? 132  ARG B C   1 
ATOM   2721 O O   . ARG B 1 132 ? 29.738 9.844   23.995  1.00 13.38 ? 132  ARG B O   1 
ATOM   2722 C CB  . ARG B 1 132 ? 32.390 8.978   24.770  1.00 8.33  ? 132  ARG B CB  1 
ATOM   2723 C CG  . ARG B 1 132 ? 33.416 9.498   25.749  1.00 8.16  ? 132  ARG B CG  1 
ATOM   2724 C CD  . ARG B 1 132 ? 33.030 10.876  26.272  1.00 8.57  ? 132  ARG B CD  1 
ATOM   2725 N NE  . ARG B 1 132 ? 32.977 11.882  25.197  1.00 14.13 ? 132  ARG B NE  1 
ATOM   2726 C CZ  . ARG B 1 132 ? 32.563 13.140  25.362  1.00 15.62 ? 132  ARG B CZ  1 
ATOM   2727 N NH1 . ARG B 1 132 ? 32.167 13.558  26.561  1.00 10.47 ? 132  ARG B NH1 1 
ATOM   2728 N NH2 . ARG B 1 132 ? 32.523 13.979  24.329  1.00 16.74 ? 132  ARG B NH2 1 
ATOM   2729 N N   . VAL B 1 133 ? 29.089 7.729   24.261  1.00 15.35 ? 133  VAL B N   1 
ATOM   2730 C CA  . VAL B 1 133 ? 27.958 7.857   23.344  1.00 15.13 ? 133  VAL B CA  1 
ATOM   2731 C C   . VAL B 1 133 ? 26.828 8.791   23.795  1.00 17.21 ? 133  VAL B C   1 
ATOM   2732 O O   . VAL B 1 133 ? 26.514 8.882   24.987  1.00 19.14 ? 133  VAL B O   1 
ATOM   2733 C CB  . VAL B 1 133 ? 27.324 6.484   23.063  1.00 11.19 ? 133  VAL B CB  1 
ATOM   2734 C CG1 . VAL B 1 133 ? 26.231 6.606   22.037  1.00 15.14 ? 133  VAL B CG1 1 
ATOM   2735 C CG2 . VAL B 1 133 ? 28.368 5.504   22.610  1.00 12.55 ? 133  VAL B CG2 1 
ATOM   2736 N N   . VAL B 1 134 ? 26.269 9.527   22.837  1.00 15.12 ? 134  VAL B N   1 
ATOM   2737 C CA  . VAL B 1 134 ? 25.113 10.390  23.071  1.00 14.92 ? 134  VAL B CA  1 
ATOM   2738 C C   . VAL B 1 134 ? 24.025 9.648   22.291  1.00 14.32 ? 134  VAL B C   1 
ATOM   2739 O O   . VAL B 1 134 ? 24.171 9.394   21.088  1.00 15.88 ? 134  VAL B O   1 
ATOM   2740 C CB  . VAL B 1 134 ? 25.288 11.806  22.486  1.00 10.80 ? 134  VAL B CB  1 
ATOM   2741 C CG1 . VAL B 1 134 ? 23.995 12.590  22.603  1.00 13.43 ? 134  VAL B CG1 1 
ATOM   2742 C CG2 . VAL B 1 134 ? 26.346 12.544  23.227  1.00 6.17  ? 134  VAL B CG2 1 
ATOM   2743 N N   . PHE B 1 135 ? 22.985 9.213   22.988  1.00 13.94 ? 135  PHE B N   1 
ATOM   2744 C CA  . PHE B 1 135 ? 21.896 8.486   22.345  1.00 13.80 ? 135  PHE B CA  1 
ATOM   2745 C C   . PHE B 1 135 ? 20.658 9.363   22.297  1.00 14.78 ? 135  PHE B C   1 
ATOM   2746 O O   . PHE B 1 135 ? 20.343 10.042  23.283  1.00 10.24 ? 135  PHE B O   1 
ATOM   2747 C CB  . PHE B 1 135 ? 21.501 7.252   23.163  1.00 15.92 ? 135  PHE B CB  1 
ATOM   2748 C CG  . PHE B 1 135 ? 22.611 6.264   23.410  1.00 17.84 ? 135  PHE B CG  1 
ATOM   2749 C CD1 . PHE B 1 135 ? 23.403 6.356   24.556  1.00 16.38 ? 135  PHE B CD1 1 
ATOM   2750 C CD2 . PHE B 1 135 ? 22.787 5.171   22.564  1.00 15.34 ? 135  PHE B CD2 1 
ATOM   2751 C CE1 . PHE B 1 135 ? 24.349 5.362   24.855  1.00 13.15 ? 135  PHE B CE1 1 
ATOM   2752 C CE2 . PHE B 1 135 ? 23.725 4.179   22.858  1.00 12.17 ? 135  PHE B CE2 1 
ATOM   2753 C CZ  . PHE B 1 135 ? 24.502 4.275   24.003  1.00 9.45  ? 135  PHE B CZ  1 
ATOM   2754 N N   . VAL B 1 136 ? 19.943 9.326   21.175  1.00 14.60 ? 136  VAL B N   1 
ATOM   2755 C CA  . VAL B 1 136 ? 18.683 10.076  21.038  1.00 15.44 ? 136  VAL B CA  1 
ATOM   2756 C C   . VAL B 1 136 ? 17.573 9.063   20.754  1.00 8.77  ? 136  VAL B C   1 
ATOM   2757 O O   . VAL B 1 136 ? 17.641 8.317   19.781  1.00 13.86 ? 136  VAL B O   1 
ATOM   2758 C CB  . VAL B 1 136 ? 18.711 11.118  19.881  1.00 14.42 ? 136  VAL B CB  1 
ATOM   2759 C CG1 . VAL B 1 136 ? 17.400 11.907  19.845  1.00 11.94 ? 136  VAL B CG1 1 
ATOM   2760 C CG2 . VAL B 1 136 ? 19.871 12.073  20.056  1.00 14.12 ? 136  VAL B CG2 1 
ATOM   2761 N N   . PHE B 1 137 ? 16.579 9.007   21.627  1.00 12.75 ? 137  PHE B N   1 
ATOM   2762 C CA  . PHE B 1 137 ? 15.459 8.083   21.461  1.00 9.97  ? 137  PHE B CA  1 
ATOM   2763 C C   . PHE B 1 137 ? 14.203 8.899   21.234  1.00 8.49  ? 137  PHE B C   1 
ATOM   2764 O O   . PHE B 1 137 ? 14.100 10.018  21.724  1.00 12.53 ? 137  PHE B O   1 
ATOM   2765 C CB  . PHE B 1 137 ? 15.271 7.245   22.731  1.00 11.85 ? 137  PHE B CB  1 
ATOM   2766 C CG  . PHE B 1 137 ? 16.502 6.504   23.161  1.00 12.17 ? 137  PHE B CG  1 
ATOM   2767 C CD1 . PHE B 1 137 ? 16.843 5.291   22.567  1.00 12.69 ? 137  PHE B CD1 1 
ATOM   2768 C CD2 . PHE B 1 137 ? 17.325 7.016   24.162  1.00 13.76 ? 137  PHE B CD2 1 
ATOM   2769 C CE1 . PHE B 1 137 ? 17.983 4.600   22.962  1.00 9.14  ? 137  PHE B CE1 1 
ATOM   2770 C CE2 . PHE B 1 137 ? 18.472 6.329   24.566  1.00 10.42 ? 137  PHE B CE2 1 
ATOM   2771 C CZ  . PHE B 1 137 ? 18.798 5.122   23.964  1.00 10.80 ? 137  PHE B CZ  1 
ATOM   2772 N N   . GLY B 1 138 ? 13.257 8.347   20.486  1.00 12.20 ? 138  GLY B N   1 
ATOM   2773 C CA  . GLY B 1 138 ? 12.002 9.030   20.239  1.00 13.28 ? 138  GLY B CA  1 
ATOM   2774 C C   . GLY B 1 138 ? 10.986 8.607   21.291  1.00 16.06 ? 138  GLY B C   1 
ATOM   2775 O O   . GLY B 1 138 ? 11.317 7.829   22.191  1.00 16.20 ? 138  GLY B O   1 
ATOM   2776 N N   . PRO B 1 139 ? 9.735  9.083   21.208  1.00 17.85 ? 139  PRO B N   1 
ATOM   2777 C CA  . PRO B 1 139 ? 8.692  8.723   22.179  1.00 15.08 ? 139  PRO B CA  1 
ATOM   2778 C C   . PRO B 1 139 ? 8.372  7.221   22.099  1.00 19.09 ? 139  PRO B C   1 
ATOM   2779 O O   . PRO B 1 139 ? 7.769  6.638   23.018  1.00 17.31 ? 139  PRO B O   1 
ATOM   2780 C CB  . PRO B 1 139 ? 7.500  9.551   21.713  1.00 16.38 ? 139  PRO B CB  1 
ATOM   2781 C CG  . PRO B 1 139 ? 8.125  10.680  20.976  1.00 14.48 ? 139  PRO B CG  1 
ATOM   2782 C CD  . PRO B 1 139 ? 9.203  10.007  20.200  1.00 14.15 ? 139  PRO B CD  1 
ATOM   2783 N N   . ASP B 1 140 ? 8.773  6.605   20.986  1.00 15.80 ? 140  ASP B N   1 
ATOM   2784 C CA  . ASP B 1 140 ? 8.564  5.181   20.751  1.00 17.56 ? 140  ASP B CA  1 
ATOM   2785 C C   . ASP B 1 140 ? 9.660  4.298   21.362  1.00 17.73 ? 140  ASP B C   1 
ATOM   2786 O O   . ASP B 1 140 ? 9.670  3.084   21.159  1.00 20.14 ? 140  ASP B O   1 
ATOM   2787 C CB  . ASP B 1 140 ? 8.450  4.912   19.247  1.00 20.16 ? 140  ASP B CB  1 
ATOM   2788 C CG  . ASP B 1 140 ? 9.677  5.353   18.473  1.00 20.28 ? 140  ASP B CG  1 
ATOM   2789 O OD1 . ASP B 1 140 ? 10.671 5.814   19.073  1.00 18.83 ? 140  ASP B OD1 1 
ATOM   2790 O OD2 . ASP B 1 140 ? 9.648  5.247   17.235  1.00 23.76 ? 140  ASP B OD2 1 
ATOM   2791 N N   . LYS B 1 141 ? 10.580 4.917   22.099  1.00 17.07 ? 141  LYS B N   1 
ATOM   2792 C CA  . LYS B 1 141 ? 11.691 4.230   22.768  1.00 18.32 ? 141  LYS B CA  1 
ATOM   2793 C C   . LYS B 1 141 ? 12.785 3.721   21.835  1.00 16.73 ? 141  LYS B C   1 
ATOM   2794 O O   . LYS B 1 141 ? 13.764 3.151   22.298  1.00 20.62 ? 141  LYS B O   1 
ATOM   2795 C CB  . LYS B 1 141 ? 11.196 3.070   23.645  1.00 19.65 ? 141  LYS B CB  1 
ATOM   2796 C CG  . LYS B 1 141 ? 10.086 3.422   24.619  1.00 22.25 ? 141  LYS B CG  1 
ATOM   2797 C CD  . LYS B 1 141 ? 10.423 4.637   25.462  1.00 25.85 ? 141  LYS B CD  1 
ATOM   2798 C CE  . LYS B 1 141 ? 9.267  5.000   26.402  1.00 26.48 ? 141  LYS B CE  1 
ATOM   2799 N NZ  . LYS B 1 141 ? 7.968  5.294   25.728  1.00 22.69 ? 141  LYS B NZ  1 
ATOM   2800 N N   . LYS B 1 142 ? 12.643 3.952   20.536  1.00 16.52 ? 142  LYS B N   1 
ATOM   2801 C CA  . LYS B 1 142 ? 13.636 3.494   19.581  1.00 14.18 ? 142  LYS B CA  1 
ATOM   2802 C C   . LYS B 1 142 ? 14.788 4.480   19.403  1.00 12.82 ? 142  LYS B C   1 
ATOM   2803 O O   . LYS B 1 142 ? 14.616 5.683   19.573  1.00 12.86 ? 142  LYS B O   1 
ATOM   2804 C CB  . LYS B 1 142 ? 12.972 3.228   18.236  1.00 15.69 ? 142  LYS B CB  1 
ATOM   2805 C CG  . LYS B 1 142 ? 11.870 2.193   18.265  1.00 19.77 ? 142  LYS B CG  1 
ATOM   2806 C CD  . LYS B 1 142 ? 11.464 1.844   16.838  1.00 25.11 ? 142  LYS B CD  1 
ATOM   2807 C CE  . LYS B 1 142 ? 10.010 1.417   16.745  1.00 27.56 ? 142  LYS B CE  1 
ATOM   2808 N NZ  . LYS B 1 142 ? 9.706  0.296   17.671  1.00 38.58 ? 142  LYS B NZ  1 
ATOM   2809 N N   . LEU B 1 143 ? 15.946 3.966   19.001  1.00 14.03 ? 143  LEU B N   1 
ATOM   2810 C CA  . LEU B 1 143 ? 17.132 4.783   18.787  1.00 11.99 ? 143  LEU B CA  1 
ATOM   2811 C C   . LEU B 1 143 ? 16.999 5.528   17.469  1.00 11.73 ? 143  LEU B C   1 
ATOM   2812 O O   . LEU B 1 143 ? 16.826 4.923   16.429  1.00 10.96 ? 143  LEU B O   1 
ATOM   2813 C CB  . LEU B 1 143 ? 18.379 3.886   18.785  1.00 17.48 ? 143  LEU B CB  1 
ATOM   2814 C CG  . LEU B 1 143 ? 19.788 4.481   18.932  1.00 19.07 ? 143  LEU B CG  1 
ATOM   2815 C CD1 . LEU B 1 143 ? 20.367 4.793   17.576  1.00 24.46 ? 143  LEU B CD1 1 
ATOM   2816 C CD2 . LEU B 1 143 ? 19.795 5.711   19.834  1.00 10.55 ? 143  LEU B CD2 1 
ATOM   2817 N N   . LYS B 1 144 ? 17.108 6.846   17.521  1.00 11.14 ? 144  LYS B N   1 
ATOM   2818 C CA  . LYS B 1 144 ? 16.956 7.679   16.335  1.00 11.70 ? 144  LYS B CA  1 
ATOM   2819 C C   . LYS B 1 144 ? 18.264 8.232   15.780  1.00 13.24 ? 144  LYS B C   1 
ATOM   2820 O O   . LYS B 1 144 ? 18.425 8.442   14.570  1.00 12.34 ? 144  LYS B O   1 
ATOM   2821 C CB  . LYS B 1 144 ? 16.036 8.855   16.684  1.00 9.47  ? 144  LYS B CB  1 
ATOM   2822 C CG  . LYS B 1 144 ? 14.657 8.453   17.218  1.00 13.27 ? 144  LYS B CG  1 
ATOM   2823 C CD  . LYS B 1 144 ? 13.785 7.818   16.127  1.00 14.66 ? 144  LYS B CD  1 
ATOM   2824 C CE  . LYS B 1 144 ? 12.497 7.247   16.704  1.00 14.06 ? 144  LYS B CE  1 
ATOM   2825 N NZ  . LYS B 1 144 ? 11.787 6.381   15.721  1.00 16.77 ? 144  LYS B NZ  1 
ATOM   2826 N N   . LEU B 1 145 ? 19.202 8.479   16.684  1.00 15.36 ? 145  LEU B N   1 
ATOM   2827 C CA  . LEU B 1 145 ? 20.487 9.076   16.328  1.00 14.10 ? 145  LEU B CA  1 
ATOM   2828 C C   . LEU B 1 145 ? 21.469 8.738   17.442  1.00 13.75 ? 145  LEU B C   1 
ATOM   2829 O O   . LEU B 1 145 ? 21.070 8.543   18.597  1.00 14.73 ? 145  LEU B O   1 
ATOM   2830 C CB  . LEU B 1 145 ? 20.273 10.598  16.257  1.00 16.97 ? 145  LEU B CB  1 
ATOM   2831 C CG  . LEU B 1 145 ? 21.200 11.738  15.798  1.00 14.81 ? 145  LEU B CG  1 
ATOM   2832 C CD1 . LEU B 1 145 ? 22.610 11.581  16.278  1.00 20.23 ? 145  LEU B CD1 1 
ATOM   2833 C CD2 . LEU B 1 145 ? 21.136 11.869  14.319  1.00 19.10 ? 145  LEU B CD2 1 
ATOM   2834 N N   . SER B 1 146 ? 22.750 8.729   17.097  1.00 13.68 ? 146  SER B N   1 
ATOM   2835 C CA  . SER B 1 146 ? 23.823 8.415   18.032  1.00 15.52 ? 146  SER B CA  1 
ATOM   2836 C C   . SER B 1 146 ? 25.056 9.230   17.613  1.00 15.48 ? 146  SER B C   1 
ATOM   2837 O O   . SER B 1 146 ? 25.318 9.423   16.416  1.00 15.95 ? 146  SER B O   1 
ATOM   2838 C CB  . SER B 1 146 ? 24.125 6.912   17.952  1.00 17.74 ? 146  SER B CB  1 
ATOM   2839 O OG  . SER B 1 146 ? 25.062 6.497   18.919  1.00 31.91 ? 146  SER B OG  1 
ATOM   2840 N N   . ILE B 1 147 ? 25.831 9.674   18.595  1.00 14.66 ? 147  ILE B N   1 
ATOM   2841 C CA  . ILE B 1 147 ? 27.044 10.463  18.340  1.00 18.41 ? 147  ILE B CA  1 
ATOM   2842 C C   . ILE B 1 147 ? 28.126 9.924   19.274  1.00 17.34 ? 147  ILE B C   1 
ATOM   2843 O O   . ILE B 1 147 ? 27.852 9.681   20.451  1.00 17.99 ? 147  ILE B O   1 
ATOM   2844 C CB  . ILE B 1 147 ? 26.763 11.974  18.585  1.00 19.83 ? 147  ILE B CB  1 
ATOM   2845 C CG1 . ILE B 1 147 ? 26.072 12.597  17.372  1.00 22.67 ? 147  ILE B CG1 1 
ATOM   2846 C CG2 . ILE B 1 147 ? 28.017 12.735  18.944  1.00 25.61 ? 147  ILE B CG2 1 
ATOM   2847 C CD1 . ILE B 1 147 ? 25.638 14.041  17.600  1.00 23.28 ? 147  ILE B CD1 1 
ATOM   2848 N N   . LEU B 1 148 ? 29.314 9.653   18.736  1.00 11.94 ? 148  LEU B N   1 
ATOM   2849 C CA  . LEU B 1 148 ? 30.411 9.105   19.545  1.00 14.54 ? 148  LEU B CA  1 
ATOM   2850 C C   . LEU B 1 148 ? 31.695 9.921   19.432  1.00 12.39 ? 148  LEU B C   1 
ATOM   2851 O O   . LEU B 1 148 ? 32.574 9.607   18.627  1.00 11.76 ? 148  LEU B O   1 
ATOM   2852 C CB  . LEU B 1 148 ? 30.710 7.634   19.178  1.00 11.92 ? 148  LEU B CB  1 
ATOM   2853 C CG  . LEU B 1 148 ? 31.108 6.589   20.253  1.00 10.53 ? 148  LEU B CG  1 
ATOM   2854 C CD1 . LEU B 1 148 ? 31.907 5.474   19.633  1.00 7.99  ? 148  LEU B CD1 1 
ATOM   2855 C CD2 . LEU B 1 148 ? 31.878 7.195   21.374  1.00 8.46  ? 148  LEU B CD2 1 
ATOM   2856 N N   . TYR B 1 149 ? 31.779 10.970  20.243  1.00 13.34 ? 149  TYR B N   1 
ATOM   2857 C CA  . TYR B 1 149 ? 32.945 11.835  20.300  1.00 13.65 ? 149  TYR B CA  1 
ATOM   2858 C C   . TYR B 1 149 ? 33.811 11.364  21.457  1.00 14.86 ? 149  TYR B C   1 
ATOM   2859 O O   . TYR B 1 149 ? 33.303 10.889  22.472  1.00 13.96 ? 149  TYR B O   1 
ATOM   2860 C CB  . TYR B 1 149 ? 32.523 13.278  20.592  1.00 11.11 ? 149  TYR B CB  1 
ATOM   2861 C CG  . TYR B 1 149 ? 31.893 14.000  19.438  1.00 12.86 ? 149  TYR B CG  1 
ATOM   2862 C CD1 . TYR B 1 149 ? 31.411 13.296  18.327  1.00 12.63 ? 149  TYR B CD1 1 
ATOM   2863 C CD2 . TYR B 1 149 ? 31.820 15.389  19.424  1.00 9.29  ? 149  TYR B CD2 1 
ATOM   2864 C CE1 . TYR B 1 149 ? 30.885 13.955  17.232  1.00 7.50  ? 149  TYR B CE1 1 
ATOM   2865 C CE2 . TYR B 1 149 ? 31.288 16.063  18.327  1.00 10.29 ? 149  TYR B CE2 1 
ATOM   2866 C CZ  . TYR B 1 149 ? 30.826 15.338  17.234  1.00 9.00  ? 149  TYR B CZ  1 
ATOM   2867 O OH  . TYR B 1 149 ? 30.328 15.987  16.135  1.00 11.98 ? 149  TYR B OH  1 
ATOM   2868 N N   . PRO B 1 150 ? 35.133 11.438  21.303  1.00 14.04 ? 150  PRO B N   1 
ATOM   2869 C CA  . PRO B 1 150 ? 36.006 11.010  22.404  1.00 13.84 ? 150  PRO B CA  1 
ATOM   2870 C C   . PRO B 1 150 ? 35.911 12.062  23.514  1.00 12.58 ? 150  PRO B C   1 
ATOM   2871 O O   . PRO B 1 150 ? 35.438 13.174  23.277  1.00 14.62 ? 150  PRO B O   1 
ATOM   2872 C CB  . PRO B 1 150 ? 37.393 10.993  21.750  1.00 11.70 ? 150  PRO B CB  1 
ATOM   2873 C CG  . PRO B 1 150 ? 37.277 12.046  20.694  1.00 10.98 ? 150  PRO B CG  1 
ATOM   2874 C CD  . PRO B 1 150 ? 35.913 11.786  20.108  1.00 15.00 ? 150  PRO B CD  1 
ATOM   2875 N N   . ALA B 1 151 ? 36.357 11.739  24.723  1.00 16.01 ? 151  ALA B N   1 
ATOM   2876 C CA  . ALA B 1 151 ? 36.278 12.702  25.827  1.00 17.16 ? 151  ALA B CA  1 
ATOM   2877 C C   . ALA B 1 151 ? 37.189 13.927  25.668  1.00 16.99 ? 151  ALA B C   1 
ATOM   2878 O O   . ALA B 1 151 ? 37.098 14.865  26.465  1.00 16.89 ? 151  ALA B O   1 
ATOM   2879 C CB  . ALA B 1 151 ? 36.550 12.005  27.154  1.00 20.45 ? 151  ALA B CB  1 
ATOM   2880 N N   . THR B 1 152 ? 38.066 13.911  24.659  1.00 16.16 ? 152  THR B N   1 
ATOM   2881 C CA  . THR B 1 152 ? 39.001 15.002  24.389  1.00 11.79 ? 152  THR B CA  1 
ATOM   2882 C C   . THR B 1 152 ? 38.460 15.965  23.336  1.00 12.48 ? 152  THR B C   1 
ATOM   2883 O O   . THR B 1 152 ? 39.066 17.005  23.041  1.00 11.47 ? 152  THR B O   1 
ATOM   2884 C CB  . THR B 1 152 ? 40.366 14.452  23.926  1.00 9.57  ? 152  THR B CB  1 
ATOM   2885 O OG1 . THR B 1 152 ? 40.156 13.376  23.015  1.00 13.66 ? 152  THR B OG1 1 
ATOM   2886 C CG2 . THR B 1 152 ? 41.155 13.924  25.108  1.00 9.28  ? 152  THR B CG2 1 
ATOM   2887 N N   . THR B 1 153 ? 37.320 15.607  22.762  1.00 13.39 ? 153  THR B N   1 
ATOM   2888 C CA  . THR B 1 153 ? 36.667 16.442  21.766  1.00 13.54 ? 153  THR B CA  1 
ATOM   2889 C C   . THR B 1 153 ? 35.270 16.763  22.256  1.00 11.77 ? 153  THR B C   1 
ATOM   2890 O O   . THR B 1 153 ? 34.393 15.900  22.254  1.00 11.35 ? 153  THR B O   1 
ATOM   2891 C CB  . THR B 1 153 ? 36.563 15.753  20.383  1.00 11.16 ? 153  THR B CB  1 
ATOM   2892 O OG1 . THR B 1 153 ? 37.855 15.708  19.773  1.00 11.74 ? 153  THR B OG1 1 
ATOM   2893 C CG2 . THR B 1 153 ? 35.627 16.521  19.482  1.00 6.67  ? 153  THR B CG2 1 
ATOM   2894 N N   . GLY B 1 154 ? 35.087 18.005  22.683  1.00 10.76 ? 154  GLY B N   1 
ATOM   2895 C CA  . GLY B 1 154 ? 33.803 18.455  23.176  1.00 12.88 ? 154  GLY B CA  1 
ATOM   2896 C C   . GLY B 1 154 ? 32.756 18.510  22.086  1.00 10.95 ? 154  GLY B C   1 
ATOM   2897 O O   . GLY B 1 154 ? 33.033 18.901  20.948  1.00 12.34 ? 154  GLY B O   1 
ATOM   2898 N N   . ARG B 1 155 ? 31.547 18.110  22.451  1.00 11.81 ? 155  ARG B N   1 
ATOM   2899 C CA  . ARG B 1 155 ? 30.418 18.099  21.542  1.00 13.13 ? 155  ARG B CA  1 
ATOM   2900 C C   . ARG B 1 155 ? 29.993 19.524  21.216  1.00 11.72 ? 155  ARG B C   1 
ATOM   2901 O O   . ARG B 1 155 ? 30.372 20.472  21.901  1.00 12.89 ? 155  ARG B O   1 
ATOM   2902 C CB  . ARG B 1 155 ? 29.257 17.339  22.173  1.00 7.33  ? 155  ARG B CB  1 
ATOM   2903 C CG  . ARG B 1 155 ? 29.605 15.906  22.553  1.00 12.52 ? 155  ARG B CG  1 
ATOM   2904 C CD  . ARG B 1 155 ? 28.595 15.346  23.556  1.00 13.59 ? 155  ARG B CD  1 
ATOM   2905 N NE  . ARG B 1 155 ? 28.954 13.991  23.984  1.00 16.00 ? 155  ARG B NE  1 
ATOM   2906 C CZ  . ARG B 1 155 ? 28.763 13.506  25.209  1.00 16.69 ? 155  ARG B CZ  1 
ATOM   2907 N NH1 . ARG B 1 155 ? 28.216 14.270  26.151  1.00 14.16 ? 155  ARG B NH1 1 
ATOM   2908 N NH2 . ARG B 1 155 ? 29.074 12.243  25.470  1.00 15.59 ? 155  ARG B NH2 1 
ATOM   2909 N N   . ASN B 1 156 ? 29.241 19.662  20.134  1.00 13.41 ? 156  ASN B N   1 
ATOM   2910 C CA  . ASN B 1 156 ? 28.732 20.941  19.675  1.00 12.02 ? 156  ASN B CA  1 
ATOM   2911 C C   . ASN B 1 156 ? 27.230 20.862  19.909  1.00 12.99 ? 156  ASN B C   1 
ATOM   2912 O O   . ASN B 1 156 ? 26.533 20.100  19.237  1.00 11.18 ? 156  ASN B O   1 
ATOM   2913 C CB  . ASN B 1 156 ? 29.042 21.086  18.181  1.00 13.95 ? 156  ASN B CB  1 
ATOM   2914 C CG  . ASN B 1 156 ? 28.487 22.362  17.582  1.00 13.10 ? 156  ASN B CG  1 
ATOM   2915 O OD1 . ASN B 1 156 ? 27.684 23.067  18.197  1.00 11.24 ? 156  ASN B OD1 1 
ATOM   2916 N ND2 . ASN B 1 156 ? 28.904 22.658  16.365  1.00 18.89 ? 156  ASN B ND2 1 
ATOM   2917 N N   . PHE B 1 157 ? 26.733 21.638  20.870  1.00 15.10 ? 157  PHE B N   1 
ATOM   2918 C CA  . PHE B 1 157 ? 25.312 21.630  21.202  1.00 13.70 ? 157  PHE B CA  1 
ATOM   2919 C C   . PHE B 1 157 ? 24.360 22.280  20.221  1.00 13.69 ? 157  PHE B C   1 
ATOM   2920 O O   . PHE B 1 157 ? 23.165 21.980  20.228  1.00 14.37 ? 157  PHE B O   1 
ATOM   2921 C CB  . PHE B 1 157 ? 25.082 22.139  22.618  1.00 13.21 ? 157  PHE B CB  1 
ATOM   2922 C CG  . PHE B 1 157 ? 25.197 21.057  23.650  1.00 15.06 ? 157  PHE B CG  1 
ATOM   2923 C CD1 . PHE B 1 157 ? 26.445 20.571  24.032  1.00 16.31 ? 157  PHE B CD1 1 
ATOM   2924 C CD2 . PHE B 1 157 ? 24.057 20.482  24.199  1.00 15.54 ? 157  PHE B CD2 1 
ATOM   2925 C CE1 . PHE B 1 157 ? 26.557 19.527  24.943  1.00 16.56 ? 157  PHE B CE1 1 
ATOM   2926 C CE2 . PHE B 1 157 ? 24.158 19.438  25.112  1.00 18.31 ? 157  PHE B CE2 1 
ATOM   2927 C CZ  . PHE B 1 157 ? 25.410 18.959  25.483  1.00 20.40 ? 157  PHE B CZ  1 
ATOM   2928 N N   . ASP B 1 158 ? 24.883 23.156  19.373  1.00 15.71 ? 158  ASP B N   1 
ATOM   2929 C CA  . ASP B 1 158 ? 24.065 23.792  18.350  1.00 15.60 ? 158  ASP B CA  1 
ATOM   2930 C C   . ASP B 1 158 ? 23.767 22.734  17.286  1.00 17.26 ? 158  ASP B C   1 
ATOM   2931 O O   . ASP B 1 158 ? 22.716 22.764  16.630  1.00 21.16 ? 158  ASP B O   1 
ATOM   2932 C CB  . ASP B 1 158 ? 24.789 24.982  17.735  1.00 17.57 ? 158  ASP B CB  1 
ATOM   2933 C CG  . ASP B 1 158 ? 24.965 26.139  18.718  1.00 21.48 ? 158  ASP B CG  1 
ATOM   2934 O OD1 . ASP B 1 158 ? 24.449 26.084  19.857  1.00 28.48 ? 158  ASP B OD1 1 
ATOM   2935 O OD2 . ASP B 1 158 ? 25.633 27.116  18.339  1.00 30.25 ? 158  ASP B OD2 1 
ATOM   2936 N N   . GLU B 1 159 ? 24.680 21.773  17.152  1.00 14.96 ? 159  GLU B N   1 
ATOM   2937 C CA  . GLU B 1 159 ? 24.527 20.668  16.219  1.00 9.82  ? 159  GLU B CA  1 
ATOM   2938 C C   . GLU B 1 159 ? 23.549 19.656  16.811  1.00 11.10 ? 159  GLU B C   1 
ATOM   2939 O O   . GLU B 1 159 ? 22.692 19.115  16.100  1.00 6.33  ? 159  GLU B O   1 
ATOM   2940 C CB  . GLU B 1 159 ? 25.878 20.005  15.945  1.00 12.03 ? 159  GLU B CB  1 
ATOM   2941 C CG  . GLU B 1 159 ? 25.795 18.784  15.028  1.00 15.42 ? 159  GLU B CG  1 
ATOM   2942 C CD  . GLU B 1 159 ? 25.203 19.089  13.660  1.00 7.74  ? 159  GLU B CD  1 
ATOM   2943 O OE1 . GLU B 1 159 ? 25.053 20.273  13.299  1.00 7.03  ? 159  GLU B OE1 1 
ATOM   2944 O OE2 . GLU B 1 159 ? 24.883 18.142  12.922  1.00 5.72  ? 159  GLU B OE2 1 
ATOM   2945 N N   . ILE B 1 160 ? 23.649 19.429  18.121  1.00 6.92  ? 160  ILE B N   1 
ATOM   2946 C CA  . ILE B 1 160 ? 22.739 18.505  18.780  1.00 10.64 ? 160  ILE B CA  1 
ATOM   2947 C C   . ILE B 1 160 ? 21.304 19.051  18.699  1.00 11.12 ? 160  ILE B C   1 
ATOM   2948 O O   . ILE B 1 160 ? 20.362 18.306  18.456  1.00 9.93  ? 160  ILE B O   1 
ATOM   2949 C CB  . ILE B 1 160 ? 23.160 18.235  20.242  1.00 11.55 ? 160  ILE B CB  1 
ATOM   2950 C CG1 . ILE B 1 160 ? 24.432 17.379  20.267  1.00 11.34 ? 160  ILE B CG1 1 
ATOM   2951 C CG2 . ILE B 1 160 ? 22.035 17.531  21.015  1.00 11.94 ? 160  ILE B CG2 1 
ATOM   2952 C CD1 . ILE B 1 160 ? 24.989 17.116  21.684  1.00 9.44  ? 160  ILE B CD1 1 
ATOM   2953 N N   . LEU B 1 161 ? 21.150 20.359  18.847  1.00 10.75 ? 161  LEU B N   1 
ATOM   2954 C CA  . LEU B 1 161 ? 19.830 20.970  18.755  1.00 14.03 ? 161  LEU B CA  1 
ATOM   2955 C C   . LEU B 1 161 ? 19.317 20.919  17.305  1.00 15.54 ? 161  LEU B C   1 
ATOM   2956 O O   . LEU B 1 161 ? 18.158 20.577  17.048  1.00 15.97 ? 161  LEU B O   1 
ATOM   2957 C CB  . LEU B 1 161 ? 19.895 22.406  19.275  1.00 19.53 ? 161  LEU B CB  1 
ATOM   2958 C CG  . LEU B 1 161 ? 18.604 23.217  19.441  1.00 25.49 ? 161  LEU B CG  1 
ATOM   2959 C CD1 . LEU B 1 161 ? 17.474 22.350  19.991  1.00 21.08 ? 161  LEU B CD1 1 
ATOM   2960 C CD2 . LEU B 1 161 ? 18.893 24.412  20.361  1.00 29.57 ? 161  LEU B CD2 1 
ATOM   2961 N N   . ARG B 1 162 ? 20.200 21.213  16.358  1.00 14.34 ? 162  ARG B N   1 
ATOM   2962 C CA  . ARG B 1 162 ? 19.868 21.194  14.930  1.00 12.96 ? 162  ARG B CA  1 
ATOM   2963 C C   . ARG B 1 162 ? 19.338 19.826  14.467  1.00 12.70 ? 162  ARG B C   1 
ATOM   2964 O O   . ARG B 1 162 ? 18.383 19.735  13.702  1.00 11.78 ? 162  ARG B O   1 
ATOM   2965 C CB  . ARG B 1 162 ? 21.127 21.565  14.138  1.00 11.24 ? 162  ARG B CB  1 
ATOM   2966 C CG  . ARG B 1 162 ? 20.994 21.516  12.639  1.00 12.91 ? 162  ARG B CG  1 
ATOM   2967 C CD  . ARG B 1 162 ? 22.361 21.369  11.990  1.00 13.82 ? 162  ARG B CD  1 
ATOM   2968 N NE  . ARG B 1 162 ? 22.195 20.769  10.683  1.00 21.99 ? 162  ARG B NE  1 
ATOM   2969 C CZ  . ARG B 1 162 ? 22.447 19.501  10.380  1.00 17.42 ? 162  ARG B CZ  1 
ATOM   2970 N NH1 . ARG B 1 162 ? 22.932 18.662  11.273  1.00 16.11 ? 162  ARG B NH1 1 
ATOM   2971 N NH2 . ARG B 1 162 ? 22.079 19.042  9.198   1.00 30.69 ? 162  ARG B NH2 1 
ATOM   2972 N N   . VAL B 1 163 ? 19.986 18.771  14.938  1.00 12.64 ? 163  VAL B N   1 
ATOM   2973 C CA  . VAL B 1 163 ? 19.664 17.393  14.607  1.00 9.96  ? 163  VAL B CA  1 
ATOM   2974 C C   . VAL B 1 163 ? 18.329 16.937  15.216  1.00 11.44 ? 163  VAL B C   1 
ATOM   2975 O O   . VAL B 1 163 ? 17.609 16.140  14.619  1.00 8.91  ? 163  VAL B O   1 
ATOM   2976 C CB  . VAL B 1 163 ? 20.895 16.502  14.988  1.00 11.04 ? 163  VAL B CB  1 
ATOM   2977 C CG1 . VAL B 1 163 ? 20.540 15.361  15.895  1.00 15.79 ? 163  VAL B CG1 1 
ATOM   2978 C CG2 . VAL B 1 163 ? 21.601 16.043  13.747  1.00 13.78 ? 163  VAL B CG2 1 
ATOM   2979 N N   . VAL B 1 164 ? 17.977 17.497  16.370  1.00 12.75 ? 164  VAL B N   1 
ATOM   2980 C CA  . VAL B 1 164 ? 16.721 17.202  17.064  1.00 13.36 ? 164  VAL B CA  1 
ATOM   2981 C C   . VAL B 1 164 ? 15.551 17.795  16.252  1.00 15.58 ? 164  VAL B C   1 
ATOM   2982 O O   . VAL B 1 164 ? 14.555 17.128  15.987  1.00 14.55 ? 164  VAL B O   1 
ATOM   2983 C CB  . VAL B 1 164 ? 16.749 17.789  18.516  1.00 14.55 ? 164  VAL B CB  1 
ATOM   2984 C CG1 . VAL B 1 164 ? 15.343 17.809  19.142  1.00 16.86 ? 164  VAL B CG1 1 
ATOM   2985 C CG2 . VAL B 1 164 ? 17.695 16.969  19.388  1.00 11.17 ? 164  VAL B CG2 1 
ATOM   2986 N N   . ILE B 1 165 ? 15.701 19.046  15.840  1.00 14.97 ? 165  ILE B N   1 
ATOM   2987 C CA  . ILE B 1 165 ? 14.699 19.727  15.033  1.00 13.13 ? 165  ILE B CA  1 
ATOM   2988 C C   . ILE B 1 165 ? 14.489 18.911  13.749  1.00 12.99 ? 165  ILE B C   1 
ATOM   2989 O O   . ILE B 1 165 ? 13.361 18.667  13.335  1.00 13.27 ? 165  ILE B O   1 
ATOM   2990 C CB  . ILE B 1 165 ? 15.179 21.175  14.713  1.00 13.39 ? 165  ILE B CB  1 
ATOM   2991 C CG1 . ILE B 1 165 ? 15.406 21.924  16.026  1.00 15.19 ? 165  ILE B CG1 1 
ATOM   2992 C CG2 . ILE B 1 165 ? 14.180 21.922  13.863  1.00 10.68 ? 165  ILE B CG2 1 
ATOM   2993 C CD1 . ILE B 1 165 ? 15.965 23.324  15.860  1.00 15.42 ? 165  ILE B CD1 1 
ATOM   2994 N N   . SER B 1 166 ? 15.582 18.455  13.143  1.00 9.96  ? 166  SER B N   1 
ATOM   2995 C CA  . SER B 1 166 ? 15.522 17.649  11.927  1.00 9.74  ? 166  SER B CA  1 
ATOM   2996 C C   . SER B 1 166 ? 14.731 16.350  12.153  1.00 11.30 ? 166  SER B C   1 
ATOM   2997 O O   . SER B 1 166 ? 13.812 16.051  11.407  1.00 12.75 ? 166  SER B O   1 
ATOM   2998 C CB  . SER B 1 166 ? 16.946 17.343  11.449  1.00 8.47  ? 166  SER B CB  1 
ATOM   2999 O OG  . SER B 1 166 ? 16.970 16.411  10.396  1.00 12.33 ? 166  SER B OG  1 
ATOM   3000 N N   . LEU B 1 167 ? 15.088 15.599  13.193  1.00 15.75 ? 167  LEU B N   1 
ATOM   3001 C CA  . LEU B 1 167 ? 14.416 14.341  13.555  1.00 14.48 ? 167  LEU B CA  1 
ATOM   3002 C C   . LEU B 1 167 ? 12.908 14.554  13.744  1.00 15.41 ? 167  LEU B C   1 
ATOM   3003 O O   . LEU B 1 167 ? 12.083 13.751  13.305  1.00 13.89 ? 167  LEU B O   1 
ATOM   3004 C CB  . LEU B 1 167 ? 14.998 13.812  14.870  1.00 13.09 ? 167  LEU B CB  1 
ATOM   3005 C CG  . LEU B 1 167 ? 15.979 12.634  14.932  1.00 19.91 ? 167  LEU B CG  1 
ATOM   3006 C CD1 . LEU B 1 167 ? 16.662 12.375  13.613  1.00 16.95 ? 167  LEU B CD1 1 
ATOM   3007 C CD2 . LEU B 1 167 ? 16.985 12.889  16.060  1.00 14.57 ? 167  LEU B CD2 1 
ATOM   3008 N N   . GLN B 1 168 ? 12.547 15.627  14.436  1.00 12.97 ? 168  GLN B N   1 
ATOM   3009 C CA  . GLN B 1 168 ? 11.147 15.912  14.679  1.00 14.00 ? 168  GLN B CA  1 
ATOM   3010 C C   . GLN B 1 168 ? 10.427 16.315  13.398  1.00 14.53 ? 168  GLN B C   1 
ATOM   3011 O O   . GLN B 1 168 ? 9.281  15.922  13.188  1.00 15.28 ? 168  GLN B O   1 
ATOM   3012 C CB  . GLN B 1 168 ? 10.996 16.946  15.785  1.00 11.36 ? 168  GLN B CB  1 
ATOM   3013 C CG  . GLN B 1 168 ? 11.445 16.411  17.134  1.00 11.32 ? 168  GLN B CG  1 
ATOM   3014 C CD  . GLN B 1 168 ? 11.270 17.409  18.253  1.00 17.72 ? 168  GLN B CD  1 
ATOM   3015 O OE1 . GLN B 1 168 ? 11.147 18.603  18.019  1.00 22.71 ? 168  GLN B OE1 1 
ATOM   3016 N NE2 . GLN B 1 168 ? 11.268 16.921  19.484  1.00 12.45 ? 168  GLN B NE2 1 
ATOM   3017 N N   . LEU B 1 169 ? 11.127 17.018  12.511  1.00 13.70 ? 169  LEU B N   1 
ATOM   3018 C CA  . LEU B 1 169 ? 10.559 17.422  11.233  1.00 13.19 ? 169  LEU B CA  1 
ATOM   3019 C C   . LEU B 1 169 ? 10.180 16.182  10.440  1.00 13.00 ? 169  LEU B C   1 
ATOM   3020 O O   . LEU B 1 169 ? 9.111  16.118  9.847   1.00 15.58 ? 169  LEU B O   1 
ATOM   3021 C CB  . LEU B 1 169 ? 11.557 18.245  10.426  1.00 14.01 ? 169  LEU B CB  1 
ATOM   3022 C CG  . LEU B 1 169 ? 11.320 19.742  10.248  1.00 18.87 ? 169  LEU B CG  1 
ATOM   3023 C CD1 . LEU B 1 169 ? 12.420 20.306  9.362   1.00 15.51 ? 169  LEU B CD1 1 
ATOM   3024 C CD2 . LEU B 1 169 ? 9.954  20.000  9.621   1.00 17.46 ? 169  LEU B CD2 1 
ATOM   3025 N N   . THR B 1 170 ? 11.070 15.199  10.419  1.00 16.06 ? 170  THR B N   1 
ATOM   3026 C CA  . THR B 1 170 ? 10.819 13.956  9.703   1.00 14.00 ? 170  THR B CA  1 
ATOM   3027 C C   . THR B 1 170 ? 9.625  13.221  10.295  1.00 17.33 ? 170  THR B C   1 
ATOM   3028 O O   . THR B 1 170 ? 8.743  12.770  9.565   1.00 17.36 ? 170  THR B O   1 
ATOM   3029 C CB  . THR B 1 170 ? 12.058 13.056  9.741   1.00 11.26 ? 170  THR B CB  1 
ATOM   3030 O OG1 . THR B 1 170 ? 13.140 13.746  9.106   1.00 19.29 ? 170  THR B OG1 1 
ATOM   3031 C CG2 . THR B 1 170 ? 11.801 11.756  9.007   1.00 13.69 ? 170  THR B CG2 1 
ATOM   3032 N N   . ALA B 1 171 ? 9.589  13.119  11.618  1.00 16.96 ? 171  ALA B N   1 
ATOM   3033 C CA  . ALA B 1 171 ? 8.498  12.428  12.298  1.00 17.63 ? 171  ALA B CA  1 
ATOM   3034 C C   . ALA B 1 171 ? 7.136  13.079  12.080  1.00 18.53 ? 171  ALA B C   1 
ATOM   3035 O O   . ALA B 1 171 ? 6.147  12.392  11.887  1.00 18.83 ? 171  ALA B O   1 
ATOM   3036 C CB  . ALA B 1 171 ? 8.793  12.311  13.801  1.00 16.31 ? 171  ALA B CB  1 
ATOM   3037 N N   . GLU B 1 172 ? 7.071  14.401  12.091  1.00 18.89 ? 172  GLU B N   1 
ATOM   3038 C CA  . GLU B 1 172 ? 5.775  15.031  11.917  1.00 22.23 ? 172  GLU B CA  1 
ATOM   3039 C C   . GLU B 1 172 ? 5.406  15.544  10.534  1.00 19.45 ? 172  GLU B C   1 
ATOM   3040 O O   . GLU B 1 172 ? 4.230  15.518  10.171  1.00 19.65 ? 172  GLU B O   1 
ATOM   3041 C CB  . GLU B 1 172 ? 5.570  16.113  12.972  1.00 27.16 ? 172  GLU B CB  1 
ATOM   3042 C CG  . GLU B 1 172 ? 6.677  17.120  13.029  1.00 41.76 ? 172  GLU B CG  1 
ATOM   3043 C CD  . GLU B 1 172 ? 6.699  17.871  14.342  1.00 51.77 ? 172  GLU B CD  1 
ATOM   3044 O OE1 . GLU B 1 172 ? 6.637  17.209  15.409  1.00 55.20 ? 172  GLU B OE1 1 
ATOM   3045 O OE2 . GLU B 1 172 ? 6.777  19.120  14.303  1.00 58.76 ? 172  GLU B OE2 1 
ATOM   3046 N N   . LYS B 1 173 ? 6.390  15.991  9.759   1.00 14.82 ? 173  LYS B N   1 
ATOM   3047 C CA  . LYS B 1 173 ? 6.132  16.532  8.420   1.00 12.92 ? 173  LYS B CA  1 
ATOM   3048 C C   . LYS B 1 173 ? 6.505  15.627  7.252   1.00 14.91 ? 173  LYS B C   1 
ATOM   3049 O O   . LYS B 1 173 ? 6.299  15.990  6.099   1.00 18.11 ? 173  LYS B O   1 
ATOM   3050 C CB  . LYS B 1 173 ? 6.843  17.865  8.261   1.00 16.79 ? 173  LYS B CB  1 
ATOM   3051 C CG  . LYS B 1 173 ? 6.587  18.817  9.401   1.00 21.58 ? 173  LYS B CG  1 
ATOM   3052 C CD  . LYS B 1 173 ? 5.129  19.182  9.461   1.00 30.15 ? 173  LYS B CD  1 
ATOM   3053 C CE  . LYS B 1 173 ? 4.872  20.242  10.515  1.00 38.83 ? 173  LYS B CE  1 
ATOM   3054 N NZ  . LYS B 1 173 ? 3.508  20.821  10.334  1.00 42.63 ? 173  LYS B NZ  1 
ATOM   3055 N N   . ARG B 1 174 ? 7.112  14.482  7.551   1.00 12.79 ? 174  ARG B N   1 
ATOM   3056 C CA  . ARG B 1 174 ? 7.502  13.519  6.529   1.00 13.30 ? 174  ARG B CA  1 
ATOM   3057 C C   . ARG B 1 174 ? 8.468  14.069  5.474   1.00 12.55 ? 174  ARG B C   1 
ATOM   3058 O O   . ARG B 1 174 ? 8.352  13.807  4.270   1.00 10.91 ? 174  ARG B O   1 
ATOM   3059 C CB  . ARG B 1 174 ? 6.253  12.913  5.888   1.00 17.79 ? 174  ARG B CB  1 
ATOM   3060 C CG  . ARG B 1 174 ? 5.317  12.299  6.919   1.00 19.67 ? 174  ARG B CG  1 
ATOM   3061 C CD  . ARG B 1 174 ? 4.753  10.996  6.440   1.00 24.35 ? 174  ARG B CD  1 
ATOM   3062 N NE  . ARG B 1 174 ? 3.689  11.196  5.475   1.00 22.96 ? 174  ARG B NE  1 
ATOM   3063 C CZ  . ARG B 1 174 ? 3.489  10.437  4.402   1.00 22.07 ? 174  ARG B CZ  1 
ATOM   3064 N NH1 . ARG B 1 174 ? 4.306  9.414   4.132   1.00 20.97 ? 174  ARG B NH1 1 
ATOM   3065 N NH2 . ARG B 1 174 ? 2.404  10.644  3.665   1.00 20.22 ? 174  ARG B NH2 1 
ATOM   3066 N N   . VAL B 1 175 ? 9.474  14.773  5.958   1.00 11.17 ? 175  VAL B N   1 
ATOM   3067 C CA  . VAL B 1 175 ? 10.484 15.361  5.103   1.00 10.70 ? 175  VAL B CA  1 
ATOM   3068 C C   . VAL B 1 175 ? 11.864 14.953  5.633   1.00 13.61 ? 175  VAL B C   1 
ATOM   3069 O O   . VAL B 1 175 ? 11.985 14.515  6.785   1.00 12.00 ? 175  VAL B O   1 
ATOM   3070 C CB  . VAL B 1 175 ? 10.372 16.905  5.112   1.00 7.02  ? 175  VAL B CB  1 
ATOM   3071 C CG1 . VAL B 1 175 ? 9.088  17.343  4.447   1.00 6.96  ? 175  VAL B CG1 1 
ATOM   3072 C CG2 . VAL B 1 175 ? 10.404 17.424  6.522   1.00 10.19 ? 175  VAL B CG2 1 
ATOM   3073 N N   . ALA B 1 176 ? 12.886 15.063  4.784   1.00 10.54 ? 176  ALA B N   1 
ATOM   3074 C CA  . ALA B 1 176 ? 14.262 14.752  5.156   1.00 11.99 ? 176  ALA B CA  1 
ATOM   3075 C C   . ALA B 1 176 ? 15.063 16.030  4.992   1.00 10.91 ? 176  ALA B C   1 
ATOM   3076 O O   . ALA B 1 176 ? 14.770 16.831  4.112   1.00 14.89 ? 176  ALA B O   1 
ATOM   3077 C CB  . ALA B 1 176 ? 14.823 13.686  4.239   1.00 9.33  ? 176  ALA B CB  1 
ATOM   3078 N N   . THR B 1 177 ? 16.072 16.237  5.823   1.00 10.87 ? 177  THR B N   1 
ATOM   3079 C CA  . THR B 1 177 ? 16.896 17.436  5.707   1.00 9.99  ? 177  THR B CA  1 
ATOM   3080 C C   . THR B 1 177 ? 18.202 17.086  4.977   1.00 11.99 ? 177  THR B C   1 
ATOM   3081 O O   . THR B 1 177 ? 18.797 16.026  5.215   1.00 11.34 ? 177  THR B O   1 
ATOM   3082 C CB  . THR B 1 177 ? 17.160 18.053  7.103   1.00 7.16  ? 177  THR B CB  1 
ATOM   3083 O OG1 . THR B 1 177 ? 17.830 17.104  7.938   1.00 9.55  ? 177  THR B OG1 1 
ATOM   3084 C CG2 . THR B 1 177 ? 15.839 18.395  7.771   1.00 12.24 ? 177  THR B CG2 1 
ATOM   3085 N N   . PRO B 1 178 ? 18.598 17.914  3.994   1.00 11.89 ? 178  PRO B N   1 
ATOM   3086 C CA  . PRO B 1 178 ? 19.835 17.660  3.233   1.00 13.04 ? 178  PRO B CA  1 
ATOM   3087 C C   . PRO B 1 178 ? 21.103 18.008  4.022   1.00 10.29 ? 178  PRO B C   1 
ATOM   3088 O O   . PRO B 1 178 ? 21.006 18.447  5.174   1.00 8.85  ? 178  PRO B O   1 
ATOM   3089 C CB  . PRO B 1 178 ? 19.655 18.550  2.001   1.00 8.46  ? 178  PRO B CB  1 
ATOM   3090 C CG  . PRO B 1 178 ? 18.886 19.730  2.544   1.00 5.61  ? 178  PRO B CG  1 
ATOM   3091 C CD  . PRO B 1 178 ? 17.864 19.080  3.457   1.00 11.07 ? 178  PRO B CD  1 
ATOM   3092 N N   . VAL B 1 179 ? 22.286 17.787  3.440   1.00 12.62 ? 179  VAL B N   1 
ATOM   3093 C CA  . VAL B 1 179 ? 23.529 18.141  4.158   1.00 14.31 ? 179  VAL B CA  1 
ATOM   3094 C C   . VAL B 1 179 ? 23.502 19.592  4.578   1.00 13.32 ? 179  VAL B C   1 
ATOM   3095 O O   . VAL B 1 179 ? 22.915 20.426  3.890   1.00 16.80 ? 179  VAL B O   1 
ATOM   3096 C CB  . VAL B 1 179 ? 24.827 18.095  3.311   1.00 16.90 ? 179  VAL B CB  1 
ATOM   3097 C CG1 . VAL B 1 179 ? 25.620 16.884  3.615   1.00 22.23 ? 179  VAL B CG1 1 
ATOM   3098 C CG2 . VAL B 1 179 ? 24.557 18.309  1.839   1.00 8.11  ? 179  VAL B CG2 1 
ATOM   3099 N N   . ASP B 1 180 ? 24.186 19.879  5.678   1.00 13.90 ? 180  ASP B N   1 
ATOM   3100 C CA  . ASP B 1 180 ? 24.332 21.230  6.209   1.00 12.70 ? 180  ASP B CA  1 
ATOM   3101 C C   . ASP B 1 180 ? 23.063 22.065  6.293   1.00 9.80  ? 180  ASP B C   1 
ATOM   3102 O O   . ASP B 1 180 ? 23.123 23.282  6.296   1.00 13.44 ? 180  ASP B O   1 
ATOM   3103 C CB  . ASP B 1 180 ? 25.396 21.979  5.392   1.00 13.47 ? 180  ASP B CB  1 
ATOM   3104 C CG  . ASP B 1 180 ? 26.712 21.196  5.259   1.00 13.78 ? 180  ASP B CG  1 
ATOM   3105 O OD1 . ASP B 1 180 ? 26.960 20.287  6.055   1.00 15.36 ? 180  ASP B OD1 1 
ATOM   3106 O OD2 . ASP B 1 180 ? 27.492 21.466  4.327   1.00 18.78 ? 180  ASP B OD2 1 
ATOM   3107 N N   . TRP B 1 181 ? 21.917 21.409  6.379   1.00 12.90 ? 181  TRP B N   1 
ATOM   3108 C CA  . TRP B 1 181 ? 20.628 22.100  6.477   1.00 10.46 ? 181  TRP B CA  1 
ATOM   3109 C C   . TRP B 1 181 ? 20.580 22.978  7.727   1.00 11.63 ? 181  TRP B C   1 
ATOM   3110 O O   . TRP B 1 181 ? 21.049 22.566  8.788   1.00 14.22 ? 181  TRP B O   1 
ATOM   3111 C CB  . TRP B 1 181 ? 19.511 21.056  6.545   1.00 8.53  ? 181  TRP B CB  1 
ATOM   3112 C CG  . TRP B 1 181 ? 18.151 21.602  6.865   1.00 8.60  ? 181  TRP B CG  1 
ATOM   3113 C CD1 . TRP B 1 181 ? 17.244 22.109  5.979   1.00 10.61 ? 181  TRP B CD1 1 
ATOM   3114 C CD2 . TRP B 1 181 ? 17.522 21.637  8.149   1.00 7.21  ? 181  TRP B CD2 1 
ATOM   3115 N NE1 . TRP B 1 181 ? 16.081 22.446  6.630   1.00 13.59 ? 181  TRP B NE1 1 
ATOM   3116 C CE2 . TRP B 1 181 ? 16.223 22.164  7.965   1.00 12.10 ? 181  TRP B CE2 1 
ATOM   3117 C CE3 . TRP B 1 181 ? 17.924 21.268  9.437   1.00 9.32  ? 181  TRP B CE3 1 
ATOM   3118 C CZ2 . TRP B 1 181 ? 15.320 22.331  9.031   1.00 11.99 ? 181  TRP B CZ2 1 
ATOM   3119 C CZ3 . TRP B 1 181 ? 17.024 21.434  10.501  1.00 11.66 ? 181  TRP B CZ3 1 
ATOM   3120 C CH2 . TRP B 1 181 ? 15.742 21.959  10.286  1.00 9.47  ? 181  TRP B CH2 1 
ATOM   3121 N N   . LYS B 1 182 ? 20.032 24.186  7.599   1.00 11.81 ? 182  LYS B N   1 
ATOM   3122 C CA  . LYS B 1 182 ? 19.886 25.106  8.730   1.00 13.33 ? 182  LYS B CA  1 
ATOM   3123 C C   . LYS B 1 182 ? 18.391 25.267  8.881   1.00 13.57 ? 182  LYS B C   1 
ATOM   3124 O O   . LYS B 1 182 ? 17.671 25.203  7.895   1.00 11.72 ? 182  LYS B O   1 
ATOM   3125 C CB  . LYS B 1 182 ? 20.490 26.471  8.414   1.00 17.03 ? 182  LYS B CB  1 
ATOM   3126 C CG  . LYS B 1 182 ? 21.965 26.459  8.030   1.00 19.94 ? 182  LYS B CG  1 
ATOM   3127 C CD  . LYS B 1 182 ? 22.852 26.462  9.241   1.00 31.53 ? 182  LYS B CD  1 
ATOM   3128 C CE  . LYS B 1 182 ? 22.560 27.669  10.124  1.00 41.30 ? 182  LYS B CE  1 
ATOM   3129 N NZ  . LYS B 1 182 ? 22.673 28.992  9.422   1.00 45.15 ? 182  LYS B NZ  1 
ATOM   3130 N N   . ASP B 1 183 ? 17.924 25.455  10.108  1.00 17.67 ? 183  ASP B N   1 
ATOM   3131 C CA  . ASP B 1 183 ? 16.495 25.616  10.394  1.00 19.00 ? 183  ASP B CA  1 
ATOM   3132 C C   . ASP B 1 183 ? 15.874 26.700  9.515   1.00 16.44 ? 183  ASP B C   1 
ATOM   3133 O O   . ASP B 1 183 ? 16.282 27.857  9.571   1.00 16.05 ? 183  ASP B O   1 
ATOM   3134 C CB  . ASP B 1 183 ? 16.303 25.955  11.884  1.00 23.63 ? 183  ASP B CB  1 
ATOM   3135 C CG  . ASP B 1 183 ? 14.849 25.889  12.333  1.00 27.08 ? 183  ASP B CG  1 
ATOM   3136 O OD1 . ASP B 1 183 ? 14.003 25.317  11.608  1.00 33.13 ? 183  ASP B OD1 1 
ATOM   3137 O OD2 . ASP B 1 183 ? 14.545 26.409  13.431  1.00 28.80 ? 183  ASP B OD2 1 
ATOM   3138 N N   . GLY B 1 184 ? 14.906 26.314  8.687   1.00 14.84 ? 184  GLY B N   1 
ATOM   3139 C CA  . GLY B 1 184 ? 14.260 27.268  7.802   1.00 11.65 ? 184  GLY B CA  1 
ATOM   3140 C C   . GLY B 1 184 ? 14.552 27.024  6.325   1.00 14.25 ? 184  GLY B C   1 
ATOM   3141 O O   . GLY B 1 184 ? 13.823 27.503  5.462   1.00 16.15 ? 184  GLY B O   1 
ATOM   3142 N N   . ASP B 1 185 ? 15.613 26.282  6.033   1.00 14.96 ? 185  ASP B N   1 
ATOM   3143 C CA  . ASP B 1 185 ? 16.001 25.978  4.659   1.00 13.33 ? 185  ASP B CA  1 
ATOM   3144 C C   . ASP B 1 185 ? 15.051 24.977  4.020   1.00 17.31 ? 185  ASP B C   1 
ATOM   3145 O O   . ASP B 1 185 ? 14.301 24.277  4.717   1.00 18.82 ? 185  ASP B O   1 
ATOM   3146 C CB  . ASP B 1 185 ? 17.407 25.363  4.617   1.00 10.24 ? 185  ASP B CB  1 
ATOM   3147 C CG  . ASP B 1 185 ? 18.512 26.352  4.914   1.00 12.65 ? 185  ASP B CG  1 
ATOM   3148 O OD1 . ASP B 1 185 ? 18.308 27.581  4.867   1.00 16.17 ? 185  ASP B OD1 1 
ATOM   3149 O OD2 . ASP B 1 185 ? 19.632 25.887  5.187   1.00 18.81 ? 185  ASP B OD2 1 
ATOM   3150 N N   . SER B 1 186 ? 15.150 24.859  2.697   1.00 18.67 ? 186  SER B N   1 
ATOM   3151 C CA  . SER B 1 186 ? 14.346 23.916  1.943   1.00 17.90 ? 186  SER B CA  1 
ATOM   3152 C C   . SER B 1 186 ? 14.630 22.517  2.468   1.00 18.19 ? 186  SER B C   1 
ATOM   3153 O O   . SER B 1 186 ? 15.719 22.211  2.962   1.00 13.81 ? 186  SER B O   1 
ATOM   3154 C CB  . SER B 1 186 ? 14.660 23.983  0.454   1.00 17.34 ? 186  SER B CB  1 
ATOM   3155 O OG  . SER B 1 186 ? 13.770 24.872  -0.190  1.00 27.73 ? 186  SER B OG  1 
ATOM   3156 N N   . VAL B 1 187 ? 13.625 21.669  2.369   1.00 17.13 ? 187  VAL B N   1 
ATOM   3157 C CA  . VAL B 1 187 ? 13.740 20.324  2.861   1.00 15.37 ? 187  VAL B CA  1 
ATOM   3158 C C   . VAL B 1 187 ? 13.526 19.353  1.684   1.00 14.26 ? 187  VAL B C   1 
ATOM   3159 O O   . VAL B 1 187 ? 13.281 19.801  0.562   1.00 13.30 ? 187  VAL B O   1 
ATOM   3160 C CB  . VAL B 1 187 ? 12.737 20.170  4.029   1.00 17.25 ? 187  VAL B CB  1 
ATOM   3161 C CG1 . VAL B 1 187 ? 11.314 19.991  3.525   1.00 13.59 ? 187  VAL B CG1 1 
ATOM   3162 C CG2 . VAL B 1 187 ? 13.187 19.103  4.972   1.00 27.19 ? 187  VAL B CG2 1 
ATOM   3163 N N   . MET B 1 188 ? 13.656 18.047  1.917   1.00 15.13 ? 188  MET B N   1 
ATOM   3164 C CA  . MET B 1 188 ? 13.495 17.049  0.855   1.00 13.11 ? 188  MET B CA  1 
ATOM   3165 C C   . MET B 1 188 ? 12.337 16.091  1.100   1.00 13.31 ? 188  MET B C   1 
ATOM   3166 O O   . MET B 1 188 ? 12.060 15.713  2.236   1.00 14.49 ? 188  MET B O   1 
ATOM   3167 C CB  . MET B 1 188 ? 14.782 16.240  0.679   1.00 15.60 ? 188  MET B CB  1 
ATOM   3168 C CG  . MET B 1 188 ? 16.009 17.099  0.457   1.00 19.75 ? 188  MET B CG  1 
ATOM   3169 S SD  . MET B 1 188 ? 17.466 16.140  0.037   1.00 19.60 ? 188  MET B SD  1 
ATOM   3170 C CE  . MET B 1 188 ? 17.501 16.374  -1.678  1.00 12.82 ? 188  MET B CE  1 
ATOM   3171 N N   . VAL B 1 189 ? 11.676 15.684  0.022   1.00 12.89 ? 189  VAL B N   1 
ATOM   3172 C CA  . VAL B 1 189 ? 10.550 14.764  0.113   1.00 12.56 ? 189  VAL B CA  1 
ATOM   3173 C C   . VAL B 1 189 ? 11.112 13.366  0.383   1.00 16.88 ? 189  VAL B C   1 
ATOM   3174 O O   . VAL B 1 189 ? 12.156 13.004  -0.158  1.00 18.64 ? 189  VAL B O   1 
ATOM   3175 C CB  . VAL B 1 189 ? 9.697  14.768  -1.203  1.00 12.02 ? 189  VAL B CB  1 
ATOM   3176 C CG1 . VAL B 1 189 ? 8.479  13.844  -1.065  1.00 10.47 ? 189  VAL B CG1 1 
ATOM   3177 C CG2 . VAL B 1 189 ? 9.247  16.195  -1.545  1.00 12.99 ? 189  VAL B CG2 1 
ATOM   3178 N N   . LEU B 1 190 ? 10.471 12.609  1.272   1.00 14.31 ? 190  LEU B N   1 
ATOM   3179 C CA  . LEU B 1 190 ? 10.939 11.261  1.565   1.00 17.42 ? 190  LEU B CA  1 
ATOM   3180 C C   . LEU B 1 190 ? 10.809 10.479  0.273   1.00 19.25 ? 190  LEU B C   1 
ATOM   3181 O O   . LEU B 1 190 ? 9.780  10.552  -0.406  1.00 20.32 ? 190  LEU B O   1 
ATOM   3182 C CB  . LEU B 1 190 ? 10.108 10.608  2.674   1.00 15.63 ? 190  LEU B CB  1 
ATOM   3183 C CG  . LEU B 1 190 ? 10.273 11.246  4.042   1.00 14.34 ? 190  LEU B CG  1 
ATOM   3184 C CD1 . LEU B 1 190 ? 9.389  10.567  5.043   1.00 14.73 ? 190  LEU B CD1 1 
ATOM   3185 C CD2 . LEU B 1 190 ? 11.723 11.137  4.465   1.00 17.31 ? 190  LEU B CD2 1 
ATOM   3186 N N   . PRO B 1 191 ? 11.856 9.725   -0.096  1.00 20.56 ? 191  PRO B N   1 
ATOM   3187 C CA  . PRO B 1 191 ? 11.852 8.929   -1.330  1.00 20.53 ? 191  PRO B CA  1 
ATOM   3188 C C   . PRO B 1 191 ? 10.671 7.964   -1.486  1.00 20.47 ? 191  PRO B C   1 
ATOM   3189 O O   . PRO B 1 191 ? 10.263 7.647   -2.601  1.00 18.72 ? 191  PRO B O   1 
ATOM   3190 C CB  . PRO B 1 191 ? 13.207 8.210   -1.280  1.00 21.84 ? 191  PRO B CB  1 
ATOM   3191 C CG  . PRO B 1 191 ? 13.550 8.182   0.191   1.00 20.85 ? 191  PRO B CG  1 
ATOM   3192 C CD  . PRO B 1 191 ? 13.117 9.547   0.645   1.00 20.17 ? 191  PRO B CD  1 
ATOM   3193 N N   . THR B 1 192 ? 10.089 7.545   -0.368  1.00 20.61 ? 192  THR B N   1 
ATOM   3194 C CA  . THR B 1 192 ? 8.962  6.622   -0.394  1.00 22.55 ? 192  THR B CA  1 
ATOM   3195 C C   . THR B 1 192 ? 7.637  7.317   -0.685  1.00 19.16 ? 192  THR B C   1 
ATOM   3196 O O   . THR B 1 192 ? 6.602  6.667   -0.756  1.00 24.61 ? 192  THR B O   1 
ATOM   3197 C CB  . THR B 1 192 ? 8.846  5.842   0.938   1.00 21.64 ? 192  THR B CB  1 
ATOM   3198 O OG1 . THR B 1 192 ? 8.663  6.756   2.026   1.00 26.38 ? 192  THR B OG1 1 
ATOM   3199 C CG2 . THR B 1 192 ? 10.113 5.047   1.194   1.00 23.17 ? 192  THR B CG2 1 
ATOM   3200 N N   . ILE B 1 193 ? 7.666  8.632   -0.846  1.00 15.94 ? 193  ILE B N   1 
ATOM   3201 C CA  . ILE B 1 193 ? 6.447  9.375   -1.125  1.00 16.42 ? 193  ILE B CA  1 
ATOM   3202 C C   . ILE B 1 193 ? 6.220  9.517   -2.626  1.00 18.35 ? 193  ILE B C   1 
ATOM   3203 O O   . ILE B 1 193 ? 6.964  10.227  -3.307  1.00 19.02 ? 193  ILE B O   1 
ATOM   3204 C CB  . ILE B 1 193 ? 6.451  10.784  -0.463  1.00 16.90 ? 193  ILE B CB  1 
ATOM   3205 C CG1 . ILE B 1 193 ? 6.614  10.655  1.060   1.00 15.83 ? 193  ILE B CG1 1 
ATOM   3206 C CG2 . ILE B 1 193 ? 5.152  11.531  -0.799  1.00 11.36 ? 193  ILE B CG2 1 
ATOM   3207 C CD1 . ILE B 1 193 ? 6.544  11.980  1.837   1.00 12.82 ? 193  ILE B CD1 1 
ATOM   3208 N N   . PRO B 1 194 ? 5.172  8.857   -3.157  1.00 21.71 ? 194  PRO B N   1 
ATOM   3209 C CA  . PRO B 1 194 ? 4.813  8.890   -4.579  1.00 22.54 ? 194  PRO B CA  1 
ATOM   3210 C C   . PRO B 1 194 ? 4.588  10.307  -5.096  1.00 24.42 ? 194  PRO B C   1 
ATOM   3211 O O   . PRO B 1 194 ? 4.238  11.219  -4.336  1.00 23.01 ? 194  PRO B O   1 
ATOM   3212 C CB  . PRO B 1 194 ? 3.523  8.072   -4.618  1.00 21.35 ? 194  PRO B CB  1 
ATOM   3213 C CG  . PRO B 1 194 ? 3.741  7.076   -3.554  1.00 20.97 ? 194  PRO B CG  1 
ATOM   3214 C CD  . PRO B 1 194 ? 4.268  7.942   -2.435  1.00 20.01 ? 194  PRO B CD  1 
ATOM   3215 N N   . GLU B 1 195 ? 4.758  10.471  -6.403  1.00 22.33 ? 195  GLU B N   1 
ATOM   3216 C CA  . GLU B 1 195 ? 4.595  11.752  -7.061  1.00 24.20 ? 195  GLU B CA  1 
ATOM   3217 C C   . GLU B 1 195 ? 3.183  12.284  -6.852  1.00 22.91 ? 195  GLU B C   1 
ATOM   3218 O O   . GLU B 1 195 ? 3.000  13.437  -6.457  1.00 21.16 ? 195  GLU B O   1 
ATOM   3219 C CB  . GLU B 1 195 ? 4.883  11.573  -8.543  1.00 30.59 ? 195  GLU B CB  1 
ATOM   3220 C CG  . GLU B 1 195 ? 5.207  12.845  -9.294  1.00 42.18 ? 195  GLU B CG  1 
ATOM   3221 C CD  . GLU B 1 195 ? 5.592  12.570  -10.753 1.00 51.20 ? 195  GLU B CD  1 
ATOM   3222 O OE1 . GLU B 1 195 ? 5.963  11.408  -11.081 1.00 51.78 ? 195  GLU B OE1 1 
ATOM   3223 O OE2 . GLU B 1 195 ? 5.547  13.518  -11.569 1.00 50.90 ? 195  GLU B OE2 1 
ATOM   3224 N N   . GLU B 1 196 ? 2.193  11.421  -7.071  1.00 23.33 ? 196  GLU B N   1 
ATOM   3225 C CA  . GLU B 1 196 ? 0.785  11.787  -6.909  1.00 24.88 ? 196  GLU B CA  1 
ATOM   3226 C C   . GLU B 1 196 ? 0.531  12.263  -5.492  1.00 23.73 ? 196  GLU B C   1 
ATOM   3227 O O   . GLU B 1 196 ? -0.204 13.222  -5.272  1.00 26.64 ? 196  GLU B O   1 
ATOM   3228 C CB  . GLU B 1 196 ? -0.153 10.597  -7.157  1.00 28.87 ? 196  GLU B CB  1 
ATOM   3229 C CG  . GLU B 1 196 ? 0.314  9.551   -8.158  1.00 40.29 ? 196  GLU B CG  1 
ATOM   3230 C CD  . GLU B 1 196 ? 1.154  8.462   -7.523  1.00 45.72 ? 196  GLU B CD  1 
ATOM   3231 O OE1 . GLU B 1 196 ? 0.575  7.611   -6.813  1.00 49.87 ? 196  GLU B OE1 1 
ATOM   3232 O OE2 . GLU B 1 196 ? 2.391  8.456   -7.727  1.00 49.16 ? 196  GLU B OE2 1 
ATOM   3233 N N   . GLU B 1 197 ? 1.145  11.581  -4.533  1.00 19.46 ? 197  GLU B N   1 
ATOM   3234 C CA  . GLU B 1 197 ? 0.969  11.903  -3.133  1.00 21.81 ? 197  GLU B CA  1 
ATOM   3235 C C   . GLU B 1 197 ? 1.690  13.176  -2.684  1.00 20.67 ? 197  GLU B C   1 
ATOM   3236 O O   . GLU B 1 197 ? 1.101  14.039  -2.028  1.00 18.91 ? 197  GLU B O   1 
ATOM   3237 C CB  . GLU B 1 197 ? 1.392  10.714  -2.292  1.00 21.43 ? 197  GLU B CB  1 
ATOM   3238 C CG  . GLU B 1 197 ? 1.149  10.883  -0.814  1.00 26.89 ? 197  GLU B CG  1 
ATOM   3239 C CD  . GLU B 1 197 ? 1.507  9.644   -0.031  1.00 29.52 ? 197  GLU B CD  1 
ATOM   3240 O OE1 . GLU B 1 197 ? 1.319  8.515   -0.548  1.00 41.99 ? 197  GLU B OE1 1 
ATOM   3241 O OE2 . GLU B 1 197 ? 1.977  9.785   1.109   1.00 32.99 ? 197  GLU B OE2 1 
ATOM   3242 N N   . ALA B 1 198 ? 2.950  13.311  -3.076  1.00 18.53 ? 198  ALA B N   1 
ATOM   3243 C CA  . ALA B 1 198 ? 3.741  14.480  -2.712  1.00 16.40 ? 198  ALA B CA  1 
ATOM   3244 C C   . ALA B 1 198 ? 3.103  15.771  -3.238  1.00 14.39 ? 198  ALA B C   1 
ATOM   3245 O O   . ALA B 1 198 ? 3.158  16.807  -2.581  1.00 15.67 ? 198  ALA B O   1 
ATOM   3246 C CB  . ALA B 1 198 ? 5.186  14.331  -3.213  1.00 14.44 ? 198  ALA B CB  1 
ATOM   3247 N N   . LYS B 1 199 ? 2.455  15.697  -4.392  1.00 16.32 ? 199  LYS B N   1 
ATOM   3248 C CA  . LYS B 1 199 ? 1.794  16.871  -4.972  1.00 21.59 ? 199  LYS B CA  1 
ATOM   3249 C C   . LYS B 1 199 ? 0.726  17.473  -4.046  1.00 21.54 ? 199  LYS B C   1 
ATOM   3250 O O   . LYS B 1 199 ? 0.588  18.689  -3.955  1.00 21.38 ? 199  LYS B O   1 
ATOM   3251 C CB  . LYS B 1 199 ? 1.108  16.499  -6.291  1.00 26.46 ? 199  LYS B CB  1 
ATOM   3252 C CG  . LYS B 1 199 ? 2.027  16.117  -7.420  1.00 35.43 ? 199  LYS B CG  1 
ATOM   3253 C CD  . LYS B 1 199 ? 1.262  15.345  -8.478  1.00 38.76 ? 199  LYS B CD  1 
ATOM   3254 C CE  . LYS B 1 199 ? 0.108  16.155  -9.039  1.00 38.11 ? 199  LYS B CE  1 
ATOM   3255 N NZ  . LYS B 1 199 ? -0.633 15.375  -10.066 1.00 39.38 ? 199  LYS B NZ  1 
ATOM   3256 N N   . LYS B 1 200 ? -0.045 16.604  -3.400  1.00 23.69 ? 200  LYS B N   1 
ATOM   3257 C CA  . LYS B 1 200 ? -1.138 17.007  -2.514  1.00 24.43 ? 200  LYS B CA  1 
ATOM   3258 C C   . LYS B 1 200 ? -0.646 17.296  -1.102  1.00 19.56 ? 200  LYS B C   1 
ATOM   3259 O O   . LYS B 1 200 ? -1.104 18.225  -0.444  1.00 18.41 ? 200  LYS B O   1 
ATOM   3260 C CB  . LYS B 1 200 ? -2.189 15.887  -2.463  1.00 31.71 ? 200  LYS B CB  1 
ATOM   3261 C CG  . LYS B 1 200 ? -2.726 15.443  -3.821  1.00 35.78 ? 200  LYS B CG  1 
ATOM   3262 C CD  . LYS B 1 200 ? -3.617 14.200  -3.714  1.00 46.26 ? 200  LYS B CD  1 
ATOM   3263 C CE  . LYS B 1 200 ? -4.903 14.452  -2.896  1.00 54.04 ? 200  LYS B CE  1 
ATOM   3264 N NZ  . LYS B 1 200 ? -5.848 13.276  -2.877  1.00 55.28 ? 200  LYS B NZ  1 
ATOM   3265 N N   . LEU B 1 201 ? 0.275  16.466  -0.631  1.00 18.37 ? 201  LEU B N   1 
ATOM   3266 C CA  . LEU B 1 201 ? 0.826  16.623  0.704   1.00 16.90 ? 201  LEU B CA  1 
ATOM   3267 C C   . LEU B 1 201 ? 1.582  17.945  0.825   1.00 16.88 ? 201  LEU B C   1 
ATOM   3268 O O   . LEU B 1 201 ? 1.526  18.591  1.855   1.00 15.69 ? 201  LEU B O   1 
ATOM   3269 C CB  . LEU B 1 201 ? 1.784  15.469  1.008   1.00 16.10 ? 201  LEU B CB  1 
ATOM   3270 C CG  . LEU B 1 201 ? 1.726  14.681  2.320   1.00 20.50 ? 201  LEU B CG  1 
ATOM   3271 C CD1 . LEU B 1 201 ? 3.000  13.855  2.410   1.00 15.43 ? 201  LEU B CD1 1 
ATOM   3272 C CD2 . LEU B 1 201 ? 1.567  15.568  3.561   1.00 13.02 ? 201  LEU B CD2 1 
ATOM   3273 N N   . PHE B 1 202 ? 2.287  18.343  -0.230  1.00 17.18 ? 202  PHE B N   1 
ATOM   3274 C CA  . PHE B 1 202 ? 3.073  19.574  -0.191  1.00 14.25 ? 202  PHE B CA  1 
ATOM   3275 C C   . PHE B 1 202 ? 2.637  20.599  -1.233  1.00 17.23 ? 202  PHE B C   1 
ATOM   3276 O O   . PHE B 1 202 ? 3.310  20.786  -2.259  1.00 18.35 ? 202  PHE B O   1 
ATOM   3277 C CB  . PHE B 1 202 ? 4.569  19.260  -0.375  1.00 14.72 ? 202  PHE B CB  1 
ATOM   3278 C CG  . PHE B 1 202 ? 5.106  18.225  0.584   1.00 8.40  ? 202  PHE B CG  1 
ATOM   3279 C CD1 . PHE B 1 202 ? 5.347  18.544  1.918   1.00 10.68 ? 202  PHE B CD1 1 
ATOM   3280 C CD2 . PHE B 1 202 ? 5.368  16.938  0.157   1.00 7.09  ? 202  PHE B CD2 1 
ATOM   3281 C CE1 . PHE B 1 202 ? 5.839  17.591  2.796   1.00 8.07  ? 202  PHE B CE1 1 
ATOM   3282 C CE2 . PHE B 1 202 ? 5.860  15.981  1.031   1.00 5.63  ? 202  PHE B CE2 1 
ATOM   3283 C CZ  . PHE B 1 202 ? 6.096  16.305  2.349   1.00 4.37  ? 202  PHE B CZ  1 
ATOM   3284 N N   . PRO B 1 203 ? 1.519  21.302  -0.975  1.00 17.76 ? 203  PRO B N   1 
ATOM   3285 C CA  . PRO B 1 203 ? 0.979  22.320  -1.882  1.00 17.50 ? 203  PRO B CA  1 
ATOM   3286 C C   . PRO B 1 203 ? 1.921  23.516  -2.126  1.00 21.16 ? 203  PRO B C   1 
ATOM   3287 O O   . PRO B 1 203 ? 1.789  24.208  -3.137  1.00 22.52 ? 203  PRO B O   1 
ATOM   3288 C CB  . PRO B 1 203 ? -0.319 22.730  -1.192  1.00 16.96 ? 203  PRO B CB  1 
ATOM   3289 C CG  . PRO B 1 203 ? -0.005 22.530  0.247   1.00 16.49 ? 203  PRO B CG  1 
ATOM   3290 C CD  . PRO B 1 203 ? 0.696  21.205  0.240   1.00 17.53 ? 203  PRO B CD  1 
ATOM   3291 N N   . LYS B 1 204 ? 2.867  23.759  -1.217  1.00 21.58 ? 204  LYS B N   1 
ATOM   3292 C CA  . LYS B 1 204 ? 3.832  24.848  -1.396  1.00 23.82 ? 204  LYS B CA  1 
ATOM   3293 C C   . LYS B 1 204 ? 4.679  24.607  -2.649  1.00 23.62 ? 204  LYS B C   1 
ATOM   3294 O O   . LYS B 1 204 ? 5.332  25.526  -3.132  1.00 28.04 ? 204  LYS B O   1 
ATOM   3295 C CB  . LYS B 1 204 ? 4.784  24.983  -0.209  1.00 19.42 ? 204  LYS B CB  1 
ATOM   3296 C CG  . LYS B 1 204 ? 4.210  25.587  1.060   1.00 23.19 ? 204  LYS B CG  1 
ATOM   3297 C CD  . LYS B 1 204 ? 5.358  25.853  2.050   1.00 25.15 ? 204  LYS B CD  1 
ATOM   3298 C CE  . LYS B 1 204 ? 4.884  25.994  3.476   1.00 26.48 ? 204  LYS B CE  1 
ATOM   3299 N NZ  . LYS B 1 204 ? 3.752  26.938  3.581   1.00 28.70 ? 204  LYS B NZ  1 
ATOM   3300 N N   . GLY B 1 205 ? 4.712  23.366  -3.136  1.00 22.89 ? 205  GLY B N   1 
ATOM   3301 C CA  . GLY B 1 205 ? 5.467  23.060  -4.342  1.00 19.54 ? 205  GLY B CA  1 
ATOM   3302 C C   . GLY B 1 205 ? 6.610  22.088  -4.149  1.00 19.60 ? 205  GLY B C   1 
ATOM   3303 O O   . GLY B 1 205 ? 7.348  22.164  -3.165  1.00 20.21 ? 205  GLY B O   1 
ATOM   3304 N N   . VAL B 1 206 ? 6.748  21.163  -5.093  1.00 18.16 ? 206  VAL B N   1 
ATOM   3305 C CA  . VAL B 1 206 ? 7.814  20.163  -5.052  1.00 19.86 ? 206  VAL B CA  1 
ATOM   3306 C C   . VAL B 1 206 ? 8.689  20.356  -6.294  1.00 19.87 ? 206  VAL B C   1 
ATOM   3307 O O   . VAL B 1 206 ? 8.193  20.334  -7.420  1.00 19.63 ? 206  VAL B O   1 
ATOM   3308 C CB  . VAL B 1 206 ? 7.249  18.729  -5.006  1.00 19.11 ? 206  VAL B CB  1 
ATOM   3309 C CG1 . VAL B 1 206 ? 8.385  17.715  -5.048  1.00 21.63 ? 206  VAL B CG1 1 
ATOM   3310 C CG2 . VAL B 1 206 ? 6.412  18.527  -3.733  1.00 22.42 ? 206  VAL B CG2 1 
ATOM   3311 N N   . PHE B 1 207 ? 9.981  20.597  -6.072  1.00 21.78 ? 207  PHE B N   1 
ATOM   3312 C CA  . PHE B 1 207 ? 10.947 20.841  -7.140  1.00 21.17 ? 207  PHE B CA  1 
ATOM   3313 C C   . PHE B 1 207 ? 11.916 19.685  -7.306  1.00 20.76 ? 207  PHE B C   1 
ATOM   3314 O O   . PHE B 1 207 ? 12.693 19.360  -6.406  1.00 21.24 ? 207  PHE B O   1 
ATOM   3315 C CB  . PHE B 1 207 ? 11.699 22.138  -6.853  1.00 26.09 ? 207  PHE B CB  1 
ATOM   3316 C CG  . PHE B 1 207 ? 10.803 23.236  -6.338  1.00 36.61 ? 207  PHE B CG  1 
ATOM   3317 C CD1 . PHE B 1 207 ? 10.035 23.996  -7.220  1.00 37.24 ? 207  PHE B CD1 1 
ATOM   3318 C CD2 . PHE B 1 207 ? 10.655 23.445  -4.964  1.00 37.20 ? 207  PHE B CD2 1 
ATOM   3319 C CE1 . PHE B 1 207 ? 9.132  24.939  -6.747  1.00 39.53 ? 207  PHE B CE1 1 
ATOM   3320 C CE2 . PHE B 1 207 ? 9.755  24.383  -4.480  1.00 37.21 ? 207  PHE B CE2 1 
ATOM   3321 C CZ  . PHE B 1 207 ? 8.989  25.132  -5.372  1.00 41.01 ? 207  PHE B CZ  1 
ATOM   3322 N N   . THR B 1 208 ? 11.843 19.058  -8.470  1.00 19.35 ? 208  THR B N   1 
ATOM   3323 C CA  . THR B 1 208 ? 12.679 17.923  -8.794  1.00 19.47 ? 208  THR B CA  1 
ATOM   3324 C C   . THR B 1 208 ? 13.871 18.399  -9.595  1.00 20.94 ? 208  THR B C   1 
ATOM   3325 O O   . THR B 1 208 ? 13.711 19.049  -10.627 1.00 24.59 ? 208  THR B O   1 
ATOM   3326 C CB  . THR B 1 208 ? 11.884 16.913  -9.629  1.00 20.65 ? 208  THR B CB  1 
ATOM   3327 O OG1 . THR B 1 208 ? 10.637 16.646  -8.970  1.00 21.67 ? 208  THR B OG1 1 
ATOM   3328 C CG2 . THR B 1 208 ? 12.664 15.610  -9.792  1.00 17.07 ? 208  THR B CG2 1 
ATOM   3329 N N   . LYS B 1 209 ? 15.059 18.153  -9.064  1.00 21.74 ? 209  LYS B N   1 
ATOM   3330 C CA  . LYS B 1 209 ? 16.301 18.529  -9.725  1.00 23.38 ? 209  LYS B CA  1 
ATOM   3331 C C   . LYS B 1 209 ? 16.546 17.484  -10.813 1.00 20.35 ? 209  LYS B C   1 
ATOM   3332 O O   . LYS B 1 209 ? 16.468 16.294  -10.548 1.00 20.28 ? 209  LYS B O   1 
ATOM   3333 C CB  . LYS B 1 209 ? 17.433 18.556  -8.682  1.00 23.01 ? 209  LYS B CB  1 
ATOM   3334 C CG  . LYS B 1 209 ? 18.853 18.498  -9.219  1.00 29.37 ? 209  LYS B CG  1 
ATOM   3335 C CD  . LYS B 1 209 ? 19.233 19.736  -10.012 1.00 34.70 ? 209  LYS B CD  1 
ATOM   3336 C CE  . LYS B 1 209 ? 20.657 19.625  -10.532 1.00 39.11 ? 209  LYS B CE  1 
ATOM   3337 N NZ  . LYS B 1 209 ? 21.004 20.701  -11.493 1.00 41.39 ? 209  LYS B NZ  1 
ATOM   3338 N N   . GLU B 1 210 ? 16.750 17.938  -12.049 1.00 22.06 ? 210  GLU B N   1 
ATOM   3339 C CA  . GLU B 1 210 ? 17.006 17.037  -13.180 1.00 20.44 ? 210  GLU B CA  1 
ATOM   3340 C C   . GLU B 1 210 ? 18.430 16.452  -13.088 1.00 19.93 ? 210  GLU B C   1 
ATOM   3341 O O   . GLU B 1 210 ? 19.409 17.193  -12.906 1.00 18.27 ? 210  GLU B O   1 
ATOM   3342 C CB  . GLU B 1 210 ? 16.806 17.784  -14.506 1.00 19.81 ? 210  GLU B CB  1 
ATOM   3343 C CG  . GLU B 1 210 ? 17.000 16.926  -15.744 1.00 25.88 ? 210  GLU B CG  1 
ATOM   3344 C CD  . GLU B 1 210 ? 16.700 17.666  -17.040 1.00 28.86 ? 210  GLU B CD  1 
ATOM   3345 O OE1 . GLU B 1 210 ? 17.291 18.747  -17.281 1.00 24.60 ? 210  GLU B OE1 1 
ATOM   3346 O OE2 . GLU B 1 210 ? 15.868 17.159  -17.825 1.00 33.04 ? 210  GLU B OE2 1 
ATOM   3347 N N   . LEU B 1 211 ? 18.536 15.126  -13.155 1.00 19.61 ? 211  LEU B N   1 
ATOM   3348 C CA  . LEU B 1 211 ? 19.823 14.435  -13.059 1.00 19.38 ? 211  LEU B CA  1 
ATOM   3349 C C   . LEU B 1 211 ? 20.101 13.646  -14.332 1.00 21.34 ? 211  LEU B C   1 
ATOM   3350 O O   . LEU B 1 211 ? 19.171 13.291  -15.069 1.00 23.41 ? 211  LEU B O   1 
ATOM   3351 C CB  . LEU B 1 211 ? 19.835 13.462  -11.868 1.00 19.67 ? 211  LEU B CB  1 
ATOM   3352 C CG  . LEU B 1 211 ? 20.212 13.897  -10.452 1.00 14.42 ? 211  LEU B CG  1 
ATOM   3353 C CD1 . LEU B 1 211 ? 20.776 15.276  -10.455 1.00 18.97 ? 211  LEU B CD1 1 
ATOM   3354 C CD2 . LEU B 1 211 ? 19.017 13.820  -9.559  1.00 22.82 ? 211  LEU B CD2 1 
ATOM   3355 N N   . PRO B 1 212 ? 21.389 13.348  -14.608 1.00 21.52 ? 212  PRO B N   1 
ATOM   3356 C CA  . PRO B 1 212 ? 21.770 12.591  -15.804 1.00 19.89 ? 212  PRO B CA  1 
ATOM   3357 C C   . PRO B 1 212 ? 21.021 11.260  -15.885 1.00 23.31 ? 212  PRO B C   1 
ATOM   3358 O O   . PRO B 1 212 ? 20.579 10.845  -16.961 1.00 24.74 ? 212  PRO B O   1 
ATOM   3359 C CB  . PRO B 1 212 ? 23.272 12.371  -15.595 1.00 18.39 ? 212  PRO B CB  1 
ATOM   3360 C CG  . PRO B 1 212 ? 23.682 13.583  -14.852 1.00 17.23 ? 212  PRO B CG  1 
ATOM   3361 C CD  . PRO B 1 212 ? 22.583 13.766  -13.851 1.00 16.07 ? 212  PRO B CD  1 
ATOM   3362 N N   . SER B 1 213 ? 20.876 10.599  -14.737 1.00 23.98 ? 213  SER B N   1 
ATOM   3363 C CA  . SER B 1 213 ? 20.202 9.312   -14.666 1.00 23.03 ? 213  SER B CA  1 
ATOM   3364 C C   . SER B 1 213 ? 18.725 9.375   -15.051 1.00 24.91 ? 213  SER B C   1 
ATOM   3365 O O   . SER B 1 213 ? 18.143 8.353   -15.410 1.00 25.66 ? 213  SER B O   1 
ATOM   3366 C CB  . SER B 1 213 ? 20.334 8.731   -13.259 1.00 22.43 ? 213  SER B CB  1 
ATOM   3367 O OG  . SER B 1 213 ? 19.550 9.464   -12.324 1.00 26.68 ? 213  SER B OG  1 
ATOM   3368 N N   . GLY B 1 214 ? 18.127 10.563  -14.966 1.00 24.18 ? 214  GLY B N   1 
ATOM   3369 C CA  . GLY B 1 214 ? 16.717 10.714  -15.284 1.00 22.41 ? 214  GLY B CA  1 
ATOM   3370 C C   . GLY B 1 214 ? 15.777 10.333  -14.141 1.00 25.50 ? 214  GLY B C   1 
ATOM   3371 O O   . GLY B 1 214 ? 14.543 10.394  -14.280 1.00 24.19 ? 214  GLY B O   1 
ATOM   3372 N N   . LYS B 1 215 ? 16.345 9.910   -13.015 1.00 23.36 ? 215  LYS B N   1 
ATOM   3373 C CA  . LYS B 1 215 ? 15.538 9.528   -11.866 1.00 21.77 ? 215  LYS B CA  1 
ATOM   3374 C C   . LYS B 1 215 ? 15.049 10.789  -11.173 1.00 19.46 ? 215  LYS B C   1 
ATOM   3375 O O   . LYS B 1 215 ? 15.680 11.830  -11.255 1.00 21.14 ? 215  LYS B O   1 
ATOM   3376 C CB  . LYS B 1 215 ? 16.340 8.637   -10.921 1.00 14.94 ? 215  LYS B CB  1 
ATOM   3377 C CG  . LYS B 1 215 ? 16.819 7.383   -11.618 1.00 16.87 ? 215  LYS B CG  1 
ATOM   3378 C CD  . LYS B 1 215 ? 17.824 6.626   -10.787 1.00 21.56 ? 215  LYS B CD  1 
ATOM   3379 C CE  . LYS B 1 215 ? 18.273 5.359   -11.492 1.00 24.07 ? 215  LYS B CE  1 
ATOM   3380 N NZ  . LYS B 1 215 ? 17.145 4.399   -11.688 1.00 27.23 ? 215  LYS B NZ  1 
ATOM   3381 N N   . LYS B 1 216 ? 13.926 10.680  -10.483 1.00 20.76 ? 216  LYS B N   1 
ATOM   3382 C CA  . LYS B 1 216 ? 13.346 11.832  -9.815  1.00 24.74 ? 216  LYS B CA  1 
ATOM   3383 C C   . LYS B 1 216 ? 13.368 11.643  -8.302  1.00 20.41 ? 216  LYS B C   1 
ATOM   3384 O O   . LYS B 1 216 ? 12.324 11.550  -7.673  1.00 26.45 ? 216  LYS B O   1 
ATOM   3385 C CB  . LYS B 1 216 ? 11.900 12.041  -10.303 1.00 29.23 ? 216  LYS B CB  1 
ATOM   3386 C CG  . LYS B 1 216 ? 11.717 12.075  -11.827 1.00 32.69 ? 216  LYS B CG  1 
ATOM   3387 C CD  . LYS B 1 216 ? 10.337 12.612  -12.224 1.00 40.69 ? 216  LYS B CD  1 
ATOM   3388 C CE  . LYS B 1 216 ? 9.177  11.707  -11.774 1.00 45.64 ? 216  LYS B CE  1 
ATOM   3389 N NZ  . LYS B 1 216 ? 9.013  10.443  -12.570 1.00 44.08 ? 216  LYS B NZ  1 
ATOM   3390 N N   . TYR B 1 217 ? 14.553 11.603  -7.716  1.00 20.39 ? 217  TYR B N   1 
ATOM   3391 C CA  . TYR B 1 217 ? 14.675 11.403  -6.274  1.00 17.72 ? 217  TYR B CA  1 
ATOM   3392 C C   . TYR B 1 217 ? 15.141 12.665  -5.554  1.00 15.78 ? 217  TYR B C   1 
ATOM   3393 O O   . TYR B 1 217 ? 14.991 12.801  -4.344  1.00 19.55 ? 217  TYR B O   1 
ATOM   3394 C CB  . TYR B 1 217 ? 15.620 10.230  -5.987  1.00 16.92 ? 217  TYR B CB  1 
ATOM   3395 C CG  . TYR B 1 217 ? 17.033 10.389  -6.538  1.00 15.02 ? 217  TYR B CG  1 
ATOM   3396 C CD1 . TYR B 1 217 ? 18.035 10.989  -5.769  1.00 13.50 ? 217  TYR B CD1 1 
ATOM   3397 C CD2 . TYR B 1 217 ? 17.379 9.883   -7.793  1.00 13.69 ? 217  TYR B CD2 1 
ATOM   3398 C CE1 . TYR B 1 217 ? 19.347 11.072  -6.222  1.00 15.19 ? 217  TYR B CE1 1 
ATOM   3399 C CE2 . TYR B 1 217 ? 18.700 9.953   -8.267  1.00 12.89 ? 217  TYR B CE2 1 
ATOM   3400 C CZ  . TYR B 1 217 ? 19.682 10.546  -7.471  1.00 16.33 ? 217  TYR B CZ  1 
ATOM   3401 O OH  . TYR B 1 217 ? 21.006 10.567  -7.867  1.00 17.57 ? 217  TYR B OH  1 
ATOM   3402 N N   . LEU B 1 218 ? 15.705 13.599  -6.303  1.00 15.65 ? 218  LEU B N   1 
ATOM   3403 C CA  . LEU B 1 218 ? 16.185 14.833  -5.721  1.00 15.30 ? 218  LEU B CA  1 
ATOM   3404 C C   . LEU B 1 218 ? 15.052 15.840  -5.747  1.00 12.73 ? 218  LEU B C   1 
ATOM   3405 O O   . LEU B 1 218 ? 15.020 16.726  -6.587  1.00 15.34 ? 218  LEU B O   1 
ATOM   3406 C CB  . LEU B 1 218 ? 17.407 15.341  -6.497  1.00 19.33 ? 218  LEU B CB  1 
ATOM   3407 C CG  . LEU B 1 218 ? 18.727 15.387  -5.721  1.00 17.71 ? 218  LEU B CG  1 
ATOM   3408 C CD1 . LEU B 1 218 ? 19.879 15.704  -6.628  1.00 23.59 ? 218  LEU B CD1 1 
ATOM   3409 C CD2 . LEU B 1 218 ? 18.635 16.445  -4.679  1.00 24.96 ? 218  LEU B CD2 1 
ATOM   3410 N N   . ARG B 1 219 ? 14.124 15.701  -4.807  1.00 12.40 ? 219  ARG B N   1 
ATOM   3411 C CA  . ARG B 1 219 ? 12.964 16.580  -4.726  1.00 11.66 ? 219  ARG B CA  1 
ATOM   3412 C C   . ARG B 1 219 ? 13.025 17.479  -3.507  1.00 12.57 ? 219  ARG B C   1 
ATOM   3413 O O   . ARG B 1 219 ? 13.135 16.989  -2.377  1.00 13.75 ? 219  ARG B O   1 
ATOM   3414 C CB  . ARG B 1 219 ? 11.683 15.741  -4.650  1.00 11.57 ? 219  ARG B CB  1 
ATOM   3415 C CG  . ARG B 1 219 ? 11.473 14.852  -5.847  1.00 16.65 ? 219  ARG B CG  1 
ATOM   3416 C CD  . ARG B 1 219 ? 10.269 13.954  -5.697  1.00 10.87 ? 219  ARG B CD  1 
ATOM   3417 N NE  . ARG B 1 219 ? 10.451 12.936  -4.673  1.00 14.99 ? 219  ARG B NE  1 
ATOM   3418 C CZ  . ARG B 1 219 ? 9.504  12.086  -4.283  1.00 16.37 ? 219  ARG B CZ  1 
ATOM   3419 N NH1 . ARG B 1 219 ? 8.299  12.131  -4.845  1.00 20.18 ? 219  ARG B NH1 1 
ATOM   3420 N NH2 . ARG B 1 219 ? 9.747  11.226  -3.297  1.00 18.52 ? 219  ARG B NH2 1 
ATOM   3421 N N   . TYR B 1 220 ? 12.950 18.787  -3.736  1.00 11.61 ? 220  TYR B N   1 
ATOM   3422 C CA  . TYR B 1 220 ? 12.971 19.767  -2.656  1.00 14.62 ? 220  TYR B CA  1 
ATOM   3423 C C   . TYR B 1 220 ? 11.600 20.388  -2.480  1.00 16.68 ? 220  TYR B C   1 
ATOM   3424 O O   . TYR B 1 220 ? 10.813 20.460  -3.423  1.00 17.69 ? 220  TYR B O   1 
ATOM   3425 C CB  . TYR B 1 220 ? 13.968 20.885  -2.943  1.00 12.79 ? 220  TYR B CB  1 
ATOM   3426 C CG  . TYR B 1 220 ? 15.416 20.448  -2.929  1.00 19.37 ? 220  TYR B CG  1 
ATOM   3427 C CD1 . TYR B 1 220 ? 16.018 19.955  -4.081  1.00 19.44 ? 220  TYR B CD1 1 
ATOM   3428 C CD2 . TYR B 1 220 ? 16.201 20.586  -1.782  1.00 16.80 ? 220  TYR B CD2 1 
ATOM   3429 C CE1 . TYR B 1 220 ? 17.363 19.619  -4.100  1.00 24.92 ? 220  TYR B CE1 1 
ATOM   3430 C CE2 . TYR B 1 220 ? 17.556 20.255  -1.790  1.00 20.01 ? 220  TYR B CE2 1 
ATOM   3431 C CZ  . TYR B 1 220 ? 18.128 19.774  -2.954  1.00 22.54 ? 220  TYR B CZ  1 
ATOM   3432 O OH  . TYR B 1 220 ? 19.456 19.448  -3.001  1.00 25.30 ? 220  TYR B OH  1 
ATOM   3433 N N   . THR B 1 221 ? 11.315 20.835  -1.271  1.00 16.18 ? 221  THR B N   1 
ATOM   3434 C CA  . THR B 1 221 ? 10.047 21.473  -0.998  1.00 17.61 ? 221  THR B CA  1 
ATOM   3435 C C   . THR B 1 221 ? 10.318 22.440  0.152   1.00 17.23 ? 221  THR B C   1 
ATOM   3436 O O   . THR B 1 221 ? 11.232 22.221  0.952   1.00 17.60 ? 221  THR B O   1 
ATOM   3437 C CB  . THR B 1 221 ? 8.926  20.423  -0.685  1.00 15.36 ? 221  THR B CB  1 
ATOM   3438 O OG1 . THR B 1 221 ? 7.640  21.044  -0.783  1.00 14.32 ? 221  THR B OG1 1 
ATOM   3439 C CG2 . THR B 1 221 ? 9.102  19.793  0.685   1.00 10.32 ? 221  THR B CG2 1 
ATOM   3440 N N   . PRO B 1 222 ? 9.639  23.594  0.153   1.00 17.10 ? 222  PRO B N   1 
ATOM   3441 C CA  . PRO B 1 222 ? 9.831  24.588  1.212   1.00 18.17 ? 222  PRO B CA  1 
ATOM   3442 C C   . PRO B 1 222 ? 9.591  23.957  2.586   1.00 18.56 ? 222  PRO B C   1 
ATOM   3443 O O   . PRO B 1 222 ? 8.842  22.990  2.686   1.00 17.21 ? 222  PRO B O   1 
ATOM   3444 C CB  . PRO B 1 222 ? 8.758  25.626  0.884   1.00 19.27 ? 222  PRO B CB  1 
ATOM   3445 C CG  . PRO B 1 222 ? 8.629  25.523  -0.625  1.00 18.50 ? 222  PRO B CG  1 
ATOM   3446 C CD  . PRO B 1 222 ? 8.626  24.040  -0.823  1.00 14.85 ? 222  PRO B CD  1 
ATOM   3447 N N   . GLN B 1 223 ? 10.249 24.452  3.635   1.00 21.13 ? 223  GLN B N   1 
ATOM   3448 C CA  . GLN B 1 223 ? 10.025 23.881  4.965   1.00 25.61 ? 223  GLN B CA  1 
ATOM   3449 C C   . GLN B 1 223 ? 8.545  24.092  5.269   1.00 25.89 ? 223  GLN B C   1 
ATOM   3450 O O   . GLN B 1 223 ? 8.083  25.232  5.320   1.00 28.51 ? 223  GLN B O   1 
ATOM   3451 C CB  . GLN B 1 223 ? 10.890 24.560  6.029   1.00 27.24 ? 223  GLN B CB  1 
ATOM   3452 C CG  . GLN B 1 223 ? 10.744 23.921  7.408   1.00 28.73 ? 223  GLN B CG  1 
ATOM   3453 C CD  . GLN B 1 223 ? 11.799 24.389  8.399   1.00 31.59 ? 223  GLN B CD  1 
ATOM   3454 O OE1 . GLN B 1 223 ? 12.983 24.472  8.073   1.00 27.16 ? 223  GLN B OE1 1 
ATOM   3455 N NE2 . GLN B 1 223 ? 11.373 24.685  9.620   1.00 31.48 ? 223  GLN B NE2 1 
ATOM   3456 N N   . PRO B 1 224 ? 7.780  22.991  5.436   1.00 29.50 ? 224  PRO B N   1 
ATOM   3457 C CA  . PRO B 1 224 ? 6.331  23.013  5.723   1.00 27.44 ? 224  PRO B CA  1 
ATOM   3458 C C   . PRO B 1 224 ? 5.932  23.489  7.122   1.00 23.77 ? 224  PRO B C   1 
ATOM   3459 O O   . PRO B 1 224 ? 6.716  23.253  8.070   1.00 28.18 ? 224  PRO B O   1 
ATOM   3460 C CB  . PRO B 1 224 ? 5.914  21.559  5.474   1.00 28.99 ? 224  PRO B CB  1 
ATOM   3461 C CG  . PRO B 1 224 ? 7.128  20.792  5.912   1.00 31.97 ? 224  PRO B CG  1 
ATOM   3462 C CD  . PRO B 1 224 ? 8.283  21.602  5.352   1.00 27.04 ? 224  PRO B CD  1 
HETATM 3463 O O   . HOH C 2 .   ? 30.383 22.295  4.934   1.00 18.53 ? 2002 HOH A O   1 
HETATM 3464 O O   . HOH C 2 .   ? 51.986 27.264  25.175  1.00 22.38 ? 2003 HOH A O   1 
HETATM 3465 O O   . HOH C 2 .   ? 35.389 7.228   -7.263  1.00 10.38 ? 2004 HOH A O   1 
HETATM 3466 O O   . HOH C 2 .   ? 29.916 -14.170 -1.173  1.00 24.37 ? 2005 HOH A O   1 
HETATM 3467 O O   . HOH C 2 .   ? 27.738 15.917  10.964  1.00 17.44 ? 2007 HOH A O   1 
HETATM 3468 O O   . HOH C 2 .   ? 15.362 12.604  10.416  1.00 11.91 ? 2009 HOH A O   1 
HETATM 3469 O O   . HOH C 2 .   ? 44.350 19.821  -0.780  1.00 18.11 ? 2012 HOH A O   1 
HETATM 3470 O O   . HOH C 2 .   ? 32.980 3.409   22.322  1.00 20.37 ? 2013 HOH A O   1 
HETATM 3471 O O   . HOH C 2 .   ? 49.274 26.800  24.820  1.00 20.51 ? 2014 HOH A O   1 
HETATM 3472 O O   . HOH C 2 .   ? 39.580 8.826   19.980  1.00 23.29 ? 2016 HOH A O   1 
HETATM 3473 O O   . HOH C 2 .   ? 25.747 9.496   9.840   1.00 17.27 ? 2018 HOH A O   1 
HETATM 3474 O O   . HOH C 2 .   ? 42.530 5.435   19.371  1.00 20.31 ? 2021 HOH A O   1 
HETATM 3475 O O   . HOH C 2 .   ? 23.210 -2.937  -7.152  1.00 25.11 ? 2023 HOH A O   1 
HETATM 3476 O O   . HOH C 2 .   ? 43.207 11.865  17.720  1.00 24.93 ? 2025 HOH A O   1 
HETATM 3477 O O   . HOH C 2 .   ? 47.331 13.012  23.795  1.00 29.73 ? 2026 HOH A O   1 
HETATM 3478 O O   . HOH C 2 .   ? 39.499 23.203  38.175  1.00 20.12 ? 2028 HOH A O   1 
HETATM 3479 O O   . HOH C 2 .   ? 46.240 14.175  1.063   1.00 40.94 ? 2029 HOH A O   1 
HETATM 3480 O O   . HOH C 2 .   ? 24.903 21.998  -4.931  1.00 33.41 ? 2030 HOH A O   1 
HETATM 3481 O O   . HOH C 2 .   ? 22.831 1.581   12.910  1.00 11.99 ? 2033 HOH A O   1 
HETATM 3482 O O   . HOH C 2 .   ? 32.544 7.023   -8.799  1.00 27.73 ? 2034 HOH A O   1 
HETATM 3483 O O   . HOH C 2 .   ? 43.690 30.355  21.997  1.00 27.55 ? 2036 HOH A O   1 
HETATM 3484 O O   . HOH C 2 .   ? 20.316 -1.306  -0.560  1.00 25.20 ? 2037 HOH A O   1 
HETATM 3485 O O   . HOH C 2 .   ? 44.546 20.633  14.055  1.00 21.36 ? 2038 HOH A O   1 
HETATM 3486 O O   . HOH C 2 .   ? 37.395 27.640  24.877  1.00 33.31 ? 2039 HOH A O   1 
HETATM 3487 O O   . HOH C 2 .   ? 46.986 11.642  2.978   1.00 25.32 ? 2040 HOH A O   1 
HETATM 3488 O O   . HOH C 2 .   ? 34.985 23.724  10.334  1.00 30.60 ? 2041 HOH A O   1 
HETATM 3489 O O   . HOH C 2 .   ? 26.254 -13.286 8.796   1.00 56.53 ? 2042 HOH A O   1 
HETATM 3490 O O   . HOH C 2 .   ? 37.013 7.616   -11.816 1.00 59.62 ? 2044 HOH A O   1 
HETATM 3491 O O   . HOH C 2 .   ? 43.063 19.363  33.501  1.00 21.06 ? 2045 HOH A O   1 
HETATM 3492 O O   . HOH C 2 .   ? 26.324 20.113  -0.951  1.00 34.08 ? 2046 HOH A O   1 
HETATM 3493 O O   . HOH C 2 .   ? 28.592 -9.125  13.756  1.00 44.82 ? 2049 HOH A O   1 
HETATM 3494 O O   . HOH C 2 .   ? 59.806 20.611  34.401  1.00 54.62 ? 2052 HOH A O   1 
HETATM 3495 O O   . HOH C 2 .   ? 35.943 30.728  38.952  1.00 54.27 ? 2053 HOH A O   1 
HETATM 3496 O O   . HOH C 2 .   ? 19.809 -3.775  10.129  1.00 26.81 ? 2057 HOH A O   1 
HETATM 3497 O O   . HOH C 2 .   ? 38.907 31.462  24.114  1.00 28.45 ? 2061 HOH A O   1 
HETATM 3498 O O   . HOH C 2 .   ? 36.453 21.425  -5.218  1.00 35.57 ? 2064 HOH A O   1 
HETATM 3499 O O   . HOH C 2 .   ? 25.927 -5.757  12.512  1.00 39.17 ? 2065 HOH A O   1 
HETATM 3500 O O   . HOH C 2 .   ? 30.358 23.395  13.264  1.00 29.26 ? 2072 HOH A O   1 
HETATM 3501 O O   . HOH C 2 .   ? 31.870 16.710  -7.477  1.00 42.13 ? 2073 HOH A O   1 
HETATM 3502 O O   . HOH C 2 .   ? 44.650 -0.328  -1.412  1.00 34.06 ? 2076 HOH A O   1 
HETATM 3503 O O   . HOH C 2 .   ? 51.241 33.989  25.717  1.00 37.58 ? 2077 HOH A O   1 
HETATM 3504 O O   . HOH C 2 .   ? 28.903 -3.859  -11.004 1.00 35.97 ? 2079 HOH A O   1 
HETATM 3505 O O   . HOH C 2 .   ? 55.568 16.177  38.855  1.00 47.71 ? 2080 HOH A O   1 
HETATM 3506 O O   . HOH C 2 .   ? 18.645 5.909   8.382   1.00 21.31 ? 2082 HOH A O   1 
HETATM 3507 O O   . HOH C 2 .   ? 41.133 -3.726  -9.554  1.00 48.77 ? 2084 HOH A O   1 
HETATM 3508 O O   . HOH C 2 .   ? 17.600 -6.974  7.910   1.00 61.08 ? 2085 HOH A O   1 
HETATM 3509 O O   . HOH C 2 .   ? 39.190 -2.310  21.905  1.00 46.13 ? 2086 HOH A O   1 
HETATM 3510 O O   . HOH C 2 .   ? 28.636 27.926  24.545  1.00 57.63 ? 2088 HOH A O   1 
HETATM 3511 O O   . HOH C 2 .   ? 14.660 7.658   8.850   1.00 38.82 ? 2089 HOH A O   1 
HETATM 3512 O O   . HOH C 2 .   ? 40.326 8.346   -5.763  1.00 56.51 ? 2095 HOH A O   1 
HETATM 3513 O O   . HOH C 2 .   ? 48.502 0.536   15.954  1.00 54.59 ? 2097 HOH A O   1 
HETATM 3514 O O   . HOH C 2 .   ? 43.081 12.111  -0.738  1.00 51.01 ? 2100 HOH A O   1 
HETATM 3515 O O   . HOH C 2 .   ? 44.895 25.066  8.192   1.00 52.44 ? 2101 HOH A O   1 
HETATM 3516 O O   . HOH C 2 .   ? 15.419 -12.835 0.395   1.00 40.96 ? 2104 HOH A O   1 
HETATM 3517 O O   . HOH C 2 .   ? 21.888 -5.929  -1.334  1.00 46.28 ? 2105 HOH A O   1 
HETATM 3518 O O   . HOH C 2 .   ? 38.649 -7.636  -9.774  1.00 61.10 ? 2107 HOH A O   1 
HETATM 3519 O O   . HOH C 2 .   ? 41.618 -9.603  6.329   1.00 38.88 ? 2108 HOH A O   1 
HETATM 3520 O O   . HOH C 2 .   ? 52.500 21.207  22.854  1.00 48.19 ? 2109 HOH A O   1 
HETATM 3521 O O   . HOH C 2 .   ? 35.352 -3.336  -11.970 1.00 48.85 ? 2110 HOH A O   1 
HETATM 3522 O O   . HOH C 2 .   ? 17.356 9.548   2.018   1.00 20.18 ? 2111 HOH A O   1 
HETATM 3523 O O   . HOH D 2 .   ? 20.502 17.911  7.819   1.00 9.60  ? 2001 HOH B O   1 
HETATM 3524 O O   . HOH D 2 .   ? 6.492  22.122  1.779   1.00 11.90 ? 2006 HOH B O   1 
HETATM 3525 O O   . HOH D 2 .   ? 11.178 25.671  28.282  1.00 14.28 ? 2008 HOH B O   1 
HETATM 3526 O O   . HOH D 2 .   ? 12.300 11.850  -2.954  1.00 20.74 ? 2010 HOH B O   1 
HETATM 3527 O O   . HOH D 2 .   ? 40.097 14.744  20.458  1.00 11.95 ? 2011 HOH B O   1 
HETATM 3528 O O   . HOH D 2 .   ? 15.989 13.895  -8.928  1.00 17.60 ? 2015 HOH B O   1 
HETATM 3529 O O   . HOH D 2 .   ? 27.967 17.342  18.575  1.00 18.21 ? 2017 HOH B O   1 
HETATM 3530 O O   . HOH D 2 .   ? 15.875 6.036   13.607  1.00 37.73 ? 2019 HOH B O   1 
HETATM 3531 O O   . HOH D 2 .   ? 35.887 -1.973  33.074  1.00 31.76 ? 2020 HOH B O   1 
HETATM 3532 O O   . HOH D 2 .   ? 20.311 23.810  3.390   1.00 21.73 ? 2022 HOH B O   1 
HETATM 3533 O O   . HOH D 2 .   ? 16.543 21.022  -12.488 1.00 25.71 ? 2024 HOH B O   1 
HETATM 3534 O O   . HOH D 2 .   ? 12.075 26.751  3.204   1.00 24.70 ? 2027 HOH B O   1 
HETATM 3535 O O   . HOH D 2 .   ? 3.600  16.876  5.782   1.00 34.72 ? 2031 HOH B O   1 
HETATM 3536 O O   . HOH D 2 .   ? 20.074 15.893  38.756  1.00 25.04 ? 2032 HOH B O   1 
HETATM 3537 O O   . HOH D 2 .   ? 31.962 20.669  44.813  1.00 22.81 ? 2035 HOH B O   1 
HETATM 3538 O O   . HOH D 2 .   ? 6.432  8.724   5.942   1.00 39.33 ? 2043 HOH B O   1 
HETATM 3539 O O   . HOH D 2 .   ? 16.943 18.579  40.344  1.00 58.41 ? 2047 HOH B O   1 
HETATM 3540 O O   . HOH D 2 .   ? 15.933 13.748  -13.477 1.00 31.60 ? 2048 HOH B O   1 
HETATM 3541 O O   . HOH D 2 .   ? 26.146 0.090   37.938  1.00 34.61 ? 2050 HOH B O   1 
HETATM 3542 O O   . HOH D 2 .   ? 41.503 11.529  20.786  1.00 55.10 ? 2051 HOH B O   1 
HETATM 3543 O O   . HOH D 2 .   ? 22.880 16.731  40.649  1.00 37.04 ? 2054 HOH B O   1 
HETATM 3544 O O   . HOH D 2 .   ? 15.732 1.527   11.511  1.00 49.85 ? 2055 HOH B O   1 
HETATM 3545 O O   . HOH D 2 .   ? 9.591  18.939  28.804  1.00 35.72 ? 2056 HOH B O   1 
HETATM 3546 O O   . HOH D 2 .   ? 35.846 -0.345  27.217  1.00 22.46 ? 2058 HOH B O   1 
HETATM 3547 O O   . HOH D 2 .   ? 7.705  1.532   28.228  1.00 37.07 ? 2059 HOH B O   1 
HETATM 3548 O O   . HOH D 2 .   ? 18.486 28.052  26.423  1.00 20.62 ? 2060 HOH B O   1 
HETATM 3549 O O   . HOH D 2 .   ? 29.815 11.963  22.173  1.00 13.56 ? 2062 HOH B O   1 
HETATM 3550 O O   . HOH D 2 .   ? 21.812 2.568   40.201  1.00 42.44 ? 2063 HOH B O   1 
HETATM 3551 O O   . HOH D 2 .   ? 28.823 34.462  39.967  1.00 52.48 ? 2066 HOH B O   1 
HETATM 3552 O O   . HOH D 2 .   ? 15.495 6.684   -15.517 1.00 51.21 ? 2067 HOH B O   1 
HETATM 3553 O O   . HOH D 2 .   ? 6.238  9.806   10.783  1.00 45.29 ? 2068 HOH B O   1 
HETATM 3554 O O   . HOH D 2 .   ? 2.794  25.297  6.008   1.00 43.36 ? 2069 HOH B O   1 
HETATM 3555 O O   . HOH D 2 .   ? 21.032 20.401  -0.981  1.00 28.91 ? 2070 HOH B O   1 
HETATM 3556 O O   . HOH D 2 .   ? 24.897 22.840  9.078   1.00 50.61 ? 2071 HOH B O   1 
HETATM 3557 O O   . HOH D 2 .   ? 11.092 20.341  13.890  1.00 22.50 ? 2074 HOH B O   1 
HETATM 3558 O O   . HOH D 2 .   ? 15.052 15.788  31.929  1.00 29.91 ? 2075 HOH B O   1 
HETATM 3559 O O   . HOH D 2 .   ? 26.798 27.706  28.863  1.00 59.73 ? 2078 HOH B O   1 
HETATM 3560 O O   . HOH D 2 .   ? 37.292 9.060   24.997  1.00 23.81 ? 2081 HOH B O   1 
HETATM 3561 O O   . HOH D 2 .   ? 3.390  22.543  1.169   1.00 30.78 ? 2083 HOH B O   1 
HETATM 3562 O O   . HOH D 2 .   ? -7.934 13.022  -1.225  1.00 31.93 ? 2087 HOH B O   1 
HETATM 3563 O O   . HOH D 2 .   ? 17.754 29.169  7.489   1.00 36.81 ? 2090 HOH B O   1 
HETATM 3564 O O   . HOH D 2 .   ? 42.972 5.535   30.928  1.00 47.48 ? 2091 HOH B O   1 
HETATM 3565 O O   . HOH D 2 .   ? 19.908 25.184  11.963  1.00 29.26 ? 2092 HOH B O   1 
HETATM 3566 O O   . HOH D 2 .   ? 41.429 1.784   30.934  1.00 48.40 ? 2093 HOH B O   1 
HETATM 3567 O O   . HOH D 2 .   ? 1.822  21.008  5.276   1.00 63.87 ? 2094 HOH B O   1 
HETATM 3568 O O   . HOH D 2 .   ? 14.211 9.720   11.834  1.00 27.09 ? 2096 HOH B O   1 
HETATM 3569 O O   . HOH D 2 .   ? 9.908  4.913   13.990  1.00 51.95 ? 2098 HOH B O   1 
HETATM 3570 O O   . HOH D 2 .   ? 24.625 26.463  5.750   1.00 58.48 ? 2099 HOH B O   1 
HETATM 3571 O O   . HOH D 2 .   ? 2.563  15.391  -11.463 1.00 29.53 ? 2102 HOH B O   1 
HETATM 3572 O O   . HOH D 2 .   ? 11.671 10.563  13.888  1.00 46.02 ? 2103 HOH B O   1 
HETATM 3573 O O   . HOH D 2 .   ? 38.153 2.462   33.665  1.00 50.49 ? 2106 HOH B O   1 
HETATM 3574 O O   . HOH D 2 .   ? 37.897 15.389  29.723  1.00 13.07 ? 2112 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   GLY 4   4   ?   ?   ?   A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   GLY 8   8   8   GLY GLY A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  PHE 14  14  14  PHE PHE A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  ASN 17  17  17  ASN ASN A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  THR 19  19  19  THR THR A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  GLY 21  21  21  GLY GLY A . n 
A 1 22  ARG 22  22  22  ARG ARG A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  ARG 24  24  24  ARG ARG A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ASP 27  27  27  ASP ASP A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  ASP 31  31  31  ASP ASP A . n 
A 1 32  SER 32  32  32  SER SER A . n 
A 1 33  TRP 33  33  33  TRP TRP A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  HIS 39  39  39  HIS HIS A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  ARG 41  41  41  ARG ARG A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  THR 44  44  44  THR THR A . n 
A 1 45  PRO 45  45  45  PRO PRO A . n 
A 1 46  VAL 46  46  46  VAL VAL A . n 
A 1 47  CSO 47  47  47  CSO CSO A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  THR 49  49  49  THR THR A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  ARG 53  53  53  ARG ARG A . n 
A 1 54  ALA 54  54  54  ALA ALA A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  ARG 64  64  64  ARG ARG A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  HIS 79  79  79  HIS HIS A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  TRP 82  82  82  TRP TRP A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  ILE 86  86  86  ILE ILE A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  TYR 89  89  89  TYR TYR A . n 
A 1 90  ASN 90  90  90  ASN ASN A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  PRO 94  94  94  PRO PRO A . n 
A 1 95  THR 95  95  95  THR THR A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  PRO 99  99  99  PRO PRO A . n 
A 1 100 PHE 100 100 100 PHE PHE A . n 
A 1 101 PRO 101 101 101 PRO PRO A . n 
A 1 102 ILE 102 102 102 ILE ILE A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 ASP 104 104 104 ASP ASP A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 ASN 107 107 107 ASN ASN A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 ILE 112 112 112 ILE ILE A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 GLY 115 115 115 GLY GLY A . n 
A 1 116 MET 116 116 116 MET MET A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 LYS 122 122 122 LYS LYS A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 GLU 124 124 124 GLU GLU A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 MET 127 127 127 MET MET A . n 
A 1 128 PRO 128 128 128 PRO PRO A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 THR 130 130 130 THR THR A . n 
A 1 131 ALA 131 131 131 ALA ALA A . n 
A 1 132 ARG 132 132 132 ARG ARG A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 VAL 134 134 134 VAL VAL A . n 
A 1 135 PHE 135 135 135 PHE PHE A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 PRO 139 139 139 PRO PRO A . n 
A 1 140 ASP 140 140 140 ASP ASP A . n 
A 1 141 LYS 141 141 141 LYS LYS A . n 
A 1 142 LYS 142 142 142 LYS LYS A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 LYS 144 144 144 LYS LYS A . n 
A 1 145 LEU 145 145 145 LEU LEU A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 TYR 149 149 149 TYR TYR A . n 
A 1 150 PRO 150 150 150 PRO PRO A . n 
A 1 151 ALA 151 151 151 ALA ALA A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 THR 153 153 153 THR THR A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 ARG 155 155 155 ARG ARG A . n 
A 1 156 ASN 156 156 156 ASN ASN A . n 
A 1 157 PHE 157 157 157 PHE PHE A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 GLU 159 159 159 GLU GLU A . n 
A 1 160 ILE 160 160 160 ILE ILE A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 ARG 162 162 162 ARG ARG A . n 
A 1 163 VAL 163 163 163 VAL VAL A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 ILE 165 165 165 ILE ILE A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 GLN 168 168 168 GLN GLN A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 THR 170 170 170 THR THR A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 GLU 172 172 172 GLU GLU A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 THR 177 177 177 THR THR A . n 
A 1 178 PRO 178 178 178 PRO PRO A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 ASP 180 180 180 ASP ASP A . n 
A 1 181 TRP 181 181 181 TRP TRP A . n 
A 1 182 LYS 182 182 182 LYS LYS A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 GLY 184 184 184 GLY GLY A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 SER 186 186 186 SER SER A . n 
A 1 187 VAL 187 187 187 VAL VAL A . n 
A 1 188 MET 188 188 188 MET MET A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 THR 192 192 192 THR THR A . n 
A 1 193 ILE 193 193 193 ILE ILE A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 GLU 195 195 195 GLU GLU A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 GLU 197 197 197 GLU GLU A . n 
A 1 198 ALA 198 198 198 ALA ALA A . n 
A 1 199 LYS 199 199 199 LYS LYS A . n 
A 1 200 LYS 200 200 200 LYS LYS A . n 
A 1 201 LEU 201 201 201 LEU LEU A . n 
A 1 202 PHE 202 202 202 PHE PHE A . n 
A 1 203 PRO 203 203 203 PRO PRO A . n 
A 1 204 LYS 204 204 204 LYS LYS A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 PHE 207 207 207 PHE PHE A . n 
A 1 208 THR 208 208 208 THR THR A . n 
A 1 209 LYS 209 209 209 LYS LYS A . n 
A 1 210 GLU 210 210 210 GLU GLU A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 PRO 212 212 212 PRO PRO A . n 
A 1 213 SER 213 213 213 SER SER A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 LYS 215 215 215 LYS LYS A . n 
A 1 216 LYS 216 216 216 LYS LYS A . n 
A 1 217 TYR 217 217 217 TYR TYR A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 TYR 220 220 220 TYR TYR A . n 
A 1 221 THR 221 221 221 THR THR A . n 
A 1 222 PRO 222 222 222 PRO PRO A . n 
A 1 223 GLN 223 223 223 GLN GLN A . n 
A 1 224 PRO 224 224 224 PRO PRO A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   PRO 2   2   2   PRO PRO B . n 
B 1 3   GLY 3   3   3   GLY GLY B . n 
B 1 4   GLY 4   4   4   GLY GLY B . n 
B 1 5   LEU 5   5   5   LEU LEU B . n 
B 1 6   LEU 6   6   6   LEU LEU B . n 
B 1 7   LEU 7   7   7   LEU LEU B . n 
B 1 8   GLY 8   8   8   GLY GLY B . n 
B 1 9   ASP 9   9   9   ASP ASP B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  ALA 11  11  11  ALA ALA B . n 
B 1 12  PRO 12  12  12  PRO PRO B . n 
B 1 13  ASN 13  13  13  ASN ASN B . n 
B 1 14  PHE 14  14  14  PHE PHE B . n 
B 1 15  GLU 15  15  15  GLU GLU B . n 
B 1 16  ALA 16  16  16  ALA ALA B . n 
B 1 17  ASN 17  17  17  ASN ASN B . n 
B 1 18  THR 18  18  18  THR THR B . n 
B 1 19  THR 19  19  19  THR THR B . n 
B 1 20  VAL 20  20  20  VAL VAL B . n 
B 1 21  GLY 21  21  21  GLY GLY B . n 
B 1 22  ARG 22  22  22  ARG ARG B . n 
B 1 23  ILE 23  23  23  ILE ILE B . n 
B 1 24  ARG 24  24  24  ARG ARG B . n 
B 1 25  PHE 25  25  25  PHE PHE B . n 
B 1 26  HIS 26  26  26  HIS HIS B . n 
B 1 27  ASP 27  27  27  ASP ASP B . n 
B 1 28  PHE 28  28  28  PHE PHE B . n 
B 1 29  LEU 29  29  29  LEU LEU B . n 
B 1 30  GLY 30  30  30  GLY GLY B . n 
B 1 31  ASP 31  31  31  ASP ASP B . n 
B 1 32  SER 32  32  32  SER SER B . n 
B 1 33  TRP 33  33  33  TRP TRP B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  LEU 36  36  36  LEU LEU B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  SER 38  38  38  SER SER B . n 
B 1 39  HIS 39  39  39  HIS HIS B . n 
B 1 40  PRO 40  40  40  PRO PRO B . n 
B 1 41  ARG 41  41  41  ARG ARG B . n 
B 1 42  ASP 42  42  42  ASP ASP B . n 
B 1 43  PHE 43  43  43  PHE PHE B . n 
B 1 44  THR 44  44  44  THR THR B . n 
B 1 45  PRO 45  45  45  PRO PRO B . n 
B 1 46  VAL 46  46  46  VAL VAL B . n 
B 1 47  CSO 47  47  47  CSO CSO B . n 
B 1 48  THR 48  48  48  THR THR B . n 
B 1 49  THR 49  49  49  THR THR B . n 
B 1 50  GLU 50  50  50  GLU GLU B . n 
B 1 51  LEU 51  51  51  LEU LEU B . n 
B 1 52  GLY 52  52  52  GLY GLY B . n 
B 1 53  ARG 53  53  53  ARG ARG B . n 
B 1 54  ALA 54  54  54  ALA ALA B . n 
B 1 55  ALA 55  55  55  ALA ALA B . n 
B 1 56  LYS 56  56  56  LYS LYS B . n 
B 1 57  LEU 57  57  57  LEU LEU B . n 
B 1 58  ALA 58  58  58  ALA ALA B . n 
B 1 59  PRO 59  59  59  PRO PRO B . n 
B 1 60  GLU 60  60  60  GLU GLU B . n 
B 1 61  PHE 61  61  61  PHE PHE B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  LYS 63  63  63  LYS LYS B . n 
B 1 64  ARG 64  64  64  ARG ARG B . n 
B 1 65  ASN 65  65  65  ASN ASN B . n 
B 1 66  VAL 66  66  66  VAL VAL B . n 
B 1 67  LYS 67  67  67  LYS LYS B . n 
B 1 68  LEU 68  68  68  LEU LEU B . n 
B 1 69  ILE 69  69  69  ILE ILE B . n 
B 1 70  ALA 70  70  70  ALA ALA B . n 
B 1 71  LEU 71  71  71  LEU LEU B . n 
B 1 72  SER 72  72  72  SER SER B . n 
B 1 73  ILE 73  73  73  ILE ILE B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  SER 75  75  75  SER SER B . n 
B 1 76  VAL 76  76  76  VAL VAL B . n 
B 1 77  GLU 77  77  77  GLU GLU B . n 
B 1 78  ASP 78  78  78  ASP ASP B . n 
B 1 79  HIS 79  79  79  HIS HIS B . n 
B 1 80  LEU 80  80  80  LEU LEU B . n 
B 1 81  ALA 81  81  81  ALA ALA B . n 
B 1 82  TRP 82  82  82  TRP TRP B . n 
B 1 83  SER 83  83  83  SER SER B . n 
B 1 84  LYS 84  84  84  LYS LYS B . n 
B 1 85  ASP 85  85  85  ASP ASP B . n 
B 1 86  ILE 86  86  86  ILE ILE B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  ALA 88  88  88  ALA ALA B . n 
B 1 89  TYR 89  89  89  TYR TYR B . n 
B 1 90  ASN 90  90  90  ASN ASN B . n 
B 1 91  SER 91  91  91  SER SER B . n 
B 1 92  GLU 92  92  92  GLU GLU B . n 
B 1 93  GLU 93  93  93  GLU GLU B . n 
B 1 94  PRO 94  94  94  PRO PRO B . n 
B 1 95  THR 95  95  95  THR THR B . n 
B 1 96  GLU 96  96  96  GLU GLU B . n 
B 1 97  LYS 97  97  97  LYS LYS B . n 
B 1 98  LEU 98  98  98  LEU LEU B . n 
B 1 99  PRO 99  99  99  PRO PRO B . n 
B 1 100 PHE 100 100 100 PHE PHE B . n 
B 1 101 PRO 101 101 101 PRO PRO B . n 
B 1 102 ILE 102 102 102 ILE ILE B . n 
B 1 103 ILE 103 103 103 ILE ILE B . n 
B 1 104 ASP 104 104 104 ASP ASP B . n 
B 1 105 ASP 105 105 105 ASP ASP B . n 
B 1 106 ARG 106 106 106 ARG ARG B . n 
B 1 107 ASN 107 107 107 ASN ASN B . n 
B 1 108 ARG 108 108 108 ARG ARG B . n 
B 1 109 GLU 109 109 109 GLU GLU B . n 
B 1 110 LEU 110 110 110 LEU LEU B . n 
B 1 111 ALA 111 111 111 ALA ALA B . n 
B 1 112 ILE 112 112 112 ILE ILE B . n 
B 1 113 LEU 113 113 113 LEU LEU B . n 
B 1 114 LEU 114 114 114 LEU LEU B . n 
B 1 115 GLY 115 115 115 GLY GLY B . n 
B 1 116 MET 116 116 116 MET MET B . n 
B 1 117 LEU 117 117 117 LEU LEU B . n 
B 1 118 ASP 118 118 118 ASP ASP B . n 
B 1 119 PRO 119 119 119 PRO PRO B . n 
B 1 120 ALA 120 120 120 ALA ALA B . n 
B 1 121 GLU 121 121 121 GLU GLU B . n 
B 1 122 LYS 122 122 ?   ?   ?   B . n 
B 1 123 ASP 123 123 ?   ?   ?   B . n 
B 1 124 GLU 124 124 ?   ?   ?   B . n 
B 1 125 LYS 125 125 ?   ?   ?   B . n 
B 1 126 GLY 126 126 ?   ?   ?   B . n 
B 1 127 MET 127 127 127 MET MET B . n 
B 1 128 PRO 128 128 128 PRO PRO B . n 
B 1 129 VAL 129 129 129 VAL VAL B . n 
B 1 130 THR 130 130 130 THR THR B . n 
B 1 131 ALA 131 131 131 ALA ALA B . n 
B 1 132 ARG 132 132 132 ARG ARG B . n 
B 1 133 VAL 133 133 133 VAL VAL B . n 
B 1 134 VAL 134 134 134 VAL VAL B . n 
B 1 135 PHE 135 135 135 PHE PHE B . n 
B 1 136 VAL 136 136 136 VAL VAL B . n 
B 1 137 PHE 137 137 137 PHE PHE B . n 
B 1 138 GLY 138 138 138 GLY GLY B . n 
B 1 139 PRO 139 139 139 PRO PRO B . n 
B 1 140 ASP 140 140 140 ASP ASP B . n 
B 1 141 LYS 141 141 141 LYS LYS B . n 
B 1 142 LYS 142 142 142 LYS LYS B . n 
B 1 143 LEU 143 143 143 LEU LEU B . n 
B 1 144 LYS 144 144 144 LYS LYS B . n 
B 1 145 LEU 145 145 145 LEU LEU B . n 
B 1 146 SER 146 146 146 SER SER B . n 
B 1 147 ILE 147 147 147 ILE ILE B . n 
B 1 148 LEU 148 148 148 LEU LEU B . n 
B 1 149 TYR 149 149 149 TYR TYR B . n 
B 1 150 PRO 150 150 150 PRO PRO B . n 
B 1 151 ALA 151 151 151 ALA ALA B . n 
B 1 152 THR 152 152 152 THR THR B . n 
B 1 153 THR 153 153 153 THR THR B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 ARG 155 155 155 ARG ARG B . n 
B 1 156 ASN 156 156 156 ASN ASN B . n 
B 1 157 PHE 157 157 157 PHE PHE B . n 
B 1 158 ASP 158 158 158 ASP ASP B . n 
B 1 159 GLU 159 159 159 GLU GLU B . n 
B 1 160 ILE 160 160 160 ILE ILE B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 ARG 162 162 162 ARG ARG B . n 
B 1 163 VAL 163 163 163 VAL VAL B . n 
B 1 164 VAL 164 164 164 VAL VAL B . n 
B 1 165 ILE 165 165 165 ILE ILE B . n 
B 1 166 SER 166 166 166 SER SER B . n 
B 1 167 LEU 167 167 167 LEU LEU B . n 
B 1 168 GLN 168 168 168 GLN GLN B . n 
B 1 169 LEU 169 169 169 LEU LEU B . n 
B 1 170 THR 170 170 170 THR THR B . n 
B 1 171 ALA 171 171 171 ALA ALA B . n 
B 1 172 GLU 172 172 172 GLU GLU B . n 
B 1 173 LYS 173 173 173 LYS LYS B . n 
B 1 174 ARG 174 174 174 ARG ARG B . n 
B 1 175 VAL 175 175 175 VAL VAL B . n 
B 1 176 ALA 176 176 176 ALA ALA B . n 
B 1 177 THR 177 177 177 THR THR B . n 
B 1 178 PRO 178 178 178 PRO PRO B . n 
B 1 179 VAL 179 179 179 VAL VAL B . n 
B 1 180 ASP 180 180 180 ASP ASP B . n 
B 1 181 TRP 181 181 181 TRP TRP B . n 
B 1 182 LYS 182 182 182 LYS LYS B . n 
B 1 183 ASP 183 183 183 ASP ASP B . n 
B 1 184 GLY 184 184 184 GLY GLY B . n 
B 1 185 ASP 185 185 185 ASP ASP B . n 
B 1 186 SER 186 186 186 SER SER B . n 
B 1 187 VAL 187 187 187 VAL VAL B . n 
B 1 188 MET 188 188 188 MET MET B . n 
B 1 189 VAL 189 189 189 VAL VAL B . n 
B 1 190 LEU 190 190 190 LEU LEU B . n 
B 1 191 PRO 191 191 191 PRO PRO B . n 
B 1 192 THR 192 192 192 THR THR B . n 
B 1 193 ILE 193 193 193 ILE ILE B . n 
B 1 194 PRO 194 194 194 PRO PRO B . n 
B 1 195 GLU 195 195 195 GLU GLU B . n 
B 1 196 GLU 196 196 196 GLU GLU B . n 
B 1 197 GLU 197 197 197 GLU GLU B . n 
B 1 198 ALA 198 198 198 ALA ALA B . n 
B 1 199 LYS 199 199 199 LYS LYS B . n 
B 1 200 LYS 200 200 200 LYS LYS B . n 
B 1 201 LEU 201 201 201 LEU LEU B . n 
B 1 202 PHE 202 202 202 PHE PHE B . n 
B 1 203 PRO 203 203 203 PRO PRO B . n 
B 1 204 LYS 204 204 204 LYS LYS B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 VAL 206 206 206 VAL VAL B . n 
B 1 207 PHE 207 207 207 PHE PHE B . n 
B 1 208 THR 208 208 208 THR THR B . n 
B 1 209 LYS 209 209 209 LYS LYS B . n 
B 1 210 GLU 210 210 210 GLU GLU B . n 
B 1 211 LEU 211 211 211 LEU LEU B . n 
B 1 212 PRO 212 212 212 PRO PRO B . n 
B 1 213 SER 213 213 213 SER SER B . n 
B 1 214 GLY 214 214 214 GLY GLY B . n 
B 1 215 LYS 215 215 215 LYS LYS B . n 
B 1 216 LYS 216 216 216 LYS LYS B . n 
B 1 217 TYR 217 217 217 TYR TYR B . n 
B 1 218 LEU 218 218 218 LEU LEU B . n 
B 1 219 ARG 219 219 219 ARG ARG B . n 
B 1 220 TYR 220 220 220 TYR TYR B . n 
B 1 221 THR 221 221 221 THR THR B . n 
B 1 222 PRO 222 222 222 PRO PRO B . n 
B 1 223 GLN 223 223 223 GLN GLN B . n 
B 1 224 PRO 224 224 224 PRO PRO B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  2002 2002 HOH HOH A . 
C 2 HOH 2  2003 2003 HOH HOH A . 
C 2 HOH 3  2004 2004 HOH HOH A . 
C 2 HOH 4  2005 2005 HOH HOH A . 
C 2 HOH 5  2007 2007 HOH HOH A . 
C 2 HOH 6  2009 2009 HOH HOH A . 
C 2 HOH 7  2012 2012 HOH HOH A . 
C 2 HOH 8  2013 2013 HOH HOH A . 
C 2 HOH 9  2014 2014 HOH HOH A . 
C 2 HOH 10 2016 2016 HOH HOH A . 
C 2 HOH 11 2018 2018 HOH HOH A . 
C 2 HOH 12 2021 2021 HOH HOH A . 
C 2 HOH 13 2023 2023 HOH HOH A . 
C 2 HOH 14 2025 2025 HOH HOH A . 
C 2 HOH 15 2026 2026 HOH HOH A . 
C 2 HOH 16 2028 2028 HOH HOH A . 
C 2 HOH 17 2029 2029 HOH HOH A . 
C 2 HOH 18 2030 2030 HOH HOH A . 
C 2 HOH 19 2033 2033 HOH HOH A . 
C 2 HOH 20 2034 2034 HOH HOH A . 
C 2 HOH 21 2036 2036 HOH HOH A . 
C 2 HOH 22 2037 2037 HOH HOH A . 
C 2 HOH 23 2038 2038 HOH HOH A . 
C 2 HOH 24 2039 2039 HOH HOH A . 
C 2 HOH 25 2040 2040 HOH HOH A . 
C 2 HOH 26 2041 2041 HOH HOH A . 
C 2 HOH 27 2042 2042 HOH HOH A . 
C 2 HOH 28 2044 2044 HOH HOH A . 
C 2 HOH 29 2045 2045 HOH HOH A . 
C 2 HOH 30 2046 2046 HOH HOH A . 
C 2 HOH 31 2049 2049 HOH HOH A . 
C 2 HOH 32 2052 2052 HOH HOH A . 
C 2 HOH 33 2053 2053 HOH HOH A . 
C 2 HOH 34 2057 2057 HOH HOH A . 
C 2 HOH 35 2061 2061 HOH HOH A . 
C 2 HOH 36 2064 2064 HOH HOH A . 
C 2 HOH 37 2065 2065 HOH HOH A . 
C 2 HOH 38 2072 2072 HOH HOH A . 
C 2 HOH 39 2073 2073 HOH HOH A . 
C 2 HOH 40 2076 2076 HOH HOH A . 
C 2 HOH 41 2077 2077 HOH HOH A . 
C 2 HOH 42 2079 2079 HOH HOH A . 
C 2 HOH 43 2080 2080 HOH HOH A . 
C 2 HOH 44 2082 2082 HOH HOH A . 
C 2 HOH 45 2084 2084 HOH HOH A . 
C 2 HOH 46 2085 2085 HOH HOH A . 
C 2 HOH 47 2086 2086 HOH HOH A . 
C 2 HOH 48 2088 2088 HOH HOH A . 
C 2 HOH 49 2089 2089 HOH HOH A . 
C 2 HOH 50 2095 2095 HOH HOH A . 
C 2 HOH 51 2097 2097 HOH HOH A . 
C 2 HOH 52 2100 2100 HOH HOH A . 
C 2 HOH 53 2101 2101 HOH HOH A . 
C 2 HOH 54 2104 2104 HOH HOH A . 
C 2 HOH 55 2105 2105 HOH HOH A . 
C 2 HOH 56 2107 2107 HOH HOH A . 
C 2 HOH 57 2108 2108 HOH HOH A . 
C 2 HOH 58 2109 2109 HOH HOH A . 
C 2 HOH 59 2110 2110 HOH HOH A . 
C 2 HOH 60 2111 2111 HOH HOH A . 
D 2 HOH 1  2001 2001 HOH HOH B . 
D 2 HOH 2  2006 2006 HOH HOH B . 
D 2 HOH 3  2008 2008 HOH HOH B . 
D 2 HOH 4  2010 2010 HOH HOH B . 
D 2 HOH 5  2011 2011 HOH HOH B . 
D 2 HOH 6  2015 2015 HOH HOH B . 
D 2 HOH 7  2017 2017 HOH HOH B . 
D 2 HOH 8  2019 2019 HOH HOH B . 
D 2 HOH 9  2020 2020 HOH HOH B . 
D 2 HOH 10 2022 2022 HOH HOH B . 
D 2 HOH 11 2024 2024 HOH HOH B . 
D 2 HOH 12 2027 2027 HOH HOH B . 
D 2 HOH 13 2031 2031 HOH HOH B . 
D 2 HOH 14 2032 2032 HOH HOH B . 
D 2 HOH 15 2035 2035 HOH HOH B . 
D 2 HOH 16 2043 2043 HOH HOH B . 
D 2 HOH 17 2047 2047 HOH HOH B . 
D 2 HOH 18 2048 2048 HOH HOH B . 
D 2 HOH 19 2050 2050 HOH HOH B . 
D 2 HOH 20 2051 2051 HOH HOH B . 
D 2 HOH 21 2054 2054 HOH HOH B . 
D 2 HOH 22 2055 2055 HOH HOH B . 
D 2 HOH 23 2056 2056 HOH HOH B . 
D 2 HOH 24 2058 2058 HOH HOH B . 
D 2 HOH 25 2059 2059 HOH HOH B . 
D 2 HOH 26 2060 2060 HOH HOH B . 
D 2 HOH 27 2062 2062 HOH HOH B . 
D 2 HOH 28 2063 2063 HOH HOH B . 
D 2 HOH 29 2066 2066 HOH HOH B . 
D 2 HOH 30 2067 2067 HOH HOH B . 
D 2 HOH 31 2068 2068 HOH HOH B . 
D 2 HOH 32 2069 2069 HOH HOH B . 
D 2 HOH 33 2070 2070 HOH HOH B . 
D 2 HOH 34 2071 2071 HOH HOH B . 
D 2 HOH 35 2074 2074 HOH HOH B . 
D 2 HOH 36 2075 2075 HOH HOH B . 
D 2 HOH 37 2078 2078 HOH HOH B . 
D 2 HOH 38 2081 2081 HOH HOH B . 
D 2 HOH 39 2083 2083 HOH HOH B . 
D 2 HOH 40 2087 2087 HOH HOH B . 
D 2 HOH 41 2090 2090 HOH HOH B . 
D 2 HOH 42 2091 2091 HOH HOH B . 
D 2 HOH 43 2092 2092 HOH HOH B . 
D 2 HOH 44 2093 2093 HOH HOH B . 
D 2 HOH 45 2094 2094 HOH HOH B . 
D 2 HOH 46 2096 2096 HOH HOH B . 
D 2 HOH 47 2098 2098 HOH HOH B . 
D 2 HOH 48 2099 2099 HOH HOH B . 
D 2 HOH 49 2102 2102 HOH HOH B . 
D 2 HOH 50 2103 2103 HOH HOH B . 
D 2 HOH 51 2106 2106 HOH HOH B . 
D 2 HOH 52 2112 2112 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A CSO 47 A CSO 47 ? CYS S-HYDROXYCYSTEINE 
2 B CSO 47 B CSO 47 ? CYS S-HYDROXYCYSTEINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4980  ? 
1 MORE         -40   ? 
1 'SSA (A^2)'  17840 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-06-17 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-11-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
5 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2           
2 4 'Structure model' pdbx_database_status 
3 4 'Structure model' struct_conn          
4 4 'Structure model' struct_ref_seq_dif   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                
2  4 'Structure model' '_database_2.pdbx_database_accession' 
3  4 'Structure model' '_pdbx_database_status.process_site'  
4  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
5  4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'     
6  4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
7  4 'Structure model' '_struct_conn.ptnr1_label_atom_id'    
8  4 'Structure model' '_struct_conn.ptnr1_label_comp_id'    
9  4 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'     
11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
12 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'    
13 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'    
14 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'     
15 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' 3.8 ? 1 
X-PLOR refinement       3.8 ? 2 
R-AXIS 'data reduction' .   ? 3 
R-AXIS 'data scaling'   .   ? 4 
X-PLOR phasing          3.8 ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A LEU 145 ? ? CB A LEU 145 ? ? CG A LEU 145 ? ? 136.47 115.30 21.17  2.30 N 
2 1 CB A VAL 179 ? ? CA A VAL 179 ? ? C  A VAL 179 ? ? 99.95  111.40 -11.45 1.90 N 
3 1 CA B LEU 145 ? ? CB B LEU 145 ? ? CG B LEU 145 ? ? 131.50 115.30 16.20  2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 119 ? ? -45.65  13.69  
2  1 LYS A 125 ? ? -144.52 -85.27 
3  1 MET A 127 ? ? 73.70   108.11 
4  1 LEU A 145 ? ? -174.61 149.85 
5  1 ASP A 180 ? ? 47.27   27.81  
6  1 LYS A 216 ? ? -110.74 58.82  
7  1 PRO B 45  ? ? -40.35  -80.88 
8  1 PRO B 94  ? ? -68.69  73.74  
9  1 PRO B 128 ? ? -68.77  83.76  
10 1 ASP B 180 ? ? 46.66   24.88  
11 1 PHE B 202 ? ? -119.54 77.13  
12 1 LYS B 216 ? ? -114.63 66.00  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A PRO 2   ? A PRO 2   
3  1 Y 1 A GLY 3   ? A GLY 3   
4  1 Y 1 A GLY 4   ? A GLY 4   
5  1 Y 1 B MET 1   ? B MET 1   
6  1 Y 1 B LYS 122 ? B LYS 122 
7  1 Y 1 B ASP 123 ? B ASP 123 
8  1 Y 1 B GLU 124 ? B GLU 124 
9  1 Y 1 B LYS 125 ? B LYS 125 
10 1 Y 1 B GLY 126 ? B GLY 126 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#