data_1PVR
# 
_entry.id   1PVR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1PVR         
NDB   PD0459       
RCSB  RCSB019612   
WWPDB D_1000019612 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1KBU 'Crystal structure of a Cre-LoxP Holliday junction complex' unspecified 
PDB 1MA7 'Crystal structure of Cre-LoxP(A8/T27) Holliday junction complex' unspecified 
PDB 1CRX 'Crystal structure of a covalent Cre-suicide substrate DNA complex' unspecified 
PDB 3CRX 'Crystal structure of Cre complexed with an immobilized DNA Holliday junction' unspecified 
PDB 4CRX 'Crystal structure of an uncleaved complex of Cre bound to LoxS, a symmetrized Lox sequence' unspecified 
PDB 1NZB 'Crystal structure of a Cre-LoxP precleavage complex' unspecified 
PDB 1OUQ 'Crystal structure of a Cre-LoxP covalent complex' unspecified 
PDB 1F44 'Crystal structure of a trimeric Cre-Lox synapse' unspecified 
PDB 1PVP 
;BASIS FOR A SWITCH IN SUBSTRATE SPECIFICITY: CRYSTAL STRUCTURE OF SELECTED VARIANT OF CRE SITE-SPECIFIC RECOMBINASE, ALSHG BOUND TO THE ENGINEERED RECOGNITION SITE LOXM7
;
unspecified 
PDB 1PVQ 
;BASIS FOR A SWITCH IN SUBSTRATE SPECIFICITY: CRYSTAL STRUCTURE OF SELECTED VARIANT OF CRE SITE-SPECIFIC RECOMBINASE, LNSGG BOUND TO THE ENGINEERED RECOGNITION SITE LOXM7
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1PVR 
_pdbx_database_status.recvd_initial_deposition_date   2003-06-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Baldwin, E.P.' 1 
'Martin, S.S.'  2 
'Abel, J.'      3 
'Gelato, K.A.'  4 
'Kim, H.'       5 
'Schultz, P.G.' 6 
'Santoro, S.W.' 7 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'A specificity switch in selected cre recombinase variants is mediated by macromolecular plasticity and water.' Chem.Biol. 
10  1085 1094 2003 CBOLE2 UK 1074-5521 2050 ? 14652076 10.1016/j.chembiol.2003.10.015  
1       'Directed evolution of the site specificity of Cre recombinase.' Proc.Natl.Acad.Sci.USA 99  4185 4190 2002 PNASA6 US 
0027-8424 0040 ? ?        10.1073/pnas.022039799          
2       'Modulation of the active complex assembly and turnover rate by protein-DNA interactions in Cre-LoxP recombination.' 
Biochemistry           42  6814 6826 2003 BICHAW US 0006-2960 0033 ? ?        10.1021/bi0272306               
3       
;The order of strand exchanges in Cre-LoxP recombination and its basis suggested by the crystal structure of a Cre-LoxP Holliday junction complex.
;
J.Mol.Biol.            319 107  127  2002 JMOBAK UK 0022-2836 0070 ? ?        '10.1016/S0022-2836(02)00246-2' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Baldwin, E.P.' 1  
primary 'Martin, S.S.'  2  
primary 'Abel, J.'      3  
primary 'Gelato, K.A.'  4  
primary 'Kim, H.'       5  
primary 'Schultz, P.G.' 6  
primary 'Santoro, S.W.' 7  
1       'Santoro, S.W.' 8  
1       'Schultz, P.G.' 9  
2       'Martin, S.S.'  10 
2       'Chu, V.C.'     11 
2       'Baldwin, E.'   12 
3       'Martin, S.S.'  13 
3       'Pulido, E.'    14 
3       'Chu, V.C.'     15 
3       'Lechner, T.S.' 16 
3       'Baldwin, E.P.' 17 
# 
_cell.entry_id           1PVR 
_cell.length_a           107.390 
_cell.length_b           121.570 
_cell.length_c           179.950 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1PVR 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 34-MER            10470.786 1   ? ?                             ? 'TOP STRAND OF LOXP WILDTYPE DNA SUBSTRATE' 
2 polymer syn 34-MER            10439.775 1   ? ?                             ? 'BOTTOM STRAND OF LOXP WILDTYPE DNA SUBSTRATE' 
3 polymer man 'Recombinase CRE' 39222.805 2   ? I174L,T258N,R259S,E262G,E266G ? 
'SELECTED CRE SITE-SPECIFIC RECOMBINASE MUTANT (I174L,T258N, R259S, E262G, E266G)' 
4 water   nat water             18.015    103 ? ?                             ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DT)(DA)(DA)(DC)(DT)(DT)(DC)(DG)(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DT)(DA)(DT)(DG)
(DC)(DT)(DA)(DT)(DA)(DC)(DG)(DA)(DA)(DG)(DT)(DT)(DA)(DT)
;
ATAACTTCGTATAATGTATGCTATACGAAGTTAT C   ? 
2 polydeoxyribonucleotide no no 
;(DA)(DT)(DA)(DA)(DC)(DT)(DT)(DC)(DG)(DT)(DA)(DT)(DA)(DG)(DC)(DA)(DT)(DA)(DC)(DA)
(DT)(DT)(DA)(DT)(DA)(DC)(DG)(DA)(DA)(DG)(DT)(DT)(DA)(DT)
;
ATAACTTCGTATAGCATACATTATACGAAGTTAT D   ? 
3 'polypeptide(L)'        no no 
;MHHHHHHSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPEDVRDY
LLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDR
CQDIRNLAFLGIAYNTLLRLAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDP
NNYLFCRVRKNGVAAPSATSQLSNSALGGIFGATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGG
WTNVNIVMNYIRNLDSETGAMVRLLEDGD
;
;MHHHHHHSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPEDVRDY
LLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDR
CQDIRNLAFLGIAYNTLLRLAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDP
NNYLFCRVRKNGVAAPSATSQLSNSALGGIFGATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGG
WTNVNIVMNYIRNLDSETGAMVRLLEDGD
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DA  n 
1 4   DA  n 
1 5   DC  n 
1 6   DT  n 
1 7   DT  n 
1 8   DC  n 
1 9   DG  n 
1 10  DT  n 
1 11  DA  n 
1 12  DT  n 
1 13  DA  n 
1 14  DA  n 
1 15  DT  n 
1 16  DG  n 
1 17  DT  n 
1 18  DA  n 
1 19  DT  n 
1 20  DG  n 
1 21  DC  n 
1 22  DT  n 
1 23  DA  n 
1 24  DT  n 
1 25  DA  n 
1 26  DC  n 
1 27  DG  n 
1 28  DA  n 
1 29  DA  n 
1 30  DG  n 
1 31  DT  n 
1 32  DT  n 
1 33  DA  n 
1 34  DT  n 
2 1   DA  n 
2 2   DT  n 
2 3   DA  n 
2 4   DA  n 
2 5   DC  n 
2 6   DT  n 
2 7   DT  n 
2 8   DC  n 
2 9   DG  n 
2 10  DT  n 
2 11  DA  n 
2 12  DT  n 
2 13  DA  n 
2 14  DG  n 
2 15  DC  n 
2 16  DA  n 
2 17  DT  n 
2 18  DA  n 
2 19  DC  n 
2 20  DA  n 
2 21  DT  n 
2 22  DT  n 
2 23  DA  n 
2 24  DT  n 
2 25  DA  n 
2 26  DC  n 
2 27  DG  n 
2 28  DA  n 
2 29  DA  n 
2 30  DG  n 
2 31  DT  n 
2 32  DT  n 
2 33  DA  n 
2 34  DT  n 
3 1   MET n 
3 2   HIS n 
3 3   HIS n 
3 4   HIS n 
3 5   HIS n 
3 6   HIS n 
3 7   HIS n 
3 8   SER n 
3 9   ASN n 
3 10  LEU n 
3 11  LEU n 
3 12  THR n 
3 13  VAL n 
3 14  HIS n 
3 15  GLN n 
3 16  ASN n 
3 17  LEU n 
3 18  PRO n 
3 19  ALA n 
3 20  LEU n 
3 21  PRO n 
3 22  VAL n 
3 23  ASP n 
3 24  ALA n 
3 25  THR n 
3 26  SER n 
3 27  ASP n 
3 28  GLU n 
3 29  VAL n 
3 30  ARG n 
3 31  LYS n 
3 32  ASN n 
3 33  LEU n 
3 34  MET n 
3 35  ASP n 
3 36  MET n 
3 37  PHE n 
3 38  ARG n 
3 39  ASP n 
3 40  ARG n 
3 41  GLN n 
3 42  ALA n 
3 43  PHE n 
3 44  SER n 
3 45  GLU n 
3 46  HIS n 
3 47  THR n 
3 48  TRP n 
3 49  LYS n 
3 50  MET n 
3 51  LEU n 
3 52  LEU n 
3 53  SER n 
3 54  VAL n 
3 55  CYS n 
3 56  ARG n 
3 57  SER n 
3 58  TRP n 
3 59  ALA n 
3 60  ALA n 
3 61  TRP n 
3 62  CYS n 
3 63  LYS n 
3 64  LEU n 
3 65  ASN n 
3 66  ASN n 
3 67  ARG n 
3 68  LYS n 
3 69  TRP n 
3 70  PHE n 
3 71  PRO n 
3 72  ALA n 
3 73  GLU n 
3 74  PRO n 
3 75  GLU n 
3 76  ASP n 
3 77  VAL n 
3 78  ARG n 
3 79  ASP n 
3 80  TYR n 
3 81  LEU n 
3 82  LEU n 
3 83  TYR n 
3 84  LEU n 
3 85  GLN n 
3 86  ALA n 
3 87  ARG n 
3 88  GLY n 
3 89  LEU n 
3 90  ALA n 
3 91  VAL n 
3 92  LYS n 
3 93  THR n 
3 94  ILE n 
3 95  GLN n 
3 96  GLN n 
3 97  HIS n 
3 98  LEU n 
3 99  GLY n 
3 100 GLN n 
3 101 LEU n 
3 102 ASN n 
3 103 MET n 
3 104 LEU n 
3 105 HIS n 
3 106 ARG n 
3 107 ARG n 
3 108 SER n 
3 109 GLY n 
3 110 LEU n 
3 111 PRO n 
3 112 ARG n 
3 113 PRO n 
3 114 SER n 
3 115 ASP n 
3 116 SER n 
3 117 ASN n 
3 118 ALA n 
3 119 VAL n 
3 120 SER n 
3 121 LEU n 
3 122 VAL n 
3 123 MET n 
3 124 ARG n 
3 125 ARG n 
3 126 ILE n 
3 127 ARG n 
3 128 LYS n 
3 129 GLU n 
3 130 ASN n 
3 131 VAL n 
3 132 ASP n 
3 133 ALA n 
3 134 GLY n 
3 135 GLU n 
3 136 ARG n 
3 137 ALA n 
3 138 LYS n 
3 139 GLN n 
3 140 ALA n 
3 141 LEU n 
3 142 ALA n 
3 143 PHE n 
3 144 GLU n 
3 145 ARG n 
3 146 THR n 
3 147 ASP n 
3 148 PHE n 
3 149 ASP n 
3 150 GLN n 
3 151 VAL n 
3 152 ARG n 
3 153 SER n 
3 154 LEU n 
3 155 MET n 
3 156 GLU n 
3 157 ASN n 
3 158 SER n 
3 159 ASP n 
3 160 ARG n 
3 161 CYS n 
3 162 GLN n 
3 163 ASP n 
3 164 ILE n 
3 165 ARG n 
3 166 ASN n 
3 167 LEU n 
3 168 ALA n 
3 169 PHE n 
3 170 LEU n 
3 171 GLY n 
3 172 ILE n 
3 173 ALA n 
3 174 TYR n 
3 175 ASN n 
3 176 THR n 
3 177 LEU n 
3 178 LEU n 
3 179 ARG n 
3 180 LEU n 
3 181 ALA n 
3 182 GLU n 
3 183 ILE n 
3 184 ALA n 
3 185 ARG n 
3 186 ILE n 
3 187 ARG n 
3 188 VAL n 
3 189 LYS n 
3 190 ASP n 
3 191 ILE n 
3 192 SER n 
3 193 ARG n 
3 194 THR n 
3 195 ASP n 
3 196 GLY n 
3 197 GLY n 
3 198 ARG n 
3 199 MET n 
3 200 LEU n 
3 201 ILE n 
3 202 HIS n 
3 203 ILE n 
3 204 GLY n 
3 205 ARG n 
3 206 THR n 
3 207 LYS n 
3 208 THR n 
3 209 LEU n 
3 210 VAL n 
3 211 SER n 
3 212 THR n 
3 213 ALA n 
3 214 GLY n 
3 215 VAL n 
3 216 GLU n 
3 217 LYS n 
3 218 ALA n 
3 219 LEU n 
3 220 SER n 
3 221 LEU n 
3 222 GLY n 
3 223 VAL n 
3 224 THR n 
3 225 LYS n 
3 226 LEU n 
3 227 VAL n 
3 228 GLU n 
3 229 ARG n 
3 230 TRP n 
3 231 ILE n 
3 232 SER n 
3 233 VAL n 
3 234 SER n 
3 235 GLY n 
3 236 VAL n 
3 237 ALA n 
3 238 ASP n 
3 239 ASP n 
3 240 PRO n 
3 241 ASN n 
3 242 ASN n 
3 243 TYR n 
3 244 LEU n 
3 245 PHE n 
3 246 CYS n 
3 247 ARG n 
3 248 VAL n 
3 249 ARG n 
3 250 LYS n 
3 251 ASN n 
3 252 GLY n 
3 253 VAL n 
3 254 ALA n 
3 255 ALA n 
3 256 PRO n 
3 257 SER n 
3 258 ALA n 
3 259 THR n 
3 260 SER n 
3 261 GLN n 
3 262 LEU n 
3 263 SER n 
3 264 ASN n 
3 265 SER n 
3 266 ALA n 
3 267 LEU n 
3 268 GLY n 
3 269 GLY n 
3 270 ILE n 
3 271 PHE n 
3 272 GLY n 
3 273 ALA n 
3 274 THR n 
3 275 HIS n 
3 276 ARG n 
3 277 LEU n 
3 278 ILE n 
3 279 TYR n 
3 280 GLY n 
3 281 ALA n 
3 282 LYS n 
3 283 ASP n 
3 284 ASP n 
3 285 SER n 
3 286 GLY n 
3 287 GLN n 
3 288 ARG n 
3 289 TYR n 
3 290 LEU n 
3 291 ALA n 
3 292 TRP n 
3 293 SER n 
3 294 GLY n 
3 295 HIS n 
3 296 SER n 
3 297 ALA n 
3 298 ARG n 
3 299 VAL n 
3 300 GLY n 
3 301 ALA n 
3 302 ALA n 
3 303 ARG n 
3 304 ASP n 
3 305 MET n 
3 306 ALA n 
3 307 ARG n 
3 308 ALA n 
3 309 GLY n 
3 310 VAL n 
3 311 SER n 
3 312 ILE n 
3 313 PRO n 
3 314 GLU n 
3 315 ILE n 
3 316 MET n 
3 317 GLN n 
3 318 ALA n 
3 319 GLY n 
3 320 GLY n 
3 321 TRP n 
3 322 THR n 
3 323 ASN n 
3 324 VAL n 
3 325 ASN n 
3 326 ILE n 
3 327 VAL n 
3 328 MET n 
3 329 ASN n 
3 330 TYR n 
3 331 ILE n 
3 332 ARG n 
3 333 ASN n 
3 334 LEU n 
3 335 ASP n 
3 336 SER n 
3 337 GLU n 
3 338 THR n 
3 339 GLY n 
3 340 ALA n 
3 341 MET n 
3 342 VAL n 
3 343 ARG n 
3 344 LEU n 
3 345 LEU n 
3 346 GLU n 
3 347 ASP n 
3 348 GLY n 
3 349 ASP n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     'P1-like viruses' 
_entity_src_gen.pdbx_gene_src_gene                 CRE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage P1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10678 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21-DE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'PET28B(+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RECR_BPP1 P06956 3 
;SNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQAR
GLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNL
AFLGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDPNNYLFCR
VRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNIV
MNYIRNLDSETGAMVRLLEDGD
;
2  ? 
2 GB  M10145    215623 1 ATAACTTCGTATAATGTATGCTATACGAAGTTAT 24 ? 
3 GB  M10494    215626 2 ATAACTTCGTATAGCATACATTATACGAAGTTAT 14 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1PVR A 8 ? 349 ? P06956 2  ? 343 ? 2 343 
2 1 1PVR B 8 ? 349 ? P06956 2  ? 343 ? 2 343 
3 2 1PVR C 1 ? 34  ? 215623 24 ? 57  ? 1 34  
4 3 1PVR D 1 ? 34  ? 215626 14 ? 47  ? 1 34  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1PVR MET A 1   ? UNP P06956 ?   ?   'Initiating Methionine' -5  1  
1 1PVR HIS A 2   ? UNP P06956 ?   ?   'EXPRESSION TAG'        -4  2  
1 1PVR HIS A 3   ? UNP P06956 ?   ?   'EXPRESSION TAG'        -3  3  
1 1PVR HIS A 4   ? UNP P06956 ?   ?   'EXPRESSION TAG'        -2  4  
1 1PVR HIS A 5   ? UNP P06956 ?   ?   'EXPRESSION TAG'        -1  5  
1 1PVR HIS A 6   ? UNP P06956 ?   ?   'EXPRESSION TAG'        0   6  
1 1PVR HIS A 7   ? UNP P06956 ?   ?   'EXPRESSION TAG'        1   7  
1 1PVR LEU A 180 ? UNP P06956 ILE 174 ENGINEERED              174 8  
1 1PVR ASN A 264 ? UNP P06956 THR 258 ENGINEERED              258 9  
1 1PVR SER A 265 ? UNP P06956 ARG 259 ENGINEERED              259 10 
1 1PVR GLY A 268 ? UNP P06956 GLU 262 ENGINEERED              262 11 
1 1PVR GLY A 272 ? UNP P06956 GLU 266 ENGINEERED              266 12 
2 1PVR MET B 1   ? UNP P06956 ?   ?   'Initiating Methionine' -5  13 
2 1PVR HIS B 2   ? UNP P06956 ?   ?   'EXPRESSION TAG'        -4  14 
2 1PVR HIS B 3   ? UNP P06956 ?   ?   'EXPRESSION TAG'        -3  15 
2 1PVR HIS B 4   ? UNP P06956 ?   ?   'EXPRESSION TAG'        -2  16 
2 1PVR HIS B 5   ? UNP P06956 ?   ?   'EXPRESSION TAG'        -1  17 
2 1PVR HIS B 6   ? UNP P06956 ?   ?   'EXPRESSION TAG'        0   18 
2 1PVR HIS B 7   ? UNP P06956 ?   ?   'EXPRESSION TAG'        1   19 
2 1PVR LEU B 180 ? UNP P06956 ILE 174 ENGINEERED              174 20 
2 1PVR ASN B 264 ? UNP P06956 THR 258 ENGINEERED              258 21 
2 1PVR SER B 265 ? UNP P06956 ARG 259 ENGINEERED              259 22 
2 1PVR GLY B 268 ? UNP P06956 GLU 262 ENGINEERED              262 23 
2 1PVR GLY B 272 ? UNP P06956 GLU 266 ENGINEERED              266 24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1PVR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.93 
_exptl_crystal.density_percent_sol   58.09 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    
;Sodium Acetate, Calcium Chloride, 2,4-Methylpentanediol
, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'Sodium Acetate'      ? ? ? 
1 2 1 'Calcium Chloride'    ? ? ? 
1 3 1 2,4-Methylpentanediol ? ? ? 
1 4 1 H2O                   ? ? ? 
1 5 2 'Sodium Acetate'      ? ? ? 
1 6 2 'Calcium Chloride'    ? ? ? 
1 7 2 2,4-Methylpentanediol ? ? ? 
1 8 2 H2O                   ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MACSCIENCE 
_diffrn_detector.pdbx_collection_date   2002-06-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    DOUBLE-CRYSTAL 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.08 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL7-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL7-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.08 
# 
_reflns.entry_id                     1PVR 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            2.65 
_reflns.d_resolution_low             90 
_reflns.number_all                   ? 
_reflns.number_obs                   33418 
_reflns.percent_possible_obs         97.1 
_reflns.pdbx_Rmerge_I_obs            0.043 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.65 
_reflns_shell.d_res_low              2.74 
_reflns_shell.percent_possible_all   98.7 
_reflns_shell.Rmerge_I_obs           0.375 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.5 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3364 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1PVR 
_refine.ls_d_res_high                            2.65 
_refine.ls_d_res_low                             5 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     28401 
_refine.ls_number_reflns_obs                     28401 
_refine.ls_number_reflns_R_free                  1447 
_refine.ls_percent_reflns_obs                    97 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.212 
_refine.ls_R_factor_R_work                       0.212 
_refine.ls_R_factor_R_free                       0.287 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      1KBU 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1PVR 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             0.25 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5068 
_refine_hist.pdbx_number_atoms_nucleic_acid   1451 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             103 
_refine_hist.number_atoms_total               6622 
_refine_hist.d_res_high                       2.65 
_refine_hist.d_res_low                        5 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d    0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
t_angle_deg 1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1PVR 
_struct.title                     
;BASIS FOR A SWITCH IN SUBSTRATE SPECIFICITY: CRYSTAL STRUCTURE OF SELECTED VARIANT OF CRE SITE-SPECIFIC RECOMBINASE, LNSGG BOUND TO THE LOXP (WILDTYPE) RECOGNITION SITE
;
_struct.pdbx_descriptor           'Recombinase CRE/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1PVR 
_struct_keywords.pdbx_keywords   RECOMBINATION/DNA 
_struct_keywords.text            'CRE, Recombinase, DNA, CRE-LOXP RECOMBINATION, RECOMBINATION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;The second part of the tetrameric biological assembly is generated 
by the two fold axis:  x, -y+1, -z+1.
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR C 25  ? ASP C 39  ? THR A 19  ASP A 33  1 ? 15 
HELX_P HELX_P2  2  ARG C 40  ? PHE C 43  ? ARG A 34  PHE A 37  5 ? 4  
HELX_P HELX_P3  3  SER C 44  ? ASN C 65  ? SER A 38  ASN A 59  1 ? 22 
HELX_P HELX_P4  4  GLU C 73  ? ARG C 87  ? GLU A 67  ARG A 81  1 ? 15 
HELX_P HELX_P5  5  ALA C 90  ? ARG C 107 ? ALA A 84  ARG A 101 1 ? 18 
HELX_P HELX_P6  6  SER C 116 ? ASP C 132 ? SER A 110 ASP A 126 1 ? 17 
HELX_P HELX_P7  7  GLU C 144 ? MET C 155 ? GLU A 138 MET A 149 1 ? 12 
HELX_P HELX_P8  8  ARG C 160 ? LEU C 177 ? ARG A 154 LEU A 171 1 ? 18 
HELX_P HELX_P9  9  ARG C 179 ? ALA C 184 ? ARG A 173 ALA A 178 1 ? 6  
HELX_P HELX_P10 10 SER C 220 ? GLY C 235 ? SER A 214 GLY A 229 1 ? 16 
HELX_P HELX_P11 11 SER C 263 ? GLY C 280 ? SER A 257 GLY A 274 1 ? 18 
HELX_P HELX_P12 12 ASP C 283 ? GLN C 287 ? ASP A 277 GLN A 281 5 ? 5  
HELX_P HELX_P13 13 HIS C 295 ? ALA C 308 ? HIS A 289 ALA A 302 1 ? 14 
HELX_P HELX_P14 14 SER C 311 ? MET C 316 ? SER A 305 MET A 310 1 ? 6  
HELX_P HELX_P15 15 VAL C 324 ? ILE C 331 ? VAL A 318 ILE A 325 1 ? 8  
HELX_P HELX_P16 16 LEU C 334 ? THR C 338 ? LEU A 328 THR A 332 5 ? 5  
HELX_P HELX_P17 17 GLY C 339 ? GLU C 346 ? GLY A 333 GLU A 340 1 ? 8  
HELX_P HELX_P18 18 THR D 25  ? ASP D 39  ? THR B 19  ASP B 33  1 ? 15 
HELX_P HELX_P19 19 ARG D 40  ? PHE D 43  ? ARG B 34  PHE B 37  5 ? 4  
HELX_P HELX_P20 20 SER D 44  ? ASN D 65  ? SER B 38  ASN B 59  1 ? 22 
HELX_P HELX_P21 21 GLU D 73  ? ARG D 87  ? GLU B 67  ARG B 81  1 ? 15 
HELX_P HELX_P22 22 ALA D 90  ? GLY D 109 ? ALA B 84  GLY B 103 1 ? 20 
HELX_P HELX_P23 23 ARG D 112 ? ASP D 115 ? ARG B 106 ASP B 109 5 ? 4  
HELX_P HELX_P24 24 SER D 116 ? ASP D 132 ? SER B 110 ASP B 126 1 ? 17 
HELX_P HELX_P25 25 GLU D 144 ? GLU D 156 ? GLU B 138 GLU B 150 1 ? 13 
HELX_P HELX_P26 26 ARG D 160 ? LEU D 177 ? ARG B 154 LEU B 171 1 ? 18 
HELX_P HELX_P27 27 ARG D 179 ? ALA D 184 ? ARG B 173 ALA B 178 1 ? 6  
HELX_P HELX_P28 28 ARG D 185 ? ILE D 186 ? ARG B 179 ILE B 180 5 ? 2  
HELX_P HELX_P29 29 ARG D 187 ? LYS D 189 ? ARG B 181 LYS B 183 5 ? 3  
HELX_P HELX_P30 30 SER D 220 ? GLY D 235 ? SER B 214 GLY B 229 1 ? 16 
HELX_P HELX_P31 31 VAL D 236 ? ASP D 239 ? VAL B 230 ASP B 233 5 ? 4  
HELX_P HELX_P32 32 SER D 263 ? GLY D 280 ? SER B 257 GLY B 274 1 ? 18 
HELX_P HELX_P33 33 HIS D 295 ? ALA D 308 ? HIS B 289 ALA B 302 1 ? 14 
HELX_P HELX_P34 34 SER D 311 ? GLY D 320 ? SER B 305 GLY B 314 1 ? 10 
HELX_P HELX_P35 35 VAL D 324 ? TYR D 330 ? VAL B 318 TYR B 324 1 ? 7  
HELX_P HELX_P36 36 GLY D 339 ? ASP D 347 ? GLY B 333 ASP B 341 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DA 1  N1 ? ? ? 1_555 B DT 34 N3 ? ? C DA 1  D DT 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DA 1  N6 ? ? ? 1_555 B DT 34 O4 ? ? C DA 1  D DT 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DT 2  N3 ? ? ? 1_555 B DA 33 N1 ? ? C DT 2  D DA 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DT 2  O4 ? ? ? 1_555 B DA 33 N6 ? ? C DT 2  D DA 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DA 3  N1 ? ? ? 1_555 B DT 32 N3 ? ? C DA 3  D DT 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DA 3  N6 ? ? ? 1_555 B DT 32 O4 ? ? C DA 3  D DT 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DA 4  N1 ? ? ? 1_555 B DT 31 N3 ? ? C DA 4  D DT 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DA 4  N6 ? ? ? 1_555 B DT 31 O4 ? ? C DA 4  D DT 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DC 5  N3 ? ? ? 1_555 B DG 30 N1 ? ? C DC 5  D DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DC 5  N4 ? ? ? 1_555 B DG 30 O6 ? ? C DC 5  D DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DC 5  O2 ? ? ? 1_555 B DG 30 N2 ? ? C DC 5  D DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DT 6  N3 ? ? ? 1_555 B DA 29 N1 ? ? C DT 6  D DA 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DT 6  O4 ? ? ? 1_555 B DA 29 N6 ? ? C DT 6  D DA 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DT 7  N3 ? ? ? 1_555 B DA 28 N1 ? ? C DT 7  D DA 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DT 7  O4 ? ? ? 1_555 B DA 28 N6 ? ? C DT 7  D DA 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DC 8  N3 ? ? ? 1_555 B DG 27 N1 ? ? C DC 8  D DG 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DC 8  N4 ? ? ? 1_555 B DG 27 O6 ? ? C DC 8  D DG 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DC 8  O2 ? ? ? 1_555 B DG 27 N2 ? ? C DC 8  D DG 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DG 9  N1 ? ? ? 1_555 B DC 26 N3 ? ? C DG 9  D DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DG 9  N2 ? ? ? 1_555 B DC 26 O2 ? ? C DG 9  D DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DG 9  O6 ? ? ? 1_555 B DC 26 N4 ? ? C DG 9  D DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DT 10 N3 ? ? ? 1_555 B DA 25 N1 ? ? C DT 10 D DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DT 10 O4 ? ? ? 1_555 B DA 25 N6 ? ? C DT 10 D DA 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DA 11 N1 ? ? ? 1_555 B DT 24 N3 ? ? C DA 11 D DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DA 11 N6 ? ? ? 1_555 B DT 24 O4 ? ? C DA 11 D DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DT 12 N3 ? ? ? 1_555 B DA 23 N1 ? ? C DT 12 D DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? A DT 12 O4 ? ? ? 1_555 B DA 23 N6 ? ? C DT 12 D DA 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? A DA 13 N1 ? ? ? 1_555 B DT 22 N3 ? ? C DA 13 D DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? A DA 13 N6 ? ? ? 1_555 B DT 22 O4 ? ? C DA 13 D DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? A DA 14 N1 ? ? ? 1_555 B DT 21 N3 ? ? C DA 14 D DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? A DA 14 N6 ? ? ? 1_555 B DT 21 O4 ? ? C DA 14 D DT 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? A DT 15 N3 ? ? ? 1_555 B DA 20 N1 ? ? C DT 15 D DA 20 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? 
hydrog33 hydrog ? ? A DG 16 N1 A ? ? 1_555 B DC 19 N3 A ? C DG 16 D DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? A DG 16 N2 A ? ? 1_555 B DC 19 O2 A ? C DG 16 D DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? A DG 16 O6 A ? ? 1_555 B DC 19 N4 A ? C DG 16 D DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 70 C . ? PHE 64 A PRO 71 C ? PRO 65 A 1 1.28  
2 PHE 70 D . ? PHE 64 B PRO 71 D ? PRO 65 B 1 -2.85 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE C 191 ? ARG C 193 ? ILE A 185 ARG A 187 
A 2 MET C 199 ? HIS C 202 ? MET A 193 HIS A 196 
A 3 GLU C 216 ? ALA C 218 ? GLU A 210 ALA A 212 
B 1 ARG C 247 ? VAL C 248 ? ARG A 241 VAL A 242 
B 2 ALA C 254 ? ALA C 255 ? ALA A 248 ALA A 249 
C 1 ILE D 191 ? ARG D 193 ? ILE B 185 ARG B 187 
C 2 MET D 199 ? THR D 206 ? MET B 193 THR B 200 
C 3 LEU D 209 ? ALA D 218 ? LEU B 203 ALA B 212 
D 1 ARG D 247 ? VAL D 248 ? ARG B 241 VAL B 242 
D 2 ALA D 254 ? ALA D 255 ? ALA B 248 ALA B 249 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER C 192 ? N SER A 186 O LEU C 200 ? O LEU A 194 
A 2 3 N ILE C 201 ? N ILE A 195 O LYS C 217 ? O LYS A 211 
B 1 2 N ARG C 247 ? N ARG A 241 O ALA C 255 ? O ALA A 249 
C 1 2 N SER D 192 ? N SER B 186 O LEU D 200 ? O LEU B 194 
C 2 3 N ILE D 201 ? N ILE B 195 O LYS D 217 ? O LYS B 211 
D 1 2 N ARG D 247 ? N ARG B 241 O ALA D 255 ? O ALA B 249 
# 
_database_PDB_matrix.entry_id          1PVR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1PVR 
_atom_sites.fract_transf_matrix[1][1]   0.009312 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008226 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005557 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DA  A 1 1   ? 72.171  5.952  61.070  1.00 100.00 ? 1   DA  C "O5'" 1 
ATOM   2    C "C5'" . DA  A 1 1   ? 72.559  7.215  60.559  1.00 66.23  ? 1   DA  C "C5'" 1 
ATOM   3    C "C4'" . DA  A 1 1   ? 74.063  7.452  60.686  1.00 100.00 ? 1   DA  C "C4'" 1 
ATOM   4    O "O4'" . DA  A 1 1   ? 74.575  8.091  59.482  1.00 100.00 ? 1   DA  C "O4'" 1 
ATOM   5    C "C3'" . DA  A 1 1   ? 74.486  8.367  61.822  1.00 52.92  ? 1   DA  C "C3'" 1 
ATOM   6    O "O3'" . DA  A 1 1   ? 75.773  7.977  62.271  1.00 68.86  ? 1   DA  C "O3'" 1 
ATOM   7    C "C2'" . DA  A 1 1   ? 74.475  9.742  61.156  1.00 60.47  ? 1   DA  C "C2'" 1 
ATOM   8    C "C1'" . DA  A 1 1   ? 74.605  9.509  59.650  1.00 56.68  ? 1   DA  C "C1'" 1 
ATOM   9    N N9    . DA  A 1 1   ? 73.483  10.038 58.861  1.00 57.37  ? 1   DA  C N9    1 
ATOM   10   C C8    . DA  A 1 1   ? 72.203  9.555  58.804  1.00 56.85  ? 1   DA  C C8    1 
ATOM   11   N N7    . DA  A 1 1   ? 71.395  10.178 57.982  1.00 54.97  ? 1   DA  C N7    1 
ATOM   12   C C5    . DA  A 1 1   ? 72.209  11.118 57.397  1.00 54.69  ? 1   DA  C C5    1 
ATOM   13   C C6    . DA  A 1 1   ? 71.939  12.101 56.430  1.00 55.20  ? 1   DA  C C6    1 
ATOM   14   N N6    . DA  A 1 1   ? 70.736  12.262 55.876  1.00 55.58  ? 1   DA  C N6    1 
ATOM   15   N N1    . DA  A 1 1   ? 72.941  12.930 56.058  1.00 54.70  ? 1   DA  C N1    1 
ATOM   16   C C2    . DA  A 1 1   ? 74.140  12.739 56.623  1.00 55.18  ? 1   DA  C C2    1 
ATOM   17   N N3    . DA  A 1 1   ? 74.518  11.841 57.542  1.00 55.08  ? 1   DA  C N3    1 
ATOM   18   C C4    . DA  A 1 1   ? 73.494  11.049 57.906  1.00 55.08  ? 1   DA  C C4    1 
ATOM   19   P P     . DT  A 1 2   ? 76.344  8.392  63.712  1.00 100.00 ? 2   DT  C P     1 
ATOM   20   O OP1   . DT  A 1 2   ? 77.730  7.876  63.821  1.00 100.00 ? 2   DT  C OP1   1 
ATOM   21   O OP2   . DT  A 1 2   ? 75.344  8.071  64.757  1.00 93.94  ? 2   DT  C OP2   1 
ATOM   22   O "O5'" . DT  A 1 2   ? 76.449  9.981  63.566  1.00 92.15  ? 2   DT  C "O5'" 1 
ATOM   23   C "C5'" . DT  A 1 2   ? 77.321  10.517 62.575  1.00 73.87  ? 2   DT  C "C5'" 1 
ATOM   24   C "C4'" . DT  A 1 2   ? 77.225  12.031 62.500  1.00 61.79  ? 2   DT  C "C4'" 1 
ATOM   25   O "O4'" . DT  A 1 2   ? 76.337  12.432 61.422  1.00 60.99  ? 2   DT  C "O4'" 1 
ATOM   26   C "C3'" . DT  A 1 2   ? 76.707  12.744 63.746  1.00 56.90  ? 2   DT  C "C3'" 1 
ATOM   27   O "O3'" . DT  A 1 2   ? 77.450  13.935 63.922  1.00 53.98  ? 2   DT  C "O3'" 1 
ATOM   28   C "C2'" . DT  A 1 2   ? 75.288  13.110 63.337  1.00 49.03  ? 2   DT  C "C2'" 1 
ATOM   29   C "C1'" . DT  A 1 2   ? 75.542  13.504 61.891  1.00 42.30  ? 2   DT  C "C1'" 1 
ATOM   30   N N1    . DT  A 1 2   ? 74.263  13.643 61.146  1.00 41.28  ? 2   DT  C N1    1 
ATOM   31   C C2    . DT  A 1 2   ? 74.137  14.703 60.269  1.00 42.22  ? 2   DT  C C2    1 
ATOM   32   O O2    . DT  A 1 2   ? 75.039  15.487 60.027  1.00 42.17  ? 2   DT  C O2    1 
ATOM   33   N N3    . DT  A 1 2   ? 72.918  14.797 59.647  1.00 38.57  ? 2   DT  C N3    1 
ATOM   34   C C4    . DT  A 1 2   ? 71.847  13.951 59.857  1.00 40.50  ? 2   DT  C C4    1 
ATOM   35   O O4    . DT  A 1 2   ? 70.805  14.139 59.249  1.00 39.81  ? 2   DT  C O4    1 
ATOM   36   C C5    . DT  A 1 2   ? 72.045  12.881 60.800  1.00 38.61  ? 2   DT  C C5    1 
ATOM   37   C C7    . DT  A 1 2   ? 70.932  11.920 61.086  1.00 38.24  ? 2   DT  C C7    1 
ATOM   38   C C6    . DT  A 1 2   ? 73.226  12.781 61.410  1.00 38.46  ? 2   DT  C C6    1 
ATOM   39   P P     . DA  A 1 3   ? 78.212  14.160 65.299  1.00 54.66  ? 3   DA  C P     1 
ATOM   40   O OP1   . DA  A 1 3   ? 79.431  13.321 65.312  1.00 59.00  ? 3   DA  C OP1   1 
ATOM   41   O OP2   . DA  A 1 3   ? 77.218  14.018 66.385  1.00 68.03  ? 3   DA  C OP2   1 
ATOM   42   O "O5'" . DA  A 1 3   ? 78.666  15.676 65.152  1.00 44.15  ? 3   DA  C "O5'" 1 
ATOM   43   C "C5'" . DA  A 1 3   ? 79.557  15.879 64.089  1.00 40.79  ? 3   DA  C "C5'" 1 
ATOM   44   C "C4'" . DA  A 1 3   ? 79.435  17.279 63.521  1.00 39.13  ? 3   DA  C "C4'" 1 
ATOM   45   O "O4'" . DA  A 1 3   ? 78.204  17.452 62.780  1.00 37.69  ? 3   DA  C "O4'" 1 
ATOM   46   C "C3'" . DA  A 1 3   ? 79.477  18.425 64.514  1.00 36.77  ? 3   DA  C "C3'" 1 
ATOM   47   O "O3'" . DA  A 1 3   ? 80.027  19.543 63.835  1.00 42.15  ? 3   DA  C "O3'" 1 
ATOM   48   C "C2'" . DA  A 1 3   ? 77.994  18.586 64.813  1.00 33.14  ? 3   DA  C "C2'" 1 
ATOM   49   C "C1'" . DA  A 1 3   ? 77.361  18.376 63.442  1.00 36.18  ? 3   DA  C "C1'" 1 
ATOM   50   N N9    . DA  A 1 3   ? 76.073  17.703 63.508  1.00 36.04  ? 3   DA  C N9    1 
ATOM   51   C C8    . DA  A 1 3   ? 75.694  16.732 64.393  1.00 36.94  ? 3   DA  C C8    1 
ATOM   52   N N7    . DA  A 1 3   ? 74.494  16.247 64.191  1.00 34.87  ? 3   DA  C N7    1 
ATOM   53   C C5    . DA  A 1 3   ? 74.073  16.919 63.066  1.00 33.90  ? 3   DA  C C5    1 
ATOM   54   C C6    . DA  A 1 3   ? 72.870  16.848 62.351  1.00 34.12  ? 3   DA  C C6    1 
ATOM   55   N N6    . DA  A 1 3   ? 71.885  16.019 62.707  1.00 32.39  ? 3   DA  C N6    1 
ATOM   56   N N1    . DA  A 1 3   ? 72.726  17.658 61.279  1.00 33.56  ? 3   DA  C N1    1 
ATOM   57   C C2    . DA  A 1 3   ? 73.737  18.483 60.970  1.00 33.64  ? 3   DA  C C2    1 
ATOM   58   N N3    . DA  A 1 3   ? 74.918  18.638 61.580  1.00 33.26  ? 3   DA  C N3    1 
ATOM   59   C C4    . DA  A 1 3   ? 75.025  17.814 62.628  1.00 32.86  ? 3   DA  C C4    1 
ATOM   60   P P     . DA  A 1 4   ? 80.727  20.835 64.480  1.00 43.09  ? 4   DA  C P     1 
ATOM   61   O OP1   . DA  A 1 4   ? 81.708  21.347 63.489  1.00 36.76  ? 4   DA  C OP1   1 
ATOM   62   O OP2   . DA  A 1 4   ? 81.162  20.514 65.855  1.00 45.52  ? 4   DA  C OP2   1 
ATOM   63   O "O5'" . DA  A 1 4   ? 79.536  21.907 64.524  1.00 41.67  ? 4   DA  C "O5'" 1 
ATOM   64   C "C5'" . DA  A 1 4   ? 78.997  22.480 63.319  1.00 30.31  ? 4   DA  C "C5'" 1 
ATOM   65   C "C4'" . DA  A 1 4   ? 77.525  22.820 63.491  1.00 27.70  ? 4   DA  C "C4'" 1 
ATOM   66   O "O4'" . DA  A 1 4   ? 76.770  21.619 63.796  1.00 27.91  ? 4   DA  C "O4'" 1 
ATOM   67   C "C3'" . DA  A 1 4   ? 77.200  23.771 64.649  1.00 29.69  ? 4   DA  C "C3'" 1 
ATOM   68   O "O3'" . DA  A 1 4   ? 76.687  25.014 64.208  1.00 28.63  ? 4   DA  C "O3'" 1 
ATOM   69   C "C2'" . DA  A 1 4   ? 76.157  23.027 65.484  1.00 26.20  ? 4   DA  C "C2'" 1 
ATOM   70   C "C1'" . DA  A 1 4   ? 75.610  22.086 64.440  1.00 23.56  ? 4   DA  C "C1'" 1 
ATOM   71   N N9    . DA  A 1 4   ? 74.797  21.003 64.959  1.00 27.42  ? 4   DA  C N9    1 
ATOM   72   C C8    . DA  A 1 4   ? 75.024  20.167 66.011  1.00 28.37  ? 4   DA  C C8    1 
ATOM   73   N N7    . DA  A 1 4   ? 74.061  19.282 66.198  1.00 31.21  ? 4   DA  C N7    1 
ATOM   74   C C5    . DA  A 1 4   ? 73.137  19.574 65.202  1.00 32.62  ? 4   DA  C C5    1 
ATOM   75   C C6    . DA  A 1 4   ? 71.886  19.009 64.864  1.00 31.24  ? 4   DA  C C6    1 
ATOM   76   N N6    . DA  A 1 4   ? 71.330  17.991 65.531  1.00 28.92  ? 4   DA  C N6    1 
ATOM   77   N N1    . DA  A 1 4   ? 71.220  19.539 63.818  1.00 30.78  ? 4   DA  C N1    1 
ATOM   78   C C2    . DA  A 1 4   ? 71.770  20.564 63.158  1.00 31.17  ? 4   DA  C C2    1 
ATOM   79   N N3    . DA  A 1 4   ? 72.930  21.182 63.389  1.00 31.21  ? 4   DA  C N3    1 
ATOM   80   C C4    . DA  A 1 4   ? 73.574  20.637 64.436  1.00 30.85  ? 4   DA  C C4    1 
ATOM   81   P P     . DC  A 1 5   ? 77.018  26.324 65.059  1.00 30.41  ? 5   DC  C P     1 
ATOM   82   O OP1   . DC  A 1 5   ? 77.506  27.442 64.223  1.00 29.26  ? 5   DC  C OP1   1 
ATOM   83   O OP2   . DC  A 1 5   ? 77.834  25.872 66.194  1.00 44.43  ? 5   DC  C OP2   1 
ATOM   84   O "O5'" . DC  A 1 5   ? 75.620  26.918 65.536  1.00 28.94  ? 5   DC  C "O5'" 1 
ATOM   85   C "C5'" . DC  A 1 5   ? 74.526  26.183 65.969  1.00 24.06  ? 5   DC  C "C5'" 1 
ATOM   86   C "C4'" . DC  A 1 5   ? 73.559  26.039 64.818  1.00 27.09  ? 5   DC  C "C4'" 1 
ATOM   87   O "O4'" . DC  A 1 5   ? 73.353  24.617 64.739  1.00 28.82  ? 5   DC  C "O4'" 1 
ATOM   88   C "C3'" . DC  A 1 5   ? 72.179  26.667 64.962  1.00 26.32  ? 5   DC  C "C3'" 1 
ATOM   89   O "O3'" . DC  A 1 5   ? 72.103  27.870 64.235  1.00 30.15  ? 5   DC  C "O3'" 1 
ATOM   90   C "C2'" . DC  A 1 5   ? 71.224  25.639 64.360  1.00 25.59  ? 5   DC  C "C2'" 1 
ATOM   91   C "C1'" . DC  A 1 5   ? 71.992  24.331 64.524  1.00 26.78  ? 5   DC  C "C1'" 1 
ATOM   92   N N1    . DC  A 1 5   ? 71.621  23.348 65.585  1.00 25.59  ? 5   DC  C N1    1 
ATOM   93   C C2    . DC  A 1 5   ? 70.497  22.553 65.365  1.00 28.13  ? 5   DC  C C2    1 
ATOM   94   O O2    . DC  A 1 5   ? 69.837  22.792 64.351  1.00 31.38  ? 5   DC  C O2    1 
ATOM   95   N N3    . DC  A 1 5   ? 70.165  21.594 66.269  1.00 27.36  ? 5   DC  C N3    1 
ATOM   96   C C4    . DC  A 1 5   ? 70.968  21.431 67.323  1.00 20.98  ? 5   DC  C C4    1 
ATOM   97   N N4    . DC  A 1 5   ? 70.659  20.505 68.222  1.00 24.47  ? 5   DC  C N4    1 
ATOM   98   C C5    . DC  A 1 5   ? 72.120  22.221 67.560  1.00 14.01  ? 5   DC  C C5    1 
ATOM   99   C C6    . DC  A 1 5   ? 72.426  23.159 66.662  1.00 14.69  ? 5   DC  C C6    1 
ATOM   100  P P     . DT  A 1 6   ? 70.933  28.894 64.605  1.00 35.81  ? 6   DT  C P     1 
ATOM   101  O OP1   . DT  A 1 6   ? 70.883  29.907 63.519  1.00 37.85  ? 6   DT  C OP1   1 
ATOM   102  O OP2   . DT  A 1 6   ? 71.080  29.316 66.017  1.00 41.99  ? 6   DT  C OP2   1 
ATOM   103  O "O5'" . DT  A 1 6   ? 69.607  28.000 64.577  1.00 45.73  ? 6   DT  C "O5'" 1 
ATOM   104  C "C5'" . DT  A 1 6   ? 69.067  27.636 63.319  1.00 44.01  ? 6   DT  C "C5'" 1 
ATOM   105  C "C4'" . DT  A 1 6   ? 67.602  27.253 63.417  1.00 37.14  ? 6   DT  C "C4'" 1 
ATOM   106  O "O4'" . DT  A 1 6   ? 67.386  25.996 64.104  1.00 36.51  ? 6   DT  C "O4'" 1 
ATOM   107  C "C3'" . DT  A 1 6   ? 66.686  28.257 64.078  1.00 32.74  ? 6   DT  C "C3'" 1 
ATOM   108  O "O3'" . DT  A 1 6   ? 65.476  28.199 63.368  1.00 45.73  ? 6   DT  C "O3'" 1 
ATOM   109  C "C2'" . DT  A 1 6   ? 66.531  27.688 65.485  1.00 28.20  ? 6   DT  C "C2'" 1 
ATOM   110  C "C1'" . DT  A 1 6   ? 66.571  26.183 65.245  1.00 34.27  ? 6   DT  C "C1'" 1 
ATOM   111  N N1    . DT  A 1 6   ? 67.261  25.421 66.314  1.00 35.94  ? 6   DT  C N1    1 
ATOM   112  C C2    . DT  A 1 6   ? 66.687  24.256 66.774  1.00 37.76  ? 6   DT  C C2    1 
ATOM   113  O O2    . DT  A 1 6   ? 65.620  23.819 66.390  1.00 38.67  ? 6   DT  C O2    1 
ATOM   114  N N3    . DT  A 1 6   ? 67.422  23.613 67.725  1.00 35.68  ? 6   DT  C N3    1 
ATOM   115  C C4    . DT  A 1 6   ? 68.635  24.027 68.229  1.00 36.71  ? 6   DT  C C4    1 
ATOM   116  O O4    . DT  A 1 6   ? 69.186  23.360 69.081  1.00 36.15  ? 6   DT  C O4    1 
ATOM   117  C C5    . DT  A 1 6   ? 69.181  25.241 67.711  1.00 33.78  ? 6   DT  C C5    1 
ATOM   118  C C7    . DT  A 1 6   ? 70.496  25.738 68.221  1.00 31.98  ? 6   DT  C C7    1 
ATOM   119  C C6    . DT  A 1 6   ? 68.483  25.875 66.765  1.00 36.21  ? 6   DT  C C6    1 
ATOM   120  P P     . DT  A 1 7   ? 64.310  29.271 63.593  1.00 51.56  ? 7   DT  C P     1 
ATOM   121  O OP1   . DT  A 1 7   ? 63.598  29.403 62.299  1.00 59.47  ? 7   DT  C OP1   1 
ATOM   122  O OP2   . DT  A 1 7   ? 64.894  30.468 64.250  1.00 43.31  ? 7   DT  C OP2   1 
ATOM   123  O "O5'" . DT  A 1 7   ? 63.323  28.519 64.614  1.00 46.37  ? 7   DT  C "O5'" 1 
ATOM   124  C "C5'" . DT  A 1 7   ? 63.260  27.105 64.599  1.00 38.59  ? 7   DT  C "C5'" 1 
ATOM   125  C "C4'" . DT  A 1 7   ? 62.284  26.598 65.634  1.00 43.84  ? 7   DT  C "C4'" 1 
ATOM   126  O "O4'" . DT  A 1 7   ? 63.019  25.916 66.678  1.00 47.61  ? 7   DT  C "O4'" 1 
ATOM   127  C "C3'" . DT  A 1 7   ? 61.443  27.638 66.351  1.00 46.17  ? 7   DT  C "C3'" 1 
ATOM   128  O "O3'" . DT  A 1 7   ? 60.165  27.037 66.566  1.00 56.07  ? 7   DT  C "O3'" 1 
ATOM   129  C "C2'" . DT  A 1 7   ? 62.213  27.827 67.659  1.00 32.98  ? 7   DT  C "C2'" 1 
ATOM   130  C "C1'" . DT  A 1 7   ? 62.684  26.410 67.955  1.00 30.35  ? 7   DT  C "C1'" 1 
ATOM   131  N N1    . DT  A 1 7   ? 63.959  26.323 68.741  1.00 31.04  ? 7   DT  C N1    1 
ATOM   132  C C2    . DT  A 1 7   ? 64.132  25.222 69.567  1.00 33.99  ? 7   DT  C C2    1 
ATOM   133  O O2    . DT  A 1 7   ? 63.301  24.340 69.712  1.00 35.00  ? 7   DT  C O2    1 
ATOM   134  N N3    . DT  A 1 7   ? 65.321  25.189 70.249  1.00 30.25  ? 7   DT  C N3    1 
ATOM   135  C C4    . DT  A 1 7   ? 66.329  26.131 70.165  1.00 30.05  ? 7   DT  C C4    1 
ATOM   136  O O4    . DT  A 1 7   ? 67.339  25.963 70.837  1.00 29.47  ? 7   DT  C O4    1 
ATOM   137  C C5    . DT  A 1 7   ? 66.088  27.255 69.288  1.00 22.59  ? 7   DT  C C5    1 
ATOM   138  C C7    . DT  A 1 7   ? 67.118  28.328 69.127  1.00 20.64  ? 7   DT  C C7    1 
ATOM   139  C C6    . DT  A 1 7   ? 64.936  27.299 68.616  1.00 25.17  ? 7   DT  C C6    1 
ATOM   140  P P     . DC  A 1 8   ? 58.788  27.764 66.970  1.00 55.67  ? 8   DC  C P     1 
ATOM   141  O OP1   . DC  A 1 8   ? 57.729  27.107 66.187  1.00 68.12  ? 8   DC  C OP1   1 
ATOM   142  O OP2   . DC  A 1 8   ? 58.901  29.243 66.962  1.00 42.52  ? 8   DC  C OP2   1 
ATOM   143  O "O5'" . DC  A 1 8   ? 58.611  27.251 68.463  1.00 44.82  ? 8   DC  C "O5'" 1 
ATOM   144  C "C5'" . DC  A 1 8   ? 58.838  25.886 68.730  1.00 44.19  ? 8   DC  C "C5'" 1 
ATOM   145  C "C4'" . DC  A 1 8   ? 58.768  25.684 70.228  1.00 48.60  ? 8   DC  C "C4'" 1 
ATOM   146  O "O4'" . DC  A 1 8   ? 60.110  25.555 70.781  1.00 49.13  ? 8   DC  C "O4'" 1 
ATOM   147  C "C3'" . DC  A 1 8   ? 58.165  26.899 70.921  1.00 51.19  ? 8   DC  C "C3'" 1 
ATOM   148  O "O3'" . DC  A 1 8   ? 57.477  26.485 72.090  1.00 58.46  ? 8   DC  C "O3'" 1 
ATOM   149  C "C2'" . DC  A 1 8   ? 59.414  27.702 71.270  1.00 38.11  ? 8   DC  C "C2'" 1 
ATOM   150  C "C1'" . DC  A 1 8   ? 60.274  26.555 71.765  1.00 33.36  ? 8   DC  C "C1'" 1 
ATOM   151  N N1    . DC  A 1 8   ? 61.699  26.909 71.995  1.00 30.35  ? 8   DC  C N1    1 
ATOM   152  C C2    . DC  A 1 8   ? 62.415  26.074 72.838  1.00 35.27  ? 8   DC  C C2    1 
ATOM   153  O O2    . DC  A 1 8   ? 61.828  25.072 73.281  1.00 41.54  ? 8   DC  C O2    1 
ATOM   154  N N3    . DC  A 1 8   ? 63.708  26.362 73.131  1.00 34.39  ? 8   DC  C N3    1 
ATOM   155  C C4    . DC  A 1 8   ? 64.272  27.443 72.609  1.00 31.64  ? 8   DC  C C4    1 
ATOM   156  N N4    . DC  A 1 8   ? 65.557  27.693 72.888  1.00 31.10  ? 8   DC  C N4    1 
ATOM   157  C C5    . DC  A 1 8   ? 63.553  28.330 71.768  1.00 28.35  ? 8   DC  C C5    1 
ATOM   158  C C6    . DC  A 1 8   ? 62.284  28.026 71.492  1.00 28.09  ? 8   DC  C C6    1 
ATOM   159  P P     . DG  A 1 9   ? 55.889  26.612 72.263  1.00 57.45  ? 9   DG  C P     1 
ATOM   160  O OP1   . DG  A 1 9   ? 55.285  25.471 71.538  1.00 63.00  ? 9   DG  C OP1   1 
ATOM   161  O OP2   . DG  A 1 9   ? 55.472  28.004 71.963  1.00 35.90  ? 9   DG  C OP2   1 
ATOM   162  O "O5'" . DG  A 1 9   ? 55.758  26.296 73.824  1.00 49.66  ? 9   DG  C "O5'" 1 
ATOM   163  C "C5'" . DG  A 1 9   ? 56.170  24.985 74.188  1.00 47.47  ? 9   DG  C "C5'" 1 
ATOM   164  C "C4'" . DG  A 1 9   ? 56.809  24.946 75.562  1.00 56.75  ? 9   DG  C "C4'" 1 
ATOM   165  O "O4'" . DG  A 1 9   ? 58.256  25.075 75.487  1.00 55.79  ? 9   DG  C "O4'" 1 
ATOM   166  C "C3'" . DG  A 1 9   ? 56.317  26.021 76.530  1.00 58.44  ? 9   DG  C "C3'" 1 
ATOM   167  O "O3'" . DG  A 1 9   ? 55.923  25.456 77.776  1.00 47.86  ? 9   DG  C "O3'" 1 
ATOM   168  C "C2'" . DG  A 1 9   ? 57.531  26.909 76.730  1.00 48.95  ? 9   DG  C "C2'" 1 
ATOM   169  C "C1'" . DG  A 1 9   ? 58.688  25.948 76.504  1.00 42.65  ? 9   DG  C "C1'" 1 
ATOM   170  N N9    . DG  A 1 9   ? 59.754  26.776 75.988  1.00 35.46  ? 9   DG  C N9    1 
ATOM   171  C C8    . DG  A 1 9   ? 59.672  27.864 75.145  1.00 32.98  ? 9   DG  C C8    1 
ATOM   172  N N7    . DG  A 1 9   ? 60.819  28.451 74.956  1.00 31.00  ? 9   DG  C N7    1 
ATOM   173  C C5    . DG  A 1 9   ? 61.697  27.720 75.755  1.00 30.40  ? 9   DG  C C5    1 
ATOM   174  C C6    . DG  A 1 9   ? 63.079  27.870 75.932  1.00 27.98  ? 9   DG  C C6    1 
ATOM   175  O O6    . DG  A 1 9   ? 63.817  28.729 75.448  1.00 28.36  ? 9   DG  C O6    1 
ATOM   176  N N1    . DG  A 1 9   ? 63.592  26.942 76.813  1.00 25.57  ? 9   DG  C N1    1 
ATOM   177  C C2    . DG  A 1 9   ? 62.862  25.976 77.448  1.00 23.61  ? 9   DG  C C2    1 
ATOM   178  N N2    . DG  A 1 9   ? 63.568  25.187 78.271  1.00 21.40  ? 9   DG  C N2    1 
ATOM   179  N N3    . DG  A 1 9   ? 61.560  25.788 77.277  1.00 27.41  ? 9   DG  C N3    1 
ATOM   180  C C4    . DG  A 1 9   ? 61.054  26.704 76.420  1.00 30.72  ? 9   DG  C C4    1 
ATOM   181  P P     . DT  A 1 10  ? 55.313  26.442 78.861  1.00 42.60  ? 10  DT  C P     1 
ATOM   182  O OP1   . DT  A 1 10  ? 53.936  25.992 79.126  1.00 46.95  ? 10  DT  C OP1   1 
ATOM   183  O OP2   . DT  A 1 10  ? 55.560  27.847 78.458  1.00 26.12  ? 10  DT  C OP2   1 
ATOM   184  O "O5'" . DT  A 1 10  ? 56.238  26.093 80.110  1.00 39.29  ? 10  DT  C "O5'" 1 
ATOM   185  C "C5'" . DT  A 1 10  ? 56.511  24.753 80.462  1.00 35.90  ? 10  DT  C "C5'" 1 
ATOM   186  C "C4'" . DT  A 1 10  ? 57.761  24.789 81.302  1.00 35.77  ? 10  DT  C "C4'" 1 
ATOM   187  O "O4'" . DT  A 1 10  ? 58.724  25.491 80.484  1.00 36.56  ? 10  DT  C "O4'" 1 
ATOM   188  C "C3'" . DT  A 1 10  ? 57.605  25.650 82.540  1.00 39.31  ? 10  DT  C "C3'" 1 
ATOM   189  O "O3'" . DT  A 1 10  ? 58.233  25.036 83.627  1.00 52.65  ? 10  DT  C "O3'" 1 
ATOM   190  C "C2'" . DT  A 1 10  ? 58.299  26.956 82.175  1.00 27.14  ? 10  DT  C "C2'" 1 
ATOM   191  C "C1'" . DT  A 1 10  ? 59.391  26.453 81.254  1.00 30.82  ? 10  DT  C "C1'" 1 
ATOM   192  N N1    . DT  A 1 10  ? 59.924  27.537 80.360  1.00 30.66  ? 10  DT  C N1    1 
ATOM   193  C C2    . DT  A 1 10  ? 61.301  27.761 80.323  1.00 29.15  ? 10  DT  C C2    1 
ATOM   194  O O2    . DT  A 1 10  ? 62.140  27.115 80.943  1.00 27.71  ? 10  DT  C O2    1 
ATOM   195  N N3    . DT  A 1 10  ? 61.676  28.796 79.505  1.00 26.19  ? 10  DT  C N3    1 
ATOM   196  C C4    . DT  A 1 10  ? 60.839  29.592 78.749  1.00 27.40  ? 10  DT  C C4    1 
ATOM   197  O O4    . DT  A 1 10  ? 61.321  30.496 78.077  1.00 26.36  ? 10  DT  C O4    1 
ATOM   198  C C5    . DT  A 1 10  ? 59.427  29.301 78.828  1.00 29.26  ? 10  DT  C C5    1 
ATOM   199  C C7    . DT  A 1 10  ? 58.449  30.141 78.040  1.00 28.71  ? 10  DT  C C7    1 
ATOM   200  C C6    . DT  A 1 10  ? 59.038  28.298 79.632  1.00 29.01  ? 10  DT  C C6    1 
ATOM   201  P P     . DA  A 1 11  ? 58.184  25.764 85.046  1.00 55.27  ? 11  DA  C P     1 
ATOM   202  O OP1   . DA  A 1 11  ? 58.010  24.682 86.045  1.00 47.50  ? 11  DA  C OP1   1 
ATOM   203  O OP2   . DA  A 1 11  ? 57.196  26.863 84.998  1.00 66.99  ? 11  DA  C OP2   1 
ATOM   204  O "O5'" . DA  A 1 11  ? 59.643  26.421 85.170  1.00 47.11  ? 11  DA  C "O5'" 1 
ATOM   205  C "C5'" . DA  A 1 11  ? 60.700  25.591 85.649  1.00 36.55  ? 11  DA  C "C5'" 1 
ATOM   206  C "C4'" . DA  A 1 11  ? 61.969  26.391 85.627  1.00 29.55  ? 11  DA  C "C4'" 1 
ATOM   207  O "O4'" . DA  A 1 11  ? 61.942  27.193 84.428  1.00 36.58  ? 11  DA  C "O4'" 1 
ATOM   208  C "C3'" . DA  A 1 11  ? 62.015  27.406 86.748  1.00 30.77  ? 11  DA  C "C3'" 1 
ATOM   209  O "O3'" . DA  A 1 11  ? 63.180  27.188 87.509  1.00 34.23  ? 11  DA  C "O3'" 1 
ATOM   210  C "C2'" . DA  A 1 11  ? 62.052  28.765 86.053  1.00 37.03  ? 11  DA  C "C2'" 1 
ATOM   211  C "C1'" . DA  A 1 11  ? 62.600  28.414 84.682  1.00 34.60  ? 11  DA  C "C1'" 1 
ATOM   212  N N9    . DA  A 1 11  ? 62.238  29.410 83.668  1.00 30.60  ? 11  DA  C N9    1 
ATOM   213  C C8    . DA  A 1 11  ? 60.986  29.744 83.223  1.00 29.95  ? 11  DA  C C8    1 
ATOM   214  N N7    . DA  A 1 11  ? 60.986  30.707 82.331  1.00 30.71  ? 11  DA  C N7    1 
ATOM   215  C C5    . DA  A 1 11  ? 62.325  31.036 82.163  1.00 26.37  ? 11  DA  C C5    1 
ATOM   216  C C6    . DA  A 1 11  ? 62.981  31.983 81.346  1.00 21.80  ? 11  DA  C C6    1 
ATOM   217  N N6    . DA  A 1 11  ? 62.372  32.830 80.514  1.00 17.81  ? 11  DA  C N6    1 
ATOM   218  N N1    . DA  A 1 11  ? 64.325  32.043 81.433  1.00 23.08  ? 11  DA  C N1    1 
ATOM   219  C C2    . DA  A 1 11  ? 64.963  31.202 82.276  1.00 24.02  ? 11  DA  C C2    1 
ATOM   220  N N3    . DA  A 1 11  ? 64.459  30.275 83.089  1.00 24.11  ? 11  DA  C N3    1 
ATOM   221  C C4    . DA  A 1 11  ? 63.114  30.248 82.990  1.00 25.82  ? 11  DA  C C4    1 
ATOM   222  P P     . DT  A 1 12  ? 63.338  27.969 88.884  1.00 35.07  ? 12  DT  C P     1 
ATOM   223  O OP1   . DT  A 1 12  ? 64.370  27.311 89.711  1.00 42.58  ? 12  DT  C OP1   1 
ATOM   224  O OP2   . DT  A 1 12  ? 62.003  28.216 89.448  1.00 40.46  ? 12  DT  C OP2   1 
ATOM   225  O "O5'" . DT  A 1 12  ? 63.953  29.340 88.400  1.00 33.97  ? 12  DT  C "O5'" 1 
ATOM   226  C "C5'" . DT  A 1 12  ? 65.191  29.231 87.759  1.00 26.36  ? 12  DT  C "C5'" 1 
ATOM   227  C "C4'" . DT  A 1 12  ? 65.645  30.631 87.438  1.00 23.08  ? 12  DT  C "C4'" 1 
ATOM   228  O "O4'" . DT  A 1 12  ? 64.892  31.100 86.290  1.00 22.45  ? 12  DT  C "O4'" 1 
ATOM   229  C "C3'" . DT  A 1 12  ? 65.468  31.653 88.560  1.00 23.75  ? 12  DT  C "C3'" 1 
ATOM   230  O "O3'" . DT  A 1 12  ? 66.723  32.257 88.712  1.00 32.42  ? 12  DT  C "O3'" 1 
ATOM   231  C "C2'" . DT  A 1 12  ? 64.504  32.669 87.950  1.00 30.93  ? 12  DT  C "C2'" 1 
ATOM   232  C "C1'" . DT  A 1 12  ? 64.751  32.486 86.454  1.00 26.69  ? 12  DT  C "C1'" 1 
ATOM   233  N N1    . DT  A 1 12  ? 63.636  32.983 85.597  1.00 27.45  ? 12  DT  C N1    1 
ATOM   234  C C2    . DT  A 1 12  ? 63.973  34.000 84.741  1.00 27.83  ? 12  DT  C C2    1 
ATOM   235  O O2    . DT  A 1 12  ? 65.100  34.439 84.674  1.00 27.50  ? 12  DT  C O2    1 
ATOM   236  N N3    . DT  A 1 12  ? 62.946  34.518 83.999  1.00 28.49  ? 12  DT  C N3    1 
ATOM   237  C C4    . DT  A 1 12  ? 61.623  34.129 84.016  1.00 28.68  ? 12  DT  C C4    1 
ATOM   238  O O4    . DT  A 1 12  ? 60.836  34.678 83.259  1.00 27.89  ? 12  DT  C O4    1 
ATOM   239  C C5    . DT  A 1 12  ? 61.310  33.055 84.917  1.00 25.29  ? 12  DT  C C5    1 
ATOM   240  C C7    . DT  A 1 12  ? 59.893  32.557 84.995  1.00 22.84  ? 12  DT  C C7    1 
ATOM   241  C C6    . DT  A 1 12  ? 62.319  32.541 85.656  1.00 26.19  ? 12  DT  C C6    1 
ATOM   242  P P     . DA  A 1 13  ? 67.274  33.174 89.892  1.00 32.50  ? 13  DA  C P     1 
ATOM   243  O OP1   . DA  A 1 13  ? 68.274  32.351 90.613  1.00 35.86  ? 13  DA  C OP1   1 
ATOM   244  O OP2   . DA  A 1 13  ? 66.161  33.791 90.635  1.00 55.42  ? 13  DA  C OP2   1 
ATOM   245  O "O5'" . DA  A 1 13  ? 67.995  34.337 89.070  1.00 28.74  ? 13  DA  C "O5'" 1 
ATOM   246  C "C5'" . DA  A 1 13  ? 69.199  34.087 88.359  1.00 22.60  ? 13  DA  C "C5'" 1 
ATOM   247  C "C4'" . DA  A 1 13  ? 69.398  35.182 87.341  1.00 22.25  ? 13  DA  C "C4'" 1 
ATOM   248  O "O4'" . DA  A 1 13  ? 68.146  35.341 86.629  1.00 24.45  ? 13  DA  C "O4'" 1 
ATOM   249  C "C3'" . DA  A 1 13  ? 69.727  36.558 87.898  1.00 21.38  ? 13  DA  C "C3'" 1 
ATOM   250  O "O3'" . DA  A 1 13  ? 70.920  37.003 87.289  1.00 21.62  ? 13  DA  C "O3'" 1 
ATOM   251  C "C2'" . DA  A 1 13  ? 68.534  37.432 87.500  1.00 26.32  ? 13  DA  C "C2'" 1 
ATOM   252  C "C1'" . DA  A 1 13  ? 67.948  36.698 86.303  1.00 23.01  ? 13  DA  C "C1'" 1 
ATOM   253  N N9    . DA  A 1 13  ? 66.506  36.852 86.164  1.00 22.34  ? 13  DA  C N9    1 
ATOM   254  C C8    . DA  A 1 13  ? 65.536  36.180 86.855  1.00 22.98  ? 13  DA  C C8    1 
ATOM   255  N N7    . DA  A 1 13  ? 64.311  36.502 86.532  1.00 22.23  ? 13  DA  C N7    1 
ATOM   256  C C5    . DA  A 1 13  ? 64.483  37.451 85.537  1.00 25.58  ? 13  DA  C C5    1 
ATOM   257  C C6    . DA  A 1 13  ? 63.554  38.196 84.767  1.00 27.25  ? 13  DA  C C6    1 
ATOM   258  N N6    . DA  A 1 13  ? 62.233  38.057 84.879  1.00 26.31  ? 13  DA  C N6    1 
ATOM   259  N N1    . DA  A 1 13  ? 64.029  39.079 83.861  1.00 26.67  ? 13  DA  C N1    1 
ATOM   260  C C2    . DA  A 1 13  ? 65.363  39.173 83.737  1.00 27.14  ? 13  DA  C C2    1 
ATOM   261  N N3    . DA  A 1 13  ? 66.338  38.529 84.401  1.00 26.16  ? 13  DA  C N3    1 
ATOM   262  C C4    . DA  A 1 13  ? 65.828  37.675 85.300  1.00 24.22  ? 13  DA  C C4    1 
ATOM   263  P P     . DA  A 1 14  ? 71.552  38.447 87.524  1.00 24.64  ? 14  DA  C P     1 
ATOM   264  O OP1   . DA  A 1 14  ? 72.820  38.520 86.776  1.00 42.46  ? 14  DA  C OP1   1 
ATOM   265  O OP2   . DA  A 1 14  ? 71.560  38.672 88.978  1.00 27.21  ? 14  DA  C OP2   1 
ATOM   266  O "O5'" . DA  A 1 14  ? 70.602  39.503 86.787  1.00 23.14  ? 14  DA  C "O5'" 1 
ATOM   267  C "C5'" . DA  A 1 14  ? 70.710  39.459 85.390  1.00 23.15  ? 14  DA  C "C5'" 1 
ATOM   268  C "C4'" . DA  A 1 14  ? 70.202  40.728 84.742  1.00 34.56  ? 14  DA  C "C4'" 1 
ATOM   269  O "O4'" . DA  A 1 14  ? 68.752  40.776 84.813  1.00 33.71  ? 14  DA  C "O4'" 1 
ATOM   270  C "C3'" . DA  A 1 14  ? 70.649  42.034 85.379  1.00 38.76  ? 14  DA  C "C3'" 1 
ATOM   271  O "O3'" . DA  A 1 14  ? 70.395  43.081 84.459  1.00 49.97  ? 14  DA  C "O3'" 1 
ATOM   272  C "C2'" . DA  A 1 14  ? 69.610  42.121 86.475  1.00 33.11  ? 14  DA  C "C2'" 1 
ATOM   273  C "C1'" . DA  A 1 14  ? 68.396  41.906 85.580  1.00 35.83  ? 14  DA  C "C1'" 1 
ATOM   274  N N9    . DA  A 1 14  ? 67.160  41.542 86.257  1.00 35.44  ? 14  DA  C N9    1 
ATOM   275  C C8    . DA  A 1 14  ? 66.962  40.799 87.386  1.00 34.86  ? 14  DA  C C8    1 
ATOM   276  N N7    . DA  A 1 14  ? 65.695  40.637 87.665  1.00 35.61  ? 14  DA  C N7    1 
ATOM   277  C C5    . DA  A 1 14  ? 65.038  41.285 86.638  1.00 36.41  ? 14  DA  C C5    1 
ATOM   278  C C6    . DA  A 1 14  ? 63.676  41.450 86.350  1.00 35.82  ? 14  DA  C C6    1 
ATOM   279  N N6    . DA  A 1 14  ? 62.716  40.936 87.113  1.00 35.23  ? 14  DA  C N6    1 
ATOM   280  N N1    . DA  A 1 14  ? 63.352  42.141 85.246  1.00 35.78  ? 14  DA  C N1    1 
ATOM   281  C C2    . DA  A 1 14  ? 64.338  42.635 84.489  1.00 36.79  ? 14  DA  C C2    1 
ATOM   282  N N3    . DA  A 1 14  ? 65.650  42.543 84.657  1.00 36.67  ? 14  DA  C N3    1 
ATOM   283  C C4    . DA  A 1 14  ? 65.929  41.838 85.759  1.00 35.68  ? 14  DA  C C4    1 
ATOM   284  P P     . DT  A 1 15  ? 71.467  43.536 83.368  1.00 51.59  ? 15  DT  C P     1 
ATOM   285  O OP1   . DT  A 1 15  ? 71.241  42.784 82.103  1.00 39.00  ? 15  DT  C OP1   1 
ATOM   286  O OP2   . DT  A 1 15  ? 72.773  43.486 84.059  1.00 63.04  ? 15  DT  C OP2   1 
ATOM   287  O "O5'" . DT  A 1 15  ? 71.029  45.061 83.169  1.00 54.94  ? 15  DT  C "O5'" 1 
ATOM   288  C "C5'" . DT  A 1 15  ? 70.462  45.699 84.312  1.00 56.90  ? 15  DT  C "C5'" 1 
ATOM   289  C "C4'" . DT  A 1 15  ? 69.321  46.628 83.938  1.00 61.27  ? 15  DT  C "C4'" 1 
ATOM   290  O "O4'" . DT  A 1 15  ? 68.057  45.983 84.236  1.00 61.67  ? 15  DT  C "O4'" 1 
ATOM   291  C "C3'" . DT  A 1 15  ? 69.325  47.952 84.690  1.00 66.07  ? 15  DT  C "C3'" 1 
ATOM   292  O "O3'" . DT  A 1 15  ? 69.217  49.053 83.799  1.00 74.72  ? 15  DT  C "O3'" 1 
ATOM   293  C "C2'" . DT  A 1 15  ? 68.127  47.885 85.628  1.00 57.63  ? 15  DT  C "C2'" 1 
ATOM   294  C "C1'" . DT  A 1 15  ? 67.219  46.835 84.996  1.00 54.28  ? 15  DT  C "C1'" 1 
ATOM   295  N N1    . DT  A 1 15  ? 66.497  45.984 86.016  1.00 52.91  ? 15  DT  C N1    1 
ATOM   296  C C2    . DT  A 1 15  ? 65.112  45.931 85.972  1.00 50.80  ? 15  DT  C C2    1 
ATOM   297  O O2    . DT  A 1 15  ? 64.434  46.535 85.155  1.00 49.69  ? 15  DT  C O2    1 
ATOM   298  N N3    . DT  A 1 15  ? 64.546  45.131 86.934  1.00 47.51  ? 15  DT  C N3    1 
ATOM   299  C C4    . DT  A 1 15  ? 65.216  44.418 87.912  1.00 49.10  ? 15  DT  C C4    1 
ATOM   300  O O4    . DT  A 1 15  ? 64.582  43.744 88.716  1.00 48.31  ? 15  DT  C O4    1 
ATOM   301  C C5    . DT  A 1 15  ? 66.652  44.527 87.899  1.00 46.86  ? 15  DT  C C5    1 
ATOM   302  C C7    . DT  A 1 15  ? 67.470  43.789 88.908  1.00 45.19  ? 15  DT  C C7    1 
ATOM   303  C C6    . DT  A 1 15  ? 67.222  45.291 86.965  1.00 49.15  ? 15  DT  C C6    1 
ATOM   304  P P     A DG  A 1 16  ? 69.663  50.501 84.324  0.57 73.39  ? 16  DG  C P     1 
ATOM   305  P P     B DG  A 1 16  ? 69.776  50.311 84.509  0.43 82.61  ? 16  DG  C P     1 
ATOM   306  O OP1   A DG  A 1 16  ? 71.040  50.734 83.840  0.57 90.06  ? 16  DG  C OP1   1 
ATOM   307  O OP1   B DG  A 1 16  ? 70.803  50.059 83.469  0.43 40.19  ? 16  DG  C OP1   1 
ATOM   308  O OP2   A DG  A 1 16  ? 69.368  50.567 85.776  0.57 100.00 ? 16  DG  C OP2   1 
ATOM   309  O OP2   B DG  A 1 16  ? 70.163  50.476 85.933  0.43 24.16  ? 16  DG  C OP2   1 
ATOM   310  O "O5'" A DG  A 1 16  ? 68.723  51.539 83.538  0.57 80.76  ? 16  DG  C "O5'" 1 
ATOM   311  O "O5'" B DG  A 1 16  ? 68.835  51.506 83.983  0.43 47.61  ? 16  DG  C "O5'" 1 
ATOM   312  C "C5'" A DG  A 1 16  ? 67.486  51.136 82.953  0.57 100.00 ? 16  DG  C "C5'" 1 
ATOM   313  C "C5'" B DG  A 1 16  ? 68.401  51.472 82.611  0.43 93.52  ? 16  DG  C "C5'" 1 
ATOM   314  C "C4'" A DG  A 1 16  ? 66.377  51.989 83.528  0.57 100.00 ? 16  DG  C "C4'" 1 
ATOM   315  C "C4'" B DG  A 1 16  ? 67.011  52.056 82.419  0.43 35.27  ? 16  DG  C "C4'" 1 
ATOM   316  O "O4'" A DG  A 1 16  ? 65.585  51.175 84.435  0.57 100.00 ? 16  DG  C "O4'" 1 
ATOM   317  O "O4'" B DG  A 1 16  ? 65.988  51.121 82.855  0.43 62.70  ? 16  DG  C "O4'" 1 
ATOM   318  C "C3'" A DG  A 1 16  ? 66.920  53.156 84.349  0.57 63.91  ? 16  DG  C "C3'" 1 
ATOM   319  C "C3'" B DG  A 1 16  ? 66.795  53.362 83.169  0.43 100.00 ? 16  DG  C "C3'" 1 
ATOM   320  O "O3'" A DG  A 1 16  ? 66.151  54.338 84.148  0.57 100.00 ? 16  DG  C "O3'" 1 
ATOM   321  O "O3'" B DG  A 1 16  ? 66.844  54.447 82.248  0.43 48.84  ? 16  DG  C "O3'" 1 
ATOM   322  C "C2'" A DG  A 1 16  ? 66.815  52.643 85.781  0.57 59.37  ? 16  DG  C "C2'" 1 
ATOM   323  C "C2'" B DG  A 1 16  ? 65.420  53.223 83.829  0.43 100.00 ? 16  DG  C "C2'" 1 
ATOM   324  C "C1'" A DG  A 1 16  ? 65.549  51.794 85.703  0.57 61.96  ? 16  DG  C "C1'" 1 
ATOM   325  C "C1'" B DG  A 1 16  ? 65.114  51.723 83.790  0.43 81.56  ? 16  DG  C "C1'" 1 
ATOM   326  N N9    A DG  A 1 16  ? 65.523  50.739 86.708  0.57 61.59  ? 16  DG  C N9    1 
ATOM   327  N N9    B DG  A 1 16  ? 65.200  51.017 85.075  0.43 80.57  ? 16  DG  C N9    1 
ATOM   328  C C8    A DG  A 1 16  ? 66.559  50.263 87.471  0.57 60.07  ? 16  DG  C C8    1 
ATOM   329  C C8    B DG  A 1 16  ? 66.295  50.779 85.874  0.43 80.26  ? 16  DG  C C8    1 
ATOM   330  N N7    A DG  A 1 16  ? 66.212  49.308 88.287  0.57 58.91  ? 16  DG  C N7    1 
ATOM   331  N N7    B DG  A 1 16  ? 66.016  50.118 86.963  0.43 79.91  ? 16  DG  C N7    1 
ATOM   332  C C5    A DG  A 1 16  ? 64.852  49.134 88.059  0.57 60.36  ? 16  DG  C C5    1 
ATOM   333  C C5    B DG  A 1 16  ? 64.643  49.895 86.889  0.43 81.84  ? 16  DG  C C5    1 
ATOM   334  C C6    A DG  A 1 16  ? 63.930  48.235 88.662  0.57 59.56  ? 16  DG  C C6    1 
ATOM   335  C C6    B DG  A 1 16  ? 63.762  49.230 87.791  0.43 82.59  ? 16  DG  C C6    1 
ATOM   336  O O6    A DG  A 1 16  ? 64.146  47.384 89.540  0.57 56.93  ? 16  DG  C O6    1 
ATOM   337  O O6    B DG  A 1 16  ? 64.027  48.670 88.871  0.43 81.06  ? 16  DG  C O6    1 
ATOM   338  N N1    A DG  A 1 16  ? 62.643  48.379 88.140  0.57 60.71  ? 16  DG  C N1    1 
ATOM   339  N N1    B DG  A 1 16  ? 62.444  49.235 87.320  0.43 82.94  ? 16  DG  C N1    1 
ATOM   340  C C2    A DG  A 1 16  ? 62.292  49.285 87.163  0.57 64.39  ? 16  DG  C C2    1 
ATOM   341  C C2    B DG  A 1 16  ? 62.031  49.813 86.135  0.43 81.73  ? 16  DG  C C2    1 
ATOM   342  N N2    A DG  A 1 16  ? 61.004  49.273 86.789  0.57 64.34  ? 16  DG  C N2    1 
ATOM   343  N N2    B DG  A 1 16  ? 60.726  49.715 85.841  0.43 80.84  ? 16  DG  C N2    1 
ATOM   344  N N3    A DG  A 1 16  ? 63.146  50.135 86.590  0.57 66.70  ? 16  DG  C N3    1 
ATOM   345  N N3    B DG  A 1 16  ? 62.844  50.431 85.284  0.43 80.37  ? 16  DG  C N3    1 
ATOM   346  C C4    A DG  A 1 16  ? 64.409  50.007 87.084  0.57 65.10  ? 16  DG  C C4    1 
ATOM   347  C C4    B DG  A 1 16  ? 64.129  50.439 85.725  0.43 80.85  ? 16  DG  C C4    1 
ATOM   348  O "O3'" . DA  A 1 18  ? 58.312  59.573 78.905  1.00 100.00 ? 18  DA  C "O3'" 1 
ATOM   349  P P     . DT  A 1 19  ? 57.179  60.691 79.075  1.00 100.00 ? 19  DT  C P     1 
ATOM   350  O OP1   . DT  A 1 19  ? 57.491  61.507 80.269  1.00 97.42  ? 19  DT  C OP1   1 
ATOM   351  O OP2   . DT  A 1 19  ? 55.882  59.983 79.007  1.00 98.44  ? 19  DT  C OP2   1 
ATOM   352  O "O5'" . DT  A 1 19  ? 57.342  61.642 77.787  1.00 100.00 ? 19  DT  C "O5'" 1 
ATOM   353  C "C5'" . DT  A 1 19  ? 58.489  62.489 77.548  1.00 100.00 ? 19  DT  C "C5'" 1 
ATOM   354  C "C4'" . DT  A 1 19  ? 58.250  63.961 77.884  1.00 98.41  ? 19  DT  C "C4'" 1 
ATOM   355  O "O4'" . DT  A 1 19  ? 59.517  64.652 78.063  1.00 97.27  ? 19  DT  C "O4'" 1 
ATOM   356  C "C3'" . DT  A 1 19  ? 57.548  64.807 76.831  1.00 94.58  ? 19  DT  C "C3'" 1 
ATOM   357  O "O3'" . DT  A 1 19  ? 57.074  65.986 77.464  1.00 92.05  ? 19  DT  C "O3'" 1 
ATOM   358  C "C2'" . DT  A 1 19  ? 58.723  65.155 75.931  1.00 84.64  ? 19  DT  C "C2'" 1 
ATOM   359  C "C1'" . DT  A 1 19  ? 59.714  65.576 77.007  1.00 83.45  ? 19  DT  C "C1'" 1 
ATOM   360  N N1    . DT  A 1 19  ? 61.135  65.514 76.552  1.00 82.86  ? 19  DT  C N1    1 
ATOM   361  C C2    . DT  A 1 19  ? 61.972  66.563 76.893  1.00 81.45  ? 19  DT  C C2    1 
ATOM   362  O O2    . DT  A 1 19  ? 61.620  67.532 77.553  1.00 79.70  ? 19  DT  C O2    1 
ATOM   363  N N3    . DT  A 1 19  ? 63.258  66.427 76.424  1.00 81.29  ? 19  DT  C N3    1 
ATOM   364  C C4    . DT  A 1 19  ? 63.771  65.380 75.674  1.00 82.57  ? 19  DT  C C4    1 
ATOM   365  O O4    . DT  A 1 19  ? 64.948  65.396 75.320  1.00 81.65  ? 19  DT  C O4    1 
ATOM   366  C C5    . DT  A 1 19  ? 62.837  64.331 75.354  1.00 82.03  ? 19  DT  C C5    1 
ATOM   367  C C7    . DT  A 1 19  ? 63.295  63.155 74.545  1.00 81.07  ? 19  DT  C C7    1 
ATOM   368  C C6    . DT  A 1 19  ? 61.577  64.446 75.796  1.00 82.00  ? 19  DT  C C6    1 
ATOM   369  P P     . DG  A 1 20  ? 55.664  66.605 77.048  1.00 90.12  ? 20  DG  C P     1 
ATOM   370  O OP1   . DG  A 1 20  ? 54.808  66.666 78.256  1.00 85.06  ? 20  DG  C OP1   1 
ATOM   371  O OP2   . DG  A 1 20  ? 55.198  65.882 75.842  1.00 93.94  ? 20  DG  C OP2   1 
ATOM   372  O "O5'" . DG  A 1 20  ? 56.063  68.087 76.614  1.00 78.16  ? 20  DG  C "O5'" 1 
ATOM   373  C "C5'" . DG  A 1 20  ? 56.415  69.120 77.502  1.00 66.83  ? 20  DG  C "C5'" 1 
ATOM   374  C "C4'" . DG  A 1 20  ? 57.119  70.150 76.659  1.00 67.56  ? 20  DG  C "C4'" 1 
ATOM   375  O "O4'" . DG  A 1 20  ? 58.363  69.574 76.213  1.00 71.08  ? 20  DG  C "O4'" 1 
ATOM   376  C "C3'" . DG  A 1 20  ? 56.391  70.464 75.359  1.00 65.36  ? 20  DG  C "C3'" 1 
ATOM   377  O "O3'" . DG  A 1 20  ? 56.756  71.784 75.016  1.00 65.10  ? 20  DG  C "O3'" 1 
ATOM   378  C "C2'" . DG  A 1 20  ? 56.984  69.459 74.371  1.00 61.75  ? 20  DG  C "C2'" 1 
ATOM   379  C "C1'" . DG  A 1 20  ? 58.411  69.696 74.819  1.00 62.14  ? 20  DG  C "C1'" 1 
ATOM   380  N N9    . DG  A 1 20  ? 59.521  68.882 74.346  1.00 55.08  ? 20  DG  C N9    1 
ATOM   381  C C8    . DG  A 1 20  ? 59.595  67.664 73.758  1.00 54.26  ? 20  DG  C C8    1 
ATOM   382  N N7    . DG  A 1 20  ? 60.837  67.312 73.505  1.00 53.69  ? 20  DG  C N7    1 
ATOM   383  C C5    . DG  A 1 20  ? 61.596  68.379 73.971  1.00 55.08  ? 20  DG  C C5    1 
ATOM   384  C C6    . DG  A 1 20  ? 62.985  68.600 73.982  1.00 57.66  ? 20  DG  C C6    1 
ATOM   385  O O6    . DG  A 1 20  ? 63.864  67.841 73.555  1.00 57.76  ? 20  DG  C O6    1 
ATOM   386  N N1    . DG  A 1 20  ? 63.305  69.831 74.557  1.00 57.25  ? 20  DG  C N1    1 
ATOM   387  C C2    . DG  A 1 20  ? 62.389  70.720 75.066  1.00 58.64  ? 20  DG  C C2    1 
ATOM   388  N N2    . DG  A 1 20  ? 62.877  71.848 75.599  1.00 62.25  ? 20  DG  C N2    1 
ATOM   389  N N3    . DG  A 1 20  ? 61.085  70.528 75.065  1.00 56.12  ? 20  DG  C N3    1 
ATOM   390  C C4    . DG  A 1 20  ? 60.788  69.344 74.501  1.00 54.94  ? 20  DG  C C4    1 
ATOM   391  P P     . DC  A 1 21  ? 55.595  72.823 74.679  1.00 61.98  ? 21  DC  C P     1 
ATOM   392  O OP1   . DC  A 1 21  ? 54.892  73.152 75.943  1.00 67.20  ? 21  DC  C OP1   1 
ATOM   393  O OP2   . DC  A 1 21  ? 54.877  72.264 73.512  1.00 65.35  ? 21  DC  C OP2   1 
ATOM   394  O "O5'" . DC  A 1 21  ? 56.388  74.125 74.210  1.00 47.80  ? 21  DC  C "O5'" 1 
ATOM   395  C "C5'" . DC  A 1 21  ? 57.303  74.688 75.123  1.00 36.07  ? 21  DC  C "C5'" 1 
ATOM   396  C "C4'" . DC  A 1 21  ? 58.618  74.901 74.418  1.00 41.81  ? 21  DC  C "C4'" 1 
ATOM   397  O "O4'" . DC  A 1 21  ? 59.189  73.649 73.982  1.00 45.72  ? 21  DC  C "O4'" 1 
ATOM   398  C "C3'" . DC  A 1 21  ? 58.553  75.781 73.183  1.00 35.06  ? 21  DC  C "C3'" 1 
ATOM   399  O "O3'" . DC  A 1 21  ? 59.178  76.954 73.590  1.00 35.11  ? 21  DC  C "O3'" 1 
ATOM   400  C "C2'" . DC  A 1 21  ? 59.352  75.027 72.116  1.00 36.68  ? 21  DC  C "C2'" 1 
ATOM   401  C "C1'" . DC  A 1 21  ? 60.071  73.943 72.918  1.00 44.32  ? 21  DC  C "C1'" 1 
ATOM   402  N N1    . DC  A 1 21  ? 60.324  72.634 72.242  1.00 44.78  ? 21  DC  C N1    1 
ATOM   403  C C2    . DC  A 1 21  ? 61.641  72.221 71.999  1.00 42.71  ? 21  DC  C C2    1 
ATOM   404  O O2    . DC  A 1 21  ? 62.579  72.969 72.270  1.00 44.77  ? 21  DC  C O2    1 
ATOM   405  N N3    . DC  A 1 21  ? 61.849  71.010 71.438  1.00 42.62  ? 21  DC  C N3    1 
ATOM   406  C C4    . DC  A 1 21  ? 60.805  70.226 71.161  1.00 44.57  ? 21  DC  C C4    1 
ATOM   407  N N4    . DC  A 1 21  ? 61.033  69.041 70.583  1.00 43.40  ? 21  DC  C N4    1 
ATOM   408  C C5    . DC  A 1 21  ? 59.465  70.618 71.443  1.00 44.49  ? 21  DC  C C5    1 
ATOM   409  C C6    . DC  A 1 21  ? 59.269  71.820 71.989  1.00 45.57  ? 21  DC  C C6    1 
ATOM   410  P P     . DT  A 1 22  ? 59.632  77.997 72.500  1.00 41.44  ? 22  DT  C P     1 
ATOM   411  O OP1   . DT  A 1 22  ? 60.061  79.234 73.204  1.00 32.01  ? 22  DT  C OP1   1 
ATOM   412  O OP2   . DT  A 1 22  ? 58.558  78.005 71.482  1.00 55.40  ? 22  DT  C OP2   1 
ATOM   413  O "O5'" . DT  A 1 22  ? 60.922  77.318 71.861  1.00 50.48  ? 22  DT  C "O5'" 1 
ATOM   414  C "C5'" . DT  A 1 22  ? 62.186  77.680 72.368  1.00 47.96  ? 22  DT  C "C5'" 1 
ATOM   415  C "C4'" . DT  A 1 22  ? 63.292  77.286 71.417  1.00 42.53  ? 22  DT  C "C4'" 1 
ATOM   416  O "O4'" . DT  A 1 22  ? 63.182  75.894 71.012  1.00 39.85  ? 22  DT  C "O4'" 1 
ATOM   417  C "C3'" . DT  A 1 22  ? 63.334  78.085 70.128  1.00 42.79  ? 22  DT  C "C3'" 1 
ATOM   418  O "O3'" . DT  A 1 22  ? 64.684  78.183 69.798  1.00 61.42  ? 22  DT  C "O3'" 1 
ATOM   419  C "C2'" . DT  A 1 22  ? 62.672  77.139 69.139  1.00 35.97  ? 22  DT  C "C2'" 1 
ATOM   420  C "C1'" . DT  A 1 22  ? 63.364  75.876 69.615  1.00 34.85  ? 22  DT  C "C1'" 1 
ATOM   421  N N1    . DT  A 1 22  ? 62.818  74.627 69.104  1.00 34.88  ? 22  DT  C N1    1 
ATOM   422  C C2    . DT  A 1 22  ? 63.737  73.668 68.767  1.00 36.20  ? 22  DT  C C2    1 
ATOM   423  O O2    . DT  A 1 22  ? 64.934  73.854 68.894  1.00 36.90  ? 22  DT  C O2    1 
ATOM   424  N N3    . DT  A 1 22  ? 63.207  72.495 68.300  1.00 32.99  ? 22  DT  C N3    1 
ATOM   425  C C4    . DT  A 1 22  ? 61.866  72.192 68.166  1.00 32.74  ? 22  DT  C C4    1 
ATOM   426  O O4    . DT  A 1 22  ? 61.550  71.081 67.741  1.00 31.56  ? 22  DT  C O4    1 
ATOM   427  C C5    . DT  A 1 22  ? 60.950  73.256 68.526  1.00 35.03  ? 22  DT  C C5    1 
ATOM   428  C C7    . DT  A 1 22  ? 59.466  73.060 68.427  1.00 33.60  ? 22  DT  C C7    1 
ATOM   429  C C6    . DT  A 1 22  ? 61.463  74.409 68.979  1.00 34.95  ? 22  DT  C C6    1 
ATOM   430  P P     . DA  A 1 23  ? 65.042  79.485 68.972  1.00 68.70  ? 23  DA  C P     1 
ATOM   431  O OP1   . DA  A 1 23  ? 65.534  80.458 69.982  1.00 71.50  ? 23  DA  C OP1   1 
ATOM   432  O OP2   . DA  A 1 23  ? 63.874  79.793 68.108  1.00 65.23  ? 23  DA  C OP2   1 
ATOM   433  O "O5'" . DA  A 1 23  ? 66.260  79.010 68.039  1.00 73.00  ? 23  DA  C "O5'" 1 
ATOM   434  C "C5'" . DA  A 1 23  ? 67.456  78.434 68.572  1.00 65.57  ? 23  DA  C "C5'" 1 
ATOM   435  C "C4'" . DA  A 1 23  ? 67.914  77.289 67.693  1.00 58.21  ? 23  DA  C "C4'" 1 
ATOM   436  O "O4'" . DA  A 1 23  ? 66.798  76.387 67.556  1.00 56.43  ? 23  DA  C "O4'" 1 
ATOM   437  C "C3'" . DA  A 1 23  ? 68.264  77.640 66.247  1.00 61.54  ? 23  DA  C "C3'" 1 
ATOM   438  O "O3'" . DA  A 1 23  ? 69.671  77.818 66.037  1.00 64.09  ? 23  DA  C "O3'" 1 
ATOM   439  C "C2'" . DA  A 1 23  ? 67.723  76.477 65.407  1.00 55.83  ? 23  DA  C "C2'" 1 
ATOM   440  C "C1'" . DA  A 1 23  ? 67.060  75.564 66.431  1.00 54.84  ? 23  DA  C "C1'" 1 
ATOM   441  N N9    . DA  A 1 23  ? 65.789  75.042 65.952  1.00 51.18  ? 23  DA  C N9    1 
ATOM   442  C C8    . DA  A 1 23  ? 64.575  75.661 66.033  1.00 51.69  ? 23  DA  C C8    1 
ATOM   443  N N7    . DA  A 1 23  ? 63.578  74.976 65.532  1.00 51.95  ? 23  DA  C N7    1 
ATOM   444  C C5    . DA  A 1 23  ? 64.181  73.823 65.079  1.00 50.20  ? 23  DA  C C5    1 
ATOM   445  C C6    . DA  A 1 23  ? 63.653  72.716 64.415  1.00 46.87  ? 23  DA  C C6    1 
ATOM   446  N N6    . DA  A 1 23  ? 62.354  72.619 64.138  1.00 45.66  ? 23  DA  C N6    1 
ATOM   447  N N1    . DA  A 1 23  ? 64.493  71.721 64.082  1.00 46.61  ? 23  DA  C N1    1 
ATOM   448  C C2    . DA  A 1 23  ? 65.782  71.849 64.398  1.00 47.67  ? 23  DA  C C2    1 
ATOM   449  N N3    . DA  A 1 23  ? 66.399  72.861 65.003  1.00 48.25  ? 23  DA  C N3    1 
ATOM   450  C C4    . DA  A 1 23  ? 65.536  73.836 65.325  1.00 49.25  ? 23  DA  C C4    1 
ATOM   451  P P     . DT  A 1 24  ? 70.119  78.185 64.542  1.00 62.51  ? 24  DT  C P     1 
ATOM   452  O OP1   . DT  A 1 24  ? 71.462  78.813 64.553  1.00 67.03  ? 24  DT  C OP1   1 
ATOM   453  O OP2   . DT  A 1 24  ? 69.008  78.934 63.912  1.00 49.81  ? 24  DT  C OP2   1 
ATOM   454  O "O5'" . DT  A 1 24  ? 70.232  76.729 63.878  1.00 59.77  ? 24  DT  C "O5'" 1 
ATOM   455  C "C5'" . DT  A 1 24  ? 71.003  75.707 64.501  1.00 51.38  ? 24  DT  C "C5'" 1 
ATOM   456  C "C4'" . DT  A 1 24  ? 71.026  74.462 63.634  1.00 51.69  ? 24  DT  C "C4'" 1 
ATOM   457  O "O4'" . DT  A 1 24  ? 69.677  73.956 63.490  1.00 50.77  ? 24  DT  C "O4'" 1 
ATOM   458  C "C3'" . DT  A 1 24  ? 71.547  74.619 62.209  1.00 57.53  ? 24  DT  C "C3'" 1 
ATOM   459  O "O3'" . DT  A 1 24  ? 72.187  73.397 61.851  1.00 66.94  ? 24  DT  C "O3'" 1 
ATOM   460  C "C2'" . DT  A 1 24  ? 70.256  74.812 61.413  1.00 50.41  ? 24  DT  C "C2'" 1 
ATOM   461  C "C1'" . DT  A 1 24  ? 69.361  73.803 62.122  1.00 47.13  ? 24  DT  C "C1'" 1 
ATOM   462  N N1    . DT  A 1 24  ? 67.896  74.039 62.009  1.00 46.67  ? 24  DT  C N1    1 
ATOM   463  C C2    . DT  A 1 24  ? 67.126  73.021 61.487  1.00 44.38  ? 24  DT  C C2    1 
ATOM   464  O O2    . DT  A 1 24  ? 67.577  71.971 61.081  1.00 42.66  ? 24  DT  C O2    1 
ATOM   465  N N3    . DT  A 1 24  ? 65.780  73.282 61.450  1.00 44.43  ? 24  DT  C N3    1 
ATOM   466  C C4    . DT  A 1 24  ? 65.137  74.432 61.882  1.00 45.69  ? 24  DT  C C4    1 
ATOM   467  O O4    . DT  A 1 24  ? 63.913  74.498 61.786  1.00 44.72  ? 24  DT  C O4    1 
ATOM   468  C C5    . DT  A 1 24  ? 66.000  75.457 62.431  1.00 45.27  ? 24  DT  C C5    1 
ATOM   469  C C7    . DT  A 1 24  ? 65.404  76.739 62.942  1.00 43.17  ? 24  DT  C C7    1 
ATOM   470  C C6    . DT  A 1 24  ? 67.321  75.205 62.488  1.00 46.52  ? 24  DT  C C6    1 
ATOM   471  P P     . DA  A 1 25  ? 72.707  73.054 60.373  1.00 66.03  ? 25  DA  C P     1 
ATOM   472  O OP1   . DA  A 1 25  ? 74.188  73.063 60.435  1.00 73.39  ? 25  DA  C OP1   1 
ATOM   473  O OP2   . DA  A 1 25  ? 71.980  73.895 59.395  1.00 65.97  ? 25  DA  C OP2   1 
ATOM   474  O "O5'" . DA  A 1 25  ? 72.203  71.559 60.149  1.00 50.91  ? 25  DA  C "O5'" 1 
ATOM   475  C "C5'" . DA  A 1 25  ? 70.878  71.508 59.696  1.00 41.83  ? 25  DA  C "C5'" 1 
ATOM   476  C "C4'" . DA  A 1 25  ? 70.790  70.426 58.662  1.00 47.92  ? 25  DA  C "C4'" 1 
ATOM   477  O "O4'" . DA  A 1 25  ? 69.438  70.339 58.158  1.00 50.47  ? 25  DA  C "O4'" 1 
ATOM   478  C "C3'" . DA  A 1 25  ? 71.587  70.741 57.423  1.00 48.23  ? 25  DA  C "C3'" 1 
ATOM   479  O "O3'" . DA  A 1 25  ? 71.557  69.571 56.655  1.00 53.43  ? 25  DA  C "O3'" 1 
ATOM   480  C "C2'" . DA  A 1 25  ? 70.694  71.809 56.811  1.00 41.55  ? 25  DA  C "C2'" 1 
ATOM   481  C "C1'" . DA  A 1 25  ? 69.298  71.259 57.100  1.00 43.96  ? 25  DA  C "C1'" 1 
ATOM   482  N N9    . DA  A 1 25  ? 68.416  72.304 57.591  1.00 40.25  ? 25  DA  C N9    1 
ATOM   483  C C8    . DA  A 1 25  ? 68.756  73.431 58.289  1.00 40.76  ? 25  DA  C C8    1 
ATOM   484  N N7    . DA  A 1 25  ? 67.735  74.198 58.580  1.00 39.73  ? 25  DA  C N7    1 
ATOM   485  C C5    . DA  A 1 25  ? 66.652  73.506 58.056  1.00 38.43  ? 25  DA  C C5    1 
ATOM   486  C C6    . DA  A 1 25  ? 65.270  73.780 58.033  1.00 35.82  ? 25  DA  C C6    1 
ATOM   487  N N6    . DA  A 1 25  ? 64.733  74.881 58.559  1.00 35.92  ? 25  DA  C N6    1 
ATOM   488  N N1    . DA  A 1 25  ? 64.455  72.901 57.425  1.00 34.82  ? 25  DA  C N1    1 
ATOM   489  C C2    . DA  A 1 25  ? 64.995  71.816 56.868  1.00 35.56  ? 25  DA  C C2    1 
ATOM   490  N N3    . DA  A 1 25  ? 66.272  71.442 56.823  1.00 35.78  ? 25  DA  C N3    1 
ATOM   491  C C4    . DA  A 1 25  ? 67.054  72.342 57.438  1.00 36.78  ? 25  DA  C C4    1 
ATOM   492  P P     . DC  A 1 26  ? 72.659  69.390 55.535  1.00 54.60  ? 26  DC  C P     1 
ATOM   493  O OP1   . DC  A 1 26  ? 73.348  68.103 55.780  1.00 67.01  ? 26  DC  C OP1   1 
ATOM   494  O OP2   . DC  A 1 26  ? 73.396  70.666 55.431  1.00 48.11  ? 26  DC  C OP2   1 
ATOM   495  O "O5'" . DC  A 1 26  ? 71.784  69.243 54.227  1.00 45.52  ? 26  DC  C "O5'" 1 
ATOM   496  C "C5'" . DC  A 1 26  ? 71.140  70.433 53.942  1.00 56.31  ? 26  DC  C "C5'" 1 
ATOM   497  C "C4'" . DC  A 1 26  ? 70.023  70.119 52.998  1.00 67.10  ? 26  DC  C "C4'" 1 
ATOM   498  O "O4'" . DC  A 1 26  ? 68.804  70.714 53.505  1.00 67.09  ? 26  DC  C "O4'" 1 
ATOM   499  C "C3'" . DC  A 1 26  ? 70.285  70.773 51.664  1.00 75.52  ? 26  DC  C "C3'" 1 
ATOM   500  O "O3'" . DC  A 1 26  ? 69.577  70.058 50.705  1.00 85.04  ? 26  DC  C "O3'" 1 
ATOM   501  C "C2'" . DC  A 1 26  ? 69.689  72.152 51.872  1.00 66.81  ? 26  DC  C "C2'" 1 
ATOM   502  C "C1'" . DC  A 1 26  ? 68.445  71.802 52.679  1.00 63.07  ? 26  DC  C "C1'" 1 
ATOM   503  N N1    . DC  A 1 26  ? 68.104  72.929 53.548  1.00 61.48  ? 26  DC  C N1    1 
ATOM   504  C C2    . DC  A 1 26  ? 66.767  73.299 53.679  1.00 58.54  ? 26  DC  C C2    1 
ATOM   505  O O2    . DC  A 1 26  ? 65.893  72.644 53.101  1.00 56.92  ? 26  DC  C O2    1 
ATOM   506  N N3    . DC  A 1 26  ? 66.488  74.366 54.458  1.00 59.43  ? 26  DC  C N3    1 
ATOM   507  C C4    . DC  A 1 26  ? 67.480  75.034 55.061  1.00 60.19  ? 26  DC  C C4    1 
ATOM   508  N N4    . DC  A 1 26  ? 67.160  76.084 55.830  1.00 59.03  ? 26  DC  C N4    1 
ATOM   509  C C5    . DC  A 1 26  ? 68.849  74.666 54.914  1.00 58.57  ? 26  DC  C C5    1 
ATOM   510  C C6    . DC  A 1 26  ? 69.117  73.611 54.144  1.00 59.46  ? 26  DC  C C6    1 
ATOM   511  P P     . DG  A 1 27  ? 70.349  69.974 49.324  1.00 85.61  ? 27  DG  C P     1 
ATOM   512  O OP1   . DG  A 1 27  ? 71.124  68.714 49.396  1.00 93.19  ? 27  DG  C OP1   1 
ATOM   513  O OP2   . DG  A 1 27  ? 71.005  71.285 49.060  1.00 65.98  ? 27  DG  C OP2   1 
ATOM   514  O "O5'" . DG  A 1 27  ? 69.109  69.750 48.351  1.00 78.97  ? 27  DG  C "O5'" 1 
ATOM   515  C "C5'" . DG  A 1 27  ? 68.007  69.107 48.966  1.00 73.19  ? 27  DG  C "C5'" 1 
ATOM   516  C "C4'" . DG  A 1 27  ? 66.732  69.547 48.280  1.00 73.86  ? 27  DG  C "C4'" 1 
ATOM   517  O "O4'" . DG  A 1 27  ? 66.104  70.586 49.068  1.00 73.07  ? 27  DG  C "O4'" 1 
ATOM   518  C "C3'" . DG  A 1 27  ? 66.953  70.153 46.904  1.00 73.84  ? 27  DG  C "C3'" 1 
ATOM   519  O "O3'" . DG  A 1 27  ? 65.800  69.991 46.101  1.00 80.10  ? 27  DG  C "O3'" 1 
ATOM   520  C "C2'" . DG  A 1 27  ? 67.176  71.618 47.249  1.00 63.86  ? 27  DG  C "C2'" 1 
ATOM   521  C "C1'" . DG  A 1 27  ? 66.176  71.814 48.380  1.00 64.01  ? 27  DG  C "C1'" 1 
ATOM   522  N N9    . DG  A 1 27  ? 66.581  72.853 49.322  1.00 64.13  ? 27  DG  C N9    1 
ATOM   523  C C8    . DG  A 1 27  ? 67.838  73.196 49.768  1.00 63.01  ? 27  DG  C C8    1 
ATOM   524  N N7    . DG  A 1 27  ? 67.843  74.221 50.581  1.00 60.35  ? 27  DG  C N7    1 
ATOM   525  C C5    . DG  A 1 27  ? 66.503  74.578 50.685  1.00 58.70  ? 27  DG  C C5    1 
ATOM   526  C C6    . DG  A 1 27  ? 65.885  75.609 51.436  1.00 53.16  ? 27  DG  C C6    1 
ATOM   527  O O6    . DG  A 1 27  ? 66.415  76.443 52.181  1.00 51.10  ? 27  DG  C O6    1 
ATOM   528  N N1    . DG  A 1 27  ? 64.508  75.629 51.253  1.00 51.89  ? 27  DG  C N1    1 
ATOM   529  C C2    . DG  A 1 27  ? 63.807  74.763 50.449  1.00 55.23  ? 27  DG  C C2    1 
ATOM   530  N N2    . DG  A 1 27  ? 62.478  74.962 50.397  1.00 52.72  ? 27  DG  C N2    1 
ATOM   531  N N3    . DG  A 1 27  ? 64.368  73.782 49.743  1.00 61.31  ? 27  DG  C N3    1 
ATOM   532  C C4    . DG  A 1 27  ? 65.715  73.748 49.912  1.00 62.89  ? 27  DG  C C4    1 
ATOM   533  P P     . DA  A 1 28  ? 65.713  70.809 44.727  1.00 82.81  ? 28  DA  C P     1 
ATOM   534  O OP1   . DA  A 1 28  ? 65.039  69.946 43.732  1.00 91.79  ? 28  DA  C OP1   1 
ATOM   535  O OP2   . DA  A 1 28  ? 67.019  71.442 44.429  1.00 79.56  ? 28  DA  C OP2   1 
ATOM   536  O "O5'" . DA  A 1 28  ? 64.695  71.981 45.056  1.00 80.89  ? 28  DA  C "O5'" 1 
ATOM   537  C "C5'" . DA  A 1 28  ? 63.321  71.758 44.854  1.00 71.55  ? 28  DA  C "C5'" 1 
ATOM   538  C "C4'" . DA  A 1 28  ? 62.634  72.951 45.463  1.00 64.53  ? 28  DA  C "C4'" 1 
ATOM   539  O "O4'" . DA  A 1 28  ? 63.589  73.536 46.376  1.00 60.91  ? 28  DA  C "O4'" 1 
ATOM   540  C "C3'" . DA  A 1 28  ? 62.342  74.039 44.448  1.00 71.64  ? 28  DA  C "C3'" 1 
ATOM   541  O "O3'" . DA  A 1 28  ? 60.941  74.208 44.340  1.00 82.55  ? 28  DA  C "O3'" 1 
ATOM   542  C "C2'" . DA  A 1 28  ? 63.064  75.280 44.977  1.00 64.20  ? 28  DA  C "C2'" 1 
ATOM   543  C "C1'" . DA  A 1 28  ? 63.330  74.909 46.428  1.00 60.04  ? 28  DA  C "C1'" 1 
ATOM   544  N N9    . DA  A 1 28  ? 64.454  75.580 47.080  1.00 57.42  ? 28  DA  C N9    1 
ATOM   545  C C8    . DA  A 1 28  ? 65.797  75.316 47.030  1.00 57.11  ? 28  DA  C C8    1 
ATOM   546  N N7    . DA  A 1 28  ? 66.515  76.132 47.776  1.00 56.10  ? 28  DA  C N7    1 
ATOM   547  C C5    . DA  A 1 28  ? 65.575  76.963 48.364  1.00 55.99  ? 28  DA  C C5    1 
ATOM   548  C C6    . DA  A 1 28  ? 65.680  78.046 49.252  1.00 54.12  ? 28  DA  C C6    1 
ATOM   549  N N6    . DA  A 1 28  ? 66.833  78.506 49.731  1.00 53.29  ? 28  DA  C N6    1 
ATOM   550  N N1    . DA  A 1 28  ? 64.547  78.665 49.620  1.00 53.94  ? 28  DA  C N1    1 
ATOM   551  C C2    . DA  A 1 28  ? 63.386  78.228 49.126  1.00 55.02  ? 28  DA  C C2    1 
ATOM   552  N N3    . DA  A 1 28  ? 63.154  77.221 48.289  1.00 54.91  ? 28  DA  C N3    1 
ATOM   553  C C4    . DA  A 1 28  ? 64.303  76.630 47.948  1.00 55.28  ? 28  DA  C C4    1 
ATOM   554  P P     . DA  A 1 29  ? 60.306  74.583 42.921  1.00 83.40  ? 29  DA  C P     1 
ATOM   555  O OP1   . DA  A 1 29  ? 59.243  73.602 42.606  1.00 77.15  ? 29  DA  C OP1   1 
ATOM   556  O OP2   . DA  A 1 29  ? 61.423  74.787 41.969  1.00 84.82  ? 29  DA  C OP2   1 
ATOM   557  O "O5'" . DA  A 1 29  ? 59.632  75.998 43.249  1.00 78.23  ? 29  DA  C "O5'" 1 
ATOM   558  C "C5'" . DA  A 1 29  ? 59.292  76.303 44.595  1.00 72.61  ? 29  DA  C "C5'" 1 
ATOM   559  C "C4'" . DA  A 1 29  ? 59.568  77.761 44.911  1.00 73.45  ? 29  DA  C "C4'" 1 
ATOM   560  O "O4'" . DA  A 1 29  ? 60.907  77.888 45.446  1.00 72.74  ? 29  DA  C "O4'" 1 
ATOM   561  C "C3'" . DA  A 1 29  ? 59.469  78.714 43.720  1.00 77.00  ? 29  DA  C "C3'" 1 
ATOM   562  O "O3'" . DA  A 1 29  ? 58.567  79.782 44.031  1.00 87.69  ? 29  DA  C "O3'" 1 
ATOM   563  C "C2'" . DA  A 1 29  ? 60.918  79.169 43.517  1.00 67.73  ? 29  DA  C "C2'" 1 
ATOM   564  C "C1'" . DA  A 1 29  ? 61.472  79.075 44.943  1.00 63.37  ? 29  DA  C "C1'" 1 
ATOM   565  N N9    . DA  A 1 29  ? 62.931  79.064 45.169  1.00 53.09  ? 29  DA  C N9    1 
ATOM   566  C C8    . DA  A 1 29  ? 63.877  78.142 44.792  1.00 53.19  ? 29  DA  C C8    1 
ATOM   567  N N7    . DA  A 1 29  ? 65.087  78.361 45.282  1.00 49.95  ? 29  DA  C N7    1 
ATOM   568  C C5    . DA  A 1 29  ? 64.908  79.474 46.083  1.00 45.61  ? 29  DA  C C5    1 
ATOM   569  C C6    . DA  A 1 29  ? 65.790  80.224 46.889  1.00 43.25  ? 29  DA  C C6    1 
ATOM   570  N N6    . DA  A 1 29  ? 67.092  79.963 47.023  1.00 42.07  ? 29  DA  C N6    1 
ATOM   571  N N1    . DA  A 1 29  ? 65.290  81.279 47.557  1.00 43.23  ? 29  DA  C N1    1 
ATOM   572  C C2    . DA  A 1 29  ? 63.987  81.554 47.420  1.00 44.63  ? 29  DA  C C2    1 
ATOM   573  N N3    . DA  A 1 29  ? 63.057  80.925 46.696  1.00 44.79  ? 29  DA  C N3    1 
ATOM   574  C C4    . DA  A 1 29  ? 63.587  79.887 46.049  1.00 45.64  ? 29  DA  C C4    1 
ATOM   575  P P     . DG  A 1 30  ? 58.171  80.842 42.898  1.00 89.00  ? 30  DG  C P     1 
ATOM   576  O OP1   . DG  A 1 30  ? 56.698  80.907 42.752  1.00 91.77  ? 30  DG  C OP1   1 
ATOM   577  O OP2   . DG  A 1 30  ? 58.987  80.504 41.711  1.00 82.30  ? 30  DG  C OP2   1 
ATOM   578  O "O5'" . DG  A 1 30  ? 58.702  82.204 43.556  1.00 80.41  ? 30  DG  C "O5'" 1 
ATOM   579  C "C5'" . DG  A 1 30  ? 58.500  82.457 44.940  1.00 69.66  ? 30  DG  C "C5'" 1 
ATOM   580  C "C4'" . DG  A 1 30  ? 59.430  83.561 45.414  1.00 71.38  ? 30  DG  C "C4'" 1 
ATOM   581  O "O4'" . DG  A 1 30  ? 60.783  83.043 45.551  1.00 73.65  ? 30  DG  C "O4'" 1 
ATOM   582  C "C3'" . DG  A 1 30  ? 59.577  84.732 44.456  1.00 66.54  ? 30  DG  C "C3'" 1 
ATOM   583  O "O3'" . DG  A 1 30  ? 60.021  85.864 45.171  1.00 67.94  ? 30  DG  C "O3'" 1 
ATOM   584  C "C2'" . DG  A 1 30  ? 60.709  84.219 43.579  1.00 67.51  ? 30  DG  C "C2'" 1 
ATOM   585  C "C1'" . DG  A 1 30  ? 61.638  83.783 44.701  1.00 64.99  ? 30  DG  C "C1'" 1 
ATOM   586  N N9    . DG  A 1 30  ? 62.780  82.956 44.306  1.00 56.56  ? 30  DG  C N9    1 
ATOM   587  C C8    . DG  A 1 30  ? 62.816  81.807 43.557  1.00 55.48  ? 30  DG  C C8    1 
ATOM   588  N N7    . DG  A 1 30  ? 64.016  81.312 43.410  1.00 51.05  ? 30  DG  C N7    1 
ATOM   589  C C5    . DG  A 1 30  ? 64.833  82.190 44.110  1.00 49.27  ? 30  DG  C C5    1 
ATOM   590  C C6    . DG  A 1 30  ? 66.239  82.175 44.311  1.00 46.96  ? 30  DG  C C6    1 
ATOM   591  O O6    . DG  A 1 30  ? 67.058  81.345 43.902  1.00 45.82  ? 30  DG  C O6    1 
ATOM   592  N N1    . DG  A 1 30  ? 66.681  83.235 45.104  1.00 44.67  ? 30  DG  C N1    1 
ATOM   593  C C2    . DG  A 1 30  ? 65.846  84.210 45.606  1.00 45.26  ? 30  DG  C C2    1 
ATOM   594  N N2    . DG  A 1 30  ? 66.424  85.165 46.346  1.00 43.55  ? 30  DG  C N2    1 
ATOM   595  N N3    . DG  A 1 30  ? 64.530  84.257 45.404  1.00 49.58  ? 30  DG  C N3    1 
ATOM   596  C C4    . DG  A 1 30  ? 64.089  83.209 44.660  1.00 50.71  ? 30  DG  C C4    1 
ATOM   597  P P     . DT  A 1 31  ? 59.497  87.298 44.694  1.00 72.64  ? 31  DT  C P     1 
ATOM   598  O OP1   . DT  A 1 31  ? 58.349  87.672 45.552  1.00 82.84  ? 31  DT  C OP1   1 
ATOM   599  O OP2   . DT  A 1 31  ? 59.309  87.228 43.224  1.00 79.47  ? 31  DT  C OP2   1 
ATOM   600  O "O5'" . DT  A 1 31  ? 60.701  88.295 45.043  1.00 63.78  ? 31  DT  C "O5'" 1 
ATOM   601  C "C5'" . DT  A 1 31  ? 61.448  88.168 46.239  1.00 67.79  ? 31  DT  C "C5'" 1 
ATOM   602  C "C4'" . DT  A 1 31  ? 62.741  88.939 46.079  1.00 71.66  ? 31  DT  C "C4'" 1 
ATOM   603  O "O4'" . DT  A 1 31  ? 63.775  88.031 45.615  1.00 70.88  ? 31  DT  C "O4'" 1 
ATOM   604  C "C3'" . DT  A 1 31  ? 62.635  90.001 44.999  1.00 72.52  ? 31  DT  C "C3'" 1 
ATOM   605  O "O3'" . DT  A 1 31  ? 63.281  91.171 45.445  1.00 79.52  ? 31  DT  C "O3'" 1 
ATOM   606  C "C2'" . DT  A 1 31  ? 63.299  89.358 43.775  1.00 53.64  ? 31  DT  C "C2'" 1 
ATOM   607  C "C1'" . DT  A 1 31  ? 64.403  88.567 44.463  1.00 49.50  ? 31  DT  C "C1'" 1 
ATOM   608  N N1    . DT  A 1 31  ? 64.973  87.408 43.711  1.00 46.95  ? 31  DT  C N1    1 
ATOM   609  C C2    . DT  A 1 31  ? 66.308  87.099 43.905  1.00 44.72  ? 31  DT  C C2    1 
ATOM   610  O O2    . DT  A 1 31  ? 67.055  87.742 44.628  1.00 43.85  ? 31  DT  C O2    1 
ATOM   611  N N3    . DT  A 1 31  ? 66.752  86.002 43.204  1.00 42.18  ? 31  DT  C N3    1 
ATOM   612  C C4    . DT  A 1 31  ? 65.994  85.204 42.356  1.00 43.91  ? 31  DT  C C4    1 
ATOM   613  O O4    . DT  A 1 31  ? 66.493  84.227 41.789  1.00 43.06  ? 31  DT  C O4    1 
ATOM   614  C C5    . DT  A 1 31  ? 64.619  85.594 42.204  1.00 41.43  ? 31  DT  C C5    1 
ATOM   615  C C7    . DT  A 1 31  ? 63.726  84.787 41.318  1.00 38.71  ? 31  DT  C C7    1 
ATOM   616  C C6    . DT  A 1 31  ? 64.173  86.654 42.887  1.00 44.19  ? 31  DT  C C6    1 
ATOM   617  P P     . DT  A 1 32  ? 62.872  92.568 44.782  1.00 84.90  ? 32  DT  C P     1 
ATOM   618  O OP1   . DT  A 1 32  ? 62.163  93.386 45.793  1.00 85.71  ? 32  DT  C OP1   1 
ATOM   619  O OP2   . DT  A 1 32  ? 62.240  92.335 43.462  1.00 87.07  ? 32  DT  C OP2   1 
ATOM   620  O "O5'" . DT  A 1 32  ? 64.334  93.154 44.542  1.00 84.01  ? 32  DT  C "O5'" 1 
ATOM   621  C "C5'" . DT  A 1 32  ? 65.329  92.156 44.376  1.00 73.50  ? 32  DT  C "C5'" 1 
ATOM   622  C "C4'" . DT  A 1 32  ? 66.706  92.756 44.540  1.00 67.65  ? 32  DT  C "C4'" 1 
ATOM   623  O "O4'" . DT  A 1 32  ? 67.734  91.744 44.379  1.00 67.23  ? 32  DT  C "O4'" 1 
ATOM   624  C "C3'" . DT  A 1 32  ? 67.036  93.852 43.546  1.00 61.38  ? 32  DT  C "C3'" 1 
ATOM   625  O "O3'" . DT  A 1 32  ? 67.762  94.839 44.213  1.00 63.20  ? 32  DT  C "O3'" 1 
ATOM   626  C "C2'" . DT  A 1 32  ? 67.903  93.177 42.485  1.00 48.74  ? 32  DT  C "C2'" 1 
ATOM   627  C "C1'" . DT  A 1 32  ? 68.416  91.897 43.146  1.00 49.77  ? 32  DT  C "C1'" 1 
ATOM   628  N N1    . DT  A 1 32  ? 68.154  90.657 42.334  1.00 48.68  ? 32  DT  C N1    1 
ATOM   629  C C2    . DT  A 1 32  ? 69.155  89.708 42.208  1.00 48.17  ? 32  DT  C C2    1 
ATOM   630  O O2    . DT  A 1 32  ? 70.260  89.783 42.714  1.00 48.51  ? 32  DT  C O2    1 
ATOM   631  N N3    . DT  A 1 32  ? 68.816  88.616 41.463  1.00 42.50  ? 32  DT  C N3    1 
ATOM   632  C C4    . DT  A 1 32  ? 67.603  88.393 40.846  1.00 44.31  ? 32  DT  C C4    1 
ATOM   633  O O4    . DT  A 1 32  ? 67.430  87.360 40.202  1.00 43.61  ? 32  DT  C O4    1 
ATOM   634  C C5    . DT  A 1 32  ? 66.616  89.427 41.007  1.00 41.77  ? 32  DT  C C5    1 
ATOM   635  C C7    . DT  A 1 32  ? 65.265  89.293 40.377  1.00 39.33  ? 32  DT  C C7    1 
ATOM   636  C C6    . DT  A 1 32  ? 66.927  90.492 41.742  1.00 44.82  ? 32  DT  C C6    1 
ATOM   637  P P     . DA  A 1 33  ? 68.353  95.973 43.280  1.00 61.14  ? 33  DA  C P     1 
ATOM   638  O OP1   . DA  A 1 33  ? 68.683  97.128 44.147  1.00 55.13  ? 33  DA  C OP1   1 
ATOM   639  O OP2   . DA  A 1 33  ? 67.444  96.113 42.119  1.00 50.37  ? 33  DA  C OP2   1 
ATOM   640  O "O5'" . DA  A 1 33  ? 69.699  95.281 42.778  1.00 59.95  ? 33  DA  C "O5'" 1 
ATOM   641  C "C5'" . DA  A 1 33  ? 70.792  95.177 43.657  1.00 56.16  ? 33  DA  C "C5'" 1 
ATOM   642  C "C4'" . DA  A 1 33  ? 71.931  94.515 42.923  1.00 51.70  ? 33  DA  C "C4'" 1 
ATOM   643  O "O4'" . DA  A 1 33  ? 71.388  93.393 42.191  1.00 53.24  ? 33  DA  C "O4'" 1 
ATOM   644  C "C3'" . DA  A 1 33  ? 72.558  95.403 41.875  1.00 52.94  ? 33  DA  C "C3'" 1 
ATOM   645  O "O3'" . DA  A 1 33  ? 73.908  95.059 41.855  1.00 63.05  ? 33  DA  C "O3'" 1 
ATOM   646  C "C2'" . DA  A 1 33  ? 71.822  95.001 40.597  1.00 40.27  ? 33  DA  C "C2'" 1 
ATOM   647  C "C1'" . DA  A 1 33  ? 71.725  93.502 40.829  1.00 38.32  ? 33  DA  C "C1'" 1 
ATOM   648  N N9    . DA  A 1 33  ? 70.682  92.793 40.101  1.00 28.42  ? 33  DA  C N9    1 
ATOM   649  C C8    . DA  A 1 33  ? 69.401  93.179 39.866  1.00 27.37  ? 33  DA  C C8    1 
ATOM   650  N N7    . DA  A 1 33  ? 68.716  92.275 39.197  1.00 27.84  ? 33  DA  C N7    1 
ATOM   651  C C5    . DA  A 1 33  ? 69.596  91.231 39.012  1.00 24.46  ? 33  DA  C C5    1 
ATOM   652  C C6    . DA  A 1 33  ? 69.464  90.005 38.356  1.00 26.15  ? 33  DA  C C6    1 
ATOM   653  N N6    . DA  A 1 33  ? 68.314  89.628 37.774  1.00 25.26  ? 33  DA  C N6    1 
ATOM   654  N N1    . DA  A 1 33  ? 70.544  89.182 38.327  1.00 25.65  ? 33  DA  C N1    1 
ATOM   655  C C2    . DA  A 1 33  ? 71.668  89.603 38.918  1.00 25.31  ? 33  DA  C C2    1 
ATOM   656  N N3    . DA  A 1 33  ? 71.901  90.755 39.555  1.00 24.61  ? 33  DA  C N3    1 
ATOM   657  C C4    . DA  A 1 33  ? 70.816  91.530 39.558  1.00 24.36  ? 33  DA  C C4    1 
ATOM   658  P P     . DT  A 1 34  ? 74.903  96.068 41.144  1.00 65.55  ? 34  DT  C P     1 
ATOM   659  O OP1   . DT  A 1 34  ? 75.254  97.128 42.116  1.00 100.00 ? 34  DT  C OP1   1 
ATOM   660  O OP2   . DT  A 1 34  ? 74.323  96.435 39.830  1.00 84.32  ? 34  DT  C OP2   1 
ATOM   661  O "O5'" . DT  A 1 34  ? 76.138  95.071 40.963  1.00 59.30  ? 34  DT  C "O5'" 1 
ATOM   662  C "C5'" . DT  A 1 34  ? 76.647  94.922 39.647  1.00 100.00 ? 34  DT  C "C5'" 1 
ATOM   663  C "C4'" . DT  A 1 34  ? 76.547  93.493 39.139  1.00 60.64  ? 34  DT  C "C4'" 1 
ATOM   664  O "O4'" . DT  A 1 34  ? 75.161  93.141 38.860  1.00 100.00 ? 34  DT  C "O4'" 1 
ATOM   665  C "C3'" . DT  A 1 34  ? 77.297  93.304 37.824  1.00 38.61  ? 34  DT  C "C3'" 1 
ATOM   666  O "O3'" . DT  A 1 34  ? 78.126  92.152 37.902  1.00 65.56  ? 34  DT  C "O3'" 1 
ATOM   667  C "C2'" . DT  A 1 34  ? 76.190  93.159 36.777  1.00 91.61  ? 34  DT  C "C2'" 1 
ATOM   668  C "C1'" . DT  A 1 34  ? 75.074  92.513 37.590  1.00 32.08  ? 34  DT  C "C1'" 1 
ATOM   669  N N1    . DT  A 1 34  ? 73.676  92.642 37.009  1.00 32.31  ? 34  DT  C N1    1 
ATOM   670  C C2    . DT  A 1 34  ? 73.162  91.526 36.358  1.00 31.60  ? 34  DT  C C2    1 
ATOM   671  O O2    . DT  A 1 34  ? 73.780  90.472 36.233  1.00 31.04  ? 34  DT  C O2    1 
ATOM   672  N N3    . DT  A 1 34  ? 71.900  91.672 35.839  1.00 27.52  ? 34  DT  C N3    1 
ATOM   673  C C4    . DT  A 1 34  ? 71.110  92.799 35.914  1.00 31.66  ? 34  DT  C C4    1 
ATOM   674  O O4    . DT  A 1 34  ? 69.989  92.773 35.411  1.00 31.08  ? 34  DT  C O4    1 
ATOM   675  C C5    . DT  A 1 34  ? 71.693  93.929 36.601  1.00 30.00  ? 34  DT  C C5    1 
ATOM   676  C C7    . DT  A 1 34  ? 70.917  95.204 36.732  1.00 29.09  ? 34  DT  C C7    1 
ATOM   677  C C6    . DT  A 1 34  ? 72.930  93.803 37.104  1.00 30.56  ? 34  DT  C C6    1 
ATOM   678  O "O5'" . DA  B 2 1   ? 68.015  38.729 149.554 1.00 73.19  ? 1   DA  D "O5'" 1 
ATOM   679  C "C5'" . DA  B 2 1   ? 69.128  38.452 150.402 1.00 100.00 ? 1   DA  D "C5'" 1 
ATOM   680  C "C4'" . DA  B 2 1   ? 70.324  38.035 149.566 1.00 47.06  ? 1   DA  D "C4'" 1 
ATOM   681  O "O4'" . DA  B 2 1   ? 70.223  36.627 149.238 1.00 83.41  ? 1   DA  D "O4'" 1 
ATOM   682  C "C3'" . DA  B 2 1   ? 70.379  38.751 148.234 1.00 38.40  ? 1   DA  D "C3'" 1 
ATOM   683  O "O3'" . DA  B 2 1   ? 71.465  39.617 148.167 1.00 66.62  ? 1   DA  D "O3'" 1 
ATOM   684  C "C2'" . DA  B 2 1   ? 70.467  37.687 147.150 1.00 98.87  ? 1   DA  D "C2'" 1 
ATOM   685  C "C1'" . DA  B 2 1   ? 70.694  36.406 147.929 1.00 30.36  ? 1   DA  D "C1'" 1 
ATOM   686  N N9    . DA  B 2 1   ? 69.962  35.279 147.345 1.00 36.81  ? 1   DA  D N9    1 
ATOM   687  C C8    . DA  B 2 1   ? 68.612  35.038 147.295 1.00 37.79  ? 1   DA  D C8    1 
ATOM   688  N N7    . DA  B 2 1   ? 68.295  33.918 146.666 1.00 38.20  ? 1   DA  D N7    1 
ATOM   689  C C5    . DA  B 2 1   ? 69.518  33.407 146.257 1.00 37.30  ? 1   DA  D C5    1 
ATOM   690  C C6    . DA  B 2 1   ? 69.878  32.237 145.562 1.00 35.32  ? 1   DA  D C6    1 
ATOM   691  N N6    . DA  B 2 1   ? 68.997  31.337 145.121 1.00 34.21  ? 1   DA  D N6    1 
ATOM   692  N N1    . DA  B 2 1   ? 71.184  32.020 145.327 1.00 34.96  ? 1   DA  D N1    1 
ATOM   693  C C2    . DA  B 2 1   ? 72.067  32.921 145.777 1.00 35.88  ? 1   DA  D C2    1 
ATOM   694  N N3    . DA  B 2 1   ? 71.864  34.050 146.454 1.00 35.76  ? 1   DA  D N3    1 
ATOM   695  C C4    . DA  B 2 1   ? 70.552  34.236 146.659 1.00 36.36  ? 1   DA  D C4    1 
ATOM   696  P P     . DT  B 2 2   ? 71.272  40.818 147.131 1.00 67.48  ? 2   DT  D P     1 
ATOM   697  O OP1   . DT  B 2 2   ? 71.988  41.972 147.726 1.00 60.67  ? 2   DT  D OP1   1 
ATOM   698  O OP2   . DT  B 2 2   ? 69.844  40.886 146.721 1.00 46.82  ? 2   DT  D OP2   1 
ATOM   699  O "O5'" . DT  B 2 2   ? 72.136  40.337 145.876 1.00 70.25  ? 2   DT  D "O5'" 1 
ATOM   700  C "C5'" . DT  B 2 2   ? 73.494  40.014 146.127 1.00 51.11  ? 2   DT  D "C5'" 1 
ATOM   701  C "C4'" . DT  B 2 2   ? 74.011  39.121 145.027 1.00 35.22  ? 2   DT  D "C4'" 1 
ATOM   702  O "O4'" . DT  B 2 2   ? 73.250  37.889 145.003 1.00 33.94  ? 2   DT  D "O4'" 1 
ATOM   703  C "C3'" . DT  B 2 2   ? 73.866  39.733 143.647 1.00 36.40  ? 2   DT  D "C3'" 1 
ATOM   704  O "O3'" . DT  B 2 2   ? 75.067  39.492 142.960 1.00 48.60  ? 2   DT  D "O3'" 1 
ATOM   705  C "C2'" . DT  B 2 2   ? 72.733  38.915 143.043 1.00 29.47  ? 2   DT  D "C2'" 1 
ATOM   706  C "C1'" . DT  B 2 2   ? 72.968  37.548 143.670 1.00 26.14  ? 2   DT  D "C1'" 1 
ATOM   707  N N1    . DT  B 2 2   ? 71.756  36.683 143.598 1.00 26.59  ? 2   DT  D N1    1 
ATOM   708  C C2    . DT  B 2 2   ? 71.904  35.478 142.974 1.00 29.67  ? 2   DT  D C2    1 
ATOM   709  O O2    . DT  B 2 2   ? 72.982  35.110 142.571 1.00 32.10  ? 2   DT  D O2    1 
ATOM   710  N N3    . DT  B 2 2   ? 70.780  34.716 142.856 1.00 26.59  ? 2   DT  D N3    1 
ATOM   711  C C4    . DT  B 2 2   ? 69.522  35.064 143.292 1.00 28.72  ? 2   DT  D C4    1 
ATOM   712  O O4    . DT  B 2 2   ? 68.587  34.284 143.136 1.00 28.31  ? 2   DT  D O4    1 
ATOM   713  C C5    . DT  B 2 2   ? 69.415  36.348 143.919 1.00 22.60  ? 2   DT  D C5    1 
ATOM   714  C C7    . DT  B 2 2   ? 68.088  36.819 144.431 1.00 21.73  ? 2   DT  D C7    1 
ATOM   715  C C6    . DT  B 2 2   ? 70.515  37.094 144.031 1.00 23.92  ? 2   DT  D C6    1 
ATOM   716  P P     . DA  B 2 3   ? 75.791  40.610 142.086 1.00 50.95  ? 3   DA  D P     1 
ATOM   717  O OP1   . DA  B 2 3   ? 76.747  41.355 142.937 1.00 51.26  ? 3   DA  D OP1   1 
ATOM   718  O OP2   . DA  B 2 3   ? 74.764  41.318 141.294 1.00 58.87  ? 3   DA  D OP2   1 
ATOM   719  O "O5'" . DA  B 2 3   ? 76.630  39.686 141.092 1.00 50.51  ? 3   DA  D "O5'" 1 
ATOM   720  C "C5'" . DA  B 2 3   ? 77.058  38.432 141.561 1.00 40.16  ? 3   DA  D "C5'" 1 
ATOM   721  C "C4'" . DA  B 2 3   ? 77.319  37.461 140.429 1.00 35.46  ? 3   DA  D "C4'" 1 
ATOM   722  O "O4'" . DA  B 2 3   ? 76.162  36.611 140.222 1.00 33.86  ? 3   DA  D "O4'" 1 
ATOM   723  C "C3'" . DA  B 2 3   ? 77.579  38.068 139.061 1.00 37.32  ? 3   DA  D "C3'" 1 
ATOM   724  O "O3'" . DA  B 2 3   ? 78.059  37.004 138.261 1.00 46.45  ? 3   DA  D "O3'" 1 
ATOM   725  C "C2'" . DA  B 2 3   ? 76.146  38.385 138.667 1.00 36.91  ? 3   DA  D "C2'" 1 
ATOM   726  C "C1'" . DA  B 2 3   ? 75.451  37.095 139.099 1.00 34.47  ? 3   DA  D "C1'" 1 
ATOM   727  N N9    . DA  B 2 3   ? 74.042  37.224 139.472 1.00 31.24  ? 3   DA  D N9    1 
ATOM   728  C C8    . DA  B 2 3   ? 73.338  38.278 139.997 1.00 30.94  ? 3   DA  D C8    1 
ATOM   729  N N7    . DA  B 2 3   ? 72.060  37.979 140.176 1.00 30.19  ? 3   DA  D N7    1 
ATOM   730  C C5    . DA  B 2 3   ? 71.952  36.662 139.764 1.00 25.68  ? 3   DA  D C5    1 
ATOM   731  C C6    . DA  B 2 3   ? 70.877  35.764 139.720 1.00 30.89  ? 3   DA  D C6    1 
ATOM   732  N N6    . DA  B 2 3   ? 69.640  36.086 140.119 1.00 30.78  ? 3   DA  D N6    1 
ATOM   733  N N1    . DA  B 2 3   ? 71.113  34.522 139.238 1.00 30.32  ? 3   DA  D N1    1 
ATOM   734  C C2    . DA  B 2 3   ? 72.355  34.224 138.834 1.00 29.56  ? 3   DA  D C2    1 
ATOM   735  N N3    . DA  B 2 3   ? 73.443  34.993 138.828 1.00 28.37  ? 3   DA  D N3    1 
ATOM   736  C C4    . DA  B 2 3   ? 73.162  36.194 139.323 1.00 26.45  ? 3   DA  D C4    1 
ATOM   737  P P     . DA  B 2 4   ? 79.146  37.094 137.090 1.00 44.83  ? 4   DA  D P     1 
ATOM   738  O OP1   . DA  B 2 4   ? 80.000  35.889 137.194 1.00 53.64  ? 4   DA  D OP1   1 
ATOM   739  O OP2   . DA  B 2 4   ? 79.782  38.430 137.062 1.00 32.05  ? 4   DA  D OP2   1 
ATOM   740  O "O5'" . DA  B 2 4   ? 78.177  36.840 135.848 1.00 48.96  ? 4   DA  D "O5'" 1 
ATOM   741  C "C5'" . DA  B 2 4   ? 77.787  35.471 135.705 1.00 47.09  ? 4   DA  D "C5'" 1 
ATOM   742  C "C4'" . DA  B 2 4   ? 76.494  35.360 134.930 1.00 48.83  ? 4   DA  D "C4'" 1 
ATOM   743  O "O4'" . DA  B 2 4   ? 75.377  35.770 135.767 1.00 49.04  ? 4   DA  D "O4'" 1 
ATOM   744  C "C3'" . DA  B 2 4   ? 76.444  36.239 133.683 1.00 49.93  ? 4   DA  D "C3'" 1 
ATOM   745  O "O3'" . DA  B 2 4   ? 76.226  35.425 132.535 1.00 56.85  ? 4   DA  D "O3'" 1 
ATOM   746  C "C2'" . DA  B 2 4   ? 75.249  37.148 133.952 1.00 42.20  ? 4   DA  D "C2'" 1 
ATOM   747  C "C1'" . DA  B 2 4   ? 74.415  36.274 134.883 1.00 34.84  ? 4   DA  D "C1'" 1 
ATOM   748  N N9    . DA  B 2 4   ? 73.356  36.998 135.578 1.00 26.37  ? 4   DA  D N9    1 
ATOM   749  C C8    . DA  B 2 4   ? 73.335  38.297 136.003 1.00 24.56  ? 4   DA  D C8    1 
ATOM   750  N N7    . DA  B 2 4   ? 72.178  38.655 136.528 1.00 24.79  ? 4   DA  D N7    1 
ATOM   751  C C5    . DA  B 2 4   ? 71.387  37.530 136.401 1.00 28.27  ? 4   DA  D C5    1 
ATOM   752  C C6    . DA  B 2 4   ? 70.052  37.264 136.753 1.00 35.30  ? 4   DA  D C6    1 
ATOM   753  N N6    . DA  B 2 4   ? 69.268  38.164 137.349 1.00 38.35  ? 4   DA  D N6    1 
ATOM   754  N N1    . DA  B 2 4   ? 69.543  36.041 136.493 1.00 33.73  ? 4   DA  D N1    1 
ATOM   755  C C2    . DA  B 2 4   ? 70.358  35.153 135.913 1.00 33.23  ? 4   DA  D C2    1 
ATOM   756  N N3    . DA  B 2 4   ? 71.640  35.283 135.541 1.00 32.00  ? 4   DA  D N3    1 
ATOM   757  C C4    . DA  B 2 4   ? 72.093  36.511 135.807 1.00 29.13  ? 4   DA  D C4    1 
ATOM   758  P P     . DC  B 2 5   ? 76.786  35.819 131.085 1.00 56.81  ? 5   DC  D P     1 
ATOM   759  O OP1   . DC  B 2 5   ? 77.685  34.745 130.603 1.00 58.23  ? 5   DC  D OP1   1 
ATOM   760  O OP2   . DC  B 2 5   ? 77.294  37.200 131.173 1.00 49.41  ? 5   DC  D OP2   1 
ATOM   761  O "O5'" . DC  B 2 5   ? 75.481  35.771 130.160 1.00 52.13  ? 5   DC  D "O5'" 1 
ATOM   762  C "C5'" . DC  B 2 5   ? 74.315  36.478 130.536 1.00 50.38  ? 5   DC  D "C5'" 1 
ATOM   763  C "C4'" . DC  B 2 5   ? 73.162  35.528 130.807 1.00 46.87  ? 5   DC  D "C4'" 1 
ATOM   764  O "O4'" . DC  B 2 5   ? 72.623  35.911 132.087 1.00 42.31  ? 5   DC  D "O4'" 1 
ATOM   765  C "C3'" . DC  B 2 5   ? 72.011  35.679 129.831 1.00 56.12  ? 5   DC  D "C3'" 1 
ATOM   766  O "O3'" . DC  B 2 5   ? 71.969  34.581 128.951 1.00 65.40  ? 5   DC  D "O3'" 1 
ATOM   767  C "C2'" . DC  B 2 5   ? 70.734  35.710 130.670 1.00 43.13  ? 5   DC  D "C2'" 1 
ATOM   768  C "C1'" . DC  B 2 5   ? 71.219  35.922 132.093 1.00 30.68  ? 5   DC  D "C1'" 1 
ATOM   769  N N1    . DC  B 2 5   ? 70.857  37.210 132.740 1.00 29.16  ? 5   DC  D N1    1 
ATOM   770  C C2    . DC  B 2 5   ? 69.590  37.278 133.284 1.00 28.91  ? 5   DC  D C2    1 
ATOM   771  O O2    . DC  B 2 5   ? 68.891  36.281 133.099 1.00 33.89  ? 5   DC  D O2    1 
ATOM   772  N N3    . DC  B 2 5   ? 69.178  38.389 133.938 1.00 27.71  ? 5   DC  D N3    1 
ATOM   773  C C4    . DC  B 2 5   ? 70.019  39.420 134.043 1.00 27.64  ? 5   DC  D C4    1 
ATOM   774  N N4    . DC  B 2 5   ? 69.604  40.529 134.669 1.00 30.75  ? 5   DC  D N4    1 
ATOM   775  C C5    . DC  B 2 5   ? 71.328  39.378 133.490 1.00 24.32  ? 5   DC  D C5    1 
ATOM   776  C C6    . DC  B 2 5   ? 71.713  38.262 132.860 1.00 25.44  ? 5   DC  D C6    1 
ATOM   777  P P     . DT  B 2 6   ? 71.163  34.815 127.592 1.00 59.86  ? 6   DT  D P     1 
ATOM   778  O OP1   . DT  B 2 6   ? 71.401  33.600 126.785 1.00 60.78  ? 6   DT  D OP1   1 
ATOM   779  O OP2   . DT  B 2 6   ? 71.548  36.177 127.136 1.00 50.66  ? 6   DT  D OP2   1 
ATOM   780  O "O5'" . DT  B 2 6   ? 69.622  34.827 128.012 1.00 43.38  ? 6   DT  D "O5'" 1 
ATOM   781  C "C5'" . DT  B 2 6   ? 68.960  33.622 128.324 1.00 38.74  ? 6   DT  D "C5'" 1 
ATOM   782  C "C4'" . DT  B 2 6   ? 67.527  33.960 128.692 1.00 49.87  ? 6   DT  D "C4'" 1 
ATOM   783  O "O4'" . DT  B 2 6   ? 67.442  34.980 129.723 1.00 52.23  ? 6   DT  D "O4'" 1 
ATOM   784  C "C3'" . DT  B 2 6   ? 66.728  34.480 127.523 1.00 54.34  ? 6   DT  D "C3'" 1 
ATOM   785  O "O3'" . DT  B 2 6   ? 65.703  33.563 127.284 1.00 68.81  ? 6   DT  D "O3'" 1 
ATOM   786  C "C2'" . DT  B 2 6   ? 66.185  35.852 127.932 1.00 45.30  ? 6   DT  D "C2'" 1 
ATOM   787  C "C1'" . DT  B 2 6   ? 66.466  35.962 129.426 1.00 38.00  ? 6   DT  D "C1'" 1 
ATOM   788  N N1    . DT  B 2 6   ? 67.073  37.263 129.837 1.00 36.90  ? 6   DT  D N1    1 
ATOM   789  C C2    . DT  B 2 6   ? 66.313  38.114 130.600 1.00 36.87  ? 6   DT  D C2    1 
ATOM   790  O O2    . DT  B 2 6   ? 65.169  37.855 130.915 1.00 36.92  ? 6   DT  D O2    1 
ATOM   791  N N3    . DT  B 2 6   ? 66.943  39.277 130.982 1.00 35.35  ? 6   DT  D N3    1 
ATOM   792  C C4    . DT  B 2 6   ? 68.240  39.651 130.673 1.00 37.76  ? 6   DT  D C4    1 
ATOM   793  O O4    . DT  B 2 6   ? 68.668  40.740 131.052 1.00 37.01  ? 6   DT  D O4    1 
ATOM   794  C C5    . DT  B 2 6   ? 68.991  38.705 129.878 1.00 36.09  ? 6   DT  D C5    1 
ATOM   795  C C7    . DT  B 2 6   ? 70.404  39.005 129.465 1.00 33.92  ? 6   DT  D C7    1 
ATOM   796  C C6    . DT  B 2 6   ? 68.381  37.569 129.510 1.00 36.81  ? 6   DT  D C6    1 
ATOM   797  P P     . DT  B 2 7   ? 64.808  33.897 126.017 1.00 72.47  ? 7   DT  D P     1 
ATOM   798  O OP1   . DT  B 2 7   ? 64.022  32.683 125.691 1.00 73.37  ? 7   DT  D OP1   1 
ATOM   799  O OP2   . DT  B 2 7   ? 65.689  34.527 125.000 1.00 73.39  ? 7   DT  D OP2   1 
ATOM   800  O "O5'" . DT  B 2 7   ? 63.848  35.026 126.630 1.00 62.34  ? 7   DT  D "O5'" 1 
ATOM   801  C "C5'" . DT  B 2 7   ? 62.720  34.663 127.390 1.00 56.30  ? 7   DT  D "C5'" 1 
ATOM   802  C "C4'" . DT  B 2 7   ? 61.948  35.892 127.830 1.00 54.11  ? 7   DT  D "C4'" 1 
ATOM   803  O "O4'" . DT  B 2 7   ? 62.845  36.917 128.324 1.00 55.66  ? 7   DT  D "O4'" 1 
ATOM   804  C "C3'" . DT  B 2 7   ? 61.144  36.582 126.747 1.00 54.32  ? 7   DT  D "C3'" 1 
ATOM   805  O "O3'" . DT  B 2 7   ? 59.936  37.011 127.340 1.00 61.46  ? 7   DT  D "O3'" 1 
ATOM   806  C "C2'" . DT  B 2 7   ? 62.022  37.787 126.406 1.00 46.66  ? 7   DT  D "C2'" 1 
ATOM   807  C "C1'" . DT  B 2 7   ? 62.427  38.166 127.820 1.00 36.99  ? 7   DT  D "C1'" 1 
ATOM   808  N N1    . DT  B 2 7   ? 63.567  39.106 127.943 1.00 35.26  ? 7   DT  D N1    1 
ATOM   809  C C2    . DT  B 2 7   ? 63.401  40.213 128.744 1.00 35.84  ? 7   DT  D C2    1 
ATOM   810  O O2    . DT  B 2 7   ? 62.364  40.483 129.341 1.00 36.19  ? 7   DT  D O2    1 
ATOM   811  N N3    . DT  B 2 7   ? 64.513  41.008 128.822 1.00 32.83  ? 7   DT  D N3    1 
ATOM   812  C C4    . DT  B 2 7   ? 65.733  40.796 128.216 1.00 34.45  ? 7   DT  D C4    1 
ATOM   813  O O4    . DT  B 2 7   ? 66.659  41.577 128.364 1.00 33.89  ? 7   DT  D O4    1 
ATOM   814  C C5    . DT  B 2 7   ? 65.838  39.630 127.418 1.00 30.69  ? 7   DT  D C5    1 
ATOM   815  C C7    . DT  B 2 7   ? 67.146  39.400 126.731 1.00 28.92  ? 7   DT  D C7    1 
ATOM   816  C C6    . DT  B 2 7   ? 64.768  38.831 127.326 1.00 33.35  ? 7   DT  D C6    1 
ATOM   817  P P     . DC  B 2 8   ? 58.726  37.278 126.337 1.00 64.47  ? 8   DC  D P     1 
ATOM   818  O OP1   . DC  B 2 8   ? 57.562  36.484 126.795 1.00 71.88  ? 8   DC  D OP1   1 
ATOM   819  O OP2   . DC  B 2 8   ? 59.259  37.066 124.966 1.00 60.40  ? 8   DC  D OP2   1 
ATOM   820  O "O5'" . DC  B 2 8   ? 58.406  38.822 126.614 1.00 52.30  ? 8   DC  D "O5'" 1 
ATOM   821  C "C5'" . DC  B 2 8   ? 59.284  39.552 127.427 1.00 47.50  ? 8   DC  D "C5'" 1 
ATOM   822  C "C4'" . DC  B 2 8   ? 58.602  40.821 127.881 1.00 54.48  ? 8   DC  D "C4'" 1 
ATOM   823  O "O4'" . DC  B 2 8   ? 59.601  41.727 128.410 1.00 56.53  ? 8   DC  D "O4'" 1 
ATOM   824  C "C3'" . DC  B 2 8   ? 57.852  41.571 126.794 1.00 52.34  ? 8   DC  D "C3'" 1 
ATOM   825  O "O3'" . DC  B 2 8   ? 56.632  42.112 127.289 1.00 61.14  ? 8   DC  D "O3'" 1 
ATOM   826  C "C2'" . DC  B 2 8   ? 58.805  42.677 126.374 1.00 48.06  ? 8   DC  D "C2'" 1 
ATOM   827  C "C1'" . DC  B 2 8   ? 59.855  42.745 127.482 1.00 44.28  ? 8   DC  D "C1'" 1 
ATOM   828  N N1    . DC  B 2 8   ? 61.223  42.576 126.947 1.00 42.81  ? 8   DC  D N1    1 
ATOM   829  C C2    . DC  B 2 8   ? 62.119  43.610 127.198 1.00 42.48  ? 8   DC  D C2    1 
ATOM   830  O O2    . DC  B 2 8   ? 61.720  44.576 127.881 1.00 43.63  ? 8   DC  D O2    1 
ATOM   831  N N3    . DC  B 2 8   ? 63.373  43.513 126.685 1.00 42.12  ? 8   DC  D N3    1 
ATOM   832  C C4    . DC  B 2 8   ? 63.732  42.456 125.957 1.00 40.37  ? 8   DC  D C4    1 
ATOM   833  N N4    . DC  B 2 8   ? 64.980  42.421 125.485 1.00 40.12  ? 8   DC  D N4    1 
ATOM   834  C C5    . DC  B 2 8   ? 62.832  41.395 125.674 1.00 38.98  ? 8   DC  D C5    1 
ATOM   835  C C6    . DC  B 2 8   ? 61.600  41.507 126.187 1.00 41.19  ? 8   DC  D C6    1 
ATOM   836  P P     . DG  B 2 9   ? 55.607  42.789 126.258 1.00 64.19  ? 9   DG  D P     1 
ATOM   837  O OP1   . DG  B 2 9   ? 54.238  42.626 126.805 1.00 65.55  ? 9   DG  D OP1   1 
ATOM   838  O OP2   . DG  B 2 9   ? 55.935  42.288 124.901 1.00 72.22  ? 9   DG  D OP2   1 
ATOM   839  O "O5'" . DG  B 2 9   ? 55.972  44.343 126.290 1.00 59.12  ? 9   DG  D "O5'" 1 
ATOM   840  C "C5'" . DG  B 2 9   ? 55.938  45.070 127.505 1.00 58.92  ? 9   DG  D "C5'" 1 
ATOM   841  C "C4'" . DG  B 2 9   ? 56.683  46.364 127.276 1.00 58.66  ? 9   DG  D "C4'" 1 
ATOM   842  O "O4'" . DG  B 2 9   ? 58.092  46.078 127.061 1.00 59.26  ? 9   DG  D "O4'" 1 
ATOM   843  C "C3'" . DG  B 2 9   ? 56.192  47.088 126.031 1.00 55.93  ? 9   DG  D "C3'" 1 
ATOM   844  O "O3'" . DG  B 2 9   ? 55.655  48.345 126.414 1.00 54.83  ? 9   DG  D "O3'" 1 
ATOM   845  C "C2'" . DG  B 2 9   ? 57.412  47.198 125.114 1.00 52.45  ? 9   DG  D "C2'" 1 
ATOM   846  C "C1'" . DG  B 2 9   ? 58.596  46.919 126.042 1.00 48.59  ? 9   DG  D "C1'" 1 
ATOM   847  N N9    . DG  B 2 9   ? 59.735  46.259 125.394 1.00 33.52  ? 9   DG  D N9    1 
ATOM   848  C C8    . DG  B 2 9   ? 59.759  45.115 124.632 1.00 28.41  ? 9   DG  D C8    1 
ATOM   849  N N7    . DG  B 2 9   ? 60.943  44.802 124.187 1.00 25.89  ? 9   DG  D N7    1 
ATOM   850  C C5    . DG  B 2 9   ? 61.768  45.808 124.690 1.00 28.85  ? 9   DG  D C5    1 
ATOM   851  C C6    . DG  B 2 9   ? 63.167  46.003 124.556 1.00 33.04  ? 9   DG  D C6    1 
ATOM   852  O O6    . DG  B 2 9   ? 63.999  45.308 123.941 1.00 32.89  ? 9   DG  D O6    1 
ATOM   853  N N1    . DG  B 2 9   ? 63.604  47.144 125.219 1.00 33.48  ? 9   DG  D N1    1 
ATOM   854  C C2    . DG  B 2 9   ? 62.796  47.991 125.932 1.00 39.19  ? 9   DG  D C2    1 
ATOM   855  N N2    . DG  B 2 9   ? 63.395  49.042 126.520 1.00 43.98  ? 9   DG  D N2    1 
ATOM   856  N N3    . DG  B 2 9   ? 61.487  47.810 126.073 1.00 38.23  ? 9   DG  D N3    1 
ATOM   857  C C4    . DG  B 2 9   ? 61.040  46.707 125.427 1.00 33.83  ? 9   DG  D C4    1 
ATOM   858  P P     . DT  B 2 10  ? 55.037  49.330 125.329 1.00 50.43  ? 10  DT  D P     1 
ATOM   859  O OP1   . DT  B 2 10  ? 53.950  50.072 125.996 1.00 47.66  ? 10  DT  D OP1   1 
ATOM   860  O OP2   . DT  B 2 10  ? 54.757  48.524 124.115 1.00 46.56  ? 10  DT  D OP2   1 
ATOM   861  O "O5'" . DT  B 2 10  ? 56.252  50.334 125.083 1.00 38.17  ? 10  DT  D "O5'" 1 
ATOM   862  C "C5'" . DT  B 2 10  ? 56.592  51.196 126.145 1.00 41.18  ? 10  DT  D "C5'" 1 
ATOM   863  C "C4'" . DT  B 2 10  ? 57.900  51.877 125.817 1.00 42.45  ? 10  DT  D "C4'" 1 
ATOM   864  O "O4'" . DT  B 2 10  ? 58.815  50.859 125.339 1.00 35.91  ? 10  DT  D "O4'" 1 
ATOM   865  C "C3'" . DT  B 2 10  ? 57.778  52.891 124.685 1.00 48.63  ? 10  DT  D "C3'" 1 
ATOM   866  O "O3'" . DT  B 2 10  ? 58.730  53.910 124.899 1.00 57.83  ? 10  DT  D "O3'" 1 
ATOM   867  C "C2'" . DT  B 2 10  ? 58.188  52.035 123.496 1.00 44.68  ? 10  DT  D "C2'" 1 
ATOM   868  C "C1'" . DT  B 2 10  ? 59.370  51.361 124.161 1.00 41.95  ? 10  DT  D "C1'" 1 
ATOM   869  N N1    . DT  B 2 10  ? 59.956  50.254 123.416 1.00 42.91  ? 10  DT  D N1    1 
ATOM   870  C C2    . DT  B 2 10  ? 61.327  50.140 123.442 1.00 42.00  ? 10  DT  D C2    1 
ATOM   871  O O2    . DT  B 2 10  ? 62.058  50.901 124.053 1.00 42.12  ? 10  DT  D O2    1 
ATOM   872  N N3    . DT  B 2 10  ? 61.818  49.088 122.725 1.00 38.13  ? 10  DT  D N3    1 
ATOM   873  C C4    . DT  B 2 10  ? 61.087  48.179 121.991 1.00 40.34  ? 10  DT  D C4    1 
ATOM   874  O O4    . DT  B 2 10  ? 61.663  47.283 121.380 1.00 39.33  ? 10  DT  D O4    1 
ATOM   875  C C5    . DT  B 2 10  ? 59.659  48.362 122.013 1.00 44.94  ? 10  DT  D C5    1 
ATOM   876  C C7    . DT  B 2 10  ? 58.771  47.420 121.249 1.00 45.16  ? 10  DT  D C7    1 
ATOM   877  C C6    . DT  B 2 10  ? 59.160  49.381 122.720 1.00 44.78  ? 10  DT  D C6    1 
ATOM   878  P P     . DA  B 2 11  ? 58.392  55.459 124.718 1.00 59.94  ? 11  DA  D P     1 
ATOM   879  O OP1   . DA  B 2 11  ? 58.394  56.112 126.049 1.00 70.26  ? 11  DA  D OP1   1 
ATOM   880  O OP2   . DA  B 2 11  ? 57.208  55.581 123.844 1.00 46.75  ? 11  DA  D OP2   1 
ATOM   881  O "O5'" . DA  B 2 11  ? 59.692  55.907 123.906 1.00 53.90  ? 11  DA  D "O5'" 1 
ATOM   882  C "C5'" . DA  B 2 11  ? 60.888  56.074 124.637 1.00 45.24  ? 11  DA  D "C5'" 1 
ATOM   883  C "C4'" . DA  B 2 11  ? 62.065  55.769 123.746 1.00 49.01  ? 11  DA  D "C4'" 1 
ATOM   884  O "O4'" . DA  B 2 11  ? 61.970  54.398 123.301 1.00 48.53  ? 11  DA  D "O4'" 1 
ATOM   885  C "C3'" . DA  B 2 11  ? 62.189  56.624 122.475 1.00 52.04  ? 11  DA  D "C3'" 1 
ATOM   886  O "O3'" . DA  B 2 11  ? 63.314  57.517 122.566 1.00 47.69  ? 11  DA  D "O3'" 1 
ATOM   887  C "C2'" . DA  B 2 11  ? 62.466  55.611 121.361 1.00 47.62  ? 11  DA  D "C2'" 1 
ATOM   888  C "C1'" . DA  B 2 11  ? 62.723  54.314 122.114 1.00 40.11  ? 11  DA  D "C1'" 1 
ATOM   889  N N9    . DA  B 2 11  ? 62.339  53.119 121.376 1.00 37.88  ? 11  DA  D N9    1 
ATOM   890  C C8    . DA  B 2 11  ? 61.115  52.573 121.094 1.00 36.74  ? 11  DA  D C8    1 
ATOM   891  N N7    . DA  B 2 11  ? 61.219  51.456 120.391 1.00 37.45  ? 11  DA  D N7    1 
ATOM   892  C C5    . DA  B 2 11  ? 62.583  51.283 120.212 1.00 39.01  ? 11  DA  D C5    1 
ATOM   893  C C6    . DA  B 2 11  ? 63.368  50.303 119.583 1.00 40.20  ? 11  DA  D C6    1 
ATOM   894  N N6    . DA  B 2 11  ? 62.874  49.239 118.950 1.00 38.37  ? 11  DA  D N6    1 
ATOM   895  N N1    . DA  B 2 11  ? 64.708  50.435 119.636 1.00 40.86  ? 11  DA  D N1    1 
ATOM   896  C C2    . DA  B 2 11  ? 65.237  51.490 120.253 1.00 41.64  ? 11  DA  D C2    1 
ATOM   897  N N3    . DA  B 2 11  ? 64.604  52.479 120.873 1.00 41.65  ? 11  DA  D N3    1 
ATOM   898  C C4    . DA  B 2 11  ? 63.278  52.302 120.822 1.00 40.07  ? 11  DA  D C4    1 
ATOM   899  P P     . DT  B 2 12  ? 63.545  58.825 121.660 1.00 46.19  ? 12  DT  D P     1 
ATOM   900  O OP1   . DT  B 2 12  ? 64.565  59.640 122.360 1.00 54.76  ? 12  DT  D OP1   1 
ATOM   901  O OP2   . DT  B 2 12  ? 62.237  59.421 121.288 1.00 53.82  ? 12  DT  D OP2   1 
ATOM   902  O "O5'" . DT  B 2 12  ? 64.212  58.364 120.249 1.00 38.64  ? 12  DT  D "O5'" 1 
ATOM   903  C "C5'" . DT  B 2 12  ? 65.081  57.403 120.701 1.00 21.08  ? 12  DT  D "C5'" 1 
ATOM   904  C "C4'" . DT  B 2 12  ? 65.889  56.721 119.534 1.00 31.85  ? 12  DT  D "C4'" 1 
ATOM   905  O "O4'" . DT  B 2 12  ? 65.242  55.453 119.331 1.00 38.74  ? 12  DT  D "O4'" 1 
ATOM   906  C "C3'" . DT  B 2 12  ? 66.188  57.401 118.189 1.00 44.44  ? 12  DT  D "C3'" 1 
ATOM   907  O "O3'" . DT  B 2 12  ? 67.595  57.241 117.868 1.00 55.32  ? 12  DT  D "O3'" 1 
ATOM   908  C "C2'" . DT  B 2 12  ? 65.349  56.524 117.261 1.00 50.05  ? 12  DT  D "C2'" 1 
ATOM   909  C "C1'" . DT  B 2 12  ? 65.431  55.166 117.967 1.00 47.34  ? 12  DT  D "C1'" 1 
ATOM   910  N N1    . DT  B 2 12  ? 64.400  54.201 117.542 1.00 46.60  ? 12  DT  D N1    1 
ATOM   911  C C2    . DT  B 2 12  ? 64.848  53.036 116.972 1.00 45.27  ? 12  DT  D C2    1 
ATOM   912  O O2    . DT  B 2 12  ? 66.026  52.791 116.799 1.00 44.06  ? 12  DT  D O2    1 
ATOM   913  N N3    . DT  B 2 12  ? 63.847  52.168 116.612 1.00 47.75  ? 12  DT  D N3    1 
ATOM   914  C C4    . DT  B 2 12  ? 62.477  52.363 116.759 1.00 47.62  ? 12  DT  D C4    1 
ATOM   915  O O4    . DT  B 2 12  ? 61.677  51.509 116.385 1.00 46.65  ? 12  DT  D O4    1 
ATOM   916  C C5    . DT  B 2 12  ? 62.091  53.604 117.374 1.00 43.59  ? 12  DT  D C5    1 
ATOM   917  C C7    . DT  B 2 12  ? 60.642  53.900 117.589 1.00 41.21  ? 12  DT  D C7    1 
ATOM   918  C C6    . DT  B 2 12  ? 63.056  54.457 117.745 1.00 44.93  ? 12  DT  D C6    1 
ATOM   919  P P     . DA  B 2 13  ? 68.095  58.107 116.619 1.00 57.00  ? 13  DA  D P     1 
ATOM   920  O OP1   . DA  B 2 13  ? 69.025  59.123 117.147 1.00 68.48  ? 13  DA  D OP1   1 
ATOM   921  O OP2   . DA  B 2 13  ? 66.934  58.565 115.827 1.00 57.63  ? 13  DA  D OP2   1 
ATOM   922  O "O5'" . DA  B 2 13  ? 68.935  57.056 115.767 1.00 52.19  ? 13  DA  D "O5'" 1 
ATOM   923  C "C5'" . DA  B 2 13  ? 69.613  56.111 116.570 1.00 54.29  ? 13  DA  D "C5'" 1 
ATOM   924  C "C4'" . DA  B 2 13  ? 70.367  55.060 115.772 1.00 54.91  ? 13  DA  D "C4'" 1 
ATOM   925  O "O4'" . DA  B 2 13  ? 69.515  53.937 115.420 1.00 53.02  ? 13  DA  D "O4'" 1 
ATOM   926  C "C3'" . DA  B 2 13  ? 70.998  55.493 114.464 1.00 55.21  ? 13  DA  D "C3'" 1 
ATOM   927  O "O3'" . DA  B 2 13  ? 72.057  54.577 114.214 1.00 64.05  ? 13  DA  D "O3'" 1 
ATOM   928  C "C2'" . DA  B 2 13  ? 69.820  55.295 113.512 1.00 51.65  ? 13  DA  D "C2'" 1 
ATOM   929  C "C1'" . DA  B 2 13  ? 69.135  54.044 114.065 1.00 49.97  ? 13  DA  D "C1'" 1 
ATOM   930  N N9    . DA  B 2 13  ? 67.669  54.032 114.016 1.00 48.19  ? 13  DA  D N9    1 
ATOM   931  C C8    . DA  B 2 13  ? 66.773  54.929 114.524 1.00 47.48  ? 13  DA  D C8    1 
ATOM   932  N N7    . DA  B 2 13  ? 65.521  54.579 114.344 1.00 46.50  ? 13  DA  D N7    1 
ATOM   933  C C5    . DA  B 2 13  ? 65.592  53.363 113.675 1.00 49.51  ? 13  DA  D C5    1 
ATOM   934  C C6    . DA  B 2 13  ? 64.614  52.447 113.182 1.00 48.87  ? 13  DA  D C6    1 
ATOM   935  N N6    . DA  B 2 13  ? 63.281  52.607 113.268 1.00 44.99  ? 13  DA  D N6    1 
ATOM   936  N N1    . DA  B 2 13  ? 65.055  51.312 112.600 1.00 48.80  ? 13  DA  D N1    1 
ATOM   937  C C2    . DA  B 2 13  ? 66.369  51.113 112.490 1.00 49.58  ? 13  DA  D C2    1 
ATOM   938  N N3    . DA  B 2 13  ? 67.365  51.895 112.898 1.00 49.65  ? 13  DA  D N3    1 
ATOM   939  C C4    . DA  B 2 13  ? 66.913  53.010 113.492 1.00 48.85  ? 13  DA  D C4    1 
ATOM   940  P P     . DG  B 2 14  ? 72.704  54.297 112.777 1.00 69.09  ? 14  DG  D P     1 
ATOM   941  O OP1   . DG  B 2 14  ? 74.037  53.683 112.981 1.00 66.37  ? 14  DG  D OP1   1 
ATOM   942  O OP2   . DG  B 2 14  ? 72.519  55.513 111.943 1.00 69.80  ? 14  DG  D OP2   1 
ATOM   943  O "O5'" . DG  B 2 14  ? 71.817  53.120 112.185 1.00 74.36  ? 14  DG  D "O5'" 1 
ATOM   944  C "C5'" . DG  B 2 14  ? 72.420  51.846 112.223 1.00 69.05  ? 14  DG  D "C5'" 1 
ATOM   945  C "C4'" . DG  B 2 14  ? 71.638  50.909 111.335 1.00 65.26  ? 14  DG  D "C4'" 1 
ATOM   946  O "O4'" . DG  B 2 14  ? 70.239  51.275 111.353 1.00 62.26  ? 14  DG  D "O4'" 1 
ATOM   947  C "C3'" . DG  B 2 14  ? 72.041  50.946 109.872 1.00 70.03  ? 14  DG  D "C3'" 1 
ATOM   948  O "O3'" . DG  B 2 14  ? 72.077  49.604 109.444 1.00 75.25  ? 14  DG  D "O3'" 1 
ATOM   949  C "C2'" . DG  B 2 14  ? 70.920  51.735 109.194 1.00 65.18  ? 14  DG  D "C2'" 1 
ATOM   950  C "C1'" . DG  B 2 14  ? 69.747  51.237 110.029 1.00 61.50  ? 14  DG  D "C1'" 1 
ATOM   951  N N9    . DG  B 2 14  ? 68.520  52.032 110.003 1.00 51.42  ? 14  DG  D N9    1 
ATOM   952  C C8    . DG  B 2 14  ? 68.338  53.328 110.404 1.00 49.03  ? 14  DG  D C8    1 
ATOM   953  N N7    . DG  B 2 14  ? 67.104  53.730 110.327 1.00 48.37  ? 14  DG  D N7    1 
ATOM   954  C C5    . DG  B 2 14  ? 66.404  52.626 109.859 1.00 48.27  ? 14  DG  D C5    1 
ATOM   955  C C6    . DG  B 2 14  ? 65.023  52.477 109.572 1.00 47.00  ? 14  DG  D C6    1 
ATOM   956  O O6    . DG  B 2 14  ? 64.118  53.314 109.695 1.00 45.09  ? 14  DG  D O6    1 
ATOM   957  N N1    . DG  B 2 14  ? 64.717  51.207 109.107 1.00 47.83  ? 14  DG  D N1    1 
ATOM   958  C C2    . DG  B 2 14  ? 65.638  50.200 108.976 1.00 55.69  ? 14  DG  D C2    1 
ATOM   959  N N2    . DG  B 2 14  ? 65.162  49.027 108.529 1.00 60.24  ? 14  DG  D N2    1 
ATOM   960  N N3    . DG  B 2 14  ? 66.935  50.324 109.251 1.00 57.00  ? 14  DG  D N3    1 
ATOM   961  C C4    . DG  B 2 14  ? 67.259  51.569 109.670 1.00 53.21  ? 14  DG  D C4    1 
ATOM   962  P P     . DC  B 2 15  ? 73.274  49.274 108.457 1.00 76.94  ? 15  DC  D P     1 
ATOM   963  O OP1   . DC  B 2 15  ? 73.174  47.855 108.044 1.00 78.65  ? 15  DC  D OP1   1 
ATOM   964  O OP2   . DC  B 2 15  ? 74.521  49.754 109.095 1.00 77.51  ? 15  DC  D OP2   1 
ATOM   965  O "O5'" . DC  B 2 15  ? 72.873  50.236 107.236 1.00 77.09  ? 15  DC  D "O5'" 1 
ATOM   966  C "C5'" . DC  B 2 15  ? 72.363  49.691 106.018 1.00 85.60  ? 15  DC  D "C5'" 1 
ATOM   967  C "C4'" . DC  B 2 15  ? 71.038  48.973 106.240 1.00 87.09  ? 15  DC  D "C4'" 1 
ATOM   968  O "O4'" . DC  B 2 15  ? 70.127  49.863 106.932 1.00 84.84  ? 15  DC  D "O4'" 1 
ATOM   969  C "C3'" . DC  B 2 15  ? 70.310  48.504 104.979 1.00 85.68  ? 15  DC  D "C3'" 1 
ATOM   970  O "O3'" . DC  B 2 15  ? 69.968  47.128 105.051 1.00 86.69  ? 15  DC  D "O3'" 1 
ATOM   971  C "C2'" . DC  B 2 15  ? 69.041  49.337 104.922 1.00 78.30  ? 15  DC  D "C2'" 1 
ATOM   972  C "C1'" . DC  B 2 15  ? 68.833  49.724 106.380 1.00 75.79  ? 15  DC  D "C1'" 1 
ATOM   973  N N1    . DC  B 2 15  ? 68.116  51.023 106.472 1.00 75.32  ? 15  DC  D N1    1 
ATOM   974  C C2    . DC  B 2 15  ? 66.857  51.099 105.864 1.00 76.34  ? 15  DC  D C2    1 
ATOM   975  O O2    . DC  B 2 15  ? 66.377  50.099 105.306 1.00 75.55  ? 15  DC  D O2    1 
ATOM   976  N N3    . DC  B 2 15  ? 66.186  52.273 105.914 1.00 76.98  ? 15  DC  D N3    1 
ATOM   977  C C4    . DC  B 2 15  ? 66.730  53.330 106.518 1.00 74.81  ? 15  DC  D C4    1 
ATOM   978  N N4    . DC  B 2 15  ? 66.035  54.470 106.536 1.00 74.03  ? 15  DC  D N4    1 
ATOM   979  C C5    . DC  B 2 15  ? 68.010  53.277 107.136 1.00 73.27  ? 15  DC  D C5    1 
ATOM   980  C C6    . DC  B 2 15  ? 68.662  52.115 107.083 1.00 74.19  ? 15  DC  D C6    1 
ATOM   981  P P     A DA  B 2 16  ? 70.270  46.233 103.755 0.57 87.27  ? 16  DA  D P     1 
ATOM   982  P P     B DA  B 2 16  ? 70.296  46.198 103.568 0.43 95.85  ? 16  DA  D P     1 
ATOM   983  O OP1   A DA  B 2 16  ? 71.496  45.446 104.043 0.57 89.72  ? 16  DA  D OP1   1 
ATOM   984  O OP1   B DA  B 2 16  ? 71.500  45.584 104.150 0.43 96.99  ? 16  DA  D OP1   1 
ATOM   985  O OP2   A DA  B 2 16  ? 70.184  47.108 102.553 0.57 79.29  ? 16  DA  D OP2   1 
ATOM   986  O OP2   B DA  B 2 16  ? 70.238  47.446 102.727 0.43 87.71  ? 16  DA  D OP2   1 
ATOM   987  O "O5'" A DA  B 2 16  ? 69.061  45.184 103.709 0.57 84.65  ? 16  DA  D "O5'" 1 
ATOM   988  O "O5'" B DA  B 2 16  ? 69.371  45.033 102.952 0.43 92.19  ? 16  DA  D "O5'" 1 
ATOM   989  C "C5'" A DA  B 2 16  ? 67.739  45.660 103.879 0.57 82.09  ? 16  DA  D "C5'" 1 
ATOM   990  C "C5'" B DA  B 2 16  ? 67.949  44.827 103.270 0.43 85.92  ? 16  DA  D "C5'" 1 
ATOM   991  C "C4'" A DA  B 2 16  ? 66.946  45.639 102.585 0.57 80.46  ? 16  DA  D "C4'" 1 
ATOM   992  C "C4'" B DA  B 2 16  ? 67.041  45.364 102.168 0.43 84.50  ? 16  DA  D "C4'" 1 
ATOM   993  O "O4'" A DA  B 2 16  ? 66.209  46.876 102.419 0.57 79.56  ? 16  DA  D "O4'" 1 
ATOM   994  O "O4'" B DA  B 2 16  ? 66.478  46.648 102.568 0.43 83.13  ? 16  DA  D "O4'" 1 
ATOM   995  C "C3'" A DA  B 2 16  ? 67.726  45.396 101.301 0.57 78.85  ? 16  DA  D "C3'" 1 
ATOM   996  C "C3'" B DA  B 2 16  ? 67.667  45.593 100.787 0.43 84.28  ? 16  DA  D "C3'" 1 
ATOM   997  O "O3'" A DA  B 2 16  ? 67.029  44.489 100.436 0.57 77.21  ? 16  DA  D "O3'" 1 
ATOM   998  O "O3'" B DA  B 2 16  ? 66.676  45.596 99.738  0.43 85.62  ? 16  DA  D "O3'" 1 
ATOM   999  C "C2'" A DA  B 2 16  ? 67.828  46.799 100.697 0.57 76.82  ? 16  DA  D "C2'" 1 
ATOM   1000 C "C2'" B DA  B 2 16  ? 68.097  47.017 101.021 0.43 80.02  ? 16  DA  D "C2'" 1 
ATOM   1001 C "C1'" A DA  B 2 16  ? 66.621  47.556 101.257 0.57 75.44  ? 16  DA  D "C1'" 1 
ATOM   1002 C "C1'" B DA  B 2 16  ? 66.772  47.583 101.555 0.43 77.06  ? 16  DA  D "C1'" 1 
ATOM   1003 N N9    A DA  B 2 16  ? 66.917  48.911 101.710 0.57 74.75  ? 16  DA  D N9    1 
ATOM   1004 N N9    B DA  B 2 16  ? 66.957  48.889 102.186 0.43 73.47  ? 16  DA  D N9    1 
ATOM   1005 C C8    A DA  B 2 16  ? 68.130  49.445 102.045 0.57 75.22  ? 16  DA  D C8    1 
ATOM   1006 C C8    B DA  B 2 16  ? 68.084  49.412 102.771 0.43 73.44  ? 16  DA  D C8    1 
ATOM   1007 N N7    A DA  B 2 16  ? 68.069  50.700 102.434 0.57 75.89  ? 16  DA  D N7    1 
ATOM   1008 N N7    B DA  B 2 16  ? 67.934  50.667 103.154 0.43 73.77  ? 16  DA  D N7    1 
ATOM   1009 C C5    A DA  B 2 16  ? 66.718  51.004 102.387 0.57 76.14  ? 16  DA  D C5    1 
ATOM   1010 C C5    B DA  B 2 16  ? 66.639  50.987 102.774 0.43 74.09  ? 16  DA  D C5    1 
ATOM   1011 C C6    A DA  B 2 16  ? 65.998  52.179 102.691 0.57 74.12  ? 16  DA  D C6    1 
ATOM   1012 C C6    B DA  B 2 16  ? 65.884  52.174 102.922 0.43 72.06  ? 16  DA  D C6    1 
ATOM   1013 N N6    A DA  B 2 16  ? 66.579  53.306 103.117 0.57 72.38  ? 16  DA  D N6    1 
ATOM   1014 N N6    B DA  B 2 16  ? 66.355  53.283 103.507 0.43 70.42  ? 16  DA  D N6    1 
ATOM   1015 N N1    A DA  B 2 16  ? 64.657  52.149 102.540 0.57 74.06  ? 16  DA  D N1    1 
ATOM   1016 N N1    B DA  B 2 16  ? 64.622  52.171 102.451 0.43 71.89  ? 16  DA  D N1    1 
ATOM   1017 C C2    A DA  B 2 16  ? 64.087  51.015 102.105 0.57 74.96  ? 16  DA  D C2    1 
ATOM   1018 C C2    B DA  B 2 16  ? 64.157  51.058 101.868 0.43 72.72  ? 16  DA  D C2    1 
ATOM   1019 N N3    A DA  B 2 16  ? 64.659  49.850 101.784 0.57 74.97  ? 16  DA  D N3    1 
ATOM   1020 N N3    B DA  B 2 16  ? 64.774  49.883 101.675 0.43 72.75  ? 16  DA  D N3    1 
ATOM   1021 C C4    A DA  B 2 16  ? 65.992  49.907 101.950 0.57 75.03  ? 16  DA  D C4    1 
ATOM   1022 C C4    B DA  B 2 16  ? 66.026  49.901 102.166 0.43 73.02  ? 16  DA  D C4    1 
ATOM   1023 P P     A DT  B 2 17  ? 66.224  43.183 100.908 0.57 74.90  ? 17  DT  D P     1 
ATOM   1024 P P     B DT  B 2 17  ? 67.125  46.172 98.308  0.43 85.44  ? 17  DT  D P     1 
ATOM   1025 O OP1   A DT  B 2 17  ? 66.517  42.919 102.335 0.57 70.00  ? 17  DT  D OP1   1 
ATOM   1026 O OP1   B DT  B 2 17  ? 68.135  45.203 97.805  0.43 84.01  ? 17  DT  D OP1   1 
ATOM   1027 O OP2   A DT  B 2 17  ? 66.526  42.111 99.936  0.57 79.93  ? 17  DT  D OP2   1 
ATOM   1028 O OP2   B DT  B 2 17  ? 67.350  47.643 98.428  0.43 82.09  ? 17  DT  D OP2   1 
ATOM   1029 O "O5'" A DT  B 2 17  ? 64.684  43.617 100.749 0.57 69.41  ? 17  DT  D "O5'" 1 
ATOM   1030 O "O5'" B DT  B 2 17  ? 65.837  45.989 97.387  0.43 82.54  ? 17  DT  D "O5'" 1 
ATOM   1031 C "C5'" A DT  B 2 17  ? 63.649  42.640 100.672 0.57 61.90  ? 17  DT  D "C5'" 1 
ATOM   1032 C "C5'" B DT  B 2 17  ? 65.043  47.153 97.324  0.43 75.25  ? 17  DT  D "C5'" 1 
ATOM   1033 C "C4'" A DT  B 2 17  ? 62.322  43.313 100.388 0.57 63.30  ? 17  DT  D "C4'" 1 
ATOM   1034 C "C4'" B DT  B 2 17  ? 63.732  46.964 98.053  0.43 70.47  ? 17  DT  D "C4'" 1 
ATOM   1035 O "O4'" A DT  B 2 17  ? 62.578  44.713 100.111 0.57 62.14  ? 17  DT  D "O4'" 1 
ATOM   1036 O "O4'" B DT  B 2 17  ? 63.609  48.053 98.990  0.43 66.93  ? 17  DT  D "O4'" 1 
ATOM   1037 C "C3'" A DT  B 2 17  ? 61.571  42.767 99.174  0.57 65.52  ? 17  DT  D "C3'" 1 
ATOM   1038 C "C3'" B DT  B 2 17  ? 62.605  47.179 97.078  0.43 71.32  ? 17  DT  D "C3'" 1 
ATOM   1039 O "O3'" A DT  B 2 17  ? 60.163  42.852 99.401  0.57 65.42  ? 17  DT  D "O3'" 1 
ATOM   1040 O "O3'" B DT  B 2 17  ? 61.354  46.964 97.705  0.43 75.04  ? 17  DT  D "O3'" 1 
ATOM   1041 C "C2'" A DT  B 2 17  ? 62.023  43.709 98.062  0.57 64.74  ? 17  DT  D "C2'" 1 
ATOM   1042 C "C2'" B DT  B 2 17  ? 62.883  48.649 96.803  0.43 60.00  ? 17  DT  D "C2'" 1 
ATOM   1043 C "C1'" A DT  B 2 17  ? 62.082  45.023 98.829  0.57 66.75  ? 17  DT  D "C1'" 1 
ATOM   1044 C "C1'" B DT  B 2 17  ? 63.060  49.128 98.259  0.43 55.48  ? 17  DT  D "C1'" 1 
ATOM   1045 N N1    A DT  B 2 17  ? 62.987  46.035 98.247  0.57 67.69  ? 17  DT  D N1    1 
ATOM   1046 N N1    B DT  B 2 17  ? 63.973  50.264 98.541  0.43 54.29  ? 17  DT  D N1    1 
ATOM   1047 C C2    A DT  B 2 17  ? 62.414  47.238 97.886  0.57 68.09  ? 17  DT  D C2    1 
ATOM   1048 C C2    B DT  B 2 17  ? 63.464  51.550 98.495  0.43 52.94  ? 17  DT  D C2    1 
ATOM   1049 O O2    A DT  B 2 17  ? 61.221  47.485 98.027  0.57 67.21  ? 17  DT  D O2    1 
ATOM   1050 O O2    B DT  B 2 17  ? 62.318  51.791 98.185  0.43 52.07  ? 17  DT  D O2    1 
ATOM   1051 N N3    A DT  B 2 17  ? 63.298  48.149 97.352  0.57 68.16  ? 17  DT  D N3    1 
ATOM   1052 N N3    B DT  B 2 17  ? 64.418  52.506 98.818  0.43 50.75  ? 17  DT  D N3    1 
ATOM   1053 C C4    A DT  B 2 17  ? 64.661  47.984 97.178  0.57 68.59  ? 17  DT  D C4    1 
ATOM   1054 C C4    B DT  B 2 17  ? 65.741  52.316 99.149  0.43 51.74  ? 17  DT  D C4    1 
ATOM   1055 O O4    A DT  B 2 17  ? 65.328  48.898 96.702  0.57 67.66  ? 17  DT  D O4    1 
ATOM   1056 O O4    B DT  B 2 17  ? 66.429  53.285 99.397  0.43 50.83  ? 17  DT  D O4    1 
ATOM   1057 C C5    A DT  B 2 17  ? 65.186  46.706 97.580  0.57 68.30  ? 17  DT  D C5    1 
ATOM   1058 C C5    B DT  B 2 17  ? 66.193  50.952 99.180  0.43 52.05  ? 17  DT  D C5    1 
ATOM   1059 C C7    A DT  B 2 17  ? 66.647  46.414 97.386  0.57 67.88  ? 17  DT  D C7    1 
ATOM   1060 C C7    B DT  B 2 17  ? 67.594  50.613 99.607  0.43 51.05  ? 17  DT  D C7    1 
ATOM   1061 C C6    A DT  B 2 17  ? 64.339  45.803 98.097  0.57 67.95  ? 17  DT  D C6    1 
ATOM   1062 C C6    B DT  B 2 17  ? 65.289  49.988 98.920  0.43 52.91  ? 17  DT  D C6    1 
ATOM   1063 P P     A DA  B 2 18  ? 59.119  42.286 98.336  0.57 63.48  ? 18  DA  D P     1 
ATOM   1064 P P     B DA  B 2 18  ? 60.234  46.578 96.645  0.43 75.03  ? 18  DA  D P     1 
ATOM   1065 O OP1   A DA  B 2 18  ? 58.635  41.002 98.877  0.57 67.20  ? 18  DA  D OP1   1 
ATOM   1066 O OP1   B DA  B 2 18  ? 59.368  45.530 97.241  0.43 73.68  ? 18  DA  D OP1   1 
ATOM   1067 O OP2   A DA  B 2 18  ? 59.816  42.348 97.027  0.57 55.55  ? 18  DA  D OP2   1 
ATOM   1068 O OP2   B DA  B 2 18  ? 60.938  46.364 95.358  0.43 75.13  ? 18  DA  D OP2   1 
ATOM   1069 O "O5'" A DA  B 2 18  ? 57.884  43.308 98.431  0.57 58.77  ? 18  DA  D "O5'" 1 
ATOM   1070 O "O5'" B DA  B 2 18  ? 59.401  47.937 96.585  0.43 70.45  ? 18  DA  D "O5'" 1 
ATOM   1071 C "C5'" A DA  B 2 18  ? 58.046  44.420 97.602  0.57 51.59  ? 18  DA  D "C5'" 1 
ATOM   1072 C "C5'" B DA  B 2 18  ? 57.978  47.820 96.773  0.43 68.25  ? 18  DA  D "C5'" 1 
ATOM   1073 C "C4'" A DA  B 2 18  ? 56.876  45.296 97.180  0.57 50.72  ? 18  DA  D "C4'" 1 
ATOM   1074 C "C4'" B DA  B 2 18  ? 57.178  48.509 95.689  0.43 66.72  ? 18  DA  D "C4'" 1 
ATOM   1075 O "O4'" A DA  B 2 18  ? 57.542  46.503 96.733  0.57 52.03  ? 18  DA  D "O4'" 1 
ATOM   1076 O "O4'" B DA  B 2 18  ? 57.933  49.568 95.036  0.43 64.42  ? 18  DA  D "O4'" 1 
ATOM   1077 C "C3'" A DA  B 2 18  ? 56.131  44.861 95.928  0.57 50.77  ? 18  DA  D "C3'" 1 
ATOM   1078 C "C3'" B DA  B 2 18  ? 56.648  47.571 94.612  0.43 69.70  ? 18  DA  D "C3'" 1 
ATOM   1079 O "O3'" A DA  B 2 18  ? 54.972  45.679 95.788  0.57 57.76  ? 18  DA  D "O3'" 1 
ATOM   1080 O "O3'" B DA  B 2 18  ? 55.243  47.380 94.825  0.43 80.21  ? 18  DA  D "O3'" 1 
ATOM   1081 C "C2'" A DA  B 2 18  ? 57.138  45.154 94.814  0.57 47.27  ? 18  DA  D "C2'" 1 
ATOM   1082 C "C2'" B DA  B 2 18  ? 56.935  48.306 93.297  0.43 57.74  ? 18  DA  D "C2'" 1 
ATOM   1083 C "C1'" A DA  B 2 18  ? 57.930  46.338 95.355  0.57 48.25  ? 18  DA  D "C1'" 1 
ATOM   1084 C "C1'" B DA  B 2 18  ? 57.760  49.557 93.624  0.43 54.51  ? 18  DA  D "C1'" 1 
ATOM   1085 N N9    A DA  B 2 18  ? 59.382  46.132 95.219  0.57 44.20  ? 18  DA  D N9    1 
ATOM   1086 N N9    B DA  B 2 18  ? 59.112  49.564 93.027  0.43 47.42  ? 18  DA  D N9    1 
ATOM   1087 C C8    A DA  B 2 18  ? 60.137  45.064 95.620  0.57 43.43  ? 18  DA  D C8    1 
ATOM   1088 C C8    B DA  B 2 18  ? 60.200  48.829 93.436  0.43 46.68  ? 18  DA  D C8    1 
ATOM   1089 N N7    A DA  B 2 18  ? 61.418  45.149 95.355  0.57 44.09  ? 18  DA  D N7    1 
ATOM   1090 N N7    B DA  B 2 18  ? 61.301  49.072 92.771  0.43 46.35  ? 18  DA  D N7    1 
ATOM   1091 C C5    A DA  B 2 18  ? 61.472  46.340 94.656  0.57 44.42  ? 18  DA  D C5    1 
ATOM   1092 C C5    B DA  B 2 18  ? 60.934  50.053 91.856  0.43 46.49  ? 18  DA  D C5    1 
ATOM   1093 C C6    A DA  B 2 18  ? 62.559  46.993 94.076  0.57 42.01  ? 18  DA  D C6    1 
ATOM   1094 C C6    B DA  B 2 18  ? 61.669  50.731 90.848  0.43 42.26  ? 18  DA  D C6    1 
ATOM   1095 N N6    A DA  B 2 18  ? 63.799  46.503 94.147  0.57 40.59  ? 18  DA  D N6    1 
ATOM   1096 N N6    B DA  B 2 18  ? 62.970  50.522 90.565  0.43 38.79  ? 18  DA  D N6    1 
ATOM   1097 N N1    A DA  B 2 18  ? 62.307  48.159 93.469  0.57 41.81  ? 18  DA  D N1    1 
ATOM   1098 N N1    B DA  B 2 18  ? 61.004  51.641 90.127  0.43 42.91  ? 18  DA  D N1    1 
ATOM   1099 C C2    A DA  B 2 18  ? 61.058  48.616 93.437  0.57 42.64  ? 18  DA  D C2    1 
ATOM   1100 C C2    B DA  B 2 18  ? 59.717  51.881 90.422  0.43 44.62  ? 18  DA  D C2    1 
ATOM   1101 N N3    A DA  B 2 18  ? 59.941  48.091 93.919  0.57 42.77  ? 18  DA  D N3    1 
ATOM   1102 N N3    B DA  B 2 18  ? 58.908  51.324 91.334  0.43 44.96  ? 18  DA  D N3    1 
ATOM   1103 C C4    A DA  B 2 18  ? 60.234  46.941 94.528  0.57 43.25  ? 18  DA  D C4    1 
ATOM   1104 C C4    B DA  B 2 18  ? 59.588  50.390 92.022  0.43 45.60  ? 18  DA  D C4    1 
ATOM   1105 P P     A DC  B 2 19  ? 53.990  45.574 94.517  0.57 60.10  ? 19  DC  D P     1 
ATOM   1106 P P     B DC  B 2 19  ? 54.430  46.053 94.411  0.43 81.82  ? 19  DC  D P     1 
ATOM   1107 O OP1   A DC  B 2 19  ? 52.614  45.856 95.008  0.57 59.44  ? 19  DC  D OP1   1 
ATOM   1108 O OP1   B DC  B 2 19  ? 53.224  45.943 95.276  0.43 100.00 ? 19  DC  D OP1   1 
ATOM   1109 O OP2   A DC  B 2 19  ? 54.248  44.255 93.887  0.57 53.93  ? 19  DC  D OP2   1 
ATOM   1110 O OP2   B DC  B 2 19  ? 55.399  44.930 94.335  0.43 100.00 ? 19  DC  D OP2   1 
ATOM   1111 O "O5'" A DC  B 2 19  ? 54.395  46.764 93.493  0.57 62.36  ? 19  DC  D "O5'" 1 
ATOM   1112 O "O5'" B DC  B 2 19  ? 53.962  46.435 92.925  0.43 94.43  ? 19  DC  D "O5'" 1 
ATOM   1113 C "C5'" A DC  B 2 19  ? 55.430  46.706 92.484  0.57 61.98  ? 19  DC  D "C5'" 1 
ATOM   1114 C "C5'" B DC  B 2 19  ? 54.993  46.511 91.945  0.43 88.08  ? 19  DC  D "C5'" 1 
ATOM   1115 C "C4'" A DC  B 2 19  ? 55.211  47.774 91.418  0.57 64.49  ? 19  DC  D "C4'" 1 
ATOM   1116 C "C4'" B DC  B 2 19  ? 54.735  47.592 90.912  0.43 89.75  ? 19  DC  D "C4'" 1 
ATOM   1117 O "O4'" A DC  B 2 19  ? 56.447  48.421 91.021  0.57 66.90  ? 19  DC  D "O4'" 1 
ATOM   1118 O "O4'" B DC  B 2 19  ? 55.950  48.356 90.689  0.43 100.00 ? 19  DC  D "O4'" 1 
ATOM   1119 C "C3'" A DC  B 2 19  ? 54.611  47.306 90.102  0.57 63.12  ? 19  DC  D "C3'" 1 
ATOM   1120 C "C3'" B DC  B 2 19  ? 54.387  47.025 89.546  0.43 47.32  ? 19  DC  D "C3'" 1 
ATOM   1121 O "O3'" A DC  B 2 19  ? 53.912  48.386 89.503  0.57 58.25  ? 19  DC  D "O3'" 1 
ATOM   1122 O "O3'" B DC  B 2 19  ? 53.552  47.918 88.824  0.43 28.93  ? 19  DC  D "O3'" 1 
ATOM   1123 C "C2'" A DC  B 2 19  ? 55.842  46.944 89.275  0.57 67.40  ? 19  DC  D "C2'" 1 
ATOM   1124 C "C2'" B DC  B 2 19  ? 55.750  46.833 88.880  0.43 62.16  ? 19  DC  D "C2'" 1 
ATOM   1125 C "C1'" A DC  B 2 19  ? 56.833  48.017 89.716  0.57 69.30  ? 19  DC  D "C1'" 1 
ATOM   1126 C "C1'" B DC  B 2 19  ? 56.615  47.923 89.513  0.43 62.11  ? 19  DC  D "C1'" 1 
ATOM   1127 N N1    A DC  B 2 19  ? 58.193  47.473 89.897  0.57 70.63  ? 19  DC  D N1    1 
ATOM   1128 N N1    B DC  B 2 19  ? 58.003  47.445 89.848  0.43 63.28  ? 19  DC  D N1    1 
ATOM   1129 C C2    A DC  B 2 19  ? 59.241  47.953 89.103  0.57 72.28  ? 19  DC  D C2    1 
ATOM   1130 C C2    B DC  B 2 19  ? 59.063  47.923 89.063  0.43 64.87  ? 19  DC  D C2    1 
ATOM   1131 O O2    A DC  B 2 19  ? 59.022  48.809 88.236  0.57 72.43  ? 19  DC  D O2    1 
ATOM   1132 O O2    B DC  B 2 19  ? 58.823  48.729 88.155  0.43 64.85  ? 19  DC  D O2    1 
ATOM   1133 N N3    A DC  B 2 19  ? 60.478  47.440 89.321  0.57 72.90  ? 19  DC  D N3    1 
ATOM   1134 N N3    B DC  B 2 19  ? 60.326  47.499 89.329  0.43 65.63  ? 19  DC  D N3    1 
ATOM   1135 C C4    A DC  B 2 19  ? 60.656  46.518 90.276  0.57 70.80  ? 19  DC  D C4    1 
ATOM   1136 C C4    B DC  B 2 19  ? 60.541  46.630 90.320  0.43 63.66  ? 19  DC  D C4    1 
ATOM   1137 N N4    A DC  B 2 19  ? 61.892  46.044 90.452  0.57 69.85  ? 19  DC  D N4    1 
ATOM   1138 N N4    B DC  B 2 19  ? 61.801  46.245 90.548  0.43 62.59  ? 19  DC  D N4    1 
ATOM   1139 C C5    A DC  B 2 19  ? 59.589  46.034 91.093  0.57 68.61  ? 19  DC  D C5    1 
ATOM   1140 C C5    B DC  B 2 19  ? 59.476  46.120 91.124  0.43 61.58  ? 19  DC  D C5    1 
ATOM   1141 C C6    A DC  B 2 19  ? 58.378  46.545 90.876  0.57 69.43  ? 19  DC  D C6    1 
ATOM   1142 C C6    B DC  B 2 19  ? 58.237  46.548 90.854  0.43 62.31  ? 19  DC  D C6    1 
ATOM   1143 P P     . DA  B 2 20  ? 52.932  47.993 88.308  1.00 58.10  ? 20  DA  D P     1 
ATOM   1144 O OP1   . DA  B 2 20  ? 52.075  49.164 87.999  1.00 59.01  ? 20  DA  D OP1   1 
ATOM   1145 O OP2   . DA  B 2 20  ? 52.341  46.685 88.665  1.00 39.86  ? 20  DA  D OP2   1 
ATOM   1146 O "O5'" . DA  B 2 20  ? 53.956  47.819 87.099  1.00 50.91  ? 20  DA  D "O5'" 1 
ATOM   1147 C "C5'" . DA  B 2 20  ? 54.136  48.889 86.198  1.00 39.37  ? 20  DA  D "C5'" 1 
ATOM   1148 C "C4'" . DA  B 2 20  ? 55.193  48.478 85.207  1.00 33.02  ? 20  DA  D "C4'" 1 
ATOM   1149 O "O4'" . DA  B 2 20  ? 56.254  47.853 85.956  1.00 36.98  ? 20  DA  D "O4'" 1 
ATOM   1150 C "C3'" . DA  B 2 20  ? 54.697  47.414 84.240  1.00 25.23  ? 20  DA  D "C3'" 1 
ATOM   1151 O "O3'" . DA  B 2 20  ? 55.008  47.783 82.966  1.00 35.54  ? 20  DA  D "O3'" 1 
ATOM   1152 C "C2'" . DA  B 2 20  ? 55.484  46.158 84.564  1.00 23.87  ? 20  DA  D "C2'" 1 
ATOM   1153 C "C1'" . DA  B 2 20  ? 56.722  46.777 85.185  1.00 29.29  ? 20  DA  D "C1'" 1 
ATOM   1154 N N9    . DA  B 2 20  ? 57.448  45.868 86.053  1.00 31.42  ? 20  DA  D N9    1 
ATOM   1155 C C8    . DA  B 2 20  ? 56.966  44.906 86.889  1.00 30.72  ? 20  DA  D C8    1 
ATOM   1156 N N7    . DA  B 2 20  ? 57.908  44.241 87.518  1.00 30.63  ? 20  DA  D N7    1 
ATOM   1157 C C5    . DA  B 2 20  ? 59.082  44.812 87.053  1.00 35.02  ? 20  DA  D C5    1 
ATOM   1158 C C6    . DA  B 2 20  ? 60.431  44.544 87.320  1.00 32.46  ? 20  DA  D C6    1 
ATOM   1159 N N6    . DA  B 2 20  ? 60.800  43.588 88.171  1.00 30.81  ? 20  DA  D N6    1 
ATOM   1160 N N1    . DA  B 2 20  ? 61.366  45.303 86.710  1.00 32.37  ? 20  DA  D N1    1 
ATOM   1161 C C2    . DA  B 2 20  ? 60.971  46.244 85.851  1.00 33.44  ? 20  DA  D C2    1 
ATOM   1162 N N3    . DA  B 2 20  ? 59.733  46.578 85.500  1.00 33.82  ? 20  DA  D N3    1 
ATOM   1163 C C4    . DA  B 2 20  ? 58.823  45.817 86.145  1.00 34.29  ? 20  DA  D C4    1 
ATOM   1164 P P     . DT  B 2 21  ? 54.280  46.976 81.815  1.00 42.59  ? 21  DT  D P     1 
ATOM   1165 O OP1   . DT  B 2 21  ? 54.429  47.851 80.628  1.00 40.53  ? 21  DT  D OP1   1 
ATOM   1166 O OP2   . DT  B 2 21  ? 52.922  46.636 82.285  1.00 55.51  ? 21  DT  D OP2   1 
ATOM   1167 O "O5'" . DT  B 2 21  ? 55.131  45.618 81.698  1.00 43.32  ? 21  DT  D "O5'" 1 
ATOM   1168 C "C5'" . DT  B 2 21  ? 55.854  45.275 80.521  1.00 41.78  ? 21  DT  D "C5'" 1 
ATOM   1169 C "C4'" . DT  B 2 21  ? 57.304  45.636 80.734  1.00 41.71  ? 21  DT  D "C4'" 1 
ATOM   1170 O "O4'" . DT  B 2 21  ? 57.624  45.118 82.029  1.00 43.98  ? 21  DT  D "O4'" 1 
ATOM   1171 C "C3'" . DT  B 2 21  ? 58.280  44.957 79.795  1.00 46.89  ? 21  DT  D "C3'" 1 
ATOM   1172 O "O3'" . DT  B 2 21  ? 58.707  45.920 78.861  1.00 47.00  ? 21  DT  D "O3'" 1 
ATOM   1173 C "C2'" . DT  B 2 21  ? 59.424  44.446 80.681  1.00 49.86  ? 21  DT  D "C2'" 1 
ATOM   1174 C "C1'" . DT  B 2 21  ? 58.989  44.791 82.097  1.00 48.44  ? 21  DT  D "C1'" 1 
ATOM   1175 N N1    . DT  B 2 21  ? 59.127  43.733 83.150  1.00 49.91  ? 21  DT  D N1    1 
ATOM   1176 C C2    . DT  B 2 21  ? 60.371  43.597 83.708  1.00 50.60  ? 21  DT  D C2    1 
ATOM   1177 O O2    . DT  B 2 21  ? 61.318  44.249 83.320  1.00 50.30  ? 21  DT  D O2    1 
ATOM   1178 N N3    . DT  B 2 21  ? 60.470  42.661 84.707  1.00 49.04  ? 21  DT  D N3    1 
ATOM   1179 C C4    . DT  B 2 21  ? 59.451  41.880 85.217  1.00 50.26  ? 21  DT  D C4    1 
ATOM   1180 O O4    . DT  B 2 21  ? 59.687  41.073 86.111  1.00 49.26  ? 21  DT  D O4    1 
ATOM   1181 C C5    . DT  B 2 21  ? 58.158  42.080 84.619  1.00 50.31  ? 21  DT  D C5    1 
ATOM   1182 C C7    . DT  B 2 21  ? 56.999  41.260 85.124  1.00 49.10  ? 21  DT  D C7    1 
ATOM   1183 C C6    . DT  B 2 21  ? 58.060  42.992 83.635  1.00 50.24  ? 21  DT  D C6    1 
ATOM   1184 P P     . DT  B 2 22  ? 58.942  45.458 77.357  1.00 49.35  ? 22  DT  D P     1 
ATOM   1185 O OP1   . DT  B 2 22  ? 58.685  46.612 76.464  1.00 56.70  ? 22  DT  D OP1   1 
ATOM   1186 O OP2   . DT  B 2 22  ? 58.295  44.145 77.135  1.00 39.73  ? 22  DT  D OP2   1 
ATOM   1187 O "O5'" . DT  B 2 22  ? 60.511  45.212 77.388  1.00 50.06  ? 22  DT  D "O5'" 1 
ATOM   1188 C "C5'" . DT  B 2 22  ? 61.234  45.523 78.549  1.00 25.94  ? 22  DT  D "C5'" 1 
ATOM   1189 C "C4'" . DT  B 2 22  ? 62.542  44.782 78.456  1.00 29.77  ? 22  DT  D "C4'" 1 
ATOM   1190 O "O4'" . DT  B 2 22  ? 62.667  43.954 79.631  1.00 33.28  ? 22  DT  D "O4'" 1 
ATOM   1191 C "C3'" . DT  B 2 22  ? 62.681  43.818 77.275  1.00 32.03  ? 22  DT  D "C3'" 1 
ATOM   1192 O "O3'" . DT  B 2 22  ? 64.072  43.649 76.970  1.00 38.22  ? 22  DT  D "O3'" 1 
ATOM   1193 C "C2'" . DT  B 2 22  ? 62.113  42.533 77.861  1.00 27.26  ? 22  DT  D "C2'" 1 
ATOM   1194 C "C1'" . DT  B 2 22  ? 62.776  42.603 79.233  1.00 27.64  ? 22  DT  D "C1'" 1 
ATOM   1195 N N1    . DT  B 2 22  ? 62.132  41.790 80.279  1.00 26.88  ? 22  DT  D N1    1 
ATOM   1196 C C2    . DT  B 2 22  ? 62.937  41.294 81.274  1.00 26.17  ? 22  DT  D C2    1 
ATOM   1197 O O2    . DT  B 2 22  ? 64.131  41.498 81.319  1.00 25.59  ? 22  DT  D O2    1 
ATOM   1198 N N3    . DT  B 2 22  ? 62.280  40.555 82.225  1.00 26.67  ? 22  DT  D N3    1 
ATOM   1199 C C4    . DT  B 2 22  ? 60.921  40.270 82.254  1.00 26.91  ? 22  DT  D C4    1 
ATOM   1200 O O4    . DT  B 2 22  ? 60.472  39.577 83.158  1.00 25.86  ? 22  DT  D O4    1 
ATOM   1201 C C5    . DT  B 2 22  ? 60.134  40.813 81.167  1.00 26.49  ? 22  DT  D C5    1 
ATOM   1202 C C7    . DT  B 2 22  ? 58.654  40.576 81.084  1.00 24.26  ? 22  DT  D C7    1 
ATOM   1203 C C6    . DT  B 2 22  ? 60.773  41.544 80.245  1.00 27.97  ? 22  DT  D C6    1 
ATOM   1204 P P     . DA  B 2 23  ? 64.564  42.983 75.604  1.00 38.93  ? 23  DA  D P     1 
ATOM   1205 O OP1   . DA  B 2 23  ? 65.260  44.019 74.826  1.00 40.75  ? 23  DA  D OP1   1 
ATOM   1206 O OP2   . DA  B 2 23  ? 63.414  42.304 74.979  1.00 55.55  ? 23  DA  D OP2   1 
ATOM   1207 O "O5'" . DA  B 2 23  ? 65.578  41.844 76.119  1.00 32.29  ? 23  DA  D "O5'" 1 
ATOM   1208 C "C5'" . DA  B 2 23  ? 66.801  42.147 76.750  1.00 38.85  ? 23  DA  D "C5'" 1 
ATOM   1209 C "C4'" . DA  B 2 23  ? 67.202  41.044 77.709  1.00 44.63  ? 23  DA  D "C4'" 1 
ATOM   1210 O "O4'" . DA  B 2 23  ? 66.077  40.756 78.561  1.00 48.27  ? 23  DA  D "O4'" 1 
ATOM   1211 C "C3'" . DA  B 2 23  ? 67.564  39.687 77.120  1.00 44.38  ? 23  DA  D "C3'" 1 
ATOM   1212 O "O3'" . DA  B 2 23  ? 68.954  39.634 76.842  1.00 44.20  ? 23  DA  D "O3'" 1 
ATOM   1213 C "C2'" . DA  B 2 23  ? 67.254  38.721 78.264  1.00 44.78  ? 23  DA  D "C2'" 1 
ATOM   1214 C "C1'" . DA  B 2 23  ? 66.366  39.533 79.207  1.00 44.77  ? 23  DA  D "C1'" 1 
ATOM   1215 N N9    . DA  B 2 23  ? 65.099  38.879 79.521  1.00 39.23  ? 23  DA  D N9    1 
ATOM   1216 C C8    . DA  B 2 23  ? 63.872  39.039 78.928  1.00 37.61  ? 23  DA  D C8    1 
ATOM   1217 N N7    . DA  B 2 23  ? 62.946  38.255 79.439  1.00 36.60  ? 23  DA  D N7    1 
ATOM   1218 C C5    . DA  B 2 23  ? 63.617  37.549 80.435  1.00 36.84  ? 23  DA  D C5    1 
ATOM   1219 C C6    . DA  B 2 23  ? 63.198  36.581 81.371  1.00 37.12  ? 23  DA  D C6    1 
ATOM   1220 N N6    . DA  B 2 23  ? 61.934  36.133 81.473  1.00 37.02  ? 23  DA  D N6    1 
ATOM   1221 N N1    . DA  B 2 23  ? 64.139  36.078 82.203  1.00 35.54  ? 23  DA  D N1    1 
ATOM   1222 C C2    . DA  B 2 23  ? 65.396  36.514 82.116  1.00 34.23  ? 23  DA  D C2    1 
ATOM   1223 N N3    . DA  B 2 23  ? 65.894  37.435 81.309  1.00 33.86  ? 23  DA  D N3    1 
ATOM   1224 C C4    . DA  B 2 23  ? 64.951  37.905 80.485  1.00 35.38  ? 23  DA  D C4    1 
ATOM   1225 P P     . DT  B 2 24  ? 69.673  38.314 76.279  1.00 36.85  ? 24  DT  D P     1 
ATOM   1226 O OP1   . DT  B 2 24  ? 70.991  38.764 75.810  1.00 48.33  ? 24  DT  D OP1   1 
ATOM   1227 O OP2   . DT  B 2 24  ? 68.726  37.647 75.367  1.00 41.23  ? 24  DT  D OP2   1 
ATOM   1228 O "O5'" . DT  B 2 24  ? 69.861  37.370 77.554  1.00 30.51  ? 24  DT  D "O5'" 1 
ATOM   1229 C "C5'" . DT  B 2 24  ? 70.848  37.627 78.532  1.00 25.07  ? 24  DT  D "C5'" 1 
ATOM   1230 C "C4'" . DT  B 2 24  ? 70.681  36.581 79.613  1.00 23.75  ? 24  DT  D "C4'" 1 
ATOM   1231 O "O4'" . DT  B 2 24  ? 69.260  36.358 79.856  1.00 28.03  ? 24  DT  D "O4'" 1 
ATOM   1232 C "C3'" . DT  B 2 24  ? 71.198  35.204 79.227  1.00 28.62  ? 24  DT  D "C3'" 1 
ATOM   1233 O "O3'" . DT  B 2 24  ? 71.692  34.627 80.406  1.00 34.77  ? 24  DT  D "O3'" 1 
ATOM   1234 C "C2'" . DT  B 2 24  ? 69.925  34.480 78.804  1.00 27.32  ? 24  DT  D "C2'" 1 
ATOM   1235 C "C1'" . DT  B 2 24  ? 68.983  34.956 79.903  1.00 26.84  ? 24  DT  D "C1'" 1 
ATOM   1236 N N1    . DT  B 2 24  ? 67.548  34.791 79.524  1.00 26.96  ? 24  DT  D N1    1 
ATOM   1237 C C2    . DT  B 2 24  ? 66.757  33.912 80.237  1.00 29.55  ? 24  DT  D C2    1 
ATOM   1238 O O2    . DT  B 2 24  ? 67.192  33.198 81.105  1.00 32.18  ? 24  DT  D O2    1 
ATOM   1239 N N3    . DT  B 2 24  ? 65.446  33.839 79.868  1.00 23.79  ? 24  DT  D N3    1 
ATOM   1240 C C4    . DT  B 2 24  ? 64.896  34.625 78.879  1.00 27.23  ? 24  DT  D C4    1 
ATOM   1241 O O4    . DT  B 2 24  ? 63.723  34.433 78.637  1.00 26.72  ? 24  DT  D O4    1 
ATOM   1242 C C5    . DT  B 2 24  ? 65.758  35.584 78.199  1.00 20.69  ? 24  DT  D C5    1 
ATOM   1243 C C7    . DT  B 2 24  ? 65.240  36.441 77.069  1.00 16.85  ? 24  DT  D C7    1 
ATOM   1244 C C6    . DT  B 2 24  ? 67.046  35.630 78.550  1.00 23.10  ? 24  DT  D C6    1 
ATOM   1245 P P     . DA  B 2 25  ? 72.634  33.348 80.404  1.00 36.05  ? 25  DA  D P     1 
ATOM   1246 O OP1   . DA  B 2 25  ? 73.558  33.503 81.549  1.00 34.59  ? 25  DA  D OP1   1 
ATOM   1247 O OP2   . DA  B 2 25  ? 73.148  33.155 79.028  1.00 47.59  ? 25  DA  D OP2   1 
ATOM   1248 O "O5'" . DA  B 2 25  ? 71.639  32.151 80.747  1.00 32.31  ? 25  DA  D "O5'" 1 
ATOM   1249 C "C5'" . DA  B 2 25  ? 71.270  32.034 82.097  1.00 26.24  ? 25  DA  D "C5'" 1 
ATOM   1250 C "C4'" . DA  B 2 25  ? 70.837  30.619 82.388  1.00 28.17  ? 25  DA  D "C4'" 1 
ATOM   1251 O "O4'" . DA  B 2 25  ? 69.480  30.366 81.953  1.00 30.37  ? 25  DA  D "O4'" 1 
ATOM   1252 C "C3'" . DA  B 2 25  ? 71.689  29.575 81.719  1.00 26.37  ? 25  DA  D "C3'" 1 
ATOM   1253 O "O3'" . DA  B 2 25  ? 71.814  28.522 82.622  1.00 29.22  ? 25  DA  D "O3'" 1 
ATOM   1254 C "C2'" . DA  B 2 25  ? 70.866  29.178 80.491  1.00 26.93  ? 25  DA  D "C2'" 1 
ATOM   1255 C "C1'" . DA  B 2 25  ? 69.426  29.365 80.953  1.00 26.17  ? 25  DA  D "C1'" 1 
ATOM   1256 N N9    . DA  B 2 25  ? 68.478  29.953 80.005  1.00 22.77  ? 25  DA  D N9    1 
ATOM   1257 C C8    . DA  B 2 25  ? 68.613  31.071 79.236  1.00 21.62  ? 25  DA  D C8    1 
ATOM   1258 N N7    . DA  B 2 25  ? 67.519  31.371 78.574  1.00 22.42  ? 25  DA  D N7    1 
ATOM   1259 C C5    . DA  B 2 25  ? 66.586  30.443 79.016  1.00 23.28  ? 25  DA  D C5    1 
ATOM   1260 C C6    . DA  B 2 25  ? 65.212  30.259 78.743  1.00 26.62  ? 25  DA  D C6    1 
ATOM   1261 N N6    . DA  B 2 25  ? 64.514  31.024 77.891  1.00 27.07  ? 25  DA  D N6    1 
ATOM   1262 N N1    . DA  B 2 25  ? 64.563  29.254 79.364  1.00 25.73  ? 25  DA  D N1    1 
ATOM   1263 C C2    . DA  B 2 25  ? 65.259  28.481 80.198  1.00 25.91  ? 25  DA  D C2    1 
ATOM   1264 N N3    . DA  B 2 25  ? 66.545  28.558 80.533  1.00 25.39  ? 25  DA  D N3    1 
ATOM   1265 C C4    . DA  B 2 25  ? 67.155  29.577 79.908  1.00 23.37  ? 25  DA  D C4    1 
ATOM   1266 P P     . DC  B 2 26  ? 72.781  27.360 82.123  1.00 32.66  ? 26  DC  D P     1 
ATOM   1267 O OP1   . DC  B 2 26  ? 73.080  26.522 83.295  1.00 33.23  ? 26  DC  D OP1   1 
ATOM   1268 O OP2   . DC  B 2 26  ? 73.862  27.972 81.323  1.00 38.24  ? 26  DC  D OP2   1 
ATOM   1269 O "O5'" . DC  B 2 26  ? 71.825  26.490 81.217  1.00 38.86  ? 26  DC  D "O5'" 1 
ATOM   1270 C "C5'" . DC  B 2 26  ? 70.976  25.744 82.056  1.00 54.30  ? 26  DC  D "C5'" 1 
ATOM   1271 C "C4'" . DC  B 2 26  ? 70.198  24.797 81.192  1.00 61.56  ? 26  DC  D "C4'" 1 
ATOM   1272 O "O4'" . DC  B 2 26  ? 69.193  25.582 80.509  1.00 59.24  ? 26  DC  D "O4'" 1 
ATOM   1273 C "C3'" . DC  B 2 26  ? 71.108  24.216 80.121  1.00 66.11  ? 26  DC  D "C3'" 1 
ATOM   1274 O "O3'" . DC  B 2 26  ? 71.124  22.791 80.232  1.00 76.21  ? 26  DC  D "O3'" 1 
ATOM   1275 C "C2'" . DC  B 2 26  ? 70.586  24.790 78.801  1.00 45.03  ? 26  DC  D "C2'" 1 
ATOM   1276 C "C1'" . DC  B 2 26  ? 69.156  25.157 79.172  1.00 50.00  ? 26  DC  D "C1'" 1 
ATOM   1277 N N1    . DC  B 2 26  ? 68.498  26.202 78.315  1.00 49.34  ? 26  DC  D N1    1 
ATOM   1278 C C2    . DC  B 2 26  ? 67.089  26.177 78.226  1.00 45.70  ? 26  DC  D C2    1 
ATOM   1279 O O2    . DC  B 2 26  ? 66.454  25.312 78.857  1.00 49.77  ? 26  DC  D O2    1 
ATOM   1280 N N3    . DC  B 2 26  ? 66.459  27.090 77.444  1.00 41.73  ? 26  DC  D N3    1 
ATOM   1281 C C4    . DC  B 2 26  ? 67.177  27.991 76.773  1.00 33.34  ? 26  DC  D C4    1 
ATOM   1282 N N4    . DC  B 2 26  ? 66.510  28.851 76.002  1.00 21.38  ? 26  DC  D N4    1 
ATOM   1283 C C5    . DC  B 2 26  ? 68.603  28.037 76.849  1.00 36.39  ? 26  DC  D C5    1 
ATOM   1284 C C6    . DC  B 2 26  ? 69.221  27.125 77.616  1.00 40.02  ? 26  DC  D C6    1 
ATOM   1285 P P     . DG  B 2 27  ? 71.915  21.862 79.198  1.00 76.02  ? 27  DG  D P     1 
ATOM   1286 O OP1   . DG  B 2 27  ? 72.880  21.032 79.959  1.00 75.83  ? 27  DG  D OP1   1 
ATOM   1287 O OP2   . DG  B 2 27  ? 72.356  22.711 78.068  1.00 70.16  ? 27  DG  D OP2   1 
ATOM   1288 O "O5'" . DG  B 2 27  ? 70.722  20.919 78.721  1.00 74.03  ? 27  DG  D "O5'" 1 
ATOM   1289 C "C5'" . DG  B 2 27  ? 69.744  20.660 79.717  1.00 75.03  ? 27  DG  D "C5'" 1 
ATOM   1290 C "C4'" . DG  B 2 27  ? 68.438  20.271 79.068  1.00 77.17  ? 27  DG  D "C4'" 1 
ATOM   1291 O "O4'" . DG  B 2 27  ? 67.801  21.471 78.555  1.00 77.23  ? 27  DG  D "O4'" 1 
ATOM   1292 C "C3'" . DG  B 2 27  ? 68.620  19.328 77.885  1.00 79.67  ? 27  DG  D "C3'" 1 
ATOM   1293 O "O3'" . DG  B 2 27  ? 67.545  18.402 77.866  1.00 83.44  ? 27  DG  D "O3'" 1 
ATOM   1294 C "C2'" . DG  B 2 27  ? 68.587  20.262 76.684  1.00 65.78  ? 27  DG  D "C2'" 1 
ATOM   1295 C "C1'" . DG  B 2 27  ? 67.611  21.336 77.162  1.00 64.97  ? 27  DG  D "C1'" 1 
ATOM   1296 N N9    . DG  B 2 27  ? 67.936  22.579 76.488  1.00 54.59  ? 27  DG  D N9    1 
ATOM   1297 C C8    . DG  B 2 27  ? 69.177  23.086 76.194  1.00 53.61  ? 27  DG  D C8    1 
ATOM   1298 N N7    . DG  B 2 27  ? 69.146  24.185 75.487  1.00 49.80  ? 27  DG  D N7    1 
ATOM   1299 C C5    . DG  B 2 27  ? 67.791  24.394 75.268  1.00 44.97  ? 27  DG  D C5    1 
ATOM   1300 C C6    . DG  B 2 27  ? 67.154  25.424 74.546  1.00 39.01  ? 27  DG  D C6    1 
ATOM   1301 O O6    . DG  B 2 27  ? 67.695  26.389 73.970  1.00 34.59  ? 27  DG  D O6    1 
ATOM   1302 N N1    . DG  B 2 27  ? 65.767  25.250 74.551  1.00 38.89  ? 27  DG  D N1    1 
ATOM   1303 C C2    . DG  B 2 27  ? 65.106  24.213 75.175  1.00 40.76  ? 27  DG  D C2    1 
ATOM   1304 N N2    . DG  B 2 27  ? 63.768  24.187 75.086  1.00 45.72  ? 27  DG  D N2    1 
ATOM   1305 N N3    . DG  B 2 27  ? 65.693  23.251 75.864  1.00 42.25  ? 27  DG  D N3    1 
ATOM   1306 C C4    . DG  B 2 27  ? 67.033  23.410 75.867  1.00 45.69  ? 27  DG  D C4    1 
ATOM   1307 P P     . DA  B 2 28  ? 67.689  17.020 77.084  1.00 79.73  ? 28  DA  D P     1 
ATOM   1308 O OP1   . DA  B 2 28  ? 68.129  16.016 78.076  1.00 85.59  ? 28  DA  D OP1   1 
ATOM   1309 O OP2   . DA  B 2 28  ? 68.480  17.288 75.860  1.00 62.56  ? 28  DA  D OP2   1 
ATOM   1310 O "O5'" . DA  B 2 28  ? 66.170  16.705 76.706  1.00 68.95  ? 28  DA  D "O5'" 1 
ATOM   1311 C "C5'" . DA  B 2 28  ? 65.145  17.399 77.392  1.00 55.36  ? 28  DA  D "C5'" 1 
ATOM   1312 C "C4'" . DA  B 2 28  ? 63.961  17.567 76.462  1.00 59.29  ? 28  DA  D "C4'" 1 
ATOM   1313 O "O4'" . DA  B 2 28  ? 64.035  18.828 75.743  1.00 58.85  ? 28  DA  D "O4'" 1 
ATOM   1314 C "C3'" . DA  B 2 28  ? 63.871  16.537 75.356  1.00 64.42  ? 28  DA  D "C3'" 1 
ATOM   1315 O "O3'" . DA  B 2 28  ? 62.534  16.558 74.918  1.00 74.30  ? 28  DA  D "O3'" 1 
ATOM   1316 C "C2'" . DA  B 2 28  ? 64.774  17.174 74.307  1.00 57.55  ? 28  DA  D "C2'" 1 
ATOM   1317 C "C1'" . DA  B 2 28  ? 64.260  18.608 74.360  1.00 47.34  ? 28  DA  D "C1'" 1 
ATOM   1318 N N9    . DA  B 2 28  ? 65.238  19.590 73.890  1.00 35.39  ? 28  DA  D N9    1 
ATOM   1319 C C8    . DA  B 2 28  ? 66.585  19.614 74.147  1.00 35.35  ? 28  DA  D C8    1 
ATOM   1320 N N7    . DA  B 2 28  ? 67.221  20.639 73.616  1.00 34.42  ? 28  DA  D N7    1 
ATOM   1321 C C5    . DA  B 2 28  ? 66.230  21.341 72.954  1.00 29.83  ? 28  DA  D C5    1 
ATOM   1322 C C6    . DA  B 2 28  ? 66.262  22.535 72.201  1.00 29.71  ? 28  DA  D C6    1 
ATOM   1323 N N6    . DA  B 2 28  ? 67.382  23.232 71.959  1.00 27.44  ? 28  DA  D N6    1 
ATOM   1324 N N1    . DA  B 2 28  ? 65.092  22.989 71.694  1.00 29.10  ? 28  DA  D N1    1 
ATOM   1325 C C2    . DA  B 2 28  ? 63.985  22.270 71.937  1.00 28.89  ? 28  DA  D C2    1 
ATOM   1326 N N3    . DA  B 2 28  ? 63.835  21.134 72.628  1.00 28.54  ? 28  DA  D N3    1 
ATOM   1327 C C4    . DA  B 2 28  ? 65.006  20.712 73.116  1.00 29.33  ? 28  DA  D C4    1 
ATOM   1328 P P     . DA  B 2 29  ? 61.918  15.291 74.171  1.00 73.34  ? 29  DA  D P     1 
ATOM   1329 O OP1   . DA  B 2 29  ? 61.070  14.608 75.172  1.00 78.89  ? 29  DA  D OP1   1 
ATOM   1330 O OP2   . DA  B 2 29  ? 63.010  14.572 73.479  1.00 63.43  ? 29  DA  D OP2   1 
ATOM   1331 O "O5'" . DA  B 2 29  ? 61.000  16.007 73.081  1.00 62.31  ? 29  DA  D "O5'" 1 
ATOM   1332 C "C5'" . DA  B 2 29  ? 61.297  17.373 72.848  1.00 60.48  ? 29  DA  D "C5'" 1 
ATOM   1333 C "C4'" . DA  B 2 29  ? 60.846  17.786 71.467  1.00 60.32  ? 29  DA  D "C4'" 1 
ATOM   1334 O "O4'" . DA  B 2 29  ? 61.779  18.748 70.912  1.00 58.31  ? 29  DA  D "O4'" 1 
ATOM   1335 C "C3'" . DA  B 2 29  ? 60.862  16.651 70.463  1.00 63.94  ? 29  DA  D "C3'" 1 
ATOM   1336 O "O3'" . DA  B 2 29  ? 60.110  17.137 69.371  1.00 66.05  ? 29  DA  D "O3'" 1 
ATOM   1337 C "C2'" . DA  B 2 29  ? 62.351  16.621 70.135  1.00 51.60  ? 29  DA  D "C2'" 1 
ATOM   1338 C "C1'" . DA  B 2 29  ? 62.567  18.115 69.918  1.00 46.43  ? 29  DA  D "C1'" 1 
ATOM   1339 N N9    . DA  B 2 29  ? 63.950  18.559 70.071  1.00 36.78  ? 29  DA  D N9    1 
ATOM   1340 C C8    . DA  B 2 29  ? 64.981  17.958 70.743  1.00 35.02  ? 29  DA  D C8    1 
ATOM   1341 N N7    . DA  B 2 29  ? 66.100  18.640 70.701  1.00 32.95  ? 29  DA  D N7    1 
ATOM   1342 C C5    . DA  B 2 29  ? 65.774  19.762 69.967  1.00 32.01  ? 29  DA  D C5    1 
ATOM   1343 C C6    . DA  B 2 29  ? 66.531  20.874 69.577  1.00 29.68  ? 29  DA  D C6    1 
ATOM   1344 N N6    . DA  B 2 29  ? 67.819  20.992 69.901  1.00 26.09  ? 29  DA  D N6    1 
ATOM   1345 N N1    . DA  B 2 29  ? 65.920  21.849 68.859  1.00 30.48  ? 29  DA  D N1    1 
ATOM   1346 C C2    . DA  B 2 29  ? 64.620  21.687 68.550  1.00 32.62  ? 29  DA  D C2    1 
ATOM   1347 N N3    . DA  B 2 29  ? 63.797  20.668 68.852  1.00 32.88  ? 29  DA  D N3    1 
ATOM   1348 C C4    . DA  B 2 29  ? 64.454  19.733 69.566  1.00 32.80  ? 29  DA  D C4    1 
ATOM   1349 P P     . DG  B 2 30  ? 59.695  16.310 68.075  1.00 65.75  ? 30  DG  D P     1 
ATOM   1350 O OP1   . DG  B 2 30  ? 58.259  16.614 67.890  1.00 67.37  ? 30  DG  D OP1   1 
ATOM   1351 O OP2   . DG  B 2 30  ? 60.188  14.915 68.149  1.00 56.84  ? 30  DG  D OP2   1 
ATOM   1352 O "O5'" . DG  B 2 30  ? 60.467  17.103 66.929  1.00 64.99  ? 30  DG  D "O5'" 1 
ATOM   1353 C "C5'" . DG  B 2 30  ? 59.784  18.308 66.645  1.00 66.77  ? 30  DG  D "C5'" 1 
ATOM   1354 C "C4'" . DG  B 2 30  ? 60.632  19.174 65.749  1.00 67.99  ? 30  DG  D "C4'" 1 
ATOM   1355 O "O4'" . DG  B 2 30  ? 61.958  19.238 66.330  1.00 66.96  ? 30  DG  D "O4'" 1 
ATOM   1356 C "C3'" . DG  B 2 30  ? 60.816  18.602 64.346  1.00 63.04  ? 30  DG  D "C3'" 1 
ATOM   1357 O "O3'" . DG  B 2 30  ? 60.620  19.626 63.376  1.00 52.12  ? 30  DG  D "O3'" 1 
ATOM   1358 C "C2'" . DG  B 2 30  ? 62.263  18.114 64.360  1.00 61.40  ? 30  DG  D "C2'" 1 
ATOM   1359 C "C1'" . DG  B 2 30  ? 62.875  19.171 65.265  1.00 56.87  ? 30  DG  D "C1'" 1 
ATOM   1360 N N9    . DG  B 2 30  ? 64.139  18.797 65.864  1.00 44.45  ? 30  DG  D N9    1 
ATOM   1361 C C8    . DG  B 2 30  ? 64.420  17.718 66.663  1.00 43.61  ? 30  DG  D C8    1 
ATOM   1362 N N7    . DG  B 2 30  ? 65.657  17.700 67.084  1.00 41.57  ? 30  DG  D N7    1 
ATOM   1363 C C5    . DG  B 2 30  ? 66.222  18.841 66.523  1.00 38.63  ? 30  DG  D C5    1 
ATOM   1364 C C6    . DG  B 2 30  ? 67.542  19.331 66.630  1.00 39.31  ? 30  DG  D C6    1 
ATOM   1365 O O6    . DG  B 2 30  ? 68.469  18.826 67.272  1.00 39.45  ? 30  DG  D O6    1 
ATOM   1366 N N1    . DG  B 2 30  ? 67.730  20.526 65.941  1.00 37.23  ? 30  DG  D N1    1 
ATOM   1367 C C2    . DG  B 2 30  ? 66.736  21.156 65.232  1.00 34.89  ? 30  DG  D C2    1 
ATOM   1368 N N2    . DG  B 2 30  ? 67.091  22.302 64.642  1.00 32.53  ? 30  DG  D N2    1 
ATOM   1369 N N3    . DG  B 2 30  ? 65.487  20.702 65.109  1.00 35.13  ? 30  DG  D N3    1 
ATOM   1370 C C4    . DG  B 2 30  ? 65.304  19.533 65.773  1.00 35.84  ? 30  DG  D C4    1 
ATOM   1371 P P     . DT  B 2 31  ? 60.948  19.248 61.866  1.00 51.07  ? 31  DT  D P     1 
ATOM   1372 O OP1   . DT  B 2 31  ? 59.966  19.984 61.049  1.00 59.58  ? 31  DT  D OP1   1 
ATOM   1373 O OP2   . DT  B 2 31  ? 61.076  17.775 61.799  1.00 30.81  ? 31  DT  D OP2   1 
ATOM   1374 O "O5'" . DT  B 2 31  ? 62.386  19.899 61.604  1.00 56.41  ? 31  DT  D "O5'" 1 
ATOM   1375 C "C5'" . DT  B 2 31  ? 62.514  21.313 61.481  1.00 50.76  ? 31  DT  D "C5'" 1 
ATOM   1376 C "C4'" . DT  B 2 31  ? 63.825  21.694 60.807  1.00 50.30  ? 31  DT  D "C4'" 1 
ATOM   1377 O "O4'" . DT  B 2 31  ? 64.965  21.337 61.638  1.00 47.75  ? 31  DT  D "O4'" 1 
ATOM   1378 C "C3'" . DT  B 2 31  ? 64.099  21.030 59.467  1.00 48.18  ? 31  DT  D "C3'" 1 
ATOM   1379 O "O3'" . DT  B 2 31  ? 64.783  21.946 58.677  1.00 47.96  ? 31  DT  D "O3'" 1 
ATOM   1380 C "C2'" . DT  B 2 31  ? 65.034  19.888 59.843  1.00 34.28  ? 31  DT  D "C2'" 1 
ATOM   1381 C "C1'" . DT  B 2 31  ? 65.886  20.573 60.894  1.00 28.77  ? 31  DT  D "C1'" 1 
ATOM   1382 N N1    . DT  B 2 31  ? 66.545  19.614 61.805  1.00 27.82  ? 31  DT  D N1    1 
ATOM   1383 C C2    . DT  B 2 31  ? 67.893  19.802 62.051  1.00 26.90  ? 31  DT  D C2    1 
ATOM   1384 O O2    . DT  B 2 31  ? 68.539  20.718 61.574  1.00 26.17  ? 31  DT  D O2    1 
ATOM   1385 N N3    . DT  B 2 31  ? 68.469  18.882 62.883  1.00 24.86  ? 31  DT  D N3    1 
ATOM   1386 C C4    . DT  B 2 31  ? 67.837  17.805 63.473  1.00 28.03  ? 31  DT  D C4    1 
ATOM   1387 O O4    . DT  B 2 31  ? 68.476  17.048 64.209  1.00 27.32  ? 31  DT  D O4    1 
ATOM   1388 C C5    . DT  B 2 31  ? 66.430  17.659 63.156  1.00 24.24  ? 31  DT  D C5    1 
ATOM   1389 C C7    . DT  B 2 31  ? 65.673  16.515 63.753  1.00 21.05  ? 31  DT  D C7    1 
ATOM   1390 C C6    . DT  B 2 31  ? 65.843  18.561 62.355  1.00 25.48  ? 31  DT  D C6    1 
ATOM   1391 P P     . DT  B 2 32  ? 64.424  22.012 57.134  1.00 49.58  ? 32  DT  D P     1 
ATOM   1392 O OP1   . DT  B 2 32  ? 63.752  23.306 56.861  1.00 41.72  ? 32  DT  D OP1   1 
ATOM   1393 O OP2   . DT  B 2 32  ? 63.821  20.722 56.737  1.00 46.82  ? 32  DT  D OP2   1 
ATOM   1394 O "O5'" . DT  B 2 32  ? 65.903  22.087 56.567  1.00 56.68  ? 32  DT  D "O5'" 1 
ATOM   1395 C "C5'" . DT  B 2 32  ? 66.777  23.099 57.022  1.00 55.01  ? 32  DT  D "C5'" 1 
ATOM   1396 C "C4'" . DT  B 2 32  ? 68.172  22.664 56.639  1.00 53.45  ? 32  DT  D "C4'" 1 
ATOM   1397 O "O4'" . DT  B 2 32  ? 68.712  21.830 57.702  1.00 52.26  ? 32  DT  D "O4'" 1 
ATOM   1398 C "C3'" . DT  B 2 32  ? 68.173  21.743 55.430  1.00 52.85  ? 32  DT  D "C3'" 1 
ATOM   1399 O "O3'" . DT  B 2 32  ? 69.422  21.857 54.804  1.00 52.72  ? 32  DT  D "O3'" 1 
ATOM   1400 C "C2'" . DT  B 2 32  ? 68.050  20.378 56.098  1.00 46.26  ? 32  DT  D "C2'" 1 
ATOM   1401 C "C1'" . DT  B 2 32  ? 69.133  20.622 57.119  1.00 40.68  ? 32  DT  D "C1'" 1 
ATOM   1402 N N1    . DT  B 2 32  ? 69.303  19.532 58.110  1.00 40.45  ? 32  DT  D N1    1 
ATOM   1403 C C2    . DT  B 2 32  ? 70.513  19.469 58.780  1.00 40.27  ? 32  DT  D C2    1 
ATOM   1404 O O2    . DT  B 2 32  ? 71.414  20.286 58.629  1.00 40.41  ? 32  DT  D O2    1 
ATOM   1405 N N3    . DT  B 2 32  ? 70.619  18.432 59.667  1.00 33.22  ? 32  DT  D N3    1 
ATOM   1406 C C4    . DT  B 2 32  ? 69.670  17.461 59.898  1.00 34.36  ? 32  DT  D C4    1 
ATOM   1407 O O4    . DT  B 2 32  ? 69.886  16.582 60.710  1.00 33.47  ? 32  DT  D O4    1 
ATOM   1408 C C5    . DT  B 2 32  ? 68.449  17.574 59.159  1.00 35.57  ? 32  DT  D C5    1 
ATOM   1409 C C7    . DT  B 2 32  ? 67.375  16.554 59.391  1.00 33.56  ? 32  DT  D C7    1 
ATOM   1410 C C6    . DT  B 2 32  ? 68.320  18.588 58.293  1.00 37.77  ? 32  DT  D C6    1 
ATOM   1411 P P     . DA  B 2 33  ? 69.418  22.618 53.412  1.00 56.00  ? 33  DA  D P     1 
ATOM   1412 O OP1   . DA  B 2 33  ? 69.069  24.045 53.623  1.00 56.83  ? 33  DA  D OP1   1 
ATOM   1413 O OP2   . DA  B 2 33  ? 68.577  21.801 52.512  1.00 59.82  ? 33  DA  D OP2   1 
ATOM   1414 O "O5'" . DA  B 2 33  ? 70.966  22.498 53.009  1.00 57.18  ? 33  DA  D "O5'" 1 
ATOM   1415 C "C5'" . DA  B 2 33  ? 71.988  23.421 53.430  1.00 48.13  ? 33  DA  D "C5'" 1 
ATOM   1416 C "C4'" . DA  B 2 33  ? 73.224  22.669 53.887  1.00 36.41  ? 33  DA  D "C4'" 1 
ATOM   1417 O "O4'" . DA  B 2 33  ? 72.741  21.616 54.754  1.00 36.33  ? 33  DA  D "O4'" 1 
ATOM   1418 C "C3'" . DA  B 2 33  ? 73.999  21.954 52.781  1.00 37.75  ? 33  DA  D "C3'" 1 
ATOM   1419 O "O3'" . DA  B 2 33  ? 75.379  22.042 52.999  1.00 45.75  ? 33  DA  D "O3'" 1 
ATOM   1420 C "C2'" . DA  B 2 33  ? 73.595  20.492 52.940  1.00 41.67  ? 33  DA  D "C2'" 1 
ATOM   1421 C "C1'" . DA  B 2 33  ? 73.382  20.406 54.435  1.00 36.22  ? 33  DA  D "C1'" 1 
ATOM   1422 N N9    . DA  B 2 33  ? 72.489  19.344 54.848  1.00 40.85  ? 33  DA  D N9    1 
ATOM   1423 C C8    . DA  B 2 33  ? 71.246  19.037 54.385  1.00 42.95  ? 33  DA  D C8    1 
ATOM   1424 N N7    . DA  B 2 33  ? 70.699  18.021 55.017  1.00 45.17  ? 33  DA  D N7    1 
ATOM   1425 C C5    . DA  B 2 33  ? 71.635  17.663 55.970  1.00 43.70  ? 33  DA  D C5    1 
ATOM   1426 C C6    . DA  B 2 33  ? 71.654  16.665 56.963  1.00 44.09  ? 33  DA  D C6    1 
ATOM   1427 N N6    . DA  B 2 33  ? 70.651  15.809 57.142  1.00 42.70  ? 33  DA  D N6    1 
ATOM   1428 N N1    . DA  B 2 33  ? 72.755  16.554 57.745  1.00 43.66  ? 33  DA  D N1    1 
ATOM   1429 C C2    . DA  B 2 33  ? 73.762  17.417 57.532  1.00 43.44  ? 33  DA  D C2    1 
ATOM   1430 N N3    . DA  B 2 33  ? 73.852  18.405 56.635  1.00 43.06  ? 33  DA  D N3    1 
ATOM   1431 C C4    . DA  B 2 33  ? 72.746  18.471 55.877  1.00 42.58  ? 33  DA  D C4    1 
ATOM   1432 P P     . DT  B 2 34  ? 76.355  22.239 51.757  1.00 48.47  ? 34  DT  D P     1 
ATOM   1433 O OP1   . DT  B 2 34  ? 77.727  22.523 52.236  1.00 42.85  ? 34  DT  D OP1   1 
ATOM   1434 O OP2   . DT  B 2 34  ? 75.678  23.181 50.834  1.00 66.70  ? 34  DT  D OP2   1 
ATOM   1435 O "O5'" . DT  B 2 34  ? 76.417  20.799 51.081  1.00 30.96  ? 34  DT  D "O5'" 1 
ATOM   1436 C "C5'" . DT  B 2 34  ? 76.194  19.574 51.733  1.00 58.06  ? 34  DT  D "C5'" 1 
ATOM   1437 C "C4'" . DT  B 2 34  ? 76.808  19.567 53.106  1.00 34.68  ? 34  DT  D "C4'" 1 
ATOM   1438 O "O4'" . DT  B 2 34  ? 75.858  18.942 53.991  1.00 72.07  ? 34  DT  D "O4'" 1 
ATOM   1439 C "C3'" . DT  B 2 34  ? 78.084  18.754 53.273  1.00 26.66  ? 34  DT  D "C3'" 1 
ATOM   1440 O "O3'" . DT  B 2 34  ? 78.809  19.234 54.403  1.00 75.36  ? 34  DT  D "O3'" 1 
ATOM   1441 C "C2'" . DT  B 2 34  ? 77.565  17.349 53.555  1.00 20.41  ? 34  DT  D "C2'" 1 
ATOM   1442 C "C1'" . DT  B 2 34  ? 76.286  17.639 54.317  1.00 36.63  ? 34  DT  D "C1'" 1 
ATOM   1443 N N1    . DT  B 2 34  ? 75.132  16.790 54.028  1.00 39.14  ? 34  DT  D N1    1 
ATOM   1444 C C2    . DT  B 2 34  ? 74.911  15.760 54.906  1.00 41.35  ? 34  DT  D C2    1 
ATOM   1445 O O2    . DT  B 2 34  ? 75.684  15.528 55.822  1.00 41.08  ? 34  DT  D O2    1 
ATOM   1446 N N3    . DT  B 2 34  ? 73.779  15.019 54.662  1.00 42.61  ? 34  DT  D N3    1 
ATOM   1447 C C4    . DT  B 2 34  ? 72.867  15.228 53.645  1.00 44.71  ? 34  DT  D C4    1 
ATOM   1448 O O4    . DT  B 2 34  ? 71.898  14.478 53.566  1.00 44.02  ? 34  DT  D O4    1 
ATOM   1449 C C5    . DT  B 2 34  ? 73.153  16.341 52.767  1.00 42.41  ? 34  DT  D C5    1 
ATOM   1450 C C7    . DT  B 2 34  ? 72.240  16.679 51.630  1.00 42.26  ? 34  DT  D C7    1 
ATOM   1451 C C6    . DT  B 2 34  ? 74.248  17.070 53.004  1.00 41.25  ? 34  DT  D C6    1 
ATOM   1452 N N     . ALA C 3 24  ? 35.989  49.810 103.024 1.00 78.06  ? 18  ALA A N     1 
ATOM   1453 C CA    . ALA C 3 24  ? 35.350  50.966 103.641 1.00 77.96  ? 18  ALA A CA    1 
ATOM   1454 C C     . ALA C 3 24  ? 34.009  50.572 104.237 1.00 79.23  ? 18  ALA A C     1 
ATOM   1455 O O     . ALA C 3 24  ? 33.115  51.400 104.408 1.00 80.91  ? 18  ALA A O     1 
ATOM   1456 C CB    . ALA C 3 24  ? 35.178  52.088 102.632 1.00 79.24  ? 18  ALA A CB    1 
ATOM   1457 N N     . THR C 3 25  ? 33.886  49.287 104.540 1.00 71.47  ? 19  THR A N     1 
ATOM   1458 C CA    . THR C 3 25  ? 32.693  48.732 105.163 1.00 69.63  ? 19  THR A CA    1 
ATOM   1459 C C     . THR C 3 25  ? 33.239  47.816 106.252 1.00 67.66  ? 19  THR A C     1 
ATOM   1460 O O     . THR C 3 25  ? 34.346  47.293 106.126 1.00 68.13  ? 19  THR A O     1 
ATOM   1461 C CB    . THR C 3 25  ? 31.894  47.895 104.166 1.00 78.70  ? 19  THR A CB    1 
ATOM   1462 O OG1   . THR C 3 25  ? 32.722  46.836 103.675 1.00 71.94  ? 19  THR A OG1   1 
ATOM   1463 C CG2   . THR C 3 25  ? 31.459  48.756 103.004 1.00 82.96  ? 19  THR A CG2   1 
ATOM   1464 N N     . SER C 3 26  ? 32.508  47.639 107.338 1.00 56.98  ? 20  SER A N     1 
ATOM   1465 C CA    . SER C 3 26  ? 33.047  46.816 108.392 1.00 53.42  ? 20  SER A CA    1 
ATOM   1466 C C     . SER C 3 26  ? 33.369  45.407 107.949 1.00 53.40  ? 20  SER A C     1 
ATOM   1467 O O     . SER C 3 26  ? 34.208  44.757 108.556 1.00 54.09  ? 20  SER A O     1 
ATOM   1468 C CB    . SER C 3 26  ? 32.154  46.809 109.618 1.00 60.17  ? 20  SER A CB    1 
ATOM   1469 O OG    . SER C 3 26  ? 32.461  45.688 110.429 1.00 82.22  ? 20  SER A OG    1 
ATOM   1470 N N     . ASP C 3 27  ? 32.710  44.926 106.896 1.00 49.52  ? 21  ASP A N     1 
ATOM   1471 C CA    . ASP C 3 27  ? 32.952  43.559 106.401 1.00 49.60  ? 21  ASP A CA    1 
ATOM   1472 C C     . ASP C 3 27  ? 34.262  43.497 105.628 1.00 51.15  ? 21  ASP A C     1 
ATOM   1473 O O     . ASP C 3 27  ? 34.983  42.504 105.687 1.00 50.32  ? 21  ASP A O     1 
ATOM   1474 C CB    . ASP C 3 27  ? 31.814  43.092 105.484 1.00 52.63  ? 21  ASP A CB    1 
ATOM   1475 C CG    . ASP C 3 27  ? 30.651  42.481 106.246 1.00 74.16  ? 21  ASP A CG    1 
ATOM   1476 O OD1   . ASP C 3 27  ? 30.744  41.293 106.620 1.00 77.51  ? 21  ASP A OD1   1 
ATOM   1477 O OD2   . ASP C 3 27  ? 29.628  43.175 106.439 1.00 84.82  ? 21  ASP A OD2   1 
ATOM   1478 N N     . GLU C 3 28  ? 34.544  44.577 104.900 1.00 47.74  ? 22  GLU A N     1 
ATOM   1479 C CA    . GLU C 3 28  ? 35.753  44.725 104.088 1.00 46.34  ? 22  GLU A CA    1 
ATOM   1480 C C     . GLU C 3 28  ? 36.975  44.760 105.002 1.00 45.27  ? 22  GLU A C     1 
ATOM   1481 O O     . GLU C 3 28  ? 37.969  44.063 104.769 1.00 42.33  ? 22  GLU A O     1 
ATOM   1482 C CB    . GLU C 3 28  ? 35.681  46.041 103.300 1.00 48.02  ? 22  GLU A CB    1 
ATOM   1483 C CG    . GLU C 3 28  ? 35.269  45.879 101.839 1.00 69.95  ? 22  GLU A CG    1 
ATOM   1484 C CD    . GLU C 3 28  ? 34.508  47.079 101.289 1.00 92.46  ? 22  GLU A CD    1 
ATOM   1485 O OE1   . GLU C 3 28  ? 33.276  47.156 101.482 1.00 75.14  ? 22  GLU A OE1   1 
ATOM   1486 O OE2   . GLU C 3 28  ? 35.141  47.938 100.641 1.00 91.06  ? 22  GLU A OE2   1 
ATOM   1487 N N     . VAL C 3 29  ? 36.879  45.584 106.044 1.00 38.75  ? 23  VAL A N     1 
ATOM   1488 C CA    . VAL C 3 29  ? 37.946  45.737 107.014 1.00 37.07  ? 23  VAL A CA    1 
ATOM   1489 C C     . VAL C 3 29  ? 38.156  44.408 107.707 1.00 42.27  ? 23  VAL A C     1 
ATOM   1490 O O     . VAL C 3 29  ? 39.288  44.003 107.967 1.00 45.32  ? 23  VAL A O     1 
ATOM   1491 C CB    . VAL C 3 29  ? 37.601  46.792 108.076 1.00 39.04  ? 23  VAL A CB    1 
ATOM   1492 C CG1   . VAL C 3 29  ? 38.546  46.668 109.261 1.00 39.31  ? 23  VAL A CG1   1 
ATOM   1493 C CG2   . VAL C 3 29  ? 37.642  48.193 107.488 1.00 37.44  ? 23  VAL A CG2   1 
ATOM   1494 N N     . ARG C 3 30  ? 37.059  43.731 108.016 1.00 35.57  ? 24  ARG A N     1 
ATOM   1495 C CA    . ARG C 3 30  ? 37.155  42.444 108.686 1.00 33.67  ? 24  ARG A CA    1 
ATOM   1496 C C     . ARG C 3 30  ? 37.946  41.487 107.808 1.00 35.79  ? 24  ARG A C     1 
ATOM   1497 O O     . ARG C 3 30  ? 38.829  40.783 108.287 1.00 37.02  ? 24  ARG A O     1 
ATOM   1498 C CB    . ARG C 3 30  ? 35.767  41.882 109.011 1.00 29.81  ? 24  ARG A CB    1 
ATOM   1499 C CG    . ARG C 3 30  ? 35.784  40.431 109.492 1.00 49.10  ? 24  ARG A CG    1 
ATOM   1500 C CD    . ARG C 3 30  ? 34.454  40.006 110.112 1.00 60.86  ? 24  ARG A CD    1 
ATOM   1501 N NE    . ARG C 3 30  ? 33.896  41.048 110.967 1.00 78.62  ? 24  ARG A NE    1 
ATOM   1502 C CZ    . ARG C 3 30  ? 33.979  41.049 112.295 1.00 87.17  ? 24  ARG A CZ    1 
ATOM   1503 N NH1   . ARG C 3 30  ? 34.593  40.055 112.927 1.00 53.49  ? 24  ARG A NH1   1 
ATOM   1504 N NH2   . ARG C 3 30  ? 33.448  42.045 112.994 1.00 73.60  ? 24  ARG A NH2   1 
ATOM   1505 N N     . LYS C 3 31  ? 37.636  41.476 106.517 1.00 31.20  ? 25  LYS A N     1 
ATOM   1506 C CA    . LYS C 3 31  ? 38.343  40.615 105.572 1.00 30.65  ? 25  LYS A CA    1 
ATOM   1507 C C     . LYS C 3 31  ? 39.844  40.968 105.534 1.00 36.61  ? 25  LYS A C     1 
ATOM   1508 O O     . LYS C 3 31  ? 40.705  40.089 105.590 1.00 33.63  ? 25  LYS A O     1 
ATOM   1509 C CB    . LYS C 3 31  ? 37.724  40.736 104.181 1.00 30.13  ? 25  LYS A CB    1 
ATOM   1510 C CG    . LYS C 3 31  ? 38.556  40.113 103.075 1.00 32.53  ? 25  LYS A CG    1 
ATOM   1511 C CD    . LYS C 3 31  ? 38.510  38.608 103.141 1.00 29.60  ? 25  LYS A CD    1 
ATOM   1512 C CE    . LYS C 3 31  ? 38.818  38.017 101.780 1.00 34.85  ? 25  LYS A CE    1 
ATOM   1513 N NZ    . LYS C 3 31  ? 40.276  38.027 101.484 1.00 44.22  ? 25  LYS A NZ    1 
ATOM   1514 N N     . ASN C 3 32  ? 40.147  42.261 105.462 1.00 34.62  ? 26  ASN A N     1 
ATOM   1515 C CA    . ASN C 3 32  ? 41.526  42.734 105.439 1.00 33.38  ? 26  ASN A CA    1 
ATOM   1516 C C     . ASN C 3 32  ? 42.324  42.303 106.660 1.00 37.46  ? 26  ASN A C     1 
ATOM   1517 O O     . ASN C 3 32  ? 43.456  41.848 106.541 1.00 38.55  ? 26  ASN A O     1 
ATOM   1518 C CB    . ASN C 3 32  ? 41.540  44.241 105.334 1.00 32.30  ? 26  ASN A CB    1 
ATOM   1519 C CG    . ASN C 3 32  ? 41.160  44.708 103.967 1.00 45.64  ? 26  ASN A CG    1 
ATOM   1520 O OD1   . ASN C 3 32  ? 41.586  44.133 102.970 1.00 39.95  ? 26  ASN A OD1   1 
ATOM   1521 N ND2   . ASN C 3 32  ? 40.343  45.739 103.903 1.00 37.56  ? 26  ASN A ND2   1 
ATOM   1522 N N     . LEU C 3 33  ? 41.741  42.462 107.841 1.00 31.59  ? 27  LEU A N     1 
ATOM   1523 C CA    . LEU C 3 33  ? 42.432  42.070 109.050 1.00 28.93  ? 27  LEU A CA    1 
ATOM   1524 C C     . LEU C 3 33  ? 42.612  40.560 109.119 1.00 31.02  ? 27  LEU A C     1 
ATOM   1525 O O     . LEU C 3 33  ? 43.635  40.098 109.592 1.00 34.43  ? 27  LEU A O     1 
ATOM   1526 C CB    . LEU C 3 33  ? 41.816  42.702 110.304 1.00 30.15  ? 27  LEU A CB    1 
ATOM   1527 C CG    . LEU C 3 33  ? 41.834  44.253 110.330 1.00 35.95  ? 27  LEU A CG    1 
ATOM   1528 C CD1   . LEU C 3 33  ? 40.728  44.870 111.194 1.00 34.69  ? 27  LEU A CD1   1 
ATOM   1529 C CD2   . LEU C 3 33  ? 43.197  44.881 110.656 1.00 35.26  ? 27  LEU A CD2   1 
ATOM   1530 N N     . MET C 3 34  ? 41.687  39.781 108.564 1.00 26.87  ? 28  MET A N     1 
ATOM   1531 C CA    . MET C 3 34  ? 41.883  38.322 108.528 1.00 26.00  ? 28  MET A CA    1 
ATOM   1532 C C     . MET C 3 34  ? 43.025  38.010 107.532 1.00 29.69  ? 28  MET A C     1 
ATOM   1533 O O     . MET C 3 34  ? 43.799  37.072 107.732 1.00 27.24  ? 28  MET A O     1 
ATOM   1534 C CB    . MET C 3 34  ? 40.599  37.572 108.135 1.00 28.51  ? 28  MET A CB    1 
ATOM   1535 C CG    . MET C 3 34  ? 39.371  37.900 108.987 1.00 31.76  ? 28  MET A CG    1 
ATOM   1536 S SD    . MET C 3 34  ? 37.869  37.004 108.489 1.00 34.61  ? 28  MET A SD    1 
ATOM   1537 C CE    . MET C 3 34  ? 37.392  36.292 109.980 1.00 32.05  ? 28  MET A CE    1 
ATOM   1538 N N     . ASP C 3 35  ? 43.131  38.822 106.474 1.00 26.37  ? 29  ASP A N     1 
ATOM   1539 C CA    . ASP C 3 35  ? 44.194  38.688 105.477 1.00 25.69  ? 29  ASP A CA    1 
ATOM   1540 C C     . ASP C 3 35  ? 45.521  38.947 106.201 1.00 33.69  ? 29  ASP A C     1 
ATOM   1541 O O     . ASP C 3 35  ? 46.493  38.221 106.017 1.00 34.01  ? 29  ASP A O     1 
ATOM   1542 C CB    . ASP C 3 35  ? 44.039  39.739 104.357 1.00 26.35  ? 29  ASP A CB    1 
ATOM   1543 C CG    . ASP C 3 35  ? 42.958  39.390 103.339 1.00 29.28  ? 29  ASP A CG    1 
ATOM   1544 O OD1   . ASP C 3 35  ? 42.515  38.227 103.277 1.00 31.72  ? 29  ASP A OD1   1 
ATOM   1545 O OD2   . ASP C 3 35  ? 42.565  40.285 102.567 1.00 29.05  ? 29  ASP A OD2   1 
ATOM   1546 N N     . MET C 3 36  ? 45.541  40.000 107.019 1.00 33.96  ? 30  MET A N     1 
ATOM   1547 C CA    . MET C 3 36  ? 46.725  40.398 107.791 1.00 35.38  ? 30  MET A CA    1 
ATOM   1548 C C     . MET C 3 36  ? 47.244  39.262 108.664 1.00 37.73  ? 30  MET A C     1 
ATOM   1549 O O     . MET C 3 36  ? 48.440  38.959 108.670 1.00 38.01  ? 30  MET A O     1 
ATOM   1550 C CB    . MET C 3 36  ? 46.398  41.587 108.694 1.00 39.48  ? 30  MET A CB    1 
ATOM   1551 C CG    . MET C 3 36  ? 46.599  42.937 108.059 1.00 48.03  ? 30  MET A CG    1 
ATOM   1552 S SD    . MET C 3 36  ? 47.385  44.095 109.201 1.00 58.97  ? 30  MET A SD    1 
ATOM   1553 C CE    . MET C 3 36  ? 47.428  43.125 110.722 1.00 56.38  ? 30  MET A CE    1 
ATOM   1554 N N     . PHE C 3 37  ? 46.340  38.649 109.420 1.00 31.65  ? 31  PHE A N     1 
ATOM   1555 C CA    . PHE C 3 37  ? 46.722  37.579 110.311 1.00 31.57  ? 31  PHE A CA    1 
ATOM   1556 C C     . PHE C 3 37  ? 47.141  36.323 109.589 1.00 33.69  ? 31  PHE A C     1 
ATOM   1557 O O     . PHE C 3 37  ? 48.130  35.692 109.965 1.00 33.56  ? 31  PHE A O     1 
ATOM   1558 C CB    . PHE C 3 37  ? 45.627  37.275 111.328 1.00 35.44  ? 31  PHE A CB    1 
ATOM   1559 C CG    . PHE C 3 37  ? 46.095  36.419 112.474 1.00 38.63  ? 31  PHE A CG    1 
ATOM   1560 C CD1   . PHE C 3 37  ? 46.249  35.049 112.313 1.00 42.30  ? 31  PHE A CD1   1 
ATOM   1561 C CD2   . PHE C 3 37  ? 46.426  36.989 113.686 1.00 43.29  ? 31  PHE A CD2   1 
ATOM   1562 C CE1   . PHE C 3 37  ? 46.694  34.256 113.345 1.00 43.96  ? 31  PHE A CE1   1 
ATOM   1563 C CE2   . PHE C 3 37  ? 46.872  36.204 114.730 1.00 47.94  ? 31  PHE A CE2   1 
ATOM   1564 C CZ    . PHE C 3 37  ? 47.017  34.832 114.554 1.00 46.39  ? 31  PHE A CZ    1 
ATOM   1565 N N     . ARG C 3 38  ? 46.397  35.959 108.549 1.00 28.02  ? 32  ARG A N     1 
ATOM   1566 C CA    . ARG C 3 38  ? 46.705  34.750 107.793 1.00 25.17  ? 32  ARG A CA    1 
ATOM   1567 C C     . ARG C 3 38  ? 48.104  34.735 107.188 1.00 29.76  ? 32  ARG A C     1 
ATOM   1568 O O     . ARG C 3 38  ? 48.731  33.683 107.083 1.00 31.84  ? 32  ARG A O     1 
ATOM   1569 C CB    . ARG C 3 38  ? 45.665  34.493 106.712 1.00 16.93  ? 32  ARG A CB    1 
ATOM   1570 C CG    . ARG C 3 38  ? 46.100  33.405 105.764 1.00 5.43   ? 32  ARG A CG    1 
ATOM   1571 C CD    . ARG C 3 38  ? 45.047  33.146 104.744 1.00 17.10  ? 32  ARG A CD    1 
ATOM   1572 N NE    . ARG C 3 38  ? 44.698  34.355 103.995 1.00 15.31  ? 32  ARG A NE    1 
ATOM   1573 C CZ    . ARG C 3 38  ? 43.866  34.335 102.962 1.00 33.42  ? 32  ARG A CZ    1 
ATOM   1574 N NH1   . ARG C 3 38  ? 43.341  33.180 102.590 1.00 23.03  ? 32  ARG A NH1   1 
ATOM   1575 N NH2   . ARG C 3 38  ? 43.565  35.443 102.292 1.00 22.03  ? 32  ARG A NH2   1 
ATOM   1576 N N     . ASP C 3 39  ? 48.577  35.905 106.774 1.00 24.25  ? 33  ASP A N     1 
ATOM   1577 C CA    . ASP C 3 39  ? 49.909  36.053 106.186 1.00 23.51  ? 33  ASP A CA    1 
ATOM   1578 C C     . ASP C 3 39  ? 50.718  37.057 107.025 1.00 32.52  ? 33  ASP A C     1 
ATOM   1579 O O     . ASP C 3 39  ? 51.271  38.017 106.484 1.00 31.78  ? 33  ASP A O     1 
ATOM   1580 C CB    . ASP C 3 39  ? 49.788  36.557 104.739 1.00 23.07  ? 33  ASP A CB    1 
ATOM   1581 C CG    . ASP C 3 39  ? 49.349  35.459 103.771 1.00 30.56  ? 33  ASP A CG    1 
ATOM   1582 O OD1   . ASP C 3 39  ? 49.704  34.279 103.986 1.00 29.07  ? 33  ASP A OD1   1 
ATOM   1583 O OD2   . ASP C 3 39  ? 48.641  35.761 102.792 1.00 29.88  ? 33  ASP A OD2   1 
ATOM   1584 N N     . ARG C 3 40  ? 50.753  36.847 108.344 1.00 30.80  ? 34  ARG A N     1 
ATOM   1585 C CA    . ARG C 3 40  ? 51.472  37.738 109.260 1.00 30.38  ? 34  ARG A CA    1 
ATOM   1586 C C     . ARG C 3 40  ? 52.981  37.589 109.102 1.00 31.86  ? 34  ARG A C     1 
ATOM   1587 O O     . ARG C 3 40  ? 53.750  38.459 109.510 1.00 29.16  ? 34  ARG A O     1 
ATOM   1588 C CB    . ARG C 3 40  ? 51.083  37.438 110.708 1.00 31.01  ? 34  ARG A CB    1 
ATOM   1589 C CG    . ARG C 3 40  ? 50.892  35.957 111.002 1.00 32.10  ? 34  ARG A CG    1 
ATOM   1590 C CD    . ARG C 3 40  ? 50.170  35.772 112.329 1.00 42.85  ? 34  ARG A CD    1 
ATOM   1591 N NE    . ARG C 3 40  ? 50.173  34.383 112.769 1.00 36.57  ? 34  ARG A NE    1 
ATOM   1592 C CZ    . ARG C 3 40  ? 49.367  33.457 112.276 1.00 56.17  ? 34  ARG A CZ    1 
ATOM   1593 N NH1   . ARG C 3 40  ? 48.512  33.775 111.319 1.00 49.24  ? 34  ARG A NH1   1 
ATOM   1594 N NH2   . ARG C 3 40  ? 49.433  32.212 112.715 1.00 59.13  ? 34  ARG A NH2   1 
ATOM   1595 N N     . GLN C 3 41  ? 53.394  36.464 108.516 1.00 28.71  ? 35  GLN A N     1 
ATOM   1596 C CA    . GLN C 3 41  ? 54.812  36.181 108.241 1.00 28.92  ? 35  GLN A CA    1 
ATOM   1597 C C     . GLN C 3 41  ? 55.256  36.944 107.050 1.00 35.13  ? 35  GLN A C     1 
ATOM   1598 O O     . GLN C 3 41  ? 56.223  36.576 106.427 1.00 38.67  ? 35  GLN A O     1 
ATOM   1599 C CB    . GLN C 3 41  ? 54.954  34.729 107.981 1.00 31.38  ? 35  GLN A CB    1 
ATOM   1600 C CG    . GLN C 3 41  ? 54.484  33.908 109.008 1.00 67.02  ? 35  GLN A CG    1 
ATOM   1601 C CD    . GLN C 3 41  ? 55.085  32.526 109.034 1.00 91.06  ? 35  GLN A CD    1 
ATOM   1602 O OE1   . GLN C 3 41  ? 56.216  32.345 108.555 1.00 78.17  ? 35  GLN A OE1   1 
ATOM   1603 N NE2   . GLN C 3 41  ? 54.204  31.557 109.231 1.00 100.00 ? 35  GLN A NE2   1 
ATOM   1604 N N     . ALA C 3 42  ? 54.511  37.971 106.669 1.00 32.20  ? 36  ALA A N     1 
ATOM   1605 C CA    . ALA C 3 42  ? 54.885  38.787 105.533 1.00 31.52  ? 36  ALA A CA    1 
ATOM   1606 C C     . ALA C 3 42  ? 55.752  39.875 106.184 1.00 36.31  ? 36  ALA A C     1 
ATOM   1607 O O     . ALA C 3 42  ? 56.366  40.690 105.508 1.00 37.15  ? 36  ALA A O     1 
ATOM   1608 C CB    . ALA C 3 42  ? 53.619  39.392 104.902 1.00 31.26  ? 36  ALA A CB    1 
ATOM   1609 N N     . PHE C 3 43  ? 55.814  39.867 107.513 1.00 34.12  ? 37  PHE A N     1 
ATOM   1610 C CA    . PHE C 3 43  ? 56.598  40.857 108.242 1.00 34.23  ? 37  PHE A CA    1 
ATOM   1611 C C     . PHE C 3 43  ? 57.426  40.212 109.329 1.00 40.99  ? 37  PHE A C     1 
ATOM   1612 O O     . PHE C 3 43  ? 57.113  39.119 109.790 1.00 40.80  ? 37  PHE A O     1 
ATOM   1613 C CB    . PHE C 3 43  ? 55.683  41.923 108.819 1.00 36.60  ? 37  PHE A CB    1 
ATOM   1614 C CG    . PHE C 3 43  ? 54.839  42.603 107.780 1.00 41.48  ? 37  PHE A CG    1 
ATOM   1615 C CD1   . PHE C 3 43  ? 55.374  43.587 106.972 1.00 46.03  ? 37  PHE A CD1   1 
ATOM   1616 C CD2   . PHE C 3 43  ? 53.511  42.231 107.579 1.00 45.22  ? 37  PHE A CD2   1 
ATOM   1617 C CE1   . PHE C 3 43  ? 54.595  44.201 106.008 1.00 47.70  ? 37  PHE A CE1   1 
ATOM   1618 C CE2   . PHE C 3 43  ? 52.734  42.845 106.608 1.00 46.25  ? 37  PHE A CE2   1 
ATOM   1619 C CZ    . PHE C 3 43  ? 53.274  43.827 105.829 1.00 44.51  ? 37  PHE A CZ    1 
ATOM   1620 N N     . SER C 3 44  ? 58.512  40.870 109.712 1.00 39.89  ? 38  SER A N     1 
ATOM   1621 C CA    . SER C 3 44  ? 59.368  40.339 110.759 1.00 38.63  ? 38  SER A CA    1 
ATOM   1622 C C     . SER C 3 44  ? 58.608  40.474 112.071 1.00 38.15  ? 38  SER A C     1 
ATOM   1623 O O     . SER C 3 44  ? 57.735  41.332 112.206 1.00 35.62  ? 38  SER A O     1 
ATOM   1624 C CB    . SER C 3 44  ? 60.672  41.144 110.826 1.00 42.63  ? 38  SER A CB    1 
ATOM   1625 O OG    . SER C 3 44  ? 60.424  42.462 111.271 1.00 53.12  ? 38  SER A OG    1 
ATOM   1626 N N     . GLU C 3 45  ? 58.936  39.636 113.044 1.00 35.23  ? 39  GLU A N     1 
ATOM   1627 C CA    . GLU C 3 45  ? 58.297  39.737 114.342 1.00 36.52  ? 39  GLU A CA    1 
ATOM   1628 C C     . GLU C 3 45  ? 58.619  41.100 114.988 1.00 42.51  ? 39  GLU A C     1 
ATOM   1629 O O     . GLU C 3 45  ? 57.839  41.604 115.800 1.00 42.53  ? 39  GLU A O     1 
ATOM   1630 C CB    . GLU C 3 45  ? 58.733  38.586 115.240 1.00 39.16  ? 39  GLU A CB    1 
ATOM   1631 C CG    . GLU C 3 45  ? 60.228  38.321 115.220 1.00 63.78  ? 39  GLU A CG    1 
ATOM   1632 C CD    . GLU C 3 45  ? 60.667  37.350 116.307 1.00 100.00 ? 39  GLU A CD    1 
ATOM   1633 O OE1   . GLU C 3 45  ? 60.401  36.133 116.168 1.00 100.00 ? 39  GLU A OE1   1 
ATOM   1634 O OE2   . GLU C 3 45  ? 61.292  37.810 117.292 1.00 100.00 ? 39  GLU A OE2   1 
ATOM   1635 N N     . HIS C 3 46  ? 59.739  41.713 114.594 1.00 39.43  ? 40  HIS A N     1 
ATOM   1636 C CA    . HIS C 3 46  ? 60.131  43.032 115.104 1.00 39.13  ? 40  HIS A CA    1 
ATOM   1637 C C     . HIS C 3 46  ? 59.155  44.081 114.647 1.00 37.44  ? 40  HIS A C     1 
ATOM   1638 O O     . HIS C 3 46  ? 58.853  45.028 115.369 1.00 36.61  ? 40  HIS A O     1 
ATOM   1639 C CB    . HIS C 3 46  ? 61.527  43.436 114.585 1.00 42.65  ? 40  HIS A CB    1 
ATOM   1640 C CG    . HIS C 3 46  ? 62.648  42.814 115.348 1.00 47.76  ? 40  HIS A CG    1 
ATOM   1641 N ND1   . HIS C 3 46  ? 62.753  42.919 116.717 1.00 50.52  ? 40  HIS A ND1   1 
ATOM   1642 C CD2   . HIS C 3 46  ? 63.659  42.009 114.946 1.00 50.26  ? 40  HIS A CD2   1 
ATOM   1643 C CE1   . HIS C 3 46  ? 63.799  42.225 117.123 1.00 51.23  ? 40  HIS A CE1   1 
ATOM   1644 N NE2   . HIS C 3 46  ? 64.366  41.662 116.069 1.00 51.15  ? 40  HIS A NE2   1 
ATOM   1645 N N     . THR C 3 47  ? 58.705  43.932 113.410 1.00 34.11  ? 41  THR A N     1 
ATOM   1646 C CA    . THR C 3 47  ? 57.764  44.873 112.826 1.00 34.48  ? 41  THR A CA    1 
ATOM   1647 C C     . THR C 3 47  ? 56.463  44.779 113.587 1.00 36.77  ? 41  THR A C     1 
ATOM   1648 O O     . THR C 3 47  ? 55.881  45.790 113.995 1.00 35.86  ? 41  THR A O     1 
ATOM   1649 C CB    . THR C 3 47  ? 57.479  44.521 111.369 1.00 45.94  ? 41  THR A CB    1 
ATOM   1650 O OG1   . THR C 3 47  ? 58.716  44.430 110.657 1.00 44.52  ? 41  THR A OG1   1 
ATOM   1651 C CG2   . THR C 3 47  ? 56.591  45.585 110.733 1.00 44.51  ? 41  THR A CG2   1 
ATOM   1652 N N     . TRP C 3 48  ? 56.019  43.540 113.763 1.00 31.72  ? 42  TRP A N     1 
ATOM   1653 C CA    . TRP C 3 48  ? 54.806  43.256 114.497 1.00 32.64  ? 42  TRP A CA    1 
ATOM   1654 C C     . TRP C 3 48  ? 54.907  43.837 115.901 1.00 33.23  ? 42  TRP A C     1 
ATOM   1655 O O     . TRP C 3 48  ? 53.982  44.512 116.356 1.00 29.89  ? 42  TRP A O     1 
ATOM   1656 C CB    . TRP C 3 48  ? 54.542  41.752 114.511 1.00 33.22  ? 42  TRP A CB    1 
ATOM   1657 C CG    . TRP C 3 48  ? 53.881  41.289 113.263 1.00 35.76  ? 42  TRP A CG    1 
ATOM   1658 C CD1   . TRP C 3 48  ? 54.414  40.492 112.295 1.00 39.39  ? 42  TRP A CD1   1 
ATOM   1659 C CD2   . TRP C 3 48  ? 52.566  41.629 112.823 1.00 36.97  ? 42  TRP A CD2   1 
ATOM   1660 N NE1   . TRP C 3 48  ? 53.501  40.294 111.289 1.00 40.01  ? 42  TRP A NE1   1 
ATOM   1661 C CE2   . TRP C 3 48  ? 52.355  40.980 111.594 1.00 42.50  ? 42  TRP A CE2   1 
ATOM   1662 C CE3   . TRP C 3 48  ? 51.526  42.383 113.373 1.00 39.28  ? 42  TRP A CE3   1 
ATOM   1663 C CZ2   . TRP C 3 48  ? 51.147  41.068 110.905 1.00 42.71  ? 42  TRP A CZ2   1 
ATOM   1664 C CZ3   . TRP C 3 48  ? 50.341  42.491 112.673 1.00 40.92  ? 42  TRP A CZ3   1 
ATOM   1665 C CH2   . TRP C 3 48  ? 50.157  41.830 111.462 1.00 41.69  ? 42  TRP A CH2   1 
ATOM   1666 N N     . LYS C 3 49  ? 56.058  43.634 116.550 1.00 32.04  ? 43  LYS A N     1 
ATOM   1667 C CA    . LYS C 3 49  ? 56.304  44.195 117.883 1.00 31.55  ? 43  LYS A CA    1 
ATOM   1668 C C     . LYS C 3 49  ? 56.023  45.690 117.899 1.00 35.88  ? 43  LYS A C     1 
ATOM   1669 O O     . LYS C 3 49  ? 55.312  46.187 118.777 1.00 38.48  ? 43  LYS A O     1 
ATOM   1670 C CB    . LYS C 3 49  ? 57.745  43.967 118.332 1.00 33.45  ? 43  LYS A CB    1 
ATOM   1671 C CG    . LYS C 3 49  ? 58.097  42.517 118.588 1.00 57.45  ? 43  LYS A CG    1 
ATOM   1672 C CD    . LYS C 3 49  ? 57.398  41.975 119.813 1.00 69.27  ? 43  LYS A CD    1 
ATOM   1673 C CE    . LYS C 3 49  ? 56.246  41.063 119.420 1.00 76.01  ? 43  LYS A CE    1 
ATOM   1674 N NZ    . LYS C 3 49  ? 55.649  40.369 120.597 1.00 84.52  ? 43  LYS A NZ    1 
ATOM   1675 N N     . MET C 3 50  ? 56.588  46.424 116.949 1.00 29.66  ? 44  MET A N     1 
ATOM   1676 C CA    . MET C 3 50  ? 56.357  47.861 116.937 1.00 29.16  ? 44  MET A CA    1 
ATOM   1677 C C     . MET C 3 50  ? 54.925  48.260 116.591 1.00 31.82  ? 44  MET A C     1 
ATOM   1678 O O     . MET C 3 50  ? 54.401  49.236 117.133 1.00 29.09  ? 44  MET A O     1 
ATOM   1679 C CB    . MET C 3 50  ? 57.415  48.613 116.131 1.00 31.10  ? 44  MET A CB    1 
ATOM   1680 C CG    . MET C 3 50  ? 58.820  48.561 116.765 1.00 34.08  ? 44  MET A CG    1 
ATOM   1681 S SD    . MET C 3 50  ? 58.933  49.200 118.466 1.00 36.89  ? 44  MET A SD    1 
ATOM   1682 C CE    . MET C 3 50  ? 58.436  50.863 118.202 1.00 32.88  ? 44  MET A CE    1 
ATOM   1683 N N     . LEU C 3 51  ? 54.274  47.481 115.728 1.00 30.75  ? 45  LEU A N     1 
ATOM   1684 C CA    . LEU C 3 51  ? 52.885  47.759 115.373 1.00 31.18  ? 45  LEU A CA    1 
ATOM   1685 C C     . LEU C 3 51  ? 52.015  47.692 116.617 1.00 35.00  ? 45  LEU A C     1 
ATOM   1686 O O     . LEU C 3 51  ? 51.287  48.644 116.923 1.00 34.15  ? 45  LEU A O     1 
ATOM   1687 C CB    . LEU C 3 51  ? 52.344  46.806 114.297 1.00 31.10  ? 45  LEU A CB    1 
ATOM   1688 C CG    . LEU C 3 51  ? 50.879  47.098 113.906 1.00 33.45  ? 45  LEU A CG    1 
ATOM   1689 C CD1   . LEU C 3 51  ? 50.728  48.397 113.130 1.00 32.31  ? 45  LEU A CD1   1 
ATOM   1690 C CD2   . LEU C 3 51  ? 50.241  45.955 113.144 1.00 33.88  ? 45  LEU A CD2   1 
ATOM   1691 N N     . LEU C 3 52  ? 52.104  46.580 117.343 1.00 30.57  ? 46  LEU A N     1 
ATOM   1692 C CA    . LEU C 3 52  ? 51.345  46.440 118.580 1.00 31.87  ? 46  LEU A CA    1 
ATOM   1693 C C     . LEU C 3 52  ? 51.731  47.565 119.539 1.00 39.63  ? 46  LEU A C     1 
ATOM   1694 O O     . LEU C 3 52  ? 50.872  48.208 120.151 1.00 39.88  ? 46  LEU A O     1 
ATOM   1695 C CB    . LEU C 3 52  ? 51.645  45.104 119.246 1.00 32.79  ? 46  LEU A CB    1 
ATOM   1696 C CG    . LEU C 3 52  ? 50.729  43.933 118.914 1.00 40.47  ? 46  LEU A CG    1 
ATOM   1697 C CD1   . LEU C 3 52  ? 50.005  44.188 117.603 1.00 42.47  ? 46  LEU A CD1   1 
ATOM   1698 C CD2   . LEU C 3 52  ? 51.558  42.668 118.809 1.00 44.41  ? 46  LEU A CD2   1 
ATOM   1699 N N     . SER C 3 53  ? 53.034  47.797 119.672 1.00 37.47  ? 47  SER A N     1 
ATOM   1700 C CA    . SER C 3 53  ? 53.521  48.831 120.571 1.00 36.95  ? 47  SER A CA    1 
ATOM   1701 C C     . SER C 3 53  ? 52.819  50.161 120.339 1.00 37.14  ? 47  SER A C     1 
ATOM   1702 O O     . SER C 3 53  ? 52.268  50.754 121.266 1.00 38.63  ? 47  SER A O     1 
ATOM   1703 C CB    . SER C 3 53  ? 55.038  48.985 120.466 1.00 42.80  ? 47  SER A CB    1 
ATOM   1704 O OG    . SER C 3 53  ? 55.548  49.663 121.601 1.00 51.70  ? 47  SER A OG    1 
ATOM   1705 N N     . VAL C 3 54  ? 52.842  50.629 119.096 1.00 30.93  ? 48  VAL A N     1 
ATOM   1706 C CA    . VAL C 3 54  ? 52.210  51.904 118.740 1.00 30.00  ? 48  VAL A CA    1 
ATOM   1707 C C     . VAL C 3 54  ? 50.713  51.930 118.994 1.00 34.78  ? 48  VAL A C     1 
ATOM   1708 O O     . VAL C 3 54  ? 50.173  52.937 119.456 1.00 31.29  ? 48  VAL A O     1 
ATOM   1709 C CB    . VAL C 3 54  ? 52.432  52.257 117.267 1.00 30.63  ? 48  VAL A CB    1 
ATOM   1710 C CG1   . VAL C 3 54  ? 51.737  53.554 116.935 1.00 28.26  ? 48  VAL A CG1   1 
ATOM   1711 C CG2   . VAL C 3 54  ? 53.916  52.331 116.955 1.00 30.55  ? 48  VAL A CG2   1 
ATOM   1712 N N     . CYS C 3 55  ? 50.050  50.823 118.658 1.00 33.47  ? 49  CYS A N     1 
ATOM   1713 C CA    . CYS C 3 55  ? 48.600  50.695 118.810 1.00 33.39  ? 49  CYS A CA    1 
ATOM   1714 C C     . CYS C 3 55  ? 48.195  50.786 120.269 1.00 36.10  ? 49  CYS A C     1 
ATOM   1715 O O     . CYS C 3 55  ? 47.181  51.394 120.609 1.00 34.13  ? 49  CYS A O     1 
ATOM   1716 C CB    . CYS C 3 55  ? 48.106  49.386 118.189 1.00 32.96  ? 49  CYS A CB    1 
ATOM   1717 S SG    . CYS C 3 55  ? 48.151  49.365 116.375 1.00 36.04  ? 49  CYS A SG    1 
ATOM   1718 N N     . ARG C 3 56  ? 49.006  50.193 121.132 1.00 33.76  ? 50  ARG A N     1 
ATOM   1719 C CA    . ARG C 3 56  ? 48.734  50.261 122.552 1.00 36.32  ? 50  ARG A CA    1 
ATOM   1720 C C     . ARG C 3 56  ? 48.913  51.701 123.025 1.00 44.51  ? 50  ARG A C     1 
ATOM   1721 O O     . ARG C 3 56  ? 48.144  52.189 123.853 1.00 49.12  ? 50  ARG A O     1 
ATOM   1722 C CB    . ARG C 3 56  ? 49.661  49.325 123.330 1.00 37.93  ? 50  ARG A CB    1 
ATOM   1723 C CG    . ARG C 3 56  ? 49.255  47.852 123.272 1.00 44.17  ? 50  ARG A CG    1 
ATOM   1724 C CD    . ARG C 3 56  ? 50.081  46.998 124.241 1.00 45.76  ? 50  ARG A CD    1 
ATOM   1725 N NE    . ARG C 3 56  ? 51.516  47.176 124.041 1.00 33.21  ? 50  ARG A NE    1 
ATOM   1726 C CZ    . ARG C 3 56  ? 52.311  46.278 123.481 1.00 49.63  ? 50  ARG A CZ    1 
ATOM   1727 N NH1   . ARG C 3 56  ? 51.816  45.120 123.070 1.00 60.73  ? 50  ARG A NH1   1 
ATOM   1728 N NH2   . ARG C 3 56  ? 53.602  46.546 123.334 1.00 40.23  ? 50  ARG A NH2   1 
ATOM   1729 N N     . SER C 3 57  ? 49.924  52.376 122.488 1.00 38.79  ? 51  SER A N     1 
ATOM   1730 C CA    . SER C 3 57  ? 50.210  53.758 122.858 1.00 37.14  ? 51  SER A CA    1 
ATOM   1731 C C     . SER C 3 57  ? 49.107  54.691 122.367 1.00 39.26  ? 51  SER A C     1 
ATOM   1732 O O     . SER C 3 57  ? 48.568  55.503 123.120 1.00 39.34  ? 51  SER A O     1 
ATOM   1733 C CB    . SER C 3 57  ? 51.566  54.178 122.283 1.00 41.99  ? 51  SER A CB    1 
ATOM   1734 O OG    . SER C 3 57  ? 51.614  55.568 122.011 1.00 61.40  ? 51  SER A OG    1 
ATOM   1735 N N     . TRP C 3 58  ? 48.764  54.547 121.097 1.00 35.31  ? 52  TRP A N     1 
ATOM   1736 C CA    . TRP C 3 58  ? 47.739  55.364 120.472 1.00 34.02  ? 52  TRP A CA    1 
ATOM   1737 C C     . TRP C 3 58  ? 46.385  55.127 121.122 1.00 36.64  ? 52  TRP A C     1 
ATOM   1738 O O     . TRP C 3 58  ? 45.656  56.078 121.399 1.00 37.22  ? 52  TRP A O     1 
ATOM   1739 C CB    . TRP C 3 58  ? 47.715  55.095 118.950 1.00 32.23  ? 52  TRP A CB    1 
ATOM   1740 C CG    . TRP C 3 58  ? 46.427  55.384 118.249 1.00 31.79  ? 52  TRP A CG    1 
ATOM   1741 C CD1   . TRP C 3 58  ? 45.564  54.470 117.708 1.00 33.99  ? 52  TRP A CD1   1 
ATOM   1742 C CD2   . TRP C 3 58  ? 45.882  56.672 117.956 1.00 31.79  ? 52  TRP A CD2   1 
ATOM   1743 N NE1   . TRP C 3 58  ? 44.498  55.110 117.132 1.00 33.61  ? 52  TRP A NE1   1 
ATOM   1744 C CE2   . TRP C 3 58  ? 44.664  56.463 117.273 1.00 36.02  ? 52  TRP A CE2   1 
ATOM   1745 C CE3   . TRP C 3 58  ? 46.297  57.983 118.214 1.00 33.02  ? 52  TRP A CE3   1 
ATOM   1746 C CZ2   . TRP C 3 58  ? 43.857  57.519 116.843 1.00 35.19  ? 52  TRP A CZ2   1 
ATOM   1747 C CZ3   . TRP C 3 58  ? 45.498  59.025 117.795 1.00 35.07  ? 52  TRP A CZ3   1 
ATOM   1748 C CH2   . TRP C 3 58  ? 44.286  58.787 117.117 1.00 35.97  ? 52  TRP A CH2   1 
ATOM   1749 N N     . ALA C 3 59  ? 46.065  53.862 121.389 1.00 33.17  ? 53  ALA A N     1 
ATOM   1750 C CA    . ALA C 3 59  ? 44.773  53.484 121.983 1.00 34.05  ? 53  ALA A CA    1 
ATOM   1751 C C     . ALA C 3 59  ? 44.543  54.039 123.394 1.00 40.29  ? 53  ALA A C     1 
ATOM   1752 O O     . ALA C 3 59  ? 43.460  54.542 123.734 1.00 36.46  ? 53  ALA A O     1 
ATOM   1753 C CB    . ALA C 3 59  ? 44.605  51.980 121.968 1.00 34.29  ? 53  ALA A CB    1 
ATOM   1754 N N     . ALA C 3 60  ? 45.571  53.926 124.221 1.00 38.96  ? 54  ALA A N     1 
ATOM   1755 C CA    . ALA C 3 60  ? 45.509  54.438 125.570 1.00 37.48  ? 54  ALA A CA    1 
ATOM   1756 C C     . ALA C 3 60  ? 45.194  55.917 125.442 1.00 43.13  ? 54  ALA A C     1 
ATOM   1757 O O     . ALA C 3 60  ? 44.185  56.390 125.973 1.00 45.90  ? 54  ALA A O     1 
ATOM   1758 C CB    . ALA C 3 60  ? 46.842  54.242 126.254 1.00 37.90  ? 54  ALA A CB    1 
ATOM   1759 N N     . TRP C 3 61  ? 46.031  56.634 124.689 1.00 37.79  ? 55  TRP A N     1 
ATOM   1760 C CA    . TRP C 3 61  ? 45.847  58.074 124.480 1.00 36.94  ? 55  TRP A CA    1 
ATOM   1761 C C     . TRP C 3 61  ? 44.441  58.447 124.047 1.00 40.93  ? 55  TRP A C     1 
ATOM   1762 O O     . TRP C 3 61  ? 43.881  59.459 124.474 1.00 39.34  ? 55  TRP A O     1 
ATOM   1763 C CB    . TRP C 3 61  ? 46.807  58.603 123.429 1.00 35.75  ? 55  TRP A CB    1 
ATOM   1764 C CG    . TRP C 3 61  ? 46.657  60.088 123.256 1.00 37.21  ? 55  TRP A CG    1 
ATOM   1765 C CD1   . TRP C 3 61  ? 47.254  61.048 124.007 1.00 40.05  ? 55  TRP A CD1   1 
ATOM   1766 C CD2   . TRP C 3 61  ? 45.794  60.780 122.330 1.00 36.58  ? 55  TRP A CD2   1 
ATOM   1767 N NE1   . TRP C 3 61  ? 46.863  62.290 123.579 1.00 39.27  ? 55  TRP A NE1   1 
ATOM   1768 C CE2   . TRP C 3 61  ? 45.963  62.155 122.557 1.00 39.29  ? 55  TRP A CE2   1 
ATOM   1769 C CE3   . TRP C 3 61  ? 44.967  60.373 121.282 1.00 38.07  ? 55  TRP A CE3   1 
ATOM   1770 C CZ2   . TRP C 3 61  ? 45.312  63.127 121.799 1.00 37.77  ? 55  TRP A CZ2   1 
ATOM   1771 C CZ3   . TRP C 3 61  ? 44.314  61.342 120.536 1.00 38.88  ? 55  TRP A CZ3   1 
ATOM   1772 C CH2   . TRP C 3 61  ? 44.478  62.701 120.812 1.00 38.94  ? 55  TRP A CH2   1 
ATOM   1773 N N     . CYS C 3 62  ? 43.910  57.656 123.127 1.00 39.26  ? 56  CYS A N     1 
ATOM   1774 C CA    . CYS C 3 62  ? 42.584  57.894 122.598 1.00 38.39  ? 56  CYS A CA    1 
ATOM   1775 C C     . CYS C 3 62  ? 41.597  57.777 123.744 1.00 44.41  ? 56  CYS A C     1 
ATOM   1776 O O     . CYS C 3 62  ? 40.766  58.668 123.943 1.00 44.42  ? 56  CYS A O     1 
ATOM   1777 C CB    . CYS C 3 62  ? 42.274  56.878 121.503 1.00 37.16  ? 56  CYS A CB    1 
ATOM   1778 S SG    . CYS C 3 62  ? 42.893  57.364 119.863 1.00 40.34  ? 56  CYS A SG    1 
ATOM   1779 N N     . LYS C 3 63  ? 41.719  56.685 124.505 1.00 40.58  ? 57  LYS A N     1 
ATOM   1780 C CA    . LYS C 3 63  ? 40.857  56.420 125.659 1.00 41.16  ? 57  LYS A CA    1 
ATOM   1781 C C     . LYS C 3 63  ? 40.903  57.618 126.581 1.00 50.20  ? 57  LYS A C     1 
ATOM   1782 O O     . LYS C 3 63  ? 39.881  58.254 126.877 1.00 47.53  ? 57  LYS A O     1 
ATOM   1783 C CB    . LYS C 3 63  ? 41.375  55.208 126.429 1.00 43.01  ? 57  LYS A CB    1 
ATOM   1784 C CG    . LYS C 3 63  ? 40.305  54.459 127.202 1.00 60.60  ? 57  LYS A CG    1 
ATOM   1785 C CD    . LYS C 3 63  ? 40.861  53.895 128.498 1.00 66.11  ? 57  LYS A CD    1 
ATOM   1786 C CE    . LYS C 3 63  ? 39.786  53.188 129.302 1.00 72.40  ? 57  LYS A CE    1 
ATOM   1787 N NZ    . LYS C 3 63  ? 40.341  51.993 129.995 1.00 80.21  ? 57  LYS A NZ    1 
ATOM   1788 N N     . LEU C 3 64  ? 42.117  57.917 127.031 1.00 49.63  ? 58  LEU A N     1 
ATOM   1789 C CA    . LEU C 3 64  ? 42.362  59.054 127.897 1.00 49.90  ? 58  LEU A CA    1 
ATOM   1790 C C     . LEU C 3 64  ? 41.721  60.312 127.319 1.00 58.23  ? 58  LEU A C     1 
ATOM   1791 O O     . LEU C 3 64  ? 40.881  60.946 127.964 1.00 58.73  ? 58  LEU A O     1 
ATOM   1792 C CB    . LEU C 3 64  ? 43.867  59.278 128.026 1.00 49.68  ? 58  LEU A CB    1 
ATOM   1793 C CG    . LEU C 3 64  ? 44.333  60.365 128.994 1.00 54.33  ? 58  LEU A CG    1 
ATOM   1794 C CD1   . LEU C 3 64  ? 43.817  60.098 130.406 1.00 53.83  ? 58  LEU A CD1   1 
ATOM   1795 C CD2   . LEU C 3 64  ? 45.857  60.488 128.974 1.00 56.38  ? 58  LEU A CD2   1 
ATOM   1796 N N     . ASN C 3 65  ? 42.132  60.675 126.106 1.00 56.56  ? 59  ASN A N     1 
ATOM   1797 C CA    . ASN C 3 65  ? 41.644  61.892 125.480 1.00 55.44  ? 59  ASN A CA    1 
ATOM   1798 C C     . ASN C 3 65  ? 40.290  61.821 124.787 1.00 57.48  ? 59  ASN A C     1 
ATOM   1799 O O     . ASN C 3 65  ? 39.988  62.630 123.911 1.00 59.34  ? 59  ASN A O     1 
ATOM   1800 C CB    . ASN C 3 65  ? 42.729  62.549 124.636 1.00 54.24  ? 59  ASN A CB    1 
ATOM   1801 C CG    . ASN C 3 65  ? 43.820  63.177 125.486 1.00 84.16  ? 59  ASN A CG    1 
ATOM   1802 O OD1   . ASN C 3 65  ? 44.090  64.375 125.385 1.00 85.80  ? 59  ASN A OD1   1 
ATOM   1803 N ND2   . ASN C 3 65  ? 44.460  62.365 126.319 1.00 77.75  ? 59  ASN A ND2   1 
ATOM   1804 N N     . ASN C 3 66  ? 39.468  60.877 125.241 1.00 50.90  ? 60  ASN A N     1 
ATOM   1805 C CA    . ASN C 3 66  ? 38.109  60.662 124.745 1.00 50.21  ? 60  ASN A CA    1 
ATOM   1806 C C     . ASN C 3 66  ? 37.900  60.653 123.221 1.00 54.35  ? 60  ASN A C     1 
ATOM   1807 O O     . ASN C 3 66  ? 37.081  61.421 122.708 1.00 55.49  ? 60  ASN A O     1 
ATOM   1808 C CB    . ASN C 3 66  ? 37.108  61.593 125.453 1.00 49.61  ? 60  ASN A CB    1 
ATOM   1809 C CG    . ASN C 3 66  ? 37.269  61.586 126.981 1.00 78.51  ? 60  ASN A CG    1 
ATOM   1810 O OD1   . ASN C 3 66  ? 36.632  60.796 127.683 1.00 81.34  ? 60  ASN A OD1   1 
ATOM   1811 N ND2   . ASN C 3 66  ? 38.136  62.459 127.492 1.00 59.96  ? 60  ASN A ND2   1 
ATOM   1812 N N     . ARG C 3 67  ? 38.621  59.774 122.511 1.00 47.99  ? 61  ARG A N     1 
ATOM   1813 C CA    . ARG C 3 67  ? 38.501  59.642 121.044 1.00 46.02  ? 61  ARG A CA    1 
ATOM   1814 C C     . ARG C 3 67  ? 38.432  58.190 120.574 1.00 47.62  ? 61  ARG A C     1 
ATOM   1815 O O     . ARG C 3 67  ? 38.609  57.270 121.372 1.00 47.68  ? 61  ARG A O     1 
ATOM   1816 C CB    . ARG C 3 67  ? 39.660  60.309 120.303 1.00 41.05  ? 61  ARG A CB    1 
ATOM   1817 C CG    . ARG C 3 67  ? 40.386  61.354 121.071 1.00 38.56  ? 61  ARG A CG    1 
ATOM   1818 C CD    . ARG C 3 67  ? 39.828  62.717 120.771 1.00 36.02  ? 61  ARG A CD    1 
ATOM   1819 N NE    . ARG C 3 67  ? 40.570  63.744 121.496 1.00 46.20  ? 61  ARG A NE    1 
ATOM   1820 C CZ    . ARG C 3 67  ? 41.349  64.655 120.925 1.00 61.50  ? 61  ARG A CZ    1 
ATOM   1821 N NH1   . ARG C 3 67  ? 41.503  64.690 119.613 1.00 41.70  ? 61  ARG A NH1   1 
ATOM   1822 N NH2   . ARG C 3 67  ? 41.986  65.537 121.672 1.00 74.84  ? 61  ARG A NH2   1 
ATOM   1823 N N     . LYS C 3 68  ? 38.199  58.008 119.271 1.00 42.19  ? 62  LYS A N     1 
ATOM   1824 C CA    . LYS C 3 68  ? 38.101  56.698 118.629 1.00 41.20  ? 62  LYS A CA    1 
ATOM   1825 C C     . LYS C 3 68  ? 39.467  56.318 118.066 1.00 44.76  ? 62  LYS A C     1 
ATOM   1826 O O     . LYS C 3 68  ? 40.103  57.104 117.373 1.00 46.94  ? 62  LYS A O     1 
ATOM   1827 C CB    . LYS C 3 68  ? 37.077  56.756 117.495 1.00 41.87  ? 62  LYS A CB    1 
ATOM   1828 C CG    . LYS C 3 68  ? 36.248  55.508 117.357 1.00 66.27  ? 62  LYS A CG    1 
ATOM   1829 C CD    . LYS C 3 68  ? 35.599  55.434 115.990 1.00 80.93  ? 62  LYS A CD    1 
ATOM   1830 C CE    . LYS C 3 68  ? 35.298  56.820 115.468 1.00 92.80  ? 62  LYS A CE    1 
ATOM   1831 N NZ    . LYS C 3 68  ? 35.222  56.824 113.984 1.00 100.00 ? 62  LYS A NZ    1 
ATOM   1832 N N     . TRP C 3 69  ? 39.925  55.117 118.379 1.00 40.89  ? 63  TRP A N     1 
ATOM   1833 C CA    . TRP C 3 69  ? 41.236  54.686 117.914 1.00 42.81  ? 63  TRP A CA    1 
ATOM   1834 C C     . TRP C 3 69  ? 41.290  53.975 116.559 1.00 48.13  ? 63  TRP A C     1 
ATOM   1835 O O     . TRP C 3 69  ? 42.366  53.834 115.968 1.00 48.13  ? 63  TRP A O     1 
ATOM   1836 C CB    . TRP C 3 69  ? 41.969  53.889 119.002 1.00 42.50  ? 63  TRP A CB    1 
ATOM   1837 C CG    . TRP C 3 69  ? 41.651  52.435 119.011 1.00 44.17  ? 63  TRP A CG    1 
ATOM   1838 C CD1   . TRP C 3 69  ? 40.629  51.826 119.665 1.00 47.72  ? 63  TRP A CD1   1 
ATOM   1839 C CD2   . TRP C 3 69  ? 42.358  51.392 118.311 1.00 44.18  ? 63  TRP A CD2   1 
ATOM   1840 N NE1   . TRP C 3 69  ? 40.645  50.468 119.417 1.00 47.77  ? 63  TRP A NE1   1 
ATOM   1841 C CE2   . TRP C 3 69  ? 41.689  50.176 118.575 1.00 48.90  ? 63  TRP A CE2   1 
ATOM   1842 C CE3   . TRP C 3 69  ? 43.474  51.377 117.466 1.00 45.05  ? 63  TRP A CE3   1 
ATOM   1843 C CZ2   . TRP C 3 69  ? 42.096  48.961 118.022 1.00 48.06  ? 63  TRP A CZ2   1 
ATOM   1844 C CZ3   . TRP C 3 69  ? 43.876  50.185 116.924 1.00 47.03  ? 63  TRP A CZ3   1 
ATOM   1845 C CH2   . TRP C 3 69  ? 43.198  48.984 117.216 1.00 48.05  ? 63  TRP A CH2   1 
ATOM   1846 N N     . PHE C 3 70  ? 40.132  53.542 116.070 1.00 44.64  ? 64  PHE A N     1 
ATOM   1847 C CA    . PHE C 3 70  ? 40.056  52.830 114.808 1.00 44.64  ? 64  PHE A CA    1 
ATOM   1848 C C     . PHE C 3 70  ? 38.655  52.956 114.218 1.00 49.01  ? 64  PHE A C     1 
ATOM   1849 O O     . PHE C 3 70  ? 37.719  52.446 114.822 1.00 50.87  ? 64  PHE A O     1 
ATOM   1850 C CB    . PHE C 3 70  ? 40.357  51.354 115.072 1.00 46.53  ? 64  PHE A CB    1 
ATOM   1851 C CG    . PHE C 3 70  ? 40.412  50.511 113.829 1.00 50.02  ? 64  PHE A CG    1 
ATOM   1852 C CD1   . PHE C 3 70  ? 41.370  50.758 112.859 1.00 55.77  ? 64  PHE A CD1   1 
ATOM   1853 C CD2   . PHE C 3 70  ? 39.519  49.462 113.637 1.00 50.34  ? 64  PHE A CD2   1 
ATOM   1854 C CE1   . PHE C 3 70  ? 41.428  49.986 111.714 1.00 56.52  ? 64  PHE A CE1   1 
ATOM   1855 C CE2   . PHE C 3 70  ? 39.574  48.690 112.504 1.00 53.27  ? 64  PHE A CE2   1 
ATOM   1856 C CZ    . PHE C 3 70  ? 40.527  48.950 111.540 1.00 53.70  ? 64  PHE A CZ    1 
ATOM   1857 N N     . PRO C 3 71  ? 38.490  53.615 113.062 1.00 42.16  ? 65  PRO A N     1 
ATOM   1858 C CA    . PRO C 3 71  ? 39.569  54.210 112.296 1.00 40.06  ? 65  PRO A CA    1 
ATOM   1859 C C     . PRO C 3 71  ? 40.106  55.485 112.914 1.00 41.27  ? 65  PRO A C     1 
ATOM   1860 O O     . PRO C 3 71  ? 39.370  56.223 113.550 1.00 39.43  ? 65  PRO A O     1 
ATOM   1861 C CB    . PRO C 3 71  ? 38.891  54.530 110.963 1.00 41.29  ? 65  PRO A CB    1 
ATOM   1862 C CG    . PRO C 3 71  ? 37.834  53.478 110.809 1.00 45.38  ? 65  PRO A CG    1 
ATOM   1863 C CD    . PRO C 3 71  ? 37.539  52.910 112.186 1.00 41.73  ? 65  PRO A CD    1 
ATOM   1864 N N     . ALA C 3 72  ? 41.393  55.739 112.701 1.00 39.37  ? 66  ALA A N     1 
ATOM   1865 C CA    . ALA C 3 72  ? 42.040  56.922 113.232 1.00 39.81  ? 66  ALA A CA    1 
ATOM   1866 C C     . ALA C 3 72  ? 41.692  58.134 112.386 1.00 46.17  ? 66  ALA A C     1 
ATOM   1867 O O     . ALA C 3 72  ? 41.892  58.130 111.174 1.00 46.11  ? 66  ALA A O     1 
ATOM   1868 C CB    . ALA C 3 72  ? 43.531  56.712 113.277 1.00 41.02  ? 66  ALA A CB    1 
ATOM   1869 N N     . GLU C 3 73  ? 41.166  59.165 113.040 1.00 46.50  ? 67  GLU A N     1 
ATOM   1870 C CA    . GLU C 3 73  ? 40.761  60.406 112.383 1.00 47.25  ? 67  GLU A CA    1 
ATOM   1871 C C     . GLU C 3 73  ? 41.879  61.452 112.407 1.00 50.95  ? 67  GLU A C     1 
ATOM   1872 O O     . GLU C 3 73  ? 42.388  61.801 113.473 1.00 49.80  ? 67  GLU A O     1 
ATOM   1873 C CB    . GLU C 3 73  ? 39.504  60.957 113.066 1.00 49.47  ? 67  GLU A CB    1 
ATOM   1874 C CG    . GLU C 3 73  ? 38.755  62.004 112.258 1.00 71.27  ? 67  GLU A CG    1 
ATOM   1875 C CD    . GLU C 3 73  ? 38.945  63.408 112.811 1.00 97.03  ? 67  GLU A CD    1 
ATOM   1876 O OE1   . GLU C 3 73  ? 38.411  63.706 113.903 1.00 100.00 ? 67  GLU A OE1   1 
ATOM   1877 O OE2   . GLU C 3 73  ? 39.655  64.207 112.164 1.00 59.07  ? 67  GLU A OE2   1 
ATOM   1878 N N     . PRO C 3 74  ? 42.236  61.947 111.221 1.00 48.05  ? 68  PRO A N     1 
ATOM   1879 C CA    . PRO C 3 74  ? 43.301  62.926 111.025 1.00 46.79  ? 68  PRO A CA    1 
ATOM   1880 C C     . PRO C 3 74  ? 43.507  63.982 112.097 1.00 48.66  ? 68  PRO A C     1 
ATOM   1881 O O     . PRO C 3 74  ? 44.647  64.341 112.376 1.00 49.10  ? 68  PRO A O     1 
ATOM   1882 C CB    . PRO C 3 74  ? 42.939  63.586 109.691 1.00 49.37  ? 68  PRO A CB    1 
ATOM   1883 C CG    . PRO C 3 74  ? 41.547  63.097 109.354 1.00 54.27  ? 68  PRO A CG    1 
ATOM   1884 C CD    . PRO C 3 74  ? 41.447  61.763 109.996 1.00 49.73  ? 68  PRO A CD    1 
ATOM   1885 N N     . GLU C 3 75  ? 42.431  64.498 112.685 1.00 43.58  ? 69  GLU A N     1 
ATOM   1886 C CA    . GLU C 3 75  ? 42.588  65.520 113.718 1.00 42.98  ? 69  GLU A CA    1 
ATOM   1887 C C     . GLU C 3 75  ? 43.132  64.906 115.011 1.00 48.39  ? 69  GLU A C     1 
ATOM   1888 O O     . GLU C 3 75  ? 44.002  65.484 115.674 1.00 48.15  ? 69  GLU A O     1 
ATOM   1889 C CB    . GLU C 3 75  ? 41.283  66.276 113.965 1.00 43.48  ? 69  GLU A CB    1 
ATOM   1890 C CG    . GLU C 3 75  ? 40.844  67.157 112.800 1.00 51.38  ? 69  GLU A CG    1 
ATOM   1891 C CD    . GLU C 3 75  ? 41.826  68.275 112.491 1.00 58.75  ? 69  GLU A CD    1 
ATOM   1892 O OE1   . GLU C 3 75  ? 42.235  68.976 113.436 1.00 55.44  ? 69  GLU A OE1   1 
ATOM   1893 O OE2   . GLU C 3 75  ? 42.181  68.459 111.305 1.00 38.03  ? 69  GLU A OE2   1 
ATOM   1894 N N     . ASP C 3 76  ? 42.633  63.716 115.343 1.00 44.13  ? 70  ASP A N     1 
ATOM   1895 C CA    . ASP C 3 76  ? 43.065  62.998 116.540 1.00 43.01  ? 70  ASP A CA    1 
ATOM   1896 C C     . ASP C 3 76  ? 44.521  62.579 116.411 1.00 47.57  ? 70  ASP A C     1 
ATOM   1897 O O     . ASP C 3 76  ? 45.314  62.812 117.314 1.00 50.25  ? 70  ASP A O     1 
ATOM   1898 C CB    . ASP C 3 76  ? 42.199  61.765 116.787 1.00 44.27  ? 70  ASP A CB    1 
ATOM   1899 C CG    . ASP C 3 76  ? 40.712  62.080 116.787 1.00 60.30  ? 70  ASP A CG    1 
ATOM   1900 O OD1   . ASP C 3 76  ? 40.338  63.210 117.163 1.00 62.63  ? 70  ASP A OD1   1 
ATOM   1901 O OD2   . ASP C 3 76  ? 39.919  61.186 116.424 1.00 66.67  ? 70  ASP A OD2   1 
ATOM   1902 N N     . VAL C 3 77  ? 44.875  61.956 115.292 1.00 40.15  ? 71  VAL A N     1 
ATOM   1903 C CA    . VAL C 3 77  ? 46.259  61.553 115.067 1.00 36.39  ? 71  VAL A CA    1 
ATOM   1904 C C     . VAL C 3 77  ? 47.160  62.786 115.138 1.00 42.69  ? 71  VAL A C     1 
ATOM   1905 O O     . VAL C 3 77  ? 48.325  62.689 115.497 1.00 42.24  ? 71  VAL A O     1 
ATOM   1906 C CB    . VAL C 3 77  ? 46.441  60.896 113.695 1.00 36.32  ? 71  VAL A CB    1 
ATOM   1907 C CG1   . VAL C 3 77  ? 47.896  60.580 113.448 1.00 35.30  ? 71  VAL A CG1   1 
ATOM   1908 C CG2   . VAL C 3 77  ? 45.623  59.641 113.601 1.00 35.83  ? 71  VAL A CG2   1 
ATOM   1909 N N     . ARG C 3 78  ? 46.619  63.951 114.794 1.00 40.82  ? 72  ARG A N     1 
ATOM   1910 C CA    . ARG C 3 78  ? 47.398  65.184 114.847 1.00 41.76  ? 72  ARG A CA    1 
ATOM   1911 C C     . ARG C 3 78  ? 47.698  65.479 116.313 1.00 47.57  ? 72  ARG A C     1 
ATOM   1912 O O     . ARG C 3 78  ? 48.855  65.557 116.729 1.00 49.05  ? 72  ARG A O     1 
ATOM   1913 C CB    . ARG C 3 78  ? 46.602  66.340 114.233 1.00 43.47  ? 72  ARG A CB    1 
ATOM   1914 C CG    . ARG C 3 78  ? 47.155  67.740 114.508 1.00 47.13  ? 72  ARG A CG    1 
ATOM   1915 C CD    . ARG C 3 78  ? 46.680  68.715 113.440 1.00 47.26  ? 72  ARG A CD    1 
ATOM   1916 N NE    . ARG C 3 78  ? 47.259  70.045 113.584 1.00 45.55  ? 72  ARG A NE    1 
ATOM   1917 C CZ    . ARG C 3 78  ? 47.235  70.749 114.708 1.00 56.33  ? 72  ARG A CZ    1 
ATOM   1918 N NH1   . ARG C 3 78  ? 46.665  70.248 115.795 1.00 43.34  ? 72  ARG A NH1   1 
ATOM   1919 N NH2   . ARG C 3 78  ? 47.780  71.955 114.744 1.00 48.71  ? 72  ARG A NH2   1 
ATOM   1920 N N     . ASP C 3 79  ? 46.637  65.620 117.095 1.00 43.85  ? 73  ASP A N     1 
ATOM   1921 C CA    . ASP C 3 79  ? 46.770  65.875 118.519 1.00 44.16  ? 73  ASP A CA    1 
ATOM   1922 C C     . ASP C 3 79  ? 47.779  64.925 119.134 1.00 45.29  ? 73  ASP A C     1 
ATOM   1923 O O     . ASP C 3 79  ? 48.613  65.330 119.937 1.00 47.30  ? 73  ASP A O     1 
ATOM   1924 C CB    . ASP C 3 79  ? 45.424  65.679 119.212 1.00 47.56  ? 73  ASP A CB    1 
ATOM   1925 C CG    . ASP C 3 79  ? 44.448  66.788 118.903 1.00 61.88  ? 73  ASP A CG    1 
ATOM   1926 O OD1   . ASP C 3 79  ? 44.854  67.746 118.208 1.00 62.08  ? 73  ASP A OD1   1 
ATOM   1927 O OD2   . ASP C 3 79  ? 43.279  66.694 119.345 1.00 68.87  ? 73  ASP A OD2   1 
ATOM   1928 N N     . TYR C 3 80  ? 47.679  63.656 118.752 1.00 37.87  ? 74  TYR A N     1 
ATOM   1929 C CA    . TYR C 3 80  ? 48.543  62.599 119.264 1.00 36.60  ? 74  TYR A CA    1 
ATOM   1930 C C     . TYR C 3 80  ? 49.998  62.845 118.933 1.00 39.86  ? 74  TYR A C     1 
ATOM   1931 O O     . TYR C 3 80  ? 50.869  62.706 119.787 1.00 41.87  ? 74  TYR A O     1 
ATOM   1932 C CB    . TYR C 3 80  ? 48.095  61.239 118.710 1.00 37.17  ? 74  TYR A CB    1 
ATOM   1933 C CG    . TYR C 3 80  ? 48.981  60.066 119.074 1.00 36.11  ? 74  TYR A CG    1 
ATOM   1934 C CD1   . TYR C 3 80  ? 49.009  59.558 120.373 1.00 36.30  ? 74  TYR A CD1   1 
ATOM   1935 C CD2   . TYR C 3 80  ? 49.763  59.437 118.104 1.00 36.54  ? 74  TYR A CD2   1 
ATOM   1936 C CE1   . TYR C 3 80  ? 49.824  58.466 120.697 1.00 34.76  ? 74  TYR A CE1   1 
ATOM   1937 C CE2   . TYR C 3 80  ? 50.567  58.344 118.419 1.00 36.02  ? 74  TYR A CE2   1 
ATOM   1938 C CZ    . TYR C 3 80  ? 50.595  57.869 119.712 1.00 35.35  ? 74  TYR A CZ    1 
ATOM   1939 O OH    . TYR C 3 80  ? 51.411  56.801 120.006 1.00 33.21  ? 74  TYR A OH    1 
ATOM   1940 N N     . LEU C 3 81  ? 50.263  63.198 117.682 1.00 34.15  ? 75  LEU A N     1 
ATOM   1941 C CA    . LEU C 3 81  ? 51.623  63.459 117.249 1.00 31.51  ? 75  LEU A CA    1 
ATOM   1942 C C     . LEU C 3 81  ? 52.201  64.634 118.033 1.00 39.33  ? 75  LEU A C     1 
ATOM   1943 O O     . LEU C 3 81  ? 53.377  64.635 118.411 1.00 38.29  ? 75  LEU A O     1 
ATOM   1944 C CB    . LEU C 3 81  ? 51.660  63.736 115.748 1.00 29.35  ? 75  LEU A CB    1 
ATOM   1945 C CG    . LEU C 3 81  ? 51.334  62.519 114.887 1.00 30.71  ? 75  LEU A CG    1 
ATOM   1946 C CD1   . LEU C 3 81  ? 51.355  62.850 113.398 1.00 29.86  ? 75  LEU A CD1   1 
ATOM   1947 C CD2   . LEU C 3 81  ? 52.260  61.361 115.208 1.00 27.78  ? 75  LEU A CD2   1 
ATOM   1948 N N     . LEU C 3 82  ? 51.380  65.647 118.278 1.00 36.58  ? 76  LEU A N     1 
ATOM   1949 C CA    . LEU C 3 82  ? 51.865  66.793 119.031 1.00 36.19  ? 76  LEU A CA    1 
ATOM   1950 C C     . LEU C 3 82  ? 52.127  66.350 120.475 1.00 44.97  ? 76  LEU A C     1 
ATOM   1951 O O     . LEU C 3 82  ? 53.006  66.875 121.155 1.00 47.49  ? 76  LEU A O     1 
ATOM   1952 C CB    . LEU C 3 82  ? 50.844  67.929 118.989 1.00 34.76  ? 76  LEU A CB    1 
ATOM   1953 C CG    . LEU C 3 82  ? 50.670  68.670 117.658 1.00 35.49  ? 76  LEU A CG    1 
ATOM   1954 C CD1   . LEU C 3 82  ? 49.629  69.754 117.840 1.00 33.81  ? 76  LEU A CD1   1 
ATOM   1955 C CD2   . LEU C 3 82  ? 51.989  69.271 117.176 1.00 31.05  ? 76  LEU A CD2   1 
ATOM   1956 N N     . TYR C 3 83  ? 51.352  65.372 120.927 1.00 40.85  ? 77  TYR A N     1 
ATOM   1957 C CA    . TYR C 3 83  ? 51.482  64.824 122.269 1.00 40.08  ? 77  TYR A CA    1 
ATOM   1958 C C     . TYR C 3 83  ? 52.792  64.037 122.356 1.00 44.22  ? 77  TYR A C     1 
ATOM   1959 O O     . TYR C 3 83  ? 53.493  64.074 123.363 1.00 44.00  ? 77  TYR A O     1 
ATOM   1960 C CB    . TYR C 3 83  ? 50.266  63.937 122.582 1.00 41.48  ? 77  TYR A CB    1 
ATOM   1961 C CG    . TYR C 3 83  ? 50.491  62.887 123.643 1.00 44.07  ? 77  TYR A CG    1 
ATOM   1962 C CD1   . TYR C 3 83  ? 50.381  63.197 124.995 1.00 45.28  ? 77  TYR A CD1   1 
ATOM   1963 C CD2   . TYR C 3 83  ? 50.766  61.575 123.293 1.00 45.47  ? 77  TYR A CD2   1 
ATOM   1964 C CE1   . TYR C 3 83  ? 50.597  62.236 125.963 1.00 44.80  ? 77  TYR A CE1   1 
ATOM   1965 C CE2   . TYR C 3 83  ? 50.975  60.605 124.256 1.00 46.34  ? 77  TYR A CE2   1 
ATOM   1966 C CZ    . TYR C 3 83  ? 50.887  60.940 125.589 1.00 52.82  ? 77  TYR A CZ    1 
ATOM   1967 O OH    . TYR C 3 83  ? 51.077  59.972 126.552 1.00 53.21  ? 77  TYR A OH    1 
ATOM   1968 N N     . LEU C 3 84  ? 53.143  63.350 121.281 1.00 41.37  ? 78  LEU A N     1 
ATOM   1969 C CA    . LEU C 3 84  ? 54.388  62.602 121.273 1.00 41.78  ? 78  LEU A CA    1 
ATOM   1970 C C     . LEU C 3 84  ? 55.526  63.605 121.369 1.00 49.10  ? 78  LEU A C     1 
ATOM   1971 O O     . LEU C 3 84  ? 56.469  63.412 122.130 1.00 51.49  ? 78  LEU A O     1 
ATOM   1972 C CB    . LEU C 3 84  ? 54.527  61.780 119.986 1.00 41.39  ? 78  LEU A CB    1 
ATOM   1973 C CG    . LEU C 3 84  ? 53.649  60.535 119.868 1.00 44.56  ? 78  LEU A CG    1 
ATOM   1974 C CD1   . LEU C 3 84  ? 54.017  59.738 118.624 1.00 44.10  ? 78  LEU A CD1   1 
ATOM   1975 C CD2   . LEU C 3 84  ? 53.792  59.685 121.113 1.00 46.28  ? 78  LEU A CD2   1 
ATOM   1976 N N     . GLN C 3 85  ? 55.419  64.682 120.598 1.00 46.59  ? 79  GLN A N     1 
ATOM   1977 C CA    . GLN C 3 85  ? 56.425  65.743 120.587 1.00 46.91  ? 79  GLN A CA    1 
ATOM   1978 C C     . GLN C 3 85  ? 56.602  66.371 121.971 1.00 50.37  ? 79  GLN A C     1 
ATOM   1979 O O     . GLN C 3 85  ? 57.731  66.530 122.438 1.00 49.82  ? 79  GLN A O     1 
ATOM   1980 C CB    . GLN C 3 85  ? 56.038  66.828 119.576 1.00 48.12  ? 79  GLN A CB    1 
ATOM   1981 C CG    . GLN C 3 85  ? 57.124  67.855 119.307 1.00 50.81  ? 79  GLN A CG    1 
ATOM   1982 C CD    . GLN C 3 85  ? 56.591  69.071 118.579 1.00 49.86  ? 79  GLN A CD    1 
ATOM   1983 O OE1   . GLN C 3 85  ? 55.537  69.585 118.922 1.00 42.17  ? 79  GLN A OE1   1 
ATOM   1984 N NE2   . GLN C 3 85  ? 57.324  69.541 117.575 1.00 37.54  ? 79  GLN A NE2   1 
ATOM   1985 N N     . ALA C 3 86  ? 55.482  66.727 122.604 1.00 44.57  ? 80  ALA A N     1 
ATOM   1986 C CA    . ALA C 3 86  ? 55.480  67.330 123.930 1.00 43.39  ? 80  ALA A CA    1 
ATOM   1987 C C     . ALA C 3 86  ? 56.062  66.370 124.939 1.00 46.86  ? 80  ALA A C     1 
ATOM   1988 O O     . ALA C 3 86  ? 56.652  66.780 125.931 1.00 50.75  ? 80  ALA A O     1 
ATOM   1989 C CB    . ALA C 3 86  ? 54.083  67.702 124.328 1.00 44.71  ? 80  ALA A CB    1 
ATOM   1990 N N     . ARG C 3 87  ? 55.899  65.083 124.676 1.00 42.55  ? 81  ARG A N     1 
ATOM   1991 C CA    . ARG C 3 87  ? 56.444  64.045 125.545 1.00 42.72  ? 81  ARG A CA    1 
ATOM   1992 C C     . ARG C 3 87  ? 57.952  64.052 125.382 1.00 45.78  ? 81  ARG A C     1 
ATOM   1993 O O     . ARG C 3 87  ? 58.652  63.208 125.927 1.00 48.60  ? 81  ARG A O     1 
ATOM   1994 C CB    . ARG C 3 87  ? 55.925  62.667 125.115 1.00 42.45  ? 81  ARG A CB    1 
ATOM   1995 C CG    . ARG C 3 87  ? 54.667  62.212 125.826 1.00 57.15  ? 81  ARG A CG    1 
ATOM   1996 C CD    . ARG C 3 87  ? 54.498  60.707 125.717 1.00 60.21  ? 81  ARG A CD    1 
ATOM   1997 N NE    . ARG C 3 87  ? 55.507  60.000 126.499 1.00 63.49  ? 81  ARG A NE    1 
ATOM   1998 C CZ    . ARG C 3 87  ? 56.065  58.847 126.138 1.00 72.68  ? 81  ARG A CZ    1 
ATOM   1999 N NH1   . ARG C 3 87  ? 55.741  58.273 124.988 1.00 47.07  ? 81  ARG A NH1   1 
ATOM   2000 N NH2   . ARG C 3 87  ? 56.985  58.286 126.907 1.00 68.21  ? 81  ARG A NH2   1 
ATOM   2001 N N     . GLY C 3 88  ? 58.448  64.984 124.587 1.00 38.99  ? 82  GLY A N     1 
ATOM   2002 C CA    . GLY C 3 88  ? 59.870  65.071 124.347 1.00 39.33  ? 82  GLY A CA    1 
ATOM   2003 C C     . GLY C 3 88  ? 60.351  63.852 123.587 1.00 45.12  ? 82  GLY A C     1 
ATOM   2004 O O     . GLY C 3 88  ? 61.460  63.379 123.815 1.00 45.82  ? 82  GLY A O     1 
ATOM   2005 N N     . LEU C 3 89  ? 59.524  63.342 122.682 1.00 44.05  ? 83  LEU A N     1 
ATOM   2006 C CA    . LEU C 3 89  ? 59.915  62.178 121.889 1.00 45.97  ? 83  LEU A CA    1 
ATOM   2007 C C     . LEU C 3 89  ? 60.589  62.583 120.575 1.00 51.08  ? 83  LEU A C     1 
ATOM   2008 O O     . LEU C 3 89  ? 60.281  63.632 120.007 1.00 53.65  ? 83  LEU A O     1 
ATOM   2009 C CB    . LEU C 3 89  ? 58.735  61.232 121.668 1.00 46.71  ? 83  LEU A CB    1 
ATOM   2010 C CG    . LEU C 3 89  ? 58.548  60.245 122.827 1.00 52.78  ? 83  LEU A CG    1 
ATOM   2011 C CD1   . LEU C 3 89  ? 57.092  60.018 123.152 1.00 53.14  ? 83  LEU A CD1   1 
ATOM   2012 C CD2   . LEU C 3 89  ? 59.242  58.929 122.518 1.00 57.54  ? 83  LEU A CD2   1 
ATOM   2013 N N     . ALA C 3 90  ? 61.551  61.786 120.124 1.00 44.90  ? 84  ALA A N     1 
ATOM   2014 C CA    . ALA C 3 90  ? 62.300  62.109 118.909 1.00 44.24  ? 84  ALA A CA    1 
ATOM   2015 C C     . ALA C 3 90  ? 61.485  62.142 117.612 1.00 50.49  ? 84  ALA A C     1 
ATOM   2016 O O     . ALA C 3 90  ? 60.463  61.474 117.472 1.00 49.98  ? 84  ALA A O     1 
ATOM   2017 C CB    . ALA C 3 90  ? 63.489  61.171 118.762 1.00 44.57  ? 84  ALA A CB    1 
ATOM   2018 N N     . VAL C 3 91  ? 61.972  62.907 116.647 1.00 49.91  ? 85  VAL A N     1 
ATOM   2019 C CA    . VAL C 3 91  ? 61.311  63.001 115.350 1.00 50.45  ? 85  VAL A CA    1 
ATOM   2020 C C     . VAL C 3 91  ? 61.206  61.624 114.706 1.00 53.42  ? 85  VAL A C     1 
ATOM   2021 O O     . VAL C 3 91  ? 60.192  61.288 114.107 1.00 55.15  ? 85  VAL A O     1 
ATOM   2022 C CB    . VAL C 3 91  ? 62.079  63.929 114.380 1.00 54.61  ? 85  VAL A CB    1 
ATOM   2023 C CG1   . VAL C 3 91  ? 61.523  63.797 112.969 1.00 54.09  ? 85  VAL A CG1   1 
ATOM   2024 C CG2   . VAL C 3 91  ? 62.009  65.370 114.857 1.00 54.74  ? 85  VAL A CG2   1 
ATOM   2025 N N     . LYS C 3 92  ? 62.262  60.832 114.813 1.00 48.13  ? 86  LYS A N     1 
ATOM   2026 C CA    . LYS C 3 92  ? 62.254  59.510 114.205 1.00 48.39  ? 86  LYS A CA    1 
ATOM   2027 C C     . LYS C 3 92  ? 61.211  58.623 114.881 1.00 52.40  ? 86  LYS A C     1 
ATOM   2028 O O     . LYS C 3 92  ? 60.593  57.759 114.252 1.00 51.06  ? 86  LYS A O     1 
ATOM   2029 C CB    . LYS C 3 92  ? 63.642  58.868 114.286 1.00 50.96  ? 86  LYS A CB    1 
ATOM   2030 C CG    . LYS C 3 92  ? 64.636  59.405 113.260 1.00 79.01  ? 86  LYS A CG    1 
ATOM   2031 C CD    . LYS C 3 92  ? 64.547  60.925 113.115 1.00 87.44  ? 86  LYS A CD    1 
ATOM   2032 C CE    . LYS C 3 92  ? 65.562  61.457 112.103 1.00 88.40  ? 86  LYS A CE    1 
ATOM   2033 N NZ    . LYS C 3 92  ? 65.248  62.853 111.666 1.00 98.14  ? 86  LYS A NZ    1 
ATOM   2034 N N     . THR C 3 93  ? 61.018  58.848 116.172 1.00 47.40  ? 87  THR A N     1 
ATOM   2035 C CA    . THR C 3 93  ? 60.059  58.071 116.933 1.00 45.72  ? 87  THR A CA    1 
ATOM   2036 C C     . THR C 3 93  ? 58.631  58.381 116.490 1.00 48.55  ? 87  THR A C     1 
ATOM   2037 O O     . THR C 3 93  ? 57.833  57.466 116.262 1.00 48.03  ? 87  THR A O     1 
ATOM   2038 C CB    . THR C 3 93  ? 60.252  58.298 118.440 1.00 43.90  ? 87  THR A CB    1 
ATOM   2039 O OG1   . THR C 3 93  ? 61.496  57.708 118.837 1.00 47.07  ? 87  THR A OG1   1 
ATOM   2040 C CG2   . THR C 3 93  ? 59.113  57.674 119.237 1.00 36.42  ? 87  THR A CG2   1 
ATOM   2041 N N     . ILE C 3 94  ? 58.324  59.669 116.349 1.00 42.43  ? 88  ILE A N     1 
ATOM   2042 C CA    . ILE C 3 94  ? 56.999  60.087 115.917 1.00 40.99  ? 88  ILE A CA    1 
ATOM   2043 C C     . ILE C 3 94  ? 56.753  59.556 114.508 1.00 45.35  ? 88  ILE A C     1 
ATOM   2044 O O     . ILE C 3 94  ? 55.644  59.160 114.154 1.00 43.73  ? 88  ILE A O     1 
ATOM   2045 C CB    . ILE C 3 94  ? 56.838  61.609 116.010 1.00 42.59  ? 88  ILE A CB    1 
ATOM   2046 C CG1   . ILE C 3 94  ? 57.013  62.048 117.470 1.00 41.61  ? 88  ILE A CG1   1 
ATOM   2047 C CG2   . ILE C 3 94  ? 55.473  62.028 115.487 1.00 43.49  ? 88  ILE A CG2   1 
ATOM   2048 C CD1   . ILE C 3 94  ? 57.609  63.427 117.658 1.00 39.33  ? 88  ILE A CD1   1 
ATOM   2049 N N     . GLN C 3 95  ? 57.823  59.482 113.731 1.00 42.08  ? 89  GLN A N     1 
ATOM   2050 C CA    . GLN C 3 95  ? 57.714  58.935 112.402 1.00 42.67  ? 89  GLN A CA    1 
ATOM   2051 C C     . GLN C 3 95  ? 57.208  57.509 112.583 1.00 47.16  ? 89  GLN A C     1 
ATOM   2052 O O     . GLN C 3 95  ? 56.176  57.146 112.031 1.00 49.79  ? 89  GLN A O     1 
ATOM   2053 C CB    . GLN C 3 95  ? 59.073  58.955 111.685 1.00 45.03  ? 89  GLN A CB    1 
ATOM   2054 C CG    . GLN C 3 95  ? 59.122  59.836 110.428 1.00 62.20  ? 89  GLN A CG    1 
ATOM   2055 C CD    . GLN C 3 95  ? 60.278  60.838 110.452 1.00 95.24  ? 89  GLN A CD    1 
ATOM   2056 O OE1   . GLN C 3 95  ? 60.074  62.044 110.310 1.00 95.10  ? 89  GLN A OE1   1 
ATOM   2057 N NE2   . GLN C 3 95  ? 61.497  60.335 110.627 1.00 81.08  ? 89  GLN A NE2   1 
ATOM   2058 N N     . GLN C 3 96  ? 57.903  56.712 113.392 1.00 42.38  ? 90  GLN A N     1 
ATOM   2059 C CA    . GLN C 3 96  ? 57.481  55.324 113.627 1.00 40.89  ? 90  GLN A CA    1 
ATOM   2060 C C     . GLN C 3 96  ? 55.997  55.227 113.978 1.00 41.35  ? 90  GLN A C     1 
ATOM   2061 O O     . GLN C 3 96  ? 55.292  54.364 113.469 1.00 41.19  ? 90  GLN A O     1 
ATOM   2062 C CB    . GLN C 3 96  ? 58.337  54.634 114.698 1.00 41.86  ? 90  GLN A CB    1 
ATOM   2063 C CG    . GLN C 3 96  ? 58.008  53.138 114.920 1.00 51.92  ? 90  GLN A CG    1 
ATOM   2064 C CD    . GLN C 3 96  ? 58.686  52.187 113.923 1.00 61.32  ? 90  GLN A CD    1 
ATOM   2065 O OE1   . GLN C 3 96  ? 58.024  51.575 113.083 1.00 59.14  ? 90  GLN A OE1   1 
ATOM   2066 N NE2   . GLN C 3 96  ? 59.999  52.029 114.048 1.00 49.84  ? 90  GLN A NE2   1 
ATOM   2067 N N     . HIS C 3 97  ? 55.524  56.119 114.839 1.00 35.42  ? 91  HIS A N     1 
ATOM   2068 C CA    . HIS C 3 97  ? 54.123  56.117 115.221 1.00 33.44  ? 91  HIS A CA    1 
ATOM   2069 C C     . HIS C 3 97  ? 53.176  56.369 114.062 1.00 36.62  ? 91  HIS A C     1 
ATOM   2070 O O     . HIS C 3 97  ? 52.269  55.577 113.833 1.00 37.70  ? 91  HIS A O     1 
ATOM   2071 C CB    . HIS C 3 97  ? 53.863  57.067 116.384 1.00 34.04  ? 91  HIS A CB    1 
ATOM   2072 C CG    . HIS C 3 97  ? 54.353  56.543 117.695 1.00 36.72  ? 91  HIS A CG    1 
ATOM   2073 N ND1   . HIS C 3 97  ? 53.521  56.337 118.779 1.00 37.35  ? 91  HIS A ND1   1 
ATOM   2074 C CD2   . HIS C 3 97  ? 55.589  56.145 118.087 1.00 36.17  ? 91  HIS A CD2   1 
ATOM   2075 C CE1   . HIS C 3 97  ? 54.229  55.854 119.785 1.00 35.36  ? 91  HIS A CE1   1 
ATOM   2076 N NE2   . HIS C 3 97  ? 55.485  55.721 119.389 1.00 35.33  ? 91  HIS A NE2   1 
ATOM   2077 N N     . LEU C 3 98  ? 53.384  57.449 113.317 1.00 32.58  ? 92  LEU A N     1 
ATOM   2078 C CA    . LEU C 3 98  ? 52.526  57.714 112.169 1.00 32.96  ? 92  LEU A CA    1 
ATOM   2079 C C     . LEU C 3 98  ? 52.700  56.541 111.219 1.00 36.50  ? 92  LEU A C     1 
ATOM   2080 O O     . LEU C 3 98  ? 51.754  56.043 110.621 1.00 37.42  ? 92  LEU A O     1 
ATOM   2081 C CB    . LEU C 3 98  ? 52.977  58.984 111.448 1.00 33.16  ? 92  LEU A CB    1 
ATOM   2082 C CG    . LEU C 3 98  ? 51.914  59.892 110.821 1.00 36.32  ? 92  LEU A CG    1 
ATOM   2083 C CD1   . LEU C 3 98  ? 52.520  60.586 109.630 1.00 36.13  ? 92  LEU A CD1   1 
ATOM   2084 C CD2   . LEU C 3 98  ? 50.650  59.131 110.439 1.00 33.03  ? 92  LEU A CD2   1 
ATOM   2085 N N     . GLY C 3 99  ? 53.941  56.104 111.089 1.00 31.56  ? 93  GLY A N     1 
ATOM   2086 C CA    . GLY C 3 99  ? 54.276  55.023 110.191 1.00 30.64  ? 93  GLY A CA    1 
ATOM   2087 C C     . GLY C 3 99  ? 53.461  53.773 110.437 1.00 36.90  ? 93  GLY A C     1 
ATOM   2088 O O     . GLY C 3 99  ? 52.883  53.207 109.512 1.00 37.56  ? 93  GLY A O     1 
ATOM   2089 N N     . GLN C 3 100 ? 53.435  53.314 111.678 1.00 34.68  ? 94  GLN A N     1 
ATOM   2090 C CA    . GLN C 3 100 ? 52.706  52.093 111.976 1.00 32.43  ? 94  GLN A CA    1 
ATOM   2091 C C     . GLN C 3 100 ? 51.212  52.290 111.804 1.00 35.92  ? 94  GLN A C     1 
ATOM   2092 O O     . GLN C 3 100 ? 50.529  51.378 111.360 1.00 37.55  ? 94  GLN A O     1 
ATOM   2093 C CB    . GLN C 3 100 ? 53.075  51.551 113.356 1.00 31.72  ? 94  GLN A CB    1 
ATOM   2094 C CG    . GLN C 3 100 ? 54.564  51.211 113.494 1.00 24.49  ? 94  GLN A CG    1 
ATOM   2095 C CD    . GLN C 3 100 ? 54.956  49.892 112.834 1.00 42.65  ? 94  GLN A CD    1 
ATOM   2096 O OE1   . GLN C 3 100 ? 54.126  49.192 112.244 1.00 34.62  ? 94  GLN A OE1   1 
ATOM   2097 N NE2   . GLN C 3 100 ? 56.235  49.545 112.941 1.00 39.00  ? 94  GLN A NE2   1 
ATOM   2098 N N     . LEU C 3 101 ? 50.725  53.492 112.119 1.00 29.90  ? 95  LEU A N     1 
ATOM   2099 C CA    . LEU C 3 101 ? 49.309  53.829 111.987 1.00 29.57  ? 95  LEU A CA    1 
ATOM   2100 C C     . LEU C 3 101 ? 48.895  53.804 110.521 1.00 36.02  ? 95  LEU A C     1 
ATOM   2101 O O     . LEU C 3 101 ? 47.847  53.258 110.173 1.00 34.75  ? 95  LEU A O     1 
ATOM   2102 C CB    . LEU C 3 101 ? 49.010  55.204 112.582 1.00 29.27  ? 95  LEU A CB    1 
ATOM   2103 C CG    . LEU C 3 101 ? 49.006  55.279 114.108 1.00 36.04  ? 95  LEU A CG    1 
ATOM   2104 C CD1   . LEU C 3 101 ? 48.584  56.662 114.581 1.00 36.86  ? 95  LEU A CD1   1 
ATOM   2105 C CD2   . LEU C 3 101 ? 48.106  54.194 114.698 1.00 40.04  ? 95  LEU A CD2   1 
ATOM   2106 N N     . ASN C 3 102 ? 49.732  54.386 109.666 1.00 33.77  ? 96  ASN A N     1 
ATOM   2107 C CA    . ASN C 3 102 ? 49.484  54.407 108.229 1.00 33.35  ? 96  ASN A CA    1 
ATOM   2108 C C     . ASN C 3 102 ? 49.423  52.964 107.743 1.00 40.24  ? 96  ASN A C     1 
ATOM   2109 O O     . ASN C 3 102 ? 48.641  52.627 106.860 1.00 42.44  ? 96  ASN A O     1 
ATOM   2110 C CB    . ASN C 3 102 ? 50.640  55.102 107.494 1.00 26.21  ? 96  ASN A CB    1 
ATOM   2111 C CG    . ASN C 3 102 ? 50.567  56.604 107.564 1.00 41.31  ? 96  ASN A CG    1 
ATOM   2112 O OD1   . ASN C 3 102 ? 49.558  57.181 107.964 1.00 45.83  ? 96  ASN A OD1   1 
ATOM   2113 N ND2   . ASN C 3 102 ? 51.646  57.255 107.158 1.00 38.41  ? 96  ASN A ND2   1 
ATOM   2114 N N     . MET C 3 103 ? 50.277  52.113 108.300 1.00 38.74  ? 97  MET A N     1 
ATOM   2115 C CA    . MET C 3 103 ? 50.328  50.707 107.890 1.00 40.64  ? 97  MET A CA    1 
ATOM   2116 C C     . MET C 3 103 ? 49.087  49.922 108.310 1.00 46.67  ? 97  MET A C     1 
ATOM   2117 O O     . MET C 3 103 ? 48.639  49.023 107.602 1.00 45.45  ? 97  MET A O     1 
ATOM   2118 C CB    . MET C 3 103 ? 51.599  50.027 108.411 1.00 43.79  ? 97  MET A CB    1 
ATOM   2119 C CG    . MET C 3 103 ? 51.372  48.649 109.021 1.00 50.25  ? 97  MET A CG    1 
ATOM   2120 S SD    . MET C 3 103 ? 52.621  47.381 108.574 1.00 57.28  ? 97  MET A SD    1 
ATOM   2121 C CE    . MET C 3 103 ? 51.784  45.902 109.098 1.00 54.04  ? 97  MET A CE    1 
ATOM   2122 N N     . LEU C 3 104 ? 48.527  50.272 109.462 1.00 43.88  ? 98  LEU A N     1 
ATOM   2123 C CA    . LEU C 3 104 ? 47.337  49.603 109.955 1.00 42.23  ? 98  LEU A CA    1 
ATOM   2124 C C     . LEU C 3 104 ? 46.145  50.005 109.091 1.00 47.85  ? 98  LEU A C     1 
ATOM   2125 O O     . LEU C 3 104 ? 45.303  49.181 108.757 1.00 51.26  ? 98  LEU A O     1 
ATOM   2126 C CB    . LEU C 3 104 ? 47.077  49.949 111.432 1.00 40.26  ? 98  LEU A CB    1 
ATOM   2127 C CG    . LEU C 3 104 ? 45.855  49.293 112.093 1.00 39.32  ? 98  LEU A CG    1 
ATOM   2128 C CD1   . LEU C 3 104 ? 46.009  47.791 112.211 1.00 36.93  ? 98  LEU A CD1   1 
ATOM   2129 C CD2   . LEU C 3 104 ? 45.527  49.902 113.439 1.00 38.04  ? 98  LEU A CD2   1 
ATOM   2130 N N     . HIS C 3 105 ? 46.063  51.270 108.718 1.00 40.49  ? 99  HIS A N     1 
ATOM   2131 C CA    . HIS C 3 105 ? 44.934  51.677 107.912 1.00 39.73  ? 99  HIS A CA    1 
ATOM   2132 C C     . HIS C 3 105 ? 45.053  51.227 106.463 1.00 47.36  ? 99  HIS A C     1 
ATOM   2133 O O     . HIS C 3 105 ? 44.045  50.923 105.819 1.00 48.14  ? 99  HIS A O     1 
ATOM   2134 C CB    . HIS C 3 105 ? 44.640  53.171 108.081 1.00 40.02  ? 99  HIS A CB    1 
ATOM   2135 C CG    . HIS C 3 105 ? 44.262  53.543 109.484 1.00 44.40  ? 99  HIS A CG    1 
ATOM   2136 N ND1   . HIS C 3 105 ? 45.105  53.345 110.556 1.00 46.87  ? 99  HIS A ND1   1 
ATOM   2137 C CD2   . HIS C 3 105 ? 43.125  54.072 109.995 1.00 47.42  ? 99  HIS A CD2   1 
ATOM   2138 C CE1   . HIS C 3 105 ? 44.511  53.750 111.664 1.00 46.89  ? 99  HIS A CE1   1 
ATOM   2139 N NE2   . HIS C 3 105 ? 43.309  54.200 111.351 1.00 47.38  ? 99  HIS A NE2   1 
ATOM   2140 N N     . ARG C 3 106 ? 46.286  51.137 105.969 1.00 44.44  ? 100 ARG A N     1 
ATOM   2141 C CA    . ARG C 3 106 ? 46.534  50.688 104.603 1.00 43.66  ? 100 ARG A CA    1 
ATOM   2142 C C     . ARG C 3 106 ? 46.240  49.184 104.489 1.00 45.03  ? 100 ARG A C     1 
ATOM   2143 O O     . ARG C 3 106 ? 45.543  48.743 103.589 1.00 45.69  ? 100 ARG A O     1 
ATOM   2144 C CB    . ARG C 3 106 ? 47.977  50.994 104.191 1.00 45.17  ? 100 ARG A CB    1 
ATOM   2145 C CG    . ARG C 3 106 ? 48.187  51.176 102.698 1.00 59.06  ? 100 ARG A CG    1 
ATOM   2146 C CD    . ARG C 3 106 ? 49.644  50.951 102.321 1.00 84.35  ? 100 ARG A CD    1 
ATOM   2147 N NE    . ARG C 3 106 ? 49.799  49.984 101.237 1.00 93.93  ? 100 ARG A NE    1 
ATOM   2148 C CZ    . ARG C 3 106 ? 50.685  48.993 101.238 1.00 100.00 ? 100 ARG A CZ    1 
ATOM   2149 N NH1   . ARG C 3 106 ? 51.498  48.822 102.270 1.00 88.36  ? 100 ARG A NH1   1 
ATOM   2150 N NH2   . ARG C 3 106 ? 50.754  48.166 100.208 1.00 81.69  ? 100 ARG A NH2   1 
ATOM   2151 N N     . ARG C 3 107 ? 46.741  48.390 105.419 1.00 40.55  ? 101 ARG A N     1 
ATOM   2152 C CA    . ARG C 3 107 ? 46.480  46.961 105.378 1.00 40.80  ? 101 ARG A CA    1 
ATOM   2153 C C     . ARG C 3 107 ? 45.051  46.619 105.816 1.00 47.79  ? 101 ARG A C     1 
ATOM   2154 O O     . ARG C 3 107 ? 44.697  45.444 105.933 1.00 50.25  ? 101 ARG A O     1 
ATOM   2155 C CB    . ARG C 3 107 ? 47.475  46.204 106.268 1.00 40.33  ? 101 ARG A CB    1 
ATOM   2156 C CG    . ARG C 3 107 ? 48.896  46.079 105.713 1.00 42.97  ? 101 ARG A CG    1 
ATOM   2157 C CD    . ARG C 3 107 ? 48.934  45.467 104.326 1.00 39.45  ? 101 ARG A CD    1 
ATOM   2158 N NE    . ARG C 3 107 ? 50.273  45.492 103.735 1.00 48.49  ? 101 ARG A NE    1 
ATOM   2159 C CZ    . ARG C 3 107 ? 50.554  45.064 102.506 1.00 54.45  ? 101 ARG A CZ    1 
ATOM   2160 N NH1   . ARG C 3 107 ? 49.589  44.592 101.732 1.00 32.04  ? 101 ARG A NH1   1 
ATOM   2161 N NH2   . ARG C 3 107 ? 51.793  45.116 102.034 1.00 47.13  ? 101 ARG A NH2   1 
ATOM   2162 N N     . SER C 3 108 ? 44.228  47.623 106.087 1.00 42.54  ? 102 SER A N     1 
ATOM   2163 C CA    . SER C 3 108 ? 42.865  47.330 106.524 1.00 40.98  ? 102 SER A CA    1 
ATOM   2164 C C     . SER C 3 108 ? 41.755  47.871 105.604 1.00 43.52  ? 102 SER A C     1 
ATOM   2165 O O     . SER C 3 108 ? 40.576  47.569 105.785 1.00 43.39  ? 102 SER A O     1 
ATOM   2166 C CB    . SER C 3 108 ? 42.654  47.664 108.006 1.00 42.01  ? 102 SER A CB    1 
ATOM   2167 O OG    . SER C 3 108 ? 42.250  49.006 108.178 1.00 60.06  ? 102 SER A OG    1 
ATOM   2168 N N     . GLY C 3 109 ? 42.151  48.647 104.601 1.00 37.04  ? 103 GLY A N     1 
ATOM   2169 C CA    . GLY C 3 109 ? 41.230  49.177 103.621 1.00 36.09  ? 103 GLY A CA    1 
ATOM   2170 C C     . GLY C 3 109 ? 40.842  50.610 103.890 1.00 43.47  ? 103 GLY A C     1 
ATOM   2171 O O     . GLY C 3 109 ? 40.095  51.221 103.119 1.00 46.24  ? 103 GLY A O     1 
ATOM   2172 N N     . LEU C 3 110 ? 41.337  51.159 104.987 1.00 39.46  ? 104 LEU A N     1 
ATOM   2173 C CA    . LEU C 3 110 ? 40.970  52.524 105.327 1.00 38.96  ? 104 LEU A CA    1 
ATOM   2174 C C     . LEU C 3 110 ? 42.038  53.517 104.926 1.00 43.60  ? 104 LEU A C     1 
ATOM   2175 O O     . LEU C 3 110 ? 43.184  53.140 104.685 1.00 45.05  ? 104 LEU A O     1 
ATOM   2176 C CB    . LEU C 3 110 ? 40.637  52.634 106.812 1.00 38.47  ? 104 LEU A CB    1 
ATOM   2177 C CG    . LEU C 3 110 ? 39.730  51.507 107.311 1.00 42.47  ? 104 LEU A CG    1 
ATOM   2178 C CD1   . LEU C 3 110 ? 39.759  51.368 108.829 1.00 41.74  ? 104 LEU A CD1   1 
ATOM   2179 C CD2   . LEU C 3 110 ? 38.314  51.707 106.798 1.00 46.55  ? 104 LEU A CD2   1 
ATOM   2180 N N     . PRO C 3 111 ? 41.650  54.782 104.824 1.00 39.64  ? 105 PRO A N     1 
ATOM   2181 C CA    . PRO C 3 111 ? 42.585  55.822 104.438 1.00 40.49  ? 105 PRO A CA    1 
ATOM   2182 C C     . PRO C 3 111 ? 43.688  56.024 105.493 1.00 46.45  ? 105 PRO A C     1 
ATOM   2183 O O     . PRO C 3 111 ? 43.433  55.944 106.704 1.00 44.84  ? 105 PRO A O     1 
ATOM   2184 C CB    . PRO C 3 111 ? 41.687  57.056 104.341 1.00 41.04  ? 105 PRO A CB    1 
ATOM   2185 C CG    . PRO C 3 111 ? 40.632  56.821 105.367 1.00 43.70  ? 105 PRO A CG    1 
ATOM   2186 C CD    . PRO C 3 111 ? 40.485  55.332 105.536 1.00 39.18  ? 105 PRO A CD    1 
ATOM   2187 N N     . ARG C 3 112 ? 44.906  56.277 105.011 1.00 41.52  ? 106 ARG A N     1 
ATOM   2188 C CA    . ARG C 3 112 ? 46.071  56.527 105.856 1.00 39.48  ? 106 ARG A CA    1 
ATOM   2189 C C     . ARG C 3 112 ? 45.941  57.901 106.490 1.00 47.72  ? 106 ARG A C     1 
ATOM   2190 O O     . ARG C 3 112 ? 45.358  58.812 105.904 1.00 47.33  ? 106 ARG A O     1 
ATOM   2191 C CB    . ARG C 3 112 ? 47.319  56.605 104.991 1.00 36.20  ? 106 ARG A CB    1 
ATOM   2192 C CG    . ARG C 3 112 ? 47.983  55.307 104.661 1.00 46.68  ? 106 ARG A CG    1 
ATOM   2193 C CD    . ARG C 3 112 ? 49.008  55.544 103.544 1.00 63.93  ? 106 ARG A CD    1 
ATOM   2194 N NE    . ARG C 3 112 ? 49.598  56.880 103.584 1.00 63.35  ? 106 ARG A NE    1 
ATOM   2195 C CZ    . ARG C 3 112 ? 50.906  57.105 103.590 1.00 77.34  ? 106 ARG A CZ    1 
ATOM   2196 N NH1   . ARG C 3 112 ? 51.745  56.070 103.581 1.00 70.09  ? 106 ARG A NH1   1 
ATOM   2197 N NH2   . ARG C 3 112 ? 51.363  58.352 103.598 1.00 48.50  ? 106 ARG A NH2   1 
ATOM   2198 N N     . PRO C 3 113 ? 46.536  58.072 107.667 1.00 45.71  ? 107 PRO A N     1 
ATOM   2199 C CA    . PRO C 3 113 ? 46.501  59.358 108.351 1.00 44.65  ? 107 PRO A CA    1 
ATOM   2200 C C     . PRO C 3 113 ? 47.409  60.353 107.649 1.00 48.02  ? 107 PRO A C     1 
ATOM   2201 O O     . PRO C 3 113 ? 47.124  61.541 107.611 1.00 47.38  ? 107 PRO A O     1 
ATOM   2202 C CB    . PRO C 3 113 ? 47.042  59.020 109.734 1.00 46.25  ? 107 PRO A CB    1 
ATOM   2203 C CG    . PRO C 3 113 ? 46.627  57.617 109.938 1.00 49.13  ? 107 PRO A CG    1 
ATOM   2204 C CD    . PRO C 3 113 ? 46.801  56.967 108.602 1.00 44.25  ? 107 PRO A CD    1 
ATOM   2205 N N     . SER C 3 114 ? 48.506  59.849 107.095 1.00 46.67  ? 108 SER A N     1 
ATOM   2206 C CA    . SER C 3 114 ? 49.469  60.671 106.358 1.00 46.99  ? 108 SER A CA    1 
ATOM   2207 C C     . SER C 3 114 ? 48.796  61.333 105.154 1.00 54.76  ? 108 SER A C     1 
ATOM   2208 O O     . SER C 3 114 ? 49.189  62.423 104.731 1.00 57.17  ? 108 SER A O     1 
ATOM   2209 C CB    . SER C 3 114 ? 50.624  59.807 105.848 1.00 48.28  ? 108 SER A CB    1 
ATOM   2210 O OG    . SER C 3 114 ? 51.536  59.511 106.878 1.00 55.58  ? 108 SER A OG    1 
ATOM   2211 N N     . ASP C 3 115 ? 47.790  60.666 104.593 1.00 49.47  ? 109 ASP A N     1 
ATOM   2212 C CA    . ASP C 3 115 ? 47.099  61.206 103.434 1.00 48.47  ? 109 ASP A CA    1 
ATOM   2213 C C     . ASP C 3 115 ? 46.226  62.391 103.764 1.00 55.27  ? 109 ASP A C     1 
ATOM   2214 O O     . ASP C 3 115 ? 45.511  62.888 102.900 1.00 61.90  ? 109 ASP A O     1 
ATOM   2215 C CB    . ASP C 3 115 ? 46.305  60.136 102.707 1.00 49.94  ? 109 ASP A CB    1 
ATOM   2216 C CG    . ASP C 3 115 ? 47.172  58.984 102.279 1.00 70.79  ? 109 ASP A CG    1 
ATOM   2217 O OD1   . ASP C 3 115 ? 48.404  59.180 102.141 1.00 72.54  ? 109 ASP A OD1   1 
ATOM   2218 O OD2   . ASP C 3 115 ? 46.635  57.867 102.122 1.00 77.90  ? 109 ASP A OD2   1 
ATOM   2219 N N     . SER C 3 116 ? 46.295  62.868 105.000 1.00 45.71  ? 110 SER A N     1 
ATOM   2220 C CA    . SER C 3 116 ? 45.520  64.034 105.375 1.00 43.78  ? 110 SER A CA    1 
ATOM   2221 C C     . SER C 3 116 ? 46.407  65.264 105.441 1.00 48.85  ? 110 SER A C     1 
ATOM   2222 O O     . SER C 3 116 ? 47.588  65.189 105.777 1.00 49.55  ? 110 SER A O     1 
ATOM   2223 C CB    . SER C 3 116 ? 44.756  63.830 106.675 1.00 45.25  ? 110 SER A CB    1 
ATOM   2224 O OG    . SER C 3 116 ? 45.581  63.230 107.647 1.00 65.37  ? 110 SER A OG    1 
ATOM   2225 N N     . ASN C 3 117 ? 45.819  66.388 105.067 1.00 45.76  ? 111 ASN A N     1 
ATOM   2226 C CA    . ASN C 3 117 ? 46.499  67.667 105.028 1.00 45.73  ? 111 ASN A CA    1 
ATOM   2227 C C     . ASN C 3 117 ? 46.972  68.094 106.432 1.00 49.96  ? 111 ASN A C     1 
ATOM   2228 O O     . ASN C 3 117 ? 48.147  68.424 106.619 1.00 50.36  ? 111 ASN A O     1 
ATOM   2229 C CB    . ASN C 3 117 ? 45.562  68.688 104.368 1.00 45.27  ? 111 ASN A CB    1 
ATOM   2230 C CG    . ASN C 3 117 ? 46.185  70.037 104.214 1.00 51.29  ? 111 ASN A CG    1 
ATOM   2231 O OD1   . ASN C 3 117 ? 47.260  70.181 103.635 1.00 59.29  ? 111 ASN A OD1   1 
ATOM   2232 N ND2   . ASN C 3 117 ? 45.507  71.049 104.729 1.00 37.07  ? 111 ASN A ND2   1 
ATOM   2233 N N     . ALA C 3 118 ? 46.078  68.030 107.418 1.00 44.92  ? 112 ALA A N     1 
ATOM   2234 C CA    . ALA C 3 118 ? 46.421  68.359 108.800 1.00 43.42  ? 112 ALA A CA    1 
ATOM   2235 C C     . ALA C 3 118 ? 47.640  67.562 109.278 1.00 44.86  ? 112 ALA A C     1 
ATOM   2236 O O     . ALA C 3 118 ? 48.633  68.126 109.722 1.00 43.76  ? 112 ALA A O     1 
ATOM   2237 C CB    . ALA C 3 118 ? 45.234  68.084 109.707 1.00 43.93  ? 112 ALA A CB    1 
ATOM   2238 N N     . VAL C 3 119 ? 47.554  66.242 109.177 1.00 40.86  ? 113 VAL A N     1 
ATOM   2239 C CA    . VAL C 3 119 ? 48.634  65.369 109.600 1.00 40.74  ? 113 VAL A CA    1 
ATOM   2240 C C     . VAL C 3 119 ? 49.918  65.573 108.804 1.00 48.86  ? 113 VAL A C     1 
ATOM   2241 O O     . VAL C 3 119 ? 51.012  65.478 109.355 1.00 50.98  ? 113 VAL A O     1 
ATOM   2242 C CB    . VAL C 3 119 ? 48.196  63.906 109.551 1.00 43.94  ? 113 VAL A CB    1 
ATOM   2243 C CG1   . VAL C 3 119 ? 49.396  62.966 109.710 1.00 43.63  ? 113 VAL A CG1   1 
ATOM   2244 C CG2   . VAL C 3 119 ? 47.109  63.650 110.607 1.00 43.06  ? 113 VAL A CG2   1 
ATOM   2245 N N     . SER C 3 120 ? 49.786  65.859 107.513 1.00 45.64  ? 114 SER A N     1 
ATOM   2246 C CA    . SER C 3 120 ? 50.949  66.104 106.671 1.00 45.62  ? 114 SER A CA    1 
ATOM   2247 C C     . SER C 3 120 ? 51.645  67.389 107.117 1.00 49.80  ? 114 SER A C     1 
ATOM   2248 O O     . SER C 3 120 ? 52.859  67.422 107.324 1.00 50.26  ? 114 SER A O     1 
ATOM   2249 C CB    . SER C 3 120 ? 50.534  66.212 105.204 1.00 50.69  ? 114 SER A CB    1 
ATOM   2250 O OG    . SER C 3 120 ? 50.690  64.965 104.544 1.00 62.80  ? 114 SER A OG    1 
ATOM   2251 N N     . LEU C 3 121 ? 50.868  68.447 107.289 1.00 45.74  ? 115 LEU A N     1 
ATOM   2252 C CA    . LEU C 3 121 ? 51.432  69.706 107.738 1.00 45.46  ? 115 LEU A CA    1 
ATOM   2253 C C     . LEU C 3 121 ? 52.108  69.565 109.105 1.00 45.69  ? 115 LEU A C     1 
ATOM   2254 O O     . LEU C 3 121 ? 53.296  69.808 109.232 1.00 46.44  ? 115 LEU A O     1 
ATOM   2255 C CB    . LEU C 3 121 ? 50.359  70.792 107.765 1.00 46.42  ? 115 LEU A CB    1 
ATOM   2256 C CG    . LEU C 3 121 ? 49.796  71.215 106.405 1.00 52.64  ? 115 LEU A CG    1 
ATOM   2257 C CD1   . LEU C 3 121 ? 48.905  72.436 106.596 1.00 54.00  ? 115 LEU A CD1   1 
ATOM   2258 C CD2   . LEU C 3 121 ? 50.905  71.490 105.391 1.00 54.33  ? 115 LEU A CD2   1 
ATOM   2259 N N     . VAL C 3 122 ? 51.358  69.153 110.122 1.00 39.55  ? 116 VAL A N     1 
ATOM   2260 C CA    . VAL C 3 122 ? 51.911  68.998 111.469 1.00 38.19  ? 116 VAL A CA    1 
ATOM   2261 C C     . VAL C 3 122 ? 53.224  68.223 111.497 1.00 39.80  ? 116 VAL A C     1 
ATOM   2262 O O     . VAL C 3 122 ? 54.179  68.614 112.169 1.00 40.73  ? 116 VAL A O     1 
ATOM   2263 C CB    . VAL C 3 122 ? 50.896  68.356 112.448 1.00 42.59  ? 116 VAL A CB    1 
ATOM   2264 C CG1   . VAL C 3 122 ? 51.301  66.931 112.796 1.00 42.45  ? 116 VAL A CG1   1 
ATOM   2265 C CG2   . VAL C 3 122 ? 50.754  69.195 113.714 1.00 42.11  ? 116 VAL A CG2   1 
ATOM   2266 N N     . MET C 3 123 ? 53.276  67.110 110.784 1.00 33.92  ? 117 MET A N     1 
ATOM   2267 C CA    . MET C 3 123 ? 54.496  66.321 110.752 1.00 33.56  ? 117 MET A CA    1 
ATOM   2268 C C     . MET C 3 123 ? 55.624  67.249 110.261 1.00 43.82  ? 117 MET A C     1 
ATOM   2269 O O     . MET C 3 123 ? 56.698  67.318 110.874 1.00 43.30  ? 117 MET A O     1 
ATOM   2270 C CB    . MET C 3 123 ? 54.306  65.102 109.836 1.00 34.77  ? 117 MET A CB    1 
ATOM   2271 C CG    . MET C 3 123 ? 55.025  63.818 110.255 1.00 38.14  ? 117 MET A CG    1 
ATOM   2272 S SD    . MET C 3 123 ? 55.102  63.480 112.016 1.00 42.28  ? 117 MET A SD    1 
ATOM   2273 C CE    . MET C 3 123 ? 56.821  63.100 112.208 1.00 38.42  ? 117 MET A CE    1 
ATOM   2274 N N     . ARG C 3 124 ? 55.346  67.991 109.185 1.00 42.40  ? 118 ARG A N     1 
ATOM   2275 C CA    . ARG C 3 124 ? 56.292  68.945 108.595 1.00 41.11  ? 118 ARG A CA    1 
ATOM   2276 C C     . ARG C 3 124 ? 56.732  69.993 109.612 1.00 43.98  ? 118 ARG A C     1 
ATOM   2277 O O     . ARG C 3 124 ? 57.910  70.321 109.706 1.00 46.37  ? 118 ARG A O     1 
ATOM   2278 C CB    . ARG C 3 124 ? 55.646  69.652 107.400 1.00 42.48  ? 118 ARG A CB    1 
ATOM   2279 C CG    . ARG C 3 124 ? 56.480  69.676 106.137 1.00 59.92  ? 118 ARG A CG    1 
ATOM   2280 C CD    . ARG C 3 124 ? 55.693  70.250 104.970 1.00 63.70  ? 118 ARG A CD    1 
ATOM   2281 N NE    . ARG C 3 124 ? 56.482  71.201 104.195 1.00 70.58  ? 118 ARG A NE    1 
ATOM   2282 C CZ    . ARG C 3 124 ? 56.040  71.840 103.115 1.00 92.20  ? 118 ARG A CZ    1 
ATOM   2283 N NH1   . ARG C 3 124 ? 54.799  71.652 102.689 1.00 79.14  ? 118 ARG A NH1   1 
ATOM   2284 N NH2   . ARG C 3 124 ? 56.827  72.695 102.480 1.00 83.43  ? 118 ARG A NH2   1 
ATOM   2285 N N     . ARG C 3 125 ? 55.784  70.516 110.377 1.00 38.28  ? 119 ARG A N     1 
ATOM   2286 C CA    . ARG C 3 125 ? 56.090  71.534 111.373 1.00 38.73  ? 119 ARG A CA    1 
ATOM   2287 C C     . ARG C 3 125 ? 56.945  71.013 112.513 1.00 47.90  ? 119 ARG A C     1 
ATOM   2288 O O     . ARG C 3 125 ? 57.912  71.658 112.913 1.00 47.80  ? 119 ARG A O     1 
ATOM   2289 C CB    . ARG C 3 125 ? 54.805  72.105 111.946 1.00 38.36  ? 119 ARG A CB    1 
ATOM   2290 C CG    . ARG C 3 125 ? 54.746  72.043 113.439 1.00 46.25  ? 119 ARG A CG    1 
ATOM   2291 C CD    . ARG C 3 125 ? 54.147  73.299 113.997 1.00 49.64  ? 119 ARG A CD    1 
ATOM   2292 N NE    . ARG C 3 125 ? 53.717  73.096 115.372 1.00 67.76  ? 119 ARG A NE    1 
ATOM   2293 C CZ    . ARG C 3 125 ? 52.551  73.504 115.850 1.00 93.42  ? 119 ARG A CZ    1 
ATOM   2294 N NH1   . ARG C 3 125 ? 51.690  74.121 115.050 1.00 90.82  ? 119 ARG A NH1   1 
ATOM   2295 N NH2   . ARG C 3 125 ? 52.235  73.274 117.118 1.00 78.57  ? 119 ARG A NH2   1 
ATOM   2296 N N     . ILE C 3 126 ? 56.554  69.861 113.059 1.00 48.14  ? 120 ILE A N     1 
ATOM   2297 C CA    . ILE C 3 126 ? 57.266  69.228 114.177 1.00 47.02  ? 120 ILE A CA    1 
ATOM   2298 C C     . ILE C 3 126 ? 58.707  68.898 113.807 1.00 49.85  ? 120 ILE A C     1 
ATOM   2299 O O     . ILE C 3 126 ? 59.617  69.063 114.615 1.00 49.88  ? 120 ILE A O     1 
ATOM   2300 C CB    . ILE C 3 126 ? 56.565  67.920 114.651 1.00 49.09  ? 120 ILE A CB    1 
ATOM   2301 C CG1   . ILE C 3 126 ? 55.324  68.234 115.500 1.00 47.96  ? 120 ILE A CG1   1 
ATOM   2302 C CG2   . ILE C 3 126 ? 57.541  67.036 115.426 1.00 48.01  ? 120 ILE A CG2   1 
ATOM   2303 C CD1   . ILE C 3 126 ? 54.482  67.010 115.829 1.00 39.69  ? 120 ILE A CD1   1 
ATOM   2304 N N     . ARG C 3 127 ? 58.908  68.406 112.592 1.00 45.28  ? 121 ARG A N     1 
ATOM   2305 C CA    . ARG C 3 127 ? 60.242  68.064 112.141 1.00 45.14  ? 121 ARG A CA    1 
ATOM   2306 C C     . ARG C 3 127 ? 61.077  69.328 112.196 1.00 53.35  ? 121 ARG A C     1 
ATOM   2307 O O     . ARG C 3 127 ? 62.211  69.319 112.679 1.00 54.86  ? 121 ARG A O     1 
ATOM   2308 C CB    . ARG C 3 127 ? 60.189  67.536 110.709 1.00 45.73  ? 121 ARG A CB    1 
ATOM   2309 C CG    . ARG C 3 127 ? 61.495  66.950 110.211 1.00 52.25  ? 121 ARG A CG    1 
ATOM   2310 C CD    . ARG C 3 127 ? 61.351  66.470 108.785 1.00 55.99  ? 121 ARG A CD    1 
ATOM   2311 N NE    . ARG C 3 127 ? 62.399  65.528 108.413 1.00 75.08  ? 121 ARG A NE    1 
ATOM   2312 C CZ    . ARG C 3 127 ? 62.281  64.208 108.517 1.00 100.00 ? 121 ARG A CZ    1 
ATOM   2313 N NH1   . ARG C 3 127 ? 61.164  63.678 109.000 1.00 94.55  ? 121 ARG A NH1   1 
ATOM   2314 N NH2   . ARG C 3 127 ? 63.277  63.413 108.144 1.00 100.00 ? 121 ARG A NH2   1 
ATOM   2315 N N     . LYS C 3 128 ? 60.489  70.421 111.715 1.00 50.62  ? 122 LYS A N     1 
ATOM   2316 C CA    . LYS C 3 128 ? 61.143  71.729 111.686 1.00 49.81  ? 122 LYS A CA    1 
ATOM   2317 C C     . LYS C 3 128 ? 61.452  72.190 113.101 1.00 54.88  ? 122 LYS A C     1 
ATOM   2318 O O     . LYS C 3 128 ? 62.610  72.386 113.461 1.00 55.27  ? 122 LYS A O     1 
ATOM   2319 C CB    . LYS C 3 128 ? 60.230  72.751 111.000 1.00 52.10  ? 122 LYS A CB    1 
ATOM   2320 C CG    . LYS C 3 128 ? 60.728  74.192 111.023 1.00 51.16  ? 122 LYS A CG    1 
ATOM   2321 C CD    . LYS C 3 128 ? 60.181  74.961 109.824 1.00 57.90  ? 122 LYS A CD    1 
ATOM   2322 C CE    . LYS C 3 128 ? 60.446  76.447 109.935 1.00 68.98  ? 122 LYS A CE    1 
ATOM   2323 N NZ    . LYS C 3 128 ? 59.201  77.206 110.257 1.00 75.63  ? 122 LYS A NZ    1 
ATOM   2324 N N     . GLU C 3 129 ? 60.404  72.343 113.904 1.00 51.61  ? 123 GLU A N     1 
ATOM   2325 C CA    . GLU C 3 129 ? 60.522  72.781 115.294 1.00 50.10  ? 123 GLU A CA    1 
ATOM   2326 C C     . GLU C 3 129 ? 61.567  72.046 116.118 1.00 53.93  ? 123 GLU A C     1 
ATOM   2327 O O     . GLU C 3 129 ? 62.246  72.651 116.940 1.00 55.28  ? 123 GLU A O     1 
ATOM   2328 C CB    . GLU C 3 129 ? 59.175  72.651 116.004 1.00 50.88  ? 123 GLU A CB    1 
ATOM   2329 C CG    . GLU C 3 129 ? 58.020  73.364 115.314 1.00 59.68  ? 123 GLU A CG    1 
ATOM   2330 C CD    . GLU C 3 129 ? 56.887  73.686 116.275 1.00 74.88  ? 123 GLU A CD    1 
ATOM   2331 O OE1   . GLU C 3 129 ? 56.632  72.870 117.184 1.00 82.58  ? 123 GLU A OE1   1 
ATOM   2332 O OE2   . GLU C 3 129 ? 56.254  74.754 116.134 1.00 69.67  ? 123 GLU A OE2   1 
ATOM   2333 N N     . ASN C 3 130 ? 61.664  70.736 115.942 1.00 49.42  ? 124 ASN A N     1 
ATOM   2334 C CA    . ASN C 3 130 ? 62.606  69.956 116.726 1.00 48.22  ? 124 ASN A CA    1 
ATOM   2335 C C     . ASN C 3 130 ? 64.058  70.187 116.330 1.00 49.31  ? 124 ASN A C     1 
ATOM   2336 O O     . ASN C 3 130 ? 64.902  70.445 117.182 1.00 48.39  ? 124 ASN A O     1 
ATOM   2337 C CB    . ASN C 3 130 ? 62.219  68.473 116.745 1.00 48.82  ? 124 ASN A CB    1 
ATOM   2338 C CG    . ASN C 3 130 ? 61.025  68.200 117.647 1.00 58.45  ? 124 ASN A CG    1 
ATOM   2339 O OD1   . ASN C 3 130 ? 60.225  69.094 117.927 1.00 56.75  ? 124 ASN A OD1   1 
ATOM   2340 N ND2   . ASN C 3 130 ? 60.892  66.956 118.090 1.00 42.77  ? 124 ASN A ND2   1 
ATOM   2341 N N     . VAL C 3 131 ? 64.340  70.116 115.036 1.00 45.59  ? 125 VAL A N     1 
ATOM   2342 C CA    . VAL C 3 131 ? 65.693  70.353 114.547 1.00 45.25  ? 125 VAL A CA    1 
ATOM   2343 C C     . VAL C 3 131 ? 66.158  71.696 115.117 1.00 51.13  ? 125 VAL A C     1 
ATOM   2344 O O     . VAL C 3 131 ? 67.281  71.834 115.611 1.00 52.82  ? 125 VAL A O     1 
ATOM   2345 C CB    . VAL C 3 131 ? 65.713  70.411 112.999 1.00 47.42  ? 125 VAL A CB    1 
ATOM   2346 C CG1   . VAL C 3 131 ? 67.052  70.919 112.483 1.00 46.45  ? 125 VAL A CG1   1 
ATOM   2347 C CG2   . VAL C 3 131 ? 65.380  69.051 112.415 1.00 47.15  ? 125 VAL A CG2   1 
ATOM   2348 N N     . ASP C 3 132 ? 65.264  72.674 115.075 1.00 45.05  ? 126 ASP A N     1 
ATOM   2349 C CA    . ASP C 3 132 ? 65.562  74.008 115.554 1.00 43.37  ? 126 ASP A CA    1 
ATOM   2350 C C     . ASP C 3 132 ? 65.636  74.087 117.058 1.00 51.17  ? 126 ASP A C     1 
ATOM   2351 O O     . ASP C 3 132 ? 65.308  75.119 117.635 1.00 54.85  ? 126 ASP A O     1 
ATOM   2352 C CB    . ASP C 3 132 ? 64.507  74.987 115.058 1.00 44.89  ? 126 ASP A CB    1 
ATOM   2353 C CG    . ASP C 3 132 ? 64.854  75.577 113.710 1.00 58.15  ? 126 ASP A CG    1 
ATOM   2354 O OD1   . ASP C 3 132 ? 65.883  75.159 113.139 1.00 57.24  ? 126 ASP A OD1   1 
ATOM   2355 O OD2   . ASP C 3 132 ? 64.100  76.448 113.216 1.00 65.37  ? 126 ASP A OD2   1 
ATOM   2356 N N     . ALA C 3 133 ? 66.071  73.020 117.711 1.00 46.97  ? 127 ALA A N     1 
ATOM   2357 C CA    . ALA C 3 133 ? 66.161  73.079 119.160 1.00 46.39  ? 127 ALA A CA    1 
ATOM   2358 C C     . ALA C 3 133 ? 67.224  72.166 119.704 1.00 52.48  ? 127 ALA A C     1 
ATOM   2359 O O     . ALA C 3 133 ? 67.436  72.112 120.905 1.00 54.46  ? 127 ALA A O     1 
ATOM   2360 C CB    . ALA C 3 133 ? 64.830  72.803 119.795 1.00 47.02  ? 127 ALA A CB    1 
ATOM   2361 N N     . GLY C 3 134 ? 67.909  71.458 118.818 1.00 50.90  ? 128 GLY A N     1 
ATOM   2362 C CA    . GLY C 3 134 ? 68.996  70.596 119.252 1.00 52.51  ? 128 GLY A CA    1 
ATOM   2363 C C     . GLY C 3 134 ? 68.857  69.126 118.916 1.00 63.02  ? 128 GLY A C     1 
ATOM   2364 O O     . GLY C 3 134 ? 69.837  68.384 118.989 1.00 65.43  ? 128 GLY A O     1 
ATOM   2365 N N     . GLU C 3 135 ? 67.655  68.689 118.556 1.00 60.53  ? 129 GLU A N     1 
ATOM   2366 C CA    . GLU C 3 135 ? 67.481  67.281 118.252 1.00 58.61  ? 129 GLU A CA    1 
ATOM   2367 C C     . GLU C 3 135 ? 68.621  66.719 117.418 1.00 60.37  ? 129 GLU A C     1 
ATOM   2368 O O     . GLU C 3 135 ? 68.854  67.129 116.273 1.00 57.87  ? 129 GLU A O     1 
ATOM   2369 C CB    . GLU C 3 135 ? 66.119  66.960 117.652 1.00 59.80  ? 129 GLU A CB    1 
ATOM   2370 C CG    . GLU C 3 135 ? 65.698  65.512 117.915 1.00 66.39  ? 129 GLU A CG    1 
ATOM   2371 C CD    . GLU C 3 135 ? 64.207  65.297 117.781 1.00 79.40  ? 129 GLU A CD    1 
ATOM   2372 O OE1   . GLU C 3 135 ? 63.435  65.820 118.612 1.00 69.33  ? 129 GLU A OE1   1 
ATOM   2373 O OE2   . GLU C 3 135 ? 63.804  64.607 116.829 1.00 68.45  ? 129 GLU A OE2   1 
ATOM   2374 N N     . ARG C 3 136 ? 69.344  65.787 118.032 1.00 56.57  ? 130 ARG A N     1 
ATOM   2375 C CA    . ARG C 3 136 ? 70.480  65.139 117.397 1.00 55.51  ? 130 ARG A CA    1 
ATOM   2376 C C     . ARG C 3 136 ? 70.342  63.628 117.356 1.00 57.26  ? 130 ARG A C     1 
ATOM   2377 O O     . ARG C 3 136 ? 70.220  62.976 118.389 1.00 59.27  ? 130 ARG A O     1 
ATOM   2378 C CB    . ARG C 3 136 ? 71.764  65.474 118.150 1.00 55.77  ? 130 ARG A CB    1 
ATOM   2379 C CG    . ARG C 3 136 ? 72.725  66.312 117.360 1.00 41.07  ? 130 ARG A CG    1 
ATOM   2380 C CD    . ARG C 3 136 ? 72.256  67.713 117.412 1.00 46.44  ? 130 ARG A CD    1 
ATOM   2381 N NE    . ARG C 3 136 ? 73.380  68.619 117.382 1.00 72.02  ? 130 ARG A NE    1 
ATOM   2382 C CZ    . ARG C 3 136 ? 73.276  69.924 117.155 1.00 99.31  ? 130 ARG A CZ    1 
ATOM   2383 N NH1   . ARG C 3 136 ? 72.081  70.496 117.015 1.00 99.30  ? 130 ARG A NH1   1 
ATOM   2384 N NH2   . ARG C 3 136 ? 74.375  70.666 117.115 1.00 86.71  ? 130 ARG A NH2   1 
ATOM   2385 N N     . ALA C 3 137 ? 70.425  63.063 116.164 1.00 50.56  ? 131 ALA A N     1 
ATOM   2386 C CA    . ALA C 3 137 ? 70.351  61.624 116.056 1.00 49.90  ? 131 ALA A CA    1 
ATOM   2387 C C     . ALA C 3 137 ? 71.643  61.189 116.700 1.00 55.75  ? 131 ALA A C     1 
ATOM   2388 O O     . ALA C 3 137 ? 72.633  61.904 116.637 1.00 59.50  ? 131 ALA A O     1 
ATOM   2389 C CB    . ALA C 3 137 ? 70.322  61.201 114.598 1.00 50.54  ? 131 ALA A CB    1 
ATOM   2390 N N     . LYS C 3 138 ? 71.643  60.043 117.350 1.00 51.69  ? 132 LYS A N     1 
ATOM   2391 C CA    . LYS C 3 138 ? 72.857  59.591 117.984 1.00 52.10  ? 132 LYS A CA    1 
ATOM   2392 C C     . LYS C 3 138 ? 73.303  58.313 117.315 1.00 59.12  ? 132 LYS A C     1 
ATOM   2393 O O     . LYS C 3 138 ? 72.588  57.753 116.483 1.00 60.82  ? 132 LYS A O     1 
ATOM   2394 C CB    . LYS C 3 138 ? 72.630  59.379 119.479 1.00 55.93  ? 132 LYS A CB    1 
ATOM   2395 C CG    . LYS C 3 138 ? 71.567  60.299 120.063 1.00 84.56  ? 132 LYS A CG    1 
ATOM   2396 C CD    . LYS C 3 138 ? 72.131  61.178 121.164 1.00 95.69  ? 132 LYS A CD    1 
ATOM   2397 C CE    . LYS C 3 138 ? 72.195  60.420 122.487 1.00 100.00 ? 132 LYS A CE    1 
ATOM   2398 N NZ    . LYS C 3 138 ? 72.999  61.124 123.528 1.00 99.35  ? 132 LYS A NZ    1 
ATOM   2399 N N     . GLN C 3 139 ? 74.506  57.876 117.658 1.00 57.10  ? 133 GLN A N     1 
ATOM   2400 C CA    . GLN C 3 139 ? 75.073  56.647 117.127 1.00 57.26  ? 133 GLN A CA    1 
ATOM   2401 C C     . GLN C 3 139 ? 75.964  56.079 118.218 1.00 61.07  ? 133 GLN A C     1 
ATOM   2402 O O     . GLN C 3 139 ? 76.219  56.729 119.231 1.00 60.93  ? 133 GLN A O     1 
ATOM   2403 C CB    . GLN C 3 139 ? 75.894  56.903 115.849 1.00 59.06  ? 133 GLN A CB    1 
ATOM   2404 C CG    . GLN C 3 139 ? 76.751  58.171 115.878 1.00 81.32  ? 133 GLN A CG    1 
ATOM   2405 C CD    . GLN C 3 139 ? 77.630  58.311 114.647 1.00 100.00 ? 133 GLN A CD    1 
ATOM   2406 O OE1   . GLN C 3 139 ? 78.852  58.195 114.726 1.00 100.00 ? 133 GLN A OE1   1 
ATOM   2407 N NE2   . GLN C 3 139 ? 77.007  58.578 113.496 1.00 99.23  ? 133 GLN A NE2   1 
ATOM   2408 N N     . ALA C 3 140 ? 76.431  54.857 118.010 1.00 57.57  ? 134 ALA A N     1 
ATOM   2409 C CA    . ALA C 3 140 ? 77.290  54.187 118.978 1.00 55.97  ? 134 ALA A CA    1 
ATOM   2410 C C     . ALA C 3 140 ? 78.650  54.879 119.167 1.00 58.84  ? 134 ALA A C     1 
ATOM   2411 O O     . ALA C 3 140 ? 79.243  55.403 118.218 1.00 57.87  ? 134 ALA A O     1 
ATOM   2412 C CB    . ALA C 3 140 ? 77.472  52.707 118.603 1.00 55.81  ? 134 ALA A CB    1 
ATOM   2413 N N     . LEU C 3 141 ? 79.132  54.854 120.408 1.00 53.37  ? 135 LEU A N     1 
ATOM   2414 C CA    . LEU C 3 141 ? 80.416  55.435 120.796 1.00 50.62  ? 135 LEU A CA    1 
ATOM   2415 C C     . LEU C 3 141 ? 81.522  54.557 120.242 1.00 51.50  ? 135 LEU A C     1 
ATOM   2416 O O     . LEU C 3 141 ? 81.547  53.356 120.500 1.00 49.92  ? 135 LEU A O     1 
ATOM   2417 C CB    . LEU C 3 141 ? 80.516  55.438 122.323 1.00 50.17  ? 135 LEU A CB    1 
ATOM   2418 C CG    . LEU C 3 141 ? 81.254  56.559 123.048 1.00 53.36  ? 135 LEU A CG    1 
ATOM   2419 C CD1   . LEU C 3 141 ? 81.743  56.021 124.381 1.00 53.24  ? 135 LEU A CD1   1 
ATOM   2420 C CD2   . LEU C 3 141 ? 82.401  57.095 122.206 1.00 54.71  ? 135 LEU A CD2   1 
ATOM   2421 N N     . ALA C 3 142 ? 82.450  55.149 119.502 1.00 48.53  ? 136 ALA A N     1 
ATOM   2422 C CA    . ALA C 3 142 ? 83.523  54.365 118.903 1.00 49.04  ? 136 ALA A CA    1 
ATOM   2423 C C     . ALA C 3 142 ? 84.322  53.507 119.883 1.00 57.71  ? 136 ALA A C     1 
ATOM   2424 O O     . ALA C 3 142 ? 84.728  53.972 120.950 1.00 57.91  ? 136 ALA A O     1 
ATOM   2425 C CB    . ALA C 3 142 ? 84.453  55.244 118.080 1.00 48.94  ? 136 ALA A CB    1 
ATOM   2426 N N     . PHE C 3 143 ? 84.546  52.252 119.503 1.00 55.17  ? 137 PHE A N     1 
ATOM   2427 C CA    . PHE C 3 143 ? 85.399  51.357 120.265 1.00 54.34  ? 137 PHE A CA    1 
ATOM   2428 C C     . PHE C 3 143 ? 86.499  51.055 119.263 1.00 55.02  ? 137 PHE A C     1 
ATOM   2429 O O     . PHE C 3 143 ? 86.312  50.303 118.311 1.00 51.99  ? 137 PHE A O     1 
ATOM   2430 C CB    . PHE C 3 143 ? 84.687  50.078 120.702 1.00 56.50  ? 137 PHE A CB    1 
ATOM   2431 C CG    . PHE C 3 143 ? 85.606  49.070 121.340 1.00 58.95  ? 137 PHE A CG    1 
ATOM   2432 C CD1   . PHE C 3 143 ? 86.128  49.289 122.605 1.00 62.51  ? 137 PHE A CD1   1 
ATOM   2433 C CD2   . PHE C 3 143 ? 85.981  47.917 120.656 1.00 60.43  ? 137 PHE A CD2   1 
ATOM   2434 C CE1   . PHE C 3 143 ? 86.986  48.364 123.190 1.00 62.77  ? 137 PHE A CE1   1 
ATOM   2435 C CE2   . PHE C 3 143 ? 86.844  46.993 121.228 1.00 62.18  ? 137 PHE A CE2   1 
ATOM   2436 C CZ    . PHE C 3 143 ? 87.349  47.218 122.494 1.00 60.66  ? 137 PHE A CZ    1 
ATOM   2437 N N     . GLU C 3 144 ? 87.622  51.735 119.447 1.00 53.08  ? 138 GLU A N     1 
ATOM   2438 C CA    . GLU C 3 144 ? 88.760  51.641 118.544 1.00 54.00  ? 138 GLU A CA    1 
ATOM   2439 C C     . GLU C 3 144 ? 89.947  50.885 119.110 1.00 58.97  ? 138 GLU A C     1 
ATOM   2440 O O     . GLU C 3 144 ? 89.993  50.544 120.290 1.00 56.76  ? 138 GLU A O     1 
ATOM   2441 C CB    . GLU C 3 144 ? 89.191  53.040 118.111 1.00 55.81  ? 138 GLU A CB    1 
ATOM   2442 C CG    . GLU C 3 144 ? 88.294  54.139 118.641 1.00 70.26  ? 138 GLU A CG    1 
ATOM   2443 C CD    . GLU C 3 144 ? 88.197  55.311 117.699 1.00 80.52  ? 138 GLU A CD    1 
ATOM   2444 O OE1   . GLU C 3 144 ? 87.634  55.121 116.601 1.00 71.15  ? 138 GLU A OE1   1 
ATOM   2445 O OE2   . GLU C 3 144 ? 88.693  56.409 118.036 1.00 63.12  ? 138 GLU A OE2   1 
ATOM   2446 N N     . ARG C 3 145 ? 90.915  50.627 118.239 1.00 57.56  ? 139 ARG A N     1 
ATOM   2447 C CA    . ARG C 3 145 ? 92.116  49.927 118.651 1.00 57.00  ? 139 ARG A CA    1 
ATOM   2448 C C     . ARG C 3 145 ? 92.666  50.549 119.925 1.00 61.63  ? 139 ARG A C     1 
ATOM   2449 O O     . ARG C 3 145 ? 93.242  49.856 120.761 1.00 61.59  ? 139 ARG A O     1 
ATOM   2450 C CB    . ARG C 3 145 ? 93.182  49.948 117.553 1.00 52.88  ? 139 ARG A CB    1 
ATOM   2451 C CG    . ARG C 3 145 ? 94.606  49.857 118.089 1.00 58.31  ? 139 ARG A CG    1 
ATOM   2452 C CD    . ARG C 3 145 ? 95.466  48.895 117.278 1.00 68.75  ? 139 ARG A CD    1 
ATOM   2453 N NE    . ARG C 3 145 ? 95.379  47.545 117.821 1.00 79.57  ? 139 ARG A NE    1 
ATOM   2454 C CZ    . ARG C 3 145 ? 95.321  46.437 117.085 1.00 100.00 ? 139 ARG A CZ    1 
ATOM   2455 N NH1   . ARG C 3 145 ? 95.353  46.524 115.763 1.00 100.00 ? 139 ARG A NH1   1 
ATOM   2456 N NH2   . ARG C 3 145 ? 95.201  45.245 117.675 1.00 91.34  ? 139 ARG A NH2   1 
ATOM   2457 N N     . THR C 3 146 ? 92.490  51.855 120.083 1.00 58.51  ? 140 THR A N     1 
ATOM   2458 C CA    . THR C 3 146 ? 92.987  52.507 121.284 1.00 59.58  ? 140 THR A CA    1 
ATOM   2459 C C     . THR C 3 146 ? 92.225  51.980 122.498 1.00 64.47  ? 140 THR A C     1 
ATOM   2460 O O     . THR C 3 146 ? 92.729  51.998 123.620 1.00 62.97  ? 140 THR A O     1 
ATOM   2461 C CB    . THR C 3 146 ? 92.876  54.038 121.199 1.00 75.57  ? 140 THR A CB    1 
ATOM   2462 O OG1   . THR C 3 146 ? 93.949  54.640 121.938 1.00 79.83  ? 140 THR A OG1   1 
ATOM   2463 C CG2   . THR C 3 146 ? 91.538  54.505 121.766 1.00 76.53  ? 140 THR A CG2   1 
ATOM   2464 N N     . ASP C 3 147 ? 91.017  51.481 122.259 1.00 63.89  ? 141 ASP A N     1 
ATOM   2465 C CA    . ASP C 3 147 ? 90.194  50.921 123.326 1.00 64.49  ? 141 ASP A CA    1 
ATOM   2466 C C     . ASP C 3 147 ? 90.426  49.408 123.457 1.00 66.96  ? 141 ASP A C     1 
ATOM   2467 O O     . ASP C 3 147 ? 90.474  48.869 124.563 1.00 64.43  ? 141 ASP A O     1 
ATOM   2468 C CB    . ASP C 3 147 ? 88.718  51.266 123.090 1.00 66.71  ? 141 ASP A CB    1 
ATOM   2469 C CG    . ASP C 3 147 ? 88.487  52.766 122.981 1.00 78.53  ? 141 ASP A CG    1 
ATOM   2470 O OD1   . ASP C 3 147 ? 88.685  53.473 123.996 1.00 82.62  ? 141 ASP A OD1   1 
ATOM   2471 O OD2   . ASP C 3 147 ? 88.133  53.240 121.880 1.00 77.07  ? 141 ASP A OD2   1 
ATOM   2472 N N     . PHE C 3 148 ? 90.620  48.741 122.323 1.00 64.91  ? 142 PHE A N     1 
ATOM   2473 C CA    . PHE C 3 148 ? 90.879  47.309 122.311 1.00 65.44  ? 142 PHE A CA    1 
ATOM   2474 C C     . PHE C 3 148 ? 92.185  47.020 123.046 1.00 70.41  ? 142 PHE A C     1 
ATOM   2475 O O     . PHE C 3 148 ? 92.254  46.121 123.884 1.00 72.78  ? 142 PHE A O     1 
ATOM   2476 C CB    . PHE C 3 148 ? 90.957  46.788 120.873 1.00 67.54  ? 142 PHE A CB    1 
ATOM   2477 C CG    . PHE C 3 148 ? 90.981  45.289 120.771 1.00 70.50  ? 142 PHE A CG    1 
ATOM   2478 C CD1   . PHE C 3 148 ? 90.041  44.515 121.445 1.00 74.50  ? 142 PHE A CD1   1 
ATOM   2479 C CD2   . PHE C 3 148 ? 91.947  44.652 120.004 1.00 74.29  ? 142 PHE A CD2   1 
ATOM   2480 C CE1   . PHE C 3 148 ? 90.062  43.129 121.353 1.00 76.02  ? 142 PHE A CE1   1 
ATOM   2481 C CE2   . PHE C 3 148 ? 91.978  43.273 119.909 1.00 78.09  ? 142 PHE A CE2   1 
ATOM   2482 C CZ    . PHE C 3 148 ? 91.029  42.508 120.581 1.00 76.34  ? 142 PHE A CZ    1 
ATOM   2483 N N     . ASP C 3 149 ? 93.221  47.790 122.733 1.00 63.87  ? 143 ASP A N     1 
ATOM   2484 C CA    . ASP C 3 149 ? 94.522  47.612 123.375 1.00 62.75  ? 143 ASP A CA    1 
ATOM   2485 C C     . ASP C 3 149 ? 94.413  47.808 124.883 1.00 66.40  ? 143 ASP A C     1 
ATOM   2486 O O     . ASP C 3 149 ? 94.980  47.041 125.659 1.00 66.48  ? 143 ASP A O     1 
ATOM   2487 C CB    . ASP C 3 149 ? 95.544  48.605 122.815 1.00 64.20  ? 143 ASP A CB    1 
ATOM   2488 C CG    . ASP C 3 149 ? 96.175  48.129 121.522 1.00 72.12  ? 143 ASP A CG    1 
ATOM   2489 O OD1   . ASP C 3 149 ? 96.385  46.904 121.367 1.00 71.88  ? 143 ASP A OD1   1 
ATOM   2490 O OD2   . ASP C 3 149 ? 96.446  48.987 120.655 1.00 76.38  ? 143 ASP A OD2   1 
ATOM   2491 N N     . GLN C 3 150 ? 93.699  48.860 125.282 1.00 61.79  ? 144 GLN A N     1 
ATOM   2492 C CA    . GLN C 3 150 ? 93.508  49.199 126.690 1.00 59.62  ? 144 GLN A CA    1 
ATOM   2493 C C     . GLN C 3 150 ? 92.891  48.041 127.448 1.00 62.43  ? 144 GLN A C     1 
ATOM   2494 O O     . GLN C 3 150 ? 93.505  47.488 128.355 1.00 62.86  ? 144 GLN A O     1 
ATOM   2495 C CB    . GLN C 3 150 ? 92.627  50.443 126.827 1.00 60.33  ? 144 GLN A CB    1 
ATOM   2496 C CG    . GLN C 3 150 ? 92.616  51.070 128.220 1.00 64.63  ? 144 GLN A CG    1 
ATOM   2497 C CD    . GLN C 3 150 ? 92.104  52.508 128.216 1.00 79.64  ? 144 GLN A CD    1 
ATOM   2498 O OE1   . GLN C 3 150 ? 91.731  53.050 129.253 1.00 72.20  ? 144 GLN A OE1   1 
ATOM   2499 N NE2   . GLN C 3 150 ? 92.095  53.132 127.045 1.00 78.90  ? 144 GLN A NE2   1 
ATOM   2500 N N     . VAL C 3 151 ? 91.672  47.672 127.079 1.00 59.10  ? 145 VAL A N     1 
ATOM   2501 C CA    . VAL C 3 151 ? 91.013  46.566 127.752 1.00 59.32  ? 145 VAL A CA    1 
ATOM   2502 C C     . VAL C 3 151 ? 91.961  45.374 127.671 1.00 64.24  ? 145 VAL A C     1 
ATOM   2503 O O     . VAL C 3 151 ? 92.244  44.722 128.677 1.00 64.05  ? 145 VAL A O     1 
ATOM   2504 C CB    . VAL C 3 151 ? 89.650  46.237 127.114 1.00 63.58  ? 145 VAL A CB    1 
ATOM   2505 C CG1   . VAL C 3 151 ? 88.987  45.085 127.837 1.00 63.55  ? 145 VAL A CG1   1 
ATOM   2506 C CG2   . VAL C 3 151 ? 88.746  47.455 127.145 1.00 63.81  ? 145 VAL A CG2   1 
ATOM   2507 N N     . ARG C 3 152 ? 92.490  45.135 126.474 1.00 61.53  ? 146 ARG A N     1 
ATOM   2508 C CA    . ARG C 3 152 ? 93.433  44.045 126.239 1.00 61.91  ? 146 ARG A CA    1 
ATOM   2509 C C     . ARG C 3 152 ? 94.540  44.050 127.301 1.00 65.56  ? 146 ARG A C     1 
ATOM   2510 O O     . ARG C 3 152 ? 94.994  43.005 127.759 1.00 66.33  ? 146 ARG A O     1 
ATOM   2511 C CB    . ARG C 3 152 ? 94.054  44.184 124.841 1.00 62.91  ? 146 ARG A CB    1 
ATOM   2512 C CG    . ARG C 3 152 ? 93.476  43.255 123.778 1.00 69.30  ? 146 ARG A CG    1 
ATOM   2513 C CD    . ARG C 3 152 ? 94.583  42.495 123.052 1.00 85.26  ? 146 ARG A CD    1 
ATOM   2514 N NE    . ARG C 3 152 ? 94.992  43.143 121.806 1.00 97.91  ? 146 ARG A NE    1 
ATOM   2515 C CZ    . ARG C 3 152 ? 96.151  42.923 121.188 1.00 100.00 ? 146 ARG A CZ    1 
ATOM   2516 N NH1   . ARG C 3 152 ? 97.030  42.070 121.702 1.00 100.00 ? 146 ARG A NH1   1 
ATOM   2517 N NH2   . ARG C 3 152 ? 96.425  43.553 120.050 1.00 100.00 ? 146 ARG A NH2   1 
ATOM   2518 N N     . SER C 3 153 ? 94.977  45.235 127.694 1.00 61.33  ? 147 SER A N     1 
ATOM   2519 C CA    . SER C 3 153 ? 96.038  45.353 128.686 1.00 62.46  ? 147 SER A CA    1 
ATOM   2520 C C     . SER C 3 153 ? 95.531  45.244 130.115 1.00 74.30  ? 147 SER A C     1 
ATOM   2521 O O     . SER C 3 153 ? 96.321  45.143 131.051 1.00 77.24  ? 147 SER A O     1 
ATOM   2522 C CB    . SER C 3 153 ? 96.743  46.698 128.543 1.00 64.23  ? 147 SER A CB    1 
ATOM   2523 O OG    . SER C 3 153 ? 96.454  47.534 129.657 1.00 68.02  ? 147 SER A OG    1 
ATOM   2524 N N     . LEU C 3 154 ? 94.216  45.334 130.290 1.00 71.07  ? 148 LEU A N     1 
ATOM   2525 C CA    . LEU C 3 154 ? 93.632  45.268 131.623 1.00 69.89  ? 148 LEU A CA    1 
ATOM   2526 C C     . LEU C 3 154 ? 93.132  43.885 131.968 1.00 76.59  ? 148 LEU A C     1 
ATOM   2527 O O     . LEU C 3 154 ? 93.090  43.512 133.136 1.00 77.64  ? 148 LEU A O     1 
ATOM   2528 C CB    . LEU C 3 154 ? 92.499  46.277 131.765 1.00 68.89  ? 148 LEU A CB    1 
ATOM   2529 C CG    . LEU C 3 154 ? 92.642  47.225 132.952 1.00 72.57  ? 148 LEU A CG    1 
ATOM   2530 C CD1   . LEU C 3 154 ? 91.997  48.563 132.640 1.00 72.43  ? 148 LEU A CD1   1 
ATOM   2531 C CD2   . LEU C 3 154 ? 92.052  46.615 134.214 1.00 76.64  ? 148 LEU A CD2   1 
ATOM   2532 N N     . MET C 3 155 ? 92.746  43.123 130.956 1.00 74.63  ? 149 MET A N     1 
ATOM   2533 C CA    . MET C 3 155 ? 92.251  41.781 131.204 1.00 75.62  ? 149 MET A CA    1 
ATOM   2534 C C     . MET C 3 155 ? 93.033  40.688 130.487 1.00 83.56  ? 149 MET A C     1 
ATOM   2535 O O     . MET C 3 155 ? 92.502  39.594 130.279 1.00 83.11  ? 149 MET A O     1 
ATOM   2536 C CB    . MET C 3 155 ? 90.764  41.679 130.854 1.00 77.78  ? 149 MET A CB    1 
ATOM   2537 C CG    . MET C 3 155 ? 90.166  42.942 130.256 1.00 81.70  ? 149 MET A CG    1 
ATOM   2538 S SD    . MET C 3 155 ? 88.390  42.768 129.914 1.00 86.72  ? 149 MET A SD    1 
ATOM   2539 C CE    . MET C 3 155 ? 88.331  41.120 129.192 1.00 83.69  ? 149 MET A CE    1 
ATOM   2540 N N     . GLU C 3 156 ? 94.283  40.948 130.112 1.00 81.76  ? 150 GLU A N     1 
ATOM   2541 C CA    . GLU C 3 156 ? 95.021  39.898 129.426 1.00 81.63  ? 150 GLU A CA    1 
ATOM   2542 C C     . GLU C 3 156 ? 95.660  38.811 130.287 1.00 85.62  ? 150 GLU A C     1 
ATOM   2543 O O     . GLU C 3 156 ? 95.730  37.652 129.872 1.00 85.30  ? 150 GLU A O     1 
ATOM   2544 C CB    . GLU C 3 156 ? 95.848  40.383 128.222 1.00 82.92  ? 150 GLU A CB    1 
ATOM   2545 C CG    . GLU C 3 156 ? 97.273  40.849 128.496 1.00 92.31  ? 150 GLU A CG    1 
ATOM   2546 C CD    . GLU C 3 156 ? 97.959  41.397 127.242 1.00 100.00 ? 150 GLU A CD    1 
ATOM   2547 O OE1   . GLU C 3 156 ? 97.283  41.551 126.199 1.00 59.49  ? 150 GLU A OE1   1 
ATOM   2548 O OE2   . GLU C 3 156 ? 99.175  41.673 127.310 1.00 100.00 ? 150 GLU A OE2   1 
ATOM   2549 N N     . ASN C 3 157 ? 96.046  39.160 131.511 1.00 81.60  ? 151 ASN A N     1 
ATOM   2550 C CA    . ASN C 3 157 ? 96.648  38.183 132.407 1.00 81.36  ? 151 ASN A CA    1 
ATOM   2551 C C     . ASN C 3 157 ? 95.674  37.577 133.441 1.00 85.17  ? 151 ASN A C     1 
ATOM   2552 O O     . ASN C 3 157 ? 96.090  36.808 134.312 1.00 86.32  ? 151 ASN A O     1 
ATOM   2553 C CB    . ASN C 3 157 ? 97.918  38.752 133.055 1.00 81.89  ? 151 ASN A CB    1 
ATOM   2554 C CG    . ASN C 3 157 ? 99.008  39.070 132.032 1.00 100.00 ? 151 ASN A CG    1 
ATOM   2555 O OD1   . ASN C 3 157 ? 99.337  38.250 131.179 1.00 97.26  ? 151 ASN A OD1   1 
ATOM   2556 N ND2   . ASN C 3 157 ? 99.570  40.265 132.122 1.00 94.91  ? 151 ASN A ND2   1 
ATOM   2557 N N     . SER C 3 158 ? 94.381  37.885 133.306 1.00 78.57  ? 152 SER A N     1 
ATOM   2558 C CA    . SER C 3 158 ? 93.338  37.398 134.225 1.00 76.64  ? 152 SER A CA    1 
ATOM   2559 C C     . SER C 3 158 ? 92.856  35.960 134.001 1.00 76.61  ? 152 SER A C     1 
ATOM   2560 O O     . SER C 3 158 ? 92.278  35.640 132.964 1.00 75.70  ? 152 SER A O     1 
ATOM   2561 C CB    . SER C 3 158 ? 92.127  38.337 134.215 1.00 79.75  ? 152 SER A CB    1 
ATOM   2562 O OG    . SER C 3 158 ? 90.920  37.602 134.061 1.00 87.10  ? 152 SER A OG    1 
ATOM   2563 N N     . ASP C 3 159 ? 93.040  35.116 135.008 1.00 70.26  ? 153 ASP A N     1 
ATOM   2564 C CA    . ASP C 3 159 ? 92.619  33.722 134.936 1.00 68.84  ? 153 ASP A CA    1 
ATOM   2565 C C     . ASP C 3 159 ? 91.130  33.542 134.624 1.00 65.75  ? 153 ASP A C     1 
ATOM   2566 O O     . ASP C 3 159 ? 90.736  32.546 134.022 1.00 65.90  ? 153 ASP A O     1 
ATOM   2567 C CB    . ASP C 3 159 ? 92.936  33.031 136.266 1.00 72.40  ? 153 ASP A CB    1 
ATOM   2568 C CG    . ASP C 3 159 ? 92.628  33.914 137.471 1.00 91.09  ? 153 ASP A CG    1 
ATOM   2569 O OD1   . ASP C 3 159 ? 92.701  35.159 137.341 1.00 90.79  ? 153 ASP A OD1   1 
ATOM   2570 O OD2   . ASP C 3 159 ? 92.306  33.359 138.543 1.00 100.00 ? 153 ASP A OD2   1 
ATOM   2571 N N     . ARG C 3 160 ? 90.317  34.500 135.067 1.00 56.34  ? 154 ARG A N     1 
ATOM   2572 C CA    . ARG C 3 160 ? 88.856  34.464 134.950 1.00 53.13  ? 154 ARG A CA    1 
ATOM   2573 C C     . ARG C 3 160 ? 88.210  34.133 133.620 1.00 53.08  ? 154 ARG A C     1 
ATOM   2574 O O     . ARG C 3 160 ? 88.276  34.918 132.683 1.00 52.91  ? 154 ARG A O     1 
ATOM   2575 C CB    . ARG C 3 160 ? 88.250  35.760 135.470 1.00 50.27  ? 154 ARG A CB    1 
ATOM   2576 C CG    . ARG C 3 160 ? 88.926  36.301 136.690 1.00 52.38  ? 154 ARG A CG    1 
ATOM   2577 C CD    . ARG C 3 160 ? 87.933  37.057 137.519 1.00 50.40  ? 154 ARG A CD    1 
ATOM   2578 N NE    . ARG C 3 160 ? 87.120  37.941 136.699 1.00 57.13  ? 154 ARG A NE    1 
ATOM   2579 C CZ    . ARG C 3 160 ? 86.358  38.912 137.193 1.00 78.42  ? 154 ARG A CZ    1 
ATOM   2580 N NH1   . ARG C 3 160 ? 86.314  39.119 138.503 1.00 73.80  ? 154 ARG A NH1   1 
ATOM   2581 N NH2   . ARG C 3 160 ? 85.654  39.687 136.380 1.00 53.68  ? 154 ARG A NH2   1 
ATOM   2582 N N     . CYS C 3 161 ? 87.491  33.016 133.588 1.00 48.34  ? 155 CYS A N     1 
ATOM   2583 C CA    . CYS C 3 161 ? 86.758  32.575 132.412 1.00 48.71  ? 155 CYS A CA    1 
ATOM   2584 C C     . CYS C 3 161 ? 86.091  33.743 131.696 1.00 52.72  ? 155 CYS A C     1 
ATOM   2585 O O     . CYS C 3 161 ? 86.605  34.235 130.707 1.00 54.97  ? 155 CYS A O     1 
ATOM   2586 C CB    . CYS C 3 161 ? 85.702  31.556 132.822 1.00 50.96  ? 155 CYS A CB    1 
ATOM   2587 S SG    . CYS C 3 161 ? 85.242  30.369 131.524 1.00 56.19  ? 155 CYS A SG    1 
ATOM   2588 N N     . GLN C 3 162 ? 84.944  34.192 132.193 1.00 49.40  ? 156 GLN A N     1 
ATOM   2589 C CA    . GLN C 3 162 ? 84.218  35.294 131.550 1.00 47.57  ? 156 GLN A CA    1 
ATOM   2590 C C     . GLN C 3 162 ? 85.081  36.509 131.213 1.00 45.44  ? 156 GLN A C     1 
ATOM   2591 O O     . GLN C 3 162 ? 84.651  37.400 130.491 1.00 44.18  ? 156 GLN A O     1 
ATOM   2592 C CB    . GLN C 3 162 ? 82.932  35.664 132.303 1.00 48.81  ? 156 GLN A CB    1 
ATOM   2593 C CG    . GLN C 3 162 ? 82.716  37.156 132.486 1.00 71.77  ? 156 GLN A CG    1 
ATOM   2594 C CD    . GLN C 3 162 ? 81.252  37.577 132.335 1.00 88.14  ? 156 GLN A CD    1 
ATOM   2595 O OE1   . GLN C 3 162 ? 80.937  38.776 132.346 1.00 86.77  ? 156 GLN A OE1   1 
ATOM   2596 N NE2   . GLN C 3 162 ? 80.350  36.593 132.219 1.00 63.55  ? 156 GLN A NE2   1 
ATOM   2597 N N     . ASP C 3 163 ? 86.309  36.527 131.709 1.00 40.42  ? 157 ASP A N     1 
ATOM   2598 C CA    . ASP C 3 163 ? 87.219  37.609 131.383 1.00 42.54  ? 157 ASP A CA    1 
ATOM   2599 C C     . ASP C 3 163 ? 87.887  37.283 130.045 1.00 49.28  ? 157 ASP A C     1 
ATOM   2600 O O     . ASP C 3 163 ? 88.049  38.158 129.191 1.00 48.92  ? 157 ASP A O     1 
ATOM   2601 C CB    . ASP C 3 163 ? 88.267  37.788 132.481 1.00 46.00  ? 157 ASP A CB    1 
ATOM   2602 C CG    . ASP C 3 163 ? 87.959  38.963 133.386 1.00 62.54  ? 157 ASP A CG    1 
ATOM   2603 O OD1   . ASP C 3 163 ? 86.785  39.396 133.396 1.00 64.41  ? 157 ASP A OD1   1 
ATOM   2604 O OD2   . ASP C 3 163 ? 88.886  39.474 134.055 1.00 66.41  ? 157 ASP A OD2   1 
ATOM   2605 N N     . ILE C 3 164 ? 88.255  36.015 129.867 1.00 46.17  ? 158 ILE A N     1 
ATOM   2606 C CA    . ILE C 3 164 ? 88.865  35.565 128.622 1.00 45.59  ? 158 ILE A CA    1 
ATOM   2607 C C     . ILE C 3 164 ? 87.814  35.621 127.516 1.00 50.94  ? 158 ILE A C     1 
ATOM   2608 O O     . ILE C 3 164 ? 88.091  36.098 126.411 1.00 52.76  ? 158 ILE A O     1 
ATOM   2609 C CB    . ILE C 3 164 ? 89.435  34.121 128.716 1.00 47.44  ? 158 ILE A CB    1 
ATOM   2610 C CG1   . ILE C 3 164 ? 88.304  33.098 128.831 1.00 46.82  ? 158 ILE A CG1   1 
ATOM   2611 C CG2   . ILE C 3 164 ? 90.460  34.005 129.841 1.00 47.64  ? 158 ILE A CG2   1 
ATOM   2612 C CD1   . ILE C 3 164 ? 88.686  31.685 128.476 1.00 51.36  ? 158 ILE A CD1   1 
ATOM   2613 N N     . ARG C 3 165 ? 86.604  35.149 127.818 1.00 45.68  ? 159 ARG A N     1 
ATOM   2614 C CA    . ARG C 3 165 ? 85.527  35.149 126.832 1.00 44.43  ? 159 ARG A CA    1 
ATOM   2615 C C     . ARG C 3 165 ? 85.276  36.543 126.299 1.00 53.88  ? 159 ARG A C     1 
ATOM   2616 O O     . ARG C 3 165 ? 85.217  36.750 125.091 1.00 54.80  ? 159 ARG A O     1 
ATOM   2617 C CB    . ARG C 3 165 ? 84.223  34.594 127.405 1.00 38.06  ? 159 ARG A CB    1 
ATOM   2618 C CG    . ARG C 3 165 ? 83.065  34.690 126.416 1.00 38.63  ? 159 ARG A CG    1 
ATOM   2619 C CD    . ARG C 3 165 ? 81.690  34.617 127.070 1.00 43.25  ? 159 ARG A CD    1 
ATOM   2620 N NE    . ARG C 3 165 ? 81.341  35.870 127.738 1.00 55.98  ? 159 ARG A NE    1 
ATOM   2621 C CZ    . ARG C 3 165 ? 80.228  36.066 128.436 1.00 60.53  ? 159 ARG A CZ    1 
ATOM   2622 N NH1   . ARG C 3 165 ? 79.326  35.096 128.551 1.00 39.80  ? 159 ARG A NH1   1 
ATOM   2623 N NH2   . ARG C 3 165 ? 80.022  37.237 129.017 1.00 47.02  ? 159 ARG A NH2   1 
ATOM   2624 N N     . ASN C 3 166 ? 85.114  37.501 127.208 1.00 53.57  ? 160 ASN A N     1 
ATOM   2625 C CA    . ASN C 3 166 ? 84.832  38.877 126.819 1.00 52.85  ? 160 ASN A CA    1 
ATOM   2626 C C     . ASN C 3 166 ? 85.933  39.498 125.973 1.00 55.86  ? 160 ASN A C     1 
ATOM   2627 O O     . ASN C 3 166 ? 85.672  40.446 125.239 1.00 55.43  ? 160 ASN A O     1 
ATOM   2628 C CB    . ASN C 3 166 ? 84.511  39.759 128.026 1.00 52.05  ? 160 ASN A CB    1 
ATOM   2629 C CG    . ASN C 3 166 ? 83.250  39.326 128.759 1.00 52.99  ? 160 ASN A CG    1 
ATOM   2630 O OD1   . ASN C 3 166 ? 82.564  38.386 128.359 1.00 39.85  ? 160 ASN A OD1   1 
ATOM   2631 N ND2   . ASN C 3 166 ? 82.937  40.025 129.840 1.00 44.53  ? 160 ASN A ND2   1 
ATOM   2632 N N     . LEU C 3 167 ? 87.156  38.976 126.057 1.00 52.69  ? 161 LEU A N     1 
ATOM   2633 C CA    . LEU C 3 167 ? 88.241  39.518 125.231 1.00 52.00  ? 161 LEU A CA    1 
ATOM   2634 C C     . LEU C 3 167 ? 88.176  38.999 123.786 1.00 55.05  ? 161 LEU A C     1 
ATOM   2635 O O     . LEU C 3 167 ? 88.399  39.748 122.837 1.00 52.26  ? 161 LEU A O     1 
ATOM   2636 C CB    . LEU C 3 167 ? 89.620  39.309 125.864 1.00 51.82  ? 161 LEU A CB    1 
ATOM   2637 C CG    . LEU C 3 167 ? 90.386  40.607 126.149 1.00 57.17  ? 161 LEU A CG    1 
ATOM   2638 C CD1   . LEU C 3 167 ? 91.681  40.326 126.900 1.00 56.15  ? 161 LEU A CD1   1 
ATOM   2639 C CD2   . LEU C 3 167 ? 90.660  41.362 124.861 1.00 64.86  ? 161 LEU A CD2   1 
ATOM   2640 N N     . ALA C 3 168 ? 87.837  37.729 123.624 1.00 54.07  ? 162 ALA A N     1 
ATOM   2641 C CA    . ALA C 3 168 ? 87.692  37.161 122.299 1.00 54.00  ? 162 ALA A CA    1 
ATOM   2642 C C     . ALA C 3 168 ? 86.624  37.995 121.628 1.00 59.01  ? 162 ALA A C     1 
ATOM   2643 O O     . ALA C 3 168 ? 86.842  38.545 120.554 1.00 59.14  ? 162 ALA A O     1 
ATOM   2644 C CB    . ALA C 3 168 ? 87.242  35.719 122.390 1.00 55.00  ? 162 ALA A CB    1 
ATOM   2645 N N     . PHE C 3 169 ? 85.474  38.103 122.287 1.00 56.46  ? 163 PHE A N     1 
ATOM   2646 C CA    . PHE C 3 169 ? 84.352  38.891 121.778 1.00 54.46  ? 163 PHE A CA    1 
ATOM   2647 C C     . PHE C 3 169 ? 84.862  40.237 121.295 1.00 61.67  ? 163 PHE A C     1 
ATOM   2648 O O     . PHE C 3 169 ? 84.758  40.568 120.114 1.00 62.63  ? 163 PHE A O     1 
ATOM   2649 C CB    . PHE C 3 169 ? 83.315  39.101 122.877 1.00 53.73  ? 163 PHE A CB    1 
ATOM   2650 C CG    . PHE C 3 169 ? 82.030  39.705 122.399 1.00 52.76  ? 163 PHE A CG    1 
ATOM   2651 C CD1   . PHE C 3 169 ? 81.084  38.925 121.745 1.00 52.53  ? 163 PHE A CD1   1 
ATOM   2652 C CD2   . PHE C 3 169 ? 81.742  41.035 122.650 1.00 54.13  ? 163 PHE A CD2   1 
ATOM   2653 C CE1   . PHE C 3 169 ? 79.874  39.460 121.333 1.00 52.30  ? 163 PHE A CE1   1 
ATOM   2654 C CE2   . PHE C 3 169 ? 80.531  41.578 122.249 1.00 57.00  ? 163 PHE A CE2   1 
ATOM   2655 C CZ    . PHE C 3 169 ? 79.596  40.786 121.582 1.00 53.72  ? 163 PHE A CZ    1 
ATOM   2656 N N     . LEU C 3 170 ? 85.456  40.999 122.204 1.00 59.31  ? 164 LEU A N     1 
ATOM   2657 C CA    . LEU C 3 170 ? 85.988  42.302 121.840 1.00 59.14  ? 164 LEU A CA    1 
ATOM   2658 C C     . LEU C 3 170 ? 86.912  42.188 120.637 1.00 63.21  ? 164 LEU A C     1 
ATOM   2659 O O     . LEU C 3 170 ? 87.179  43.180 119.970 1.00 63.71  ? 164 LEU A O     1 
ATOM   2660 C CB    . LEU C 3 170 ? 86.679  42.969 123.034 1.00 59.03  ? 164 LEU A CB    1 
ATOM   2661 C CG    . LEU C 3 170 ? 85.758  43.355 124.211 1.00 62.15  ? 164 LEU A CG    1 
ATOM   2662 C CD1   . LEU C 3 170 ? 86.526  44.102 125.300 1.00 61.57  ? 164 LEU A CD1   1 
ATOM   2663 C CD2   . LEU C 3 170 ? 84.532  44.157 123.758 1.00 59.19  ? 164 LEU A CD2   1 
ATOM   2664 N N     . GLY C 3 171 ? 87.356  40.963 120.350 1.00 60.20  ? 165 GLY A N     1 
ATOM   2665 C CA    . GLY C 3 171 ? 88.233  40.667 119.213 1.00 59.41  ? 165 GLY A CA    1 
ATOM   2666 C C     . GLY C 3 171 ? 87.464  40.282 117.941 1.00 61.62  ? 165 GLY A C     1 
ATOM   2667 O O     . GLY C 3 171 ? 87.647  40.901 116.896 1.00 60.23  ? 165 GLY A O     1 
ATOM   2668 N N     . ILE C 3 172 ? 86.618  39.259 118.020 1.00 59.45  ? 166 ILE A N     1 
ATOM   2669 C CA    . ILE C 3 172 ? 85.835  38.849 116.856 1.00 59.90  ? 166 ILE A CA    1 
ATOM   2670 C C     . ILE C 3 172 ? 85.050  40.069 116.384 1.00 67.58  ? 166 ILE A C     1 
ATOM   2671 O O     . ILE C 3 172 ? 84.740  40.216 115.205 1.00 70.52  ? 166 ILE A O     1 
ATOM   2672 C CB    . ILE C 3 172 ? 84.798  37.749 117.213 1.00 62.20  ? 166 ILE A CB    1 
ATOM   2673 C CG1   . ILE C 3 172 ? 85.480  36.402 117.479 1.00 63.28  ? 166 ILE A CG1   1 
ATOM   2674 C CG2   . ILE C 3 172 ? 83.761  37.616 116.109 1.00 59.50  ? 166 ILE A CG2   1 
ATOM   2675 C CD1   . ILE C 3 172 ? 84.549  35.195 117.299 1.00 70.34  ? 166 ILE A CD1   1 
ATOM   2676 N N     . ALA C 3 173 ? 84.743  40.950 117.327 1.00 63.67  ? 167 ALA A N     1 
ATOM   2677 C CA    . ALA C 3 173 ? 83.932  42.133 117.064 1.00 63.95  ? 167 ALA A CA    1 
ATOM   2678 C C     . ALA C 3 173 ? 84.612  43.375 116.444 1.00 67.76  ? 167 ALA A C     1 
ATOM   2679 O O     . ALA C 3 173 ? 84.039  44.022 115.561 1.00 66.23  ? 167 ALA A O     1 
ATOM   2680 C CB    . ALA C 3 173 ? 83.115  42.499 118.308 1.00 64.56  ? 167 ALA A CB    1 
ATOM   2681 N N     . TYR C 3 174 ? 85.809  43.723 116.917 1.00 64.23  ? 168 TYR A N     1 
ATOM   2682 C CA    . TYR C 3 174 ? 86.550  44.870 116.369 1.00 63.77  ? 168 TYR A CA    1 
ATOM   2683 C C     . TYR C 3 174 ? 87.153  44.387 115.059 1.00 68.90  ? 168 TYR A C     1 
ATOM   2684 O O     . TYR C 3 174 ? 86.901  44.944 113.991 1.00 69.43  ? 168 TYR A O     1 
ATOM   2685 C CB    . TYR C 3 174 ? 87.674  45.318 117.327 1.00 63.95  ? 168 TYR A CB    1 
ATOM   2686 C CG    . TYR C 3 174 ? 88.620  46.387 116.776 1.00 66.22  ? 168 TYR A CG    1 
ATOM   2687 C CD1   . TYR C 3 174 ? 88.264  47.737 116.775 1.00 68.18  ? 168 TYR A CD1   1 
ATOM   2688 C CD2   . TYR C 3 174 ? 89.881  46.051 116.291 1.00 67.53  ? 168 TYR A CD2   1 
ATOM   2689 C CE1   . TYR C 3 174 ? 89.132  48.721 116.281 1.00 67.29  ? 168 TYR A CE1   1 
ATOM   2690 C CE2   . TYR C 3 174 ? 90.757  47.031 115.798 1.00 68.69  ? 168 TYR A CE2   1 
ATOM   2691 C CZ    . TYR C 3 174 ? 90.376  48.361 115.797 1.00 73.54  ? 168 TYR A CZ    1 
ATOM   2692 O OH    . TYR C 3 174 ? 91.234  49.319 115.298 1.00 72.62  ? 168 TYR A OH    1 
ATOM   2693 N N     . ASN C 3 175 ? 87.908  43.299 115.164 1.00 65.28  ? 169 ASN A N     1 
ATOM   2694 C CA    . ASN C 3 175 ? 88.559  42.668 114.030 1.00 64.29  ? 169 ASN A CA    1 
ATOM   2695 C C     . ASN C 3 175 ? 87.596  42.418 112.855 1.00 63.93  ? 169 ASN A C     1 
ATOM   2696 O O     . ASN C 3 175 ? 87.944  42.674 111.707 1.00 62.68  ? 169 ASN A O     1 
ATOM   2697 C CB    . ASN C 3 175 ? 89.229  41.358 114.491 1.00 68.67  ? 169 ASN A CB    1 
ATOM   2698 C CG    . ASN C 3 175 ? 90.183  40.778 113.453 1.00 86.70  ? 169 ASN A CG    1 
ATOM   2699 O OD1   . ASN C 3 175 ? 91.343  40.464 113.752 1.00 52.70  ? 169 ASN A OD1   1 
ATOM   2700 N ND2   . ASN C 3 175 ? 89.692  40.618 112.231 1.00 92.19  ? 169 ASN A ND2   1 
ATOM   2701 N N     . THR C 3 176 ? 86.385  41.940 113.137 1.00 59.18  ? 170 THR A N     1 
ATOM   2702 C CA    . THR C 3 176 ? 85.431  41.619 112.070 1.00 59.03  ? 170 THR A CA    1 
ATOM   2703 C C     . THR C 3 176 ? 84.327  42.605 111.660 1.00 64.48  ? 170 THR A C     1 
ATOM   2704 O O     . THR C 3 176 ? 83.947  42.643 110.490 1.00 65.79  ? 170 THR A O     1 
ATOM   2705 C CB    . THR C 3 176 ? 84.845  40.194 112.208 1.00 60.04  ? 170 THR A CB    1 
ATOM   2706 O OG1   . THR C 3 176 ? 83.658  40.226 113.015 1.00 50.75  ? 170 THR A OG1   1 
ATOM   2707 C CG2   . THR C 3 176 ? 85.879  39.240 112.806 1.00 53.16  ? 170 THR A CG2   1 
ATOM   2708 N N     . LEU C 3 177 ? 83.783  43.360 112.608 1.00 59.98  ? 171 LEU A N     1 
ATOM   2709 C CA    . LEU C 3 177 ? 82.718  44.322 112.306 1.00 58.23  ? 171 LEU A CA    1 
ATOM   2710 C C     . LEU C 3 177 ? 81.365  43.651 112.086 1.00 62.27  ? 171 LEU A C     1 
ATOM   2711 O O     . LEU C 3 177 ? 80.414  44.298 111.638 1.00 61.36  ? 171 LEU A O     1 
ATOM   2712 C CB    . LEU C 3 177 ? 83.081  45.213 111.108 1.00 57.22  ? 171 LEU A CB    1 
ATOM   2713 C CG    . LEU C 3 177 ? 84.311  46.123 111.255 1.00 59.73  ? 171 LEU A CG    1 
ATOM   2714 C CD1   . LEU C 3 177 ? 85.630  45.374 111.107 1.00 59.21  ? 171 LEU A CD1   1 
ATOM   2715 C CD2   . LEU C 3 177 ? 84.238  47.294 110.296 1.00 58.64  ? 171 LEU A CD2   1 
ATOM   2716 N N     . LEU C 3 178 ? 81.287  42.364 112.430 1.00 59.47  ? 172 LEU A N     1 
ATOM   2717 C CA    . LEU C 3 178 ? 80.053  41.579 112.312 1.00 60.08  ? 172 LEU A CA    1 
ATOM   2718 C C     . LEU C 3 178 ? 78.982  42.107 113.258 1.00 65.21  ? 172 LEU A C     1 
ATOM   2719 O O     . LEU C 3 178 ? 79.292  42.565 114.354 1.00 65.77  ? 172 LEU A O     1 
ATOM   2720 C CB    . LEU C 3 178 ? 80.329  40.115 112.655 1.00 59.87  ? 172 LEU A CB    1 
ATOM   2721 C CG    . LEU C 3 178 ? 80.596  39.161 111.492 1.00 64.28  ? 172 LEU A CG    1 
ATOM   2722 C CD1   . LEU C 3 178 ? 81.518  38.047 111.962 1.00 64.78  ? 172 LEU A CD1   1 
ATOM   2723 C CD2   . LEU C 3 178 ? 79.286  38.606 110.930 1.00 66.54  ? 172 LEU A CD2   1 
ATOM   2724 N N     . ARG C 3 179 ? 77.723  42.037 112.855 1.00 61.91  ? 173 ARG A N     1 
ATOM   2725 C CA    . ARG C 3 179 ? 76.680  42.529 113.732 1.00 62.83  ? 173 ARG A CA    1 
ATOM   2726 C C     . ARG C 3 179 ? 76.486  41.585 114.908 1.00 68.17  ? 173 ARG A C     1 
ATOM   2727 O O     . ARG C 3 179 ? 77.003  40.471 114.913 1.00 66.33  ? 173 ARG A O     1 
ATOM   2728 C CB    . ARG C 3 179 ? 75.380  42.776 112.967 1.00 67.31  ? 173 ARG A CB    1 
ATOM   2729 C CG    . ARG C 3 179 ? 75.426  44.014 112.071 1.00 86.24  ? 173 ARG A CG    1 
ATOM   2730 C CD    . ARG C 3 179 ? 74.802  43.745 110.712 1.00 94.43  ? 173 ARG A CD    1 
ATOM   2731 N NE    . ARG C 3 179 ? 74.937  44.884 109.808 1.00 99.20  ? 173 ARG A NE    1 
ATOM   2732 C CZ    . ARG C 3 179 ? 74.497  44.889 108.553 1.00 100.00 ? 173 ARG A CZ    1 
ATOM   2733 N NH1   . ARG C 3 179 ? 73.884  43.817 108.067 1.00 100.00 ? 173 ARG A NH1   1 
ATOM   2734 N NH2   . ARG C 3 179 ? 74.658  45.965 107.789 1.00 89.95  ? 173 ARG A NH2   1 
ATOM   2735 N N     . LEU C 3 180 ? 75.771  42.059 115.922 1.00 67.66  ? 174 LEU A N     1 
ATOM   2736 C CA    . LEU C 3 180 ? 75.518  41.276 117.124 1.00 67.73  ? 174 LEU A CA    1 
ATOM   2737 C C     . LEU C 3 180 ? 74.823  40.006 116.696 1.00 71.18  ? 174 LEU A C     1 
ATOM   2738 O O     . LEU C 3 180 ? 75.397  38.915 116.757 1.00 67.61  ? 174 LEU A O     1 
ATOM   2739 C CB    . LEU C 3 180 ? 74.587  42.052 118.065 1.00 68.16  ? 174 LEU A CB    1 
ATOM   2740 C CG    . LEU C 3 180 ? 75.086  42.601 119.408 1.00 71.45  ? 174 LEU A CG    1 
ATOM   2741 C CD1   . LEU C 3 180 ? 76.558  43.012 119.350 1.00 70.49  ? 174 LEU A CD1   1 
ATOM   2742 C CD2   . LEU C 3 180 ? 74.199  43.761 119.854 1.00 71.34  ? 174 LEU A CD2   1 
ATOM   2743 N N     . ALA C 3 181 ? 73.590  40.166 116.217 1.00 71.76  ? 175 ALA A N     1 
ATOM   2744 C CA    . ALA C 3 181 ? 72.779  39.036 115.764 1.00 73.85  ? 175 ALA A CA    1 
ATOM   2745 C C     . ALA C 3 181 ? 73.599  37.961 115.034 1.00 81.34  ? 175 ALA A C     1 
ATOM   2746 O O     . ALA C 3 181 ? 73.218  36.785 114.979 1.00 82.22  ? 175 ALA A O     1 
ATOM   2747 C CB    . ALA C 3 181 ? 71.627  39.516 114.902 1.00 74.77  ? 175 ALA A CB    1 
ATOM   2748 N N     . GLU C 3 182 ? 74.745  38.366 114.497 1.00 77.04  ? 176 GLU A N     1 
ATOM   2749 C CA    . GLU C 3 182 ? 75.608  37.443 113.771 1.00 76.82  ? 176 GLU A CA    1 
ATOM   2750 C C     . GLU C 3 182 ? 76.758  36.777 114.544 1.00 83.42  ? 176 GLU A C     1 
ATOM   2751 O O     . GLU C 3 182 ? 77.141  35.637 114.226 1.00 83.07  ? 176 GLU A O     1 
ATOM   2752 C CB    . GLU C 3 182 ? 76.058  38.045 112.428 1.00 78.18  ? 176 GLU A CB    1 
ATOM   2753 C CG    . GLU C 3 182 ? 74.998  38.959 111.764 1.00 86.80  ? 176 GLU A CG    1 
ATOM   2754 C CD    . GLU C 3 182 ? 75.580  39.853 110.668 1.00 100.00 ? 176 GLU A CD    1 
ATOM   2755 O OE1   . GLU C 3 182 ? 76.772  39.678 110.339 1.00 89.04  ? 176 GLU A OE1   1 
ATOM   2756 O OE2   . GLU C 3 182 ? 74.858  40.740 110.152 1.00 85.64  ? 176 GLU A OE2   1 
ATOM   2757 N N     . ILE C 3 183 ? 77.310  37.471 115.547 1.00 80.06  ? 177 ILE A N     1 
ATOM   2758 C CA    . ILE C 3 183 ? 78.428  36.921 116.341 1.00 76.44  ? 177 ILE A CA    1 
ATOM   2759 C C     . ILE C 3 183 ? 77.920  35.851 117.290 1.00 73.60  ? 177 ILE A C     1 
ATOM   2760 O O     . ILE C 3 183 ? 78.665  34.968 117.706 1.00 71.32  ? 177 ILE A O     1 
ATOM   2761 C CB    . ILE C 3 183 ? 79.212  37.987 117.146 1.00 77.96  ? 177 ILE A CB    1 
ATOM   2762 C CG1   . ILE C 3 183 ? 80.231  38.702 116.256 1.00 76.38  ? 177 ILE A CG1   1 
ATOM   2763 C CG2   . ILE C 3 183 ? 79.985  37.331 118.290 1.00 77.99  ? 177 ILE A CG2   1 
ATOM   2764 C CD1   . ILE C 3 183 ? 81.220  39.549 117.027 1.00 76.47  ? 177 ILE A CD1   1 
ATOM   2765 N N     . ALA C 3 184 ? 76.636  35.933 117.608 1.00 68.79  ? 178 ALA A N     1 
ATOM   2766 C CA    . ALA C 3 184 ? 75.984  34.947 118.438 1.00 69.55  ? 178 ALA A CA    1 
ATOM   2767 C C     . ALA C 3 184 ? 75.782  33.687 117.593 1.00 77.64  ? 178 ALA A C     1 
ATOM   2768 O O     . ALA C 3 184 ? 75.913  32.562 118.089 1.00 77.58  ? 178 ALA A O     1 
ATOM   2769 C CB    . ALA C 3 184 ? 74.641  35.483 118.925 1.00 69.96  ? 178 ALA A CB    1 
ATOM   2770 N N     . ARG C 3 185 ? 75.485  33.883 116.309 1.00 75.15  ? 179 ARG A N     1 
ATOM   2771 C CA    . ARG C 3 185 ? 75.237  32.745 115.415 1.00 73.39  ? 179 ARG A CA    1 
ATOM   2772 C C     . ARG C 3 185 ? 76.420  31.831 115.113 1.00 72.97  ? 179 ARG A C     1 
ATOM   2773 O O     . ARG C 3 185 ? 76.221  30.674 114.747 1.00 70.26  ? 179 ARG A O     1 
ATOM   2774 C CB    . ARG C 3 185 ? 74.493  33.152 114.135 1.00 74.46  ? 179 ARG A CB    1 
ATOM   2775 C CG    . ARG C 3 185 ? 72.969  33.131 114.264 1.00 76.26  ? 179 ARG A CG    1 
ATOM   2776 C CD    . ARG C 3 185 ? 72.302  33.360 112.916 1.00 77.26  ? 179 ARG A CD    1 
ATOM   2777 N NE    . ARG C 3 185 ? 71.367  34.480 112.941 1.00 84.83  ? 179 ARG A NE    1 
ATOM   2778 C CZ    . ARG C 3 185 ? 71.571  35.655 112.346 1.00 100.00 ? 179 ARG A CZ    1 
ATOM   2779 N NH1   . ARG C 3 185 ? 72.697  35.889 111.678 1.00 95.11  ? 179 ARG A NH1   1 
ATOM   2780 N NH2   . ARG C 3 185 ? 70.653  36.609 112.447 1.00 97.27  ? 179 ARG A NH2   1 
ATOM   2781 N N     . ILE C 3 186 ? 77.639  32.333 115.274 1.00 70.81  ? 180 ILE A N     1 
ATOM   2782 C CA    . ILE C 3 186 ? 78.825  31.527 115.008 1.00 72.54  ? 180 ILE A CA    1 
ATOM   2783 C C     . ILE C 3 186 ? 78.859  30.155 115.692 1.00 81.78  ? 180 ILE A C     1 
ATOM   2784 O O     . ILE C 3 186 ? 78.467  30.015 116.857 1.00 84.72  ? 180 ILE A O     1 
ATOM   2785 C CB    . ILE C 3 186 ? 80.112  32.291 115.346 1.00 75.76  ? 180 ILE A CB    1 
ATOM   2786 C CG1   . ILE C 3 186 ? 80.079  33.676 114.696 1.00 75.90  ? 180 ILE A CG1   1 
ATOM   2787 C CG2   . ILE C 3 186 ? 81.345  31.482 114.933 1.00 76.20  ? 180 ILE A CG2   1 
ATOM   2788 C CD1   . ILE C 3 186 ? 81.264  34.541 115.049 1.00 89.07  ? 180 ILE A CD1   1 
ATOM   2789 N N     . ARG C 3 187 ? 79.330  29.153 114.947 1.00 77.51  ? 181 ARG A N     1 
ATOM   2790 C CA    . ARG C 3 187 ? 79.499  27.796 115.453 1.00 77.76  ? 181 ARG A CA    1 
ATOM   2791 C C     . ARG C 3 187 ? 80.998  27.466 115.372 1.00 89.13  ? 181 ARG A C     1 
ATOM   2792 O O     . ARG C 3 187 ? 81.740  28.133 114.645 1.00 89.08  ? 181 ARG A O     1 
ATOM   2793 C CB    . ARG C 3 187 ? 78.586  26.805 114.722 1.00 71.41  ? 181 ARG A CB    1 
ATOM   2794 C CG    . ARG C 3 187 ? 77.304  26.505 115.508 1.00 71.66  ? 181 ARG A CG    1 
ATOM   2795 C CD    . ARG C 3 187 ? 76.138  26.049 114.646 1.00 73.24  ? 181 ARG A CD    1 
ATOM   2796 N NE    . ARG C 3 187 ? 75.116  27.084 114.542 1.00 87.39  ? 181 ARG A NE    1 
ATOM   2797 C CZ    . ARG C 3 187 ? 75.066  27.978 113.557 1.00 100.00 ? 181 ARG A CZ    1 
ATOM   2798 N NH1   . ARG C 3 187 ? 75.975  27.954 112.587 1.00 100.00 ? 181 ARG A NH1   1 
ATOM   2799 N NH2   . ARG C 3 187 ? 74.107  28.898 113.541 1.00 100.00 ? 181 ARG A NH2   1 
ATOM   2800 N N     . VAL C 3 188 ? 81.469  26.532 116.198 1.00 90.85  ? 182 VAL A N     1 
ATOM   2801 C CA    . VAL C 3 188 ? 82.910  26.215 116.235 1.00 92.47  ? 182 VAL A CA    1 
ATOM   2802 C C     . VAL C 3 188 ? 83.589  25.767 114.935 1.00 93.09  ? 182 VAL A C     1 
ATOM   2803 O O     . VAL C 3 188 ? 84.745  26.121 114.677 1.00 90.42  ? 182 VAL A O     1 
ATOM   2804 C CB    . VAL C 3 188 ? 83.322  25.301 117.424 1.00 98.01  ? 182 VAL A CB    1 
ATOM   2805 C CG1   . VAL C 3 188 ? 84.833  25.036 117.401 1.00 97.44  ? 182 VAL A CG1   1 
ATOM   2806 C CG2   . VAL C 3 188 ? 82.925  25.940 118.754 1.00 98.25  ? 182 VAL A CG2   1 
ATOM   2807 N N     . LYS C 3 189 ? 82.880  24.971 114.143 1.00 89.41  ? 183 LYS A N     1 
ATOM   2808 C CA    . LYS C 3 189 ? 83.412  24.480 112.889 1.00 89.57  ? 183 LYS A CA    1 
ATOM   2809 C C     . LYS C 3 189 ? 83.829  25.692 112.066 1.00 94.71  ? 183 LYS A C     1 
ATOM   2810 O O     . LYS C 3 189 ? 84.966  25.784 111.590 1.00 96.21  ? 183 LYS A O     1 
ATOM   2811 C CB    . LYS C 3 189 ? 82.294  23.763 112.150 1.00 91.66  ? 183 LYS A CB    1 
ATOM   2812 C CG    . LYS C 3 189 ? 80.962  24.517 112.253 1.00 90.56  ? 183 LYS A CG    1 
ATOM   2813 C CD    . LYS C 3 189 ? 79.808  23.727 111.685 1.00 92.37  ? 183 LYS A CD    1 
ATOM   2814 C CE    . LYS C 3 189 ? 79.847  22.279 112.166 1.00 92.93  ? 183 LYS A CE    1 
ATOM   2815 N NZ    . LYS C 3 189 ? 78.496  21.839 112.645 1.00 90.72  ? 183 LYS A NZ    1 
ATOM   2816 N N     . ASP C 3 190 ? 82.884  26.623 111.920 1.00 87.62  ? 184 ASP A N     1 
ATOM   2817 C CA    . ASP C 3 190 ? 83.039  27.844 111.144 1.00 84.67  ? 184 ASP A CA    1 
ATOM   2818 C C     . ASP C 3 190 ? 84.393  28.481 111.378 1.00 88.09  ? 184 ASP A C     1 
ATOM   2819 O O     . ASP C 3 190 ? 84.900  29.239 110.538 1.00 86.01  ? 184 ASP A O     1 
ATOM   2820 C CB    . ASP C 3 190 ? 81.925  28.829 111.517 1.00 84.32  ? 184 ASP A CB    1 
ATOM   2821 C CG    . ASP C 3 190 ? 80.535  28.280 111.272 1.00 83.96  ? 184 ASP A CG    1 
ATOM   2822 O OD1   . ASP C 3 190 ? 80.413  27.030 111.064 1.00 81.81  ? 184 ASP A OD1   1 
ATOM   2823 O OD2   . ASP C 3 190 ? 79.576  29.105 111.320 1.00 92.44  ? 184 ASP A OD2   1 
ATOM   2824 N N     . ILE C 3 191 ? 85.006  28.146 112.507 1.00 86.57  ? 185 ILE A N     1 
ATOM   2825 C CA    . ILE C 3 191 ? 86.314  28.682 112.816 1.00 87.81  ? 185 ILE A CA    1 
ATOM   2826 C C     . ILE C 3 191 ? 87.444  27.717 112.477 1.00 93.70  ? 185 ILE A C     1 
ATOM   2827 O O     . ILE C 3 191 ? 87.893  26.924 113.309 1.00 95.57  ? 185 ILE A O     1 
ATOM   2828 C CB    . ILE C 3 191 ? 86.366  29.366 114.210 1.00 91.43  ? 185 ILE A CB    1 
ATOM   2829 C CG1   . ILE C 3 191 ? 87.773  29.323 114.812 1.00 91.94  ? 185 ILE A CG1   1 
ATOM   2830 C CG2   . ILE C 3 191 ? 85.242  28.843 115.109 1.00 92.16  ? 185 ILE A CG2   1 
ATOM   2831 C CD1   . ILE C 3 191 ? 88.809  30.086 114.013 0.00 99.38  ? 185 ILE A CD1   1 
ATOM   2832 N N     . SER C 3 192 ? 87.812  27.744 111.202 1.00 88.46  ? 186 SER A N     1 
ATOM   2833 C CA    . SER C 3 192 ? 88.894  26.945 110.670 1.00 86.72  ? 186 SER A CA    1 
ATOM   2834 C C     . SER C 3 192 ? 90.102  27.875 110.765 1.00 85.91  ? 186 SER A C     1 
ATOM   2835 O O     . SER C 3 192 ? 89.965  29.025 111.179 1.00 85.15  ? 186 SER A O     1 
ATOM   2836 C CB    . SER C 3 192 ? 88.598  26.532 109.225 1.00 90.55  ? 186 SER A CB    1 
ATOM   2837 O OG    . SER C 3 192 ? 89.419  27.239 108.311 1.00 99.82  ? 186 SER A OG    1 
ATOM   2838 N N     . ARG C 3 193 ? 91.290  27.389 110.399 1.00 80.92  ? 187 ARG A N     1 
ATOM   2839 C CA    . ARG C 3 193 ? 92.524  28.189 110.531 1.00 81.77  ? 187 ARG A CA    1 
ATOM   2840 C C     . ARG C 3 193 ? 93.242  28.657 109.248 1.00 87.49  ? 187 ARG A C     1 
ATOM   2841 O O     . ARG C 3 193 ? 92.634  28.635 108.176 1.00 89.45  ? 187 ARG A O     1 
ATOM   2842 C CB    . ARG C 3 193 ? 93.502  27.519 111.498 1.00 84.45  ? 187 ARG A CB    1 
ATOM   2843 C CG    . ARG C 3 193 ? 92.894  27.125 112.849 1.00 98.28  ? 187 ARG A CG    1 
ATOM   2844 C CD    . ARG C 3 193 ? 93.265  28.138 113.930 1.00 100.00 ? 187 ARG A CD    1 
ATOM   2845 N NE    . ARG C 3 193 ? 93.249  27.573 115.278 1.00 95.47  ? 187 ARG A NE    1 
ATOM   2846 C CZ    . ARG C 3 193 ? 94.245  27.719 116.147 1.00 100.00 ? 187 ARG A CZ    1 
ATOM   2847 N NH1   . ARG C 3 193 ? 95.333  28.398 115.796 1.00 97.91  ? 187 ARG A NH1   1 
ATOM   2848 N NH2   . ARG C 3 193 ? 94.164  27.186 117.359 1.00 100.00 ? 187 ARG A NH2   1 
ATOM   2849 N N     . THR C 3 194 ? 94.509  29.113 109.369 1.00 80.12  ? 188 THR A N     1 
ATOM   2850 C CA    . THR C 3 194 ? 95.310  29.632 108.225 1.00 77.45  ? 188 THR A CA    1 
ATOM   2851 C C     . THR C 3 194 ? 96.799  30.144 108.393 1.00 75.94  ? 188 THR A C     1 
ATOM   2852 O O     . THR C 3 194 ? 97.531  29.642 109.242 1.00 73.29  ? 188 THR A O     1 
ATOM   2853 C CB    . THR C 3 194 ? 94.457  30.481 107.235 1.00 90.19  ? 188 THR A CB    1 
ATOM   2854 O OG1   . THR C 3 194 ? 94.790  30.146 105.883 1.00 100.00 ? 188 THR A OG1   1 
ATOM   2855 C CG2   . THR C 3 194 ? 94.611  31.974 107.473 1.00 88.33  ? 188 THR A CG2   1 
ATOM   2856 N N     . ASP C 3 195 ? 97.225  31.112 107.567 1.00 72.58  ? 189 ASP A N     1 
ATOM   2857 C CA    . ASP C 3 195 ? 98.595  31.690 107.493 1.00 73.44  ? 189 ASP A CA    1 
ATOM   2858 C C     . ASP C 3 195 ? 99.507  31.983 108.707 1.00 79.19  ? 189 ASP A C     1 
ATOM   2859 O O     . ASP C 3 195 ? 99.790  33.142 109.009 1.00 78.32  ? 189 ASP A O     1 
ATOM   2860 C CB    . ASP C 3 195 ? 98.616  32.891 106.538 0.00 75.22  ? 189 ASP A CB    1 
ATOM   2861 C CG    . ASP C 3 195 ? 98.429  32.489 105.090 0.00 83.79  ? 189 ASP A CG    1 
ATOM   2862 O OD1   . ASP C 3 195 ? 98.247  31.286 104.831 0.00 89.50  ? 189 ASP A OD1   1 
ATOM   2863 O OD2   . ASP C 3 195 ? 98.478  33.380 104.214 0.00 84.09  ? 189 ASP A OD2   1 
ATOM   2864 N N     . GLY C 3 196 ? 100.050 30.941 109.328 1.00 77.69  ? 190 GLY A N     1 
ATOM   2865 C CA    . GLY C 3 196 ? 100.939 31.111 110.477 1.00 78.57  ? 190 GLY A CA    1 
ATOM   2866 C C     . GLY C 3 196 ? 100.117 30.679 111.672 1.00 83.98  ? 190 GLY A C     1 
ATOM   2867 O O     . GLY C 3 196 ? 100.401 31.004 112.831 1.00 81.13  ? 190 GLY A O     1 
ATOM   2868 N N     . GLY C 3 197 ? 99.070  29.939 111.348 1.00 84.04  ? 191 GLY A N     1 
ATOM   2869 C CA    . GLY C 3 197 ? 98.141  29.495 112.344 1.00 85.92  ? 191 GLY A CA    1 
ATOM   2870 C C     . GLY C 3 197 ? 97.262  30.707 112.573 1.00 94.57  ? 191 GLY A C     1 
ATOM   2871 O O     . GLY C 3 197 ? 97.087  31.150 113.708 1.00 96.05  ? 191 GLY A O     1 
ATOM   2872 N N     . ARG C 3 198 ? 96.748  31.280 111.492 1.00 89.97  ? 192 ARG A N     1 
ATOM   2873 C CA    . ARG C 3 198 ? 95.856  32.411 111.653 1.00 88.73  ? 192 ARG A CA    1 
ATOM   2874 C C     . ARG C 3 198 ? 94.465  31.814 111.563 1.00 91.84  ? 192 ARG A C     1 
ATOM   2875 O O     . ARG C 3 198 ? 94.243  30.871 110.813 1.00 92.49  ? 192 ARG A O     1 
ATOM   2876 C CB    . ARG C 3 198 ? 96.085  33.486 110.585 1.00 86.61  ? 192 ARG A CB    1 
ATOM   2877 C CG    . ARG C 3 198 ? 96.287  34.873 111.177 1.00 86.32  ? 192 ARG A CG    1 
ATOM   2878 C CD    . ARG C 3 198 ? 97.196  35.744 110.305 1.00 89.96  ? 192 ARG A CD    1 
ATOM   2879 N NE    . ARG C 3 198 ? 98.535  35.170 110.221 1.00 97.21  ? 192 ARG A NE    1 
ATOM   2880 C CZ    . ARG C 3 198 ? 99.623  35.846 109.838 1.00 100.00 ? 192 ARG A CZ    1 
ATOM   2881 N NH1   . ARG C 3 198 ? 99.544  37.145 109.543 1.00 81.97  ? 192 ARG A NH1   1 
ATOM   2882 N NH2   . ARG C 3 198 ? 100.799 35.230 109.807 1.00 79.83  ? 192 ARG A NH2   1 
ATOM   2883 N N     . MET C 3 199 ? 93.546  32.295 112.384 1.00 87.40  ? 193 MET A N     1 
ATOM   2884 C CA    . MET C 3 199 ? 92.193  31.764 112.338 1.00 87.07  ? 193 MET A CA    1 
ATOM   2885 C C     . MET C 3 199 ? 91.450  32.402 111.139 1.00 87.27  ? 193 MET A C     1 
ATOM   2886 O O     . MET C 3 199 ? 92.007  33.276 110.466 1.00 86.47  ? 193 MET A O     1 
ATOM   2887 C CB    . MET C 3 199 ? 91.473  31.960 113.681 1.00 90.01  ? 193 MET A CB    1 
ATOM   2888 C CG    . MET C 3 199 ? 92.021  31.085 114.813 1.00 94.56  ? 193 MET A CG    1 
ATOM   2889 S SD    . MET C 3 199 ? 91.427  31.568 116.465 1.00 100.00 ? 193 MET A SD    1 
ATOM   2890 C CE    . MET C 3 199 ? 90.217  30.247 116.834 1.00 96.47  ? 193 MET A CE    1 
ATOM   2891 N N     . LEU C 3 200 ? 90.237  31.916 110.852 1.00 81.06  ? 194 LEU A N     1 
ATOM   2892 C CA    . LEU C 3 200 ? 89.392  32.364 109.726 1.00 79.77  ? 194 LEU A CA    1 
ATOM   2893 C C     . LEU C 3 200 ? 87.917  31.943 110.017 1.00 82.85  ? 194 LEU A C     1 
ATOM   2894 O O     . LEU C 3 200 ? 87.710  31.083 110.874 1.00 83.88  ? 194 LEU A O     1 
ATOM   2895 C CB    . LEU C 3 200 ? 89.871  31.633 108.472 1.00 79.94  ? 194 LEU A CB    1 
ATOM   2896 C CG    . LEU C 3 200 ? 90.136  32.307 107.121 1.00 83.30  ? 194 LEU A CG    1 
ATOM   2897 C CD1   . LEU C 3 200 ? 91.354  31.653 106.467 1.00 81.95  ? 194 LEU A CD1   1 
ATOM   2898 C CD2   . LEU C 3 200 ? 88.911  32.156 106.226 1.00 85.04  ? 194 LEU A CD2   1 
ATOM   2899 N N     . ILE C 3 201 ? 86.892  32.494 109.327 1.00 80.51  ? 195 ILE A N     1 
ATOM   2900 C CA    . ILE C 3 201 ? 85.457  32.158 109.643 1.00 81.81  ? 195 ILE A CA    1 
ATOM   2901 C C     . ILE C 3 201 ? 84.293  32.353 108.560 1.00 92.95  ? 195 ILE A C     1 
ATOM   2902 O O     . ILE C 3 201 ? 84.144  33.476 108.055 1.00 94.62  ? 195 ILE A O     1 
ATOM   2903 C CB    . ILE C 3 201 ? 85.003  33.007 110.881 1.00 84.47  ? 195 ILE A CB    1 
ATOM   2904 C CG1   . ILE C 3 201 ? 85.992  32.929 112.058 1.00 84.01  ? 195 ILE A CG1   1 
ATOM   2905 C CG2   . ILE C 3 201 ? 83.576  32.663 111.293 1.00 85.88  ? 195 ILE A CG2   1 
ATOM   2906 C CD1   . ILE C 3 201 ? 85.634  33.840 113.225 1.00 78.97  ? 195 ILE A CD1   1 
ATOM   2907 N N     . HIS C 3 202 ? 83.419  31.331 108.289 1.00 92.70  ? 196 HIS A N     1 
ATOM   2908 C CA    . HIS C 3 202 ? 82.224  31.459 107.340 1.00 93.77  ? 196 HIS A CA    1 
ATOM   2909 C C     . HIS C 3 202 ? 81.021  31.938 108.133 1.00 98.53  ? 196 HIS A C     1 
ATOM   2910 O O     . HIS C 3 202 ? 80.521  31.244 109.009 1.00 99.87  ? 196 HIS A O     1 
ATOM   2911 C CB    . HIS C 3 202 ? 81.799  30.131 106.497 1.00 94.39  ? 196 HIS A CB    1 
ATOM   2912 C CG    . HIS C 3 202 ? 80.594  30.296 105.557 1.00 97.99  ? 196 HIS A CG    1 
ATOM   2913 N ND1   . HIS C 3 202 ? 79.310  30.039 105.976 1.00 100.00 ? 196 HIS A ND1   1 
ATOM   2914 C CD2   . HIS C 3 202 ? 80.509  30.578 104.228 1.00 100.00 ? 196 HIS A CD2   1 
ATOM   2915 C CE1   . HIS C 3 202 ? 78.486  30.194 104.960 1.00 99.92  ? 196 HIS A CE1   1 
ATOM   2916 N NE2   . HIS C 3 202 ? 79.187  30.520 103.887 1.00 100.00 ? 196 HIS A NE2   1 
ATOM   2917 N N     . ILE C 3 203 ? 80.562  33.142 107.823 1.00 94.81  ? 197 ILE A N     1 
ATOM   2918 C CA    . ILE C 3 203 ? 79.396  33.712 108.475 1.00 95.43  ? 197 ILE A CA    1 
ATOM   2919 C C     . ILE C 3 203 ? 78.285  33.524 107.439 1.00 99.90  ? 197 ILE A C     1 
ATOM   2920 O O     . ILE C 3 203 ? 78.455  32.749 106.499 1.00 98.44  ? 197 ILE A O     1 
ATOM   2921 C CB    . ILE C 3 203 ? 79.677  35.185 108.814 1.00 98.69  ? 197 ILE A CB    1 
ATOM   2922 C CG1   . ILE C 3 203 ? 81.131  35.497 108.440 1.00 99.03  ? 197 ILE A CG1   1 
ATOM   2923 C CG2   . ILE C 3 203 ? 79.463  35.433 110.313 1.00 99.29  ? 197 ILE A CG2   1 
ATOM   2924 C CD1   . ILE C 3 203 ? 81.969  36.048 109.565 1.00 100.00 ? 197 ILE A CD1   1 
ATOM   2925 N N     . GLY C 3 204 ? 77.146  34.181 107.615 1.00 97.00  ? 198 GLY A N     1 
ATOM   2926 C CA    . GLY C 3 204 ? 76.049  34.021 106.665 1.00 96.55  ? 198 GLY A CA    1 
ATOM   2927 C C     . GLY C 3 204 ? 75.232  35.294 106.678 0.00 100.00 ? 198 GLY A C     1 
ATOM   2928 O O     . GLY C 3 204 ? 74.128  35.357 106.140 0.00 99.31  ? 198 GLY A O     1 
ATOM   2929 N N     . ARG C 3 205 ? 75.812  36.309 107.304 0.00 97.00  ? 199 ARG A N     1 
ATOM   2930 C CA    . ARG C 3 205 ? 75.195  37.616 107.471 1.00 96.95  ? 199 ARG A CA    1 
ATOM   2931 C C     . ARG C 3 205 ? 73.941  38.035 106.702 1.00 100.00 ? 199 ARG A C     1 
ATOM   2932 O O     . ARG C 3 205 ? 72.879  38.212 107.308 1.00 100.00 ? 199 ARG A O     1 
ATOM   2933 C CB    . ARG C 3 205 ? 76.223  38.746 107.619 1.00 98.17  ? 199 ARG A CB    1 
ATOM   2934 C CG    . ARG C 3 205 ? 76.902  39.227 106.335 1.00 100.00 ? 199 ARG A CG    1 
ATOM   2935 C CD    . ARG C 3 205 ? 77.555  40.601 106.563 1.00 100.00 ? 199 ARG A CD    1 
ATOM   2936 N NE    . ARG C 3 205 ? 79.019  40.586 106.493 1.00 97.47  ? 199 ARG A NE    1 
ATOM   2937 C CZ    . ARG C 3 205 ? 79.721  41.243 105.573 1.00 100.00 ? 199 ARG A CZ    1 
ATOM   2938 N NH1   . ARG C 3 205 ? 79.093  41.932 104.633 1.00 93.80  ? 199 ARG A NH1   1 
ATOM   2939 N NH2   . ARG C 3 205 ? 81.048  41.193 105.567 1.00 87.27  ? 199 ARG A NH2   1 
ATOM   2940 N N     . THR C 3 206 ? 74.052  38.232 105.392 1.00 96.35  ? 200 THR A N     1 
ATOM   2941 C CA    . THR C 3 206 ? 72.894  38.674 104.611 1.00 95.85  ? 200 THR A CA    1 
ATOM   2942 C C     . THR C 3 206 ? 71.642  37.800 104.695 1.00 99.36  ? 200 THR A C     1 
ATOM   2943 O O     . THR C 3 206 ? 71.718  36.571 104.681 1.00 99.20  ? 200 THR A O     1 
ATOM   2944 C CB    . THR C 3 206 ? 73.228  38.879 103.134 1.00 100.00 ? 200 THR A CB    1 
ATOM   2945 O OG1   . THR C 3 206 ? 73.706  37.650 102.576 1.00 100.00 ? 200 THR A OG1   1 
ATOM   2946 C CG2   . THR C 3 206 ? 74.279  39.951 102.976 1.00 100.00 ? 200 THR A CG2   1 
ATOM   2947 N N     . LYS C 3 207 ? 70.486  38.461 104.747 1.00 94.34  ? 201 LYS A N     1 
ATOM   2948 C CA    . LYS C 3 207 ? 69.199  37.787 104.780 1.00 92.81  ? 201 LYS A CA    1 
ATOM   2949 C C     . LYS C 3 207 ? 68.345  38.294 103.627 1.00 95.73  ? 201 LYS A C     1 
ATOM   2950 O O     . LYS C 3 207 ? 67.117  38.283 103.694 1.00 96.03  ? 201 LYS A O     1 
ATOM   2951 C CB    . LYS C 3 207 ? 68.507  38.037 106.125 1.00 94.60  ? 201 LYS A CB    1 
ATOM   2952 C CG    . LYS C 3 207 ? 67.276  37.173 106.392 1.00 89.96  ? 201 LYS A CG    1 
ATOM   2953 C CD    . LYS C 3 207 ? 67.344  35.847 105.666 1.00 87.11  ? 201 LYS A CD    1 
ATOM   2954 C CE    . LYS C 3 207 ? 68.644  35.116 105.950 1.00 84.92  ? 201 LYS A CE    1 
ATOM   2955 N NZ    . LYS C 3 207 ? 68.930  34.074 104.926 1.00 87.16  ? 201 LYS A NZ    1 
ATOM   2956 N N     . THR C 3 208 ? 69.016  38.744 102.570 1.00 91.38  ? 202 THR A N     1 
ATOM   2957 C CA    . THR C 3 208 ? 68.351  39.248 101.373 1.00 90.56  ? 202 THR A CA    1 
ATOM   2958 C C     . THR C 3 208 ? 68.682  38.345 100.187 1.00 91.76  ? 202 THR A C     1 
ATOM   2959 O O     . THR C 3 208 ? 69.811  37.874 100.052 1.00 91.37  ? 202 THR A O     1 
ATOM   2960 C CB    . THR C 3 208 ? 68.735  40.714 101.064 1.00 100.00 ? 202 THR A CB    1 
ATOM   2961 O OG1   . THR C 3 208 ? 69.481  40.770 99.840  1.00 100.00 ? 202 THR A OG1   1 
ATOM   2962 C CG2   . THR C 3 208 ? 69.570  41.311 102.200 1.00 100.00 ? 202 THR A CG2   1 
ATOM   2963 N N     . LEU C 3 209 ? 67.671  38.104 99.353  1.00 86.61  ? 203 LEU A N     1 
ATOM   2964 C CA    . LEU C 3 209 ? 67.725  37.205 98.196  1.00 85.97  ? 203 LEU A CA    1 
ATOM   2965 C C     . LEU C 3 209 ? 68.779  37.480 97.129  1.00 92.85  ? 203 LEU A C     1 
ATOM   2966 O O     . LEU C 3 209 ? 69.538  36.581 96.744  1.00 92.32  ? 203 LEU A O     1 
ATOM   2967 C CB    . LEU C 3 209 ? 66.346  37.127 97.547  1.00 85.28  ? 203 LEU A CB    1 
ATOM   2968 C CG    . LEU C 3 209 ? 66.242  36.408 96.207  1.00 89.01  ? 203 LEU A CG    1 
ATOM   2969 C CD1   . LEU C 3 209 ? 66.416  34.921 96.417  1.00 89.53  ? 203 LEU A CD1   1 
ATOM   2970 C CD2   . LEU C 3 209 ? 64.903  36.702 95.564  1.00 89.67  ? 203 LEU A CD2   1 
ATOM   2971 N N     . VAL C 3 210 ? 68.787  38.712 96.627  1.00 90.84  ? 204 VAL A N     1 
ATOM   2972 C CA    . VAL C 3 210 ? 69.744  39.132 95.611  1.00 90.48  ? 204 VAL A CA    1 
ATOM   2973 C C     . VAL C 3 210 ? 70.836  39.865 96.339  1.00 94.00  ? 204 VAL A C     1 
ATOM   2974 O O     . VAL C 3 210 ? 71.006  41.074 96.197  1.00 92.94  ? 204 VAL A O     1 
ATOM   2975 C CB    . VAL C 3 210 ? 69.130  40.101 94.588  1.00 93.84  ? 204 VAL A CB    1 
ATOM   2976 C CG1   . VAL C 3 210 ? 69.628  39.781 93.189  1.00 93.38  ? 204 VAL A CG1   1 
ATOM   2977 C CG2   . VAL C 3 210 ? 67.609  40.067 94.652  1.00 93.40  ? 204 VAL A CG2   1 
ATOM   2978 N N     . SER C 3 211 ? 71.550  39.120 97.158  1.00 92.29  ? 205 SER A N     1 
ATOM   2979 C CA    . SER C 3 211 ? 72.628  39.683 97.922  1.00 93.40  ? 205 SER A CA    1 
ATOM   2980 C C     . SER C 3 211 ? 73.677  38.609 97.882  1.00 99.55  ? 205 SER A C     1 
ATOM   2981 O O     . SER C 3 211 ? 74.270  38.314 96.842  1.00 100.00 ? 205 SER A O     1 
ATOM   2982 C CB    . SER C 3 211 ? 72.186  39.902 99.369  0.00 95.93  ? 205 SER A CB    1 
ATOM   2983 O OG    . SER C 3 211 ? 72.717  41.108 99.885  0.00 100.00 ? 205 SER A OG    1 
ATOM   2984 N N     . THR C 3 212 ? 73.851  37.983 99.029  1.00 96.11  ? 206 THR A N     1 
ATOM   2985 C CA    . THR C 3 212 ? 74.821  36.938 99.155  1.00 95.49  ? 206 THR A CA    1 
ATOM   2986 C C     . THR C 3 212 ? 74.275  35.863 100.050 1.00 100.00 ? 206 THR A C     1 
ATOM   2987 O O     . THR C 3 212 ? 73.235  36.015 100.695 1.00 100.00 ? 206 THR A O     1 
ATOM   2988 C CB    . THR C 3 212 ? 76.094  37.481 99.805  1.00 100.00 ? 206 THR A CB    1 
ATOM   2989 O OG1   . THR C 3 212 ? 75.785  37.964 101.117 1.00 100.00 ? 206 THR A OG1   1 
ATOM   2990 C CG2   . THR C 3 212 ? 76.663  38.622 98.978  1.00 99.50  ? 206 THR A CG2   1 
ATOM   2991 N N     . ALA C 3 213 ? 75.013  34.770 100.087 1.00 97.46  ? 207 ALA A N     1 
ATOM   2992 C CA    . ALA C 3 213 ? 74.682  33.658 100.938 1.00 97.32  ? 207 ALA A CA    1 
ATOM   2993 C C     . ALA C 3 213 ? 75.649  33.811 102.093 1.00 100.00 ? 207 ALA A C     1 
ATOM   2994 O O     . ALA C 3 213 ? 75.398  33.317 103.193 1.00 100.00 ? 207 ALA A O     1 
ATOM   2995 C CB    . ALA C 3 213 ? 74.921  32.351 100.209 1.00 98.35  ? 207 ALA A CB    1 
ATOM   2996 N N     . GLY C 3 214 ? 76.754  34.512 101.853 0.00 94.89  ? 208 GLY A N     1 
ATOM   2997 C CA    . GLY C 3 214 ? 77.708  34.728 102.932 1.00 93.89  ? 208 GLY A CA    1 
ATOM   2998 C C     . GLY C 3 214 ? 79.202  34.827 102.619 1.00 95.44  ? 208 GLY A C     1 
ATOM   2999 O O     . GLY C 3 214 ? 79.669  34.453 101.546 1.00 95.06  ? 208 GLY A O     1 
ATOM   3000 N N     . VAL C 3 215 ? 79.944  35.311 103.613 1.00 90.00  ? 209 VAL A N     1 
ATOM   3001 C CA    . VAL C 3 215 ? 81.391  35.513 103.543 1.00 88.10  ? 209 VAL A CA    1 
ATOM   3002 C C     . VAL C 3 215 ? 82.159  34.624 104.543 1.00 89.07  ? 209 VAL A C     1 
ATOM   3003 O O     . VAL C 3 215 ? 81.572  33.876 105.333 1.00 88.46  ? 209 VAL A O     1 
ATOM   3004 C CB    . VAL C 3 215 ? 81.714  37.015 103.810 1.00 91.54  ? 209 VAL A CB    1 
ATOM   3005 C CG1   . VAL C 3 215 ? 83.183  37.341 103.505 1.00 91.50  ? 209 VAL A CG1   1 
ATOM   3006 C CG2   . VAL C 3 215 ? 80.748  37.923 103.034 1.00 91.33  ? 209 VAL A CG2   1 
ATOM   3007 N N     . GLU C 3 216 ? 83.489  34.729 104.460 1.00 82.69  ? 210 GLU A N     1 
ATOM   3008 C CA    . GLU C 3 216 ? 84.466  34.059 105.329 1.00 80.92  ? 210 GLU A CA    1 
ATOM   3009 C C     . GLU C 3 216 ? 85.320  35.231 105.872 1.00 83.93  ? 210 GLU A C     1 
ATOM   3010 O O     . GLU C 3 216 ? 85.661  36.134 105.112 1.00 84.51  ? 210 GLU A O     1 
ATOM   3011 C CB    . GLU C 3 216 ? 85.338  33.066 104.525 1.00 81.90  ? 210 GLU A CB    1 
ATOM   3012 C CG    . GLU C 3 216 ? 85.307  31.612 105.039 1.00 89.78  ? 210 GLU A CG    1 
ATOM   3013 C CD    . GLU C 3 216 ? 85.487  30.542 103.941 1.00 100.00 ? 210 GLU A CD    1 
ATOM   3014 O OE1   . GLU C 3 216 ? 86.055  30.854 102.868 1.00 100.00 ? 210 GLU A OE1   1 
ATOM   3015 O OE2   . GLU C 3 216 ? 85.082  29.376 104.170 1.00 100.00 ? 210 GLU A OE2   1 
ATOM   3016 N N     . LYS C 3 217 ? 85.601  35.255 107.178 1.00 78.20  ? 211 LYS A N     1 
ATOM   3017 C CA    . LYS C 3 217 ? 86.353  36.350 107.826 1.00 75.91  ? 211 LYS A CA    1 
ATOM   3018 C C     . LYS C 3 217 ? 87.608  35.871 108.586 1.00 77.58  ? 211 LYS A C     1 
ATOM   3019 O O     . LYS C 3 217 ? 87.611  34.790 109.167 1.00 76.39  ? 211 LYS A O     1 
ATOM   3020 C CB    . LYS C 3 217 ? 85.428  37.111 108.789 1.00 75.82  ? 211 LYS A CB    1 
ATOM   3021 C CG    . LYS C 3 217 ? 84.836  38.395 108.232 1.00 70.41  ? 211 LYS A CG    1 
ATOM   3022 C CD    . LYS C 3 217 ? 85.710  39.597 108.570 1.00 71.58  ? 211 LYS A CD    1 
ATOM   3023 C CE    . LYS C 3 217 ? 85.100  40.901 108.068 1.00 68.75  ? 211 LYS A CE    1 
ATOM   3024 N NZ    . LYS C 3 217 ? 85.948  42.078 108.406 1.00 71.26  ? 211 LYS A NZ    1 
ATOM   3025 N N     . ALA C 3 218 ? 88.666  36.673 108.612 1.00 74.06  ? 212 ALA A N     1 
ATOM   3026 C CA    . ALA C 3 218 ? 89.890  36.239 109.291 1.00 74.11  ? 212 ALA A CA    1 
ATOM   3027 C C     . ALA C 3 218 ? 90.345  37.006 110.535 1.00 76.81  ? 212 ALA A C     1 
ATOM   3028 O O     . ALA C 3 218 ? 89.932  38.138 110.782 1.00 77.69  ? 212 ALA A O     1 
ATOM   3029 C CB    . ALA C 3 218 ? 91.033  36.109 108.301 1.00 75.60  ? 212 ALA A CB    1 
ATOM   3030 N N     . LEU C 3 219 ? 91.224  36.370 111.306 1.00 72.20  ? 213 LEU A N     1 
ATOM   3031 C CA    . LEU C 3 219 ? 91.778  36.975 112.516 1.00 71.03  ? 213 LEU A CA    1 
ATOM   3032 C C     . LEU C 3 219 ? 93.299  37.003 112.545 1.00 75.37  ? 213 LEU A C     1 
ATOM   3033 O O     . LEU C 3 219 ? 93.972  36.264 111.828 1.00 77.43  ? 213 LEU A O     1 
ATOM   3034 C CB    . LEU C 3 219 ? 91.272  36.323 113.810 1.00 69.89  ? 213 LEU A CB    1 
ATOM   3035 C CG    . LEU C 3 219 ? 90.065  35.403 113.921 1.00 71.78  ? 213 LEU A CG    1 
ATOM   3036 C CD1   . LEU C 3 219 ? 90.030  34.840 115.338 1.00 70.65  ? 213 LEU A CD1   1 
ATOM   3037 C CD2   . LEU C 3 219 ? 88.778  36.148 113.583 1.00 71.58  ? 213 LEU A CD2   1 
ATOM   3038 N N     . SER C 3 220 ? 93.809  37.848 113.434 1.00 69.21  ? 214 SER A N     1 
ATOM   3039 C CA    . SER C 3 220 ? 95.228  38.098 113.624 1.00 68.88  ? 214 SER A CA    1 
ATOM   3040 C C     . SER C 3 220 ? 95.938  37.239 114.660 1.00 76.14  ? 214 SER A C     1 
ATOM   3041 O O     . SER C 3 220 ? 95.387  36.283 115.180 1.00 73.43  ? 214 SER A O     1 
ATOM   3042 C CB    . SER C 3 220 ? 95.408  39.562 114.026 1.00 70.87  ? 214 SER A CB    1 
ATOM   3043 O OG    . SER C 3 220 ? 96.159  39.678 115.223 1.00 79.10  ? 214 SER A OG    1 
ATOM   3044 N N     . LEU C 3 221 ? 97.170  37.627 114.975 1.00 77.67  ? 215 LEU A N     1 
ATOM   3045 C CA    . LEU C 3 221 ? 97.964  36.949 115.990 1.00 79.23  ? 215 LEU A CA    1 
ATOM   3046 C C     . LEU C 3 221 ? 97.334  37.369 117.306 1.00 87.19  ? 215 LEU A C     1 
ATOM   3047 O O     . LEU C 3 221 ? 97.443  36.676 118.315 1.00 89.85  ? 215 LEU A O     1 
ATOM   3048 C CB    . LEU C 3 221 ? 99.421  37.416 115.930 0.00 79.68  ? 215 LEU A CB    1 
ATOM   3049 C CG    . LEU C 3 221 ? 100.297 36.745 114.870 0.00 84.72  ? 215 LEU A CG    1 
ATOM   3050 C CD1   . LEU C 3 221 ? 101.770 36.987 115.159 0.00 84.89  ? 215 LEU A CD1   1 
ATOM   3051 C CD2   . LEU C 3 221 ? 100.000 35.255 114.793 0.00 87.22  ? 215 LEU A CD2   1 
ATOM   3052 N N     . GLY C 3 222 ? 96.653  38.510 117.272 1.00 82.17  ? 216 GLY A N     1 
ATOM   3053 C CA    . GLY C 3 222 ? 95.953  39.025 118.437 1.00 80.28  ? 216 GLY A CA    1 
ATOM   3054 C C     . GLY C 3 222 ? 94.610  38.313 118.544 1.00 78.57  ? 216 GLY A C     1 
ATOM   3055 O O     . GLY C 3 222 ? 94.503  37.252 119.154 1.00 74.33  ? 216 GLY A O     1 
ATOM   3056 N N     . VAL C 3 223 ? 93.594  38.863 117.900 1.00 75.37  ? 217 VAL A N     1 
ATOM   3057 C CA    . VAL C 3 223 ? 92.279  38.251 117.957 1.00 75.10  ? 217 VAL A CA    1 
ATOM   3058 C C     . VAL C 3 223 ? 92.224  36.717 117.823 1.00 82.01  ? 217 VAL A C     1 
ATOM   3059 O O     . VAL C 3 223 ? 91.237  36.119 118.232 1.00 82.18  ? 217 VAL A O     1 
ATOM   3060 C CB    . VAL C 3 223 ? 91.249  38.986 117.069 1.00 77.87  ? 217 VAL A CB    1 
ATOM   3061 C CG1   . VAL C 3 223 ? 89.906  38.269 117.071 1.00 77.35  ? 217 VAL A CG1   1 
ATOM   3062 C CG2   . VAL C 3 223 ? 91.083  40.424 117.541 1.00 77.35  ? 217 VAL A CG2   1 
ATOM   3063 N N     . THR C 3 224 ? 93.263  36.059 117.306 1.00 80.70  ? 218 THR A N     1 
ATOM   3064 C CA    . THR C 3 224 ? 93.211  34.586 117.192 1.00 81.35  ? 218 THR A CA    1 
ATOM   3065 C C     . THR C 3 224 ? 93.715  33.896 118.467 1.00 86.06  ? 218 THR A C     1 
ATOM   3066 O O     . THR C 3 224 ? 93.200  32.870 118.901 1.00 86.40  ? 218 THR A O     1 
ATOM   3067 C CB    . THR C 3 224 ? 94.036  34.042 115.985 1.00 83.79  ? 218 THR A CB    1 
ATOM   3068 O OG1   . THR C 3 224 ? 93.179  33.829 114.856 1.00 76.43  ? 218 THR A OG1   1 
ATOM   3069 C CG2   . THR C 3 224 ? 94.740  32.740 116.344 1.00 82.10  ? 218 THR A CG2   1 
ATOM   3070 N N     . LYS C 3 225 ? 94.764  34.481 119.037 1.00 80.21  ? 219 LYS A N     1 
ATOM   3071 C CA    . LYS C 3 225 ? 95.409  34.000 120.258 1.00 78.49  ? 219 LYS A CA    1 
ATOM   3072 C C     . LYS C 3 225 ? 94.472  34.100 121.482 1.00 81.27  ? 219 LYS A C     1 
ATOM   3073 O O     . LYS C 3 225 ? 94.735  33.519 122.538 1.00 81.96  ? 219 LYS A O     1 
ATOM   3074 C CB    . LYS C 3 225 ? 96.643  34.872 120.519 1.00 79.54  ? 219 LYS A CB    1 
ATOM   3075 C CG    . LYS C 3 225 ? 97.939  34.127 120.733 1.00 77.12  ? 219 LYS A CG    1 
ATOM   3076 C CD    . LYS C 3 225 ? 98.868  35.008 121.539 1.00 90.31  ? 219 LYS A CD    1 
ATOM   3077 C CE    . LYS C 3 225 ? 100.316 34.590 121.374 1.00 100.00 ? 219 LYS A CE    1 
ATOM   3078 N NZ    . LYS C 3 225 ? 101.284 35.655 121.795 1.00 100.00 ? 219 LYS A NZ    1 
ATOM   3079 N N     . LEU C 3 226 ? 93.427  34.898 121.332 1.00 74.55  ? 220 LEU A N     1 
ATOM   3080 C CA    . LEU C 3 226 ? 92.467  35.141 122.381 1.00 72.96  ? 220 LEU A CA    1 
ATOM   3081 C C     . LEU C 3 226 ? 91.324  34.164 122.227 1.00 77.20  ? 220 LEU A C     1 
ATOM   3082 O O     . LEU C 3 226 ? 90.978  33.404 123.133 1.00 79.24  ? 220 LEU A O     1 
ATOM   3083 C CB    . LEU C 3 226 ? 91.862  36.515 122.146 1.00 72.37  ? 220 LEU A CB    1 
ATOM   3084 C CG    . LEU C 3 226 ? 92.377  37.803 122.788 1.00 76.18  ? 220 LEU A CG    1 
ATOM   3085 C CD1   . LEU C 3 226 ? 93.793  37.694 123.352 1.00 75.82  ? 220 LEU A CD1   1 
ATOM   3086 C CD2   . LEU C 3 226 ? 92.289  38.928 121.777 1.00 77.34  ? 220 LEU A CD2   1 
ATOM   3087 N N     . VAL C 3 227 ? 90.717  34.211 121.049 1.00 71.51  ? 221 VAL A N     1 
ATOM   3088 C CA    . VAL C 3 227 ? 89.590  33.355 120.727 1.00 70.48  ? 221 VAL A CA    1 
ATOM   3089 C C     . VAL C 3 227 ? 89.932  31.923 121.117 1.00 74.52  ? 221 VAL A C     1 
ATOM   3090 O O     . VAL C 3 227 ? 89.048  31.107 121.380 1.00 74.54  ? 221 VAL A O     1 
ATOM   3091 C CB    . VAL C 3 227 ? 89.216  33.460 119.239 1.00 74.62  ? 221 VAL A CB    1 
ATOM   3092 C CG1   . VAL C 3 227 ? 88.062  32.535 118.925 1.00 74.70  ? 221 VAL A CG1   1 
ATOM   3093 C CG2   . VAL C 3 227 ? 88.829  34.884 118.901 1.00 74.90  ? 221 VAL A CG2   1 
ATOM   3094 N N     . GLU C 3 228 ? 91.232  31.647 121.179 1.00 71.53  ? 222 GLU A N     1 
ATOM   3095 C CA    . GLU C 3 228 ? 91.776  30.361 121.586 1.00 71.35  ? 222 GLU A CA    1 
ATOM   3096 C C     . GLU C 3 228 ? 91.378  30.069 123.026 1.00 73.66  ? 222 GLU A C     1 
ATOM   3097 O O     . GLU C 3 228 ? 90.441  29.306 123.289 1.00 75.42  ? 222 GLU A O     1 
ATOM   3098 C CB    . GLU C 3 228 ? 93.299  30.435 121.515 1.00 72.78  ? 222 GLU A CB    1 
ATOM   3099 C CG    . GLU C 3 228 ? 93.957  29.204 120.945 1.00 85.37  ? 222 GLU A CG    1 
ATOM   3100 C CD    . GLU C 3 228 ? 94.985  29.550 119.893 1.00 97.90  ? 222 GLU A CD    1 
ATOM   3101 O OE1   . GLU C 3 228 ? 94.593  29.678 118.718 1.00 66.44  ? 222 GLU A OE1   1 
ATOM   3102 O OE2   . GLU C 3 228 ? 96.176  29.705 120.239 1.00 97.38  ? 222 GLU A OE2   1 
ATOM   3103 N N     . ARG C 3 229 ? 92.107  30.682 123.953 1.00 64.06  ? 223 ARG A N     1 
ATOM   3104 C CA    . ARG C 3 229 ? 91.818  30.514 125.360 1.00 60.71  ? 223 ARG A CA    1 
ATOM   3105 C C     . ARG C 3 229 ? 90.328  30.267 125.542 1.00 62.95  ? 223 ARG A C     1 
ATOM   3106 O O     . ARG C 3 229 ? 89.936  29.222 126.060 1.00 63.57  ? 223 ARG A O     1 
ATOM   3107 C CB    . ARG C 3 229 ? 92.267  31.741 126.142 1.00 56.59  ? 223 ARG A CB    1 
ATOM   3108 C CG    . ARG C 3 229 ? 93.525  31.512 126.944 1.00 61.63  ? 223 ARG A CG    1 
ATOM   3109 C CD    . ARG C 3 229 ? 94.048  32.793 127.553 1.00 55.79  ? 223 ARG A CD    1 
ATOM   3110 N NE    . ARG C 3 229 ? 94.257  32.649 128.991 1.00 69.45  ? 223 ARG A NE    1 
ATOM   3111 C CZ    . ARG C 3 229 ? 94.920  33.525 129.737 1.00 83.13  ? 223 ARG A CZ    1 
ATOM   3112 N NH1   . ARG C 3 229 ? 95.435  34.617 129.185 1.00 84.96  ? 223 ARG A NH1   1 
ATOM   3113 N NH2   . ARG C 3 229 ? 95.061  33.315 131.040 1.00 50.17  ? 223 ARG A NH2   1 
ATOM   3114 N N     . TRP C 3 230 ? 89.489  31.198 125.092 1.00 57.13  ? 224 TRP A N     1 
ATOM   3115 C CA    . TRP C 3 230 ? 88.061  30.977 125.253 1.00 57.08  ? 224 TRP A CA    1 
ATOM   3116 C C     . TRP C 3 230 ? 87.737  29.514 124.932 1.00 68.13  ? 224 TRP A C     1 
ATOM   3117 O O     . TRP C 3 230 ? 87.090  28.832 125.721 1.00 68.90  ? 224 TRP A O     1 
ATOM   3118 C CB    . TRP C 3 230 ? 87.206  31.941 124.426 1.00 54.06  ? 224 TRP A CB    1 
ATOM   3119 C CG    . TRP C 3 230 ? 85.733  31.644 124.555 1.00 54.48  ? 224 TRP A CG    1 
ATOM   3120 C CD1   . TRP C 3 230 ? 84.850  31.402 123.542 1.00 57.10  ? 224 TRP A CD1   1 
ATOM   3121 C CD2   . TRP C 3 230 ? 84.995  31.484 125.778 1.00 55.00  ? 224 TRP A CD2   1 
ATOM   3122 N NE1   . TRP C 3 230 ? 83.605  31.114 124.056 1.00 57.31  ? 224 TRP A NE1   1 
ATOM   3123 C CE2   . TRP C 3 230 ? 83.667  31.164 125.427 1.00 59.95  ? 224 TRP A CE2   1 
ATOM   3124 C CE3   . TRP C 3 230 ? 85.325  31.591 127.135 1.00 56.38  ? 224 TRP A CE3   1 
ATOM   3125 C CZ2   . TRP C 3 230 ? 82.668  30.970 126.384 1.00 59.45  ? 224 TRP A CZ2   1 
ATOM   3126 C CZ3   . TRP C 3 230 ? 84.335  31.381 128.081 1.00 57.91  ? 224 TRP A CZ3   1 
ATOM   3127 C CH2   . TRP C 3 230 ? 83.024  31.078 127.702 1.00 58.73  ? 224 TRP A CH2   1 
ATOM   3128 N N     . ILE C 3 231 ? 88.229  29.016 123.803 1.00 67.65  ? 225 ILE A N     1 
ATOM   3129 C CA    . ILE C 3 231 ? 87.981  27.630 123.422 0.00 68.46  ? 225 ILE A CA    1 
ATOM   3130 C C     . ILE C 3 231 ? 88.654  26.632 124.365 1.00 74.49  ? 225 ILE A C     1 
ATOM   3131 O O     . ILE C 3 231 ? 88.074  25.589 124.687 1.00 75.01  ? 225 ILE A O     1 
ATOM   3132 C CB    . ILE C 3 231 ? 88.368  27.352 121.959 0.00 71.59  ? 225 ILE A CB    1 
ATOM   3133 C CG1   . ILE C 3 231 ? 87.272  27.861 121.019 0.00 72.08  ? 225 ILE A CG1   1 
ATOM   3134 C CG2   . ILE C 3 231 ? 88.608  25.866 121.745 0.00 72.33  ? 225 ILE A CG2   1 
ATOM   3135 C CD1   . ILE C 3 231 ? 87.726  28.963 120.088 0.00 79.62  ? 225 ILE A CD1   1 
ATOM   3136 N N     . SER C 3 232 ? 89.859  26.956 124.829 1.00 70.35  ? 226 SER A N     1 
ATOM   3137 C CA    . SER C 3 232 ? 90.559  26.068 125.754 1.00 70.02  ? 226 SER A CA    1 
ATOM   3138 C C     . SER C 3 232 ? 89.698  25.913 126.996 1.00 77.66  ? 226 SER A C     1 
ATOM   3139 O O     . SER C 3 232 ? 89.419  24.800 127.453 1.00 79.62  ? 226 SER A O     1 
ATOM   3140 C CB    . SER C 3 232 ? 91.912  26.647 126.163 1.00 70.30  ? 226 SER A CB    1 
ATOM   3141 O OG    . SER C 3 232 ? 92.195  26.331 127.517 1.00 69.35  ? 226 SER A OG    1 
ATOM   3142 N N     . VAL C 3 233 ? 89.268  27.048 127.532 1.00 73.05  ? 227 VAL A N     1 
ATOM   3143 C CA    . VAL C 3 233 ? 88.446  27.044 128.726 1.00 71.44  ? 227 VAL A CA    1 
ATOM   3144 C C     . VAL C 3 233 ? 86.954  26.817 128.494 1.00 76.47  ? 227 VAL A C     1 
ATOM   3145 O O     . VAL C 3 233 ? 86.323  26.091 129.250 1.00 75.67  ? 227 VAL A O     1 
ATOM   3146 C CB    . VAL C 3 233 ? 88.676  28.287 129.590 1.00 73.06  ? 227 VAL A CB    1 
ATOM   3147 C CG1   . VAL C 3 233 ? 88.447  27.944 131.049 1.00 73.08  ? 227 VAL A CG1   1 
ATOM   3148 C CG2   . VAL C 3 233 ? 90.081  28.838 129.371 1.00 71.82  ? 227 VAL A CG2   1 
ATOM   3149 N N     . SER C 3 234 ? 86.376  27.432 127.469 1.00 76.19  ? 228 SER A N     1 
ATOM   3150 C CA    . SER C 3 234 ? 84.941  27.266 127.238 1.00 77.89  ? 228 SER A CA    1 
ATOM   3151 C C     . SER C 3 234 ? 84.485  25.814 127.059 1.00 88.12  ? 228 SER A C     1 
ATOM   3152 O O     . SER C 3 234 ? 83.299  25.503 127.218 1.00 88.28  ? 228 SER A O     1 
ATOM   3153 C CB    . SER C 3 234 ? 84.435  28.143 126.084 1.00 81.22  ? 228 SER A CB    1 
ATOM   3154 O OG    . SER C 3 234 ? 85.038  27.789 124.847 1.00 90.24  ? 228 SER A OG    1 
ATOM   3155 N N     . GLY C 3 235 ? 85.419  24.925 126.730 1.00 87.43  ? 229 GLY A N     1 
ATOM   3156 C CA    . GLY C 3 235 ? 85.074  23.527 126.505 1.00 87.94  ? 229 GLY A CA    1 
ATOM   3157 C C     . GLY C 3 235 ? 84.263  23.463 125.220 1.00 94.05  ? 229 GLY A C     1 
ATOM   3158 O O     . GLY C 3 235 ? 83.389  22.614 125.054 1.00 94.01  ? 229 GLY A O     1 
ATOM   3159 N N     . VAL C 3 236 ? 84.554  24.397 124.322 1.00 93.24  ? 230 VAL A N     1 
ATOM   3160 C CA    . VAL C 3 236 ? 83.859  24.489 123.045 1.00 94.22  ? 230 VAL A CA    1 
ATOM   3161 C C     . VAL C 3 236 ? 84.202  23.333 122.110 1.00 99.16  ? 230 VAL A C     1 
ATOM   3162 O O     . VAL C 3 236 ? 83.337  22.843 121.383 1.00 98.78  ? 230 VAL A O     1 
ATOM   3163 C CB    . VAL C 3 236 ? 84.167  25.819 122.335 0.00 98.32  ? 230 VAL A CB    1 
ATOM   3164 C CG1   . VAL C 3 236 ? 85.235  25.620 121.275 0.00 98.15  ? 230 VAL A CG1   1 
ATOM   3165 C CG2   . VAL C 3 236 ? 82.904  26.409 121.726 0.00 98.15  ? 230 VAL A CG2   1 
ATOM   3166 N N     . ALA C 3 237 ? 85.461  22.904 122.121 1.00 96.45  ? 231 ALA A N     1 
ATOM   3167 C CA    . ALA C 3 237 ? 85.899  21.809 121.256 1.00 96.44  ? 231 ALA A CA    1 
ATOM   3168 C C     . ALA C 3 237 ? 85.219  20.480 121.577 1.00 99.29  ? 231 ALA A C     1 
ATOM   3169 O O     . ALA C 3 237 ? 85.816  19.409 121.421 0.00 98.85  ? 231 ALA A O     1 
ATOM   3170 C CB    . ALA C 3 237 ? 87.410  21.664 121.308 0.00 97.21  ? 231 ALA A CB    1 
ATOM   3171 N N     . ASP C 3 238 ? 83.968  20.550 122.023 1.00 94.31  ? 232 ASP A N     1 
ATOM   3172 C CA    . ASP C 3 238 ? 83.250  19.324 122.378 1.00 93.07  ? 232 ASP A CA    1 
ATOM   3173 C C     . ASP C 3 238 ? 82.317  18.709 121.350 1.00 97.84  ? 232 ASP A C     1 
ATOM   3174 O O     . ASP C 3 238 ? 82.613  17.647 120.810 1.00 99.40  ? 232 ASP A O     1 
ATOM   3175 C CB    . ASP C 3 238 ? 82.744  19.318 123.824 1.00 94.10  ? 232 ASP A CB    1 
ATOM   3176 C CG    . ASP C 3 238 ? 83.815  19.726 124.812 1.00 96.64  ? 232 ASP A CG    1 
ATOM   3177 O OD1   . ASP C 3 238 ? 84.980  19.944 124.382 1.00 96.07  ? 232 ASP A OD1   1 
ATOM   3178 O OD2   . ASP C 3 238 ? 83.500  19.898 126.008 1.00 100.00 ? 232 ASP A OD2   1 
ATOM   3179 N N     . ASP C 3 239 ? 81.208  19.371 121.049 1.00 92.77  ? 233 ASP A N     1 
ATOM   3180 C CA    . ASP C 3 239 ? 80.319  18.872 120.012 1.00 92.94  ? 233 ASP A CA    1 
ATOM   3181 C C     . ASP C 3 239 ? 80.180  19.954 118.940 0.00 97.90  ? 233 ASP A C     1 
ATOM   3182 O O     . ASP C 3 239 ? 79.255  20.757 118.945 0.00 97.35  ? 233 ASP A O     1 
ATOM   3183 C CB    . ASP C 3 239 ? 78.997  18.231 120.576 1.00 94.74  ? 233 ASP A CB    1 
ATOM   3184 C CG    . ASP C 3 239 ? 77.801  19.188 120.545 1.00 97.64  ? 233 ASP A CG    1 
ATOM   3185 O OD1   . ASP C 3 239 ? 77.364  19.547 119.433 1.00 91.05  ? 233 ASP A OD1   1 
ATOM   3186 O OD2   . ASP C 3 239 ? 77.341  19.639 121.618 1.00 100.00 ? 233 ASP A OD2   1 
ATOM   3187 N N     . PRO C 3 240 ? 81.216  20.136 118.147 1.00 95.54  ? 234 PRO A N     1 
ATOM   3188 C CA    . PRO C 3 240 ? 81.107  21.196 117.123 1.00 95.69  ? 234 PRO A CA    1 
ATOM   3189 C C     . PRO C 3 240 ? 79.807  21.784 116.451 1.00 97.15  ? 234 PRO A C     1 
ATOM   3190 O O     . PRO C 3 240 ? 79.922  22.746 115.681 1.00 97.89  ? 234 PRO A O     1 
ATOM   3191 C CB    . PRO C 3 240 ? 82.260  20.899 116.175 1.00 97.17  ? 234 PRO A CB    1 
ATOM   3192 C CG    . PRO C 3 240 ? 83.312  20.305 117.098 1.00 100.00 ? 234 PRO A CG    1 
ATOM   3193 C CD    . PRO C 3 240 ? 82.619  19.663 118.278 1.00 95.34  ? 234 PRO A CD    1 
ATOM   3194 N N     . ASN C 3 241 ? 78.607  21.288 116.794 1.00 88.76  ? 235 ASN A N     1 
ATOM   3195 C CA    . ASN C 3 241 ? 77.336  21.847 116.314 1.00 87.20  ? 235 ASN A CA    1 
ATOM   3196 C C     . ASN C 3 241 ? 77.100  23.045 117.222 1.00 88.82  ? 235 ASN A C     1 
ATOM   3197 O O     . ASN C 3 241 ? 76.102  23.757 117.129 1.00 88.98  ? 235 ASN A O     1 
ATOM   3198 C CB    . ASN C 3 241 ? 76.206  20.840 116.561 1.00 89.64  ? 235 ASN A CB    1 
ATOM   3199 C CG    . ASN C 3 241 ? 75.933  19.997 115.359 1.00 100.00 ? 235 ASN A CG    1 
ATOM   3200 O OD1   . ASN C 3 241 ? 74.850  19.410 115.214 1.00 100.00 ? 235 ASN A OD1   1 
ATOM   3201 N ND2   . ASN C 3 241 ? 76.909  19.932 114.470 1.00 95.84  ? 235 ASN A ND2   1 
ATOM   3202 N N     . ASN C 3 242 ? 78.037  23.171 118.157 1.00 81.61  ? 236 ASN A N     1 
ATOM   3203 C CA    . ASN C 3 242 ? 78.109  24.200 119.190 0.00 78.91  ? 236 ASN A CA    1 
ATOM   3204 C C     . ASN C 3 242 ? 78.368  25.592 118.651 1.00 77.98  ? 236 ASN A C     1 
ATOM   3205 O O     . ASN C 3 242 ? 78.975  25.763 117.601 0.00 77.50  ? 236 ASN A O     1 
ATOM   3206 C CB    . ASN C 3 242 ? 79.314  23.896 120.074 1.00 77.01  ? 236 ASN A CB    1 
ATOM   3207 C CG    . ASN C 3 242 ? 78.934  23.396 121.443 1.00 90.89  ? 236 ASN A CG    1 
ATOM   3208 O OD1   . ASN C 3 242 ? 77.756  23.148 121.727 1.00 76.58  ? 236 ASN A OD1   1 
ATOM   3209 N ND2   . ASN C 3 242 ? 79.933  23.264 122.324 1.00 76.75  ? 236 ASN A ND2   1 
ATOM   3210 N N     . TYR C 3 243 ? 77.989  26.582 119.448 1.00 71.58  ? 237 TYR A N     1 
ATOM   3211 C CA    . TYR C 3 243 ? 78.197  27.988 119.134 1.00 69.70  ? 237 TYR A CA    1 
ATOM   3212 C C     . TYR C 3 243 ? 79.481  28.437 119.805 1.00 70.63  ? 237 TYR A C     1 
ATOM   3213 O O     . TYR C 3 243 ? 79.829  27.939 120.868 1.00 72.81  ? 237 TYR A O     1 
ATOM   3214 C CB    . TYR C 3 243 ? 77.072  28.816 119.742 1.00 70.49  ? 237 TYR A CB    1 
ATOM   3215 C CG    . TYR C 3 243 ? 75.755  28.774 119.025 1.00 72.29  ? 237 TYR A CG    1 
ATOM   3216 C CD1   . TYR C 3 243 ? 75.494  29.628 117.971 1.00 75.11  ? 237 TYR A CD1   1 
ATOM   3217 C CD2   . TYR C 3 243 ? 74.713  28.003 119.514 1.00 73.29  ? 237 TYR A CD2   1 
ATOM   3218 C CE1   . TYR C 3 243 ? 74.252  29.636 117.345 1.00 77.33  ? 237 TYR A CE1   1 
ATOM   3219 C CE2   . TYR C 3 243 ? 73.478  27.994 118.904 1.00 74.89  ? 237 TYR A CE2   1 
ATOM   3220 C CZ    . TYR C 3 243 ? 73.249  28.813 117.815 1.00 85.62  ? 237 TYR A CZ    1 
ATOM   3221 O OH    . TYR C 3 243 ? 72.007  28.809 117.222 1.00 87.26  ? 237 TYR A OH    1 
ATOM   3222 N N     . LEU C 3 244 ? 80.146  29.437 119.246 1.00 62.01  ? 238 LEU A N     1 
ATOM   3223 C CA    . LEU C 3 244 ? 81.364  29.895 119.881 1.00 60.00  ? 238 LEU A CA    1 
ATOM   3224 C C     . LEU C 3 244 ? 81.095  30.641 121.184 1.00 67.69  ? 238 LEU A C     1 
ATOM   3225 O O     . LEU C 3 244 ? 81.853  30.510 122.150 1.00 68.88  ? 238 LEU A O     1 
ATOM   3226 C CB    . LEU C 3 244 ? 82.194  30.750 118.932 1.00 58.43  ? 238 LEU A CB    1 
ATOM   3227 C CG    . LEU C 3 244 ? 83.579  31.090 119.490 1.00 59.83  ? 238 LEU A CG    1 
ATOM   3228 C CD1   . LEU C 3 244 ? 84.465  29.858 119.530 1.00 57.67  ? 238 LEU A CD1   1 
ATOM   3229 C CD2   . LEU C 3 244 ? 84.250  32.220 118.713 1.00 61.30  ? 238 LEU A CD2   1 
ATOM   3230 N N     . PHE C 3 245 ? 80.034  31.441 121.223 1.00 63.04  ? 239 PHE A N     1 
ATOM   3231 C CA    . PHE C 3 245 ? 79.766  32.201 122.433 1.00 60.53  ? 239 PHE A CA    1 
ATOM   3232 C C     . PHE C 3 245 ? 78.615  31.711 123.292 1.00 62.68  ? 239 PHE A C     1 
ATOM   3233 O O     . PHE C 3 245 ? 77.471  31.617 122.850 1.00 60.72  ? 239 PHE A O     1 
ATOM   3234 C CB    . PHE C 3 245 ? 79.755  33.709 122.175 1.00 61.01  ? 239 PHE A CB    1 
ATOM   3235 C CG    . PHE C 3 245 ? 81.110  34.263 121.832 1.00 60.57  ? 239 PHE A CG    1 
ATOM   3236 C CD1   . PHE C 3 245 ? 82.128  34.259 122.767 1.00 62.19  ? 239 PHE A CD1   1 
ATOM   3237 C CD2   . PHE C 3 245 ? 81.378  34.738 120.562 1.00 63.03  ? 239 PHE A CD2   1 
ATOM   3238 C CE1   . PHE C 3 245 ? 83.382  34.758 122.459 1.00 63.96  ? 239 PHE A CE1   1 
ATOM   3239 C CE2   . PHE C 3 245 ? 82.630  35.235 120.243 1.00 66.40  ? 239 PHE A CE2   1 
ATOM   3240 C CZ    . PHE C 3 245 ? 83.635  35.246 121.194 1.00 64.35  ? 239 PHE A CZ    1 
ATOM   3241 N N     . CYS C 3 246 ? 78.964  31.370 124.526 1.00 60.66  ? 240 CYS A N     1 
ATOM   3242 C CA    . CYS C 3 246 ? 78.017  30.870 125.512 1.00 60.46  ? 240 CYS A CA    1 
ATOM   3243 C C     . CYS C 3 246 ? 78.036  31.733 126.765 1.00 60.64  ? 240 CYS A C     1 
ATOM   3244 O O     . CYS C 3 246 ? 78.869  32.630 126.921 1.00 58.57  ? 240 CYS A O     1 
ATOM   3245 C CB    . CYS C 3 246 ? 78.378  29.440 125.903 1.00 61.09  ? 240 CYS A CB    1 
ATOM   3246 S SG    . CYS C 3 246 ? 80.089  29.301 126.498 1.00 65.09  ? 240 CYS A SG    1 
ATOM   3247 N N     . ARG C 3 247 ? 77.122  31.432 127.674 1.00 56.00  ? 241 ARG A N     1 
ATOM   3248 C CA    . ARG C 3 247 ? 77.034  32.167 128.923 1.00 54.22  ? 241 ARG A CA    1 
ATOM   3249 C C     . ARG C 3 247 ? 77.951  31.541 129.954 1.00 50.44  ? 241 ARG A C     1 
ATOM   3250 O O     . ARG C 3 247 ? 78.083  30.325 130.040 1.00 47.80  ? 241 ARG A O     1 
ATOM   3251 C CB    . ARG C 3 247 ? 75.593  32.172 129.448 1.00 56.43  ? 241 ARG A CB    1 
ATOM   3252 C CG    . ARG C 3 247 ? 75.212  30.912 130.212 1.00 63.72  ? 241 ARG A CG    1 
ATOM   3253 C CD    . ARG C 3 247 ? 73.713  30.689 130.201 1.00 60.94  ? 241 ARG A CD    1 
ATOM   3254 N NE    . ARG C 3 247 ? 73.073  31.302 131.355 1.00 64.87  ? 241 ARG A NE    1 
ATOM   3255 C CZ    . ARG C 3 247 ? 71.766  31.487 131.454 1.00 78.18  ? 241 ARG A CZ    1 
ATOM   3256 N NH1   . ARG C 3 247 ? 70.975  31.086 130.465 1.00 60.81  ? 241 ARG A NH1   1 
ATOM   3257 N NH2   . ARG C 3 247 ? 71.255  32.054 132.540 1.00 66.86  ? 241 ARG A NH2   1 
ATOM   3258 N N     . VAL C 3 248 ? 78.576  32.386 130.749 1.00 45.25  ? 242 VAL A N     1 
ATOM   3259 C CA    . VAL C 3 248 ? 79.445  31.903 131.797 1.00 44.50  ? 242 VAL A CA    1 
ATOM   3260 C C     . VAL C 3 248 ? 78.800  32.290 133.143 1.00 46.95  ? 242 VAL A C     1 
ATOM   3261 O O     . VAL C 3 248 ? 78.555  33.471 133.439 1.00 44.55  ? 242 VAL A O     1 
ATOM   3262 C CB    . VAL C 3 248 ? 80.905  32.408 131.607 1.00 47.67  ? 242 VAL A CB    1 
ATOM   3263 C CG1   . VAL C 3 248 ? 81.751  32.148 132.837 1.00 47.35  ? 242 VAL A CG1   1 
ATOM   3264 C CG2   . VAL C 3 248 ? 81.533  31.748 130.401 1.00 47.07  ? 242 VAL A CG2   1 
ATOM   3265 N N     . ARG C 3 249 ? 78.453  31.267 133.920 1.00 40.98  ? 243 ARG A N     1 
ATOM   3266 C CA    . ARG C 3 249 ? 77.798  31.471 135.206 1.00 37.89  ? 243 ARG A CA    1 
ATOM   3267 C C     . ARG C 3 249 ? 78.658  32.142 136.282 1.00 42.62  ? 243 ARG A C     1 
ATOM   3268 O O     . ARG C 3 249 ? 79.830  32.444 136.072 1.00 40.93  ? 243 ARG A O     1 
ATOM   3269 C CB    . ARG C 3 249 ? 77.131  30.190 135.702 1.00 30.07  ? 243 ARG A CB    1 
ATOM   3270 C CG    . ARG C 3 249 ? 75.715  30.021 135.181 1.00 21.56  ? 243 ARG A CG    1 
ATOM   3271 C CD    . ARG C 3 249 ? 75.304  28.562 135.031 1.00 33.40  ? 243 ARG A CD    1 
ATOM   3272 N NE    . ARG C 3 249 ? 73.925  28.431 134.550 1.00 54.92  ? 243 ARG A NE    1 
ATOM   3273 C CZ    . ARG C 3 249 ? 73.595  27.968 133.344 1.00 83.19  ? 243 ARG A CZ    1 
ATOM   3274 N NH1   . ARG C 3 249 ? 74.543  27.570 132.504 1.00 84.99  ? 243 ARG A NH1   1 
ATOM   3275 N NH2   . ARG C 3 249 ? 72.323  27.882 132.975 1.00 62.09  ? 243 ARG A NH2   1 
ATOM   3276 N N     . LYS C 3 250 ? 78.048  32.420 137.427 1.00 41.26  ? 244 LYS A N     1 
ATOM   3277 C CA    . LYS C 3 250 ? 78.726  33.133 138.505 1.00 40.89  ? 244 LYS A CA    1 
ATOM   3278 C C     . LYS C 3 250 ? 79.960  32.469 139.084 1.00 43.94  ? 244 LYS A C     1 
ATOM   3279 O O     . LYS C 3 250 ? 80.829  33.165 139.625 1.00 43.86  ? 244 LYS A O     1 
ATOM   3280 C CB    . LYS C 3 250 ? 77.751  33.535 139.614 1.00 43.27  ? 244 LYS A CB    1 
ATOM   3281 C CG    . LYS C 3 250 ? 77.278  32.381 140.478 1.00 48.30  ? 244 LYS A CG    1 
ATOM   3282 C CD    . LYS C 3 250 ? 75.943  32.688 141.139 1.00 41.98  ? 244 LYS A CD    1 
ATOM   3283 C CE    . LYS C 3 250 ? 76.062  33.816 142.151 1.00 33.76  ? 244 LYS A CE    1 
ATOM   3284 N NZ    . LYS C 3 250 ? 74.952  33.731 143.126 1.00 39.47  ? 244 LYS A NZ    1 
ATOM   3285 N N     . ASN C 3 251 ? 80.041  31.144 138.962 1.00 40.11  ? 245 ASN A N     1 
ATOM   3286 C CA    . ASN C 3 251 ? 81.190  30.386 139.458 1.00 40.77  ? 245 ASN A CA    1 
ATOM   3287 C C     . ASN C 3 251 ? 82.326  30.425 138.456 1.00 49.72  ? 245 ASN A C     1 
ATOM   3288 O O     . ASN C 3 251 ? 83.411  29.924 138.733 1.00 52.93  ? 245 ASN A O     1 
ATOM   3289 C CB    . ASN C 3 251 ? 80.816  28.931 139.675 1.00 34.23  ? 245 ASN A CB    1 
ATOM   3290 C CG    . ASN C 3 251 ? 80.024  28.389 138.540 1.00 54.96  ? 245 ASN A CG    1 
ATOM   3291 O OD1   . ASN C 3 251 ? 79.586  29.149 137.674 1.00 56.44  ? 245 ASN A OD1   1 
ATOM   3292 N ND2   . ASN C 3 251 ? 79.828  27.076 138.514 1.00 45.46  ? 245 ASN A ND2   1 
ATOM   3293 N N     . GLY C 3 252 ? 82.068  30.995 137.284 1.00 46.11  ? 246 GLY A N     1 
ATOM   3294 C CA    . GLY C 3 252 ? 83.093  31.118 136.250 1.00 45.65  ? 246 GLY A CA    1 
ATOM   3295 C C     . GLY C 3 252 ? 83.142  29.893 135.353 1.00 51.60  ? 246 GLY A C     1 
ATOM   3296 O O     . GLY C 3 252 ? 84.150  29.638 134.710 1.00 53.24  ? 246 GLY A O     1 
ATOM   3297 N N     . VAL C 3 253 ? 82.049  29.140 135.312 1.00 49.11  ? 247 VAL A N     1 
ATOM   3298 C CA    . VAL C 3 253 ? 81.978  27.947 134.476 1.00 51.28  ? 247 VAL A CA    1 
ATOM   3299 C C     . VAL C 3 253 ? 81.051  28.247 133.310 1.00 61.04  ? 247 VAL A C     1 
ATOM   3300 O O     . VAL C 3 253 ? 79.920  28.694 133.519 1.00 60.53  ? 247 VAL A O     1 
ATOM   3301 C CB    . VAL C 3 253 ? 81.407  26.729 135.253 1.00 54.94  ? 247 VAL A CB    1 
ATOM   3302 C CG1   . VAL C 3 253 ? 81.153  25.555 134.317 1.00 53.88  ? 247 VAL A CG1   1 
ATOM   3303 C CG2   . VAL C 3 253 ? 82.328  26.332 136.394 1.00 54.77  ? 247 VAL A CG2   1 
ATOM   3304 N N     . ALA C 3 254 ? 81.540  27.999 132.092 1.00 60.21  ? 248 ALA A N     1 
ATOM   3305 C CA    . ALA C 3 254 ? 80.791  28.248 130.858 1.00 60.21  ? 248 ALA A CA    1 
ATOM   3306 C C     . ALA C 3 254 ? 79.794  27.155 130.545 1.00 64.03  ? 248 ALA A C     1 
ATOM   3307 O O     . ALA C 3 254 ? 79.960  26.025 130.979 1.00 64.00  ? 248 ALA A O     1 
ATOM   3308 C CB    . ALA C 3 254 ? 81.744  28.418 129.699 1.00 61.53  ? 248 ALA A CB    1 
ATOM   3309 N N     . ALA C 3 255 ? 78.768  27.488 129.771 1.00 64.13  ? 249 ALA A N     1 
ATOM   3310 C CA    . ALA C 3 255 ? 77.738  26.511 129.425 1.00 66.43  ? 249 ALA A CA    1 
ATOM   3311 C C     . ALA C 3 255 ? 77.428  26.449 127.930 1.00 75.65  ? 249 ALA A C     1 
ATOM   3312 O O     . ALA C 3 255 ? 76.609  27.227 127.433 1.00 77.62  ? 249 ALA A O     1 
ATOM   3313 C CB    . ALA C 3 255 ? 76.463  26.797 130.211 1.00 67.07  ? 249 ALA A CB    1 
ATOM   3314 N N     . PRO C 3 256 ? 78.088  25.538 127.228 1.00 72.57  ? 250 PRO A N     1 
ATOM   3315 C CA    . PRO C 3 256 ? 77.888  25.342 125.803 1.00 72.57  ? 250 PRO A CA    1 
ATOM   3316 C C     . PRO C 3 256 ? 76.449  25.005 125.440 1.00 78.33  ? 250 PRO A C     1 
ATOM   3317 O O     . PRO C 3 256 ? 75.670  24.575 126.283 1.00 79.47  ? 250 PRO A O     1 
ATOM   3318 C CB    . PRO C 3 256 ? 78.829  24.183 125.517 1.00 73.84  ? 250 PRO A CB    1 
ATOM   3319 C CG    . PRO C 3 256 ? 80.009  24.468 126.485 1.00 77.77  ? 250 PRO A CG    1 
ATOM   3320 C CD    . PRO C 3 256 ? 79.494  25.329 127.618 1.00 72.48  ? 250 PRO A CD    1 
ATOM   3321 N N     . SER C 3 257 ? 76.105  25.183 124.176 1.00 75.72  ? 251 SER A N     1 
ATOM   3322 C CA    . SER C 3 257 ? 74.748  24.887 123.768 1.00 77.80  ? 251 SER A CA    1 
ATOM   3323 C C     . SER C 3 257 ? 74.487  25.022 122.280 1.00 90.23  ? 251 SER A C     1 
ATOM   3324 O O     . SER C 3 257 ? 74.245  26.132 121.793 1.00 91.31  ? 251 SER A O     1 
ATOM   3325 C CB    . SER C 3 257 ? 73.794  25.799 124.529 1.00 79.14  ? 251 SER A CB    1 
ATOM   3326 O OG    . SER C 3 257 ? 72.436  25.561 124.185 1.00 86.94  ? 251 SER A OG    1 
ATOM   3327 N N     . ALA C 3 258 ? 74.502  23.902 121.564 1.00 89.52  ? 252 ALA A N     1 
ATOM   3328 C CA    . ALA C 3 258 ? 74.228  23.930 120.128 1.00 89.79  ? 252 ALA A CA    1 
ATOM   3329 C C     . ALA C 3 258 ? 72.790  24.367 119.879 1.00 94.70  ? 252 ALA A C     1 
ATOM   3330 O O     . ALA C 3 258 ? 72.421  24.738 118.765 1.00 95.65  ? 252 ALA A O     1 
ATOM   3331 C CB    . ALA C 3 258 ? 74.491  22.573 119.503 1.00 90.60  ? 252 ALA A CB    1 
ATOM   3332 N N     . THR C 3 259 ? 71.984  24.337 120.930 1.00 90.22  ? 253 THR A N     1 
ATOM   3333 C CA    . THR C 3 259 ? 70.591  24.714 120.776 1.00 89.37  ? 253 THR A CA    1 
ATOM   3334 C C     . THR C 3 259 ? 70.237  26.153 121.115 1.00 90.85  ? 253 THR A C     1 
ATOM   3335 O O     . THR C 3 259 ? 69.094  26.563 120.903 1.00 90.43  ? 253 THR A O     1 
ATOM   3336 C CB    . THR C 3 259 ? 69.616  23.766 121.510 1.00 99.94  ? 253 THR A CB    1 
ATOM   3337 O OG1   . THR C 3 259 ? 68.604  23.338 120.589 1.00 99.01  ? 253 THR A OG1   1 
ATOM   3338 C CG2   . THR C 3 259 ? 68.945  24.477 122.695 1.00 98.94  ? 253 THR A CG2   1 
ATOM   3339 N N     . SER C 3 260 ? 71.156  26.912 121.695 1.00 85.23  ? 254 SER A N     1 
ATOM   3340 C CA    . SER C 3 260 ? 70.825  28.285 122.056 1.00 83.49  ? 254 SER A CA    1 
ATOM   3341 C C     . SER C 3 260 ? 71.896  29.312 121.867 1.00 80.71  ? 254 SER A C     1 
ATOM   3342 O O     . SER C 3 260 ? 73.068  28.980 121.646 1.00 79.56  ? 254 SER A O     1 
ATOM   3343 C CB    . SER C 3 260 ? 70.043  28.393 123.368 1.00 86.80  ? 254 SER A CB    1 
ATOM   3344 O OG    . SER C 3 260 ? 68.637  28.373 123.117 1.00 95.37  ? 254 SER A OG    1 
ATOM   3345 N N     . GLN C 3 261 ? 71.473  30.564 121.751 1.00 72.84  ? 255 GLN A N     1 
ATOM   3346 C CA    . GLN C 3 261 ? 72.423  31.631 121.504 1.00 71.25  ? 255 GLN A CA    1 
ATOM   3347 C C     . GLN C 3 261 ? 72.414  32.777 122.491 1.00 66.87  ? 255 GLN A C     1 
ATOM   3348 O O     . GLN C 3 261 ? 71.358  33.214 122.961 1.00 64.76  ? 255 GLN A O     1 
ATOM   3349 C CB    . GLN C 3 261 ? 72.393  32.093 120.038 1.00 73.26  ? 255 GLN A CB    1 
ATOM   3350 C CG    . GLN C 3 261 ? 71.108  32.773 119.610 1.00 87.15  ? 255 GLN A CG    1 
ATOM   3351 C CD    . GLN C 3 261 ? 71.147  33.210 118.130 1.00 100.00 ? 255 GLN A CD    1 
ATOM   3352 O OE1   . GLN C 3 261 ? 71.856  32.596 117.321 1.00 98.21  ? 255 GLN A OE1   1 
ATOM   3353 N NE2   . GLN C 3 261 ? 70.412  34.283 117.818 1.00 100.00 ? 255 GLN A NE2   1 
ATOM   3354 N N     . LEU C 3 262 ? 73.606  33.241 122.846 1.00 56.71  ? 256 LEU A N     1 
ATOM   3355 C CA    . LEU C 3 262 ? 73.687  34.334 123.782 1.00 53.87  ? 256 LEU A CA    1 
ATOM   3356 C C     . LEU C 3 262 ? 72.789  35.403 123.189 1.00 56.18  ? 256 LEU A C     1 
ATOM   3357 O O     . LEU C 3 262 ? 72.926  35.743 122.022 1.00 56.03  ? 256 LEU A O     1 
ATOM   3358 C CB    . LEU C 3 262 ? 75.130  34.826 123.890 1.00 53.15  ? 256 LEU A CB    1 
ATOM   3359 C CG    . LEU C 3 262 ? 75.983  34.288 125.049 1.00 55.22  ? 256 LEU A CG    1 
ATOM   3360 C CD1   . LEU C 3 262 ? 77.200  35.164 125.286 1.00 54.66  ? 256 LEU A CD1   1 
ATOM   3361 C CD2   . LEU C 3 262 ? 75.177  34.148 126.326 1.00 54.91  ? 256 LEU A CD2   1 
ATOM   3362 N N     . SER C 3 263 ? 71.801  35.851 123.952 1.00 55.35  ? 257 SER A N     1 
ATOM   3363 C CA    . SER C 3 263 ? 70.879  36.887 123.486 1.00 57.14  ? 257 SER A CA    1 
ATOM   3364 C C     . SER C 3 263 ? 71.673  38.151 123.138 1.00 63.80  ? 257 SER A C     1 
ATOM   3365 O O     . SER C 3 263 ? 72.773  38.364 123.660 1.00 63.63  ? 257 SER A O     1 
ATOM   3366 C CB    . SER C 3 263 ? 69.834  37.201 124.563 1.00 60.22  ? 257 SER A CB    1 
ATOM   3367 O OG    . SER C 3 263 ? 70.226  38.314 125.351 1.00 67.41  ? 257 SER A OG    1 
ATOM   3368 N N     . ASN C 3 264 ? 71.133  38.985 122.254 1.00 60.25  ? 258 ASN A N     1 
ATOM   3369 C CA    . ASN C 3 264 ? 71.865  40.183 121.867 1.00 59.89  ? 258 ASN A CA    1 
ATOM   3370 C C     . ASN C 3 264 ? 72.106  41.120 123.047 1.00 63.31  ? 258 ASN A C     1 
ATOM   3371 O O     . ASN C 3 264 ? 73.133  41.800 123.108 1.00 60.97  ? 258 ASN A O     1 
ATOM   3372 C CB    . ASN C 3 264 ? 71.246  40.874 120.648 1.00 60.68  ? 258 ASN A CB    1 
ATOM   3373 C CG    . ASN C 3 264 ? 71.702  40.243 119.336 1.00 84.98  ? 258 ASN A CG    1 
ATOM   3374 O OD1   . ASN C 3 264 ? 71.971  39.047 119.282 1.00 95.07  ? 258 ASN A OD1   1 
ATOM   3375 N ND2   . ASN C 3 264 ? 71.804  41.053 118.289 1.00 70.16  ? 258 ASN A ND2   1 
ATOM   3376 N N     . SER C 3 265 ? 71.186  41.087 124.010 1.00 60.90  ? 259 SER A N     1 
ATOM   3377 C CA    . SER C 3 265 ? 71.264  41.886 125.244 1.00 60.11  ? 259 SER A CA    1 
ATOM   3378 C C     . SER C 3 265 ? 72.595  41.676 125.991 1.00 60.91  ? 259 SER A C     1 
ATOM   3379 O O     . SER C 3 265 ? 73.257  42.633 126.404 1.00 58.22  ? 259 SER A O     1 
ATOM   3380 C CB    . SER C 3 265 ? 70.098  41.502 126.172 1.00 60.99  ? 259 SER A CB    1 
ATOM   3381 O OG    . SER C 3 265 ? 69.457  42.638 126.719 1.00 62.39  ? 259 SER A OG    1 
ATOM   3382 N N     . ALA C 3 266 ? 72.959  40.408 126.173 1.00 55.79  ? 260 ALA A N     1 
ATOM   3383 C CA    . ALA C 3 266 ? 74.190  40.033 126.861 1.00 54.02  ? 260 ALA A CA    1 
ATOM   3384 C C     . ALA C 3 266 ? 75.394  40.517 126.089 1.00 55.01  ? 260 ALA A C     1 
ATOM   3385 O O     . ALA C 3 266 ? 76.292  41.130 126.650 1.00 52.57  ? 260 ALA A O     1 
ATOM   3386 C CB    . ALA C 3 266 ? 74.257  38.534 127.031 1.00 54.78  ? 260 ALA A CB    1 
ATOM   3387 N N     . LEU C 3 267 ? 75.400  40.217 124.794 1.00 54.66  ? 261 LEU A N     1 
ATOM   3388 C CA    . LEU C 3 267 ? 76.486  40.610 123.897 1.00 53.50  ? 261 LEU A CA    1 
ATOM   3389 C C     . LEU C 3 267 ? 76.671  42.119 123.935 1.00 51.77  ? 261 LEU A C     1 
ATOM   3390 O O     . LEU C 3 267 ? 77.792  42.619 124.022 1.00 46.88  ? 261 LEU A O     1 
ATOM   3391 C CB    . LEU C 3 267 ? 76.183  40.129 122.480 1.00 53.46  ? 261 LEU A CB    1 
ATOM   3392 C CG    . LEU C 3 267 ? 76.070  38.611 122.386 1.00 56.40  ? 261 LEU A CG    1 
ATOM   3393 C CD1   . LEU C 3 267 ? 75.306  38.225 121.130 1.00 56.92  ? 261 LEU A CD1   1 
ATOM   3394 C CD2   . LEU C 3 267 ? 77.459  37.982 122.410 1.00 55.02  ? 261 LEU A CD2   1 
ATOM   3395 N N     . GLY C 3 268 ? 75.557  42.841 123.930 1.00 50.76  ? 262 GLY A N     1 
ATOM   3396 C CA    . GLY C 3 268 ? 75.616  44.284 124.024 1.00 51.02  ? 262 GLY A CA    1 
ATOM   3397 C C     . GLY C 3 268 ? 76.062  44.559 125.453 1.00 55.84  ? 262 GLY A C     1 
ATOM   3398 O O     . GLY C 3 268 ? 76.633  45.612 125.746 1.00 56.46  ? 262 GLY A O     1 
ATOM   3399 N N     . GLY C 3 269 ? 75.816  43.586 126.330 1.00 49.85  ? 263 GLY A N     1 
ATOM   3400 C CA    . GLY C 3 269 ? 76.185  43.708 127.739 1.00 48.17  ? 263 GLY A CA    1 
ATOM   3401 C C     . GLY C 3 269 ? 77.698  43.790 127.953 1.00 46.12  ? 263 GLY A C     1 
ATOM   3402 O O     . GLY C 3 269 ? 78.186  44.637 128.699 1.00 43.23  ? 263 GLY A O     1 
ATOM   3403 N N     . ILE C 3 270 ? 78.440  42.912 127.286 1.00 42.24  ? 264 ILE A N     1 
ATOM   3404 C CA    . ILE C 3 270 ? 79.896  42.886 127.393 1.00 41.86  ? 264 ILE A CA    1 
ATOM   3405 C C     . ILE C 3 270 ? 80.525  44.228 127.035 1.00 49.91  ? 264 ILE A C     1 
ATOM   3406 O O     . ILE C 3 270 ? 81.594  44.564 127.533 1.00 50.76  ? 264 ILE A O     1 
ATOM   3407 C CB    . ILE C 3 270 ? 80.519  41.788 126.501 1.00 43.31  ? 264 ILE A CB    1 
ATOM   3408 C CG1   . ILE C 3 270 ? 79.893  40.421 126.817 1.00 42.87  ? 264 ILE A CG1   1 
ATOM   3409 C CG2   . ILE C 3 270 ? 82.017  41.745 126.704 1.00 41.68  ? 264 ILE A CG2   1 
ATOM   3410 C CD1   . ILE C 3 270 ? 80.010  39.371 125.715 1.00 37.29  ? 264 ILE A CD1   1 
ATOM   3411 N N     . PHE C 3 271 ? 79.858  44.989 126.169 1.00 47.86  ? 265 PHE A N     1 
ATOM   3412 C CA    . PHE C 3 271 ? 80.347  46.293 125.735 1.00 47.53  ? 265 PHE A CA    1 
ATOM   3413 C C     . PHE C 3 271 ? 80.042  47.329 126.800 1.00 54.71  ? 265 PHE A C     1 
ATOM   3414 O O     . PHE C 3 271 ? 80.819  48.263 127.025 1.00 56.61  ? 265 PHE A O     1 
ATOM   3415 C CB    . PHE C 3 271 ? 79.659  46.695 124.435 1.00 48.56  ? 265 PHE A CB    1 
ATOM   3416 C CG    . PHE C 3 271 ? 80.482  46.437 123.215 1.00 49.30  ? 265 PHE A CG    1 
ATOM   3417 C CD1   . PHE C 3 271 ? 81.753  46.961 123.106 1.00 53.50  ? 265 PHE A CD1   1 
ATOM   3418 C CD2   . PHE C 3 271 ? 79.988  45.666 122.179 1.00 50.67  ? 265 PHE A CD2   1 
ATOM   3419 C CE1   . PHE C 3 271 ? 82.526  46.713 121.987 1.00 54.51  ? 265 PHE A CE1   1 
ATOM   3420 C CE2   . PHE C 3 271 ? 80.746  45.424 121.061 1.00 53.47  ? 265 PHE A CE2   1 
ATOM   3421 C CZ    . PHE C 3 271 ? 82.023  45.944 120.968 1.00 52.56  ? 265 PHE A CZ    1 
ATOM   3422 N N     . GLY C 3 272 ? 78.895  47.166 127.449 1.00 49.70  ? 266 GLY A N     1 
ATOM   3423 C CA    . GLY C 3 272 ? 78.507  48.073 128.512 1.00 47.92  ? 266 GLY A CA    1 
ATOM   3424 C C     . GLY C 3 272 ? 79.441  47.772 129.678 1.00 48.08  ? 266 GLY A C     1 
ATOM   3425 O O     . GLY C 3 272 ? 80.161  48.643 130.161 1.00 46.63  ? 266 GLY A O     1 
ATOM   3426 N N     . ALA C 3 273 ? 79.446  46.515 130.097 1.00 41.89  ? 267 ALA A N     1 
ATOM   3427 C CA    . ALA C 3 273 ? 80.283  46.072 131.197 1.00 42.30  ? 267 ALA A CA    1 
ATOM   3428 C C     . ALA C 3 273 ? 81.710  46.562 131.087 1.00 49.93  ? 267 ALA A C     1 
ATOM   3429 O O     . ALA C 3 273 ? 82.265  47.130 132.028 1.00 52.37  ? 267 ALA A O     1 
ATOM   3430 C CB    . ALA C 3 273 ? 80.283  44.564 131.264 1.00 43.35  ? 267 ALA A CB    1 
ATOM   3431 N N     . THR C 3 274 ? 82.325  46.277 129.952 1.00 47.77  ? 268 THR A N     1 
ATOM   3432 C CA    . THR C 3 274 ? 83.715  46.639 129.728 1.00 47.99  ? 268 THR A CA    1 
ATOM   3433 C C     . THR C 3 274 ? 84.012  48.132 129.845 1.00 50.63  ? 268 THR A C     1 
ATOM   3434 O O     . THR C 3 274 ? 85.045  48.533 130.369 1.00 48.81  ? 268 THR A O     1 
ATOM   3435 C CB    . THR C 3 274 ? 84.246  46.073 128.407 1.00 58.41  ? 268 THR A CB    1 
ATOM   3436 O OG1   . THR C 3 274 ? 84.045  44.654 128.381 1.00 63.89  ? 268 THR A OG1   1 
ATOM   3437 C CG2   . THR C 3 274 ? 85.729  46.364 128.273 1.00 59.35  ? 268 THR A CG2   1 
ATOM   3438 N N     . HIS C 3 275 ? 83.098  48.962 129.371 1.00 49.45  ? 269 HIS A N     1 
ATOM   3439 C CA    . HIS C 3 275 ? 83.301  50.401 129.442 1.00 50.58  ? 269 HIS A CA    1 
ATOM   3440 C C     . HIS C 3 275 ? 83.327  50.881 130.883 1.00 55.09  ? 269 HIS A C     1 
ATOM   3441 O O     . HIS C 3 275 ? 84.076  51.788 131.249 1.00 54.99  ? 269 HIS A O     1 
ATOM   3442 C CB    . HIS C 3 275 ? 82.175  51.123 128.704 1.00 51.81  ? 269 HIS A CB    1 
ATOM   3443 C CG    . HIS C 3 275 ? 82.340  52.607 128.668 1.00 55.23  ? 269 HIS A CG    1 
ATOM   3444 N ND1   . HIS C 3 275 ? 81.723  53.450 129.569 1.00 57.14  ? 269 HIS A ND1   1 
ATOM   3445 C CD2   . HIS C 3 275 ? 83.060  53.400 127.840 1.00 56.90  ? 269 HIS A CD2   1 
ATOM   3446 C CE1   . HIS C 3 275 ? 82.052  54.699 129.292 1.00 56.90  ? 269 HIS A CE1   1 
ATOM   3447 N NE2   . HIS C 3 275 ? 82.860  54.696 128.247 1.00 57.06  ? 269 HIS A NE2   1 
ATOM   3448 N N     . ARG C 3 276 ? 82.458  50.294 131.688 1.00 52.09  ? 270 ARG A N     1 
ATOM   3449 C CA    . ARG C 3 276 ? 82.342  50.669 133.081 1.00 53.36  ? 270 ARG A CA    1 
ATOM   3450 C C     . ARG C 3 276 ? 83.618  50.287 133.822 1.00 58.48  ? 270 ARG A C     1 
ATOM   3451 O O     . ARG C 3 276 ? 84.111  51.021 134.679 1.00 55.61  ? 270 ARG A O     1 
ATOM   3452 C CB    . ARG C 3 276 ? 81.111  49.993 133.695 1.00 55.54  ? 270 ARG A CB    1 
ATOM   3453 C CG    . ARG C 3 276 ? 81.392  49.148 134.913 1.00 69.54  ? 270 ARG A CG    1 
ATOM   3454 C CD    . ARG C 3 276 ? 80.154  49.040 135.783 1.00 82.33  ? 270 ARG A CD    1 
ATOM   3455 N NE    . ARG C 3 276 ? 79.135  48.180 135.183 1.00 93.18  ? 270 ARG A NE    1 
ATOM   3456 C CZ    . ARG C 3 276 ? 79.286  46.875 134.966 1.00 100.00 ? 270 ARG A CZ    1 
ATOM   3457 N NH1   . ARG C 3 276 ? 80.421  46.268 135.286 1.00 90.66  ? 270 ARG A NH1   1 
ATOM   3458 N NH2   . ARG C 3 276 ? 78.303  46.167 134.423 1.00 86.01  ? 270 ARG A NH2   1 
ATOM   3459 N N     . LEU C 3 277 ? 84.168  49.138 133.464 1.00 58.00  ? 271 LEU A N     1 
ATOM   3460 C CA    . LEU C 3 277 ? 85.401  48.673 134.080 1.00 58.37  ? 271 LEU A CA    1 
ATOM   3461 C C     . LEU C 3 277 ? 86.432  49.793 134.024 1.00 67.66  ? 271 LEU A C     1 
ATOM   3462 O O     . LEU C 3 277 ? 87.006  50.172 135.042 1.00 71.36  ? 271 LEU A O     1 
ATOM   3463 C CB    . LEU C 3 277 ? 85.926  47.435 133.354 1.00 57.52  ? 271 LEU A CB    1 
ATOM   3464 C CG    . LEU C 3 277 ? 87.336  47.017 133.756 1.00 60.63  ? 271 LEU A CG    1 
ATOM   3465 C CD1   . LEU C 3 277 ? 87.269  46.026 134.907 1.00 61.11  ? 271 LEU A CD1   1 
ATOM   3466 C CD2   . LEU C 3 277 ? 88.077  46.437 132.560 1.00 58.75  ? 271 LEU A CD2   1 
ATOM   3467 N N     . ILE C 3 278 ? 86.641  50.333 132.827 1.00 63.50  ? 272 ILE A N     1 
ATOM   3468 C CA    . ILE C 3 278 ? 87.600  51.411 132.603 1.00 62.48  ? 272 ILE A CA    1 
ATOM   3469 C C     . ILE C 3 278 ? 87.085  52.759 133.097 1.00 68.24  ? 272 ILE A C     1 
ATOM   3470 O O     . ILE C 3 278 ? 87.792  53.510 133.779 1.00 68.55  ? 272 ILE A O     1 
ATOM   3471 C CB    . ILE C 3 278 ? 87.870  51.582 131.094 1.00 63.87  ? 272 ILE A CB    1 
ATOM   3472 C CG1   . ILE C 3 278 ? 88.387  50.284 130.489 1.00 63.55  ? 272 ILE A CG1   1 
ATOM   3473 C CG2   . ILE C 3 278 ? 88.835  52.730 130.841 1.00 63.82  ? 272 ILE A CG2   1 
ATOM   3474 C CD1   . ILE C 3 278 ? 88.963  50.453 129.101 1.00 72.88  ? 272 ILE A CD1   1 
ATOM   3475 N N     . TYR C 3 279 ? 85.864  53.083 132.699 1.00 63.71  ? 273 TYR A N     1 
ATOM   3476 C CA    . TYR C 3 279 ? 85.295  54.375 133.021 1.00 62.04  ? 273 TYR A CA    1 
ATOM   3477 C C     . TYR C 3 279 ? 84.357  54.451 134.228 1.00 66.74  ? 273 TYR A C     1 
ATOM   3478 O O     . TYR C 3 279 ? 84.069  55.543 134.719 1.00 65.92  ? 273 TYR A O     1 
ATOM   3479 C CB    . TYR C 3 279 ? 84.719  55.021 131.758 1.00 61.73  ? 273 TYR A CB    1 
ATOM   3480 C CG    . TYR C 3 279 ? 85.720  55.086 130.625 1.00 61.50  ? 273 TYR A CG    1 
ATOM   3481 C CD1   . TYR C 3 279 ? 86.049  53.956 129.892 1.00 63.01  ? 273 TYR A CD1   1 
ATOM   3482 C CD2   . TYR C 3 279 ? 86.368  56.273 130.322 1.00 62.73  ? 273 TYR A CD2   1 
ATOM   3483 C CE1   . TYR C 3 279 ? 86.980  54.015 128.867 1.00 65.87  ? 273 TYR A CE1   1 
ATOM   3484 C CE2   . TYR C 3 279 ? 87.294  56.345 129.300 1.00 64.67  ? 273 TYR A CE2   1 
ATOM   3485 C CZ    . TYR C 3 279 ? 87.599  55.215 128.573 1.00 76.79  ? 273 TYR A CZ    1 
ATOM   3486 O OH    . TYR C 3 279 ? 88.517  55.292 127.547 1.00 82.37  ? 273 TYR A OH    1 
ATOM   3487 N N     . GLY C 3 280 ? 83.912  53.302 134.730 1.00 64.58  ? 274 GLY A N     1 
ATOM   3488 C CA    . GLY C 3 280 ? 83.033  53.281 135.899 1.00 64.95  ? 274 GLY A CA    1 
ATOM   3489 C C     . GLY C 3 280 ? 81.584  53.718 135.656 1.00 70.63  ? 274 GLY A C     1 
ATOM   3490 O O     . GLY C 3 280 ? 81.247  54.261 134.612 1.00 68.96  ? 274 GLY A O     1 
ATOM   3491 N N     . ALA C 3 281 ? 80.745  53.480 136.657 1.00 72.28  ? 275 ALA A N     1 
ATOM   3492 C CA    . ALA C 3 281 ? 79.311  53.782 136.638 1.00 75.10  ? 275 ALA A CA    1 
ATOM   3493 C C     . ALA C 3 281 ? 78.696  54.600 135.521 1.00 82.77  ? 275 ALA A C     1 
ATOM   3494 O O     . ALA C 3 281 ? 79.324  55.498 134.959 1.00 82.88  ? 275 ALA A O     1 
ATOM   3495 C CB    . ALA C 3 281 ? 78.867  54.327 137.977 1.00 76.84  ? 275 ALA A CB    1 
ATOM   3496 N N     . LYS C 3 282 ? 77.411  54.334 135.291 1.00 83.11  ? 276 LYS A N     1 
ATOM   3497 C CA    . LYS C 3 282 ? 76.629  55.022 134.269 1.00 84.69  ? 276 LYS A CA    1 
ATOM   3498 C C     . LYS C 3 282 ? 76.495  56.511 134.576 1.00 89.40  ? 276 LYS A C     1 
ATOM   3499 O O     . LYS C 3 282 ? 76.136  56.905 135.676 1.00 89.42  ? 276 LYS A O     1 
ATOM   3500 C CB    . LYS C 3 282 ? 75.269  54.352 134.095 1.00 88.86  ? 276 LYS A CB    1 
ATOM   3501 C CG    . LYS C 3 282 ? 75.341  52.827 134.080 1.00 99.85  ? 276 LYS A CG    1 
ATOM   3502 C CD    . LYS C 3 282 ? 75.187  52.270 135.484 1.00 100.00 ? 276 LYS A CD    1 
ATOM   3503 C CE    . LYS C 3 282 ? 74.518  53.284 136.399 1.00 98.68  ? 276 LYS A CE    1 
ATOM   3504 N NZ    . LYS C 3 282 ? 73.561  52.638 137.336 1.00 100.00 ? 276 LYS A NZ    1 
ATOM   3505 N N     . ASP C 3 283 ? 76.780  57.323 133.575 1.00 87.74  ? 277 ASP A N     1 
ATOM   3506 C CA    . ASP C 3 283 ? 76.940  58.763 133.703 1.00 88.66  ? 277 ASP A CA    1 
ATOM   3507 C C     . ASP C 3 283 ? 75.890  59.787 133.281 1.00 95.47  ? 277 ASP A C     1 
ATOM   3508 O O     . ASP C 3 283 ? 74.694  59.699 133.562 1.00 95.35  ? 277 ASP A O     1 
ATOM   3509 C CB    . ASP C 3 283 ? 78.204  59.113 132.926 1.00 90.00  ? 277 ASP A CB    1 
ATOM   3510 C CG    . ASP C 3 283 ? 78.349  58.203 131.716 1.00 90.64  ? 277 ASP A CG    1 
ATOM   3511 O OD1   . ASP C 3 283 ? 78.138  56.984 131.823 1.00 100.00 ? 277 ASP A OD1   1 
ATOM   3512 O OD2   . ASP C 3 283 ? 78.719  58.731 130.601 1.00 85.76  ? 277 ASP A OD2   1 
ATOM   3513 N N     . ASP C 3 284 ? 76.456  60.810 132.645 1.00 93.93  ? 278 ASP A N     1 
ATOM   3514 C CA    . ASP C 3 284 ? 75.803  62.026 132.171 1.00 93.95  ? 278 ASP A CA    1 
ATOM   3515 C C     . ASP C 3 284 ? 74.378  62.045 131.641 0.00 98.82  ? 278 ASP A C     1 
ATOM   3516 O O     . ASP C 3 284 ? 74.098  61.575 130.532 0.00 98.61  ? 278 ASP A O     1 
ATOM   3517 C CB    . ASP C 3 284 ? 76.724  62.792 131.218 0.00 95.17  ? 278 ASP A CB    1 
ATOM   3518 C CG    . ASP C 3 284 ? 77.996  63.287 131.911 0.00 99.50  ? 278 ASP A CG    1 
ATOM   3519 O OD1   . ASP C 3 284 ? 78.187  62.992 133.117 0.00 100.00 ? 278 ASP A OD1   1 
ATOM   3520 O OD2   . ASP C 3 284 ? 78.813  63.969 131.245 0.00 100.00 ? 278 ASP A OD2   1 
ATOM   3521 N N     . SER C 3 285 ? 73.499  62.706 132.394 0.00 95.21  ? 279 SER A N     1 
ATOM   3522 C CA    . SER C 3 285 ? 72.107  62.939 131.976 0.00 94.94  ? 279 SER A CA    1 
ATOM   3523 C C     . SER C 3 285 ? 71.028  61.881 132.240 1.00 100.00 ? 279 SER A C     1 
ATOM   3524 O O     . SER C 3 285 ? 69.873  62.202 132.519 1.00 100.00 ? 279 SER A O     1 
ATOM   3525 C CB    . SER C 3 285 ? 72.041  63.474 130.551 0.00 97.12  ? 279 SER A CB    1 
ATOM   3526 O OG    . SER C 3 285 ? 70.703  63.780 130.197 0.00 100.00 ? 279 SER A OG    1 
ATOM   3527 N N     . GLY C 3 286 ? 71.421  60.632 132.103 1.00 95.59  ? 280 GLY A N     1 
ATOM   3528 C CA    . GLY C 3 286 ? 70.490  59.592 132.406 1.00 95.24  ? 280 GLY A CA    1 
ATOM   3529 C C     . GLY C 3 286 ? 70.087  58.679 131.271 1.00 99.08  ? 280 GLY A C     1 
ATOM   3530 O O     . GLY C 3 286 ? 69.344  57.725 131.525 1.00 100.00 ? 280 GLY A O     1 
ATOM   3531 N N     . GLN C 3 287 ? 70.657  58.859 130.060 1.00 92.74  ? 281 GLN A N     1 
ATOM   3532 C CA    . GLN C 3 287 ? 70.316  58.016 128.884 1.00 91.01  ? 281 GLN A CA    1 
ATOM   3533 C C     . GLN C 3 287 ? 70.890  58.281 127.465 1.00 91.92  ? 281 GLN A C     1 
ATOM   3534 O O     . GLN C 3 287 ? 71.155  59.426 127.068 1.00 92.30  ? 281 GLN A O     1 
ATOM   3535 C CB    . GLN C 3 287 ? 68.783  57.976 128.790 1.00 92.51  ? 281 GLN A CB    1 
ATOM   3536 C CG    . GLN C 3 287 ? 68.147  56.995 127.796 1.00 98.50  ? 281 GLN A CG    1 
ATOM   3537 C CD    . GLN C 3 287 ? 68.331  55.532 128.216 1.00 100.00 ? 281 GLN A CD    1 
ATOM   3538 O OE1   . GLN C 3 287 ? 69.062  54.799 127.537 1.00 100.00 ? 281 GLN A OE1   1 
ATOM   3539 N NE2   . GLN C 3 287 ? 67.598  55.106 129.261 1.00 100.00 ? 281 GLN A NE2   1 
ATOM   3540 N N     . ARG C 3 288 ? 71.027  57.184 126.711 1.00 86.38  ? 282 ARG A N     1 
ATOM   3541 C CA    . ARG C 3 288 ? 71.437  57.204 125.304 1.00 85.54  ? 282 ARG A CA    1 
ATOM   3542 C C     . ARG C 3 288 ? 72.913  57.237 124.911 1.00 85.68  ? 282 ARG A C     1 
ATOM   3543 O O     . ARG C 3 288 ? 73.469  58.315 124.743 1.00 86.24  ? 282 ARG A O     1 
ATOM   3544 C CB    . ARG C 3 288 ? 70.675  58.315 124.559 1.00 87.59  ? 282 ARG A CB    1 
ATOM   3545 C CG    . ARG C 3 288 ? 69.603  57.848 123.642 1.00 98.97  ? 282 ARG A CG    1 
ATOM   3546 C CD    . ARG C 3 288 ? 70.121  56.738 122.853 1.00 100.00 ? 282 ARG A CD    1 
ATOM   3547 N NE    . ARG C 3 288 ? 68.952  55.878 122.574 1.00 100.00 ? 282 ARG A NE    1 
ATOM   3548 C CZ    . ARG C 3 288 ? 67.797  56.305 122.044 1.00 100.00 ? 282 ARG A CZ    1 
ATOM   3549 N NH1   . ARG C 3 288 ? 67.709  57.528 121.617 1.00 100.00 ? 282 ARG A NH1   1 
ATOM   3550 N NH2   . ARG C 3 288 ? 66.751  55.536 121.853 1.00 100.00 ? 282 ARG A NH2   1 
ATOM   3551 N N     . TYR C 3 289 ? 73.552  56.082 124.721 1.00 76.68  ? 283 TYR A N     1 
ATOM   3552 C CA    . TYR C 3 289 ? 74.960  56.026 124.239 1.00 74.36  ? 283 TYR A CA    1 
ATOM   3553 C C     . TYR C 3 289 ? 76.100  56.576 125.093 1.00 73.04  ? 283 TYR A C     1 
ATOM   3554 O O     . TYR C 3 289 ? 77.114  57.036 124.558 1.00 74.25  ? 283 TYR A O     1 
ATOM   3555 C CB    . TYR C 3 289 ? 75.094  56.625 122.830 1.00 75.67  ? 283 TYR A CB    1 
ATOM   3556 C CG    . TYR C 3 289 ? 74.356  55.859 121.790 1.00 77.67  ? 283 TYR A CG    1 
ATOM   3557 C CD1   . TYR C 3 289 ? 74.470  54.481 121.720 1.00 79.58  ? 283 TYR A CD1   1 
ATOM   3558 C CD2   . TYR C 3 289 ? 73.461  56.492 120.939 1.00 78.40  ? 283 TYR A CD2   1 
ATOM   3559 C CE1   . TYR C 3 289 ? 73.762  53.756 120.805 1.00 78.31  ? 283 TYR A CE1   1 
ATOM   3560 C CE2   . TYR C 3 289 ? 72.743  55.764 120.007 1.00 79.21  ? 283 TYR A CE2   1 
ATOM   3561 C CZ    . TYR C 3 289 ? 72.897  54.392 119.950 1.00 83.58  ? 283 TYR A CZ    1 
ATOM   3562 O OH    . TYR C 3 289 ? 72.206  53.646 119.022 1.00 82.86  ? 283 TYR A OH    1 
ATOM   3563 N N     . LEU C 3 290 ? 75.967  56.497 126.403 1.00 62.34  ? 284 LEU A N     1 
ATOM   3564 C CA    . LEU C 3 290 ? 77.015  56.997 127.264 1.00 59.12  ? 284 LEU A CA    1 
ATOM   3565 C C     . LEU C 3 290 ? 78.204  56.049 127.362 1.00 58.49  ? 284 LEU A C     1 
ATOM   3566 O O     . LEU C 3 290 ? 79.326  56.470 127.618 1.00 60.58  ? 284 LEU A O     1 
ATOM   3567 C CB    . LEU C 3 290 ? 76.447  57.355 128.624 1.00 59.22  ? 284 LEU A CB    1 
ATOM   3568 C CG    . LEU C 3 290 ? 75.326  58.383 128.460 1.00 64.89  ? 284 LEU A CG    1 
ATOM   3569 C CD1   . LEU C 3 290 ? 74.728  58.759 129.802 1.00 64.92  ? 284 LEU A CD1   1 
ATOM   3570 C CD2   . LEU C 3 290 ? 75.836  59.616 127.709 1.00 68.99  ? 284 LEU A CD2   1 
ATOM   3571 N N     . ALA C 3 291 ? 77.952  54.774 127.117 1.00 47.44  ? 285 ALA A N     1 
ATOM   3572 C CA    . ALA C 3 291 ? 78.988  53.762 127.158 1.00 43.63  ? 285 ALA A CA    1 
ATOM   3573 C C     . ALA C 3 291 ? 79.031  52.993 125.841 1.00 50.40  ? 285 ALA A C     1 
ATOM   3574 O O     . ALA C 3 291 ? 78.315  53.315 124.899 1.00 52.58  ? 285 ALA A O     1 
ATOM   3575 C CB    . ALA C 3 291 ? 78.733  52.815 128.295 1.00 43.17  ? 285 ALA A CB    1 
ATOM   3576 N N     . TRP C 3 292 ? 79.865  51.963 125.782 1.00 47.19  ? 286 TRP A N     1 
ATOM   3577 C CA    . TRP C 3 292 ? 80.010  51.168 124.573 1.00 47.63  ? 286 TRP A CA    1 
ATOM   3578 C C     . TRP C 3 292 ? 78.794  50.265 124.339 1.00 52.43  ? 286 TRP A C     1 
ATOM   3579 O O     . TRP C 3 292 ? 78.299  49.641 125.282 1.00 53.63  ? 286 TRP A O     1 
ATOM   3580 C CB    . TRP C 3 292 ? 81.319  50.363 124.635 1.00 46.79  ? 286 TRP A CB    1 
ATOM   3581 C CG    . TRP C 3 292 ? 82.570  51.210 124.400 1.00 47.74  ? 286 TRP A CG    1 
ATOM   3582 C CD1   . TRP C 3 292 ? 82.730  52.201 123.462 1.00 50.68  ? 286 TRP A CD1   1 
ATOM   3583 C CD2   . TRP C 3 292 ? 83.819  51.132 125.111 1.00 47.40  ? 286 TRP A CD2   1 
ATOM   3584 N NE1   . TRP C 3 292 ? 83.990  52.745 123.560 1.00 50.73  ? 286 TRP A NE1   1 
ATOM   3585 C CE2   . TRP C 3 292 ? 84.679  52.105 124.560 1.00 51.70  ? 286 TRP A CE2   1 
ATOM   3586 C CE3   . TRP C 3 292 ? 84.291  50.336 126.156 1.00 48.51  ? 286 TRP A CE3   1 
ATOM   3587 C CZ2   . TRP C 3 292 ? 85.980  52.300 125.023 1.00 50.57  ? 286 TRP A CZ2   1 
ATOM   3588 C CZ3   . TRP C 3 292 ? 85.589  50.532 126.609 1.00 49.92  ? 286 TRP A CZ3   1 
ATOM   3589 C CH2   . TRP C 3 292 ? 86.414  51.504 126.043 1.00 50.37  ? 286 TRP A CH2   1 
ATOM   3590 N N     . SER C 3 293 ? 78.293  50.234 123.100 1.00 47.02  ? 287 SER A N     1 
ATOM   3591 C CA    . SER C 3 293 ? 77.140  49.395 122.747 1.00 45.53  ? 287 SER A CA    1 
ATOM   3592 C C     . SER C 3 293 ? 77.553  48.468 121.625 1.00 47.17  ? 287 SER A C     1 
ATOM   3593 O O     . SER C 3 293 ? 78.697  48.521 121.160 1.00 46.63  ? 287 SER A O     1 
ATOM   3594 C CB    . SER C 3 293 ? 75.910  50.218 122.351 1.00 48.50  ? 287 SER A CB    1 
ATOM   3595 O OG    . SER C 3 293 ? 76.145  50.961 121.173 1.00 68.59  ? 287 SER A OG    1 
ATOM   3596 N N     . GLY C 3 294 ? 76.639  47.601 121.215 1.00 44.54  ? 288 GLY A N     1 
ATOM   3597 C CA    . GLY C 3 294 ? 76.926  46.622 120.169 1.00 47.86  ? 288 GLY A CA    1 
ATOM   3598 C C     . GLY C 3 294 ? 77.609  47.161 118.909 1.00 56.01  ? 288 GLY A C     1 
ATOM   3599 O O     . GLY C 3 294 ? 78.403  46.456 118.275 1.00 54.31  ? 288 GLY A O     1 
ATOM   3600 N N     . HIS C 3 295 ? 77.289  48.399 118.539 1.00 55.62  ? 289 HIS A N     1 
ATOM   3601 C CA    . HIS C 3 295 ? 77.857  48.998 117.333 1.00 56.41  ? 289 HIS A CA    1 
ATOM   3602 C C     . HIS C 3 295 ? 79.180  49.731 117.452 1.00 62.08  ? 289 HIS A C     1 
ATOM   3603 O O     . HIS C 3 295 ? 79.830  50.061 116.457 1.00 62.52  ? 289 HIS A O     1 
ATOM   3604 C CB    . HIS C 3 295 ? 76.806  49.780 116.562 1.00 57.20  ? 289 HIS A CB    1 
ATOM   3605 C CG    . HIS C 3 295 ? 75.980  48.900 115.689 1.00 61.53  ? 289 HIS A CG    1 
ATOM   3606 N ND1   . HIS C 3 295 ? 75.318  49.347 114.567 1.00 63.52  ? 289 HIS A ND1   1 
ATOM   3607 C CD2   . HIS C 3 295 ? 75.782  47.562 115.738 1.00 64.83  ? 289 HIS A CD2   1 
ATOM   3608 C CE1   . HIS C 3 295 ? 74.718  48.324 113.982 1.00 63.94  ? 289 HIS A CE1   1 
ATOM   3609 N NE2   . HIS C 3 295 ? 74.992  47.228 114.668 1.00 64.74  ? 289 HIS A NE2   1 
ATOM   3610 N N     . SER C 3 296 ? 79.595  49.935 118.690 1.00 57.70  ? 290 SER A N     1 
ATOM   3611 C CA    . SER C 3 296 ? 80.833  50.622 118.982 1.00 55.37  ? 290 SER A CA    1 
ATOM   3612 C C     . SER C 3 296 ? 82.039  50.057 118.236 1.00 50.56  ? 290 SER A C     1 
ATOM   3613 O O     . SER C 3 296 ? 82.876  50.810 117.763 1.00 47.84  ? 290 SER A O     1 
ATOM   3614 C CB    . SER C 3 296 ? 81.079  50.612 120.494 1.00 61.09  ? 290 SER A CB    1 
ATOM   3615 O OG    . SER C 3 296 ? 79.909  50.995 121.205 1.00 71.46  ? 290 SER A OG    1 
ATOM   3616 N N     . ALA C 3 297 ? 82.144  48.736 118.150 1.00 47.34  ? 291 ALA A N     1 
ATOM   3617 C CA    . ALA C 3 297 ? 83.302  48.112 117.508 1.00 49.13  ? 291 ALA A CA    1 
ATOM   3618 C C     . ALA C 3 297 ? 83.430  48.400 116.013 1.00 55.47  ? 291 ALA A C     1 
ATOM   3619 O O     . ALA C 3 297 ? 84.517  48.716 115.516 1.00 53.25  ? 291 ALA A O     1 
ATOM   3620 C CB    . ALA C 3 297 ? 83.319  46.621 117.772 1.00 50.21  ? 291 ALA A CB    1 
ATOM   3621 N N     . ARG C 3 298 ? 82.317  48.256 115.299 1.00 52.68  ? 292 ARG A N     1 
ATOM   3622 C CA    . ARG C 3 298 ? 82.278  48.518 113.870 1.00 51.81  ? 292 ARG A CA    1 
ATOM   3623 C C     . ARG C 3 298 ? 82.713  49.966 113.705 1.00 57.19  ? 292 ARG A C     1 
ATOM   3624 O O     . ARG C 3 298 ? 83.710  50.270 113.050 1.00 55.39  ? 292 ARG A O     1 
ATOM   3625 C CB    . ARG C 3 298 ? 80.836  48.372 113.364 1.00 48.07  ? 292 ARG A CB    1 
ATOM   3626 C CG    . ARG C 3 298 ? 80.518  47.048 112.667 1.00 53.93  ? 292 ARG A CG    1 
ATOM   3627 C CD    . ARG C 3 298 ? 79.094  46.589 112.970 1.00 58.78  ? 292 ARG A CD    1 
ATOM   3628 N NE    . ARG C 3 298 ? 78.102  47.191 112.079 1.00 69.79  ? 292 ARG A NE    1 
ATOM   3629 C CZ    . ARG C 3 298 ? 77.800  46.714 110.874 1.00 83.22  ? 292 ARG A CZ    1 
ATOM   3630 N NH1   . ARG C 3 298 ? 78.433  45.648 110.418 1.00 77.52  ? 292 ARG A NH1   1 
ATOM   3631 N NH2   . ARG C 3 298 ? 76.886  47.302 110.114 1.00 68.70  ? 292 ARG A NH2   1 
ATOM   3632 N N     . VAL C 3 299 ? 81.929  50.841 114.332 1.00 55.88  ? 293 VAL A N     1 
ATOM   3633 C CA    . VAL C 3 299 ? 82.122  52.286 114.333 1.00 56.17  ? 293 VAL A CA    1 
ATOM   3634 C C     . VAL C 3 299 ? 83.545  52.733 114.642 1.00 59.34  ? 293 VAL A C     1 
ATOM   3635 O O     . VAL C 3 299 ? 83.950  53.829 114.268 1.00 58.57  ? 293 VAL A O     1 
ATOM   3636 C CB    . VAL C 3 299 ? 81.161  52.960 115.353 1.00 61.23  ? 293 VAL A CB    1 
ATOM   3637 C CG1   . VAL C 3 299 ? 81.610  54.376 115.680 1.00 60.99  ? 293 VAL A CG1   1 
ATOM   3638 C CG2   . VAL C 3 299 ? 79.729  52.960 114.834 1.00 61.35  ? 293 VAL A CG2   1 
ATOM   3639 N N     . GLY C 3 300 ? 84.299  51.905 115.345 1.00 59.09  ? 294 GLY A N     1 
ATOM   3640 C CA    . GLY C 3 300 ? 85.662  52.268 115.694 1.00 61.28  ? 294 GLY A CA    1 
ATOM   3641 C C     . GLY C 3 300 ? 86.599  51.714 114.635 1.00 68.39  ? 294 GLY A C     1 
ATOM   3642 O O     . GLY C 3 300 ? 87.459  52.428 114.118 1.00 70.02  ? 294 GLY A O     1 
ATOM   3643 N N     . ALA C 3 301 ? 86.421  50.437 114.308 1.00 63.95  ? 295 ALA A N     1 
ATOM   3644 C CA    . ALA C 3 301 ? 87.256  49.799 113.300 1.00 62.22  ? 295 ALA A CA    1 
ATOM   3645 C C     . ALA C 3 301 ? 87.281  50.690 112.061 1.00 62.81  ? 295 ALA A C     1 
ATOM   3646 O O     . ALA C 3 301 ? 88.351  51.054 111.562 1.00 61.39  ? 295 ALA A O     1 
ATOM   3647 C CB    . ALA C 3 301 ? 86.729  48.402 112.963 1.00 62.58  ? 295 ALA A CB    1 
ATOM   3648 N N     . ALA C 3 302 ? 86.091  51.061 111.593 1.00 56.85  ? 296 ALA A N     1 
ATOM   3649 C CA    . ALA C 3 302 ? 85.932  51.907 110.412 1.00 55.49  ? 296 ALA A CA    1 
ATOM   3650 C C     . ALA C 3 302 ? 86.819  53.146 110.426 1.00 58.83  ? 296 ALA A C     1 
ATOM   3651 O O     . ALA C 3 302 ? 87.601  53.366 109.500 1.00 57.56  ? 296 ALA A O     1 
ATOM   3652 C CB    . ALA C 3 302 ? 84.482  52.304 110.239 1.00 55.75  ? 296 ALA A CB    1 
ATOM   3653 N N     . ARG C 3 303 ? 86.678  53.965 111.464 1.00 55.44  ? 297 ARG A N     1 
ATOM   3654 C CA    . ARG C 3 303 ? 87.475  55.178 111.580 1.00 55.62  ? 297 ARG A CA    1 
ATOM   3655 C C     . ARG C 3 303 ? 88.959  54.819 111.595 1.00 62.02  ? 297 ARG A C     1 
ATOM   3656 O O     . ARG C 3 303 ? 89.788  55.486 110.978 1.00 61.50  ? 297 ARG A O     1 
ATOM   3657 C CB    . ARG C 3 303 ? 87.107  55.936 112.855 1.00 54.49  ? 297 ARG A CB    1 
ATOM   3658 C CG    . ARG C 3 303 ? 85.619  56.177 113.029 1.00 60.24  ? 297 ARG A CG    1 
ATOM   3659 C CD    . ARG C 3 303 ? 85.284  56.499 114.477 1.00 69.05  ? 297 ARG A CD    1 
ATOM   3660 N NE    . ARG C 3 303 ? 86.072  57.619 114.985 1.00 75.09  ? 297 ARG A NE    1 
ATOM   3661 C CZ    . ARG C 3 303 ? 85.704  58.890 114.892 1.00 96.30  ? 297 ARG A CZ    1 
ATOM   3662 N NH1   . ARG C 3 303 ? 84.561  59.209 114.298 1.00 89.66  ? 297 ARG A NH1   1 
ATOM   3663 N NH2   . ARG C 3 303 ? 86.483  59.844 115.383 1.00 87.94  ? 297 ARG A NH2   1 
ATOM   3664 N N     . ASP C 3 304 ? 89.291  53.757 112.314 1.00 60.41  ? 298 ASP A N     1 
ATOM   3665 C CA    . ASP C 3 304 ? 90.666  53.303 112.408 1.00 60.39  ? 298 ASP A CA    1 
ATOM   3666 C C     . ASP C 3 304 ? 91.172  52.950 111.022 1.00 63.32  ? 298 ASP A C     1 
ATOM   3667 O O     . ASP C 3 304 ? 92.288  53.306 110.650 1.00 62.32  ? 298 ASP A O     1 
ATOM   3668 C CB    . ASP C 3 304 ? 90.741  52.085 113.328 1.00 62.59  ? 298 ASP A CB    1 
ATOM   3669 C CG    . ASP C 3 304 ? 90.814  52.473 114.782 1.00 76.00  ? 298 ASP A CG    1 
ATOM   3670 O OD1   . ASP C 3 304 ? 91.605  53.386 115.113 1.00 79.93  ? 298 ASP A OD1   1 
ATOM   3671 O OD2   . ASP C 3 304 ? 90.055  51.887 115.582 1.00 77.14  ? 298 ASP A OD2   1 
ATOM   3672 N N     . MET C 3 305 ? 90.323  52.244 110.274 1.00 61.31  ? 299 MET A N     1 
ATOM   3673 C CA    . MET C 3 305 ? 90.602  51.806 108.905 1.00 61.01  ? 299 MET A CA    1 
ATOM   3674 C C     . MET C 3 305 ? 90.563  53.000 107.956 1.00 67.62  ? 299 MET A C     1 
ATOM   3675 O O     . MET C 3 305 ? 91.157  52.970 106.882 1.00 69.10  ? 299 MET A O     1 
ATOM   3676 C CB    . MET C 3 305 ? 89.556  50.783 108.460 1.00 62.21  ? 299 MET A CB    1 
ATOM   3677 C CG    . MET C 3 305 ? 90.097  49.382 108.283 1.00 64.06  ? 299 MET A CG    1 
ATOM   3678 S SD    . MET C 3 305 ? 88.886  48.286 107.540 1.00 66.20  ? 299 MET A SD    1 
ATOM   3679 C CE    . MET C 3 305 ? 87.428  49.246 107.726 1.00 62.63  ? 299 MET A CE    1 
ATOM   3680 N N     . ALA C 3 306 ? 89.861  54.052 108.364 1.00 62.98  ? 300 ALA A N     1 
ATOM   3681 C CA    . ALA C 3 306 ? 89.784  55.274 107.572 1.00 61.98  ? 300 ALA A CA    1 
ATOM   3682 C C     . ALA C 3 306 ? 91.019  56.128 107.886 1.00 66.90  ? 300 ALA A C     1 
ATOM   3683 O O     . ALA C 3 306 ? 91.684  56.642 106.987 1.00 67.37  ? 300 ALA A O     1 
ATOM   3684 C CB    . ALA C 3 306 ? 88.498  56.041 107.883 1.00 62.03  ? 300 ALA A CB    1 
ATOM   3685 N N     . ARG C 3 307 ? 91.335  56.253 109.170 1.00 62.59  ? 301 ARG A N     1 
ATOM   3686 C CA    . ARG C 3 307 ? 92.497  57.016 109.587 1.00 62.06  ? 301 ARG A CA    1 
ATOM   3687 C C     . ARG C 3 307 ? 93.734  56.449 108.902 1.00 70.54  ? 301 ARG A C     1 
ATOM   3688 O O     . ARG C 3 307 ? 94.608  57.188 108.463 1.00 72.13  ? 301 ARG A O     1 
ATOM   3689 C CB    . ARG C 3 307 ? 92.656  56.960 111.110 1.00 57.29  ? 301 ARG A CB    1 
ATOM   3690 C CG    . ARG C 3 307 ? 91.833  58.010 111.864 1.00 49.63  ? 301 ARG A CG    1 
ATOM   3691 C CD    . ARG C 3 307 ? 91.982  57.879 113.381 1.00 54.33  ? 301 ARG A CD    1 
ATOM   3692 N NE    . ARG C 3 307 ? 90.995  56.974 113.970 1.00 64.87  ? 301 ARG A NE    1 
ATOM   3693 C CZ    . ARG C 3 307 ? 90.073  57.338 114.857 1.00 71.95  ? 301 ARG A CZ    1 
ATOM   3694 N NH1   . ARG C 3 307 ? 89.990  58.594 115.268 1.00 44.58  ? 301 ARG A NH1   1 
ATOM   3695 N NH2   . ARG C 3 307 ? 89.226  56.442 115.336 1.00 68.86  ? 301 ARG A NH2   1 
ATOM   3696 N N     . ALA C 3 308 ? 93.796  55.127 108.807 1.00 69.58  ? 302 ALA A N     1 
ATOM   3697 C CA    . ALA C 3 308 ? 94.921  54.448 108.169 1.00 70.65  ? 302 ALA A CA    1 
ATOM   3698 C C     . ALA C 3 308 ? 94.809  54.560 106.655 1.00 77.47  ? 302 ALA A C     1 
ATOM   3699 O O     . ALA C 3 308 ? 95.470  53.838 105.909 1.00 79.11  ? 302 ALA A O     1 
ATOM   3700 C CB    . ALA C 3 308 ? 94.957  52.984 108.586 1.00 71.40  ? 302 ALA A CB    1 
ATOM   3701 N N     . GLY C 3 309 ? 93.957  55.468 106.205 1.00 73.61  ? 303 GLY A N     1 
ATOM   3702 C CA    . GLY C 3 309 ? 93.777  55.671 104.784 1.00 73.63  ? 303 GLY A CA    1 
ATOM   3703 C C     . GLY C 3 309 ? 93.474  54.369 104.065 1.00 78.81  ? 303 GLY A C     1 
ATOM   3704 O O     . GLY C 3 309 ? 94.282  53.877 103.284 1.00 78.13  ? 303 GLY A O     1 
ATOM   3705 N N     . VAL C 3 310 ? 92.297  53.820 104.325 1.00 78.09  ? 304 VAL A N     1 
ATOM   3706 C CA    . VAL C 3 310 ? 91.869  52.614 103.638 1.00 78.67  ? 304 VAL A CA    1 
ATOM   3707 C C     . VAL C 3 310 ? 90.644  53.013 102.821 1.00 87.19  ? 304 VAL A C     1 
ATOM   3708 O O     . VAL C 3 310 ? 89.668  53.555 103.347 1.00 88.65  ? 304 VAL A O     1 
ATOM   3709 C CB    . VAL C 3 310 ? 91.579  51.433 104.593 1.00 81.74  ? 304 VAL A CB    1 
ATOM   3710 C CG1   . VAL C 3 310 ? 91.237  50.184 103.800 1.00 81.58  ? 304 VAL A CG1   1 
ATOM   3711 C CG2   . VAL C 3 310 ? 92.777  51.171 105.494 1.00 81.32  ? 304 VAL A CG2   1 
ATOM   3712 N N     . SER C 3 311 ? 90.760  52.838 101.510 1.00 84.50  ? 305 SER A N     1 
ATOM   3713 C CA    . SER C 3 311 ? 89.711  53.197 100.566 1.00 84.33  ? 305 SER A CA    1 
ATOM   3714 C C     . SER C 3 311 ? 88.353  52.855 101.125 1.00 88.35  ? 305 SER A C     1 
ATOM   3715 O O     . SER C 3 311 ? 88.194  51.828 101.777 1.00 88.08  ? 305 SER A O     1 
ATOM   3716 C CB    . SER C 3 311 ? 89.894  52.389 99.289  1.00 89.01  ? 305 SER A CB    1 
ATOM   3717 O OG    . SER C 3 311 ? 89.634  51.019 99.545  1.00 100.00 ? 305 SER A OG    1 
ATOM   3718 N N     . ILE C 3 312 ? 87.353  53.662 100.793 1.00 86.03  ? 306 ILE A N     1 
ATOM   3719 C CA    . ILE C 3 312 ? 86.000  53.370 101.236 1.00 86.51  ? 306 ILE A CA    1 
ATOM   3720 C C     . ILE C 3 312 ? 85.505  51.971 100.835 1.00 93.33  ? 306 ILE A C     1 
ATOM   3721 O O     . ILE C 3 312 ? 84.477  51.520 101.341 1.00 93.07  ? 306 ILE A O     1 
ATOM   3722 C CB    . ILE C 3 312 ? 84.984  54.464 100.853 1.00 88.92  ? 306 ILE A CB    1 
ATOM   3723 C CG1   . ILE C 3 312 ? 85.449  55.814 101.383 1.00 88.54  ? 306 ILE A CG1   1 
ATOM   3724 C CG2   . ILE C 3 312 ? 83.633  54.173 101.485 1.00 89.36  ? 306 ILE A CG2   1 
ATOM   3725 C CD1   . ILE C 3 312 ? 84.752  56.213 102.658 1.00 88.49  ? 306 ILE A CD1   1 
ATOM   3726 N N     . PRO C 3 313 ? 86.222  51.265 99.956  1.00 90.77  ? 307 PRO A N     1 
ATOM   3727 C CA    . PRO C 3 313 ? 85.801  49.914 99.667  1.00 90.61  ? 307 PRO A CA    1 
ATOM   3728 C C     . PRO C 3 313 ? 85.781  49.207 101.008 1.00 96.02  ? 307 PRO A C     1 
ATOM   3729 O O     . PRO C 3 313 ? 84.790  49.290 101.729 1.00 97.65  ? 307 PRO A O     1 
ATOM   3730 C CB    . PRO C 3 313 ? 86.932  49.394 98.786  0.00 92.11  ? 307 PRO A CB    1 
ATOM   3731 C CG    . PRO C 3 313 ? 87.347  50.614 97.995  0.00 96.22  ? 307 PRO A CG    1 
ATOM   3732 C CD    . PRO C 3 313 ? 86.873  51.841 98.764  0.00 91.33  ? 307 PRO A CD    1 
ATOM   3733 N N     . GLU C 3 314 ? 86.880  48.559 101.378 1.00 90.40  ? 308 GLU A N     1 
ATOM   3734 C CA    . GLU C 3 314 ? 86.896  47.869 102.655 1.00 89.34  ? 308 GLU A CA    1 
ATOM   3735 C C     . GLU C 3 314 ? 86.090  48.581 103.735 1.00 89.51  ? 308 GLU A C     1 
ATOM   3736 O O     . GLU C 3 314 ? 85.321  47.948 104.449 1.00 89.06  ? 308 GLU A O     1 
ATOM   3737 C CB    . GLU C 3 314 ? 88.304  47.540 103.133 1.00 91.15  ? 308 GLU A CB    1 
ATOM   3738 C CG    . GLU C 3 314 ? 88.361  46.242 103.944 1.00 100.00 ? 308 GLU A CG    1 
ATOM   3739 C CD    . GLU C 3 314 ? 87.405  45.178 103.413 1.00 100.00 ? 308 GLU A CD    1 
ATOM   3740 O OE1   . GLU C 3 314 ? 86.174  45.345 103.568 1.00 100.00 ? 308 GLU A OE1   1 
ATOM   3741 O OE2   . GLU C 3 314 ? 87.891  44.168 102.853 1.00 100.00 ? 308 GLU A OE2   1 
ATOM   3742 N N     . ILE C 3 315 ? 86.256  49.889 103.864 1.00 84.61  ? 309 ILE A N     1 
ATOM   3743 C CA    . ILE C 3 315 ? 85.496  50.605 104.870 1.00 85.36  ? 309 ILE A CA    1 
ATOM   3744 C C     . ILE C 3 315 ? 83.993  50.380 104.694 1.00 91.68  ? 309 ILE A C     1 
ATOM   3745 O O     . ILE C 3 315 ? 83.354  49.788 105.563 1.00 93.22  ? 309 ILE A O     1 
ATOM   3746 C CB    . ILE C 3 315 ? 85.892  52.084 104.959 1.00 88.55  ? 309 ILE A CB    1 
ATOM   3747 C CG1   . ILE C 3 315 ? 87.382  52.190 105.304 1.00 88.27  ? 309 ILE A CG1   1 
ATOM   3748 C CG2   . ILE C 3 315 ? 85.033  52.796 105.992 1.00 90.20  ? 309 ILE A CG2   1 
ATOM   3749 C CD1   . ILE C 3 315 ? 87.712  53.238 106.345 1.00 97.82  ? 309 ILE A CD1   1 
ATOM   3750 N N     . MET C 3 316 ? 83.425  50.814 103.576 1.00 87.43  ? 310 MET A N     1 
ATOM   3751 C CA    . MET C 3 316 ? 82.007  50.569 103.354 1.00 86.54  ? 310 MET A CA    1 
ATOM   3752 C C     . MET C 3 316 ? 81.865  49.133 102.847 1.00 87.58  ? 310 MET A C     1 
ATOM   3753 O O     . MET C 3 316 ? 80.977  48.806 102.068 1.00 87.62  ? 310 MET A O     1 
ATOM   3754 C CB    . MET C 3 316 ? 81.386  51.636 102.435 1.00 89.31  ? 310 MET A CB    1 
ATOM   3755 C CG    . MET C 3 316 ? 81.246  51.312 100.959 1.00 94.15  ? 310 MET A CG    1 
ATOM   3756 S SD    . MET C 3 316 ? 79.895  52.296 100.265 1.00 99.97  ? 310 MET A SD    1 
ATOM   3757 C CE    . MET C 3 316 ? 79.602  51.429 98.720  0.00 96.55  ? 310 MET A CE    1 
ATOM   3758 N N     . GLN C 3 317 ? 82.742  48.264 103.349 1.00 82.93  ? 311 GLN A N     1 
ATOM   3759 C CA    . GLN C 3 317 ? 82.780  46.861 102.935 1.00 82.31  ? 311 GLN A CA    1 
ATOM   3760 C C     . GLN C 3 317 ? 83.082  45.811 104.014 1.00 87.32  ? 311 GLN A C     1 
ATOM   3761 O O     . GLN C 3 317 ? 82.518  44.716 103.985 1.00 86.96  ? 311 GLN A O     1 
ATOM   3762 C CB    . GLN C 3 317 ? 83.814  46.702 101.838 0.00 83.38  ? 311 GLN A CB    1 
ATOM   3763 C CG    . GLN C 3 317 ? 83.505  45.649 100.834 0.00 90.46  ? 311 GLN A CG    1 
ATOM   3764 C CD    . GLN C 3 317 ? 84.387  45.793 99.627  0.00 100.00 ? 311 GLN A CD    1 
ATOM   3765 O OE1   . GLN C 3 317 ? 85.026  46.831 99.432  0.00 95.99  ? 311 GLN A OE1   1 
ATOM   3766 N NE2   . GLN C 3 317 ? 84.446  44.746 98.814  0.00 92.62  ? 311 GLN A NE2   1 
ATOM   3767 N N     . ALA C 3 318 ? 84.016  46.114 104.916 1.00 83.61  ? 312 ALA A N     1 
ATOM   3768 C CA    . ALA C 3 318 ? 84.385  45.182 105.977 1.00 81.61  ? 312 ALA A CA    1 
ATOM   3769 C C     . ALA C 3 318 ? 83.192  44.995 106.897 1.00 84.51  ? 312 ALA A C     1 
ATOM   3770 O O     . ALA C 3 318 ? 83.228  44.179 107.813 1.00 84.88  ? 312 ALA A O     1 
ATOM   3771 C CB    . ALA C 3 318 ? 85.578  45.700 106.748 1.00 81.69  ? 312 ALA A CB    1 
ATOM   3772 N N     . GLY C 3 319 ? 82.135  45.756 106.632 1.00 80.06  ? 313 GLY A N     1 
ATOM   3773 C CA    . GLY C 3 319 ? 80.909  45.681 107.408 1.00 80.27  ? 313 GLY A CA    1 
ATOM   3774 C C     . GLY C 3 319 ? 79.743  45.215 106.536 1.00 86.20  ? 313 GLY A C     1 
ATOM   3775 O O     . GLY C 3 319 ? 78.647  44.952 107.037 1.00 88.21  ? 313 GLY A O     1 
ATOM   3776 N N     . GLY C 3 320 ? 79.986  45.117 105.232 1.00 81.24  ? 314 GLY A N     1 
ATOM   3777 C CA    . GLY C 3 320 ? 78.961  44.685 104.284 1.00 80.42  ? 314 GLY A CA    1 
ATOM   3778 C C     . GLY C 3 320 ? 77.984  45.828 104.051 1.00 83.30  ? 314 GLY A C     1 
ATOM   3779 O O     . GLY C 3 320 ? 76.788  45.624 103.896 1.00 82.77  ? 314 GLY A O     1 
ATOM   3780 N N     . TRP C 3 321 ? 78.537  47.034 104.073 1.00 80.42  ? 315 TRP A N     1 
ATOM   3781 C CA    . TRP C 3 321 ? 77.786  48.267 103.956 1.00 80.60  ? 315 TRP A CA    1 
ATOM   3782 C C     . TRP C 3 321 ? 77.332  48.601 102.532 1.00 89.78  ? 315 TRP A C     1 
ATOM   3783 O O     . TRP C 3 321 ? 78.143  48.974 101.685 1.00 89.14  ? 315 TRP A O     1 
ATOM   3784 C CB    . TRP C 3 321 ? 78.652  49.385 104.542 1.00 78.31  ? 315 TRP A CB    1 
ATOM   3785 C CG    . TRP C 3 321 ? 78.342  49.680 105.992 1.00 78.50  ? 315 TRP A CG    1 
ATOM   3786 C CD1   . TRP C 3 321 ? 77.116  50.015 106.499 1.00 81.50  ? 315 TRP A CD1   1 
ATOM   3787 C CD2   . TRP C 3 321 ? 79.248  49.675 107.116 1.00 77.46  ? 315 TRP A CD2   1 
ATOM   3788 N NE1   . TRP C 3 321 ? 77.193  50.212 107.853 1.00 80.57  ? 315 TRP A NE1   1 
ATOM   3789 C CE2   . TRP C 3 321 ? 78.487  50.016 108.259 1.00 81.37  ? 315 TRP A CE2   1 
ATOM   3790 C CE3   . TRP C 3 321 ? 80.616  49.433 107.267 1.00 78.09  ? 315 TRP A CE3   1 
ATOM   3791 C CZ2   . TRP C 3 321 ? 79.044  50.120 109.524 1.00 80.11  ? 315 TRP A CZ2   1 
ATOM   3792 C CZ3   . TRP C 3 321 ? 81.166  49.526 108.529 1.00 79.70  ? 315 TRP A CZ3   1 
ATOM   3793 C CH2   . TRP C 3 321 ? 80.377  49.866 109.644 1.00 80.28  ? 315 TRP A CH2   1 
ATOM   3794 N N     . THR C 3 322 ? 76.028  48.477 102.259 1.00 91.13  ? 316 THR A N     1 
ATOM   3795 C CA    . THR C 3 322 ? 75.498  48.752 100.910 1.00 92.48  ? 316 THR A CA    1 
ATOM   3796 C C     . THR C 3 322 ? 75.141  50.225 100.659 1.00 97.24  ? 316 THR A C     1 
ATOM   3797 O O     . THR C 3 322 ? 74.508  50.551 99.653  1.00 97.04  ? 316 THR A O     1 
ATOM   3798 C CB    . THR C 3 322 ? 74.281  47.846 100.549 1.00 100.00 ? 316 THR A CB    1 
ATOM   3799 O OG1   . THR C 3 322 ? 74.272  47.593 99.136  1.00 100.00 ? 316 THR A OG1   1 
ATOM   3800 C CG2   . THR C 3 322 ? 72.961  48.510 100.958 1.00 96.86  ? 316 THR A CG2   1 
ATOM   3801 N N     . ASN C 3 323 ? 75.547  51.102 101.578 1.00 93.52  ? 317 ASN A N     1 
ATOM   3802 C CA    . ASN C 3 323 ? 75.210  52.511 101.462 1.00 93.65  ? 317 ASN A CA    1 
ATOM   3803 C C     . ASN C 3 323 ? 76.101  53.450 102.290 1.00 100.00 ? 317 ASN A C     1 
ATOM   3804 O O     . ASN C 3 323 ? 75.911  53.585 103.501 1.00 100.00 ? 317 ASN A O     1 
ATOM   3805 C CB    . ASN C 3 323 ? 73.738  52.724 101.859 1.00 91.95  ? 317 ASN A CB    1 
ATOM   3806 C CG    . ASN C 3 323 ? 73.450  52.319 103.304 1.00 100.00 ? 317 ASN A CG    1 
ATOM   3807 O OD1   . ASN C 3 323 ? 74.298  51.732 103.982 1.00 100.00 ? 317 ASN A OD1   1 
ATOM   3808 N ND2   . ASN C 3 323 ? 72.260  52.666 103.794 1.00 100.00 ? 317 ASN A ND2   1 
ATOM   3809 N N     . VAL C 3 324 ? 77.023  54.159 101.645 1.00 96.17  ? 318 VAL A N     1 
ATOM   3810 C CA    . VAL C 3 324 ? 77.866  55.098 102.392 1.00 94.49  ? 318 VAL A CA    1 
ATOM   3811 C C     . VAL C 3 324 ? 77.350  56.096 103.437 1.00 94.78  ? 318 VAL A C     1 
ATOM   3812 O O     . VAL C 3 324 ? 77.977  56.280 104.475 1.00 94.84  ? 318 VAL A O     1 
ATOM   3813 C CB    . VAL C 3 324 ? 79.332  55.285 101.896 1.00 97.17  ? 318 VAL A CB    1 
ATOM   3814 C CG1   . VAL C 3 324 ? 79.380  55.453 100.391 1.00 96.50  ? 318 VAL A CG1   1 
ATOM   3815 C CG2   . VAL C 3 324 ? 79.998  56.461 102.583 1.00 96.55  ? 318 VAL A CG2   1 
ATOM   3816 N N     . ASN C 3 325 ? 76.206  56.725 103.204 1.00 89.32  ? 319 ASN A N     1 
ATOM   3817 C CA    . ASN C 3 325 ? 75.720  57.672 104.206 1.00 89.45  ? 319 ASN A CA    1 
ATOM   3818 C C     . ASN C 3 325 ? 76.056  57.169 105.608 1.00 93.98  ? 319 ASN A C     1 
ATOM   3819 O O     . ASN C 3 325 ? 76.455  57.949 106.480 1.00 94.43  ? 319 ASN A O     1 
ATOM   3820 C CB    . ASN C 3 325 ? 74.215  57.921 104.072 0.00 87.75  ? 319 ASN A CB    1 
ATOM   3821 C CG    . ASN C 3 325 ? 73.829  58.412 102.692 0.00 100.00 ? 319 ASN A CG    1 
ATOM   3822 O OD1   . ASN C 3 325 ? 72.987  57.812 102.026 0.00 94.34  ? 319 ASN A OD1   1 
ATOM   3823 N ND2   . ASN C 3 325 ? 74.454  59.498 102.249 0.00 91.86  ? 319 ASN A ND2   1 
ATOM   3824 N N     . ILE C 3 326 ? 75.916  55.861 105.811 1.00 87.67  ? 320 ILE A N     1 
ATOM   3825 C CA    . ILE C 3 326 ? 76.186  55.259 107.108 1.00 84.80  ? 320 ILE A CA    1 
ATOM   3826 C C     . ILE C 3 326 ? 77.651  55.270 107.551 1.00 81.42  ? 320 ILE A C     1 
ATOM   3827 O O     . ILE C 3 326 ? 77.953  55.722 108.653 1.00 80.14  ? 320 ILE A O     1 
ATOM   3828 C CB    . ILE C 3 326 ? 75.454  53.913 107.295 1.00 88.13  ? 320 ILE A CB    1 
ATOM   3829 C CG1   . ILE C 3 326 ? 73.944  54.162 107.363 1.00 89.34  ? 320 ILE A CG1   1 
ATOM   3830 C CG2   . ILE C 3 326 ? 75.919  53.215 108.561 1.00 88.27  ? 320 ILE A CG2   1 
ATOM   3831 C CD1   . ILE C 3 326 ? 73.573  55.350 108.231 1.00 100.00 ? 320 ILE A CD1   1 
ATOM   3832 N N     . VAL C 3 327 ? 78.560  54.846 106.678 1.00 75.15  ? 321 VAL A N     1 
ATOM   3833 C CA    . VAL C 3 327 ? 79.996  54.859 106.991 1.00 74.36  ? 321 VAL A CA    1 
ATOM   3834 C C     . VAL C 3 327 ? 80.540  56.286 107.011 1.00 77.34  ? 321 VAL A C     1 
ATOM   3835 O O     . VAL C 3 327 ? 81.603  56.559 107.572 1.00 77.43  ? 321 VAL A O     1 
ATOM   3836 C CB    . VAL C 3 327 ? 80.816  54.089 105.937 1.00 77.76  ? 321 VAL A CB    1 
ATOM   3837 C CG1   . VAL C 3 327 ? 82.291  54.032 106.334 1.00 76.85  ? 321 VAL A CG1   1 
ATOM   3838 C CG2   . VAL C 3 327 ? 80.251  52.695 105.734 1.00 77.61  ? 321 VAL A CG2   1 
ATOM   3839 N N     . MET C 3 328 ? 79.813  57.186 106.359 1.00 72.10  ? 322 MET A N     1 
ATOM   3840 C CA    . MET C 3 328 ? 80.202  58.591 106.268 1.00 71.04  ? 322 MET A CA    1 
ATOM   3841 C C     . MET C 3 328 ? 79.844  59.348 107.547 1.00 73.53  ? 322 MET A C     1 
ATOM   3842 O O     . MET C 3 328 ? 80.540  60.282 107.939 1.00 72.42  ? 322 MET A O     1 
ATOM   3843 C CB    . MET C 3 328 ? 79.503  59.250 105.074 1.00 73.35  ? 322 MET A CB    1 
ATOM   3844 C CG    . MET C 3 328 ? 80.239  59.179 103.733 1.00 76.60  ? 322 MET A CG    1 
ATOM   3845 S SD    . MET C 3 328 ? 81.925  58.561 103.786 1.00 80.50  ? 322 MET A SD    1 
ATOM   3846 C CE    . MET C 3 328 ? 82.327  58.545 102.037 1.00 77.44  ? 322 MET A CE    1 
ATOM   3847 N N     . ASN C 3 329 ? 78.750  58.946 108.188 1.00 69.93  ? 323 ASN A N     1 
ATOM   3848 C CA    . ASN C 3 329 ? 78.310  59.577 109.432 1.00 69.34  ? 323 ASN A CA    1 
ATOM   3849 C C     . ASN C 3 329 ? 79.219  59.088 110.564 1.00 68.86  ? 323 ASN A C     1 
ATOM   3850 O O     . ASN C 3 329 ? 79.254  59.663 111.656 1.00 67.45  ? 323 ASN A O     1 
ATOM   3851 C CB    . ASN C 3 329 ? 76.846  59.214 109.727 1.00 73.78  ? 323 ASN A CB    1 
ATOM   3852 C CG    . ASN C 3 329 ? 76.050  60.383 110.318 1.00 100.00 ? 323 ASN A CG    1 
ATOM   3853 O OD1   . ASN C 3 329 ? 76.423  60.952 111.350 1.00 83.43  ? 323 ASN A OD1   1 
ATOM   3854 N ND2   . ASN C 3 329 ? 74.943  60.732 109.668 1.00 100.00 ? 323 ASN A ND2   1 
ATOM   3855 N N     . TYR C 3 330 ? 79.960  58.020 110.278 1.00 62.57  ? 324 TYR A N     1 
ATOM   3856 C CA    . TYR C 3 330 ? 80.884  57.432 111.241 1.00 61.04  ? 324 TYR A CA    1 
ATOM   3857 C C     . TYR C 3 330 ? 82.283  58.056 111.169 1.00 69.06  ? 324 TYR A C     1 
ATOM   3858 O O     . TYR C 3 330 ? 82.932  58.217 112.199 1.00 72.08  ? 324 TYR A O     1 
ATOM   3859 C CB    . TYR C 3 330 ? 80.985  55.905 111.055 1.00 59.41  ? 324 TYR A CB    1 
ATOM   3860 C CG    . TYR C 3 330 ? 79.735  55.119 111.415 1.00 58.02  ? 324 TYR A CG    1 
ATOM   3861 C CD1   . TYR C 3 330 ? 78.555  55.750 111.737 1.00 60.85  ? 324 TYR A CD1   1 
ATOM   3862 C CD2   . TYR C 3 330 ? 79.741  53.730 111.346 1.00 58.00  ? 324 TYR A CD2   1 
ATOM   3863 C CE1   . TYR C 3 330 ? 77.399  55.021 112.067 1.00 63.36  ? 324 TYR A CE1   1 
ATOM   3864 C CE2   . TYR C 3 330 ? 78.590  52.989 111.657 1.00 58.42  ? 324 TYR A CE2   1 
ATOM   3865 C CZ    . TYR C 3 330 ? 77.429  53.636 112.004 1.00 67.20  ? 324 TYR A CZ    1 
ATOM   3866 O OH    . TYR C 3 330 ? 76.299  52.919 112.267 1.00 73.24  ? 324 TYR A OH    1 
ATOM   3867 N N     . ILE C 3 331 ? 82.761  58.397 109.973 1.00 63.72  ? 325 ILE A N     1 
ATOM   3868 C CA    . ILE C 3 331 ? 84.097  58.990 109.854 1.00 62.28  ? 325 ILE A CA    1 
ATOM   3869 C C     . ILE C 3 331 ? 84.113  60.514 109.663 1.00 64.75  ? 325 ILE A C     1 
ATOM   3870 O O     . ILE C 3 331 ? 85.126  61.096 109.277 1.00 65.38  ? 325 ILE A O     1 
ATOM   3871 C CB    . ILE C 3 331 ? 84.974  58.276 108.787 1.00 64.55  ? 325 ILE A CB    1 
ATOM   3872 C CG1   . ILE C 3 331 ? 84.359  58.393 107.392 1.00 63.81  ? 325 ILE A CG1   1 
ATOM   3873 C CG2   . ILE C 3 331 ? 85.148  56.815 109.141 1.00 65.25  ? 325 ILE A CG2   1 
ATOM   3874 C CD1   . ILE C 3 331 ? 85.241  57.838 106.293 1.00 61.36  ? 325 ILE A CD1   1 
ATOM   3875 N N     . ARG C 3 332 ? 82.996  61.162 109.975 1.00 60.53  ? 326 ARG A N     1 
ATOM   3876 C CA    . ARG C 3 332 ? 82.866  62.611 109.787 1.00 61.27  ? 326 ARG A CA    1 
ATOM   3877 C C     . ARG C 3 332 ? 83.748  63.607 110.561 1.00 69.07  ? 326 ARG A C     1 
ATOM   3878 O O     . ARG C 3 332 ? 84.122  64.648 110.014 1.00 70.97  ? 326 ARG A O     1 
ATOM   3879 C CB    . ARG C 3 332 ? 81.398  63.059 109.749 1.00 59.73  ? 326 ARG A CB    1 
ATOM   3880 C CG    . ARG C 3 332 ? 80.577  62.724 110.993 1.00 73.90  ? 326 ARG A CG    1 
ATOM   3881 C CD    . ARG C 3 332 ? 79.147  63.236 110.851 1.00 81.76  ? 326 ARG A CD    1 
ATOM   3882 N NE    . ARG C 3 332 ? 78.391  63.196 112.104 1.00 96.44  ? 326 ARG A NE    1 
ATOM   3883 C CZ    . ARG C 3 332 ? 77.211  63.789 112.279 1.00 100.00 ? 326 ARG A CZ    1 
ATOM   3884 N NH1   . ARG C 3 332 ? 76.657  64.485 111.291 1.00 72.04  ? 326 ARG A NH1   1 
ATOM   3885 N NH2   . ARG C 3 332 ? 76.593  63.711 113.450 1.00 100.00 ? 326 ARG A NH2   1 
ATOM   3886 N N     . ASN C 3 333 ? 84.046  63.324 111.828 1.00 63.20  ? 327 ASN A N     1 
ATOM   3887 C CA    . ASN C 3 333 ? 84.876  64.221 112.633 1.00 61.31  ? 327 ASN A CA    1 
ATOM   3888 C C     . ASN C 3 333 ? 86.372  63.953 112.397 1.00 64.37  ? 327 ASN A C     1 
ATOM   3889 O O     . ASN C 3 333 ? 87.235  64.652 112.936 1.00 63.26  ? 327 ASN A O     1 
ATOM   3890 C CB    . ASN C 3 333 ? 84.534  64.056 114.112 1.00 57.55  ? 327 ASN A CB    1 
ATOM   3891 C CG    . ASN C 3 333 ? 84.645  62.622 114.569 1.00 66.12  ? 327 ASN A CG    1 
ATOM   3892 O OD1   . ASN C 3 333 ? 84.707  61.703 113.751 1.00 58.35  ? 327 ASN A OD1   1 
ATOM   3893 N ND2   . ASN C 3 333 ? 84.666  62.419 115.880 1.00 62.99  ? 327 ASN A ND2   1 
ATOM   3894 N N     . LEU C 3 334 ? 86.665  62.941 111.581 1.00 60.77  ? 328 LEU A N     1 
ATOM   3895 C CA    . LEU C 3 334 ? 88.043  62.579 111.247 1.00 60.67  ? 328 LEU A CA    1 
ATOM   3896 C C     . LEU C 3 334 ? 88.676  63.614 110.310 1.00 66.23  ? 328 LEU A C     1 
ATOM   3897 O O     . LEU C 3 334 ? 88.106  63.947 109.268 1.00 69.00  ? 328 LEU A O     1 
ATOM   3898 C CB    . LEU C 3 334 ? 88.072  61.209 110.570 1.00 60.26  ? 328 LEU A CB    1 
ATOM   3899 C CG    . LEU C 3 334 ? 88.068  59.976 111.470 1.00 64.23  ? 328 LEU A CG    1 
ATOM   3900 C CD1   . LEU C 3 334 ? 87.149  60.210 112.638 1.00 63.55  ? 328 LEU A CD1   1 
ATOM   3901 C CD2   . LEU C 3 334 ? 87.615  58.759 110.675 1.00 68.62  ? 328 LEU A CD2   1 
ATOM   3902 N N     . ASP C 3 335 ? 89.861  64.102 110.662 1.00 59.04  ? 329 ASP A N     1 
ATOM   3903 C CA    . ASP C 3 335 ? 90.545  65.110 109.852 1.00 57.27  ? 329 ASP A CA    1 
ATOM   3904 C C     . ASP C 3 335 ? 90.648  64.738 108.379 1.00 59.78  ? 329 ASP A C     1 
ATOM   3905 O O     . ASP C 3 335 ? 90.589  65.597 107.506 1.00 60.41  ? 329 ASP A O     1 
ATOM   3906 C CB    . ASP C 3 335 ? 91.937  65.414 110.419 1.00 58.97  ? 329 ASP A CB    1 
ATOM   3907 C CG    . ASP C 3 335 ? 91.882  66.061 111.804 1.00 70.89  ? 329 ASP A CG    1 
ATOM   3908 O OD1   . ASP C 3 335 ? 91.856  65.326 112.818 1.00 79.85  ? 329 ASP A OD1   1 
ATOM   3909 O OD2   . ASP C 3 335 ? 91.871  67.309 111.872 1.00 68.53  ? 329 ASP A OD2   1 
ATOM   3910 N N     . SER C 3 336 ? 90.807  63.451 108.112 1.00 57.18  ? 330 SER A N     1 
ATOM   3911 C CA    . SER C 3 336 ? 90.938  62.948 106.746 1.00 57.01  ? 330 SER A CA    1 
ATOM   3912 C C     . SER C 3 336 ? 89.703  63.264 105.927 1.00 57.30  ? 330 SER A C     1 
ATOM   3913 O O     . SER C 3 336 ? 89.764  63.358 104.699 1.00 56.63  ? 330 SER A O     1 
ATOM   3914 C CB    . SER C 3 336 ? 91.146  61.429 106.757 1.00 62.64  ? 330 SER A CB    1 
ATOM   3915 O OG    . SER C 3 336 ? 90.576  60.839 107.917 1.00 77.20  ? 330 SER A OG    1 
ATOM   3916 N N     . GLU C 3 337 ? 88.572  63.400 106.617 1.00 51.09  ? 331 GLU A N     1 
ATOM   3917 C CA    . GLU C 3 337 ? 87.287  63.679 105.976 1.00 49.83  ? 331 GLU A CA    1 
ATOM   3918 C C     . GLU C 3 337 ? 86.888  65.155 106.064 1.00 55.69  ? 331 GLU A C     1 
ATOM   3919 O O     . GLU C 3 337 ? 85.709  65.506 105.924 1.00 55.52  ? 331 GLU A O     1 
ATOM   3920 C CB    . GLU C 3 337 ? 86.198  62.827 106.626 1.00 50.02  ? 331 GLU A CB    1 
ATOM   3921 C CG    . GLU C 3 337 ? 86.488  61.346 106.568 1.00 61.65  ? 331 GLU A CG    1 
ATOM   3922 C CD    . GLU C 3 337 ? 86.895  60.876 105.179 1.00 74.35  ? 331 GLU A CD    1 
ATOM   3923 O OE1   . GLU C 3 337 ? 86.089  61.031 104.238 1.00 51.07  ? 331 GLU A OE1   1 
ATOM   3924 O OE2   . GLU C 3 337 ? 88.016  60.339 105.033 1.00 61.41  ? 331 GLU A OE2   1 
ATOM   3925 N N     . THR C 3 338 ? 87.881  66.015 106.236 1.00 50.37  ? 332 THR A N     1 
ATOM   3926 C CA    . THR C 3 338 ? 87.651  67.434 106.422 0.50 47.21  ? 332 THR A CA    1 
ATOM   3927 C C     . THR C 3 338 ? 87.046  68.273 105.272 1.00 50.59  ? 332 THR A C     1 
ATOM   3928 O O     . THR C 3 338 ? 86.193  69.142 105.509 1.00 50.06  ? 332 THR A O     1 
ATOM   3929 C CB    . THR C 3 338 ? 88.832  68.076 107.135 1.00 42.65  ? 332 THR A CB    1 
ATOM   3930 O OG1   . THR C 3 338 ? 88.384  68.650 108.367 1.00 47.41  ? 332 THR A OG1   1 
ATOM   3931 C CG2   . THR C 3 338 ? 89.489  69.108 106.264 1.00 50.68  ? 332 THR A CG2   1 
ATOM   3932 N N     . GLY C 3 339 ? 87.439  68.004 104.028 1.00 45.49  ? 333 GLY A N     1 
ATOM   3933 C CA    . GLY C 3 339 ? 86.879  68.755 102.904 1.00 44.30  ? 333 GLY A CA    1 
ATOM   3934 C C     . GLY C 3 339 ? 87.911  69.400 101.986 1.00 49.44  ? 333 GLY A C     1 
ATOM   3935 O O     . GLY C 3 339 ? 89.089  69.511 102.340 1.00 52.47  ? 333 GLY A O     1 
ATOM   3936 N N     . ALA C 3 340 ? 87.447  69.833 100.815 1.00 43.03  ? 334 ALA A N     1 
ATOM   3937 C CA    . ALA C 3 340 ? 88.297  70.456 99.802  1.00 40.80  ? 334 ALA A CA    1 
ATOM   3938 C C     . ALA C 3 340 ? 88.684  71.900 100.136 1.00 43.33  ? 334 ALA A C     1 
ATOM   3939 O O     . ALA C 3 340 ? 89.755  72.379 99.754  1.00 41.93  ? 334 ALA A O     1 
ATOM   3940 C CB    . ALA C 3 340 ? 87.613  70.391 98.439  1.00 40.38  ? 334 ALA A CB    1 
ATOM   3941 N N     . MET C 3 341 ? 87.798  72.589 100.844 1.00 38.47  ? 335 MET A N     1 
ATOM   3942 C CA    . MET C 3 341 ? 88.011  73.981 101.223 1.00 36.93  ? 335 MET A CA    1 
ATOM   3943 C C     . MET C 3 341 ? 89.130  74.106 102.240 1.00 38.84  ? 335 MET A C     1 
ATOM   3944 O O     . MET C 3 341 ? 89.859  75.100 102.264 1.00 37.05  ? 335 MET A O     1 
ATOM   3945 C CB    . MET C 3 341 ? 86.727  74.551 101.820 1.00 38.77  ? 335 MET A CB    1 
ATOM   3946 C CG    . MET C 3 341 ? 86.278  75.837 101.184 1.00 41.69  ? 335 MET A CG    1 
ATOM   3947 S SD    . MET C 3 341 ? 86.699  75.868 99.458  1.00 44.74  ? 335 MET A SD    1 
ATOM   3948 C CE    . MET C 3 341 ? 87.134  77.595 99.253  1.00 41.16  ? 335 MET A CE    1 
ATOM   3949 N N     . VAL C 3 342 ? 89.231  73.103 103.106 1.00 34.48  ? 336 VAL A N     1 
ATOM   3950 C CA    . VAL C 3 342 ? 90.261  73.064 104.134 1.00 31.95  ? 336 VAL A CA    1 
ATOM   3951 C C     . VAL C 3 342 ? 91.570  72.802 103.398 1.00 40.03  ? 336 VAL A C     1 
ATOM   3952 O O     . VAL C 3 342 ? 92.602  73.421 103.682 1.00 40.06  ? 336 VAL A O     1 
ATOM   3953 C CB    . VAL C 3 342 ? 90.016  71.909 105.116 1.00 32.88  ? 336 VAL A CB    1 
ATOM   3954 C CG1   . VAL C 3 342 ? 91.326  71.428 105.665 1.00 34.44  ? 336 VAL A CG1   1 
ATOM   3955 C CG2   . VAL C 3 342 ? 89.090  72.328 106.249 1.00 30.53  ? 336 VAL A CG2   1 
ATOM   3956 N N     . ARG C 3 343 ? 91.498  71.901 102.421 1.00 39.41  ? 337 ARG A N     1 
ATOM   3957 C CA    . ARG C 3 343 ? 92.644  71.553 101.585 1.00 40.01  ? 337 ARG A CA    1 
ATOM   3958 C C     . ARG C 3 343 ? 93.160  72.767 100.811 1.00 43.01  ? 337 ARG A C     1 
ATOM   3959 O O     . ARG C 3 343 ? 94.358  73.016 100.769 1.00 45.42  ? 337 ARG A O     1 
ATOM   3960 C CB    . ARG C 3 343 ? 92.275  70.427 100.615 1.00 42.72  ? 337 ARG A CB    1 
ATOM   3961 C CG    . ARG C 3 343 ? 93.432  69.496 100.285 1.00 62.25  ? 337 ARG A CG    1 
ATOM   3962 C CD    . ARG C 3 343 ? 92.942  68.161 99.772  1.00 70.17  ? 337 ARG A CD    1 
ATOM   3963 N NE    . ARG C 3 343 ? 92.166  68.320 98.546  1.00 77.74  ? 337 ARG A NE    1 
ATOM   3964 C CZ    . ARG C 3 343 ? 90.930  67.855 98.379  1.00 78.19  ? 337 ARG A CZ    1 
ATOM   3965 N NH1   . ARG C 3 343 ? 90.326  67.197 99.364  1.00 46.59  ? 337 ARG A NH1   1 
ATOM   3966 N NH2   . ARG C 3 343 ? 90.286  68.056 97.233  1.00 55.15  ? 337 ARG A NH2   1 
ATOM   3967 N N     . LEU C 3 344 ? 92.250  73.521 100.206 1.00 36.62  ? 338 LEU A N     1 
ATOM   3968 C CA    . LEU C 3 344 ? 92.617  74.702 99.443  1.00 35.34  ? 338 LEU A CA    1 
ATOM   3969 C C     . LEU C 3 344 ? 93.178  75.742 100.376 1.00 41.02  ? 338 LEU A C     1 
ATOM   3970 O O     . LEU C 3 344 ? 94.237  76.299 100.130 1.00 44.36  ? 338 LEU A O     1 
ATOM   3971 C CB    . LEU C 3 344 ? 91.375  75.310 98.798  1.00 36.05  ? 338 LEU A CB    1 
ATOM   3972 C CG    . LEU C 3 344 ? 90.668  74.636 97.630  1.00 41.32  ? 338 LEU A CG    1 
ATOM   3973 C CD1   . LEU C 3 344 ? 89.987  75.708 96.785  1.00 40.90  ? 338 LEU A CD1   1 
ATOM   3974 C CD2   . LEU C 3 344 ? 91.661  73.839 96.811  1.00 47.26  ? 338 LEU A CD2   1 
ATOM   3975 N N     . LEU C 3 345 ? 92.419  76.042 101.422 1.00 37.89  ? 339 LEU A N     1 
ATOM   3976 C CA    . LEU C 3 345 ? 92.811  77.063 102.386 1.00 36.28  ? 339 LEU A CA    1 
ATOM   3977 C C     . LEU C 3 345 ? 94.207  76.816 102.946 1.00 40.17  ? 339 LEU A C     1 
ATOM   3978 O O     . LEU C 3 345 ? 95.008  77.739 103.095 1.00 41.10  ? 339 LEU A O     1 
ATOM   3979 C CB    . LEU C 3 345 ? 91.770  77.184 103.508 1.00 34.38  ? 339 LEU A CB    1 
ATOM   3980 C CG    . LEU C 3 345 ? 90.417  77.799 103.132 1.00 32.73  ? 339 LEU A CG    1 
ATOM   3981 C CD1   . LEU C 3 345 ? 89.330  77.383 104.120 1.00 28.89  ? 339 LEU A CD1   1 
ATOM   3982 C CD2   . LEU C 3 345 ? 90.544  79.303 103.077 1.00 33.58  ? 339 LEU A CD2   1 
ATOM   3983 N N     . GLU C 3 346 ? 94.506  75.560 103.234 1.00 36.81  ? 340 GLU A N     1 
ATOM   3984 C CA    . GLU C 3 346 ? 95.807  75.216 103.784 1.00 38.20  ? 340 GLU A CA    1 
ATOM   3985 C C     . GLU C 3 346 ? 96.857  74.955 102.701 1.00 52.19  ? 340 GLU A C     1 
ATOM   3986 O O     . GLU C 3 346 ? 97.872  74.299 102.961 1.00 55.51  ? 340 GLU A O     1 
ATOM   3987 C CB    . GLU C 3 346 ? 95.690  73.998 104.684 1.00 39.00  ? 340 GLU A CB    1 
ATOM   3988 C CG    . GLU C 3 346 ? 95.203  74.315 106.069 1.00 42.66  ? 340 GLU A CG    1 
ATOM   3989 C CD    . GLU C 3 346 ? 94.733  73.087 106.823 1.00 57.64  ? 340 GLU A CD    1 
ATOM   3990 O OE1   . GLU C 3 346 ? 95.282  71.988 106.602 1.00 66.29  ? 340 GLU A OE1   1 
ATOM   3991 O OE2   . GLU C 3 346 ? 93.812  73.224 107.648 1.00 54.39  ? 340 GLU A OE2   1 
ATOM   3992 N N     . ASP C 3 347 ? 96.587  75.474 101.490 1.00 51.15  ? 341 ASP A N     1 
ATOM   3993 C CA    . ASP C 3 347 ? 97.415  75.418 100.247 1.00 76.70  ? 341 ASP A CA    1 
ATOM   3994 C C     . ASP C 3 347 ? 96.755  74.573 99.173  1.00 100.00 ? 341 ASP A C     1 
ATOM   3995 O O     . ASP C 3 347 ? 97.394  74.226 98.183  1.00 95.15  ? 341 ASP A O     1 
ATOM   3996 C CB    . ASP C 3 347 ? 98.848  74.940 100.473 1.00 78.99  ? 341 ASP A CB    1 
ATOM   3997 C CG    . ASP C 3 347 ? 99.800  76.067 100.783 1.00 97.74  ? 341 ASP A CG    1 
ATOM   3998 O OD1   . ASP C 3 347 ? 100.912 75.756 101.261 1.00 100.00 ? 341 ASP A OD1   1 
ATOM   3999 O OD2   . ASP C 3 347 ? 99.418  77.248 100.609 1.00 100.00 ? 341 ASP A OD2   1 
ATOM   4000 N N     . THR D 3 25  ? 34.025  47.950 81.553  1.00 71.72  ? 19  THR B N     1 
ATOM   4001 C CA    . THR D 3 25  ? 33.045  46.902 81.281  1.00 70.85  ? 19  THR B CA    1 
ATOM   4002 C C     . THR D 3 25  ? 33.480  45.864 80.242  1.00 68.91  ? 19  THR B C     1 
ATOM   4003 O O     . THR D 3 25  ? 34.290  46.117 79.357  1.00 67.93  ? 19  THR B O     1 
ATOM   4004 C CB    . THR D 3 25  ? 31.685  47.486 80.819  1.00 88.61  ? 19  THR B CB    1 
ATOM   4005 O OG1   . THR D 3 25  ? 31.788  47.979 79.468  1.00 86.02  ? 19  THR B OG1   1 
ATOM   4006 C CG2   . THR D 3 25  ? 31.220  48.590 81.762  1.00 91.17  ? 19  THR B CG2   1 
ATOM   4007 N N     . SER D 3 26  ? 32.850  44.710 80.307  1.00 63.53  ? 20  SER B N     1 
ATOM   4008 C CA    . SER D 3 26  ? 33.135  43.652 79.369  1.00 63.92  ? 20  SER B CA    1 
ATOM   4009 C C     . SER D 3 26  ? 33.464  44.173 77.977  1.00 73.63  ? 20  SER B C     1 
ATOM   4010 O O     . SER D 3 26  ? 34.369  43.635 77.323  1.00 75.26  ? 20  SER B O     1 
ATOM   4011 C CB    . SER D 3 26  ? 31.981  42.655 79.323  1.00 66.56  ? 20  SER B CB    1 
ATOM   4012 O OG    . SER D 3 26  ? 32.119  41.792 78.212  1.00 72.98  ? 20  SER B OG    1 
ATOM   4013 N N     . ASP D 3 27  ? 32.769  45.213 77.517  1.00 70.84  ? 21  ASP B N     1 
ATOM   4014 C CA    . ASP D 3 27  ? 33.087  45.718 76.193  1.00 69.53  ? 21  ASP B CA    1 
ATOM   4015 C C     . ASP D 3 27  ? 34.477  46.351 76.204  1.00 67.77  ? 21  ASP B C     1 
ATOM   4016 O O     . ASP D 3 27  ? 35.360  45.933 75.465  1.00 68.49  ? 21  ASP B O     1 
ATOM   4017 C CB    . ASP D 3 27  ? 32.018  46.667 75.654  1.00 72.20  ? 21  ASP B CB    1 
ATOM   4018 C CG    . ASP D 3 27  ? 31.056  45.970 74.696  1.00 89.24  ? 21  ASP B CG    1 
ATOM   4019 O OD1   . ASP D 3 27  ? 31.362  44.831 74.273  1.00 89.85  ? 21  ASP B OD1   1 
ATOM   4020 O OD2   . ASP D 3 27  ? 29.988  46.541 74.388  1.00 100.00 ? 21  ASP B OD2   1 
ATOM   4021 N N     . GLU D 3 28  ? 34.678  47.318 77.090  1.00 58.69  ? 22  GLU B N     1 
ATOM   4022 C CA    . GLU D 3 28  ? 35.943  48.021 77.228  1.00 56.81  ? 22  GLU B CA    1 
ATOM   4023 C C     . GLU D 3 28  ? 37.101  47.058 77.368  1.00 63.96  ? 22  GLU B C     1 
ATOM   4024 O O     . GLU D 3 28  ? 38.083  47.159 76.640  1.00 66.42  ? 22  GLU B O     1 
ATOM   4025 C CB    . GLU D 3 28  ? 35.890  48.883 78.480  1.00 57.60  ? 22  GLU B CB    1 
ATOM   4026 C CG    . GLU D 3 28  ? 36.679  50.158 78.395  1.00 75.15  ? 22  GLU B CG    1 
ATOM   4027 C CD    . GLU D 3 28  ? 36.157  51.214 79.342  1.00 100.00 ? 22  GLU B CD    1 
ATOM   4028 O OE1   . GLU D 3 28  ? 35.048  51.028 79.900  1.00 100.00 ? 22  GLU B OE1   1 
ATOM   4029 O OE2   . GLU D 3 28  ? 36.850  52.239 79.510  1.00 100.00 ? 22  GLU B OE2   1 
ATOM   4030 N N     . VAL D 3 29  ? 37.002  46.143 78.333  1.00 56.62  ? 23  VAL B N     1 
ATOM   4031 C CA    . VAL D 3 29  ? 38.062  45.171 78.592  1.00 52.40  ? 23  VAL B CA    1 
ATOM   4032 C C     . VAL D 3 29  ? 38.430  44.385 77.336  1.00 52.70  ? 23  VAL B C     1 
ATOM   4033 O O     . VAL D 3 29  ? 39.603  44.177 77.054  1.00 50.47  ? 23  VAL B O     1 
ATOM   4034 C CB    . VAL D 3 29  ? 37.704  44.213 79.760  1.00 54.34  ? 23  VAL B CB    1 
ATOM   4035 C CG1   . VAL D 3 29  ? 38.337  42.851 79.541  1.00 55.03  ? 23  VAL B CG1   1 
ATOM   4036 C CG2   . VAL D 3 29  ? 38.138  44.799 81.104  1.00 52.39  ? 23  VAL B CG2   1 
ATOM   4037 N N     . ARG D 3 30  ? 37.430  43.977 76.563  1.00 50.94  ? 24  ARG B N     1 
ATOM   4038 C CA    . ARG D 3 30  ? 37.688  43.263 75.315  1.00 50.63  ? 24  ARG B CA    1 
ATOM   4039 C C     . ARG D 3 30  ? 38.509  44.166 74.393  1.00 52.55  ? 24  ARG B C     1 
ATOM   4040 O O     . ARG D 3 30  ? 39.352  43.685 73.644  1.00 54.63  ? 24  ARG B O     1 
ATOM   4041 C CB    . ARG D 3 30  ? 36.362  42.894 74.622  1.00 51.62  ? 24  ARG B CB    1 
ATOM   4042 C CG    . ARG D 3 30  ? 36.399  41.632 73.725  1.00 66.47  ? 24  ARG B CG    1 
ATOM   4043 C CD    . ARG D 3 30  ? 35.968  41.922 72.259  1.00 77.85  ? 24  ARG B CD    1 
ATOM   4044 N NE    . ARG D 3 30  ? 34.515  42.071 72.099  1.00 90.81  ? 24  ARG B NE    1 
ATOM   4045 C CZ    . ARG D 3 30  ? 33.874  43.242 72.126  1.00 100.00 ? 24  ARG B CZ    1 
ATOM   4046 N NH1   . ARG D 3 30  ? 34.532  44.353 72.375  1.00 93.69  ? 24  ARG B NH1   1 
ATOM   4047 N NH2   . ARG D 3 30  ? 32.559  43.283 71.918  1.00 100.00 ? 24  ARG B NH2   1 
ATOM   4048 N N     . LYS D 3 31  ? 38.266  45.472 74.461  1.00 45.89  ? 25  LYS B N     1 
ATOM   4049 C CA    . LYS D 3 31  ? 38.966  46.425 73.597  1.00 45.81  ? 25  LYS B CA    1 
ATOM   4050 C C     . LYS D 3 31  ? 40.413  46.696 73.992  1.00 48.20  ? 25  LYS B C     1 
ATOM   4051 O O     . LYS D 3 31  ? 41.320  46.667 73.157  1.00 46.18  ? 25  LYS B O     1 
ATOM   4052 C CB    . LYS D 3 31  ? 38.192  47.741 73.493  1.00 47.29  ? 25  LYS B CB    1 
ATOM   4053 C CG    . LYS D 3 31  ? 38.787  48.716 72.496  1.00 49.19  ? 25  LYS B CG    1 
ATOM   4054 C CD    . LYS D 3 31  ? 38.576  50.144 72.944  1.00 48.85  ? 25  LYS B CD    1 
ATOM   4055 C CE    . LYS D 3 31  ? 39.084  51.104 71.901  1.00 52.94  ? 25  LYS B CE    1 
ATOM   4056 N NZ    . LYS D 3 31  ? 40.069  52.045 72.491  1.00 68.05  ? 25  LYS B NZ    1 
ATOM   4057 N N     . ASN D 3 32  ? 40.603  46.991 75.271  1.00 43.56  ? 26  ASN B N     1 
ATOM   4058 C CA    . ASN D 3 32  ? 41.911  47.276 75.822  1.00 41.13  ? 26  ASN B CA    1 
ATOM   4059 C C     . ASN D 3 32  ? 42.869  46.149 75.511  1.00 50.59  ? 26  ASN B C     1 
ATOM   4060 O O     . ASN D 3 32  ? 44.018  46.385 75.144  1.00 52.65  ? 26  ASN B O     1 
ATOM   4061 C CB    . ASN D 3 32  ? 41.799  47.420 77.326  1.00 30.18  ? 26  ASN B CB    1 
ATOM   4062 C CG    . ASN D 3 32  ? 41.105  48.672 77.720  1.00 39.60  ? 26  ASN B CG    1 
ATOM   4063 O OD1   . ASN D 3 32  ? 40.427  48.727 78.737  1.00 52.02  ? 26  ASN B OD1   1 
ATOM   4064 N ND2   . ASN D 3 32  ? 41.281  49.708 76.921  1.00 25.65  ? 26  ASN B ND2   1 
ATOM   4065 N N     . LEU D 3 33  ? 42.406  44.918 75.704  1.00 48.18  ? 27  LEU B N     1 
ATOM   4066 C CA    . LEU D 3 33  ? 43.238  43.751 75.454  1.00 49.13  ? 27  LEU B CA    1 
ATOM   4067 C C     . LEU D 3 33  ? 43.468  43.640 73.959  1.00 56.11  ? 27  LEU B C     1 
ATOM   4068 O O     . LEU D 3 33  ? 44.562  43.305 73.504  1.00 55.79  ? 27  LEU B O     1 
ATOM   4069 C CB    . LEU D 3 33  ? 42.552  42.484 75.964  1.00 49.38  ? 27  LEU B CB    1 
ATOM   4070 C CG    . LEU D 3 33  ? 43.215  41.780 77.147  1.00 55.09  ? 27  LEU B CG    1 
ATOM   4071 C CD1   . LEU D 3 33  ? 44.230  42.705 77.783  1.00 56.55  ? 27  LEU B CD1   1 
ATOM   4072 C CD2   . LEU D 3 33  ? 42.167  41.376 78.163  1.00 57.95  ? 27  LEU B CD2   1 
ATOM   4073 N N     . MET D 3 34  ? 42.422  43.940 73.197  1.00 53.37  ? 28  MET B N     1 
ATOM   4074 C CA    . MET D 3 34  ? 42.497  43.889 71.746  1.00 52.70  ? 28  MET B CA    1 
ATOM   4075 C C     . MET D 3 34  ? 43.438  44.987 71.290  1.00 57.21  ? 28  MET B C     1 
ATOM   4076 O O     . MET D 3 34  ? 44.173  44.827 70.318  1.00 58.07  ? 28  MET B O     1 
ATOM   4077 C CB    . MET D 3 34  ? 41.114  44.099 71.134  1.00 55.25  ? 28  MET B CB    1 
ATOM   4078 C CG    . MET D 3 34  ? 40.770  43.121 70.024  0.00 58.96  ? 28  MET B CG    1 
ATOM   4079 S SD    . MET D 3 34  ? 39.147  42.368 70.244  0.00 63.23  ? 28  MET B SD    1 
ATOM   4080 C CE    . MET D 3 34  ? 38.079  43.784 69.995  0.00 60.00  ? 28  MET B CE    1 
ATOM   4081 N N     . ASP D 3 35  ? 43.413  46.102 72.012  1.00 53.05  ? 29  ASP B N     1 
ATOM   4082 C CA    . ASP D 3 35  ? 44.263  47.247 71.713  1.00 52.91  ? 29  ASP B CA    1 
ATOM   4083 C C     . ASP D 3 35  ? 45.726  46.900 71.969  1.00 56.40  ? 29  ASP B C     1 
ATOM   4084 O O     . ASP D 3 35  ? 46.631  47.498 71.400  1.00 56.56  ? 29  ASP B O     1 
ATOM   4085 C CB    . ASP D 3 35  ? 43.883  48.415 72.626  1.00 55.20  ? 29  ASP B CB    1 
ATOM   4086 C CG    . ASP D 3 35  ? 42.958  49.406 71.963  1.00 64.22  ? 29  ASP B CG    1 
ATOM   4087 O OD1   . ASP D 3 35  ? 42.533  49.165 70.812  1.00 61.65  ? 29  ASP B OD1   1 
ATOM   4088 O OD2   . ASP D 3 35  ? 42.656  50.426 72.615  1.00 76.52  ? 29  ASP B OD2   1 
ATOM   4089 N N     . MET D 3 36  ? 45.953  45.955 72.868  1.00 53.75  ? 30  MET B N     1 
ATOM   4090 C CA    . MET D 3 36  ? 47.306  45.564 73.218  1.00 53.31  ? 30  MET B CA    1 
ATOM   4091 C C     . MET D 3 36  ? 47.862  44.657 72.142  1.00 56.64  ? 30  MET B C     1 
ATOM   4092 O O     . MET D 3 36  ? 48.973  44.850 71.659  1.00 54.12  ? 30  MET B O     1 
ATOM   4093 C CB    . MET D 3 36  ? 47.315  44.846 74.565  1.00 55.75  ? 30  MET B CB    1 
ATOM   4094 C CG    . MET D 3 36  ? 48.660  44.900 75.263  1.00 60.55  ? 30  MET B CG    1 
ATOM   4095 S SD    . MET D 3 36  ? 48.679  44.014 76.836  1.00 65.93  ? 30  MET B SD    1 
ATOM   4096 C CE    . MET D 3 36  ? 47.305  42.889 76.601  1.00 62.97  ? 30  MET B CE    1 
ATOM   4097 N N     . PHE D 3 37  ? 47.070  43.658 71.772  1.00 54.94  ? 31  PHE B N     1 
ATOM   4098 C CA    . PHE D 3 37  ? 47.472  42.715 70.745  1.00 54.00  ? 31  PHE B CA    1 
ATOM   4099 C C     . PHE D 3 37  ? 47.773  43.390 69.411  1.00 55.89  ? 31  PHE B C     1 
ATOM   4100 O O     . PHE D 3 37  ? 48.643  42.934 68.675  1.00 54.97  ? 31  PHE B O     1 
ATOM   4101 C CB    . PHE D 3 37  ? 46.410  41.638 70.556  1.00 56.16  ? 31  PHE B CB    1 
ATOM   4102 C CG    . PHE D 3 37  ? 46.742  40.658 69.477  1.00 58.45  ? 31  PHE B CG    1 
ATOM   4103 C CD1   . PHE D 3 37  ? 47.845  39.828 69.593  1.00 62.12  ? 31  PHE B CD1   1 
ATOM   4104 C CD2   . PHE D 3 37  ? 45.977  40.592 68.332  1.00 60.65  ? 31  PHE B CD2   1 
ATOM   4105 C CE1   . PHE D 3 37  ? 48.170  38.943 68.592  1.00 63.17  ? 31  PHE B CE1   1 
ATOM   4106 C CE2   . PHE D 3 37  ? 46.297  39.706 67.327  1.00 64.44  ? 31  PHE B CE2   1 
ATOM   4107 C CZ    . PHE D 3 37  ? 47.395  38.878 67.458  1.00 62.52  ? 31  PHE B CZ    1 
ATOM   4108 N N     . ARG D 3 38  ? 47.051  44.466 69.100  1.00 51.04  ? 32  ARG B N     1 
ATOM   4109 C CA    . ARG D 3 38  ? 47.248  45.182 67.837  1.00 49.20  ? 32  ARG B CA    1 
ATOM   4110 C C     . ARG D 3 38  ? 48.653  45.736 67.726  1.00 52.10  ? 32  ARG B C     1 
ATOM   4111 O O     . ARG D 3 38  ? 49.307  45.594 66.696  1.00 53.44  ? 32  ARG B O     1 
ATOM   4112 C CB    . ARG D 3 38  ? 46.233  46.305 67.665  1.00 48.59  ? 32  ARG B CB    1 
ATOM   4113 C CG    . ARG D 3 38  ? 45.930  46.612 66.218  1.00 45.78  ? 32  ARG B CG    1 
ATOM   4114 C CD    . ARG D 3 38  ? 44.984  47.789 66.085  1.00 38.38  ? 32  ARG B CD    1 
ATOM   4115 N NE    . ARG D 3 38  ? 45.257  48.826 67.070  1.00 46.13  ? 32  ARG B NE    1 
ATOM   4116 C CZ    . ARG D 3 38  ? 44.450  49.853 67.305  1.00 57.35  ? 32  ARG B CZ    1 
ATOM   4117 N NH1   . ARG D 3 38  ? 43.326  49.968 66.620  1.00 35.56  ? 32  ARG B NH1   1 
ATOM   4118 N NH2   . ARG D 3 38  ? 44.766  50.765 68.214  1.00 47.29  ? 32  ARG B NH2   1 
ATOM   4119 N N     . ASP D 3 39  ? 49.116  46.373 68.792  1.00 47.34  ? 33  ASP B N     1 
ATOM   4120 C CA    . ASP D 3 39  ? 50.470  46.913 68.822  1.00 45.71  ? 33  ASP B CA    1 
ATOM   4121 C C     . ASP D 3 39  ? 51.405  46.067 69.698  1.00 48.48  ? 33  ASP B C     1 
ATOM   4122 O O     . ASP D 3 39  ? 52.134  46.585 70.556  1.00 46.79  ? 33  ASP B O     1 
ATOM   4123 C CB    . ASP D 3 39  ? 50.470  48.393 69.189  1.00 46.34  ? 33  ASP B CB    1 
ATOM   4124 C CG    . ASP D 3 39  ? 50.039  49.269 68.027  1.00 57.36  ? 33  ASP B CG    1 
ATOM   4125 O OD1   . ASP D 3 39  ? 50.639  49.131 66.943  1.00 55.53  ? 33  ASP B OD1   1 
ATOM   4126 O OD2   . ASP D 3 39  ? 49.088  50.063 68.179  1.00 69.33  ? 33  ASP B OD2   1 
ATOM   4127 N N     . ARG D 3 40  ? 51.330  44.758 69.447  1.00 43.82  ? 34  ARG B N     1 
ATOM   4128 C CA    . ARG D 3 40  ? 52.126  43.688 70.053  1.00 42.91  ? 34  ARG B CA    1 
ATOM   4129 C C     . ARG D 3 40  ? 53.580  44.136 70.246  1.00 44.87  ? 34  ARG B C     1 
ATOM   4130 O O     . ARG D 3 40  ? 54.216  43.907 71.291  1.00 45.61  ? 34  ARG B O     1 
ATOM   4131 C CB    . ARG D 3 40  ? 52.156  42.554 69.015  1.00 43.41  ? 34  ARG B CB    1 
ATOM   4132 C CG    . ARG D 3 40  ? 51.623  41.222 69.482  1.00 51.87  ? 34  ARG B CG    1 
ATOM   4133 C CD    . ARG D 3 40  ? 50.940  40.411 68.350  1.00 74.13  ? 34  ARG B CD    1 
ATOM   4134 N NE    . ARG D 3 40  ? 50.989  41.029 67.022  1.00 90.81  ? 34  ARG B NE    1 
ATOM   4135 C CZ    . ARG D 3 40  ? 50.644  40.403 65.895  1.00 100.00 ? 34  ARG B CZ    1 
ATOM   4136 N NH1   . ARG D 3 40  ? 50.227  39.141 65.925  1.00 81.75  ? 34  ARG B NH1   1 
ATOM   4137 N NH2   . ARG D 3 40  ? 50.707  41.034 64.730  1.00 100.00 ? 34  ARG B NH2   1 
ATOM   4138 N N     . GLN D 3 41  ? 54.084  44.733 69.167  1.00 36.52  ? 35  GLN B N     1 
ATOM   4139 C CA    . GLN D 3 41  ? 55.446  45.208 69.026  1.00 34.90  ? 35  GLN B CA    1 
ATOM   4140 C C     . GLN D 3 41  ? 55.902  46.280 70.001  1.00 41.11  ? 35  GLN B C     1 
ATOM   4141 O O     . GLN D 3 41  ? 57.094  46.559 70.098  1.00 43.68  ? 35  GLN B O     1 
ATOM   4142 C CB    . GLN D 3 41  ? 55.664  45.696 67.602  1.00 36.39  ? 35  GLN B CB    1 
ATOM   4143 C CG    . GLN D 3 41  ? 56.359  44.700 66.692  1.00 65.03  ? 35  GLN B CG    1 
ATOM   4144 C CD    . GLN D 3 41  ? 55.710  43.335 66.705  1.00 99.72  ? 35  GLN B CD    1 
ATOM   4145 O OE1   . GLN D 3 41  ? 56.353  42.335 67.010  1.00 99.98  ? 35  GLN B OE1   1 
ATOM   4146 N NE2   . GLN D 3 41  ? 54.431  43.278 66.367  1.00 94.94  ? 35  GLN B NE2   1 
ATOM   4147 N N     . ALA D 3 42  ? 54.965  46.903 70.699  1.00 36.28  ? 36  ALA B N     1 
ATOM   4148 C CA    . ALA D 3 42  ? 55.325  47.918 71.664  1.00 35.10  ? 36  ALA B CA    1 
ATOM   4149 C C     . ALA D 3 42  ? 56.114  47.199 72.758  1.00 42.70  ? 36  ALA B C     1 
ATOM   4150 O O     . ALA D 3 42  ? 56.856  47.834 73.518  1.00 46.86  ? 36  ALA B O     1 
ATOM   4151 C CB    . ALA D 3 42  ? 54.065  48.557 72.235  1.00 35.20  ? 36  ALA B CB    1 
ATOM   4152 N N     . PHE D 3 43  ? 55.964  45.870 72.819  1.00 34.94  ? 37  PHE B N     1 
ATOM   4153 C CA    . PHE D 3 43  ? 56.635  45.058 73.842  1.00 35.01  ? 37  PHE B CA    1 
ATOM   4154 C C     . PHE D 3 43  ? 57.656  44.080 73.281  1.00 37.25  ? 37  PHE B C     1 
ATOM   4155 O O     . PHE D 3 43  ? 57.586  43.716 72.115  1.00 39.37  ? 37  PHE B O     1 
ATOM   4156 C CB    . PHE D 3 43  ? 55.605  44.288 74.697  1.00 36.49  ? 37  PHE B CB    1 
ATOM   4157 C CG    . PHE D 3 43  ? 54.448  45.131 75.149  1.00 36.97  ? 37  PHE B CG    1 
ATOM   4158 C CD1   . PHE D 3 43  ? 54.535  45.901 76.295  1.00 37.76  ? 37  PHE B CD1   1 
ATOM   4159 C CD2   . PHE D 3 43  ? 53.298  45.221 74.371  1.00 39.19  ? 37  PHE B CD2   1 
ATOM   4160 C CE1   . PHE D 3 43  ? 53.487  46.722 76.672  1.00 39.03  ? 37  PHE B CE1   1 
ATOM   4161 C CE2   . PHE D 3 43  ? 52.236  46.038 74.745  1.00 39.90  ? 37  PHE B CE2   1 
ATOM   4162 C CZ    . PHE D 3 43  ? 52.332  46.785 75.896  1.00 38.17  ? 37  PHE B CZ    1 
ATOM   4163 N N     . SER D 3 44  ? 58.568  43.620 74.135  1.00 30.34  ? 38  SER B N     1 
ATOM   4164 C CA    . SER D 3 44  ? 59.580  42.650 73.743  1.00 26.13  ? 38  SER B CA    1 
ATOM   4165 C C     . SER D 3 44  ? 58.895  41.354 73.373  1.00 33.02  ? 38  SER B C     1 
ATOM   4166 O O     . SER D 3 44  ? 57.877  40.990 73.953  1.00 35.84  ? 38  SER B O     1 
ATOM   4167 C CB    . SER D 3 44  ? 60.537  42.371 74.893  1.00 22.38  ? 38  SER B CB    1 
ATOM   4168 O OG    . SER D 3 44  ? 60.913  41.003 74.878  1.00 28.93  ? 38  SER B OG    1 
ATOM   4169 N N     . GLU D 3 45  ? 59.467  40.644 72.414  1.00 30.70  ? 39  GLU B N     1 
ATOM   4170 C CA    . GLU D 3 45  ? 58.918  39.373 71.979  1.00 30.89  ? 39  GLU B CA    1 
ATOM   4171 C C     . GLU D 3 45  ? 58.832  38.479 73.211  1.00 36.07  ? 39  GLU B C     1 
ATOM   4172 O O     . GLU D 3 45  ? 57.905  37.683 73.380  1.00 34.54  ? 39  GLU B O     1 
ATOM   4173 C CB    . GLU D 3 45  ? 59.871  38.743 70.956  1.00 32.07  ? 39  GLU B CB    1 
ATOM   4174 C CG    . GLU D 3 45  ? 61.282  38.500 71.485  1.00 40.72  ? 39  GLU B CG    1 
ATOM   4175 C CD    . GLU D 3 45  ? 62.357  38.935 70.512  1.00 81.91  ? 39  GLU B CD    1 
ATOM   4176 O OE1   . GLU D 3 45  ? 62.539  40.161 70.334  1.00 78.03  ? 39  GLU B OE1   1 
ATOM   4177 O OE2   . GLU D 3 45  ? 63.010  38.047 69.923  1.00 100.00 ? 39  GLU B OE2   1 
ATOM   4178 N N     . HIS D 3 46  ? 59.822  38.628 74.078  1.00 35.74  ? 40  HIS B N     1 
ATOM   4179 C CA    . HIS D 3 46  ? 59.915  37.824 75.284  1.00 37.96  ? 40  HIS B CA    1 
ATOM   4180 C C     . HIS D 3 46  ? 58.823  38.080 76.304  1.00 42.61  ? 40  HIS B C     1 
ATOM   4181 O O     . HIS D 3 46  ? 58.320  37.147 76.936  1.00 42.11  ? 40  HIS B O     1 
ATOM   4182 C CB    . HIS D 3 46  ? 61.306  37.989 75.897  1.00 38.98  ? 40  HIS B CB    1 
ATOM   4183 C CG    . HIS D 3 46  ? 62.397  37.525 74.990  1.00 42.15  ? 40  HIS B CG    1 
ATOM   4184 N ND1   . HIS D 3 46  ? 63.343  38.375 74.457  1.00 43.55  ? 40  HIS B ND1   1 
ATOM   4185 C CD2   . HIS D 3 46  ? 62.640  36.308 74.450  1.00 41.90  ? 40  HIS B CD2   1 
ATOM   4186 C CE1   . HIS D 3 46  ? 64.149  37.692 73.664  1.00 41.41  ? 40  HIS B CE1   1 
ATOM   4187 N NE2   . HIS D 3 46  ? 63.743  36.437 73.643  1.00 41.56  ? 40  HIS B NE2   1 
ATOM   4188 N N     . THR D 3 47  ? 58.471  39.353 76.460  1.00 39.00  ? 41  THR B N     1 
ATOM   4189 C CA    . THR D 3 47  ? 57.426  39.771 77.380  1.00 37.83  ? 41  THR B CA    1 
ATOM   4190 C C     . THR D 3 47  ? 56.155  39.035 76.997  1.00 42.70  ? 41  THR B C     1 
ATOM   4191 O O     . THR D 3 47  ? 55.456  38.513 77.868  1.00 44.52  ? 41  THR B O     1 
ATOM   4192 C CB    . THR D 3 47  ? 57.235  41.291 77.327  1.00 46.06  ? 41  THR B CB    1 
ATOM   4193 O OG1   . THR D 3 47  ? 58.264  41.933 78.100  1.00 44.82  ? 41  THR B OG1   1 
ATOM   4194 C CG2   . THR D 3 47  ? 55.872  41.680 77.845  1.00 44.24  ? 41  THR B CG2   1 
ATOM   4195 N N     . TRP D 3 48  ? 55.904  38.930 75.689  1.00 37.33  ? 42  TRP B N     1 
ATOM   4196 C CA    . TRP D 3 48  ? 54.751  38.186 75.183  1.00 36.61  ? 42  TRP B CA    1 
ATOM   4197 C C     . TRP D 3 48  ? 54.916  36.697 75.469  1.00 36.99  ? 42  TRP B C     1 
ATOM   4198 O O     . TRP D 3 48  ? 53.960  36.010 75.845  1.00 35.78  ? 42  TRP B O     1 
ATOM   4199 C CB    . TRP D 3 48  ? 54.577  38.400 73.681  1.00 37.28  ? 42  TRP B CB    1 
ATOM   4200 C CG    . TRP D 3 48  ? 53.807  39.610 73.363  1.00 40.72  ? 42  TRP B CG    1 
ATOM   4201 C CD1   . TRP D 3 48  ? 54.304  40.769 72.873  1.00 44.75  ? 42  TRP B CD1   1 
ATOM   4202 C CD2   . TRP D 3 48  ? 52.405  39.830 73.579  1.00 41.89  ? 42  TRP B CD2   1 
ATOM   4203 N NE1   . TRP D 3 48  ? 53.300  41.702 72.746  1.00 46.39  ? 42  TRP B NE1   1 
ATOM   4204 C CE2   . TRP D 3 48  ? 52.128  41.154 73.197  1.00 47.73  ? 42  TRP B CE2   1 
ATOM   4205 C CE3   . TRP D 3 48  ? 51.354  39.035 74.048  1.00 44.08  ? 42  TRP B CE3   1 
ATOM   4206 C CZ2   . TRP D 3 48  ? 50.843  41.700 73.261  1.00 46.58  ? 42  TRP B CZ2   1 
ATOM   4207 C CZ3   . TRP D 3 48  ? 50.074  39.589 74.116  1.00 44.51  ? 42  TRP B CZ3   1 
ATOM   4208 C CH2   . TRP D 3 48  ? 49.837  40.902 73.726  1.00 44.78  ? 42  TRP B CH2   1 
ATOM   4209 N N     . LYS D 3 49  ? 56.132  36.194 75.271  1.00 32.26  ? 43  LYS B N     1 
ATOM   4210 C CA    . LYS D 3 49  ? 56.414  34.784 75.506  1.00 30.53  ? 43  LYS B CA    1 
ATOM   4211 C C     . LYS D 3 49  ? 56.041  34.418 76.932  1.00 36.90  ? 43  LYS B C     1 
ATOM   4212 O O     . LYS D 3 49  ? 55.462  33.351 77.168  1.00 38.98  ? 43  LYS B O     1 
ATOM   4213 C CB    . LYS D 3 49  ? 57.898  34.475 75.267  1.00 31.60  ? 43  LYS B CB    1 
ATOM   4214 C CG    . LYS D 3 49  ? 58.405  33.265 76.050  1.00 38.50  ? 43  LYS B CG    1 
ATOM   4215 C CD    . LYS D 3 49  ? 59.917  33.069 75.925  1.00 42.03  ? 43  LYS B CD    1 
ATOM   4216 C CE    . LYS D 3 49  ? 60.682  34.229 76.548  1.00 47.06  ? 43  LYS B CE    1 
ATOM   4217 N NZ    . LYS D 3 49  ? 62.129  34.217 76.215  1.00 39.36  ? 43  LYS B NZ    1 
ATOM   4218 N N     . MET D 3 50  ? 56.386  35.291 77.884  1.00 30.36  ? 44  MET B N     1 
ATOM   4219 C CA    . MET D 3 50  ? 56.102  35.010 79.289  1.00 28.07  ? 44  MET B CA    1 
ATOM   4220 C C     . MET D 3 50  ? 54.650  35.232 79.664  1.00 30.33  ? 44  MET B C     1 
ATOM   4221 O O     . MET D 3 50  ? 54.096  34.465 80.449  1.00 30.57  ? 44  MET B O     1 
ATOM   4222 C CB    . MET D 3 50  ? 57.043  35.756 80.234  1.00 29.43  ? 44  MET B CB    1 
ATOM   4223 C CG    . MET D 3 50  ? 58.474  35.228 80.268  1.00 30.68  ? 44  MET B CG    1 
ATOM   4224 S SD    . MET D 3 50  ? 58.621  33.453 80.267  1.00 34.28  ? 44  MET B SD    1 
ATOM   4225 C CE    . MET D 3 50  ? 58.057  33.030 81.886  1.00 30.79  ? 44  MET B CE    1 
ATOM   4226 N N     . LEU D 3 51  ? 54.024  36.258 79.091  1.00 26.44  ? 45  LEU B N     1 
ATOM   4227 C CA    . LEU D 3 51  ? 52.608  36.507 79.360  1.00 27.39  ? 45  LEU B CA    1 
ATOM   4228 C C     . LEU D 3 51  ? 51.848  35.238 78.994  1.00 31.38  ? 45  LEU B C     1 
ATOM   4229 O O     . LEU D 3 51  ? 51.095  34.677 79.786  1.00 31.43  ? 45  LEU B O     1 
ATOM   4230 C CB    . LEU D 3 51  ? 52.083  37.672 78.521  1.00 28.37  ? 45  LEU B CB    1 
ATOM   4231 C CG    . LEU D 3 51  ? 50.552  37.754 78.485  1.00 32.39  ? 45  LEU B CG    1 
ATOM   4232 C CD1   . LEU D 3 51  ? 49.966  37.690 79.896  1.00 30.43  ? 45  LEU B CD1   1 
ATOM   4233 C CD2   . LEU D 3 51  ? 50.065  38.989 77.722  1.00 30.25  ? 45  LEU B CD2   1 
ATOM   4234 N N     . LEU D 3 52  ? 52.083  34.752 77.790  1.00 28.91  ? 46  LEU B N     1 
ATOM   4235 C CA    . LEU D 3 52  ? 51.424  33.534 77.361  1.00 29.12  ? 46  LEU B CA    1 
ATOM   4236 C C     . LEU D 3 52  ? 51.847  32.321 78.197  1.00 33.14  ? 46  LEU B C     1 
ATOM   4237 O O     . LEU D 3 52  ? 51.045  31.430 78.463  1.00 35.00  ? 46  LEU B O     1 
ATOM   4238 C CB    . LEU D 3 52  ? 51.621  33.307 75.854  1.00 29.42  ? 46  LEU B CB    1 
ATOM   4239 C CG    . LEU D 3 52  ? 50.822  34.201 74.881  1.00 33.52  ? 46  LEU B CG    1 
ATOM   4240 C CD1   . LEU D 3 52  ? 50.348  35.511 75.490  1.00 31.92  ? 46  LEU B CD1   1 
ATOM   4241 C CD2   . LEU D 3 52  ? 51.621  34.489 73.623  1.00 38.59  ? 46  LEU B CD2   1 
ATOM   4242 N N     . SER D 3 53  ? 53.101  32.280 78.631  1.00 29.39  ? 47  SER B N     1 
ATOM   4243 C CA    . SER D 3 53  ? 53.559  31.141 79.422  1.00 27.99  ? 47  SER B CA    1 
ATOM   4244 C C     . SER D 3 53  ? 52.871  31.053 80.793  1.00 32.07  ? 47  SER B C     1 
ATOM   4245 O O     . SER D 3 53  ? 52.480  29.971 81.240  1.00 31.67  ? 47  SER B O     1 
ATOM   4246 C CB    . SER D 3 53  ? 55.082  31.135 79.553  1.00 27.60  ? 47  SER B CB    1 
ATOM   4247 O OG    . SER D 3 53  ? 55.534  29.881 80.038  1.00 33.16  ? 47  SER B OG    1 
ATOM   4248 N N     . VAL D 3 54  ? 52.720  32.198 81.453  1.00 27.98  ? 48  VAL B N     1 
ATOM   4249 C CA    . VAL D 3 54  ? 52.063  32.256 82.758  1.00 26.98  ? 48  VAL B CA    1 
ATOM   4250 C C     . VAL D 3 54  ? 50.591  31.908 82.612  1.00 34.07  ? 48  VAL B C     1 
ATOM   4251 O O     . VAL D 3 54  ? 50.068  31.073 83.359  1.00 33.53  ? 48  VAL B O     1 
ATOM   4252 C CB    . VAL D 3 54  ? 52.117  33.664 83.327  1.00 28.58  ? 48  VAL B CB    1 
ATOM   4253 C CG1   . VAL D 3 54  ? 51.373  33.721 84.640  1.00 27.44  ? 48  VAL B CG1   1 
ATOM   4254 C CG2   . VAL D 3 54  ? 53.567  34.150 83.442  1.00 28.01  ? 48  VAL B CG2   1 
ATOM   4255 N N     . CYS D 3 55  ? 49.934  32.563 81.649  1.00 30.68  ? 49  CYS B N     1 
ATOM   4256 C CA    . CYS D 3 55  ? 48.514  32.355 81.400  1.00 28.77  ? 49  CYS B CA    1 
ATOM   4257 C C     . CYS D 3 55  ? 48.225  30.889 81.200  1.00 35.63  ? 49  CYS B C     1 
ATOM   4258 O O     . CYS D 3 55  ? 47.245  30.360 81.719  1.00 37.81  ? 49  CYS B O     1 
ATOM   4259 C CB    . CYS D 3 55  ? 48.053  33.167 80.205  1.00 28.20  ? 49  CYS B CB    1 
ATOM   4260 S SG    . CYS D 3 55  ? 47.935  34.931 80.601  1.00 33.04  ? 49  CYS B SG    1 
ATOM   4261 N N     . ARG D 3 56  ? 49.106  30.227 80.461  1.00 32.57  ? 50  ARG B N     1 
ATOM   4262 C CA    . ARG D 3 56  ? 48.964  28.806 80.205  1.00 32.72  ? 50  ARG B CA    1 
ATOM   4263 C C     . ARG D 3 56  ? 48.937  28.095 81.561  1.00 37.73  ? 50  ARG B C     1 
ATOM   4264 O O     . ARG D 3 56  ? 48.011  27.337 81.859  1.00 39.21  ? 50  ARG B O     1 
ATOM   4265 C CB    . ARG D 3 56  ? 50.152  28.327 79.360  1.00 34.62  ? 50  ARG B CB    1 
ATOM   4266 C CG    . ARG D 3 56  ? 49.780  27.636 78.058  1.00 38.80  ? 50  ARG B CG    1 
ATOM   4267 C CD    . ARG D 3 56  ? 50.596  28.149 76.881  1.00 53.29  ? 50  ARG B CD    1 
ATOM   4268 N NE    . ARG D 3 56  ? 52.039  28.044 77.084  1.00 58.85  ? 50  ARG B NE    1 
ATOM   4269 C CZ    . ARG D 3 56  ? 52.932  28.735 76.380  1.00 69.90  ? 50  ARG B CZ    1 
ATOM   4270 N NH1   . ARG D 3 56  ? 52.518  29.579 75.445  1.00 67.96  ? 50  ARG B NH1   1 
ATOM   4271 N NH2   . ARG D 3 56  ? 54.234  28.594 76.610  1.00 47.06  ? 50  ARG B NH2   1 
ATOM   4272 N N     . SER D 3 57  ? 49.942  28.396 82.383  1.00 33.75  ? 51  SER B N     1 
ATOM   4273 C CA    . SER D 3 57  ? 50.128  27.819 83.710  1.00 31.15  ? 51  SER B CA    1 
ATOM   4274 C C     . SER D 3 57  ? 48.942  28.068 84.628  1.00 32.43  ? 51  SER B C     1 
ATOM   4275 O O     . SER D 3 57  ? 48.358  27.136 85.182  1.00 33.76  ? 51  SER B O     1 
ATOM   4276 C CB    . SER D 3 57  ? 51.386  28.417 84.326  1.00 35.36  ? 51  SER B CB    1 
ATOM   4277 O OG    . SER D 3 57  ? 51.853  27.629 85.401  1.00 62.85  ? 51  SER B OG    1 
ATOM   4278 N N     . TRP D 3 58  ? 48.610  29.344 84.782  1.00 24.77  ? 52  TRP B N     1 
ATOM   4279 C CA    . TRP D 3 58  ? 47.495  29.804 85.598  1.00 24.43  ? 52  TRP B CA    1 
ATOM   4280 C C     . TRP D 3 58  ? 46.245  29.088 85.130  1.00 35.60  ? 52  TRP B C     1 
ATOM   4281 O O     . TRP D 3 58  ? 45.624  28.342 85.886  1.00 41.45  ? 52  TRP B O     1 
ATOM   4282 C CB    . TRP D 3 58  ? 47.358  31.318 85.395  1.00 23.93  ? 52  TRP B CB    1 
ATOM   4283 C CG    . TRP D 3 58  ? 46.110  31.979 85.926  1.00 25.70  ? 52  TRP B CG    1 
ATOM   4284 C CD1   . TRP D 3 58  ? 45.237  32.769 85.218  1.00 29.14  ? 52  TRP B CD1   1 
ATOM   4285 C CD2   . TRP D 3 58  ? 45.685  32.044 87.292  1.00 24.97  ? 52  TRP B CD2   1 
ATOM   4286 N NE1   . TRP D 3 58  ? 44.273  33.269 86.052  1.00 29.18  ? 52  TRP B NE1   1 
ATOM   4287 C CE2   . TRP D 3 58  ? 44.520  32.830 87.330  1.00 30.38  ? 52  TRP B CE2   1 
ATOM   4288 C CE3   . TRP D 3 58  ? 46.164  31.493 88.481  1.00 26.18  ? 52  TRP B CE3   1 
ATOM   4289 C CZ2   . TRP D 3 58  ? 43.819  33.067 88.511  1.00 29.48  ? 52  TRP B CZ2   1 
ATOM   4290 C CZ3   . TRP D 3 58  ? 45.471  31.724 89.645  1.00 28.51  ? 52  TRP B CZ3   1 
ATOM   4291 C CH2   . TRP D 3 58  ? 44.309  32.506 89.655  1.00 29.18  ? 52  TRP B CH2   1 
ATOM   4292 N N     . ALA D 3 59  ? 45.899  29.286 83.863  1.00 31.17  ? 53  ALA B N     1 
ATOM   4293 C CA    . ALA D 3 59  ? 44.735  28.649 83.262  1.00 28.62  ? 53  ALA B CA    1 
ATOM   4294 C C     . ALA D 3 59  ? 44.698  27.158 83.581  1.00 34.64  ? 53  ALA B C     1 
ATOM   4295 O O     . ALA D 3 59  ? 43.634  26.596 83.859  1.00 34.21  ? 53  ALA B O     1 
ATOM   4296 C CB    . ALA D 3 59  ? 44.736  28.875 81.773  1.00 28.09  ? 53  ALA B CB    1 
ATOM   4297 N N     . ALA D 3 60  ? 45.864  26.521 83.545  1.00 32.19  ? 54  ALA B N     1 
ATOM   4298 C CA    . ALA D 3 60  ? 45.957  25.100 83.844  1.00 31.86  ? 54  ALA B CA    1 
ATOM   4299 C C     . ALA D 3 60  ? 45.512  24.839 85.273  1.00 39.92  ? 54  ALA B C     1 
ATOM   4300 O O     . ALA D 3 60  ? 44.641  24.010 85.515  1.00 43.25  ? 54  ALA B O     1 
ATOM   4301 C CB    . ALA D 3 60  ? 47.371  24.620 83.647  1.00 32.38  ? 54  ALA B CB    1 
ATOM   4302 N N     . TRP D 3 61  ? 46.129  25.546 86.218  1.00 35.85  ? 55  TRP B N     1 
ATOM   4303 C CA    . TRP D 3 61  ? 45.806  25.403 87.639  1.00 33.76  ? 55  TRP B CA    1 
ATOM   4304 C C     . TRP D 3 61  ? 44.328  25.666 87.831  1.00 33.11  ? 55  TRP B C     1 
ATOM   4305 O O     . TRP D 3 61  ? 43.652  24.945 88.547  1.00 34.46  ? 55  TRP B O     1 
ATOM   4306 C CB    . TRP D 3 61  ? 46.609  26.409 88.475  1.00 32.12  ? 55  TRP B CB    1 
ATOM   4307 C CG    . TRP D 3 61  ? 46.397  26.309 89.955  1.00 33.16  ? 55  TRP B CG    1 
ATOM   4308 C CD1   . TRP D 3 61  ? 47.062  25.492 90.831  1.00 36.31  ? 55  TRP B CD1   1 
ATOM   4309 C CD2   . TRP D 3 61  ? 45.497  27.098 90.751  1.00 33.14  ? 55  TRP B CD2   1 
ATOM   4310 N NE1   . TRP D 3 61  ? 46.618  25.716 92.119  1.00 35.75  ? 55  TRP B NE1   1 
ATOM   4311 C CE2   . TRP D 3 61  ? 45.649  26.685 92.092  1.00 36.05  ? 55  TRP B CE2   1 
ATOM   4312 C CE3   . TRP D 3 61  ? 44.572  28.102 90.459  1.00 34.20  ? 55  TRP B CE3   1 
ATOM   4313 C CZ2   . TRP D 3 61  ? 44.918  27.244 93.126  1.00 34.48  ? 55  TRP B CZ2   1 
ATOM   4314 C CZ3   . TRP D 3 61  ? 43.838  28.643 91.489  1.00 34.94  ? 55  TRP B CZ3   1 
ATOM   4315 C CH2   . TRP D 3 61  ? 44.013  28.212 92.804  1.00 35.43  ? 55  TRP B CH2   1 
ATOM   4316 N N     . CYS D 3 62  ? 43.834  26.716 87.195  1.00 25.96  ? 56  CYS B N     1 
ATOM   4317 C CA    . CYS D 3 62  ? 42.433  27.063 87.323  1.00 27.40  ? 56  CYS B CA    1 
ATOM   4318 C C     . CYS D 3 62  ? 41.494  25.925 86.885  1.00 33.46  ? 56  CYS B C     1 
ATOM   4319 O O     . CYS D 3 62  ? 40.489  25.638 87.535  1.00 30.08  ? 56  CYS B O     1 
ATOM   4320 C CB    . CYS D 3 62  ? 42.127  28.324 86.520  1.00 27.75  ? 56  CYS B CB    1 
ATOM   4321 S SG    . CYS D 3 62  ? 42.459  29.884 87.380  1.00 31.60  ? 56  CYS B SG    1 
ATOM   4322 N N     . LYS D 3 63  ? 41.799  25.291 85.764  1.00 33.63  ? 57  LYS B N     1 
ATOM   4323 C CA    . LYS D 3 63  ? 40.929  24.241 85.283  1.00 34.50  ? 57  LYS B CA    1 
ATOM   4324 C C     . LYS D 3 63  ? 40.936  23.081 86.247  1.00 44.12  ? 57  LYS B C     1 
ATOM   4325 O O     . LYS D 3 63  ? 39.943  22.381 86.392  1.00 49.84  ? 57  LYS B O     1 
ATOM   4326 C CB    . LYS D 3 63  ? 41.334  23.781 83.886  1.00 38.07  ? 57  LYS B CB    1 
ATOM   4327 C CG    . LYS D 3 63  ? 40.339  22.817 83.261  1.00 62.04  ? 57  LYS B CG    1 
ATOM   4328 C CD    . LYS D 3 63  ? 40.471  22.727 81.750  1.00 68.97  ? 57  LYS B CD    1 
ATOM   4329 C CE    . LYS D 3 63  ? 39.964  21.381 81.248  1.00 81.43  ? 57  LYS B CE    1 
ATOM   4330 N NZ    . LYS D 3 63  ? 40.752  20.886 80.088  1.00 98.58  ? 57  LYS B NZ    1 
ATOM   4331 N N     . LEU D 3 64  ? 42.068  22.868 86.899  1.00 40.18  ? 58  LEU B N     1 
ATOM   4332 C CA    . LEU D 3 64  ? 42.220  21.773 87.850  1.00 39.12  ? 58  LEU B CA    1 
ATOM   4333 C C     . LEU D 3 64  ? 41.326  21.927 89.083  1.00 47.37  ? 58  LEU B C     1 
ATOM   4334 O O     . LEU D 3 64  ? 40.885  20.938 89.662  1.00 50.12  ? 58  LEU B O     1 
ATOM   4335 C CB    . LEU D 3 64  ? 43.674  21.715 88.301  1.00 38.59  ? 58  LEU B CB    1 
ATOM   4336 C CG    . LEU D 3 64  ? 44.195  20.414 88.897  1.00 44.31  ? 58  LEU B CG    1 
ATOM   4337 C CD1   . LEU D 3 64  ? 44.147  19.305 87.861  1.00 43.24  ? 58  LEU B CD1   1 
ATOM   4338 C CD2   . LEU D 3 64  ? 45.621  20.646 89.359  1.00 52.24  ? 58  LEU B CD2   1 
ATOM   4339 N N     . ASN D 3 65  ? 41.089  23.168 89.489  1.00 43.95  ? 59  ASN B N     1 
ATOM   4340 C CA    . ASN D 3 65  ? 40.292  23.465 90.672  1.00 41.86  ? 59  ASN B CA    1 
ATOM   4341 C C     . ASN D 3 65  ? 38.966  24.127 90.321  1.00 44.51  ? 59  ASN B C     1 
ATOM   4342 O O     . ASN D 3 65  ? 38.288  24.706 91.172  1.00 47.09  ? 59  ASN B O     1 
ATOM   4343 C CB    . ASN D 3 65  ? 41.093  24.360 91.608  1.00 37.44  ? 59  ASN B CB    1 
ATOM   4344 C CG    . ASN D 3 65  ? 42.272  23.648 92.199  1.00 57.23  ? 59  ASN B CG    1 
ATOM   4345 O OD1   . ASN D 3 65  ? 42.111  22.629 92.862  1.00 67.64  ? 59  ASN B OD1   1 
ATOM   4346 N ND2   . ASN D 3 65  ? 43.469  24.147 91.930  1.00 47.55  ? 59  ASN B ND2   1 
ATOM   4347 N N     . ASN D 3 66  ? 38.596  24.034 89.056  1.00 36.47  ? 60  ASN B N     1 
ATOM   4348 C CA    . ASN D 3 66  ? 37.356  24.615 88.611  1.00 35.39  ? 60  ASN B CA    1 
ATOM   4349 C C     . ASN D 3 66  ? 37.289  26.064 89.058  1.00 39.89  ? 60  ASN B C     1 
ATOM   4350 O O     . ASN D 3 66  ? 36.422  26.418 89.850  1.00 43.34  ? 60  ASN B O     1 
ATOM   4351 C CB    . ASN D 3 66  ? 36.179  23.836 89.188  1.00 36.80  ? 60  ASN B CB    1 
ATOM   4352 C CG    . ASN D 3 66  ? 34.924  23.960 88.353  1.00 88.66  ? 60  ASN B CG    1 
ATOM   4353 O OD1   . ASN D 3 66  ? 33.825  24.106 88.883  1.00 88.90  ? 60  ASN B OD1   1 
ATOM   4354 N ND2   . ASN D 3 66  ? 35.078  23.894 87.037  1.00 93.72  ? 60  ASN B ND2   1 
ATOM   4355 N N     . ARG D 3 67  ? 38.203  26.895 88.551  1.00 33.23  ? 61  ARG B N     1 
ATOM   4356 C CA    . ARG D 3 67  ? 38.205  28.330 88.848  1.00 30.70  ? 61  ARG B CA    1 
ATOM   4357 C C     . ARG D 3 67  ? 38.245  29.171 87.555  1.00 39.25  ? 61  ARG B C     1 
ATOM   4358 O O     . ARG D 3 67  ? 38.856  28.785 86.556  1.00 42.64  ? 61  ARG B O     1 
ATOM   4359 C CB    . ARG D 3 67  ? 39.359  28.722 89.777  1.00 19.37  ? 61  ARG B CB    1 
ATOM   4360 C CG    . ARG D 3 67  ? 39.651  27.755 90.912  1.00 22.56  ? 61  ARG B CG    1 
ATOM   4361 C CD    . ARG D 3 67  ? 38.529  27.699 91.945  1.00 32.69  ? 61  ARG B CD    1 
ATOM   4362 N NE    . ARG D 3 67  ? 38.288  28.955 92.663  1.00 34.73  ? 61  ARG B NE    1 
ATOM   4363 C CZ    . ARG D 3 67  ? 37.432  29.074 93.677  1.00 41.99  ? 61  ARG B CZ    1 
ATOM   4364 N NH1   . ARG D 3 67  ? 36.752  28.029 94.108  1.00 40.33  ? 61  ARG B NH1   1 
ATOM   4365 N NH2   . ARG D 3 67  ? 37.264  30.236 94.277  1.00 29.25  ? 61  ARG B NH2   1 
ATOM   4366 N N     . LYS D 3 68  ? 37.587  30.321 87.579  1.00 35.65  ? 62  LYS B N     1 
ATOM   4367 C CA    . LYS D 3 68  ? 37.558  31.213 86.425  1.00 35.85  ? 62  LYS B CA    1 
ATOM   4368 C C     . LYS D 3 68  ? 38.903  31.908 86.375  1.00 45.32  ? 62  LYS B C     1 
ATOM   4369 O O     . LYS D 3 68  ? 39.281  32.586 87.323  1.00 48.57  ? 62  LYS B O     1 
ATOM   4370 C CB    . LYS D 3 68  ? 36.434  32.249 86.586  1.00 35.96  ? 62  LYS B CB    1 
ATOM   4371 C CG    . LYS D 3 68  ? 36.321  33.256 85.449  1.00 56.24  ? 62  LYS B CG    1 
ATOM   4372 C CD    . LYS D 3 68  ? 34.885  33.761 85.276  1.00 66.17  ? 62  LYS B CD    1 
ATOM   4373 C CE    . LYS D 3 68  ? 34.648  35.063 86.046  1.00 75.13  ? 62  LYS B CE    1 
ATOM   4374 N NZ    . LYS D 3 68  ? 34.080  36.146 85.185  1.00 78.67  ? 62  LYS B NZ    1 
ATOM   4375 N N     . TRP D 3 69  ? 39.637  31.716 85.284  1.00 43.33  ? 63  TRP B N     1 
ATOM   4376 C CA    . TRP D 3 69  ? 40.972  32.292 85.142  1.00 42.98  ? 63  TRP B CA    1 
ATOM   4377 C C     . TRP D 3 69  ? 41.055  33.771 84.871  1.00 39.34  ? 63  TRP B C     1 
ATOM   4378 O O     . TRP D 3 69  ? 42.130  34.354 85.002  1.00 40.44  ? 63  TRP B O     1 
ATOM   4379 C CB    . TRP D 3 69  ? 41.827  31.512 84.139  1.00 44.76  ? 63  TRP B CB    1 
ATOM   4380 C CG    . TRP D 3 69  ? 41.680  31.949 82.694  1.00 48.15  ? 63  TRP B CG    1 
ATOM   4381 C CD1   . TRP D 3 69  ? 40.786  31.465 81.773  1.00 51.45  ? 63  TRP B CD1   1 
ATOM   4382 C CD2   . TRP D 3 69  ? 42.510  32.889 81.985  1.00 48.48  ? 63  TRP B CD2   1 
ATOM   4383 N NE1   . TRP D 3 69  ? 40.984  32.077 80.558  1.00 51.45  ? 63  TRP B NE1   1 
ATOM   4384 C CE2   . TRP D 3 69  ? 42.046  32.940 80.655  1.00 52.69  ? 63  TRP B CE2   1 
ATOM   4385 C CE3   . TRP D 3 69  ? 43.599  33.688 82.346  1.00 49.35  ? 63  TRP B CE3   1 
ATOM   4386 C CZ2   . TRP D 3 69  ? 42.608  33.786 79.700  1.00 51.30  ? 63  TRP B CZ2   1 
ATOM   4387 C CZ3   . TRP D 3 69  ? 44.168  34.504 81.386  1.00 50.30  ? 63  TRP B CZ3   1 
ATOM   4388 C CH2   . TRP D 3 69  ? 43.674  34.544 80.080  1.00 50.61  ? 63  TRP B CH2   1 
ATOM   4389 N N     . PHE D 3 70  ? 39.940  34.390 84.508  1.00 34.17  ? 64  PHE B N     1 
ATOM   4390 C CA    . PHE D 3 70  ? 39.951  35.834 84.233  1.00 33.28  ? 64  PHE B CA    1 
ATOM   4391 C C     . PHE D 3 70  ? 38.550  36.386 84.166  1.00 36.24  ? 64  PHE B C     1 
ATOM   4392 O O     . PHE D 3 70  ? 37.730  35.837 83.451  1.00 41.49  ? 64  PHE B O     1 
ATOM   4393 C CB    . PHE D 3 70  ? 40.640  36.112 82.896  1.00 34.92  ? 64  PHE B CB    1 
ATOM   4394 C CG    . PHE D 3 70  ? 40.751  37.571 82.561  1.00 36.04  ? 64  PHE B CG    1 
ATOM   4395 C CD1   . PHE D 3 70  ? 41.792  38.334 83.069  1.00 40.10  ? 64  PHE B CD1   1 
ATOM   4396 C CD2   . PHE D 3 70  ? 39.832  38.180 81.735  1.00 37.22  ? 64  PHE B CD2   1 
ATOM   4397 C CE1   . PHE D 3 70  ? 41.906  39.683 82.769  1.00 40.15  ? 64  PHE B CE1   1 
ATOM   4398 C CE2   . PHE D 3 70  ? 39.947  39.531 81.422  1.00 39.93  ? 64  PHE B CE2   1 
ATOM   4399 C CZ    . PHE D 3 70  ? 40.983  40.283 81.942  1.00 37.34  ? 64  PHE B CZ    1 
ATOM   4400 N N     . PRO D 3 71  ? 38.277  37.484 84.872  1.00 28.01  ? 65  PRO B N     1 
ATOM   4401 C CA    . PRO D 3 71  ? 39.246  38.134 85.745  1.00 25.64  ? 65  PRO B CA    1 
ATOM   4402 C C     . PRO D 3 71  ? 39.607  37.231 86.899  1.00 32.41  ? 65  PRO B C     1 
ATOM   4403 O O     . PRO D 3 71  ? 38.825  36.361 87.306  1.00 34.92  ? 65  PRO B O     1 
ATOM   4404 C CB    . PRO D 3 71  ? 38.487  39.352 86.247  1.00 24.79  ? 65  PRO B CB    1 
ATOM   4405 C CG    . PRO D 3 71  ? 37.643  39.741 85.065  1.00 29.75  ? 65  PRO B CG    1 
ATOM   4406 C CD    . PRO D 3 71  ? 37.419  38.479 84.213  1.00 26.58  ? 65  PRO B CD    1 
ATOM   4407 N N     . ALA D 3 72  ? 40.821  37.416 87.395  1.00 26.18  ? 66  ALA B N     1 
ATOM   4408 C CA    . ALA D 3 72  ? 41.339  36.583 88.455  1.00 25.49  ? 66  ALA B CA    1 
ATOM   4409 C C     . ALA D 3 72  ? 40.905  37.066 89.829  1.00 29.96  ? 66  ALA B C     1 
ATOM   4410 O O     . ALA D 3 72  ? 40.771  38.263 90.058  1.00 32.08  ? 66  ALA B O     1 
ATOM   4411 C CB    . ALA D 3 72  ? 42.849  36.515 88.359  1.00 26.85  ? 66  ALA B CB    1 
ATOM   4412 N N     . GLU D 3 73  ? 40.686  36.121 90.740  1.00 25.66  ? 67  GLU B N     1 
ATOM   4413 C CA    . GLU D 3 73  ? 40.307  36.449 92.106  1.00 24.84  ? 67  GLU B CA    1 
ATOM   4414 C C     . GLU D 3 73  ? 41.548  36.312 92.966  1.00 28.97  ? 67  GLU B C     1 
ATOM   4415 O O     . GLU D 3 73  ? 42.179  35.252 92.993  1.00 23.50  ? 67  GLU B O     1 
ATOM   4416 C CB    . GLU D 3 73  ? 39.248  35.492 92.659  1.00 25.82  ? 67  GLU B CB    1 
ATOM   4417 C CG    . GLU D 3 73  ? 37.914  35.502 91.937  1.00 36.78  ? 67  GLU B CG    1 
ATOM   4418 C CD    . GLU D 3 73  ? 37.074  36.710 92.252  1.00 61.59  ? 67  GLU B CD    1 
ATOM   4419 O OE1   . GLU D 3 73  ? 37.342  37.384 93.269  1.00 63.38  ? 67  GLU B OE1   1 
ATOM   4420 O OE2   . GLU D 3 73  ? 36.134  36.977 91.480  1.00 68.56  ? 67  GLU B OE2   1 
ATOM   4421 N N     . PRO D 3 74  ? 41.862  37.388 93.686  1.00 27.81  ? 68  PRO B N     1 
ATOM   4422 C CA    . PRO D 3 74  ? 43.002  37.448 94.599  1.00 25.46  ? 68  PRO B CA    1 
ATOM   4423 C C     . PRO D 3 74  ? 43.159  36.149 95.338  1.00 29.22  ? 68  PRO B C     1 
ATOM   4424 O O     . PRO D 3 74  ? 44.233  35.567 95.342  1.00 35.38  ? 68  PRO B O     1 
ATOM   4425 C CB    . PRO D 3 74  ? 42.584  38.531 95.585  1.00 27.48  ? 68  PRO B CB    1 
ATOM   4426 C CG    . PRO D 3 74  ? 41.753  39.473 94.757  1.00 31.63  ? 68  PRO B CG    1 
ATOM   4427 C CD    . PRO D 3 74  ? 41.080  38.641 93.685  1.00 26.74  ? 68  PRO B CD    1 
ATOM   4428 N N     . GLU D 3 75  ? 42.086  35.687 95.964  1.00 21.94  ? 69  GLU B N     1 
ATOM   4429 C CA    . GLU D 3 75  ? 42.124  34.424 96.699  1.00 20.03  ? 69  GLU B CA    1 
ATOM   4430 C C     . GLU D 3 75  ? 42.620  33.271 95.812  1.00 24.00  ? 69  GLU B C     1 
ATOM   4431 O O     . GLU D 3 75  ? 43.427  32.435 96.234  1.00 25.21  ? 69  GLU B O     1 
ATOM   4432 C CB    . GLU D 3 75  ? 40.751  34.099 97.314  1.00 20.40  ? 69  GLU B CB    1 
ATOM   4433 C CG    . GLU D 3 75  ? 40.326  34.996 98.485  1.00 20.95  ? 69  GLU B CG    1 
ATOM   4434 C CD    . GLU D 3 75  ? 41.185  34.807 99.734  1.00 37.94  ? 69  GLU B CD    1 
ATOM   4435 O OE1   . GLU D 3 75  ? 41.599  33.662 100.014 1.00 29.46  ? 69  GLU B OE1   1 
ATOM   4436 O OE2   . GLU D 3 75  ? 41.453  35.805 100.435 1.00 21.80  ? 69  GLU B OE2   1 
ATOM   4437 N N     . ASP D 3 76  ? 42.156  33.233 94.572  1.00 21.83  ? 70  ASP B N     1 
ATOM   4438 C CA    . ASP D 3 76  ? 42.584  32.174 93.665  1.00 23.38  ? 70  ASP B CA    1 
ATOM   4439 C C     . ASP D 3 76  ? 44.058  32.338 93.279  1.00 25.77  ? 70  ASP B C     1 
ATOM   4440 O O     . ASP D 3 76  ? 44.780  31.356 93.158  1.00 23.29  ? 70  ASP B O     1 
ATOM   4441 C CB    . ASP D 3 76  ? 41.686  32.122 92.417  1.00 25.93  ? 70  ASP B CB    1 
ATOM   4442 C CG    . ASP D 3 76  ? 40.324  31.479 92.691  1.00 34.92  ? 70  ASP B CG    1 
ATOM   4443 O OD1   . ASP D 3 76  ? 40.106  30.934 93.801  1.00 34.22  ? 70  ASP B OD1   1 
ATOM   4444 O OD2   . ASP D 3 76  ? 39.464  31.525 91.789  1.00 46.30  ? 70  ASP B OD2   1 
ATOM   4445 N N     . VAL D 3 77  ? 44.505  33.585 93.111  1.00 23.48  ? 71  VAL B N     1 
ATOM   4446 C CA    . VAL D 3 77  ? 45.891  33.877 92.741  1.00 22.56  ? 71  VAL B CA    1 
ATOM   4447 C C     . VAL D 3 77  ? 46.824  33.532 93.872  1.00 26.46  ? 71  VAL B C     1 
ATOM   4448 O O     . VAL D 3 77  ? 47.918  33.034 93.651  1.00 25.65  ? 71  VAL B O     1 
ATOM   4449 C CB    . VAL D 3 77  ? 46.114  35.359 92.411  1.00 26.77  ? 71  VAL B CB    1 
ATOM   4450 C CG1   . VAL D 3 77  ? 47.609  35.593 92.187  1.00 26.77  ? 71  VAL B CG1   1 
ATOM   4451 C CG2   . VAL D 3 77  ? 45.290  35.787 91.169  1.00 25.50  ? 71  VAL B CG2   1 
ATOM   4452 N N     . ARG D 3 78  ? 46.371  33.808 95.092  1.00 27.07  ? 72  ARG B N     1 
ATOM   4453 C CA    . ARG D 3 78  ? 47.110  33.497 96.315  1.00 26.87  ? 72  ARG B CA    1 
ATOM   4454 C C     . ARG D 3 78  ? 47.339  31.993 96.388  1.00 33.06  ? 72  ARG B C     1 
ATOM   4455 O O     . ARG D 3 78  ? 48.447  31.516 96.679  1.00 33.70  ? 72  ARG B O     1 
ATOM   4456 C CB    . ARG D 3 78  ? 46.292  33.924 97.528  1.00 25.84  ? 72  ARG B CB    1 
ATOM   4457 C CG    . ARG D 3 78  ? 47.088  33.922 98.816  1.00 31.28  ? 72  ARG B CG    1 
ATOM   4458 C CD    . ARG D 3 78  ? 46.199  34.126 100.030 1.00 36.10  ? 72  ARG B CD    1 
ATOM   4459 N NE    . ARG D 3 78  ? 46.940  33.853 101.259 1.00 31.07  ? 72  ARG B NE    1 
ATOM   4460 C CZ    . ARG D 3 78  ? 46.971  32.676 101.870 1.00 38.34  ? 72  ARG B CZ    1 
ATOM   4461 N NH1   . ARG D 3 78  ? 46.272  31.659 101.394 1.00 33.03  ? 72  ARG B NH1   1 
ATOM   4462 N NH2   . ARG D 3 78  ? 47.691  32.523 102.969 1.00 28.42  ? 72  ARG B NH2   1 
ATOM   4463 N N     . ASP D 3 79  ? 46.276  31.245 96.120  1.00 28.61  ? 73  ASP B N     1 
ATOM   4464 C CA    . ASP D 3 79  ? 46.375  29.800 96.113  1.00 28.94  ? 73  ASP B CA    1 
ATOM   4465 C C     . ASP D 3 79  ? 47.398  29.370 95.057  1.00 33.26  ? 73  ASP B C     1 
ATOM   4466 O O     . ASP D 3 79  ? 48.201  28.468 95.290  1.00 34.66  ? 73  ASP B O     1 
ATOM   4467 C CB    . ASP D 3 79  ? 44.999  29.189 95.832  1.00 31.67  ? 73  ASP B CB    1 
ATOM   4468 C CG    . ASP D 3 79  ? 44.089  29.239 97.042  1.00 50.45  ? 73  ASP B CG    1 
ATOM   4469 O OD1   . ASP D 3 79  ? 44.547  29.708 98.105  1.00 53.25  ? 73  ASP B OD1   1 
ATOM   4470 O OD2   . ASP D 3 79  ? 42.931  28.783 96.942  1.00 60.52  ? 73  ASP B OD2   1 
ATOM   4471 N N     . TYR D 3 80  ? 47.381  30.055 93.913  1.00 29.17  ? 74  TYR B N     1 
ATOM   4472 C CA    . TYR D 3 80  ? 48.283  29.776 92.792  1.00 26.39  ? 74  TYR B CA    1 
ATOM   4473 C C     . TYR D 3 80  ? 49.748  30.009 93.132  1.00 30.08  ? 74  TYR B C     1 
ATOM   4474 O O     . TYR D 3 80  ? 50.587  29.163 92.827  1.00 29.92  ? 74  TYR B O     1 
ATOM   4475 C CB    . TYR D 3 80  ? 47.899  30.611 91.568  1.00 25.34  ? 74  TYR B CB    1 
ATOM   4476 C CG    . TYR D 3 80  ? 48.784  30.371 90.359  1.00 24.58  ? 74  TYR B CG    1 
ATOM   4477 C CD1   . TYR D 3 80  ? 48.929  29.091 89.826  1.00 25.89  ? 74  TYR B CD1   1 
ATOM   4478 C CD2   . TYR D 3 80  ? 49.468  31.420 89.744  1.00 22.35  ? 74  TYR B CD2   1 
ATOM   4479 C CE1   . TYR D 3 80  ? 49.740  28.858 88.727  1.00 18.15  ? 74  TYR B CE1   1 
ATOM   4480 C CE2   . TYR D 3 80  ? 50.281  31.186 88.648  1.00 20.95  ? 74  TYR B CE2   1 
ATOM   4481 C CZ    . TYR D 3 80  ? 50.412  29.903 88.158  1.00 18.41  ? 74  TYR B CZ    1 
ATOM   4482 O OH    . TYR D 3 80  ? 51.213  29.664 87.083  1.00 26.80  ? 74  TYR B OH    1 
ATOM   4483 N N     . LEU D 3 81  ? 50.051  31.153 93.755  1.00 23.53  ? 75  LEU B N     1 
ATOM   4484 C CA    . LEU D 3 81  ? 51.425  31.473 94.147  1.00 21.61  ? 75  LEU B CA    1 
ATOM   4485 C C     . LEU D 3 81  ? 51.925  30.424 95.128  1.00 30.64  ? 75  LEU B C     1 
ATOM   4486 O O     . LEU D 3 81  ? 53.005  29.854 94.965  1.00 31.87  ? 75  LEU B O     1 
ATOM   4487 C CB    . LEU D 3 81  ? 51.492  32.844 94.808  1.00 19.54  ? 75  LEU B CB    1 
ATOM   4488 C CG    . LEU D 3 81  ? 50.928  33.998 93.993  1.00 20.82  ? 75  LEU B CG    1 
ATOM   4489 C CD1   . LEU D 3 81  ? 51.133  35.289 94.743  1.00 20.95  ? 75  LEU B CD1   1 
ATOM   4490 C CD2   . LEU D 3 81  ? 51.554  34.058 92.618  1.00 18.31  ? 75  LEU B CD2   1 
ATOM   4491 N N     . LEU D 3 82  ? 51.126  30.162 96.153  1.00 30.22  ? 76  LEU B N     1 
ATOM   4492 C CA    . LEU D 3 82  ? 51.504  29.156 97.138  1.00 30.24  ? 76  LEU B CA    1 
ATOM   4493 C C     . LEU D 3 82  ? 51.757  27.829 96.440  1.00 36.50  ? 76  LEU B C     1 
ATOM   4494 O O     . LEU D 3 82  ? 52.677  27.097 96.783  1.00 40.22  ? 76  LEU B O     1 
ATOM   4495 C CB    . LEU D 3 82  ? 50.428  29.008 98.211  1.00 29.39  ? 76  LEU B CB    1 
ATOM   4496 C CG    . LEU D 3 82  ? 50.293  30.184 99.182  1.00 30.98  ? 76  LEU B CG    1 
ATOM   4497 C CD1   . LEU D 3 82  ? 48.971  30.098 99.930  1.00 28.90  ? 76  LEU B CD1   1 
ATOM   4498 C CD2   . LEU D 3 82  ? 51.490  30.273 100.125 1.00 24.65  ? 76  LEU B CD2   1 
ATOM   4499 N N     . TYR D 3 83  ? 50.938  27.527 95.447  1.00 31.74  ? 77  TYR B N     1 
ATOM   4500 C CA    . TYR D 3 83  ? 51.096  26.300 94.681  1.00 30.38  ? 77  TYR B CA    1 
ATOM   4501 C C     . TYR D 3 83  ? 52.470  26.322 93.987  1.00 32.12  ? 77  TYR B C     1 
ATOM   4502 O O     . TYR D 3 83  ? 53.210  25.336 93.999  1.00 31.66  ? 77  TYR B O     1 
ATOM   4503 C CB    . TYR D 3 83  ? 49.972  26.219 93.646  1.00 30.54  ? 77  TYR B CB    1 
ATOM   4504 C CG    . TYR D 3 83  ? 50.225  25.275 92.499  1.00 30.14  ? 77  TYR B CG    1 
ATOM   4505 C CD1   . TYR D 3 83  ? 50.120  23.911 92.671  1.00 31.61  ? 77  TYR B CD1   1 
ATOM   4506 C CD2   . TYR D 3 83  ? 50.530  25.754 91.239  1.00 29.31  ? 77  TYR B CD2   1 
ATOM   4507 C CE1   . TYR D 3 83  ? 50.323  23.052 91.629  1.00 32.62  ? 77  TYR B CE1   1 
ATOM   4508 C CE2   . TYR D 3 83  ? 50.746  24.898 90.195  1.00 29.13  ? 77  TYR B CE2   1 
ATOM   4509 C CZ    . TYR D 3 83  ? 50.663  23.546 90.398  1.00 38.46  ? 77  TYR B CZ    1 
ATOM   4510 O OH    . TYR D 3 83  ? 50.855  22.663 89.365  1.00 48.25  ? 77  TYR B OH    1 
ATOM   4511 N N     . LEU D 3 84  ? 52.802  27.458 93.381  1.00 23.24  ? 78  LEU B N     1 
ATOM   4512 C CA    . LEU D 3 84  ? 54.080  27.613 92.706  1.00 19.70  ? 78  LEU B CA    1 
ATOM   4513 C C     . LEU D 3 84  ? 55.167  27.349 93.725  1.00 29.74  ? 78  LEU B C     1 
ATOM   4514 O O     . LEU D 3 84  ? 56.065  26.545 93.489  1.00 30.31  ? 78  LEU B O     1 
ATOM   4515 C CB    . LEU D 3 84  ? 54.236  29.029 92.147  1.00 16.83  ? 78  LEU B CB    1 
ATOM   4516 C CG    . LEU D 3 84  ? 53.356  29.354 90.951  1.00 15.72  ? 78  LEU B CG    1 
ATOM   4517 C CD1   . LEU D 3 84  ? 53.707  30.689 90.362  1.00 11.92  ? 78  LEU B CD1   1 
ATOM   4518 C CD2   . LEU D 3 84  ? 53.519  28.251 89.942  1.00 14.19  ? 78  LEU B CD2   1 
ATOM   4519 N N     . GLN D 3 85  ? 55.068  28.008 94.876  1.00 28.96  ? 79  GLN B N     1 
ATOM   4520 C CA    . GLN D 3 85  ? 56.053  27.802 95.935  1.00 29.13  ? 79  GLN B CA    1 
ATOM   4521 C C     . GLN D 3 85  ? 56.196  26.321 96.310  1.00 37.32  ? 79  GLN B C     1 
ATOM   4522 O O     . GLN D 3 85  ? 57.310  25.807 96.420  1.00 39.66  ? 79  GLN B O     1 
ATOM   4523 C CB    . GLN D 3 85  ? 55.721  28.622 97.171  1.00 29.63  ? 79  GLN B CB    1 
ATOM   4524 C CG    . GLN D 3 85  ? 56.701  28.380 98.308  1.00 37.61  ? 79  GLN B CG    1 
ATOM   4525 C CD    . GLN D 3 85  ? 56.328  29.115 99.578  1.00 53.38  ? 79  GLN B CD    1 
ATOM   4526 O OE1   . GLN D 3 85  ? 55.218  28.968 100.090 1.00 54.74  ? 79  GLN B OE1   1 
ATOM   4527 N NE2   . GLN D 3 85  ? 57.265  29.897 100.109 1.00 40.16  ? 79  GLN B NE2   1 
ATOM   4528 N N     . ALA D 3 86  ? 55.071  25.635 96.489  1.00 34.58  ? 80  ALA B N     1 
ATOM   4529 C CA    . ALA D 3 86  ? 55.093  24.214 96.809  1.00 33.69  ? 80  ALA B CA    1 
ATOM   4530 C C     . ALA D 3 86  ? 55.786  23.420 95.725  1.00 35.70  ? 80  ALA B C     1 
ATOM   4531 O O     . ALA D 3 86  ? 56.310  22.354 95.999  1.00 37.40  ? 80  ALA B O     1 
ATOM   4532 C CB    . ALA D 3 86  ? 53.698  23.683 97.008  1.00 34.81  ? 80  ALA B CB    1 
ATOM   4533 N N     . ARG D 3 87  ? 55.771  23.920 94.495  1.00 33.12  ? 81  ARG B N     1 
ATOM   4534 C CA    . ARG D 3 87  ? 56.422  23.210 93.390  1.00 32.68  ? 81  ARG B CA    1 
ATOM   4535 C C     . ARG D 3 87  ? 57.930  23.348 93.542  1.00 37.49  ? 81  ARG B C     1 
ATOM   4536 O O     . ARG D 3 87  ? 58.690  22.663 92.873  1.00 42.43  ? 81  ARG B O     1 
ATOM   4537 C CB    . ARG D 3 87  ? 55.960  23.738 92.019  1.00 29.55  ? 81  ARG B CB    1 
ATOM   4538 C CG    . ARG D 3 87  ? 54.511  23.423 91.691  1.00 29.74  ? 81  ARG B CG    1 
ATOM   4539 C CD    . ARG D 3 87  ? 54.274  23.373 90.195  1.00 34.65  ? 81  ARG B CD    1 
ATOM   4540 N NE    . ARG D 3 87  ? 55.451  22.882 89.496  1.00 53.84  ? 81  ARG B NE    1 
ATOM   4541 C CZ    . ARG D 3 87  ? 56.012  23.500 88.466  1.00 60.45  ? 81  ARG B CZ    1 
ATOM   4542 N NH1   . ARG D 3 87  ? 55.499  24.642 88.026  1.00 38.11  ? 81  ARG B NH1   1 
ATOM   4543 N NH2   . ARG D 3 87  ? 57.096  22.995 87.892  1.00 48.99  ? 81  ARG B NH2   1 
ATOM   4544 N N     . GLY D 3 88  ? 58.354  24.221 94.448  1.00 29.90  ? 82  GLY B N     1 
ATOM   4545 C CA    . GLY D 3 88  ? 59.766  24.419 94.710  1.00 28.62  ? 82  GLY B CA    1 
ATOM   4546 C C     . GLY D 3 88  ? 60.415  25.323 93.678  1.00 35.59  ? 82  GLY B C     1 
ATOM   4547 O O     . GLY D 3 88  ? 61.595  25.169 93.358  1.00 39.66  ? 82  GLY B O     1 
ATOM   4548 N N     . LEU D 3 89  ? 59.652  26.279 93.167  1.00 29.94  ? 83  LEU B N     1 
ATOM   4549 C CA    . LEU D 3 89  ? 60.183  27.214 92.184  1.00 29.51  ? 83  LEU B CA    1 
ATOM   4550 C C     . LEU D 3 89  ? 60.792  28.420 92.886  1.00 30.64  ? 83  LEU B C     1 
ATOM   4551 O O     . LEU D 3 89  ? 60.491  28.712 94.037  1.00 29.53  ? 83  LEU B O     1 
ATOM   4552 C CB    . LEU D 3 89  ? 59.096  27.681 91.207  1.00 29.95  ? 83  LEU B CB    1 
ATOM   4553 C CG    . LEU D 3 89  ? 58.318  26.642 90.400  1.00 34.73  ? 83  LEU B CG    1 
ATOM   4554 C CD1   . LEU D 3 89  ? 57.241  27.344 89.603  1.00 35.71  ? 83  LEU B CD1   1 
ATOM   4555 C CD2   . LEU D 3 89  ? 59.248  25.890 89.476  1.00 34.35  ? 83  LEU B CD2   1 
ATOM   4556 N N     . ALA D 3 90  ? 61.626  29.141 92.158  1.00 26.93  ? 84  ALA B N     1 
ATOM   4557 C CA    . ALA D 3 90  ? 62.296  30.306 92.689  1.00 27.61  ? 84  ALA B CA    1 
ATOM   4558 C C     . ALA D 3 90  ? 61.367  31.498 92.931  1.00 35.56  ? 84  ALA B C     1 
ATOM   4559 O O     . ALA D 3 90  ? 60.426  31.720 92.180  1.00 39.92  ? 84  ALA B O     1 
ATOM   4560 C CB    . ALA D 3 90  ? 63.407  30.698 91.736  1.00 28.25  ? 84  ALA B CB    1 
ATOM   4561 N N     . VAL D 3 91  ? 61.688  32.299 93.944  1.00 30.06  ? 85  VAL B N     1 
ATOM   4562 C CA    . VAL D 3 91  ? 60.933  33.508 94.280  1.00 26.98  ? 85  VAL B CA    1 
ATOM   4563 C C     . VAL D 3 91  ? 60.791  34.403 93.043  1.00 32.84  ? 85  VAL B C     1 
ATOM   4564 O O     . VAL D 3 91  ? 59.726  34.951 92.781  1.00 34.79  ? 85  VAL B O     1 
ATOM   4565 C CB    . VAL D 3 91  ? 61.633  34.276 95.436  1.00 27.95  ? 85  VAL B CB    1 
ATOM   4566 C CG1   . VAL D 3 91  ? 61.112  35.696 95.561  1.00 27.84  ? 85  VAL B CG1   1 
ATOM   4567 C CG2   . VAL D 3 91  ? 61.495  33.520 96.753  1.00 26.58  ? 85  VAL B CG2   1 
ATOM   4568 N N     . LYS D 3 92  ? 61.862  34.516 92.268  1.00 28.27  ? 86  LYS B N     1 
ATOM   4569 C CA    . LYS D 3 92  ? 61.851  35.307 91.042  1.00 26.29  ? 86  LYS B CA    1 
ATOM   4570 C C     . LYS D 3 92  ? 60.861  34.724 90.029  1.00 27.91  ? 86  LYS B C     1 
ATOM   4571 O O     . LYS D 3 92  ? 60.219  35.471 89.280  1.00 27.22  ? 86  LYS B O     1 
ATOM   4572 C CB    . LYS D 3 92  ? 63.257  35.360 90.428  1.00 28.82  ? 86  LYS B CB    1 
ATOM   4573 C CG    . LYS D 3 92  ? 64.255  36.243 91.171  1.00 26.02  ? 86  LYS B CG    1 
ATOM   4574 C CD    . LYS D 3 92  ? 64.093  37.689 90.761  1.00 40.04  ? 86  LYS B CD    1 
ATOM   4575 C CE    . LYS D 3 92  ? 65.383  38.310 90.273  1.00 52.96  ? 86  LYS B CE    1 
ATOM   4576 N NZ    . LYS D 3 92  ? 65.105  39.640 89.648  1.00 60.62  ? 86  LYS B NZ    1 
ATOM   4577 N N     . THR D 3 93  ? 60.751  33.399 89.970  1.00 22.65  ? 87  THR B N     1 
ATOM   4578 C CA    . THR D 3 93  ? 59.800  32.818 89.033  1.00 23.43  ? 87  THR B CA    1 
ATOM   4579 C C     . THR D 3 93  ? 58.376  33.104 89.528  1.00 31.58  ? 87  THR B C     1 
ATOM   4580 O O     . THR D 3 93  ? 57.559  33.666 88.805  1.00 32.86  ? 87  THR B O     1 
ATOM   4581 C CB    . THR D 3 93  ? 60.112  31.338 88.710  1.00 29.01  ? 87  THR B CB    1 
ATOM   4582 O OG1   . THR D 3 93  ? 58.953  30.515 88.894  1.00 33.19  ? 87  THR B OG1   1 
ATOM   4583 C CG2   . THR D 3 93  ? 61.230  30.862 89.584  1.00 25.87  ? 87  THR B CG2   1 
ATOM   4584 N N     . ILE D 3 94  ? 58.116  32.827 90.798  1.00 29.57  ? 88  ILE B N     1 
ATOM   4585 C CA    . ILE D 3 94  ? 56.819  33.131 91.374  1.00 28.69  ? 88  ILE B CA    1 
ATOM   4586 C C     . ILE D 3 94  ? 56.479  34.597 91.100  1.00 31.38  ? 88  ILE B C     1 
ATOM   4587 O O     . ILE D 3 94  ? 55.403  34.923 90.600  1.00 30.42  ? 88  ILE B O     1 
ATOM   4588 C CB    . ILE D 3 94  ? 56.813  32.849 92.887  1.00 31.47  ? 88  ILE B CB    1 
ATOM   4589 C CG1   . ILE D 3 94  ? 56.716  31.339 93.117  1.00 29.71  ? 88  ILE B CG1   1 
ATOM   4590 C CG2   . ILE D 3 94  ? 55.668  33.620 93.589  1.00 32.22  ? 88  ILE B CG2   1 
ATOM   4591 C CD1   . ILE D 3 94  ? 57.559  30.833 94.238  1.00 33.79  ? 88  ILE B CD1   1 
ATOM   4592 N N     . GLN D 3 95  ? 57.409  35.493 91.389  1.00 27.88  ? 89  GLN B N     1 
ATOM   4593 C CA    . GLN D 3 95  ? 57.140  36.906 91.126  1.00 27.53  ? 89  GLN B CA    1 
ATOM   4594 C C     . GLN D 3 95  ? 56.770  37.198 89.677  1.00 29.60  ? 89  GLN B C     1 
ATOM   4595 O O     . GLN D 3 95  ? 55.993  38.116 89.432  1.00 30.31  ? 89  GLN B O     1 
ATOM   4596 C CB    . GLN D 3 95  ? 58.305  37.800 91.556  1.00 28.67  ? 89  GLN B CB    1 
ATOM   4597 C CG    . GLN D 3 95  ? 58.777  37.565 92.964  1.00 36.20  ? 89  GLN B CG    1 
ATOM   4598 C CD    . GLN D 3 95  ? 59.972  38.397 93.289  1.00 58.86  ? 89  GLN B CD    1 
ATOM   4599 O OE1   . GLN D 3 95  ? 60.877  38.559 92.465  1.00 63.84  ? 89  GLN B OE1   1 
ATOM   4600 N NE2   . GLN D 3 95  ? 59.982  38.958 94.493  1.00 50.03  ? 89  GLN B NE2   1 
ATOM   4601 N N     . GLN D 3 96  ? 57.345  36.438 88.735  1.00 24.22  ? 90  GLN B N     1 
ATOM   4602 C CA    . GLN D 3 96  ? 57.110  36.617 87.296  1.00 22.27  ? 90  GLN B CA    1 
ATOM   4603 C C     . GLN D 3 96  ? 55.684  36.247 86.939  1.00 23.72  ? 90  GLN B C     1 
ATOM   4604 O O     . GLN D 3 96  ? 55.034  36.911 86.119  1.00 21.22  ? 90  GLN B O     1 
ATOM   4605 C CB    . GLN D 3 96  ? 58.089  35.769 86.471  1.00 23.00  ? 90  GLN B CB    1 
ATOM   4606 C CG    . GLN D 3 96  ? 57.779  35.704 84.962  1.00 33.39  ? 90  GLN B CG    1 
ATOM   4607 C CD    . GLN D 3 96  ? 58.228  36.926 84.169  1.00 41.15  ? 90  GLN B CD    1 
ATOM   4608 O OE1   . GLN D 3 96  ? 59.361  37.386 84.288  1.00 48.61  ? 90  GLN B OE1   1 
ATOM   4609 N NE2   . GLN D 3 96  ? 57.351  37.415 83.315  1.00 32.32  ? 90  GLN B NE2   1 
ATOM   4610 N N     . HIS D 3 97  ? 55.202  35.187 87.576  1.00 20.32  ? 91  HIS B N     1 
ATOM   4611 C CA    . HIS D 3 97  ? 53.836  34.739 87.379  1.00 20.38  ? 91  HIS B CA    1 
ATOM   4612 C C     . HIS D 3 97  ? 52.850  35.806 87.840  1.00 30.32  ? 91  HIS B C     1 
ATOM   4613 O O     . HIS D 3 97  ? 51.883  36.088 87.133  1.00 31.65  ? 91  HIS B O     1 
ATOM   4614 C CB    . HIS D 3 97  ? 53.616  33.373 88.045  1.00 19.48  ? 91  HIS B CB    1 
ATOM   4615 C CG    . HIS D 3 97  ? 54.257  32.245 87.294  1.00 23.56  ? 91  HIS B CG    1 
ATOM   4616 N ND1   . HIS D 3 97  ? 53.551  31.147 86.849  1.00 26.07  ? 91  HIS B ND1   1 
ATOM   4617 C CD2   . HIS D 3 97  ? 55.522  32.085 86.835  1.00 24.36  ? 91  HIS B CD2   1 
ATOM   4618 C CE1   . HIS D 3 97  ? 54.364  30.336 86.195  1.00 23.78  ? 91  HIS B CE1   1 
ATOM   4619 N NE2   . HIS D 3 97  ? 55.566  30.883 86.170  1.00 23.82  ? 91  HIS B NE2   1 
ATOM   4620 N N     . LEU D 3 98  ? 53.154  36.446 88.975  1.00 27.28  ? 92  LEU B N     1 
ATOM   4621 C CA    . LEU D 3 98  ? 52.350  37.531 89.536  1.00 27.47  ? 92  LEU B CA    1 
ATOM   4622 C C     . LEU D 3 98  ? 52.428  38.775 88.660  1.00 34.45  ? 92  LEU B C     1 
ATOM   4623 O O     . LEU D 3 98  ? 51.457  39.517 88.515  1.00 38.18  ? 92  LEU B O     1 
ATOM   4624 C CB    . LEU D 3 98  ? 52.901  37.900 90.912  1.00 29.71  ? 92  LEU B CB    1 
ATOM   4625 C CG    . LEU D 3 98  ? 51.958  38.352 92.037  1.00 35.36  ? 92  LEU B CG    1 
ATOM   4626 C CD1   . LEU D 3 98  ? 52.737  38.734 93.310  1.00 31.85  ? 92  LEU B CD1   1 
ATOM   4627 C CD2   . LEU D 3 98  ? 51.023  39.461 91.578  1.00 38.58  ? 92  LEU B CD2   1 
ATOM   4628 N N     . GLY D 3 99  ? 53.605  39.023 88.102  1.00 30.36  ? 93  GLY B N     1 
ATOM   4629 C CA    . GLY D 3 99  ? 53.820  40.187 87.243  1.00 28.14  ? 93  GLY B CA    1 
ATOM   4630 C C     . GLY D 3 99  ? 52.999  40.112 85.961  1.00 27.65  ? 93  GLY B C     1 
ATOM   4631 O O     . GLY D 3 99  ? 52.379  41.083 85.560  1.00 24.32  ? 93  GLY B O     1 
ATOM   4632 N N     . GLN D 3 100 ? 53.026  38.956 85.306  1.00 27.49  ? 94  GLN B N     1 
ATOM   4633 C CA    . GLN D 3 100 ? 52.271  38.750 84.071  1.00 28.77  ? 94  GLN B CA    1 
ATOM   4634 C C     . GLN D 3 100 ? 50.767  38.890 84.354  1.00 36.36  ? 94  GLN B C     1 
ATOM   4635 O O     . GLN D 3 100 ? 50.071  39.659 83.684  1.00 37.73  ? 94  GLN B O     1 
ATOM   4636 C CB    . GLN D 3 100 ? 52.594  37.374 83.468  1.00 28.86  ? 94  GLN B CB    1 
ATOM   4637 C CG    . GLN D 3 100 ? 53.966  37.309 82.824  1.00 20.98  ? 94  GLN B CG    1 
ATOM   4638 C CD    . GLN D 3 100 ? 54.244  38.494 81.924  1.00 38.54  ? 94  GLN B CD    1 
ATOM   4639 O OE1   . GLN D 3 100 ? 53.328  39.064 81.343  1.00 46.80  ? 94  GLN B OE1   1 
ATOM   4640 N NE2   . GLN D 3 100 ? 55.510  38.876 81.805  1.00 41.15  ? 94  GLN B NE2   1 
ATOM   4641 N N     . LEU D 3 101 ? 50.281  38.167 85.365  1.00 29.02  ? 95  LEU B N     1 
ATOM   4642 C CA    . LEU D 3 101 ? 48.889  38.259 85.771  1.00 27.31  ? 95  LEU B CA    1 
ATOM   4643 C C     . LEU D 3 101 ? 48.578  39.731 86.031  1.00 34.11  ? 95  LEU B C     1 
ATOM   4644 O O     . LEU D 3 101 ? 47.528  40.244 85.618  1.00 37.23  ? 95  LEU B O     1 
ATOM   4645 C CB    . LEU D 3 101 ? 48.646  37.464 87.057  1.00 26.93  ? 95  LEU B CB    1 
ATOM   4646 C CG    . LEU D 3 101 ? 48.535  35.946 86.908  1.00 32.28  ? 95  LEU B CG    1 
ATOM   4647 C CD1   . LEU D 3 101 ? 48.167  35.310 88.225  1.00 32.89  ? 95  LEU B CD1   1 
ATOM   4648 C CD2   . LEU D 3 101 ? 47.550  35.549 85.816  1.00 32.83  ? 95  LEU B CD2   1 
ATOM   4649 N N     . ASN D 3 102 ? 49.492  40.417 86.709  1.00 25.79  ? 96  ASN B N     1 
ATOM   4650 C CA    . ASN D 3 102 ? 49.285  41.821 87.003  1.00 24.79  ? 96  ASN B CA    1 
ATOM   4651 C C     . ASN D 3 102 ? 49.157  42.649 85.726  1.00 33.21  ? 96  ASN B C     1 
ATOM   4652 O O     . ASN D 3 102 ? 48.354  43.580 85.650  1.00 37.63  ? 96  ASN B O     1 
ATOM   4653 C CB    . ASN D 3 102 ? 50.421  42.367 87.863  1.00 25.52  ? 96  ASN B CB    1 
ATOM   4654 C CG    . ASN D 3 102 ? 50.229  42.093 89.352  1.00 37.09  ? 96  ASN B CG    1 
ATOM   4655 O OD1   . ASN D 3 102 ? 49.143  41.745 89.806  1.00 35.55  ? 96  ASN B OD1   1 
ATOM   4656 N ND2   . ASN D 3 102 ? 51.295  42.272 90.117  1.00 26.27  ? 96  ASN B ND2   1 
ATOM   4657 N N     . MET D 3 103 ? 49.966  42.323 84.730  1.00 30.76  ? 97  MET B N     1 
ATOM   4658 C CA    . MET D 3 103 ? 49.955  43.058 83.472  1.00 30.93  ? 97  MET B CA    1 
ATOM   4659 C C     . MET D 3 103 ? 48.653  42.832 82.745  1.00 31.93  ? 97  MET B C     1 
ATOM   4660 O O     . MET D 3 103 ? 48.018  43.786 82.297  1.00 33.70  ? 97  MET B O     1 
ATOM   4661 C CB    . MET D 3 103 ? 51.136  42.642 82.593  1.00 34.49  ? 97  MET B CB    1 
ATOM   4662 C CG    . MET D 3 103 ? 51.698  43.770 81.732  1.00 39.55  ? 97  MET B CG    1 
ATOM   4663 S SD    . MET D 3 103 ? 52.440  43.173 80.197  1.00 44.33  ? 97  MET B SD    1 
ATOM   4664 C CE    . MET D 3 103 ? 52.126  41.447 80.344  1.00 41.64  ? 97  MET B CE    1 
ATOM   4665 N N     . LEU D 3 104 ? 48.254  41.569 82.642  1.00 26.32  ? 98  LEU B N     1 
ATOM   4666 C CA    . LEU D 3 104 ? 47.003  41.218 81.971  1.00 27.57  ? 98  LEU B CA    1 
ATOM   4667 C C     . LEU D 3 104 ? 45.898  42.098 82.520  1.00 33.87  ? 98  LEU B C     1 
ATOM   4668 O O     . LEU D 3 104 ? 45.206  42.790 81.783  1.00 36.96  ? 98  LEU B O     1 
ATOM   4669 C CB    . LEU D 3 104 ? 46.652  39.751 82.230  1.00 26.91  ? 98  LEU B CB    1 
ATOM   4670 C CG    . LEU D 3 104 ? 45.629  39.087 81.304  1.00 30.12  ? 98  LEU B CG    1 
ATOM   4671 C CD1   . LEU D 3 104 ? 46.008  39.286 79.848  1.00 30.79  ? 98  LEU B CD1   1 
ATOM   4672 C CD2   . LEU D 3 104 ? 45.564  37.608 81.634  1.00 30.67  ? 98  LEU B CD2   1 
ATOM   4673 N N     . HIS D 3 105 ? 45.753  42.080 83.834  1.00 27.50  ? 99  HIS B N     1 
ATOM   4674 C CA    . HIS D 3 105 ? 44.735  42.875 84.477  1.00 26.36  ? 99  HIS B CA    1 
ATOM   4675 C C     . HIS D 3 105 ? 44.889  44.383 84.279  1.00 31.12  ? 99  HIS B C     1 
ATOM   4676 O O     . HIS D 3 105 ? 43.977  45.056 83.791  1.00 29.32  ? 99  HIS B O     1 
ATOM   4677 C CB    . HIS D 3 105 ? 44.642  42.469 85.940  1.00 26.40  ? 99  HIS B CB    1 
ATOM   4678 C CG    . HIS D 3 105 ? 44.090  41.096 86.118  1.00 29.19  ? 99  HIS B CG    1 
ATOM   4679 N ND1   . HIS D 3 105 ? 44.865  39.964 85.979  1.00 31.68  ? 99  HIS B ND1   1 
ATOM   4680 C CD2   . HIS D 3 105 ? 42.820  40.665 86.287  1.00 29.64  ? 99  HIS B CD2   1 
ATOM   4681 C CE1   . HIS D 3 105 ? 44.106  38.892 86.131  1.00 30.11  ? 99  HIS B CE1   1 
ATOM   4682 N NE2   . HIS D 3 105 ? 42.861  39.291 86.311  1.00 30.13  ? 99  HIS B NE2   1 
ATOM   4683 N N     . ARG D 3 106 ? 46.049  44.911 84.640  1.00 29.17  ? 100 ARG B N     1 
ATOM   4684 C CA    . ARG D 3 106 ? 46.301  46.335 84.502  1.00 29.10  ? 100 ARG B CA    1 
ATOM   4685 C C     . ARG D 3 106 ? 46.052  46.854 83.080  1.00 34.26  ? 100 ARG B C     1 
ATOM   4686 O O     . ARG D 3 106 ? 45.371  47.856 82.879  1.00 34.89  ? 100 ARG B O     1 
ATOM   4687 C CB    . ARG D 3 106 ? 47.729  46.633 84.930  1.00 28.88  ? 100 ARG B CB    1 
ATOM   4688 C CG    . ARG D 3 106 ? 47.934  48.008 85.524  1.00 36.07  ? 100 ARG B CG    1 
ATOM   4689 C CD    . ARG D 3 106 ? 49.408  48.302 85.601  1.00 66.89  ? 100 ARG B CD    1 
ATOM   4690 N NE    . ARG D 3 106 ? 49.673  49.734 85.567  1.00 84.14  ? 100 ARG B NE    1 
ATOM   4691 C CZ    . ARG D 3 106 ? 50.424  50.337 84.649  1.00 100.00 ? 100 ARG B CZ    1 
ATOM   4692 N NH1   . ARG D 3 106 ? 50.998  49.627 83.684  1.00 85.04  ? 100 ARG B NH1   1 
ATOM   4693 N NH2   . ARG D 3 106 ? 50.612  51.651 84.703  1.00 92.35  ? 100 ARG B NH2   1 
ATOM   4694 N N     . ARG D 3 107 ? 46.617  46.167 82.099  1.00 31.15  ? 101 ARG B N     1 
ATOM   4695 C CA    . ARG D 3 107 ? 46.489  46.579 80.715  1.00 30.85  ? 101 ARG B CA    1 
ATOM   4696 C C     . ARG D 3 107 ? 45.069  46.435 80.225  1.00 41.75  ? 101 ARG B C     1 
ATOM   4697 O O     . ARG D 3 107 ? 44.680  47.021 79.224  1.00 45.10  ? 101 ARG B O     1 
ATOM   4698 C CB    . ARG D 3 107 ? 47.427  45.755 79.846  1.00 30.78  ? 101 ARG B CB    1 
ATOM   4699 C CG    . ARG D 3 107 ? 48.899  46.013 80.128  1.00 44.72  ? 101 ARG B CG    1 
ATOM   4700 C CD    . ARG D 3 107 ? 49.523  46.849 79.032  1.00 36.94  ? 101 ARG B CD    1 
ATOM   4701 N NE    . ARG D 3 107 ? 50.666  47.632 79.491  1.00 30.04  ? 101 ARG B NE    1 
ATOM   4702 C CZ    . ARG D 3 107 ? 50.989  48.824 78.997  1.00 46.90  ? 101 ARG B CZ    1 
ATOM   4703 N NH1   . ARG D 3 107 ? 50.241  49.369 78.047  1.00 32.22  ? 101 ARG B NH1   1 
ATOM   4704 N NH2   . ARG D 3 107 ? 52.061  49.471 79.446  1.00 34.29  ? 101 ARG B NH2   1 
ATOM   4705 N N     . SER D 3 108 ? 44.292  45.628 80.925  1.00 40.77  ? 102 SER B N     1 
ATOM   4706 C CA    . SER D 3 108 ? 42.902  45.422 80.551  1.00 39.02  ? 102 SER B CA    1 
ATOM   4707 C C     . SER D 3 108 ? 42.053  46.569 81.102  1.00 41.52  ? 102 SER B C     1 
ATOM   4708 O O     . SER D 3 108 ? 40.941  46.800 80.655  1.00 38.42  ? 102 SER B O     1 
ATOM   4709 C CB    . SER D 3 108 ? 42.415  44.086 81.111  1.00 39.01  ? 102 SER B CB    1 
ATOM   4710 O OG    . SER D 3 108 ? 42.866  43.001 80.318  1.00 47.19  ? 102 SER B OG    1 
ATOM   4711 N N     . GLY D 3 109 ? 42.598  47.294 82.072  1.00 40.20  ? 103 GLY B N     1 
ATOM   4712 C CA    . GLY D 3 109 ? 41.874  48.381 82.698  1.00 40.60  ? 103 GLY B CA    1 
ATOM   4713 C C     . GLY D 3 109 ? 41.166  47.798 83.912  1.00 51.00  ? 103 GLY B C     1 
ATOM   4714 O O     . GLY D 3 109 ? 40.159  48.332 84.379  1.00 55.51  ? 103 GLY B O     1 
ATOM   4715 N N     . LEU D 3 110 ? 41.702  46.693 84.423  1.00 45.07  ? 104 LEU B N     1 
ATOM   4716 C CA    . LEU D 3 110 ? 41.124  46.035 85.585  1.00 42.67  ? 104 LEU B CA    1 
ATOM   4717 C C     . LEU D 3 110 ? 42.059  46.135 86.776  1.00 49.62  ? 104 LEU B C     1 
ATOM   4718 O O     . LEU D 3 110 ? 43.206  46.570 86.645  1.00 50.37  ? 104 LEU B O     1 
ATOM   4719 C CB    . LEU D 3 110 ? 40.829  44.577 85.277  1.00 41.24  ? 104 LEU B CB    1 
ATOM   4720 C CG    . LEU D 3 110 ? 39.717  44.466 84.251  1.00 45.37  ? 104 LEU B CG    1 
ATOM   4721 C CD1   . LEU D 3 110 ? 39.253  43.032 84.084  1.00 45.08  ? 104 LEU B CD1   1 
ATOM   4722 C CD2   . LEU D 3 110 ? 38.589  45.366 84.685  1.00 50.35  ? 104 LEU B CD2   1 
ATOM   4723 N N     . PRO D 3 111 ? 41.565  45.748 87.946  1.00 44.48  ? 105 PRO B N     1 
ATOM   4724 C CA    . PRO D 3 111 ? 42.375  45.801 89.141  1.00 42.46  ? 105 PRO B CA    1 
ATOM   4725 C C     . PRO D 3 111 ? 43.411  44.694 89.082  1.00 43.23  ? 105 PRO B C     1 
ATOM   4726 O O     . PRO D 3 111 ? 43.129  43.600 88.602  1.00 41.89  ? 105 PRO B O     1 
ATOM   4727 C CB    . PRO D 3 111 ? 41.357  45.529 90.243  1.00 43.14  ? 105 PRO B CB    1 
ATOM   4728 C CG    . PRO D 3 111 ? 40.131  46.148 89.747  1.00 46.70  ? 105 PRO B CG    1 
ATOM   4729 C CD    . PRO D 3 111 ? 40.143  45.973 88.251  1.00 43.29  ? 105 PRO B CD    1 
ATOM   4730 N N     . ARG D 3 112 ? 44.612  45.005 89.560  1.00 38.46  ? 106 ARG B N     1 
ATOM   4731 C CA    . ARG D 3 112 ? 45.729  44.067 89.599  1.00 36.69  ? 106 ARG B CA    1 
ATOM   4732 C C     . ARG D 3 112 ? 45.571  43.133 90.801  1.00 44.01  ? 106 ARG B C     1 
ATOM   4733 O O     . ARG D 3 112 ? 45.149  43.562 91.880  1.00 45.36  ? 106 ARG B O     1 
ATOM   4734 C CB    . ARG D 3 112 ? 47.036  44.849 89.759  1.00 29.40  ? 106 ARG B CB    1 
ATOM   4735 C CG    . ARG D 3 112 ? 47.499  45.560 88.502  1.00 33.90  ? 106 ARG B CG    1 
ATOM   4736 C CD    . ARG D 3 112 ? 48.832  46.275 88.715  1.00 42.42  ? 106 ARG B CD    1 
ATOM   4737 N NE    . ARG D 3 112 ? 49.046  46.643 90.113  1.00 39.23  ? 106 ARG B NE    1 
ATOM   4738 C CZ    . ARG D 3 112 ? 50.128  46.319 90.825  1.00 65.98  ? 106 ARG B CZ    1 
ATOM   4739 N NH1   . ARG D 3 112 ? 51.115  45.626 90.276  1.00 50.96  ? 106 ARG B NH1   1 
ATOM   4740 N NH2   . ARG D 3 112 ? 50.230  46.682 92.097  1.00 60.91  ? 106 ARG B NH2   1 
ATOM   4741 N N     . PRO D 3 113 ? 45.907  41.855 90.628  1.00 38.73  ? 107 PRO B N     1 
ATOM   4742 C CA    . PRO D 3 113 ? 45.818  40.928 91.746  1.00 37.53  ? 107 PRO B CA    1 
ATOM   4743 C C     . PRO D 3 113 ? 46.663  41.455 92.915  1.00 39.00  ? 107 PRO B C     1 
ATOM   4744 O O     . PRO D 3 113 ? 46.257  41.385 94.072  1.00 36.42  ? 107 PRO B O     1 
ATOM   4745 C CB    . PRO D 3 113 ? 46.409  39.645 91.169  1.00 38.00  ? 107 PRO B CB    1 
ATOM   4746 C CG    . PRO D 3 113 ? 46.050  39.694 89.718  1.00 39.98  ? 107 PRO B CG    1 
ATOM   4747 C CD    . PRO D 3 113 ? 45.953  41.146 89.334  1.00 36.28  ? 107 PRO B CD    1 
ATOM   4748 N N     . SER D 3 114 ? 47.829  42.010 92.607  1.00 35.28  ? 108 SER B N     1 
ATOM   4749 C CA    . SER D 3 114 ? 48.673  42.549 93.653  1.00 35.14  ? 108 SER B CA    1 
ATOM   4750 C C     . SER D 3 114 ? 47.946  43.683 94.393  1.00 41.18  ? 108 SER B C     1 
ATOM   4751 O O     . SER D 3 114 ? 48.343  44.077 95.492  1.00 41.47  ? 108 SER B O     1 
ATOM   4752 C CB    . SER D 3 114 ? 50.009  43.017 93.081  1.00 36.58  ? 108 SER B CB    1 
ATOM   4753 O OG    . SER D 3 114 ? 51.080  42.373 93.748  1.00 50.21  ? 108 SER B OG    1 
ATOM   4754 N N     . ASP D 3 115 ? 46.857  44.176 93.803  1.00 37.89  ? 109 ASP B N     1 
ATOM   4755 C CA    . ASP D 3 115 ? 46.073  45.255 94.410  1.00 34.44  ? 109 ASP B CA    1 
ATOM   4756 C C     . ASP D 3 115 ? 45.275  44.799 95.619  1.00 35.33  ? 109 ASP B C     1 
ATOM   4757 O O     . ASP D 3 115 ? 44.547  45.577 96.206  1.00 35.69  ? 109 ASP B O     1 
ATOM   4758 C CB    . ASP D 3 115 ? 45.146  45.903 93.393  1.00 33.35  ? 109 ASP B CB    1 
ATOM   4759 C CG    . ASP D 3 115 ? 45.865  46.898 92.529  1.00 41.64  ? 109 ASP B CG    1 
ATOM   4760 O OD1   . ASP D 3 115 ? 47.011  47.266 92.882  1.00 40.80  ? 109 ASP B OD1   1 
ATOM   4761 O OD2   . ASP D 3 115 ? 45.303  47.307 91.495  1.00 52.27  ? 109 ASP B OD2   1 
ATOM   4762 N N     . SER D 3 116 ? 45.428  43.542 96.000  1.00 29.85  ? 110 SER B N     1 
ATOM   4763 C CA    . SER D 3 116 ? 44.723  43.041 97.156  1.00 29.71  ? 110 SER B CA    1 
ATOM   4764 C C     . SER D 3 116 ? 45.685  42.459 98.200  1.00 36.38  ? 110 SER B C     1 
ATOM   4765 O O     . SER D 3 116 ? 46.701  41.846 97.858  1.00 38.03  ? 110 SER B O     1 
ATOM   4766 C CB    . SER D 3 116 ? 43.620  42.054 96.744  1.00 30.26  ? 110 SER B CB    1 
ATOM   4767 O OG    . SER D 3 116 ? 44.157  40.864 96.204  1.00 41.53  ? 110 SER B OG    1 
ATOM   4768 N N     . ASN D 3 117 ? 45.375  42.681 99.476  1.00 29.48  ? 111 ASN B N     1 
ATOM   4769 C CA    . ASN D 3 117 ? 46.214  42.184 100.555 1.00 27.62  ? 111 ASN B CA    1 
ATOM   4770 C C     . ASN D 3 117 ? 46.501  40.702 100.453 1.00 30.74  ? 111 ASN B C     1 
ATOM   4771 O O     . ASN D 3 117 ? 47.586  40.257 100.789 1.00 33.52  ? 111 ASN B O     1 
ATOM   4772 C CB    . ASN D 3 117 ? 45.580  42.450 101.918 1.00 32.92  ? 111 ASN B CB    1 
ATOM   4773 C CG    . ASN D 3 117 ? 45.654  43.898 102.331 1.00 49.74  ? 111 ASN B CG    1 
ATOM   4774 O OD1   . ASN D 3 117 ? 46.687  44.548 102.192 1.00 45.05  ? 111 ASN B OD1   1 
ATOM   4775 N ND2   . ASN D 3 117 ? 44.558  44.404 102.882 1.00 47.85  ? 111 ASN B ND2   1 
ATOM   4776 N N     . ALA D 3 118 ? 45.528  39.905 100.044 1.00 28.02  ? 112 ALA B N     1 
ATOM   4777 C CA    . ALA D 3 118 ? 45.794  38.473 100.004 1.00 26.27  ? 112 ALA B CA    1 
ATOM   4778 C C     . ALA D 3 118 ? 47.009  38.226 99.160  1.00 32.21  ? 112 ALA B C     1 
ATOM   4779 O O     . ALA D 3 118 ? 47.899  37.483 99.565  1.00 32.19  ? 112 ALA B O     1 
ATOM   4780 C CB    . ALA D 3 118 ? 44.607  37.686 99.499  1.00 26.15  ? 112 ALA B CB    1 
ATOM   4781 N N     . VAL D 3 119 ? 47.041  38.870 97.991  1.00 30.27  ? 113 VAL B N     1 
ATOM   4782 C CA    . VAL D 3 119 ? 48.143  38.733 97.033  1.00 29.71  ? 113 VAL B CA    1 
ATOM   4783 C C     . VAL D 3 119 ? 49.415  39.499 97.414  1.00 31.62  ? 113 VAL B C     1 
ATOM   4784 O O     . VAL D 3 119 ? 50.501  38.926 97.406  1.00 33.31  ? 113 VAL B O     1 
ATOM   4785 C CB    . VAL D 3 119 ? 47.680  39.042 95.600  1.00 32.61  ? 113 VAL B CB    1 
ATOM   4786 C CG1   . VAL D 3 119 ? 48.703  38.567 94.583  1.00 32.60  ? 113 VAL B CG1   1 
ATOM   4787 C CG2   . VAL D 3 119 ? 46.331  38.380 95.350  1.00 31.76  ? 113 VAL B CG2   1 
ATOM   4788 N N     . SER D 3 120 ? 49.279  40.757 97.813  1.00 26.68  ? 114 SER B N     1 
ATOM   4789 C CA    . SER D 3 120 ? 50.443  41.510 98.270  1.00 26.17  ? 114 SER B CA    1 
ATOM   4790 C C     . SER D 3 120 ? 51.141  40.744 99.400  1.00 35.12  ? 114 SER B C     1 
ATOM   4791 O O     . SER D 3 120 ? 52.346  40.451 99.349  1.00 39.56  ? 114 SER B O     1 
ATOM   4792 C CB    . SER D 3 120 ? 50.005  42.874 98.775  1.00 26.13  ? 114 SER B CB    1 
ATOM   4793 O OG    . SER D 3 120 ? 49.064  43.407 97.866  1.00 51.37  ? 114 SER B OG    1 
ATOM   4794 N N     . LEU D 3 121 ? 50.364  40.398 100.417 1.00 26.20  ? 115 LEU B N     1 
ATOM   4795 C CA    . LEU D 3 121 ? 50.900  39.719 101.575 1.00 21.97  ? 115 LEU B CA    1 
ATOM   4796 C C     . LEU D 3 121 ? 51.474  38.362 101.324 1.00 25.24  ? 115 LEU B C     1 
ATOM   4797 O O     . LEU D 3 121 ? 52.445  38.004 101.959 1.00 31.75  ? 115 LEU B O     1 
ATOM   4798 C CB    . LEU D 3 121 ? 49.873  39.640 102.709 1.00 22.00  ? 115 LEU B CB    1 
ATOM   4799 C CG    . LEU D 3 121 ? 49.332  40.958 103.280 1.00 25.30  ? 115 LEU B CG    1 
ATOM   4800 C CD1   . LEU D 3 121 ? 48.249  40.724 104.315 1.00 22.06  ? 115 LEU B CD1   1 
ATOM   4801 C CD2   . LEU D 3 121 ? 50.457  41.846 103.831 1.00 23.39  ? 115 LEU B CD2   1 
ATOM   4802 N N     . VAL D 3 122 ? 50.855  37.568 100.464 1.00 20.89  ? 116 VAL B N     1 
ATOM   4803 C CA    . VAL D 3 122 ? 51.360  36.212 100.247 1.00 22.63  ? 116 VAL B CA    1 
ATOM   4804 C C     . VAL D 3 122 ? 52.716  36.216 99.547  1.00 27.66  ? 116 VAL B C     1 
ATOM   4805 O O     . VAL D 3 122 ? 53.586  35.403 99.865  1.00 27.18  ? 116 VAL B O     1 
ATOM   4806 C CB    . VAL D 3 122 ? 50.355  35.320 99.490  1.00 27.06  ? 116 VAL B CB    1 
ATOM   4807 C CG1   . VAL D 3 122 ? 50.421  35.590 97.979  1.00 28.21  ? 116 VAL B CG1   1 
ATOM   4808 C CG2   . VAL D 3 122 ? 50.610  33.860 99.805  1.00 26.26  ? 116 VAL B CG2   1 
ATOM   4809 N N     . MET D 3 123 ? 52.879  37.156 98.612  1.00 23.40  ? 117 MET B N     1 
ATOM   4810 C CA    . MET D 3 123 ? 54.114  37.324 97.857  1.00 23.25  ? 117 MET B CA    1 
ATOM   4811 C C     . MET D 3 123 ? 55.267  37.578 98.830  1.00 28.64  ? 117 MET B C     1 
ATOM   4812 O O     . MET D 3 123 ? 56.267  36.854 98.806  1.00 28.89  ? 117 MET B O     1 
ATOM   4813 C CB    . MET D 3 123 ? 53.958  38.480 96.868  1.00 25.94  ? 117 MET B CB    1 
ATOM   4814 C CG    . MET D 3 123 ? 54.883  38.432 95.655  1.00 31.59  ? 117 MET B CG    1 
ATOM   4815 S SD    . MET D 3 123 ? 54.967  36.863 94.772  1.00 38.21  ? 117 MET B SD    1 
ATOM   4816 C CE    . MET D 3 123 ? 56.434  36.209 95.463  1.00 36.02  ? 117 MET B CE    1 
ATOM   4817 N N     . ARG D 3 124 ? 55.094  38.586 99.699  1.00 22.57  ? 118 ARG B N     1 
ATOM   4818 C CA    . ARG D 3 124 ? 56.066  38.967 100.741 1.00 18.44  ? 118 ARG B CA    1 
ATOM   4819 C C     . ARG D 3 124 ? 56.410  37.769 101.605 1.00 26.12  ? 118 ARG B C     1 
ATOM   4820 O O     . ARG D 3 124 ? 57.569  37.517 101.928 1.00 28.92  ? 118 ARG B O     1 
ATOM   4821 C CB    . ARG D 3 124 ? 55.448  40.019 101.667 1.00 12.04  ? 118 ARG B CB    1 
ATOM   4822 C CG    . ARG D 3 124 ? 55.508  41.444 101.147 1.00 24.52  ? 118 ARG B CG    1 
ATOM   4823 C CD    . ARG D 3 124 ? 55.256  42.454 102.264 1.00 40.43  ? 118 ARG B CD    1 
ATOM   4824 N NE    . ARG D 3 124 ? 56.308  43.464 102.352 1.00 53.37  ? 118 ARG B NE    1 
ATOM   4825 C CZ    . ARG D 3 124 ? 57.348  43.392 103.184 1.00 80.95  ? 118 ARG B CZ    1 
ATOM   4826 N NH1   . ARG D 3 124 ? 57.478  42.360 104.016 1.00 55.23  ? 118 ARG B NH1   1 
ATOM   4827 N NH2   . ARG D 3 124 ? 58.258  44.361 103.191 1.00 76.01  ? 118 ARG B NH2   1 
ATOM   4828 N N     . ARG D 3 125 ? 55.376  37.050 102.013 1.00 25.35  ? 119 ARG B N     1 
ATOM   4829 C CA    . ARG D 3 125 ? 55.528  35.887 102.864 1.00 25.84  ? 119 ARG B CA    1 
ATOM   4830 C C     . ARG D 3 125 ? 56.310  34.789 102.151 1.00 37.79  ? 119 ARG B C     1 
ATOM   4831 O O     . ARG D 3 125 ? 57.155  34.128 102.757 1.00 39.79  ? 119 ARG B O     1 
ATOM   4832 C CB    . ARG D 3 125 ? 54.145  35.390 103.283 1.00 19.99  ? 119 ARG B CB    1 
ATOM   4833 C CG    . ARG D 3 125 ? 54.146  34.142 104.145 1.00 18.43  ? 119 ARG B CG    1 
ATOM   4834 C CD    . ARG D 3 125 ? 52.848  33.393 103.959 1.00 20.62  ? 119 ARG B CD    1 
ATOM   4835 N NE    . ARG D 3 125 ? 52.742  32.229 104.823 1.00 30.32  ? 119 ARG B NE    1 
ATOM   4836 C CZ    . ARG D 3 125 ? 51.634  31.513 104.968 1.00 64.27  ? 119 ARG B CZ    1 
ATOM   4837 N NH1   . ARG D 3 125 ? 50.535  31.845 104.303 1.00 66.08  ? 119 ARG B NH1   1 
ATOM   4838 N NH2   . ARG D 3 125 ? 51.633  30.461 105.775 1.00 58.36  ? 119 ARG B NH2   1 
ATOM   4839 N N     . ILE D 3 126 ? 56.032  34.602 100.863 1.00 35.45  ? 120 ILE B N     1 
ATOM   4840 C CA    . ILE D 3 126 ? 56.705  33.574 100.082 1.00 34.46  ? 120 ILE B CA    1 
ATOM   4841 C C     . ILE D 3 126 ? 58.173  33.931 99.958  1.00 34.85  ? 120 ILE B C     1 
ATOM   4842 O O     . ILE D 3 126 ? 59.035  33.115 100.250 1.00 33.36  ? 120 ILE B O     1 
ATOM   4843 C CB    . ILE D 3 126 ? 56.072  33.426 98.685  1.00 39.31  ? 120 ILE B CB    1 
ATOM   4844 C CG1   . ILE D 3 126 ? 54.604  33.006 98.815  1.00 38.14  ? 120 ILE B CG1   1 
ATOM   4845 C CG2   . ILE D 3 126 ? 56.844  32.411 97.854  1.00 45.62  ? 120 ILE B CG2   1 
ATOM   4846 C CD1   . ILE D 3 126 ? 53.978  32.533 97.529  1.00 27.47  ? 120 ILE B CD1   1 
ATOM   4847 N N     . ARG D 3 127 ? 58.448  35.160 99.538  1.00 32.16  ? 121 ARG B N     1 
ATOM   4848 C CA    . ARG D 3 127 ? 59.819  35.637 99.440  1.00 33.01  ? 121 ARG B CA    1 
ATOM   4849 C C     . ARG D 3 127 ? 60.468  35.343 100.785 1.00 40.23  ? 121 ARG B C     1 
ATOM   4850 O O     . ARG D 3 127 ? 61.386  34.518 100.896 1.00 39.94  ? 121 ARG B O     1 
ATOM   4851 C CB    . ARG D 3 127 ? 59.835  37.153 99.206  1.00 30.25  ? 121 ARG B CB    1 
ATOM   4852 C CG    . ARG D 3 127 ? 61.230  37.779 99.175  1.00 27.16  ? 121 ARG B CG    1 
ATOM   4853 C CD    . ARG D 3 127 ? 61.174  39.304 99.150  1.00 33.27  ? 121 ARG B CD    1 
ATOM   4854 N NE    . ARG D 3 127 ? 61.085  39.861 97.799  1.00 64.08  ? 121 ARG B NE    1 
ATOM   4855 C CZ    . ARG D 3 127 ? 62.128  40.225 97.052  1.00 86.94  ? 121 ARG B CZ    1 
ATOM   4856 N NH1   . ARG D 3 127 ? 63.366  40.062 97.503  1.00 73.66  ? 121 ARG B NH1   1 
ATOM   4857 N NH2   . ARG D 3 127 ? 61.934  40.741 95.843  1.00 67.13  ? 121 ARG B NH2   1 
ATOM   4858 N N     . LYS D 3 128 ? 59.932  36.000 101.813 1.00 37.53  ? 122 LYS B N     1 
ATOM   4859 C CA    . LYS D 3 128 ? 60.413  35.869 103.193 1.00 35.87  ? 122 LYS B CA    1 
ATOM   4860 C C     . LYS D 3 128 ? 60.680  34.439 103.634 1.00 38.92  ? 122 LYS B C     1 
ATOM   4861 O O     . LYS D 3 128 ? 61.785  34.101 104.026 1.00 38.03  ? 122 LYS B O     1 
ATOM   4862 C CB    . LYS D 3 128 ? 59.496  36.605 104.178 1.00 35.69  ? 122 LYS B CB    1 
ATOM   4863 C CG    . LYS D 3 128 ? 60.108  37.905 104.705 1.00 45.48  ? 122 LYS B CG    1 
ATOM   4864 C CD    . LYS D 3 128 ? 59.293  38.574 105.813 1.00 52.07  ? 122 LYS B CD    1 
ATOM   4865 C CE    . LYS D 3 128 ? 60.158  38.856 107.042 1.00 77.49  ? 122 LYS B CE    1 
ATOM   4866 N NZ    . LYS D 3 128 ? 61.252  39.838 106.773 1.00 93.72  ? 122 LYS B NZ    1 
ATOM   4867 N N     . GLU D 3 129 ? 59.674  33.587 103.563 1.00 36.94  ? 123 GLU B N     1 
ATOM   4868 C CA    . GLU D 3 129 ? 59.887  32.210 103.949 1.00 37.08  ? 123 GLU B CA    1 
ATOM   4869 C C     . GLU D 3 129 ? 61.030  31.602 103.143 1.00 46.47  ? 123 GLU B C     1 
ATOM   4870 O O     . GLU D 3 129 ? 61.904  30.957 103.708 1.00 46.46  ? 123 GLU B O     1 
ATOM   4871 C CB    . GLU D 3 129 ? 58.612  31.395 103.761 1.00 37.50  ? 123 GLU B CB    1 
ATOM   4872 C CG    . GLU D 3 129 ? 57.406  31.938 104.483 1.00 39.19  ? 123 GLU B CG    1 
ATOM   4873 C CD    . GLU D 3 129 ? 56.319  30.896 104.599 1.00 73.17  ? 123 GLU B CD    1 
ATOM   4874 O OE1   . GLU D 3 129 ? 56.071  30.181 103.604 1.00 77.16  ? 123 GLU B OE1   1 
ATOM   4875 O OE2   . GLU D 3 129 ? 55.730  30.778 105.692 1.00 80.16  ? 123 GLU B OE2   1 
ATOM   4876 N N     . ASN D 3 130 ? 61.020  31.819 101.829 1.00 47.68  ? 124 ASN B N     1 
ATOM   4877 C CA    . ASN D 3 130 ? 62.039  31.263 100.938 1.00 47.96  ? 124 ASN B CA    1 
ATOM   4878 C C     . ASN D 3 130 ? 63.469  31.699 101.252 1.00 51.13  ? 124 ASN B C     1 
ATOM   4879 O O     . ASN D 3 130 ? 64.346  30.849 101.438 1.00 49.06  ? 124 ASN B O     1 
ATOM   4880 C CB    . ASN D 3 130 ? 61.680  31.481 99.457  1.00 45.56  ? 124 ASN B CB    1 
ATOM   4881 C CG    . ASN D 3 130 ? 60.822  30.351 98.888  1.00 49.13  ? 124 ASN B CG    1 
ATOM   4882 O OD1   . ASN D 3 130 ? 60.161  29.628 99.632  1.00 49.50  ? 124 ASN B OD1   1 
ATOM   4883 N ND2   . ASN D 3 130 ? 60.802  30.223 97.567  1.00 26.82  ? 124 ASN B ND2   1 
ATOM   4884 N N     . VAL D 3 131 ? 63.701  33.010 101.322 1.00 49.12  ? 125 VAL B N     1 
ATOM   4885 C CA    . VAL D 3 131 ? 65.035  33.524 101.635 1.00 50.65  ? 125 VAL B CA    1 
ATOM   4886 C C     . VAL D 3 131 ? 65.508  33.143 103.034 1.00 58.45  ? 125 VAL B C     1 
ATOM   4887 O O     . VAL D 3 131 ? 66.682  32.832 103.227 1.00 58.24  ? 125 VAL B O     1 
ATOM   4888 C CB    . VAL D 3 131 ? 65.145  35.037 101.424 1.00 55.22  ? 125 VAL B CB    1 
ATOM   4889 C CG1   . VAL D 3 131 ? 64.321  35.456 100.221 1.00 55.32  ? 125 VAL B CG1   1 
ATOM   4890 C CG2   . VAL D 3 131 ? 64.719  35.789 102.668 1.00 55.68  ? 125 VAL B CG2   1 
ATOM   4891 N N     . ASP D 3 132 ? 64.590  33.145 104.002 1.00 58.15  ? 126 ASP B N     1 
ATOM   4892 C CA    . ASP D 3 132 ? 64.932  32.772 105.376 1.00 58.59  ? 126 ASP B CA    1 
ATOM   4893 C C     . ASP D 3 132 ? 65.056  31.263 105.465 1.00 63.39  ? 126 ASP B C     1 
ATOM   4894 O O     . ASP D 3 132 ? 64.787  30.671 106.508 1.00 66.45  ? 126 ASP B O     1 
ATOM   4895 C CB    . ASP D 3 132 ? 63.901  33.268 106.400 1.00 60.78  ? 126 ASP B CB    1 
ATOM   4896 C CG    . ASP D 3 132 ? 63.789  34.782 106.446 1.00 78.16  ? 126 ASP B CG    1 
ATOM   4897 O OD1   . ASP D 3 132 ? 64.349  35.473 105.568 1.00 82.19  ? 126 ASP B OD1   1 
ATOM   4898 O OD2   . ASP D 3 132 ? 63.111  35.290 107.360 1.00 83.15  ? 126 ASP B OD2   1 
ATOM   4899 N N     . ALA D 3 133 ? 65.434  30.650 104.349 1.00 56.88  ? 127 ALA B N     1 
ATOM   4900 C CA    . ALA D 3 133 ? 65.670  29.214 104.288 1.00 55.84  ? 127 ALA B CA    1 
ATOM   4901 C C     . ALA D 3 133 ? 66.852  29.106 103.348 1.00 59.26  ? 127 ALA B C     1 
ATOM   4902 O O     . ALA D 3 133 ? 67.207  28.036 102.863 1.00 59.78  ? 127 ALA B O     1 
ATOM   4903 C CB    . ALA D 3 133 ? 64.475  28.481 103.739 1.00 56.02  ? 127 ALA B CB    1 
ATOM   4904 N N     . GLY D 3 134 ? 67.460  30.257 103.098 1.00 55.18  ? 128 GLY B N     1 
ATOM   4905 C CA    . GLY D 3 134 ? 68.617  30.331 102.234 1.00 57.13  ? 128 GLY B CA    1 
ATOM   4906 C C     . GLY D 3 134 ? 68.266  30.980 100.911 1.00 66.76  ? 128 GLY B C     1 
ATOM   4907 O O     . GLY D 3 134 ? 68.510  32.154 100.718 1.00 67.87  ? 128 GLY B O     1 
ATOM   4908 N N     . GLU D 3 135 ? 67.679  30.195 100.018 1.00 61.42  ? 129 GLU B N     1 
ATOM   4909 C CA    . GLU D 3 135 ? 67.302  30.640 98.685  1.00 58.07  ? 129 GLU B CA    1 
ATOM   4910 C C     . GLU D 3 135 ? 67.960  31.922 98.260  1.00 58.10  ? 129 GLU B C     1 
ATOM   4911 O O     . GLU D 3 135 ? 67.682  33.001 98.803  1.00 53.09  ? 129 GLU B O     1 
ATOM   4912 C CB    . GLU D 3 135 ? 65.791  30.789 98.523  1.00 59.07  ? 129 GLU B CB    1 
ATOM   4913 C CG    . GLU D 3 135 ? 65.230  30.045 97.312  1.00 65.67  ? 129 GLU B CG    1 
ATOM   4914 C CD    . GLU D 3 135 ? 64.684  30.959 96.230  1.00 69.94  ? 129 GLU B CD    1 
ATOM   4915 O OE1   . GLU D 3 135 ? 65.424  31.837 95.751  1.00 59.29  ? 129 GLU B OE1   1 
ATOM   4916 O OE2   . GLU D 3 135 ? 63.524  30.767 95.824  1.00 66.88  ? 129 GLU B OE2   1 
ATOM   4917 N N     . ARG D 3 136 ? 68.756  31.829 97.209  1.00 57.12  ? 130 ARG B N     1 
ATOM   4918 C CA    . ARG D 3 136 ? 69.341  33.031 96.675  1.00 57.14  ? 130 ARG B CA    1 
ATOM   4919 C C     . ARG D 3 136 ? 69.419  33.035 95.158  1.00 55.77  ? 130 ARG B C     1 
ATOM   4920 O O     . ARG D 3 136 ? 69.672  32.015 94.519  1.00 56.10  ? 130 ARG B O     1 
ATOM   4921 C CB    . ARG D 3 136 ? 70.614  33.463 97.411  1.00 62.41  ? 130 ARG B CB    1 
ATOM   4922 C CG    . ARG D 3 136 ? 70.401  33.792 98.909  1.00 72.61  ? 130 ARG B CG    1 
ATOM   4923 C CD    . ARG D 3 136 ? 69.632  35.130 99.163  1.00 76.72  ? 130 ARG B CD    1 
ATOM   4924 N NE    . ARG D 3 136 ? 69.713  35.648 100.548 1.00 87.26  ? 130 ARG B NE    1 
ATOM   4925 C CZ    . ARG D 3 136 ? 69.815  34.928 101.667 1.00 100.00 ? 130 ARG B CZ    1 
ATOM   4926 N NH1   . ARG D 3 136 ? 69.988  33.617 101.636 1.00 88.94  ? 130 ARG B NH1   1 
ATOM   4927 N NH2   . ARG D 3 136 ? 69.786  35.541 102.843 1.00 100.00 ? 130 ARG B NH2   1 
ATOM   4928 N N     . ALA D 3 137 ? 69.075  34.182 94.593  1.00 48.57  ? 131 ALA B N     1 
ATOM   4929 C CA    . ALA D 3 137 ? 69.077  34.356 93.154  1.00 47.90  ? 131 ALA B CA    1 
ATOM   4930 C C     . ALA D 3 137 ? 70.510  34.253 92.675  1.00 50.94  ? 131 ALA B C     1 
ATOM   4931 O O     . ALA D 3 137 ? 71.372  35.006 93.112  1.00 52.91  ? 131 ALA B O     1 
ATOM   4932 C CB    . ALA D 3 137 ? 68.493  35.709 92.790  1.00 48.90  ? 131 ALA B CB    1 
ATOM   4933 N N     . LYS D 3 138 ? 70.765  33.316 91.774  1.00 44.25  ? 132 LYS B N     1 
ATOM   4934 C CA    . LYS D 3 138 ? 72.110  33.127 91.254  1.00 41.83  ? 132 LYS B CA    1 
ATOM   4935 C C     . LYS D 3 138 ? 72.533  34.122 90.180  1.00 42.73  ? 132 LYS B C     1 
ATOM   4936 O O     . LYS D 3 138 ? 71.778  35.017 89.787  1.00 40.70  ? 132 LYS B O     1 
ATOM   4937 C CB    . LYS D 3 138 ? 72.314  31.702 90.741  1.00 43.10  ? 132 LYS B CB    1 
ATOM   4938 C CG    . LYS D 3 138 ? 71.653  30.621 91.577  1.00 50.27  ? 132 LYS B CG    1 
ATOM   4939 C CD    . LYS D 3 138 ? 71.845  29.264 90.918  1.00 56.15  ? 132 LYS B CD    1 
ATOM   4940 C CE    . LYS D 3 138 ? 71.990  28.156 91.948  1.00 70.92  ? 132 LYS B CE    1 
ATOM   4941 N NZ    . LYS D 3 138 ? 72.925  27.086 91.489  1.00 84.47  ? 132 LYS B NZ    1 
ATOM   4942 N N     . GLN D 3 139 ? 73.777  33.960 89.743  1.00 39.08  ? 133 GLN B N     1 
ATOM   4943 C CA    . GLN D 3 139 ? 74.370  34.789 88.707  1.00 37.97  ? 133 GLN B CA    1 
ATOM   4944 C C     . GLN D 3 139 ? 75.363  33.948 87.932  1.00 40.80  ? 133 GLN B C     1 
ATOM   4945 O O     . GLN D 3 139 ? 75.860  32.931 88.422  1.00 42.09  ? 133 GLN B O     1 
ATOM   4946 C CB    . GLN D 3 139 ? 75.021  36.049 89.279  1.00 39.39  ? 133 GLN B CB    1 
ATOM   4947 C CG    . GLN D 3 139 ? 76.411  35.873 89.831  1.00 58.21  ? 133 GLN B CG    1 
ATOM   4948 C CD    . GLN D 3 139 ? 76.934  37.152 90.446  1.00 88.34  ? 133 GLN B CD    1 
ATOM   4949 O OE1   . GLN D 3 139 ? 78.143  37.378 90.504  1.00 98.90  ? 133 GLN B OE1   1 
ATOM   4950 N NE2   . GLN D 3 139 ? 76.024  38.015 90.879  1.00 66.82  ? 133 GLN B NE2   1 
ATOM   4951 N N     . ALA D 3 140 ? 75.599  34.341 86.689  1.00 36.22  ? 134 ALA B N     1 
ATOM   4952 C CA    . ALA D 3 140 ? 76.490  33.601 85.808  1.00 33.58  ? 134 ALA B CA    1 
ATOM   4953 C C     . ALA D 3 140 ? 77.876  33.487 86.363  1.00 33.77  ? 134 ALA B C     1 
ATOM   4954 O O     . ALA D 3 140 ? 78.387  34.428 86.975  1.00 34.00  ? 134 ALA B O     1 
ATOM   4955 C CB    . ALA D 3 140 ? 76.550  34.254 84.459  1.00 34.39  ? 134 ALA B CB    1 
ATOM   4956 N N     . LEU D 3 141 ? 78.488  32.334 86.085  1.00 27.82  ? 135 LEU B N     1 
ATOM   4957 C CA    . LEU D 3 141 ? 79.867  32.010 86.464  1.00 25.21  ? 135 LEU B CA    1 
ATOM   4958 C C     . LEU D 3 141 ? 80.723  33.033 85.754  1.00 27.91  ? 135 LEU B C     1 
ATOM   4959 O O     . LEU D 3 141 ? 80.518  33.298 84.566  1.00 32.30  ? 135 LEU B O     1 
ATOM   4960 C CB    . LEU D 3 141 ? 80.187  30.635 85.904  1.00 25.49  ? 135 LEU B CB    1 
ATOM   4961 C CG    . LEU D 3 141 ? 81.479  29.911 86.241  1.00 30.87  ? 135 LEU B CG    1 
ATOM   4962 C CD1   . LEU D 3 141 ? 81.570  29.740 87.734  1.00 30.18  ? 135 LEU B CD1   1 
ATOM   4963 C CD2   . LEU D 3 141 ? 81.392  28.552 85.573  1.00 32.78  ? 135 LEU B CD2   1 
ATOM   4964 N N     . ALA D 3 142 ? 81.649  33.657 86.461  1.00 20.25  ? 136 ALA B N     1 
ATOM   4965 C CA    . ALA D 3 142 ? 82.452  34.684 85.815  1.00 18.22  ? 136 ALA B CA    1 
ATOM   4966 C C     . ALA D 3 142 ? 83.373  34.160 84.707  1.00 30.38  ? 136 ALA B C     1 
ATOM   4967 O O     . ALA D 3 142 ? 83.941  33.060 84.809  1.00 31.14  ? 136 ALA B O     1 
ATOM   4968 C CB    . ALA D 3 142 ? 83.237  35.464 86.836  1.00 16.83  ? 136 ALA B CB    1 
ATOM   4969 N N     . PHE D 3 143 ? 83.507  34.968 83.655  1.00 25.42  ? 137 PHE B N     1 
ATOM   4970 C CA    . PHE D 3 143 ? 84.409  34.698 82.549  1.00 22.13  ? 137 PHE B CA    1 
ATOM   4971 C C     . PHE D 3 143 ? 85.304  35.926 82.547  1.00 26.86  ? 137 PHE B C     1 
ATOM   4972 O O     . PHE D 3 143 ? 84.925  36.982 82.030  1.00 26.82  ? 137 PHE B O     1 
ATOM   4973 C CB    . PHE D 3 143 ? 83.656  34.630 81.227  1.00 22.43  ? 137 PHE B CB    1 
ATOM   4974 C CG    . PHE D 3 143 ? 84.549  34.481 80.022  1.00 20.58  ? 137 PHE B CG    1 
ATOM   4975 C CD1   . PHE D 3 143 ? 84.989  33.231 79.636  1.00 21.64  ? 137 PHE B CD1   1 
ATOM   4976 C CD2   . PHE D 3 143 ? 84.916  35.580 79.268  1.00 20.48  ? 137 PHE B CD2   1 
ATOM   4977 C CE1   . PHE D 3 143 ? 85.790  33.073 78.529  1.00 22.34  ? 137 PHE B CE1   1 
ATOM   4978 C CE2   . PHE D 3 143 ? 85.708  35.431 78.149  1.00 24.25  ? 137 PHE B CE2   1 
ATOM   4979 C CZ    . PHE D 3 143 ? 86.142  34.169 77.774  1.00 22.02  ? 137 PHE B CZ    1 
ATOM   4980 N N     . GLU D 3 144 ? 86.476  35.804 83.159  1.00 24.56  ? 138 GLU B N     1 
ATOM   4981 C CA    . GLU D 3 144 ? 87.393  36.939 83.251  1.00 26.57  ? 138 GLU B CA    1 
ATOM   4982 C C     . GLU D 3 144 ? 88.601  36.874 82.312  1.00 31.86  ? 138 GLU B C     1 
ATOM   4983 O O     . GLU D 3 144 ? 88.757  35.912 81.551  1.00 29.85  ? 138 GLU B O     1 
ATOM   4984 C CB    . GLU D 3 144 ? 87.791  37.142 84.713  1.00 28.22  ? 138 GLU B CB    1 
ATOM   4985 C CG    . GLU D 3 144 ? 87.063  36.135 85.610  1.00 40.86  ? 138 GLU B CG    1 
ATOM   4986 C CD    . GLU D 3 144 ? 86.954  36.573 87.050  1.00 67.18  ? 138 GLU B CD    1 
ATOM   4987 O OE1   . GLU D 3 144 ? 85.956  37.251 87.398  1.00 49.29  ? 138 GLU B OE1   1 
ATOM   4988 O OE2   . GLU D 3 144 ? 87.858  36.207 87.835  1.00 62.43  ? 138 GLU B OE2   1 
ATOM   4989 N N     . ARG D 3 145 ? 89.430  37.920 82.353  1.00 30.06  ? 139 ARG B N     1 
ATOM   4990 C CA    . ARG D 3 145 ? 90.602  38.028 81.481  1.00 30.24  ? 139 ARG B CA    1 
ATOM   4991 C C     . ARG D 3 145 ? 91.533  36.832 81.497  1.00 30.84  ? 139 ARG B C     1 
ATOM   4992 O O     . ARG D 3 145 ? 92.169  36.518 80.484  1.00 30.58  ? 139 ARG B O     1 
ATOM   4993 C CB    . ARG D 3 145 ? 91.403  39.293 81.777  1.00 33.30  ? 139 ARG B CB    1 
ATOM   4994 C CG    . ARG D 3 145 ? 92.835  39.256 81.223  1.00 36.57  ? 139 ARG B CG    1 
ATOM   4995 C CD    . ARG D 3 145 ? 92.881  39.642 79.747  1.00 34.08  ? 139 ARG B CD    1 
ATOM   4996 N NE    . ARG D 3 145 ? 94.100  40.354 79.360  1.00 45.59  ? 139 ARG B NE    1 
ATOM   4997 C CZ    . ARG D 3 145 ? 94.341  41.625 79.647  1.00 61.39  ? 139 ARG B CZ    1 
ATOM   4998 N NH1   . ARG D 3 145 ? 93.452  42.313 80.348  1.00 53.92  ? 139 ARG B NH1   1 
ATOM   4999 N NH2   . ARG D 3 145 ? 95.466  42.197 79.236  1.00 53.49  ? 139 ARG B NH2   1 
ATOM   5000 N N     . THR D 3 146 ? 91.643  36.190 82.652  1.00 26.40  ? 140 THR B N     1 
ATOM   5001 C CA    . THR D 3 146 ? 92.515  35.034 82.773  1.00 27.48  ? 140 THR B CA    1 
ATOM   5002 C C     . THR D 3 146 ? 91.885  33.960 81.925  1.00 36.03  ? 140 THR B C     1 
ATOM   5003 O O     . THR D 3 146 ? 92.528  33.356 81.068  1.00 39.27  ? 140 THR B O     1 
ATOM   5004 C CB    . THR D 3 146 ? 92.599  34.567 84.211  1.00 35.66  ? 140 THR B CB    1 
ATOM   5005 O OG1   . THR D 3 146 ? 93.163  35.612 85.007  1.00 56.33  ? 140 THR B OG1   1 
ATOM   5006 C CG2   . THR D 3 146 ? 93.455  33.328 84.333  1.00 31.67  ? 140 THR B CG2   1 
ATOM   5007 N N     . ASP D 3 147 ? 90.585  33.793 82.123  1.00 30.41  ? 141 ASP B N     1 
ATOM   5008 C CA    . ASP D 3 147 ? 89.793  32.842 81.359  1.00 27.20  ? 141 ASP B CA    1 
ATOM   5009 C C     . ASP D 3 147 ? 89.916  33.145 79.868  1.00 27.35  ? 141 ASP B C     1 
ATOM   5010 O O     . ASP D 3 147 ? 90.145  32.245 79.063  1.00 24.66  ? 141 ASP B O     1 
ATOM   5011 C CB    . ASP D 3 147 ? 88.330  32.924 81.799  1.00 26.56  ? 141 ASP B CB    1 
ATOM   5012 C CG    . ASP D 3 147 ? 88.155  32.648 83.280  1.00 23.37  ? 141 ASP B CG    1 
ATOM   5013 O OD1   . ASP D 3 147 ? 88.714  31.631 83.754  1.00 22.95  ? 141 ASP B OD1   1 
ATOM   5014 O OD2   . ASP D 3 147 ? 87.455  33.434 83.962  1.00 24.92  ? 141 ASP B OD2   1 
ATOM   5015 N N     . PHE D 3 148 ? 89.783  34.421 79.514  1.00 26.56  ? 142 PHE B N     1 
ATOM   5016 C CA    . PHE D 3 148 ? 89.894  34.853 78.111  1.00 26.96  ? 142 PHE B CA    1 
ATOM   5017 C C     . PHE D 3 148 ? 91.291  34.556 77.565  1.00 31.52  ? 142 PHE B C     1 
ATOM   5018 O O     . PHE D 3 148 ? 91.454  33.881 76.543  1.00 33.05  ? 142 PHE B O     1 
ATOM   5019 C CB    . PHE D 3 148 ? 89.568  36.348 77.975  1.00 26.87  ? 142 PHE B CB    1 
ATOM   5020 C CG    . PHE D 3 148 ? 89.631  36.856 76.569  1.00 26.53  ? 142 PHE B CG    1 
ATOM   5021 C CD1   . PHE D 3 148 ? 89.050  36.149 75.530  1.00 29.69  ? 142 PHE B CD1   1 
ATOM   5022 C CD2   . PHE D 3 148 ? 90.261  38.049 76.286  1.00 29.27  ? 142 PHE B CD2   1 
ATOM   5023 C CE1   . PHE D 3 148 ? 89.129  36.623 74.221  1.00 31.77  ? 142 PHE B CE1   1 
ATOM   5024 C CE2   . PHE D 3 148 ? 90.335  38.535 74.980  1.00 32.45  ? 142 PHE B CE2   1 
ATOM   5025 C CZ    . PHE D 3 148 ? 89.780  37.818 73.946  1.00 29.59  ? 142 PHE B CZ    1 
ATOM   5026 N N     . ASP D 3 149 ? 92.302  35.035 78.274  1.00 24.31  ? 143 ASP B N     1 
ATOM   5027 C CA    . ASP D 3 149 ? 93.670  34.794 77.867  1.00 22.33  ? 143 ASP B CA    1 
ATOM   5028 C C     . ASP D 3 149 ? 93.965  33.301 77.685  1.00 27.43  ? 143 ASP B C     1 
ATOM   5029 O O     . ASP D 3 149 ? 94.641  32.912 76.739  1.00 28.80  ? 143 ASP B O     1 
ATOM   5030 C CB    . ASP D 3 149 ? 94.615  35.435 78.870  1.00 23.23  ? 143 ASP B CB    1 
ATOM   5031 C CG    . ASP D 3 149 ? 94.582  36.940 78.802  1.00 41.71  ? 143 ASP B CG    1 
ATOM   5032 O OD1   . ASP D 3 149 ? 93.638  37.464 78.187  1.00 47.51  ? 143 ASP B OD1   1 
ATOM   5033 O OD2   . ASP D 3 149 ? 95.499  37.601 79.332  1.00 57.99  ? 143 ASP B OD2   1 
ATOM   5034 N N     . GLN D 3 150 ? 93.450  32.470 78.584  1.00 24.98  ? 144 GLN B N     1 
ATOM   5035 C CA    . GLN D 3 150 ? 93.661  31.023 78.494  1.00 25.63  ? 144 GLN B CA    1 
ATOM   5036 C C     . GLN D 3 150 ? 92.937  30.408 77.306  1.00 33.33  ? 144 GLN B C     1 
ATOM   5037 O O     . GLN D 3 150 ? 93.531  29.657 76.538  1.00 36.13  ? 144 GLN B O     1 
ATOM   5038 C CB    . GLN D 3 150 ? 93.260  30.322 79.791  1.00 25.38  ? 144 GLN B CB    1 
ATOM   5039 C CG    . GLN D 3 150 ? 94.078  30.773 80.989  1.00 17.72  ? 144 GLN B CG    1 
ATOM   5040 C CD    . GLN D 3 150 ? 93.677  30.056 82.231  1.00 29.66  ? 144 GLN B CD    1 
ATOM   5041 O OE1   . GLN D 3 150 ? 92.890  29.128 82.173  1.00 35.34  ? 144 GLN B OE1   1 
ATOM   5042 N NE2   . GLN D 3 150 ? 94.188  30.493 83.370  1.00 28.58  ? 144 GLN B NE2   1 
ATOM   5043 N N     . VAL D 3 151 ? 91.660  30.734 77.154  1.00 29.23  ? 145 VAL B N     1 
ATOM   5044 C CA    . VAL D 3 151 ? 90.874  30.224 76.043  1.00 28.31  ? 145 VAL B CA    1 
ATOM   5045 C C     . VAL D 3 151 ? 91.534  30.635 74.713  1.00 29.62  ? 145 VAL B C     1 
ATOM   5046 O O     . VAL D 3 151 ? 91.715  29.811 73.813  1.00 29.52  ? 145 VAL B O     1 
ATOM   5047 C CB    . VAL D 3 151 ? 89.438  30.765 76.110  1.00 33.08  ? 145 VAL B CB    1 
ATOM   5048 C CG1   . VAL D 3 151 ? 88.653  30.352 74.873  1.00 35.13  ? 145 VAL B CG1   1 
ATOM   5049 C CG2   . VAL D 3 151 ? 88.753  30.279 77.360  1.00 32.09  ? 145 VAL B CG2   1 
ATOM   5050 N N     . ARG D 3 152 ? 91.913  31.905 74.609  1.00 22.87  ? 146 ARG B N     1 
ATOM   5051 C CA    . ARG D 3 152 ? 92.550  32.436 73.406  1.00 22.28  ? 146 ARG B CA    1 
ATOM   5052 C C     . ARG D 3 152 ? 93.911  31.803 73.132  1.00 30.70  ? 146 ARG B C     1 
ATOM   5053 O O     . ARG D 3 152 ? 94.251  31.514 71.995  1.00 35.35  ? 146 ARG B O     1 
ATOM   5054 C CB    . ARG D 3 152 ? 92.695  33.963 73.512  1.00 19.27  ? 146 ARG B CB    1 
ATOM   5055 C CG    . ARG D 3 152 ? 93.596  34.581 72.453  1.00 34.06  ? 146 ARG B CG    1 
ATOM   5056 C CD    . ARG D 3 152 ? 93.304  36.064 72.225  1.00 44.94  ? 146 ARG B CD    1 
ATOM   5057 N NE    . ARG D 3 152 ? 93.891  36.923 73.251  1.00 54.09  ? 146 ARG B NE    1 
ATOM   5058 C CZ    . ARG D 3 152 ? 93.940  38.253 73.184  1.00 68.26  ? 146 ARG B CZ    1 
ATOM   5059 N NH1   . ARG D 3 152 ? 93.442  38.896 72.137  1.00 36.98  ? 146 ARG B NH1   1 
ATOM   5060 N NH2   . ARG D 3 152 ? 94.490  38.948 74.172  1.00 59.19  ? 146 ARG B NH2   1 
ATOM   5061 N N     . SER D 3 153 ? 94.703  31.614 74.179  1.00 26.20  ? 147 SER B N     1 
ATOM   5062 C CA    . SER D 3 153 ? 96.034  31.045 74.043  1.00 22.90  ? 147 SER B CA    1 
ATOM   5063 C C     . SER D 3 153 ? 95.924  29.695 73.380  1.00 28.91  ? 147 SER B C     1 
ATOM   5064 O O     . SER D 3 153 ? 96.835  29.231 72.684  1.00 30.58  ? 147 SER B O     1 
ATOM   5065 C CB    . SER D 3 153 ? 96.656  30.858 75.423  1.00 19.31  ? 147 SER B CB    1 
ATOM   5066 O OG    . SER D 3 153 ? 96.399  29.558 75.914  1.00 23.53  ? 147 SER B OG    1 
ATOM   5067 N N     . LEU D 3 154 ? 94.798  29.047 73.628  1.00 23.28  ? 148 LEU B N     1 
ATOM   5068 C CA    . LEU D 3 154 ? 94.563  27.719 73.100  1.00 21.61  ? 148 LEU B CA    1 
ATOM   5069 C C     . LEU D 3 154 ? 93.917  27.728 71.726  1.00 31.20  ? 148 LEU B C     1 
ATOM   5070 O O     . LEU D 3 154 ? 94.325  26.991 70.841  1.00 35.17  ? 148 LEU B O     1 
ATOM   5071 C CB    . LEU D 3 154 ? 93.675  26.927 74.061  1.00 20.74  ? 148 LEU B CB    1 
ATOM   5072 C CG    . LEU D 3 154 ? 94.228  26.233 75.303  1.00 23.00  ? 148 LEU B CG    1 
ATOM   5073 C CD1   . LEU D 3 154 ? 93.053  25.684 76.098  1.00 20.78  ? 148 LEU B CD1   1 
ATOM   5074 C CD2   . LEU D 3 154 ? 95.198  25.114 74.950  1.00 23.59  ? 148 LEU B CD2   1 
ATOM   5075 N N     . MET D 3 155 ? 92.859  28.511 71.572  1.00 29.86  ? 149 MET B N     1 
ATOM   5076 C CA    . MET D 3 155 ? 92.103  28.535 70.326  1.00 30.61  ? 149 MET B CA    1 
ATOM   5077 C C     . MET D 3 155 ? 92.738  29.340 69.191  1.00 32.05  ? 149 MET B C     1 
ATOM   5078 O O     . MET D 3 155 ? 92.488  29.082 68.020  1.00 32.88  ? 149 MET B O     1 
ATOM   5079 C CB    . MET D 3 155 ? 90.660  28.965 70.589  1.00 32.99  ? 149 MET B CB    1 
ATOM   5080 C CG    . MET D 3 155 ? 89.812  27.910 71.266  1.00 35.63  ? 149 MET B CG    1 
ATOM   5081 S SD    . MET D 3 155 ? 88.341  28.650 72.005  1.00 40.71  ? 149 MET B SD    1 
ATOM   5082 C CE    . MET D 3 155 ? 87.428  29.181 70.606  1.00 37.51  ? 149 MET B CE    1 
ATOM   5083 N N     . GLU D 3 156 ? 93.564  30.304 69.557  1.00 26.16  ? 150 GLU B N     1 
ATOM   5084 C CA    . GLU D 3 156 ? 94.294  31.125 68.608  1.00 25.88  ? 150 GLU B CA    1 
ATOM   5085 C C     . GLU D 3 156 ? 94.822  30.270 67.462  1.00 37.33  ? 150 GLU B C     1 
ATOM   5086 O O     . GLU D 3 156 ? 94.759  30.646 66.279  1.00 37.74  ? 150 GLU B O     1 
ATOM   5087 C CB    . GLU D 3 156 ? 95.516  31.695 69.319  1.00 25.66  ? 150 GLU B CB    1 
ATOM   5088 C CG    . GLU D 3 156 ? 95.587  33.173 69.342  1.00 31.04  ? 150 GLU B CG    1 
ATOM   5089 C CD    . GLU D 3 156 ? 96.708  33.623 70.198  1.00 57.14  ? 150 GLU B CD    1 
ATOM   5090 O OE1   . GLU D 3 156 ? 97.388  32.725 70.731  1.00 32.99  ? 150 GLU B OE1   1 
ATOM   5091 O OE2   . GLU D 3 156 ? 96.880  34.850 70.363  1.00 79.49  ? 150 GLU B OE2   1 
ATOM   5092 N N     . ASN D 3 157 ? 95.401  29.134 67.832  1.00 34.98  ? 151 ASN B N     1 
ATOM   5093 C CA    . ASN D 3 157 ? 96.039  28.257 66.868  1.00 35.29  ? 151 ASN B CA    1 
ATOM   5094 C C     . ASN D 3 157 ? 95.168  27.446 65.936  1.00 39.16  ? 151 ASN B C     1 
ATOM   5095 O O     . ASN D 3 157 ? 95.677  26.832 65.012  1.00 42.85  ? 151 ASN B O     1 
ATOM   5096 C CB    . ASN D 3 157 ? 97.066  27.375 67.561  1.00 35.67  ? 151 ASN B CB    1 
ATOM   5097 C CG    . ASN D 3 157 ? 97.923  28.153 68.510  1.00 46.10  ? 151 ASN B CG    1 
ATOM   5098 O OD1   . ASN D 3 157 ? 98.622  29.079 68.104  1.00 44.96  ? 151 ASN B OD1   1 
ATOM   5099 N ND2   . ASN D 3 157 ? 97.844  27.816 69.794  1.00 28.98  ? 151 ASN B ND2   1 
ATOM   5100 N N     . SER D 3 158 ? 93.863  27.436 66.167  1.00 32.52  ? 152 SER B N     1 
ATOM   5101 C CA    . SER D 3 158 ? 92.956  26.673 65.322  1.00 30.07  ? 152 SER B CA    1 
ATOM   5102 C C     . SER D 3 158 ? 92.636  27.389 64.035  1.00 36.55  ? 152 SER B C     1 
ATOM   5103 O O     . SER D 3 158 ? 92.450  28.602 64.026  1.00 38.07  ? 152 SER B O     1 
ATOM   5104 C CB    . SER D 3 158 ? 91.663  26.385 66.052  1.00 32.00  ? 152 SER B CB    1 
ATOM   5105 O OG    . SER D 3 158 ? 90.874  25.490 65.293  1.00 40.91  ? 152 SER B OG    1 
ATOM   5106 N N     . ASP D 3 159 ? 92.572  26.642 62.939  1.00 33.92  ? 153 ASP B N     1 
ATOM   5107 C CA    . ASP D 3 159 ? 92.242  27.230 61.647  1.00 33.68  ? 153 ASP B CA    1 
ATOM   5108 C C     . ASP D 3 159 ? 90.782  26.981 61.290  1.00 34.03  ? 153 ASP B C     1 
ATOM   5109 O O     . ASP D 3 159 ? 90.290  27.520 60.308  1.00 34.32  ? 153 ASP B O     1 
ATOM   5110 C CB    . ASP D 3 159 ? 93.164  26.703 60.553  1.00 36.22  ? 153 ASP B CB    1 
ATOM   5111 C CG    . ASP D 3 159 ? 94.576  27.259 60.662  1.00 60.85  ? 153 ASP B CG    1 
ATOM   5112 O OD1   . ASP D 3 159 ? 94.757  28.377 61.199  1.00 61.49  ? 153 ASP B OD1   1 
ATOM   5113 O OD2   . ASP D 3 159 ? 95.510  26.563 60.211  1.00 76.39  ? 153 ASP B OD2   1 
ATOM   5114 N N     . ARG D 3 160 ? 90.104  26.175 62.108  1.00 27.23  ? 154 ARG B N     1 
ATOM   5115 C CA    . ARG D 3 160 ? 88.692  25.859 61.933  1.00 26.38  ? 154 ARG B CA    1 
ATOM   5116 C C     . ARG D 3 160 ? 87.858  27.129 61.976  1.00 39.76  ? 154 ARG B C     1 
ATOM   5117 O O     . ARG D 3 160 ? 88.059  27.993 62.827  1.00 42.18  ? 154 ARG B O     1 
ATOM   5118 C CB    . ARG D 3 160 ? 88.203  25.012 63.088  1.00 18.08  ? 154 ARG B CB    1 
ATOM   5119 C CG    . ARG D 3 160 ? 88.335  23.549 62.911  1.00 16.45  ? 154 ARG B CG    1 
ATOM   5120 C CD    . ARG D 3 160 ? 88.083  22.896 64.241  1.00 30.10  ? 154 ARG B CD    1 
ATOM   5121 N NE    . ARG D 3 160 ? 86.779  22.252 64.319  1.00 49.46  ? 154 ARG B NE    1 
ATOM   5122 C CZ    . ARG D 3 160 ? 86.024  22.222 65.413  1.00 77.11  ? 154 ARG B CZ    1 
ATOM   5123 N NH1   . ARG D 3 160 ? 86.439  22.815 66.526  1.00 67.20  ? 154 ARG B NH1   1 
ATOM   5124 N NH2   . ARG D 3 160 ? 84.850  21.601 65.398  1.00 62.77  ? 154 ARG B NH2   1 
ATOM   5125 N N     . CYS D 3 161 ? 86.865  27.202 61.102  1.00 38.66  ? 155 CYS B N     1 
ATOM   5126 C CA    . CYS D 3 161 ? 85.949  28.330 61.048  1.00 38.94  ? 155 CYS B CA    1 
ATOM   5127 C C     . CYS D 3 161 ? 85.299  28.535 62.412  1.00 36.93  ? 155 CYS B C     1 
ATOM   5128 O O     . CYS D 3 161 ? 85.331  29.634 62.974  1.00 33.43  ? 155 CYS B O     1 
ATOM   5129 C CB    . CYS D 3 161 ? 84.861  28.032 60.023  1.00 42.01  ? 155 CYS B CB    1 
ATOM   5130 S SG    . CYS D 3 161 ? 84.175  29.495 59.193  1.00 47.86  ? 155 CYS B SG    1 
ATOM   5131 N N     . GLN D 3 162 ? 84.697  27.464 62.926  1.00 33.94  ? 156 GLN B N     1 
ATOM   5132 C CA    . GLN D 3 162 ? 84.037  27.481 64.231  1.00 33.47  ? 156 GLN B CA    1 
ATOM   5133 C C     . GLN D 3 162 ? 84.895  28.144 65.292  1.00 37.72  ? 156 GLN B C     1 
ATOM   5134 O O     . GLN D 3 162 ? 84.492  29.150 65.866  1.00 41.71  ? 156 GLN B O     1 
ATOM   5135 C CB    . GLN D 3 162 ? 83.675  26.068 64.682  1.00 34.22  ? 156 GLN B CB    1 
ATOM   5136 C CG    . GLN D 3 162 ? 82.329  25.980 65.378  1.00 56.23  ? 156 GLN B CG    1 
ATOM   5137 C CD    . GLN D 3 162 ? 82.073  24.617 65.961  1.00 85.11  ? 156 GLN B CD    1 
ATOM   5138 O OE1   . GLN D 3 162 ? 82.982  23.970 66.481  1.00 85.42  ? 156 GLN B OE1   1 
ATOM   5139 N NE2   . GLN D 3 162 ? 80.835  24.156 65.856  1.00 83.48  ? 156 GLN B NE2   1 
ATOM   5140 N N     . ASP D 3 163 ? 86.078  27.584 65.545  1.00 30.70  ? 157 ASP B N     1 
ATOM   5141 C CA    . ASP D 3 163 ? 86.994  28.142 66.543  1.00 26.92  ? 157 ASP B CA    1 
ATOM   5142 C C     . ASP D 3 163 ? 87.270  29.604 66.262  1.00 25.76  ? 157 ASP B C     1 
ATOM   5143 O O     . ASP D 3 163 ? 87.232  30.428 67.173  1.00 25.32  ? 157 ASP B O     1 
ATOM   5144 C CB    . ASP D 3 163 ? 88.290  27.339 66.639  1.00 26.88  ? 157 ASP B CB    1 
ATOM   5145 C CG    . ASP D 3 163 ? 88.036  25.858 66.786  1.00 40.79  ? 157 ASP B CG    1 
ATOM   5146 O OD1   . ASP D 3 163 ? 86.936  25.490 67.262  1.00 41.93  ? 157 ASP B OD1   1 
ATOM   5147 O OD2   . ASP D 3 163 ? 88.916  25.059 66.401  1.00 52.61  ? 157 ASP B OD2   1 
ATOM   5148 N N     . ILE D 3 164 ? 87.521  29.945 65.004  1.00 19.92  ? 158 ILE B N     1 
ATOM   5149 C CA    . ILE D 3 164 ? 87.789  31.347 64.680  1.00 21.52  ? 158 ILE B CA    1 
ATOM   5150 C C     . ILE D 3 164 ? 86.589  32.222 65.105  1.00 31.47  ? 158 ILE B C     1 
ATOM   5151 O O     . ILE D 3 164 ? 86.760  33.265 65.743  1.00 30.33  ? 158 ILE B O     1 
ATOM   5152 C CB    . ILE D 3 164 ? 88.147  31.562 63.167  1.00 23.71  ? 158 ILE B CB    1 
ATOM   5153 C CG1   . ILE D 3 164 ? 89.588  31.146 62.884  1.00 23.74  ? 158 ILE B CG1   1 
ATOM   5154 C CG2   . ILE D 3 164 ? 87.999  33.026 62.767  1.00 23.64  ? 158 ILE B CG2   1 
ATOM   5155 C CD1   . ILE D 3 164 ? 89.727  30.016 61.893  1.00 27.29  ? 158 ILE B CD1   1 
ATOM   5156 N N     . ARG D 3 165 ? 85.378  31.783 64.761  1.00 30.41  ? 159 ARG B N     1 
ATOM   5157 C CA    . ARG D 3 165 ? 84.170  32.535 65.097  1.00 29.01  ? 159 ARG B CA    1 
ATOM   5158 C C     . ARG D 3 165 ? 84.025  32.651 66.588  1.00 31.34  ? 159 ARG B C     1 
ATOM   5159 O O     . ARG D 3 165 ? 83.891  33.757 67.129  1.00 32.24  ? 159 ARG B O     1 
ATOM   5160 C CB    . ARG D 3 165 ? 82.923  31.841 64.568  1.00 24.19  ? 159 ARG B CB    1 
ATOM   5161 C CG    . ARG D 3 165 ? 81.633  32.580 64.915  1.00 21.72  ? 159 ARG B CG    1 
ATOM   5162 C CD    . ARG D 3 165 ? 80.396  31.732 64.595  1.00 19.66  ? 159 ARG B CD    1 
ATOM   5163 N NE    . ARG D 3 165 ? 80.312  30.585 65.490  1.00 13.36  ? 159 ARG B NE    1 
ATOM   5164 C CZ    . ARG D 3 165 ? 79.437  29.596 65.363  1.00 31.21  ? 159 ARG B CZ    1 
ATOM   5165 N NH1   . ARG D 3 165 ? 78.571  29.612 64.363  1.00 17.98  ? 159 ARG B NH1   1 
ATOM   5166 N NH2   . ARG D 3 165 ? 79.432  28.584 66.231  1.00 9.63   ? 159 ARG B NH2   1 
ATOM   5167 N N     . ASN D 3 166 ? 84.010  31.489 67.237  1.00 22.82  ? 160 ASN B N     1 
ATOM   5168 C CA    . ASN D 3 166 ? 83.843  31.400 68.677  1.00 22.64  ? 160 ASN B CA    1 
ATOM   5169 C C     . ASN D 3 166 ? 84.820  32.274 69.433  1.00 30.17  ? 160 ASN B C     1 
ATOM   5170 O O     . ASN D 3 166 ? 84.444  32.930 70.394  1.00 33.79  ? 160 ASN B O     1 
ATOM   5171 C CB    . ASN D 3 166 ? 83.961  29.959 69.150  1.00 21.47  ? 160 ASN B CB    1 
ATOM   5172 C CG    . ASN D 3 166 ? 82.756  29.129 68.778  1.00 25.81  ? 160 ASN B CG    1 
ATOM   5173 O OD1   . ASN D 3 166 ? 81.843  29.612 68.138  1.00 29.18  ? 160 ASN B OD1   1 
ATOM   5174 N ND2   . ASN D 3 166 ? 82.759  27.863 69.168  1.00 22.70  ? 160 ASN B ND2   1 
ATOM   5175 N N     . LEU D 3 167 ? 86.075  32.290 69.003  1.00 25.49  ? 161 LEU B N     1 
ATOM   5176 C CA    . LEU D 3 167 ? 87.081  33.095 69.676  1.00 22.75  ? 161 LEU B CA    1 
ATOM   5177 C C     . LEU D 3 167 ? 86.781  34.574 69.512  1.00 22.68  ? 161 LEU B C     1 
ATOM   5178 O O     . LEU D 3 167 ? 87.024  35.363 70.419  1.00 26.16  ? 161 LEU B O     1 
ATOM   5179 C CB    . LEU D 3 167 ? 88.477  32.733 69.179  1.00 23.99  ? 161 LEU B CB    1 
ATOM   5180 C CG    . LEU D 3 167 ? 89.686  33.372 69.881  1.00 29.48  ? 161 LEU B CG    1 
ATOM   5181 C CD1   . LEU D 3 167 ? 89.502  33.431 71.414  1.00 28.79  ? 161 LEU B CD1   1 
ATOM   5182 C CD2   . LEU D 3 167 ? 91.012  32.689 69.477  1.00 23.68  ? 161 LEU B CD2   1 
ATOM   5183 N N     . ALA D 3 168 ? 86.199  34.942 68.375  1.00 17.70  ? 162 ALA B N     1 
ATOM   5184 C CA    . ALA D 3 168 ? 85.815  36.337 68.098  1.00 17.90  ? 162 ALA B CA    1 
ATOM   5185 C C     . ALA D 3 168 ? 84.618  36.710 68.956  1.00 24.19  ? 162 ALA B C     1 
ATOM   5186 O O     . ALA D 3 168 ? 84.572  37.779 69.543  1.00 23.29  ? 162 ALA B O     1 
ATOM   5187 C CB    . ALA D 3 168 ? 85.452  36.503 66.631  1.00 18.49  ? 162 ALA B CB    1 
ATOM   5188 N N     . PHE D 3 169 ? 83.642  35.809 69.020  1.00 24.36  ? 163 PHE B N     1 
ATOM   5189 C CA    . PHE D 3 169 ? 82.456  36.037 69.827  1.00 23.33  ? 163 PHE B CA    1 
ATOM   5190 C C     . PHE D 3 169 ? 82.884  36.303 71.252  1.00 27.90  ? 163 PHE B C     1 
ATOM   5191 O O     . PHE D 3 169 ? 82.569  37.352 71.809  1.00 29.58  ? 163 PHE B O     1 
ATOM   5192 C CB    . PHE D 3 169 ? 81.532  34.826 69.816  1.00 25.04  ? 163 PHE B CB    1 
ATOM   5193 C CG    . PHE D 3 169 ? 80.459  34.884 70.870  1.00 27.52  ? 163 PHE B CG    1 
ATOM   5194 C CD1   . PHE D 3 169 ? 79.459  35.849 70.808  1.00 28.24  ? 163 PHE B CD1   1 
ATOM   5195 C CD2   . PHE D 3 169 ? 80.462  33.991 71.933  1.00 29.35  ? 163 PHE B CD2   1 
ATOM   5196 C CE1   . PHE D 3 169 ? 78.483  35.908 71.765  1.00 27.96  ? 163 PHE B CE1   1 
ATOM   5197 C CE2   . PHE D 3 169 ? 79.478  34.039 72.891  1.00 32.34  ? 163 PHE B CE2   1 
ATOM   5198 C CZ    . PHE D 3 169 ? 78.488  35.002 72.810  1.00 29.86  ? 163 PHE B CZ    1 
ATOM   5199 N N     . LEU D 3 170 ? 83.582  35.344 71.855  1.00 22.18  ? 164 LEU B N     1 
ATOM   5200 C CA    . LEU D 3 170 ? 84.028  35.528 73.235  1.00 21.99  ? 164 LEU B CA    1 
ATOM   5201 C C     . LEU D 3 170 ? 84.790  36.854 73.396  1.00 30.22  ? 164 LEU B C     1 
ATOM   5202 O O     . LEU D 3 170 ? 84.604  37.567 74.389  1.00 30.60  ? 164 LEU B O     1 
ATOM   5203 C CB    . LEU D 3 170 ? 84.847  34.337 73.745  1.00 19.85  ? 164 LEU B CB    1 
ATOM   5204 C CG    . LEU D 3 170 ? 84.118  33.001 73.861  1.00 21.40  ? 164 LEU B CG    1 
ATOM   5205 C CD1   . LEU D 3 170 ? 85.116  31.855 73.926  1.00 21.75  ? 164 LEU B CD1   1 
ATOM   5206 C CD2   . LEU D 3 170 ? 83.203  32.956 75.068  1.00 17.82  ? 164 LEU B CD2   1 
ATOM   5207 N N     . GLY D 3 171 ? 85.605  37.197 72.398  1.00 27.49  ? 165 GLY B N     1 
ATOM   5208 C CA    . GLY D 3 171 ? 86.391  38.430 72.421  1.00 28.16  ? 165 GLY B CA    1 
ATOM   5209 C C     . GLY D 3 171 ? 85.511  39.664 72.574  1.00 34.27  ? 165 GLY B C     1 
ATOM   5210 O O     . GLY D 3 171 ? 85.760  40.506 73.437  1.00 36.86  ? 165 GLY B O     1 
ATOM   5211 N N     . ILE D 3 172 ? 84.479  39.765 71.740  1.00 29.63  ? 166 ILE B N     1 
ATOM   5212 C CA    . ILE D 3 172 ? 83.540  40.884 71.813  1.00 29.57  ? 166 ILE B CA    1 
ATOM   5213 C C     . ILE D 3 172 ? 82.731  40.836 73.121  1.00 30.35  ? 166 ILE B C     1 
ATOM   5214 O O     . ILE D 3 172 ? 82.563  41.841 73.797  1.00 27.85  ? 166 ILE B O     1 
ATOM   5215 C CB    . ILE D 3 172 ? 82.572  40.877 70.608  1.00 32.27  ? 166 ILE B CB    1 
ATOM   5216 C CG1   . ILE D 3 172 ? 83.226  41.570 69.410  1.00 31.39  ? 166 ILE B CG1   1 
ATOM   5217 C CG2   . ILE D 3 172 ? 81.246  41.541 70.987  1.00 32.49  ? 166 ILE B CG2   1 
ATOM   5218 C CD1   . ILE D 3 172 ? 82.577  41.276 68.098  1.00 29.77  ? 166 ILE B CD1   1 
ATOM   5219 N N     . ALA D 3 173 ? 82.237  39.650 73.459  1.00 27.27  ? 167 ALA B N     1 
ATOM   5220 C CA    . ALA D 3 173 ? 81.459  39.445 74.673  1.00 26.17  ? 167 ALA B CA    1 
ATOM   5221 C C     . ALA D 3 173 ? 82.201  40.039 75.855  1.00 32.60  ? 167 ALA B C     1 
ATOM   5222 O O     . ALA D 3 173 ? 81.651  40.864 76.595  1.00 34.19  ? 167 ALA B O     1 
ATOM   5223 C CB    . ALA D 3 173 ? 81.212  37.958 74.905  1.00 26.08  ? 167 ALA B CB    1 
ATOM   5224 N N     . TYR D 3 174 ? 83.446  39.613 76.044  1.00 26.20  ? 168 TYR B N     1 
ATOM   5225 C CA    . TYR D 3 174 ? 84.232  40.113 77.167  1.00 26.26  ? 168 TYR B CA    1 
ATOM   5226 C C     . TYR D 3 174 ? 84.578  41.582 77.011  1.00 31.46  ? 168 TYR B C     1 
ATOM   5227 O O     . TYR D 3 174 ? 84.469  42.370 77.954  1.00 31.08  ? 168 TYR B O     1 
ATOM   5228 C CB    . TYR D 3 174 ? 85.529  39.312 77.354  1.00 26.66  ? 168 TYR B CB    1 
ATOM   5229 C CG    . TYR D 3 174 ? 86.382  39.837 78.489  1.00 25.02  ? 168 TYR B CG    1 
ATOM   5230 C CD1   . TYR D 3 174 ? 86.034  39.595 79.820  1.00 26.32  ? 168 TYR B CD1   1 
ATOM   5231 C CD2   . TYR D 3 174 ? 87.504  40.623 78.234  1.00 24.28  ? 168 TYR B CD2   1 
ATOM   5232 C CE1   . TYR D 3 174 ? 86.789  40.113 80.857  1.00 28.13  ? 168 TYR B CE1   1 
ATOM   5233 C CE2   . TYR D 3 174 ? 88.273  41.136 79.268  1.00 24.22  ? 168 TYR B CE2   1 
ATOM   5234 C CZ    . TYR D 3 174 ? 87.909  40.882 80.575  1.00 34.61  ? 168 TYR B CZ    1 
ATOM   5235 O OH    . TYR D 3 174 ? 88.676  41.397 81.588  1.00 35.81  ? 168 TYR B OH    1 
ATOM   5236 N N     . ASN D 3 175 ? 85.026  41.943 75.817  1.00 26.58  ? 169 ASN B N     1 
ATOM   5237 C CA    . ASN D 3 175 ? 85.438  43.306 75.563  1.00 26.47  ? 169 ASN B CA    1 
ATOM   5238 C C     . ASN D 3 175 ? 84.311  44.303 75.763  1.00 31.19  ? 169 ASN B C     1 
ATOM   5239 O O     . ASN D 3 175 ? 84.438  45.244 76.544  1.00 31.58  ? 169 ASN B O     1 
ATOM   5240 C CB    . ASN D 3 175 ? 86.029  43.428 74.154  1.00 30.57  ? 169 ASN B CB    1 
ATOM   5241 C CG    . ASN D 3 175 ? 86.822  44.711 73.957  1.00 48.98  ? 169 ASN B CG    1 
ATOM   5242 O OD1   . ASN D 3 175 ? 87.836  44.715 73.266  1.00 40.65  ? 169 ASN B OD1   1 
ATOM   5243 N ND2   . ASN D 3 175 ? 86.346  45.809 74.538  1.00 38.17  ? 169 ASN B ND2   1 
ATOM   5244 N N     . THR D 3 176 ? 83.212  44.086 75.045  1.00 28.09  ? 170 THR B N     1 
ATOM   5245 C CA    . THR D 3 176 ? 82.046  44.973 75.069  1.00 28.44  ? 170 THR B CA    1 
ATOM   5246 C C     . THR D 3 176 ? 81.030  44.812 76.211  1.00 32.98  ? 170 THR B C     1 
ATOM   5247 O O     . THR D 3 176 ? 80.290  45.737 76.510  1.00 35.82  ? 170 THR B O     1 
ATOM   5248 C CB    . THR D 3 176 ? 81.261  44.873 73.745  1.00 32.47  ? 170 THR B CB    1 
ATOM   5249 O OG1   . THR D 3 176 ? 80.725  43.551 73.613  1.00 34.67  ? 170 THR B OG1   1 
ATOM   5250 C CG2   . THR D 3 176 ? 82.172  45.156 72.552  1.00 26.51  ? 170 THR B CG2   1 
ATOM   5251 N N     . LEU D 3 177 ? 80.950  43.632 76.804  1.00 28.85  ? 171 LEU B N     1 
ATOM   5252 C CA    . LEU D 3 177 ? 79.954  43.372 77.832  1.00 28.22  ? 171 LEU B CA    1 
ATOM   5253 C C     . LEU D 3 177 ? 78.551  43.296 77.234  1.00 33.61  ? 171 LEU B C     1 
ATOM   5254 O O     . LEU D 3 177 ? 77.571  43.127 77.953  1.00 35.22  ? 171 LEU B O     1 
ATOM   5255 C CB    . LEU D 3 177 ? 79.996  44.430 78.928  1.00 28.50  ? 171 LEU B CB    1 
ATOM   5256 C CG    . LEU D 3 177 ? 81.136  44.300 79.940  1.00 34.43  ? 171 LEU B CG    1 
ATOM   5257 C CD1   . LEU D 3 177 ? 82.405  44.916 79.356  1.00 35.12  ? 171 LEU B CD1   1 
ATOM   5258 C CD2   . LEU D 3 177 ? 80.773  44.934 81.292  1.00 34.07  ? 171 LEU B CD2   1 
ATOM   5259 N N     . LEU D 3 178 ? 78.439  43.425 75.920  1.00 30.80  ? 172 LEU B N     1 
ATOM   5260 C CA    . LEU D 3 178 ? 77.119  43.357 75.293  1.00 28.73  ? 172 LEU B CA    1 
ATOM   5261 C C     . LEU D 3 178 ? 76.394  42.095 75.756  1.00 33.40  ? 172 LEU B C     1 
ATOM   5262 O O     . LEU D 3 178 ? 77.016  41.161 76.254  1.00 35.20  ? 172 LEU B O     1 
ATOM   5263 C CB    . LEU D 3 178 ? 77.266  43.344 73.770  1.00 27.01  ? 172 LEU B CB    1 
ATOM   5264 C CG    . LEU D 3 178 ? 77.621  44.695 73.159  1.00 25.91  ? 172 LEU B CG    1 
ATOM   5265 C CD1   . LEU D 3 178 ? 77.814  44.588 71.648  1.00 24.20  ? 172 LEU B CD1   1 
ATOM   5266 C CD2   . LEU D 3 178 ? 76.537  45.680 73.506  1.00 22.01  ? 172 LEU B CD2   1 
ATOM   5267 N N     . ARG D 3 179 ? 75.079  42.061 75.587  1.00 29.23  ? 173 ARG B N     1 
ATOM   5268 C CA    . ARG D 3 179 ? 74.294  40.875 75.959  1.00 28.67  ? 173 ARG B CA    1 
ATOM   5269 C C     . ARG D 3 179 ? 74.091  39.994 74.715  1.00 29.43  ? 173 ARG B C     1 
ATOM   5270 O O     . ARG D 3 179 ? 74.116  40.473 73.579  1.00 26.07  ? 173 ARG B O     1 
ATOM   5271 C CB    . ARG D 3 179 ? 72.935  41.261 76.583  1.00 29.01  ? 173 ARG B CB    1 
ATOM   5272 C CG    . ARG D 3 179 ? 73.009  42.124 77.877  1.00 35.68  ? 173 ARG B CG    1 
ATOM   5273 C CD    . ARG D 3 179 ? 71.578  42.451 78.380  1.00 38.50  ? 173 ARG B CD    1 
ATOM   5274 N NE    . ARG D 3 179 ? 71.547  43.553 79.343  1.00 43.52  ? 173 ARG B NE    1 
ATOM   5275 C CZ    . ARG D 3 179 ? 71.231  44.810 79.027  1.00 60.72  ? 173 ARG B CZ    1 
ATOM   5276 N NH1   . ARG D 3 179 ? 71.020  45.141 77.768  1.00 48.55  ? 173 ARG B NH1   1 
ATOM   5277 N NH2   . ARG D 3 179 ? 71.189  45.736 79.974  1.00 70.68  ? 173 ARG B NH2   1 
ATOM   5278 N N     . LEU D 3 180 ? 73.921  38.697 74.920  1.00 27.48  ? 174 LEU B N     1 
ATOM   5279 C CA    . LEU D 3 180 ? 73.758  37.785 73.795  1.00 27.05  ? 174 LEU B CA    1 
ATOM   5280 C C     . LEU D 3 180 ? 73.031  38.425 72.629  1.00 35.27  ? 174 LEU B C     1 
ATOM   5281 O O     . LEU D 3 180 ? 73.550  38.462 71.508  1.00 36.94  ? 174 LEU B O     1 
ATOM   5282 C CB    . LEU D 3 180 ? 73.014  36.511 74.204  1.00 26.31  ? 174 LEU B CB    1 
ATOM   5283 C CG    . LEU D 3 180 ? 73.811  35.563 75.096  1.00 28.86  ? 174 LEU B CG    1 
ATOM   5284 C CD1   . LEU D 3 180 ? 73.135  34.206 75.232  1.00 26.71  ? 174 LEU B CD1   1 
ATOM   5285 C CD2   . LEU D 3 180 ? 75.238  35.456 74.582  1.00 26.93  ? 174 LEU B CD2   1 
ATOM   5286 N N     . ALA D 3 181 ? 71.811  38.891 72.873  1.00 32.03  ? 175 ALA B N     1 
ATOM   5287 C CA    . ALA D 3 181 ? 70.996  39.444 71.792  1.00 32.10  ? 175 ALA B CA    1 
ATOM   5288 C C     . ALA D 3 181 ? 71.417  40.750 71.133  1.00 36.47  ? 175 ALA B C     1 
ATOM   5289 O O     . ALA D 3 181 ? 71.028  41.018 70.003  1.00 35.70  ? 175 ALA B O     1 
ATOM   5290 C CB    . ALA D 3 181 ? 69.534  39.431 72.134  1.00 33.24  ? 175 ALA B CB    1 
ATOM   5291 N N     . GLU D 3 182 ? 72.228  41.549 71.814  1.00 35.28  ? 176 GLU B N     1 
ATOM   5292 C CA    . GLU D 3 182 ? 72.725  42.779 71.210  1.00 35.17  ? 176 GLU B CA    1 
ATOM   5293 C C     . GLU D 3 182 ? 73.845  42.331 70.286  1.00 40.18  ? 176 GLU B C     1 
ATOM   5294 O O     . GLU D 3 182 ? 74.013  42.859 69.198  1.00 43.33  ? 176 GLU B O     1 
ATOM   5295 C CB    . GLU D 3 182 ? 73.277  43.729 72.273  1.00 37.07  ? 176 GLU B CB    1 
ATOM   5296 C CG    . GLU D 3 182 ? 72.218  44.350 73.144  1.00 48.11  ? 176 GLU B CG    1 
ATOM   5297 C CD    . GLU D 3 182 ? 72.610  44.351 74.598  1.00 55.22  ? 176 GLU B CD    1 
ATOM   5298 O OE1   . GLU D 3 182 ? 73.773  44.689 74.888  1.00 53.00  ? 176 GLU B OE1   1 
ATOM   5299 O OE2   . GLU D 3 182 ? 71.763  44.004 75.444  1.00 51.28  ? 176 GLU B OE2   1 
ATOM   5300 N N     . ILE D 3 183 ? 74.595  41.325 70.722  1.00 35.58  ? 177 ILE B N     1 
ATOM   5301 C CA    . ILE D 3 183 ? 75.673  40.772 69.916  1.00 34.23  ? 177 ILE B CA    1 
ATOM   5302 C C     . ILE D 3 183 ? 75.072  40.112 68.675  1.00 34.89  ? 177 ILE B C     1 
ATOM   5303 O O     . ILE D 3 183 ? 75.506  40.372 67.554  1.00 35.49  ? 177 ILE B O     1 
ATOM   5304 C CB    . ILE D 3 183 ? 76.523  39.739 70.723  1.00 36.15  ? 177 ILE B CB    1 
ATOM   5305 C CG1   . ILE D 3 183 ? 77.321  40.441 71.827  1.00 34.42  ? 177 ILE B CG1   1 
ATOM   5306 C CG2   . ILE D 3 183 ? 77.489  38.984 69.811  1.00 35.30  ? 177 ILE B CG2   1 
ATOM   5307 C CD1   . ILE D 3 183 ? 78.066  39.478 72.711  1.00 32.12  ? 177 ILE B CD1   1 
ATOM   5308 N N     . ALA D 3 184 ? 74.060  39.278 68.882  1.00 30.39  ? 178 ALA B N     1 
ATOM   5309 C CA    . ALA D 3 184 ? 73.399  38.585 67.771  1.00 31.25  ? 178 ALA B CA    1 
ATOM   5310 C C     . ALA D 3 184 ? 72.711  39.500 66.753  1.00 40.08  ? 178 ALA B C     1 
ATOM   5311 O O     . ALA D 3 184 ? 72.243  39.034 65.713  1.00 41.61  ? 178 ALA B O     1 
ATOM   5312 C CB    . ALA D 3 184 ? 72.414  37.544 68.284  1.00 31.14  ? 178 ALA B CB    1 
ATOM   5313 N N     . ARG D 3 185 ? 72.621  40.789 67.056  1.00 36.71  ? 179 ARG B N     1 
ATOM   5314 C CA    . ARG D 3 185 ? 71.974  41.718 66.141  1.00 35.62  ? 179 ARG B CA    1 
ATOM   5315 C C     . ARG D 3 185 ? 72.998  42.568 65.405  1.00 41.58  ? 179 ARG B C     1 
ATOM   5316 O O     . ARG D 3 185 ? 72.642  43.335 64.505  1.00 42.36  ? 179 ARG B O     1 
ATOM   5317 C CB    . ARG D 3 185 ? 70.991  42.616 66.885  1.00 33.06  ? 179 ARG B CB    1 
ATOM   5318 C CG    . ARG D 3 185 ? 69.759  41.904 67.396  1.00 36.04  ? 179 ARG B CG    1 
ATOM   5319 C CD    . ARG D 3 185 ? 68.682  42.903 67.863  1.00 45.88  ? 179 ARG B CD    1 
ATOM   5320 N NE    . ARG D 3 185 ? 69.086  43.691 69.033  1.00 33.27  ? 179 ARG B NE    1 
ATOM   5321 C CZ    . ARG D 3 185 ? 68.634  43.478 70.265  1.00 43.05  ? 179 ARG B CZ    1 
ATOM   5322 N NH1   . ARG D 3 185 ? 67.776  42.495 70.493  1.00 39.07  ? 179 ARG B NH1   1 
ATOM   5323 N NH2   . ARG D 3 185 ? 69.042  44.233 71.274  1.00 26.89  ? 179 ARG B NH2   1 
ATOM   5324 N N     . ILE D 3 186 ? 74.267  42.448 65.788  1.00 36.34  ? 180 ILE B N     1 
ATOM   5325 C CA    . ILE D 3 186 ? 75.298  43.221 65.117  1.00 35.00  ? 180 ILE B CA    1 
ATOM   5326 C C     . ILE D 3 186 ? 75.339  42.846 63.645  1.00 38.34  ? 180 ILE B C     1 
ATOM   5327 O O     . ILE D 3 186 ? 75.574  41.687 63.294  1.00 37.68  ? 180 ILE B O     1 
ATOM   5328 C CB    . ILE D 3 186 ? 76.691  42.994 65.704  1.00 37.57  ? 180 ILE B CB    1 
ATOM   5329 C CG1   . ILE D 3 186 ? 76.730  43.395 67.177  1.00 37.99  ? 180 ILE B CG1   1 
ATOM   5330 C CG2   . ILE D 3 186 ? 77.730  43.778 64.885  1.00 36.80  ? 180 ILE B CG2   1 
ATOM   5331 C CD1   . ILE D 3 186 ? 78.128  43.354 67.771  1.00 52.14  ? 180 ILE B CD1   1 
ATOM   5332 N N     . ARG D 3 187 ? 75.097  43.835 62.794  1.00 35.23  ? 181 ARG B N     1 
ATOM   5333 C CA    . ARG D 3 187 ? 75.130  43.650 61.346  1.00 36.35  ? 181 ARG B CA    1 
ATOM   5334 C C     . ARG D 3 187 ? 76.476  44.212 60.872  1.00 40.26  ? 181 ARG B C     1 
ATOM   5335 O O     . ARG D 3 187 ? 77.036  45.107 61.512  1.00 40.18  ? 181 ARG B O     1 
ATOM   5336 C CB    . ARG D 3 187 ? 73.963  44.404 60.678  1.00 37.14  ? 181 ARG B CB    1 
ATOM   5337 C CG    . ARG D 3 187 ? 72.718  43.556 60.408  1.00 33.24  ? 181 ARG B CG    1 
ATOM   5338 C CD    . ARG D 3 187 ? 71.552  44.424 59.934  1.00 40.50  ? 181 ARG B CD    1 
ATOM   5339 N NE    . ARG D 3 187 ? 70.234  43.857 60.246  1.00 46.95  ? 181 ARG B NE    1 
ATOM   5340 C CZ    . ARG D 3 187 ? 69.605  42.975 59.476  1.00 45.07  ? 181 ARG B CZ    1 
ATOM   5341 N NH1   . ARG D 3 187 ? 70.211  42.495 58.401  1.00 38.45  ? 181 ARG B NH1   1 
ATOM   5342 N NH2   . ARG D 3 187 ? 68.422  42.498 59.816  1.00 26.78  ? 181 ARG B NH2   1 
ATOM   5343 N N     . VAL D 3 188 ? 77.004  43.671 59.776  1.00 35.56  ? 182 VAL B N     1 
ATOM   5344 C CA    . VAL D 3 188 ? 78.301  44.096 59.245  1.00 35.21  ? 182 VAL B CA    1 
ATOM   5345 C C     . VAL D 3 188 ? 78.409  45.611 59.057  1.00 45.98  ? 182 VAL B C     1 
ATOM   5346 O O     . VAL D 3 188 ? 79.428  46.216 59.408  1.00 47.37  ? 182 VAL B O     1 
ATOM   5347 C CB    . VAL D 3 188 ? 78.657  43.368 57.917  1.00 36.75  ? 182 VAL B CB    1 
ATOM   5348 C CG1   . VAL D 3 188 ? 79.929  43.943 57.317  1.00 35.70  ? 182 VAL B CG1   1 
ATOM   5349 C CG2   . VAL D 3 188 ? 78.807  41.867 58.142  1.00 35.86  ? 182 VAL B CG2   1 
ATOM   5350 N N     . LYS D 3 189 ? 77.362  46.220 58.501  1.00 43.95  ? 183 LYS B N     1 
ATOM   5351 C CA    . LYS D 3 189 ? 77.341  47.664 58.278  1.00 43.68  ? 183 LYS B CA    1 
ATOM   5352 C C     . LYS D 3 189 ? 77.428  48.424 59.597  1.00 47.79  ? 183 LYS B C     1 
ATOM   5353 O O     . LYS D 3 189 ? 77.476  49.652 59.618  1.00 49.85  ? 183 LYS B O     1 
ATOM   5354 C CB    . LYS D 3 189 ? 76.043  48.058 57.573  1.00 46.74  ? 183 LYS B CB    1 
ATOM   5355 C CG    . LYS D 3 189 ? 74.821  47.366 58.149  1.00 70.46  ? 183 LYS B CG    1 
ATOM   5356 C CD    . LYS D 3 189 ? 73.724  48.343 58.515  1.00 84.15  ? 183 LYS B CD    1 
ATOM   5357 C CE    . LYS D 3 189 ? 72.771  48.531 57.348  1.00 98.47  ? 183 LYS B CE    1 
ATOM   5358 N NZ    . LYS D 3 189 ? 71.335  48.576 57.764  1.00 100.00 ? 183 LYS B NZ    1 
ATOM   5359 N N     . ASP D 3 190 ? 77.492  47.691 60.703  1.00 41.58  ? 184 ASP B N     1 
ATOM   5360 C CA    . ASP D 3 190 ? 77.530  48.320 62.012  1.00 39.63  ? 184 ASP B CA    1 
ATOM   5361 C C     . ASP D 3 190 ? 78.917  48.547 62.558  1.00 44.02  ? 184 ASP B C     1 
ATOM   5362 O O     . ASP D 3 190 ? 79.086  49.251 63.551  1.00 44.26  ? 184 ASP B O     1 
ATOM   5363 C CB    . ASP D 3 190 ? 76.662  47.557 62.999  1.00 40.52  ? 184 ASP B CB    1 
ATOM   5364 C CG    . ASP D 3 190 ? 75.193  47.748 62.729  1.00 47.02  ? 184 ASP B CG    1 
ATOM   5365 O OD1   . ASP D 3 190 ? 74.834  48.743 62.069  1.00 51.57  ? 184 ASP B OD1   1 
ATOM   5366 O OD2   . ASP D 3 190 ? 74.402  46.887 63.153  1.00 50.38  ? 184 ASP B OD2   1 
ATOM   5367 N N     . ILE D 3 191 ? 79.920  47.978 61.896  1.00 40.94  ? 185 ILE B N     1 
ATOM   5368 C CA    . ILE D 3 191 ? 81.301  48.155 62.341  1.00 40.17  ? 185 ILE B CA    1 
ATOM   5369 C C     . ILE D 3 191 ? 81.959  49.356 61.692  1.00 47.79  ? 185 ILE B C     1 
ATOM   5370 O O     . ILE D 3 191 ? 81.739  49.640 60.513  1.00 45.67  ? 185 ILE B O     1 
ATOM   5371 C CB    . ILE D 3 191 ? 82.187  46.918 62.078  1.00 40.43  ? 185 ILE B CB    1 
ATOM   5372 C CG1   . ILE D 3 191 ? 81.660  45.699 62.834  1.00 39.89  ? 185 ILE B CG1   1 
ATOM   5373 C CG2   . ILE D 3 191 ? 83.610  47.210 62.492  1.00 37.39  ? 185 ILE B CG2   1 
ATOM   5374 C CD1   . ILE D 3 191 ? 81.663  44.426 62.023  1.00 48.20  ? 185 ILE B CD1   1 
ATOM   5375 N N     . SER D 3 192 ? 82.800  50.034 62.466  1.00 48.93  ? 186 SER B N     1 
ATOM   5376 C CA    . SER D 3 192 ? 83.527  51.212 61.992  1.00 48.55  ? 186 SER B CA    1 
ATOM   5377 C C     . SER D 3 192 ? 84.967  51.061 62.444  1.00 52.67  ? 186 SER B C     1 
ATOM   5378 O O     . SER D 3 192 ? 85.371  49.975 62.843  1.00 54.23  ? 186 SER B O     1 
ATOM   5379 C CB    . SER D 3 192 ? 82.930  52.486 62.601  1.00 52.20  ? 186 SER B CB    1 
ATOM   5380 O OG    . SER D 3 192 ? 81.907  52.191 63.547  1.00 65.71  ? 186 SER B OG    1 
ATOM   5381 N N     . ARG D 3 193 ? 85.728  52.150 62.404  1.00 49.08  ? 187 ARG B N     1 
ATOM   5382 C CA    . ARG D 3 193 ? 87.112  52.115 62.841  1.00 49.31  ? 187 ARG B CA    1 
ATOM   5383 C C     . ARG D 3 193 ? 87.512  53.444 63.409  1.00 56.15  ? 187 ARG B C     1 
ATOM   5384 O O     . ARG D 3 193 ? 87.146  54.482 62.871  1.00 55.24  ? 187 ARG B O     1 
ATOM   5385 C CB    . ARG D 3 193 ? 88.039  51.845 61.665  1.00 50.20  ? 187 ARG B CB    1 
ATOM   5386 C CG    . ARG D 3 193 ? 87.807  50.513 61.016  1.00 70.10  ? 187 ARG B CG    1 
ATOM   5387 C CD    . ARG D 3 193 ? 89.027  49.619 61.105  1.00 75.24  ? 187 ARG B CD    1 
ATOM   5388 N NE    . ARG D 3 193 ? 88.759  48.352 60.443  1.00 79.59  ? 187 ARG B NE    1 
ATOM   5389 C CZ    . ARG D 3 193 ? 89.480  47.252 60.619  1.00 83.58  ? 187 ARG B CZ    1 
ATOM   5390 N NH1   . ARG D 3 193 ? 90.507  47.259 61.463  1.00 66.23  ? 187 ARG B NH1   1 
ATOM   5391 N NH2   . ARG D 3 193 ? 89.151  46.133 59.992  1.00 55.29  ? 187 ARG B NH2   1 
ATOM   5392 N N     . THR D 3 194 ? 88.313  53.415 64.463  1.00 56.99  ? 188 THR B N     1 
ATOM   5393 C CA    . THR D 3 194 ? 88.900  54.620 65.010  1.00 59.64  ? 188 THR B CA    1 
ATOM   5394 C C     . THR D 3 194 ? 90.065  54.794 64.028  1.00 69.85  ? 188 THR B C     1 
ATOM   5395 O O     . THR D 3 194 ? 90.447  53.838 63.350  1.00 69.90  ? 188 THR B O     1 
ATOM   5396 C CB    . THR D 3 194 ? 89.471  54.360 66.438  1.00 63.28  ? 188 THR B CB    1 
ATOM   5397 O OG1   . THR D 3 194 ? 90.606  53.489 66.344  1.00 56.35  ? 188 THR B OG1   1 
ATOM   5398 C CG2   . THR D 3 194 ? 88.422  53.714 67.336  1.00 57.66  ? 188 THR B CG2   1 
ATOM   5399 N N     . ASP D 3 195 ? 90.655  55.980 63.959  1.00 68.59  ? 189 ASP B N     1 
ATOM   5400 C CA    . ASP D 3 195 ? 91.766  56.202 63.037  1.00 68.47  ? 189 ASP B CA    1 
ATOM   5401 C C     . ASP D 3 195 ? 92.927  55.261 63.276  1.00 68.94  ? 189 ASP B C     1 
ATOM   5402 O O     . ASP D 3 195 ? 93.718  54.988 62.367  1.00 68.30  ? 189 ASP B O     1 
ATOM   5403 C CB    . ASP D 3 195 ? 92.271  57.629 63.145  1.00 71.95  ? 189 ASP B CB    1 
ATOM   5404 C CG    . ASP D 3 195 ? 91.456  58.594 62.300  1.00 93.66  ? 189 ASP B CG    1 
ATOM   5405 O OD1   . ASP D 3 195 ? 90.626  58.133 61.485  1.00 94.88  ? 189 ASP B OD1   1 
ATOM   5406 O OD2   . ASP D 3 195 ? 91.639  59.819 62.462  1.00 100.00 ? 189 ASP B OD2   1 
ATOM   5407 N N     . GLY D 3 196 ? 93.055  54.841 64.537  1.00 62.24  ? 190 GLY B N     1 
ATOM   5408 C CA    . GLY D 3 196 ? 94.147  53.990 65.033  1.00 60.26  ? 190 GLY B CA    1 
ATOM   5409 C C     . GLY D 3 196 ? 94.014  52.524 64.648  1.00 60.27  ? 190 GLY B C     1 
ATOM   5410 O O     . GLY D 3 196 ? 94.927  51.726 64.881  1.00 57.52  ? 190 GLY B O     1 
ATOM   5411 N N     . GLY D 3 197 ? 92.855  52.182 64.083  1.00 57.43  ? 191 GLY B N     1 
ATOM   5412 C CA    . GLY D 3 197 ? 92.591  50.830 63.595  1.00 58.04  ? 191 GLY B CA    1 
ATOM   5413 C C     . GLY D 3 197 ? 91.670  49.955 64.442  1.00 61.45  ? 191 GLY B C     1 
ATOM   5414 O O     . GLY D 3 197 ? 91.380  48.813 64.075  1.00 63.86  ? 191 GLY B O     1 
ATOM   5415 N N     . ARG D 3 198 ? 91.217  50.471 65.576  1.00 52.64  ? 192 ARG B N     1 
ATOM   5416 C CA    . ARG D 3 198 ? 90.351  49.681 66.434  1.00 50.49  ? 192 ARG B CA    1 
ATOM   5417 C C     . ARG D 3 198 ? 88.942  49.618 65.868  1.00 53.63  ? 192 ARG B C     1 
ATOM   5418 O O     . ARG D 3 198 ? 88.414  50.606 65.343  1.00 51.61  ? 192 ARG B O     1 
ATOM   5419 C CB    . ARG D 3 198 ? 90.329  50.246 67.848  1.00 47.16  ? 192 ARG B CB    1 
ATOM   5420 C CG    . ARG D 3 198 ? 91.634  50.067 68.596  1.00 48.65  ? 192 ARG B CG    1 
ATOM   5421 C CD    . ARG D 3 198 ? 91.722  51.032 69.759  1.00 49.15  ? 192 ARG B CD    1 
ATOM   5422 N NE    . ARG D 3 198 ? 92.981  51.765 69.753  1.00 48.32  ? 192 ARG B NE    1 
ATOM   5423 C CZ    . ARG D 3 198 ? 94.094  51.312 70.312  1.00 66.85  ? 192 ARG B CZ    1 
ATOM   5424 N NH1   . ARG D 3 198 ? 94.087  50.134 70.917  1.00 53.97  ? 192 ARG B NH1   1 
ATOM   5425 N NH2   . ARG D 3 198 ? 95.207  52.031 70.256  1.00 53.48  ? 192 ARG B NH2   1 
ATOM   5426 N N     . MET D 3 199 ? 88.328  48.446 65.967  1.00 49.85  ? 193 MET B N     1 
ATOM   5427 C CA    . MET D 3 199 ? 86.977  48.298 65.460  1.00 48.34  ? 193 MET B CA    1 
ATOM   5428 C C     . MET D 3 199 ? 85.977  48.936 66.408  1.00 52.02  ? 193 MET B C     1 
ATOM   5429 O O     . MET D 3 199 ? 86.118  48.878 67.632  1.00 49.58  ? 193 MET B O     1 
ATOM   5430 C CB    . MET D 3 199 ? 86.630  46.832 65.205  1.00 50.28  ? 193 MET B CB    1 
ATOM   5431 C CG    . MET D 3 199 ? 86.476  46.495 63.729  1.00 55.00  ? 193 MET B CG    1 
ATOM   5432 S SD    . MET D 3 199 ? 86.510  44.718 63.353  1.00 60.72  ? 193 MET B SD    1 
ATOM   5433 C CE    . MET D 3 199 ? 85.606  44.050 64.735  1.00 57.88  ? 193 MET B CE    1 
ATOM   5434 N N     . LEU D 3 200 ? 84.980  49.585 65.827  1.00 51.13  ? 194 LEU B N     1 
ATOM   5435 C CA    . LEU D 3 200 ? 83.921  50.214 66.597  1.00 49.87  ? 194 LEU B CA    1 
ATOM   5436 C C     . LEU D 3 200 ? 82.620  49.520 66.203  1.00 50.32  ? 194 LEU B C     1 
ATOM   5437 O O     . LEU D 3 200 ? 82.345  49.316 65.012  1.00 49.23  ? 194 LEU B O     1 
ATOM   5438 C CB    . LEU D 3 200 ? 83.849  51.707 66.280  1.00 49.71  ? 194 LEU B CB    1 
ATOM   5439 C CG    . LEU D 3 200 ? 84.869  52.560 67.028  1.00 54.11  ? 194 LEU B CG    1 
ATOM   5440 C CD1   . LEU D 3 200 ? 84.726  54.019 66.625  1.00 54.21  ? 194 LEU B CD1   1 
ATOM   5441 C CD2   . LEU D 3 200 ? 84.703  52.384 68.533  1.00 54.98  ? 194 LEU B CD2   1 
ATOM   5442 N N     . ILE D 3 201 ? 81.852  49.115 67.207  1.00 42.95  ? 195 ILE B N     1 
ATOM   5443 C CA    . ILE D 3 201 ? 80.587  48.441 66.978  1.00 41.27  ? 195 ILE B CA    1 
ATOM   5444 C C     . ILE D 3 201 ? 79.443  49.307 67.474  1.00 39.12  ? 195 ILE B C     1 
ATOM   5445 O O     . ILE D 3 201 ? 79.398  49.686 68.642  1.00 36.50  ? 195 ILE B O     1 
ATOM   5446 C CB    . ILE D 3 201 ? 80.549  47.090 67.678  1.00 45.47  ? 195 ILE B CB    1 
ATOM   5447 C CG1   . ILE D 3 201 ? 81.770  46.262 67.281  1.00 46.28  ? 195 ILE B CG1   1 
ATOM   5448 C CG2   . ILE D 3 201 ? 79.275  46.350 67.330  1.00 47.53  ? 195 ILE B CG2   1 
ATOM   5449 C CD1   . ILE D 3 201 ? 81.780  44.887 67.890  1.00 60.11  ? 195 ILE B CD1   1 
ATOM   5450 N N     . HIS D 3 202 ? 78.542  49.649 66.562  1.00 34.34  ? 196 HIS B N     1 
ATOM   5451 C CA    . HIS D 3 202 ? 77.410  50.499 66.886  1.00 34.39  ? 196 HIS B CA    1 
ATOM   5452 C C     . HIS D 3 202 ? 76.247  49.655 67.344  1.00 39.78  ? 196 HIS B C     1 
ATOM   5453 O O     . HIS D 3 202 ? 75.821  48.734 66.638  1.00 40.40  ? 196 HIS B O     1 
ATOM   5454 C CB    . HIS D 3 202 ? 76.970  51.304 65.653  1.00 36.05  ? 196 HIS B CB    1 
ATOM   5455 C CG    . HIS D 3 202 ? 75.776  52.165 65.904  1.00 39.46  ? 196 HIS B CG    1 
ATOM   5456 N ND1   . HIS D 3 202 ? 75.883  53.454 66.386  1.00 41.10  ? 196 HIS B ND1   1 
ATOM   5457 C CD2   . HIS D 3 202 ? 74.451  51.902 65.808  1.00 40.06  ? 196 HIS B CD2   1 
ATOM   5458 C CE1   . HIS D 3 202 ? 74.673  53.954 66.556  1.00 40.24  ? 196 HIS B CE1   1 
ATOM   5459 N NE2   . HIS D 3 202 ? 73.787  53.034 66.214  1.00 40.00  ? 196 HIS B NE2   1 
ATOM   5460 N N     . ILE D 3 203 ? 75.707  49.991 68.508  1.00 37.99  ? 197 ILE B N     1 
ATOM   5461 C CA    . ILE D 3 203 ? 74.586  49.250 69.078  1.00 38.62  ? 197 ILE B CA    1 
ATOM   5462 C C     . ILE D 3 203 ? 73.325  50.092 69.139  1.00 48.75  ? 197 ILE B C     1 
ATOM   5463 O O     . ILE D 3 203 ? 73.273  51.083 69.866  1.00 50.38  ? 197 ILE B O     1 
ATOM   5464 C CB    . ILE D 3 203 ? 74.893  48.756 70.508  1.00 40.11  ? 197 ILE B CB    1 
ATOM   5465 C CG1   . ILE D 3 203 ? 76.312  48.201 70.591  1.00 38.48  ? 197 ILE B CG1   1 
ATOM   5466 C CG2   . ILE D 3 203 ? 73.875  47.697 70.927  1.00 39.61  ? 197 ILE B CG2   1 
ATOM   5467 C CD1   . ILE D 3 203 ? 76.505  46.944 69.746  1.00 31.47  ? 197 ILE B CD1   1 
ATOM   5468 N N     . GLY D 3 204 ? 72.305  49.686 68.389  1.00 46.79  ? 198 GLY B N     1 
ATOM   5469 C CA    . GLY D 3 204 ? 71.040  50.404 68.373  1.00 47.54  ? 198 GLY B CA    1 
ATOM   5470 C C     . GLY D 3 204 ? 70.208  50.184 69.639  1.00 54.37  ? 198 GLY B C     1 
ATOM   5471 O O     . GLY D 3 204 ? 70.083  51.080 70.470  1.00 58.67  ? 198 GLY B O     1 
ATOM   5472 N N     . ARG D 3 205 ? 69.611  49.005 69.767  1.00 47.18  ? 199 ARG B N     1 
ATOM   5473 C CA    . ARG D 3 205 ? 68.766  48.714 70.916  1.00 45.59  ? 199 ARG B CA    1 
ATOM   5474 C C     . ARG D 3 205 ? 69.331  47.689 71.905  1.00 46.03  ? 199 ARG B C     1 
ATOM   5475 O O     . ARG D 3 205 ? 70.012  46.739 71.519  1.00 41.76  ? 199 ARG B O     1 
ATOM   5476 C CB    . ARG D 3 205 ? 67.349  48.336 70.459  1.00 43.86  ? 199 ARG B CB    1 
ATOM   5477 C CG    . ARG D 3 205 ? 67.010  46.855 70.570  1.00 46.53  ? 199 ARG B CG    1 
ATOM   5478 C CD    . ARG D 3 205 ? 65.518  46.593 70.345  1.00 41.48  ? 199 ARG B CD    1 
ATOM   5479 N NE    . ARG D 3 205 ? 65.300  45.603 69.296  1.00 40.32  ? 199 ARG B NE    1 
ATOM   5480 C CZ    . ARG D 3 205 ? 64.933  44.350 69.519  1.00 60.55  ? 199 ARG B CZ    1 
ATOM   5481 N NH1   . ARG D 3 205 ? 64.708  43.939 70.759  1.00 49.07  ? 199 ARG B NH1   1 
ATOM   5482 N NH2   . ARG D 3 205 ? 64.774  43.512 68.500  1.00 60.55  ? 199 ARG B NH2   1 
ATOM   5483 N N     . THR D 3 206 ? 69.010  47.884 73.183  1.00 44.12  ? 200 THR B N     1 
ATOM   5484 C CA    . THR D 3 206 ? 69.455  46.996 74.246  1.00 45.15  ? 200 THR B CA    1 
ATOM   5485 C C     . THR D 3 206 ? 68.345  46.800 75.277  1.00 50.59  ? 200 THR B C     1 
ATOM   5486 O O     . THR D 3 206 ? 67.308  47.437 75.194  1.00 51.64  ? 200 THR B O     1 
ATOM   5487 C CB    . THR D 3 206 ? 70.670  47.589 74.935  1.00 51.61  ? 200 THR B CB    1 
ATOM   5488 O OG1   . THR D 3 206 ? 70.238  48.598 75.851  1.00 52.66  ? 200 THR B OG1   1 
ATOM   5489 C CG2   . THR D 3 206 ? 71.556  48.231 73.900  1.00 51.73  ? 200 THR B CG2   1 
ATOM   5490 N N     . LYS D 3 207 ? 68.563  45.910 76.238  1.00 48.24  ? 201 LYS B N     1 
ATOM   5491 C CA    . LYS D 3 207 ? 67.574  45.661 77.287  1.00 49.44  ? 201 LYS B CA    1 
ATOM   5492 C C     . LYS D 3 207 ? 67.095  46.987 77.867  1.00 58.57  ? 201 LYS B C     1 
ATOM   5493 O O     . LYS D 3 207 ? 65.900  47.206 78.065  1.00 59.08  ? 201 LYS B O     1 
ATOM   5494 C CB    . LYS D 3 207 ? 68.195  44.825 78.421  1.00 50.20  ? 201 LYS B CB    1 
ATOM   5495 C CG    . LYS D 3 207 ? 67.212  43.918 79.170  1.00 49.73  ? 201 LYS B CG    1 
ATOM   5496 C CD    . LYS D 3 207 ? 67.242  44.202 80.671  1.00 62.11  ? 201 LYS B CD    1 
ATOM   5497 C CE    . LYS D 3 207 ? 66.759  43.028 81.518  1.00 62.92  ? 201 LYS B CE    1 
ATOM   5498 N NZ    . LYS D 3 207 ? 67.079  43.246 82.959  1.00 58.34  ? 201 LYS B NZ    1 
ATOM   5499 N N     . THR D 3 208 ? 68.049  47.866 78.142  1.00 56.67  ? 202 THR B N     1 
ATOM   5500 C CA    . THR D 3 208 ? 67.762  49.144 78.757  1.00 57.06  ? 202 THR B CA    1 
ATOM   5501 C C     . THR D 3 208 ? 67.633  50.383 77.858  1.00 64.36  ? 202 THR B C     1 
ATOM   5502 O O     . THR D 3 208 ? 67.419  51.483 78.367  1.00 67.04  ? 202 THR B O     1 
ATOM   5503 C CB    . THR D 3 208 ? 68.752  49.410 79.898  1.00 68.78  ? 202 THR B CB    1 
ATOM   5504 O OG1   . THR D 3 208 ? 70.055  49.647 79.354  1.00 78.36  ? 202 THR B OG1   1 
ATOM   5505 C CG2   . THR D 3 208 ? 68.819  48.195 80.809  1.00 64.16  ? 202 THR B CG2   1 
ATOM   5506 N N     . LEU D 3 209 ? 67.755  50.246 76.542  1.00 59.42  ? 203 LEU B N     1 
ATOM   5507 C CA    . LEU D 3 209 ? 67.624  51.442 75.718  1.00 59.03  ? 203 LEU B CA    1 
ATOM   5508 C C     . LEU D 3 209 ? 67.426  51.304 74.209  1.00 63.63  ? 203 LEU B C     1 
ATOM   5509 O O     . LEU D 3 209 ? 68.249  50.736 73.507  1.00 66.23  ? 203 LEU B O     1 
ATOM   5510 C CB    . LEU D 3 209 ? 68.696  52.468 76.076  1.00 59.74  ? 203 LEU B CB    1 
ATOM   5511 C CG    . LEU D 3 209 ? 69.463  53.147 74.944  1.00 67.58  ? 203 LEU B CG    1 
ATOM   5512 C CD1   . LEU D 3 209 ? 68.662  54.306 74.350  1.00 69.46  ? 203 LEU B CD1   1 
ATOM   5513 C CD2   . LEU D 3 209 ? 70.820  53.630 75.450  1.00 71.87  ? 203 LEU B CD2   1 
ATOM   5514 N N     . VAL D 3 210 ? 66.313  51.844 73.724  1.00 59.62  ? 204 VAL B N     1 
ATOM   5515 C CA    . VAL D 3 210 ? 65.964  51.814 72.306  1.00 59.93  ? 204 VAL B CA    1 
ATOM   5516 C C     . VAL D 3 210 ? 65.954  53.238 71.736  1.00 64.12  ? 204 VAL B C     1 
ATOM   5517 O O     . VAL D 3 210 ? 64.950  53.947 71.821  1.00 64.25  ? 204 VAL B O     1 
ATOM   5518 C CB    . VAL D 3 210 ? 64.558  51.179 72.094  1.00 64.60  ? 204 VAL B CB    1 
ATOM   5519 C CG1   . VAL D 3 210 ? 64.168  51.184 70.617  1.00 64.46  ? 204 VAL B CG1   1 
ATOM   5520 C CG2   . VAL D 3 210 ? 64.523  49.764 72.654  1.00 64.49  ? 204 VAL B CG2   1 
ATOM   5521 N N     . SER D 3 211 ? 67.071  53.658 71.157  1.00 61.58  ? 205 SER B N     1 
ATOM   5522 C CA    . SER D 3 211 ? 67.155  54.994 70.577  1.00 61.83  ? 205 SER B CA    1 
ATOM   5523 C C     . SER D 3 211 ? 67.904  54.930 69.253  1.00 66.40  ? 205 SER B C     1 
ATOM   5524 O O     . SER D 3 211 ? 68.627  53.959 68.992  1.00 66.90  ? 205 SER B O     1 
ATOM   5525 C CB    . SER D 3 211 ? 67.856  55.946 71.542  1.00 66.30  ? 205 SER B CB    1 
ATOM   5526 O OG    . SER D 3 211 ? 69.231  56.048 71.234  1.00 75.83  ? 205 SER B OG    1 
ATOM   5527 N N     . THR D 3 212 ? 67.715  55.944 68.409  1.00 61.83  ? 206 THR B N     1 
ATOM   5528 C CA    . THR D 3 212 ? 68.392  55.971 67.114  1.00 59.81  ? 206 THR B CA    1 
ATOM   5529 C C     . THR D 3 212 ? 69.793  56.530 67.274  1.00 60.41  ? 206 THR B C     1 
ATOM   5530 O O     . THR D 3 212 ? 70.527  56.654 66.299  1.00 59.04  ? 206 THR B O     1 
ATOM   5531 C CB    . THR D 3 212 ? 67.678  56.855 66.076  1.00 62.99  ? 206 THR B CB    1 
ATOM   5532 O OG1   . THR D 3 212 ? 67.382  58.137 66.651  1.00 71.01  ? 206 THR B OG1   1 
ATOM   5533 C CG2   . THR D 3 212 ? 66.402  56.183 65.578  1.00 55.65  ? 206 THR B CG2   1 
ATOM   5534 N N     . ALA D 3 213 ? 70.148  56.907 68.493  1.00 56.67  ? 207 ALA B N     1 
ATOM   5535 C CA    . ALA D 3 213 ? 71.473  57.436 68.744  1.00 57.43  ? 207 ALA B CA    1 
ATOM   5536 C C     . ALA D 3 213 ? 72.374  56.237 68.811  1.00 62.04  ? 207 ALA B C     1 
ATOM   5537 O O     . ALA D 3 213 ? 73.267  56.070 67.992  1.00 64.30  ? 207 ALA B O     1 
ATOM   5538 C CB    . ALA D 3 213 ? 71.511  58.206 70.059  1.00 58.65  ? 207 ALA B CB    1 
ATOM   5539 N N     . GLY D 3 214 ? 72.098  55.367 69.769  1.00 56.19  ? 208 GLY B N     1 
ATOM   5540 C CA    . GLY D 3 214 ? 72.898  54.180 69.903  1.00 56.17  ? 208 GLY B CA    1 
ATOM   5541 C C     . GLY D 3 214 ? 74.223  54.506 70.572  1.00 63.18  ? 208 GLY B C     1 
ATOM   5542 O O     . GLY D 3 214 ? 74.504  55.651 70.930  1.00 64.45  ? 208 GLY B O     1 
ATOM   5543 N N     . VAL D 3 215 ? 75.008  53.457 70.755  1.00 59.17  ? 209 VAL B N     1 
ATOM   5544 C CA    . VAL D 3 215 ? 76.306  53.533 71.386  1.00 57.47  ? 209 VAL B CA    1 
ATOM   5545 C C     . VAL D 3 215 ? 77.302  52.935 70.424  1.00 57.48  ? 209 VAL B C     1 
ATOM   5546 O O     . VAL D 3 215 ? 76.925  52.218 69.498  1.00 58.53  ? 209 VAL B O     1 
ATOM   5547 C CB    . VAL D 3 215 ? 76.321  52.702 72.671  1.00 60.91  ? 209 VAL B CB    1 
ATOM   5548 C CG1   . VAL D 3 215 ? 76.074  53.596 73.866  1.00 60.67  ? 209 VAL B CG1   1 
ATOM   5549 C CG2   . VAL D 3 215 ? 75.280  51.606 72.600  1.00 60.53  ? 209 VAL B CG2   1 
ATOM   5550 N N     . GLU D 3 216 ? 78.568  53.254 70.625  1.00 49.69  ? 210 GLU B N     1 
ATOM   5551 C CA    . GLU D 3 216 ? 79.623  52.702 69.796  1.00 47.31  ? 210 GLU B CA    1 
ATOM   5552 C C     . GLU D 3 216 ? 80.509  51.915 70.736  1.00 48.93  ? 210 GLU B C     1 
ATOM   5553 O O     . GLU D 3 216 ? 81.081  52.482 71.661  1.00 49.05  ? 210 GLU B O     1 
ATOM   5554 C CB    . GLU D 3 216 ? 80.429  53.811 69.134  1.00 47.88  ? 210 GLU B CB    1 
ATOM   5555 C CG    . GLU D 3 216 ? 79.677  54.558 68.045  1.00 55.68  ? 210 GLU B CG    1 
ATOM   5556 C CD    . GLU D 3 216 ? 79.327  53.693 66.844  1.00 79.87  ? 210 GLU B CD    1 
ATOM   5557 O OE1   . GLU D 3 216 ? 80.219  52.997 66.306  1.00 85.38  ? 210 GLU B OE1   1 
ATOM   5558 O OE2   . GLU D 3 216 ? 78.158  53.743 66.415  1.00 67.70  ? 210 GLU B OE2   1 
ATOM   5559 N N     . LYS D 3 217 ? 80.564  50.602 70.559  1.00 43.49  ? 211 LYS B N     1 
ATOM   5560 C CA    . LYS D 3 217 ? 81.410  49.782 71.417  1.00 42.79  ? 211 LYS B CA    1 
ATOM   5561 C C     . LYS D 3 217 ? 82.733  49.550 70.692  1.00 45.03  ? 211 LYS B C     1 
ATOM   5562 O O     . LYS D 3 217 ? 82.779  48.907 69.640  1.00 45.98  ? 211 LYS B O     1 
ATOM   5563 C CB    . LYS D 3 217 ? 80.747  48.439 71.773  1.00 45.03  ? 211 LYS B CB    1 
ATOM   5564 C CG    . LYS D 3 217 ? 79.243  48.505 71.973  1.00 50.16  ? 211 LYS B CG    1 
ATOM   5565 C CD    . LYS D 3 217 ? 78.884  48.989 73.371  1.00 50.31  ? 211 LYS B CD    1 
ATOM   5566 C CE    . LYS D 3 217 ? 79.974  48.715 74.380  1.00 53.89  ? 211 LYS B CE    1 
ATOM   5567 N NZ    . LYS D 3 217 ? 79.374  48.484 75.727  1.00 60.07  ? 211 LYS B NZ    1 
ATOM   5568 N N     . ALA D 3 218 ? 83.805  50.106 71.242  1.00 38.80  ? 212 ALA B N     1 
ATOM   5569 C CA    . ALA D 3 218 ? 85.126  49.956 70.653  1.00 38.12  ? 212 ALA B CA    1 
ATOM   5570 C C     . ALA D 3 218 ? 85.754  48.631 71.067  1.00 45.21  ? 212 ALA B C     1 
ATOM   5571 O O     . ALA D 3 218 ? 85.486  48.105 72.155  1.00 46.83  ? 212 ALA B O     1 
ATOM   5572 C CB    . ALA D 3 218 ? 86.017  51.095 71.069  1.00 38.77  ? 212 ALA B CB    1 
ATOM   5573 N N     . LEU D 3 219 ? 86.597  48.097 70.189  1.00 41.25  ? 213 LEU B N     1 
ATOM   5574 C CA    . LEU D 3 219 ? 87.289  46.831 70.441  1.00 38.87  ? 213 LEU B CA    1 
ATOM   5575 C C     . LEU D 3 219 ? 88.787  47.078 70.511  1.00 38.46  ? 213 LEU B C     1 
ATOM   5576 O O     . LEU D 3 219 ? 89.316  47.941 69.810  1.00 35.20  ? 213 LEU B O     1 
ATOM   5577 C CB    . LEU D 3 219 ? 86.987  45.824 69.327  1.00 37.79  ? 213 LEU B CB    1 
ATOM   5578 C CG    . LEU D 3 219 ? 85.505  45.509 69.101  1.00 38.77  ? 213 LEU B CG    1 
ATOM   5579 C CD1   . LEU D 3 219 ? 85.368  44.338 68.137  1.00 36.32  ? 213 LEU B CD1   1 
ATOM   5580 C CD2   . LEU D 3 219 ? 84.844  45.203 70.435  1.00 38.06  ? 213 LEU B CD2   1 
ATOM   5581 N N     . SER D 3 220 ? 89.469  46.342 71.379  1.00 34.27  ? 214 SER B N     1 
ATOM   5582 C CA    . SER D 3 220 ? 90.907  46.504 71.508  1.00 33.47  ? 214 SER B CA    1 
ATOM   5583 C C     . SER D 3 220 ? 91.536  46.077 70.193  1.00 42.11  ? 214 SER B C     1 
ATOM   5584 O O     . SER D 3 220 ? 90.872  45.490 69.336  1.00 45.83  ? 214 SER B O     1 
ATOM   5585 C CB    . SER D 3 220 ? 91.464  45.661 72.670  1.00 34.85  ? 214 SER B CB    1 
ATOM   5586 O OG    . SER D 3 220 ? 91.450  44.264 72.385  1.00 37.08  ? 214 SER B OG    1 
ATOM   5587 N N     . LEU D 3 221 ? 92.814  46.381 70.024  1.00 36.76  ? 215 LEU B N     1 
ATOM   5588 C CA    . LEU D 3 221 ? 93.520  46.000 68.820  1.00 36.20  ? 215 LEU B CA    1 
ATOM   5589 C C     . LEU D 3 221 ? 93.447  44.478 68.660  1.00 38.86  ? 215 LEU B C     1 
ATOM   5590 O O     . LEU D 3 221 ? 93.210  43.955 67.568  1.00 39.32  ? 215 LEU B O     1 
ATOM   5591 C CB    . LEU D 3 221 ? 94.981  46.439 68.934  1.00 36.53  ? 215 LEU B CB    1 
ATOM   5592 C CG    . LEU D 3 221 ? 95.216  47.938 68.784  1.00 42.22  ? 215 LEU B CG    1 
ATOM   5593 C CD1   . LEU D 3 221 ? 96.632  48.268 69.186  1.00 42.60  ? 215 LEU B CD1   1 
ATOM   5594 C CD2   . LEU D 3 221 ? 94.926  48.387 67.344  1.00 44.54  ? 215 LEU B CD2   1 
ATOM   5595 N N     . GLY D 3 222 ? 93.649  43.771 69.764  1.00 31.89  ? 216 GLY B N     1 
ATOM   5596 C CA    . GLY D 3 222 ? 93.641  42.317 69.756  1.00 30.95  ? 216 GLY B CA    1 
ATOM   5597 C C     . GLY D 3 222 ? 92.295  41.690 69.448  1.00 34.25  ? 216 GLY B C     1 
ATOM   5598 O O     . GLY D 3 222 ? 92.232  40.729 68.684  1.00 35.25  ? 216 GLY B O     1 
ATOM   5599 N N     . VAL D 3 223 ? 91.227  42.190 70.070  1.00 30.42  ? 217 VAL B N     1 
ATOM   5600 C CA    . VAL D 3 223 ? 89.897  41.629 69.798  1.00 31.11  ? 217 VAL B CA    1 
ATOM   5601 C C     . VAL D 3 223 ? 89.550  41.992 68.362  1.00 36.90  ? 217 VAL B C     1 
ATOM   5602 O O     . VAL D 3 223 ? 88.897  41.229 67.645  1.00 34.31  ? 217 VAL B O     1 
ATOM   5603 C CB    . VAL D 3 223 ? 88.817  42.166 70.766  1.00 32.77  ? 217 VAL B CB    1 
ATOM   5604 C CG1   . VAL D 3 223 ? 87.484  41.491 70.510  1.00 30.48  ? 217 VAL B CG1   1 
ATOM   5605 C CG2   . VAL D 3 223 ? 89.243  41.921 72.192  1.00 32.99  ? 217 VAL B CG2   1 
ATOM   5606 N N     . THR D 3 224 ? 90.049  43.154 67.945  1.00 34.24  ? 218 THR B N     1 
ATOM   5607 C CA    . THR D 3 224 ? 89.866  43.647 66.593  1.00 33.91  ? 218 THR B CA    1 
ATOM   5608 C C     . THR D 3 224 ? 90.416  42.639 65.587  1.00 39.38  ? 218 THR B C     1 
ATOM   5609 O O     . THR D 3 224 ? 89.732  42.270 64.633  1.00 39.37  ? 218 THR B O     1 
ATOM   5610 C CB    . THR D 3 224 ? 90.570  44.986 66.408  1.00 37.50  ? 218 THR B CB    1 
ATOM   5611 O OG1   . THR D 3 224 ? 89.813  46.008 67.071  1.00 41.32  ? 218 THR B OG1   1 
ATOM   5612 C CG2   . THR D 3 224 ? 90.688  45.302 64.928  1.00 36.66  ? 218 THR B CG2   1 
ATOM   5613 N N     . LYS D 3 225 ? 91.641  42.176 65.822  1.00 35.02  ? 219 LYS B N     1 
ATOM   5614 C CA    . LYS D 3 225 ? 92.262  41.177 64.962  1.00 34.79  ? 219 LYS B CA    1 
ATOM   5615 C C     . LYS D 3 225 ? 91.381  39.938 64.948  1.00 36.58  ? 219 LYS B C     1 
ATOM   5616 O O     . LYS D 3 225 ? 91.065  39.389 63.889  1.00 39.70  ? 219 LYS B O     1 
ATOM   5617 C CB    . LYS D 3 225 ? 93.646  40.795 65.497  1.00 39.43  ? 219 LYS B CB    1 
ATOM   5618 C CG    . LYS D 3 225 ? 94.811  41.257 64.629  1.00 67.08  ? 219 LYS B CG    1 
ATOM   5619 C CD    . LYS D 3 225 ? 95.655  42.296 65.347  1.00 77.69  ? 219 LYS B CD    1 
ATOM   5620 C CE    . LYS D 3 225 ? 95.448  43.673 64.741  1.00 90.10  ? 219 LYS B CE    1 
ATOM   5621 N NZ    . LYS D 3 225 ? 96.301  44.697 65.403  1.00 100.00 ? 219 LYS B NZ    1 
ATOM   5622 N N     . LEU D 3 226 ? 90.983  39.505 66.139  1.00 27.76  ? 220 LEU B N     1 
ATOM   5623 C CA    . LEU D 3 226 ? 90.145  38.324 66.271  1.00 25.68  ? 220 LEU B CA    1 
ATOM   5624 C C     . LEU D 3 226 ? 88.911  38.454 65.381  1.00 33.45  ? 220 LEU B C     1 
ATOM   5625 O O     . LEU D 3 226 ? 88.517  37.502 64.699  1.00 31.82  ? 220 LEU B O     1 
ATOM   5626 C CB    . LEU D 3 226 ? 89.680  38.154 67.714  1.00 24.01  ? 220 LEU B CB    1 
ATOM   5627 C CG    . LEU D 3 226 ? 90.662  37.714 68.782  1.00 26.72  ? 220 LEU B CG    1 
ATOM   5628 C CD1   . LEU D 3 226 ? 89.935  37.405 70.093  1.00 26.04  ? 220 LEU B CD1   1 
ATOM   5629 C CD2   . LEU D 3 226 ? 91.455  36.524 68.299  1.00 26.00  ? 220 LEU B CD2   1 
ATOM   5630 N N     . VAL D 3 227 ? 88.271  39.618 65.437  1.00 31.44  ? 221 VAL B N     1 
ATOM   5631 C CA    . VAL D 3 227 ? 87.056  39.832 64.673  1.00 30.35  ? 221 VAL B CA    1 
ATOM   5632 C C     . VAL D 3 227 ? 87.372  39.842 63.194  1.00 29.89  ? 221 VAL B C     1 
ATOM   5633 O O     . VAL D 3 227 ? 86.688  39.197 62.404  1.00 28.81  ? 221 VAL B O     1 
ATOM   5634 C CB    . VAL D 3 227 ? 86.295  41.127 65.088  1.00 34.23  ? 221 VAL B CB    1 
ATOM   5635 C CG1   . VAL D 3 227 ? 84.926  41.145 64.442  1.00 34.79  ? 221 VAL B CG1   1 
ATOM   5636 C CG2   . VAL D 3 227 ? 86.134  41.204 66.597  1.00 33.04  ? 221 VAL B CG2   1 
ATOM   5637 N N     . GLU D 3 228 ? 88.415  40.570 62.820  1.00 26.04  ? 222 GLU B N     1 
ATOM   5638 C CA    . GLU D 3 228 ? 88.816  40.636 61.420  1.00 26.58  ? 222 GLU B CA    1 
ATOM   5639 C C     . GLU D 3 228 ? 88.999  39.216 60.886  1.00 30.43  ? 222 GLU B C     1 
ATOM   5640 O O     . GLU D 3 228 ? 88.380  38.813 59.898  1.00 31.61  ? 222 GLU B O     1 
ATOM   5641 C CB    . GLU D 3 228 ? 90.113  41.428 61.279  1.00 27.82  ? 222 GLU B CB    1 
ATOM   5642 C CG    . GLU D 3 228 ? 89.904  42.929 61.096  1.00 35.46  ? 222 GLU B CG    1 
ATOM   5643 C CD    . GLU D 3 228 ? 91.180  43.711 61.343  1.00 55.27  ? 222 GLU B CD    1 
ATOM   5644 O OE1   . GLU D 3 228 ? 92.200  43.084 61.716  1.00 46.99  ? 222 GLU B OE1   1 
ATOM   5645 O OE2   . GLU D 3 228 ? 91.182  44.944 61.157  1.00 47.43  ? 222 GLU B OE2   1 
ATOM   5646 N N     . ARG D 3 229 ? 89.824  38.438 61.566  1.00 24.53  ? 223 ARG B N     1 
ATOM   5647 C CA    . ARG D 3 229 ? 90.030  37.083 61.117  1.00 24.75  ? 223 ARG B CA    1 
ATOM   5648 C C     . ARG D 3 229 ? 88.744  36.311 60.866  1.00 36.80  ? 223 ARG B C     1 
ATOM   5649 O O     . ARG D 3 229 ? 88.698  35.491 59.957  1.00 41.18  ? 223 ARG B O     1 
ATOM   5650 C CB    . ARG D 3 229 ? 90.958  36.304 62.036  1.00 17.93  ? 223 ARG B CB    1 
ATOM   5651 C CG    . ARG D 3 229 ? 91.318  34.969 61.433  1.00 21.94  ? 223 ARG B CG    1 
ATOM   5652 C CD    . ARG D 3 229 ? 92.099  34.100 62.380  1.00 20.06  ? 223 ARG B CD    1 
ATOM   5653 N NE    . ARG D 3 229 ? 92.600  32.935 61.677  1.00 32.89  ? 223 ARG B NE    1 
ATOM   5654 C CZ    . ARG D 3 229 ? 93.066  31.850 62.269  1.00 54.43  ? 223 ARG B CZ    1 
ATOM   5655 N NH1   . ARG D 3 229 ? 93.052  31.759 63.596  1.00 43.73  ? 223 ARG B NH1   1 
ATOM   5656 N NH2   . ARG D 3 229 ? 93.516  30.843 61.530  1.00 46.01  ? 223 ARG B NH2   1 
ATOM   5657 N N     . TRP D 3 230 ? 87.708  36.553 61.671  1.00 32.39  ? 224 TRP B N     1 
ATOM   5658 C CA    . TRP D 3 230 ? 86.428  35.850 61.512  1.00 29.55  ? 224 TRP B CA    1 
ATOM   5659 C C     . TRP D 3 230 ? 85.727  36.345 60.254  1.00 36.49  ? 224 TRP B C     1 
ATOM   5660 O O     . TRP D 3 230 ? 85.198  35.559 59.457  1.00 38.14  ? 224 TRP B O     1 
ATOM   5661 C CB    . TRP D 3 230 ? 85.513  36.078 62.729  1.00 26.16  ? 224 TRP B CB    1 
ATOM   5662 C CG    . TRP D 3 230 ? 84.027  36.048 62.399  1.00 25.85  ? 224 TRP B CG    1 
ATOM   5663 C CD1   . TRP D 3 230 ? 83.161  37.107 62.399  1.00 28.06  ? 224 TRP B CD1   1 
ATOM   5664 C CD2   . TRP D 3 230 ? 83.250  34.902 61.997  1.00 24.95  ? 224 TRP B CD2   1 
ATOM   5665 N NE1   . TRP D 3 230 ? 81.898  36.690 62.028  1.00 25.48  ? 224 TRP B NE1   1 
ATOM   5666 C CE2   . TRP D 3 230 ? 81.929  35.346 61.773  1.00 25.43  ? 224 TRP B CE2   1 
ATOM   5667 C CE3   . TRP D 3 230 ? 83.548  33.544 61.801  1.00 25.85  ? 224 TRP B CE3   1 
ATOM   5668 C CZ2   . TRP D 3 230 ? 80.910  34.485 61.372  1.00 24.47  ? 224 TRP B CZ2   1 
ATOM   5669 C CZ3   . TRP D 3 230 ? 82.528  32.686 61.408  1.00 26.22  ? 224 TRP B CZ3   1 
ATOM   5670 C CH2   . TRP D 3 230 ? 81.224  33.159 61.207  1.00 26.03  ? 224 TRP B CH2   1 
ATOM   5671 N N     . ILE D 3 231 ? 85.707  37.660 60.095  1.00 32.27  ? 225 ILE B N     1 
ATOM   5672 C CA    . ILE D 3 231 ? 85.057  38.257 58.945  1.00 32.03  ? 225 ILE B CA    1 
ATOM   5673 C C     . ILE D 3 231 ? 85.640  37.579 57.710  1.00 35.03  ? 225 ILE B C     1 
ATOM   5674 O O     . ILE D 3 231 ? 84.934  36.935 56.933  1.00 35.12  ? 225 ILE B O     1 
ATOM   5675 C CB    . ILE D 3 231 ? 85.303  39.780 58.911  1.00 34.72  ? 225 ILE B CB    1 
ATOM   5676 C CG1   . ILE D 3 231 ? 84.440  40.479 59.967  1.00 33.40  ? 225 ILE B CG1   1 
ATOM   5677 C CG2   . ILE D 3 231 ? 85.005  40.333 57.543  1.00 36.92  ? 225 ILE B CG2   1 
ATOM   5678 C CD1   . ILE D 3 231 ? 84.617  41.988 60.028  1.00 31.56  ? 225 ILE B CD1   1 
ATOM   5679 N N     . SER D 3 232 ? 86.956  37.667 57.586  1.00 32.03  ? 226 SER B N     1 
ATOM   5680 C CA    . SER D 3 232 ? 87.694  37.066 56.482  1.00 32.52  ? 226 SER B CA    1 
ATOM   5681 C C     . SER D 3 232 ? 87.311  35.613 56.113  1.00 36.28  ? 226 SER B C     1 
ATOM   5682 O O     . SER D 3 232 ? 86.789  35.344 55.033  1.00 39.54  ? 226 SER B O     1 
ATOM   5683 C CB    . SER D 3 232 ? 89.199  37.205 56.754  1.00 36.81  ? 226 SER B CB    1 
ATOM   5684 O OG    . SER D 3 232 ? 89.975  36.447 55.850  1.00 48.69  ? 226 SER B OG    1 
ATOM   5685 N N     . VAL D 3 233 ? 87.586  34.676 57.005  1.00 29.78  ? 227 VAL B N     1 
ATOM   5686 C CA    . VAL D 3 233 ? 87.297  33.271 56.751  1.00 28.83  ? 227 VAL B CA    1 
ATOM   5687 C C     . VAL D 3 233 ? 85.810  32.975 56.525  1.00 37.38  ? 227 VAL B C     1 
ATOM   5688 O O     . VAL D 3 233 ? 85.465  31.940 55.962  1.00 38.29  ? 227 VAL B O     1 
ATOM   5689 C CB    . VAL D 3 233 ? 87.841  32.401 57.925  1.00 30.34  ? 227 VAL B CB    1 
ATOM   5690 C CG1   . VAL D 3 233 ? 86.948  32.555 59.158  1.00 29.41  ? 227 VAL B CG1   1 
ATOM   5691 C CG2   . VAL D 3 233 ? 87.983  30.933 57.531  1.00 29.06  ? 227 VAL B CG2   1 
ATOM   5692 N N     . SER D 3 234 ? 84.929  33.867 56.971  1.00 39.46  ? 228 SER B N     1 
ATOM   5693 C CA    . SER D 3 234 ? 83.470  33.639 56.876  1.00 40.37  ? 228 SER B CA    1 
ATOM   5694 C C     . SER D 3 234 ? 82.706  34.256 55.691  1.00 47.83  ? 228 SER B C     1 
ATOM   5695 O O     . SER D 3 234 ? 81.676  33.729 55.266  1.00 49.60  ? 228 SER B O     1 
ATOM   5696 C CB    . SER D 3 234 ? 82.781  34.042 58.186  1.00 37.77  ? 228 SER B CB    1 
ATOM   5697 O OG    . SER D 3 234 ? 83.000  35.416 58.456  1.00 25.38  ? 228 SER B OG    1 
ATOM   5698 N N     . GLY D 3 235 ? 83.168  35.395 55.193  1.00 43.69  ? 229 GLY B N     1 
ATOM   5699 C CA    . GLY D 3 235 ? 82.488  36.039 54.075  1.00 44.02  ? 229 GLY B CA    1 
ATOM   5700 C C     . GLY D 3 235 ? 81.220  36.822 54.440  1.00 48.81  ? 229 GLY B C     1 
ATOM   5701 O O     . GLY D 3 235 ? 80.471  37.238 53.560  1.00 50.12  ? 229 GLY B O     1 
ATOM   5702 N N     . VAL D 3 236 ? 80.981  37.058 55.723  1.00 44.01  ? 230 VAL B N     1 
ATOM   5703 C CA    . VAL D 3 236 ? 79.802  37.827 56.102  1.00 42.33  ? 230 VAL B CA    1 
ATOM   5704 C C     . VAL D 3 236 ? 79.853  39.224 55.468  1.00 46.78  ? 230 VAL B C     1 
ATOM   5705 O O     . VAL D 3 236 ? 78.816  39.834 55.187  1.00 45.15  ? 230 VAL B O     1 
ATOM   5706 C CB    . VAL D 3 236 ? 79.664  37.972 57.636  1.00 42.51  ? 230 VAL B CB    1 
ATOM   5707 C CG1   . VAL D 3 236 ? 79.289  36.639 58.264  1.00 41.57  ? 230 VAL B CG1   1 
ATOM   5708 C CG2   . VAL D 3 236 ? 80.932  38.555 58.246  1.00 41.23  ? 230 VAL B CG2   1 
ATOM   5709 N N     . ALA D 3 237 ? 81.065  39.729 55.256  1.00 43.77  ? 231 ALA B N     1 
ATOM   5710 C CA    . ALA D 3 237 ? 81.241  41.062 54.703  1.00 43.96  ? 231 ALA B CA    1 
ATOM   5711 C C     . ALA D 3 237 ? 80.707  41.162 53.287  1.00 50.47  ? 231 ALA B C     1 
ATOM   5712 O O     . ALA D 3 237 ? 80.632  42.253 52.716  1.00 50.84  ? 231 ALA B O     1 
ATOM   5713 C CB    . ALA D 3 237 ? 82.691  41.463 54.751  1.00 44.82  ? 231 ALA B CB    1 
ATOM   5714 N N     . ASP D 3 238 ? 80.329  40.015 52.733  1.00 48.89  ? 232 ASP B N     1 
ATOM   5715 C CA    . ASP D 3 238 ? 79.784  39.929 51.394  1.00 51.14  ? 232 ASP B CA    1 
ATOM   5716 C C     . ASP D 3 238 ? 78.444  40.644 51.283  1.00 61.29  ? 232 ASP B C     1 
ATOM   5717 O O     . ASP D 3 238 ? 77.791  40.579 50.243  1.00 63.75  ? 232 ASP B O     1 
ATOM   5718 C CB    . ASP D 3 238 ? 79.578  38.474 51.005  1.00 54.46  ? 232 ASP B CB    1 
ATOM   5719 C CG    . ASP D 3 238 ? 80.764  37.893 50.276  1.00 80.45  ? 232 ASP B CG    1 
ATOM   5720 O OD1   . ASP D 3 238 ? 81.868  38.467 50.376  1.00 81.87  ? 232 ASP B OD1   1 
ATOM   5721 O OD2   . ASP D 3 238 ? 80.592  36.843 49.621  1.00 93.55  ? 232 ASP B OD2   1 
ATOM   5722 N N     . ASP D 3 239 ? 78.014  41.264 52.376  1.00 57.58  ? 233 ASP B N     1 
ATOM   5723 C CA    . ASP D 3 239 ? 76.742  41.975 52.447  1.00 54.97  ? 233 ASP B CA    1 
ATOM   5724 C C     . ASP D 3 239 ? 76.615  42.750 53.745  1.00 54.21  ? 233 ASP B C     1 
ATOM   5725 O O     . ASP D 3 239 ? 76.137  42.265 54.761  1.00 50.51  ? 233 ASP B O     1 
ATOM   5726 C CB    . ASP D 3 239 ? 75.528  41.094 52.209  1.00 55.90  ? 233 ASP B CB    1 
ATOM   5727 C CG    . ASP D 3 239 ? 74.242  41.872 52.231  1.00 59.46  ? 233 ASP B CG    1 
ATOM   5728 O OD1   . ASP D 3 239 ? 74.264  43.108 52.380  1.00 57.65  ? 233 ASP B OD1   1 
ATOM   5729 O OD2   . ASP D 3 239 ? 73.168  41.261 52.080  1.00 62.48  ? 233 ASP B OD2   1 
ATOM   5730 N N     . PRO D 3 240 ? 76.976  44.014 53.638  1.00 52.32  ? 234 PRO B N     1 
ATOM   5731 C CA    . PRO D 3 240 ? 76.954  44.927 54.772  1.00 53.06  ? 234 PRO B CA    1 
ATOM   5732 C C     . PRO D 3 240 ? 75.758  44.799 55.687  1.00 56.85  ? 234 PRO B C     1 
ATOM   5733 O O     . PRO D 3 240 ? 75.837  45.128 56.869  1.00 54.65  ? 234 PRO B O     1 
ATOM   5734 C CB    . PRO D 3 240 ? 76.968  46.301 54.103  1.00 54.87  ? 234 PRO B CB    1 
ATOM   5735 C CG    . PRO D 3 240 ? 76.291  46.092 52.801  1.00 58.28  ? 234 PRO B CG    1 
ATOM   5736 C CD    . PRO D 3 240 ? 76.642  44.685 52.369  1.00 52.48  ? 234 PRO B CD    1 
ATOM   5737 N N     . ASN D 3 241 ? 74.651  44.328 55.123  1.00 54.04  ? 235 ASN B N     1 
ATOM   5738 C CA    . ASN D 3 241 ? 73.407  44.145 55.875  1.00 53.74  ? 235 ASN B CA    1 
ATOM   5739 C C     . ASN D 3 241 ? 73.342  42.728 56.439  1.00 58.13  ? 235 ASN B C     1 
ATOM   5740 O O     . ASN D 3 241 ? 72.282  42.211 56.802  1.00 59.10  ? 235 ASN B O     1 
ATOM   5741 C CB    . ASN D 3 241 ? 72.184  44.450 55.004  1.00 51.22  ? 235 ASN B CB    1 
ATOM   5742 C CG    . ASN D 3 241 ? 71.985  45.932 54.801  1.00 74.88  ? 235 ASN B CG    1 
ATOM   5743 O OD1   . ASN D 3 241 ? 71.560  46.636 55.712  1.00 69.52  ? 235 ASN B OD1   1 
ATOM   5744 N ND2   . ASN D 3 241 ? 72.349  46.426 53.628  1.00 76.18  ? 235 ASN B ND2   1 
ATOM   5745 N N     . ASN D 3 242 ? 74.510  42.105 56.508  1.00 52.92  ? 236 ASN B N     1 
ATOM   5746 C CA    . ASN D 3 242 ? 74.629  40.752 57.031  1.00 51.17  ? 236 ASN B CA    1 
ATOM   5747 C C     . ASN D 3 242 ? 75.017  40.752 58.496  1.00 49.44  ? 236 ASN B C     1 
ATOM   5748 O O     . ASN D 3 242 ? 75.861  41.527 58.943  1.00 46.92  ? 236 ASN B O     1 
ATOM   5749 C CB    . ASN D 3 242 ? 75.701  39.971 56.276  1.00 52.23  ? 236 ASN B CB    1 
ATOM   5750 C CG    . ASN D 3 242 ? 75.121  38.937 55.370  1.00 63.43  ? 236 ASN B CG    1 
ATOM   5751 O OD1   . ASN D 3 242 ? 73.933  38.625 55.444  1.00 57.92  ? 236 ASN B OD1   1 
ATOM   5752 N ND2   . ASN D 3 242 ? 75.964  38.365 54.523  1.00 54.54  ? 236 ASN B ND2   1 
ATOM   5753 N N     . TYR D 3 243 ? 74.430  39.824 59.233  1.00 44.32  ? 237 TYR B N     1 
ATOM   5754 C CA    . TYR D 3 243 ? 74.743  39.668 60.639  1.00 41.95  ? 237 TYR B CA    1 
ATOM   5755 C C     . TYR D 3 243 ? 76.180  39.168 60.753  1.00 44.62  ? 237 TYR B C     1 
ATOM   5756 O O     . TYR D 3 243 ? 76.571  38.205 60.095  1.00 46.75  ? 237 TYR B O     1 
ATOM   5757 C CB    . TYR D 3 243 ? 73.783  38.671 61.281  1.00 41.49  ? 237 TYR B CB    1 
ATOM   5758 C CG    . TYR D 3 243 ? 72.402  39.237 61.510  1.00 43.08  ? 237 TYR B CG    1 
ATOM   5759 C CD1   . TYR D 3 243 ? 72.237  40.435 62.178  1.00 44.64  ? 237 TYR B CD1   1 
ATOM   5760 C CD2   . TYR D 3 243 ? 71.264  38.571 61.057  1.00 44.57  ? 237 TYR B CD2   1 
ATOM   5761 C CE1   . TYR D 3 243 ? 70.985  40.962 62.396  1.00 48.02  ? 237 TYR B CE1   1 
ATOM   5762 C CE2   . TYR D 3 243 ? 70.001  39.083 61.275  1.00 46.08  ? 237 TYR B CE2   1 
ATOM   5763 C CZ    . TYR D 3 243 ? 69.865  40.287 61.943  1.00 58.26  ? 237 TYR B CZ    1 
ATOM   5764 O OH    . TYR D 3 243 ? 68.609  40.822 62.165  1.00 58.80  ? 237 TYR B OH    1 
ATOM   5765 N N     . LEU D 3 244 ? 76.962  39.847 61.583  1.00 35.69  ? 238 LEU B N     1 
ATOM   5766 C CA    . LEU D 3 244 ? 78.356  39.510 61.829  1.00 33.23  ? 238 LEU B CA    1 
ATOM   5767 C C     . LEU D 3 244 ? 78.645  38.036 62.144  1.00 35.93  ? 238 LEU B C     1 
ATOM   5768 O O     . LEU D 3 244 ? 79.628  37.469 61.658  1.00 35.67  ? 238 LEU B O     1 
ATOM   5769 C CB    . LEU D 3 244 ? 78.864  40.368 62.977  1.00 31.92  ? 238 LEU B CB    1 
ATOM   5770 C CG    . LEU D 3 244 ? 80.291  40.097 63.413  1.00 34.17  ? 238 LEU B CG    1 
ATOM   5771 C CD1   . LEU D 3 244 ? 81.170  39.876 62.187  1.00 34.80  ? 238 LEU B CD1   1 
ATOM   5772 C CD2   . LEU D 3 244 ? 80.793  41.249 64.261  1.00 30.86  ? 238 LEU B CD2   1 
ATOM   5773 N N     . PHE D 3 245 ? 77.814  37.440 62.996  1.00 30.88  ? 239 PHE B N     1 
ATOM   5774 C CA    . PHE D 3 245 ? 77.983  36.045 63.410  1.00 29.18  ? 239 PHE B CA    1 
ATOM   5775 C C     . PHE D 3 245 ? 76.895  35.211 62.793  1.00 31.88  ? 239 PHE B C     1 
ATOM   5776 O O     . PHE D 3 245 ? 75.758  35.652 62.735  1.00 33.70  ? 239 PHE B O     1 
ATOM   5777 C CB    . PHE D 3 245 ? 77.914  35.919 64.946  1.00 30.09  ? 239 PHE B CB    1 
ATOM   5778 C CG    . PHE D 3 245 ? 79.084  36.547 65.663  1.00 30.66  ? 239 PHE B CG    1 
ATOM   5779 C CD1   . PHE D 3 245 ? 80.291  35.861 65.781  1.00 31.29  ? 239 PHE B CD1   1 
ATOM   5780 C CD2   . PHE D 3 245 ? 78.989  37.844 66.183  1.00 31.28  ? 239 PHE B CD2   1 
ATOM   5781 C CE1   . PHE D 3 245 ? 81.380  36.453 66.406  1.00 32.50  ? 239 PHE B CE1   1 
ATOM   5782 C CE2   . PHE D 3 245 ? 80.075  38.442 66.827  1.00 33.45  ? 239 PHE B CE2   1 
ATOM   5783 C CZ    . PHE D 3 245 ? 81.273  37.748 66.935  1.00 31.52  ? 239 PHE B CZ    1 
ATOM   5784 N N     . CYS D 3 246 ? 77.229  34.003 62.354  1.00 29.93  ? 240 CYS B N     1 
ATOM   5785 C CA    . CYS D 3 246 ? 76.241  33.120 61.739  1.00 31.28  ? 240 CYS B CA    1 
ATOM   5786 C C     . CYS D 3 246 ? 76.618  31.678 61.946  1.00 36.94  ? 240 CYS B C     1 
ATOM   5787 O O     . CYS D 3 246 ? 77.676  31.397 62.504  1.00 40.52  ? 240 CYS B O     1 
ATOM   5788 C CB    . CYS D 3 246 ? 76.199  33.361 60.244  1.00 32.15  ? 240 CYS B CB    1 
ATOM   5789 S SG    . CYS D 3 246 ? 77.849  33.244 59.514  1.00 36.34  ? 240 CYS B SG    1 
ATOM   5790 N N     . ARG D 3 247 ? 75.780  30.758 61.470  1.00 32.26  ? 241 ARG B N     1 
ATOM   5791 C CA    . ARG D 3 247 ? 76.136  29.355 61.624  1.00 33.15  ? 241 ARG B CA    1 
ATOM   5792 C C     . ARG D 3 247 ? 77.342  29.013 60.783  1.00 41.25  ? 241 ARG B C     1 
ATOM   5793 O O     . ARG D 3 247 ? 77.653  29.675 59.789  1.00 44.76  ? 241 ARG B O     1 
ATOM   5794 C CB    . ARG D 3 247 ? 75.012  28.367 61.309  1.00 30.90  ? 241 ARG B CB    1 
ATOM   5795 C CG    . ARG D 3 247 ? 73.721  28.968 60.897  1.00 36.77  ? 241 ARG B CG    1 
ATOM   5796 C CD    . ARG D 3 247 ? 72.987  28.036 59.965  1.00 14.13  ? 241 ARG B CD    1 
ATOM   5797 N NE    . ARG D 3 247 ? 72.921  26.668 60.470  1.00 17.99  ? 241 ARG B NE    1 
ATOM   5798 C CZ    . ARG D 3 247 ? 71.789  25.981 60.553  1.00 32.81  ? 241 ARG B CZ    1 
ATOM   5799 N NH1   . ARG D 3 247 ? 70.647  26.557 60.204  1.00 37.65  ? 241 ARG B NH1   1 
ATOM   5800 N NH2   . ARG D 3 247 ? 71.788  24.734 60.992  1.00 30.65  ? 241 ARG B NH2   1 
ATOM   5801 N N     . VAL D 3 248 ? 77.993  27.939 61.204  1.00 33.38  ? 242 VAL B N     1 
ATOM   5802 C CA    . VAL D 3 248 ? 79.162  27.401 60.556  1.00 29.69  ? 242 VAL B CA    1 
ATOM   5803 C C     . VAL D 3 248 ? 78.915  25.897 60.632  1.00 36.27  ? 242 VAL B C     1 
ATOM   5804 O O     . VAL D 3 248 ? 78.856  25.328 61.721  1.00 37.60  ? 242 VAL B O     1 
ATOM   5805 C CB    . VAL D 3 248 ? 80.410  27.845 61.318  1.00 29.25  ? 242 VAL B CB    1 
ATOM   5806 C CG1   . VAL D 3 248 ? 81.668  27.244 60.696  1.00 29.97  ? 242 VAL B CG1   1 
ATOM   5807 C CG2   . VAL D 3 248 ? 80.481  29.373 61.320  1.00 26.86  ? 242 VAL B CG2   1 
ATOM   5808 N N     . ARG D 3 249 ? 78.649  25.268 59.487  1.00 31.56  ? 243 ARG B N     1 
ATOM   5809 C CA    . ARG D 3 249 ? 78.297  23.856 59.485  1.00 30.01  ? 243 ARG B CA    1 
ATOM   5810 C C     . ARG D 3 249 ? 79.433  22.833 59.651  1.00 32.41  ? 243 ARG B C     1 
ATOM   5811 O O     . ARG D 3 249 ? 80.611  23.181 59.609  1.00 35.80  ? 243 ARG B O     1 
ATOM   5812 C CB    . ARG D 3 249 ? 77.357  23.529 58.319  1.00 34.16  ? 243 ARG B CB    1 
ATOM   5813 C CG    . ARG D 3 249 ? 76.017  24.284 58.344  1.00 38.91  ? 243 ARG B CG    1 
ATOM   5814 C CD    . ARG D 3 249 ? 75.248  24.134 57.025  1.00 41.81  ? 243 ARG B CD    1 
ATOM   5815 N NE    . ARG D 3 249 ? 73.814  23.910 57.208  1.00 28.80  ? 243 ARG B NE    1 
ATOM   5816 C CZ    . ARG D 3 249 ? 73.297  22.783 57.694  1.00 51.93  ? 243 ARG B CZ    1 
ATOM   5817 N NH1   . ARG D 3 249 ? 74.099  21.781 58.028  1.00 51.95  ? 243 ARG B NH1   1 
ATOM   5818 N NH2   . ARG D 3 249 ? 71.979  22.648 57.839  1.00 26.72  ? 243 ARG B NH2   1 
ATOM   5819 N N     . LYS D 3 250 ? 79.073  21.569 59.857  1.00 27.51  ? 244 LYS B N     1 
ATOM   5820 C CA    . LYS D 3 250 ? 80.063  20.514 60.068  1.00 26.53  ? 244 LYS B CA    1 
ATOM   5821 C C     . LYS D 3 250 ? 81.257  20.578 59.138  1.00 36.73  ? 244 LYS B C     1 
ATOM   5822 O O     . LYS D 3 250 ? 82.360  20.237 59.537  1.00 39.11  ? 244 LYS B O     1 
ATOM   5823 C CB    . LYS D 3 250 ? 79.441  19.112 60.092  1.00 25.18  ? 244 LYS B CB    1 
ATOM   5824 C CG    . LYS D 3 250 ? 79.127  18.537 58.728  1.00 23.63  ? 244 LYS B CG    1 
ATOM   5825 C CD    . LYS D 3 250 ? 78.111  17.405 58.821  1.00 30.84  ? 244 LYS B CD    1 
ATOM   5826 C CE    . LYS D 3 250 ? 78.787  16.059 59.051  1.00 60.56  ? 244 LYS B CE    1 
ATOM   5827 N NZ    . LYS D 3 250 ? 77.857  14.915 58.808  1.00 67.64  ? 244 LYS B NZ    1 
ATOM   5828 N N     . ASN D 3 251 ? 81.059  21.040 57.910  1.00 36.63  ? 245 ASN B N     1 
ATOM   5829 C CA    . ASN D 3 251 ? 82.171  21.107 56.968  1.00 38.22  ? 245 ASN B CA    1 
ATOM   5830 C C     . ASN D 3 251 ? 83.027  22.377 57.038  1.00 43.99  ? 245 ASN B C     1 
ATOM   5831 O O     . ASN D 3 251 ? 83.960  22.562 56.245  1.00 44.84  ? 245 ASN B O     1 
ATOM   5832 C CB    . ASN D 3 251 ? 81.713  20.761 55.544  1.00 44.29  ? 245 ASN B CB    1 
ATOM   5833 C CG    . ASN D 3 251 ? 81.234  21.966 54.761  1.00 59.73  ? 245 ASN B CG    1 
ATOM   5834 O OD1   . ASN D 3 251 ? 80.682  22.913 55.318  1.00 51.80  ? 245 ASN B OD1   1 
ATOM   5835 N ND2   . ASN D 3 251 ? 81.430  21.923 53.446  1.00 48.85  ? 245 ASN B ND2   1 
ATOM   5836 N N     . GLY D 3 252 ? 82.720  23.240 58.003  1.00 38.85  ? 246 GLY B N     1 
ATOM   5837 C CA    . GLY D 3 252 ? 83.471  24.477 58.185  1.00 38.37  ? 246 GLY B CA    1 
ATOM   5838 C C     . GLY D 3 252 ? 82.917  25.663 57.403  1.00 45.84  ? 246 GLY B C     1 
ATOM   5839 O O     . GLY D 3 252 ? 83.362  26.797 57.586  1.00 50.91  ? 246 GLY B O     1 
ATOM   5840 N N     . VAL D 3 253 ? 81.949  25.414 56.530  1.00 39.15  ? 247 VAL B N     1 
ATOM   5841 C CA    . VAL D 3 253 ? 81.366  26.493 55.738  1.00 37.41  ? 247 VAL B CA    1 
ATOM   5842 C C     . VAL D 3 253 ? 80.390  27.368 56.551  1.00 38.36  ? 247 VAL B C     1 
ATOM   5843 O O     . VAL D 3 253 ? 79.396  26.874 57.089  1.00 38.10  ? 247 VAL B O     1 
ATOM   5844 C CB    . VAL D 3 253 ? 80.708  25.950 54.433  1.00 38.83  ? 247 VAL B CB    1 
ATOM   5845 C CG1   . VAL D 3 253 ? 80.033  27.085 53.635  1.00 37.54  ? 247 VAL B CG1   1 
ATOM   5846 C CG2   . VAL D 3 253 ? 81.748  25.210 53.584  1.00 36.89  ? 247 VAL B CG2   1 
ATOM   5847 N N     . ALA D 3 254 ? 80.698  28.658 56.643  1.00 32.11  ? 248 ALA B N     1 
ATOM   5848 C CA    . ALA D 3 254 ? 79.867  29.621 57.351  1.00 32.75  ? 248 ALA B CA    1 
ATOM   5849 C C     . ALA D 3 254 ? 78.641  29.976 56.502  1.00 43.97  ? 248 ALA B C     1 
ATOM   5850 O O     . ALA D 3 254 ? 78.750  30.166 55.294  1.00 50.19  ? 248 ALA B O     1 
ATOM   5851 C CB    . ALA D 3 254 ? 80.682  30.873 57.652  1.00 32.95  ? 248 ALA B CB    1 
ATOM   5852 N N     . ALA D 3 255 ? 77.466  30.073 57.120  1.00 36.19  ? 249 ALA B N     1 
ATOM   5853 C CA    . ALA D 3 255 ? 76.247  30.380 56.374  1.00 32.33  ? 249 ALA B CA    1 
ATOM   5854 C C     . ALA D 3 255 ? 75.708  31.786 56.615  1.00 32.76  ? 249 ALA B C     1 
ATOM   5855 O O     . ALA D 3 255 ? 74.742  31.968 57.348  1.00 33.00  ? 249 ALA B O     1 
ATOM   5856 C CB    . ALA D 3 255 ? 75.169  29.348 56.680  1.00 31.92  ? 249 ALA B CB    1 
ATOM   5857 N N     . PRO D 3 256 ? 76.298  32.776 55.968  1.00 26.65  ? 250 PRO B N     1 
ATOM   5858 C CA    . PRO D 3 256 ? 75.880  34.159 56.183  1.00 27.58  ? 250 PRO B CA    1 
ATOM   5859 C C     . PRO D 3 256 ? 74.430  34.468 55.859  1.00 37.12  ? 250 PRO B C     1 
ATOM   5860 O O     . PRO D 3 256 ? 73.860  33.871 54.953  1.00 39.73  ? 250 PRO B O     1 
ATOM   5861 C CB    . PRO D 3 256 ? 76.851  34.961 55.315  1.00 28.49  ? 250 PRO B CB    1 
ATOM   5862 C CG    . PRO D 3 256 ? 78.073  34.092 55.219  1.00 31.22  ? 250 PRO B CG    1 
ATOM   5863 C CD    . PRO D 3 256 ? 77.530  32.678 55.169  1.00 25.50  ? 250 PRO B CD    1 
ATOM   5864 N N     . SER D 3 257 ? 73.833  35.390 56.619  1.00 36.65  ? 251 SER B N     1 
ATOM   5865 C CA    . SER D 3 257 ? 72.431  35.757 56.411  1.00 36.84  ? 251 SER B CA    1 
ATOM   5866 C C     . SER D 3 257 ? 72.049  37.137 56.903  1.00 41.87  ? 251 SER B C     1 
ATOM   5867 O O     . SER D 3 257 ? 72.346  37.492 58.032  1.00 43.30  ? 251 SER B O     1 
ATOM   5868 C CB    . SER D 3 257 ? 71.499  34.741 57.048  1.00 39.72  ? 251 SER B CB    1 
ATOM   5869 O OG    . SER D 3 257 ? 70.181  35.251 57.069  1.00 47.74  ? 251 SER B OG    1 
ATOM   5870 N N     . ALA D 3 258 ? 71.339  37.893 56.071  1.00 39.82  ? 252 ALA B N     1 
ATOM   5871 C CA    . ALA D 3 258 ? 70.888  39.223 56.461  1.00 39.30  ? 252 ALA B CA    1 
ATOM   5872 C C     . ALA D 3 258 ? 69.458  39.199 56.983  1.00 44.33  ? 252 ALA B C     1 
ATOM   5873 O O     . ALA D 3 258 ? 68.927  40.228 57.385  1.00 47.56  ? 252 ALA B O     1 
ATOM   5874 C CB    . ALA D 3 258 ? 71.031  40.199 55.331  1.00 39.60  ? 252 ALA B CB    1 
ATOM   5875 N N     . THR D 3 259 ? 68.853  38.020 57.030  1.00 38.26  ? 253 THR B N     1 
ATOM   5876 C CA    . THR D 3 259 ? 67.504  37.923 57.534  1.00 39.28  ? 253 THR B CA    1 
ATOM   5877 C C     . THR D 3 259 ? 67.366  37.121 58.839  1.00 49.02  ? 253 THR B C     1 
ATOM   5878 O O     . THR D 3 259 ? 66.510  37.430 59.672  1.00 52.01  ? 253 THR B O     1 
ATOM   5879 C CB    . THR D 3 259 ? 66.533  37.452 56.447  1.00 48.08  ? 253 THR B CB    1 
ATOM   5880 O OG1   . THR D 3 259 ? 66.621  36.032 56.318  1.00 56.68  ? 253 THR B OG1   1 
ATOM   5881 C CG2   . THR D 3 259 ? 66.914  38.063 55.122  1.00 43.79  ? 253 THR B CG2   1 
ATOM   5882 N N     . SER D 3 260 ? 68.211  36.113 59.040  1.00 44.11  ? 254 SER B N     1 
ATOM   5883 C CA    . SER D 3 260 ? 68.141  35.326 60.271  1.00 41.68  ? 254 SER B CA    1 
ATOM   5884 C C     . SER D 3 260 ? 69.410  35.400 61.121  1.00 42.17  ? 254 SER B C     1 
ATOM   5885 O O     . SER D 3 260 ? 70.501  35.098 60.644  1.00 40.49  ? 254 SER B O     1 
ATOM   5886 C CB    . SER D 3 260 ? 67.825  33.874 59.960  1.00 45.29  ? 254 SER B CB    1 
ATOM   5887 O OG    . SER D 3 260 ? 68.608  33.030 60.782  1.00 63.52  ? 254 SER B OG    1 
ATOM   5888 N N     . GLN D 3 261 ? 69.252  35.782 62.389  1.00 37.64  ? 255 GLN B N     1 
ATOM   5889 C CA    . GLN D 3 261 ? 70.405  35.852 63.277  1.00 37.28  ? 255 GLN B CA    1 
ATOM   5890 C C     . GLN D 3 261 ? 70.739  34.504 63.929  1.00 43.56  ? 255 GLN B C     1 
ATOM   5891 O O     . GLN D 3 261 ? 69.925  33.570 63.930  1.00 45.44  ? 255 GLN B O     1 
ATOM   5892 C CB    . GLN D 3 261 ? 70.298  36.920 64.369  1.00 38.19  ? 255 GLN B CB    1 
ATOM   5893 C CG    . GLN D 3 261 ? 69.116  37.861 64.252  1.00 39.34  ? 255 GLN B CG    1 
ATOM   5894 C CD    . GLN D 3 261 ? 68.746  38.399 65.606  1.00 45.62  ? 255 GLN B CD    1 
ATOM   5895 O OE1   . GLN D 3 261 ? 68.473  37.666 66.549  1.00 41.39  ? 255 GLN B OE1   1 
ATOM   5896 N NE2   . GLN D 3 261 ? 68.645  39.712 65.764  1.00 40.44  ? 255 GLN B NE2   1 
ATOM   5897 N N     . LEU D 3 262 ? 71.947  34.405 64.485  1.00 36.61  ? 256 LEU B N     1 
ATOM   5898 C CA    . LEU D 3 262 ? 72.359  33.187 65.164  1.00 33.56  ? 256 LEU B CA    1 
ATOM   5899 C C     . LEU D 3 262 ? 71.575  33.195 66.469  1.00 33.85  ? 256 LEU B C     1 
ATOM   5900 O O     . LEU D 3 262 ? 71.450  34.230 67.120  1.00 33.18  ? 256 LEU B O     1 
ATOM   5901 C CB    . LEU D 3 262 ? 73.867  33.189 65.415  1.00 33.11  ? 256 LEU B CB    1 
ATOM   5902 C CG    . LEU D 3 262 ? 74.520  31.898 65.919  1.00 36.81  ? 256 LEU B CG    1 
ATOM   5903 C CD1   . LEU D 3 262 ? 74.112  30.719 65.076  1.00 36.89  ? 256 LEU B CD1   1 
ATOM   5904 C CD2   . LEU D 3 262 ? 76.039  32.026 65.962  1.00 36.72  ? 256 LEU B CD2   1 
ATOM   5905 N N     . SER D 3 263 ? 70.977  32.062 66.810  1.00 29.19  ? 257 SER B N     1 
ATOM   5906 C CA    . SER D 3 263 ? 70.144  31.991 68.000  1.00 27.30  ? 257 SER B CA    1 
ATOM   5907 C C     . SER D 3 263 ? 70.933  32.147 69.268  1.00 36.48  ? 257 SER B C     1 
ATOM   5908 O O     . SER D 3 263 ? 72.085  31.723 69.348  1.00 39.27  ? 257 SER B O     1 
ATOM   5909 C CB    . SER D 3 263 ? 69.317  30.707 68.033  1.00 23.80  ? 257 SER B CB    1 
ATOM   5910 O OG    . SER D 3 263 ? 70.088  29.618 68.475  1.00 24.88  ? 257 SER B OG    1 
ATOM   5911 N N     . ASN D 3 264 ? 70.300  32.764 70.260  1.00 33.38  ? 258 ASN B N     1 
ATOM   5912 C CA    . ASN D 3 264 ? 70.931  33.007 71.542  1.00 31.15  ? 258 ASN B CA    1 
ATOM   5913 C C     . ASN D 3 264 ? 71.327  31.667 72.161  1.00 33.16  ? 258 ASN B C     1 
ATOM   5914 O O     . ASN D 3 264 ? 72.324  31.560 72.858  1.00 35.61  ? 258 ASN B O     1 
ATOM   5915 C CB    . ASN D 3 264 ? 69.967  33.782 72.437  1.00 32.26  ? 258 ASN B CB    1 
ATOM   5916 C CG    . ASN D 3 264 ? 69.904  35.267 72.095  1.00 69.39  ? 258 ASN B CG    1 
ATOM   5917 O OD1   . ASN D 3 264 ? 70.193  35.668 70.970  1.00 69.07  ? 258 ASN B OD1   1 
ATOM   5918 N ND2   . ASN D 3 264 ? 69.504  36.082 73.065  1.00 69.87  ? 258 ASN B ND2   1 
ATOM   5919 N N     . SER D 3 265 ? 70.553  30.632 71.867  1.00 27.55  ? 259 SER B N     1 
ATOM   5920 C CA    . SER D 3 265 ? 70.836  29.287 72.358  1.00 25.54  ? 259 SER B CA    1 
ATOM   5921 C C     . SER D 3 265 ? 72.187  28.838 71.816  1.00 34.22  ? 259 SER B C     1 
ATOM   5922 O O     . SER D 3 265 ? 72.869  28.022 72.415  1.00 38.46  ? 259 SER B O     1 
ATOM   5923 C CB    . SER D 3 265 ? 69.751  28.324 71.852  1.00 26.61  ? 259 SER B CB    1 
ATOM   5924 O OG    . SER D 3 265 ? 69.667  27.155 72.645  1.00 38.96  ? 259 SER B OG    1 
ATOM   5925 N N     . ALA D 3 266 ? 72.550  29.348 70.650  1.00 30.41  ? 260 ALA B N     1 
ATOM   5926 C CA    . ALA D 3 266 ? 73.801  28.987 70.021  1.00 29.58  ? 260 ALA B CA    1 
ATOM   5927 C C     . ALA D 3 266 ? 74.905  29.803 70.668  1.00 31.76  ? 260 ALA B C     1 
ATOM   5928 O O     . ALA D 3 266 ? 75.912  29.267 71.117  1.00 32.06  ? 260 ALA B O     1 
ATOM   5929 C CB    . ALA D 3 266 ? 73.729  29.281 68.521  1.00 30.67  ? 260 ALA B CB    1 
ATOM   5930 N N     . LEU D 3 267 ? 74.698  31.113 70.718  1.00 27.75  ? 261 LEU B N     1 
ATOM   5931 C CA    . LEU D 3 267 ? 75.671  32.036 71.295  1.00 27.97  ? 261 LEU B CA    1 
ATOM   5932 C C     . LEU D 3 267 ? 76.066  31.661 72.718  1.00 35.38  ? 261 LEU B C     1 
ATOM   5933 O O     . LEU D 3 267 ? 77.232  31.780 73.101  1.00 35.05  ? 261 LEU B O     1 
ATOM   5934 C CB    . LEU D 3 267 ? 75.127  33.463 71.269  1.00 27.66  ? 261 LEU B CB    1 
ATOM   5935 C CG    . LEU D 3 267 ? 75.012  34.109 69.889  1.00 33.05  ? 261 LEU B CG    1 
ATOM   5936 C CD1   . LEU D 3 267 ? 74.316  35.455 69.965  1.00 33.95  ? 261 LEU B CD1   1 
ATOM   5937 C CD2   . LEU D 3 267 ? 76.385  34.258 69.236  1.00 35.41  ? 261 LEU B CD2   1 
ATOM   5938 N N     . GLY D 3 268 ? 75.079  31.225 73.502  1.00 34.22  ? 262 GLY B N     1 
ATOM   5939 C CA    . GLY D 3 268 ? 75.289  30.828 74.891  1.00 31.98  ? 262 GLY B CA    1 
ATOM   5940 C C     . GLY D 3 268 ? 75.988  29.480 74.911  1.00 33.85  ? 262 GLY B C     1 
ATOM   5941 O O     . GLY D 3 268 ? 76.785  29.183 75.807  1.00 34.69  ? 262 GLY B O     1 
ATOM   5942 N N     . GLY D 3 269 ? 75.696  28.655 73.914  1.00 28.94  ? 263 GLY B N     1 
ATOM   5943 C CA    . GLY D 3 269 ? 76.339  27.354 73.817  1.00 28.35  ? 263 GLY B CA    1 
ATOM   5944 C C     . GLY D 3 269 ? 77.846  27.545 73.579  1.00 33.21  ? 263 GLY B C     1 
ATOM   5945 O O     . GLY D 3 269 ? 78.660  26.691 73.933  1.00 32.94  ? 263 GLY B O     1 
ATOM   5946 N N     . ILE D 3 270 ? 78.228  28.660 72.969  1.00 28.37  ? 264 ILE B N     1 
ATOM   5947 C CA    . ILE D 3 270 ? 79.645  28.882 72.723  1.00 28.03  ? 264 ILE B CA    1 
ATOM   5948 C C     . ILE D 3 270 ? 80.388  28.987 74.046  1.00 32.28  ? 264 ILE B C     1 
ATOM   5949 O O     . ILE D 3 270 ? 81.516  28.509 74.163  1.00 35.74  ? 264 ILE B O     1 
ATOM   5950 C CB    . ILE D 3 270 ? 79.909  30.148 71.874  1.00 30.95  ? 264 ILE B CB    1 
ATOM   5951 C CG1   . ILE D 3 270 ? 79.175  30.071 70.528  1.00 29.97  ? 264 ILE B CG1   1 
ATOM   5952 C CG2   . ILE D 3 270 ? 81.402  30.338 71.654  1.00 31.00  ? 264 ILE B CG2   1 
ATOM   5953 C CD1   . ILE D 3 270 ? 79.235  31.358 69.730  1.00 12.06  ? 264 ILE B CD1   1 
ATOM   5954 N N     . PHE D 3 271 ? 79.732  29.581 75.044  1.00 24.91  ? 265 PHE B N     1 
ATOM   5955 C CA    . PHE D 3 271 ? 80.316  29.781 76.375  1.00 21.70  ? 265 PHE B CA    1 
ATOM   5956 C C     . PHE D 3 271 ? 80.461  28.462 77.099  1.00 27.90  ? 265 PHE B C     1 
ATOM   5957 O O     . PHE D 3 271 ? 81.516  28.147 77.657  1.00 29.34  ? 265 PHE B O     1 
ATOM   5958 C CB    . PHE D 3 271 ? 79.428  30.692 77.207  1.00 20.96  ? 265 PHE B CB    1 
ATOM   5959 C CG    . PHE D 3 271 ? 79.761  32.159 77.088  1.00 20.36  ? 265 PHE B CG    1 
ATOM   5960 C CD1   . PHE D 3 271 ? 80.932  32.683 77.660  1.00 20.99  ? 265 PHE B CD1   1 
ATOM   5961 C CD2   . PHE D 3 271 ? 78.876  33.029 76.466  1.00 17.50  ? 265 PHE B CD2   1 
ATOM   5962 C CE1   . PHE D 3 271 ? 81.212  34.045 77.590  1.00 19.81  ? 265 PHE B CE1   1 
ATOM   5963 C CE2   . PHE D 3 271 ? 79.156  34.397 76.389  1.00 19.12  ? 265 PHE B CE2   1 
ATOM   5964 C CZ    . PHE D 3 271 ? 80.313  34.905 76.950  1.00 17.40  ? 265 PHE B CZ    1 
ATOM   5965 N N     . GLY D 3 272 ? 79.385  27.688 77.087  1.00 22.57  ? 266 GLY B N     1 
ATOM   5966 C CA    . GLY D 3 272 ? 79.377  26.398 77.754  1.00 19.71  ? 266 GLY B CA    1 
ATOM   5967 C C     . GLY D 3 272 ? 80.312  25.426 77.079  1.00 27.67  ? 266 GLY B C     1 
ATOM   5968 O O     . GLY D 3 272 ? 80.902  24.589 77.750  1.00 29.07  ? 266 GLY B O     1 
ATOM   5969 N N     . ALA D 3 273 ? 80.413  25.515 75.751  1.00 27.26  ? 267 ALA B N     1 
ATOM   5970 C CA    . ALA D 3 273 ? 81.282  24.638 74.961  1.00 26.65  ? 267 ALA B CA    1 
ATOM   5971 C C     . ALA D 3 273 ? 82.741  24.945 75.295  1.00 32.30  ? 267 ALA B C     1 
ATOM   5972 O O     . ALA D 3 273 ? 83.541  24.041 75.527  1.00 30.65  ? 267 ALA B O     1 
ATOM   5973 C CB    . ALA D 3 273 ? 81.025  24.841 73.470  1.00 26.53  ? 267 ALA B CB    1 
ATOM   5974 N N     . THR D 3 274 ? 83.071  26.236 75.324  1.00 28.46  ? 268 THR B N     1 
ATOM   5975 C CA    . THR D 3 274 ? 84.418  26.669 75.653  1.00 26.92  ? 268 THR B CA    1 
ATOM   5976 C C     . THR D 3 274 ? 84.776  26.184 77.042  1.00 35.40  ? 268 THR B C     1 
ATOM   5977 O O     . THR D 3 274 ? 85.892  25.733 77.289  1.00 38.46  ? 268 THR B O     1 
ATOM   5978 C CB    . THR D 3 274 ? 84.523  28.169 75.679  1.00 23.25  ? 268 THR B CB    1 
ATOM   5979 O OG1   . THR D 3 274 ? 84.255  28.678 74.376  1.00 26.63  ? 268 THR B OG1   1 
ATOM   5980 C CG2   . THR D 3 274 ? 85.920  28.569 76.085  1.00 24.21  ? 268 THR B CG2   1 
ATOM   5981 N N     . HIS D 3 275 ? 83.824  26.295 77.959  1.00 29.89  ? 269 HIS B N     1 
ATOM   5982 C CA    . HIS D 3 275 ? 84.045  25.848 79.319  1.00 25.58  ? 269 HIS B CA    1 
ATOM   5983 C C     . HIS D 3 275 ? 84.353  24.346 79.322  1.00 27.15  ? 269 HIS B C     1 
ATOM   5984 O O     . HIS D 3 275 ? 85.340  23.913 79.897  1.00 30.10  ? 269 HIS B O     1 
ATOM   5985 C CB    . HIS D 3 275 ? 82.833  26.193 80.198  1.00 24.76  ? 269 HIS B CB    1 
ATOM   5986 C CG    . HIS D 3 275 ? 83.092  26.044 81.664  1.00 28.10  ? 269 HIS B CG    1 
ATOM   5987 N ND1   . HIS D 3 275 ? 82.719  24.921 82.375  1.00 29.63  ? 269 HIS B ND1   1 
ATOM   5988 C CD2   . HIS D 3 275 ? 83.708  26.864 82.549  1.00 28.52  ? 269 HIS B CD2   1 
ATOM   5989 C CE1   . HIS D 3 275 ? 83.103  25.052 83.631  1.00 28.12  ? 269 HIS B CE1   1 
ATOM   5990 N NE2   . HIS D 3 275 ? 83.698  26.225 83.765  1.00 28.05  ? 269 HIS B NE2   1 
ATOM   5991 N N     . ARG D 3 276 ? 83.517  23.563 78.652  1.00 23.28  ? 270 ARG B N     1 
ATOM   5992 C CA    . ARG D 3 276 ? 83.672  22.117 78.580  1.00 22.94  ? 270 ARG B CA    1 
ATOM   5993 C C     . ARG D 3 276 ? 85.080  21.785 78.114  1.00 31.75  ? 270 ARG B C     1 
ATOM   5994 O O     . ARG D 3 276 ? 85.742  20.899 78.652  1.00 32.15  ? 270 ARG B O     1 
ATOM   5995 C CB    . ARG D 3 276 ? 82.655  21.537 77.587  1.00 20.32  ? 270 ARG B CB    1 
ATOM   5996 C CG    . ARG D 3 276 ? 82.590  20.008 77.603  1.00 34.91  ? 270 ARG B CG    1 
ATOM   5997 C CD    . ARG D 3 276 ? 81.410  19.432 76.813  1.00 39.13  ? 270 ARG B CD    1 
ATOM   5998 N NE    . ARG D 3 276 ? 81.273  20.004 75.480  1.00 53.11  ? 270 ARG B NE    1 
ATOM   5999 C CZ    . ARG D 3 276 ? 80.267  20.790 75.110  1.00 70.43  ? 270 ARG B CZ    1 
ATOM   6000 N NH1   . ARG D 3 276 ? 79.314  21.118 75.983  1.00 51.16  ? 270 ARG B NH1   1 
ATOM   6001 N NH2   . ARG D 3 276 ? 80.224  21.262 73.870  1.00 51.34  ? 270 ARG B NH2   1 
ATOM   6002 N N     . LEU D 3 277 ? 85.516  22.516 77.095  1.00 28.28  ? 271 LEU B N     1 
ATOM   6003 C CA    . LEU D 3 277 ? 86.835  22.365 76.504  1.00 27.78  ? 271 LEU B CA    1 
ATOM   6004 C C     . LEU D 3 277 ? 87.981  22.413 77.530  1.00 33.61  ? 271 LEU B C     1 
ATOM   6005 O O     . LEU D 3 277 ? 88.856  21.545 77.548  1.00 35.18  ? 271 LEU B O     1 
ATOM   6006 C CB    . LEU D 3 277 ? 87.032  23.457 75.451  1.00 27.05  ? 271 LEU B CB    1 
ATOM   6007 C CG    . LEU D 3 277 ? 88.441  23.621 74.880  1.00 30.56  ? 271 LEU B CG    1 
ATOM   6008 C CD1   . LEU D 3 277 ? 88.691  22.619 73.756  1.00 29.68  ? 271 LEU B CD1   1 
ATOM   6009 C CD2   . LEU D 3 277 ? 88.641  25.053 74.404  1.00 28.88  ? 271 LEU B CD2   1 
ATOM   6010 N N     . ILE D 3 278 ? 87.974  23.420 78.390  1.00 27.34  ? 272 ILE B N     1 
ATOM   6011 C CA    . ILE D 3 278 ? 89.024  23.554 79.386  1.00 27.92  ? 272 ILE B CA    1 
ATOM   6012 C C     . ILE D 3 278 ? 88.823  22.743 80.677  1.00 33.13  ? 272 ILE B C     1 
ATOM   6013 O O     . ILE D 3 278 ? 89.801  22.313 81.298  1.00 35.71  ? 272 ILE B O     1 
ATOM   6014 C CB    . ILE D 3 278 ? 89.183  25.028 79.803  1.00 31.82  ? 272 ILE B CB    1 
ATOM   6015 C CG1   . ILE D 3 278 ? 89.670  25.888 78.637  1.00 33.02  ? 272 ILE B CG1   1 
ATOM   6016 C CG2   . ILE D 3 278 ? 90.109  25.154 81.017  1.00 29.77  ? 272 ILE B CG2   1 
ATOM   6017 C CD1   . ILE D 3 278 ? 90.676  26.933 79.076  1.00 43.50  ? 272 ILE B CD1   1 
ATOM   6018 N N     . TYR D 3 279 ? 87.569  22.580 81.107  1.00 25.84  ? 273 TYR B N     1 
ATOM   6019 C CA    . TYR D 3 279 ? 87.265  21.940 82.389  1.00 23.65  ? 273 TYR B CA    1 
ATOM   6020 C C     . TYR D 3 279 ? 86.524  20.614 82.373  1.00 30.35  ? 273 TYR B C     1 
ATOM   6021 O O     . TYR D 3 279 ? 86.212  20.060 83.435  1.00 33.78  ? 273 TYR B O     1 
ATOM   6022 C CB    . TYR D 3 279 ? 86.494  22.903 83.286  1.00 22.95  ? 273 TYR B CB    1 
ATOM   6023 C CG    . TYR D 3 279 ? 87.192  24.205 83.537  1.00 22.39  ? 273 TYR B CG    1 
ATOM   6024 C CD1   . TYR D 3 279 ? 88.188  24.298 84.496  1.00 21.46  ? 273 TYR B CD1   1 
ATOM   6025 C CD2   . TYR D 3 279 ? 86.867  25.341 82.813  1.00 23.21  ? 273 TYR B CD2   1 
ATOM   6026 C CE1   . TYR D 3 279 ? 88.842  25.483 84.737  1.00 21.10  ? 273 TYR B CE1   1 
ATOM   6027 C CE2   . TYR D 3 279 ? 87.528  26.534 83.048  1.00 26.16  ? 273 TYR B CE2   1 
ATOM   6028 C CZ    . TYR D 3 279 ? 88.507  26.593 84.018  1.00 31.97  ? 273 TYR B CZ    1 
ATOM   6029 O OH    . TYR D 3 279 ? 89.146  27.774 84.287  1.00 46.38  ? 273 TYR B OH    1 
ATOM   6030 N N     . GLY D 3 280 ? 86.218  20.110 81.187  1.00 23.42  ? 274 GLY B N     1 
ATOM   6031 C CA    . GLY D 3 280 ? 85.530  18.833 81.085  1.00 22.52  ? 274 GLY B CA    1 
ATOM   6032 C C     . GLY D 3 280 ? 84.016  18.980 81.075  1.00 31.75  ? 274 GLY B C     1 
ATOM   6033 O O     . GLY D 3 280 ? 83.489  20.084 81.165  1.00 34.39  ? 274 GLY B O     1 
ATOM   6034 N N     . ALA D 3 281 ? 83.330  17.851 81.012  1.00 32.58  ? 275 ALA B N     1 
ATOM   6035 C CA    . ALA D 3 281 ? 81.871  17.814 80.995  1.00 34.54  ? 275 ALA B CA    1 
ATOM   6036 C C     . ALA D 3 281 ? 81.349  18.170 82.389  1.00 44.52  ? 275 ALA B C     1 
ATOM   6037 O O     . ALA D 3 281 ? 82.005  17.891 83.394  1.00 43.36  ? 275 ALA B O     1 
ATOM   6038 C CB    . ALA D 3 281 ? 81.390  16.447 80.595  1.00 35.06  ? 275 ALA B CB    1 
ATOM   6039 N N     . LYS D 3 282 ? 80.155  18.758 82.440  1.00 45.80  ? 276 LYS B N     1 
ATOM   6040 C CA    . LYS D 3 282 ? 79.578  19.217 83.700  1.00 46.10  ? 276 LYS B CA    1 
ATOM   6041 C C     . LYS D 3 282 ? 78.781  18.270 84.563  1.00 55.90  ? 276 LYS B C     1 
ATOM   6042 O O     . LYS D 3 282 ? 78.185  17.316 84.082  1.00 55.81  ? 276 LYS B O     1 
ATOM   6043 C CB    . LYS D 3 282 ? 78.818  20.527 83.522  1.00 46.75  ? 276 LYS B CB    1 
ATOM   6044 C CG    . LYS D 3 282 ? 77.521  20.392 82.772  1.00 36.88  ? 276 LYS B CG    1 
ATOM   6045 C CD    . LYS D 3 282 ? 76.875  21.760 82.570  1.00 41.33  ? 276 LYS B CD    1 
ATOM   6046 C CE    . LYS D 3 282 ? 75.431  21.647 82.063  1.00 39.27  ? 276 LYS B CE    1 
ATOM   6047 N NZ    . LYS D 3 282 ? 75.000  22.864 81.323  1.00 53.70  ? 276 LYS B NZ    1 
ATOM   6048 N N     . ASP D 3 283 ? 78.779  18.590 85.853  1.00 59.60  ? 277 ASP B N     1 
ATOM   6049 C CA    . ASP D 3 283 ? 78.060  17.867 86.896  1.00 62.32  ? 277 ASP B CA    1 
ATOM   6050 C C     . ASP D 3 283 ? 76.812  17.176 86.375  1.00 68.38  ? 277 ASP B C     1 
ATOM   6051 O O     . ASP D 3 283 ? 76.280  17.533 85.325  1.00 67.60  ? 277 ASP B O     1 
ATOM   6052 C CB    . ASP D 3 283 ? 77.614  18.882 87.953  1.00 65.73  ? 277 ASP B CB    1 
ATOM   6053 C CG    . ASP D 3 283 ? 77.986  18.470 89.348  1.00 85.09  ? 277 ASP B CG    1 
ATOM   6054 O OD1   . ASP D 3 283 ? 77.880  17.261 89.638  1.00 89.63  ? 277 ASP B OD1   1 
ATOM   6055 O OD2   . ASP D 3 283 ? 78.349  19.357 90.153  1.00 87.95  ? 277 ASP B OD2   1 
ATOM   6056 N N     . ASP D 3 284 ? 76.307  16.230 87.156  1.00 68.29  ? 278 ASP B N     1 
ATOM   6057 C CA    . ASP D 3 284 ? 75.068  15.536 86.818  1.00 70.18  ? 278 ASP B CA    1 
ATOM   6058 C C     . ASP D 3 284 ? 73.949  16.198 87.636  1.00 72.72  ? 278 ASP B C     1 
ATOM   6059 O O     . ASP D 3 284 ? 72.756  15.954 87.418  1.00 71.38  ? 278 ASP B O     1 
ATOM   6060 C CB    . ASP D 3 284 ? 75.179  14.053 87.179  1.00 73.76  ? 278 ASP B CB    1 
ATOM   6061 C CG    . ASP D 3 284 ? 76.001  13.826 88.440  1.00 97.11  ? 278 ASP B CG    1 
ATOM   6062 O OD1   . ASP D 3 284 ? 76.313  14.827 89.124  1.00 100.00 ? 278 ASP B OD1   1 
ATOM   6063 O OD2   . ASP D 3 284 ? 76.346  12.659 88.743  1.00 100.00 ? 278 ASP B OD2   1 
ATOM   6064 N N     . SER D 3 285 ? 74.360  17.054 88.568  1.00 68.42  ? 279 SER B N     1 
ATOM   6065 C CA    . SER D 3 285 ? 73.443  17.778 89.442  1.00 68.25  ? 279 SER B CA    1 
ATOM   6066 C C     . SER D 3 285 ? 72.193  18.352 88.764  1.00 70.30  ? 279 SER B C     1 
ATOM   6067 O O     . SER D 3 285 ? 71.106  18.338 89.340  1.00 70.58  ? 279 SER B O     1 
ATOM   6068 C CB    . SER D 3 285 ? 74.191  18.906 90.146  1.00 72.01  ? 279 SER B CB    1 
ATOM   6069 O OG    . SER D 3 285 ? 74.851  19.722 89.197  1.00 79.08  ? 279 SER B OG    1 
ATOM   6070 N N     . GLY D 3 286 ? 72.343  18.889 87.559  1.00 63.26  ? 280 GLY B N     1 
ATOM   6071 C CA    . GLY D 3 286 ? 71.206  19.491 86.864  1.00 60.30  ? 280 GLY B CA    1 
ATOM   6072 C C     . GLY D 3 286 ? 71.105  20.966 87.258  1.00 58.53  ? 280 GLY B C     1 
ATOM   6073 O O     . GLY D 3 286 ? 70.221  21.691 86.797  1.00 55.05  ? 280 GLY B O     1 
ATOM   6074 N N     . GLN D 3 287 ? 72.011  21.407 88.122  1.00 54.11  ? 281 GLN B N     1 
ATOM   6075 C CA    . GLN D 3 287 ? 72.014  22.802 88.534  1.00 53.04  ? 281 GLN B CA    1 
ATOM   6076 C C     . GLN D 3 287 ? 72.276  23.685 87.294  1.00 51.06  ? 281 GLN B C     1 
ATOM   6077 O O     . GLN D 3 287 ? 72.642  23.199 86.226  1.00 50.41  ? 281 GLN B O     1 
ATOM   6078 C CB    . GLN D 3 287 ? 73.119  23.073 89.567  1.00 54.85  ? 281 GLN B CB    1 
ATOM   6079 C CG    . GLN D 3 287 ? 73.115  22.203 90.811  1.00 74.38  ? 281 GLN B CG    1 
ATOM   6080 C CD    . GLN D 3 287 ? 74.375  22.370 91.650  1.00 100.00 ? 281 GLN B CD    1 
ATOM   6081 O OE1   . GLN D 3 287 ? 74.506  23.328 92.427  1.00 96.93  ? 281 GLN B OE1   1 
ATOM   6082 N NE2   . GLN D 3 287 ? 75.316  21.460 91.565  1.00 100.00 ? 281 GLN B NE2   1 
ATOM   6083 N N     . ARG D 3 288 ? 72.138  24.990 87.479  1.00 42.08  ? 282 ARG B N     1 
ATOM   6084 C CA    . ARG D 3 288 ? 72.396  25.957 86.434  1.00 39.37  ? 282 ARG B CA    1 
ATOM   6085 C C     . ARG D 3 288 ? 73.709  26.623 86.806  1.00 43.15  ? 282 ARG B C     1 
ATOM   6086 O O     . ARG D 3 288 ? 74.077  26.631 87.979  1.00 44.56  ? 282 ARG B O     1 
ATOM   6087 C CB    . ARG D 3 288 ? 71.309  27.028 86.461  1.00 36.45  ? 282 ARG B CB    1 
ATOM   6088 C CG    . ARG D 3 288 ? 70.170  26.809 85.479  1.00 50.06  ? 282 ARG B CG    1 
ATOM   6089 C CD    . ARG D 3 288 ? 69.325  28.078 85.334  1.00 52.96  ? 282 ARG B CD    1 
ATOM   6090 N NE    . ARG D 3 288 ? 67.979  27.817 84.814  1.00 44.22  ? 282 ARG B NE    1 
ATOM   6091 C CZ    . ARG D 3 288 ? 67.133  28.775 84.436  1.00 49.34  ? 282 ARG B CZ    1 
ATOM   6092 N NH1   . ARG D 3 288 ? 67.489  30.049 84.544  1.00 41.48  ? 282 ARG B NH1   1 
ATOM   6093 N NH2   . ARG D 3 288 ? 65.934  28.470 83.956  1.00 27.39  ? 282 ARG B NH2   1 
ATOM   6094 N N     . TYR D 3 289 ? 74.391  27.214 85.823  1.00 36.10  ? 283 TYR B N     1 
ATOM   6095 C CA    . TYR D 3 289 ? 75.648  27.920 86.057  1.00 31.75  ? 283 TYR B CA    1 
ATOM   6096 C C     . TYR D 3 289 ? 76.832  27.025 86.394  1.00 35.35  ? 283 TYR B C     1 
ATOM   6097 O O     . TYR D 3 289 ? 77.784  27.465 87.047  1.00 38.36  ? 283 TYR B O     1 
ATOM   6098 C CB    . TYR D 3 289 ? 75.475  28.964 87.150  1.00 30.89  ? 283 TYR B CB    1 
ATOM   6099 C CG    . TYR D 3 289 ? 74.514  30.036 86.766  1.00 32.36  ? 283 TYR B CG    1 
ATOM   6100 C CD1   . TYR D 3 289 ? 74.434  30.476 85.455  1.00 33.27  ? 283 TYR B CD1   1 
ATOM   6101 C CD2   . TYR D 3 289 ? 73.654  30.587 87.695  1.00 35.17  ? 283 TYR B CD2   1 
ATOM   6102 C CE1   . TYR D 3 289 ? 73.529  31.458 85.078  1.00 31.09  ? 283 TYR B CE1   1 
ATOM   6103 C CE2   . TYR D 3 289 ? 72.735  31.562 87.327  1.00 36.47  ? 283 TYR B CE2   1 
ATOM   6104 C CZ    . TYR D 3 289 ? 72.683  31.993 86.018  1.00 35.29  ? 283 TYR B CZ    1 
ATOM   6105 O OH    . TYR D 3 289 ? 71.788  32.963 85.642  1.00 26.10  ? 283 TYR B OH    1 
ATOM   6106 N N     . LEU D 3 290 ? 76.796  25.778 85.946  1.00 28.74  ? 284 LEU B N     1 
ATOM   6107 C CA    . LEU D 3 290 ? 77.919  24.888 86.187  1.00 29.89  ? 284 LEU B CA    1 
ATOM   6108 C C     . LEU D 3 290 ? 79.070  25.179 85.203  1.00 37.12  ? 284 LEU B C     1 
ATOM   6109 O O     . LEU D 3 290 ? 80.199  24.746 85.421  1.00 39.86  ? 284 LEU B O     1 
ATOM   6110 C CB    . LEU D 3 290 ? 77.466  23.433 86.089  1.00 29.65  ? 284 LEU B CB    1 
ATOM   6111 C CG    . LEU D 3 290 ? 76.381  23.067 87.108  1.00 33.61  ? 284 LEU B CG    1 
ATOM   6112 C CD1   . LEU D 3 290 ? 76.251  21.582 87.333  1.00 32.09  ? 284 LEU B CD1   1 
ATOM   6113 C CD2   . LEU D 3 290 ? 76.581  23.791 88.422  1.00 37.57  ? 284 LEU B CD2   1 
ATOM   6114 N N     . ALA D 3 291 ? 78.765  25.919 84.133  1.00 29.61  ? 285 ALA B N     1 
ATOM   6115 C CA    . ALA D 3 291 ? 79.736  26.307 83.112  1.00 26.68  ? 285 ALA B CA    1 
ATOM   6116 C C     . ALA D 3 291 ? 79.437  27.747 82.678  1.00 30.41  ? 285 ALA B C     1 
ATOM   6117 O O     . ALA D 3 291 ? 78.413  28.301 83.054  1.00 31.29  ? 285 ALA B O     1 
ATOM   6118 C CB    . ALA D 3 291 ? 79.651  25.373 81.935  1.00 26.53  ? 285 ALA B CB    1 
ATOM   6119 N N     . TRP D 3 292 ? 80.324  28.369 81.913  1.00 24.88  ? 286 TRP B N     1 
ATOM   6120 C CA    . TRP D 3 292 ? 80.080  29.739 81.512  1.00 24.78  ? 286 TRP B CA    1 
ATOM   6121 C C     . TRP D 3 292 ? 78.815  29.782 80.679  1.00 28.00  ? 286 TRP B C     1 
ATOM   6122 O O     . TRP D 3 292 ? 78.384  28.768 80.151  1.00 28.32  ? 286 TRP B O     1 
ATOM   6123 C CB    . TRP D 3 292 ? 81.261  30.312 80.738  1.00 25.12  ? 286 TRP B CB    1 
ATOM   6124 C CG    . TRP D 3 292 ? 82.569  30.380 81.505  1.00 28.48  ? 286 TRP B CG    1 
ATOM   6125 C CD1   . TRP D 3 292 ? 82.786  30.950 82.730  1.00 31.41  ? 286 TRP B CD1   1 
ATOM   6126 C CD2   . TRP D 3 292 ? 83.847  29.891 81.059  1.00 29.78  ? 286 TRP B CD2   1 
ATOM   6127 N NE1   . TRP D 3 292 ? 84.112  30.833 83.075  1.00 31.07  ? 286 TRP B NE1   1 
ATOM   6128 C CE2   . TRP D 3 292 ? 84.784  30.187 82.066  1.00 33.88  ? 286 TRP B CE2   1 
ATOM   6129 C CE3   . TRP D 3 292 ? 84.287  29.228 79.902  1.00 31.13  ? 286 TRP B CE3   1 
ATOM   6130 C CZ2   . TRP D 3 292 ? 86.135  29.858 81.941  1.00 33.78  ? 286 TRP B CZ2   1 
ATOM   6131 C CZ3   . TRP D 3 292 ? 85.621  28.927 79.779  1.00 31.92  ? 286 TRP B CZ3   1 
ATOM   6132 C CH2   . TRP D 3 292 ? 86.529  29.240 80.787  1.00 32.40  ? 286 TRP B CH2   1 
ATOM   6133 N N     . SER D 3 293 ? 78.215  30.963 80.582  1.00 26.14  ? 287 SER B N     1 
ATOM   6134 C CA    . SER D 3 293 ? 76.987  31.169 79.821  1.00 25.47  ? 287 SER B CA    1 
ATOM   6135 C C     . SER D 3 293 ? 76.874  32.636 79.433  1.00 28.45  ? 287 SER B C     1 
ATOM   6136 O O     . SER D 3 293 ? 77.624  33.480 79.922  1.00 30.98  ? 287 SER B O     1 
ATOM   6137 C CB    . SER D 3 293 ? 75.772  30.782 80.670  1.00 29.77  ? 287 SER B CB    1 
ATOM   6138 O OG    . SER D 3 293 ? 75.502  31.784 81.646  1.00 30.48  ? 287 SER B OG    1 
ATOM   6139 N N     . GLY D 3 294 ? 75.887  32.927 78.598  1.00 23.74  ? 288 GLY B N     1 
ATOM   6140 C CA    . GLY D 3 294 ? 75.599  34.273 78.111  1.00 22.04  ? 288 GLY B CA    1 
ATOM   6141 C C     . GLY D 3 294 ? 76.030  35.451 78.958  1.00 27.72  ? 288 GLY B C     1 
ATOM   6142 O O     . GLY D 3 294 ? 76.545  36.424 78.428  1.00 29.43  ? 288 GLY B O     1 
ATOM   6143 N N     . HIS D 3 295 ? 75.796  35.403 80.261  1.00 27.78  ? 289 HIS B N     1 
ATOM   6144 C CA    . HIS D 3 295 ? 76.144  36.553 81.094  1.00 28.72  ? 289 HIS B CA    1 
ATOM   6145 C C     . HIS D 3 295 ? 77.519  36.505 81.751  1.00 31.27  ? 289 HIS B C     1 
ATOM   6146 O O     . HIS D 3 295 ? 77.927  37.469 82.415  1.00 33.18  ? 289 HIS B O     1 
ATOM   6147 C CB    . HIS D 3 295 ? 75.044  36.811 82.150  1.00 30.73  ? 289 HIS B CB    1 
ATOM   6148 C CG    . HIS D 3 295 ? 74.123  37.934 81.797  1.00 35.55  ? 289 HIS B CG    1 
ATOM   6149 N ND1   . HIS D 3 295 ? 73.600  38.094 80.531  1.00 38.96  ? 289 HIS B ND1   1 
ATOM   6150 C CD2   . HIS D 3 295 ? 73.645  38.962 82.534  1.00 38.04  ? 289 HIS B CD2   1 
ATOM   6151 C CE1   . HIS D 3 295 ? 72.839  39.172 80.503  1.00 38.71  ? 289 HIS B CE1   1 
ATOM   6152 N NE2   . HIS D 3 295 ? 72.848  39.716 81.706  1.00 39.08  ? 289 HIS B NE2   1 
ATOM   6153 N N     . SER D 3 296 ? 78.239  35.403 81.551  1.00 23.08  ? 290 SER B N     1 
ATOM   6154 C CA    . SER D 3 296 ? 79.542  35.192 82.178  1.00 21.15  ? 290 SER B CA    1 
ATOM   6155 C C     . SER D 3 296 ? 80.641  36.239 82.001  1.00 30.26  ? 290 SER B C     1 
ATOM   6156 O O     . SER D 3 296 ? 81.479  36.413 82.882  1.00 34.29  ? 290 SER B O     1 
ATOM   6157 C CB    . SER D 3 296 ? 80.054  33.809 81.835  1.00 20.41  ? 290 SER B CB    1 
ATOM   6158 O OG    . SER D 3 296 ? 79.056  32.847 82.111  1.00 24.73  ? 290 SER B OG    1 
ATOM   6159 N N     . ALA D 3 297 ? 80.645  36.918 80.860  1.00 27.11  ? 291 ALA B N     1 
ATOM   6160 C CA    . ALA D 3 297 ? 81.654  37.923 80.550  1.00 26.77  ? 291 ALA B CA    1 
ATOM   6161 C C     . ALA D 3 297 ? 81.320  39.298 81.097  1.00 35.94  ? 291 ALA B C     1 
ATOM   6162 O O     . ALA D 3 297 ? 82.211  40.121 81.302  1.00 35.42  ? 291 ALA B O     1 
ATOM   6163 C CB    . ALA D 3 297 ? 81.883  37.985 79.070  1.00 27.15  ? 291 ALA B CB    1 
ATOM   6164 N N     . ARG D 3 298 ? 80.027  39.536 81.318  1.00 37.42  ? 292 ARG B N     1 
ATOM   6165 C CA    . ARG D 3 298 ? 79.507  40.789 81.891  1.00 36.45  ? 292 ARG B CA    1 
ATOM   6166 C C     . ARG D 3 298 ? 79.878  40.760 83.375  1.00 36.04  ? 292 ARG B C     1 
ATOM   6167 O O     . ARG D 3 298 ? 80.578  41.627 83.898  1.00 34.80  ? 292 ARG B O     1 
ATOM   6168 C CB    . ARG D 3 298 ? 77.975  40.799 81.776  1.00 36.02  ? 292 ARG B CB    1 
ATOM   6169 C CG    . ARG D 3 298 ? 77.413  41.775 80.755  1.00 46.16  ? 292 ARG B CG    1 
ATOM   6170 C CD    . ARG D 3 298 ? 75.880  41.690 80.646  1.00 49.61  ? 292 ARG B CD    1 
ATOM   6171 N NE    . ARG D 3 298 ? 75.182  42.760 81.371  1.00 45.66  ? 292 ARG B NE    1 
ATOM   6172 C CZ    . ARG D 3 298 ? 75.035  44.008 80.932  1.00 43.84  ? 292 ARG B CZ    1 
ATOM   6173 N NH1   . ARG D 3 298 ? 75.538  44.366 79.762  1.00 18.03  ? 292 ARG B NH1   1 
ATOM   6174 N NH2   . ARG D 3 298 ? 74.386  44.903 81.661  1.00 37.40  ? 292 ARG B NH2   1 
ATOM   6175 N N     . VAL D 3 299 ? 79.423  39.713 84.038  1.00 30.43  ? 293 VAL B N     1 
ATOM   6176 C CA    . VAL D 3 299 ? 79.757  39.512 85.431  1.00 30.55  ? 293 VAL B CA    1 
ATOM   6177 C C     . VAL D 3 299 ? 81.271  39.647 85.585  1.00 31.80  ? 293 VAL B C     1 
ATOM   6178 O O     . VAL D 3 299 ? 81.749  40.462 86.360  1.00 31.91  ? 293 VAL B O     1 
ATOM   6179 C CB    . VAL D 3 299 ? 79.363  38.095 85.872  1.00 36.45  ? 293 VAL B CB    1 
ATOM   6180 C CG1   . VAL D 3 299 ? 80.027  37.746 87.181  1.00 36.97  ? 293 VAL B CG1   1 
ATOM   6181 C CG2   . VAL D 3 299 ? 77.837  37.943 85.936  1.00 36.57  ? 293 VAL B CG2   1 
ATOM   6182 N N     . GLY D 3 300 ? 82.019  38.854 84.820  1.00 31.27  ? 294 GLY B N     1 
ATOM   6183 C CA    . GLY D 3 300 ? 83.493  38.844 84.863  1.00 33.25  ? 294 GLY B CA    1 
ATOM   6184 C C     . GLY D 3 300 ? 84.236  40.150 84.520  1.00 38.20  ? 294 GLY B C     1 
ATOM   6185 O O     . GLY D 3 300 ? 85.253  40.472 85.142  1.00 34.74  ? 294 GLY B O     1 
ATOM   6186 N N     . ALA D 3 301 ? 83.765  40.862 83.499  1.00 37.01  ? 295 ALA B N     1 
ATOM   6187 C CA    . ALA D 3 301 ? 84.392  42.119 83.095  1.00 38.03  ? 295 ALA B CA    1 
ATOM   6188 C C     . ALA D 3 301 ? 84.171  43.173 84.182  1.00 48.97  ? 295 ALA B C     1 
ATOM   6189 O O     . ALA D 3 301 ? 85.113  43.830 84.635  1.00 48.96  ? 295 ALA B O     1 
ATOM   6190 C CB    . ALA D 3 301 ? 83.829  42.592 81.764  1.00 37.87  ? 295 ALA B CB    1 
ATOM   6191 N N     . ALA D 3 302 ? 82.916  43.322 84.600  1.00 46.73  ? 296 ALA B N     1 
ATOM   6192 C CA    . ALA D 3 302 ? 82.560  44.261 85.652  1.00 45.33  ? 296 ALA B CA    1 
ATOM   6193 C C     . ALA D 3 302 ? 83.558  44.058 86.768  1.00 45.30  ? 296 ALA B C     1 
ATOM   6194 O O     . ALA D 3 302 ? 84.226  44.987 87.200  1.00 46.51  ? 296 ALA B O     1 
ATOM   6195 C CB    . ALA D 3 302 ? 81.156  43.965 86.158  1.00 46.77  ? 296 ALA B CB    1 
ATOM   6196 N N     . ARG D 3 303 ? 83.669  42.818 87.219  1.00 39.16  ? 297 ARG B N     1 
ATOM   6197 C CA    . ARG D 3 303 ? 84.612  42.470 88.275  1.00 39.82  ? 297 ARG B CA    1 
ATOM   6198 C C     . ARG D 3 303 ? 86.056  42.821 87.905  1.00 46.43  ? 297 ARG B C     1 
ATOM   6199 O O     . ARG D 3 303 ? 86.778  43.439 88.678  1.00 48.73  ? 297 ARG B O     1 
ATOM   6200 C CB    . ARG D 3 303 ? 84.575  40.970 88.534  1.00 40.09  ? 297 ARG B CB    1 
ATOM   6201 C CG    . ARG D 3 303 ? 83.264  40.399 89.002  1.00 44.02  ? 297 ARG B CG    1 
ATOM   6202 C CD    . ARG D 3 303 ? 83.540  38.966 89.397  1.00 61.05  ? 297 ARG B CD    1 
ATOM   6203 N NE    . ARG D 3 303 ? 82.393  38.309 89.998  1.00 69.20  ? 297 ARG B NE    1 
ATOM   6204 C CZ    . ARG D 3 303 ? 82.451  37.110 90.560  1.00 86.12  ? 297 ARG B CZ    1 
ATOM   6205 N NH1   . ARG D 3 303 ? 83.611  36.464 90.608  1.00 65.48  ? 297 ARG B NH1   1 
ATOM   6206 N NH2   . ARG D 3 303 ? 81.364  36.574 91.099  1.00 84.84  ? 297 ARG B NH2   1 
ATOM   6207 N N     . ASP D 3 304 ? 86.507  42.363 86.746  1.00 41.97  ? 298 ASP B N     1 
ATOM   6208 C CA    . ASP D 3 304 ? 87.876  42.638 86.344  1.00 40.33  ? 298 ASP B CA    1 
ATOM   6209 C C     . ASP D 3 304 ? 88.158  44.135 86.491  1.00 45.45  ? 298 ASP B C     1 
ATOM   6210 O O     . ASP D 3 304 ? 89.195  44.530 87.024  1.00 47.54  ? 298 ASP B O     1 
ATOM   6211 C CB    . ASP D 3 304 ? 88.131  42.167 84.906  1.00 39.66  ? 298 ASP B CB    1 
ATOM   6212 C CG    . ASP D 3 304 ? 88.386  40.682 84.817  1.00 39.19  ? 298 ASP B CG    1 
ATOM   6213 O OD1   . ASP D 3 304 ? 88.596  40.048 85.865  1.00 38.86  ? 298 ASP B OD1   1 
ATOM   6214 O OD2   . ASP D 3 304 ? 88.421  40.135 83.698  1.00 48.49  ? 298 ASP B OD2   1 
ATOM   6215 N N     . MET D 3 305 ? 87.222  44.960 86.029  1.00 39.06  ? 299 MET B N     1 
ATOM   6216 C CA    . MET D 3 305 ? 87.368  46.410 86.094  1.00 39.08  ? 299 MET B CA    1 
ATOM   6217 C C     . MET D 3 305 ? 87.451  46.925 87.541  1.00 43.80  ? 299 MET B C     1 
ATOM   6218 O O     . MET D 3 305 ? 88.262  47.799 87.851  1.00 44.34  ? 299 MET B O     1 
ATOM   6219 C CB    . MET D 3 305 ? 86.196  47.092 85.389  1.00 41.14  ? 299 MET B CB    1 
ATOM   6220 C CG    . MET D 3 305 ? 86.196  46.991 83.894  1.00 44.13  ? 299 MET B CG    1 
ATOM   6221 S SD    . MET D 3 305 ? 84.740  47.808 83.221  1.00 48.77  ? 299 MET B SD    1 
ATOM   6222 C CE    . MET D 3 305 ? 85.476  49.322 82.650  1.00 45.10  ? 299 MET B CE    1 
ATOM   6223 N N     . ALA D 3 306 ? 86.577  46.423 88.408  1.00 38.32  ? 300 ALA B N     1 
ATOM   6224 C CA    . ALA D 3 306 ? 86.582  46.833 89.804  1.00 38.05  ? 300 ALA B CA    1 
ATOM   6225 C C     . ALA D 3 306 ? 87.965  46.562 90.380  1.00 50.11  ? 300 ALA B C     1 
ATOM   6226 O O     . ALA D 3 306 ? 88.566  47.419 91.018  1.00 54.06  ? 300 ALA B O     1 
ATOM   6227 C CB    . ALA D 3 306 ? 85.540  46.078 90.583  1.00 37.81  ? 300 ALA B CB    1 
ATOM   6228 N N     . ARG D 3 307 ? 88.481  45.367 90.142  1.00 48.30  ? 301 ARG B N     1 
ATOM   6229 C CA    . ARG D 3 307 ? 89.806  45.028 90.634  1.00 48.80  ? 301 ARG B CA    1 
ATOM   6230 C C     . ARG D 3 307 ? 90.852  46.013 90.108  1.00 52.81  ? 301 ARG B C     1 
ATOM   6231 O O     . ARG D 3 307 ? 91.694  46.478 90.862  1.00 55.90  ? 301 ARG B O     1 
ATOM   6232 C CB    . ARG D 3 307 ? 90.184  43.602 90.223  1.00 50.65  ? 301 ARG B CB    1 
ATOM   6233 C CG    . ARG D 3 307 ? 90.114  42.561 91.341  1.00 63.76  ? 301 ARG B CG    1 
ATOM   6234 C CD    . ARG D 3 307 ? 91.108  41.404 91.097  1.00 76.22  ? 301 ARG B CD    1 
ATOM   6235 N NE    . ARG D 3 307 ? 90.784  40.614 89.907  1.00 67.86  ? 301 ARG B NE    1 
ATOM   6236 C CZ    . ARG D 3 307 ? 89.662  39.917 89.757  1.00 70.59  ? 301 ARG B CZ    1 
ATOM   6237 N NH1   . ARG D 3 307 ? 88.758  39.888 90.722  1.00 61.72  ? 301 ARG B NH1   1 
ATOM   6238 N NH2   . ARG D 3 307 ? 89.446  39.242 88.644  1.00 58.24  ? 301 ARG B NH2   1 
ATOM   6239 N N     . ALA D 3 308 ? 90.803  46.323 88.818  1.00 49.08  ? 302 ALA B N     1 
ATOM   6240 C CA    . ALA D 3 308 ? 91.788  47.216 88.200  1.00 48.61  ? 302 ALA B CA    1 
ATOM   6241 C C     . ALA D 3 308 ? 91.777  48.627 88.758  1.00 53.00  ? 302 ALA B C     1 
ATOM   6242 O O     . ALA D 3 308 ? 92.623  49.453 88.403  1.00 53.78  ? 302 ALA B O     1 
ATOM   6243 C CB    . ALA D 3 308 ? 91.621  47.241 86.684  1.00 49.00  ? 302 ALA B CB    1 
ATOM   6244 N N     . GLY D 3 309 ? 90.817  48.905 89.629  1.00 48.09  ? 303 GLY B N     1 
ATOM   6245 C CA    . GLY D 3 309 ? 90.702  50.225 90.228  1.00 45.74  ? 303 GLY B CA    1 
ATOM   6246 C C     . GLY D 3 309 ? 89.923  51.143 89.300  1.00 45.66  ? 303 GLY B C     1 
ATOM   6247 O O     . GLY D 3 309 ? 90.021  52.355 89.385  1.00 47.50  ? 303 GLY B O     1 
ATOM   6248 N N     . VAL D 3 310 ? 89.153  50.566 88.398  1.00 40.42  ? 304 VAL B N     1 
ATOM   6249 C CA    . VAL D 3 310 ? 88.361  51.380 87.486  1.00 39.64  ? 304 VAL B CA    1 
ATOM   6250 C C     . VAL D 3 310 ? 87.242  52.071 88.266  1.00 48.06  ? 304 VAL B C     1 
ATOM   6251 O O     . VAL D 3 310 ? 86.757  51.537 89.266  1.00 49.61  ? 304 VAL B O     1 
ATOM   6252 C CB    . VAL D 3 310 ? 87.759  50.524 86.364  1.00 39.89  ? 304 VAL B CB    1 
ATOM   6253 C CG1   . VAL D 3 310 ? 86.937  51.382 85.406  1.00 37.59  ? 304 VAL B CG1   1 
ATOM   6254 C CG2   . VAL D 3 310 ? 88.863  49.744 85.640  1.00 39.20  ? 304 VAL B CG2   1 
ATOM   6255 N N     . SER D 3 311 ? 86.836  53.256 87.816  1.00 47.04  ? 305 SER B N     1 
ATOM   6256 C CA    . SER D 3 311 ? 85.781  54.010 88.497  1.00 48.89  ? 305 SER B CA    1 
ATOM   6257 C C     . SER D 3 311 ? 84.358  53.490 88.241  1.00 60.89  ? 305 SER B C     1 
ATOM   6258 O O     . SER D 3 311 ? 84.008  53.107 87.121  1.00 61.32  ? 305 SER B O     1 
ATOM   6259 C CB    . SER D 3 311 ? 85.874  55.497 88.160  1.00 49.60  ? 305 SER B CB    1 
ATOM   6260 O OG    . SER D 3 311 ? 85.028  55.824 87.074  1.00 60.41  ? 305 SER B OG    1 
ATOM   6261 N N     . ILE D 3 312 ? 83.540  53.481 89.289  1.00 59.88  ? 306 ILE B N     1 
ATOM   6262 C CA    . ILE D 3 312 ? 82.168  53.008 89.164  1.00 59.41  ? 306 ILE B CA    1 
ATOM   6263 C C     . ILE D 3 312 ? 81.503  53.748 88.012  1.00 63.20  ? 306 ILE B C     1 
ATOM   6264 O O     . ILE D 3 312 ? 80.792  53.162 87.200  1.00 64.85  ? 306 ILE B O     1 
ATOM   6265 C CB    . ILE D 3 312 ? 81.360  53.239 90.456  1.00 61.92  ? 306 ILE B CB    1 
ATOM   6266 C CG1   . ILE D 3 312 ? 81.314  51.964 91.302  1.00 61.92  ? 306 ILE B CG1   1 
ATOM   6267 C CG2   . ILE D 3 312 ? 79.957  53.678 90.116  1.00 63.04  ? 306 ILE B CG2   1 
ATOM   6268 C CD1   . ILE D 3 312 ? 82.638  51.599 91.948  1.00 69.87  ? 306 ILE B CD1   1 
ATOM   6269 N N     . PRO D 3 313 ? 81.744  55.044 87.934  1.00 57.18  ? 307 PRO B N     1 
ATOM   6270 C CA    . PRO D 3 313 ? 81.159  55.829 86.863  1.00 56.18  ? 307 PRO B CA    1 
ATOM   6271 C C     . PRO D 3 313 ? 81.541  55.217 85.518  1.00 58.48  ? 307 PRO B C     1 
ATOM   6272 O O     . PRO D 3 313 ? 80.727  55.154 84.590  1.00 55.92  ? 307 PRO B O     1 
ATOM   6273 C CB    . PRO D 3 313 ? 81.826  57.193 87.037  1.00 57.59  ? 307 PRO B CB    1 
ATOM   6274 C CG    . PRO D 3 313 ? 82.086  57.290 88.518  1.00 62.98  ? 307 PRO B CG    1 
ATOM   6275 C CD    . PRO D 3 313 ? 82.107  55.877 89.089  1.00 57.93  ? 307 PRO B CD    1 
ATOM   6276 N N     . GLU D 3 314 ? 82.789  54.762 85.423  1.00 54.50  ? 308 GLU B N     1 
ATOM   6277 C CA    . GLU D 3 314 ? 83.308  54.165 84.194  1.00 53.03  ? 308 GLU B CA    1 
ATOM   6278 C C     . GLU D 3 314 ? 82.922  52.705 84.023  1.00 52.27  ? 308 GLU B C     1 
ATOM   6279 O O     . GLU D 3 314 ? 82.703  52.257 82.903  1.00 52.63  ? 308 GLU B O     1 
ATOM   6280 C CB    . GLU D 3 314 ? 84.820  54.271 84.159  1.00 54.88  ? 308 GLU B CB    1 
ATOM   6281 C CG    . GLU D 3 314 ? 85.373  55.287 83.196  1.00 69.13  ? 308 GLU B CG    1 
ATOM   6282 C CD    . GLU D 3 314 ? 86.851  55.135 82.992  1.00 98.51  ? 308 GLU B CD    1 
ATOM   6283 O OE1   . GLU D 3 314 ? 87.601  55.068 84.004  1.00 93.22  ? 308 GLU B OE1   1 
ATOM   6284 O OE2   . GLU D 3 314 ? 87.299  54.953 81.817  1.00 85.87  ? 308 GLU B OE2   1 
ATOM   6285 N N     . ILE D 3 315 ? 82.875  51.950 85.119  1.00 45.41  ? 309 ILE B N     1 
ATOM   6286 C CA    . ILE D 3 315 ? 82.465  50.557 85.040  1.00 43.55  ? 309 ILE B CA    1 
ATOM   6287 C C     . ILE D 3 315 ? 81.040  50.545 84.466  1.00 51.94  ? 309 ILE B C     1 
ATOM   6288 O O     . ILE D 3 315 ? 80.706  49.752 83.591  1.00 52.68  ? 309 ILE B O     1 
ATOM   6289 C CB    . ILE D 3 315 ? 82.431  49.908 86.422  1.00 44.82  ? 309 ILE B CB    1 
ATOM   6290 C CG1   . ILE D 3 315 ? 83.827  49.869 87.045  1.00 43.70  ? 309 ILE B CG1   1 
ATOM   6291 C CG2   . ILE D 3 315 ? 81.788  48.524 86.345  1.00 44.16  ? 309 ILE B CG2   1 
ATOM   6292 C CD1   . ILE D 3 315 ? 83.952  48.864 88.200  1.00 38.77  ? 309 ILE B CD1   1 
ATOM   6293 N N     . MET D 3 316 ? 80.203  51.454 84.951  1.00 50.73  ? 310 MET B N     1 
ATOM   6294 C CA    . MET D 3 316 ? 78.828  51.552 84.478  1.00 51.07  ? 310 MET B CA    1 
ATOM   6295 C C     . MET D 3 316 ? 78.730  51.865 82.978  1.00 53.76  ? 310 MET B C     1 
ATOM   6296 O O     . MET D 3 316 ? 77.863  51.333 82.275  1.00 52.43  ? 310 MET B O     1 
ATOM   6297 C CB    . MET D 3 316 ? 78.040  52.580 85.307  1.00 54.48  ? 310 MET B CB    1 
ATOM   6298 C CG    . MET D 3 316 ? 77.563  52.047 86.671  1.00 59.99  ? 310 MET B CG    1 
ATOM   6299 S SD    . MET D 3 316 ? 77.049  53.328 87.869  1.00 65.89  ? 310 MET B SD    1 
ATOM   6300 C CE    . MET D 3 316 ? 76.179  54.462 86.775  1.00 62.54  ? 310 MET B CE    1 
ATOM   6301 N N     . GLN D 3 317 ? 79.605  52.735 82.480  1.00 49.34  ? 311 GLN B N     1 
ATOM   6302 C CA    . GLN D 3 317 ? 79.572  53.080 81.060  1.00 47.99  ? 311 GLN B CA    1 
ATOM   6303 C C     . GLN D 3 317 ? 79.924  51.863 80.220  1.00 56.41  ? 311 GLN B C     1 
ATOM   6304 O O     . GLN D 3 317 ? 79.440  51.719 79.099  1.00 59.33  ? 311 GLN B O     1 
ATOM   6305 C CB    . GLN D 3 317 ? 80.516  54.240 80.743  1.00 48.21  ? 311 GLN B CB    1 
ATOM   6306 C CG    . GLN D 3 317 ? 80.777  54.432 79.260  1.00 58.03  ? 311 GLN B CG    1 
ATOM   6307 C CD    . GLN D 3 317 ? 79.892  55.488 78.647  1.00 96.51  ? 311 GLN B CD    1 
ATOM   6308 O OE1   . GLN D 3 317 ? 80.196  56.677 78.717  1.00 98.84  ? 311 GLN B OE1   1 
ATOM   6309 N NE2   . GLN D 3 317 ? 78.789  55.062 78.039  1.00 100.00 ? 311 GLN B NE2   1 
ATOM   6310 N N     . ALA D 3 318 ? 80.762  50.987 80.780  1.00 50.65  ? 312 ALA B N     1 
ATOM   6311 C CA    . ALA D 3 318 ? 81.193  49.756 80.119  1.00 47.88  ? 312 ALA B CA    1 
ATOM   6312 C C     . ALA D 3 318 ? 80.005  48.839 79.840  1.00 51.19  ? 312 ALA B C     1 
ATOM   6313 O O     . ALA D 3 318 ? 79.827  48.351 78.717  1.00 49.14  ? 312 ALA B O     1 
ATOM   6314 C CB    . ALA D 3 318 ? 82.217  49.023 80.992  1.00 47.87  ? 312 ALA B CB    1 
ATOM   6315 N N     . GLY D 3 319 ? 79.204  48.606 80.878  1.00 49.33  ? 313 GLY B N     1 
ATOM   6316 C CA    . GLY D 3 319 ? 78.043  47.724 80.800  1.00 49.17  ? 313 GLY B CA    1 
ATOM   6317 C C     . GLY D 3 319 ? 76.756  48.404 80.362  1.00 54.07  ? 313 GLY B C     1 
ATOM   6318 O O     . GLY D 3 319 ? 75.718  47.749 80.241  1.00 56.93  ? 313 GLY B O     1 
ATOM   6319 N N     . GLY D 3 320 ? 76.814  49.709 80.131  1.00 48.68  ? 314 GLY B N     1 
ATOM   6320 C CA    . GLY D 3 320 ? 75.633  50.440 79.687  1.00 48.74  ? 314 GLY B CA    1 
ATOM   6321 C C     . GLY D 3 320 ? 74.600  50.671 80.788  1.00 50.86  ? 314 GLY B C     1 
ATOM   6322 O O     . GLY D 3 320 ? 73.494  51.137 80.521  1.00 46.58  ? 314 GLY B O     1 
ATOM   6323 N N     . TRP D 3 321 ? 74.958  50.350 82.023  1.00 49.91  ? 315 TRP B N     1 
ATOM   6324 C CA    . TRP D 3 321 ? 74.035  50.559 83.117  1.00 51.36  ? 315 TRP B CA    1 
ATOM   6325 C C     . TRP D 3 321 ? 73.763  52.051 83.260  1.00 60.24  ? 315 TRP B C     1 
ATOM   6326 O O     . TRP D 3 321 ? 74.523  52.878 82.766  1.00 63.43  ? 315 TRP B O     1 
ATOM   6327 C CB    . TRP D 3 321 ? 74.592  49.938 84.394  1.00 50.19  ? 315 TRP B CB    1 
ATOM   6328 C CG    . TRP D 3 321 ? 74.730  48.449 84.312  1.00 51.62  ? 315 TRP B CG    1 
ATOM   6329 C CD1   . TRP D 3 321 ? 73.733  47.513 84.383  1.00 54.13  ? 315 TRP B CD1   1 
ATOM   6330 C CD2   . TRP D 3 321 ? 75.952  47.719 84.118  1.00 52.11  ? 315 TRP B CD2   1 
ATOM   6331 N NE1   . TRP D 3 321 ? 74.266  46.250 84.273  1.00 53.64  ? 315 TRP B NE1   1 
ATOM   6332 C CE2   . TRP D 3 321 ? 75.623  46.349 84.104  1.00 55.56  ? 315 TRP B CE2   1 
ATOM   6333 C CE3   . TRP D 3 321 ? 77.289  48.092 83.964  1.00 53.74  ? 315 TRP B CE3   1 
ATOM   6334 C CZ2   . TRP D 3 321 ? 76.588  45.354 84.002  1.00 55.09  ? 315 TRP B CZ2   1 
ATOM   6335 C CZ3   . TRP D 3 321 ? 78.249  47.098 83.751  1.00 55.01  ? 315 TRP B CZ3   1 
ATOM   6336 C CH2   . TRP D 3 321 ? 77.889  45.750 83.767  1.00 55.68  ? 315 TRP B CH2   1 
ATOM   6337 N N     . THR D 3 322 ? 72.627  52.389 83.848  1.00 57.34  ? 316 THR B N     1 
ATOM   6338 C CA    . THR D 3 322 ? 72.245  53.777 84.020  1.00 57.67  ? 316 THR B CA    1 
ATOM   6339 C C     . THR D 3 322 ? 72.178  53.992 85.523  1.00 63.94  ? 316 THR B C     1 
ATOM   6340 O O     . THR D 3 322 ? 72.166  55.116 86.014  1.00 63.79  ? 316 THR B O     1 
ATOM   6341 C CB    . THR D 3 322 ? 70.864  54.038 83.358  1.00 70.61  ? 316 THR B CB    1 
ATOM   6342 O OG1   . THR D 3 322 ? 69.810  53.577 84.212  1.00 65.94  ? 316 THR B OG1   1 
ATOM   6343 C CG2   . THR D 3 322 ? 70.754  53.285 82.043  1.00 73.26  ? 316 THR B CG2   1 
ATOM   6344 N N     . ASN D 3 323 ? 72.175  52.871 86.239  1.00 64.60  ? 317 ASN B N     1 
ATOM   6345 C CA    . ASN D 3 323 ? 72.083  52.830 87.698  1.00 66.41  ? 317 ASN B CA    1 
ATOM   6346 C C     . ASN D 3 323 ? 73.312  52.136 88.306  1.00 73.80  ? 317 ASN B C     1 
ATOM   6347 O O     . ASN D 3 323 ? 74.247  51.824 87.578  1.00 76.37  ? 317 ASN B O     1 
ATOM   6348 C CB    . ASN D 3 323 ? 70.775  52.150 88.096  1.00 70.51  ? 317 ASN B CB    1 
ATOM   6349 C CG    . ASN D 3 323 ? 70.490  52.269 89.559  1.00 98.35  ? 317 ASN B CG    1 
ATOM   6350 O OD1   . ASN D 3 323 ? 70.441  53.370 90.111  1.00 99.23  ? 317 ASN B OD1   1 
ATOM   6351 N ND2   . ASN D 3 323 ? 70.332  51.132 90.221  1.00 89.12  ? 317 ASN B ND2   1 
ATOM   6352 N N     . VAL D 3 324 ? 73.334  51.912 89.622  1.00 69.45  ? 318 VAL B N     1 
ATOM   6353 C CA    . VAL D 3 324 ? 74.529  51.366 90.302  1.00 68.23  ? 318 VAL B CA    1 
ATOM   6354 C C     . VAL D 3 324 ? 74.435  50.028 91.089  1.00 71.40  ? 318 VAL B C     1 
ATOM   6355 O O     . VAL D 3 324 ? 75.396  49.590 91.714  1.00 70.00  ? 318 VAL B O     1 
ATOM   6356 C CB    . VAL D 3 324 ? 75.141  52.490 91.212  1.00 72.71  ? 318 VAL B CB    1 
ATOM   6357 C CG1   . VAL D 3 324 ? 76.464  52.102 91.835  1.00 72.55  ? 318 VAL B CG1   1 
ATOM   6358 C CG2   . VAL D 3 324 ? 75.325  53.768 90.417  1.00 72.74  ? 318 VAL B CG2   1 
ATOM   6359 N N     . ASN D 3 325 ? 73.304  49.344 91.030  1.00 70.45  ? 319 ASN B N     1 
ATOM   6360 C CA    . ASN D 3 325 ? 73.129  48.127 91.831  1.00 71.77  ? 319 ASN B CA    1 
ATOM   6361 C C     . ASN D 3 325 ? 73.519  46.731 91.322  1.00 78.96  ? 319 ASN B C     1 
ATOM   6362 O O     . ASN D 3 325 ? 73.875  45.857 92.116  1.00 78.49  ? 319 ASN B O     1 
ATOM   6363 C CB    . ASN D 3 325 ? 71.774  48.147 92.534  1.00 74.45  ? 319 ASN B CB    1 
ATOM   6364 C CG    . ASN D 3 325 ? 71.258  49.564 92.749  1.00 97.31  ? 319 ASN B CG    1 
ATOM   6365 O OD1   . ASN D 3 325 ? 71.598  50.486 92.009  1.00 83.35  ? 319 ASN B OD1   1 
ATOM   6366 N ND2   . ASN D 3 325 ? 70.425  49.735 93.765  1.00 98.25  ? 319 ASN B ND2   1 
ATOM   6367 N N     . ILE D 3 326 ? 73.445  46.507 90.013  1.00 77.17  ? 320 ILE B N     1 
ATOM   6368 C CA    . ILE D 3 326 ? 73.847  45.215 89.465  1.00 76.96  ? 320 ILE B CA    1 
ATOM   6369 C C     . ILE D 3 326 ? 75.360  45.237 89.582  1.00 80.98  ? 320 ILE B C     1 
ATOM   6370 O O     . ILE D 3 326 ? 75.984  44.282 90.046  1.00 80.63  ? 320 ILE B O     1 
ATOM   6371 C CB    . ILE D 3 326 ? 73.472  45.101 87.967  1.00 80.13  ? 320 ILE B CB    1 
ATOM   6372 C CG1   . ILE D 3 326 ? 71.966  44.904 87.810  1.00 81.26  ? 320 ILE B CG1   1 
ATOM   6373 C CG2   . ILE D 3 326 ? 74.185  43.932 87.318  1.00 79.58  ? 320 ILE B CG2   1 
ATOM   6374 C CD1   . ILE D 3 326 ? 71.356  44.000 88.873  1.00 90.28  ? 320 ILE B CD1   1 
ATOM   6375 N N     . VAL D 3 327 ? 75.923  46.375 89.194  1.00 77.10  ? 321 VAL B N     1 
ATOM   6376 C CA    . VAL D 3 327 ? 77.352  46.613 89.241  1.00 77.00  ? 321 VAL B CA    1 
ATOM   6377 C C     . VAL D 3 327 ? 77.970  46.256 90.593  1.00 77.42  ? 321 VAL B C     1 
ATOM   6378 O O     . VAL D 3 327 ? 79.063  45.695 90.653  1.00 78.16  ? 321 VAL B O     1 
ATOM   6379 C CB    . VAL D 3 327 ? 77.663  48.082 88.881  1.00 82.55  ? 321 VAL B CB    1 
ATOM   6380 C CG1   . VAL D 3 327 ? 79.153  48.294 88.664  1.00 82.31  ? 321 VAL B CG1   1 
ATOM   6381 C CG2   . VAL D 3 327 ? 76.847  48.520 87.657  1.00 82.59  ? 321 VAL B CG2   1 
ATOM   6382 N N     . MET D 3 328 ? 77.270  46.562 91.675  1.00 72.40  ? 322 MET B N     1 
ATOM   6383 C CA    . MET D 3 328 ? 77.781  46.258 93.006  1.00 72.92  ? 322 MET B CA    1 
ATOM   6384 C C     . MET D 3 328 ? 77.601  44.796 93.384  1.00 80.06  ? 322 MET B C     1 
ATOM   6385 O O     . MET D 3 328 ? 78.449  44.179 94.035  1.00 80.36  ? 322 MET B O     1 
ATOM   6386 C CB    . MET D 3 328 ? 77.109  47.156 94.032  1.00 74.80  ? 322 MET B CB    1 
ATOM   6387 C CG    . MET D 3 328 ? 77.168  48.620 93.647  1.00 78.14  ? 322 MET B CG    1 
ATOM   6388 S SD    . MET D 3 328 ? 78.794  49.302 93.984  1.00 82.04  ? 322 MET B SD    1 
ATOM   6389 C CE    . MET D 3 328 ? 79.250  48.331 95.404  1.00 78.33  ? 322 MET B CE    1 
ATOM   6390 N N     . ASN D 3 329 ? 76.467  44.246 92.972  1.00 78.15  ? 323 ASN B N     1 
ATOM   6391 C CA    . ASN D 3 329 ? 76.130  42.853 93.254  1.00 78.35  ? 323 ASN B CA    1 
ATOM   6392 C C     . ASN D 3 329 ? 77.208  41.923 92.724  1.00 82.08  ? 323 ASN B C     1 
ATOM   6393 O O     . ASN D 3 329 ? 77.637  41.002 93.416  1.00 82.11  ? 323 ASN B O     1 
ATOM   6394 C CB    . ASN D 3 329 ? 74.791  42.491 92.632  1.00 82.59  ? 323 ASN B CB    1 
ATOM   6395 C CG    . ASN D 3 329 ? 74.169  41.250 93.266  1.00 100.00 ? 323 ASN B CG    1 
ATOM   6396 O OD1   . ASN D 3 329 ? 74.837  40.503 93.998  1.00 88.57  ? 323 ASN B OD1   1 
ATOM   6397 N ND2   . ASN D 3 329 ? 72.887  41.013 92.971  1.00 100.00 ? 323 ASN B ND2   1 
ATOM   6398 N N     . TYR D 3 330 ? 77.621  42.156 91.481  1.00 78.29  ? 324 TYR B N     1 
ATOM   6399 C CA    . TYR D 3 330 ? 78.630  41.321 90.824  1.00 77.88  ? 324 TYR B CA    1 
ATOM   6400 C C     . TYR D 3 330 ? 79.992  41.206 91.549  1.00 86.40  ? 324 TYR B C     1 
ATOM   6401 O O     . TYR D 3 330 ? 80.673  40.196 91.384  1.00 87.27  ? 324 TYR B O     1 
ATOM   6402 C CB    . TYR D 3 330 ? 78.852  41.758 89.365  1.00 77.06  ? 324 TYR B CB    1 
ATOM   6403 C CG    . TYR D 3 330 ? 77.705  41.560 88.369  1.00 77.25  ? 324 TYR B CG    1 
ATOM   6404 C CD1   . TYR D 3 330 ? 76.880  40.432 88.395  1.00 78.81  ? 324 TYR B CD1   1 
ATOM   6405 C CD2   . TYR D 3 330 ? 77.516  42.474 87.335  1.00 77.71  ? 324 TYR B CD2   1 
ATOM   6406 C CE1   . TYR D 3 330 ? 75.855  40.263 87.439  1.00 76.94  ? 324 TYR B CE1   1 
ATOM   6407 C CE2   . TYR D 3 330 ? 76.513  42.311 86.385  1.00 78.31  ? 324 TYR B CE2   1 
ATOM   6408 C CZ    . TYR D 3 330 ? 75.680  41.211 86.441  1.00 81.45  ? 324 TYR B CZ    1 
ATOM   6409 O OH    . TYR D 3 330 ? 74.691  41.061 85.491  1.00 78.13  ? 324 TYR B OH    1 
ATOM   6410 N N     . ILE D 3 331 ? 80.399  42.220 92.324  1.00 83.95  ? 325 ILE B N     1 
ATOM   6411 C CA    . ILE D 3 331 ? 81.723  42.223 92.999  1.00 83.93  ? 325 ILE B CA    1 
ATOM   6412 C C     . ILE D 3 331 ? 81.970  41.569 94.378  1.00 87.85  ? 325 ILE B C     1 
ATOM   6413 O O     . ILE D 3 331 ? 82.917  40.811 94.546  1.00 85.49  ? 325 ILE B O     1 
ATOM   6414 C CB    . ILE D 3 331 ? 82.413  43.609 92.957  1.00 87.05  ? 325 ILE B CB    1 
ATOM   6415 C CG1   . ILE D 3 331 ? 81.559  44.635 92.202  1.00 86.82  ? 325 ILE B CG1   1 
ATOM   6416 C CG2   . ILE D 3 331 ? 83.798  43.490 92.330  1.00 87.77  ? 325 ILE B CG2   1 
ATOM   6417 C CD1   . ILE D 3 331 ? 82.036  46.079 92.368  1.00 82.63  ? 325 ILE B CD1   1 
ATOM   6418 N N     . ARG D 3 332 ? 81.173  41.939 95.367  1.00 88.40  ? 326 ARG B N     1 
ATOM   6419 C CA    . ARG D 3 332 ? 81.301  41.432 96.743  1.00 90.31  ? 326 ARG B CA    1 
ATOM   6420 C C     . ARG D 3 332 ? 82.049  40.124 97.048  1.00 97.29  ? 326 ARG B C     1 
ATOM   6421 O O     . ARG D 3 332 ? 81.477  39.206 97.642  1.00 98.01  ? 326 ARG B O     1 
ATOM   6422 C CB    . ARG D 3 332 ? 79.942  41.427 97.455  1.00 91.31  ? 326 ARG B CB    1 
ATOM   6423 C CG    . ARG D 3 332 ? 79.239  42.783 97.503  1.00 98.22  ? 326 ARG B CG    1 
ATOM   6424 C CD    . ARG D 3 332 ? 78.633  43.076 98.879  1.00 100.00 ? 326 ARG B CD    1 
ATOM   6425 N NE    . ARG D 3 332 ? 79.505  43.906 99.710  1.00 97.30  ? 326 ARG B NE    1 
ATOM   6426 C CZ    . ARG D 3 332 ? 79.436  43.956 101.036 1.00 100.00 ? 326 ARG B CZ    1 
ATOM   6427 N NH1   . ARG D 3 332 ? 78.539  43.222 101.677 1.00 100.00 ? 326 ARG B NH1   1 
ATOM   6428 N NH2   . ARG D 3 332 ? 80.264  44.731 101.722 1.00 98.50  ? 326 ARG B NH2   1 
ATOM   6429 N N     . ASN D 3 333 ? 83.336  40.055 96.715  1.00 93.78  ? 327 ASN B N     1 
ATOM   6430 C CA    . ASN D 3 333 ? 84.119  38.849 96.981  1.00 93.44  ? 327 ASN B CA    1 
ATOM   6431 C C     . ASN D 3 333 ? 85.466  39.170 97.612  1.00 98.71  ? 327 ASN B C     1 
ATOM   6432 O O     . ASN D 3 333 ? 85.980  38.409 98.439  1.00 99.56  ? 327 ASN B O     1 
ATOM   6433 C CB    . ASN D 3 333 ? 84.348  38.093 95.676  1.00 91.41  ? 327 ASN B CB    1 
ATOM   6434 C CG    . ASN D 3 333 ? 83.044  37.698 94.989  1.00 100.00 ? 327 ASN B CG    1 
ATOM   6435 O OD1   . ASN D 3 333 ? 82.806  36.517 94.745  1.00 100.00 ? 327 ASN B OD1   1 
ATOM   6436 N ND2   . ASN D 3 333 ? 82.190  38.674 94.690  1.00 87.70  ? 327 ASN B ND2   1 
ATOM   6437 N N     . LEU D 3 334 ? 86.052  40.282 97.180  1.00 93.88  ? 328 LEU B N     1 
ATOM   6438 C CA    . LEU D 3 334 ? 87.342  40.729 97.683  1.00 96.91  ? 328 LEU B CA    1 
ATOM   6439 C C     . LEU D 3 334 ? 87.208  42.160 98.194  1.00 100.00 ? 328 LEU B C     1 
ATOM   6440 O O     . LEU D 3 334 ? 86.199  42.823 97.951  0.00 61.41  ? 328 LEU B O     1 
ATOM   6441 C CB    . LEU D 3 334 ? 88.381  40.679 96.568  0.00 96.54  ? 328 LEU B CB    1 
ATOM   6442 C CG    . LEU D 3 334 ? 87.956  39.928 95.306  1.00 100.00 ? 328 LEU B CG    1 
ATOM   6443 C CD1   . LEU D 3 334 ? 87.310  40.872 94.300  1.00 100.00 ? 328 LEU B CD1   1 
ATOM   6444 C CD2   . LEU D 3 334 ? 89.165  39.227 94.695  1.00 100.00 ? 328 LEU B CD2   1 
ATOM   6445 N N     . THR D 3 338 ? 90.892  41.188 100.435 1.00 100.00 ? 332 THR B N     1 
ATOM   6446 C CA    . THR D 3 338 ? 90.359  41.753 101.672 1.00 98.61  ? 332 THR B CA    1 
ATOM   6447 C C     . THR D 3 338 ? 91.486  41.824 102.705 1.00 100.00 ? 332 THR B C     1 
ATOM   6448 O O     . THR D 3 338 ? 92.636  42.097 102.353 1.00 99.38  ? 332 THR B O     1 
ATOM   6449 C CB    . THR D 3 338 ? 89.203  40.874 102.230 1.00 100.00 ? 332 THR B CB    1 
ATOM   6450 O OG1   . THR D 3 338 ? 89.711  39.949 103.200 1.00 100.00 ? 332 THR B OG1   1 
ATOM   6451 C CG2   . THR D 3 338 ? 88.523  40.091 101.119 1.00 97.44  ? 332 THR B CG2   1 
ATOM   6452 N N     . GLY D 3 339 ? 91.157  41.545 103.962 1.00 96.08  ? 333 GLY B N     1 
ATOM   6453 C CA    . GLY D 3 339 ? 92.155  41.509 105.017 1.00 95.40  ? 333 GLY B CA    1 
ATOM   6454 C C     . GLY D 3 339 ? 92.702  42.859 105.487 1.00 97.30  ? 333 GLY B C     1 
ATOM   6455 O O     . GLY D 3 339 ? 93.774  42.913 106.117 1.00 94.43  ? 333 GLY B O     1 
ATOM   6456 N N     . ALA D 3 340 ? 92.001  43.955 105.213 1.00 95.02  ? 334 ALA B N     1 
ATOM   6457 C CA    . ALA D 3 340 ? 92.518  45.221 105.716 1.00 95.50  ? 334 ALA B CA    1 
ATOM   6458 C C     . ALA D 3 340 ? 92.829  45.136 107.223 1.00 99.29  ? 334 ALA B C     1 
ATOM   6459 O O     . ALA D 3 340 ? 93.574  45.966 107.767 1.00 98.49  ? 334 ALA B O     1 
ATOM   6460 C CB    . ALA D 3 340 ? 91.537  46.357 105.428 1.00 96.42  ? 334 ALA B CB    1 
ATOM   6461 N N     . MET D 3 341 ? 92.260  44.105 107.873 1.00 94.15  ? 335 MET B N     1 
ATOM   6462 C CA    . MET D 3 341 ? 92.402  43.836 109.327 1.00 91.62  ? 335 MET B CA    1 
ATOM   6463 C C     . MET D 3 341 ? 93.581  43.182 110.032 1.00 94.71  ? 335 MET B C     1 
ATOM   6464 O O     . MET D 3 341 ? 94.251  43.859 110.821 1.00 93.41  ? 335 MET B O     1 
ATOM   6465 C CB    . MET D 3 341 ? 91.089  43.685 110.077 1.00 93.19  ? 335 MET B CB    1 
ATOM   6466 C CG    . MET D 3 341 ? 90.210  44.917 109.955 1.00 96.54  ? 335 MET B CG    1 
ATOM   6467 S SD    . MET D 3 341 ? 90.455  46.203 111.214 1.00 100.00 ? 335 MET B SD    1 
ATOM   6468 C CE    . MET D 3 341 ? 89.039  47.259 110.879 1.00 96.02  ? 335 MET B CE    1 
ATOM   6469 N N     . VAL D 3 342 ? 93.902  41.919 109.730 1.00 90.03  ? 336 VAL B N     1 
ATOM   6470 C CA    . VAL D 3 342 ? 95.074  41.331 110.379 1.00 88.67  ? 336 VAL B CA    1 
ATOM   6471 C C     . VAL D 3 342 ? 96.189  42.329 110.144 1.00 88.51  ? 336 VAL B C     1 
ATOM   6472 O O     . VAL D 3 342 ? 97.111  42.454 110.955 1.00 86.40  ? 336 VAL B O     1 
ATOM   6473 C CB    . VAL D 3 342 ? 95.490  39.952 109.814 1.00 92.84  ? 336 VAL B CB    1 
ATOM   6474 C CG1   . VAL D 3 342 ? 94.341  38.964 109.869 1.00 93.28  ? 336 VAL B CG1   1 
ATOM   6475 C CG2   . VAL D 3 342 ? 96.040  40.082 108.410 0.00 92.73  ? 336 VAL B CG2   1 
ATOM   6476 N N     . ARG D 3 343 ? 96.073  43.036 109.022 1.00 83.72  ? 337 ARG B N     1 
ATOM   6477 C CA    . ARG D 3 343 ? 96.946  44.112 108.610 1.00 82.88  ? 337 ARG B CA    1 
ATOM   6478 C C     . ARG D 3 343 ? 96.984  45.299 109.588 1.00 85.55  ? 337 ARG B C     1 
ATOM   6479 O O     . ARG D 3 343 ? 98.057  45.650 110.092 1.00 84.61  ? 337 ARG B O     1 
ATOM   6480 C CB    . ARG D 3 343 ? 96.555  44.528 107.208 1.00 84.36  ? 337 ARG B CB    1 
ATOM   6481 C CG    . ARG D 3 343 ? 97.247  43.668 106.146 1.00 100.00 ? 337 ARG B CG    1 
ATOM   6482 C CD    . ARG D 3 343 ? 96.350  43.309 104.961 1.00 100.00 ? 337 ARG B CD    1 
ATOM   6483 N NE    . ARG D 3 343 ? 95.828  44.498 104.278 1.00 100.00 ? 337 ARG B NE    1 
ATOM   6484 C CZ    . ARG D 3 343 ? 95.047  44.468 103.217 1.00 100.00 ? 337 ARG B CZ    1 
ATOM   6485 N NH1   . ARG D 3 343 ? 94.728  43.302 102.656 1.00 81.91  ? 337 ARG B NH1   1 
ATOM   6486 N NH2   . ARG D 3 343 ? 94.585  45.605 102.709 1.00 85.22  ? 337 ARG B NH2   1 
ATOM   6487 N N     . LEU D 3 344 ? 95.835  45.881 109.917 1.00 81.11  ? 338 LEU B N     1 
ATOM   6488 C CA    . LEU D 3 344 ? 95.856  46.972 110.887 1.00 80.05  ? 338 LEU B CA    1 
ATOM   6489 C C     . LEU D 3 344 ? 96.313  46.447 112.258 1.00 88.40  ? 338 LEU B C     1 
ATOM   6490 O O     . LEU D 3 344 ? 97.119  47.079 112.951 1.00 89.10  ? 338 LEU B O     1 
ATOM   6491 C CB    . LEU D 3 344 ? 94.506  47.691 110.961 1.00 78.44  ? 338 LEU B CB    1 
ATOM   6492 C CG    . LEU D 3 344 ? 94.481  49.003 110.174 1.00 80.52  ? 338 LEU B CG    1 
ATOM   6493 C CD1   . LEU D 3 344 ? 93.043  49.362 109.779 1.00 80.70  ? 338 LEU B CD1   1 
ATOM   6494 C CD2   . LEU D 3 344 ? 95.109  50.164 110.983 1.00 81.11  ? 338 LEU B CD2   1 
ATOM   6495 N N     . LEU D 3 345 ? 95.832  45.262 112.628 1.00 85.54  ? 339 LEU B N     1 
ATOM   6496 C CA    . LEU D 3 345 ? 96.199  44.638 113.899 1.00 86.13  ? 339 LEU B CA    1 
ATOM   6497 C C     . LEU D 3 345 ? 97.640  44.146 113.996 1.00 94.61  ? 339 LEU B C     1 
ATOM   6498 O O     . LEU D 3 345 ? 98.294  44.359 115.017 1.00 95.20  ? 339 LEU B O     1 
ATOM   6499 C CB    . LEU D 3 345 ? 95.197  43.547 114.291 1.00 86.83  ? 339 LEU B CB    1 
ATOM   6500 C CG    . LEU D 3 345 ? 93.817  44.065 114.729 1.00 93.69  ? 339 LEU B CG    1 
ATOM   6501 C CD1   . LEU D 3 345 ? 92.697  43.639 113.782 1.00 94.44  ? 339 LEU B CD1   1 
ATOM   6502 C CD2   . LEU D 3 345 ? 93.498  43.667 116.172 1.00 98.18  ? 339 LEU B CD2   1 
ATOM   6503 N N     . GLU D 3 346 ? 98.122  43.480 112.942 1.00 92.39  ? 340 GLU B N     1 
ATOM   6504 C CA    . GLU D 3 346 ? 99.499  42.987 112.935 1.00 91.81  ? 340 GLU B CA    1 
ATOM   6505 C C     . GLU D 3 346 ? 100.451 44.130 113.180 1.00 96.72  ? 340 GLU B C     1 
ATOM   6506 O O     . GLU D 3 346 ? 101.321 44.042 114.041 1.00 98.42  ? 340 GLU B O     1 
ATOM   6507 C CB    . GLU D 3 346 ? 99.849  42.131 111.734 1.00 92.79  ? 340 GLU B CB    1 
ATOM   6508 C CG    . GLU D 3 346 ? 100.072 40.695 112.129 1.00 97.62  ? 340 GLU B CG    1 
ATOM   6509 C CD    . GLU D 3 346 ? 99.087  39.768 111.418 1.00 100.00 ? 340 GLU B CD    1 
ATOM   6510 O OE1   . GLU D 3 346 ? 99.358  39.366 110.280 1.00 100.00 ? 340 GLU B OE1   1 
ATOM   6511 O OE2   . GLU D 3 346 ? 97.982  39.563 111.969 1.00 100.00 ? 340 GLU B OE2   1 
ATOM   6512 N N     . ASP D 3 347 ? 100.215 45.263 112.530 1.00 90.84  ? 341 ASP B N     1 
ATOM   6513 C CA    . ASP D 3 347 ? 100.925 46.438 112.958 1.00 98.72  ? 341 ASP B CA    1 
ATOM   6514 C C     . ASP D 3 347 ? 99.917  47.354 113.626 1.00 100.00 ? 341 ASP B C     1 
ATOM   6515 O O     . ASP D 3 347 ? 100.168 47.862 114.712 1.00 93.72  ? 341 ASP B O     1 
ATOM   6516 C CB    . ASP D 3 347 ? 101.772 47.211 111.960 1.00 100.00 ? 341 ASP B CB    1 
ATOM   6517 C CG    . ASP D 3 347 ? 102.418 48.439 112.631 1.00 97.79  ? 341 ASP B CG    1 
ATOM   6518 O OD1   . ASP D 3 347 ? 102.511 49.512 112.007 1.00 92.61  ? 341 ASP B OD1   1 
ATOM   6519 O OD2   . ASP D 3 347 ? 102.750 48.327 113.844 1.00 99.01  ? 341 ASP B OD2   1 
HETATM 6520 O O     . HOH E 4 .   ? 57.331  29.266 84.732  1.00 74.29  ? 35  HOH C O     1 
HETATM 6521 O O     . HOH E 4 .   ? 74.095  22.904 61.445  1.00 37.85  ? 36  HOH C O     1 
HETATM 6522 O O     . HOH E 4 .   ? 73.907  17.545 68.652  1.00 39.50  ? 37  HOH C O     1 
HETATM 6523 O O     . HOH E 4 .   ? 72.331  37.982 91.500  1.00 61.11  ? 38  HOH C O     1 
HETATM 6524 O O     . HOH E 4 .   ? 61.039  31.121 73.270  1.00 45.42  ? 39  HOH C O     1 
HETATM 6525 O O     . HOH E 4 .   ? 72.715  20.264 70.818  1.00 57.82  ? 40  HOH C O     1 
HETATM 6526 O O     . HOH E 4 .   ? 82.367  23.535 62.123  1.00 51.13  ? 41  HOH C O     1 
HETATM 6527 O O     . HOH E 4 .   ? 83.347  19.532 62.097  1.00 56.19  ? 42  HOH C O     1 
HETATM 6528 O O     . HOH E 4 .   ? 67.504  29.961 92.883  1.00 51.16  ? 43  HOH C O     1 
HETATM 6529 O O     . HOH E 4 .   ? 60.085  65.243 72.632  1.00 60.13  ? 44  HOH C O     1 
HETATM 6530 O O     . HOH E 4 .   ? 57.321  65.325 72.546  1.00 49.94  ? 45  HOH C O     1 
HETATM 6531 O O     . HOH F 4 .   ? 74.740  33.094 132.932 1.00 61.72  ? 42  HOH D O     1 
HETATM 6532 O O     . HOH F 4 .   ? 58.682  39.418 87.530  1.00 47.05  ? 56  HOH D O     1 
HETATM 6533 O O     . HOH F 4 .   ? 65.711  22.291 80.369  1.00 81.98  ? 85  HOH D O     1 
HETATM 6534 O O     . HOH F 4 .   ? 68.569  38.719 82.136  1.00 84.32  ? 126 HOH D O     1 
HETATM 6535 O O     . HOH F 4 .   ? 57.880  54.487 121.893 1.00 41.60  ? 131 HOH D O     1 
HETATM 6536 O O     . HOH F 4 .   ? 74.243  24.677 83.900  1.00 56.55  ? 167 HOH D O     1 
HETATM 6537 O O     . HOH F 4 .   ? 61.374  54.115 113.272 1.00 59.18  ? 209 HOH D O     1 
HETATM 6538 O O     . HOH F 4 .   ? 73.981  28.997 78.743  1.00 38.95  ? 301 HOH D O     1 
HETATM 6539 O O     . HOH F 4 .   ? 71.596  30.849 76.977  1.00 59.04  ? 302 HOH D O     1 
HETATM 6540 O O     . HOH F 4 .   ? 70.642  17.936 71.946  1.00 56.64  ? 303 HOH D O     1 
HETATM 6541 O O     . HOH F 4 .   ? 74.428  37.262 149.462 1.00 36.33  ? 304 HOH D O     1 
HETATM 6542 O O     . HOH F 4 .   ? 76.655  35.727 151.467 1.00 31.51  ? 305 HOH D O     1 
HETATM 6543 O O     . HOH F 4 .   ? 64.077  43.424 122.349 1.00 64.96  ? 306 HOH D O     1 
HETATM 6544 O O     . HOH F 4 .   ? 74.241  18.615 80.058  1.00 64.59  ? 307 HOH D O     1 
HETATM 6545 O O     . HOH F 4 .   ? 71.094  16.806 74.109  1.00 68.02  ? 308 HOH D O     1 
HETATM 6546 O O     . HOH F 4 .   ? 61.466  42.619 122.029 1.00 67.14  ? 346 HOH D O     1 
HETATM 6547 O O     . HOH F 4 .   ? 63.138  53.350 89.321  1.00 74.30  ? 347 HOH D O     1 
HETATM 6548 O O     . HOH G 4 .   ? 74.906  44.960 116.309 1.00 36.23  ? 344 HOH A O     1 
HETATM 6549 O O     . HOH G 4 .   ? 53.627  44.498 99.260  1.00 64.42  ? 345 HOH A O     1 
HETATM 6550 O O     . HOH G 4 .   ? 68.723  40.077 122.645 1.00 32.85  ? 346 HOH A O     1 
HETATM 6551 O O     . HOH G 4 .   ? 44.579  68.717 115.764 1.00 55.02  ? 347 HOH A O     1 
HETATM 6552 O O     . HOH G 4 .   ? 60.069  70.020 107.535 1.00 58.51  ? 348 HOH A O     1 
HETATM 6553 O O     . HOH G 4 .   ? 75.245  29.024 123.275 1.00 74.02  ? 349 HOH A O     1 
HETATM 6554 O O     . HOH G 4 .   ? 80.589  58.783 127.743 1.00 67.77  ? 350 HOH A O     1 
HETATM 6555 O O     . HOH G 4 .   ? 42.205  40.681 99.570  1.00 50.03  ? 351 HOH A O     1 
HETATM 6556 O O     . HOH G 4 .   ? 43.085  35.240 109.136 1.00 30.44  ? 352 HOH A O     1 
HETATM 6557 O O     . HOH G 4 .   ? 51.945  50.909 104.132 1.00 70.15  ? 353 HOH A O     1 
HETATM 6558 O O     . HOH G 4 .   ? 54.589  65.413 106.093 1.00 52.81  ? 354 HOH A O     1 
HETATM 6559 O O     . HOH G 4 .   ? 65.738  76.304 120.628 1.00 74.08  ? 355 HOH A O     1 
HETATM 6560 O O     . HOH G 4 .   ? 75.666  67.455 117.274 1.00 77.09  ? 356 HOH A O     1 
HETATM 6561 O O     . HOH G 4 .   ? 78.330  59.046 123.430 1.00 79.71  ? 357 HOH A O     1 
HETATM 6562 O O     . HOH G 4 .   ? 93.311  55.607 125.832 1.00 65.01  ? 358 HOH A O     1 
HETATM 6563 O O     . HOH G 4 .   ? 84.941  42.552 132.218 1.00 54.28  ? 359 HOH A O     1 
HETATM 6564 O O     . HOH G 4 .   ? 96.004  41.709 117.617 1.00 55.12  ? 360 HOH A O     1 
HETATM 6565 O O     . HOH G 4 .   ? 79.406  32.120 118.909 1.00 49.61  ? 361 HOH A O     1 
HETATM 6566 O O     . HOH G 4 .   ? 72.011  25.627 115.878 1.00 71.81  ? 362 HOH A O     1 
HETATM 6567 O O     . HOH G 4 .   ? 41.540  67.628 108.837 1.00 60.05  ? 363 HOH A O     1 
HETATM 6568 O O     . HOH G 4 .   ? 94.430  36.487 128.083 1.00 73.52  ? 364 HOH A O     1 
HETATM 6569 O O     . HOH G 4 .   ? 82.605  40.641 138.226 1.00 75.64  ? 365 HOH A O     1 
HETATM 6570 O O     . HOH G 4 .   ? 90.421  24.906 116.312 1.00 70.47  ? 366 HOH A O     1 
HETATM 6571 O O     . HOH G 4 .   ? 89.278  41.188 136.378 1.00 74.94  ? 367 HOH A O     1 
HETATM 6572 O O     . HOH G 4 .   ? 94.997  53.361 112.325 1.00 73.02  ? 368 HOH A O     1 
HETATM 6573 O O     . HOH G 4 .   ? 94.923  51.104 113.682 1.00 70.27  ? 369 HOH A O     1 
HETATM 6574 O O     . HOH G 4 .   ? 60.475  31.742 108.122 1.00 72.25  ? 370 HOH A O     1 
HETATM 6575 O O     . HOH G 4 .   ? 100.224 74.985 105.162 1.00 66.84  ? 371 HOH A O     1 
HETATM 6576 O O     . HOH H 4 .   ? 77.408  30.534 83.989  1.00 32.53  ? 344 HOH B O     1 
HETATM 6577 O O     . HOH H 4 .   ? 93.179  41.940 73.436  1.00 28.15  ? 345 HOH B O     1 
HETATM 6578 O O     . HOH H 4 .   ? 60.153  28.298 96.334  1.00 41.18  ? 346 HOH B O     1 
HETATM 6579 O O     . HOH H 4 .   ? 90.008  29.325 82.250  1.00 55.73  ? 347 HOH B O     1 
HETATM 6580 O O     . HOH H 4 .   ? 79.174  39.950 77.442  1.00 37.37  ? 348 HOH B O     1 
HETATM 6581 O O     . HOH H 4 .   ? 72.932  34.858 60.680  1.00 50.32  ? 349 HOH B O     1 
HETATM 6582 O O     . HOH H 4 .   ? 98.620  30.841 71.673  1.00 43.26  ? 350 HOH B O     1 
HETATM 6583 O O     . HOH H 4 .   ? 75.150  25.219 61.552  1.00 45.50  ? 351 HOH B O     1 
HETATM 6584 O O     . HOH H 4 .   ? 75.682  39.243 64.801  1.00 59.26  ? 352 HOH B O     1 
HETATM 6585 O O     . HOH H 4 .   ? 65.461  34.566 72.183  1.00 61.41  ? 353 HOH B O     1 
HETATM 6586 O O     . HOH H 4 .   ? 68.480  35.614 67.924  1.00 64.98  ? 354 HOH B O     1 
HETATM 6587 O O     . HOH H 4 .   ? 90.901  30.461 66.050  1.00 41.66  ? 355 HOH B O     1 
HETATM 6588 O O     . HOH H 4 .   ? 85.116  26.383 86.661  1.00 51.53  ? 356 HOH B O     1 
HETATM 6589 O O     . HOH H 4 .   ? 95.160  44.576 72.551  1.00 55.00  ? 357 HOH B O     1 
HETATM 6590 O O     . HOH H 4 .   ? 72.066  34.704 84.030  1.00 26.83  ? 358 HOH B O     1 
HETATM 6591 O O     . HOH H 4 .   ? 53.634  28.507 103.202 1.00 74.03  ? 359 HOH B O     1 
HETATM 6592 O O     . HOH H 4 .   ? 91.626  33.154 65.848  1.00 27.31  ? 360 HOH B O     1 
HETATM 6593 O O     . HOH H 4 .   ? 81.598  22.507 81.827  1.00 58.10  ? 361 HOH B O     1 
HETATM 6594 O O     . HOH H 4 .   ? 54.988  31.105 75.316  1.00 55.82  ? 362 HOH B O     1 
HETATM 6595 O O     . HOH H 4 .   ? 37.416  23.248 93.879  1.00 53.36  ? 363 HOH B O     1 
HETATM 6596 O O     . HOH H 4 .   ? 85.200  24.607 54.957  1.00 36.22  ? 364 HOH B O     1 
HETATM 6597 O O     . HOH H 4 .   ? 69.011  42.447 74.478  1.00 73.07  ? 365 HOH B O     1 
HETATM 6598 O O     . HOH H 4 .   ? 42.509  43.705 99.527  1.00 44.80  ? 366 HOH B O     1 
HETATM 6599 O O     . HOH H 4 .   ? 78.002  38.168 79.221  1.00 45.10  ? 367 HOH B O     1 
HETATM 6600 O O     . HOH H 4 .   ? 38.833  36.389 95.600  1.00 64.42  ? 368 HOH B O     1 
HETATM 6601 O O     . HOH H 4 .   ? 49.582  24.736 86.241  1.00 58.36  ? 369 HOH B O     1 
HETATM 6602 O O     . HOH H 4 .   ? 76.907  26.251 55.016  1.00 74.63  ? 370 HOH B O     1 
HETATM 6603 O O     . HOH H 4 .   ? 87.140  25.433 58.234  1.00 41.11  ? 371 HOH B O     1 
HETATM 6604 O O     . HOH H 4 .   ? 79.498  22.274 79.752  1.00 62.14  ? 372 HOH B O     1 
HETATM 6605 O O     . HOH H 4 .   ? 76.770  46.593 77.416  1.00 47.51  ? 373 HOH B O     1 
HETATM 6606 O O     . HOH H 4 .   ? 67.110  31.370 71.477  1.00 26.80  ? 374 HOH B O     1 
HETATM 6607 O O     . HOH H 4 .   ? 64.391  26.973 93.975  1.00 79.21  ? 375 HOH B O     1 
HETATM 6608 O O     . HOH H 4 .   ? 68.994  28.633 96.318  1.00 58.01  ? 376 HOH B O     1 
HETATM 6609 O O     . HOH H 4 .   ? 66.231  37.148 70.737  1.00 58.50  ? 377 HOH B O     1 
HETATM 6610 O O     . HOH H 4 .   ? 79.230  55.269 72.585  1.00 78.81  ? 378 HOH B O     1 
HETATM 6611 O O     . HOH H 4 .   ? 78.642  30.407 53.003  1.00 47.93  ? 379 HOH B O     1 
HETATM 6612 O O     . HOH H 4 .   ? 76.594  30.032 51.958  1.00 66.48  ? 380 HOH B O     1 
HETATM 6613 O O     . HOH H 4 .   ? 73.375  29.420 53.097  1.00 66.16  ? 381 HOH B O     1 
HETATM 6614 O O     . HOH H 4 .   ? 80.266  21.279 90.140  1.00 52.63  ? 382 HOH B O     1 
HETATM 6615 O O     . HOH H 4 .   ? 89.074  39.476 106.038 1.00 84.41  ? 383 HOH B O     1 
HETATM 6616 O O     . HOH H 4 .   ? 84.990  31.644 86.551  1.00 58.59  ? 384 HOH B O     1 
HETATM 6617 O O     . HOH H 4 .   ? 86.428  29.058 86.741  1.00 51.80  ? 385 HOH B O     1 
HETATM 6618 O O     . HOH H 4 .   ? 74.607  46.006 76.623  1.00 83.35  ? 386 HOH B O     1 
HETATM 6619 O O     . HOH H 4 .   ? 78.147  37.381 48.537  1.00 48.77  ? 387 HOH B O     1 
HETATM 6620 O O     . HOH H 4 .   ? 94.853  48.286 102.878 1.00 75.60  ? 388 HOH B O     1 
HETATM 6621 O O     . HOH H 4 .   ? 67.231  33.527 69.967  1.00 68.57  ? 389 HOH B O     1 
HETATM 6622 O O     . HOH H 4 .   ? 72.161  26.547 74.945  1.00 42.97  ? 390 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   1   DA  A   C . n 
A 1 2   DT  2   2   2   DT  T   C . n 
A 1 3   DA  3   3   3   DA  A   C . n 
A 1 4   DA  4   4   4   DA  A   C . n 
A 1 5   DC  5   5   5   DC  C   C . n 
A 1 6   DT  6   6   6   DT  T   C . n 
A 1 7   DT  7   7   7   DT  T   C . n 
A 1 8   DC  8   8   8   DC  C   C . n 
A 1 9   DG  9   9   9   DG  G   C . n 
A 1 10  DT  10  10  10  DT  T   C . n 
A 1 11  DA  11  11  11  DA  A   C . n 
A 1 12  DT  12  12  12  DT  T   C . n 
A 1 13  DA  13  13  13  DA  A   C . n 
A 1 14  DA  14  14  14  DA  A   C . n 
A 1 15  DT  15  15  15  DT  T   C . n 
A 1 16  DG  16  16  16  DG  G   C . n 
A 1 17  DT  17  17  ?   ?   ?   C . n 
A 1 18  DA  18  18  18  DA  A   C . n 
A 1 19  DT  19  19  19  DT  T   C . n 
A 1 20  DG  20  20  20  DG  G   C . n 
A 1 21  DC  21  21  21  DC  C   C . n 
A 1 22  DT  22  22  22  DT  T   C . n 
A 1 23  DA  23  23  23  DA  A   C . n 
A 1 24  DT  24  24  24  DT  T   C . n 
A 1 25  DA  25  25  25  DA  A   C . n 
A 1 26  DC  26  26  26  DC  C   C . n 
A 1 27  DG  27  27  27  DG  G   C . n 
A 1 28  DA  28  28  28  DA  A   C . n 
A 1 29  DA  29  29  29  DA  A   C . n 
A 1 30  DG  30  30  30  DG  G   C . n 
A 1 31  DT  31  31  31  DT  T   C . n 
A 1 32  DT  32  32  32  DT  T   C . n 
A 1 33  DA  33  33  33  DA  A   C . n 
A 1 34  DT  34  34  34  DT  T   C . n 
B 2 1   DA  1   1   1   DA  A   D . n 
B 2 2   DT  2   2   2   DT  T   D . n 
B 2 3   DA  3   3   3   DA  A   D . n 
B 2 4   DA  4   4   4   DA  A   D . n 
B 2 5   DC  5   5   5   DC  C   D . n 
B 2 6   DT  6   6   6   DT  T   D . n 
B 2 7   DT  7   7   7   DT  T   D . n 
B 2 8   DC  8   8   8   DC  C   D . n 
B 2 9   DG  9   9   9   DG  G   D . n 
B 2 10  DT  10  10  10  DT  T   D . n 
B 2 11  DA  11  11  11  DA  A   D . n 
B 2 12  DT  12  12  12  DT  T   D . n 
B 2 13  DA  13  13  13  DA  A   D . n 
B 2 14  DG  14  14  14  DG  G   D . n 
B 2 15  DC  15  15  15  DC  C   D . n 
B 2 16  DA  16  16  16  DA  A   D . n 
B 2 17  DT  17  17  17  DT  T   D . n 
B 2 18  DA  18  18  18  DA  A   D . n 
B 2 19  DC  19  19  19  DC  C   D . n 
B 2 20  DA  20  20  20  DA  A   D . n 
B 2 21  DT  21  21  21  DT  T   D . n 
B 2 22  DT  22  22  22  DT  T   D . n 
B 2 23  DA  23  23  23  DA  A   D . n 
B 2 24  DT  24  24  24  DT  T   D . n 
B 2 25  DA  25  25  25  DA  A   D . n 
B 2 26  DC  26  26  26  DC  C   D . n 
B 2 27  DG  27  27  27  DG  G   D . n 
B 2 28  DA  28  28  28  DA  A   D . n 
B 2 29  DA  29  29  29  DA  A   D . n 
B 2 30  DG  30  30  30  DG  G   D . n 
B 2 31  DT  31  31  31  DT  T   D . n 
B 2 32  DT  32  32  32  DT  T   D . n 
B 2 33  DA  33  33  33  DA  A   D . n 
B 2 34  DT  34  34  34  DT  T   D . n 
C 3 1   MET 1   -5  ?   ?   ?   A . n 
C 3 2   HIS 2   -4  ?   ?   ?   A . n 
C 3 3   HIS 3   -3  ?   ?   ?   A . n 
C 3 4   HIS 4   -2  ?   ?   ?   A . n 
C 3 5   HIS 5   -1  ?   ?   ?   A . n 
C 3 6   HIS 6   0   ?   ?   ?   A . n 
C 3 7   HIS 7   1   ?   ?   ?   A . n 
C 3 8   SER 8   2   ?   ?   ?   A . n 
C 3 9   ASN 9   3   ?   ?   ?   A . n 
C 3 10  LEU 10  4   ?   ?   ?   A . n 
C 3 11  LEU 11  5   ?   ?   ?   A . n 
C 3 12  THR 12  6   ?   ?   ?   A . n 
C 3 13  VAL 13  7   ?   ?   ?   A . n 
C 3 14  HIS 14  8   ?   ?   ?   A . n 
C 3 15  GLN 15  9   ?   ?   ?   A . n 
C 3 16  ASN 16  10  ?   ?   ?   A . n 
C 3 17  LEU 17  11  ?   ?   ?   A . n 
C 3 18  PRO 18  12  ?   ?   ?   A . n 
C 3 19  ALA 19  13  ?   ?   ?   A . n 
C 3 20  LEU 20  14  ?   ?   ?   A . n 
C 3 21  PRO 21  15  ?   ?   ?   A . n 
C 3 22  VAL 22  16  ?   ?   ?   A . n 
C 3 23  ASP 23  17  ?   ?   ?   A . n 
C 3 24  ALA 24  18  18  ALA ALA A . n 
C 3 25  THR 25  19  19  THR THR A . n 
C 3 26  SER 26  20  20  SER SER A . n 
C 3 27  ASP 27  21  21  ASP ASP A . n 
C 3 28  GLU 28  22  22  GLU GLU A . n 
C 3 29  VAL 29  23  23  VAL VAL A . n 
C 3 30  ARG 30  24  24  ARG ARG A . n 
C 3 31  LYS 31  25  25  LYS LYS A . n 
C 3 32  ASN 32  26  26  ASN ASN A . n 
C 3 33  LEU 33  27  27  LEU LEU A . n 
C 3 34  MET 34  28  28  MET MET A . n 
C 3 35  ASP 35  29  29  ASP ASP A . n 
C 3 36  MET 36  30  30  MET MET A . n 
C 3 37  PHE 37  31  31  PHE PHE A . n 
C 3 38  ARG 38  32  32  ARG ARG A . n 
C 3 39  ASP 39  33  33  ASP ASP A . n 
C 3 40  ARG 40  34  34  ARG ARG A . n 
C 3 41  GLN 41  35  35  GLN GLN A . n 
C 3 42  ALA 42  36  36  ALA ALA A . n 
C 3 43  PHE 43  37  37  PHE PHE A . n 
C 3 44  SER 44  38  38  SER SER A . n 
C 3 45  GLU 45  39  39  GLU GLU A . n 
C 3 46  HIS 46  40  40  HIS HIS A . n 
C 3 47  THR 47  41  41  THR THR A . n 
C 3 48  TRP 48  42  42  TRP TRP A . n 
C 3 49  LYS 49  43  43  LYS LYS A . n 
C 3 50  MET 50  44  44  MET MET A . n 
C 3 51  LEU 51  45  45  LEU LEU A . n 
C 3 52  LEU 52  46  46  LEU LEU A . n 
C 3 53  SER 53  47  47  SER SER A . n 
C 3 54  VAL 54  48  48  VAL VAL A . n 
C 3 55  CYS 55  49  49  CYS CYS A . n 
C 3 56  ARG 56  50  50  ARG ARG A . n 
C 3 57  SER 57  51  51  SER SER A . n 
C 3 58  TRP 58  52  52  TRP TRP A . n 
C 3 59  ALA 59  53  53  ALA ALA A . n 
C 3 60  ALA 60  54  54  ALA ALA A . n 
C 3 61  TRP 61  55  55  TRP TRP A . n 
C 3 62  CYS 62  56  56  CYS CYS A . n 
C 3 63  LYS 63  57  57  LYS LYS A . n 
C 3 64  LEU 64  58  58  LEU LEU A . n 
C 3 65  ASN 65  59  59  ASN ASN A . n 
C 3 66  ASN 66  60  60  ASN ASN A . n 
C 3 67  ARG 67  61  61  ARG ARG A . n 
C 3 68  LYS 68  62  62  LYS LYS A . n 
C 3 69  TRP 69  63  63  TRP TRP A . n 
C 3 70  PHE 70  64  64  PHE PHE A . n 
C 3 71  PRO 71  65  65  PRO PRO A . n 
C 3 72  ALA 72  66  66  ALA ALA A . n 
C 3 73  GLU 73  67  67  GLU GLU A . n 
C 3 74  PRO 74  68  68  PRO PRO A . n 
C 3 75  GLU 75  69  69  GLU GLU A . n 
C 3 76  ASP 76  70  70  ASP ASP A . n 
C 3 77  VAL 77  71  71  VAL VAL A . n 
C 3 78  ARG 78  72  72  ARG ARG A . n 
C 3 79  ASP 79  73  73  ASP ASP A . n 
C 3 80  TYR 80  74  74  TYR TYR A . n 
C 3 81  LEU 81  75  75  LEU LEU A . n 
C 3 82  LEU 82  76  76  LEU LEU A . n 
C 3 83  TYR 83  77  77  TYR TYR A . n 
C 3 84  LEU 84  78  78  LEU LEU A . n 
C 3 85  GLN 85  79  79  GLN GLN A . n 
C 3 86  ALA 86  80  80  ALA ALA A . n 
C 3 87  ARG 87  81  81  ARG ARG A . n 
C 3 88  GLY 88  82  82  GLY GLY A . n 
C 3 89  LEU 89  83  83  LEU LEU A . n 
C 3 90  ALA 90  84  84  ALA ALA A . n 
C 3 91  VAL 91  85  85  VAL VAL A . n 
C 3 92  LYS 92  86  86  LYS LYS A . n 
C 3 93  THR 93  87  87  THR THR A . n 
C 3 94  ILE 94  88  88  ILE ILE A . n 
C 3 95  GLN 95  89  89  GLN GLN A . n 
C 3 96  GLN 96  90  90  GLN GLN A . n 
C 3 97  HIS 97  91  91  HIS HIS A . n 
C 3 98  LEU 98  92  92  LEU LEU A . n 
C 3 99  GLY 99  93  93  GLY GLY A . n 
C 3 100 GLN 100 94  94  GLN GLN A . n 
C 3 101 LEU 101 95  95  LEU LEU A . n 
C 3 102 ASN 102 96  96  ASN ASN A . n 
C 3 103 MET 103 97  97  MET MET A . n 
C 3 104 LEU 104 98  98  LEU LEU A . n 
C 3 105 HIS 105 99  99  HIS HIS A . n 
C 3 106 ARG 106 100 100 ARG ARG A . n 
C 3 107 ARG 107 101 101 ARG ARG A . n 
C 3 108 SER 108 102 102 SER SER A . n 
C 3 109 GLY 109 103 103 GLY GLY A . n 
C 3 110 LEU 110 104 104 LEU LEU A . n 
C 3 111 PRO 111 105 105 PRO PRO A . n 
C 3 112 ARG 112 106 106 ARG ARG A . n 
C 3 113 PRO 113 107 107 PRO PRO A . n 
C 3 114 SER 114 108 108 SER SER A . n 
C 3 115 ASP 115 109 109 ASP ASP A . n 
C 3 116 SER 116 110 110 SER SER A . n 
C 3 117 ASN 117 111 111 ASN ASN A . n 
C 3 118 ALA 118 112 112 ALA ALA A . n 
C 3 119 VAL 119 113 113 VAL VAL A . n 
C 3 120 SER 120 114 114 SER SER A . n 
C 3 121 LEU 121 115 115 LEU LEU A . n 
C 3 122 VAL 122 116 116 VAL VAL A . n 
C 3 123 MET 123 117 117 MET MET A . n 
C 3 124 ARG 124 118 118 ARG ARG A . n 
C 3 125 ARG 125 119 119 ARG ARG A . n 
C 3 126 ILE 126 120 120 ILE ILE A . n 
C 3 127 ARG 127 121 121 ARG ARG A . n 
C 3 128 LYS 128 122 122 LYS LYS A . n 
C 3 129 GLU 129 123 123 GLU GLU A . n 
C 3 130 ASN 130 124 124 ASN ASN A . n 
C 3 131 VAL 131 125 125 VAL VAL A . n 
C 3 132 ASP 132 126 126 ASP ASP A . n 
C 3 133 ALA 133 127 127 ALA ALA A . n 
C 3 134 GLY 134 128 128 GLY GLY A . n 
C 3 135 GLU 135 129 129 GLU GLU A . n 
C 3 136 ARG 136 130 130 ARG ARG A . n 
C 3 137 ALA 137 131 131 ALA ALA A . n 
C 3 138 LYS 138 132 132 LYS LYS A . n 
C 3 139 GLN 139 133 133 GLN GLN A . n 
C 3 140 ALA 140 134 134 ALA ALA A . n 
C 3 141 LEU 141 135 135 LEU LEU A . n 
C 3 142 ALA 142 136 136 ALA ALA A . n 
C 3 143 PHE 143 137 137 PHE PHE A . n 
C 3 144 GLU 144 138 138 GLU GLU A . n 
C 3 145 ARG 145 139 139 ARG ARG A . n 
C 3 146 THR 146 140 140 THR THR A . n 
C 3 147 ASP 147 141 141 ASP ASP A . n 
C 3 148 PHE 148 142 142 PHE PHE A . n 
C 3 149 ASP 149 143 143 ASP ASP A . n 
C 3 150 GLN 150 144 144 GLN GLN A . n 
C 3 151 VAL 151 145 145 VAL VAL A . n 
C 3 152 ARG 152 146 146 ARG ARG A . n 
C 3 153 SER 153 147 147 SER SER A . n 
C 3 154 LEU 154 148 148 LEU LEU A . n 
C 3 155 MET 155 149 149 MET MET A . n 
C 3 156 GLU 156 150 150 GLU GLU A . n 
C 3 157 ASN 157 151 151 ASN ASN A . n 
C 3 158 SER 158 152 152 SER SER A . n 
C 3 159 ASP 159 153 153 ASP ASP A . n 
C 3 160 ARG 160 154 154 ARG ARG A . n 
C 3 161 CYS 161 155 155 CYS CYS A . n 
C 3 162 GLN 162 156 156 GLN GLN A . n 
C 3 163 ASP 163 157 157 ASP ASP A . n 
C 3 164 ILE 164 158 158 ILE ILE A . n 
C 3 165 ARG 165 159 159 ARG ARG A . n 
C 3 166 ASN 166 160 160 ASN ASN A . n 
C 3 167 LEU 167 161 161 LEU LEU A . n 
C 3 168 ALA 168 162 162 ALA ALA A . n 
C 3 169 PHE 169 163 163 PHE PHE A . n 
C 3 170 LEU 170 164 164 LEU LEU A . n 
C 3 171 GLY 171 165 165 GLY GLY A . n 
C 3 172 ILE 172 166 166 ILE ILE A . n 
C 3 173 ALA 173 167 167 ALA ALA A . n 
C 3 174 TYR 174 168 168 TYR TYR A . n 
C 3 175 ASN 175 169 169 ASN ASN A . n 
C 3 176 THR 176 170 170 THR THR A . n 
C 3 177 LEU 177 171 171 LEU LEU A . n 
C 3 178 LEU 178 172 172 LEU LEU A . n 
C 3 179 ARG 179 173 173 ARG ARG A . n 
C 3 180 LEU 180 174 174 LEU LEU A . n 
C 3 181 ALA 181 175 175 ALA ALA A . n 
C 3 182 GLU 182 176 176 GLU GLU A . n 
C 3 183 ILE 183 177 177 ILE ILE A . n 
C 3 184 ALA 184 178 178 ALA ALA A . n 
C 3 185 ARG 185 179 179 ARG ARG A . n 
C 3 186 ILE 186 180 180 ILE ILE A . n 
C 3 187 ARG 187 181 181 ARG ARG A . n 
C 3 188 VAL 188 182 182 VAL VAL A . n 
C 3 189 LYS 189 183 183 LYS LYS A . n 
C 3 190 ASP 190 184 184 ASP ASP A . n 
C 3 191 ILE 191 185 185 ILE ILE A . n 
C 3 192 SER 192 186 186 SER SER A . n 
C 3 193 ARG 193 187 187 ARG ARG A . n 
C 3 194 THR 194 188 188 THR THR A . n 
C 3 195 ASP 195 189 189 ASP ASP A . n 
C 3 196 GLY 196 190 190 GLY GLY A . n 
C 3 197 GLY 197 191 191 GLY GLY A . n 
C 3 198 ARG 198 192 192 ARG ARG A . n 
C 3 199 MET 199 193 193 MET MET A . n 
C 3 200 LEU 200 194 194 LEU LEU A . n 
C 3 201 ILE 201 195 195 ILE ILE A . n 
C 3 202 HIS 202 196 196 HIS HIS A . n 
C 3 203 ILE 203 197 197 ILE ILE A . n 
C 3 204 GLY 204 198 198 GLY GLY A . n 
C 3 205 ARG 205 199 199 ARG ARG A . n 
C 3 206 THR 206 200 200 THR THR A . n 
C 3 207 LYS 207 201 201 LYS LYS A . n 
C 3 208 THR 208 202 202 THR THR A . n 
C 3 209 LEU 209 203 203 LEU LEU A . n 
C 3 210 VAL 210 204 204 VAL VAL A . n 
C 3 211 SER 211 205 205 SER SER A . n 
C 3 212 THR 212 206 206 THR THR A . n 
C 3 213 ALA 213 207 207 ALA ALA A . n 
C 3 214 GLY 214 208 208 GLY GLY A . n 
C 3 215 VAL 215 209 209 VAL VAL A . n 
C 3 216 GLU 216 210 210 GLU GLU A . n 
C 3 217 LYS 217 211 211 LYS LYS A . n 
C 3 218 ALA 218 212 212 ALA ALA A . n 
C 3 219 LEU 219 213 213 LEU LEU A . n 
C 3 220 SER 220 214 214 SER SER A . n 
C 3 221 LEU 221 215 215 LEU LEU A . n 
C 3 222 GLY 222 216 216 GLY GLY A . n 
C 3 223 VAL 223 217 217 VAL VAL A . n 
C 3 224 THR 224 218 218 THR THR A . n 
C 3 225 LYS 225 219 219 LYS LYS A . n 
C 3 226 LEU 226 220 220 LEU LEU A . n 
C 3 227 VAL 227 221 221 VAL VAL A . n 
C 3 228 GLU 228 222 222 GLU GLU A . n 
C 3 229 ARG 229 223 223 ARG ARG A . n 
C 3 230 TRP 230 224 224 TRP TRP A . n 
C 3 231 ILE 231 225 225 ILE ILE A . n 
C 3 232 SER 232 226 226 SER SER A . n 
C 3 233 VAL 233 227 227 VAL VAL A . n 
C 3 234 SER 234 228 228 SER SER A . n 
C 3 235 GLY 235 229 229 GLY GLY A . n 
C 3 236 VAL 236 230 230 VAL VAL A . n 
C 3 237 ALA 237 231 231 ALA ALA A . n 
C 3 238 ASP 238 232 232 ASP ASP A . n 
C 3 239 ASP 239 233 233 ASP ASP A . n 
C 3 240 PRO 240 234 234 PRO PRO A . n 
C 3 241 ASN 241 235 235 ASN ASN A . n 
C 3 242 ASN 242 236 236 ASN ASN A . n 
C 3 243 TYR 243 237 237 TYR TYR A . n 
C 3 244 LEU 244 238 238 LEU LEU A . n 
C 3 245 PHE 245 239 239 PHE PHE A . n 
C 3 246 CYS 246 240 240 CYS CYS A . n 
C 3 247 ARG 247 241 241 ARG ARG A . n 
C 3 248 VAL 248 242 242 VAL VAL A . n 
C 3 249 ARG 249 243 243 ARG ARG A . n 
C 3 250 LYS 250 244 244 LYS LYS A . n 
C 3 251 ASN 251 245 245 ASN ASN A . n 
C 3 252 GLY 252 246 246 GLY GLY A . n 
C 3 253 VAL 253 247 247 VAL VAL A . n 
C 3 254 ALA 254 248 248 ALA ALA A . n 
C 3 255 ALA 255 249 249 ALA ALA A . n 
C 3 256 PRO 256 250 250 PRO PRO A . n 
C 3 257 SER 257 251 251 SER SER A . n 
C 3 258 ALA 258 252 252 ALA ALA A . n 
C 3 259 THR 259 253 253 THR THR A . n 
C 3 260 SER 260 254 254 SER SER A . n 
C 3 261 GLN 261 255 255 GLN GLN A . n 
C 3 262 LEU 262 256 256 LEU LEU A . n 
C 3 263 SER 263 257 257 SER SER A . n 
C 3 264 ASN 264 258 258 ASN ASN A . n 
C 3 265 SER 265 259 259 SER SER A . n 
C 3 266 ALA 266 260 260 ALA ALA A . n 
C 3 267 LEU 267 261 261 LEU LEU A . n 
C 3 268 GLY 268 262 262 GLY GLY A . n 
C 3 269 GLY 269 263 263 GLY GLY A . n 
C 3 270 ILE 270 264 264 ILE ILE A . n 
C 3 271 PHE 271 265 265 PHE PHE A . n 
C 3 272 GLY 272 266 266 GLY GLY A . n 
C 3 273 ALA 273 267 267 ALA ALA A . n 
C 3 274 THR 274 268 268 THR THR A . n 
C 3 275 HIS 275 269 269 HIS HIS A . n 
C 3 276 ARG 276 270 270 ARG ARG A . n 
C 3 277 LEU 277 271 271 LEU LEU A . n 
C 3 278 ILE 278 272 272 ILE ILE A . n 
C 3 279 TYR 279 273 273 TYR TYR A . n 
C 3 280 GLY 280 274 274 GLY GLY A . n 
C 3 281 ALA 281 275 275 ALA ALA A . n 
C 3 282 LYS 282 276 276 LYS LYS A . n 
C 3 283 ASP 283 277 277 ASP ASP A . n 
C 3 284 ASP 284 278 278 ASP ASP A . n 
C 3 285 SER 285 279 279 SER SER A . n 
C 3 286 GLY 286 280 280 GLY GLY A . n 
C 3 287 GLN 287 281 281 GLN GLN A . n 
C 3 288 ARG 288 282 282 ARG ARG A . n 
C 3 289 TYR 289 283 283 TYR TYR A . n 
C 3 290 LEU 290 284 284 LEU LEU A . n 
C 3 291 ALA 291 285 285 ALA ALA A . n 
C 3 292 TRP 292 286 286 TRP TRP A . n 
C 3 293 SER 293 287 287 SER SER A . n 
C 3 294 GLY 294 288 288 GLY GLY A . n 
C 3 295 HIS 295 289 289 HIS HIS A . n 
C 3 296 SER 296 290 290 SER SER A . n 
C 3 297 ALA 297 291 291 ALA ALA A . n 
C 3 298 ARG 298 292 292 ARG ARG A . n 
C 3 299 VAL 299 293 293 VAL VAL A . n 
C 3 300 GLY 300 294 294 GLY GLY A . n 
C 3 301 ALA 301 295 295 ALA ALA A . n 
C 3 302 ALA 302 296 296 ALA ALA A . n 
C 3 303 ARG 303 297 297 ARG ARG A . n 
C 3 304 ASP 304 298 298 ASP ASP A . n 
C 3 305 MET 305 299 299 MET MET A . n 
C 3 306 ALA 306 300 300 ALA ALA A . n 
C 3 307 ARG 307 301 301 ARG ARG A . n 
C 3 308 ALA 308 302 302 ALA ALA A . n 
C 3 309 GLY 309 303 303 GLY GLY A . n 
C 3 310 VAL 310 304 304 VAL VAL A . n 
C 3 311 SER 311 305 305 SER SER A . n 
C 3 312 ILE 312 306 306 ILE ILE A . n 
C 3 313 PRO 313 307 307 PRO PRO A . n 
C 3 314 GLU 314 308 308 GLU GLU A . n 
C 3 315 ILE 315 309 309 ILE ILE A . n 
C 3 316 MET 316 310 310 MET MET A . n 
C 3 317 GLN 317 311 311 GLN GLN A . n 
C 3 318 ALA 318 312 312 ALA ALA A . n 
C 3 319 GLY 319 313 313 GLY GLY A . n 
C 3 320 GLY 320 314 314 GLY GLY A . n 
C 3 321 TRP 321 315 315 TRP TRP A . n 
C 3 322 THR 322 316 316 THR THR A . n 
C 3 323 ASN 323 317 317 ASN ASN A . n 
C 3 324 VAL 324 318 318 VAL VAL A . n 
C 3 325 ASN 325 319 319 ASN ASN A . n 
C 3 326 ILE 326 320 320 ILE ILE A . n 
C 3 327 VAL 327 321 321 VAL VAL A . n 
C 3 328 MET 328 322 322 MET MET A . n 
C 3 329 ASN 329 323 323 ASN ASN A . n 
C 3 330 TYR 330 324 324 TYR TYR A . n 
C 3 331 ILE 331 325 325 ILE ILE A . n 
C 3 332 ARG 332 326 326 ARG ARG A . n 
C 3 333 ASN 333 327 327 ASN ASN A . n 
C 3 334 LEU 334 328 328 LEU LEU A . n 
C 3 335 ASP 335 329 329 ASP ASP A . n 
C 3 336 SER 336 330 330 SER SER A . n 
C 3 337 GLU 337 331 331 GLU GLU A . n 
C 3 338 THR 338 332 332 THR THR A . n 
C 3 339 GLY 339 333 333 GLY GLY A . n 
C 3 340 ALA 340 334 334 ALA ALA A . n 
C 3 341 MET 341 335 335 MET MET A . n 
C 3 342 VAL 342 336 336 VAL VAL A . n 
C 3 343 ARG 343 337 337 ARG ARG A . n 
C 3 344 LEU 344 338 338 LEU LEU A . n 
C 3 345 LEU 345 339 339 LEU LEU A . n 
C 3 346 GLU 346 340 340 GLU GLU A . n 
C 3 347 ASP 347 341 341 ASP ASP A . n 
C 3 348 GLY 348 342 ?   ?   ?   A . n 
C 3 349 ASP 349 343 ?   ?   ?   A . n 
D 3 1   MET 1   -5  ?   ?   ?   B . n 
D 3 2   HIS 2   -4  ?   ?   ?   B . n 
D 3 3   HIS 3   -3  ?   ?   ?   B . n 
D 3 4   HIS 4   -2  ?   ?   ?   B . n 
D 3 5   HIS 5   -1  ?   ?   ?   B . n 
D 3 6   HIS 6   0   ?   ?   ?   B . n 
D 3 7   HIS 7   1   ?   ?   ?   B . n 
D 3 8   SER 8   2   ?   ?   ?   B . n 
D 3 9   ASN 9   3   ?   ?   ?   B . n 
D 3 10  LEU 10  4   ?   ?   ?   B . n 
D 3 11  LEU 11  5   ?   ?   ?   B . n 
D 3 12  THR 12  6   ?   ?   ?   B . n 
D 3 13  VAL 13  7   ?   ?   ?   B . n 
D 3 14  HIS 14  8   ?   ?   ?   B . n 
D 3 15  GLN 15  9   ?   ?   ?   B . n 
D 3 16  ASN 16  10  ?   ?   ?   B . n 
D 3 17  LEU 17  11  ?   ?   ?   B . n 
D 3 18  PRO 18  12  ?   ?   ?   B . n 
D 3 19  ALA 19  13  ?   ?   ?   B . n 
D 3 20  LEU 20  14  ?   ?   ?   B . n 
D 3 21  PRO 21  15  ?   ?   ?   B . n 
D 3 22  VAL 22  16  ?   ?   ?   B . n 
D 3 23  ASP 23  17  ?   ?   ?   B . n 
D 3 24  ALA 24  18  ?   ?   ?   B . n 
D 3 25  THR 25  19  19  THR THR B . n 
D 3 26  SER 26  20  20  SER SER B . n 
D 3 27  ASP 27  21  21  ASP ASP B . n 
D 3 28  GLU 28  22  22  GLU GLU B . n 
D 3 29  VAL 29  23  23  VAL VAL B . n 
D 3 30  ARG 30  24  24  ARG ARG B . n 
D 3 31  LYS 31  25  25  LYS LYS B . n 
D 3 32  ASN 32  26  26  ASN ASN B . n 
D 3 33  LEU 33  27  27  LEU LEU B . n 
D 3 34  MET 34  28  28  MET MET B . n 
D 3 35  ASP 35  29  29  ASP ASP B . n 
D 3 36  MET 36  30  30  MET MET B . n 
D 3 37  PHE 37  31  31  PHE PHE B . n 
D 3 38  ARG 38  32  32  ARG ARG B . n 
D 3 39  ASP 39  33  33  ASP ASP B . n 
D 3 40  ARG 40  34  34  ARG ARG B . n 
D 3 41  GLN 41  35  35  GLN GLN B . n 
D 3 42  ALA 42  36  36  ALA ALA B . n 
D 3 43  PHE 43  37  37  PHE PHE B . n 
D 3 44  SER 44  38  38  SER SER B . n 
D 3 45  GLU 45  39  39  GLU GLU B . n 
D 3 46  HIS 46  40  40  HIS HIS B . n 
D 3 47  THR 47  41  41  THR THR B . n 
D 3 48  TRP 48  42  42  TRP TRP B . n 
D 3 49  LYS 49  43  43  LYS LYS B . n 
D 3 50  MET 50  44  44  MET MET B . n 
D 3 51  LEU 51  45  45  LEU LEU B . n 
D 3 52  LEU 52  46  46  LEU LEU B . n 
D 3 53  SER 53  47  47  SER SER B . n 
D 3 54  VAL 54  48  48  VAL VAL B . n 
D 3 55  CYS 55  49  49  CYS CYS B . n 
D 3 56  ARG 56  50  50  ARG ARG B . n 
D 3 57  SER 57  51  51  SER SER B . n 
D 3 58  TRP 58  52  52  TRP TRP B . n 
D 3 59  ALA 59  53  53  ALA ALA B . n 
D 3 60  ALA 60  54  54  ALA ALA B . n 
D 3 61  TRP 61  55  55  TRP TRP B . n 
D 3 62  CYS 62  56  56  CYS CYS B . n 
D 3 63  LYS 63  57  57  LYS LYS B . n 
D 3 64  LEU 64  58  58  LEU LEU B . n 
D 3 65  ASN 65  59  59  ASN ASN B . n 
D 3 66  ASN 66  60  60  ASN ASN B . n 
D 3 67  ARG 67  61  61  ARG ARG B . n 
D 3 68  LYS 68  62  62  LYS LYS B . n 
D 3 69  TRP 69  63  63  TRP TRP B . n 
D 3 70  PHE 70  64  64  PHE PHE B . n 
D 3 71  PRO 71  65  65  PRO PRO B . n 
D 3 72  ALA 72  66  66  ALA ALA B . n 
D 3 73  GLU 73  67  67  GLU GLU B . n 
D 3 74  PRO 74  68  68  PRO PRO B . n 
D 3 75  GLU 75  69  69  GLU GLU B . n 
D 3 76  ASP 76  70  70  ASP ASP B . n 
D 3 77  VAL 77  71  71  VAL VAL B . n 
D 3 78  ARG 78  72  72  ARG ARG B . n 
D 3 79  ASP 79  73  73  ASP ASP B . n 
D 3 80  TYR 80  74  74  TYR TYR B . n 
D 3 81  LEU 81  75  75  LEU LEU B . n 
D 3 82  LEU 82  76  76  LEU LEU B . n 
D 3 83  TYR 83  77  77  TYR TYR B . n 
D 3 84  LEU 84  78  78  LEU LEU B . n 
D 3 85  GLN 85  79  79  GLN GLN B . n 
D 3 86  ALA 86  80  80  ALA ALA B . n 
D 3 87  ARG 87  81  81  ARG ARG B . n 
D 3 88  GLY 88  82  82  GLY GLY B . n 
D 3 89  LEU 89  83  83  LEU LEU B . n 
D 3 90  ALA 90  84  84  ALA ALA B . n 
D 3 91  VAL 91  85  85  VAL VAL B . n 
D 3 92  LYS 92  86  86  LYS LYS B . n 
D 3 93  THR 93  87  87  THR THR B . n 
D 3 94  ILE 94  88  88  ILE ILE B . n 
D 3 95  GLN 95  89  89  GLN GLN B . n 
D 3 96  GLN 96  90  90  GLN GLN B . n 
D 3 97  HIS 97  91  91  HIS HIS B . n 
D 3 98  LEU 98  92  92  LEU LEU B . n 
D 3 99  GLY 99  93  93  GLY GLY B . n 
D 3 100 GLN 100 94  94  GLN GLN B . n 
D 3 101 LEU 101 95  95  LEU LEU B . n 
D 3 102 ASN 102 96  96  ASN ASN B . n 
D 3 103 MET 103 97  97  MET MET B . n 
D 3 104 LEU 104 98  98  LEU LEU B . n 
D 3 105 HIS 105 99  99  HIS HIS B . n 
D 3 106 ARG 106 100 100 ARG ARG B . n 
D 3 107 ARG 107 101 101 ARG ARG B . n 
D 3 108 SER 108 102 102 SER SER B . n 
D 3 109 GLY 109 103 103 GLY GLY B . n 
D 3 110 LEU 110 104 104 LEU LEU B . n 
D 3 111 PRO 111 105 105 PRO PRO B . n 
D 3 112 ARG 112 106 106 ARG ARG B . n 
D 3 113 PRO 113 107 107 PRO PRO B . n 
D 3 114 SER 114 108 108 SER SER B . n 
D 3 115 ASP 115 109 109 ASP ASP B . n 
D 3 116 SER 116 110 110 SER SER B . n 
D 3 117 ASN 117 111 111 ASN ASN B . n 
D 3 118 ALA 118 112 112 ALA ALA B . n 
D 3 119 VAL 119 113 113 VAL VAL B . n 
D 3 120 SER 120 114 114 SER SER B . n 
D 3 121 LEU 121 115 115 LEU LEU B . n 
D 3 122 VAL 122 116 116 VAL VAL B . n 
D 3 123 MET 123 117 117 MET MET B . n 
D 3 124 ARG 124 118 118 ARG ARG B . n 
D 3 125 ARG 125 119 119 ARG ARG B . n 
D 3 126 ILE 126 120 120 ILE ILE B . n 
D 3 127 ARG 127 121 121 ARG ARG B . n 
D 3 128 LYS 128 122 122 LYS LYS B . n 
D 3 129 GLU 129 123 123 GLU GLU B . n 
D 3 130 ASN 130 124 124 ASN ASN B . n 
D 3 131 VAL 131 125 125 VAL VAL B . n 
D 3 132 ASP 132 126 126 ASP ASP B . n 
D 3 133 ALA 133 127 127 ALA ALA B . n 
D 3 134 GLY 134 128 128 GLY GLY B . n 
D 3 135 GLU 135 129 129 GLU GLU B . n 
D 3 136 ARG 136 130 130 ARG ARG B . n 
D 3 137 ALA 137 131 131 ALA ALA B . n 
D 3 138 LYS 138 132 132 LYS LYS B . n 
D 3 139 GLN 139 133 133 GLN GLN B . n 
D 3 140 ALA 140 134 134 ALA ALA B . n 
D 3 141 LEU 141 135 135 LEU LEU B . n 
D 3 142 ALA 142 136 136 ALA ALA B . n 
D 3 143 PHE 143 137 137 PHE PHE B . n 
D 3 144 GLU 144 138 138 GLU GLU B . n 
D 3 145 ARG 145 139 139 ARG ARG B . n 
D 3 146 THR 146 140 140 THR THR B . n 
D 3 147 ASP 147 141 141 ASP ASP B . n 
D 3 148 PHE 148 142 142 PHE PHE B . n 
D 3 149 ASP 149 143 143 ASP ASP B . n 
D 3 150 GLN 150 144 144 GLN GLN B . n 
D 3 151 VAL 151 145 145 VAL VAL B . n 
D 3 152 ARG 152 146 146 ARG ARG B . n 
D 3 153 SER 153 147 147 SER SER B . n 
D 3 154 LEU 154 148 148 LEU LEU B . n 
D 3 155 MET 155 149 149 MET MET B . n 
D 3 156 GLU 156 150 150 GLU GLU B . n 
D 3 157 ASN 157 151 151 ASN ASN B . n 
D 3 158 SER 158 152 152 SER SER B . n 
D 3 159 ASP 159 153 153 ASP ASP B . n 
D 3 160 ARG 160 154 154 ARG ARG B . n 
D 3 161 CYS 161 155 155 CYS CYS B . n 
D 3 162 GLN 162 156 156 GLN GLN B . n 
D 3 163 ASP 163 157 157 ASP ASP B . n 
D 3 164 ILE 164 158 158 ILE ILE B . n 
D 3 165 ARG 165 159 159 ARG ARG B . n 
D 3 166 ASN 166 160 160 ASN ASN B . n 
D 3 167 LEU 167 161 161 LEU LEU B . n 
D 3 168 ALA 168 162 162 ALA ALA B . n 
D 3 169 PHE 169 163 163 PHE PHE B . n 
D 3 170 LEU 170 164 164 LEU LEU B . n 
D 3 171 GLY 171 165 165 GLY GLY B . n 
D 3 172 ILE 172 166 166 ILE ILE B . n 
D 3 173 ALA 173 167 167 ALA ALA B . n 
D 3 174 TYR 174 168 168 TYR TYR B . n 
D 3 175 ASN 175 169 169 ASN ASN B . n 
D 3 176 THR 176 170 170 THR THR B . n 
D 3 177 LEU 177 171 171 LEU LEU B . n 
D 3 178 LEU 178 172 172 LEU LEU B . n 
D 3 179 ARG 179 173 173 ARG ARG B . n 
D 3 180 LEU 180 174 174 LEU LEU B . n 
D 3 181 ALA 181 175 175 ALA ALA B . n 
D 3 182 GLU 182 176 176 GLU GLU B . n 
D 3 183 ILE 183 177 177 ILE ILE B . n 
D 3 184 ALA 184 178 178 ALA ALA B . n 
D 3 185 ARG 185 179 179 ARG ARG B . n 
D 3 186 ILE 186 180 180 ILE ILE B . n 
D 3 187 ARG 187 181 181 ARG ARG B . n 
D 3 188 VAL 188 182 182 VAL VAL B . n 
D 3 189 LYS 189 183 183 LYS LYS B . n 
D 3 190 ASP 190 184 184 ASP ASP B . n 
D 3 191 ILE 191 185 185 ILE ILE B . n 
D 3 192 SER 192 186 186 SER SER B . n 
D 3 193 ARG 193 187 187 ARG ARG B . n 
D 3 194 THR 194 188 188 THR THR B . n 
D 3 195 ASP 195 189 189 ASP ASP B . n 
D 3 196 GLY 196 190 190 GLY GLY B . n 
D 3 197 GLY 197 191 191 GLY GLY B . n 
D 3 198 ARG 198 192 192 ARG ARG B . n 
D 3 199 MET 199 193 193 MET MET B . n 
D 3 200 LEU 200 194 194 LEU LEU B . n 
D 3 201 ILE 201 195 195 ILE ILE B . n 
D 3 202 HIS 202 196 196 HIS HIS B . n 
D 3 203 ILE 203 197 197 ILE ILE B . n 
D 3 204 GLY 204 198 198 GLY GLY B . n 
D 3 205 ARG 205 199 199 ARG ARG B . n 
D 3 206 THR 206 200 200 THR THR B . n 
D 3 207 LYS 207 201 201 LYS LYS B . n 
D 3 208 THR 208 202 202 THR THR B . n 
D 3 209 LEU 209 203 203 LEU LEU B . n 
D 3 210 VAL 210 204 204 VAL VAL B . n 
D 3 211 SER 211 205 205 SER SER B . n 
D 3 212 THR 212 206 206 THR THR B . n 
D 3 213 ALA 213 207 207 ALA ALA B . n 
D 3 214 GLY 214 208 208 GLY GLY B . n 
D 3 215 VAL 215 209 209 VAL VAL B . n 
D 3 216 GLU 216 210 210 GLU GLU B . n 
D 3 217 LYS 217 211 211 LYS LYS B . n 
D 3 218 ALA 218 212 212 ALA ALA B . n 
D 3 219 LEU 219 213 213 LEU LEU B . n 
D 3 220 SER 220 214 214 SER SER B . n 
D 3 221 LEU 221 215 215 LEU LEU B . n 
D 3 222 GLY 222 216 216 GLY GLY B . n 
D 3 223 VAL 223 217 217 VAL VAL B . n 
D 3 224 THR 224 218 218 THR THR B . n 
D 3 225 LYS 225 219 219 LYS LYS B . n 
D 3 226 LEU 226 220 220 LEU LEU B . n 
D 3 227 VAL 227 221 221 VAL VAL B . n 
D 3 228 GLU 228 222 222 GLU GLU B . n 
D 3 229 ARG 229 223 223 ARG ARG B . n 
D 3 230 TRP 230 224 224 TRP TRP B . n 
D 3 231 ILE 231 225 225 ILE ILE B . n 
D 3 232 SER 232 226 226 SER SER B . n 
D 3 233 VAL 233 227 227 VAL VAL B . n 
D 3 234 SER 234 228 228 SER SER B . n 
D 3 235 GLY 235 229 229 GLY GLY B . n 
D 3 236 VAL 236 230 230 VAL VAL B . n 
D 3 237 ALA 237 231 231 ALA ALA B . n 
D 3 238 ASP 238 232 232 ASP ASP B . n 
D 3 239 ASP 239 233 233 ASP ASP B . n 
D 3 240 PRO 240 234 234 PRO PRO B . n 
D 3 241 ASN 241 235 235 ASN ASN B . n 
D 3 242 ASN 242 236 236 ASN ASN B . n 
D 3 243 TYR 243 237 237 TYR TYR B . n 
D 3 244 LEU 244 238 238 LEU LEU B . n 
D 3 245 PHE 245 239 239 PHE PHE B . n 
D 3 246 CYS 246 240 240 CYS CYS B . n 
D 3 247 ARG 247 241 241 ARG ARG B . n 
D 3 248 VAL 248 242 242 VAL VAL B . n 
D 3 249 ARG 249 243 243 ARG ARG B . n 
D 3 250 LYS 250 244 244 LYS LYS B . n 
D 3 251 ASN 251 245 245 ASN ASN B . n 
D 3 252 GLY 252 246 246 GLY GLY B . n 
D 3 253 VAL 253 247 247 VAL VAL B . n 
D 3 254 ALA 254 248 248 ALA ALA B . n 
D 3 255 ALA 255 249 249 ALA ALA B . n 
D 3 256 PRO 256 250 250 PRO PRO B . n 
D 3 257 SER 257 251 251 SER SER B . n 
D 3 258 ALA 258 252 252 ALA ALA B . n 
D 3 259 THR 259 253 253 THR THR B . n 
D 3 260 SER 260 254 254 SER SER B . n 
D 3 261 GLN 261 255 255 GLN GLN B . n 
D 3 262 LEU 262 256 256 LEU LEU B . n 
D 3 263 SER 263 257 257 SER SER B . n 
D 3 264 ASN 264 258 258 ASN ASN B . n 
D 3 265 SER 265 259 259 SER SER B . n 
D 3 266 ALA 266 260 260 ALA ALA B . n 
D 3 267 LEU 267 261 261 LEU LEU B . n 
D 3 268 GLY 268 262 262 GLY GLY B . n 
D 3 269 GLY 269 263 263 GLY GLY B . n 
D 3 270 ILE 270 264 264 ILE ILE B . n 
D 3 271 PHE 271 265 265 PHE PHE B . n 
D 3 272 GLY 272 266 266 GLY GLY B . n 
D 3 273 ALA 273 267 267 ALA ALA B . n 
D 3 274 THR 274 268 268 THR THR B . n 
D 3 275 HIS 275 269 269 HIS HIS B . n 
D 3 276 ARG 276 270 270 ARG ARG B . n 
D 3 277 LEU 277 271 271 LEU LEU B . n 
D 3 278 ILE 278 272 272 ILE ILE B . n 
D 3 279 TYR 279 273 273 TYR TYR B . n 
D 3 280 GLY 280 274 274 GLY GLY B . n 
D 3 281 ALA 281 275 275 ALA ALA B . n 
D 3 282 LYS 282 276 276 LYS LYS B . n 
D 3 283 ASP 283 277 277 ASP ASP B . n 
D 3 284 ASP 284 278 278 ASP ASP B . n 
D 3 285 SER 285 279 279 SER SER B . n 
D 3 286 GLY 286 280 280 GLY GLY B . n 
D 3 287 GLN 287 281 281 GLN GLN B . n 
D 3 288 ARG 288 282 282 ARG ARG B . n 
D 3 289 TYR 289 283 283 TYR TYR B . n 
D 3 290 LEU 290 284 284 LEU LEU B . n 
D 3 291 ALA 291 285 285 ALA ALA B . n 
D 3 292 TRP 292 286 286 TRP TRP B . n 
D 3 293 SER 293 287 287 SER SER B . n 
D 3 294 GLY 294 288 288 GLY GLY B . n 
D 3 295 HIS 295 289 289 HIS HIS B . n 
D 3 296 SER 296 290 290 SER SER B . n 
D 3 297 ALA 297 291 291 ALA ALA B . n 
D 3 298 ARG 298 292 292 ARG ARG B . n 
D 3 299 VAL 299 293 293 VAL VAL B . n 
D 3 300 GLY 300 294 294 GLY GLY B . n 
D 3 301 ALA 301 295 295 ALA ALA B . n 
D 3 302 ALA 302 296 296 ALA ALA B . n 
D 3 303 ARG 303 297 297 ARG ARG B . n 
D 3 304 ASP 304 298 298 ASP ASP B . n 
D 3 305 MET 305 299 299 MET MET B . n 
D 3 306 ALA 306 300 300 ALA ALA B . n 
D 3 307 ARG 307 301 301 ARG ARG B . n 
D 3 308 ALA 308 302 302 ALA ALA B . n 
D 3 309 GLY 309 303 303 GLY GLY B . n 
D 3 310 VAL 310 304 304 VAL VAL B . n 
D 3 311 SER 311 305 305 SER SER B . n 
D 3 312 ILE 312 306 306 ILE ILE B . n 
D 3 313 PRO 313 307 307 PRO PRO B . n 
D 3 314 GLU 314 308 308 GLU GLU B . n 
D 3 315 ILE 315 309 309 ILE ILE B . n 
D 3 316 MET 316 310 310 MET MET B . n 
D 3 317 GLN 317 311 311 GLN GLN B . n 
D 3 318 ALA 318 312 312 ALA ALA B . n 
D 3 319 GLY 319 313 313 GLY GLY B . n 
D 3 320 GLY 320 314 314 GLY GLY B . n 
D 3 321 TRP 321 315 315 TRP TRP B . n 
D 3 322 THR 322 316 316 THR THR B . n 
D 3 323 ASN 323 317 317 ASN ASN B . n 
D 3 324 VAL 324 318 318 VAL VAL B . n 
D 3 325 ASN 325 319 319 ASN ASN B . n 
D 3 326 ILE 326 320 320 ILE ILE B . n 
D 3 327 VAL 327 321 321 VAL VAL B . n 
D 3 328 MET 328 322 322 MET MET B . n 
D 3 329 ASN 329 323 323 ASN ASN B . n 
D 3 330 TYR 330 324 324 TYR TYR B . n 
D 3 331 ILE 331 325 325 ILE ILE B . n 
D 3 332 ARG 332 326 326 ARG ARG B . n 
D 3 333 ASN 333 327 327 ASN ASN B . n 
D 3 334 LEU 334 328 328 LEU LEU B . n 
D 3 335 ASP 335 329 ?   ?   ?   B . n 
D 3 336 SER 336 330 ?   ?   ?   B . n 
D 3 337 GLU 337 331 ?   ?   ?   B . n 
D 3 338 THR 338 332 332 THR THR B . n 
D 3 339 GLY 339 333 333 GLY GLY B . n 
D 3 340 ALA 340 334 334 ALA ALA B . n 
D 3 341 MET 341 335 335 MET MET B . n 
D 3 342 VAL 342 336 336 VAL VAL B . n 
D 3 343 ARG 343 337 337 ARG ARG B . n 
D 3 344 LEU 344 338 338 LEU LEU B . n 
D 3 345 LEU 345 339 339 LEU LEU B . n 
D 3 346 GLU 346 340 340 GLU GLU B . n 
D 3 347 ASP 347 341 341 ASP ASP B . n 
D 3 348 GLY 348 342 ?   ?   ?   B . n 
D 3 349 ASP 349 343 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   octameric 
_pdbx_struct_assembly.oligomeric_count     8 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_566 x,-y+1,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 121.5700000000 0.0000000000 0.0000000000 -1.0000000000 179.9500000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-02-17 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
TNT       refinement       . ? 3 
TNT       phasing          . ? 4 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 "C5'" D DT 12 ? ? "C4'" D DT 12 ? ? 1.575 1.512 0.063  0.007 N 
2 1 "O3'" D DC 15 ? ? P     D DA 16 ? B 1.781 1.607 0.174  0.012 Y 
3 1 "O3'" D DC 19 ? B P     D DA 20 ? ? 0.810 1.607 -0.797 0.012 Y 
4 1 "O3'" D DA 20 ? ? "C3'" D DA 20 ? ? 1.362 1.419 -0.057 0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" C DT  2   ? ? "C1'" C DT  2   ? ? N1    C DT  2   ? ? 112.84 108.30 4.54   0.30 N 
2  1 "C3'" C DA  3   ? ? "O3'" C DA  3   ? ? P     C DA  4   ? ? 127.67 119.70 7.97   1.20 Y 
3  1 "O4'" C DA  4   ? ? "C1'" C DA  4   ? ? N9    C DA  4   ? ? 112.22 108.30 3.92   0.30 N 
4  1 "O5'" C DC  5   ? ? P     C DC  5   ? ? OP1   C DC  5   ? ? 100.20 105.70 -5.50  0.90 N 
5  1 "C3'" C DT  7   ? ? "O3'" C DT  7   ? ? P     C DC  8   ? ? 127.84 119.70 8.14   1.20 Y 
6  1 "O4'" C DC  8   ? ? "C1'" C DC  8   ? ? N1    C DC  8   ? ? 112.82 108.30 4.52   0.30 N 
7  1 "O4'" C DA  11  ? ? "C1'" C DA  11  ? ? N9    C DA  11  ? ? 110.38 108.30 2.08   0.30 N 
8  1 "C3'" C DT  12  ? ? "O3'" C DT  12  ? ? P     C DA  13  ? ? 129.68 119.70 9.98   1.20 Y 
9  1 "C3'" C DA  14  ? ? "C2'" C DA  14  ? ? "C1'" C DA  14  ? ? 96.52  102.40 -5.88  0.80 N 
10 1 "C3'" C DT  15  ? ? "O3'" C DT  15  ? ? P     C DG  16  ? B 108.33 119.70 -11.37 1.20 Y 
11 1 "O3'" C DT  15  ? ? P     C DG  16  ? B OP2   C DG  16  ? B 128.60 110.50 18.10  1.10 Y 
12 1 "O3'" C DT  15  ? ? P     C DG  16  ? B OP1   C DG  16  ? B 77.91  105.20 -27.29 2.20 Y 
13 1 "C3'" C DG  20  ? ? "C2'" C DG  20  ? ? "C1'" C DG  20  ? ? 94.10  102.40 -8.30  0.80 N 
14 1 "C3'" C DT  22  ? ? "C2'" C DT  22  ? ? "C1'" C DT  22  ? ? 96.62  102.40 -5.78  0.80 N 
15 1 P     C DC  26  ? ? "O5'" C DC  26  ? ? "C5'" C DC  26  ? ? 110.39 120.90 -10.51 1.60 N 
16 1 C6    C DC  26  ? ? N1    C DC  26  ? ? C2    C DC  26  ? ? 122.74 120.30 2.44   0.40 N 
17 1 "C3'" C DC  26  ? ? "O3'" C DC  26  ? ? P     C DG  27  ? ? 112.36 119.70 -7.34  1.20 Y 
18 1 "C3'" C DG  30  ? ? "C2'" C DG  30  ? ? "C1'" C DG  30  ? ? 97.24  102.40 -5.16  0.80 N 
19 1 "O4'" C DT  34  ? ? "C1'" C DT  34  ? ? N1    C DT  34  ? ? 111.16 108.30 2.86   0.30 N 
20 1 "O4'" D DT  2   ? ? "C1'" D DT  2   ? ? N1    D DT  2   ? ? 110.48 108.30 2.18   0.30 N 
21 1 "C3'" D DA  3   ? ? "O3'" D DA  3   ? ? P     D DA  4   ? ? 127.00 119.70 7.30   1.20 Y 
22 1 "O4'" D DA  4   ? ? "C1'" D DA  4   ? ? N9    D DA  4   ? ? 112.12 108.30 3.82   0.30 N 
23 1 N1    D DC  5   ? ? C2    D DC  5   ? ? O2    D DC  5   ? ? 114.95 118.90 -3.95  0.60 N 
24 1 "O4'" D DT  7   ? ? "C1'" D DT  7   ? ? "C2'" D DT  7   ? ? 101.00 105.90 -4.90  0.80 N 
25 1 "C3'" D DT  10  ? ? "C2'" D DT  10  ? ? "C1'" D DT  10  ? ? 96.75  102.40 -5.65  0.80 N 
26 1 P     D DT  12  ? ? "O5'" D DT  12  ? ? "C5'" D DT  12  ? ? 99.92  120.90 -20.98 1.60 N 
27 1 "O4'" D DT  12  ? ? "C4'" D DT  12  ? ? "C3'" D DT  12  ? ? 110.75 106.00 4.75   0.60 N 
28 1 "C5'" D DT  12  ? ? "C4'" D DT  12  ? ? "C3'" D DT  12  ? ? 123.84 115.70 8.14   1.20 N 
29 1 "O3'" D DC  15  ? ? P     D DA  16  ? B "O5'" D DA  16  ? B 126.20 104.00 22.20  1.90 Y 
30 1 "O3'" D DC  15  ? ? P     D DA  16  ? B OP2   D DA  16  ? B 91.44  105.20 -13.76 2.20 Y 
31 1 "C4'" D DA  16  ? B "C3'" D DA  16  ? B "C2'" D DA  16  ? B 96.77  102.20 -5.43  0.70 N 
32 1 "O4'" D DA  16  ? B "C1'" D DA  16  ? B "C2'" D DA  16  ? B 100.68 105.90 -5.22  0.80 N 
33 1 "C4'" D DT  17  ? B "C3'" D DT  17  ? B "C2'" D DT  17  ? B 96.79  102.20 -5.41  0.70 N 
34 1 "C3'" D DT  17  ? B "O3'" D DT  17  ? B P     D DA  18  ? B 111.35 119.70 -8.35  1.20 Y 
35 1 "O4'" D DA  18  ? A "C4'" D DA  18  ? A "C3'" D DA  18  ? A 102.09 104.50 -2.41  0.40 N 
36 1 "O4'" D DA  18  ? A "C1'" D DA  18  ? A N9    D DA  18  ? A 111.70 108.30 3.40   0.30 N 
37 1 "O4'" D DC  19  ? B "C1'" D DC  19  ? B N1    D DC  19  ? B 110.15 108.30 1.85   0.30 N 
38 1 "C3'" D DC  19  ? B "O3'" D DC  19  ? B P     D DA  20  ? ? 146.33 119.70 26.63  1.20 Y 
39 1 "O3'" D DC  19  ? B P     D DA  20  ? ? "O5'" D DA  20  ? ? 88.93  104.00 -15.07 1.90 Y 
40 1 "O3'" D DC  19  ? B P     D DA  20  ? ? OP1   D DA  20  ? ? 130.38 110.50 19.88  1.10 Y 
41 1 "O4'" D DT  24  ? ? "C1'" D DT  24  ? ? "C2'" D DT  24  ? ? 99.37  105.90 -6.53  0.80 N 
42 1 C2    D DT  24  ? ? N3    D DT  24  ? ? C4    D DT  24  ? ? 123.19 127.20 -4.01  0.60 N 
43 1 N3    D DT  24  ? ? C4    D DT  24  ? ? O4    D DT  24  ? ? 116.04 119.90 -3.86  0.60 N 
44 1 "O4'" D DA  25  ? ? "C1'" D DA  25  ? ? N9    D DA  25  ? ? 101.42 108.00 -6.58  0.70 N 
45 1 P     D DC  26  ? ? "O5'" D DC  26  ? ? "C5'" D DC  26  ? ? 108.38 120.90 -12.52 1.60 N 
46 1 "O4'" D DC  26  ? ? "C1'" D DC  26  ? ? N1    D DC  26  ? ? 110.13 108.30 1.83   0.30 N 
47 1 "O4'" D DG  27  ? ? "C1'" D DG  27  ? ? N9    D DG  27  ? ? 110.25 108.30 1.95   0.30 N 
48 1 P     D DG  30  ? ? "O5'" D DG  30  ? ? "C5'" D DG  30  ? ? 109.55 120.90 -11.35 1.60 N 
49 1 "C3'" D DT  32  ? ? "C2'" D DT  32  ? ? "C1'" D DT  32  ? ? 95.38  102.40 -7.02  0.80 N 
50 1 "O4'" D DT  32  ? ? "C1'" D DT  32  ? ? N1    D DT  32  ? ? 112.88 108.30 4.58   0.30 N 
51 1 N     A PRO 234 ? ? CA    A PRO 234 ? ? C     A PRO 234 ? ? 128.57 112.10 16.47  2.60 N 
52 1 C     A ALA 249 ? ? N     A PRO 250 ? ? CD    A PRO 250 ? ? 115.60 128.40 -12.80 2.10 Y 
53 1 NE    A ARG 282 ? ? CZ    A ARG 282 ? ? NH2   A ARG 282 ? ? 123.89 120.30 3.59   0.50 N 
54 1 N     B MET 335 ? ? CA    B MET 335 ? ? C     B MET 335 ? ? 127.26 111.00 16.26  2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 68  ? ? -34.83  -38.20  
2  1 ASP A 126 ? ? -72.74  31.93   
3  1 ALA A 127 ? ? -152.17 0.02    
4  1 CYS A 155 ? ? -39.83  -80.25  
5  1 GLN A 156 ? ? -48.57  -10.03  
6  1 ALA A 175 ? ? -37.86  -23.10  
7  1 ARG A 187 ? ? -112.10 -165.17 
8  1 THR A 188 ? ? -179.25 -149.68 
9  1 ASP A 189 ? ? -38.87  72.62   
10 1 ILE A 197 ? ? -102.31 -166.59 
11 1 ARG A 199 ? ? -12.65  -69.11  
12 1 SER A 205 ? ? -140.99 -108.50 
13 1 VAL A 217 ? ? -42.60  -18.43  
14 1 GLU A 222 ? ? -62.41  -79.75  
15 1 ALA A 231 ? ? -64.02  32.58   
16 1 ASP A 232 ? ? -96.95  -68.56  
17 1 PRO A 234 ? ? -25.75  -1.10   
18 1 SER A 251 ? ? -175.47 98.81   
19 1 ALA A 275 ? ? -9.46   152.54  
20 1 ASP A 277 ? ? -103.12 -137.09 
21 1 ASP A 278 ? ? -34.46  112.68  
22 1 SER A 279 ? ? 85.59   -37.42  
23 1 GLN A 281 ? ? 175.48  150.07  
24 1 ARG A 282 ? ? 84.92   90.78   
25 1 SER A 305 ? ? -39.35  146.41  
26 1 PRO A 307 ? ? -56.83  -92.52  
27 1 MET A 310 ? ? -80.69  33.96   
28 1 GLN A 311 ? ? -142.29 -40.17  
29 1 ASN A 317 ? ? -160.62 104.48  
30 1 ASN A 319 ? ? -35.95  -39.78  
31 1 SER B 20  ? ? -34.87  -39.02  
32 1 ASP B 33  ? ? -105.59 48.11   
33 1 ASP B 126 ? ? -76.72  28.79   
34 1 ALA B 127 ? ? -143.02 12.71   
35 1 GLU B 129 ? ? 16.16   117.15  
36 1 ASP B 232 ? ? -65.26  2.52    
37 1 ASP B 233 ? ? -171.61 95.37   
38 1 ALA B 249 ? ? -108.06 79.31   
39 1 ASP B 277 ? ? -28.54  162.97  
40 1 ARG B 326 ? ? -20.15  60.34   
41 1 ASN B 327 ? ? -133.59 -36.12  
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    VAL 
_pdbx_validate_chiral.auth_seq_id     318 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_validate_polymer_linkage.id 
_pdbx_validate_polymer_linkage.PDB_model_num 
_pdbx_validate_polymer_linkage.auth_atom_id_1 
_pdbx_validate_polymer_linkage.auth_asym_id_1 
_pdbx_validate_polymer_linkage.auth_comp_id_1 
_pdbx_validate_polymer_linkage.auth_seq_id_1 
_pdbx_validate_polymer_linkage.PDB_ins_code_1 
_pdbx_validate_polymer_linkage.label_alt_id_1 
_pdbx_validate_polymer_linkage.auth_atom_id_2 
_pdbx_validate_polymer_linkage.auth_asym_id_2 
_pdbx_validate_polymer_linkage.auth_comp_id_2 
_pdbx_validate_polymer_linkage.auth_seq_id_2 
_pdbx_validate_polymer_linkage.PDB_ins_code_2 
_pdbx_validate_polymer_linkage.label_alt_id_2 
_pdbx_validate_polymer_linkage.dist 
1 1 "O3'" D DC 15 ? ? P D DA 16 ? B 1.78 
2 1 "O3'" D DC 19 ? B P D DA 20 ? ? 0.81 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 C DA  18  ? P     ? A DA  18  P     
2  1 Y 1 C DA  18  ? OP1   ? A DA  18  OP1   
3  1 Y 1 C DA  18  ? OP2   ? A DA  18  OP2   
4  1 Y 1 C DA  18  ? "O5'" ? A DA  18  "O5'" 
5  1 Y 1 C DA  18  ? "C5'" ? A DA  18  "C5'" 
6  1 Y 1 C DA  18  ? "C4'" ? A DA  18  "C4'" 
7  1 Y 1 C DA  18  ? "O4'" ? A DA  18  "O4'" 
8  1 Y 1 C DA  18  ? "C3'" ? A DA  18  "C3'" 
9  1 Y 1 C DA  18  ? "C2'" ? A DA  18  "C2'" 
10 1 Y 1 C DA  18  ? "C1'" ? A DA  18  "C1'" 
11 1 Y 1 C DA  18  ? N9    ? A DA  18  N9    
12 1 Y 1 C DA  18  ? C8    ? A DA  18  C8    
13 1 Y 1 C DA  18  ? N7    ? A DA  18  N7    
14 1 Y 1 C DA  18  ? C5    ? A DA  18  C5    
15 1 Y 1 C DA  18  ? C6    ? A DA  18  C6    
16 1 Y 1 C DA  18  ? N6    ? A DA  18  N6    
17 1 Y 1 C DA  18  ? N1    ? A DA  18  N1    
18 1 Y 1 C DA  18  ? C2    ? A DA  18  C2    
19 1 Y 1 C DA  18  ? N3    ? A DA  18  N3    
20 1 Y 1 C DA  18  ? C4    ? A DA  18  C4    
21 1 Y 0 A ILE 185 ? CD1   ? C ILE 191 CD1   
22 1 Y 0 A ASP 189 ? CB    ? C ASP 195 CB    
23 1 Y 0 A ASP 189 ? CG    ? C ASP 195 CG    
24 1 Y 0 A ASP 189 ? OD1   ? C ASP 195 OD1   
25 1 Y 0 A ASP 189 ? OD2   ? C ASP 195 OD2   
26 1 Y 0 A GLY 198 ? C     ? C GLY 204 C     
27 1 Y 0 A GLY 198 ? O     ? C GLY 204 O     
28 1 Y 0 A ARG 199 ? N     ? C ARG 205 N     
29 1 Y 0 A SER 205 ? CB    ? C SER 211 CB    
30 1 Y 0 A SER 205 ? OG    ? C SER 211 OG    
31 1 Y 0 A GLY 208 ? N     ? C GLY 214 N     
32 1 Y 0 A LEU 215 ? CB    ? C LEU 221 CB    
33 1 Y 0 A LEU 215 ? CG    ? C LEU 221 CG    
34 1 Y 0 A LEU 215 ? CD1   ? C LEU 221 CD1   
35 1 Y 0 A LEU 215 ? CD2   ? C LEU 221 CD2   
36 1 Y 0 A ILE 225 ? CA    ? C ILE 231 CA    
37 1 Y 0 A ILE 225 ? CB    ? C ILE 231 CB    
38 1 Y 0 A ILE 225 ? CG1   ? C ILE 231 CG1   
39 1 Y 0 A ILE 225 ? CG2   ? C ILE 231 CG2   
40 1 Y 0 A ILE 225 ? CD1   ? C ILE 231 CD1   
41 1 Y 0 A VAL 230 ? CB    ? C VAL 236 CB    
42 1 Y 0 A VAL 230 ? CG1   ? C VAL 236 CG1   
43 1 Y 0 A VAL 230 ? CG2   ? C VAL 236 CG2   
44 1 Y 0 A ALA 231 ? O     ? C ALA 237 O     
45 1 Y 0 A ALA 231 ? CB    ? C ALA 237 CB    
46 1 Y 0 A ASP 233 ? C     ? C ASP 239 C     
47 1 Y 0 A ASP 233 ? O     ? C ASP 239 O     
48 1 Y 0 A ASN 236 ? CA    ? C ASN 242 CA    
49 1 Y 0 A ASN 236 ? O     ? C ASN 242 O     
50 1 Y 0 A ASP 278 ? C     ? C ASP 284 C     
51 1 Y 0 A ASP 278 ? O     ? C ASP 284 O     
52 1 Y 0 A ASP 278 ? CB    ? C ASP 284 CB    
53 1 Y 0 A ASP 278 ? CG    ? C ASP 284 CG    
54 1 Y 0 A ASP 278 ? OD1   ? C ASP 284 OD1   
55 1 Y 0 A ASP 278 ? OD2   ? C ASP 284 OD2   
56 1 Y 0 A SER 279 ? N     ? C SER 285 N     
57 1 Y 0 A SER 279 ? CA    ? C SER 285 CA    
58 1 Y 0 A SER 279 ? CB    ? C SER 285 CB    
59 1 Y 0 A SER 279 ? OG    ? C SER 285 OG    
60 1 Y 0 A PRO 307 ? CB    ? C PRO 313 CB    
61 1 Y 0 A PRO 307 ? CG    ? C PRO 313 CG    
62 1 Y 0 A PRO 307 ? CD    ? C PRO 313 CD    
63 1 Y 0 A MET 310 ? CE    ? C MET 316 CE    
64 1 Y 0 A GLN 311 ? CB    ? C GLN 317 CB    
65 1 Y 0 A GLN 311 ? CG    ? C GLN 317 CG    
66 1 Y 0 A GLN 311 ? CD    ? C GLN 317 CD    
67 1 Y 0 A GLN 311 ? OE1   ? C GLN 317 OE1   
68 1 Y 0 A GLN 311 ? NE2   ? C GLN 317 NE2   
69 1 Y 0 A ASN 319 ? CB    ? C ASN 325 CB    
70 1 Y 0 A ASN 319 ? CG    ? C ASN 325 CG    
71 1 Y 0 A ASN 319 ? OD1   ? C ASN 325 OD1   
72 1 Y 0 A ASN 319 ? ND2   ? C ASN 325 ND2   
73 1 Y 0 B MET 28  ? CG    ? D MET 34  CG    
74 1 Y 0 B MET 28  ? SD    ? D MET 34  SD    
75 1 Y 0 B MET 28  ? CE    ? D MET 34  CE    
76 1 Y 0 B LEU 328 ? O     ? D LEU 334 O     
77 1 Y 0 B LEU 328 ? CB    ? D LEU 334 CB    
78 1 Y 0 B VAL 336 ? CG2   ? D VAL 342 CG2   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 C DT  17  ? A DT  17  
2  1 Y 1 A MET -5  ? C MET 1   
3  1 Y 1 A HIS -4  ? C HIS 2   
4  1 Y 1 A HIS -3  ? C HIS 3   
5  1 Y 1 A HIS -2  ? C HIS 4   
6  1 Y 1 A HIS -1  ? C HIS 5   
7  1 Y 1 A HIS 0   ? C HIS 6   
8  1 Y 1 A HIS 1   ? C HIS 7   
9  1 Y 1 A SER 2   ? C SER 8   
10 1 Y 1 A ASN 3   ? C ASN 9   
11 1 Y 1 A LEU 4   ? C LEU 10  
12 1 Y 1 A LEU 5   ? C LEU 11  
13 1 Y 1 A THR 6   ? C THR 12  
14 1 Y 1 A VAL 7   ? C VAL 13  
15 1 Y 1 A HIS 8   ? C HIS 14  
16 1 Y 1 A GLN 9   ? C GLN 15  
17 1 Y 1 A ASN 10  ? C ASN 16  
18 1 Y 1 A LEU 11  ? C LEU 17  
19 1 Y 1 A PRO 12  ? C PRO 18  
20 1 Y 1 A ALA 13  ? C ALA 19  
21 1 Y 1 A LEU 14  ? C LEU 20  
22 1 Y 1 A PRO 15  ? C PRO 21  
23 1 Y 1 A VAL 16  ? C VAL 22  
24 1 Y 1 A ASP 17  ? C ASP 23  
25 1 Y 1 A GLY 342 ? C GLY 348 
26 1 Y 1 A ASP 343 ? C ASP 349 
27 1 Y 1 B MET -5  ? D MET 1   
28 1 Y 1 B HIS -4  ? D HIS 2   
29 1 Y 1 B HIS -3  ? D HIS 3   
30 1 Y 1 B HIS -2  ? D HIS 4   
31 1 Y 1 B HIS -1  ? D HIS 5   
32 1 Y 1 B HIS 0   ? D HIS 6   
33 1 Y 1 B HIS 1   ? D HIS 7   
34 1 Y 1 B SER 2   ? D SER 8   
35 1 Y 1 B ASN 3   ? D ASN 9   
36 1 Y 1 B LEU 4   ? D LEU 10  
37 1 Y 1 B LEU 5   ? D LEU 11  
38 1 Y 1 B THR 6   ? D THR 12  
39 1 Y 1 B VAL 7   ? D VAL 13  
40 1 Y 1 B HIS 8   ? D HIS 14  
41 1 Y 1 B GLN 9   ? D GLN 15  
42 1 Y 1 B ASN 10  ? D ASN 16  
43 1 Y 1 B LEU 11  ? D LEU 17  
44 1 Y 1 B PRO 12  ? D PRO 18  
45 1 Y 1 B ALA 13  ? D ALA 19  
46 1 Y 1 B LEU 14  ? D LEU 20  
47 1 Y 1 B PRO 15  ? D PRO 21  
48 1 Y 1 B VAL 16  ? D VAL 22  
49 1 Y 1 B ASP 17  ? D ASP 23  
50 1 Y 1 B ALA 18  ? D ALA 24  
51 1 Y 1 B ASP 329 ? D ASP 335 
52 1 Y 1 B SER 330 ? D SER 336 
53 1 Y 1 B GLU 331 ? D GLU 337 
54 1 Y 1 B GLY 342 ? D GLY 348 
55 1 Y 1 B ASP 343 ? D ASP 349 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1PVR 'double helix'        
1PVR 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 1  1_555 B DT 34 1_555 0.629  -0.168 0.115  -0.302  -17.396 15.419 1  C_DA1:DT34_D  C 1  ? D 34 ? 20 1 
1 A DT 2  1_555 B DA 33 1_555 -0.062 -0.353 0.316  -6.335  -3.963  -1.984 2  C_DT2:DA33_D  C 2  ? D 33 ? 20 1 
1 A DA 3  1_555 B DT 32 1_555 0.738  -0.213 -0.083 6.173   -9.707  -1.863 3  C_DA3:DT32_D  C 3  ? D 32 ? 20 1 
1 A DA 4  1_555 B DT 31 1_555 0.103  0.115  0.432  15.109  -8.241  4.528  4  C_DA4:DT31_D  C 4  ? D 31 ? 20 1 
1 A DC 5  1_555 B DG 30 1_555 0.369  -0.338 -0.058 8.530   -23.876 0.188  5  C_DC5:DG30_D  C 5  ? D 30 ? 19 1 
1 A DT 6  1_555 B DA 29 1_555 0.266  -0.439 -0.398 -1.454  -14.366 3.839  6  C_DT6:DA29_D  C 6  ? D 29 ? 20 1 
1 A DT 7  1_555 B DA 28 1_555 0.519  -0.354 0.142  -4.574  -14.504 4.419  7  C_DT7:DA28_D  C 7  ? D 28 ? 20 1 
1 A DC 8  1_555 B DG 27 1_555 -0.808 -0.309 0.037  -9.398  -10.470 -1.554 8  C_DC8:DG27_D  C 8  ? D 27 ? 19 1 
1 A DG 9  1_555 B DC 26 1_555 0.055  -0.116 -0.313 -7.217  -1.402  -5.049 9  C_DG9:DC26_D  C 9  ? D 26 ? 19 1 
1 A DT 10 1_555 B DA 25 1_555 -0.052 0.044  0.164  9.115   -0.997  5.386  10 C_DT10:DA25_D C 10 ? D 25 ? 20 1 
1 A DA 11 1_555 B DT 24 1_555 -0.413 -0.343 0.148  3.325   -7.762  2.300  11 C_DA11:DT24_D C 11 ? D 24 ? 20 1 
1 A DT 12 1_555 B DA 23 1_555 0.402  -0.489 0.501  -4.104  -2.185  -3.468 12 C_DT12:DA23_D C 12 ? D 23 ? 20 1 
1 A DA 13 1_555 B DT 22 1_555 -0.088 -0.133 -0.490 -14.089 -3.198  -0.783 13 C_DA13:DT22_D C 13 ? D 22 ? 20 1 
1 A DA 14 1_555 B DT 21 1_555 -0.348 -0.037 -0.332 -5.208  -15.024 3.268  14 C_DA14:DT21_D C 14 ? D 21 ? 20 1 
1 A DT 15 1_555 B DA 20 1_555 0.217  0.347  0.008  1.120   -10.437 11.708 15 C_DT15:DA20_D C 15 ? D 20 ? ?  ? 
1 A DG 16 1_555 B DC 19 1_555 0.178  -0.265 0.221  20.668  -9.143  2.465  16 C_DG16:DC19_D C 16 ? D 19 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 1  1_555 B DT 34 1_555 A DT 2  1_555 B DA 33 1_555 -1.056 -0.612 3.630 -2.003 -1.421 21.596 -0.990 1.908  3.743 -3.777  
5.324  21.734 1  CC_DA1DT2:DA33DT34_DD   C 1  ? D 34 ? C 2  ? D 33 ? 
1 A DT 2  1_555 B DA 33 1_555 A DA 3  1_555 B DT 32 1_555 -0.349 1.657  2.993 3.009  0.038  47.504 2.051  0.653  2.968 0.047   
-3.730 47.594 2  CC_DT2DA3:DT32DA33_DD   C 2  ? D 33 ? C 3  ? D 32 ? 
1 A DA 3  1_555 B DT 32 1_555 A DA 4  1_555 B DT 31 1_555 0.919  -0.053 3.192 -3.803 2.185  23.075 -0.833 -3.481 2.986 5.399   
9.398  23.483 3  CC_DA3DA4:DT31DT32_DD   C 3  ? D 32 ? C 4  ? D 31 ? 
1 A DA 4  1_555 B DT 31 1_555 A DC 5  1_555 B DG 30 1_555 0.471  -1.041 3.448 4.057  -1.690 32.728 -1.525 -0.092 3.527 -2.982  
-7.160 33.014 4  CC_DA4DC5:DG30DT31_DD   C 4  ? D 31 ? C 5  ? D 30 ? 
1 A DC 5  1_555 B DG 30 1_555 A DT 6  1_555 B DA 29 1_555 -0.178 -0.382 3.435 4.167  7.870  39.361 -1.476 0.746  3.267 11.506  
-6.092 40.317 5  CC_DC5DT6:DA29DG30_DD   C 5  ? D 30 ? C 6  ? D 29 ? 
1 A DT 6  1_555 B DA 29 1_555 A DT 7  1_555 B DA 28 1_555 0.187  -0.024 3.314 -0.986 4.631  34.202 -0.767 -0.470 3.276 7.828   
1.667  34.519 6  CC_DT6DT7:DA28DA29_DD   C 6  ? D 29 ? C 7  ? D 28 ? 
1 A DT 7  1_555 B DA 28 1_555 A DC 8  1_555 B DG 27 1_555 0.656  0.066  3.336 2.762  6.003  28.226 -1.237 -0.682 3.326 12.100  
-5.568 28.974 7  CC_DT7DC8:DG27DA28_DD   C 7  ? D 28 ? C 8  ? D 27 ? 
1 A DC 8  1_555 B DG 27 1_555 A DG 9  1_555 B DC 26 1_555 -0.454 0.732  3.261 0.244  6.265  37.668 0.317  0.726  3.333 9.622   
-0.374 38.168 8  CC_DC8DG9:DC26DG27_DD   C 8  ? D 27 ? C 9  ? D 26 ? 
1 A DG 9  1_555 B DC 26 1_555 A DT 10 1_555 B DA 25 1_555 0.229  -0.058 3.067 -2.396 0.459  25.169 -0.257 -1.175 3.031 1.049   
5.482  25.285 9  CC_DG9DT10:DA25DC26_DD  C 9  ? D 26 ? C 10 ? D 25 ? 
1 A DT 10 1_555 B DA 25 1_555 A DA 11 1_555 B DT 24 1_555 0.596  -0.939 3.279 3.467  3.719  35.959 -2.025 -0.474 3.210 5.987   
-5.581 36.304 10 CC_DT10DA11:DT24DA25_DD C 10 ? D 25 ? C 11 ? D 24 ? 
1 A DA 11 1_555 B DT 24 1_555 A DT 12 1_555 B DA 23 1_555 0.586  -1.145 3.616 -0.894 3.298  34.788 -2.448 -1.122 3.481 5.500   
1.491  34.951 11 CC_DA11DT12:DA23DT24_DD C 11 ? D 24 ? C 12 ? D 23 ? 
1 A DT 12 1_555 B DA 23 1_555 A DA 13 1_555 B DT 22 1_555 -0.658 -0.934 3.506 5.152  -8.269 36.697 -0.283 1.731  3.507 -12.858 
-8.011 37.926 12 CC_DT12DA13:DT22DA23_DD C 12 ? D 23 ? C 13 ? D 22 ? 
1 A DA 13 1_555 B DT 22 1_555 A DA 14 1_555 B DT 21 1_555 0.099  -0.437 3.258 1.510  0.698  33.766 -0.863 0.072  3.250 1.200   
-2.597 33.806 13 CC_DA13DA14:DT21DT22_DD C 13 ? D 22 ? C 14 ? D 21 ? 
1 A DA 14 1_555 B DT 21 1_555 A DT 15 1_555 B DA 20 1_555 -0.589 -0.369 3.077 -4.886 4.344  28.977 -1.586 0.176  3.047 8.545   
9.612  29.690 14 CC_DA14DT15:DA20DT21_DD C 14 ? D 21 ? C 15 ? D 20 ? 
1 A DT 15 1_555 B DA 20 1_555 A DG 16 1_555 B DC 19 1_555 -0.881 0.931  3.065 -1.198 1.450  30.453 1.496  1.448  3.137 2.756   
2.278  30.509 15 CC_DT15DG16:DC19DA20_DD C 15 ? D 20 ? C 16 ? D 19 ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 HOH 1  35  22  HOH HOH C . 
E 4 HOH 2  36  57  HOH HOH C . 
E 4 HOH 3  37  105 HOH HOH C . 
E 4 HOH 4  38  117 HOH HOH C . 
E 4 HOH 5  39  145 HOH HOH C . 
E 4 HOH 6  40  161 HOH HOH C . 
E 4 HOH 7  41  173 HOH HOH C . 
E 4 HOH 8  42  186 HOH HOH C . 
E 4 HOH 9  43  323 HOH HOH C . 
E 4 HOH 10 44  344 HOH HOH C . 
E 4 HOH 11 45  345 HOH HOH C . 
F 4 HOH 1  42  42  HOH HOH D . 
F 4 HOH 2  56  56  HOH HOH D . 
F 4 HOH 3  85  85  HOH HOH D . 
F 4 HOH 4  126 126 HOH HOH D . 
F 4 HOH 5  131 131 HOH HOH D . 
F 4 HOH 6  167 167 HOH HOH D . 
F 4 HOH 7  209 209 HOH HOH D . 
F 4 HOH 8  301 301 HOH HOH D . 
F 4 HOH 9  302 302 HOH HOH D . 
F 4 HOH 10 303 303 HOH HOH D . 
F 4 HOH 11 304 304 HOH HOH D . 
F 4 HOH 12 305 305 HOH HOH D . 
F 4 HOH 13 306 306 HOH HOH D . 
F 4 HOH 14 307 307 HOH HOH D . 
F 4 HOH 15 308 308 HOH HOH D . 
F 4 HOH 16 346 346 HOH HOH D . 
F 4 HOH 17 347 347 HOH HOH D . 
G 4 HOH 1  344 26  HOH HOH A . 
G 4 HOH 2  345 128 HOH HOH A . 
G 4 HOH 3  346 170 HOH HOH A . 
G 4 HOH 4  347 195 HOH HOH A . 
G 4 HOH 5  348 210 HOH HOH A . 
G 4 HOH 6  349 215 HOH HOH A . 
G 4 HOH 7  350 218 HOH HOH A . 
G 4 HOH 8  351 309 HOH HOH A . 
G 4 HOH 9  352 310 HOH HOH A . 
G 4 HOH 10 353 311 HOH HOH A . 
G 4 HOH 11 354 312 HOH HOH A . 
G 4 HOH 12 355 313 HOH HOH A . 
G 4 HOH 13 356 314 HOH HOH A . 
G 4 HOH 14 357 315 HOH HOH A . 
G 4 HOH 15 358 316 HOH HOH A . 
G 4 HOH 16 359 317 HOH HOH A . 
G 4 HOH 17 360 318 HOH HOH A . 
G 4 HOH 18 361 319 HOH HOH A . 
G 4 HOH 19 362 320 HOH HOH A . 
G 4 HOH 20 363 330 HOH HOH A . 
G 4 HOH 21 364 331 HOH HOH A . 
G 4 HOH 22 365 332 HOH HOH A . 
G 4 HOH 23 366 333 HOH HOH A . 
G 4 HOH 24 367 335 HOH HOH A . 
G 4 HOH 25 368 336 HOH HOH A . 
G 4 HOH 26 369 337 HOH HOH A . 
G 4 HOH 27 370 338 HOH HOH A . 
G 4 HOH 28 371 349 HOH HOH A . 
H 4 HOH 1  344 1   HOH HOH B . 
H 4 HOH 2  345 2   HOH HOH B . 
H 4 HOH 3  346 5   HOH HOH B . 
H 4 HOH 4  347 6   HOH HOH B . 
H 4 HOH 5  348 7   HOH HOH B . 
H 4 HOH 6  349 10  HOH HOH B . 
H 4 HOH 7  350 11  HOH HOH B . 
H 4 HOH 8  351 16  HOH HOH B . 
H 4 HOH 9  352 17  HOH HOH B . 
H 4 HOH 10 353 20  HOH HOH B . 
H 4 HOH 11 354 30  HOH HOH B . 
H 4 HOH 12 355 31  HOH HOH B . 
H 4 HOH 13 356 37  HOH HOH B . 
H 4 HOH 14 357 40  HOH HOH B . 
H 4 HOH 15 358 41  HOH HOH B . 
H 4 HOH 16 359 43  HOH HOH B . 
H 4 HOH 17 360 44  HOH HOH B . 
H 4 HOH 18 361 45  HOH HOH B . 
H 4 HOH 19 362 46  HOH HOH B . 
H 4 HOH 20 363 53  HOH HOH B . 
H 4 HOH 21 364 62  HOH HOH B . 
H 4 HOH 22 365 65  HOH HOH B . 
H 4 HOH 23 366 68  HOH HOH B . 
H 4 HOH 24 367 73  HOH HOH B . 
H 4 HOH 25 368 80  HOH HOH B . 
H 4 HOH 26 369 83  HOH HOH B . 
H 4 HOH 27 370 90  HOH HOH B . 
H 4 HOH 28 371 92  HOH HOH B . 
H 4 HOH 29 372 115 HOH HOH B . 
H 4 HOH 30 373 138 HOH HOH B . 
H 4 HOH 31 374 179 HOH HOH B . 
H 4 HOH 32 375 321 HOH HOH B . 
H 4 HOH 33 376 322 HOH HOH B . 
H 4 HOH 34 377 324 HOH HOH B . 
H 4 HOH 35 378 325 HOH HOH B . 
H 4 HOH 36 379 326 HOH HOH B . 
H 4 HOH 37 380 327 HOH HOH B . 
H 4 HOH 38 381 328 HOH HOH B . 
H 4 HOH 39 382 329 HOH HOH B . 
H 4 HOH 40 383 334 HOH HOH B . 
H 4 HOH 41 384 339 HOH HOH B . 
H 4 HOH 42 385 340 HOH HOH B . 
H 4 HOH 43 386 341 HOH HOH B . 
H 4 HOH 44 387 342 HOH HOH B . 
H 4 HOH 45 388 343 HOH HOH B . 
H 4 HOH 46 389 348 HOH HOH B . 
H 4 HOH 47 390 501 HOH HOH B . 
#