data_1PVS
# 
_entry.id   1PVS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1PVS         
RCSB  RCSB019613   
WWPDB D_1000019613 
# 
_pdbx_database_status.entry_id                        1PVS 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2003-06-28 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
_audit_author.name           'Teale, M.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
;3-methyladenine-DNA glycosylase II: the crystal structure of an AlkA-hypoxanthine complex suggests the possibility of product inhibition.
;
_citation.journal_abbrev            Bioconjug.Chem. 
_citation.journal_volume            13 
_citation.page_first                403 
_citation.page_last                 407 
_citation.year                      2002 
_citation.journal_id_ASTM           BCCHES 
_citation.country                   US 
_citation.journal_id_ISSN           1043-1802 
_citation.journal_id_CSD            2063 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12009927 
_citation.pdbx_database_id_DOI      10.1021/bc015527v 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Teale, M.'    1 
primary 'Symersky, J.' 2 
primary 'DeLucas, L.'  3 
# 
_cell.entry_id           1PVS 
_cell.length_a           58.005 
_cell.length_b           75.979 
_cell.length_c           61.417 
_cell.angle_alpha        90.00 
_cell.angle_beta         110.03 
_cell.angle_gamma        90.00 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
# 
_symmetry.entry_id                         1PVS 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                4 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA-3-methyladenine glycosylase II'  31425.236 2   3.2.2.21 ? ? ? 
2 non-polymer syn '7-HYDROXY-PYRAZOLO[4,3-D]PYRIMIDINE' 136.111   2   ?        ? ? ? 
3 water       nat water                                 18.015    226 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        '3-methyladenine-DNA glycosylase II, inducible, TAG II, DNA-3-methyladenine glycosidase II' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSR
LFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQR
LAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYL
IKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSR
LFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQR
LAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYL
IKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   TYR n 
1 3   THR n 
1 4   LEU n 
1 5   ASN n 
1 6   TRP n 
1 7   GLN n 
1 8   PRO n 
1 9   PRO n 
1 10  TYR n 
1 11  ASP n 
1 12  TRP n 
1 13  SER n 
1 14  TRP n 
1 15  MET n 
1 16  LEU n 
1 17  GLY n 
1 18  PHE n 
1 19  LEU n 
1 20  ALA n 
1 21  ALA n 
1 22  ARG n 
1 23  ALA n 
1 24  VAL n 
1 25  SER n 
1 26  SER n 
1 27  VAL n 
1 28  GLU n 
1 29  THR n 
1 30  VAL n 
1 31  ALA n 
1 32  ASP n 
1 33  SER n 
1 34  TYR n 
1 35  TYR n 
1 36  ALA n 
1 37  ARG n 
1 38  SER n 
1 39  LEU n 
1 40  ALA n 
1 41  VAL n 
1 42  GLY n 
1 43  GLU n 
1 44  TYR n 
1 45  ARG n 
1 46  GLY n 
1 47  VAL n 
1 48  VAL n 
1 49  THR n 
1 50  ALA n 
1 51  ILE n 
1 52  PRO n 
1 53  ASP n 
1 54  ILE n 
1 55  ALA n 
1 56  ARG n 
1 57  HIS n 
1 58  THR n 
1 59  LEU n 
1 60  HIS n 
1 61  ILE n 
1 62  ASN n 
1 63  LEU n 
1 64  SER n 
1 65  ALA n 
1 66  GLY n 
1 67  LEU n 
1 68  GLU n 
1 69  PRO n 
1 70  VAL n 
1 71  ALA n 
1 72  ALA n 
1 73  GLU n 
1 74  CYS n 
1 75  LEU n 
1 76  ALA n 
1 77  LYS n 
1 78  MET n 
1 79  SER n 
1 80  ARG n 
1 81  LEU n 
1 82  PHE n 
1 83  ASP n 
1 84  LEU n 
1 85  GLN n 
1 86  CYS n 
1 87  ASN n 
1 88  PRO n 
1 89  GLN n 
1 90  ILE n 
1 91  VAL n 
1 92  ASN n 
1 93  GLY n 
1 94  ALA n 
1 95  LEU n 
1 96  GLY n 
1 97  ARG n 
1 98  LEU n 
1 99  GLY n 
1 100 ALA n 
1 101 ALA n 
1 102 ARG n 
1 103 PRO n 
1 104 GLY n 
1 105 LEU n 
1 106 ARG n 
1 107 LEU n 
1 108 PRO n 
1 109 GLY n 
1 110 CYS n 
1 111 VAL n 
1 112 ASP n 
1 113 ALA n 
1 114 PHE n 
1 115 GLU n 
1 116 GLN n 
1 117 GLY n 
1 118 VAL n 
1 119 ARG n 
1 120 ALA n 
1 121 ILE n 
1 122 LEU n 
1 123 GLY n 
1 124 GLN n 
1 125 LEU n 
1 126 VAL n 
1 127 SER n 
1 128 VAL n 
1 129 ALA n 
1 130 MET n 
1 131 ALA n 
1 132 ALA n 
1 133 LYS n 
1 134 LEU n 
1 135 THR n 
1 136 ALA n 
1 137 ARG n 
1 138 VAL n 
1 139 ALA n 
1 140 GLN n 
1 141 LEU n 
1 142 TYR n 
1 143 GLY n 
1 144 GLU n 
1 145 ARG n 
1 146 LEU n 
1 147 ASP n 
1 148 ASP n 
1 149 PHE n 
1 150 PRO n 
1 151 GLU n 
1 152 TYR n 
1 153 ILE n 
1 154 CYS n 
1 155 PHE n 
1 156 PRO n 
1 157 THR n 
1 158 PRO n 
1 159 GLN n 
1 160 ARG n 
1 161 LEU n 
1 162 ALA n 
1 163 ALA n 
1 164 ALA n 
1 165 ASP n 
1 166 PRO n 
1 167 GLN n 
1 168 ALA n 
1 169 LEU n 
1 170 LYS n 
1 171 ALA n 
1 172 LEU n 
1 173 GLY n 
1 174 MET n 
1 175 PRO n 
1 176 LEU n 
1 177 LYS n 
1 178 ARG n 
1 179 ALA n 
1 180 GLU n 
1 181 ALA n 
1 182 LEU n 
1 183 ILE n 
1 184 HIS n 
1 185 LEU n 
1 186 ALA n 
1 187 ASN n 
1 188 ALA n 
1 189 ALA n 
1 190 LEU n 
1 191 GLU n 
1 192 GLY n 
1 193 THR n 
1 194 LEU n 
1 195 PRO n 
1 196 MET n 
1 197 THR n 
1 198 ILE n 
1 199 PRO n 
1 200 GLY n 
1 201 ASP n 
1 202 VAL n 
1 203 GLU n 
1 204 GLN n 
1 205 ALA n 
1 206 MET n 
1 207 LYS n 
1 208 THR n 
1 209 LEU n 
1 210 GLN n 
1 211 THR n 
1 212 PHE n 
1 213 PRO n 
1 214 GLY n 
1 215 ILE n 
1 216 GLY n 
1 217 ARG n 
1 218 TRP n 
1 219 THR n 
1 220 ALA n 
1 221 ASN n 
1 222 TYR n 
1 223 PHE n 
1 224 ALA n 
1 225 LEU n 
1 226 ARG n 
1 227 GLY n 
1 228 TRP n 
1 229 GLN n 
1 230 ALA n 
1 231 LYS n 
1 232 ASP n 
1 233 VAL n 
1 234 PHE n 
1 235 LEU n 
1 236 PRO n 
1 237 ASP n 
1 238 ASP n 
1 239 TYR n 
1 240 LEU n 
1 241 ILE n 
1 242 LYS n 
1 243 GLN n 
1 244 ARG n 
1 245 PHE n 
1 246 PRO n 
1 247 GLY n 
1 248 MET n 
1 249 THR n 
1 250 PRO n 
1 251 ALA n 
1 252 GLN n 
1 253 ILE n 
1 254 ARG n 
1 255 ARG n 
1 256 TYR n 
1 257 ALA n 
1 258 GLU n 
1 259 ARG n 
1 260 TRP n 
1 261 LYS n 
1 262 PRO n 
1 263 TRP n 
1 264 ARG n 
1 265 SER n 
1 266 TYR n 
1 267 ALA n 
1 268 LEU n 
1 269 LEU n 
1 270 HIS n 
1 271 ILE n 
1 272 TRP n 
1 273 TYR n 
1 274 THR n 
1 275 GLU n 
1 276 GLY n 
1 277 TRP n 
1 278 GLN n 
1 279 PRO n 
1 280 ASP n 
1 281 GLU n 
1 282 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 'ALKA OR AIDA OR B2068' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    3MG2_ECOLI 
_struct_ref.pdbx_db_accession          P04395 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSR
LFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQR
LAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYL
IKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1PVS A 1 ? 282 ? P04395 1 ? 282 ? 1 282 
2 1 1PVS B 1 ? 282 ? P04395 1 ? 282 ? 1 282 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
7HP non-polymer         . '7-HYDROXY-PYRAZOLO[4,3-D]PYRIMIDINE' ? 'C5 H4 N4 O'     136.111 
ALA 'L-peptide linking' y ALANINE                               ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                              ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                            ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                       ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                              ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                             ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                       ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                               ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                             ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                 ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                            ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                               ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                            ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                         ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                               ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                             ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                            ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                              ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1PVS 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   39.16 
_exptl_crystal.density_Matthews      2.02 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    graphite 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     1PVS 
_reflns.d_resolution_high            2.39 
_reflns.d_resolution_low             19.77 
_reflns.limit_h_max                  22 
_reflns.limit_h_min                  -24 
_reflns.limit_k_max                  31 
_reflns.limit_k_min                  -24 
_reflns.limit_l_max                  25 
_reflns.limit_l_min                  0 
_reflns.number_all                   19046 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.observed_criterion_F_max     469940.18 
_reflns.observed_criterion_F_min     0.450000 
_reflns.B_iso_Wilson_estimate        9.7 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_obs                   19046 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1PVS 
_refine.ls_number_reflns_all                     17875 
_refine.ls_number_reflns_obs                     17875 
_refine.ls_percent_reflns_obs                    90.3 
_refine.ls_d_res_high                            2.40 
_refine.ls_d_res_low                             14.99 
_refine.B_iso_min                                1.13 
_refine.B_iso_max                                44.42 
_refine.B_iso_mean                               14.63 
_refine.occupancy_min                            1.00 
_refine.occupancy_max                            1.00 
_refine.aniso_B[1][1]                            -1.91 
_refine.aniso_B[2][2]                            0.22 
_refine.aniso_B[3][3]                            1.70 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.84 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_param_bsol                 20.6971 
_refine.solvent_model_param_ksol                 0.335713 
_refine.solvent_model_details                    'CNS bulk solvent model used' 
_refine.ls_R_factor_R_work                       0.232 
_refine.ls_R_factor_R_free                       0.292 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_number_reflns_R_free                  1734 
_refine.ls_percent_reflns_R_free                 9.8 
_refine.details                                  ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1PVS 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     2.40 
_refine_analyze.Luzzati_coordinate_error_obs    0.29 
_refine_analyze.Luzzati_sigma_a_obs             0.20 
_refine_analyze.Luzzati_coordinate_error_free   0.39 
_refine_analyze.Luzzati_sigma_a_free            0.33 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4430 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             226 
_refine_hist.number_atoms_total               4676 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        14.99 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d           0.008 . ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg        1.3   . ? ? 'X-RAY DIFFRACTION' ? 
x_torsion_deg      21.8  . ? ? 'X-RAY DIFFRACTION' ? 
x_torsion_impr_deg 1.27  . ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_all 
2.40 2.51  2453 2116 1907 86.2 0.253 . 0.017 209 8.5 8 . 'X-RAY DIFFRACTION' . 
2.51 2.64  2456 2221 1980 90.4 0.241 . 0.015 241 9.8 8 . 'X-RAY DIFFRACTION' . 
2.64 2.80  2435 2230 2022 91.5 0.235 . 0.016 208 8.5 8 . 'X-RAY DIFFRACTION' . 
2.80 3.02  2439 2267 2061 92.9 0.246 . 0.017 206 8.4 8 . 'X-RAY DIFFRACTION' . 
3.02 3.32  2438 2284 2065 93.7 0.255 . 0.017 219 9.0 8 . 'X-RAY DIFFRACTION' . 
3.32 3.79  2466 2110 1913 85.6 0.227 . 0.016 197 8.0 8 . 'X-RAY DIFFRACTION' . 
3.79 4.75  2467 2296 2054 93.1 0.21  . 0.014 242 9.8 8 . 'X-RAY DIFFRACTION' . 
4.75 14.99 2502 2217 2005 88.6 0.21  . 0.014 212 8.5 8 . 'X-RAY DIFFRACTION' . 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param  protein.top      'X-RAY DIFFRACTION' 
2 carbohydrate.param carbohydrate.top 'X-RAY DIFFRACTION' 
3 hypo.param         hypo.top         'X-RAY DIFFRACTION' 
4 water.param        water.top        'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1PVS 
_struct.title                     '3-methyladenine Glcosylase II(AlkA) Hypoxanthine complex' 
_struct.pdbx_descriptor           'DNA-3-methyladenine glycosylase II (E.C.3.2.2.21)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1PVS 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'AlkA, hypoxanthine, DNA glycosylase, DNA repair, reaction-product complex, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 11  ? ALA A 23  ? ASP A 11  ALA A 23  1 ? 13 
HELX_P HELX_P2  2  ALA A 65  ? PRO A 69  ? ALA A 65  PRO A 69  5 ? 5  
HELX_P HELX_P3  3  VAL A 70  ? ASP A 83  ? VAL A 70  ASP A 83  1 ? 14 
HELX_P HELX_P4  4  ASN A 87  ? GLY A 96  ? ASN A 87  GLY A 96  1 ? 10 
HELX_P HELX_P5  5  GLY A 96  ? ALA A 101 ? GLY A 96  ALA A 101 1 ? 6  
HELX_P HELX_P6  6  ASP A 112 ? GLY A 123 ? ASP A 112 GLY A 123 1 ? 12 
HELX_P HELX_P7  7  SER A 127 ? GLY A 143 ? SER A 127 GLY A 143 1 ? 17 
HELX_P HELX_P8  8  THR A 157 ? ALA A 163 ? THR A 157 ALA A 163 1 ? 7  
HELX_P HELX_P9  9  ASP A 165 ? LEU A 172 ? ASP A 165 LEU A 172 1 ? 8  
HELX_P HELX_P10 10 PRO A 175 ? GLY A 192 ? PRO A 175 GLY A 192 1 ? 18 
HELX_P HELX_P11 11 ASP A 201 ? GLN A 210 ? ASP A 201 GLN A 210 1 ? 10 
HELX_P HELX_P12 12 GLY A 216 ? TRP A 228 ? GLY A 216 TRP A 228 1 ? 13 
HELX_P HELX_P13 13 ASP A 238 ? PHE A 245 ? ASP A 238 PHE A 245 1 ? 8  
HELX_P HELX_P14 14 THR A 249 ? GLU A 258 ? THR A 249 GLU A 258 1 ? 10 
HELX_P HELX_P15 15 ARG A 259 ? LYS A 261 ? ARG A 259 LYS A 261 5 ? 3  
HELX_P HELX_P16 16 TRP A 263 ? THR A 274 ? TRP A 263 THR A 274 1 ? 12 
HELX_P HELX_P17 17 ASP B 11  ? ALA B 23  ? ASP B 11  ALA B 23  1 ? 13 
HELX_P HELX_P18 18 ILE B 54  ? ARG B 56  ? ILE B 54  ARG B 56  5 ? 3  
HELX_P HELX_P19 19 ALA B 65  ? PRO B 69  ? ALA B 65  PRO B 69  5 ? 5  
HELX_P HELX_P20 20 VAL B 70  ? ASP B 83  ? VAL B 70  ASP B 83  1 ? 14 
HELX_P HELX_P21 21 ASN B 87  ? GLY B 96  ? ASN B 87  GLY B 96  1 ? 10 
HELX_P HELX_P22 22 GLY B 96  ? ALA B 101 ? GLY B 96  ALA B 101 1 ? 6  
HELX_P HELX_P23 23 ASP B 112 ? GLY B 123 ? ASP B 112 GLY B 123 1 ? 12 
HELX_P HELX_P24 24 SER B 127 ? GLY B 143 ? SER B 127 GLY B 143 1 ? 17 
HELX_P HELX_P25 25 THR B 157 ? ALA B 163 ? THR B 157 ALA B 163 1 ? 7  
HELX_P HELX_P26 26 ASP B 165 ? LEU B 172 ? ASP B 165 LEU B 172 1 ? 8  
HELX_P HELX_P27 27 PRO B 175 ? GLU B 191 ? PRO B 175 GLU B 191 1 ? 17 
HELX_P HELX_P28 28 ASP B 201 ? THR B 211 ? ASP B 201 THR B 211 1 ? 11 
HELX_P HELX_P29 29 GLY B 216 ? TRP B 228 ? GLY B 216 TRP B 228 1 ? 13 
HELX_P HELX_P30 30 ASP B 238 ? PHE B 245 ? ASP B 238 PHE B 245 1 ? 8  
HELX_P HELX_P31 31 THR B 249 ? GLU B 258 ? THR B 249 GLU B 258 1 ? 10 
HELX_P HELX_P32 32 ARG B 259 ? LYS B 261 ? ARG B 259 LYS B 261 5 ? 3  
HELX_P HELX_P33 33 TRP B 263 ? TYR B 273 ? TRP B 263 TYR B 273 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 8   A . ? PRO 8   A PRO 9   A ? PRO 9   A 1 -0.35 
2 LYS 261 A . ? LYS 261 A PRO 262 A ? PRO 262 A 1 -0.28 
3 PRO 8   B . ? PRO 8   B PRO 9   B ? PRO 9   B 1 0.08  
4 LYS 261 B . ? LYS 261 B PRO 262 B ? PRO 262 B 1 0.36  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 2   ? ASN A 5   ? TYR A 2   ASN A 5   
A 2 THR A 58  ? LEU A 63  ? THR A 58  LEU A 63  
A 3 TYR A 44  ? ASP A 53  ? TYR A 44  ASP A 53  
A 4 TYR A 35  ? VAL A 41  ? TYR A 35  VAL A 41  
A 5 GLU A 28  ? VAL A 30  ? GLU A 28  VAL A 30  
B 1 GLU A 144 ? ARG A 145 ? GLU A 144 ARG A 145 
B 2 ILE A 153 ? CYS A 154 ? ILE A 153 CYS A 154 
C 1 TYR B 2   ? ASN B 5   ? TYR B 2   ASN B 5   
C 2 THR B 58  ? LEU B 63  ? THR B 58  LEU B 63  
C 3 TYR B 44  ? ASP B 53  ? TYR B 44  ASP B 53  
C 4 TYR B 35  ? VAL B 41  ? TYR B 35  VAL B 41  
C 5 GLU B 28  ? VAL B 30  ? GLU B 28  VAL B 30  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 2   ? N TYR A 2   O ILE A 61  ? O ILE A 61  
A 2 3 O HIS A 60  ? O HIS A 60  N ILE A 51  ? N ILE A 51  
A 3 4 O ALA A 50  ? O ALA A 50  N TYR A 35  ? N TYR A 35  
A 4 5 O ALA A 36  ? O ALA A 36  N THR A 29  ? N THR A 29  
B 1 2 N GLU A 144 ? N GLU A 144 O CYS A 154 ? O CYS A 154 
C 1 2 N LEU B 4   ? N LEU B 4   O LEU B 59  ? O LEU B 59  
C 2 3 O HIS B 60  ? O HIS B 60  N ILE B 51  ? N ILE B 51  
C 3 4 O ALA B 50  ? O ALA B 50  N TYR B 35  ? N TYR B 35  
C 4 5 O ALA B 36  ? O ALA B 36  N THR B 29  ? N THR B 29  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE 7HP B 700' 
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE 7HP A 800' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  GLY B 123 ? GLY B 123 . ? 1_555 ? 
2  AC1 8  GLN B 124 ? GLN B 124 . ? 1_555 ? 
3  AC1 8  LEU B 125 ? LEU B 125 . ? 1_555 ? 
4  AC1 8  VAL B 126 ? VAL B 126 . ? 1_555 ? 
5  AC1 8  TRP B 218 ? TRP B 218 . ? 1_555 ? 
6  AC1 8  ASP B 237 ? ASP B 237 . ? 1_555 ? 
7  AC1 8  ASP B 238 ? ASP B 238 . ? 1_555 ? 
8  AC1 8  TYR B 239 ? TYR B 239 . ? 1_555 ? 
9  AC2 10 GLY A 123 ? GLY A 123 . ? 1_555 ? 
10 AC2 10 GLN A 124 ? GLN A 124 . ? 1_555 ? 
11 AC2 10 LEU A 125 ? LEU A 125 . ? 1_555 ? 
12 AC2 10 VAL A 126 ? VAL A 126 . ? 1_555 ? 
13 AC2 10 TRP A 218 ? TRP A 218 . ? 1_555 ? 
14 AC2 10 ASP A 237 ? ASP A 237 . ? 1_555 ? 
15 AC2 10 ASP A 238 ? ASP A 238 . ? 1_555 ? 
16 AC2 10 TYR A 239 ? TYR A 239 . ? 1_555 ? 
17 AC2 10 HOH E .   ? HOH A 811 . ? 1_555 ? 
18 AC2 10 HOH E .   ? HOH A 876 . ? 1_555 ? 
# 
_atom_sites.entry_id                    1PVS 
_atom_sites.fract_transf_matrix[1][1]   0.017240 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.006285 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013162 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017331 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1   ? 10.051 -2.018  5.907  1.00 20.92 ? 1   MET A N   1 
ATOM   2    C CA  . MET A 1 1   ? 11.488 -2.022  6.317  1.00 20.83 ? 1   MET A CA  1 
ATOM   3    C C   . MET A 1 1   ? 12.407 -1.780  5.117  1.00 19.52 ? 1   MET A C   1 
ATOM   4    O O   . MET A 1 1   ? 12.680 -2.683  4.326  1.00 21.35 ? 1   MET A O   1 
ATOM   5    C CB  . MET A 1 1   ? 11.844 -3.360  6.976  1.00 22.91 ? 1   MET A CB  1 
ATOM   6    C CG  . MET A 1 1   ? 13.166 -3.372  7.748  1.00 24.04 ? 1   MET A CG  1 
ATOM   7    S SD  . MET A 1 1   ? 13.126 -2.467  9.334  1.00 25.28 ? 1   MET A SD  1 
ATOM   8    C CE  . MET A 1 1   ? 11.932 -3.426  10.303 1.00 25.51 ? 1   MET A CE  1 
ATOM   9    N N   . TYR A 1 2   ? 12.876 -0.547  4.996  1.00 16.30 ? 2   TYR A N   1 
ATOM   10   C CA  . TYR A 1 2   ? 13.770 -0.151  3.928  1.00 12.53 ? 2   TYR A CA  1 
ATOM   11   C C   . TYR A 1 2   ? 15.199 -0.289  4.411  1.00 12.34 ? 2   TYR A C   1 
ATOM   12   O O   . TYR A 1 2   ? 15.442 -0.403  5.615  1.00 10.77 ? 2   TYR A O   1 
ATOM   13   C CB  . TYR A 1 2   ? 13.488 1.297   3.533  1.00 10.41 ? 2   TYR A CB  1 
ATOM   14   C CG  . TYR A 1 2   ? 12.049 1.506   3.133  1.00 6.26  ? 2   TYR A CG  1 
ATOM   15   C CD1 . TYR A 1 2   ? 11.048 1.632   4.094  1.00 4.95  ? 2   TYR A CD1 1 
ATOM   16   C CD2 . TYR A 1 2   ? 11.680 1.490   1.797  1.00 1.13  ? 2   TYR A CD2 1 
ATOM   17   C CE1 . TYR A 1 2   ? 9.708  1.734   3.722  1.00 4.41  ? 2   TYR A CE1 1 
ATOM   18   C CE2 . TYR A 1 2   ? 10.351 1.590   1.418  1.00 4.48  ? 2   TYR A CE2 1 
ATOM   19   C CZ  . TYR A 1 2   ? 9.375  1.711   2.380  1.00 3.24  ? 2   TYR A CZ  1 
ATOM   20   O OH  . TYR A 1 2   ? 8.070  1.829   1.985  1.00 1.58  ? 2   TYR A OH  1 
ATOM   21   N N   . THR A 1 3   ? 16.137 -0.261  3.468  1.00 12.14 ? 3   THR A N   1 
ATOM   22   C CA  . THR A 1 3   ? 17.557 -0.386  3.777  1.00 13.57 ? 3   THR A CA  1 
ATOM   23   C C   . THR A 1 3   ? 18.415 0.640   3.034  1.00 12.72 ? 3   THR A C   1 
ATOM   24   O O   . THR A 1 3   ? 18.195 0.907   1.855  1.00 15.38 ? 3   THR A O   1 
ATOM   25   C CB  . THR A 1 3   ? 18.089 -1.794  3.416  1.00 14.69 ? 3   THR A CB  1 
ATOM   26   O OG1 . THR A 1 3   ? 17.385 -2.788  4.171  1.00 14.06 ? 3   THR A OG1 1 
ATOM   27   C CG2 . THR A 1 3   ? 19.584 -1.899  3.729  1.00 17.65 ? 3   THR A CG2 1 
ATOM   28   N N   . LEU A 1 4   ? 19.395 1.206   3.728  1.00 11.97 ? 4   LEU A N   1 
ATOM   29   C CA  . LEU A 1 4   ? 20.303 2.183   3.132  1.00 13.00 ? 4   LEU A CA  1 
ATOM   30   C C   . LEU A 1 4   ? 21.726 1.756   3.494  1.00 14.38 ? 4   LEU A C   1 
ATOM   31   O O   . LEU A 1 4   ? 21.947 1.071   4.499  1.00 14.30 ? 4   LEU A O   1 
ATOM   32   C CB  . LEU A 1 4   ? 20.010 3.589   3.670  1.00 11.49 ? 4   LEU A CB  1 
ATOM   33   C CG  . LEU A 1 4   ? 18.605 4.143   3.396  1.00 10.35 ? 4   LEU A CG  1 
ATOM   34   C CD1 . LEU A 1 4   ? 18.392 5.418   4.177  1.00 10.54 ? 4   LEU A CD1 1 
ATOM   35   C CD2 . LEU A 1 4   ? 18.430 4.384   1.898  1.00 10.01 ? 4   LEU A CD2 1 
ATOM   36   N N   . ASN A 1 5   ? 22.697 2.156   2.687  1.00 14.67 ? 5   ASN A N   1 
ATOM   37   C CA  . ASN A 1 5   ? 24.065 1.754   2.955  1.00 14.35 ? 5   ASN A CA  1 
ATOM   38   C C   . ASN A 1 5   ? 24.968 2.869   3.443  1.00 14.54 ? 5   ASN A C   1 
ATOM   39   O O   . ASN A 1 5   ? 24.658 4.043   3.277  1.00 17.33 ? 5   ASN A O   1 
ATOM   40   C CB  . ASN A 1 5   ? 24.653 1.126   1.698  1.00 15.06 ? 5   ASN A CB  1 
ATOM   41   C CG  . ASN A 1 5   ? 25.973 0.457   1.954  1.00 15.03 ? 5   ASN A CG  1 
ATOM   42   O OD1 . ASN A 1 5   ? 27.026 1.096   1.934  1.00 14.70 ? 5   ASN A OD1 1 
ATOM   43   N ND2 . ASN A 1 5   ? 25.927 -0.842  2.219  1.00 17.50 ? 5   ASN A ND2 1 
ATOM   44   N N   . TRP A 1 6   ? 26.080 2.491   4.067  1.00 14.85 ? 6   TRP A N   1 
ATOM   45   C CA  . TRP A 1 6   ? 27.059 3.458   4.555  1.00 13.29 ? 6   TRP A CA  1 
ATOM   46   C C   . TRP A 1 6   ? 28.441 2.822   4.435  1.00 13.84 ? 6   TRP A C   1 
ATOM   47   O O   . TRP A 1 6   ? 28.567 1.595   4.359  1.00 11.79 ? 6   TRP A O   1 
ATOM   48   C CB  . TRP A 1 6   ? 26.757 3.875   6.008  1.00 12.20 ? 6   TRP A CB  1 
ATOM   49   C CG  . TRP A 1 6   ? 27.238 2.940   7.092  1.00 11.63 ? 6   TRP A CG  1 
ATOM   50   C CD1 . TRP A 1 6   ? 28.539 2.708   7.476  1.00 10.83 ? 6   TRP A CD1 1 
ATOM   51   C CD2 . TRP A 1 6   ? 26.421 2.154   7.963  1.00 9.75  ? 6   TRP A CD2 1 
ATOM   52   N NE1 . TRP A 1 6   ? 28.574 1.831   8.533  1.00 10.02 ? 6   TRP A NE1 1 
ATOM   53   C CE2 . TRP A 1 6   ? 27.288 1.472   8.851  1.00 11.23 ? 6   TRP A CE2 1 
ATOM   54   C CE3 . TRP A 1 6   ? 25.040 1.959   8.083  1.00 9.74  ? 6   TRP A CE3 1 
ATOM   55   C CZ2 . TRP A 1 6   ? 26.813 0.609   9.844  1.00 11.14 ? 6   TRP A CZ2 1 
ATOM   56   C CZ3 . TRP A 1 6   ? 24.568 1.099   9.073  1.00 11.83 ? 6   TRP A CZ3 1 
ATOM   57   C CH2 . TRP A 1 6   ? 25.453 0.436   9.939  1.00 12.83 ? 6   TRP A CH2 1 
ATOM   58   N N   . GLN A 1 7   ? 29.472 3.660   4.387  1.00 12.84 ? 7   GLN A N   1 
ATOM   59   C CA  . GLN A 1 7   ? 30.836 3.181   4.251  1.00 13.70 ? 7   GLN A CA  1 
ATOM   60   C C   . GLN A 1 7   ? 31.581 3.201   5.583  1.00 13.17 ? 7   GLN A C   1 
ATOM   61   O O   . GLN A 1 7   ? 31.658 4.230   6.250  1.00 12.22 ? 7   GLN A O   1 
ATOM   62   C CB  . GLN A 1 7   ? 31.580 4.027   3.213  1.00 14.74 ? 7   GLN A CB  1 
ATOM   63   C CG  . GLN A 1 7   ? 32.128 3.205   2.054  1.00 20.11 ? 7   GLN A CG  1 
ATOM   64   C CD  . GLN A 1 7   ? 33.423 2.499   2.404  1.00 23.87 ? 7   GLN A CD  1 
ATOM   65   O OE1 . GLN A 1 7   ? 33.731 1.432   1.868  1.00 24.73 ? 7   GLN A OE1 1 
ATOM   66   N NE2 . GLN A 1 7   ? 34.202 3.104   3.297  1.00 23.56 ? 7   GLN A NE2 1 
ATOM   67   N N   . PRO A 1 8   ? 32.122 2.047   5.995  1.00 12.76 ? 8   PRO A N   1 
ATOM   68   C CA  . PRO A 1 8   ? 32.868 1.915   7.249  1.00 13.00 ? 8   PRO A CA  1 
ATOM   69   C C   . PRO A 1 8   ? 34.135 2.771   7.263  1.00 11.84 ? 8   PRO A C   1 
ATOM   70   O O   . PRO A 1 8   ? 34.731 3.026   6.221  1.00 14.83 ? 8   PRO A O   1 
ATOM   71   C CB  . PRO A 1 8   ? 33.173 0.416   7.310  1.00 11.43 ? 8   PRO A CB  1 
ATOM   72   C CG  . PRO A 1 8   ? 31.993 -0.184  6.608  1.00 12.50 ? 8   PRO A CG  1 
ATOM   73   C CD  . PRO A 1 8   ? 31.862 0.722   5.409  1.00 12.17 ? 8   PRO A CD  1 
ATOM   74   N N   . PRO A 1 9   ? 34.556 3.230   8.447  1.00 10.84 ? 9   PRO A N   1 
ATOM   75   C CA  . PRO A 1 9   ? 33.898 2.986   9.734  1.00 10.44 ? 9   PRO A CA  1 
ATOM   76   C C   . PRO A 1 9   ? 32.775 3.972   10.022 1.00 8.92  ? 9   PRO A C   1 
ATOM   77   O O   . PRO A 1 9   ? 32.698 5.040   9.419  1.00 6.26  ? 9   PRO A O   1 
ATOM   78   C CB  . PRO A 1 9   ? 35.044 3.152   10.730 1.00 8.68  ? 9   PRO A CB  1 
ATOM   79   C CG  . PRO A 1 9   ? 35.820 4.272   10.117 1.00 8.98  ? 9   PRO A CG  1 
ATOM   80   C CD  . PRO A 1 9   ? 35.873 3.864   8.652  1.00 8.89  ? 9   PRO A CD  1 
ATOM   81   N N   . TYR A 1 10  ? 31.906 3.600   10.955 1.00 8.70  ? 10  TYR A N   1 
ATOM   82   C CA  . TYR A 1 10  ? 30.821 4.468   11.375 1.00 7.53  ? 10  TYR A CA  1 
ATOM   83   C C   . TYR A 1 10  ? 30.689 4.270   12.876 1.00 9.31  ? 10  TYR A C   1 
ATOM   84   O O   . TYR A 1 10  ? 30.312 3.194   13.341 1.00 7.99  ? 10  TYR A O   1 
ATOM   85   C CB  . TYR A 1 10  ? 29.511 4.106   10.680 1.00 5.70  ? 10  TYR A CB  1 
ATOM   86   C CG  . TYR A 1 10  ? 28.425 5.150   10.861 1.00 3.83  ? 10  TYR A CG  1 
ATOM   87   C CD1 . TYR A 1 10  ? 27.975 5.510   12.136 1.00 1.13  ? 10  TYR A CD1 1 
ATOM   88   C CD2 . TYR A 1 10  ? 27.839 5.775   9.748  1.00 1.21  ? 10  TYR A CD2 1 
ATOM   89   C CE1 . TYR A 1 10  ? 26.965 6.464   12.310 1.00 1.13  ? 10  TYR A CE1 1 
ATOM   90   C CE2 . TYR A 1 10  ? 26.831 6.733   9.907  1.00 1.85  ? 10  TYR A CE2 1 
ATOM   91   C CZ  . TYR A 1 10  ? 26.396 7.069   11.194 1.00 1.91  ? 10  TYR A CZ  1 
ATOM   92   O OH  . TYR A 1 10  ? 25.377 7.984   11.350 1.00 1.13  ? 10  TYR A OH  1 
ATOM   93   N N   . ASP A 1 11  ? 31.034 5.313   13.628 1.00 8.91  ? 11  ASP A N   1 
ATOM   94   C CA  . ASP A 1 11  ? 30.959 5.273   15.081 1.00 7.28  ? 11  ASP A CA  1 
ATOM   95   C C   . ASP A 1 11  ? 29.498 5.511   15.437 1.00 6.81  ? 11  ASP A C   1 
ATOM   96   O O   . ASP A 1 11  ? 29.063 6.659   15.548 1.00 4.73  ? 11  ASP A O   1 
ATOM   97   C CB  . ASP A 1 11  ? 31.822 6.388   15.682 1.00 7.80  ? 11  ASP A CB  1 
ATOM   98   C CG  . ASP A 1 11  ? 32.225 6.111   17.117 1.00 9.10  ? 11  ASP A CG  1 
ATOM   99   O OD1 . ASP A 1 11  ? 31.400 5.577   17.888 1.00 7.38  ? 11  ASP A OD1 1 
ATOM   100  O OD2 . ASP A 1 11  ? 33.378 6.439   17.478 1.00 10.19 ? 11  ASP A OD2 1 
ATOM   101  N N   . TRP A 1 12  ? 28.743 4.426   15.596 1.00 6.77  ? 12  TRP A N   1 
ATOM   102  C CA  . TRP A 1 12  ? 27.327 4.519   15.941 1.00 7.83  ? 12  TRP A CA  1 
ATOM   103  C C   . TRP A 1 12  ? 27.095 4.872   17.407 1.00 7.98  ? 12  TRP A C   1 
ATOM   104  O O   . TRP A 1 12  ? 26.128 5.563   17.755 1.00 6.32  ? 12  TRP A O   1 
ATOM   105  C CB  . TRP A 1 12  ? 26.587 3.212   15.592 1.00 7.81  ? 12  TRP A CB  1 
ATOM   106  C CG  . TRP A 1 12  ? 26.096 3.179   14.160 1.00 11.26 ? 12  TRP A CG  1 
ATOM   107  C CD1 . TRP A 1 12  ? 26.680 2.543   13.095 1.00 12.77 ? 12  TRP A CD1 1 
ATOM   108  C CD2 . TRP A 1 12  ? 24.966 3.886   13.630 1.00 10.14 ? 12  TRP A CD2 1 
ATOM   109  N NE1 . TRP A 1 12  ? 25.984 2.815   11.936 1.00 12.13 ? 12  TRP A NE1 1 
ATOM   110  C CE2 . TRP A 1 12  ? 24.929 3.638   12.236 1.00 10.82 ? 12  TRP A CE2 1 
ATOM   111  C CE3 . TRP A 1 12  ? 23.985 4.709   14.198 1.00 9.13  ? 12  TRP A CE3 1 
ATOM   112  C CZ2 . TRP A 1 12  ? 23.946 4.185   11.402 1.00 11.45 ? 12  TRP A CZ2 1 
ATOM   113  C CZ3 . TRP A 1 12  ? 23.003 5.255   13.365 1.00 11.90 ? 12  TRP A CZ3 1 
ATOM   114  C CH2 . TRP A 1 12  ? 22.995 4.988   11.980 1.00 11.67 ? 12  TRP A CH2 1 
ATOM   115  N N   . SER A 1 13  ? 27.994 4.407   18.266 1.00 8.78  ? 13  SER A N   1 
ATOM   116  C CA  . SER A 1 13  ? 27.883 4.674   19.696 1.00 7.60  ? 13  SER A CA  1 
ATOM   117  C C   . SER A 1 13  ? 27.927 6.190   19.923 1.00 6.48  ? 13  SER A C   1 
ATOM   118  O O   . SER A 1 13  ? 27.098 6.759   20.638 1.00 6.29  ? 13  SER A O   1 
ATOM   119  C CB  . SER A 1 13  ? 29.032 3.973   20.439 1.00 6.09  ? 13  SER A CB  1 
ATOM   120  O OG  . SER A 1 13  ? 28.961 4.187   21.830 1.00 12.38 ? 13  SER A OG  1 
ATOM   121  N N   . TRP A 1 14  ? 28.897 6.837   19.292 1.00 5.58  ? 14  TRP A N   1 
ATOM   122  C CA  . TRP A 1 14  ? 29.057 8.275   19.402 1.00 7.22  ? 14  TRP A CA  1 
ATOM   123  C C   . TRP A 1 14  ? 27.820 9.012   18.864 1.00 7.58  ? 14  TRP A C   1 
ATOM   124  O O   . TRP A 1 14  ? 27.318 9.951   19.490 1.00 5.55  ? 14  TRP A O   1 
ATOM   125  C CB  . TRP A 1 14  ? 30.297 8.712   18.626 1.00 7.84  ? 14  TRP A CB  1 
ATOM   126  C CG  . TRP A 1 14  ? 30.493 10.167  18.660 1.00 8.09  ? 14  TRP A CG  1 
ATOM   127  C CD1 . TRP A 1 14  ? 31.099 10.891  19.648 1.00 11.06 ? 14  TRP A CD1 1 
ATOM   128  C CD2 . TRP A 1 14  ? 30.000 11.111  17.715 1.00 9.03  ? 14  TRP A CD2 1 
ATOM   129  N NE1 . TRP A 1 14  ? 31.007 12.236  19.378 1.00 9.01  ? 14  TRP A NE1 1 
ATOM   130  C CE2 . TRP A 1 14  ? 30.332 12.400  18.196 1.00 9.94  ? 14  TRP A CE2 1 
ATOM   131  C CE3 . TRP A 1 14  ? 29.301 11.000  16.505 1.00 9.65  ? 14  TRP A CE3 1 
ATOM   132  C CZ2 . TRP A 1 14  ? 29.987 13.569  17.509 1.00 9.93  ? 14  TRP A CZ2 1 
ATOM   133  C CZ3 . TRP A 1 14  ? 28.962 12.160  15.824 1.00 8.45  ? 14  TRP A CZ3 1 
ATOM   134  C CH2 . TRP A 1 14  ? 29.304 13.427  16.328 1.00 7.93  ? 14  TRP A CH2 1 
ATOM   135  N N   . MET A 1 15  ? 27.337 8.578   17.701 1.00 6.63  ? 15  MET A N   1 
ATOM   136  C CA  . MET A 1 15  ? 26.171 9.196   17.073 1.00 8.36  ? 15  MET A CA  1 
ATOM   137  C C   . MET A 1 15  ? 24.904 9.160   17.934 1.00 7.91  ? 15  MET A C   1 
ATOM   138  O O   . MET A 1 15  ? 24.265 10.189  18.146 1.00 10.82 ? 15  MET A O   1 
ATOM   139  C CB  . MET A 1 15  ? 25.880 8.536   15.715 1.00 8.59  ? 15  MET A CB  1 
ATOM   140  C CG  . MET A 1 15  ? 24.594 9.057   15.039 1.00 6.79  ? 15  MET A CG  1 
ATOM   141  S SD  . MET A 1 15  ? 24.663 10.846  14.717 1.00 6.76  ? 15  MET A SD  1 
ATOM   142  C CE  . MET A 1 15  ? 25.817 10.840  13.303 1.00 1.13  ? 15  MET A CE  1 
ATOM   143  N N   . LEU A 1 16  ? 24.528 7.982   18.419 1.00 7.49  ? 16  LEU A N   1 
ATOM   144  C CA  . LEU A 1 16  ? 23.329 7.866   19.246 1.00 5.75  ? 16  LEU A CA  1 
ATOM   145  C C   . LEU A 1 16  ? 23.539 8.591   20.570 1.00 5.47  ? 16  LEU A C   1 
ATOM   146  O O   . LEU A 1 16  ? 22.587 9.089   21.176 1.00 4.13  ? 16  LEU A O   1 
ATOM   147  C CB  . LEU A 1 16  ? 22.991 6.389   19.491 1.00 4.28  ? 16  LEU A CB  1 
ATOM   148  C CG  . LEU A 1 16  ? 22.873 5.582   18.192 1.00 5.83  ? 16  LEU A CG  1 
ATOM   149  C CD1 . LEU A 1 16  ? 22.627 4.101   18.471 1.00 5.12  ? 16  LEU A CD1 1 
ATOM   150  C CD2 . LEU A 1 16  ? 21.747 6.169   17.355 1.00 3.57  ? 16  LEU A CD2 1 
ATOM   151  N N   . GLY A 1 17  ? 24.793 8.650   21.010 1.00 6.00  ? 17  GLY A N   1 
ATOM   152  C CA  . GLY A 1 17  ? 25.114 9.332   22.250 1.00 5.52  ? 17  GLY A CA  1 
ATOM   153  C C   . GLY A 1 17  ? 24.868 10.812  22.072 1.00 4.92  ? 17  GLY A C   1 
ATOM   154  O O   . GLY A 1 17  ? 24.368 11.490  22.968 1.00 7.45  ? 17  GLY A O   1 
ATOM   155  N N   . PHE A 1 18  ? 25.227 11.299  20.890 1.00 5.13  ? 18  PHE A N   1 
ATOM   156  C CA  . PHE A 1 18  ? 25.057 12.690  20.504 1.00 2.92  ? 18  PHE A CA  1 
ATOM   157  C C   . PHE A 1 18  ? 23.569 13.049  20.432 1.00 3.24  ? 18  PHE A C   1 
ATOM   158  O O   . PHE A 1 18  ? 23.143 14.080  20.947 1.00 2.36  ? 18  PHE A O   1 
ATOM   159  C CB  . PHE A 1 18  ? 25.719 12.906  19.141 1.00 1.13  ? 18  PHE A CB  1 
ATOM   160  C CG  . PHE A 1 18  ? 25.738 14.333  18.692 1.00 3.90  ? 18  PHE A CG  1 
ATOM   161  C CD1 . PHE A 1 18  ? 24.595 14.927  18.163 1.00 4.20  ? 18  PHE A CD1 1 
ATOM   162  C CD2 . PHE A 1 18  ? 26.896 15.098  18.823 1.00 2.66  ? 18  PHE A CD2 1 
ATOM   163  C CE1 . PHE A 1 18  ? 24.601 16.263  17.775 1.00 4.93  ? 18  PHE A CE1 1 
ATOM   164  C CE2 . PHE A 1 18  ? 26.915 16.431  18.441 1.00 4.31  ? 18  PHE A CE2 1 
ATOM   165  C CZ  . PHE A 1 18  ? 25.761 17.020  17.916 1.00 5.29  ? 18  PHE A CZ  1 
ATOM   166  N N   . LEU A 1 19  ? 22.782 12.194  19.787 1.00 3.57  ? 19  LEU A N   1 
ATOM   167  C CA  . LEU A 1 19  ? 21.348 12.437  19.656 1.00 3.62  ? 19  LEU A CA  1 
ATOM   168  C C   . LEU A 1 19  ? 20.619 12.232  20.981 1.00 4.63  ? 19  LEU A C   1 
ATOM   169  O O   . LEU A 1 19  ? 19.691 12.969  21.298 1.00 6.27  ? 19  LEU A O   1 
ATOM   170  C CB  . LEU A 1 19  ? 20.756 11.528  18.566 1.00 3.42  ? 19  LEU A CB  1 
ATOM   171  C CG  . LEU A 1 19  ? 21.402 11.715  17.180 1.00 7.03  ? 19  LEU A CG  1 
ATOM   172  C CD1 . LEU A 1 19  ? 20.849 10.702  16.175 1.00 5.00  ? 19  LEU A CD1 1 
ATOM   173  C CD2 . LEU A 1 19  ? 21.149 13.141  16.695 1.00 4.48  ? 19  LEU A CD2 1 
ATOM   174  N N   . ALA A 1 20  ? 21.037 11.243  21.764 1.00 4.23  ? 20  ALA A N   1 
ATOM   175  C CA  . ALA A 1 20  ? 20.382 10.999  23.046 1.00 4.90  ? 20  ALA A CA  1 
ATOM   176  C C   . ALA A 1 20  ? 20.439 12.232  23.940 1.00 4.97  ? 20  ALA A C   1 
ATOM   177  O O   . ALA A 1 20  ? 19.439 12.602  24.552 1.00 6.26  ? 20  ALA A O   1 
ATOM   178  C CB  . ALA A 1 20  ? 21.021 9.807   23.767 1.00 3.34  ? 20  ALA A CB  1 
ATOM   179  N N   . ALA A 1 21  ? 21.602 12.871  24.023 1.00 4.89  ? 21  ALA A N   1 
ATOM   180  C CA  . ALA A 1 21  ? 21.728 14.053  24.871 1.00 4.52  ? 21  ALA A CA  1 
ATOM   181  C C   . ALA A 1 21  ? 20.869 15.192  24.355 1.00 3.51  ? 21  ALA A C   1 
ATOM   182  O O   . ALA A 1 21  ? 20.356 15.996  25.123 1.00 2.03  ? 21  ALA A O   1 
ATOM   183  C CB  . ALA A 1 21  ? 23.183 14.493  24.961 1.00 3.57  ? 21  ALA A CB  1 
ATOM   184  N N   . ARG A 1 22  ? 20.694 15.260  23.047 1.00 5.79  ? 22  ARG A N   1 
ATOM   185  C CA  . ARG A 1 22  ? 19.893 16.333  22.499 1.00 5.39  ? 22  ARG A CA  1 
ATOM   186  C C   . ARG A 1 22  ? 18.452 15.941  22.212 1.00 4.72  ? 22  ARG A C   1 
ATOM   187  O O   . ARG A 1 22  ? 17.670 16.751  21.729 1.00 5.35  ? 22  ARG A O   1 
ATOM   188  C CB  . ARG A 1 22  ? 20.562 16.866  21.242 1.00 4.44  ? 22  ARG A CB  1 
ATOM   189  C CG  . ARG A 1 22  ? 21.933 17.415  21.510 1.00 4.70  ? 22  ARG A CG  1 
ATOM   190  C CD  . ARG A 1 22  ? 22.557 17.953  20.242 1.00 6.14  ? 22  ARG A CD  1 
ATOM   191  N NE  . ARG A 1 22  ? 23.918 18.408  20.478 1.00 9.35  ? 22  ARG A NE  1 
ATOM   192  C CZ  . ARG A 1 22  ? 24.856 17.685  21.079 1.00 11.15 ? 22  ARG A CZ  1 
ATOM   193  N NH1 . ARG A 1 22  ? 24.581 16.464  21.517 1.00 10.92 ? 22  ARG A NH1 1 
ATOM   194  N NH2 . ARG A 1 22  ? 26.076 18.180  21.228 1.00 12.68 ? 22  ARG A NH2 1 
ATOM   195  N N   . ALA A 1 23  ? 18.094 14.704  22.529 1.00 4.39  ? 23  ALA A N   1 
ATOM   196  C CA  . ALA A 1 23  ? 16.736 14.230  22.269 1.00 6.44  ? 23  ALA A CA  1 
ATOM   197  C C   . ALA A 1 23  ? 15.642 14.951  23.070 1.00 8.10  ? 23  ALA A C   1 
ATOM   198  O O   . ALA A 1 23  ? 15.750 15.120  24.291 1.00 9.64  ? 23  ALA A O   1 
ATOM   199  C CB  . ALA A 1 23  ? 16.656 12.722  22.516 1.00 5.78  ? 23  ALA A CB  1 
ATOM   200  N N   . VAL A 1 24  ? 14.585 15.364  22.373 1.00 6.56  ? 24  VAL A N   1 
ATOM   201  C CA  . VAL A 1 24  ? 13.458 16.059  22.994 1.00 4.79  ? 24  VAL A CA  1 
ATOM   202  C C   . VAL A 1 24  ? 12.415 15.042  23.467 1.00 6.48  ? 24  VAL A C   1 
ATOM   203  O O   . VAL A 1 24  ? 11.868 14.269  22.665 1.00 4.00  ? 24  VAL A O   1 
ATOM   204  C CB  . VAL A 1 24  ? 12.813 17.066  21.991 1.00 5.43  ? 24  VAL A CB  1 
ATOM   205  C CG1 . VAL A 1 24  ? 11.575 17.722  22.602 1.00 3.89  ? 24  VAL A CG1 1 
ATOM   206  C CG2 . VAL A 1 24  ? 13.831 18.131  21.600 1.00 5.07  ? 24  VAL A CG2 1 
ATOM   207  N N   . SER A 1 25  ? 12.137 15.068  24.787 1.00 6.61  ? 25  SER A N   1 
ATOM   208  C CA  . SER A 1 25  ? 11.169 14.171  25.371 1.00 6.67  ? 25  SER A CA  1 
ATOM   209  C C   . SER A 1 25  ? 9.785  14.350  24.691 1.00 6.58  ? 25  SER A C   1 
ATOM   210  O O   . SER A 1 25  ? 9.280  15.459  24.605 1.00 2.88  ? 25  SER A O   1 
ATOM   211  C CB  . SER A 1 25  ? 11.037 14.366  26.875 1.00 10.33 ? 25  SER A CB  1 
ATOM   212  O OG  . SER A 1 25  ? 12.287 14.253  27.534 1.00 14.57 ? 25  SER A OG  1 
ATOM   213  N N   . SER A 1 26  ? 9.315  13.193  24.311 1.00 5.69  ? 26  SER A N   1 
ATOM   214  C CA  . SER A 1 26  ? 8.073  12.819  23.697 1.00 9.81  ? 26  SER A CA  1 
ATOM   215  C C   . SER A 1 26  ? 8.127  13.223  22.199 1.00 10.87 ? 26  SER A C   1 
ATOM   216  O O   . SER A 1 26  ? 7.216  12.846  21.420 1.00 10.04 ? 26  SER A O   1 
ATOM   217  C CB  . SER A 1 26  ? 6.874  13.572  24.330 1.00 8.95  ? 26  SER A CB  1 
ATOM   218  O OG  . SER A 1 26  ? 6.705  13.269  25.686 1.00 12.81 ? 26  SER A OG  1 
ATOM   219  N N   . VAL A 1 27  ? 9.385  13.267  21.724 1.00 11.06 ? 27  VAL A N   1 
ATOM   220  C CA  . VAL A 1 27  ? 9.549  13.422  20.260 1.00 11.99 ? 27  VAL A CA  1 
ATOM   221  C C   . VAL A 1 27  ? 10.457 12.296  19.748 1.00 11.66 ? 27  VAL A C   1 
ATOM   222  O O   . VAL A 1 27  ? 10.124 11.722  18.696 1.00 13.01 ? 27  VAL A O   1 
ATOM   223  C CB  . VAL A 1 27  ? 10.053 14.795  19.852 1.00 12.22 ? 27  VAL A CB  1 
ATOM   224  C CG1 . VAL A 1 27  ? 10.187 14.952  18.329 1.00 11.27 ? 27  VAL A CG1 1 
ATOM   225  C CG2 . VAL A 1 27  ? 9.134  15.932  20.334 1.00 8.94  ? 27  VAL A CG2 1 
ATOM   226  N N   . GLU A 1 28  ? 11.642 12.229  20.422 1.00 11.24 ? 28  GLU A N   1 
ATOM   227  C CA  . GLU A 1 28  ? 12.633 11.248  20.012 1.00 11.52 ? 28  GLU A CA  1 
ATOM   228  C C   . GLU A 1 28  ? 12.863 10.209  21.090 1.00 13.10 ? 28  GLU A C   1 
ATOM   229  O O   . GLU A 1 28  ? 12.649 10.452  22.276 1.00 12.19 ? 28  GLU A O   1 
ATOM   230  C CB  . GLU A 1 28  ? 13.957 11.930  19.699 1.00 9.81  ? 28  GLU A CB  1 
ATOM   231  C CG  . GLU A 1 28  ? 13.809 13.156  18.834 1.00 11.18 ? 28  GLU A CG  1 
ATOM   232  C CD  . GLU A 1 28  ? 15.039 14.026  18.869 1.00 10.68 ? 28  GLU A CD  1 
ATOM   233  O OE1 . GLU A 1 28  ? 16.083 13.610  18.326 1.00 12.39 ? 28  GLU A OE1 1 
ATOM   234  O OE2 . GLU A 1 28  ? 14.963 15.123  19.455 1.00 10.81 ? 28  GLU A OE2 1 
ATOM   235  N N   . THR A 1 29  ? 13.309 9.042   20.659 1.00 14.37 ? 29  THR A N   1 
ATOM   236  C CA  . THR A 1 29  ? 13.595 7.957   21.571 1.00 15.22 ? 29  THR A CA  1 
ATOM   237  C C   . THR A 1 29  ? 14.916 7.393   21.108 1.00 14.69 ? 29  THR A C   1 
ATOM   238  O O   . THR A 1 29  ? 15.023 6.832   20.015 1.00 13.05 ? 29  THR A O   1 
ATOM   239  C CB  . THR A 1 29  ? 12.506 6.882   21.504 1.00 16.87 ? 29  THR A CB  1 
ATOM   240  O OG1 . THR A 1 29  ? 11.254 7.456   21.903 1.00 15.06 ? 29  THR A OG1 1 
ATOM   241  C CG2 . THR A 1 29  ? 12.845 5.721   22.425 1.00 17.63 ? 29  THR A CG2 1 
ATOM   242  N N   . VAL A 1 30  ? 15.937 7.568   21.931 1.00 14.04 ? 30  VAL A N   1 
ATOM   243  C CA  . VAL A 1 30  ? 17.242 7.076   21.560 1.00 13.47 ? 30  VAL A CA  1 
ATOM   244  C C   . VAL A 1 30  ? 17.727 5.994   22.493 1.00 14.07 ? 30  VAL A C   1 
ATOM   245  O O   . VAL A 1 30  ? 17.664 6.132   23.716 1.00 14.73 ? 30  VAL A O   1 
ATOM   246  C CB  . VAL A 1 30  ? 18.272 8.200   21.536 1.00 12.44 ? 30  VAL A CB  1 
ATOM   247  C CG1 . VAL A 1 30  ? 19.499 7.737   20.783 1.00 12.00 ? 30  VAL A CG1 1 
ATOM   248  C CG2 . VAL A 1 30  ? 17.675 9.437   20.893 1.00 11.19 ? 30  VAL A CG2 1 
ATOM   249  N N   . ALA A 1 31  ? 18.213 4.911   21.900 1.00 13.63 ? 31  ALA A N   1 
ATOM   250  C CA  . ALA A 1 31  ? 18.716 3.790   22.664 1.00 14.47 ? 31  ALA A CA  1 
ATOM   251  C C   . ALA A 1 31  ? 20.066 3.369   22.115 1.00 14.93 ? 31  ALA A C   1 
ATOM   252  O O   . ALA A 1 31  ? 20.600 4.001   21.201 1.00 14.45 ? 31  ALA A O   1 
ATOM   253  C CB  . ALA A 1 31  ? 17.730 2.633   22.607 1.00 14.13 ? 31  ALA A CB  1 
ATOM   254  N N   . ASP A 1 32  ? 20.617 2.298   22.676 1.00 15.22 ? 32  ASP A N   1 
ATOM   255  C CA  . ASP A 1 32  ? 21.919 1.803   22.251 1.00 15.47 ? 32  ASP A CA  1 
ATOM   256  C C   . ASP A 1 32  ? 21.942 1.134   20.891 1.00 14.16 ? 32  ASP A C   1 
ATOM   257  O O   . ASP A 1 32  ? 22.982 1.123   20.233 1.00 14.08 ? 32  ASP A O   1 
ATOM   258  C CB  . ASP A 1 32  ? 22.480 0.828   23.290 1.00 19.58 ? 32  ASP A CB  1 
ATOM   259  C CG  . ASP A 1 32  ? 23.201 1.536   24.419 1.00 23.11 ? 32  ASP A CG  1 
ATOM   260  O OD1 . ASP A 1 32  ? 22.597 2.436   25.040 1.00 24.79 ? 32  ASP A OD1 1 
ATOM   261  O OD2 . ASP A 1 32  ? 24.373 1.192   24.681 1.00 24.01 ? 32  ASP A OD2 1 
ATOM   262  N N   . SER A 1 33  ? 20.809 0.586   20.459 1.00 11.72 ? 33  SER A N   1 
ATOM   263  C CA  . SER A 1 33  ? 20.769 -0.105  19.173 1.00 10.92 ? 33  SER A CA  1 
ATOM   264  C C   . SER A 1 33  ? 19.820 0.482   18.134 1.00 10.21 ? 33  SER A C   1 
ATOM   265  O O   . SER A 1 33  ? 19.695 -0.056  17.024 1.00 10.01 ? 33  SER A O   1 
ATOM   266  C CB  . SER A 1 33  ? 20.408 -1.571  19.390 1.00 10.57 ? 33  SER A CB  1 
ATOM   267  O OG  . SER A 1 33  ? 19.084 -1.685  19.884 1.00 10.70 ? 33  SER A OG  1 
ATOM   268  N N   . TYR A 1 34  ? 19.157 1.582   18.470 1.00 9.26  ? 34  TYR A N   1 
ATOM   269  C CA  . TYR A 1 34  ? 18.227 2.188   17.524 1.00 8.45  ? 34  TYR A CA  1 
ATOM   270  C C   . TYR A 1 34  ? 17.840 3.618   17.861 1.00 7.30  ? 34  TYR A C   1 
ATOM   271  O O   . TYR A 1 34  ? 18.050 4.093   18.971 1.00 8.11  ? 34  TYR A O   1 
ATOM   272  C CB  . TYR A 1 34  ? 16.950 1.341   17.434 1.00 8.54  ? 34  TYR A CB  1 
ATOM   273  C CG  . TYR A 1 34  ? 16.027 1.487   18.631 1.00 6.22  ? 34  TYR A CG  1 
ATOM   274  C CD1 . TYR A 1 34  ? 15.118 2.544   18.720 1.00 6.76  ? 34  TYR A CD1 1 
ATOM   275  C CD2 . TYR A 1 34  ? 16.109 0.597   19.701 1.00 7.53  ? 34  TYR A CD2 1 
ATOM   276  C CE1 . TYR A 1 34  ? 14.313 2.714   19.858 1.00 7.44  ? 34  TYR A CE1 1 
ATOM   277  C CE2 . TYR A 1 34  ? 15.317 0.755   20.838 1.00 8.33  ? 34  TYR A CE2 1 
ATOM   278  C CZ  . TYR A 1 34  ? 14.425 1.815   20.912 1.00 7.50  ? 34  TYR A CZ  1 
ATOM   279  O OH  . TYR A 1 34  ? 13.669 1.973   22.049 1.00 7.24  ? 34  TYR A OH  1 
ATOM   280  N N   . TYR A 1 35  ? 17.257 4.286   16.876 1.00 7.71  ? 35  TYR A N   1 
ATOM   281  C CA  . TYR A 1 35  ? 16.791 5.649   17.013 1.00 7.41  ? 35  TYR A CA  1 
ATOM   282  C C   . TYR A 1 35  ? 15.390 5.740   16.417 1.00 7.35  ? 35  TYR A C   1 
ATOM   283  O O   . TYR A 1 35  ? 15.096 5.123   15.384 1.00 6.67  ? 35  TYR A O   1 
ATOM   284  C CB  . TYR A 1 35  ? 17.749 6.606   16.296 1.00 8.19  ? 35  TYR A CB  1 
ATOM   285  C CG  . TYR A 1 35  ? 17.291 8.051   16.278 1.00 9.66  ? 35  TYR A CG  1 
ATOM   286  C CD1 . TYR A 1 35  ? 16.301 8.475   15.399 1.00 10.03 ? 35  TYR A CD1 1 
ATOM   287  C CD2 . TYR A 1 35  ? 17.839 8.990   17.148 1.00 10.15 ? 35  TYR A CD2 1 
ATOM   288  C CE1 . TYR A 1 35  ? 15.867 9.799   15.384 1.00 9.58  ? 35  TYR A CE1 1 
ATOM   289  C CE2 . TYR A 1 35  ? 17.406 10.323  17.141 1.00 10.13 ? 35  TYR A CE2 1 
ATOM   290  C CZ  . TYR A 1 35  ? 16.421 10.712  16.252 1.00 8.59  ? 35  TYR A CZ  1 
ATOM   291  O OH  . TYR A 1 35  ? 15.984 12.009  16.220 1.00 7.90  ? 35  TYR A OH  1 
ATOM   292  N N   . ALA A 1 36  ? 14.517 6.497   17.075 1.00 6.98  ? 36  ALA A N   1 
ATOM   293  C CA  . ALA A 1 36  ? 13.151 6.658   16.587 1.00 6.57  ? 36  ALA A CA  1 
ATOM   294  C C   . ALA A 1 36  ? 12.585 8.003   16.998 1.00 6.54  ? 36  ALA A C   1 
ATOM   295  O O   . ALA A 1 36  ? 12.997 8.588   17.998 1.00 6.78  ? 36  ALA A O   1 
ATOM   296  C CB  . ALA A 1 36  ? 12.259 5.535   17.117 1.00 6.03  ? 36  ALA A CB  1 
ATOM   297  N N   . ARG A 1 37  ? 11.638 8.494   16.212 1.00 6.67  ? 37  ARG A N   1 
ATOM   298  C CA  . ARG A 1 37  ? 11.014 9.769   16.502 1.00 7.29  ? 37  ARG A CA  1 
ATOM   299  C C   . ARG A 1 37  ? 9.803  9.992   15.620 1.00 7.80  ? 37  ARG A C   1 
ATOM   300  O O   . ARG A 1 37  ? 9.652  9.369   14.565 1.00 8.21  ? 37  ARG A O   1 
ATOM   301  C CB  . ARG A 1 37  ? 12.001 10.907  16.267 1.00 7.48  ? 37  ARG A CB  1 
ATOM   302  C CG  . ARG A 1 37  ? 12.510 10.962  14.834 1.00 7.23  ? 37  ARG A CG  1 
ATOM   303  C CD  . ARG A 1 37  ? 13.048 12.338  14.516 1.00 7.32  ? 37  ARG A CD  1 
ATOM   304  N NE  . ARG A 1 37  ? 12.015 13.354  14.683 1.00 8.72  ? 37  ARG A NE  1 
ATOM   305  C CZ  . ARG A 1 37  ? 12.274 14.639  14.903 1.00 10.56 ? 37  ARG A CZ  1 
ATOM   306  N NH1 . ARG A 1 37  ? 13.532 15.051  14.982 1.00 9.65  ? 37  ARG A NH1 1 
ATOM   307  N NH2 . ARG A 1 37  ? 11.281 15.511  15.047 1.00 9.78  ? 37  ARG A NH2 1 
ATOM   308  N N   . SER A 1 38  ? 8.942  10.892  16.075 1.00 7.26  ? 38  SER A N   1 
ATOM   309  C CA  . SER A 1 38  ? 7.750  11.263  15.339 1.00 8.89  ? 38  SER A CA  1 
ATOM   310  C C   . SER A 1 38  ? 8.248  12.025  14.111 1.00 8.54  ? 38  SER A C   1 
ATOM   311  O O   . SER A 1 38  ? 9.350  12.582  14.128 1.00 7.73  ? 38  SER A O   1 
ATOM   312  C CB  . SER A 1 38  ? 6.897  12.184  16.201 1.00 8.63  ? 38  SER A CB  1 
ATOM   313  O OG  . SER A 1 38  ? 7.643  13.345  16.540 1.00 7.22  ? 38  SER A OG  1 
ATOM   314  N N   . LEU A 1 39  ? 7.446  12.057  13.056 1.00 8.22  ? 39  LEU A N   1 
ATOM   315  C CA  . LEU A 1 39  ? 7.842  12.755  11.835 1.00 8.74  ? 39  LEU A CA  1 
ATOM   316  C C   . LEU A 1 39  ? 6.616  13.112  11.013 1.00 11.21 ? 39  LEU A C   1 
ATOM   317  O O   . LEU A 1 39  ? 5.748  12.266  10.788 1.00 11.92 ? 39  LEU A O   1 
ATOM   318  C CB  . LEU A 1 39  ? 8.784  11.876  11.012 1.00 6.88  ? 39  LEU A CB  1 
ATOM   319  C CG  . LEU A 1 39  ? 9.239  12.360  9.631  1.00 9.77  ? 39  LEU A CG  1 
ATOM   320  C CD1 . LEU A 1 39  ? 9.834  13.751  9.751  1.00 6.83  ? 39  LEU A CD1 1 
ATOM   321  C CD2 . LEU A 1 39  ? 10.268 11.381  9.041  1.00 4.54  ? 39  LEU A CD2 1 
ATOM   322  N N   . ALA A 1 40  ? 6.550  14.367  10.575 1.00 11.81 ? 40  ALA A N   1 
ATOM   323  C CA  . ALA A 1 40  ? 5.431  14.853  9.779  1.00 13.91 ? 40  ALA A CA  1 
ATOM   324  C C   . ALA A 1 40  ? 5.873  15.420  8.436  1.00 15.85 ? 40  ALA A C   1 
ATOM   325  O O   . ALA A 1 40  ? 6.639  16.383  8.373  1.00 16.80 ? 40  ALA A O   1 
ATOM   326  C CB  . ALA A 1 40  ? 4.658  15.921  10.556 1.00 13.76 ? 40  ALA A CB  1 
ATOM   327  N N   . VAL A 1 41  ? 5.398  14.809  7.358  1.00 17.59 ? 41  VAL A N   1 
ATOM   328  C CA  . VAL A 1 41  ? 5.709  15.275  6.013  1.00 18.41 ? 41  VAL A CA  1 
ATOM   329  C C   . VAL A 1 41  ? 4.351  15.668  5.440  1.00 18.80 ? 41  VAL A C   1 
ATOM   330  O O   . VAL A 1 41  ? 3.582  14.815  4.991  1.00 19.57 ? 41  VAL A O   1 
ATOM   331  C CB  . VAL A 1 41  ? 6.357  14.155  5.167  1.00 19.16 ? 41  VAL A CB  1 
ATOM   332  C CG1 . VAL A 1 41  ? 6.751  14.691  3.795  1.00 17.36 ? 41  VAL A CG1 1 
ATOM   333  C CG2 . VAL A 1 41  ? 7.575  13.601  5.895  1.00 18.37 ? 41  VAL A CG2 1 
ATOM   334  N N   . GLY A 1 42  ? 4.050  16.963  5.479  1.00 19.91 ? 42  GLY A N   1 
ATOM   335  C CA  . GLY A 1 42  ? 2.762  17.428  5.006  1.00 18.78 ? 42  GLY A CA  1 
ATOM   336  C C   . GLY A 1 42  ? 1.737  16.914  5.997  1.00 19.59 ? 42  GLY A C   1 
ATOM   337  O O   . GLY A 1 42  ? 1.942  17.007  7.208  1.00 18.17 ? 42  GLY A O   1 
ATOM   338  N N   . GLU A 1 43  ? 0.644  16.347  5.497  1.00 20.33 ? 43  GLU A N   1 
ATOM   339  C CA  . GLU A 1 43  ? -0.389 15.826  6.381  1.00 21.18 ? 43  GLU A CA  1 
ATOM   340  C C   . GLU A 1 43  ? -0.129 14.368  6.743  1.00 20.82 ? 43  GLU A C   1 
ATOM   341  O O   . GLU A 1 43  ? -0.963 13.712  7.373  1.00 21.94 ? 43  GLU A O   1 
ATOM   342  C CB  . GLU A 1 43  ? -1.775 15.984  5.742  1.00 23.34 ? 43  GLU A CB  1 
ATOM   343  C CG  . GLU A 1 43  ? -2.199 17.444  5.545  1.00 24.85 ? 43  GLU A CG  1 
ATOM   344  C CD  . GLU A 1 43  ? -2.052 18.276  6.813  1.00 26.58 ? 43  GLU A CD  1 
ATOM   345  O OE1 . GLU A 1 43  ? -2.721 17.969  7.824  1.00 25.26 ? 43  GLU A OE1 1 
ATOM   346  O OE2 . GLU A 1 43  ? -1.257 19.239  6.800  1.00 29.13 ? 43  GLU A OE2 1 
ATOM   347  N N   . TYR A 1 44  ? 1.036  13.863  6.347  1.00 19.32 ? 44  TYR A N   1 
ATOM   348  C CA  . TYR A 1 44  ? 1.408  12.487  6.659  1.00 16.91 ? 44  TYR A CA  1 
ATOM   349  C C   . TYR A 1 44  ? 2.199  12.470  7.958  1.00 15.45 ? 44  TYR A C   1 
ATOM   350  O O   . TYR A 1 44  ? 3.219  13.149  8.087  1.00 14.83 ? 44  TYR A O   1 
ATOM   351  C CB  . TYR A 1 44  ? 2.231  11.889  5.525  1.00 15.74 ? 44  TYR A CB  1 
ATOM   352  C CG  . TYR A 1 44  ? 1.459  11.787  4.236  1.00 15.44 ? 44  TYR A CG  1 
ATOM   353  C CD1 . TYR A 1 44  ? 0.431  10.857  4.088  1.00 14.86 ? 44  TYR A CD1 1 
ATOM   354  C CD2 . TYR A 1 44  ? 1.753  12.626  3.159  1.00 15.02 ? 44  TYR A CD2 1 
ATOM   355  C CE1 . TYR A 1 44  ? -0.286 10.762  2.897  1.00 14.68 ? 44  TYR A CE1 1 
ATOM   356  C CE2 . TYR A 1 44  ? 1.048  12.540  1.966  1.00 14.29 ? 44  TYR A CE2 1 
ATOM   357  C CZ  . TYR A 1 44  ? 0.032  11.608  1.840  1.00 14.62 ? 44  TYR A CZ  1 
ATOM   358  O OH  . TYR A 1 44  ? -0.656 11.518  0.654  1.00 14.87 ? 44  TYR A OH  1 
ATOM   359  N N   . ARG A 1 45  ? 1.722  11.684  8.913  1.00 13.97 ? 45  ARG A N   1 
ATOM   360  C CA  . ARG A 1 45  ? 2.352  11.602  10.222 1.00 13.30 ? 45  ARG A CA  1 
ATOM   361  C C   . ARG A 1 45  ? 2.605  10.165  10.687 1.00 11.17 ? 45  ARG A C   1 
ATOM   362  O O   . ARG A 1 45  ? 1.886  9.239   10.313 1.00 9.44  ? 45  ARG A O   1 
ATOM   363  C CB  . ARG A 1 45  ? 1.488  12.351  11.248 1.00 14.21 ? 45  ARG A CB  1 
ATOM   364  C CG  . ARG A 1 45  ? 1.412  13.868  11.002 1.00 17.80 ? 45  ARG A CG  1 
ATOM   365  C CD  . ARG A 1 45  ? 0.474  14.566  11.976 1.00 20.43 ? 45  ARG A CD  1 
ATOM   366  N NE  . ARG A 1 45  ? -0.639 15.211  11.284 1.00 24.61 ? 45  ARG A NE  1 
ATOM   367  C CZ  . ARG A 1 45  ? -0.591 16.430  10.749 1.00 26.07 ? 45  ARG A CZ  1 
ATOM   368  N NH1 . ARG A 1 45  ? 0.518  17.155  10.828 1.00 26.06 ? 45  ARG A NH1 1 
ATOM   369  N NH2 . ARG A 1 45  ? -1.650 16.921  10.119 1.00 25.30 ? 45  ARG A NH2 1 
ATOM   370  N N   . GLY A 1 46  ? 3.644  9.989   11.494 1.00 9.99  ? 46  GLY A N   1 
ATOM   371  C CA  . GLY A 1 46  ? 3.963  8.663   11.988 1.00 9.11  ? 46  GLY A CA  1 
ATOM   372  C C   . GLY A 1 46  ? 5.243  8.570   12.791 1.00 5.87  ? 46  GLY A C   1 
ATOM   373  O O   . GLY A 1 46  ? 5.760  9.567   13.304 1.00 6.31  ? 46  GLY A O   1 
ATOM   374  N N   . VAL A 1 47  ? 5.757  7.354   12.885 1.00 6.39  ? 47  VAL A N   1 
ATOM   375  C CA  . VAL A 1 47  ? 6.969  7.089   13.636 1.00 7.36  ? 47  VAL A CA  1 
ATOM   376  C C   . VAL A 1 47  ? 8.006  6.429   12.754 1.00 5.64  ? 47  VAL A C   1 
ATOM   377  O O   . VAL A 1 47  ? 7.730  5.439   12.100 1.00 8.64  ? 47  VAL A O   1 
ATOM   378  C CB  . VAL A 1 47  ? 6.665  6.175   14.845 1.00 7.92  ? 47  VAL A CB  1 
ATOM   379  C CG1 . VAL A 1 47  ? 7.964  5.719   15.520 1.00 4.91  ? 47  VAL A CG1 1 
ATOM   380  C CG2 . VAL A 1 47  ? 5.783  6.926   15.829 1.00 6.16  ? 47  VAL A CG2 1 
ATOM   381  N N   . VAL A 1 48  ? 9.202  6.993   12.745 1.00 6.05  ? 48  VAL A N   1 
ATOM   382  C CA  . VAL A 1 48  ? 10.295 6.460   11.957 1.00 6.43  ? 48  VAL A CA  1 
ATOM   383  C C   . VAL A 1 48  ? 11.274 5.811   12.919 1.00 4.35  ? 48  VAL A C   1 
ATOM   384  O O   . VAL A 1 48  ? 11.586 6.374   13.960 1.00 3.61  ? 48  VAL A O   1 
ATOM   385  C CB  . VAL A 1 48  ? 11.025 7.586   11.218 1.00 5.23  ? 48  VAL A CB  1 
ATOM   386  C CG1 . VAL A 1 48  ? 12.116 7.020   10.341 1.00 1.64  ? 48  VAL A CG1 1 
ATOM   387  C CG2 . VAL A 1 48  ? 10.037 8.378   10.419 1.00 9.71  ? 48  VAL A CG2 1 
ATOM   388  N N   . THR A 1 49  ? 11.754 4.628   12.567 1.00 3.80  ? 49  THR A N   1 
ATOM   389  C CA  . THR A 1 49  ? 12.707 3.929   13.411 1.00 4.19  ? 49  THR A CA  1 
ATOM   390  C C   . THR A 1 49  ? 13.916 3.525   12.575 1.00 4.22  ? 49  THR A C   1 
ATOM   391  O O   . THR A 1 49  ? 13.776 2.987   11.479 1.00 4.43  ? 49  THR A O   1 
ATOM   392  C CB  . THR A 1 49  ? 12.057 2.683   14.041 1.00 2.55  ? 49  THR A CB  1 
ATOM   393  O OG1 . THR A 1 49  ? 10.919 3.089   14.816 1.00 1.13  ? 49  THR A OG1 1 
ATOM   394  C CG2 . THR A 1 49  ? 13.041 1.946   14.931 1.00 1.13  ? 49  THR A CG2 1 
ATOM   395  N N   . ALA A 1 50  ? 15.103 3.812   13.092 1.00 3.60  ? 50  ALA A N   1 
ATOM   396  C CA  . ALA A 1 50  ? 16.331 3.477   12.390 1.00 5.26  ? 50  ALA A CA  1 
ATOM   397  C C   . ALA A 1 50  ? 17.130 2.452   13.204 1.00 5.61  ? 50  ALA A C   1 
ATOM   398  O O   . ALA A 1 50  ? 17.465 2.685   14.372 1.00 4.40  ? 50  ALA A O   1 
ATOM   399  C CB  . ALA A 1 50  ? 17.147 4.738   12.158 1.00 3.75  ? 50  ALA A CB  1 
ATOM   400  N N   . ILE A 1 51  ? 17.428 1.324   12.571 1.00 5.94  ? 51  ILE A N   1 
ATOM   401  C CA  . ILE A 1 51  ? 18.158 0.233   13.196 1.00 6.10  ? 51  ILE A CA  1 
ATOM   402  C C   . ILE A 1 51  ? 19.418 -0.078  12.407 1.00 6.95  ? 51  ILE A C   1 
ATOM   403  O O   . ILE A 1 51  ? 19.355 -0.542  11.270 1.00 9.07  ? 51  ILE A O   1 
ATOM   404  C CB  . ILE A 1 51  ? 17.298 -1.046  13.232 1.00 7.74  ? 51  ILE A CB  1 
ATOM   405  C CG1 . ILE A 1 51  ? 15.982 -0.750  13.944 1.00 6.56  ? 51  ILE A CG1 1 
ATOM   406  C CG2 . ILE A 1 51  ? 18.061 -2.185  13.929 1.00 6.43  ? 51  ILE A CG2 1 
ATOM   407  C CD1 . ILE A 1 51  ? 14.888 -1.765  13.646 1.00 9.31  ? 51  ILE A CD1 1 
ATOM   408  N N   . PRO A 1 52  ? 20.585 0.195   12.991 1.00 6.21  ? 52  PRO A N   1 
ATOM   409  C CA  . PRO A 1 52  ? 21.822 -0.092  12.270 1.00 7.07  ? 52  PRO A CA  1 
ATOM   410  C C   . PRO A 1 52  ? 22.261 -1.554  12.376 1.00 8.54  ? 52  PRO A C   1 
ATOM   411  O O   . PRO A 1 52  ? 22.047 -2.210  13.396 1.00 9.67  ? 52  PRO A O   1 
ATOM   412  C CB  . PRO A 1 52  ? 22.813 0.875   12.906 1.00 7.07  ? 52  PRO A CB  1 
ATOM   413  C CG  . PRO A 1 52  ? 22.313 0.999   14.296 1.00 8.04  ? 52  PRO A CG  1 
ATOM   414  C CD  . PRO A 1 52  ? 20.828 1.118   14.111 1.00 6.29  ? 52  PRO A CD  1 
ATOM   415  N N   . ASP A 1 53  ? 22.850 -2.053  11.296 1.00 9.06  ? 53  ASP A N   1 
ATOM   416  C CA  . ASP A 1 53  ? 23.376 -3.415  11.219 1.00 11.07 ? 53  ASP A CA  1 
ATOM   417  C C   . ASP A 1 53  ? 24.852 -3.188  10.927 1.00 11.89 ? 53  ASP A C   1 
ATOM   418  O O   . ASP A 1 53  ? 25.284 -3.215  9.770  1.00 11.90 ? 53  ASP A O   1 
ATOM   419  C CB  . ASP A 1 53  ? 22.745 -4.191  10.059 1.00 12.05 ? 53  ASP A CB  1 
ATOM   420  C CG  . ASP A 1 53  ? 23.334 -5.593  9.906  1.00 13.00 ? 53  ASP A CG  1 
ATOM   421  O OD1 . ASP A 1 53  ? 24.562 -5.744  10.072 1.00 12.12 ? 53  ASP A OD1 1 
ATOM   422  O OD2 . ASP A 1 53  ? 22.572 -6.540  9.602  1.00 13.07 ? 53  ASP A OD2 1 
ATOM   423  N N   . ILE A 1 54  ? 25.611 -2.947  11.987 1.00 11.89 ? 54  ILE A N   1 
ATOM   424  C CA  . ILE A 1 54  ? 27.030 -2.663  11.880 1.00 12.50 ? 54  ILE A CA  1 
ATOM   425  C C   . ILE A 1 54  ? 27.800 -3.634  11.003 1.00 13.01 ? 54  ILE A C   1 
ATOM   426  O O   . ILE A 1 54  ? 28.503 -3.216  10.084 1.00 12.38 ? 54  ILE A O   1 
ATOM   427  C CB  . ILE A 1 54  ? 27.664 -2.617  13.277 1.00 12.81 ? 54  ILE A CB  1 
ATOM   428  C CG1 . ILE A 1 54  ? 26.908 -1.598  14.128 1.00 12.90 ? 54  ILE A CG1 1 
ATOM   429  C CG2 . ILE A 1 54  ? 29.138 -2.249  13.175 1.00 9.97  ? 54  ILE A CG2 1 
ATOM   430  C CD1 . ILE A 1 54  ? 27.320 -1.585  15.581 1.00 17.37 ? 54  ILE A CD1 1 
ATOM   431  N N   . ALA A 1 55  ? 27.666 -4.923  11.290 1.00 13.41 ? 55  ALA A N   1 
ATOM   432  C CA  . ALA A 1 55  ? 28.366 -5.954  10.532 1.00 15.85 ? 55  ALA A CA  1 
ATOM   433  C C   . ALA A 1 55  ? 28.165 -5.793  9.030  1.00 16.55 ? 55  ALA A C   1 
ATOM   434  O O   . ALA A 1 55  ? 29.125 -5.856  8.259  1.00 17.47 ? 55  ALA A O   1 
ATOM   435  C CB  . ALA A 1 55  ? 27.900 -7.333  10.976 1.00 16.26 ? 55  ALA A CB  1 
ATOM   436  N N   . ARG A 1 56  ? 26.926 -5.585  8.602  1.00 16.13 ? 56  ARG A N   1 
ATOM   437  C CA  . ARG A 1 56  ? 26.677 -5.426  7.176  1.00 17.09 ? 56  ARG A CA  1 
ATOM   438  C C   . ARG A 1 56  ? 26.638 -3.966  6.721  1.00 16.85 ? 56  ARG A C   1 
ATOM   439  O O   . ARG A 1 56  ? 26.262 -3.673  5.586  1.00 15.18 ? 56  ARG A O   1 
ATOM   440  C CB  . ARG A 1 56  ? 25.385 -6.160  6.778  1.00 18.93 ? 56  ARG A CB  1 
ATOM   441  C CG  . ARG A 1 56  ? 25.559 -7.688  6.704  1.00 24.33 ? 56  ARG A CG  1 
ATOM   442  C CD  . ARG A 1 56  ? 24.396 -8.403  6.002  1.00 27.48 ? 56  ARG A CD  1 
ATOM   443  N NE  . ARG A 1 56  ? 23.231 -8.603  6.863  1.00 29.45 ? 56  ARG A NE  1 
ATOM   444  C CZ  . ARG A 1 56  ? 23.119 -9.564  7.778  1.00 30.98 ? 56  ARG A CZ  1 
ATOM   445  N NH1 . ARG A 1 56  ? 24.106 -10.433 7.963  1.00 31.76 ? 56  ARG A NH1 1 
ATOM   446  N NH2 . ARG A 1 56  ? 22.013 -9.660  8.507  1.00 30.88 ? 56  ARG A NH2 1 
ATOM   447  N N   . HIS A 1 57  ? 27.075 -3.062  7.598  1.00 17.00 ? 57  HIS A N   1 
ATOM   448  C CA  . HIS A 1 57  ? 27.084 -1.622  7.323  1.00 16.74 ? 57  HIS A CA  1 
ATOM   449  C C   . HIS A 1 57  ? 25.859 -1.171  6.525  1.00 16.42 ? 57  HIS A C   1 
ATOM   450  O O   . HIS A 1 57  ? 25.970 -0.513  5.490  1.00 14.70 ? 57  HIS A O   1 
ATOM   451  C CB  . HIS A 1 57  ? 28.386 -1.203  6.610  1.00 16.54 ? 57  HIS A CB  1 
ATOM   452  C CG  . HIS A 1 57  ? 28.631 -1.901  5.305  1.00 17.63 ? 57  HIS A CG  1 
ATOM   453  N ND1 . HIS A 1 57  ? 27.909 -1.628  4.161  1.00 15.54 ? 57  HIS A ND1 1 
ATOM   454  C CD2 . HIS A 1 57  ? 29.528 -2.858  4.965  1.00 16.43 ? 57  HIS A CD2 1 
ATOM   455  C CE1 . HIS A 1 57  ? 28.352 -2.385  3.173  1.00 15.88 ? 57  HIS A CE1 1 
ATOM   456  N NE2 . HIS A 1 57  ? 29.334 -3.140  3.634  1.00 17.06 ? 57  HIS A NE2 1 
ATOM   457  N N   . THR A 1 58  ? 24.685 -1.539  7.035  1.00 15.40 ? 58  THR A N   1 
ATOM   458  C CA  . THR A 1 58  ? 23.411 -1.194  6.417  1.00 13.20 ? 58  THR A CA  1 
ATOM   459  C C   . THR A 1 58  ? 22.440 -0.743  7.505  1.00 12.72 ? 58  THR A C   1 
ATOM   460  O O   . THR A 1 58  ? 22.269 -1.425  8.521  1.00 11.48 ? 58  THR A O   1 
ATOM   461  C CB  . THR A 1 58  ? 22.776 -2.404  5.667  1.00 14.52 ? 58  THR A CB  1 
ATOM   462  O OG1 . THR A 1 58  ? 22.604 -3.495  6.577  1.00 17.89 ? 58  THR A OG1 1 
ATOM   463  C CG2 . THR A 1 58  ? 23.650 -2.857  4.503  1.00 11.21 ? 58  THR A CG2 1 
ATOM   464  N N   . LEU A 1 59  ? 21.810 0.414   7.291  1.00 10.15 ? 59  LEU A N   1 
ATOM   465  C CA  . LEU A 1 59  ? 20.847 0.960   8.240  1.00 7.48  ? 59  LEU A CA  1 
ATOM   466  C C   . LEU A 1 59  ? 19.418 0.579   7.823  1.00 8.70  ? 59  LEU A C   1 
ATOM   467  O O   . LEU A 1 59  ? 18.967 0.945   6.736  1.00 8.71  ? 59  LEU A O   1 
ATOM   468  C CB  . LEU A 1 59  ? 20.978 2.488   8.296  1.00 4.47  ? 59  LEU A CB  1 
ATOM   469  C CG  . LEU A 1 59  ? 20.068 3.232   9.278  1.00 2.16  ? 59  LEU A CG  1 
ATOM   470  C CD1 . LEU A 1 59  ? 20.435 2.818   10.699 1.00 1.13  ? 59  LEU A CD1 1 
ATOM   471  C CD2 . LEU A 1 59  ? 20.217 4.741   9.106  1.00 1.66  ? 59  LEU A CD2 1 
ATOM   472  N N   . HIS A 1 60  ? 18.716 -0.159  8.682  1.00 7.95  ? 60  HIS A N   1 
ATOM   473  C CA  . HIS A 1 60  ? 17.338 -0.580  8.407  1.00 7.49  ? 60  HIS A CA  1 
ATOM   474  C C   . HIS A 1 60  ? 16.363 0.429   9.003  1.00 7.49  ? 60  HIS A C   1 
ATOM   475  O O   . HIS A 1 60  ? 16.422 0.718   10.194 1.00 8.26  ? 60  HIS A O   1 
ATOM   476  C CB  . HIS A 1 60  ? 17.054 -1.960  9.013  1.00 6.24  ? 60  HIS A CB  1 
ATOM   477  C CG  . HIS A 1 60  ? 17.781 -3.086  8.343  1.00 9.95  ? 60  HIS A CG  1 
ATOM   478  N ND1 . HIS A 1 60  ? 17.224 -3.837  7.324  1.00 9.66  ? 60  HIS A ND1 1 
ATOM   479  C CD2 . HIS A 1 60  ? 19.008 -3.615  8.573  1.00 9.53  ? 60  HIS A CD2 1 
ATOM   480  C CE1 . HIS A 1 60  ? 18.073 -4.782  6.962  1.00 6.69  ? 60  HIS A CE1 1 
ATOM   481  N NE2 . HIS A 1 60  ? 19.163 -4.669  7.703  1.00 9.07  ? 60  HIS A NE2 1 
ATOM   482  N N   . ILE A 1 61  ? 15.464 0.948   8.165  1.00 7.66  ? 61  ILE A N   1 
ATOM   483  C CA  . ILE A 1 61  ? 14.471 1.948   8.563  1.00 5.85  ? 61  ILE A CA  1 
ATOM   484  C C   . ILE A 1 61  ? 13.042 1.365   8.562  1.00 7.25  ? 61  ILE A C   1 
ATOM   485  O O   . ILE A 1 61  ? 12.638 0.710   7.603  1.00 5.58  ? 61  ILE A O   1 
ATOM   486  C CB  . ILE A 1 61  ? 14.485 3.143   7.578  1.00 6.22  ? 61  ILE A CB  1 
ATOM   487  C CG1 . ILE A 1 61  ? 15.911 3.690   7.422  1.00 6.84  ? 61  ILE A CG1 1 
ATOM   488  C CG2 . ILE A 1 61  ? 13.495 4.206   8.029  1.00 2.35  ? 61  ILE A CG2 1 
ATOM   489  C CD1 . ILE A 1 61  ? 16.500 4.314   8.665  1.00 10.53 ? 61  ILE A CD1 1 
ATOM   490  N N   . ASN A 1 62  ? 12.286 1.616   9.628  1.00 6.54  ? 62  ASN A N   1 
ATOM   491  C CA  . ASN A 1 62  ? 10.911 1.135   9.734  1.00 9.35  ? 62  ASN A CA  1 
ATOM   492  C C   . ASN A 1 62  ? 9.993  2.347   9.868  1.00 10.01 ? 62  ASN A C   1 
ATOM   493  O O   . ASN A 1 62  ? 10.252 3.256   10.662 1.00 9.93  ? 62  ASN A O   1 
ATOM   494  C CB  . ASN A 1 62  ? 10.743 0.227   10.961 1.00 10.94 ? 62  ASN A CB  1 
ATOM   495  C CG  . ASN A 1 62  ? 9.368  -0.429  11.028 1.00 12.49 ? 62  ASN A CG  1 
ATOM   496  O OD1 . ASN A 1 62  ? 9.083  -1.376  10.292 1.00 14.54 ? 62  ASN A OD1 1 
ATOM   497  N ND2 . ASN A 1 62  ? 8.508  0.076   11.907 1.00 10.94 ? 62  ASN A ND2 1 
ATOM   498  N N   . LEU A 1 63  ? 8.920  2.362   9.090  1.00 10.34 ? 63  LEU A N   1 
ATOM   499  C CA  . LEU A 1 63  ? 7.982  3.473   9.141  1.00 10.34 ? 63  LEU A CA  1 
ATOM   500  C C   . LEU A 1 63  ? 6.613  2.960   9.562  1.00 10.10 ? 63  LEU A C   1 
ATOM   501  O O   . LEU A 1 63  ? 6.230  1.845   9.212  1.00 8.96  ? 63  LEU A O   1 
ATOM   502  C CB  . LEU A 1 63  ? 7.891  4.140   7.765  1.00 9.41  ? 63  LEU A CB  1 
ATOM   503  C CG  . LEU A 1 63  ? 9.207  4.697   7.201  1.00 11.71 ? 63  LEU A CG  1 
ATOM   504  C CD1 . LEU A 1 63  ? 9.056  5.001   5.718  1.00 11.81 ? 63  LEU A CD1 1 
ATOM   505  C CD2 . LEU A 1 63  ? 9.614  5.940   7.973  1.00 7.69  ? 63  LEU A CD2 1 
ATOM   506  N N   . SER A 1 64  ? 5.888  3.763   10.332 1.00 8.99  ? 64  SER A N   1 
ATOM   507  C CA  . SER A 1 64  ? 4.551  3.369   10.737 1.00 8.97  ? 64  SER A CA  1 
ATOM   508  C C   . SER A 1 64  ? 3.689  3.638   9.507  1.00 9.93  ? 64  SER A C   1 
ATOM   509  O O   . SER A 1 64  ? 4.069  4.424   8.629  1.00 7.61  ? 64  SER A O   1 
ATOM   510  C CB  . SER A 1 64  ? 4.058  4.212   11.912 1.00 8.14  ? 64  SER A CB  1 
ATOM   511  O OG  . SER A 1 64  ? 3.819  5.543   11.504 1.00 10.54 ? 64  SER A OG  1 
ATOM   512  N N   . ALA A 1 65  ? 2.536  2.981   9.446  1.00 9.33  ? 65  ALA A N   1 
ATOM   513  C CA  . ALA A 1 65  ? 1.611  3.109   8.325  1.00 9.12  ? 65  ALA A CA  1 
ATOM   514  C C   . ALA A 1 65  ? 1.334  4.527   7.803  1.00 8.97  ? 65  ALA A C   1 
ATOM   515  O O   . ALA A 1 65  ? 1.163  4.719   6.600  1.00 10.18 ? 65  ALA A O   1 
ATOM   516  C CB  . ALA A 1 65  ? 0.289  2.421   8.686  1.00 7.69  ? 65  ALA A CB  1 
ATOM   517  N N   . GLY A 1 66  ? 1.280  5.514   8.692  1.00 7.93  ? 66  GLY A N   1 
ATOM   518  C CA  . GLY A 1 66  ? 0.991  6.874   8.255  1.00 6.75  ? 66  GLY A CA  1 
ATOM   519  C C   . GLY A 1 66  ? 2.031  7.589   7.407  1.00 6.52  ? 66  GLY A C   1 
ATOM   520  O O   . GLY A 1 66  ? 1.757  8.648   6.851  1.00 7.35  ? 66  GLY A O   1 
ATOM   521  N N   . LEU A 1 67  ? 3.219  7.008   7.292  1.00 6.55  ? 67  LEU A N   1 
ATOM   522  C CA  . LEU A 1 67  ? 4.297  7.616   6.524  1.00 6.01  ? 67  LEU A CA  1 
ATOM   523  C C   . LEU A 1 67  ? 4.650  6.895   5.233  1.00 5.47  ? 67  LEU A C   1 
ATOM   524  O O   . LEU A 1 67  ? 5.428  7.413   4.427  1.00 4.87  ? 67  LEU A O   1 
ATOM   525  C CB  . LEU A 1 67  ? 5.547  7.712   7.394  1.00 2.96  ? 67  LEU A CB  1 
ATOM   526  C CG  . LEU A 1 67  ? 5.407  8.626   8.610  1.00 3.78  ? 67  LEU A CG  1 
ATOM   527  C CD1 . LEU A 1 67  ? 6.656  8.514   9.475  1.00 2.67  ? 67  LEU A CD1 1 
ATOM   528  C CD2 . LEU A 1 67  ? 5.189  10.070  8.148  1.00 3.53  ? 67  LEU A CD2 1 
ATOM   529  N N   . GLU A 1 68  ? 4.092  5.703   5.035  1.00 6.15  ? 68  GLU A N   1 
ATOM   530  C CA  . GLU A 1 68  ? 4.389  4.932   3.830  1.00 8.75  ? 68  GLU A CA  1 
ATOM   531  C C   . GLU A 1 68  ? 4.248  5.721   2.530  1.00 7.05  ? 68  GLU A C   1 
ATOM   532  O O   . GLU A 1 68  ? 5.097  5.612   1.656  1.00 9.57  ? 68  GLU A O   1 
ATOM   533  C CB  . GLU A 1 68  ? 3.531  3.661   3.754  1.00 8.40  ? 68  GLU A CB  1 
ATOM   534  C CG  . GLU A 1 68  ? 3.933  2.535   4.710  1.00 10.86 ? 68  GLU A CG  1 
ATOM   535  C CD  . GLU A 1 68  ? 5.384  2.062   4.555  1.00 14.11 ? 68  GLU A CD  1 
ATOM   536  O OE1 . GLU A 1 68  ? 6.049  2.390   3.542  1.00 11.60 ? 68  GLU A OE1 1 
ATOM   537  O OE2 . GLU A 1 68  ? 5.860  1.338   5.460  1.00 15.53 ? 68  GLU A OE2 1 
ATOM   538  N N   . PRO A 1 69  ? 3.181  6.520   2.382  1.00 6.63  ? 69  PRO A N   1 
ATOM   539  C CA  . PRO A 1 69  ? 3.022  7.289   1.140  1.00 8.76  ? 69  PRO A CA  1 
ATOM   540  C C   . PRO A 1 69  ? 4.222  8.169   0.794  1.00 8.01  ? 69  PRO A C   1 
ATOM   541  O O   . PRO A 1 69  ? 4.526  8.381   -0.380 1.00 8.65  ? 69  PRO A O   1 
ATOM   542  C CB  . PRO A 1 69  ? 1.750  8.101   1.398  1.00 8.55  ? 69  PRO A CB  1 
ATOM   543  C CG  . PRO A 1 69  ? 0.934  7.152   2.223  1.00 9.19  ? 69  PRO A CG  1 
ATOM   544  C CD  . PRO A 1 69  ? 1.966  6.615   3.214  1.00 8.42  ? 69  PRO A CD  1 
ATOM   545  N N   . VAL A 1 70  ? 4.903  8.671   1.819  1.00 8.06  ? 70  VAL A N   1 
ATOM   546  C CA  . VAL A 1 70  ? 6.077  9.520   1.625  1.00 6.95  ? 70  VAL A CA  1 
ATOM   547  C C   . VAL A 1 70  ? 7.344  8.870   2.175  1.00 8.13  ? 70  VAL A C   1 
ATOM   548  O O   . VAL A 1 70  ? 8.254  9.556   2.673  1.00 6.02  ? 70  VAL A O   1 
ATOM   549  C CB  . VAL A 1 70  ? 5.909  10.900  2.305  1.00 8.00  ? 70  VAL A CB  1 
ATOM   550  C CG1 . VAL A 1 70  ? 4.966  11.760  1.490  1.00 6.69  ? 70  VAL A CG1 1 
ATOM   551  C CG2 . VAL A 1 70  ? 5.388  10.733  3.725  1.00 6.74  ? 70  VAL A CG2 1 
ATOM   552  N N   . ALA A 1 71  ? 7.399  7.545   2.071  1.00 6.69  ? 71  ALA A N   1 
ATOM   553  C CA  . ALA A 1 71  ? 8.531  6.759   2.544  1.00 6.54  ? 71  ALA A CA  1 
ATOM   554  C C   . ALA A 1 71  ? 9.871  7.302   2.062  1.00 6.46  ? 71  ALA A C   1 
ATOM   555  O O   . ALA A 1 71  ? 10.803 7.471   2.856  1.00 7.44  ? 71  ALA A O   1 
ATOM   556  C CB  . ALA A 1 71  ? 8.364  5.303   2.097  1.00 6.49  ? 71  ALA A CB  1 
ATOM   557  N N   . ALA A 1 72  ? 9.955  7.566   0.758  1.00 4.36  ? 72  ALA A N   1 
ATOM   558  C CA  . ALA A 1 72  ? 11.162 8.075   0.106  1.00 4.94  ? 72  ALA A CA  1 
ATOM   559  C C   . ALA A 1 72  ? 11.736 9.347   0.729  1.00 3.30  ? 72  ALA A C   1 
ATOM   560  O O   . ALA A 1 72  ? 12.950 9.482   0.890  1.00 1.13  ? 72  ALA A O   1 
ATOM   561  C CB  . ALA A 1 72  ? 10.892 8.313   -1.391 1.00 4.33  ? 72  ALA A CB  1 
ATOM   562  N N   . GLU A 1 73  ? 10.864 10.292  1.037  1.00 3.75  ? 73  GLU A N   1 
ATOM   563  C CA  . GLU A 1 73  ? 11.310 11.532  1.642  1.00 4.79  ? 73  GLU A CA  1 
ATOM   564  C C   . GLU A 1 73  ? 11.698 11.227  3.093  1.00 4.52  ? 73  GLU A C   1 
ATOM   565  O O   . GLU A 1 73  ? 12.565 11.885  3.657  1.00 3.34  ? 73  GLU A O   1 
ATOM   566  C CB  . GLU A 1 73  ? 10.209 12.595  1.557  1.00 6.37  ? 73  GLU A CB  1 
ATOM   567  C CG  . GLU A 1 73  ? 10.596 13.974  2.084  1.00 10.75 ? 73  GLU A CG  1 
ATOM   568  C CD  . GLU A 1 73  ? 11.965 14.445  1.589  1.00 13.45 ? 73  GLU A CD  1 
ATOM   569  O OE1 . GLU A 1 73  ? 12.255 14.335  0.379  1.00 17.58 ? 73  GLU A OE1 1 
ATOM   570  O OE2 . GLU A 1 73  ? 12.753 14.943  2.417  1.00 10.26 ? 73  GLU A OE2 1 
ATOM   571  N N   . CYS A 1 74  ? 11.080 10.211  3.689  1.00 3.92  ? 74  CYS A N   1 
ATOM   572  C CA  . CYS A 1 74  ? 11.438 9.840   5.055  1.00 3.60  ? 74  CYS A CA  1 
ATOM   573  C C   . CYS A 1 74  ? 12.830 9.227   5.042  1.00 3.85  ? 74  CYS A C   1 
ATOM   574  O O   . CYS A 1 74  ? 13.630 9.467   5.939  1.00 1.13  ? 74  CYS A O   1 
ATOM   575  C CB  . CYS A 1 74  ? 10.451 8.823   5.628  1.00 1.48  ? 74  CYS A CB  1 
ATOM   576  S SG  . CYS A 1 74  ? 8.836  9.529   6.058  1.00 2.43  ? 74  CYS A SG  1 
ATOM   577  N N   . LEU A 1 75  ? 13.113 8.423   4.022  1.00 4.81  ? 75  LEU A N   1 
ATOM   578  C CA  . LEU A 1 75  ? 14.419 7.798   3.928  1.00 4.76  ? 75  LEU A CA  1 
ATOM   579  C C   . LEU A 1 75  ? 15.458 8.882   3.687  1.00 6.45  ? 75  LEU A C   1 
ATOM   580  O O   . LEU A 1 75  ? 16.553 8.847   4.261  1.00 6.46  ? 75  LEU A O   1 
ATOM   581  C CB  . LEU A 1 75  ? 14.445 6.778   2.784  1.00 2.91  ? 75  LEU A CB  1 
ATOM   582  C CG  . LEU A 1 75  ? 13.397 5.660   2.816  1.00 3.00  ? 75  LEU A CG  1 
ATOM   583  C CD1 . LEU A 1 75  ? 13.611 4.731   1.624  1.00 1.13  ? 75  LEU A CD1 1 
ATOM   584  C CD2 . LEU A 1 75  ? 13.491 4.881   4.107  1.00 2.43  ? 75  LEU A CD2 1 
ATOM   585  N N   . ALA A 1 76  ? 15.110 9.861   2.855  1.00 6.86  ? 76  ALA A N   1 
ATOM   586  C CA  . ALA A 1 76  ? 16.036 10.947  2.549  1.00 6.34  ? 76  ALA A CA  1 
ATOM   587  C C   . ALA A 1 76  ? 16.389 11.736  3.812  1.00 7.92  ? 76  ALA A C   1 
ATOM   588  O O   . ALA A 1 76  ? 17.546 12.137  4.006  1.00 9.08  ? 76  ALA A O   1 
ATOM   589  C CB  . ALA A 1 76  ? 15.425 11.874  1.503  1.00 1.84  ? 76  ALA A CB  1 
ATOM   590  N N   . LYS A 1 77  ? 15.397 11.958  4.673  1.00 6.43  ? 77  LYS A N   1 
ATOM   591  C CA  . LYS A 1 77  ? 15.629 12.705  5.906  1.00 7.24  ? 77  LYS A CA  1 
ATOM   592  C C   . LYS A 1 77  ? 16.579 11.955  6.856  1.00 10.11 ? 77  LYS A C   1 
ATOM   593  O O   . LYS A 1 77  ? 17.490 12.564  7.447  1.00 9.59  ? 77  LYS A O   1 
ATOM   594  C CB  . LYS A 1 77  ? 14.297 13.008  6.593  1.00 6.30  ? 77  LYS A CB  1 
ATOM   595  C CG  . LYS A 1 77  ? 13.414 13.988  5.802  1.00 5.46  ? 77  LYS A CG  1 
ATOM   596  C CD  . LYS A 1 77  ? 12.056 14.153  6.466  1.00 6.29  ? 77  LYS A CD  1 
ATOM   597  C CE  . LYS A 1 77  ? 11.150 15.110  5.713  1.00 6.12  ? 77  LYS A CE  1 
ATOM   598  N NZ  . LYS A 1 77  ? 11.666 16.510  5.679  1.00 6.88  ? 77  LYS A NZ  1 
ATOM   599  N N   . MET A 1 78  ? 16.372 10.641  6.998  1.00 8.24  ? 78  MET A N   1 
ATOM   600  C CA  . MET A 1 78  ? 17.229 9.816   7.847  1.00 7.95  ? 78  MET A CA  1 
ATOM   601  C C   . MET A 1 78  ? 18.679 9.868   7.348  1.00 6.79  ? 78  MET A C   1 
ATOM   602  O O   . MET A 1 78  ? 19.614 9.958   8.151  1.00 7.11  ? 78  MET A O   1 
ATOM   603  C CB  . MET A 1 78  ? 16.748 8.354   7.853  1.00 7.98  ? 78  MET A CB  1 
ATOM   604  C CG  . MET A 1 78  ? 15.416 8.098   8.559  1.00 7.64  ? 78  MET A CG  1 
ATOM   605  S SD  . MET A 1 78  ? 15.475 8.491   10.330 1.00 12.76 ? 78  MET A SD  1 
ATOM   606  C CE  . MET A 1 78  ? 14.711 10.121  10.342 1.00 8.55  ? 78  MET A CE  1 
ATOM   607  N N   . SER A 1 79  ? 18.861 9.816   6.028  1.00 4.39  ? 79  SER A N   1 
ATOM   608  C CA  . SER A 1 79  ? 20.202 9.834   5.438  1.00 3.49  ? 79  SER A CA  1 
ATOM   609  C C   . SER A 1 79  ? 20.935 11.126  5.748  1.00 2.78  ? 79  SER A C   1 
ATOM   610  O O   . SER A 1 79  ? 22.157 11.137  5.914  1.00 1.75  ? 79  SER A O   1 
ATOM   611  C CB  . SER A 1 79  ? 20.138 9.642   3.911  1.00 1.74  ? 79  SER A CB  1 
ATOM   612  O OG  . SER A 1 79  ? 19.593 10.781  3.256  1.00 1.13  ? 79  SER A OG  1 
ATOM   613  N N   . ARG A 1 80  ? 20.195 12.224  5.814  1.00 2.41  ? 80  ARG A N   1 
ATOM   614  C CA  . ARG A 1 80  ? 20.824 13.498  6.102  1.00 3.10  ? 80  ARG A CA  1 
ATOM   615  C C   . ARG A 1 80  ? 21.104 13.625  7.596  1.00 3.48  ? 80  ARG A C   1 
ATOM   616  O O   . ARG A 1 80  ? 22.083 14.261  8.001  1.00 1.13  ? 80  ARG A O   1 
ATOM   617  C CB  . ARG A 1 80  ? 19.952 14.649  5.605  1.00 1.64  ? 80  ARG A CB  1 
ATOM   618  C CG  . ARG A 1 80  ? 19.976 14.804  4.084  1.00 2.76  ? 80  ARG A CG  1 
ATOM   619  C CD  . ARG A 1 80  ? 19.296 16.092  3.666  1.00 2.47  ? 80  ARG A CD  1 
ATOM   620  N NE  . ARG A 1 80  ? 17.854 16.048  3.890  1.00 4.02  ? 80  ARG A NE  1 
ATOM   621  C CZ  . ARG A 1 80  ? 16.981 15.593  2.992  1.00 4.26  ? 80  ARG A CZ  1 
ATOM   622  N NH1 . ARG A 1 80  ? 17.418 15.147  1.824  1.00 1.92  ? 80  ARG A NH1 1 
ATOM   623  N NH2 . ARG A 1 80  ? 15.675 15.610  3.249  1.00 1.13  ? 80  ARG A NH2 1 
ATOM   624  N N   . LEU A 1 81  ? 20.252 13.007  8.410  1.00 3.29  ? 81  LEU A N   1 
ATOM   625  C CA  . LEU A 1 81  ? 20.428 13.038  9.861  1.00 6.27  ? 81  LEU A CA  1 
ATOM   626  C C   . LEU A 1 81  ? 21.687 12.273  10.274 1.00 6.37  ? 81  LEU A C   1 
ATOM   627  O O   . LEU A 1 81  ? 22.462 12.740  11.112 1.00 6.26  ? 81  LEU A O   1 
ATOM   628  C CB  . LEU A 1 81  ? 19.212 12.421  10.562 1.00 3.90  ? 81  LEU A CB  1 
ATOM   629  C CG  . LEU A 1 81  ? 19.362 12.111  12.060 1.00 4.77  ? 81  LEU A CG  1 
ATOM   630  C CD1 . LEU A 1 81  ? 19.574 13.389  12.844 1.00 1.13  ? 81  LEU A CD1 1 
ATOM   631  C CD2 . LEU A 1 81  ? 18.131 11.366  12.562 1.00 3.55  ? 81  LEU A CD2 1 
ATOM   632  N N   . PHE A 1 82  ? 21.883 11.106  9.663  1.00 6.96  ? 82  PHE A N   1 
ATOM   633  C CA  . PHE A 1 82  ? 23.015 10.242  9.974  1.00 7.49  ? 82  PHE A CA  1 
ATOM   634  C C   . PHE A 1 82  ? 24.220 10.372  9.056  1.00 6.85  ? 82  PHE A C   1 
ATOM   635  O O   . PHE A 1 82  ? 25.216 9.663   9.230  1.00 7.62  ? 82  PHE A O   1 
ATOM   636  C CB  . PHE A 1 82  ? 22.541 8.799   10.018 1.00 3.59  ? 82  PHE A CB  1 
ATOM   637  C CG  . PHE A 1 82  ? 21.497 8.551   11.065 1.00 3.08  ? 82  PHE A CG  1 
ATOM   638  C CD1 . PHE A 1 82  ? 21.788 8.730   12.416 1.00 2.12  ? 82  PHE A CD1 1 
ATOM   639  C CD2 . PHE A 1 82  ? 20.227 8.127   10.702 1.00 1.13  ? 82  PHE A CD2 1 
ATOM   640  C CE1 . PHE A 1 82  ? 20.824 8.482   13.392 1.00 1.94  ? 82  PHE A CE1 1 
ATOM   641  C CE2 . PHE A 1 82  ? 19.259 7.878   11.664 1.00 1.13  ? 82  PHE A CE2 1 
ATOM   642  C CZ  . PHE A 1 82  ? 19.556 8.054   13.013 1.00 3.36  ? 82  PHE A CZ  1 
ATOM   643  N N   . ASP A 1 83  ? 24.119 11.259  8.071  1.00 5.15  ? 83  ASP A N   1 
ATOM   644  C CA  . ASP A 1 83  ? 25.241 11.520  7.175  1.00 4.91  ? 83  ASP A CA  1 
ATOM   645  C C   . ASP A 1 83  ? 25.756 10.236  6.513  1.00 3.14  ? 83  ASP A C   1 
ATOM   646  O O   . ASP A 1 83  ? 26.940 9.929   6.584  1.00 2.43  ? 83  ASP A O   1 
ATOM   647  C CB  . ASP A 1 83  ? 26.328 12.214  8.016  1.00 3.89  ? 83  ASP A CB  1 
ATOM   648  C CG  . ASP A 1 83  ? 27.489 12.738  7.196  1.00 5.19  ? 83  ASP A CG  1 
ATOM   649  O OD1 . ASP A 1 83  ? 27.290 13.121  6.018  1.00 2.59  ? 83  ASP A OD1 1 
ATOM   650  O OD2 . ASP A 1 83  ? 28.605 12.791  7.765  1.00 3.10  ? 83  ASP A OD2 1 
ATOM   651  N N   . LEU A 1 84  ? 24.859 9.507   5.850  1.00 4.02  ? 84  LEU A N   1 
ATOM   652  C CA  . LEU A 1 84  ? 25.210 8.245   5.189  1.00 5.39  ? 84  LEU A CA  1 
ATOM   653  C C   . LEU A 1 84  ? 26.122 8.395   3.977  1.00 4.97  ? 84  LEU A C   1 
ATOM   654  O O   . LEU A 1 84  ? 26.766 7.429   3.552  1.00 3.62  ? 84  LEU A O   1 
ATOM   655  C CB  . LEU A 1 84  ? 23.941 7.502   4.765  1.00 5.17  ? 84  LEU A CB  1 
ATOM   656  C CG  . LEU A 1 84  ? 22.900 7.248   5.859  1.00 7.49  ? 84  LEU A CG  1 
ATOM   657  C CD1 . LEU A 1 84  ? 21.745 6.435   5.279  1.00 6.16  ? 84  LEU A CD1 1 
ATOM   658  C CD2 . LEU A 1 84  ? 23.543 6.503   7.034  1.00 7.13  ? 84  LEU A CD2 1 
ATOM   659  N N   . GLN A 1 85  ? 26.169 9.605   3.426  1.00 4.48  ? 85  GLN A N   1 
ATOM   660  C CA  . GLN A 1 85  ? 26.991 9.903   2.249  1.00 5.23  ? 85  GLN A CA  1 
ATOM   661  C C   . GLN A 1 85  ? 28.467 10.042  2.552  1.00 5.99  ? 85  GLN A C   1 
ATOM   662  O O   . GLN A 1 85  ? 29.295 9.936   1.652  1.00 5.70  ? 85  GLN A O   1 
ATOM   663  C CB  . GLN A 1 85  ? 26.546 11.219  1.603  1.00 6.52  ? 85  GLN A CB  1 
ATOM   664  C CG  . GLN A 1 85  ? 26.855 12.503  2.422  1.00 4.24  ? 85  GLN A CG  1 
ATOM   665  C CD  . GLN A 1 85  ? 28.342 12.883  2.476  1.00 5.83  ? 85  GLN A CD  1 
ATOM   666  O OE1 . GLN A 1 85  ? 29.048 12.832  1.468  1.00 6.47  ? 85  GLN A OE1 1 
ATOM   667  N NE2 . GLN A 1 85  ? 28.812 13.289  3.655  1.00 4.56  ? 85  GLN A NE2 1 
ATOM   668  N N   . CYS A 1 86  ? 28.801 10.290  3.813  1.00 6.82  ? 86  CYS A N   1 
ATOM   669  C CA  . CYS A 1 86  ? 30.192 10.511  4.166  1.00 7.96  ? 86  CYS A CA  1 
ATOM   670  C C   . CYS A 1 86  ? 31.209 9.456   3.782  1.00 8.37  ? 86  CYS A C   1 
ATOM   671  O O   . CYS A 1 86  ? 31.011 8.265   3.988  1.00 8.71  ? 86  CYS A O   1 
ATOM   672  C CB  . CYS A 1 86  ? 30.338 10.787  5.657  1.00 10.07 ? 86  CYS A CB  1 
ATOM   673  S SG  . CYS A 1 86  ? 32.035 11.287  6.110  1.00 14.19 ? 86  CYS A SG  1 
ATOM   674  N N   . ASN A 1 87  ? 32.319 9.922   3.225  1.00 9.31  ? 87  ASN A N   1 
ATOM   675  C CA  . ASN A 1 87  ? 33.416 9.051   2.854  1.00 9.94  ? 87  ASN A CA  1 
ATOM   676  C C   . ASN A 1 87  ? 34.522 9.260   3.894  1.00 10.17 ? 87  ASN A C   1 
ATOM   677  O O   . ASN A 1 87  ? 35.380 10.123  3.727  1.00 10.76 ? 87  ASN A O   1 
ATOM   678  C CB  . ASN A 1 87  ? 33.951 9.412   1.481  1.00 9.30  ? 87  ASN A CB  1 
ATOM   679  C CG  . ASN A 1 87  ? 35.037 8.465   1.033  1.00 11.49 ? 87  ASN A CG  1 
ATOM   680  O OD1 . ASN A 1 87  ? 35.925 8.106   1.812  1.00 8.67  ? 87  ASN A OD1 1 
ATOM   681  N ND2 . ASN A 1 87  ? 34.988 8.062   -0.231 1.00 13.40 ? 87  ASN A ND2 1 
ATOM   682  N N   . PRO A 1 88  ? 34.521 8.461   4.976  1.00 11.23 ? 88  PRO A N   1 
ATOM   683  C CA  . PRO A 1 88  ? 35.513 8.553   6.059  1.00 12.12 ? 88  PRO A CA  1 
ATOM   684  C C   . PRO A 1 88  ? 36.986 8.542   5.650  1.00 13.05 ? 88  PRO A C   1 
ATOM   685  O O   . PRO A 1 88  ? 37.802 9.225   6.269  1.00 15.27 ? 88  PRO A O   1 
ATOM   686  C CB  . PRO A 1 88  ? 35.139 7.384   6.972  1.00 11.80 ? 88  PRO A CB  1 
ATOM   687  C CG  . PRO A 1 88  ? 34.471 6.413   6.046  1.00 11.89 ? 88  PRO A CG  1 
ATOM   688  C CD  . PRO A 1 88  ? 33.635 7.302   5.178  1.00 10.42 ? 88  PRO A CD  1 
ATOM   689  N N   . GLN A 1 89  ? 37.328 7.776   4.618  1.00 12.45 ? 89  GLN A N   1 
ATOM   690  C CA  . GLN A 1 89  ? 38.707 7.707   4.136  1.00 12.62 ? 89  GLN A CA  1 
ATOM   691  C C   . GLN A 1 89  ? 39.191 9.077   3.668  1.00 11.96 ? 89  GLN A C   1 
ATOM   692  O O   . GLN A 1 89  ? 40.315 9.486   3.962  1.00 11.68 ? 89  GLN A O   1 
ATOM   693  C CB  . GLN A 1 89  ? 38.824 6.723   2.968  1.00 13.39 ? 89  GLN A CB  1 
ATOM   694  C CG  . GLN A 1 89  ? 38.933 5.246   3.342  1.00 14.44 ? 89  GLN A CG  1 
ATOM   695  C CD  . GLN A 1 89  ? 37.829 4.776   4.277  1.00 17.56 ? 89  GLN A CD  1 
ATOM   696  O OE1 . GLN A 1 89  ? 38.011 4.708   5.497  1.00 18.00 ? 89  GLN A OE1 1 
ATOM   697  N NE2 . GLN A 1 89  ? 36.672 4.455   3.706  1.00 16.42 ? 89  GLN A NE2 1 
ATOM   698  N N   . ILE A 1 90  ? 38.342 9.776   2.921  1.00 11.68 ? 90  ILE A N   1 
ATOM   699  C CA  . ILE A 1 90  ? 38.701 11.091  2.412  1.00 11.46 ? 90  ILE A CA  1 
ATOM   700  C C   . ILE A 1 90  ? 38.813 12.089  3.552  1.00 12.20 ? 90  ILE A C   1 
ATOM   701  O O   . ILE A 1 90  ? 39.862 12.693  3.751  1.00 13.54 ? 90  ILE A O   1 
ATOM   702  C CB  . ILE A 1 90  ? 37.668 11.596  1.387  1.00 9.45  ? 90  ILE A CB  1 
ATOM   703  C CG1 . ILE A 1 90  ? 37.661 10.658  0.178  1.00 9.08  ? 90  ILE A CG1 1 
ATOM   704  C CG2 . ILE A 1 90  ? 37.996 13.032  0.972  1.00 5.45  ? 90  ILE A CG2 1 
ATOM   705  C CD1 . ILE A 1 90  ? 36.648 11.008  -0.883 1.00 9.94  ? 90  ILE A CD1 1 
ATOM   706  N N   . VAL A 1 91  ? 37.738 12.246  4.311  1.00 13.58 ? 91  VAL A N   1 
ATOM   707  C CA  . VAL A 1 91  ? 37.742 13.174  5.434  1.00 15.78 ? 91  VAL A CA  1 
ATOM   708  C C   . VAL A 1 91  ? 38.910 12.941  6.390  1.00 15.82 ? 91  VAL A C   1 
ATOM   709  O O   . VAL A 1 91  ? 39.617 13.885  6.751  1.00 14.20 ? 91  VAL A O   1 
ATOM   710  C CB  . VAL A 1 91  ? 36.430 13.096  6.246  1.00 16.92 ? 91  VAL A CB  1 
ATOM   711  C CG1 . VAL A 1 91  ? 36.497 14.062  7.431  1.00 15.86 ? 91  VAL A CG1 1 
ATOM   712  C CG2 . VAL A 1 91  ? 35.239 13.437  5.348  1.00 16.91 ? 91  VAL A CG2 1 
ATOM   713  N N   . ASN A 1 92  ? 39.123 11.695  6.805  1.00 15.33 ? 92  ASN A N   1 
ATOM   714  C CA  . ASN A 1 92  ? 40.220 11.416  7.732  1.00 16.85 ? 92  ASN A CA  1 
ATOM   715  C C   . ASN A 1 92  ? 41.583 11.642  7.085  1.00 14.86 ? 92  ASN A C   1 
ATOM   716  O O   . ASN A 1 92  ? 42.532 12.040  7.755  1.00 15.00 ? 92  ASN A O   1 
ATOM   717  C CB  . ASN A 1 92  ? 40.101 9.994   8.301  1.00 18.20 ? 92  ASN A CB  1 
ATOM   718  C CG  . ASN A 1 92  ? 38.799 9.787   9.076  1.00 20.90 ? 92  ASN A CG  1 
ATOM   719  O OD1 . ASN A 1 92  ? 38.371 10.654  9.847  1.00 21.57 ? 92  ASN A OD1 1 
ATOM   720  N ND2 . ASN A 1 92  ? 38.173 8.630   8.886  1.00 20.96 ? 92  ASN A ND2 1 
ATOM   721  N N   . GLY A 1 93  ? 41.674 11.403  5.781  1.00 14.66 ? 93  GLY A N   1 
ATOM   722  C CA  . GLY A 1 93  ? 42.925 11.625  5.082  1.00 13.94 ? 93  GLY A CA  1 
ATOM   723  C C   . GLY A 1 93  ? 43.286 13.101  5.147  1.00 14.25 ? 93  GLY A C   1 
ATOM   724  O O   . GLY A 1 93  ? 44.414 13.462  5.482  1.00 14.12 ? 93  GLY A O   1 
ATOM   725  N N   . ALA A 1 94  ? 42.330 13.967  4.837  1.00 13.78 ? 94  ALA A N   1 
ATOM   726  C CA  . ALA A 1 94  ? 42.593 15.405  4.886  1.00 15.36 ? 94  ALA A CA  1 
ATOM   727  C C   . ALA A 1 94  ? 42.805 15.913  6.320  1.00 16.10 ? 94  ALA A C   1 
ATOM   728  O O   . ALA A 1 94  ? 43.726 16.682  6.572  1.00 17.29 ? 94  ALA A O   1 
ATOM   729  C CB  . ALA A 1 94  ? 41.451 16.169  4.220  1.00 13.78 ? 94  ALA A CB  1 
ATOM   730  N N   . LEU A 1 95  ? 41.957 15.481  7.254  1.00 17.17 ? 95  LEU A N   1 
ATOM   731  C CA  . LEU A 1 95  ? 42.059 15.907  8.650  1.00 18.63 ? 95  LEU A CA  1 
ATOM   732  C C   . LEU A 1 95  ? 43.356 15.444  9.304  1.00 21.24 ? 95  LEU A C   1 
ATOM   733  O O   . LEU A 1 95  ? 43.867 16.085  10.222 1.00 21.65 ? 95  LEU A O   1 
ATOM   734  C CB  . LEU A 1 95  ? 40.862 15.386  9.460  1.00 17.42 ? 95  LEU A CB  1 
ATOM   735  C CG  . LEU A 1 95  ? 39.510 16.075  9.244  1.00 16.57 ? 95  LEU A CG  1 
ATOM   736  C CD1 . LEU A 1 95  ? 38.470 15.459  10.150 1.00 16.56 ? 95  LEU A CD1 1 
ATOM   737  C CD2 . LEU A 1 95  ? 39.642 17.568  9.536  1.00 17.25 ? 95  LEU A CD2 1 
ATOM   738  N N   . GLY A 1 96  ? 43.874 14.315  8.835  1.00 24.50 ? 96  GLY A N   1 
ATOM   739  C CA  . GLY A 1 96  ? 45.109 13.782  9.379  1.00 25.33 ? 96  GLY A CA  1 
ATOM   740  C C   . GLY A 1 96  ? 45.001 13.287  10.808 1.00 25.94 ? 96  GLY A C   1 
ATOM   741  O O   . GLY A 1 96  ? 44.067 12.571  11.169 1.00 25.18 ? 96  GLY A O   1 
ATOM   742  N N   . ARG A 1 97  ? 45.969 13.691  11.623 1.00 26.45 ? 97  ARG A N   1 
ATOM   743  C CA  . ARG A 1 97  ? 46.034 13.302  13.023 1.00 27.67 ? 97  ARG A CA  1 
ATOM   744  C C   . ARG A 1 97  ? 44.757 13.597  13.813 1.00 26.90 ? 97  ARG A C   1 
ATOM   745  O O   . ARG A 1 97  ? 44.338 12.791  14.642 1.00 27.43 ? 97  ARG A O   1 
ATOM   746  C CB  . ARG A 1 97  ? 47.228 14.002  13.684 1.00 31.29 ? 97  ARG A CB  1 
ATOM   747  C CG  . ARG A 1 97  ? 47.986 13.140  14.685 1.00 35.20 ? 97  ARG A CG  1 
ATOM   748  C CD  . ARG A 1 97  ? 47.162 12.867  15.938 1.00 37.68 ? 97  ARG A CD  1 
ATOM   749  N NE  . ARG A 1 97  ? 46.989 11.437  16.187 1.00 39.27 ? 97  ARG A NE  1 
ATOM   750  C CZ  . ARG A 1 97  ? 46.527 10.932  17.329 1.00 39.61 ? 97  ARG A CZ  1 
ATOM   751  N NH1 . ARG A 1 97  ? 46.194 11.743  18.328 1.00 39.14 ? 97  ARG A NH1 1 
ATOM   752  N NH2 . ARG A 1 97  ? 46.393 9.619   17.473 1.00 38.07 ? 97  ARG A NH2 1 
ATOM   753  N N   . LEU A 1 98  ? 44.143 14.747  13.550 1.00 26.13 ? 98  LEU A N   1 
ATOM   754  C CA  . LEU A 1 98  ? 42.925 15.170  14.245 1.00 24.43 ? 98  LEU A CA  1 
ATOM   755  C C   . LEU A 1 98  ? 41.817 14.127  14.258 1.00 25.24 ? 98  LEU A C   1 
ATOM   756  O O   . LEU A 1 98  ? 41.101 13.977  15.251 1.00 25.97 ? 98  LEU A O   1 
ATOM   757  C CB  . LEU A 1 98  ? 42.367 16.442  13.610 1.00 22.81 ? 98  LEU A CB  1 
ATOM   758  C CG  . LEU A 1 98  ? 41.802 17.502  14.561 1.00 21.47 ? 98  LEU A CG  1 
ATOM   759  C CD1 . LEU A 1 98  ? 40.937 18.452  13.755 1.00 21.38 ? 98  LEU A CD1 1 
ATOM   760  C CD2 . LEU A 1 98  ? 40.990 16.872  15.678 1.00 20.17 ? 98  LEU A CD2 1 
ATOM   761  N N   . GLY A 1 99  ? 41.659 13.424  13.145 1.00 25.90 ? 99  GLY A N   1 
ATOM   762  C CA  . GLY A 1 99  ? 40.622 12.418  13.063 1.00 26.98 ? 99  GLY A CA  1 
ATOM   763  C C   . GLY A 1 99  ? 41.084 11.029  13.455 1.00 28.10 ? 99  GLY A C   1 
ATOM   764  O O   . GLY A 1 99  ? 40.267 10.116  13.559 1.00 28.31 ? 99  GLY A O   1 
ATOM   765  N N   . ALA A 1 100 ? 42.385 10.866  13.680 1.00 28.62 ? 100 ALA A N   1 
ATOM   766  C CA  . ALA A 1 100 ? 42.943 9.571   14.053 1.00 28.67 ? 100 ALA A CA  1 
ATOM   767  C C   . ALA A 1 100 ? 42.225 8.953   15.245 1.00 28.30 ? 100 ALA A C   1 
ATOM   768  O O   . ALA A 1 100 ? 42.016 7.745   15.288 1.00 29.92 ? 100 ALA A O   1 
ATOM   769  C CB  . ALA A 1 100 ? 44.435 9.714   14.359 1.00 29.15 ? 100 ALA A CB  1 
ATOM   770  N N   . ALA A 1 101 ? 41.847 9.787   16.205 1.00 28.30 ? 101 ALA A N   1 
ATOM   771  C CA  . ALA A 1 101 ? 41.158 9.330   17.411 1.00 27.20 ? 101 ALA A CA  1 
ATOM   772  C C   . ALA A 1 101 ? 39.941 8.466   17.090 1.00 27.34 ? 101 ALA A C   1 
ATOM   773  O O   . ALA A 1 101 ? 39.919 7.270   17.387 1.00 28.59 ? 101 ALA A O   1 
ATOM   774  C CB  . ALA A 1 101 ? 40.735 10.525  18.241 1.00 29.39 ? 101 ALA A CB  1 
ATOM   775  N N   . ARG A 1 102 ? 38.922 9.071   16.493 1.00 24.95 ? 102 ARG A N   1 
ATOM   776  C CA  . ARG A 1 102 ? 37.724 8.332   16.134 1.00 21.43 ? 102 ARG A CA  1 
ATOM   777  C C   . ARG A 1 102 ? 37.366 8.592   14.678 1.00 18.32 ? 102 ARG A C   1 
ATOM   778  O O   . ARG A 1 102 ? 36.678 9.555   14.347 1.00 15.55 ? 102 ARG A O   1 
ATOM   779  C CB  . ARG A 1 102 ? 36.568 8.711   17.068 1.00 22.50 ? 102 ARG A CB  1 
ATOM   780  C CG  . ARG A 1 102 ? 36.396 10.198  17.287 1.00 23.78 ? 102 ARG A CG  1 
ATOM   781  C CD  . ARG A 1 102 ? 36.055 10.483  18.739 1.00 25.45 ? 102 ARG A CD  1 
ATOM   782  N NE  . ARG A 1 102 ? 34.935 9.676   19.208 1.00 25.54 ? 102 ARG A NE  1 
ATOM   783  C CZ  . ARG A 1 102 ? 34.455 9.720   20.444 1.00 25.35 ? 102 ARG A CZ  1 
ATOM   784  N NH1 . ARG A 1 102 ? 34.995 10.533  21.345 1.00 25.10 ? 102 ARG A NH1 1 
ATOM   785  N NH2 . ARG A 1 102 ? 33.430 8.955   20.777 1.00 27.96 ? 102 ARG A NH2 1 
ATOM   786  N N   . PRO A 1 103 ? 37.847 7.725   13.783 1.00 15.85 ? 103 PRO A N   1 
ATOM   787  C CA  . PRO A 1 103 ? 37.579 7.874   12.355 1.00 13.15 ? 103 PRO A CA  1 
ATOM   788  C C   . PRO A 1 103 ? 36.125 7.640   11.948 1.00 12.40 ? 103 PRO A C   1 
ATOM   789  O O   . PRO A 1 103 ? 35.734 8.003   10.838 1.00 11.42 ? 103 PRO A O   1 
ATOM   790  C CB  . PRO A 1 103 ? 38.563 6.891   11.716 1.00 12.87 ? 103 PRO A CB  1 
ATOM   791  C CG  . PRO A 1 103 ? 38.738 5.837   12.758 1.00 14.16 ? 103 PRO A CG  1 
ATOM   792  C CD  . PRO A 1 103 ? 38.782 6.616   14.049 1.00 14.40 ? 103 PRO A CD  1 
ATOM   793  N N   . GLY A 1 104 ? 35.326 7.066   12.851 1.00 8.73  ? 104 GLY A N   1 
ATOM   794  C CA  . GLY A 1 104 ? 33.921 6.799   12.616 1.00 8.94  ? 104 GLY A CA  1 
ATOM   795  C C   . GLY A 1 104 ? 32.987 7.937   12.960 1.00 9.76  ? 104 GLY A C   1 
ATOM   796  O O   . GLY A 1 104 ? 31.779 7.828   12.686 1.00 9.72  ? 104 GLY A O   1 
ATOM   797  N N   . LEU A 1 105 ? 33.525 9.064   13.378 1.00 10.17 ? 105 LEU A N   1 
ATOM   798  C CA  . LEU A 1 105 ? 32.830 10.313  13.641 1.00 10.17 ? 105 LEU A CA  1 
ATOM   799  C C   . LEU A 1 105 ? 32.124 10.881  12.398 1.00 9.72  ? 105 LEU A C   1 
ATOM   800  O O   . LEU A 1 105 ? 32.655 11.032  11.316 1.00 7.73  ? 105 LEU A O   1 
ATOM   801  C CB  . LEU A 1 105 ? 33.885 11.371  14.058 1.00 12.36 ? 105 LEU A CB  1 
ATOM   802  C CG  . LEU A 1 105 ? 33.447 12.417  15.066 1.00 14.59 ? 105 LEU A CG  1 
ATOM   803  C CD1 . LEU A 1 105 ? 32.237 13.197  14.638 1.00 17.15 ? 105 LEU A CD1 1 
ATOM   804  C CD2 . LEU A 1 105 ? 33.229 11.709  16.413 1.00 17.37 ? 105 LEU A CD2 1 
ATOM   805  N N   . ARG A 1 106 ? 30.803 11.072  12.581 1.00 8.35  ? 106 ARG A N   1 
ATOM   806  C CA  . ARG A 1 106 ? 29.887 11.545  11.563 1.00 7.96  ? 106 ARG A CA  1 
ATOM   807  C C   . ARG A 1 106 ? 29.273 12.909  11.883 1.00 9.31  ? 106 ARG A C   1 
ATOM   808  O O   . ARG A 1 106 ? 29.215 13.305  13.048 1.00 8.18  ? 106 ARG A O   1 
ATOM   809  C CB  . ARG A 1 106 ? 28.803 10.516  11.258 1.00 7.98  ? 106 ARG A CB  1 
ATOM   810  C CG  . ARG A 1 106 ? 29.343 9.209   10.653 1.00 6.84  ? 106 ARG A CG  1 
ATOM   811  C CD  . ARG A 1 106 ? 29.979 9.531   9.294  1.00 6.98  ? 106 ARG A CD  1 
ATOM   812  N NE  . ARG A 1 106 ? 30.677 8.413   8.705  1.00 10.25 ? 106 ARG A NE  1 
ATOM   813  C CZ  . ARG A 1 106 ? 30.161 7.576   7.819  1.00 9.64  ? 106 ARG A CZ  1 
ATOM   814  N NH1 . ARG A 1 106 ? 28.901 7.692   7.434  1.00 11.37 ? 106 ARG A NH1 1 
ATOM   815  N NH2 . ARG A 1 106 ? 30.913 6.585   7.338  1.00 10.64 ? 106 ARG A NH2 1 
ATOM   816  N N   . LEU A 1 107 ? 28.778 13.640  10.868 1.00 8.67  ? 107 LEU A N   1 
ATOM   817  C CA  . LEU A 1 107 ? 28.130 14.942  11.088 1.00 8.37  ? 107 LEU A CA  1 
ATOM   818  C C   . LEU A 1 107 ? 26.625 14.770  11.331 1.00 10.09 ? 107 LEU A C   1 
ATOM   819  O O   . LEU A 1 107 ? 25.867 14.487  10.398 1.00 10.09 ? 107 LEU A O   1 
ATOM   820  C CB  . LEU A 1 107 ? 28.320 15.863  9.881  1.00 9.76  ? 107 LEU A CB  1 
ATOM   821  C CG  . LEU A 1 107 ? 27.552 17.195  9.966  1.00 11.70 ? 107 LEU A CG  1 
ATOM   822  C CD1 . LEU A 1 107 ? 28.246 18.139  10.949 1.00 10.60 ? 107 LEU A CD1 1 
ATOM   823  C CD2 . LEU A 1 107 ? 27.473 17.845  8.593  1.00 13.91 ? 107 LEU A CD2 1 
ATOM   824  N N   . PRO A 1 108 ? 26.168 14.966  12.581 1.00 9.73  ? 108 PRO A N   1 
ATOM   825  C CA  . PRO A 1 108 ? 24.742 14.810  12.874 1.00 8.80  ? 108 PRO A CA  1 
ATOM   826  C C   . PRO A 1 108 ? 23.899 15.891  12.200 1.00 9.63  ? 108 PRO A C   1 
ATOM   827  O O   . PRO A 1 108 ? 24.064 17.074  12.483 1.00 11.84 ? 108 PRO A O   1 
ATOM   828  C CB  . PRO A 1 108 ? 24.689 14.911  14.397 1.00 9.73  ? 108 PRO A CB  1 
ATOM   829  C CG  . PRO A 1 108 ? 26.095 14.572  14.829 1.00 9.56  ? 108 PRO A CG  1 
ATOM   830  C CD  . PRO A 1 108 ? 26.922 15.271  13.807 1.00 8.81  ? 108 PRO A CD  1 
ATOM   831  N N   . GLY A 1 109 ? 22.995 15.486  11.315 1.00 8.81  ? 109 GLY A N   1 
ATOM   832  C CA  . GLY A 1 109 ? 22.154 16.463  10.637 1.00 8.70  ? 109 GLY A CA  1 
ATOM   833  C C   . GLY A 1 109 ? 20.824 16.693  11.326 1.00 7.52  ? 109 GLY A C   1 
ATOM   834  O O   . GLY A 1 109 ? 20.770 16.948  12.528 1.00 7.14  ? 109 GLY A O   1 
ATOM   835  N N   . CYS A 1 110 ? 19.748 16.594  10.557 1.00 6.97  ? 110 CYS A N   1 
ATOM   836  C CA  . CYS A 1 110 ? 18.406 16.789  11.081 1.00 6.20  ? 110 CYS A CA  1 
ATOM   837  C C   . CYS A 1 110 ? 17.392 16.135  10.156 1.00 7.45  ? 110 CYS A C   1 
ATOM   838  O O   . CYS A 1 110 ? 17.732 15.643  9.074  1.00 6.74  ? 110 CYS A O   1 
ATOM   839  C CB  . CYS A 1 110 ? 18.076 18.282  11.201 1.00 6.06  ? 110 CYS A CB  1 
ATOM   840  S SG  . CYS A 1 110 ? 17.870 19.137  9.610  1.00 3.52  ? 110 CYS A SG  1 
ATOM   841  N N   . VAL A 1 111 ? 16.140 16.147  10.600 1.00 9.05  ? 111 VAL A N   1 
ATOM   842  C CA  . VAL A 1 111 ? 15.038 15.575  9.849  1.00 11.63 ? 111 VAL A CA  1 
ATOM   843  C C   . VAL A 1 111 ? 14.244 16.650  9.095  1.00 11.12 ? 111 VAL A C   1 
ATOM   844  O O   . VAL A 1 111 ? 13.565 16.353  8.109  1.00 11.23 ? 111 VAL A O   1 
ATOM   845  C CB  . VAL A 1 111 ? 14.081 14.821  10.793 1.00 12.43 ? 111 VAL A CB  1 
ATOM   846  C CG1 . VAL A 1 111 ? 13.009 14.125  9.992  1.00 17.10 ? 111 VAL A CG1 1 
ATOM   847  C CG2 . VAL A 1 111 ? 14.854 13.807  11.609 1.00 17.92 ? 111 VAL A CG2 1 
ATOM   848  N N   . ASP A 1 112 ? 14.328 17.893  9.570  1.00 10.37 ? 112 ASP A N   1 
ATOM   849  C CA  . ASP A 1 112 ? 13.615 19.016  8.965  1.00 9.29  ? 112 ASP A CA  1 
ATOM   850  C C   . ASP A 1 112 ? 14.348 20.308  9.311  1.00 8.33  ? 112 ASP A C   1 
ATOM   851  O O   . ASP A 1 112 ? 14.595 20.583  10.482 1.00 7.89  ? 112 ASP A O   1 
ATOM   852  C CB  . ASP A 1 112 ? 12.175 19.060  9.491  1.00 12.47 ? 112 ASP A CB  1 
ATOM   853  C CG  . ASP A 1 112 ? 11.391 20.254  8.973  1.00 16.47 ? 112 ASP A CG  1 
ATOM   854  O OD1 . ASP A 1 112 ? 11.247 20.395  7.736  1.00 20.03 ? 112 ASP A OD1 1 
ATOM   855  O OD2 . ASP A 1 112 ? 10.909 21.051  9.808  1.00 16.21 ? 112 ASP A OD2 1 
ATOM   856  N N   . ALA A 1 113 ? 14.693 21.104  8.299  1.00 7.62  ? 113 ALA A N   1 
ATOM   857  C CA  . ALA A 1 113 ? 15.425 22.348  8.527  1.00 4.66  ? 113 ALA A CA  1 
ATOM   858  C C   . ALA A 1 113 ? 14.706 23.364  9.411  1.00 5.19  ? 113 ALA A C   1 
ATOM   859  O O   . ALA A 1 113 ? 15.352 24.091  10.169 1.00 5.71  ? 113 ALA A O   1 
ATOM   860  C CB  . ALA A 1 113 ? 15.798 22.993  7.195  1.00 1.13  ? 113 ALA A CB  1 
ATOM   861  N N   . PHE A 1 114 ? 13.380 23.426  9.330  1.00 5.31  ? 114 PHE A N   1 
ATOM   862  C CA  . PHE A 1 114 ? 12.653 24.381  10.154 1.00 6.21  ? 114 PHE A CA  1 
ATOM   863  C C   . PHE A 1 114 ? 12.746 24.020  11.634 1.00 7.50  ? 114 PHE A C   1 
ATOM   864  O O   . PHE A 1 114 ? 12.815 24.901  12.502 1.00 8.92  ? 114 PHE A O   1 
ATOM   865  C CB  . PHE A 1 114 ? 11.185 24.446  9.755  1.00 6.42  ? 114 PHE A CB  1 
ATOM   866  C CG  . PHE A 1 114 ? 10.317 25.058  10.812 1.00 7.02  ? 114 PHE A CG  1 
ATOM   867  C CD1 . PHE A 1 114 ? 10.470 26.397  11.161 1.00 5.44  ? 114 PHE A CD1 1 
ATOM   868  C CD2 . PHE A 1 114 ? 9.390  24.282  11.502 1.00 5.41  ? 114 PHE A CD2 1 
ATOM   869  C CE1 . PHE A 1 114 ? 9.715  26.954  12.185 1.00 7.09  ? 114 PHE A CE1 1 
ATOM   870  C CE2 . PHE A 1 114 ? 8.629  24.823  12.529 1.00 6.53  ? 114 PHE A CE2 1 
ATOM   871  C CZ  . PHE A 1 114 ? 8.793  26.169  12.874 1.00 6.83  ? 114 PHE A CZ  1 
ATOM   872  N N   . GLU A 1 115 ? 12.713 22.721  11.910 1.00 7.97  ? 115 GLU A N   1 
ATOM   873  C CA  . GLU A 1 115 ? 12.811 22.222  13.275 1.00 9.10  ? 115 GLU A CA  1 
ATOM   874  C C   . GLU A 1 115 ? 14.195 22.583  13.800 1.00 8.79  ? 115 GLU A C   1 
ATOM   875  O O   . GLU A 1 115 ? 14.326 23.231  14.839 1.00 9.64  ? 115 GLU A O   1 
ATOM   876  C CB  . GLU A 1 115 ? 12.646 20.693  13.325 1.00 9.61  ? 115 GLU A CB  1 
ATOM   877  C CG  . GLU A 1 115 ? 12.643 20.142  14.753 1.00 8.36  ? 115 GLU A CG  1 
ATOM   878  C CD  . GLU A 1 115 ? 12.922 18.648  14.848 1.00 9.18  ? 115 GLU A CD  1 
ATOM   879  O OE1 . GLU A 1 115 ? 12.170 17.844  14.258 1.00 7.42  ? 115 GLU A OE1 1 
ATOM   880  O OE2 . GLU A 1 115 ? 13.900 18.275  15.531 1.00 10.56 ? 115 GLU A OE2 1 
ATOM   881  N N   . GLN A 1 116 ? 15.224 22.175  13.066 1.00 7.20  ? 116 GLN A N   1 
ATOM   882  C CA  . GLN A 1 116 ? 16.593 22.446  13.484 1.00 8.94  ? 116 GLN A CA  1 
ATOM   883  C C   . GLN A 1 116 ? 16.806 23.938  13.731 1.00 8.18  ? 116 GLN A C   1 
ATOM   884  O O   . GLN A 1 116 ? 17.438 24.325  14.719 1.00 8.13  ? 116 GLN A O   1 
ATOM   885  C CB  . GLN A 1 116 ? 17.592 21.917  12.446 1.00 9.05  ? 116 GLN A CB  1 
ATOM   886  C CG  . GLN A 1 116 ? 18.993 21.692  13.009 1.00 10.13 ? 116 GLN A CG  1 
ATOM   887  C CD  . GLN A 1 116 ? 19.031 20.668  14.147 1.00 12.21 ? 116 GLN A CD  1 
ATOM   888  O OE1 . GLN A 1 116 ? 19.861 20.764  15.050 1.00 12.30 ? 116 GLN A OE1 1 
ATOM   889  N NE2 . GLN A 1 116 ? 18.137 19.684  14.100 1.00 10.94 ? 116 GLN A NE2 1 
ATOM   890  N N   . GLY A 1 117 ? 16.274 24.775  12.844 1.00 8.15  ? 117 GLY A N   1 
ATOM   891  C CA  . GLY A 1 117 ? 16.411 26.211  13.027 1.00 5.36  ? 117 GLY A CA  1 
ATOM   892  C C   . GLY A 1 117 ? 15.863 26.588  14.393 1.00 4.42  ? 117 GLY A C   1 
ATOM   893  O O   . GLY A 1 117 ? 16.460 27.377  15.134 1.00 1.66  ? 117 GLY A O   1 
ATOM   894  N N   . VAL A 1 118 ? 14.721 25.996  14.728 1.00 3.21  ? 118 VAL A N   1 
ATOM   895  C CA  . VAL A 1 118 ? 14.076 26.231  16.007 1.00 4.78  ? 118 VAL A CA  1 
ATOM   896  C C   . VAL A 1 118 ? 14.981 25.773  17.150 1.00 5.52  ? 118 VAL A C   1 
ATOM   897  O O   . VAL A 1 118 ? 15.088 26.450  18.169 1.00 7.16  ? 118 VAL A O   1 
ATOM   898  C CB  . VAL A 1 118 ? 12.716 25.489  16.068 1.00 4.38  ? 118 VAL A CB  1 
ATOM   899  C CG1 . VAL A 1 118 ? 12.127 25.565  17.464 1.00 1.53  ? 118 VAL A CG1 1 
ATOM   900  C CG2 . VAL A 1 118 ? 11.751 26.104  15.057 1.00 4.54  ? 118 VAL A CG2 1 
ATOM   901  N N   . ARG A 1 119 ? 15.643 24.631  16.969 1.00 4.98  ? 119 ARG A N   1 
ATOM   902  C CA  . ARG A 1 119 ? 16.536 24.098  17.994 1.00 6.85  ? 119 ARG A CA  1 
ATOM   903  C C   . ARG A 1 119 ? 17.757 24.986  18.204 1.00 7.92  ? 119 ARG A C   1 
ATOM   904  O O   . ARG A 1 119 ? 18.164 25.241  19.340 1.00 6.23  ? 119 ARG A O   1 
ATOM   905  C CB  . ARG A 1 119 ? 17.026 22.697  17.622 1.00 6.43  ? 119 ARG A CB  1 
ATOM   906  C CG  . ARG A 1 119 ? 15.943 21.658  17.460 1.00 7.95  ? 119 ARG A CG  1 
ATOM   907  C CD  . ARG A 1 119 ? 16.528 20.270  17.685 1.00 7.47  ? 119 ARG A CD  1 
ATOM   908  N NE  . ARG A 1 119 ? 15.525 19.232  17.507 1.00 6.78  ? 119 ARG A NE  1 
ATOM   909  C CZ  . ARG A 1 119 ? 15.587 18.029  18.069 1.00 7.60  ? 119 ARG A CZ  1 
ATOM   910  N NH1 . ARG A 1 119 ? 16.610 17.710  18.854 1.00 2.76  ? 119 ARG A NH1 1 
ATOM   911  N NH2 . ARG A 1 119 ? 14.616 17.147  17.845 1.00 6.10  ? 119 ARG A NH2 1 
ATOM   912  N N   . ALA A 1 120 ? 18.351 25.433  17.099 1.00 7.39  ? 120 ALA A N   1 
ATOM   913  C CA  . ALA A 1 120 ? 19.528 26.289  17.161 1.00 9.18  ? 120 ALA A CA  1 
ATOM   914  C C   . ALA A 1 120 ? 19.227 27.517  18.009 1.00 9.67  ? 120 ALA A C   1 
ATOM   915  O O   . ALA A 1 120 ? 20.005 27.875  18.891 1.00 11.20 ? 120 ALA A O   1 
ATOM   916  C CB  . ALA A 1 120 ? 19.949 26.710  15.757 1.00 6.26  ? 120 ALA A CB  1 
ATOM   917  N N   . ILE A 1 121 ? 18.089 28.152  17.745 1.00 10.80 ? 121 ILE A N   1 
ATOM   918  C CA  . ILE A 1 121 ? 17.704 29.337  18.489 1.00 11.08 ? 121 ILE A CA  1 
ATOM   919  C C   . ILE A 1 121 ? 17.537 28.981  19.958 1.00 10.25 ? 121 ILE A C   1 
ATOM   920  O O   . ILE A 1 121 ? 18.032 29.691  20.826 1.00 10.23 ? 121 ILE A O   1 
ATOM   921  C CB  . ILE A 1 121 ? 16.388 29.944  17.948 1.00 12.30 ? 121 ILE A CB  1 
ATOM   922  C CG1 . ILE A 1 121 ? 16.590 30.433  16.517 1.00 11.35 ? 121 ILE A CG1 1 
ATOM   923  C CG2 . ILE A 1 121 ? 15.966 31.128  18.805 1.00 12.15 ? 121 ILE A CG2 1 
ATOM   924  C CD1 . ILE A 1 121 ? 15.330 31.018  15.892 1.00 11.97 ? 121 ILE A CD1 1 
ATOM   925  N N   . LEU A 1 122 ? 16.850 27.876  20.229 1.00 10.22 ? 122 LEU A N   1 
ATOM   926  C CA  . LEU A 1 122 ? 16.627 27.434  21.597 1.00 9.51  ? 122 LEU A CA  1 
ATOM   927  C C   . LEU A 1 122 ? 17.929 27.006  22.268 1.00 10.87 ? 122 LEU A C   1 
ATOM   928  O O   . LEU A 1 122 ? 18.005 26.913  23.492 1.00 12.24 ? 122 LEU A O   1 
ATOM   929  C CB  . LEU A 1 122 ? 15.620 26.281  21.618 1.00 8.80  ? 122 LEU A CB  1 
ATOM   930  C CG  . LEU A 1 122 ? 14.188 26.660  21.231 1.00 7.84  ? 122 LEU A CG  1 
ATOM   931  C CD1 . LEU A 1 122 ? 13.272 25.475  21.418 1.00 7.25  ? 122 LEU A CD1 1 
ATOM   932  C CD2 . LEU A 1 122 ? 13.720 27.823  22.094 1.00 7.99  ? 122 LEU A CD2 1 
ATOM   933  N N   . GLY A 1 123 ? 18.953 26.743  21.466 1.00 12.22 ? 123 GLY A N   1 
ATOM   934  C CA  . GLY A 1 123 ? 20.231 26.340  22.021 1.00 12.76 ? 123 GLY A CA  1 
ATOM   935  C C   . GLY A 1 123 ? 21.079 27.546  22.383 1.00 13.75 ? 123 GLY A C   1 
ATOM   936  O O   . GLY A 1 123 ? 22.186 27.404  22.902 1.00 11.68 ? 123 GLY A O   1 
ATOM   937  N N   . GLN A 1 124 ? 20.555 28.742  22.112 1.00 15.08 ? 124 GLN A N   1 
ATOM   938  C CA  . GLN A 1 124 ? 21.260 29.989  22.406 1.00 15.38 ? 124 GLN A CA  1 
ATOM   939  C C   . GLN A 1 124 ? 21.569 30.191  23.895 1.00 17.01 ? 124 GLN A C   1 
ATOM   940  O O   . GLN A 1 124 ? 20.712 29.972  24.757 1.00 17.29 ? 124 GLN A O   1 
ATOM   941  C CB  . GLN A 1 124 ? 20.451 31.190  21.886 1.00 12.96 ? 124 GLN A CB  1 
ATOM   942  C CG  . GLN A 1 124 ? 20.460 31.355  20.362 1.00 12.29 ? 124 GLN A CG  1 
ATOM   943  C CD  . GLN A 1 124 ? 19.524 32.451  19.862 1.00 8.66  ? 124 GLN A CD  1 
ATOM   944  O OE1 . GLN A 1 124 ? 18.775 33.039  20.638 1.00 10.70 ? 124 GLN A OE1 1 
ATOM   945  N NE2 . GLN A 1 124 ? 19.571 32.734  18.570 1.00 7.08  ? 124 GLN A NE2 1 
ATOM   946  N N   . LEU A 1 125 ? 22.803 30.613  24.172 1.00 18.67 ? 125 LEU A N   1 
ATOM   947  C CA  . LEU A 1 125 ? 23.298 30.882  25.527 1.00 21.53 ? 125 LEU A CA  1 
ATOM   948  C C   . LEU A 1 125 ? 22.741 29.934  26.583 1.00 20.40 ? 125 LEU A C   1 
ATOM   949  O O   . LEU A 1 125 ? 22.293 30.374  27.640 1.00 22.34 ? 125 LEU A O   1 
ATOM   950  C CB  . LEU A 1 125 ? 22.969 32.325  25.921 1.00 23.67 ? 125 LEU A CB  1 
ATOM   951  C CG  . LEU A 1 125 ? 23.324 33.391  24.881 1.00 24.85 ? 125 LEU A CG  1 
ATOM   952  C CD1 . LEU A 1 125 ? 22.221 33.455  23.835 1.00 26.58 ? 125 LEU A CD1 1 
ATOM   953  C CD2 . LEU A 1 125 ? 23.473 34.744  25.552 1.00 24.56 ? 125 LEU A CD2 1 
ATOM   954  N N   . VAL A 1 126 ? 22.805 28.637  26.305 1.00 19.07 ? 126 VAL A N   1 
ATOM   955  C CA  . VAL A 1 126 ? 22.255 27.634  27.207 1.00 16.53 ? 126 VAL A CA  1 
ATOM   956  C C   . VAL A 1 126 ? 22.858 26.247  26.953 1.00 15.12 ? 126 VAL A C   1 
ATOM   957  O O   . VAL A 1 126 ? 23.256 25.937  25.835 1.00 16.29 ? 126 VAL A O   1 
ATOM   958  C CB  . VAL A 1 126 ? 20.720 27.613  27.030 1.00 16.56 ? 126 VAL A CB  1 
ATOM   959  C CG1 . VAL A 1 126 ? 20.181 26.205  27.126 1.00 17.76 ? 126 VAL A CG1 1 
ATOM   960  C CG2 . VAL A 1 126 ? 20.077 28.516  28.073 1.00 15.87 ? 126 VAL A CG2 1 
ATOM   961  N N   . SER A 1 127 ? 22.928 25.413  27.985 1.00 12.76 ? 127 SER A N   1 
ATOM   962  C CA  . SER A 1 127 ? 23.502 24.078  27.824 1.00 10.90 ? 127 SER A CA  1 
ATOM   963  C C   . SER A 1 127 ? 22.596 23.107  27.058 1.00 10.98 ? 127 SER A C   1 
ATOM   964  O O   . SER A 1 127 ? 21.381 23.306  26.943 1.00 7.93  ? 127 SER A O   1 
ATOM   965  C CB  . SER A 1 127 ? 23.846 23.474  29.192 1.00 8.48  ? 127 SER A CB  1 
ATOM   966  O OG  . SER A 1 127 ? 22.679 23.144  29.940 1.00 7.63  ? 127 SER A OG  1 
ATOM   967  N N   . VAL A 1 128 ? 23.212 22.052  26.539 1.00 10.54 ? 128 VAL A N   1 
ATOM   968  C CA  . VAL A 1 128 ? 22.506 21.029  25.787 1.00 10.80 ? 128 VAL A CA  1 
ATOM   969  C C   . VAL A 1 128 ? 21.281 20.539  26.559 1.00 10.96 ? 128 VAL A C   1 
ATOM   970  O O   . VAL A 1 128 ? 20.178 20.501  26.020 1.00 11.37 ? 128 VAL A O   1 
ATOM   971  C CB  . VAL A 1 128 ? 23.456 19.840  25.483 1.00 11.18 ? 128 VAL A CB  1 
ATOM   972  C CG1 . VAL A 1 128 ? 22.720 18.753  24.720 1.00 11.06 ? 128 VAL A CG1 1 
ATOM   973  C CG2 . VAL A 1 128 ? 24.654 20.329  24.692 1.00 9.02  ? 128 VAL A CG2 1 
ATOM   974  N N   . ALA A 1 129 ? 21.480 20.179  27.824 1.00 12.14 ? 129 ALA A N   1 
ATOM   975  C CA  . ALA A 1 129 ? 20.400 19.681  28.679 1.00 10.89 ? 129 ALA A CA  1 
ATOM   976  C C   . ALA A 1 129 ? 19.258 20.683  28.851 1.00 11.10 ? 129 ALA A C   1 
ATOM   977  O O   . ALA A 1 129 ? 18.086 20.332  28.712 1.00 11.51 ? 129 ALA A O   1 
ATOM   978  C CB  . ALA A 1 129 ? 20.958 19.303  30.040 1.00 8.79  ? 129 ALA A CB  1 
ATOM   979  N N   . MET A 1 130 ? 19.607 21.925  29.166 1.00 12.42 ? 130 MET A N   1 
ATOM   980  C CA  . MET A 1 130 ? 18.621 22.986  29.349 1.00 13.52 ? 130 MET A CA  1 
ATOM   981  C C   . MET A 1 130 ? 17.875 23.185  28.031 1.00 11.94 ? 130 MET A C   1 
ATOM   982  O O   . MET A 1 130 ? 16.645 23.295  28.008 1.00 11.27 ? 130 MET A O   1 
ATOM   983  C CB  . MET A 1 130 ? 19.331 24.277  29.789 1.00 17.36 ? 130 MET A CB  1 
ATOM   984  C CG  . MET A 1 130 ? 18.440 25.510  29.931 1.00 23.82 ? 130 MET A CG  1 
ATOM   985  S SD  . MET A 1 130 ? 16.955 25.251  30.956 1.00 32.67 ? 130 MET A SD  1 
ATOM   986  C CE  . MET A 1 130 ? 17.692 24.816  32.610 1.00 29.49 ? 130 MET A CE  1 
ATOM   987  N N   . ALA A 1 131 ? 18.627 23.207  26.934 1.00 10.87 ? 131 ALA A N   1 
ATOM   988  C CA  . ALA A 1 131 ? 18.048 23.367  25.603 1.00 10.75 ? 131 ALA A CA  1 
ATOM   989  C C   . ALA A 1 131 ? 16.978 22.298  25.317 1.00 9.12  ? 131 ALA A C   1 
ATOM   990  O O   . ALA A 1 131 ? 15.865 22.625  24.911 1.00 7.01  ? 131 ALA A O   1 
ATOM   991  C CB  . ALA A 1 131 ? 19.153 23.310  24.540 1.00 10.45 ? 131 ALA A CB  1 
ATOM   992  N N   . ALA A 1 132 ? 17.320 21.029  25.544 1.00 8.22  ? 132 ALA A N   1 
ATOM   993  C CA  . ALA A 1 132 ? 16.397 19.916  25.311 1.00 8.06  ? 132 ALA A CA  1 
ATOM   994  C C   . ALA A 1 132 ? 15.150 20.057  26.170 1.00 10.41 ? 132 ALA A C   1 
ATOM   995  O O   . ALA A 1 132 ? 14.029 19.820  25.708 1.00 11.50 ? 132 ALA A O   1 
ATOM   996  C CB  . ALA A 1 132 ? 17.088 18.586  25.614 1.00 5.36  ? 132 ALA A CB  1 
ATOM   997  N N   . LYS A 1 133 ? 15.356 20.425  27.431 1.00 11.21 ? 133 LYS A N   1 
ATOM   998  C CA  . LYS A 1 133 ? 14.256 20.614  28.369 1.00 12.99 ? 133 LYS A CA  1 
ATOM   999  C C   . LYS A 1 133 ? 13.326 21.715  27.858 1.00 13.93 ? 133 LYS A C   1 
ATOM   1000 O O   . LYS A 1 133 ? 12.106 21.604  27.954 1.00 14.20 ? 133 LYS A O   1 
ATOM   1001 C CB  . LYS A 1 133 ? 14.803 20.994  29.747 1.00 14.78 ? 133 LYS A CB  1 
ATOM   1002 C CG  . LYS A 1 133 ? 13.747 21.473  30.735 1.00 15.95 ? 133 LYS A CG  1 
ATOM   1003 C CD  . LYS A 1 133 ? 14.372 22.293  31.854 1.00 18.17 ? 133 LYS A CD  1 
ATOM   1004 C CE  . LYS A 1 133 ? 13.315 22.956  32.732 1.00 18.63 ? 133 LYS A CE  1 
ATOM   1005 N NZ  . LYS A 1 133 ? 13.941 23.809  33.791 1.00 20.52 ? 133 LYS A NZ  1 
ATOM   1006 N N   . LEU A 1 134 ? 13.903 22.779  27.312 1.00 15.19 ? 134 LEU A N   1 
ATOM   1007 C CA  . LEU A 1 134 ? 13.100 23.881  26.784 1.00 16.74 ? 134 LEU A CA  1 
ATOM   1008 C C   . LEU A 1 134 ? 12.339 23.461  25.527 1.00 16.70 ? 134 LEU A C   1 
ATOM   1009 O O   . LEU A 1 134 ? 11.140 23.729  25.380 1.00 15.48 ? 134 LEU A O   1 
ATOM   1010 C CB  . LEU A 1 134 ? 13.994 25.084  26.463 1.00 16.42 ? 134 LEU A CB  1 
ATOM   1011 C CG  . LEU A 1 134 ? 13.377 26.284  25.732 1.00 19.45 ? 134 LEU A CG  1 
ATOM   1012 C CD1 . LEU A 1 134 ? 12.075 26.722  26.392 1.00 20.57 ? 134 LEU A CD1 1 
ATOM   1013 C CD2 . LEU A 1 134 ? 14.380 27.430  25.739 1.00 20.73 ? 134 LEU A CD2 1 
ATOM   1014 N N   . THR A 1 135 ? 13.046 22.798  24.620 1.00 16.00 ? 135 THR A N   1 
ATOM   1015 C CA  . THR A 1 135 ? 12.440 22.355  23.375 1.00 15.30 ? 135 THR A CA  1 
ATOM   1016 C C   . THR A 1 135 ? 11.287 21.384  23.626 1.00 14.80 ? 135 THR A C   1 
ATOM   1017 O O   . THR A 1 135 ? 10.349 21.308  22.836 1.00 13.12 ? 135 THR A O   1 
ATOM   1018 C CB  . THR A 1 135 ? 13.491 21.699  22.464 1.00 13.98 ? 135 THR A CB  1 
ATOM   1019 O OG1 . THR A 1 135 ? 14.572 22.617  22.256 1.00 10.05 ? 135 THR A OG1 1 
ATOM   1020 C CG2 . THR A 1 135 ? 12.881 21.341  21.114 1.00 13.60 ? 135 THR A CG2 1 
ATOM   1021 N N   . ALA A 1 136 ? 11.355 20.647  24.729 1.00 14.70 ? 136 ALA A N   1 
ATOM   1022 C CA  . ALA A 1 136 ? 10.292 19.703  25.054 1.00 14.39 ? 136 ALA A CA  1 
ATOM   1023 C C   . ALA A 1 136 ? 9.023  20.454  25.466 1.00 14.04 ? 136 ALA A C   1 
ATOM   1024 O O   . ALA A 1 136 ? 7.913  20.050  25.111 1.00 13.30 ? 136 ALA A O   1 
ATOM   1025 C CB  . ALA A 1 136 ? 10.735 18.769  26.177 1.00 12.02 ? 136 ALA A CB  1 
ATOM   1026 N N   . ARG A 1 137 ? 9.189  21.540  26.218 1.00 12.77 ? 137 ARG A N   1 
ATOM   1027 C CA  . ARG A 1 137 ? 8.045  22.335  26.666 1.00 15.54 ? 137 ARG A CA  1 
ATOM   1028 C C   . ARG A 1 137 ? 7.375  22.981  25.465 1.00 15.94 ? 137 ARG A C   1 
ATOM   1029 O O   . ARG A 1 137 ? 6.150  23.017  25.364 1.00 16.20 ? 137 ARG A O   1 
ATOM   1030 C CB  . ARG A 1 137 ? 8.490  23.419  27.656 1.00 15.12 ? 137 ARG A CB  1 
ATOM   1031 C CG  . ARG A 1 137 ? 8.922  22.876  29.010 1.00 17.78 ? 137 ARG A CG  1 
ATOM   1032 C CD  . ARG A 1 137 ? 9.392  23.986  29.950 1.00 19.30 ? 137 ARG A CD  1 
ATOM   1033 N NE  . ARG A 1 137 ? 9.638  23.487  31.303 1.00 20.91 ? 137 ARG A NE  1 
ATOM   1034 C CZ  . ARG A 1 137 ? 9.918  24.260  32.349 1.00 24.27 ? 137 ARG A CZ  1 
ATOM   1035 N NH1 . ARG A 1 137 ? 9.993  25.580  32.206 1.00 26.56 ? 137 ARG A NH1 1 
ATOM   1036 N NH2 . ARG A 1 137 ? 10.113 23.719  33.546 1.00 25.65 ? 137 ARG A NH2 1 
ATOM   1037 N N   . VAL A 1 138 ? 8.191  23.490  24.549 1.00 15.16 ? 138 VAL A N   1 
ATOM   1038 C CA  . VAL A 1 138 ? 7.664  24.117  23.358 1.00 14.11 ? 138 VAL A CA  1 
ATOM   1039 C C   . VAL A 1 138 ? 6.888  23.095  22.533 1.00 12.94 ? 138 VAL A C   1 
ATOM   1040 O O   . VAL A 1 138 ? 5.802  23.393  22.050 1.00 12.72 ? 138 VAL A O   1 
ATOM   1041 C CB  . VAL A 1 138 ? 8.798  24.722  22.523 1.00 15.26 ? 138 VAL A CB  1 
ATOM   1042 C CG1 . VAL A 1 138 ? 8.237  25.329  21.256 1.00 14.67 ? 138 VAL A CG1 1 
ATOM   1043 C CG2 . VAL A 1 138 ? 9.527  25.776  23.343 1.00 13.34 ? 138 VAL A CG2 1 
ATOM   1044 N N   . ALA A 1 139 ? 7.431  21.889  22.387 1.00 11.51 ? 139 ALA A N   1 
ATOM   1045 C CA  . ALA A 1 139 ? 6.762  20.838  21.616 1.00 11.63 ? 139 ALA A CA  1 
ATOM   1046 C C   . ALA A 1 139 ? 5.515  20.342  22.340 1.00 12.15 ? 139 ALA A C   1 
ATOM   1047 O O   . ALA A 1 139 ? 4.507  20.013  21.720 1.00 11.58 ? 139 ALA A O   1 
ATOM   1048 C CB  . ALA A 1 139 ? 7.714  19.675  21.372 1.00 10.54 ? 139 ALA A CB  1 
ATOM   1049 N N   . GLN A 1 140 ? 5.601  20.288  23.664 1.00 13.56 ? 140 GLN A N   1 
ATOM   1050 C CA  . GLN A 1 140 ? 4.501  19.849  24.510 1.00 11.66 ? 140 GLN A CA  1 
ATOM   1051 C C   . GLN A 1 140 ? 3.308  20.799  24.346 1.00 11.94 ? 140 GLN A C   1 
ATOM   1052 O O   . GLN A 1 140 ? 2.153  20.372  24.216 1.00 11.72 ? 140 GLN A O   1 
ATOM   1053 C CB  . GLN A 1 140 ? 4.981  19.839  25.965 1.00 13.61 ? 140 GLN A CB  1 
ATOM   1054 C CG  . GLN A 1 140 ? 3.881  19.797  26.993 1.00 15.36 ? 140 GLN A CG  1 
ATOM   1055 C CD  . GLN A 1 140 ? 3.094  18.515  26.929 1.00 19.17 ? 140 GLN A CD  1 
ATOM   1056 O OE1 . GLN A 1 140 ? 1.945  18.459  27.371 1.00 21.36 ? 140 GLN A OE1 1 
ATOM   1057 N NE2 . GLN A 1 140 ? 3.709  17.465  26.386 1.00 18.96 ? 140 GLN A NE2 1 
ATOM   1058 N N   . LEU A 1 141 ? 3.605  22.091  24.333 1.00 8.28  ? 141 LEU A N   1 
ATOM   1059 C CA  . LEU A 1 141 ? 2.583  23.114  24.205 1.00 8.56  ? 141 LEU A CA  1 
ATOM   1060 C C   . LEU A 1 141 ? 2.005  23.290  22.785 1.00 9.39  ? 141 LEU A C   1 
ATOM   1061 O O   . LEU A 1 141 ? 0.788  23.337  22.610 1.00 9.42  ? 141 LEU A O   1 
ATOM   1062 C CB  . LEU A 1 141 ? 3.153  24.444  24.706 1.00 4.99  ? 141 LEU A CB  1 
ATOM   1063 C CG  . LEU A 1 141 ? 2.194  25.634  24.811 1.00 6.47  ? 141 LEU A CG  1 
ATOM   1064 C CD1 . LEU A 1 141 ? 1.159  25.378  25.905 1.00 6.63  ? 141 LEU A CD1 1 
ATOM   1065 C CD2 . LEU A 1 141 ? 2.977  26.899  25.116 1.00 6.44  ? 141 LEU A CD2 1 
ATOM   1066 N N   . TYR A 1 142 ? 2.879  23.377  21.786 1.00 11.89 ? 142 TYR A N   1 
ATOM   1067 C CA  . TYR A 1 142 ? 2.470  23.594  20.391 1.00 14.56 ? 142 TYR A CA  1 
ATOM   1068 C C   . TYR A 1 142 ? 2.534  22.376  19.464 1.00 16.04 ? 142 TYR A C   1 
ATOM   1069 O O   . TYR A 1 142 ? 2.293  22.492  18.259 1.00 15.73 ? 142 TYR A O   1 
ATOM   1070 C CB  . TYR A 1 142 ? 3.316  24.726  19.795 1.00 13.22 ? 142 TYR A CB  1 
ATOM   1071 C CG  . TYR A 1 142 ? 3.194  26.032  20.549 1.00 13.87 ? 142 TYR A CG  1 
ATOM   1072 C CD1 . TYR A 1 142 ? 1.998  26.756  20.544 1.00 15.08 ? 142 TYR A CD1 1 
ATOM   1073 C CD2 . TYR A 1 142 ? 4.264  26.541  21.274 1.00 14.34 ? 142 TYR A CD2 1 
ATOM   1074 C CE1 . TYR A 1 142 ? 1.873  27.954  21.240 1.00 14.47 ? 142 TYR A CE1 1 
ATOM   1075 C CE2 . TYR A 1 142 ? 4.154  27.738  21.975 1.00 14.96 ? 142 TYR A CE2 1 
ATOM   1076 C CZ  . TYR A 1 142 ? 2.956  28.440  21.952 1.00 16.23 ? 142 TYR A CZ  1 
ATOM   1077 O OH  . TYR A 1 142 ? 2.846  29.634  22.621 1.00 17.20 ? 142 TYR A OH  1 
ATOM   1078 N N   . GLY A 1 143 ? 2.857  21.214  20.022 1.00 18.49 ? 143 GLY A N   1 
ATOM   1079 C CA  . GLY A 1 143 ? 2.946  20.010  19.219 1.00 20.82 ? 143 GLY A CA  1 
ATOM   1080 C C   . GLY A 1 143 ? 1.632  19.264  19.147 1.00 24.16 ? 143 GLY A C   1 
ATOM   1081 O O   . GLY A 1 143 ? 0.722  19.514  19.939 1.00 26.62 ? 143 GLY A O   1 
ATOM   1082 N N   . GLU A 1 144 ? 1.530  18.349  18.189 1.00 25.43 ? 144 GLU A N   1 
ATOM   1083 C CA  . GLU A 1 144 ? 0.326  17.546  18.001 1.00 27.08 ? 144 GLU A CA  1 
ATOM   1084 C C   . GLU A 1 144 ? 0.632  16.080  18.281 1.00 25.61 ? 144 GLU A C   1 
ATOM   1085 O O   . GLU A 1 144 ? 1.630  15.553  17.799 1.00 25.83 ? 144 GLU A O   1 
ATOM   1086 C CB  . GLU A 1 144 ? -0.166 17.693  16.567 1.00 30.87 ? 144 GLU A CB  1 
ATOM   1087 C CG  . GLU A 1 144 ? -0.637 19.088  16.227 1.00 36.71 ? 144 GLU A CG  1 
ATOM   1088 C CD  . GLU A 1 144 ? -0.692 19.328  14.735 1.00 39.62 ? 144 GLU A CD  1 
ATOM   1089 O OE1 . GLU A 1 144 ? -1.259 18.466  14.021 1.00 39.63 ? 144 GLU A OE1 1 
ATOM   1090 O OE2 . GLU A 1 144 ? -0.170 20.378  14.286 1.00 41.11 ? 144 GLU A OE2 1 
ATOM   1091 N N   . ARG A 1 145 ? -0.225 15.416  19.048 1.00 24.91 ? 145 ARG A N   1 
ATOM   1092 C CA  . ARG A 1 145 ? -0.001 14.013  19.368 1.00 24.28 ? 145 ARG A CA  1 
ATOM   1093 C C   . ARG A 1 145 ? -0.409 13.092  18.224 1.00 23.46 ? 145 ARG A C   1 
ATOM   1094 O O   . ARG A 1 145 ? -1.291 13.420  17.434 1.00 20.95 ? 145 ARG A O   1 
ATOM   1095 C CB  . ARG A 1 145 ? -0.770 13.625  20.632 1.00 25.95 ? 145 ARG A CB  1 
ATOM   1096 C CG  . ARG A 1 145 ? -0.527 14.542  21.825 1.00 28.56 ? 145 ARG A CG  1 
ATOM   1097 C CD  . ARG A 1 145 ? -0.969 13.876  23.126 1.00 29.36 ? 145 ARG A CD  1 
ATOM   1098 N NE  . ARG A 1 145 ? 0.083  13.034  23.688 1.00 30.38 ? 145 ARG A NE  1 
ATOM   1099 C CZ  . ARG A 1 145 ? 1.067  13.483  24.463 1.00 31.29 ? 145 ARG A CZ  1 
ATOM   1100 N NH1 . ARG A 1 145 ? 1.134  14.771  24.780 1.00 30.68 ? 145 ARG A NH1 1 
ATOM   1101 N NH2 . ARG A 1 145 ? 1.996  12.646  24.906 1.00 30.95 ? 145 ARG A NH2 1 
ATOM   1102 N N   . LEU A 1 146 ? 0.251  11.942  18.133 1.00 23.53 ? 146 LEU A N   1 
ATOM   1103 C CA  . LEU A 1 146 ? -0.063 10.968  17.100 1.00 23.29 ? 146 LEU A CA  1 
ATOM   1104 C C   . LEU A 1 146 ? -1.209 10.095  17.597 1.00 25.17 ? 146 LEU A C   1 
ATOM   1105 O O   . LEU A 1 146 ? -1.140 9.527   18.689 1.00 24.66 ? 146 LEU A O   1 
ATOM   1106 C CB  . LEU A 1 146 ? 1.154  10.092  16.795 1.00 22.41 ? 146 LEU A CB  1 
ATOM   1107 C CG  . LEU A 1 146 ? 2.381  10.738  16.145 1.00 20.20 ? 146 LEU A CG  1 
ATOM   1108 C CD1 . LEU A 1 146 ? 3.490  9.704   16.049 1.00 20.15 ? 146 LEU A CD1 1 
ATOM   1109 C CD2 . LEU A 1 146 ? 2.029  11.274  14.768 1.00 19.09 ? 146 LEU A CD2 1 
ATOM   1110 N N   . ASP A 1 147 ? -2.261 9.995   16.790 1.00 26.69 ? 147 ASP A N   1 
ATOM   1111 C CA  . ASP A 1 147 ? -3.432 9.196   17.145 1.00 28.16 ? 147 ASP A CA  1 
ATOM   1112 C C   . ASP A 1 147 ? -3.057 7.738   17.376 1.00 27.78 ? 147 ASP A C   1 
ATOM   1113 O O   . ASP A 1 147 ? -3.365 7.167   18.424 1.00 28.66 ? 147 ASP A O   1 
ATOM   1114 C CB  . ASP A 1 147 ? -4.486 9.268   16.033 1.00 31.20 ? 147 ASP A CB  1 
ATOM   1115 C CG  . ASP A 1 147 ? -4.861 10.690  15.676 1.00 32.55 ? 147 ASP A CG  1 
ATOM   1116 O OD1 . ASP A 1 147 ? -5.337 11.425  16.568 1.00 33.69 ? 147 ASP A OD1 1 
ATOM   1117 O OD2 . ASP A 1 147 ? -4.681 11.069  14.498 1.00 34.22 ? 147 ASP A OD2 1 
ATOM   1118 N N   . ASP A 1 148 ? -2.393 7.141   16.389 1.00 26.75 ? 148 ASP A N   1 
ATOM   1119 C CA  . ASP A 1 148 ? -1.985 5.748   16.476 1.00 25.68 ? 148 ASP A CA  1 
ATOM   1120 C C   . ASP A 1 148 ? -0.855 5.477   17.471 1.00 23.81 ? 148 ASP A C   1 
ATOM   1121 O O   . ASP A 1 148 ? -0.711 4.356   17.951 1.00 23.46 ? 148 ASP A O   1 
ATOM   1122 C CB  . ASP A 1 148 ? -1.633 5.207   15.076 1.00 27.83 ? 148 ASP A CB  1 
ATOM   1123 C CG  . ASP A 1 148 ? -0.829 6.193   14.233 1.00 29.92 ? 148 ASP A CG  1 
ATOM   1124 O OD1 . ASP A 1 148 ? -1.229 7.374   14.132 1.00 32.73 ? 148 ASP A OD1 1 
ATOM   1125 O OD2 . ASP A 1 148 ? 0.198  5.780   13.651 1.00 29.10 ? 148 ASP A OD2 1 
ATOM   1126 N N   . PHE A 1 149 ? -0.057 6.494   17.786 1.00 22.66 ? 149 PHE A N   1 
ATOM   1127 C CA  . PHE A 1 149 ? 1.036  6.327   18.749 1.00 21.76 ? 149 PHE A CA  1 
ATOM   1128 C C   . PHE A 1 149 ? 1.012  7.456   19.783 1.00 22.20 ? 149 PHE A C   1 
ATOM   1129 O O   . PHE A 1 149 ? 1.830  8.384   19.742 1.00 18.83 ? 149 PHE A O   1 
ATOM   1130 C CB  . PHE A 1 149 ? 2.395  6.274   18.034 1.00 21.08 ? 149 PHE A CB  1 
ATOM   1131 C CG  . PHE A 1 149 ? 2.580  5.050   17.176 1.00 21.03 ? 149 PHE A CG  1 
ATOM   1132 C CD1 . PHE A 1 149 ? 2.206  5.054   15.835 1.00 21.19 ? 149 PHE A CD1 1 
ATOM   1133 C CD2 . PHE A 1 149 ? 3.079  3.872   17.726 1.00 21.74 ? 149 PHE A CD2 1 
ATOM   1134 C CE1 . PHE A 1 149 ? 2.324  3.897   15.054 1.00 21.41 ? 149 PHE A CE1 1 
ATOM   1135 C CE2 . PHE A 1 149 ? 3.200  2.711   16.959 1.00 21.85 ? 149 PHE A CE2 1 
ATOM   1136 C CZ  . PHE A 1 149 ? 2.820  2.723   15.619 1.00 21.77 ? 149 PHE A CZ  1 
ATOM   1137 N N   . PRO A 1 150 ? 0.072  7.369   20.740 1.00 22.52 ? 150 PRO A N   1 
ATOM   1138 C CA  . PRO A 1 150 ? -0.159 8.322   21.828 1.00 22.48 ? 150 PRO A CA  1 
ATOM   1139 C C   . PRO A 1 150 ? 1.067  8.764   22.623 1.00 22.65 ? 150 PRO A C   1 
ATOM   1140 O O   . PRO A 1 150 ? 1.053  9.831   23.235 1.00 21.70 ? 150 PRO A O   1 
ATOM   1141 C CB  . PRO A 1 150 ? -1.179 7.597   22.703 1.00 23.98 ? 150 PRO A CB  1 
ATOM   1142 C CG  . PRO A 1 150 ? -1.944 6.770   21.711 1.00 23.45 ? 150 PRO A CG  1 
ATOM   1143 C CD  . PRO A 1 150 ? -0.820 6.203   20.885 1.00 22.86 ? 150 PRO A CD  1 
ATOM   1144 N N   . GLU A 1 151 ? 2.122  7.958   22.624 1.00 21.84 ? 151 GLU A N   1 
ATOM   1145 C CA  . GLU A 1 151 ? 3.319  8.329   23.374 1.00 22.41 ? 151 GLU A CA  1 
ATOM   1146 C C   . GLU A 1 151 ? 4.182  9.346   22.627 1.00 21.08 ? 151 GLU A C   1 
ATOM   1147 O O   . GLU A 1 151 ? 5.099  9.934   23.208 1.00 21.12 ? 151 GLU A O   1 
ATOM   1148 C CB  . GLU A 1 151 ? 4.161  7.089   23.696 1.00 24.42 ? 151 GLU A CB  1 
ATOM   1149 C CG  . GLU A 1 151 ? 3.444  5.765   23.503 1.00 26.88 ? 151 GLU A CG  1 
ATOM   1150 C CD  . GLU A 1 151 ? 3.713  5.155   22.144 1.00 26.97 ? 151 GLU A CD  1 
ATOM   1151 O OE1 . GLU A 1 151 ? 4.862  4.721   21.899 1.00 27.23 ? 151 GLU A OE1 1 
ATOM   1152 O OE2 . GLU A 1 151 ? 2.774  5.110   21.320 1.00 27.54 ? 151 GLU A OE2 1 
ATOM   1153 N N   . TYR A 1 152 ? 3.889  9.545   21.345 1.00 17.58 ? 152 TYR A N   1 
ATOM   1154 C CA  . TYR A 1 152 ? 4.640  10.484  20.514 1.00 16.34 ? 152 TYR A CA  1 
ATOM   1155 C C   . TYR A 1 152 ? 3.892  11.759  20.151 1.00 14.89 ? 152 TYR A C   1 
ATOM   1156 O O   . TYR A 1 152 ? 2.680  11.754  19.929 1.00 14.88 ? 152 TYR A O   1 
ATOM   1157 C CB  . TYR A 1 152 ? 5.084  9.816   19.207 1.00 15.18 ? 152 TYR A CB  1 
ATOM   1158 C CG  . TYR A 1 152 ? 6.292  8.932   19.353 1.00 14.04 ? 152 TYR A CG  1 
ATOM   1159 C CD1 . TYR A 1 152 ? 7.550  9.480   19.615 1.00 14.51 ? 152 TYR A CD1 1 
ATOM   1160 C CD2 . TYR A 1 152 ? 6.182  7.548   19.264 1.00 12.65 ? 152 TYR A CD2 1 
ATOM   1161 C CE1 . TYR A 1 152 ? 8.667  8.667   19.786 1.00 12.15 ? 152 TYR A CE1 1 
ATOM   1162 C CE2 . TYR A 1 152 ? 7.296  6.732   19.438 1.00 13.18 ? 152 TYR A CE2 1 
ATOM   1163 C CZ  . TYR A 1 152 ? 8.531  7.301   19.697 1.00 11.57 ? 152 TYR A CZ  1 
ATOM   1164 O OH  . TYR A 1 152 ? 9.632  6.497   19.863 1.00 12.63 ? 152 TYR A OH  1 
ATOM   1165 N N   . ILE A 1 153 ? 4.641  12.851  20.081 1.00 15.12 ? 153 ILE A N   1 
ATOM   1166 C CA  . ILE A 1 153 ? 4.093  14.141  19.701 1.00 14.79 ? 153 ILE A CA  1 
ATOM   1167 C C   . ILE A 1 153 ? 4.995  14.701  18.586 1.00 12.61 ? 153 ILE A C   1 
ATOM   1168 O O   . ILE A 1 153 ? 6.215  14.547  18.635 1.00 9.28  ? 153 ILE A O   1 
ATOM   1169 C CB  . ILE A 1 153 ? 4.035  15.110  20.918 1.00 16.89 ? 153 ILE A CB  1 
ATOM   1170 C CG1 . ILE A 1 153 ? 3.450  16.454  20.487 1.00 18.16 ? 153 ILE A CG1 1 
ATOM   1171 C CG2 . ILE A 1 153 ? 5.420  15.312  21.511 1.00 19.43 ? 153 ILE A CG2 1 
ATOM   1172 C CD1 . ILE A 1 153 ? 3.263  17.398  21.623 1.00 20.97 ? 153 ILE A CD1 1 
ATOM   1173 N N   . CYS A 1 154 ? 4.381  15.312  17.573 1.00 11.83 ? 154 CYS A N   1 
ATOM   1174 C CA  . CYS A 1 154 ? 5.121  15.884  16.445 1.00 11.74 ? 154 CYS A CA  1 
ATOM   1175 C C   . CYS A 1 154 ? 5.661  17.255  16.797 1.00 10.36 ? 154 CYS A C   1 
ATOM   1176 O O   . CYS A 1 154 ? 5.006  18.018  17.506 1.00 9.41  ? 154 CYS A O   1 
ATOM   1177 C CB  . CYS A 1 154 ? 4.217  16.015  15.211 1.00 10.09 ? 154 CYS A CB  1 
ATOM   1178 S SG  . CYS A 1 154 ? 3.661  14.458  14.499 1.00 12.35 ? 154 CYS A SG  1 
ATOM   1179 N N   . PHE A 1 155 ? 6.852  17.565  16.297 1.00 9.94  ? 155 PHE A N   1 
ATOM   1180 C CA  . PHE A 1 155 ? 7.461  18.859  16.560 1.00 11.11 ? 155 PHE A CA  1 
ATOM   1181 C C   . PHE A 1 155 ? 6.470  19.905  16.056 1.00 10.81 ? 155 PHE A C   1 
ATOM   1182 O O   . PHE A 1 155 ? 5.803  19.692  15.053 1.00 12.03 ? 155 PHE A O   1 
ATOM   1183 C CB  . PHE A 1 155 ? 8.788  18.990  15.800 1.00 10.16 ? 155 PHE A CB  1 
ATOM   1184 C CG  . PHE A 1 155 ? 9.640  20.149  16.252 1.00 9.90  ? 155 PHE A CG  1 
ATOM   1185 C CD1 . PHE A 1 155 ? 10.561 19.995  17.287 1.00 9.47  ? 155 PHE A CD1 1 
ATOM   1186 C CD2 . PHE A 1 155 ? 9.506  21.399  15.662 1.00 9.27  ? 155 PHE A CD2 1 
ATOM   1187 C CE1 . PHE A 1 155 ? 11.336 21.066  17.724 1.00 5.51  ? 155 PHE A CE1 1 
ATOM   1188 C CE2 . PHE A 1 155 ? 10.273 22.477  16.093 1.00 7.53  ? 155 PHE A CE2 1 
ATOM   1189 C CZ  . PHE A 1 155 ? 11.192 22.309  17.127 1.00 6.69  ? 155 PHE A CZ  1 
ATOM   1190 N N   . PRO A 1 156 ? 6.337  21.034  16.764 1.00 10.91 ? 156 PRO A N   1 
ATOM   1191 C CA  . PRO A 1 156 ? 5.407  22.079  16.330 1.00 12.28 ? 156 PRO A CA  1 
ATOM   1192 C C   . PRO A 1 156 ? 5.605  22.462  14.859 1.00 12.64 ? 156 PRO A C   1 
ATOM   1193 O O   . PRO A 1 156 ? 6.735  22.566  14.379 1.00 12.49 ? 156 PRO A O   1 
ATOM   1194 C CB  . PRO A 1 156 ? 5.731  23.226  17.279 1.00 10.30 ? 156 PRO A CB  1 
ATOM   1195 C CG  . PRO A 1 156 ? 6.022  22.510  18.545 1.00 8.05  ? 156 PRO A CG  1 
ATOM   1196 C CD  . PRO A 1 156 ? 6.901  21.357  18.086 1.00 10.98 ? 156 PRO A CD  1 
ATOM   1197 N N   . THR A 1 157 ? 4.500  22.657  14.149 1.00 13.46 ? 157 THR A N   1 
ATOM   1198 C CA  . THR A 1 157 ? 4.548  23.045  12.741 1.00 14.55 ? 157 THR A CA  1 
ATOM   1199 C C   . THR A 1 157 ? 4.676  24.567  12.659 1.00 13.32 ? 157 THR A C   1 
ATOM   1200 O O   . THR A 1 157 ? 4.328  25.269  13.605 1.00 12.20 ? 157 THR A O   1 
ATOM   1201 C CB  . THR A 1 157 ? 3.256  22.649  12.010 1.00 14.66 ? 157 THR A CB  1 
ATOM   1202 O OG1 . THR A 1 157 ? 2.156  23.355  12.594 1.00 15.31 ? 157 THR A OG1 1 
ATOM   1203 C CG2 . THR A 1 157 ? 3.008  21.155  12.123 1.00 14.23 ? 157 THR A CG2 1 
ATOM   1204 N N   . PRO A 1 158 ? 5.181  25.090  11.527 1.00 13.26 ? 158 PRO A N   1 
ATOM   1205 C CA  . PRO A 1 158 ? 5.366  26.528  11.286 1.00 13.15 ? 158 PRO A CA  1 
ATOM   1206 C C   . PRO A 1 158 ? 4.080  27.324  11.531 1.00 14.60 ? 158 PRO A C   1 
ATOM   1207 O O   . PRO A 1 158 ? 4.103  28.373  12.169 1.00 14.46 ? 158 PRO A O   1 
ATOM   1208 C CB  . PRO A 1 158 ? 5.782  26.583  9.817  1.00 13.84 ? 158 PRO A CB  1 
ATOM   1209 C CG  . PRO A 1 158 ? 6.505  25.296  9.620  1.00 12.55 ? 158 PRO A CG  1 
ATOM   1210 C CD  . PRO A 1 158 ? 5.650  24.303  10.372 1.00 12.81 ? 158 PRO A CD  1 
ATOM   1211 N N   . GLN A 1 159 ? 2.961  26.816  11.015 1.00 16.24 ? 159 GLN A N   1 
ATOM   1212 C CA  . GLN A 1 159 ? 1.668  27.474  11.167 1.00 17.30 ? 159 GLN A CA  1 
ATOM   1213 C C   . GLN A 1 159 ? 1.344  27.701  12.638 1.00 18.25 ? 159 GLN A C   1 
ATOM   1214 O O   . GLN A 1 159 ? 0.977  28.804  13.040 1.00 18.88 ? 159 GLN A O   1 
ATOM   1215 C CB  . GLN A 1 159 ? 0.548  26.638  10.534 1.00 16.93 ? 159 GLN A CB  1 
ATOM   1216 C CG  . GLN A 1 159 ? 0.792  26.231  9.085  1.00 21.29 ? 159 GLN A CG  1 
ATOM   1217 C CD  . GLN A 1 159 ? 1.508  24.892  8.963  1.00 23.61 ? 159 GLN A CD  1 
ATOM   1218 O OE1 . GLN A 1 159 ? 0.950  23.842  9.292  1.00 26.36 ? 159 GLN A OE1 1 
ATOM   1219 N NE2 . GLN A 1 159 ? 2.746  24.922  8.487  1.00 23.77 ? 159 GLN A NE2 1 
ATOM   1220 N N   . ARG A 1 160 ? 1.484  26.653  13.442 1.00 18.31 ? 160 ARG A N   1 
ATOM   1221 C CA  . ARG A 1 160 ? 1.189  26.752  14.863 1.00 19.15 ? 160 ARG A CA  1 
ATOM   1222 C C   . ARG A 1 160 ? 2.089  27.788  15.536 1.00 18.67 ? 160 ARG A C   1 
ATOM   1223 O O   . ARG A 1 160 ? 1.600  28.734  16.155 1.00 16.67 ? 160 ARG A O   1 
ATOM   1224 C CB  . ARG A 1 160 ? 1.349  25.381  15.520 1.00 20.55 ? 160 ARG A CB  1 
ATOM   1225 C CG  . ARG A 1 160 ? 0.963  25.335  16.986 1.00 24.20 ? 160 ARG A CG  1 
ATOM   1226 C CD  . ARG A 1 160 ? -0.458 25.829  17.243 1.00 26.52 ? 160 ARG A CD  1 
ATOM   1227 N NE  . ARG A 1 160 ? -0.810 25.659  18.650 1.00 27.79 ? 160 ARG A NE  1 
ATOM   1228 C CZ  . ARG A 1 160 ? -1.088 24.482  19.207 1.00 28.48 ? 160 ARG A CZ  1 
ATOM   1229 N NH1 . ARG A 1 160 ? -1.067 23.378  18.469 1.00 27.18 ? 160 ARG A NH1 1 
ATOM   1230 N NH2 . ARG A 1 160 ? -1.358 24.408  20.506 1.00 26.85 ? 160 ARG A NH2 1 
ATOM   1231 N N   . LEU A 1 161 ? 3.402  27.620  15.392 1.00 18.86 ? 161 LEU A N   1 
ATOM   1232 C CA  . LEU A 1 161 ? 4.367  28.551  15.984 1.00 18.50 ? 161 LEU A CA  1 
ATOM   1233 C C   . LEU A 1 161 ? 4.325  29.953  15.388 1.00 17.53 ? 161 LEU A C   1 
ATOM   1234 O O   . LEU A 1 161 ? 5.036  30.844  15.848 1.00 17.83 ? 161 LEU A O   1 
ATOM   1235 C CB  . LEU A 1 161 ? 5.793  28.010  15.840 1.00 18.98 ? 161 LEU A CB  1 
ATOM   1236 C CG  . LEU A 1 161 ? 6.204  26.865  16.763 1.00 20.22 ? 161 LEU A CG  1 
ATOM   1237 C CD1 . LEU A 1 161 ? 7.596  26.376  16.376 1.00 20.28 ? 161 LEU A CD1 1 
ATOM   1238 C CD2 . LEU A 1 161 ? 6.171  27.342  18.212 1.00 19.40 ? 161 LEU A CD2 1 
ATOM   1239 N N   . ALA A 1 162 ? 3.515  30.157  14.358 1.00 15.72 ? 162 ALA A N   1 
ATOM   1240 C CA  . ALA A 1 162 ? 3.436  31.475  13.746 1.00 14.21 ? 162 ALA A CA  1 
ATOM   1241 C C   . ALA A 1 162 ? 2.407  32.307  14.492 1.00 14.15 ? 162 ALA A C   1 
ATOM   1242 O O   . ALA A 1 162 ? 2.512  33.532  14.550 1.00 13.76 ? 162 ALA A O   1 
ATOM   1243 C CB  . ALA A 1 162 ? 3.055  31.357  12.273 1.00 11.08 ? 162 ALA A CB  1 
ATOM   1244 N N   . ALA A 1 163 ? 1.418  31.624  15.063 1.00 15.22 ? 163 ALA A N   1 
ATOM   1245 C CA  . ALA A 1 163 ? 0.346  32.266  15.812 1.00 17.34 ? 163 ALA A CA  1 
ATOM   1246 C C   . ALA A 1 163 ? 0.518  32.117  17.322 1.00 17.88 ? 163 ALA A C   1 
ATOM   1247 O O   . ALA A 1 163 ? -0.385 32.448  18.090 1.00 18.21 ? 163 ALA A O   1 
ATOM   1248 C CB  . ALA A 1 163 ? -1.001 31.689  15.388 1.00 16.45 ? 163 ALA A CB  1 
ATOM   1249 N N   . ALA A 1 164 ? 1.668  31.614  17.751 1.00 18.67 ? 164 ALA A N   1 
ATOM   1250 C CA  . ALA A 1 164 ? 1.909  31.452  19.180 1.00 20.92 ? 164 ALA A CA  1 
ATOM   1251 C C   . ALA A 1 164 ? 2.119  32.823  19.809 1.00 21.15 ? 164 ALA A C   1 
ATOM   1252 O O   . ALA A 1 164 ? 2.758  33.694  19.218 1.00 22.20 ? 164 ALA A O   1 
ATOM   1253 C CB  . ALA A 1 164 ? 3.137  30.577  19.416 1.00 21.48 ? 164 ALA A CB  1 
ATOM   1254 N N   . ASP A 1 165 ? 1.569  33.019  21.000 1.00 21.39 ? 165 ASP A N   1 
ATOM   1255 C CA  . ASP A 1 165 ? 1.726  34.287  21.698 1.00 21.56 ? 165 ASP A CA  1 
ATOM   1256 C C   . ASP A 1 165 ? 3.157  34.382  22.222 1.00 21.10 ? 165 ASP A C   1 
ATOM   1257 O O   . ASP A 1 165 ? 3.621  33.491  22.933 1.00 20.76 ? 165 ASP A O   1 
ATOM   1258 C CB  . ASP A 1 165 ? 0.721  34.379  22.855 1.00 21.65 ? 165 ASP A CB  1 
ATOM   1259 C CG  . ASP A 1 165 ? 1.070  35.473  23.852 1.00 23.31 ? 165 ASP A CG  1 
ATOM   1260 O OD1 . ASP A 1 165 ? 1.604  36.522  23.427 1.00 22.58 ? 165 ASP A OD1 1 
ATOM   1261 O OD2 . ASP A 1 165 ? 0.797  35.289  25.060 1.00 23.33 ? 165 ASP A OD2 1 
ATOM   1262 N N   . PRO A 1 166 ? 3.877  35.459  21.862 1.00 20.24 ? 166 PRO A N   1 
ATOM   1263 C CA  . PRO A 1 166 ? 5.262  35.693  22.285 1.00 19.87 ? 166 PRO A CA  1 
ATOM   1264 C C   . PRO A 1 166 ? 5.466  35.400  23.775 1.00 19.91 ? 166 PRO A C   1 
ATOM   1265 O O   . PRO A 1 166 ? 6.451  34.768  24.168 1.00 18.36 ? 166 PRO A O   1 
ATOM   1266 C CB  . PRO A 1 166 ? 5.472  37.162  21.950 1.00 19.73 ? 166 PRO A CB  1 
ATOM   1267 C CG  . PRO A 1 166 ? 4.662  37.329  20.714 1.00 20.12 ? 166 PRO A CG  1 
ATOM   1268 C CD  . PRO A 1 166 ? 3.388  36.573  21.029 1.00 20.10 ? 166 PRO A CD  1 
ATOM   1269 N N   . GLN A 1 167 ? 4.520  35.872  24.587 1.00 19.41 ? 167 GLN A N   1 
ATOM   1270 C CA  . GLN A 1 167 ? 4.539  35.688  26.034 1.00 19.42 ? 167 GLN A CA  1 
ATOM   1271 C C   . GLN A 1 167 ? 4.422  34.207  26.401 1.00 19.65 ? 167 GLN A C   1 
ATOM   1272 O O   . GLN A 1 167 ? 5.057  33.743  27.349 1.00 18.96 ? 167 GLN A O   1 
ATOM   1273 C CB  . GLN A 1 167 ? 3.378  36.461  26.669 1.00 20.85 ? 167 GLN A CB  1 
ATOM   1274 C CG  . GLN A 1 167 ? 3.512  37.974  26.629 1.00 20.93 ? 167 GLN A CG  1 
ATOM   1275 C CD  . GLN A 1 167 ? 4.651  38.477  27.493 1.00 23.40 ? 167 GLN A CD  1 
ATOM   1276 O OE1 . GLN A 1 167 ? 4.742  38.149  28.684 1.00 25.47 ? 167 GLN A OE1 1 
ATOM   1277 N NE2 . GLN A 1 167 ? 5.527  39.287  26.904 1.00 23.80 ? 167 GLN A NE2 1 
ATOM   1278 N N   . ALA A 1 168 ? 3.602  33.471  25.654 1.00 19.56 ? 168 ALA A N   1 
ATOM   1279 C CA  . ALA A 1 168 ? 3.416  32.043  25.912 1.00 19.92 ? 168 ALA A CA  1 
ATOM   1280 C C   . ALA A 1 168 ? 4.763  31.331  25.829 1.00 20.28 ? 168 ALA A C   1 
ATOM   1281 O O   . ALA A 1 168 ? 5.161  30.619  26.756 1.00 21.13 ? 168 ALA A O   1 
ATOM   1282 C CB  . ALA A 1 168 ? 2.440  31.446  24.905 1.00 19.29 ? 168 ALA A CB  1 
ATOM   1283 N N   . LEU A 1 169 ? 5.468  31.522  24.717 1.00 19.55 ? 169 LEU A N   1 
ATOM   1284 C CA  . LEU A 1 169 ? 6.781  30.909  24.556 1.00 18.23 ? 169 LEU A CA  1 
ATOM   1285 C C   . LEU A 1 169 ? 7.726  31.482  25.621 1.00 17.74 ? 169 LEU A C   1 
ATOM   1286 O O   . LEU A 1 169 ? 8.571  30.765  26.160 1.00 17.52 ? 169 LEU A O   1 
ATOM   1287 C CB  . LEU A 1 169 ? 7.334  31.187  23.156 1.00 17.18 ? 169 LEU A CB  1 
ATOM   1288 C CG  . LEU A 1 169 ? 6.710  30.423  21.984 1.00 16.51 ? 169 LEU A CG  1 
ATOM   1289 C CD1 . LEU A 1 169 ? 7.123  31.098  20.690 1.00 15.72 ? 169 LEU A CD1 1 
ATOM   1290 C CD2 . LEU A 1 169 ? 7.137  28.951  22.004 1.00 11.07 ? 169 LEU A CD2 1 
ATOM   1291 N N   . LYS A 1 170 ? 7.569  32.771  25.926 1.00 15.95 ? 170 LYS A N   1 
ATOM   1292 C CA  . LYS A 1 170 ? 8.397  33.429  26.928 1.00 15.39 ? 170 LYS A CA  1 
ATOM   1293 C C   . LYS A 1 170 ? 8.320  32.663  28.239 1.00 15.29 ? 170 LYS A C   1 
ATOM   1294 O O   . LYS A 1 170 ? 9.341  32.290  28.805 1.00 14.19 ? 170 LYS A O   1 
ATOM   1295 C CB  . LYS A 1 170 ? 7.926  34.871  27.153 1.00 14.49 ? 170 LYS A CB  1 
ATOM   1296 C CG  . LYS A 1 170 ? 8.768  35.671  28.160 1.00 14.38 ? 170 LYS A CG  1 
ATOM   1297 C CD  . LYS A 1 170 ? 8.189  37.075  28.372 1.00 15.35 ? 170 LYS A CD  1 
ATOM   1298 C CE  . LYS A 1 170 ? 9.172  38.031  29.051 1.00 14.05 ? 170 LYS A CE  1 
ATOM   1299 N NZ  . LYS A 1 170 ? 9.603  37.594  30.399 1.00 11.19 ? 170 LYS A NZ  1 
ATOM   1300 N N   . ALA A 1 171 ? 7.097  32.427  28.709 1.00 15.92 ? 171 ALA A N   1 
ATOM   1301 C CA  . ALA A 1 171 ? 6.870  31.722  29.968 1.00 15.99 ? 171 ALA A CA  1 
ATOM   1302 C C   . ALA A 1 171 ? 7.566  30.357  30.056 1.00 14.68 ? 171 ALA A C   1 
ATOM   1303 O O   . ALA A 1 171 ? 7.854  29.877  31.154 1.00 13.59 ? 171 ALA A O   1 
ATOM   1304 C CB  . ALA A 1 171 ? 5.368  31.560  30.204 1.00 16.41 ? 171 ALA A CB  1 
ATOM   1305 N N   . LEU A 1 172 ? 7.839  29.737  28.909 1.00 13.54 ? 172 LEU A N   1 
ATOM   1306 C CA  . LEU A 1 172 ? 8.498  28.429  28.895 1.00 11.72 ? 172 LEU A CA  1 
ATOM   1307 C C   . LEU A 1 172 ? 9.978  28.528  29.314 1.00 11.92 ? 172 LEU A C   1 
ATOM   1308 O O   . LEU A 1 172 ? 10.615 27.514  29.622 1.00 10.02 ? 172 LEU A O   1 
ATOM   1309 C CB  . LEU A 1 172 ? 8.372  27.786  27.500 1.00 10.22 ? 172 LEU A CB  1 
ATOM   1310 C CG  . LEU A 1 172 ? 6.960  27.606  26.916 1.00 7.09  ? 172 LEU A CG  1 
ATOM   1311 C CD1 . LEU A 1 172 ? 7.037  27.022  25.520 1.00 2.98  ? 172 LEU A CD1 1 
ATOM   1312 C CD2 . LEU A 1 172 ? 6.133  26.711  27.818 1.00 5.33  ? 172 LEU A CD2 1 
ATOM   1313 N N   . GLY A 1 173 ? 10.520 29.745  29.326 1.00 11.30 ? 173 GLY A N   1 
ATOM   1314 C CA  . GLY A 1 173 ? 11.905 29.929  29.734 1.00 10.38 ? 173 GLY A CA  1 
ATOM   1315 C C   . GLY A 1 173 ? 12.851 30.592  28.752 1.00 11.51 ? 173 GLY A C   1 
ATOM   1316 O O   . GLY A 1 173 ? 13.991 30.154  28.606 1.00 11.67 ? 173 GLY A O   1 
ATOM   1317 N N   . MET A 1 174 ? 12.399 31.644  28.075 1.00 12.49 ? 174 MET A N   1 
ATOM   1318 C CA  . MET A 1 174 ? 13.249 32.363  27.126 1.00 12.29 ? 174 MET A CA  1 
ATOM   1319 C C   . MET A 1 174 ? 12.872 33.844  27.099 1.00 13.66 ? 174 MET A C   1 
ATOM   1320 O O   . MET A 1 174 ? 11.747 34.219  27.455 1.00 14.14 ? 174 MET A O   1 
ATOM   1321 C CB  . MET A 1 174 ? 13.109 31.775  25.713 1.00 11.47 ? 174 MET A CB  1 
ATOM   1322 C CG  . MET A 1 174 ? 11.721 31.949  25.090 1.00 10.20 ? 174 MET A CG  1 
ATOM   1323 S SD  . MET A 1 174 ? 11.594 31.272  23.416 1.00 10.66 ? 174 MET A SD  1 
ATOM   1324 C CE  . MET A 1 174 ? 11.179 29.552  23.782 1.00 9.18  ? 174 MET A CE  1 
ATOM   1325 N N   . PRO A 1 175 ? 13.813 34.710  26.690 1.00 13.26 ? 175 PRO A N   1 
ATOM   1326 C CA  . PRO A 1 175 ? 13.523 36.146  26.631 1.00 14.22 ? 175 PRO A CA  1 
ATOM   1327 C C   . PRO A 1 175 ? 12.504 36.386  25.515 1.00 16.91 ? 175 PRO A C   1 
ATOM   1328 O O   . PRO A 1 175 ? 12.321 35.526  24.651 1.00 19.04 ? 175 PRO A O   1 
ATOM   1329 C CB  . PRO A 1 175 ? 14.886 36.765  26.307 1.00 13.38 ? 175 PRO A CB  1 
ATOM   1330 C CG  . PRO A 1 175 ? 15.879 35.734  26.777 1.00 12.56 ? 175 PRO A CG  1 
ATOM   1331 C CD  . PRO A 1 175 ? 15.225 34.442  26.372 1.00 12.52 ? 175 PRO A CD  1 
ATOM   1332 N N   . LEU A 1 176 ? 11.847 37.540  25.529 1.00 19.28 ? 176 LEU A N   1 
ATOM   1333 C CA  . LEU A 1 176 ? 10.851 37.874  24.511 1.00 21.22 ? 176 LEU A CA  1 
ATOM   1334 C C   . LEU A 1 176 ? 11.495 37.860  23.131 1.00 22.16 ? 176 LEU A C   1 
ATOM   1335 O O   . LEU A 1 176 ? 10.900 37.392  22.158 1.00 21.51 ? 176 LEU A O   1 
ATOM   1336 C CB  . LEU A 1 176 ? 10.266 39.261  24.777 1.00 23.18 ? 176 LEU A CB  1 
ATOM   1337 C CG  . LEU A 1 176 ? 9.123  39.716  23.866 1.00 24.88 ? 176 LEU A CG  1 
ATOM   1338 C CD1 . LEU A 1 176 ? 7.857  38.920  24.202 1.00 24.60 ? 176 LEU A CD1 1 
ATOM   1339 C CD2 . LEU A 1 176 ? 8.874  41.214  24.058 1.00 25.47 ? 176 LEU A CD2 1 
ATOM   1340 N N   . LYS A 1 177 ? 12.716 38.382  23.060 1.00 23.17 ? 177 LYS A N   1 
ATOM   1341 C CA  . LYS A 1 177 ? 13.467 38.437  21.814 1.00 22.93 ? 177 LYS A CA  1 
ATOM   1342 C C   . LYS A 1 177 ? 13.525 37.038  21.190 1.00 21.50 ? 177 LYS A C   1 
ATOM   1343 O O   . LYS A 1 177 ? 13.176 36.853  20.023 1.00 19.53 ? 177 LYS A O   1 
ATOM   1344 C CB  . LYS A 1 177 ? 14.886 38.938  22.089 1.00 24.04 ? 177 LYS A CB  1 
ATOM   1345 C CG  . LYS A 1 177 ? 14.948 40.265  22.837 1.00 28.74 ? 177 LYS A CG  1 
ATOM   1346 C CD  . LYS A 1 177 ? 15.200 41.442  21.896 1.00 32.25 ? 177 LYS A CD  1 
ATOM   1347 C CE  . LYS A 1 177 ? 16.563 41.321  21.212 1.00 32.84 ? 177 LYS A CE  1 
ATOM   1348 N NZ  . LYS A 1 177 ? 16.833 42.438  20.267 1.00 32.92 ? 177 LYS A NZ  1 
ATOM   1349 N N   . ARG A 1 178 ? 13.961 36.064  21.987 1.00 19.85 ? 178 ARG A N   1 
ATOM   1350 C CA  . ARG A 1 178 ? 14.084 34.672  21.549 1.00 19.65 ? 178 ARG A CA  1 
ATOM   1351 C C   . ARG A 1 178 ? 12.762 34.168  20.988 1.00 18.52 ? 178 ARG A C   1 
ATOM   1352 O O   . ARG A 1 178 ? 12.720 33.550  19.917 1.00 16.76 ? 178 ARG A O   1 
ATOM   1353 C CB  . ARG A 1 178 ? 14.489 33.784  22.726 1.00 21.40 ? 178 ARG A CB  1 
ATOM   1354 C CG  . ARG A 1 178 ? 14.955 32.387  22.343 1.00 21.08 ? 178 ARG A CG  1 
ATOM   1355 C CD  . ARG A 1 178 ? 16.461 32.296  22.485 1.00 22.24 ? 178 ARG A CD  1 
ATOM   1356 N NE  . ARG A 1 178 ? 16.878 32.484  23.870 1.00 20.77 ? 178 ARG A NE  1 
ATOM   1357 C CZ  . ARG A 1 178 ? 18.028 33.035  24.243 1.00 22.59 ? 178 ARG A CZ  1 
ATOM   1358 N NH1 . ARG A 1 178 ? 18.896 33.465  23.340 1.00 22.04 ? 178 ARG A NH1 1 
ATOM   1359 N NH2 . ARG A 1 178 ? 18.308 33.164  25.529 1.00 25.47 ? 178 ARG A NH2 1 
ATOM   1360 N N   . ALA A 1 179 ? 11.690 34.439  21.728 1.00 16.92 ? 179 ALA A N   1 
ATOM   1361 C CA  . ALA A 1 179 ? 10.350 34.028  21.339 1.00 16.51 ? 179 ALA A CA  1 
ATOM   1362 C C   . ALA A 1 179 ? 9.880  34.715  20.064 1.00 15.75 ? 179 ALA A C   1 
ATOM   1363 O O   . ALA A 1 179 ? 9.041  34.181  19.346 1.00 15.37 ? 179 ALA A O   1 
ATOM   1364 C CB  . ALA A 1 179 ? 9.369  34.302  22.483 1.00 14.93 ? 179 ALA A CB  1 
ATOM   1365 N N   . GLU A 1 180 ? 10.418 35.896  19.781 1.00 15.70 ? 180 GLU A N   1 
ATOM   1366 C CA  . GLU A 1 180 ? 10.035 36.626  18.576 1.00 15.78 ? 180 GLU A CA  1 
ATOM   1367 C C   . GLU A 1 180 ? 10.833 36.121  17.390 1.00 15.51 ? 180 GLU A C   1 
ATOM   1368 O O   . GLU A 1 180 ? 10.373 36.172  16.250 1.00 16.28 ? 180 GLU A O   1 
ATOM   1369 C CB  . GLU A 1 180 ? 10.273 38.127  18.746 1.00 16.73 ? 180 GLU A CB  1 
ATOM   1370 C CG  . GLU A 1 180 ? 9.472  38.749  19.875 1.00 18.61 ? 180 GLU A CG  1 
ATOM   1371 C CD  . GLU A 1 180 ? 9.630  40.255  19.938 1.00 19.40 ? 180 GLU A CD  1 
ATOM   1372 O OE1 . GLU A 1 180 ? 10.755 40.750  19.700 1.00 22.23 ? 180 GLU A OE1 1 
ATOM   1373 O OE2 . GLU A 1 180 ? 8.634  40.942  20.244 1.00 21.50 ? 180 GLU A OE2 1 
ATOM   1374 N N   . ALA A 1 181 ? 12.038 35.643  17.670 1.00 14.73 ? 181 ALA A N   1 
ATOM   1375 C CA  . ALA A 1 181 ? 12.906 35.109  16.636 1.00 14.35 ? 181 ALA A CA  1 
ATOM   1376 C C   . ALA A 1 181 ? 12.220 33.869  16.094 1.00 13.95 ? 181 ALA A C   1 
ATOM   1377 O O   . ALA A 1 181 ? 12.116 33.678  14.886 1.00 14.98 ? 181 ALA A O   1 
ATOM   1378 C CB  . ALA A 1 181 ? 14.260 34.744  17.225 1.00 14.47 ? 181 ALA A CB  1 
ATOM   1379 N N   . LEU A 1 182 ? 11.740 33.032  17.003 1.00 13.42 ? 182 LEU A N   1 
ATOM   1380 C CA  . LEU A 1 182 ? 11.058 31.808  16.614 1.00 14.24 ? 182 LEU A CA  1 
ATOM   1381 C C   . LEU A 1 182 ? 9.820  32.103  15.783 1.00 13.99 ? 182 LEU A C   1 
ATOM   1382 O O   . LEU A 1 182 ? 9.597  31.466  14.756 1.00 11.11 ? 182 LEU A O   1 
ATOM   1383 C CB  . LEU A 1 182 ? 10.648 31.018  17.846 1.00 14.74 ? 182 LEU A CB  1 
ATOM   1384 C CG  . LEU A 1 182 ? 11.776 30.704  18.817 1.00 15.72 ? 182 LEU A CG  1 
ATOM   1385 C CD1 . LEU A 1 182 ? 11.168 30.036  20.029 1.00 17.87 ? 182 LEU A CD1 1 
ATOM   1386 C CD2 . LEU A 1 182 ? 12.821 29.813  18.165 1.00 17.11 ? 182 LEU A CD2 1 
ATOM   1387 N N   . ILE A 1 183 ? 9.016  33.063  16.240 1.00 14.34 ? 183 ILE A N   1 
ATOM   1388 C CA  . ILE A 1 183 ? 7.793  33.435  15.539 1.00 15.41 ? 183 ILE A CA  1 
ATOM   1389 C C   . ILE A 1 183 ? 8.104  33.879  14.117 1.00 15.58 ? 183 ILE A C   1 
ATOM   1390 O O   . ILE A 1 183 ? 7.393  33.517  13.183 1.00 16.39 ? 183 ILE A O   1 
ATOM   1391 C CB  . ILE A 1 183 ? 7.038  34.569  16.285 1.00 16.79 ? 183 ILE A CB  1 
ATOM   1392 C CG1 . ILE A 1 183 ? 6.509  34.041  17.621 1.00 15.47 ? 183 ILE A CG1 1 
ATOM   1393 C CG2 . ILE A 1 183 ? 5.879  35.090  15.431 1.00 14.43 ? 183 ILE A CG2 1 
ATOM   1394 C CD1 . ILE A 1 183 ? 5.758  35.075  18.450 1.00 13.13 ? 183 ILE A CD1 1 
ATOM   1395 N N   . HIS A 1 184 ? 9.170  34.659  13.960 1.00 16.74 ? 184 HIS A N   1 
ATOM   1396 C CA  . HIS A 1 184 ? 9.582  35.136  12.640 1.00 17.02 ? 184 HIS A CA  1 
ATOM   1397 C C   . HIS A 1 184 ? 10.072 33.962  11.791 1.00 17.32 ? 184 HIS A C   1 
ATOM   1398 O O   . HIS A 1 184 ? 9.763  33.872  10.600 1.00 18.51 ? 184 HIS A O   1 
ATOM   1399 C CB  . HIS A 1 184 ? 10.703 36.183  12.774 1.00 16.73 ? 184 HIS A CB  1 
ATOM   1400 C CG  . HIS A 1 184 ? 11.334 36.567  11.469 1.00 17.01 ? 184 HIS A CG  1 
ATOM   1401 N ND1 . HIS A 1 184 ? 10.648 37.227  10.472 1.00 17.95 ? 184 HIS A ND1 1 
ATOM   1402 C CD2 . HIS A 1 184 ? 12.583 36.356  10.989 1.00 17.53 ? 184 HIS A CD2 1 
ATOM   1403 C CE1 . HIS A 1 184 ? 11.447 37.405  9.433  1.00 17.85 ? 184 HIS A CE1 1 
ATOM   1404 N NE2 . HIS A 1 184 ? 12.626 36.885  9.722  1.00 18.11 ? 184 HIS A NE2 1 
ATOM   1405 N N   . LEU A 1 185 ? 10.842 33.066  12.409 1.00 16.05 ? 185 LEU A N   1 
ATOM   1406 C CA  . LEU A 1 185 ? 11.371 31.902  11.713 1.00 14.41 ? 185 LEU A CA  1 
ATOM   1407 C C   . LEU A 1 185 ? 10.224 31.088  11.148 1.00 14.24 ? 185 LEU A C   1 
ATOM   1408 O O   . LEU A 1 185 ? 10.307 30.558  10.039 1.00 16.71 ? 185 LEU A O   1 
ATOM   1409 C CB  . LEU A 1 185 ? 12.176 31.024  12.671 1.00 14.20 ? 185 LEU A CB  1 
ATOM   1410 C CG  . LEU A 1 185 ? 12.833 29.797  12.034 1.00 14.52 ? 185 LEU A CG  1 
ATOM   1411 C CD1 . LEU A 1 185 ? 14.070 30.238  11.252 1.00 13.96 ? 185 LEU A CD1 1 
ATOM   1412 C CD2 . LEU A 1 185 ? 13.219 28.801  13.111 1.00 15.20 ? 185 LEU A CD2 1 
ATOM   1413 N N   . ALA A 1 186 ? 9.153  30.991  11.925 1.00 13.42 ? 186 ALA A N   1 
ATOM   1414 C CA  . ALA A 1 186 ? 7.970  30.241  11.532 1.00 13.47 ? 186 ALA A CA  1 
ATOM   1415 C C   . ALA A 1 186 ? 7.352  30.806  10.255 1.00 14.65 ? 186 ALA A C   1 
ATOM   1416 O O   . ALA A 1 186 ? 6.949  30.049  9.370  1.00 13.76 ? 186 ALA A O   1 
ATOM   1417 C CB  . ALA A 1 186 ? 6.953  30.260  12.663 1.00 12.37 ? 186 ALA A CB  1 
ATOM   1418 N N   . ASN A 1 187 ? 7.271  32.135  10.169 1.00 15.79 ? 187 ASN A N   1 
ATOM   1419 C CA  . ASN A 1 187 ? 6.715  32.797  8.992  1.00 18.37 ? 187 ASN A CA  1 
ATOM   1420 C C   . ASN A 1 187 ? 7.665  32.707  7.804  1.00 18.42 ? 187 ASN A C   1 
ATOM   1421 O O   . ASN A 1 187 ? 7.227  32.675  6.657  1.00 19.49 ? 187 ASN A O   1 
ATOM   1422 C CB  . ASN A 1 187 ? 6.404  34.273  9.286  1.00 21.45 ? 187 ASN A CB  1 
ATOM   1423 C CG  . ASN A 1 187 ? 5.024  34.470  9.896  1.00 25.13 ? 187 ASN A CG  1 
ATOM   1424 O OD1 . ASN A 1 187 ? 4.887  34.934  11.034 1.00 25.85 ? 187 ASN A OD1 1 
ATOM   1425 N ND2 . ASN A 1 187 ? 3.988  34.111  9.138  1.00 26.90 ? 187 ASN A ND2 1 
ATOM   1426 N N   . ALA A 1 188 ? 8.963  32.675  8.082  1.00 18.14 ? 188 ALA A N   1 
ATOM   1427 C CA  . ALA A 1 188 ? 9.953  32.580  7.019  1.00 17.53 ? 188 ALA A CA  1 
ATOM   1428 C C   . ALA A 1 188 ? 9.804  31.205  6.377  1.00 18.19 ? 188 ALA A C   1 
ATOM   1429 O O   . ALA A 1 188 ? 9.892  31.060  5.153  1.00 17.51 ? 188 ALA A O   1 
ATOM   1430 C CB  . ALA A 1 188 ? 11.356 32.754  7.587  1.00 17.87 ? 188 ALA A CB  1 
ATOM   1431 N N   . ALA A 1 189 ? 9.563  30.195  7.210  1.00 16.18 ? 189 ALA A N   1 
ATOM   1432 C CA  . ALA A 1 189 ? 9.388  28.833  6.712  1.00 14.71 ? 189 ALA A CA  1 
ATOM   1433 C C   . ALA A 1 189 ? 8.139  28.776  5.831  1.00 13.87 ? 189 ALA A C   1 
ATOM   1434 O O   . ALA A 1 189 ? 8.167  28.189  4.746  1.00 14.31 ? 189 ALA A O   1 
ATOM   1435 C CB  . ALA A 1 189 ? 9.264  27.847  7.884  1.00 12.69 ? 189 ALA A CB  1 
ATOM   1436 N N   . LEU A 1 190 ? 7.051  29.389  6.300  1.00 12.57 ? 190 LEU A N   1 
ATOM   1437 C CA  . LEU A 1 190 ? 5.794  29.422  5.557  1.00 12.51 ? 190 LEU A CA  1 
ATOM   1438 C C   . LEU A 1 190 ? 5.958  30.028  4.155  1.00 13.95 ? 190 LEU A C   1 
ATOM   1439 O O   . LEU A 1 190 ? 5.455  29.472  3.171  1.00 13.72 ? 190 LEU A O   1 
ATOM   1440 C CB  . LEU A 1 190 ? 4.733  30.213  6.329  1.00 11.02 ? 190 LEU A CB  1 
ATOM   1441 C CG  . LEU A 1 190 ? 4.254  29.638  7.668  1.00 10.46 ? 190 LEU A CG  1 
ATOM   1442 C CD1 . LEU A 1 190 ? 3.317  30.627  8.346  1.00 7.32  ? 190 LEU A CD1 1 
ATOM   1443 C CD2 . LEU A 1 190 ? 3.552  28.307  7.442  1.00 8.10  ? 190 LEU A CD2 1 
ATOM   1444 N N   . GLU A 1 191 ? 6.660  31.160  4.071  1.00 15.23 ? 191 GLU A N   1 
ATOM   1445 C CA  . GLU A 1 191 ? 6.893  31.853  2.798  1.00 16.64 ? 191 GLU A CA  1 
ATOM   1446 C C   . GLU A 1 191 ? 7.916  31.169  1.895  1.00 16.04 ? 191 GLU A C   1 
ATOM   1447 O O   . GLU A 1 191 ? 7.854  31.299  0.678  1.00 17.86 ? 191 GLU A O   1 
ATOM   1448 C CB  . GLU A 1 191 ? 7.374  33.293  3.042  1.00 17.34 ? 191 GLU A CB  1 
ATOM   1449 C CG  . GLU A 1 191 ? 6.298  34.295  3.425  1.00 19.57 ? 191 GLU A CG  1 
ATOM   1450 C CD  . GLU A 1 191 ? 6.856  35.695  3.633  1.00 20.98 ? 191 GLU A CD  1 
ATOM   1451 O OE1 . GLU A 1 191 ? 7.587  36.186  2.741  1.00 21.39 ? 191 GLU A OE1 1 
ATOM   1452 O OE2 . GLU A 1 191 ? 6.554  36.303  4.684  1.00 20.08 ? 191 GLU A OE2 1 
ATOM   1453 N N   . GLY A 1 192 ? 8.867  30.462  2.494  1.00 17.29 ? 192 GLY A N   1 
ATOM   1454 C CA  . GLY A 1 192 ? 9.896  29.798  1.713  1.00 14.79 ? 192 GLY A CA  1 
ATOM   1455 C C   . GLY A 1 192 ? 11.199 30.583  1.632  1.00 13.20 ? 192 GLY A C   1 
ATOM   1456 O O   . GLY A 1 192 ? 12.016 30.334  0.744  1.00 12.54 ? 192 GLY A O   1 
ATOM   1457 N N   . THR A 1 193 ? 11.398 31.521  2.558  1.00 12.59 ? 193 THR A N   1 
ATOM   1458 C CA  . THR A 1 193 ? 12.606 32.355  2.589  1.00 13.31 ? 193 THR A CA  1 
ATOM   1459 C C   . THR A 1 193 ? 13.746 31.639  3.297  1.00 12.86 ? 193 THR A C   1 
ATOM   1460 O O   . THR A 1 193 ? 14.916 31.975  3.114  1.00 12.16 ? 193 THR A O   1 
ATOM   1461 C CB  . THR A 1 193 ? 12.361 33.717  3.306  1.00 14.31 ? 193 THR A CB  1 
ATOM   1462 O OG1 . THR A 1 193 ? 11.896 33.495  4.648  1.00 17.47 ? 193 THR A OG1 1 
ATOM   1463 C CG2 . THR A 1 193 ? 11.322 34.534  2.547  1.00 15.53 ? 193 THR A CG2 1 
ATOM   1464 N N   . LEU A 1 194 ? 13.384 30.647  4.108  1.00 13.27 ? 194 LEU A N   1 
ATOM   1465 C CA  . LEU A 1 194 ? 14.341 29.837  4.856  1.00 11.31 ? 194 LEU A CA  1 
ATOM   1466 C C   . LEU A 1 194 ? 14.688 28.616  4.007  1.00 11.72 ? 194 LEU A C   1 
ATOM   1467 O O   . LEU A 1 194 ? 13.829 27.791  3.731  1.00 11.71 ? 194 LEU A O   1 
ATOM   1468 C CB  . LEU A 1 194 ? 13.710 29.379  6.173  1.00 12.48 ? 194 LEU A CB  1 
ATOM   1469 C CG  . LEU A 1 194 ? 14.551 28.496  7.092  1.00 10.77 ? 194 LEU A CG  1 
ATOM   1470 C CD1 . LEU A 1 194 ? 15.647 29.324  7.705  1.00 9.49  ? 194 LEU A CD1 1 
ATOM   1471 C CD2 . LEU A 1 194 ? 13.673 27.882  8.163  1.00 10.60 ? 194 LEU A CD2 1 
ATOM   1472 N N   . PRO A 1 195 ? 15.951 28.494  3.569  1.00 11.58 ? 195 PRO A N   1 
ATOM   1473 C CA  . PRO A 1 195 ? 16.359 27.352  2.751  1.00 11.54 ? 195 PRO A CA  1 
ATOM   1474 C C   . PRO A 1 195 ? 16.201 26.028  3.491  1.00 12.22 ? 195 PRO A C   1 
ATOM   1475 O O   . PRO A 1 195 ? 16.881 25.778  4.492  1.00 12.57 ? 195 PRO A O   1 
ATOM   1476 C CB  . PRO A 1 195 ? 17.819 27.659  2.436  1.00 11.51 ? 195 PRO A CB  1 
ATOM   1477 C CG  . PRO A 1 195 ? 17.845 29.145  2.396  1.00 11.02 ? 195 PRO A CG  1 
ATOM   1478 C CD  . PRO A 1 195 ? 17.022 29.504  3.615  1.00 12.99 ? 195 PRO A CD  1 
ATOM   1479 N N   . MET A 1 196 ? 15.315 25.177  2.990  1.00 11.46 ? 196 MET A N   1 
ATOM   1480 C CA  . MET A 1 196 ? 15.075 23.886  3.616  1.00 11.77 ? 196 MET A CA  1 
ATOM   1481 C C   . MET A 1 196 ? 16.147 22.867  3.270  1.00 11.01 ? 196 MET A C   1 
ATOM   1482 O O   . MET A 1 196 ? 16.318 21.867  3.962  1.00 9.85  ? 196 MET A O   1 
ATOM   1483 C CB  . MET A 1 196 ? 13.697 23.364  3.216  1.00 12.15 ? 196 MET A CB  1 
ATOM   1484 C CG  . MET A 1 196 ? 12.577 24.278  3.679  1.00 13.01 ? 196 MET A CG  1 
ATOM   1485 S SD  . MET A 1 196 ? 12.742 24.719  5.434  1.00 14.91 ? 196 MET A SD  1 
ATOM   1486 C CE  . MET A 1 196 ? 12.193 23.212  6.188  1.00 14.27 ? 196 MET A CE  1 
ATOM   1487 N N   . THR A 1 197 ? 16.874 23.137  2.197  1.00 10.80 ? 197 THR A N   1 
ATOM   1488 C CA  . THR A 1 197 ? 17.941 22.259  1.753  1.00 10.94 ? 197 THR A CA  1 
ATOM   1489 C C   . THR A 1 197 ? 19.167 23.141  1.580  1.00 10.28 ? 197 THR A C   1 
ATOM   1490 O O   . THR A 1 197 ? 19.044 24.341  1.330  1.00 11.59 ? 197 THR A O   1 
ATOM   1491 C CB  . THR A 1 197 ? 17.578 21.582  0.414  1.00 12.63 ? 197 THR A CB  1 
ATOM   1492 O OG1 . THR A 1 197 ? 18.674 20.775  -0.028 1.00 9.97  ? 197 THR A OG1 1 
ATOM   1493 C CG2 . THR A 1 197 ? 17.267 22.639  -0.650 1.00 12.82 ? 197 THR A CG2 1 
ATOM   1494 N N   . ILE A 1 198 ? 20.352 22.559  1.704  1.00 9.19  ? 198 ILE A N   1 
ATOM   1495 C CA  . ILE A 1 198 ? 21.562 23.343  1.591  1.00 10.20 ? 198 ILE A CA  1 
ATOM   1496 C C   . ILE A 1 198 ? 21.673 24.108  0.283  1.00 11.62 ? 198 ILE A C   1 
ATOM   1497 O O   . ILE A 1 198 ? 21.513 23.551  -0.796 1.00 13.27 ? 198 ILE A O   1 
ATOM   1498 C CB  . ILE A 1 198 ? 22.813 22.477  1.771  1.00 10.49 ? 198 ILE A CB  1 
ATOM   1499 C CG1 . ILE A 1 198 ? 24.049 23.377  1.812  1.00 7.06  ? 198 ILE A CG1 1 
ATOM   1500 C CG2 . ILE A 1 198 ? 22.916 21.459  0.635  1.00 10.34 ? 198 ILE A CG2 1 
ATOM   1501 C CD1 . ILE A 1 198 ? 25.315 22.660  2.265  1.00 11.24 ? 198 ILE A CD1 1 
ATOM   1502 N N   . PRO A 1 199 ? 21.940 25.413  0.372  1.00 11.81 ? 199 PRO A N   1 
ATOM   1503 C CA  . PRO A 1 199 ? 22.084 26.294  -0.790 1.00 13.69 ? 199 PRO A CA  1 
ATOM   1504 C C   . PRO A 1 199 ? 23.469 26.192  -1.422 1.00 13.15 ? 199 PRO A C   1 
ATOM   1505 O O   . PRO A 1 199 ? 24.443 25.870  -0.749 1.00 11.74 ? 199 PRO A O   1 
ATOM   1506 C CB  . PRO A 1 199 ? 21.816 27.674  -0.201 1.00 13.73 ? 199 PRO A CB  1 
ATOM   1507 C CG  . PRO A 1 199 ? 22.415 27.549  1.169  1.00 15.13 ? 199 PRO A CG  1 
ATOM   1508 C CD  . PRO A 1 199 ? 21.904 26.197  1.620  1.00 12.46 ? 199 PRO A CD  1 
ATOM   1509 N N   . GLY A 1 200 ? 23.543 26.474  -2.720 1.00 13.88 ? 200 GLY A N   1 
ATOM   1510 C CA  . GLY A 1 200 ? 24.805 26.401  -3.432 1.00 15.39 ? 200 GLY A CA  1 
ATOM   1511 C C   . GLY A 1 200 ? 25.883 27.273  -2.826 1.00 16.12 ? 200 GLY A C   1 
ATOM   1512 O O   . GLY A 1 200 ? 27.057 26.912  -2.840 1.00 17.47 ? 200 GLY A O   1 
ATOM   1513 N N   . ASP A 1 201 ? 25.493 28.430  -2.309 1.00 16.19 ? 201 ASP A N   1 
ATOM   1514 C CA  . ASP A 1 201 ? 26.452 29.328  -1.681 1.00 16.83 ? 201 ASP A CA  1 
ATOM   1515 C C   . ASP A 1 201 ? 26.074 29.525  -0.222 1.00 15.15 ? 201 ASP A C   1 
ATOM   1516 O O   . ASP A 1 201 ? 25.236 30.365  0.102  1.00 15.41 ? 201 ASP A O   1 
ATOM   1517 C CB  . ASP A 1 201 ? 26.470 30.682  -2.375 1.00 17.89 ? 201 ASP A CB  1 
ATOM   1518 C CG  . ASP A 1 201 ? 27.552 31.578  -1.832 1.00 18.72 ? 201 ASP A CG  1 
ATOM   1519 O OD1 . ASP A 1 201 ? 27.565 31.810  -0.605 1.00 20.53 ? 201 ASP A OD1 1 
ATOM   1520 O OD2 . ASP A 1 201 ? 28.397 32.038  -2.627 1.00 21.67 ? 201 ASP A OD2 1 
ATOM   1521 N N   . VAL A 1 202 ? 26.709 28.753  0.650  1.00 14.82 ? 202 VAL A N   1 
ATOM   1522 C CA  . VAL A 1 202 ? 26.436 28.804  2.076  1.00 15.20 ? 202 VAL A CA  1 
ATOM   1523 C C   . VAL A 1 202 ? 26.711 30.149  2.738  1.00 16.58 ? 202 VAL A C   1 
ATOM   1524 O O   . VAL A 1 202 ? 25.861 30.670  3.451  1.00 17.53 ? 202 VAL A O   1 
ATOM   1525 C CB  . VAL A 1 202 ? 27.232 27.713  2.816  1.00 15.28 ? 202 VAL A CB  1 
ATOM   1526 C CG1 . VAL A 1 202 ? 26.786 27.640  4.261  1.00 13.85 ? 202 VAL A CG1 1 
ATOM   1527 C CG2 . VAL A 1 202 ? 27.029 26.371  2.127  1.00 14.35 ? 202 VAL A CG2 1 
ATOM   1528 N N   . GLU A 1 203 ? 27.888 30.712  2.501  1.00 19.12 ? 203 GLU A N   1 
ATOM   1529 C CA  . GLU A 1 203 ? 28.251 31.992  3.103  1.00 21.97 ? 203 GLU A CA  1 
ATOM   1530 C C   . GLU A 1 203 ? 27.203 33.070  2.836  1.00 22.22 ? 203 GLU A C   1 
ATOM   1531 O O   . GLU A 1 203 ? 26.770 33.769  3.757  1.00 22.06 ? 203 GLU A O   1 
ATOM   1532 C CB  . GLU A 1 203 ? 29.624 32.437  2.593  1.00 24.45 ? 203 GLU A CB  1 
ATOM   1533 C CG  . GLU A 1 203 ? 30.761 31.489  2.990  1.00 27.25 ? 203 GLU A CG  1 
ATOM   1534 C CD  . GLU A 1 203 ? 30.925 31.369  4.500  1.00 31.08 ? 203 GLU A CD  1 
ATOM   1535 O OE1 . GLU A 1 203 ? 31.081 32.420  5.165  1.00 30.63 ? 203 GLU A OE1 1 
ATOM   1536 O OE2 . GLU A 1 203 ? 30.901 30.229  5.023  1.00 32.91 ? 203 GLU A OE2 1 
ATOM   1537 N N   . GLN A 1 204 ? 26.794 33.198  1.576  1.00 21.80 ? 204 GLN A N   1 
ATOM   1538 C CA  . GLN A 1 204 ? 25.779 34.174  1.193  1.00 20.64 ? 204 GLN A CA  1 
ATOM   1539 C C   . GLN A 1 204 ? 24.498 33.923  1.971  1.00 20.39 ? 204 GLN A C   1 
ATOM   1540 O O   . GLN A 1 204 ? 23.920 34.834  2.556  1.00 20.48 ? 204 GLN A O   1 
ATOM   1541 C CB  . GLN A 1 204 ? 25.470 34.067  -0.304 1.00 23.16 ? 204 GLN A CB  1 
ATOM   1542 C CG  . GLN A 1 204 ? 26.340 34.914  -1.203 1.00 25.75 ? 204 GLN A CG  1 
ATOM   1543 C CD  . GLN A 1 204 ? 26.145 36.397  -0.943 1.00 26.61 ? 204 GLN A CD  1 
ATOM   1544 O OE1 . GLN A 1 204 ? 26.572 36.923  0.087  1.00 27.62 ? 204 GLN A OE1 1 
ATOM   1545 N NE2 . GLN A 1 204 ? 25.478 37.074  -1.869 1.00 26.83 ? 204 GLN A NE2 1 
ATOM   1546 N N   . ALA A 1 205 ? 24.051 32.674  1.963  1.00 19.82 ? 205 ALA A N   1 
ATOM   1547 C CA  . ALA A 1 205 ? 22.823 32.314  2.656  1.00 18.96 ? 205 ALA A CA  1 
ATOM   1548 C C   . ALA A 1 205 ? 22.902 32.631  4.148  1.00 18.53 ? 205 ALA A C   1 
ATOM   1549 O O   . ALA A 1 205 ? 21.972 33.213  4.707  1.00 18.25 ? 205 ALA A O   1 
ATOM   1550 C CB  . ALA A 1 205 ? 22.511 30.836  2.441  1.00 18.79 ? 205 ALA A CB  1 
ATOM   1551 N N   . MET A 1 206 ? 23.999 32.254  4.800  1.00 18.09 ? 206 MET A N   1 
ATOM   1552 C CA  . MET A 1 206 ? 24.142 32.537  6.226  1.00 20.62 ? 206 MET A CA  1 
ATOM   1553 C C   . MET A 1 206 ? 24.032 34.041  6.466  1.00 21.60 ? 206 MET A C   1 
ATOM   1554 O O   . MET A 1 206 ? 23.373 34.491  7.404  1.00 19.09 ? 206 MET A O   1 
ATOM   1555 C CB  . MET A 1 206 ? 25.481 32.017  6.754  1.00 20.31 ? 206 MET A CB  1 
ATOM   1556 C CG  . MET A 1 206 ? 25.586 30.496  6.775  1.00 22.21 ? 206 MET A CG  1 
ATOM   1557 S SD  . MET A 1 206 ? 26.911 29.913  7.850  1.00 23.29 ? 206 MET A SD  1 
ATOM   1558 C CE  . MET A 1 206 ? 28.330 30.516  6.969  1.00 24.79 ? 206 MET A CE  1 
ATOM   1559 N N   . LYS A 1 207 ? 24.690 34.807  5.600  1.00 24.98 ? 207 LYS A N   1 
ATOM   1560 C CA  . LYS A 1 207 ? 24.672 36.261  5.666  1.00 26.86 ? 207 LYS A CA  1 
ATOM   1561 C C   . LYS A 1 207 ? 23.220 36.725  5.726  1.00 27.02 ? 207 LYS A C   1 
ATOM   1562 O O   . LYS A 1 207 ? 22.826 37.495  6.605  1.00 28.00 ? 207 LYS A O   1 
ATOM   1563 C CB  . LYS A 1 207 ? 25.342 36.831  4.412  1.00 30.00 ? 207 LYS A CB  1 
ATOM   1564 C CG  . LYS A 1 207 ? 25.199 38.333  4.232  1.00 32.42 ? 207 LYS A CG  1 
ATOM   1565 C CD  . LYS A 1 207 ? 25.280 38.699  2.756  1.00 35.62 ? 207 LYS A CD  1 
ATOM   1566 C CE  . LYS A 1 207 ? 24.132 38.056  1.977  1.00 37.30 ? 207 LYS A CE  1 
ATOM   1567 N NZ  . LYS A 1 207 ? 24.109 38.450  0.543  1.00 37.50 ? 207 LYS A NZ  1 
ATOM   1568 N N   . THR A 1 208 ? 22.426 36.242  4.778  1.00 25.40 ? 208 THR A N   1 
ATOM   1569 C CA  . THR A 1 208 ? 21.019 36.599  4.709  1.00 24.14 ? 208 THR A CA  1 
ATOM   1570 C C   . THR A 1 208 ? 20.289 36.130  5.964  1.00 25.39 ? 208 THR A C   1 
ATOM   1571 O O   . THR A 1 208 ? 19.400 36.816  6.467  1.00 25.06 ? 208 THR A O   1 
ATOM   1572 C CB  . THR A 1 208 ? 20.347 35.959  3.473  1.00 21.97 ? 208 THR A CB  1 
ATOM   1573 O OG1 . THR A 1 208 ? 21.021 36.382  2.283  1.00 17.70 ? 208 THR A OG1 1 
ATOM   1574 C CG2 . THR A 1 208 ? 18.892 36.371  3.390  1.00 19.63 ? 208 THR A CG2 1 
ATOM   1575 N N   . LEU A 1 209 ? 20.676 34.961  6.466  1.00 26.55 ? 209 LEU A N   1 
ATOM   1576 C CA  . LEU A 1 209 ? 20.059 34.373  7.652  1.00 25.49 ? 209 LEU A CA  1 
ATOM   1577 C C   . LEU A 1 209 ? 20.221 35.242  8.891  1.00 26.37 ? 209 LEU A C   1 
ATOM   1578 O O   . LEU A 1 209 ? 19.333 35.297  9.744  1.00 26.58 ? 209 LEU A O   1 
ATOM   1579 C CB  . LEU A 1 209 ? 20.666 33.000  7.932  1.00 24.30 ? 209 LEU A CB  1 
ATOM   1580 C CG  . LEU A 1 209 ? 19.660 31.887  8.215  1.00 24.45 ? 209 LEU A CG  1 
ATOM   1581 C CD1 . LEU A 1 209 ? 20.386 30.718  8.850  1.00 23.15 ? 209 LEU A CD1 1 
ATOM   1582 C CD2 . LEU A 1 209 ? 18.564 32.389  9.141  1.00 24.94 ? 209 LEU A CD2 1 
ATOM   1583 N N   . GLN A 1 210 ? 21.363 35.912  8.993  1.00 26.74 ? 210 GLN A N   1 
ATOM   1584 C CA  . GLN A 1 210 ? 21.639 36.771  10.135 1.00 27.89 ? 210 GLN A CA  1 
ATOM   1585 C C   . GLN A 1 210 ? 20.917 38.113  10.094 1.00 28.98 ? 210 GLN A C   1 
ATOM   1586 O O   . GLN A 1 210 ? 20.927 38.852  11.082 1.00 29.19 ? 210 GLN A O   1 
ATOM   1587 C CB  . GLN A 1 210 ? 23.142 36.993  10.260 1.00 28.38 ? 210 GLN A CB  1 
ATOM   1588 C CG  . GLN A 1 210 ? 23.873 35.822  10.888 1.00 28.31 ? 210 GLN A CG  1 
ATOM   1589 C CD  . GLN A 1 210 ? 25.354 35.845  10.600 1.00 27.86 ? 210 GLN A CD  1 
ATOM   1590 O OE1 . GLN A 1 210 ? 25.787 35.486  9.507  1.00 28.59 ? 210 GLN A OE1 1 
ATOM   1591 N NE2 . GLN A 1 210 ? 26.141 36.281  11.574 1.00 28.99 ? 210 GLN A NE2 1 
ATOM   1592 N N   . THR A 1 211 ? 20.297 38.436  8.962  1.00 28.46 ? 211 THR A N   1 
ATOM   1593 C CA  . THR A 1 211 ? 19.564 39.692  8.853  1.00 29.65 ? 211 THR A CA  1 
ATOM   1594 C C   . THR A 1 211 ? 18.214 39.476  9.539  1.00 30.60 ? 211 THR A C   1 
ATOM   1595 O O   . THR A 1 211 ? 17.364 40.367  9.594  1.00 29.86 ? 211 THR A O   1 
ATOM   1596 C CB  . THR A 1 211 ? 19.345 40.117  7.375  1.00 29.41 ? 211 THR A CB  1 
ATOM   1597 O OG1 . THR A 1 211 ? 18.346 39.290  6.767  1.00 31.33 ? 211 THR A OG1 1 
ATOM   1598 C CG2 . THR A 1 211 ? 20.643 40.000  6.589  1.00 29.15 ? 211 THR A CG2 1 
ATOM   1599 N N   . PHE A 1 212 ? 18.038 38.268  10.062 1.00 30.62 ? 212 PHE A N   1 
ATOM   1600 C CA  . PHE A 1 212 ? 16.823 37.903  10.769 1.00 30.24 ? 212 PHE A CA  1 
ATOM   1601 C C   . PHE A 1 212 ? 16.969 38.335  12.225 1.00 29.94 ? 212 PHE A C   1 
ATOM   1602 O O   . PHE A 1 212 ? 18.074 38.353  12.777 1.00 30.22 ? 212 PHE A O   1 
ATOM   1603 C CB  . PHE A 1 212 ? 16.599 36.387  10.680 1.00 30.18 ? 212 PHE A CB  1 
ATOM   1604 C CG  . PHE A 1 212 ? 15.946 35.936  9.397  1.00 30.05 ? 212 PHE A CG  1 
ATOM   1605 C CD1 . PHE A 1 212 ? 16.206 36.588  8.191  1.00 30.54 ? 212 PHE A CD1 1 
ATOM   1606 C CD2 . PHE A 1 212 ? 15.083 34.843  9.392  1.00 29.16 ? 212 PHE A CD2 1 
ATOM   1607 C CE1 . PHE A 1 212 ? 15.615 36.158  7.000  1.00 28.79 ? 212 PHE A CE1 1 
ATOM   1608 C CE2 . PHE A 1 212 ? 14.488 34.406  8.208  1.00 28.72 ? 212 PHE A CE2 1 
ATOM   1609 C CZ  . PHE A 1 212 ? 14.755 35.065  7.011  1.00 28.75 ? 212 PHE A CZ  1 
ATOM   1610 N N   . PRO A 1 213 ? 15.852 38.714  12.860 1.00 29.35 ? 213 PRO A N   1 
ATOM   1611 C CA  . PRO A 1 213 ? 15.865 39.147  14.258 1.00 28.90 ? 213 PRO A CA  1 
ATOM   1612 C C   . PRO A 1 213 ? 16.100 37.985  15.218 1.00 28.34 ? 213 PRO A C   1 
ATOM   1613 O O   . PRO A 1 213 ? 15.354 37.004  15.217 1.00 29.00 ? 213 PRO A O   1 
ATOM   1614 C CB  . PRO A 1 213 ? 14.483 39.777  14.435 1.00 28.95 ? 213 PRO A CB  1 
ATOM   1615 C CG  . PRO A 1 213 ? 13.626 38.967  13.511 1.00 28.96 ? 213 PRO A CG  1 
ATOM   1616 C CD  . PRO A 1 213 ? 14.502 38.838  12.280 1.00 28.85 ? 213 PRO A CD  1 
ATOM   1617 N N   . GLY A 1 214 ? 17.149 38.093  16.025 1.00 27.96 ? 214 GLY A N   1 
ATOM   1618 C CA  . GLY A 1 214 ? 17.444 37.047  16.987 1.00 28.10 ? 214 GLY A CA  1 
ATOM   1619 C C   . GLY A 1 214 ? 18.357 35.942  16.492 1.00 27.96 ? 214 GLY A C   1 
ATOM   1620 O O   . GLY A 1 214 ? 18.525 34.929  17.170 1.00 27.99 ? 214 GLY A O   1 
ATOM   1621 N N   . ILE A 1 215 ? 18.951 36.123  15.318 1.00 27.70 ? 215 ILE A N   1 
ATOM   1622 C CA  . ILE A 1 215 ? 19.850 35.111  14.773 1.00 28.85 ? 215 ILE A CA  1 
ATOM   1623 C C   . ILE A 1 215 ? 21.278 35.630  14.655 1.00 28.48 ? 215 ILE A C   1 
ATOM   1624 O O   . ILE A 1 215 ? 21.604 36.397  13.746 1.00 28.02 ? 215 ILE A O   1 
ATOM   1625 C CB  . ILE A 1 215 ? 19.373 34.627  13.390 1.00 29.61 ? 215 ILE A CB  1 
ATOM   1626 C CG1 . ILE A 1 215 ? 18.019 33.923  13.543 1.00 30.86 ? 215 ILE A CG1 1 
ATOM   1627 C CG2 . ILE A 1 215 ? 20.426 33.715  12.766 1.00 27.63 ? 215 ILE A CG2 1 
ATOM   1628 C CD1 . ILE A 1 215 ? 17.415 33.417  12.249 1.00 32.76 ? 215 ILE A CD1 1 
ATOM   1629 N N   . GLY A 1 216 ? 22.130 35.201  15.579 1.00 26.85 ? 216 GLY A N   1 
ATOM   1630 C CA  . GLY A 1 216 ? 23.508 35.646  15.551 1.00 25.45 ? 216 GLY A CA  1 
ATOM   1631 C C   . GLY A 1 216 ? 24.406 34.737  14.737 1.00 24.31 ? 216 GLY A C   1 
ATOM   1632 O O   . GLY A 1 216 ? 23.945 33.789  14.094 1.00 22.17 ? 216 GLY A O   1 
ATOM   1633 N N   . ARG A 1 217 ? 25.699 35.042  14.783 1.00 23.08 ? 217 ARG A N   1 
ATOM   1634 C CA  . ARG A 1 217 ? 26.732 34.299  14.074 1.00 21.39 ? 217 ARG A CA  1 
ATOM   1635 C C   . ARG A 1 217 ? 26.771 32.831  14.522 1.00 18.18 ? 217 ARG A C   1 
ATOM   1636 O O   . ARG A 1 217 ? 26.850 31.922  13.695 1.00 16.25 ? 217 ARG A O   1 
ATOM   1637 C CB  . ARG A 1 217 ? 28.090 34.980  14.317 1.00 23.87 ? 217 ARG A CB  1 
ATOM   1638 C CG  . ARG A 1 217 ? 29.216 34.533  13.399 1.00 27.39 ? 217 ARG A CG  1 
ATOM   1639 C CD  . ARG A 1 217 ? 28.844 34.758  11.941 1.00 29.04 ? 217 ARG A CD  1 
ATOM   1640 N NE  . ARG A 1 217 ? 29.762 34.078  11.030 1.00 33.49 ? 217 ARG A NE  1 
ATOM   1641 C CZ  . ARG A 1 217 ? 29.512 33.864  9.739  1.00 33.83 ? 217 ARG A CZ  1 
ATOM   1642 N NH1 . ARG A 1 217 ? 28.370 34.276  9.199  1.00 34.02 ? 217 ARG A NH1 1 
ATOM   1643 N NH2 . ARG A 1 217 ? 30.403 33.230  8.985  1.00 34.30 ? 217 ARG A NH2 1 
ATOM   1644 N N   . TRP A 1 218 ? 26.706 32.599  15.829 1.00 14.63 ? 218 TRP A N   1 
ATOM   1645 C CA  . TRP A 1 218 ? 26.741 31.230  16.343 1.00 14.13 ? 218 TRP A CA  1 
ATOM   1646 C C   . TRP A 1 218 ? 25.539 30.429  15.833 1.00 12.77 ? 218 TRP A C   1 
ATOM   1647 O O   . TRP A 1 218 ? 25.697 29.344  15.265 1.00 12.68 ? 218 TRP A O   1 
ATOM   1648 C CB  . TRP A 1 218 ? 26.749 31.216  17.876 1.00 10.27 ? 218 TRP A CB  1 
ATOM   1649 C CG  . TRP A 1 218 ? 26.825 29.822  18.424 1.00 10.08 ? 218 TRP A CG  1 
ATOM   1650 C CD1 . TRP A 1 218 ? 27.945 29.037  18.525 1.00 9.82  ? 218 TRP A CD1 1 
ATOM   1651 C CD2 . TRP A 1 218 ? 25.731 29.018  18.872 1.00 7.57  ? 218 TRP A CD2 1 
ATOM   1652 N NE1 . TRP A 1 218 ? 27.610 27.795  19.006 1.00 10.96 ? 218 TRP A NE1 1 
ATOM   1653 C CE2 . TRP A 1 218 ? 26.258 27.753  19.227 1.00 9.20  ? 218 TRP A CE2 1 
ATOM   1654 C CE3 . TRP A 1 218 ? 24.352 29.241  19.006 1.00 8.18  ? 218 TRP A CE3 1 
ATOM   1655 C CZ2 . TRP A 1 218 ? 25.451 26.705  19.708 1.00 8.35  ? 218 TRP A CZ2 1 
ATOM   1656 C CZ3 . TRP A 1 218 ? 23.547 28.201  19.483 1.00 8.98  ? 218 TRP A CZ3 1 
ATOM   1657 C CH2 . TRP A 1 218 ? 24.103 26.948  19.828 1.00 7.23  ? 218 TRP A CH2 1 
ATOM   1658 N N   . THR A 1 219 ? 24.343 30.968  16.051 1.00 10.12 ? 219 THR A N   1 
ATOM   1659 C CA  . THR A 1 219 ? 23.111 30.330  15.614 1.00 9.93  ? 219 THR A CA  1 
ATOM   1660 C C   . THR A 1 219 ? 23.178 30.057  14.109 1.00 10.58 ? 219 THR A C   1 
ATOM   1661 O O   . THR A 1 219 ? 22.845 28.960  13.651 1.00 12.21 ? 219 THR A O   1 
ATOM   1662 C CB  . THR A 1 219 ? 21.899 31.233  15.927 1.00 8.51  ? 219 THR A CB  1 
ATOM   1663 O OG1 . THR A 1 219 ? 21.862 31.509  17.334 1.00 8.92  ? 219 THR A OG1 1 
ATOM   1664 C CG2 . THR A 1 219 ? 20.597 30.559  15.523 1.00 6.61  ? 219 THR A CG2 1 
ATOM   1665 N N   . ALA A 1 220 ? 23.632 31.051  13.350 1.00 8.94  ? 220 ALA A N   1 
ATOM   1666 C CA  . ALA A 1 220 ? 23.751 30.933  11.900 1.00 8.51  ? 220 ALA A CA  1 
ATOM   1667 C C   . ALA A 1 220 ? 24.673 29.784  11.480 1.00 8.68  ? 220 ALA A C   1 
ATOM   1668 O O   . ALA A 1 220 ? 24.297 28.959  10.638 1.00 7.54  ? 220 ALA A O   1 
ATOM   1669 C CB  . ALA A 1 220 ? 24.254 32.250  11.311 1.00 7.98  ? 220 ALA A CB  1 
ATOM   1670 N N   . ASN A 1 221 ? 25.866 29.756  12.059 1.00 8.08  ? 221 ASN A N   1 
ATOM   1671 C CA  . ASN A 1 221 ? 26.817 28.709  11.754 1.00 9.04  ? 221 ASN A CA  1 
ATOM   1672 C C   . ASN A 1 221 ? 26.287 27.333  12.126 1.00 8.72  ? 221 ASN A C   1 
ATOM   1673 O O   . ASN A 1 221 ? 26.440 26.364  11.376 1.00 7.69  ? 221 ASN A O   1 
ATOM   1674 C CB  . ASN A 1 221 ? 28.142 28.956  12.425 1.00 9.26  ? 221 ASN A CB  1 
ATOM   1675 C CG  . ASN A 1 221 ? 28.949 30.144  12.046 1.00 13.33 ? 221 ASN A CG  1 
ATOM   1676 O OD1 . ASN A 1 221 ? 29.891 30.498  12.800 1.00 13.74 ? 221 ASN A OD1 1 
ATOM   1677 N ND2 . ASN A 1 221 ? 28.800 30.782  10.902 1.00 11.18 ? 221 ASN A ND2 1 
ATOM   1678 N N   . TYR A 1 222 ? 25.755 27.239  13.357 1.00 7.03  ? 222 TYR A N   1 
ATOM   1679 C CA  . TYR A 1 222 ? 25.280 25.971  13.916 1.00 7.37  ? 222 TYR A CA  1 
ATOM   1680 C C   . TYR A 1 222 ? 24.138 25.435  13.053 1.00 5.64  ? 222 TYR A C   1 
ATOM   1681 O O   . TYR A 1 222 ? 24.161 24.286  12.611 1.00 4.52  ? 222 TYR A O   1 
ATOM   1682 C CB  . TYR A 1 222 ? 24.809 26.142  15.353 1.00 7.91  ? 222 TYR A CB  1 
ATOM   1683 C CG  . TYR A 1 222 ? 24.496 24.836  16.053 1.00 10.79 ? 222 TYR A CG  1 
ATOM   1684 C CD1 . TYR A 1 222 ? 25.528 23.892  16.194 1.00 10.80 ? 222 TYR A CD1 1 
ATOM   1685 C CD2 . TYR A 1 222 ? 23.294 24.542  16.649 1.00 11.05 ? 222 TYR A CD2 1 
ATOM   1686 C CE1 . TYR A 1 222 ? 25.336 22.677  16.794 1.00 11.61 ? 222 TYR A CE1 1 
ATOM   1687 C CE2 . TYR A 1 222 ? 23.098 23.325  17.288 1.00 12.10 ? 222 TYR A CE2 1 
ATOM   1688 C CZ  . TYR A 1 222 ? 24.102 22.394  17.346 1.00 12.43 ? 222 TYR A CZ  1 
ATOM   1689 O OH  . TYR A 1 222 ? 23.921 21.194  18.005 1.00 12.23 ? 222 TYR A OH  1 
ATOM   1690 N N   . PHE A 1 223 ? 23.234 26.461  12.680 1.00 6.33  ? 223 PHE A N   1 
ATOM   1691 C CA  . PHE A 1 223 ? 22.108 26.031  11.852 1.00 7.30  ? 223 PHE A CA  1 
ATOM   1692 C C   . PHE A 1 223 ? 22.591 25.469  10.548 1.00 5.12  ? 223 PHE A C   1 
ATOM   1693 O O   . PHE A 1 223 ? 22.045 24.470  10.060 1.00 4.37  ? 223 PHE A O   1 
ATOM   1694 C CB  . PHE A 1 223 ? 21.101 27.158  11.668 1.00 5.84  ? 223 PHE A CB  1 
ATOM   1695 C CG  . PHE A 1 223 ? 20.196 27.069  10.483 1.00 7.38  ? 223 PHE A CG  1 
ATOM   1696 C CD1 . PHE A 1 223 ? 19.102 26.230  10.446 1.00 7.49  ? 223 PHE A CD1 1 
ATOM   1697 C CD2 . PHE A 1 223 ? 20.485 27.806  9.336  1.00 6.54  ? 223 PHE A CD2 1 
ATOM   1698 C CE1 . PHE A 1 223 ? 18.303 26.123  9.324  1.00 6.64  ? 223 PHE A CE1 1 
ATOM   1699 C CE2 . PHE A 1 223 ? 19.691 27.708  8.215  1.00 3.79  ? 223 PHE A CE2 1 
ATOM   1700 C CZ  . PHE A 1 223 ? 18.591 26.871  8.199  1.00 4.41  ? 223 PHE A CZ  1 
ATOM   1701 N N   . ALA A 1 224 ? 23.623 26.206  9.951  1.00 4.68  ? 224 ALA A N   1 
ATOM   1702 C CA  . ALA A 1 224 ? 24.053 25.681  8.588  1.00 5.87  ? 224 ALA A CA  1 
ATOM   1703 C C   . ALA A 1 224 ? 24.606 24.257  8.705  1.00 4.77  ? 224 ALA A C   1 
ATOM   1704 O O   . ALA A 1 224 ? 24.485 23.386  7.826  1.00 6.83  ? 224 ALA A O   1 
ATOM   1705 C CB  . ALA A 1 224 ? 25.087 26.623  8.003  1.00 5.67  ? 224 ALA A CB  1 
ATOM   1706 N N   . LEU A 1 225 ? 25.432 24.115  9.749  1.00 6.08  ? 225 LEU A N   1 
ATOM   1707 C CA  . LEU A 1 225 ? 26.113 22.864  10.033 1.00 7.00  ? 225 LEU A CA  1 
ATOM   1708 C C   . LEU A 1 225 ? 25.108 21.702  10.201 1.00 6.21  ? 225 LEU A C   1 
ATOM   1709 O O   . LEU A 1 225 ? 25.267 20.672  9.548  1.00 7.33  ? 225 LEU A O   1 
ATOM   1710 C CB  . LEU A 1 225 ? 26.946 22.937  11.311 1.00 7.66  ? 225 LEU A CB  1 
ATOM   1711 C CG  . LEU A 1 225 ? 27.759 21.732  11.749 1.00 12.16 ? 225 LEU A CG  1 
ATOM   1712 C CD1 . LEU A 1 225 ? 28.787 22.184  12.805 1.00 12.50 ? 225 LEU A CD1 1 
ATOM   1713 C CD2 . LEU A 1 225 ? 26.877 20.674  12.432 1.00 12.42 ? 225 LEU A CD2 1 
ATOM   1714 N N   . ARG A 1 226 ? 24.113 21.833  11.073 1.00 4.22  ? 226 ARG A N   1 
ATOM   1715 C CA  . ARG A 1 226 ? 23.154 20.762  11.328 1.00 3.62  ? 226 ARG A CA  1 
ATOM   1716 C C   . ARG A 1 226 ? 21.979 20.822  10.385 1.00 2.39  ? 226 ARG A C   1 
ATOM   1717 O O   . ARG A 1 226 ? 21.513 19.797  9.900  1.00 1.60  ? 226 ARG A O   1 
ATOM   1718 C CB  . ARG A 1 226 ? 22.618 20.877  12.750 1.00 5.49  ? 226 ARG A CB  1 
ATOM   1719 C CG  . ARG A 1 226 ? 23.697 20.907  13.800 1.00 6.08  ? 226 ARG A CG  1 
ATOM   1720 C CD  . ARG A 1 226 ? 24.107 19.506  14.183 1.00 6.87  ? 226 ARG A CD  1 
ATOM   1721 N NE  . ARG A 1 226 ? 23.572 19.183  15.495 1.00 11.91 ? 226 ARG A NE  1 
ATOM   1722 C CZ  . ARG A 1 226 ? 22.436 18.534  15.719 1.00 10.70 ? 226 ARG A CZ  1 
ATOM   1723 N NH1 . ARG A 1 226 ? 21.693 18.106  14.711 1.00 14.46 ? 226 ARG A NH1 1 
ATOM   1724 N NH2 . ARG A 1 226 ? 22.032 18.348  16.959 1.00 13.15 ? 226 ARG A NH2 1 
ATOM   1725 N N   . GLY A 1 227 ? 21.490 22.037  10.163 1.00 3.50  ? 227 GLY A N   1 
ATOM   1726 C CA  . GLY A 1 227 ? 20.340 22.253  9.305  1.00 3.01  ? 227 GLY A CA  1 
ATOM   1727 C C   . GLY A 1 227 ? 20.557 21.995  7.830  1.00 2.12  ? 227 GLY A C   1 
ATOM   1728 O O   . GLY A 1 227 ? 19.649 21.517  7.160  1.00 1.13  ? 227 GLY A O   1 
ATOM   1729 N N   . TRP A 1 228 ? 21.741 22.312  7.312  1.00 2.48  ? 228 TRP A N   1 
ATOM   1730 C CA  . TRP A 1 228 ? 22.022 22.084  5.895  1.00 4.50  ? 228 TRP A CA  1 
ATOM   1731 C C   . TRP A 1 228 ? 23.103 21.043  5.698  1.00 4.87  ? 228 TRP A C   1 
ATOM   1732 O O   . TRP A 1 228 ? 23.366 20.627  4.577  1.00 5.68  ? 228 TRP A O   1 
ATOM   1733 C CB  . TRP A 1 228 ? 22.475 23.370  5.200  1.00 4.52  ? 228 TRP A CB  1 
ATOM   1734 C CG  . TRP A 1 228 ? 21.468 24.480  5.213  1.00 2.91  ? 228 TRP A CG  1 
ATOM   1735 C CD1 . TRP A 1 228 ? 20.108 24.359  5.250  1.00 3.76  ? 228 TRP A CD1 1 
ATOM   1736 C CD2 . TRP A 1 228 ? 21.746 25.879  5.155  1.00 1.65  ? 228 TRP A CD2 1 
ATOM   1737 N NE1 . TRP A 1 228 ? 19.520 25.601  5.221  1.00 4.11  ? 228 TRP A NE1 1 
ATOM   1738 C CE2 . TRP A 1 228 ? 20.504 26.554  5.164  1.00 3.21  ? 228 TRP A CE2 1 
ATOM   1739 C CE3 . TRP A 1 228 ? 22.926 26.633  5.095  1.00 1.86  ? 228 TRP A CE3 1 
ATOM   1740 C CZ2 . TRP A 1 228 ? 20.407 27.947  5.120  1.00 2.25  ? 228 TRP A CZ2 1 
ATOM   1741 C CZ3 . TRP A 1 228 ? 22.831 28.021  5.049  1.00 1.85  ? 228 TRP A CZ3 1 
ATOM   1742 C CH2 . TRP A 1 228 ? 21.579 28.663  5.063  1.00 3.96  ? 228 TRP A CH2 1 
ATOM   1743 N N   . GLN A 1 229 ? 23.727 20.635  6.794  1.00 5.66  ? 229 GLN A N   1 
ATOM   1744 C CA  . GLN A 1 229 ? 24.814 19.662  6.772  1.00 5.11  ? 229 GLN A CA  1 
ATOM   1745 C C   . GLN A 1 229 ? 25.976 20.186  5.957  1.00 4.49  ? 229 GLN A C   1 
ATOM   1746 O O   . GLN A 1 229 ? 26.564 19.472  5.134  1.00 3.58  ? 229 GLN A O   1 
ATOM   1747 C CB  . GLN A 1 229 ? 24.358 18.305  6.226  1.00 6.58  ? 229 GLN A CB  1 
ATOM   1748 C CG  . GLN A 1 229 ? 23.214 17.683  7.007  1.00 6.33  ? 229 GLN A CG  1 
ATOM   1749 C CD  . GLN A 1 229 ? 21.870 18.247  6.592  1.00 9.58  ? 229 GLN A CD  1 
ATOM   1750 O OE1 . GLN A 1 229 ? 21.425 18.040  5.463  1.00 12.71 ? 229 GLN A OE1 1 
ATOM   1751 N NE2 . GLN A 1 229 ? 21.216 18.967  7.498  1.00 7.27  ? 229 GLN A NE2 1 
ATOM   1752 N N   . ALA A 1 230 ? 26.300 21.454  6.185  1.00 4.27  ? 230 ALA A N   1 
ATOM   1753 C CA  . ALA A 1 230 ? 27.426 22.085  5.513  1.00 5.69  ? 230 ALA A CA  1 
ATOM   1754 C C   . ALA A 1 230 ? 28.660 21.458  6.165  1.00 7.53  ? 230 ALA A C   1 
ATOM   1755 O O   . ALA A 1 230 ? 28.720 21.349  7.388  1.00 8.63  ? 230 ALA A O   1 
ATOM   1756 C CB  . ALA A 1 230 ? 27.404 23.593  5.744  1.00 3.09  ? 230 ALA A CB  1 
ATOM   1757 N N   . LYS A 1 231 ? 29.634 21.046  5.356  1.00 8.86  ? 231 LYS A N   1 
ATOM   1758 C CA  . LYS A 1 231 ? 30.836 20.397  5.879  1.00 8.56  ? 231 LYS A CA  1 
ATOM   1759 C C   . LYS A 1 231 ? 32.007 21.315  6.220  1.00 10.92 ? 231 LYS A C   1 
ATOM   1760 O O   . LYS A 1 231 ? 32.943 20.884  6.893  1.00 12.64 ? 231 LYS A O   1 
ATOM   1761 C CB  . LYS A 1 231 ? 31.335 19.317  4.893  1.00 6.76  ? 231 LYS A CB  1 
ATOM   1762 C CG  . LYS A 1 231 ? 30.328 18.208  4.560  1.00 4.97  ? 231 LYS A CG  1 
ATOM   1763 C CD  . LYS A 1 231 ? 29.635 17.659  5.820  1.00 1.78  ? 231 LYS A CD  1 
ATOM   1764 C CE  . LYS A 1 231 ? 28.704 16.490  5.513  1.00 1.13  ? 231 LYS A CE  1 
ATOM   1765 N NZ  . LYS A 1 231 ? 27.597 16.792  4.552  1.00 1.13  ? 231 LYS A NZ  1 
ATOM   1766 N N   . ASP A 1 232 ? 31.975 22.567  5.774  1.00 11.61 ? 232 ASP A N   1 
ATOM   1767 C CA  . ASP A 1 232 ? 33.102 23.455  6.046  1.00 12.50 ? 232 ASP A CA  1 
ATOM   1768 C C   . ASP A 1 232 ? 32.779 24.653  6.924  1.00 12.56 ? 232 ASP A C   1 
ATOM   1769 O O   . ASP A 1 232 ? 33.173 25.778  6.616  1.00 12.04 ? 232 ASP A O   1 
ATOM   1770 C CB  . ASP A 1 232 ? 33.720 23.931  4.722  1.00 16.06 ? 232 ASP A CB  1 
ATOM   1771 C CG  . ASP A 1 232 ? 35.124 24.487  4.895  1.00 18.58 ? 232 ASP A CG  1 
ATOM   1772 O OD1 . ASP A 1 232 ? 35.928 23.862  5.629  1.00 17.26 ? 232 ASP A OD1 1 
ATOM   1773 O OD2 . ASP A 1 232 ? 35.426 25.536  4.277  1.00 18.53 ? 232 ASP A OD2 1 
ATOM   1774 N N   . VAL A 1 233 ? 32.076 24.414  8.026  1.00 10.67 ? 233 VAL A N   1 
ATOM   1775 C CA  . VAL A 1 233 ? 31.728 25.497  8.930  1.00 12.34 ? 233 VAL A CA  1 
ATOM   1776 C C   . VAL A 1 233 ? 32.295 25.263  10.330 1.00 11.71 ? 233 VAL A C   1 
ATOM   1777 O O   . VAL A 1 233 ? 32.195 24.171  10.884 1.00 12.28 ? 233 VAL A O   1 
ATOM   1778 C CB  . VAL A 1 233 ? 30.182 25.693  9.036  1.00 13.42 ? 233 VAL A CB  1 
ATOM   1779 C CG1 . VAL A 1 233 ? 29.566 25.771  7.649  1.00 12.43 ? 233 VAL A CG1 1 
ATOM   1780 C CG2 . VAL A 1 233 ? 29.555 24.568  9.831  1.00 15.32 ? 233 VAL A CG2 1 
ATOM   1781 N N   . PHE A 1 234 ? 32.905 26.299  10.891 1.00 10.92 ? 234 PHE A N   1 
ATOM   1782 C CA  . PHE A 1 234 ? 33.452 26.207  12.236 1.00 10.45 ? 234 PHE A CA  1 
ATOM   1783 C C   . PHE A 1 234 ? 32.633 27.135  13.130 1.00 8.83  ? 234 PHE A C   1 
ATOM   1784 O O   . PHE A 1 234 ? 31.923 28.007  12.630 1.00 6.49  ? 234 PHE A O   1 
ATOM   1785 C CB  . PHE A 1 234 ? 34.931 26.616  12.255 1.00 9.43  ? 234 PHE A CB  1 
ATOM   1786 C CG  . PHE A 1 234 ? 35.735 25.900  13.306 1.00 5.11  ? 234 PHE A CG  1 
ATOM   1787 C CD1 . PHE A 1 234 ? 35.984 24.533  13.192 1.00 4.61  ? 234 PHE A CD1 1 
ATOM   1788 C CD2 . PHE A 1 234 ? 36.206 26.583  14.424 1.00 2.50  ? 234 PHE A CD2 1 
ATOM   1789 C CE1 . PHE A 1 234 ? 36.693 23.851  14.177 1.00 2.94  ? 234 PHE A CE1 1 
ATOM   1790 C CE2 . PHE A 1 234 ? 36.916 25.915  15.414 1.00 3.75  ? 234 PHE A CE2 1 
ATOM   1791 C CZ  . PHE A 1 234 ? 37.164 24.541  15.291 1.00 2.86  ? 234 PHE A CZ  1 
ATOM   1792 N N   . LEU A 1 235 ? 32.721 26.931  14.441 1.00 7.97  ? 235 LEU A N   1 
ATOM   1793 C CA  . LEU A 1 235 ? 31.999 27.749  15.417 1.00 10.00 ? 235 LEU A CA  1 
ATOM   1794 C C   . LEU A 1 235 ? 33.002 28.395  16.383 1.00 12.85 ? 235 LEU A C   1 
ATOM   1795 O O   . LEU A 1 235 ? 33.216 27.909  17.491 1.00 13.23 ? 235 LEU A O   1 
ATOM   1796 C CB  . LEU A 1 235 ? 31.011 26.877  16.205 1.00 9.38  ? 235 LEU A CB  1 
ATOM   1797 C CG  . LEU A 1 235 ? 29.636 26.538  15.607 1.00 10.65 ? 235 LEU A CG  1 
ATOM   1798 C CD1 . LEU A 1 235 ? 29.763 26.177  14.146 1.00 11.76 ? 235 LEU A CD1 1 
ATOM   1799 C CD2 . LEU A 1 235 ? 29.000 25.402  16.391 1.00 5.74  ? 235 LEU A CD2 1 
ATOM   1800 N N   . PRO A 1 236 ? 33.632 29.503  15.969 1.00 13.44 ? 236 PRO A N   1 
ATOM   1801 C CA  . PRO A 1 236 ? 34.609 30.189  16.816 1.00 16.33 ? 236 PRO A CA  1 
ATOM   1802 C C   . PRO A 1 236 ? 33.996 30.855  18.040 1.00 17.74 ? 236 PRO A C   1 
ATOM   1803 O O   . PRO A 1 236 ? 34.703 31.179  18.996 1.00 17.99 ? 236 PRO A O   1 
ATOM   1804 C CB  . PRO A 1 236 ? 35.252 31.187  15.855 1.00 16.21 ? 236 PRO A CB  1 
ATOM   1805 C CG  . PRO A 1 236 ? 34.127 31.516  14.928 1.00 16.36 ? 236 PRO A CG  1 
ATOM   1806 C CD  . PRO A 1 236 ? 33.523 30.161  14.659 1.00 14.29 ? 236 PRO A CD  1 
ATOM   1807 N N   . ASP A 1 237 ? 32.678 31.050  18.004 1.00 19.78 ? 237 ASP A N   1 
ATOM   1808 C CA  . ASP A 1 237 ? 31.945 31.672  19.109 1.00 19.15 ? 237 ASP A CA  1 
ATOM   1809 C C   . ASP A 1 237 ? 31.474 30.623  20.116 1.00 18.81 ? 237 ASP A C   1 
ATOM   1810 O O   . ASP A 1 237 ? 31.122 30.958  21.249 1.00 19.29 ? 237 ASP A O   1 
ATOM   1811 C CB  . ASP A 1 237 ? 30.722 32.437  18.581 1.00 19.21 ? 237 ASP A CB  1 
ATOM   1812 C CG  . ASP A 1 237 ? 31.094 33.633  17.714 1.00 21.09 ? 237 ASP A CG  1 
ATOM   1813 O OD1 . ASP A 1 237 ? 31.723 34.580  18.234 1.00 21.41 ? 237 ASP A OD1 1 
ATOM   1814 O OD2 . ASP A 1 237 ? 30.756 33.631  16.510 1.00 21.47 ? 237 ASP A OD2 1 
ATOM   1815 N N   . ASP A 1 238 ? 31.472 29.357  19.712 1.00 18.80 ? 238 ASP A N   1 
ATOM   1816 C CA  . ASP A 1 238 ? 31.020 28.280  20.593 1.00 19.47 ? 238 ASP A CA  1 
ATOM   1817 C C   . ASP A 1 238 ? 31.692 28.318  21.965 1.00 20.06 ? 238 ASP A C   1 
ATOM   1818 O O   . ASP A 1 238 ? 32.913 28.458  22.061 1.00 18.05 ? 238 ASP A O   1 
ATOM   1819 C CB  . ASP A 1 238 ? 31.275 26.920  19.950 1.00 18.28 ? 238 ASP A CB  1 
ATOM   1820 C CG  . ASP A 1 238 ? 30.605 25.795  20.707 1.00 19.62 ? 238 ASP A CG  1 
ATOM   1821 O OD1 . ASP A 1 238 ? 29.356 25.732  20.672 1.00 20.31 ? 238 ASP A OD1 1 
ATOM   1822 O OD2 . ASP A 1 238 ? 31.318 24.987  21.344 1.00 14.67 ? 238 ASP A OD2 1 
ATOM   1823 N N   . TYR A 1 239 ? 30.893 28.169  23.022 1.00 20.84 ? 239 TYR A N   1 
ATOM   1824 C CA  . TYR A 1 239 ? 31.411 28.207  24.390 1.00 21.30 ? 239 TYR A CA  1 
ATOM   1825 C C   . TYR A 1 239 ? 32.398 27.088  24.678 1.00 19.52 ? 239 TYR A C   1 
ATOM   1826 O O   . TYR A 1 239 ? 33.436 27.315  25.298 1.00 18.90 ? 239 TYR A O   1 
ATOM   1827 C CB  . TYR A 1 239 ? 30.272 28.149  25.417 1.00 24.60 ? 239 TYR A CB  1 
ATOM   1828 C CG  . TYR A 1 239 ? 29.320 29.330  25.375 1.00 28.63 ? 239 TYR A CG  1 
ATOM   1829 C CD1 . TYR A 1 239 ? 29.758 30.601  24.981 1.00 30.00 ? 239 TYR A CD1 1 
ATOM   1830 C CD2 . TYR A 1 239 ? 27.976 29.179  25.742 1.00 30.65 ? 239 TYR A CD2 1 
ATOM   1831 C CE1 . TYR A 1 239 ? 28.878 31.693  24.946 1.00 32.54 ? 239 TYR A CE1 1 
ATOM   1832 C CE2 . TYR A 1 239 ? 27.089 30.259  25.713 1.00 33.13 ? 239 TYR A CE2 1 
ATOM   1833 C CZ  . TYR A 1 239 ? 27.546 31.510  25.312 1.00 33.34 ? 239 TYR A CZ  1 
ATOM   1834 O OH  . TYR A 1 239 ? 26.665 32.568  25.264 1.00 35.98 ? 239 TYR A OH  1 
ATOM   1835 N N   . LEU A 1 240 ? 32.072 25.880  24.236 1.00 18.36 ? 240 LEU A N   1 
ATOM   1836 C CA  . LEU A 1 240 ? 32.962 24.748  24.447 1.00 16.88 ? 240 LEU A CA  1 
ATOM   1837 C C   . LEU A 1 240 ? 34.261 24.982  23.688 1.00 17.79 ? 240 LEU A C   1 
ATOM   1838 O O   . LEU A 1 240 ? 35.346 24.722  24.202 1.00 20.20 ? 240 LEU A O   1 
ATOM   1839 C CB  . LEU A 1 240 ? 32.297 23.462  23.967 1.00 13.70 ? 240 LEU A CB  1 
ATOM   1840 C CG  . LEU A 1 240 ? 33.091 22.166  24.115 1.00 14.87 ? 240 LEU A CG  1 
ATOM   1841 C CD1 . LEU A 1 240 ? 33.792 22.105  25.470 1.00 9.24  ? 240 LEU A CD1 1 
ATOM   1842 C CD2 . LEU A 1 240 ? 32.125 20.991  23.950 1.00 11.04 ? 240 LEU A CD2 1 
ATOM   1843 N N   . ILE A 1 241 ? 34.140 25.495  22.468 1.00 16.72 ? 241 ILE A N   1 
ATOM   1844 C CA  . ILE A 1 241 ? 35.290 25.774  21.621 1.00 16.89 ? 241 ILE A CA  1 
ATOM   1845 C C   . ILE A 1 241 ? 36.273 26.727  22.297 1.00 18.42 ? 241 ILE A C   1 
ATOM   1846 O O   . ILE A 1 241 ? 37.487 26.555  22.192 1.00 16.87 ? 241 ILE A O   1 
ATOM   1847 C CB  . ILE A 1 241 ? 34.826 26.354  20.257 1.00 16.55 ? 241 ILE A CB  1 
ATOM   1848 C CG1 . ILE A 1 241 ? 34.115 25.261  19.456 1.00 15.12 ? 241 ILE A CG1 1 
ATOM   1849 C CG2 . ILE A 1 241 ? 36.000 26.935  19.487 1.00 13.55 ? 241 ILE A CG2 1 
ATOM   1850 C CD1 . ILE A 1 241 ? 34.904 23.959  19.337 1.00 15.00 ? 241 ILE A CD1 1 
ATOM   1851 N N   . LYS A 1 242 ? 35.743 27.731  22.989 1.00 20.54 ? 242 LYS A N   1 
ATOM   1852 C CA  . LYS A 1 242 ? 36.580 28.693  23.698 1.00 22.38 ? 242 LYS A CA  1 
ATOM   1853 C C   . LYS A 1 242 ? 37.406 27.950  24.751 1.00 22.42 ? 242 LYS A C   1 
ATOM   1854 O O   . LYS A 1 242 ? 38.580 28.257  24.959 1.00 22.45 ? 242 LYS A O   1 
ATOM   1855 C CB  . LYS A 1 242 ? 35.716 29.759  24.379 1.00 23.50 ? 242 LYS A CB  1 
ATOM   1856 C CG  . LYS A 1 242 ? 34.880 30.594  23.429 1.00 27.88 ? 242 LYS A CG  1 
ATOM   1857 C CD  . LYS A 1 242 ? 34.211 31.752  24.166 1.00 29.75 ? 242 LYS A CD  1 
ATOM   1858 C CE  . LYS A 1 242 ? 33.249 32.517  23.258 1.00 31.86 ? 242 LYS A CE  1 
ATOM   1859 N NZ  . LYS A 1 242 ? 33.898 32.991  21.998 1.00 31.91 ? 242 LYS A NZ  1 
ATOM   1860 N N   . GLN A 1 243 ? 36.781 26.972  25.408 1.00 21.71 ? 243 GLN A N   1 
ATOM   1861 C CA  . GLN A 1 243 ? 37.459 26.172  26.427 1.00 22.04 ? 243 GLN A CA  1 
ATOM   1862 C C   . GLN A 1 243 ? 38.634 25.434  25.788 1.00 21.07 ? 243 GLN A C   1 
ATOM   1863 O O   . GLN A 1 243 ? 39.716 25.325  26.373 1.00 21.04 ? 243 GLN A O   1 
ATOM   1864 C CB  . GLN A 1 243 ? 36.498 25.147  27.038 1.00 24.16 ? 243 GLN A CB  1 
ATOM   1865 C CG  . GLN A 1 243 ? 35.156 25.707  27.457 1.00 25.66 ? 243 GLN A CG  1 
ATOM   1866 C CD  . GLN A 1 243 ? 35.268 26.719  28.574 1.00 27.66 ? 243 GLN A CD  1 
ATOM   1867 O OE1 . GLN A 1 243 ? 36.053 27.669  28.497 1.00 28.68 ? 243 GLN A OE1 1 
ATOM   1868 N NE2 . GLN A 1 243 ? 34.472 26.529  29.621 1.00 26.41 ? 243 GLN A NE2 1 
ATOM   1869 N N   . ARG A 1 244 ? 38.412 24.924  24.583 1.00 19.94 ? 244 ARG A N   1 
ATOM   1870 C CA  . ARG A 1 244 ? 39.449 24.206  23.859 1.00 19.26 ? 244 ARG A CA  1 
ATOM   1871 C C   . ARG A 1 244 ? 40.542 25.170  23.401 1.00 19.01 ? 244 ARG A C   1 
ATOM   1872 O O   . ARG A 1 244 ? 41.684 24.768  23.220 1.00 19.21 ? 244 ARG A O   1 
ATOM   1873 C CB  . ARG A 1 244 ? 38.833 23.483  22.656 1.00 19.46 ? 244 ARG A CB  1 
ATOM   1874 C CG  . ARG A 1 244 ? 37.807 22.409  23.017 1.00 19.39 ? 244 ARG A CG  1 
ATOM   1875 C CD  . ARG A 1 244 ? 38.496 21.133  23.470 1.00 20.63 ? 244 ARG A CD  1 
ATOM   1876 N NE  . ARG A 1 244 ? 37.569 20.029  23.724 1.00 19.69 ? 244 ARG A NE  1 
ATOM   1877 C CZ  . ARG A 1 244 ? 36.904 19.852  24.861 1.00 20.82 ? 244 ARG A CZ  1 
ATOM   1878 N NH1 . ARG A 1 244 ? 37.059 20.708  25.860 1.00 18.80 ? 244 ARG A NH1 1 
ATOM   1879 N NH2 . ARG A 1 244 ? 36.096 18.809  25.008 1.00 19.28 ? 244 ARG A NH2 1 
ATOM   1880 N N   . PHE A 1 245 ? 40.187 26.440  23.212 1.00 20.96 ? 245 PHE A N   1 
ATOM   1881 C CA  . PHE A 1 245 ? 41.158 27.459  22.790 1.00 23.64 ? 245 PHE A CA  1 
ATOM   1882 C C   . PHE A 1 245 ? 41.266 28.577  23.832 1.00 24.64 ? 245 PHE A C   1 
ATOM   1883 O O   . PHE A 1 245 ? 40.803 29.696  23.605 1.00 26.19 ? 245 PHE A O   1 
ATOM   1884 C CB  . PHE A 1 245 ? 40.770 28.080  21.438 1.00 22.38 ? 245 PHE A CB  1 
ATOM   1885 C CG  . PHE A 1 245 ? 40.761 27.102  20.291 1.00 22.79 ? 245 PHE A CG  1 
ATOM   1886 C CD1 . PHE A 1 245 ? 39.681 26.250  20.090 1.00 23.02 ? 245 PHE A CD1 1 
ATOM   1887 C CD2 . PHE A 1 245 ? 41.833 27.040  19.407 1.00 21.34 ? 245 PHE A CD2 1 
ATOM   1888 C CE1 . PHE A 1 245 ? 39.669 25.352  19.022 1.00 23.54 ? 245 PHE A CE1 1 
ATOM   1889 C CE2 . PHE A 1 245 ? 41.829 26.144  18.341 1.00 21.35 ? 245 PHE A CE2 1 
ATOM   1890 C CZ  . PHE A 1 245 ? 40.745 25.302  18.149 1.00 22.39 ? 245 PHE A CZ  1 
ATOM   1891 N N   . PRO A 1 246 ? 41.887 28.286  24.988 1.00 25.99 ? 246 PRO A N   1 
ATOM   1892 C CA  . PRO A 1 246 ? 42.066 29.247  26.083 1.00 26.70 ? 246 PRO A CA  1 
ATOM   1893 C C   . PRO A 1 246 ? 42.847 30.505  25.690 1.00 26.46 ? 246 PRO A C   1 
ATOM   1894 O O   . PRO A 1 246 ? 43.960 30.425  25.160 1.00 24.93 ? 246 PRO A O   1 
ATOM   1895 C CB  . PRO A 1 246 ? 42.802 28.426  27.145 1.00 26.70 ? 246 PRO A CB  1 
ATOM   1896 C CG  . PRO A 1 246 ? 42.357 27.023  26.862 1.00 26.50 ? 246 PRO A CG  1 
ATOM   1897 C CD  . PRO A 1 246 ? 42.442 26.974  25.363 1.00 25.91 ? 246 PRO A CD  1 
ATOM   1898 N N   . GLY A 1 247 ? 42.252 31.664  25.962 1.00 26.80 ? 247 GLY A N   1 
ATOM   1899 C CA  . GLY A 1 247 ? 42.900 32.922  25.641 1.00 27.14 ? 247 GLY A CA  1 
ATOM   1900 C C   . GLY A 1 247 ? 42.637 33.438  24.239 1.00 26.66 ? 247 GLY A C   1 
ATOM   1901 O O   . GLY A 1 247 ? 42.498 34.641  24.035 1.00 29.52 ? 247 GLY A O   1 
ATOM   1902 N N   . MET A 1 248 ? 42.565 32.543  23.264 1.00 24.67 ? 248 MET A N   1 
ATOM   1903 C CA  . MET A 1 248 ? 42.328 32.969  21.894 1.00 22.63 ? 248 MET A CA  1 
ATOM   1904 C C   . MET A 1 248 ? 40.927 33.515  21.660 1.00 21.99 ? 248 MET A C   1 
ATOM   1905 O O   . MET A 1 248 ? 39.930 32.932  22.103 1.00 21.89 ? 248 MET A O   1 
ATOM   1906 C CB  . MET A 1 248 ? 42.591 31.816  20.935 1.00 22.97 ? 248 MET A CB  1 
ATOM   1907 C CG  . MET A 1 248 ? 44.048 31.530  20.715 1.00 21.28 ? 248 MET A CG  1 
ATOM   1908 S SD  . MET A 1 248 ? 44.258 30.017  19.797 1.00 21.33 ? 248 MET A SD  1 
ATOM   1909 C CE  . MET A 1 248 ? 44.336 28.877  21.137 1.00 21.89 ? 248 MET A CE  1 
ATOM   1910 N N   . THR A 1 249 ? 40.866 34.639  20.954 1.00 18.84 ? 249 THR A N   1 
ATOM   1911 C CA  . THR A 1 249 ? 39.596 35.280  20.637 1.00 16.46 ? 249 THR A CA  1 
ATOM   1912 C C   . THR A 1 249 ? 38.923 34.552  19.482 1.00 15.22 ? 249 THR A C   1 
ATOM   1913 O O   . THR A 1 249 ? 39.528 33.705  18.828 1.00 15.08 ? 249 THR A O   1 
ATOM   1914 C CB  . THR A 1 249 ? 39.790 36.737  20.186 1.00 16.19 ? 249 THR A CB  1 
ATOM   1915 O OG1 . THR A 1 249 ? 40.513 36.753  18.946 1.00 14.90 ? 249 THR A OG1 1 
ATOM   1916 C CG2 . THR A 1 249 ? 40.542 37.530  21.234 1.00 14.33 ? 249 THR A CG2 1 
ATOM   1917 N N   . PRO A 1 250 ? 37.653 34.875  19.218 1.00 14.66 ? 250 PRO A N   1 
ATOM   1918 C CA  . PRO A 1 250 ? 36.937 34.227  18.119 1.00 14.47 ? 250 PRO A CA  1 
ATOM   1919 C C   . PRO A 1 250 ? 37.690 34.340  16.792 1.00 13.68 ? 250 PRO A C   1 
ATOM   1920 O O   . PRO A 1 250 ? 37.786 33.368  16.041 1.00 13.28 ? 250 PRO A O   1 
ATOM   1921 C CB  . PRO A 1 250 ? 35.609 34.973  18.103 1.00 12.97 ? 250 PRO A CB  1 
ATOM   1922 C CG  . PRO A 1 250 ? 35.377 35.220  19.555 1.00 14.12 ? 250 PRO A CG  1 
ATOM   1923 C CD  . PRO A 1 250 ? 36.739 35.719  20.009 1.00 13.24 ? 250 PRO A CD  1 
ATOM   1924 N N   . ALA A 1 251 ? 38.226 35.528  16.514 1.00 13.06 ? 251 ALA A N   1 
ATOM   1925 C CA  . ALA A 1 251 ? 38.967 35.781  15.275 1.00 12.51 ? 251 ALA A CA  1 
ATOM   1926 C C   . ALA A 1 251 ? 40.224 34.916  15.149 1.00 11.47 ? 251 ALA A C   1 
ATOM   1927 O O   . ALA A 1 251 ? 40.573 34.471  14.054 1.00 10.07 ? 251 ALA A O   1 
ATOM   1928 C CB  . ALA A 1 251 ? 39.341 37.260  15.186 1.00 12.35 ? 251 ALA A CB  1 
ATOM   1929 N N   . GLN A 1 252 ? 40.897 34.694  16.276 1.00 11.16 ? 252 GLN A N   1 
ATOM   1930 C CA  . GLN A 1 252 ? 42.112 33.879  16.317 1.00 11.88 ? 252 GLN A CA  1 
ATOM   1931 C C   . GLN A 1 252 ? 41.760 32.408  16.113 1.00 10.06 ? 252 GLN A C   1 
ATOM   1932 O O   . GLN A 1 252 ? 42.475 31.665  15.431 1.00 8.74  ? 252 GLN A O   1 
ATOM   1933 C CB  . GLN A 1 252 ? 42.832 34.056  17.666 1.00 11.18 ? 252 GLN A CB  1 
ATOM   1934 C CG  . GLN A 1 252 ? 43.376 35.464  17.896 1.00 13.06 ? 252 GLN A CG  1 
ATOM   1935 C CD  . GLN A 1 252 ? 44.099 35.627  19.224 1.00 9.62  ? 252 GLN A CD  1 
ATOM   1936 O OE1 . GLN A 1 252 ? 43.515 35.461  20.295 1.00 8.25  ? 252 GLN A OE1 1 
ATOM   1937 N NE2 . GLN A 1 252 ? 45.377 35.967  19.154 1.00 9.71  ? 252 GLN A NE2 1 
ATOM   1938 N N   . ILE A 1 253 ? 40.654 31.989  16.711 1.00 9.31  ? 253 ILE A N   1 
ATOM   1939 C CA  . ILE A 1 253 ? 40.215 30.610  16.576 1.00 9.22  ? 253 ILE A CA  1 
ATOM   1940 C C   . ILE A 1 253 ? 39.824 30.381  15.125 1.00 8.83  ? 253 ILE A C   1 
ATOM   1941 O O   . ILE A 1 253 ? 40.146 29.346  14.545 1.00 10.45 ? 253 ILE A O   1 
ATOM   1942 C CB  . ILE A 1 253 ? 39.034 30.329  17.508 1.00 7.47  ? 253 ILE A CB  1 
ATOM   1943 C CG1 . ILE A 1 253 ? 39.453 30.653  18.951 1.00 8.87  ? 253 ILE A CG1 1 
ATOM   1944 C CG2 . ILE A 1 253 ? 38.600 28.873  17.377 1.00 8.64  ? 253 ILE A CG2 1 
ATOM   1945 C CD1 . ILE A 1 253 ? 38.374 30.403  20.003 1.00 10.86 ? 253 ILE A CD1 1 
ATOM   1946 N N   . ARG A 1 254 ? 39.161 31.369  14.536 1.00 8.85  ? 254 ARG A N   1 
ATOM   1947 C CA  . ARG A 1 254 ? 38.742 31.294  13.139 1.00 12.04 ? 254 ARG A CA  1 
ATOM   1948 C C   . ARG A 1 254 ? 39.969 31.182  12.233 1.00 12.42 ? 254 ARG A C   1 
ATOM   1949 O O   . ARG A 1 254 ? 39.943 30.501  11.203 1.00 12.37 ? 254 ARG A O   1 
ATOM   1950 C CB  . ARG A 1 254 ? 37.941 32.540  12.763 1.00 11.99 ? 254 ARG A CB  1 
ATOM   1951 C CG  . ARG A 1 254 ? 37.446 32.555  11.331 1.00 11.07 ? 254 ARG A CG  1 
ATOM   1952 C CD  . ARG A 1 254 ? 36.689 33.845  11.047 1.00 12.63 ? 254 ARG A CD  1 
ATOM   1953 N NE  . ARG A 1 254 ? 35.602 34.045  12.003 1.00 12.31 ? 254 ARG A NE  1 
ATOM   1954 C CZ  . ARG A 1 254 ? 35.476 35.122  12.774 1.00 15.10 ? 254 ARG A CZ  1 
ATOM   1955 N NH1 . ARG A 1 254 ? 36.374 36.098  12.699 1.00 15.88 ? 254 ARG A NH1 1 
ATOM   1956 N NH2 . ARG A 1 254 ? 34.452 35.226  13.618 1.00 14.60 ? 254 ARG A NH2 1 
ATOM   1957 N N   . ARG A 1 255 ? 41.039 31.870  12.618 1.00 11.68 ? 255 ARG A N   1 
ATOM   1958 C CA  . ARG A 1 255 ? 42.273 31.824  11.852 1.00 12.90 ? 255 ARG A CA  1 
ATOM   1959 C C   . ARG A 1 255 ? 42.898 30.441  12.010 1.00 12.95 ? 255 ARG A C   1 
ATOM   1960 O O   . ARG A 1 255 ? 43.359 29.839  11.036 1.00 13.26 ? 255 ARG A O   1 
ATOM   1961 C CB  . ARG A 1 255 ? 43.243 32.919  12.328 1.00 14.32 ? 255 ARG A CB  1 
ATOM   1962 C CG  . ARG A 1 255 ? 44.696 32.739  11.887 1.00 15.72 ? 255 ARG A CG  1 
ATOM   1963 C CD  . ARG A 1 255 ? 44.833 32.497  10.392 1.00 16.98 ? 255 ARG A CD  1 
ATOM   1964 N NE  . ARG A 1 255 ? 46.190 32.080  10.045 1.00 19.67 ? 255 ARG A NE  1 
ATOM   1965 C CZ  . ARG A 1 255 ? 46.480 31.092  9.200  1.00 21.23 ? 255 ARG A CZ  1 
ATOM   1966 N NH1 . ARG A 1 255 ? 45.505 30.409  8.609  1.00 21.36 ? 255 ARG A NH1 1 
ATOM   1967 N NH2 . ARG A 1 255 ? 47.746 30.784  8.942  1.00 21.50 ? 255 ARG A NH2 1 
ATOM   1968 N N   . TYR A 1 256 ? 42.892 29.921  13.231 1.00 12.30 ? 256 TYR A N   1 
ATOM   1969 C CA  . TYR A 1 256 ? 43.474 28.611  13.461 1.00 12.40 ? 256 TYR A CA  1 
ATOM   1970 C C   . TYR A 1 256 ? 42.784 27.508  12.668 1.00 10.92 ? 256 TYR A C   1 
ATOM   1971 O O   . TYR A 1 256 ? 43.445 26.641  12.107 1.00 7.76  ? 256 TYR A O   1 
ATOM   1972 C CB  . TYR A 1 256 ? 43.433 28.268  14.950 1.00 13.31 ? 256 TYR A CB  1 
ATOM   1973 C CG  . TYR A 1 256 ? 44.276 27.065  15.319 1.00 13.48 ? 256 TYR A CG  1 
ATOM   1974 C CD1 . TYR A 1 256 ? 43.816 25.769  15.103 1.00 11.95 ? 256 TYR A CD1 1 
ATOM   1975 C CD2 . TYR A 1 256 ? 45.538 27.230  15.890 1.00 15.63 ? 256 TYR A CD2 1 
ATOM   1976 C CE1 . TYR A 1 256 ? 44.582 24.665  15.446 1.00 12.89 ? 256 TYR A CE1 1 
ATOM   1977 C CE2 . TYR A 1 256 ? 46.316 26.129  16.240 1.00 17.19 ? 256 TYR A CE2 1 
ATOM   1978 C CZ  . TYR A 1 256 ? 45.833 24.851  16.016 1.00 16.59 ? 256 TYR A CZ  1 
ATOM   1979 O OH  . TYR A 1 256 ? 46.604 23.766  16.363 1.00 19.66 ? 256 TYR A OH  1 
ATOM   1980 N N   . ALA A 1 257 ? 41.455 27.556  12.615 1.00 11.38 ? 257 ALA A N   1 
ATOM   1981 C CA  . ALA A 1 257 ? 40.671 26.530  11.926 1.00 13.13 ? 257 ALA A CA  1 
ATOM   1982 C C   . ALA A 1 257 ? 40.767 26.455  10.400 1.00 13.79 ? 257 ALA A C   1 
ATOM   1983 O O   . ALA A 1 257 ? 40.359 25.453  9.805  1.00 14.70 ? 257 ALA A O   1 
ATOM   1984 C CB  . ALA A 1 257 ? 39.211 26.652  12.337 1.00 12.54 ? 257 ALA A CB  1 
ATOM   1985 N N   . GLU A 1 258 ? 41.313 27.485  9.762  1.00 13.85 ? 258 GLU A N   1 
ATOM   1986 C CA  . GLU A 1 258 ? 41.422 27.494  8.303  1.00 14.52 ? 258 GLU A CA  1 
ATOM   1987 C C   . GLU A 1 258 ? 42.217 26.310  7.767  1.00 13.92 ? 258 GLU A C   1 
ATOM   1988 O O   . GLU A 1 258 ? 42.054 25.896  6.612  1.00 12.08 ? 258 GLU A O   1 
ATOM   1989 C CB  . GLU A 1 258 ? 42.067 28.796  7.830  1.00 17.34 ? 258 GLU A CB  1 
ATOM   1990 C CG  . GLU A 1 258 ? 41.323 30.041  8.266  1.00 21.11 ? 258 GLU A CG  1 
ATOM   1991 C CD  . GLU A 1 258 ? 41.753 31.271  7.490  1.00 25.63 ? 258 GLU A CD  1 
ATOM   1992 O OE1 . GLU A 1 258 ? 42.981 31.481  7.349  1.00 25.92 ? 258 GLU A OE1 1 
ATOM   1993 O OE2 . GLU A 1 258 ? 40.864 32.027  7.028  1.00 26.15 ? 258 GLU A OE2 1 
ATOM   1994 N N   . ARG A 1 259 ? 43.062 25.757  8.622  1.00 12.53 ? 259 ARG A N   1 
ATOM   1995 C CA  . ARG A 1 259 ? 43.904 24.635  8.259  1.00 13.02 ? 259 ARG A CA  1 
ATOM   1996 C C   . ARG A 1 259 ? 43.118 23.345  8.024  1.00 14.02 ? 259 ARG A C   1 
ATOM   1997 O O   . ARG A 1 259 ? 43.669 22.379  7.504  1.00 14.42 ? 259 ARG A O   1 
ATOM   1998 C CB  . ARG A 1 259 ? 44.930 24.404  9.365  1.00 14.97 ? 259 ARG A CB  1 
ATOM   1999 C CG  . ARG A 1 259 ? 44.310 23.965  10.689 1.00 15.17 ? 259 ARG A CG  1 
ATOM   2000 C CD  . ARG A 1 259 ? 45.361 23.766  11.755 1.00 15.82 ? 259 ARG A CD  1 
ATOM   2001 N NE  . ARG A 1 259 ? 46.015 25.020  12.106 1.00 19.83 ? 259 ARG A NE  1 
ATOM   2002 C CZ  . ARG A 1 259 ? 47.061 25.121  12.922 1.00 20.21 ? 259 ARG A CZ  1 
ATOM   2003 N NH1 . ARG A 1 259 ? 47.586 24.037  13.479 1.00 21.61 ? 259 ARG A NH1 1 
ATOM   2004 N NH2 . ARG A 1 259 ? 47.576 26.309  13.187 1.00 21.23 ? 259 ARG A NH2 1 
ATOM   2005 N N   . TRP A 1 260 ? 41.841 23.318  8.408  1.00 13.63 ? 260 TRP A N   1 
ATOM   2006 C CA  . TRP A 1 260 ? 41.038 22.106  8.232  1.00 11.67 ? 260 TRP A CA  1 
ATOM   2007 C C   . TRP A 1 260 ? 40.090 22.200  7.042  1.00 12.54 ? 260 TRP A C   1 
ATOM   2008 O O   . TRP A 1 260 ? 39.303 21.286  6.775  1.00 10.90 ? 260 TRP A O   1 
ATOM   2009 C CB  . TRP A 1 260 ? 40.265 21.789  9.518  1.00 10.50 ? 260 TRP A CB  1 
ATOM   2010 C CG  . TRP A 1 260 ? 41.180 21.491  10.689 1.00 10.53 ? 260 TRP A CG  1 
ATOM   2011 C CD1 . TRP A 1 260 ? 42.224 20.599  10.709 1.00 10.74 ? 260 TRP A CD1 1 
ATOM   2012 C CD2 . TRP A 1 260 ? 41.160 22.104  11.984 1.00 8.81  ? 260 TRP A CD2 1 
ATOM   2013 N NE1 . TRP A 1 260 ? 42.853 20.626  11.929 1.00 10.44 ? 260 TRP A NE1 1 
ATOM   2014 C CE2 . TRP A 1 260 ? 42.222 21.540  12.733 1.00 11.24 ? 260 TRP A CE2 1 
ATOM   2015 C CE3 . TRP A 1 260 ? 40.352 23.075  12.587 1.00 9.81  ? 260 TRP A CE3 1 
ATOM   2016 C CZ2 . TRP A 1 260 ? 42.495 21.918  14.058 1.00 9.88  ? 260 TRP A CZ2 1 
ATOM   2017 C CZ3 . TRP A 1 260 ? 40.623 23.451  13.904 1.00 11.29 ? 260 TRP A CZ3 1 
ATOM   2018 C CH2 . TRP A 1 260 ? 41.687 22.872  14.622 1.00 12.03 ? 260 TRP A CH2 1 
ATOM   2019 N N   . LYS A 1 261 ? 40.176 23.308  6.317  1.00 13.68 ? 261 LYS A N   1 
ATOM   2020 C CA  . LYS A 1 261 ? 39.356 23.497  5.134  1.00 14.02 ? 261 LYS A CA  1 
ATOM   2021 C C   . LYS A 1 261 ? 39.685 22.344  4.194  1.00 11.55 ? 261 LYS A C   1 
ATOM   2022 O O   . LYS A 1 261 ? 40.821 21.882  4.167  1.00 12.70 ? 261 LYS A O   1 
ATOM   2023 C CB  . LYS A 1 261 ? 39.706 24.826  4.471  1.00 15.79 ? 261 LYS A CB  1 
ATOM   2024 C CG  . LYS A 1 261 ? 38.852 25.148  3.269  1.00 19.07 ? 261 LYS A CG  1 
ATOM   2025 C CD  . LYS A 1 261 ? 39.137 26.541  2.734  1.00 20.09 ? 261 LYS A CD  1 
ATOM   2026 C CE  . LYS A 1 261 ? 38.384 26.772  1.438  1.00 22.08 ? 261 LYS A CE  1 
ATOM   2027 N NZ  . LYS A 1 261 ? 38.674 28.106  0.862  1.00 24.94 ? 261 LYS A NZ  1 
ATOM   2028 N N   . PRO A 1 262 ? 38.698 21.847  3.429  1.00 11.15 ? 262 PRO A N   1 
ATOM   2029 C CA  . PRO A 1 262 ? 37.300 22.289  3.392  1.00 11.90 ? 262 PRO A CA  1 
ATOM   2030 C C   . PRO A 1 262 ? 36.394 21.379  4.215  1.00 12.64 ? 262 PRO A C   1 
ATOM   2031 O O   . PRO A 1 262 ? 35.266 21.088  3.808  1.00 11.93 ? 262 PRO A O   1 
ATOM   2032 C CB  . PRO A 1 262 ? 36.970 22.199  1.914  1.00 9.54  ? 262 PRO A CB  1 
ATOM   2033 C CG  . PRO A 1 262 ? 37.631 20.909  1.557  1.00 10.61 ? 262 PRO A CG  1 
ATOM   2034 C CD  . PRO A 1 262 ? 38.999 21.029  2.240  1.00 8.99  ? 262 PRO A CD  1 
ATOM   2035 N N   . TRP A 1 263 ? 36.886 20.927  5.369  1.00 13.28 ? 263 TRP A N   1 
ATOM   2036 C CA  . TRP A 1 263 ? 36.113 20.040  6.233  1.00 11.07 ? 263 TRP A CA  1 
ATOM   2037 C C   . TRP A 1 263 ? 36.067 20.554  7.670  1.00 11.20 ? 263 TRP A C   1 
ATOM   2038 O O   . TRP A 1 263 ? 36.166 19.773  8.612  1.00 12.75 ? 263 TRP A O   1 
ATOM   2039 C CB  . TRP A 1 263 ? 36.719 18.634  6.223  1.00 9.49  ? 263 TRP A CB  1 
ATOM   2040 C CG  . TRP A 1 263 ? 36.902 18.054  4.855  1.00 9.15  ? 263 TRP A CG  1 
ATOM   2041 C CD1 . TRP A 1 263 ? 38.081 17.701  4.267  1.00 8.73  ? 263 TRP A CD1 1 
ATOM   2042 C CD2 . TRP A 1 263 ? 35.875 17.772  3.897  1.00 9.02  ? 263 TRP A CD2 1 
ATOM   2043 N NE1 . TRP A 1 263 ? 37.852 17.216  2.999  1.00 9.37  ? 263 TRP A NE1 1 
ATOM   2044 C CE2 . TRP A 1 263 ? 36.506 17.249  2.747  1.00 8.82  ? 263 TRP A CE2 1 
ATOM   2045 C CE3 . TRP A 1 263 ? 34.481 17.913  3.899  1.00 8.06  ? 263 TRP A CE3 1 
ATOM   2046 C CZ2 . TRP A 1 263 ? 35.790 16.865  1.606  1.00 8.60  ? 263 TRP A CZ2 1 
ATOM   2047 C CZ3 . TRP A 1 263 ? 33.769 17.533  2.765  1.00 8.91  ? 263 TRP A CZ3 1 
ATOM   2048 C CH2 . TRP A 1 263 ? 34.426 17.014  1.634  1.00 8.40  ? 263 TRP A CH2 1 
ATOM   2049 N N   . ARG A 1 264 ? 35.905 21.858  7.846  1.00 9.27  ? 264 ARG A N   1 
ATOM   2050 C CA  . ARG A 1 264 ? 35.865 22.414  9.191  1.00 9.61  ? 264 ARG A CA  1 
ATOM   2051 C C   . ARG A 1 264 ? 34.723 21.880  10.055 1.00 9.44  ? 264 ARG A C   1 
ATOM   2052 O O   . ARG A 1 264 ? 34.861 21.803  11.278 1.00 7.01  ? 264 ARG A O   1 
ATOM   2053 C CB  . ARG A 1 264 ? 35.842 23.945  9.132  1.00 10.59 ? 264 ARG A CB  1 
ATOM   2054 C CG  . ARG A 1 264 ? 37.234 24.541  8.892  1.00 10.47 ? 264 ARG A CG  1 
ATOM   2055 C CD  . ARG A 1 264 ? 37.224 26.044  8.598  1.00 11.86 ? 264 ARG A CD  1 
ATOM   2056 N NE  . ARG A 1 264 ? 36.733 26.345  7.253  1.00 14.92 ? 264 ARG A NE  1 
ATOM   2057 C CZ  . ARG A 1 264 ? 36.845 27.533  6.657  1.00 15.34 ? 264 ARG A CZ  1 
ATOM   2058 N NH1 . ARG A 1 264 ? 37.437 28.541  7.282  1.00 14.75 ? 264 ARG A NH1 1 
ATOM   2059 N NH2 . ARG A 1 264 ? 36.360 27.720  5.438  1.00 15.17 ? 264 ARG A NH2 1 
ATOM   2060 N N   . SER A 1 265 ? 33.604 21.514  9.430  1.00 8.39  ? 265 SER A N   1 
ATOM   2061 C CA  . SER A 1 265 ? 32.469 20.963  10.176 1.00 8.34  ? 265 SER A CA  1 
ATOM   2062 C C   . SER A 1 265 ? 32.858 19.651  10.849 1.00 7.65  ? 265 SER A C   1 
ATOM   2063 O O   . SER A 1 265 ? 32.421 19.367  11.964 1.00 7.27  ? 265 SER A O   1 
ATOM   2064 C CB  . SER A 1 265 ? 31.261 20.702  9.264  1.00 5.50  ? 265 SER A CB  1 
ATOM   2065 O OG  . SER A 1 265 ? 30.587 21.899  8.935  1.00 3.92  ? 265 SER A OG  1 
ATOM   2066 N N   . TYR A 1 266 ? 33.657 18.842  10.163 1.00 7.40  ? 266 TYR A N   1 
ATOM   2067 C CA  . TYR A 1 266 ? 34.095 17.572  10.742 1.00 9.21  ? 266 TYR A CA  1 
ATOM   2068 C C   . TYR A 1 266 ? 35.160 17.869  11.791 1.00 9.67  ? 266 TYR A C   1 
ATOM   2069 O O   . TYR A 1 266 ? 35.227 17.201  12.824 1.00 9.06  ? 266 TYR A O   1 
ATOM   2070 C CB  . TYR A 1 266 ? 34.656 16.636  9.659  1.00 9.30  ? 266 TYR A CB  1 
ATOM   2071 C CG  . TYR A 1 266 ? 33.575 15.975  8.807  1.00 8.90  ? 266 TYR A CG  1 
ATOM   2072 C CD1 . TYR A 1 266 ? 32.783 14.950  9.324  1.00 7.24  ? 266 TYR A CD1 1 
ATOM   2073 C CD2 . TYR A 1 266 ? 33.329 16.400  7.498  1.00 6.21  ? 266 TYR A CD2 1 
ATOM   2074 C CE1 . TYR A 1 266 ? 31.771 14.365  8.562  1.00 7.64  ? 266 TYR A CE1 1 
ATOM   2075 C CE2 . TYR A 1 266 ? 32.316 15.821  6.729  1.00 6.72  ? 266 TYR A CE2 1 
ATOM   2076 C CZ  . TYR A 1 266 ? 31.544 14.810  7.269  1.00 6.11  ? 266 TYR A CZ  1 
ATOM   2077 O OH  . TYR A 1 266 ? 30.535 14.246  6.526  1.00 7.08  ? 266 TYR A OH  1 
ATOM   2078 N N   . ALA A 1 267 ? 35.982 18.885  11.526 1.00 8.58  ? 267 ALA A N   1 
ATOM   2079 C CA  . ALA A 1 267 ? 37.022 19.289  12.461 1.00 9.33  ? 267 ALA A CA  1 
ATOM   2080 C C   . ALA A 1 267 ? 36.357 19.729  13.762 1.00 9.68  ? 267 ALA A C   1 
ATOM   2081 O O   . ALA A 1 267 ? 36.801 19.366  14.850 1.00 10.59 ? 267 ALA A O   1 
ATOM   2082 C CB  . ALA A 1 267 ? 37.836 20.431  11.875 1.00 7.39  ? 267 ALA A CB  1 
ATOM   2083 N N   . LEU A 1 268 ? 35.279 20.499  13.637 1.00 8.04  ? 268 LEU A N   1 
ATOM   2084 C CA  . LEU A 1 268 ? 34.556 20.995  14.789 1.00 6.98  ? 268 LEU A CA  1 
ATOM   2085 C C   . LEU A 1 268 ? 34.067 19.857  15.677 1.00 9.92  ? 268 LEU A C   1 
ATOM   2086 O O   . LEU A 1 268 ? 34.155 19.936  16.904 1.00 10.50 ? 268 LEU A O   1 
ATOM   2087 C CB  . LEU A 1 268 ? 33.370 21.834  14.331 1.00 4.37  ? 268 LEU A CB  1 
ATOM   2088 C CG  . LEU A 1 268 ? 32.431 22.255  15.461 1.00 2.76  ? 268 LEU A CG  1 
ATOM   2089 C CD1 . LEU A 1 268 ? 33.016 23.419  16.254 1.00 3.19  ? 268 LEU A CD1 1 
ATOM   2090 C CD2 . LEU A 1 268 ? 31.110 22.635  14.862 1.00 5.09  ? 268 LEU A CD2 1 
ATOM   2091 N N   . LEU A 1 269 ? 33.547 18.800  15.057 1.00 9.87  ? 269 LEU A N   1 
ATOM   2092 C CA  . LEU A 1 269 ? 33.038 17.649  15.799 1.00 10.64 ? 269 LEU A CA  1 
ATOM   2093 C C   . LEU A 1 269 ? 34.145 16.957  16.589 1.00 11.17 ? 269 LEU A C   1 
ATOM   2094 O O   . LEU A 1 269 ? 33.984 16.679  17.780 1.00 9.67  ? 269 LEU A O   1 
ATOM   2095 C CB  . LEU A 1 269 ? 32.381 16.657  14.833 1.00 13.44 ? 269 LEU A CB  1 
ATOM   2096 C CG  . LEU A 1 269 ? 31.126 17.194  14.139 1.00 13.30 ? 269 LEU A CG  1 
ATOM   2097 C CD1 . LEU A 1 269 ? 30.651 16.225  13.081 1.00 13.25 ? 269 LEU A CD1 1 
ATOM   2098 C CD2 . LEU A 1 269 ? 30.044 17.435  15.181 1.00 15.38 ? 269 LEU A CD2 1 
ATOM   2099 N N   . HIS A 1 270 ? 35.266 16.675  15.929 1.00 10.39 ? 270 HIS A N   1 
ATOM   2100 C CA  . HIS A 1 270 ? 36.385 16.029  16.597 1.00 13.25 ? 270 HIS A CA  1 
ATOM   2101 C C   . HIS A 1 270 ? 36.912 16.866  17.768 1.00 16.08 ? 270 HIS A C   1 
ATOM   2102 O O   . HIS A 1 270 ? 37.210 16.332  18.841 1.00 16.19 ? 270 HIS A O   1 
ATOM   2103 C CB  . HIS A 1 270 ? 37.526 15.754  15.612 1.00 13.23 ? 270 HIS A CB  1 
ATOM   2104 C CG  . HIS A 1 270 ? 37.266 14.608  14.684 1.00 14.48 ? 270 HIS A CG  1 
ATOM   2105 N ND1 . HIS A 1 270 ? 36.766 14.778  13.409 1.00 15.01 ? 270 HIS A ND1 1 
ATOM   2106 C CD2 . HIS A 1 270 ? 37.450 13.275  14.840 1.00 15.37 ? 270 HIS A CD2 1 
ATOM   2107 C CE1 . HIS A 1 270 ? 36.660 13.600  12.820 1.00 15.82 ? 270 HIS A CE1 1 
ATOM   2108 N NE2 . HIS A 1 270 ? 37.068 12.671  13.667 1.00 13.72 ? 270 HIS A NE2 1 
ATOM   2109 N N   . ILE A 1 271 ? 37.020 18.176  17.573 1.00 16.47 ? 271 ILE A N   1 
ATOM   2110 C CA  . ILE A 1 271 ? 37.508 19.039  18.641 1.00 16.95 ? 271 ILE A CA  1 
ATOM   2111 C C   . ILE A 1 271 ? 36.520 19.019  19.798 1.00 17.32 ? 271 ILE A C   1 
ATOM   2112 O O   . ILE A 1 271 ? 36.908 19.008  20.967 1.00 16.24 ? 271 ILE A O   1 
ATOM   2113 C CB  . ILE A 1 271 ? 37.712 20.479  18.132 1.00 16.27 ? 271 ILE A CB  1 
ATOM   2114 C CG1 . ILE A 1 271 ? 38.816 20.482  17.074 1.00 16.60 ? 271 ILE A CG1 1 
ATOM   2115 C CG2 . ILE A 1 271 ? 38.086 21.396  19.284 1.00 14.67 ? 271 ILE A CG2 1 
ATOM   2116 C CD1 . ILE A 1 271 ? 39.029 21.806  16.410 1.00 19.83 ? 271 ILE A CD1 1 
ATOM   2117 N N   . TRP A 1 272 ? 35.238 18.995  19.460 1.00 18.24 ? 272 TRP A N   1 
ATOM   2118 C CA  . TRP A 1 272 ? 34.188 18.962  20.462 1.00 19.40 ? 272 TRP A CA  1 
ATOM   2119 C C   . TRP A 1 272 ? 34.265 17.700  21.317 1.00 21.05 ? 272 TRP A C   1 
ATOM   2120 O O   . TRP A 1 272 ? 33.964 17.732  22.514 1.00 19.56 ? 272 TRP A O   1 
ATOM   2121 C CB  . TRP A 1 272 ? 32.821 19.034  19.789 1.00 19.38 ? 272 TRP A CB  1 
ATOM   2122 C CG  . TRP A 1 272 ? 32.196 20.382  19.853 1.00 20.31 ? 272 TRP A CG  1 
ATOM   2123 C CD1 . TRP A 1 272 ? 32.713 21.499  20.446 1.00 22.15 ? 272 TRP A CD1 1 
ATOM   2124 C CD2 . TRP A 1 272 ? 30.909 20.754  19.353 1.00 21.31 ? 272 TRP A CD2 1 
ATOM   2125 N NE1 . TRP A 1 272 ? 31.827 22.541  20.353 1.00 21.50 ? 272 TRP A NE1 1 
ATOM   2126 C CE2 . TRP A 1 272 ? 30.709 22.113  19.685 1.00 22.51 ? 272 TRP A CE2 1 
ATOM   2127 C CE3 . TRP A 1 272 ? 29.902 20.072  18.658 1.00 22.35 ? 272 TRP A CE3 1 
ATOM   2128 C CZ2 . TRP A 1 272 ? 29.538 22.805  19.346 1.00 23.17 ? 272 TRP A CZ2 1 
ATOM   2129 C CZ3 . TRP A 1 272 ? 28.736 20.760  18.320 1.00 21.91 ? 272 TRP A CZ3 1 
ATOM   2130 C CH2 . TRP A 1 272 ? 28.566 22.112  18.666 1.00 23.35 ? 272 TRP A CH2 1 
ATOM   2131 N N   . TYR A 1 273 ? 34.740 16.584  20.685 1.00 22.54 ? 273 TYR A N   1 
ATOM   2132 C CA  . TYR A 1 273 ? 34.810 15.300  21.318 1.00 22.86 ? 273 TYR A CA  1 
ATOM   2133 C C   . TYR A 1 273 ? 36.160 14.804  21.710 1.00 22.33 ? 273 TYR A C   1 
ATOM   2134 O O   . TYR A 1 273 ? 36.408 13.656  22.152 1.00 22.35 ? 273 TYR A O   1 
ATOM   2135 C CB  . TYR A 1 273 ? 33.864 14.315  20.695 1.00 23.41 ? 273 TYR A CB  1 
ATOM   2136 C CG  . TYR A 1 273 ? 32.390 14.579  20.934 1.00 26.30 ? 273 TYR A CG  1 
ATOM   2137 C CD1 . TYR A 1 273 ? 31.618 15.440  20.201 1.00 26.38 ? 273 TYR A CD1 1 
ATOM   2138 C CD2 . TYR A 1 273 ? 31.763 13.899  21.990 1.00 26.09 ? 273 TYR A CD2 1 
ATOM   2139 C CE1 . TYR A 1 273 ? 30.286 15.667  20.526 1.00 26.43 ? 273 TYR A CE1 1 
ATOM   2140 C CE2 . TYR A 1 273 ? 30.440 14.091  22.303 1.00 26.01 ? 273 TYR A CE2 1 
ATOM   2141 C CZ  . TYR A 1 273 ? 29.695 14.991  21.566 1.00 25.94 ? 273 TYR A CZ  1 
ATOM   2142 O OH  . TYR A 1 273 ? 28.370 15.180  21.877 1.00 25.59 ? 273 TYR A OH  1 
ATOM   2143 N N   . THR A 1 274 ? 37.195 15.684  21.650 1.00 22.04 ? 274 THR A N   1 
ATOM   2144 C CA  . THR A 1 274 ? 38.528 15.331  22.203 1.00 21.78 ? 274 THR A CA  1 
ATOM   2145 C C   . THR A 1 274 ? 38.737 16.141  23.469 1.00 21.97 ? 274 THR A C   1 
ATOM   2146 O O   . THR A 1 274 ? 38.815 17.389  23.433 1.00 22.60 ? 274 THR A O   1 
ATOM   2147 C CB  . THR A 1 274 ? 39.644 15.520  21.190 1.00 21.01 ? 274 THR A CB  1 
ATOM   2148 O OG1 . THR A 1 274 ? 39.274 14.881  19.951 1.00 18.09 ? 274 THR A OG1 1 
ATOM   2149 C CG2 . THR A 1 274 ? 40.956 14.923  21.668 1.00 21.37 ? 274 THR A CG2 1 
ATOM   2150 N N   . GLU A 1 275 ? 38.673 15.483  24.591 1.00 22.58 ? 275 GLU A N   1 
ATOM   2151 C CA  . GLU A 1 275 ? 38.690 16.104  25.884 1.00 23.77 ? 275 GLU A CA  1 
ATOM   2152 C C   . GLU A 1 275 ? 39.879 16.977  26.184 1.00 22.81 ? 275 GLU A C   1 
ATOM   2153 O O   . GLU A 1 275 ? 39.736 18.070  26.748 1.00 20.83 ? 275 GLU A O   1 
ATOM   2154 C CB  . GLU A 1 275 ? 38.447 15.084  27.005 1.00 27.70 ? 275 GLU A CB  1 
ATOM   2155 C CG  . GLU A 1 275 ? 37.847 15.710  28.265 1.00 31.80 ? 275 GLU A CG  1 
ATOM   2156 C CD  . GLU A 1 275 ? 36.460 16.278  27.967 1.00 35.07 ? 275 GLU A CD  1 
ATOM   2157 O OE1 . GLU A 1 275 ? 35.849 15.893  26.938 1.00 36.82 ? 275 GLU A OE1 1 
ATOM   2158 O OE2 . GLU A 1 275 ? 35.934 17.060  28.774 1.00 34.93 ? 275 GLU A OE2 1 
ATOM   2159 N N   . GLY A 1 276 ? 41.043 16.430  25.919 1.00 21.57 ? 276 GLY A N   1 
ATOM   2160 C CA  . GLY A 1 276 ? 42.300 17.077  26.302 1.00 22.38 ? 276 GLY A CA  1 
ATOM   2161 C C   . GLY A 1 276 ? 42.917 17.764  25.103 1.00 22.16 ? 276 GLY A C   1 
ATOM   2162 O O   . GLY A 1 276 ? 44.037 18.279  25.185 1.00 21.09 ? 276 GLY A O   1 
ATOM   2163 N N   . TRP A 1 277 ? 42.118 17.917  24.046 1.00 22.33 ? 277 TRP A N   1 
ATOM   2164 C CA  . TRP A 1 277 ? 42.501 18.710  22.912 1.00 21.34 ? 277 TRP A CA  1 
ATOM   2165 C C   . TRP A 1 277 ? 42.928 20.148  23.281 1.00 20.14 ? 277 TRP A C   1 
ATOM   2166 O O   . TRP A 1 277 ? 42.503 20.762  24.230 1.00 21.16 ? 277 TRP A O   1 
ATOM   2167 C CB  . TRP A 1 277 ? 41.368 18.872  21.872 1.00 19.07 ? 277 TRP A CB  1 
ATOM   2168 C CG  . TRP A 1 277 ? 41.957 19.293  20.542 1.00 17.35 ? 277 TRP A CG  1 
ATOM   2169 C CD1 . TRP A 1 277 ? 42.416 18.371  19.621 1.00 16.85 ? 277 TRP A CD1 1 
ATOM   2170 C CD2 . TRP A 1 277 ? 42.241 20.574  20.025 1.00 16.21 ? 277 TRP A CD2 1 
ATOM   2171 N NE1 . TRP A 1 277 ? 42.949 19.020  18.549 1.00 18.00 ? 277 TRP A NE1 1 
ATOM   2172 C CE2 . TRP A 1 277 ? 42.850 20.372  18.757 1.00 16.97 ? 277 TRP A CE2 1 
ATOM   2173 C CE3 . TRP A 1 277 ? 42.030 21.891  20.441 1.00 15.71 ? 277 TRP A CE3 1 
ATOM   2174 C CZ2 . TRP A 1 277 ? 43.242 21.415  17.929 1.00 15.61 ? 277 TRP A CZ2 1 
ATOM   2175 C CZ3 . TRP A 1 277 ? 42.415 22.926  19.615 1.00 14.91 ? 277 TRP A CZ3 1 
ATOM   2176 C CH2 . TRP A 1 277 ? 43.015 22.687  18.369 1.00 15.25 ? 277 TRP A CH2 1 
ATOM   2177 N N   . GLN A 1 278 ? 43.975 20.518  22.535 1.00 22.01 ? 278 GLN A N   1 
ATOM   2178 C CA  . GLN A 1 278 ? 44.729 21.744  22.680 1.00 22.93 ? 278 GLN A CA  1 
ATOM   2179 C C   . GLN A 1 278 ? 45.449 22.105  21.394 1.00 22.96 ? 278 GLN A C   1 
ATOM   2180 O O   . GLN A 1 278 ? 45.871 21.241  20.636 1.00 21.46 ? 278 GLN A O   1 
ATOM   2181 C CB  . GLN A 1 278 ? 45.741 21.657  23.838 1.00 22.76 ? 278 GLN A CB  1 
ATOM   2182 C CG  . GLN A 1 278 ? 46.854 20.664  23.682 1.00 24.18 ? 278 GLN A CG  1 
ATOM   2183 C CD  . GLN A 1 278 ? 47.727 20.425  24.880 1.00 26.51 ? 278 GLN A CD  1 
ATOM   2184 O OE1 . GLN A 1 278 ? 48.201 21.281  25.604 1.00 26.34 ? 278 GLN A OE1 1 
ATOM   2185 N NE2 . GLN A 1 278 ? 47.912 19.118  25.167 1.00 25.14 ? 278 GLN A NE2 1 
ATOM   2186 N N   . PRO A 1 279 ? 45.586 23.401  21.104 1.00 24.46 ? 279 PRO A N   1 
ATOM   2187 C CA  . PRO A 1 279 ? 46.245 23.848  19.877 1.00 25.84 ? 279 PRO A CA  1 
ATOM   2188 C C   . PRO A 1 279 ? 47.758 23.664  19.846 1.00 28.05 ? 279 PRO A C   1 
ATOM   2189 O O   . PRO A 1 279 ? 48.403 23.424  20.874 1.00 28.03 ? 279 PRO A O   1 
ATOM   2190 C CB  . PRO A 1 279 ? 45.840 25.315  19.789 1.00 25.47 ? 279 PRO A CB  1 
ATOM   2191 C CG  . PRO A 1 279 ? 45.691 25.707  21.219 1.00 25.68 ? 279 PRO A CG  1 
ATOM   2192 C CD  . PRO A 1 279 ? 44.951 24.535  21.797 1.00 24.46 ? 279 PRO A CD  1 
ATOM   2193 N N   . ASP A 1 280 ? 48.301 23.783  18.641 1.00 31.15 ? 280 ASP A N   1 
ATOM   2194 C CA  . ASP A 1 280 ? 49.730 23.665  18.382 1.00 34.76 ? 280 ASP A CA  1 
ATOM   2195 C C   . ASP A 1 280 ? 50.453 24.951  18.753 1.00 35.84 ? 280 ASP A C   1 
ATOM   2196 O O   . ASP A 1 280 ? 49.982 25.740  19.572 1.00 36.37 ? 280 ASP A O   1 
ATOM   2197 C CB  . ASP A 1 280 ? 49.971 23.380  16.899 1.00 36.02 ? 280 ASP A CB  1 
ATOM   2198 C CG  . ASP A 1 280 ? 49.845 21.914  16.555 1.00 38.45 ? 280 ASP A CG  1 
ATOM   2199 O OD1 . ASP A 1 280 ? 48.937 21.239  17.088 1.00 40.98 ? 280 ASP A OD1 1 
ATOM   2200 O OD2 . ASP A 1 280 ? 50.655 21.436  15.738 1.00 39.94 ? 280 ASP A OD2 1 
ATOM   2201 N N   . GLU A 1 281 ? 51.608 25.148  18.132 1.00 38.81 ? 281 GLU A N   1 
ATOM   2202 C CA  . GLU A 1 281 ? 52.424 26.330  18.356 1.00 40.50 ? 281 GLU A CA  1 
ATOM   2203 C C   . GLU A 1 281 ? 53.164 26.647  17.065 1.00 41.90 ? 281 GLU A C   1 
ATOM   2204 O O   . GLU A 1 281 ? 53.608 25.739  16.358 1.00 42.23 ? 281 GLU A O   1 
ATOM   2205 C CB  . GLU A 1 281 ? 53.419 26.078  19.487 1.00 40.83 ? 281 GLU A CB  1 
ATOM   2206 C CG  . GLU A 1 281 ? 52.803 26.143  20.873 1.00 42.98 ? 281 GLU A CG  1 
ATOM   2207 C CD  . GLU A 1 281 ? 53.730 25.616  21.947 1.00 44.42 ? 281 GLU A CD  1 
ATOM   2208 O OE1 . GLU A 1 281 ? 53.911 24.378  22.020 1.00 44.00 ? 281 GLU A OE1 1 
ATOM   2209 O OE2 . GLU A 1 281 ? 54.282 26.443  22.710 1.00 44.23 ? 281 GLU A OE2 1 
ATOM   2210 N N   . ALA A 1 282 ? 53.283 27.938  16.761 1.00 42.84 ? 282 ALA A N   1 
ATOM   2211 C CA  . ALA A 1 282 ? 53.956 28.394  15.547 1.00 42.85 ? 282 ALA A CA  1 
ATOM   2212 C C   . ALA A 1 282 ? 54.038 29.920  15.544 1.00 43.30 ? 282 ALA A C   1 
ATOM   2213 O O   . ALA A 1 282 ? 53.705 30.515  16.593 1.00 43.40 ? 282 ALA A O   1 
ATOM   2214 C CB  . ALA A 1 282 ? 53.200 27.904  14.305 1.00 42.77 ? 282 ALA A CB  1 
ATOM   2215 O OXT . ALA A 1 282 ? 54.448 30.498  14.514 1.00 14.63 ? 282 ALA A OXT 1 
ATOM   2216 N N   . MET B 1 1   ? 38.847 36.181  5.823  1.00 21.33 ? 1   MET B N   1 
ATOM   2217 C CA  . MET B 1 1   ? 40.220 36.283  6.396  1.00 21.38 ? 1   MET B CA  1 
ATOM   2218 C C   . MET B 1 1   ? 41.219 36.504  5.265  1.00 20.49 ? 1   MET B C   1 
ATOM   2219 O O   . MET B 1 1   ? 41.612 35.569  4.562  1.00 22.56 ? 1   MET B O   1 
ATOM   2220 C CB  . MET B 1 1   ? 40.575 35.005  7.163  1.00 22.15 ? 1   MET B CB  1 
ATOM   2221 C CG  . MET B 1 1   ? 41.843 35.101  8.025  1.00 23.95 ? 1   MET B CG  1 
ATOM   2222 S SD  . MET B 1 1   ? 41.631 35.977  9.619  1.00 22.80 ? 1   MET B SD  1 
ATOM   2223 C CE  . MET B 1 1   ? 40.341 34.988  10.407 1.00 22.12 ? 1   MET B CE  1 
ATOM   2224 N N   . TYR B 1 2   ? 41.616 37.758  5.103  1.00 17.08 ? 2   TYR B N   1 
ATOM   2225 C CA  . TYR B 1 2   ? 42.555 38.162  4.076  1.00 14.69 ? 2   TYR B CA  1 
ATOM   2226 C C   . TYR B 1 2   ? 43.987 37.992  4.560  1.00 14.19 ? 2   TYR B C   1 
ATOM   2227 O O   . TYR B 1 2   ? 44.234 37.867  5.762  1.00 12.29 ? 2   TYR B O   1 
ATOM   2228 C CB  . TYR B 1 2   ? 42.289 39.625  3.698  1.00 12.96 ? 2   TYR B CB  1 
ATOM   2229 C CG  . TYR B 1 2   ? 40.860 39.874  3.249  1.00 8.55  ? 2   TYR B CG  1 
ATOM   2230 C CD1 . TYR B 1 2   ? 39.829 40.039  4.179  1.00 7.28  ? 2   TYR B CD1 1 
ATOM   2231 C CD2 . TYR B 1 2   ? 40.533 39.886  1.893  1.00 4.07  ? 2   TYR B CD2 1 
ATOM   2232 C CE1 . TYR B 1 2   ? 38.500 40.200  3.760  1.00 6.61  ? 2   TYR B CE1 1 
ATOM   2233 C CE2 . TYR B 1 2   ? 39.217 40.049  1.466  1.00 3.48  ? 2   TYR B CE2 1 
ATOM   2234 C CZ  . TYR B 1 2   ? 38.208 40.200  2.397  1.00 6.05  ? 2   TYR B CZ  1 
ATOM   2235 O OH  . TYR B 1 2   ? 36.912 40.338  1.963  1.00 6.03  ? 2   TYR B OH  1 
ATOM   2236 N N   . THR B 1 3   ? 44.931 37.987  3.623  1.00 13.75 ? 3   THR B N   1 
ATOM   2237 C CA  . THR B 1 3   ? 46.337 37.834  3.981  1.00 15.32 ? 3   THR B CA  1 
ATOM   2238 C C   . THR B 1 3   ? 47.236 38.831  3.247  1.00 14.08 ? 3   THR B C   1 
ATOM   2239 O O   . THR B 1 3   ? 47.080 39.055  2.046  1.00 15.18 ? 3   THR B O   1 
ATOM   2240 C CB  . THR B 1 3   ? 46.853 36.413  3.665  1.00 15.64 ? 3   THR B CB  1 
ATOM   2241 O OG1 . THR B 1 3   ? 45.827 35.454  3.929  1.00 19.24 ? 3   THR B OG1 1 
ATOM   2242 C CG2 . THR B 1 3   ? 48.046 36.085  4.543  1.00 18.92 ? 3   THR B CG2 1 
ATOM   2243 N N   . LEU B 1 4   ? 48.176 39.427  3.974  1.00 12.97 ? 4   LEU B N   1 
ATOM   2244 C CA  . LEU B 1 4   ? 49.122 40.376  3.386  1.00 13.22 ? 4   LEU B CA  1 
ATOM   2245 C C   . LEU B 1 4   ? 50.521 39.896  3.767  1.00 14.19 ? 4   LEU B C   1 
ATOM   2246 O O   . LEU B 1 4   ? 50.705 39.258  4.807  1.00 14.99 ? 4   LEU B O   1 
ATOM   2247 C CB  . LEU B 1 4   ? 48.875 41.794  3.918  1.00 10.90 ? 4   LEU B CB  1 
ATOM   2248 C CG  . LEU B 1 4   ? 47.511 42.431  3.611  1.00 9.64  ? 4   LEU B CG  1 
ATOM   2249 C CD1 . LEU B 1 4   ? 47.344 43.720  4.400  1.00 8.58  ? 4   LEU B CD1 1 
ATOM   2250 C CD2 . LEU B 1 4   ? 47.388 42.690  2.119  1.00 9.62  ? 4   LEU B CD2 1 
ATOM   2251 N N   . ASN B 1 5   ? 51.508 40.199  2.930  1.00 14.03 ? 5   ASN B N   1 
ATOM   2252 C CA  . ASN B 1 5   ? 52.868 39.749  3.182  1.00 12.30 ? 5   ASN B CA  1 
ATOM   2253 C C   . ASN B 1 5   ? 53.837 40.851  3.591  1.00 12.91 ? 5   ASN B C   1 
ATOM   2254 O O   . ASN B 1 5   ? 53.642 42.021  3.265  1.00 13.26 ? 5   ASN B O   1 
ATOM   2255 C CB  . ASN B 1 5   ? 53.392 39.038  1.932  1.00 10.91 ? 5   ASN B CB  1 
ATOM   2256 C CG  . ASN B 1 5   ? 54.796 38.492  2.106  1.00 10.98 ? 5   ASN B CG  1 
ATOM   2257 O OD1 . ASN B 1 5   ? 55.777 39.235  2.137  1.00 12.38 ? 5   ASN B OD1 1 
ATOM   2258 N ND2 . ASN B 1 5   ? 54.897 37.180  2.213  1.00 14.76 ? 5   ASN B ND2 1 
ATOM   2259 N N   . TRP B 1 6   ? 54.871 40.464  4.336  1.00 12.38 ? 6   TRP B N   1 
ATOM   2260 C CA  . TRP B 1 6   ? 55.908 41.395  4.760  1.00 10.56 ? 6   TRP B CA  1 
ATOM   2261 C C   . TRP B 1 6   ? 57.237 40.663  4.635  1.00 10.59 ? 6   TRP B C   1 
ATOM   2262 O O   . TRP B 1 6   ? 57.266 39.437  4.597  1.00 10.10 ? 6   TRP B O   1 
ATOM   2263 C CB  . TRP B 1 6   ? 55.667 41.885  6.200  1.00 8.87  ? 6   TRP B CB  1 
ATOM   2264 C CG  . TRP B 1 6   ? 56.100 40.961  7.297  1.00 8.85  ? 6   TRP B CG  1 
ATOM   2265 C CD1 . TRP B 1 6   ? 57.389 40.659  7.666  1.00 8.39  ? 6   TRP B CD1 1 
ATOM   2266 C CD2 . TRP B 1 6   ? 55.255 40.252  8.197  1.00 7.81  ? 6   TRP B CD2 1 
ATOM   2267 N NE1 . TRP B 1 6   ? 57.392 39.814  8.738  1.00 8.30  ? 6   TRP B NE1 1 
ATOM   2268 C CE2 . TRP B 1 6   ? 56.094 39.544  9.088  1.00 10.34 ? 6   TRP B CE2 1 
ATOM   2269 C CE3 . TRP B 1 6   ? 53.869 40.143  8.343  1.00 9.55  ? 6   TRP B CE3 1 
ATOM   2270 C CZ2 . TRP B 1 6   ? 55.590 38.739  10.111 1.00 9.03  ? 6   TRP B CZ2 1 
ATOM   2271 C CZ3 . TRP B 1 6   ? 53.366 39.341  9.362  1.00 11.04 ? 6   TRP B CZ3 1 
ATOM   2272 C CH2 . TRP B 1 6   ? 54.228 38.650  10.232 1.00 11.70 ? 6   TRP B CH2 1 
ATOM   2273 N N   . GLN B 1 7   ? 58.326 41.418  4.549  1.00 11.24 ? 7   GLN B N   1 
ATOM   2274 C CA  . GLN B 1 7   ? 59.655 40.839  4.411  1.00 13.20 ? 7   GLN B CA  1 
ATOM   2275 C C   . GLN B 1 7   ? 60.452 41.006  5.702  1.00 13.17 ? 7   GLN B C   1 
ATOM   2276 O O   . GLN B 1 7   ? 60.640 42.121  6.189  1.00 9.64  ? 7   GLN B O   1 
ATOM   2277 C CB  . GLN B 1 7   ? 60.391 41.501  3.242  1.00 14.49 ? 7   GLN B CB  1 
ATOM   2278 C CG  . GLN B 1 7   ? 60.319 43.016  3.279  1.00 21.95 ? 7   GLN B CG  1 
ATOM   2279 C CD  . GLN B 1 7   ? 60.785 43.668  1.988  1.00 27.10 ? 7   GLN B CD  1 
ATOM   2280 O OE1 . GLN B 1 7   ? 61.934 43.491  1.572  1.00 31.62 ? 7   GLN B OE1 1 
ATOM   2281 N NE2 . GLN B 1 7   ? 59.893 44.429  1.343  1.00 27.55 ? 7   GLN B NE2 1 
ATOM   2282 N N   . PRO B 1 8   ? 60.904 39.881  6.283  1.00 13.85 ? 8   PRO B N   1 
ATOM   2283 C CA  . PRO B 1 8   ? 61.686 39.811  7.520  1.00 13.27 ? 8   PRO B CA  1 
ATOM   2284 C C   . PRO B 1 8   ? 62.986 40.597  7.428  1.00 12.19 ? 8   PRO B C   1 
ATOM   2285 O O   . PRO B 1 8   ? 63.564 40.725  6.348  1.00 12.78 ? 8   PRO B O   1 
ATOM   2286 C CB  . PRO B 1 8   ? 61.931 38.315  7.682  1.00 14.17 ? 8   PRO B CB  1 
ATOM   2287 C CG  . PRO B 1 8   ? 60.685 37.727  7.114  1.00 15.46 ? 8   PRO B CG  1 
ATOM   2288 C CD  . PRO B 1 8   ? 60.509 38.531  5.848  1.00 13.52 ? 8   PRO B CD  1 
ATOM   2289 N N   . PRO B 1 9   ? 63.472 41.113  8.567  1.00 12.44 ? 9   PRO B N   1 
ATOM   2290 C CA  . PRO B 1 9   ? 62.824 40.957  9.869  1.00 11.43 ? 9   PRO B CA  1 
ATOM   2291 C C   . PRO B 1 9   ? 61.768 42.007  10.143 1.00 10.84 ? 9   PRO B C   1 
ATOM   2292 O O   . PRO B 1 9   ? 61.771 43.089  9.548  1.00 10.55 ? 9   PRO B O   1 
ATOM   2293 C CB  . PRO B 1 9   ? 63.987 41.089  10.836 1.00 11.01 ? 9   PRO B CB  1 
ATOM   2294 C CG  . PRO B 1 9   ? 64.776 42.181  10.184 1.00 11.08 ? 9   PRO B CG  1 
ATOM   2295 C CD  . PRO B 1 9   ? 64.799 41.739  8.728  1.00 10.92 ? 9   PRO B CD  1 
ATOM   2296 N N   . TYR B 1 10  ? 60.872 41.671  11.059 1.00 9.77  ? 10  TYR B N   1 
ATOM   2297 C CA  . TYR B 1 10  ? 59.815 42.566  11.483 1.00 8.43  ? 10  TYR B CA  1 
ATOM   2298 C C   . TYR B 1 10  ? 59.643 42.334  12.979 1.00 9.06  ? 10  TYR B C   1 
ATOM   2299 O O   . TYR B 1 10  ? 59.314 41.231  13.416 1.00 8.67  ? 10  TYR B O   1 
ATOM   2300 C CB  . TYR B 1 10  ? 58.519 42.249  10.753 1.00 6.76  ? 10  TYR B CB  1 
ATOM   2301 C CG  . TYR B 1 10  ? 57.451 43.309  10.918 1.00 3.95  ? 10  TYR B CG  1 
ATOM   2302 C CD1 . TYR B 1 10  ? 56.963 43.655  12.181 1.00 1.13  ? 10  TYR B CD1 1 
ATOM   2303 C CD2 . TYR B 1 10  ? 56.902 43.939  9.797  1.00 2.33  ? 10  TYR B CD2 1 
ATOM   2304 C CE1 . TYR B 1 10  ? 55.948 44.605  12.326 1.00 1.89  ? 10  TYR B CE1 1 
ATOM   2305 C CE2 . TYR B 1 10  ? 55.888 44.887  9.924  1.00 2.05  ? 10  TYR B CE2 1 
ATOM   2306 C CZ  . TYR B 1 10  ? 55.415 45.213  11.188 1.00 2.89  ? 10  TYR B CZ  1 
ATOM   2307 O OH  . TYR B 1 10  ? 54.394 46.123  11.308 1.00 2.83  ? 10  TYR B OH  1 
ATOM   2308 N N   . ASP B 1 11  ? 59.878 43.378  13.762 1.00 9.18  ? 11  ASP B N   1 
ATOM   2309 C CA  . ASP B 1 11  ? 59.766 43.289  15.208 1.00 8.51  ? 11  ASP B CA  1 
ATOM   2310 C C   . ASP B 1 11  ? 58.321 43.623  15.612 1.00 8.69  ? 11  ASP B C   1 
ATOM   2311 O O   . ASP B 1 11  ? 57.968 44.792  15.777 1.00 6.46  ? 11  ASP B O   1 
ATOM   2312 C CB  . ASP B 1 11  ? 60.763 44.270  15.845 1.00 8.83  ? 11  ASP B CB  1 
ATOM   2313 C CG  . ASP B 1 11  ? 61.007 43.994  17.318 1.00 9.57  ? 11  ASP B CG  1 
ATOM   2314 O OD1 . ASP B 1 11  ? 60.061 43.545  17.996 1.00 9.76  ? 11  ASP B OD1 1 
ATOM   2315 O OD2 . ASP B 1 11  ? 62.135 44.248  17.801 1.00 9.35  ? 11  ASP B OD2 1 
ATOM   2316 N N   . TRP B 1 12  ? 57.495 42.583  15.751 1.00 8.40  ? 12  TRP B N   1 
ATOM   2317 C CA  . TRP B 1 12  ? 56.088 42.734  16.130 1.00 8.54  ? 12  TRP B CA  1 
ATOM   2318 C C   . TRP B 1 12  ? 55.904 43.054  17.607 1.00 9.32  ? 12  TRP B C   1 
ATOM   2319 O O   . TRP B 1 12  ? 54.988 43.787  17.990 1.00 9.90  ? 12  TRP B O   1 
ATOM   2320 C CB  . TRP B 1 12  ? 55.282 41.473  15.760 1.00 7.27  ? 12  TRP B CB  1 
ATOM   2321 C CG  . TRP B 1 12  ? 54.883 41.435  14.305 1.00 8.81  ? 12  TRP B CG  1 
ATOM   2322 C CD1 . TRP B 1 12  ? 55.535 40.798  13.288 1.00 10.28 ? 12  TRP B CD1 1 
ATOM   2323 C CD2 . TRP B 1 12  ? 53.796 42.147  13.698 1.00 7.79  ? 12  TRP B CD2 1 
ATOM   2324 N NE1 . TRP B 1 12  ? 54.927 41.074  12.081 1.00 10.81 ? 12  TRP B NE1 1 
ATOM   2325 C CE2 . TRP B 1 12  ? 53.856 41.900  12.306 1.00 9.55  ? 12  TRP B CE2 1 
ATOM   2326 C CE3 . TRP B 1 12  ? 52.781 42.976  14.194 1.00 7.95  ? 12  TRP B CE3 1 
ATOM   2327 C CZ2 . TRP B 1 12  ? 52.933 42.452  11.402 1.00 8.59  ? 12  TRP B CZ2 1 
ATOM   2328 C CZ3 . TRP B 1 12  ? 51.860 43.528  13.292 1.00 7.28  ? 12  TRP B CZ3 1 
ATOM   2329 C CH2 . TRP B 1 12  ? 51.947 43.260  11.914 1.00 7.49  ? 12  TRP B CH2 1 
ATOM   2330 N N   . SER B 1 13  ? 56.777 42.498  18.440 1.00 9.48  ? 13  SER B N   1 
ATOM   2331 C CA  . SER B 1 13  ? 56.718 42.757  19.867 1.00 7.67  ? 13  SER B CA  1 
ATOM   2332 C C   . SER B 1 13  ? 56.818 44.274  20.080 1.00 5.70  ? 13  SER B C   1 
ATOM   2333 O O   . SER B 1 13  ? 56.022 44.862  20.805 1.00 5.36  ? 13  SER B O   1 
ATOM   2334 C CB  . SER B 1 13  ? 57.871 42.032  20.574 1.00 7.52  ? 13  SER B CB  1 
ATOM   2335 O OG  . SER B 1 13  ? 57.911 42.346  21.952 1.00 13.01 ? 13  SER B OG  1 
ATOM   2336 N N   . TRP B 1 14  ? 57.786 44.903  19.421 1.00 4.17  ? 14  TRP B N   1 
ATOM   2337 C CA  . TRP B 1 14  ? 57.988 46.345  19.546 1.00 5.21  ? 14  TRP B CA  1 
ATOM   2338 C C   . TRP B 1 14  ? 56.833 47.148  18.956 1.00 4.19  ? 14  TRP B C   1 
ATOM   2339 O O   . TRP B 1 14  ? 56.415 48.159  19.528 1.00 1.13  ? 14  TRP B O   1 
ATOM   2340 C CB  . TRP B 1 14  ? 59.293 46.764  18.859 1.00 7.50  ? 14  TRP B CB  1 
ATOM   2341 C CG  . TRP B 1 14  ? 59.492 48.247  18.831 1.00 8.85  ? 14  TRP B CG  1 
ATOM   2342 C CD1 . TRP B 1 14  ? 60.098 49.019  19.790 1.00 11.28 ? 14  TRP B CD1 1 
ATOM   2343 C CD2 . TRP B 1 14  ? 59.051 49.150  17.811 1.00 8.95  ? 14  TRP B CD2 1 
ATOM   2344 N NE1 . TRP B 1 14  ? 60.059 50.347  19.427 1.00 10.61 ? 14  TRP B NE1 1 
ATOM   2345 C CE2 . TRP B 1 14  ? 59.424 50.456  18.217 1.00 10.07 ? 14  TRP B CE2 1 
ATOM   2346 C CE3 . TRP B 1 14  ? 58.375 48.986  16.594 1.00 7.56  ? 14  TRP B CE3 1 
ATOM   2347 C CZ2 . TRP B 1 14  ? 59.146 51.588  17.444 1.00 10.67 ? 14  TRP B CZ2 1 
ATOM   2348 C CZ3 . TRP B 1 14  ? 58.101 50.112  15.829 1.00 8.37  ? 14  TRP B CZ3 1 
ATOM   2349 C CH2 . TRP B 1 14  ? 58.486 51.396  16.255 1.00 9.16  ? 14  TRP B CH2 1 
ATOM   2350 N N   . MET B 1 15  ? 56.330 46.700  17.806 1.00 4.01  ? 15  MET B N   1 
ATOM   2351 C CA  . MET B 1 15  ? 55.228 47.379  17.136 1.00 5.67  ? 15  MET B CA  1 
ATOM   2352 C C   . MET B 1 15  ? 53.931 47.340  17.951 1.00 6.63  ? 15  MET B C   1 
ATOM   2353 O O   . MET B 1 15  ? 53.211 48.333  18.032 1.00 8.06  ? 15  MET B O   1 
ATOM   2354 C CB  . MET B 1 15  ? 54.990 46.763  15.754 1.00 5.25  ? 15  MET B CB  1 
ATOM   2355 C CG  . MET B 1 15  ? 53.730 47.291  15.058 1.00 3.87  ? 15  MET B CG  1 
ATOM   2356 S SD  . MET B 1 15  ? 53.836 49.071  14.748 1.00 5.89  ? 15  MET B SD  1 
ATOM   2357 C CE  . MET B 1 15  ? 54.991 49.052  13.374 1.00 2.51  ? 15  MET B CE  1 
ATOM   2358 N N   . LEU B 1 16  ? 53.625 46.195  18.549 1.00 7.40  ? 16  LEU B N   1 
ATOM   2359 C CA  . LEU B 1 16  ? 52.414 46.085  19.356 1.00 7.39  ? 16  LEU B CA  1 
ATOM   2360 C C   . LEU B 1 16  ? 52.586 46.844  20.668 1.00 8.20  ? 16  LEU B C   1 
ATOM   2361 O O   . LEU B 1 16  ? 51.618 47.349  21.240 1.00 8.44  ? 16  LEU B O   1 
ATOM   2362 C CB  . LEU B 1 16  ? 52.084 44.611  19.615 1.00 5.87  ? 16  LEU B CB  1 
ATOM   2363 C CG  . LEU B 1 16  ? 51.772 43.863  18.310 1.00 6.30  ? 16  LEU B CG  1 
ATOM   2364 C CD1 . LEU B 1 16  ? 51.685 42.354  18.534 1.00 5.58  ? 16  LEU B CD1 1 
ATOM   2365 C CD2 . LEU B 1 16  ? 50.467 44.403  17.739 1.00 5.37  ? 16  LEU B CD2 1 
ATOM   2366 N N   . GLY B 1 17  ? 53.825 46.924  21.144 1.00 9.10  ? 17  GLY B N   1 
ATOM   2367 C CA  . GLY B 1 17  ? 54.088 47.646  22.371 1.00 6.62  ? 17  GLY B CA  1 
ATOM   2368 C C   . GLY B 1 17  ? 53.937 49.132  22.114 1.00 5.39  ? 17  GLY B C   1 
ATOM   2369 O O   . GLY B 1 17  ? 53.498 49.883  22.983 1.00 6.79  ? 17  GLY B O   1 
ATOM   2370 N N   . PHE B 1 18  ? 54.306 49.555  20.911 1.00 5.58  ? 18  PHE B N   1 
ATOM   2371 C CA  . PHE B 1 18  ? 54.211 50.952  20.521 1.00 4.04  ? 18  PHE B CA  1 
ATOM   2372 C C   . PHE B 1 18  ? 52.747 51.355  20.456 1.00 4.54  ? 18  PHE B C   1 
ATOM   2373 O O   . PHE B 1 18  ? 52.355 52.399  20.971 1.00 4.72  ? 18  PHE B O   1 
ATOM   2374 C CB  . PHE B 1 18  ? 54.871 51.159  19.158 1.00 2.39  ? 18  PHE B CB  1 
ATOM   2375 C CG  . PHE B 1 18  ? 54.902 52.599  18.707 1.00 3.00  ? 18  PHE B CG  1 
ATOM   2376 C CD1 . PHE B 1 18  ? 53.792 53.177  18.089 1.00 2.97  ? 18  PHE B CD1 1 
ATOM   2377 C CD2 . PHE B 1 18  ? 56.037 53.379  18.913 1.00 1.13  ? 18  PHE B CD2 1 
ATOM   2378 C CE1 . PHE B 1 18  ? 53.812 54.510  17.684 1.00 2.04  ? 18  PHE B CE1 1 
ATOM   2379 C CE2 . PHE B 1 18  ? 56.072 54.713  18.515 1.00 3.02  ? 18  PHE B CE2 1 
ATOM   2380 C CZ  . PHE B 1 18  ? 54.959 55.285  17.899 1.00 1.15  ? 18  PHE B CZ  1 
ATOM   2381 N N   . LEU B 1 19  ? 51.937 50.510  19.828 1.00 4.53  ? 19  LEU B N   1 
ATOM   2382 C CA  . LEU B 1 19  ? 50.515 50.785  19.691 1.00 3.98  ? 19  LEU B CA  1 
ATOM   2383 C C   . LEU B 1 19  ? 49.767 50.652  21.012 1.00 3.74  ? 19  LEU B C   1 
ATOM   2384 O O   . LEU B 1 19  ? 48.844 51.414  21.286 1.00 4.05  ? 19  LEU B O   1 
ATOM   2385 C CB  . LEU B 1 19  ? 49.899 49.848  18.639 1.00 3.97  ? 19  LEU B CB  1 
ATOM   2386 C CG  . LEU B 1 19  ? 50.539 49.898  17.244 1.00 5.94  ? 19  LEU B CG  1 
ATOM   2387 C CD1 . LEU B 1 19  ? 49.957 48.806  16.358 1.00 7.03  ? 19  LEU B CD1 1 
ATOM   2388 C CD2 . LEU B 1 19  ? 50.309 51.272  16.628 1.00 5.45  ? 19  LEU B CD2 1 
ATOM   2389 N N   . ALA B 1 20  ? 50.158 49.686  21.833 1.00 2.75  ? 20  ALA B N   1 
ATOM   2390 C CA  . ALA B 1 20  ? 49.484 49.489  23.114 1.00 4.51  ? 20  ALA B CA  1 
ATOM   2391 C C   . ALA B 1 20  ? 49.592 50.731  24.000 1.00 4.97  ? 20  ALA B C   1 
ATOM   2392 O O   . ALA B 1 20  ? 48.596 51.177  24.570 1.00 5.72  ? 20  ALA B O   1 
ATOM   2393 C CB  . ALA B 1 20  ? 50.059 48.261  23.853 1.00 1.74  ? 20  ALA B CB  1 
ATOM   2394 N N   . ALA B 1 21  ? 50.790 51.297  24.119 1.00 4.56  ? 21  ALA B N   1 
ATOM   2395 C CA  . ALA B 1 21  ? 50.953 52.478  24.960 1.00 4.35  ? 21  ALA B CA  1 
ATOM   2396 C C   . ALA B 1 21  ? 50.083 53.632  24.473 1.00 4.90  ? 21  ALA B C   1 
ATOM   2397 O O   . ALA B 1 21  ? 49.561 54.405  25.271 1.00 3.62  ? 21  ALA B O   1 
ATOM   2398 C CB  . ALA B 1 21  ? 52.410 52.907  25.002 1.00 2.52  ? 21  ALA B CB  1 
ATOM   2399 N N   . ARG B 1 22  ? 49.923 53.739  23.158 1.00 5.45  ? 22  ARG B N   1 
ATOM   2400 C CA  . ARG B 1 22  ? 49.129 54.810  22.580 1.00 3.86  ? 22  ARG B CA  1 
ATOM   2401 C C   . ARG B 1 22  ? 47.678 54.433  22.291 1.00 3.34  ? 22  ARG B C   1 
ATOM   2402 O O   . ARG B 1 22  ? 46.903 55.259  21.814 1.00 2.56  ? 22  ARG B O   1 
ATOM   2403 C CB  . ARG B 1 22  ? 49.799 55.293  21.301 1.00 3.78  ? 22  ARG B CB  1 
ATOM   2404 C CG  . ARG B 1 22  ? 51.194 55.801  21.523 1.00 5.17  ? 22  ARG B CG  1 
ATOM   2405 C CD  . ARG B 1 22  ? 51.842 56.199  20.221 1.00 5.42  ? 22  ARG B CD  1 
ATOM   2406 N NE  . ARG B 1 22  ? 53.183 56.724  20.440 1.00 6.97  ? 22  ARG B NE  1 
ATOM   2407 C CZ  . ARG B 1 22  ? 54.178 56.039  20.994 1.00 9.02  ? 22  ARG B CZ  1 
ATOM   2408 N NH1 . ARG B 1 22  ? 53.994 54.791  21.397 1.00 8.93  ? 22  ARG B NH1 1 
ATOM   2409 N NH2 . ARG B 1 22  ? 55.368 56.603  21.136 1.00 10.95 ? 22  ARG B NH2 1 
ATOM   2410 N N   . ALA B 1 23  ? 47.310 53.194  22.593 1.00 2.62  ? 23  ALA B N   1 
ATOM   2411 C CA  . ALA B 1 23  ? 45.953 52.718  22.340 1.00 3.90  ? 23  ALA B CA  1 
ATOM   2412 C C   . ALA B 1 23  ? 44.873 53.505  23.090 1.00 5.01  ? 23  ALA B C   1 
ATOM   2413 O O   . ALA B 1 23  ? 44.993 53.774  24.288 1.00 5.47  ? 23  ALA B O   1 
ATOM   2414 C CB  . ALA B 1 23  ? 45.856 51.229  22.678 1.00 2.79  ? 23  ALA B CB  1 
ATOM   2415 N N   . VAL B 1 24  ? 43.812 53.861  22.373 1.00 4.18  ? 24  VAL B N   1 
ATOM   2416 C CA  . VAL B 1 24  ? 42.710 54.618  22.955 1.00 4.51  ? 24  VAL B CA  1 
ATOM   2417 C C   . VAL B 1 24  ? 41.608 53.696  23.465 1.00 6.03  ? 24  VAL B C   1 
ATOM   2418 O O   . VAL B 1 24  ? 41.027 52.917  22.698 1.00 6.00  ? 24  VAL B O   1 
ATOM   2419 C CB  . VAL B 1 24  ? 42.121 55.605  21.915 1.00 4.84  ? 24  VAL B CB  1 
ATOM   2420 C CG1 . VAL B 1 24  ? 40.909 56.325  22.483 1.00 5.04  ? 24  VAL B CG1 1 
ATOM   2421 C CG2 . VAL B 1 24  ? 43.183 56.606  21.506 1.00 4.72  ? 24  VAL B CG2 1 
ATOM   2422 N N   . SER B 1 25  ? 41.315 53.794  24.761 1.00 6.45  ? 25  SER B N   1 
ATOM   2423 C CA  . SER B 1 25  ? 40.292 52.970  25.393 1.00 7.32  ? 25  SER B CA  1 
ATOM   2424 C C   . SER B 1 25  ? 38.952 53.047  24.683 1.00 7.92  ? 25  SER B C   1 
ATOM   2425 O O   . SER B 1 25  ? 38.444 54.141  24.417 1.00 6.02  ? 25  SER B O   1 
ATOM   2426 C CB  . SER B 1 25  ? 40.101 53.379  26.860 1.00 10.22 ? 25  SER B CB  1 
ATOM   2427 O OG  . SER B 1 25  ? 41.271 53.167  27.632 1.00 14.20 ? 25  SER B OG  1 
ATOM   2428 N N   . SER B 1 26  ? 38.383 51.874  24.397 1.00 9.27  ? 26  SER B N   1 
ATOM   2429 C CA  . SER B 1 26  ? 37.091 51.747  23.728 1.00 11.54 ? 26  SER B CA  1 
ATOM   2430 C C   . SER B 1 26  ? 37.206 51.878  22.215 1.00 9.11  ? 26  SER B C   1 
ATOM   2431 O O   . SER B 1 26  ? 36.214 51.787  21.503 1.00 8.00  ? 26  SER B O   1 
ATOM   2432 C CB  . SER B 1 26  ? 36.105 52.796  24.249 1.00 12.65 ? 26  SER B CB  1 
ATOM   2433 O OG  . SER B 1 26  ? 35.941 52.671  25.642 1.00 19.32 ? 26  SER B OG  1 
ATOM   2434 N N   . VAL B 1 27  ? 38.417 52.100  21.732 1.00 9.03  ? 27  VAL B N   1 
ATOM   2435 C CA  . VAL B 1 27  ? 38.636 52.225  20.296 1.00 10.40 ? 27  VAL B CA  1 
ATOM   2436 C C   . VAL B 1 27  ? 39.596 51.153  19.775 1.00 10.22 ? 27  VAL B C   1 
ATOM   2437 O O   . VAL B 1 27  ? 39.360 50.557  18.728 1.00 12.09 ? 27  VAL B O   1 
ATOM   2438 C CB  . VAL B 1 27  ? 39.198 53.625  19.929 1.00 9.73  ? 27  VAL B CB  1 
ATOM   2439 C CG1 . VAL B 1 27  ? 39.473 53.690  18.441 1.00 7.43  ? 27  VAL B CG1 1 
ATOM   2440 C CG2 . VAL B 1 27  ? 38.214 54.716  20.330 1.00 7.93  ? 27  VAL B CG2 1 
ATOM   2441 N N   . GLU B 1 28  ? 40.682 50.916  20.501 1.00 10.74 ? 28  GLU B N   1 
ATOM   2442 C CA  . GLU B 1 28  ? 41.666 49.925  20.089 1.00 9.75  ? 28  GLU B CA  1 
ATOM   2443 C C   . GLU B 1 28  ? 41.921 48.918  21.191 1.00 11.65 ? 28  GLU B C   1 
ATOM   2444 O O   . GLU B 1 28  ? 41.799 49.222  22.379 1.00 11.89 ? 28  GLU B O   1 
ATOM   2445 C CB  . GLU B 1 28  ? 42.988 50.595  19.750 1.00 8.41  ? 28  GLU B CB  1 
ATOM   2446 C CG  . GLU B 1 28  ? 42.868 51.794  18.863 1.00 7.40  ? 28  GLU B CG  1 
ATOM   2447 C CD  . GLU B 1 28  ? 44.097 52.664  18.944 1.00 8.13  ? 28  GLU B CD  1 
ATOM   2448 O OE1 . GLU B 1 28  ? 45.174 52.236  18.473 1.00 8.89  ? 28  GLU B OE1 1 
ATOM   2449 O OE2 . GLU B 1 28  ? 43.988 53.776  19.498 1.00 6.68  ? 28  GLU B OE2 1 
ATOM   2450 N N   . THR B 1 29  ? 42.306 47.719  20.783 1.00 12.08 ? 29  THR B N   1 
ATOM   2451 C CA  . THR B 1 29  ? 42.600 46.652  21.715 1.00 12.25 ? 29  THR B CA  1 
ATOM   2452 C C   . THR B 1 29  ? 43.915 46.057  21.247 1.00 11.47 ? 29  THR B C   1 
ATOM   2453 O O   . THR B 1 29  ? 44.002 45.514  20.143 1.00 11.11 ? 29  THR B O   1 
ATOM   2454 C CB  . THR B 1 29  ? 41.510 45.578  21.666 1.00 13.73 ? 29  THR B CB  1 
ATOM   2455 O OG1 . THR B 1 29  ? 40.228 46.200  21.810 1.00 16.68 ? 29  THR B OG1 1 
ATOM   2456 C CG2 . THR B 1 29  ? 41.705 44.569  22.774 1.00 13.66 ? 29  THR B CG2 1 
ATOM   2457 N N   . VAL B 1 30  ? 44.924 46.144  22.087 1.00 8.97  ? 30  VAL B N   1 
ATOM   2458 C CA  . VAL B 1 30  ? 46.232 45.647  21.638 1.00 8.38  ? 30  VAL B CA  1 
ATOM   2459 C C   . VAL B 1 30  ? 46.662 44.489  22.526 1.00 9.18  ? 30  VAL B C   1 
ATOM   2460 O O   . VAL B 1 30  ? 46.620 44.649  23.761 1.00 7.74  ? 30  VAL B O   1 
ATOM   2461 C CB  . VAL B 1 30  ? 47.331 46.711  21.569 1.00 7.33  ? 30  VAL B CB  1 
ATOM   2462 C CG1 . VAL B 1 30  ? 48.604 46.155  20.912 1.00 8.16  ? 30  VAL B CG1 1 
ATOM   2463 C CG2 . VAL B 1 30  ? 46.952 47.978  20.804 1.00 6.42  ? 30  VAL B CG2 1 
ATOM   2464 N N   . ALA B 1 31  ? 47.108 43.416  21.945 1.00 8.78  ? 31  ALA B N   1 
ATOM   2465 C CA  . ALA B 1 31  ? 47.557 42.260  22.821 1.00 9.74  ? 31  ALA B CA  1 
ATOM   2466 C C   . ALA B 1 31  ? 48.936 41.825  22.437 1.00 9.63  ? 31  ALA B C   1 
ATOM   2467 O O   . ALA B 1 31  ? 49.582 42.497  21.596 1.00 11.84 ? 31  ALA B O   1 
ATOM   2468 C CB  . ALA B 1 31  ? 46.471 41.190  22.685 1.00 7.78  ? 31  ALA B CB  1 
ATOM   2469 N N   . ASP B 1 32  ? 49.401 40.659  22.850 1.00 10.98 ? 32  ASP B N   1 
ATOM   2470 C CA  . ASP B 1 32  ? 50.661 40.055  22.501 1.00 12.00 ? 32  ASP B CA  1 
ATOM   2471 C C   . ASP B 1 32  ? 50.707 39.455  21.114 1.00 10.88 ? 32  ASP B C   1 
ATOM   2472 O O   . ASP B 1 32  ? 51.741 39.439  20.444 1.00 8.78  ? 32  ASP B O   1 
ATOM   2473 C CB  . ASP B 1 32  ? 51.060 39.034  23.557 1.00 15.06 ? 32  ASP B CB  1 
ATOM   2474 C CG  . ASP B 1 32  ? 51.853 39.582  24.711 1.00 18.64 ? 32  ASP B CG  1 
ATOM   2475 O OD1 . ASP B 1 32  ? 51.454 40.513  25.416 1.00 18.56 ? 32  ASP B OD1 1 
ATOM   2476 O OD2 . ASP B 1 32  ? 52.994 39.062  24.900 1.00 20.75 ? 32  ASP B OD2 1 
ATOM   2477 N N   . SER B 1 33  ? 49.577 38.905  20.657 1.00 10.15 ? 33  SER B N   1 
ATOM   2478 C CA  . SER B 1 33  ? 49.547 38.256  19.358 1.00 9.94  ? 33  SER B CA  1 
ATOM   2479 C C   . SER B 1 33  ? 48.618 38.877  18.324 1.00 9.15  ? 33  SER B C   1 
ATOM   2480 O O   . SER B 1 33  ? 48.533 38.391  17.196 1.00 11.30 ? 33  SER B O   1 
ATOM   2481 C CB  . SER B 1 33  ? 49.197 36.774  19.540 1.00 10.79 ? 33  SER B CB  1 
ATOM   2482 O OG  . SER B 1 33  ? 47.940 36.628  20.175 1.00 12.26 ? 33  SER B OG  1 
ATOM   2483 N N   . TYR B 1 34  ? 47.914 39.942  18.686 1.00 8.64  ? 34  TYR B N   1 
ATOM   2484 C CA  . TYR B 1 34  ? 47.020 40.565  17.720 1.00 7.20  ? 34  TYR B CA  1 
ATOM   2485 C C   . TYR B 1 34  ? 46.709 42.026  18.020 1.00 7.56  ? 34  TYR B C   1 
ATOM   2486 O O   . TYR B 1 34  ? 47.018 42.530  19.097 1.00 8.12  ? 34  TYR B O   1 
ATOM   2487 C CB  . TYR B 1 34  ? 45.715 39.767  17.632 1.00 5.43  ? 34  TYR B CB  1 
ATOM   2488 C CG  . TYR B 1 34  ? 44.802 39.971  18.813 1.00 4.92  ? 34  TYR B CG  1 
ATOM   2489 C CD1 . TYR B 1 34  ? 43.873 41.010  18.829 1.00 3.74  ? 34  TYR B CD1 1 
ATOM   2490 C CD2 . TYR B 1 34  ? 44.900 39.148  19.943 1.00 6.11  ? 34  TYR B CD2 1 
ATOM   2491 C CE1 . TYR B 1 34  ? 43.061 41.229  19.941 1.00 5.04  ? 34  TYR B CE1 1 
ATOM   2492 C CE2 . TYR B 1 34  ? 44.090 39.360  21.059 1.00 6.32  ? 34  TYR B CE2 1 
ATOM   2493 C CZ  . TYR B 1 34  ? 43.178 40.401  21.049 1.00 5.27  ? 34  TYR B CZ  1 
ATOM   2494 O OH  . TYR B 1 34  ? 42.386 40.620  22.149 1.00 6.83  ? 34  TYR B OH  1 
ATOM   2495 N N   . TYR B 1 35  ? 46.104 42.690  17.037 1.00 8.38  ? 35  TYR B N   1 
ATOM   2496 C CA  . TYR B 1 35  ? 45.703 44.085  17.132 1.00 8.11  ? 35  TYR B CA  1 
ATOM   2497 C C   . TYR B 1 35  ? 44.311 44.207  16.527 1.00 8.08  ? 35  TYR B C   1 
ATOM   2498 O O   . TYR B 1 35  ? 44.004 43.578  15.510 1.00 9.33  ? 35  TYR B O   1 
ATOM   2499 C CB  . TYR B 1 35  ? 46.679 44.985  16.366 1.00 8.32  ? 35  TYR B CB  1 
ATOM   2500 C CG  . TYR B 1 35  ? 46.286 46.453  16.348 1.00 9.42  ? 35  TYR B CG  1 
ATOM   2501 C CD1 . TYR B 1 35  ? 46.594 47.304  17.409 1.00 11.80 ? 35  TYR B CD1 1 
ATOM   2502 C CD2 . TYR B 1 35  ? 45.571 46.981  15.275 1.00 10.56 ? 35  TYR B CD2 1 
ATOM   2503 C CE1 . TYR B 1 35  ? 46.190 48.656  17.394 1.00 11.30 ? 35  TYR B CE1 1 
ATOM   2504 C CE2 . TYR B 1 35  ? 45.165 48.311  15.246 1.00 8.90  ? 35  TYR B CE2 1 
ATOM   2505 C CZ  . TYR B 1 35  ? 45.471 49.146  16.302 1.00 10.20 ? 35  TYR B CZ  1 
ATOM   2506 O OH  . TYR B 1 35  ? 45.036 50.450  16.258 1.00 7.37  ? 35  TYR B OH  1 
ATOM   2507 N N   . ALA B 1 36  ? 43.463 45.006  17.162 1.00 6.85  ? 36  ALA B N   1 
ATOM   2508 C CA  . ALA B 1 36  ? 42.102 45.202  16.678 1.00 5.68  ? 36  ALA B CA  1 
ATOM   2509 C C   . ALA B 1 36  ? 41.593 46.558  17.111 1.00 4.00  ? 36  ALA B C   1 
ATOM   2510 O O   . ALA B 1 36  ? 42.035 47.099  18.118 1.00 3.41  ? 36  ALA B O   1 
ATOM   2511 C CB  . ALA B 1 36  ? 41.182 44.106  17.219 1.00 6.53  ? 36  ALA B CB  1 
ATOM   2512 N N   . ARG B 1 37  ? 40.655 47.100  16.342 1.00 3.17  ? 37  ARG B N   1 
ATOM   2513 C CA  . ARG B 1 37  ? 40.077 48.400  16.646 1.00 3.13  ? 37  ARG B CA  1 
ATOM   2514 C C   . ARG B 1 37  ? 38.852 48.659  15.777 1.00 3.15  ? 37  ARG B C   1 
ATOM   2515 O O   . ARG B 1 37  ? 38.682 48.047  14.721 1.00 1.13  ? 37  ARG B O   1 
ATOM   2516 C CB  . ARG B 1 37  ? 41.097 49.506  16.380 1.00 1.66  ? 37  ARG B CB  1 
ATOM   2517 C CG  . ARG B 1 37  ? 41.588 49.520  14.934 1.00 1.13  ? 37  ARG B CG  1 
ATOM   2518 C CD  . ARG B 1 37  ? 42.151 50.877  14.564 1.00 1.13  ? 37  ARG B CD  1 
ATOM   2519 N NE  . ARG B 1 37  ? 41.126 51.915  14.680 1.00 1.64  ? 37  ARG B NE  1 
ATOM   2520 C CZ  . ARG B 1 37  ? 41.385 53.196  14.917 1.00 1.13  ? 37  ARG B CZ  1 
ATOM   2521 N NH1 . ARG B 1 37  ? 42.636 53.599  15.062 1.00 1.13  ? 37  ARG B NH1 1 
ATOM   2522 N NH2 . ARG B 1 37  ? 40.391 54.075  15.021 1.00 1.17  ? 37  ARG B NH2 1 
ATOM   2523 N N   . SER B 1 38  ? 38.009 49.581  16.236 1.00 2.02  ? 38  SER B N   1 
ATOM   2524 C CA  . SER B 1 38  ? 36.823 49.971  15.491 1.00 4.53  ? 38  SER B CA  1 
ATOM   2525 C C   . SER B 1 38  ? 37.332 50.673  14.235 1.00 5.21  ? 38  SER B C   1 
ATOM   2526 O O   . SER B 1 38  ? 38.480 51.115  14.187 1.00 6.34  ? 38  SER B O   1 
ATOM   2527 C CB  . SER B 1 38  ? 35.997 50.962  16.308 1.00 6.15  ? 38  SER B CB  1 
ATOM   2528 O OG  . SER B 1 38  ? 36.741 52.154  16.544 1.00 5.76  ? 38  SER B OG  1 
ATOM   2529 N N   . LEU B 1 39  ? 36.487 50.788  13.226 1.00 5.33  ? 39  LEU B N   1 
ATOM   2530 C CA  . LEU B 1 39  ? 36.896 51.443  11.993 1.00 5.92  ? 39  LEU B CA  1 
ATOM   2531 C C   . LEU B 1 39  ? 35.669 51.828  11.201 1.00 7.38  ? 39  LEU B C   1 
ATOM   2532 O O   . LEU B 1 39  ? 34.699 51.069  11.133 1.00 8.69  ? 39  LEU B O   1 
ATOM   2533 C CB  . LEU B 1 39  ? 37.791 50.508  11.166 1.00 3.16  ? 39  LEU B CB  1 
ATOM   2534 C CG  . LEU B 1 39  ? 38.345 51.024  9.831  1.00 5.08  ? 39  LEU B CG  1 
ATOM   2535 C CD1 . LEU B 1 39  ? 39.036 52.372  10.035 1.00 5.16  ? 39  LEU B CD1 1 
ATOM   2536 C CD2 . LEU B 1 39  ? 39.330 50.014  9.257  1.00 1.41  ? 39  LEU B CD2 1 
ATOM   2537 N N   . ALA B 1 40  ? 35.702 53.017  10.615 1.00 8.00  ? 40  ALA B N   1 
ATOM   2538 C CA  . ALA B 1 40  ? 34.585 53.486  9.817  1.00 9.59  ? 40  ALA B CA  1 
ATOM   2539 C C   . ALA B 1 40  ? 35.073 54.018  8.473  1.00 10.48 ? 40  ALA B C   1 
ATOM   2540 O O   . ALA B 1 40  ? 35.856 54.964  8.408  1.00 11.17 ? 40  ALA B O   1 
ATOM   2541 C CB  . ALA B 1 40  ? 33.813 54.580  10.568 1.00 8.84  ? 40  ALA B CB  1 
ATOM   2542 N N   . VAL B 1 41  ? 34.619 53.390  7.399  1.00 11.11 ? 41  VAL B N   1 
ATOM   2543 C CA  . VAL B 1 41  ? 34.974 53.815  6.056  1.00 11.32 ? 41  VAL B CA  1 
ATOM   2544 C C   . VAL B 1 41  ? 33.666 54.329  5.480  1.00 13.11 ? 41  VAL B C   1 
ATOM   2545 O O   . VAL B 1 41  ? 32.788 53.545  5.117  1.00 13.27 ? 41  VAL B O   1 
ATOM   2546 C CB  . VAL B 1 41  ? 35.520 52.633  5.232  1.00 10.41 ? 41  VAL B CB  1 
ATOM   2547 C CG1 . VAL B 1 41  ? 35.921 53.103  3.843  1.00 9.40  ? 41  VAL B CG1 1 
ATOM   2548 C CG2 . VAL B 1 41  ? 36.723 52.031  5.943  1.00 8.54  ? 41  VAL B CG2 1 
ATOM   2549 N N   . GLY B 1 42  ? 33.531 55.654  5.426  1.00 13.75 ? 42  GLY B N   1 
ATOM   2550 C CA  . GLY B 1 42  ? 32.297 56.243  4.949  1.00 13.25 ? 42  GLY B CA  1 
ATOM   2551 C C   . GLY B 1 42  ? 31.213 55.847  5.935  1.00 14.26 ? 42  GLY B C   1 
ATOM   2552 O O   . GLY B 1 42  ? 31.346 56.101  7.135  1.00 14.53 ? 42  GLY B O   1 
ATOM   2553 N N   . GLU B 1 43  ? 30.154 55.212  5.440  1.00 15.53 ? 43  GLU B N   1 
ATOM   2554 C CA  . GLU B 1 43  ? 29.051 54.764  6.289  1.00 17.12 ? 43  GLU B CA  1 
ATOM   2555 C C   . GLU B 1 43  ? 29.222 53.301  6.685  1.00 15.70 ? 43  GLU B C   1 
ATOM   2556 O O   . GLU B 1 43  ? 28.321 52.703  7.276  1.00 17.56 ? 43  GLU B O   1 
ATOM   2557 C CB  . GLU B 1 43  ? 27.702 54.928  5.577  1.00 19.77 ? 43  GLU B CB  1 
ATOM   2558 C CG  . GLU B 1 43  ? 27.214 56.367  5.431  1.00 22.91 ? 43  GLU B CG  1 
ATOM   2559 C CD  . GLU B 1 43  ? 27.051 57.071  6.765  1.00 25.46 ? 43  GLU B CD  1 
ATOM   2560 O OE1 . GLU B 1 43  ? 26.376 56.514  7.662  1.00 26.61 ? 43  GLU B OE1 1 
ATOM   2561 O OE2 . GLU B 1 43  ? 27.594 58.188  6.909  1.00 25.84 ? 43  GLU B OE2 1 
ATOM   2562 N N   . TYR B 1 44  ? 30.373 52.726  6.343  1.00 13.57 ? 44  TYR B N   1 
ATOM   2563 C CA  . TYR B 1 44  ? 30.677 51.332  6.671  1.00 12.47 ? 44  TYR B CA  1 
ATOM   2564 C C   . TYR B 1 44  ? 31.470 51.265  7.970  1.00 10.32 ? 44  TYR B C   1 
ATOM   2565 O O   . TYR B 1 44  ? 32.551 51.831  8.061  1.00 7.83  ? 44  TYR B O   1 
ATOM   2566 C CB  . TYR B 1 44  ? 31.486 50.685  5.548  1.00 12.26 ? 44  TYR B CB  1 
ATOM   2567 C CG  . TYR B 1 44  ? 30.698 50.480  4.290  1.00 11.68 ? 44  TYR B CG  1 
ATOM   2568 C CD1 . TYR B 1 44  ? 29.672 49.539  4.238  1.00 11.53 ? 44  TYR B CD1 1 
ATOM   2569 C CD2 . TYR B 1 44  ? 30.958 51.245  3.146  1.00 11.32 ? 44  TYR B CD2 1 
ATOM   2570 C CE1 . TYR B 1 44  ? 28.921 49.361  3.086  1.00 10.52 ? 44  TYR B CE1 1 
ATOM   2571 C CE2 . TYR B 1 44  ? 30.217 51.073  1.985  1.00 9.72  ? 44  TYR B CE2 1 
ATOM   2572 C CZ  . TYR B 1 44  ? 29.199 50.128  1.963  1.00 10.97 ? 44  TYR B CZ  1 
ATOM   2573 O OH  . TYR B 1 44  ? 28.461 49.935  0.817  1.00 9.47  ? 44  TYR B OH  1 
ATOM   2574 N N   . ARG B 1 45  ? 30.937 50.553  8.959  1.00 11.81 ? 45  ARG B N   1 
ATOM   2575 C CA  . ARG B 1 45  ? 31.584 50.442  10.264 1.00 13.66 ? 45  ARG B CA  1 
ATOM   2576 C C   . ARG B 1 45  ? 31.745 49.009  10.784 1.00 13.42 ? 45  ARG B C   1 
ATOM   2577 O O   . ARG B 1 45  ? 31.007 48.107  10.391 1.00 14.15 ? 45  ARG B O   1 
ATOM   2578 C CB  . ARG B 1 45  ? 30.812 51.281  11.290 1.00 13.81 ? 45  ARG B CB  1 
ATOM   2579 C CG  . ARG B 1 45  ? 30.800 52.764  10.969 1.00 14.47 ? 45  ARG B CG  1 
ATOM   2580 C CD  . ARG B 1 45  ? 30.044 53.565  12.011 1.00 15.96 ? 45  ARG B CD  1 
ATOM   2581 N NE  . ARG B 1 45  ? 28.941 54.298  11.395 1.00 20.04 ? 45  ARG B NE  1 
ATOM   2582 C CZ  . ARG B 1 45  ? 29.075 55.425  10.703 1.00 17.78 ? 45  ARG B CZ  1 
ATOM   2583 N NH1 . ARG B 1 45  ? 30.269 55.975  10.538 1.00 17.83 ? 45  ARG B NH1 1 
ATOM   2584 N NH2 . ARG B 1 45  ? 28.011 55.989  10.148 1.00 20.47 ? 45  ARG B NH2 1 
ATOM   2585 N N   . GLY B 1 46  ? 32.715 48.815  11.674 1.00 13.82 ? 46  GLY B N   1 
ATOM   2586 C CA  . GLY B 1 46  ? 32.959 47.494  12.231 1.00 12.22 ? 46  GLY B CA  1 
ATOM   2587 C C   . GLY B 1 46  ? 34.290 47.362  12.957 1.00 10.13 ? 46  GLY B C   1 
ATOM   2588 O O   . GLY B 1 46  ? 34.880 48.353  13.395 1.00 7.78  ? 46  GLY B O   1 
ATOM   2589 N N   . VAL B 1 47  ? 34.768 46.131  13.082 1.00 9.61  ? 47  VAL B N   1 
ATOM   2590 C CA  . VAL B 1 47  ? 36.029 45.879  13.773 1.00 9.98  ? 47  VAL B CA  1 
ATOM   2591 C C   . VAL B 1 47  ? 37.041 45.180  12.873 1.00 7.41  ? 47  VAL B C   1 
ATOM   2592 O O   . VAL B 1 47  ? 36.711 44.240  12.169 1.00 4.91  ? 47  VAL B O   1 
ATOM   2593 C CB  . VAL B 1 47  ? 35.795 45.019  15.046 1.00 9.88  ? 47  VAL B CB  1 
ATOM   2594 C CG1 . VAL B 1 47  ? 37.114 44.748  15.758 1.00 10.34 ? 47  VAL B CG1 1 
ATOM   2595 C CG2 . VAL B 1 47  ? 34.834 45.735  15.977 1.00 11.44 ? 47  VAL B CG2 1 
ATOM   2596 N N   . VAL B 1 48  ? 38.282 45.648  12.902 1.00 6.94  ? 48  VAL B N   1 
ATOM   2597 C CA  . VAL B 1 48  ? 39.320 45.046  12.090 1.00 8.48  ? 48  VAL B CA  1 
ATOM   2598 C C   . VAL B 1 48  ? 40.340 44.395  13.018 1.00 6.48  ? 48  VAL B C   1 
ATOM   2599 O O   . VAL B 1 48  ? 40.849 45.035  13.937 1.00 5.38  ? 48  VAL B O   1 
ATOM   2600 C CB  . VAL B 1 48  ? 40.009 46.115  11.219 1.00 7.39  ? 48  VAL B CB  1 
ATOM   2601 C CG1 . VAL B 1 48  ? 41.099 45.493  10.370 1.00 6.18  ? 48  VAL B CG1 1 
ATOM   2602 C CG2 . VAL B 1 48  ? 38.982 46.781  10.347 1.00 12.10 ? 48  VAL B CG2 1 
ATOM   2603 N N   . THR B 1 49  ? 40.621 43.119  12.779 1.00 5.26  ? 49  THR B N   1 
ATOM   2604 C CA  . THR B 1 49  ? 41.594 42.395  13.594 1.00 5.29  ? 49  THR B CA  1 
ATOM   2605 C C   . THR B 1 49  ? 42.798 42.005  12.751 1.00 3.28  ? 49  THR B C   1 
ATOM   2606 O O   . THR B 1 49  ? 42.645 41.450  11.672 1.00 4.44  ? 49  THR B O   1 
ATOM   2607 C CB  . THR B 1 49  ? 40.975 41.114  14.197 1.00 3.63  ? 49  THR B CB  1 
ATOM   2608 O OG1 . THR B 1 49  ? 39.835 41.463  14.990 1.00 2.78  ? 49  THR B OG1 1 
ATOM   2609 C CG2 . THR B 1 49  ? 41.990 40.391  15.079 1.00 1.14  ? 49  THR B CG2 1 
ATOM   2610 N N   . ALA B 1 50  ? 43.992 42.312  13.243 1.00 3.68  ? 50  ALA B N   1 
ATOM   2611 C CA  . ALA B 1 50  ? 45.225 41.981  12.539 1.00 5.02  ? 50  ALA B CA  1 
ATOM   2612 C C   . ALA B 1 50  ? 46.006 40.953  13.369 1.00 7.65  ? 50  ALA B C   1 
ATOM   2613 O O   . ALA B 1 50  ? 46.316 41.184  14.544 1.00 5.43  ? 50  ALA B O   1 
ATOM   2614 C CB  . ALA B 1 50  ? 46.049 43.234  12.321 1.00 4.28  ? 50  ALA B CB  1 
ATOM   2615 N N   . ILE B 1 51  ? 46.310 39.821  12.736 1.00 8.55  ? 51  ILE B N   1 
ATOM   2616 C CA  . ILE B 1 51  ? 47.006 38.703  13.366 1.00 8.61  ? 51  ILE B CA  1 
ATOM   2617 C C   . ILE B 1 51  ? 48.234 38.299  12.568 1.00 8.31  ? 51  ILE B C   1 
ATOM   2618 O O   . ILE B 1 51  ? 48.115 37.774  11.464 1.00 9.64  ? 51  ILE B O   1 
ATOM   2619 C CB  . ILE B 1 51  ? 46.108 37.462  13.417 1.00 9.52  ? 51  ILE B CB  1 
ATOM   2620 C CG1 . ILE B 1 51  ? 44.790 37.802  14.104 1.00 8.41  ? 51  ILE B CG1 1 
ATOM   2621 C CG2 . ILE B 1 51  ? 46.840 36.314  14.116 1.00 10.32 ? 51  ILE B CG2 1 
ATOM   2622 C CD1 . ILE B 1 51  ? 43.738 36.733  13.905 1.00 10.05 ? 51  ILE B CD1 1 
ATOM   2623 N N   . PRO B 1 52  ? 49.429 38.531  13.120 1.00 5.46  ? 52  PRO B N   1 
ATOM   2624 C CA  . PRO B 1 52  ? 50.668 38.175  12.432 1.00 6.35  ? 52  PRO B CA  1 
ATOM   2625 C C   . PRO B 1 52  ? 51.060 36.701  12.612 1.00 6.60  ? 52  PRO B C   1 
ATOM   2626 O O   . PRO B 1 52  ? 50.896 36.124  13.688 1.00 7.05  ? 52  PRO B O   1 
ATOM   2627 C CB  . PRO B 1 52  ? 51.683 39.149  13.029 1.00 6.31  ? 52  PRO B CB  1 
ATOM   2628 C CG  . PRO B 1 52  ? 51.197 39.324  14.421 1.00 7.68  ? 52  PRO B CG  1 
ATOM   2629 C CD  . PRO B 1 52  ? 49.687 39.387  14.291 1.00 6.41  ? 52  PRO B CD  1 
ATOM   2630 N N   . ASP B 1 53  ? 51.557 36.109  11.529 1.00 6.47  ? 53  ASP B N   1 
ATOM   2631 C CA  . ASP B 1 53  ? 52.005 34.717  11.478 1.00 8.94  ? 53  ASP B CA  1 
ATOM   2632 C C   . ASP B 1 53  ? 53.500 34.838  11.215 1.00 9.47  ? 53  ASP B C   1 
ATOM   2633 O O   . ASP B 1 53  ? 53.950 34.790  10.068 1.00 10.21 ? 53  ASP B O   1 
ATOM   2634 C CB  . ASP B 1 53  ? 51.325 33.989  10.311 1.00 10.71 ? 53  ASP B CB  1 
ATOM   2635 C CG  . ASP B 1 53  ? 51.691 32.514  10.234 1.00 13.59 ? 53  ASP B CG  1 
ATOM   2636 O OD1 . ASP B 1 53  ? 52.891 32.185  10.109 1.00 15.62 ? 53  ASP B OD1 1 
ATOM   2637 O OD2 . ASP B 1 53  ? 50.766 31.677  10.291 1.00 13.94 ? 53  ASP B OD2 1 
ATOM   2638 N N   . ILE B 1 54  ? 54.260 35.018  12.289 1.00 9.84  ? 54  ILE B N   1 
ATOM   2639 C CA  . ILE B 1 54  ? 55.705 35.200  12.202 1.00 9.94  ? 54  ILE B CA  1 
ATOM   2640 C C   . ILE B 1 54  ? 56.458 34.240  11.285 1.00 10.35 ? 54  ILE B C   1 
ATOM   2641 O O   . ILE B 1 54  ? 57.221 34.671  10.415 1.00 8.80  ? 54  ILE B O   1 
ATOM   2642 C CB  . ILE B 1 54  ? 56.349 35.114  13.593 1.00 9.93  ? 54  ILE B CB  1 
ATOM   2643 C CG1 . ILE B 1 54  ? 55.545 35.959  14.588 1.00 11.11 ? 54  ILE B CG1 1 
ATOM   2644 C CG2 . ILE B 1 54  ? 57.804 35.571  13.517 1.00 9.93  ? 54  ILE B CG2 1 
ATOM   2645 C CD1 . ILE B 1 54  ? 55.352 37.409  14.163 1.00 10.98 ? 54  ILE B CD1 1 
ATOM   2646 N N   . ALA B 1 55  ? 56.257 32.946  11.496 1.00 10.59 ? 55  ALA B N   1 
ATOM   2647 C CA  . ALA B 1 55  ? 56.936 31.933  10.702 1.00 14.34 ? 55  ALA B CA  1 
ATOM   2648 C C   . ALA B 1 55  ? 56.683 32.078  9.208  1.00 14.41 ? 55  ALA B C   1 
ATOM   2649 O O   . ALA B 1 55  ? 57.527 31.707  8.399  1.00 16.03 ? 55  ALA B O   1 
ATOM   2650 C CB  . ALA B 1 55  ? 56.526 30.540  11.169 1.00 14.51 ? 55  ALA B CB  1 
ATOM   2651 N N   . ARG B 1 56  ? 55.530 32.612  8.832  1.00 14.90 ? 56  ARG B N   1 
ATOM   2652 C CA  . ARG B 1 56  ? 55.227 32.772  7.413  1.00 16.48 ? 56  ARG B CA  1 
ATOM   2653 C C   . ARG B 1 56  ? 55.273 34.231  6.970  1.00 16.34 ? 56  ARG B C   1 
ATOM   2654 O O   . ARG B 1 56  ? 54.879 34.550  5.850  1.00 16.93 ? 56  ARG B O   1 
ATOM   2655 C CB  . ARG B 1 56  ? 53.846 32.187  7.103  1.00 17.92 ? 56  ARG B CB  1 
ATOM   2656 C CG  . ARG B 1 56  ? 53.733 30.696  7.373  1.00 24.33 ? 56  ARG B CG  1 
ATOM   2657 C CD  . ARG B 1 56  ? 52.285 30.243  7.481  1.00 27.45 ? 56  ARG B CD  1 
ATOM   2658 N NE  . ARG B 1 56  ? 52.208 28.824  7.810  1.00 31.87 ? 56  ARG B NE  1 
ATOM   2659 C CZ  . ARG B 1 56  ? 52.663 27.854  7.021  1.00 35.38 ? 56  ARG B CZ  1 
ATOM   2660 N NH1 . ARG B 1 56  ? 53.223 28.152  5.853  1.00 35.57 ? 56  ARG B NH1 1 
ATOM   2661 N NH2 . ARG B 1 56  ? 52.575 26.585  7.404  1.00 34.62 ? 56  ARG B NH2 1 
ATOM   2662 N N   . HIS B 1 57  ? 55.779 35.106  7.839  1.00 16.05 ? 57  HIS B N   1 
ATOM   2663 C CA  . HIS B 1 57  ? 55.850 36.547  7.568  1.00 15.48 ? 57  HIS B CA  1 
ATOM   2664 C C   . HIS B 1 57  ? 54.619 37.030  6.800  1.00 14.20 ? 57  HIS B C   1 
ATOM   2665 O O   . HIS B 1 57  ? 54.717 37.808  5.850  1.00 14.07 ? 57  HIS B O   1 
ATOM   2666 C CB  . HIS B 1 57  ? 57.135 36.933  6.802  1.00 15.24 ? 57  HIS B CB  1 
ATOM   2667 C CG  . HIS B 1 57  ? 57.302 36.239  5.483  1.00 15.89 ? 57  HIS B CG  1 
ATOM   2668 N ND1 . HIS B 1 57  ? 57.987 35.049  5.351  1.00 15.83 ? 57  HIS B ND1 1 
ATOM   2669 C CD2 . HIS B 1 57  ? 56.872 36.566  4.240  1.00 13.75 ? 57  HIS B CD2 1 
ATOM   2670 C CE1 . HIS B 1 57  ? 57.972 34.673  4.084  1.00 14.73 ? 57  HIS B CE1 1 
ATOM   2671 N NE2 . HIS B 1 57  ? 57.303 35.576  3.390  1.00 15.38 ? 57  HIS B NE2 1 
ATOM   2672 N N   . THR B 1 58  ? 53.458 36.546  7.227  1.00 12.97 ? 58  THR B N   1 
ATOM   2673 C CA  . THR B 1 58  ? 52.195 36.920  6.617  1.00 12.39 ? 58  THR B CA  1 
ATOM   2674 C C   . THR B 1 58  ? 51.254 37.456  7.697  1.00 11.13 ? 58  THR B C   1 
ATOM   2675 O O   . THR B 1 58  ? 51.124 36.867  8.771  1.00 10.03 ? 58  THR B O   1 
ATOM   2676 C CB  . THR B 1 58  ? 51.536 35.712  5.887  1.00 13.36 ? 58  THR B CB  1 
ATOM   2677 O OG1 . THR B 1 58  ? 51.367 34.625  6.801  1.00 17.27 ? 58  THR B OG1 1 
ATOM   2678 C CG2 . THR B 1 58  ? 52.401 35.244  4.716  1.00 12.98 ? 58  THR B CG2 1 
ATOM   2679 N N   . LEU B 1 59  ? 50.622 38.593  7.418  1.00 9.34  ? 59  LEU B N   1 
ATOM   2680 C CA  . LEU B 1 59  ? 49.684 39.201  8.356  1.00 7.59  ? 59  LEU B CA  1 
ATOM   2681 C C   . LEU B 1 59  ? 48.245 38.843  7.963  1.00 6.90  ? 59  LEU B C   1 
ATOM   2682 O O   . LEU B 1 59  ? 47.829 39.107  6.835  1.00 6.21  ? 59  LEU B O   1 
ATOM   2683 C CB  . LEU B 1 59  ? 49.863 40.726  8.360  1.00 4.63  ? 59  LEU B CB  1 
ATOM   2684 C CG  . LEU B 1 59  ? 48.958 41.547  9.280  1.00 1.40  ? 59  LEU B CG  1 
ATOM   2685 C CD1 . LEU B 1 59  ? 49.184 41.144  10.724 1.00 1.13  ? 59  LEU B CD1 1 
ATOM   2686 C CD2 . LEU B 1 59  ? 49.256 43.035  9.089  1.00 2.78  ? 59  LEU B CD2 1 
ATOM   2687 N N   . HIS B 1 60  ? 47.495 38.232  8.884  1.00 6.68  ? 60  HIS B N   1 
ATOM   2688 C CA  . HIS B 1 60  ? 46.106 37.854  8.620  1.00 7.10  ? 60  HIS B CA  1 
ATOM   2689 C C   . HIS B 1 60  ? 45.145 38.884  9.188  1.00 8.70  ? 60  HIS B C   1 
ATOM   2690 O O   . HIS B 1 60  ? 45.223 39.232  10.367 1.00 11.42 ? 60  HIS B O   1 
ATOM   2691 C CB  . HIS B 1 60  ? 45.776 36.482  9.217  1.00 6.53  ? 60  HIS B CB  1 
ATOM   2692 C CG  . HIS B 1 60  ? 46.384 35.334  8.472  1.00 8.33  ? 60  HIS B CG  1 
ATOM   2693 N ND1 . HIS B 1 60  ? 47.677 34.908  8.689  1.00 9.28  ? 60  HIS B ND1 1 
ATOM   2694 C CD2 . HIS B 1 60  ? 45.897 34.560  7.472  1.00 8.38  ? 60  HIS B CD2 1 
ATOM   2695 C CE1 . HIS B 1 60  ? 47.961 33.924  7.851  1.00 10.40 ? 60  HIS B CE1 1 
ATOM   2696 N NE2 . HIS B 1 60  ? 46.898 33.695  7.101  1.00 7.90  ? 60  HIS B NE2 1 
ATOM   2697 N N   . ILE B 1 61  ? 44.243 39.375  8.345  1.00 7.94  ? 61  ILE B N   1 
ATOM   2698 C CA  . ILE B 1 61  ? 43.270 40.379  8.758  1.00 7.95  ? 61  ILE B CA  1 
ATOM   2699 C C   . ILE B 1 61  ? 41.855 39.800  8.742  1.00 7.73  ? 61  ILE B C   1 
ATOM   2700 O O   . ILE B 1 61  ? 41.485 39.062  7.836  1.00 5.86  ? 61  ILE B O   1 
ATOM   2701 C CB  . ILE B 1 61  ? 43.328 41.640  7.838  1.00 7.48  ? 61  ILE B CB  1 
ATOM   2702 C CG1 . ILE B 1 61  ? 44.489 42.550  8.260  1.00 9.73  ? 61  ILE B CG1 1 
ATOM   2703 C CG2 . ILE B 1 61  ? 42.042 42.432  7.940  1.00 5.47  ? 61  ILE B CG2 1 
ATOM   2704 C CD1 . ILE B 1 61  ? 45.582 42.688  7.221  1.00 11.53 ? 61  ILE B CD1 1 
ATOM   2705 N N   . ASN B 1 62  ? 41.078 40.133  9.764  1.00 7.11  ? 62  ASN B N   1 
ATOM   2706 C CA  . ASN B 1 62  ? 39.709 39.663  9.874  1.00 8.69  ? 62  ASN B CA  1 
ATOM   2707 C C   . ASN B 1 62  ? 38.825 40.883  10.011 1.00 9.52  ? 62  ASN B C   1 
ATOM   2708 O O   . ASN B 1 62  ? 39.140 41.801  10.773 1.00 8.32  ? 62  ASN B O   1 
ATOM   2709 C CB  . ASN B 1 62  ? 39.542 38.790  11.113 1.00 11.04 ? 62  ASN B CB  1 
ATOM   2710 C CG  . ASN B 1 62  ? 38.183 38.143  11.186 1.00 11.13 ? 62  ASN B CG  1 
ATOM   2711 O OD1 . ASN B 1 62  ? 37.900 37.192  10.459 1.00 14.10 ? 62  ASN B OD1 1 
ATOM   2712 N ND2 . ASN B 1 62  ? 37.325 38.662  12.056 1.00 11.77 ? 62  ASN B ND2 1 
ATOM   2713 N N   . LEU B 1 63  ? 37.716 40.898  9.282  1.00 8.86  ? 63  LEU B N   1 
ATOM   2714 C CA  . LEU B 1 63  ? 36.806 42.031  9.362  1.00 9.73  ? 63  LEU B CA  1 
ATOM   2715 C C   . LEU B 1 63  ? 35.409 41.566  9.765  1.00 8.99  ? 63  LEU B C   1 
ATOM   2716 O O   . LEU B 1 63  ? 34.987 40.470  9.400  1.00 9.94  ? 63  LEU B O   1 
ATOM   2717 C CB  . LEU B 1 63  ? 36.729 42.741  8.007  1.00 10.96 ? 63  LEU B CB  1 
ATOM   2718 C CG  . LEU B 1 63  ? 38.014 43.127  7.271  1.00 11.73 ? 63  LEU B CG  1 
ATOM   2719 C CD1 . LEU B 1 63  ? 37.631 43.646  5.897  1.00 13.10 ? 63  LEU B CD1 1 
ATOM   2720 C CD2 . LEU B 1 63  ? 38.799 44.179  8.050  1.00 10.02 ? 63  LEU B CD2 1 
ATOM   2721 N N   . SER B 1 64  ? 34.702 42.390  10.530 1.00 7.58  ? 64  SER B N   1 
ATOM   2722 C CA  . SER B 1 64  ? 33.338 42.081  10.937 1.00 7.82  ? 64  SER B CA  1 
ATOM   2723 C C   . SER B 1 64  ? 32.488 42.291  9.680  1.00 8.79  ? 64  SER B C   1 
ATOM   2724 O O   . SER B 1 64  ? 32.939 42.916  8.714  1.00 8.98  ? 64  SER B O   1 
ATOM   2725 C CB  . SER B 1 64  ? 32.860 43.055  11.998 1.00 7.86  ? 64  SER B CB  1 
ATOM   2726 O OG  . SER B 1 64  ? 32.565 44.310  11.398 1.00 11.76 ? 64  SER B OG  1 
ATOM   2727 N N   . ALA B 1 65  ? 31.256 41.795  9.706  1.00 7.36  ? 65  ALA B N   1 
ATOM   2728 C CA  . ALA B 1 65  ? 30.347 41.908  8.567  1.00 6.47  ? 65  ALA B CA  1 
ATOM   2729 C C   . ALA B 1 65  ? 30.188 43.305  7.955  1.00 5.92  ? 65  ALA B C   1 
ATOM   2730 O O   . ALA B 1 65  ? 30.184 43.444  6.735  1.00 6.65  ? 65  ALA B O   1 
ATOM   2731 C CB  . ALA B 1 65  ? 28.971 41.349  8.957  1.00 5.53  ? 65  ALA B CB  1 
ATOM   2732 N N   . GLY B 1 66  ? 30.050 44.333  8.790  1.00 5.28  ? 66  GLY B N   1 
ATOM   2733 C CA  . GLY B 1 66  ? 29.866 45.686  8.281  1.00 3.78  ? 66  GLY B CA  1 
ATOM   2734 C C   . GLY B 1 66  ? 30.953 46.326  7.424  1.00 4.88  ? 66  GLY B C   1 
ATOM   2735 O O   . GLY B 1 66  ? 30.701 47.358  6.804  1.00 4.34  ? 66  GLY B O   1 
ATOM   2736 N N   . LEU B 1 67  ? 32.141 45.722  7.363  1.00 4.62  ? 67  LEU B N   1 
ATOM   2737 C CA  . LEU B 1 67  ? 33.254 46.290  6.603  1.00 7.11  ? 67  LEU B CA  1 
ATOM   2738 C C   . LEU B 1 67  ? 33.639 45.551  5.332  1.00 7.92  ? 67  LEU B C   1 
ATOM   2739 O O   . LEU B 1 67  ? 34.444 46.053  4.543  1.00 8.66  ? 67  LEU B O   1 
ATOM   2740 C CB  . LEU B 1 67  ? 34.497 46.400  7.491  1.00 3.71  ? 67  LEU B CB  1 
ATOM   2741 C CG  . LEU B 1 67  ? 34.388 47.333  8.694  1.00 6.79  ? 67  LEU B CG  1 
ATOM   2742 C CD1 . LEU B 1 67  ? 35.665 47.253  9.514  1.00 5.73  ? 67  LEU B CD1 1 
ATOM   2743 C CD2 . LEU B 1 67  ? 34.132 48.765  8.217  1.00 8.17  ? 67  LEU B CD2 1 
ATOM   2744 N N   . GLU B 1 68  ? 33.083 44.363  5.134  1.00 8.37  ? 68  GLU B N   1 
ATOM   2745 C CA  . GLU B 1 68  ? 33.405 43.582  3.937  1.00 9.45  ? 68  GLU B CA  1 
ATOM   2746 C C   . GLU B 1 68  ? 33.228 44.345  2.627  1.00 8.31  ? 68  GLU B C   1 
ATOM   2747 O O   . GLU B 1 68  ? 34.033 44.197  1.716  1.00 10.76 ? 68  GLU B O   1 
ATOM   2748 C CB  . GLU B 1 68  ? 32.574 42.293  3.890  1.00 10.55 ? 68  GLU B CB  1 
ATOM   2749 C CG  . GLU B 1 68  ? 32.988 41.230  4.898  1.00 8.67  ? 68  GLU B CG  1 
ATOM   2750 C CD  . GLU B 1 68  ? 34.421 40.750  4.704  1.00 12.46 ? 68  GLU B CD  1 
ATOM   2751 O OE1 . GLU B 1 68  ? 35.036 41.067  3.657  1.00 12.31 ? 68  GLU B OE1 1 
ATOM   2752 O OE2 . GLU B 1 68  ? 34.928 40.036  5.599  1.00 14.28 ? 68  GLU B OE2 1 
ATOM   2753 N N   . PRO B 1 69  ? 32.172 45.159  2.507  1.00 6.41  ? 69  PRO B N   1 
ATOM   2754 C CA  . PRO B 1 69  ? 31.980 45.907  1.258  1.00 6.35  ? 69  PRO B CA  1 
ATOM   2755 C C   . PRO B 1 69  ? 33.194 46.759  0.893  1.00 7.84  ? 69  PRO B C   1 
ATOM   2756 O O   . PRO B 1 69  ? 33.436 47.040  -0.283 1.00 9.28  ? 69  PRO B O   1 
ATOM   2757 C CB  . PRO B 1 69  ? 30.746 46.760  1.552  1.00 6.13  ? 69  PRO B CB  1 
ATOM   2758 C CG  . PRO B 1 69  ? 29.944 45.874  2.461  1.00 7.07  ? 69  PRO B CG  1 
ATOM   2759 C CD  . PRO B 1 69  ? 31.004 45.303  3.398  1.00 7.74  ? 69  PRO B CD  1 
ATOM   2760 N N   . VAL B 1 70  ? 33.952 47.165  1.909  1.00 6.44  ? 70  VAL B N   1 
ATOM   2761 C CA  . VAL B 1 70  ? 35.146 47.977  1.717  1.00 3.56  ? 70  VAL B CA  1 
ATOM   2762 C C   . VAL B 1 70  ? 36.392 47.295  2.293  1.00 5.74  ? 70  VAL B C   1 
ATOM   2763 O O   . VAL B 1 70  ? 37.342 47.953  2.759  1.00 2.45  ? 70  VAL B O   1 
ATOM   2764 C CB  . VAL B 1 70  ? 34.979 49.377  2.353  1.00 4.23  ? 70  VAL B CB  1 
ATOM   2765 C CG1 . VAL B 1 70  ? 34.068 50.228  1.479  1.00 2.92  ? 70  VAL B CG1 1 
ATOM   2766 C CG2 . VAL B 1 70  ? 34.396 49.260  3.747  1.00 2.92  ? 70  VAL B CG2 1 
ATOM   2767 N N   . ALA B 1 71  ? 36.392 45.966  2.232  1.00 3.84  ? 71  ALA B N   1 
ATOM   2768 C CA  . ALA B 1 71  ? 37.510 45.172  2.721  1.00 3.60  ? 71  ALA B CA  1 
ATOM   2769 C C   . ALA B 1 71  ? 38.867 45.676  2.218  1.00 3.83  ? 71  ALA B C   1 
ATOM   2770 O O   . ALA B 1 71  ? 39.784 45.880  3.014  1.00 5.06  ? 71  ALA B O   1 
ATOM   2771 C CB  . ALA B 1 71  ? 37.313 43.698  2.321  1.00 2.92  ? 71  ALA B CB  1 
ATOM   2772 N N   . ALA B 1 72  ? 38.988 45.868  0.902  1.00 1.47  ? 72  ALA B N   1 
ATOM   2773 C CA  . ALA B 1 72  ? 40.233 46.327  0.275  1.00 2.53  ? 72  ALA B CA  1 
ATOM   2774 C C   . ALA B 1 72  ? 40.819 47.607  0.870  1.00 3.21  ? 72  ALA B C   1 
ATOM   2775 O O   . ALA B 1 72  ? 42.030 47.721  1.054  1.00 2.07  ? 72  ALA B O   1 
ATOM   2776 C CB  . ALA B 1 72  ? 40.030 46.510  -1.232 1.00 2.16  ? 72  ALA B CB  1 
ATOM   2777 N N   . GLU B 1 73  ? 39.963 48.584  1.135  1.00 4.18  ? 73  GLU B N   1 
ATOM   2778 C CA  . GLU B 1 73  ? 40.416 49.831  1.723  1.00 6.38  ? 73  GLU B CA  1 
ATOM   2779 C C   . GLU B 1 73  ? 40.847 49.532  3.164  1.00 6.07  ? 73  GLU B C   1 
ATOM   2780 O O   . GLU B 1 73  ? 41.792 50.132  3.678  1.00 4.86  ? 73  GLU B O   1 
ATOM   2781 C CB  . GLU B 1 73  ? 39.291 50.866  1.691  1.00 8.71  ? 73  GLU B CB  1 
ATOM   2782 C CG  . GLU B 1 73  ? 39.710 52.255  2.131  1.00 15.24 ? 73  GLU B CG  1 
ATOM   2783 C CD  . GLU B 1 73  ? 41.043 52.686  1.527  1.00 17.00 ? 73  GLU B CD  1 
ATOM   2784 O OE1 . GLU B 1 73  ? 41.314 52.327  0.364  1.00 20.10 ? 73  GLU B OE1 1 
ATOM   2785 O OE2 . GLU B 1 73  ? 41.814 53.390  2.213  1.00 14.46 ? 73  GLU B OE2 1 
ATOM   2786 N N   . CYS B 1 74  ? 40.160 48.591  3.809  1.00 5.45  ? 74  CYS B N   1 
ATOM   2787 C CA  . CYS B 1 74  ? 40.515 48.212  5.169  1.00 4.00  ? 74  CYS B CA  1 
ATOM   2788 C C   . CYS B 1 74  ? 41.898 47.586  5.135  1.00 4.65  ? 74  CYS B C   1 
ATOM   2789 O O   . CYS B 1 74  ? 42.739 47.868  5.993  1.00 2.39  ? 74  CYS B O   1 
ATOM   2790 C CB  . CYS B 1 74  ? 39.515 47.204  5.730  1.00 3.52  ? 74  CYS B CB  1 
ATOM   2791 S SG  . CYS B 1 74  ? 37.881 47.905  6.091  1.00 2.74  ? 74  CYS B SG  1 
ATOM   2792 N N   . LEU B 1 75  ? 42.137 46.735  4.139  1.00 4.26  ? 75  LEU B N   1 
ATOM   2793 C CA  . LEU B 1 75  ? 43.432 46.083  4.017  1.00 3.91  ? 75  LEU B CA  1 
ATOM   2794 C C   . LEU B 1 75  ? 44.502 47.147  3.775  1.00 5.71  ? 75  LEU B C   1 
ATOM   2795 O O   . LEU B 1 75  ? 45.598 47.083  4.344  1.00 7.01  ? 75  LEU B O   1 
ATOM   2796 C CB  . LEU B 1 75  ? 43.413 45.070  2.870  1.00 1.13  ? 75  LEU B CB  1 
ATOM   2797 C CG  . LEU B 1 75  ? 42.331 43.985  2.917  1.00 2.31  ? 75  LEU B CG  1 
ATOM   2798 C CD1 . LEU B 1 75  ? 42.535 43.000  1.773  1.00 1.13  ? 75  LEU B CD1 1 
ATOM   2799 C CD2 . LEU B 1 75  ? 42.385 43.249  4.243  1.00 2.22  ? 75  LEU B CD2 1 
ATOM   2800 N N   . ALA B 1 76  ? 44.185 48.138  2.944  1.00 4.47  ? 76  ALA B N   1 
ATOM   2801 C CA  . ALA B 1 76  ? 45.140 49.200  2.659  1.00 4.88  ? 76  ALA B CA  1 
ATOM   2802 C C   . ALA B 1 76  ? 45.484 49.968  3.940  1.00 5.15  ? 76  ALA B C   1 
ATOM   2803 O O   . ALA B 1 76  ? 46.653 50.236  4.221  1.00 5.26  ? 76  ALA B O   1 
ATOM   2804 C CB  . ALA B 1 76  ? 44.570 50.153  1.597  1.00 4.05  ? 76  ALA B CB  1 
ATOM   2805 N N   . LYS B 1 77  ? 44.470 50.322  4.723  1.00 4.36  ? 77  LYS B N   1 
ATOM   2806 C CA  . LYS B 1 77  ? 44.727 51.061  5.955  1.00 5.77  ? 77  LYS B CA  1 
ATOM   2807 C C   . LYS B 1 77  ? 45.637 50.289  6.917  1.00 7.31  ? 77  LYS B C   1 
ATOM   2808 O O   . LYS B 1 77  ? 46.501 50.883  7.577  1.00 6.98  ? 77  LYS B O   1 
ATOM   2809 C CB  . LYS B 1 77  ? 43.403 51.432  6.612  1.00 5.25  ? 77  LYS B CB  1 
ATOM   2810 C CG  . LYS B 1 77  ? 42.616 52.444  5.775  1.00 3.41  ? 77  LYS B CG  1 
ATOM   2811 C CD  . LYS B 1 77  ? 41.241 52.698  6.356  1.00 4.87  ? 77  LYS B CD  1 
ATOM   2812 C CE  . LYS B 1 77  ? 40.461 53.719  5.542  1.00 3.15  ? 77  LYS B CE  1 
ATOM   2813 N NZ  . LYS B 1 77  ? 40.996 55.102  5.686  1.00 1.13  ? 77  LYS B NZ  1 
ATOM   2814 N N   . MET B 1 78  ? 45.460 48.968  6.981  1.00 6.88  ? 78  MET B N   1 
ATOM   2815 C CA  . MET B 1 78  ? 46.288 48.123  7.834  1.00 7.47  ? 78  MET B CA  1 
ATOM   2816 C C   . MET B 1 78  ? 47.737 48.110  7.331  1.00 7.71  ? 78  MET B C   1 
ATOM   2817 O O   . MET B 1 78  ? 48.675 48.089  8.131  1.00 9.08  ? 78  MET B O   1 
ATOM   2818 C CB  . MET B 1 78  ? 45.741 46.691  7.855  1.00 7.98  ? 78  MET B CB  1 
ATOM   2819 C CG  . MET B 1 78  ? 44.374 46.522  8.532  1.00 8.48  ? 78  MET B CG  1 
ATOM   2820 S SD  . MET B 1 78  ? 44.432 46.735  10.328 1.00 14.12 ? 78  MET B SD  1 
ATOM   2821 C CE  . MET B 1 78  ? 43.717 48.368  10.507 1.00 8.49  ? 78  MET B CE  1 
ATOM   2822 N N   . SER B 1 79  ? 47.921 48.125  6.011  1.00 6.10  ? 79  SER B N   1 
ATOM   2823 C CA  . SER B 1 79  ? 49.263 48.104  5.425  1.00 4.35  ? 79  SER B CA  1 
ATOM   2824 C C   . SER B 1 79  ? 50.030 49.380  5.740  1.00 3.74  ? 79  SER B C   1 
ATOM   2825 O O   . SER B 1 79  ? 51.255 49.359  5.889  1.00 2.43  ? 79  SER B O   1 
ATOM   2826 C CB  . SER B 1 79  ? 49.203 47.918  3.900  1.00 1.13  ? 79  SER B CB  1 
ATOM   2827 O OG  . SER B 1 79  ? 48.554 49.003  3.255  1.00 1.13  ? 79  SER B OG  1 
ATOM   2828 N N   . ARG B 1 80  ? 49.312 50.495  5.823  1.00 3.35  ? 80  ARG B N   1 
ATOM   2829 C CA  . ARG B 1 80  ? 49.962 51.760  6.119  1.00 4.10  ? 80  ARG B CA  1 
ATOM   2830 C C   . ARG B 1 80  ? 50.226 51.892  7.620  1.00 4.28  ? 80  ARG B C   1 
ATOM   2831 O O   . ARG B 1 80  ? 51.184 52.552  8.040  1.00 2.32  ? 80  ARG B O   1 
ATOM   2832 C CB  . ARG B 1 80  ? 49.117 52.921  5.599  1.00 2.08  ? 80  ARG B CB  1 
ATOM   2833 C CG  . ARG B 1 80  ? 49.074 52.985  4.074  1.00 1.43  ? 80  ARG B CG  1 
ATOM   2834 C CD  . ARG B 1 80  ? 48.504 54.308  3.598  1.00 2.14  ? 80  ARG B CD  1 
ATOM   2835 N NE  . ARG B 1 80  ? 47.079 54.427  3.877  1.00 5.53  ? 80  ARG B NE  1 
ATOM   2836 C CZ  . ARG B 1 80  ? 46.118 54.007  3.058  1.00 7.12  ? 80  ARG B CZ  1 
ATOM   2837 N NH1 . ARG B 1 80  ? 46.443 53.441  1.900  1.00 6.13  ? 80  ARG B NH1 1 
ATOM   2838 N NH2 . ARG B 1 80  ? 44.837 54.155  3.393  1.00 1.73  ? 80  ARG B NH2 1 
ATOM   2839 N N   . LEU B 1 81  ? 49.385 51.244  8.419  1.00 5.10  ? 81  LEU B N   1 
ATOM   2840 C CA  . LEU B 1 81  ? 49.541 51.261  9.870  1.00 8.01  ? 81  LEU B CA  1 
ATOM   2841 C C   . LEU B 1 81  ? 50.738 50.416  10.309 1.00 7.05  ? 81  LEU B C   1 
ATOM   2842 O O   . LEU B 1 81  ? 51.430 50.767  11.265 1.00 7.31  ? 81  LEU B O   1 
ATOM   2843 C CB  . LEU B 1 81  ? 48.277 50.725  10.551 1.00 6.95  ? 81  LEU B CB  1 
ATOM   2844 C CG  . LEU B 1 81  ? 48.411 50.368  12.038 1.00 8.78  ? 81  LEU B CG  1 
ATOM   2845 C CD1 . LEU B 1 81  ? 48.712 51.619  12.853 1.00 7.42  ? 81  LEU B CD1 1 
ATOM   2846 C CD2 . LEU B 1 81  ? 47.131 49.708  12.525 1.00 7.90  ? 81  LEU B CD2 1 
ATOM   2847 N N   . PHE B 1 82  ? 50.984 49.309  9.607  1.00 6.70  ? 82  PHE B N   1 
ATOM   2848 C CA  . PHE B 1 82  ? 52.083 48.423  9.972  1.00 5.33  ? 82  PHE B CA  1 
ATOM   2849 C C   . PHE B 1 82  ? 53.306 48.500  9.091  1.00 4.26  ? 82  PHE B C   1 
ATOM   2850 O O   . PHE B 1 82  ? 54.269 47.762  9.305  1.00 4.16  ? 82  PHE B O   1 
ATOM   2851 C CB  . PHE B 1 82  ? 51.583 46.989  10.057 1.00 2.28  ? 82  PHE B CB  1 
ATOM   2852 C CG  . PHE B 1 82  ? 50.567 46.781  11.139 1.00 1.77  ? 82  PHE B CG  1 
ATOM   2853 C CD1 . PHE B 1 82  ? 50.908 46.956  12.477 1.00 1.44  ? 82  PHE B CD1 1 
ATOM   2854 C CD2 . PHE B 1 82  ? 49.270 46.425  10.825 1.00 1.13  ? 82  PHE B CD2 1 
ATOM   2855 C CE1 . PHE B 1 82  ? 49.965 46.775  13.485 1.00 1.13  ? 82  PHE B CE1 1 
ATOM   2856 C CE2 . PHE B 1 82  ? 48.326 46.245  11.823 1.00 2.27  ? 82  PHE B CE2 1 
ATOM   2857 C CZ  . PHE B 1 82  ? 48.674 46.420  13.157 1.00 1.25  ? 82  PHE B CZ  1 
ATOM   2858 N N   . ASP B 1 83  ? 53.271 49.393  8.108  1.00 3.66  ? 83  ASP B N   1 
ATOM   2859 C CA  . ASP B 1 83  ? 54.415 49.598  7.228  1.00 3.67  ? 83  ASP B CA  1 
ATOM   2860 C C   . ASP B 1 83  ? 54.848 48.291  6.551  1.00 2.68  ? 83  ASP B C   1 
ATOM   2861 O O   . ASP B 1 83  ? 56.024 47.951  6.538  1.00 1.21  ? 83  ASP B O   1 
ATOM   2862 C CB  . ASP B 1 83  ? 55.551 50.192  8.077  1.00 3.91  ? 83  ASP B CB  1 
ATOM   2863 C CG  . ASP B 1 83  ? 56.720 50.695  7.256  1.00 4.24  ? 83  ASP B CG  1 
ATOM   2864 O OD1 . ASP B 1 83  ? 56.523 51.106  6.092  1.00 5.43  ? 83  ASP B OD1 1 
ATOM   2865 O OD2 . ASP B 1 83  ? 57.845 50.694  7.800  1.00 1.28  ? 83  ASP B OD2 1 
ATOM   2866 N N   . LEU B 1 84  ? 53.884 47.574  5.979  1.00 4.16  ? 84  LEU B N   1 
ATOM   2867 C CA  . LEU B 1 84  ? 54.157 46.304  5.310  1.00 4.89  ? 84  LEU B CA  1 
ATOM   2868 C C   . LEU B 1 84  ? 55.080 46.418  4.101  1.00 3.23  ? 84  LEU B C   1 
ATOM   2869 O O   . LEU B 1 84  ? 55.669 45.423  3.679  1.00 3.86  ? 84  LEU B O   1 
ATOM   2870 C CB  . LEU B 1 84  ? 52.842 45.639  4.886  1.00 4.30  ? 84  LEU B CB  1 
ATOM   2871 C CG  . LEU B 1 84  ? 51.880 45.229  6.009  1.00 8.46  ? 84  LEU B CG  1 
ATOM   2872 C CD1 . LEU B 1 84  ? 50.643 44.542  5.416  1.00 6.85  ? 84  LEU B CD1 1 
ATOM   2873 C CD2 . LEU B 1 84  ? 52.596 44.289  6.984  1.00 6.94  ? 84  LEU B CD2 1 
ATOM   2874 N N   . GLN B 1 85  ? 55.213 47.620  3.551  1.00 1.71  ? 85  GLN B N   1 
ATOM   2875 C CA  . GLN B 1 85  ? 56.063 47.846  2.377  1.00 4.13  ? 85  GLN B CA  1 
ATOM   2876 C C   . GLN B 1 85  ? 57.548 47.911  2.672  1.00 5.74  ? 85  GLN B C   1 
ATOM   2877 O O   . GLN B 1 85  ? 58.369 47.706  1.782  1.00 4.67  ? 85  GLN B O   1 
ATOM   2878 C CB  . GLN B 1 85  ? 55.686 49.159  1.692  1.00 3.48  ? 85  GLN B CB  1 
ATOM   2879 C CG  . GLN B 1 85  ? 55.940 50.432  2.531  1.00 2.23  ? 85  GLN B CG  1 
ATOM   2880 C CD  . GLN B 1 85  ? 57.416 50.839  2.634  1.00 3.23  ? 85  GLN B CD  1 
ATOM   2881 O OE1 . GLN B 1 85  ? 58.137 50.878  1.633  1.00 2.13  ? 85  GLN B OE1 1 
ATOM   2882 N NE2 . GLN B 1 85  ? 57.860 51.166  3.847  1.00 1.97  ? 85  GLN B NE2 1 
ATOM   2883 N N   . CYS B 1 86  ? 57.892 48.205  3.920  1.00 8.53  ? 86  CYS B N   1 
ATOM   2884 C CA  . CYS B 1 86  ? 59.288 48.359  4.278  1.00 9.44  ? 86  CYS B CA  1 
ATOM   2885 C C   . CYS B 1 86  ? 60.228 47.231  3.915  1.00 10.31 ? 86  CYS B C   1 
ATOM   2886 O O   . CYS B 1 86  ? 59.926 46.052  4.114  1.00 9.04  ? 86  CYS B O   1 
ATOM   2887 C CB  . CYS B 1 86  ? 59.434 48.647  5.768  1.00 11.74 ? 86  CYS B CB  1 
ATOM   2888 S SG  . CYS B 1 86  ? 61.164 48.887  6.271  1.00 15.42 ? 86  CYS B SG  1 
ATOM   2889 N N   . ASN B 1 87  ? 61.377 47.628  3.372  1.00 9.96  ? 87  ASN B N   1 
ATOM   2890 C CA  . ASN B 1 87  ? 62.445 46.711  3.004  1.00 11.04 ? 87  ASN B CA  1 
ATOM   2891 C C   . ASN B 1 87  ? 63.589 46.964  4.004  1.00 11.38 ? 87  ASN B C   1 
ATOM   2892 O O   . ASN B 1 87  ? 64.446 47.818  3.774  1.00 10.50 ? 87  ASN B O   1 
ATOM   2893 C CB  . ASN B 1 87  ? 62.940 46.998  1.584  1.00 11.79 ? 87  ASN B CB  1 
ATOM   2894 C CG  . ASN B 1 87  ? 64.007 46.008  1.125  1.00 13.45 ? 87  ASN B CG  1 
ATOM   2895 O OD1 . ASN B 1 87  ? 64.963 45.720  1.846  1.00 12.10 ? 87  ASN B OD1 1 
ATOM   2896 N ND2 . ASN B 1 87  ? 63.848 45.493  -0.085 1.00 14.52 ? 87  ASN B ND2 1 
ATOM   2897 N N   . PRO B 1 88  ? 63.609 46.228  5.131  1.00 12.83 ? 88  PRO B N   1 
ATOM   2898 C CA  . PRO B 1 88  ? 64.644 46.376  6.165  1.00 13.68 ? 88  PRO B CA  1 
ATOM   2899 C C   . PRO B 1 88  ? 66.089 46.284  5.676  1.00 15.06 ? 88  PRO B C   1 
ATOM   2900 O O   . PRO B 1 88  ? 66.983 46.899  6.266  1.00 16.21 ? 88  PRO B O   1 
ATOM   2901 C CB  . PRO B 1 88  ? 64.296 45.274  7.161  1.00 14.24 ? 88  PRO B CB  1 
ATOM   2902 C CG  . PRO B 1 88  ? 63.565 44.258  6.321  1.00 14.55 ? 88  PRO B CG  1 
ATOM   2903 C CD  . PRO B 1 88  ? 62.684 45.138  5.487  1.00 12.80 ? 88  PRO B CD  1 
ATOM   2904 N N   . GLN B 1 89  ? 66.321 45.516  4.611  1.00 14.63 ? 89  GLN B N   1 
ATOM   2905 C CA  . GLN B 1 89  ? 67.661 45.370  4.055  1.00 14.53 ? 89  GLN B CA  1 
ATOM   2906 C C   . GLN B 1 89  ? 68.181 46.741  3.636  1.00 14.22 ? 89  GLN B C   1 
ATOM   2907 O O   . GLN B 1 89  ? 69.248 47.178  4.064  1.00 13.94 ? 89  GLN B O   1 
ATOM   2908 C CB  . GLN B 1 89  ? 67.648 44.457  2.823  1.00 16.45 ? 89  GLN B CB  1 
ATOM   2909 C CG  . GLN B 1 89  ? 67.470 42.957  3.075  1.00 21.62 ? 89  GLN B CG  1 
ATOM   2910 C CD  . GLN B 1 89  ? 66.064 42.574  3.537  1.00 23.55 ? 89  GLN B CD  1 
ATOM   2911 O OE1 . GLN B 1 89  ? 65.791 42.475  4.739  1.00 23.13 ? 89  GLN B OE1 1 
ATOM   2912 N NE2 . GLN B 1 89  ? 65.165 42.361  2.577  1.00 23.39 ? 89  GLN B NE2 1 
ATOM   2913 N N   . ILE B 1 90  ? 67.413 47.415  2.789  1.00 14.44 ? 90  ILE B N   1 
ATOM   2914 C CA  . ILE B 1 90  ? 67.796 48.731  2.295  1.00 14.58 ? 90  ILE B CA  1 
ATOM   2915 C C   . ILE B 1 90  ? 67.916 49.742  3.423  1.00 15.71 ? 90  ILE B C   1 
ATOM   2916 O O   . ILE B 1 90  ? 68.929 50.436  3.535  1.00 15.51 ? 90  ILE B O   1 
ATOM   2917 C CB  . ILE B 1 90  ? 66.787 49.234  1.247  1.00 13.21 ? 90  ILE B CB  1 
ATOM   2918 C CG1 . ILE B 1 90  ? 66.730 48.223  0.095  1.00 13.41 ? 90  ILE B CG1 1 
ATOM   2919 C CG2 . ILE B 1 90  ? 67.195 50.619  0.736  1.00 11.60 ? 90  ILE B CG2 1 
ATOM   2920 C CD1 . ILE B 1 90  ? 65.739 48.557  -0.995 1.00 12.30 ? 90  ILE B CD1 1 
ATOM   2921 N N   . VAL B 1 91  ? 66.895 49.812  4.272  1.00 16.37 ? 91  VAL B N   1 
ATOM   2922 C CA  . VAL B 1 91  ? 66.918 50.750  5.387  1.00 18.08 ? 91  VAL B CA  1 
ATOM   2923 C C   . VAL B 1 91  ? 68.088 50.551  6.351  1.00 18.51 ? 91  VAL B C   1 
ATOM   2924 O O   . VAL B 1 91  ? 68.782 51.510  6.700  1.00 18.18 ? 91  VAL B O   1 
ATOM   2925 C CB  . VAL B 1 91  ? 65.602 50.704  6.191  1.00 18.66 ? 91  VAL B CB  1 
ATOM   2926 C CG1 . VAL B 1 91  ? 65.727 51.566  7.450  1.00 18.47 ? 91  VAL B CG1 1 
ATOM   2927 C CG2 . VAL B 1 91  ? 64.455 51.222  5.328  1.00 20.01 ? 91  VAL B CG2 1 
ATOM   2928 N N   . ASN B 1 92  ? 68.325 49.319  6.783  1.00 19.36 ? 92  ASN B N   1 
ATOM   2929 C CA  . ASN B 1 92  ? 69.426 49.090  7.716  1.00 19.72 ? 92  ASN B CA  1 
ATOM   2930 C C   . ASN B 1 92  ? 70.788 49.269  7.060  1.00 18.99 ? 92  ASN B C   1 
ATOM   2931 O O   . ASN B 1 92  ? 71.739 49.711  7.702  1.00 19.60 ? 92  ASN B O   1 
ATOM   2932 C CB  . ASN B 1 92  ? 69.281 47.716  8.370  1.00 18.14 ? 92  ASN B CB  1 
ATOM   2933 C CG  . ASN B 1 92  ? 67.978 47.599  9.155  1.00 20.58 ? 92  ASN B CG  1 
ATOM   2934 O OD1 . ASN B 1 92  ? 67.535 48.568  9.788  1.00 21.77 ? 92  ASN B OD1 1 
ATOM   2935 N ND2 . ASN B 1 92  ? 67.363 46.422  9.128  1.00 18.64 ? 92  ASN B ND2 1 
ATOM   2936 N N   . GLY B 1 93  ? 70.876 48.947  5.776  1.00 19.45 ? 93  GLY B N   1 
ATOM   2937 C CA  . GLY B 1 93  ? 72.129 49.129  5.073  1.00 19.71 ? 93  GLY B CA  1 
ATOM   2938 C C   . GLY B 1 93  ? 72.499 50.606  5.057  1.00 21.23 ? 93  GLY B C   1 
ATOM   2939 O O   . GLY B 1 93  ? 73.676 50.958  5.119  1.00 24.33 ? 93  GLY B O   1 
ATOM   2940 N N   . ALA B 1 94  ? 71.502 51.481  4.983  1.00 18.80 ? 94  ALA B N   1 
ATOM   2941 C CA  . ALA B 1 94  ? 71.767 52.919  4.961  1.00 19.24 ? 94  ALA B CA  1 
ATOM   2942 C C   . ALA B 1 94  ? 71.969 53.517  6.356  1.00 19.31 ? 94  ALA B C   1 
ATOM   2943 O O   . ALA B 1 94  ? 72.737 54.458  6.525  1.00 20.43 ? 94  ALA B O   1 
ATOM   2944 C CB  . ALA B 1 94  ? 70.633 53.649  4.236  1.00 17.54 ? 94  ALA B CB  1 
ATOM   2945 N N   . LEU B 1 95  ? 71.271 52.980  7.349  1.00 19.11 ? 95  LEU B N   1 
ATOM   2946 C CA  . LEU B 1 95  ? 71.386 53.478  8.713  1.00 20.03 ? 95  LEU B CA  1 
ATOM   2947 C C   . LEU B 1 95  ? 72.649 52.948  9.390  1.00 22.26 ? 95  LEU B C   1 
ATOM   2948 O O   . LEU B 1 95  ? 73.229 53.610  10.250 1.00 21.55 ? 95  LEU B O   1 
ATOM   2949 C CB  . LEU B 1 95  ? 70.150 53.074  9.526  1.00 19.16 ? 95  LEU B CB  1 
ATOM   2950 C CG  . LEU B 1 95  ? 68.818 53.767  9.203  1.00 17.14 ? 95  LEU B CG  1 
ATOM   2951 C CD1 . LEU B 1 95  ? 67.705 53.124  10.006 1.00 16.31 ? 95  LEU B CD1 1 
ATOM   2952 C CD2 . LEU B 1 95  ? 68.904 55.258  9.521  1.00 17.45 ? 95  LEU B CD2 1 
ATOM   2953 N N   . GLY B 1 96  ? 73.062 51.745  9.001  1.00 24.81 ? 96  GLY B N   1 
ATOM   2954 C CA  . GLY B 1 96  ? 74.248 51.139  9.577  1.00 24.80 ? 96  GLY B CA  1 
ATOM   2955 C C   . GLY B 1 96  ? 74.098 50.812  11.051 1.00 25.59 ? 96  GLY B C   1 
ATOM   2956 O O   . GLY B 1 96  ? 73.080 50.266  11.475 1.00 26.05 ? 96  GLY B O   1 
ATOM   2957 N N   . ARG B 1 97  ? 75.118 51.158  11.829 1.00 26.46 ? 97  ARG B N   1 
ATOM   2958 C CA  . ARG B 1 97  ? 75.139 50.911  13.269 1.00 28.50 ? 97  ARG B CA  1 
ATOM   2959 C C   . ARG B 1 97  ? 73.811 51.215  13.963 1.00 27.71 ? 97  ARG B C   1 
ATOM   2960 O O   . ARG B 1 97  ? 73.302 50.402  14.738 1.00 26.76 ? 97  ARG B O   1 
ATOM   2961 C CB  . ARG B 1 97  ? 76.240 51.753  13.925 1.00 32.00 ? 97  ARG B CB  1 
ATOM   2962 C CG  . ARG B 1 97  ? 77.593 51.694  13.218 1.00 35.78 ? 97  ARG B CG  1 
ATOM   2963 C CD  . ARG B 1 97  ? 78.256 50.317  13.316 1.00 36.98 ? 97  ARG B CD  1 
ATOM   2964 N NE  . ARG B 1 97  ? 78.671 49.994  14.679 1.00 39.17 ? 97  ARG B NE  1 
ATOM   2965 C CZ  . ARG B 1 97  ? 77.861 49.524  15.624 1.00 41.18 ? 97  ARG B CZ  1 
ATOM   2966 N NH1 . ARG B 1 97  ? 76.576 49.312  15.358 1.00 42.70 ? 97  ARG B NH1 1 
ATOM   2967 N NH2 . ARG B 1 97  ? 78.334 49.269  16.839 1.00 40.53 ? 97  ARG B NH2 1 
ATOM   2968 N N   . LEU B 1 98  ? 73.262 52.396  13.690 1.00 27.64 ? 98  LEU B N   1 
ATOM   2969 C CA  . LEU B 1 98  ? 72.003 52.824  14.301 1.00 26.48 ? 98  LEU B CA  1 
ATOM   2970 C C   . LEU B 1 98  ? 70.864 51.836  14.057 1.00 26.89 ? 98  LEU B C   1 
ATOM   2971 O O   . LEU B 1 98  ? 69.861 51.844  14.773 1.00 26.77 ? 98  LEU B O   1 
ATOM   2972 C CB  . LEU B 1 98  ? 71.607 54.210  13.778 1.00 24.56 ? 98  LEU B CB  1 
ATOM   2973 C CG  . LEU B 1 98  ? 70.363 54.883  14.372 1.00 23.23 ? 98  LEU B CG  1 
ATOM   2974 C CD1 . LEU B 1 98  ? 70.554 55.129  15.856 1.00 21.23 ? 98  LEU B CD1 1 
ATOM   2975 C CD2 . LEU B 1 98  ? 70.103 56.193  13.647 1.00 23.50 ? 98  LEU B CD2 1 
ATOM   2976 N N   . GLY B 1 99  ? 71.022 50.985  13.051 1.00 27.64 ? 99  GLY B N   1 
ATOM   2977 C CA  . GLY B 1 99  ? 69.989 50.013  12.749 1.00 29.49 ? 99  GLY B CA  1 
ATOM   2978 C C   . GLY B 1 99  ? 70.289 48.641  13.319 1.00 30.38 ? 99  GLY B C   1 
ATOM   2979 O O   . GLY B 1 99  ? 69.396 47.806  13.445 1.00 30.68 ? 99  GLY B O   1 
ATOM   2980 N N   . ALA B 1 100 ? 71.548 48.408  13.672 1.00 30.91 ? 100 ALA B N   1 
ATOM   2981 C CA  . ALA B 1 100 ? 71.952 47.122  14.223 1.00 30.45 ? 100 ALA B CA  1 
ATOM   2982 C C   . ALA B 1 100 ? 71.147 46.747  15.467 1.00 30.14 ? 100 ALA B C   1 
ATOM   2983 O O   . ALA B 1 100 ? 70.888 45.574  15.709 1.00 30.14 ? 100 ALA B O   1 
ATOM   2984 C CB  . ALA B 1 100 ? 73.452 47.140  14.547 1.00 31.29 ? 100 ALA B CB  1 
ATOM   2985 N N   . ALA B 1 101 ? 70.747 47.743  16.249 1.00 30.21 ? 101 ALA B N   1 
ATOM   2986 C CA  . ALA B 1 101 ? 69.975 47.495  17.470 1.00 29.77 ? 101 ALA B CA  1 
ATOM   2987 C C   . ALA B 1 101 ? 68.711 46.666  17.219 1.00 29.31 ? 101 ALA B C   1 
ATOM   2988 O O   . ALA B 1 101 ? 68.609 45.520  17.664 1.00 28.89 ? 101 ALA B O   1 
ATOM   2989 C CB  . ALA B 1 101 ? 69.596 48.822  18.126 1.00 31.36 ? 101 ALA B CB  1 
ATOM   2990 N N   . ARG B 1 102 ? 67.744 47.264  16.525 1.00 27.76 ? 102 ARG B N   1 
ATOM   2991 C CA  . ARG B 1 102 ? 66.483 46.605  16.203 1.00 24.93 ? 102 ARG B CA  1 
ATOM   2992 C C   . ARG B 1 102 ? 66.257 46.726  14.703 1.00 23.66 ? 102 ARG B C   1 
ATOM   2993 O O   . ARG B 1 102 ? 65.607 47.667  14.240 1.00 20.73 ? 102 ARG B O   1 
ATOM   2994 C CB  . ARG B 1 102 ? 65.316 47.284  16.915 1.00 26.24 ? 102 ARG B CB  1 
ATOM   2995 C CG  . ARG B 1 102 ? 65.430 47.389  18.415 1.00 26.62 ? 102 ARG B CG  1 
ATOM   2996 C CD  . ARG B 1 102 ? 64.839 48.720  18.850 1.00 29.28 ? 102 ARG B CD  1 
ATOM   2997 N NE  . ARG B 1 102 ? 64.730 48.855  20.295 1.00 28.58 ? 102 ARG B NE  1 
ATOM   2998 C CZ  . ARG B 1 102 ? 63.905 48.137  21.041 1.00 28.03 ? 102 ARG B CZ  1 
ATOM   2999 N NH1 . ARG B 1 102 ? 63.120 47.231  20.472 1.00 26.99 ? 102 ARG B NH1 1 
ATOM   3000 N NH2 . ARG B 1 102 ? 63.860 48.337  22.351 1.00 29.62 ? 102 ARG B NH2 1 
ATOM   3001 N N   . PRO B 1 103 ? 66.786 45.774  13.925 1.00 20.91 ? 103 PRO B N   1 
ATOM   3002 C CA  . PRO B 1 103 ? 66.616 45.822  12.473 1.00 18.33 ? 103 PRO B CA  1 
ATOM   3003 C C   . PRO B 1 103 ? 65.175 45.610  12.021 1.00 16.84 ? 103 PRO B C   1 
ATOM   3004 O O   . PRO B 1 103 ? 64.801 46.029  10.927 1.00 16.59 ? 103 PRO B O   1 
ATOM   3005 C CB  . PRO B 1 103 ? 67.570 44.736  11.976 1.00 17.77 ? 103 PRO B CB  1 
ATOM   3006 C CG  . PRO B 1 103 ? 67.577 43.742  13.101 1.00 20.16 ? 103 PRO B CG  1 
ATOM   3007 C CD  . PRO B 1 103 ? 67.592 44.612  14.341 1.00 20.60 ? 103 PRO B CD  1 
ATOM   3008 N N   . GLY B 1 104 ? 64.368 44.979  12.873 1.00 14.73 ? 104 GLY B N   1 
ATOM   3009 C CA  . GLY B 1 104 ? 62.978 44.717  12.533 1.00 13.64 ? 104 GLY B CA  1 
ATOM   3010 C C   . GLY B 1 104 ? 62.017 45.838  12.887 1.00 13.81 ? 104 GLY B C   1 
ATOM   3011 O O   . GLY B 1 104 ? 60.804 45.720  12.713 1.00 13.65 ? 104 GLY B O   1 
ATOM   3012 N N   . LEU B 1 105 ? 62.561 46.939  13.381 1.00 13.40 ? 105 LEU B N   1 
ATOM   3013 C CA  . LEU B 1 105 ? 61.754 48.085  13.764 1.00 13.91 ? 105 LEU B CA  1 
ATOM   3014 C C   . LEU B 1 105 ? 61.082 48.684  12.515 1.00 14.63 ? 105 LEU B C   1 
ATOM   3015 O O   . LEU B 1 105 ? 61.728 48.886  11.492 1.00 15.42 ? 105 LEU B O   1 
ATOM   3016 C CB  . LEU B 1 105 ? 62.666 49.098  14.454 1.00 14.59 ? 105 LEU B CB  1 
ATOM   3017 C CG  . LEU B 1 105 ? 62.048 50.283  15.182 1.00 15.87 ? 105 LEU B CG  1 
ATOM   3018 C CD1 . LEU B 1 105 ? 63.039 50.826  16.207 1.00 16.93 ? 105 LEU B CD1 1 
ATOM   3019 C CD2 . LEU B 1 105 ? 61.663 51.349  14.171 1.00 16.91 ? 105 LEU B CD2 1 
ATOM   3020 N N   . ARG B 1 106 ? 59.779 48.944  12.601 1.00 13.64 ? 106 ARG B N   1 
ATOM   3021 C CA  . ARG B 1 106 ? 59.027 49.504  11.481 1.00 10.90 ? 106 ARG B CA  1 
ATOM   3022 C C   . ARG B 1 106 ? 58.450 50.866  11.831 1.00 9.73  ? 106 ARG B C   1 
ATOM   3023 O O   . ARG B 1 106 ? 58.531 51.305  12.978 1.00 7.76  ? 106 ARG B O   1 
ATOM   3024 C CB  . ARG B 1 106 ? 57.880 48.563  11.078 1.00 10.90 ? 106 ARG B CB  1 
ATOM   3025 C CG  . ARG B 1 106 ? 58.318 47.268  10.412 1.00 10.77 ? 106 ARG B CG  1 
ATOM   3026 C CD  . ARG B 1 106 ? 59.174 47.552  9.195  1.00 10.92 ? 106 ARG B CD  1 
ATOM   3027 N NE  . ARG B 1 106 ? 59.726 46.336  8.607  1.00 11.51 ? 106 ARG B NE  1 
ATOM   3028 C CZ  . ARG B 1 106 ? 59.056 45.530  7.793  1.00 14.41 ? 106 ARG B CZ  1 
ATOM   3029 N NH1 . ARG B 1 106 ? 57.797 45.816  7.468  1.00 14.47 ? 106 ARG B NH1 1 
ATOM   3030 N NH2 . ARG B 1 106 ? 59.643 44.445  7.296  1.00 11.18 ? 106 ARG B NH2 1 
ATOM   3031 N N   . LEU B 1 107 ? 57.873 51.534  10.833 1.00 8.84  ? 107 LEU B N   1 
ATOM   3032 C CA  . LEU B 1 107 ? 57.253 52.842  11.048 1.00 9.24  ? 107 LEU B CA  1 
ATOM   3033 C C   . LEU B 1 107 ? 55.746 52.696  11.284 1.00 9.31  ? 107 LEU B C   1 
ATOM   3034 O O   . LEU B 1 107 ? 55.006 52.282  10.389 1.00 9.16  ? 107 LEU B O   1 
ATOM   3035 C CB  . LEU B 1 107 ? 57.480 53.763  9.842  1.00 9.15  ? 107 LEU B CB  1 
ATOM   3036 C CG  . LEU B 1 107 ? 56.786 55.136  9.924  1.00 13.21 ? 107 LEU B CG  1 
ATOM   3037 C CD1 . LEU B 1 107 ? 57.579 56.067  10.829 1.00 12.47 ? 107 LEU B CD1 1 
ATOM   3038 C CD2 . LEU B 1 107 ? 56.658 55.751  8.538  1.00 13.79 ? 107 LEU B CD2 1 
ATOM   3039 N N   . PRO B 1 108 ? 55.274 53.020  12.502 1.00 10.60 ? 108 PRO B N   1 
ATOM   3040 C CA  . PRO B 1 108 ? 53.843 52.925  12.832 1.00 8.53  ? 108 PRO B CA  1 
ATOM   3041 C C   . PRO B 1 108 ? 53.075 54.034  12.112 1.00 9.46  ? 108 PRO B C   1 
ATOM   3042 O O   . PRO B 1 108 ? 53.354 55.214  12.315 1.00 11.36 ? 108 PRO B O   1 
ATOM   3043 C CB  . PRO B 1 108 ? 53.822 53.123  14.345 1.00 9.47  ? 108 PRO B CB  1 
ATOM   3044 C CG  . PRO B 1 108 ? 55.198 52.665  14.778 1.00 8.89  ? 108 PRO B CG  1 
ATOM   3045 C CD  . PRO B 1 108 ? 56.079 53.246  13.715 1.00 8.76  ? 108 PRO B CD  1 
ATOM   3046 N N   . GLY B 1 109 ? 52.113 53.669  11.274 1.00 8.72  ? 109 GLY B N   1 
ATOM   3047 C CA  . GLY B 1 109 ? 51.363 54.693  10.564 1.00 7.49  ? 109 GLY B CA  1 
ATOM   3048 C C   . GLY B 1 109 ? 50.040 55.020  11.222 1.00 6.14  ? 109 GLY B C   1 
ATOM   3049 O O   . GLY B 1 109 ? 50.000 55.446  12.375 1.00 7.14  ? 109 GLY B O   1 
ATOM   3050 N N   . CYS B 1 110 ? 48.954 54.819  10.486 1.00 5.77  ? 110 CYS B N   1 
ATOM   3051 C CA  . CYS B 1 110 ? 47.612 55.080  10.992 1.00 5.75  ? 110 CYS B CA  1 
ATOM   3052 C C   . CYS B 1 110 ? 46.578 54.498  10.032 1.00 6.87  ? 110 CYS B C   1 
ATOM   3053 O O   . CYS B 1 110 ? 46.901 54.134  8.896  1.00 6.21  ? 110 CYS B O   1 
ATOM   3054 C CB  . CYS B 1 110 ? 47.374 56.589  11.134 1.00 6.01  ? 110 CYS B CB  1 
ATOM   3055 S SG  . CYS B 1 110 ? 47.190 57.468  9.559  1.00 6.54  ? 110 CYS B SG  1 
ATOM   3056 N N   . VAL B 1 111 ? 45.333 54.411  10.488 1.00 8.13  ? 111 VAL B N   1 
ATOM   3057 C CA  . VAL B 1 111 ? 44.266 53.890  9.644  1.00 9.43  ? 111 VAL B CA  1 
ATOM   3058 C C   . VAL B 1 111 ? 43.447 55.016  9.012  1.00 8.77  ? 111 VAL B C   1 
ATOM   3059 O O   . VAL B 1 111 ? 42.695 54.781  8.067  1.00 9.65  ? 111 VAL B O   1 
ATOM   3060 C CB  . VAL B 1 111 ? 43.312 52.946  10.430 1.00 8.08  ? 111 VAL B CB  1 
ATOM   3061 C CG1 . VAL B 1 111 ? 44.101 51.776  11.010 1.00 10.25 ? 111 VAL B CG1 1 
ATOM   3062 C CG2 . VAL B 1 111 ? 42.597 53.710  11.527 1.00 7.08  ? 111 VAL B CG2 1 
ATOM   3063 N N   . ASP B 1 112 ? 43.593 56.232  9.536  1.00 8.60  ? 112 ASP B N   1 
ATOM   3064 C CA  . ASP B 1 112 ? 42.868 57.393  9.015  1.00 8.60  ? 112 ASP B CA  1 
ATOM   3065 C C   . ASP B 1 112 ? 43.667 58.659  9.294  1.00 6.78  ? 112 ASP B C   1 
ATOM   3066 O O   . ASP B 1 112 ? 43.917 58.994  10.450 1.00 6.02  ? 112 ASP B O   1 
ATOM   3067 C CB  . ASP B 1 112 ? 41.485 57.503  9.663  1.00 10.26 ? 112 ASP B CB  1 
ATOM   3068 C CG  . ASP B 1 112 ? 40.684 58.680  9.133  1.00 13.79 ? 112 ASP B CG  1 
ATOM   3069 O OD1 . ASP B 1 112 ? 40.470 58.772  7.903  1.00 18.85 ? 112 ASP B OD1 1 
ATOM   3070 O OD2 . ASP B 1 112 ? 40.258 59.524  9.945  1.00 18.37 ? 112 ASP B OD2 1 
ATOM   3071 N N   . ALA B 1 113 ? 44.060 59.359  8.234  1.00 5.58  ? 113 ALA B N   1 
ATOM   3072 C CA  . ALA B 1 113 ? 44.853 60.578  8.362  1.00 4.74  ? 113 ALA B CA  1 
ATOM   3073 C C   . ALA B 1 113 ? 44.201 61.672  9.210  1.00 6.41  ? 113 ALA B C   1 
ATOM   3074 O O   . ALA B 1 113 ? 44.901 62.398  9.918  1.00 4.51  ? 113 ALA B O   1 
ATOM   3075 C CB  . ALA B 1 113 ? 45.191 61.123  6.989  1.00 1.77  ? 113 ALA B CB  1 
ATOM   3076 N N   . PHE B 1 114 ? 42.875 61.797  9.143  1.00 7.71  ? 114 PHE B N   1 
ATOM   3077 C CA  . PHE B 1 114 ? 42.178 62.815  9.925  1.00 7.48  ? 114 PHE B CA  1 
ATOM   3078 C C   . PHE B 1 114 ? 42.323 62.525  11.412 1.00 8.85  ? 114 PHE B C   1 
ATOM   3079 O O   . PHE B 1 114 ? 42.519 63.438  12.224 1.00 8.72  ? 114 PHE B O   1 
ATOM   3080 C CB  . PHE B 1 114 ? 40.688 62.851  9.576  1.00 8.00  ? 114 PHE B CB  1 
ATOM   3081 C CG  . PHE B 1 114 ? 39.845 63.552  10.615 1.00 7.20  ? 114 PHE B CG  1 
ATOM   3082 C CD1 . PHE B 1 114 ? 40.033 64.907  10.880 1.00 6.89  ? 114 PHE B CD1 1 
ATOM   3083 C CD2 . PHE B 1 114 ? 38.921 62.843  11.374 1.00 5.29  ? 114 PHE B CD2 1 
ATOM   3084 C CE1 . PHE B 1 114 ? 39.316 65.544  11.890 1.00 8.54  ? 114 PHE B CE1 1 
ATOM   3085 C CE2 . PHE B 1 114 ? 38.201 63.468  12.383 1.00 6.54  ? 114 PHE B CE2 1 
ATOM   3086 C CZ  . PHE B 1 114 ? 38.402 64.827  12.644 1.00 7.03  ? 114 PHE B CZ  1 
ATOM   3087 N N   . GLU B 1 115 ? 42.201 61.248  11.753 1.00 9.17  ? 115 GLU B N   1 
ATOM   3088 C CA  . GLU B 1 115 ? 42.311 60.797  13.129 1.00 9.38  ? 115 GLU B CA  1 
ATOM   3089 C C   . GLU B 1 115 ? 43.700 61.106  13.641 1.00 9.90  ? 115 GLU B C   1 
ATOM   3090 O O   . GLU B 1 115 ? 43.872 61.730  14.689 1.00 9.86  ? 115 GLU B O   1 
ATOM   3091 C CB  . GLU B 1 115 ? 42.089 59.286  13.231 1.00 8.36  ? 115 GLU B CB  1 
ATOM   3092 C CG  . GLU B 1 115 ? 42.242 58.785  14.663 1.00 9.02  ? 115 GLU B CG  1 
ATOM   3093 C CD  . GLU B 1 115 ? 42.208 57.273  14.798 1.00 9.24  ? 115 GLU B CD  1 
ATOM   3094 O OE1 . GLU B 1 115 ? 41.284 56.636  14.247 1.00 6.66  ? 115 GLU B OE1 1 
ATOM   3095 O OE2 . GLU B 1 115 ? 43.101 56.724  15.480 1.00 9.14  ? 115 GLU B OE2 1 
ATOM   3096 N N   . GLN B 1 116 ? 44.696 60.657  12.889 1.00 9.32  ? 116 GLN B N   1 
ATOM   3097 C CA  . GLN B 1 116 ? 46.072 60.858  13.289 1.00 8.25  ? 116 GLN B CA  1 
ATOM   3098 C C   . GLN B 1 116 ? 46.342 62.348  13.456 1.00 7.47  ? 116 GLN B C   1 
ATOM   3099 O O   . GLN B 1 116 ? 47.091 62.758  14.350 1.00 6.93  ? 116 GLN B O   1 
ATOM   3100 C CB  . GLN B 1 116 ? 47.020 60.233  12.264 1.00 8.25  ? 116 GLN B CB  1 
ATOM   3101 C CG  . GLN B 1 116 ? 48.402 59.957  12.827 1.00 8.57  ? 116 GLN B CG  1 
ATOM   3102 C CD  . GLN B 1 116 ? 48.370 59.100  14.086 1.00 9.58  ? 116 GLN B CD  1 
ATOM   3103 O OE1 . GLN B 1 116 ? 49.181 59.290  14.987 1.00 13.19 ? 116 GLN B OE1 1 
ATOM   3104 N NE2 . GLN B 1 116 ? 47.444 58.146  14.146 1.00 8.42  ? 116 GLN B NE2 1 
ATOM   3105 N N   . GLY B 1 117 ? 45.718 63.156  12.607 1.00 6.15  ? 117 GLY B N   1 
ATOM   3106 C CA  . GLY B 1 117 ? 45.891 64.593  12.708 1.00 2.94  ? 117 GLY B CA  1 
ATOM   3107 C C   . GLY B 1 117 ? 45.365 65.027  14.063 1.00 3.15  ? 117 GLY B C   1 
ATOM   3108 O O   . GLY B 1 117 ? 46.012 65.785  14.796 1.00 2.36  ? 117 GLY B O   1 
ATOM   3109 N N   . VAL B 1 118 ? 44.183 64.529  14.398 1.00 1.13  ? 118 VAL B N   1 
ATOM   3110 C CA  . VAL B 1 118 ? 43.562 64.845  15.672 1.00 4.46  ? 118 VAL B CA  1 
ATOM   3111 C C   . VAL B 1 118 ? 44.485 64.430  16.816 1.00 5.54  ? 118 VAL B C   1 
ATOM   3112 O O   . VAL B 1 118 ? 44.656 65.167  17.784 1.00 7.30  ? 118 VAL B O   1 
ATOM   3113 C CB  . VAL B 1 118 ? 42.198 64.117  15.821 1.00 4.22  ? 118 VAL B CB  1 
ATOM   3114 C CG1 . VAL B 1 118 ? 41.668 64.265  17.238 1.00 3.93  ? 118 VAL B CG1 1 
ATOM   3115 C CG2 . VAL B 1 118 ? 41.199 64.677  14.824 1.00 3.64  ? 118 VAL B CG2 1 
ATOM   3116 N N   . ARG B 1 119 ? 45.087 63.253  16.695 1.00 6.75  ? 119 ARG B N   1 
ATOM   3117 C CA  . ARG B 1 119 ? 45.982 62.752  17.730 1.00 9.05  ? 119 ARG B CA  1 
ATOM   3118 C C   . ARG B 1 119 ? 47.217 63.617  17.908 1.00 8.91  ? 119 ARG B C   1 
ATOM   3119 O O   . ARG B 1 119 ? 47.568 63.979  19.028 1.00 9.58  ? 119 ARG B O   1 
ATOM   3120 C CB  . ARG B 1 119 ? 46.423 61.325  17.413 1.00 10.11 ? 119 ARG B CB  1 
ATOM   3121 C CG  . ARG B 1 119 ? 45.287 60.329  17.350 1.00 11.08 ? 119 ARG B CG  1 
ATOM   3122 C CD  . ARG B 1 119 ? 45.821 58.908  17.379 1.00 11.30 ? 119 ARG B CD  1 
ATOM   3123 N NE  . ARG B 1 119 ? 44.727 57.951  17.435 1.00 13.97 ? 119 ARG B NE  1 
ATOM   3124 C CZ  . ARG B 1 119 ? 44.786 56.781  18.062 1.00 14.24 ? 119 ARG B CZ  1 
ATOM   3125 N NH1 . ARG B 1 119 ? 45.896 56.416  18.694 1.00 10.76 ? 119 ARG B NH1 1 
ATOM   3126 N NH2 . ARG B 1 119 ? 43.728 55.979  18.058 1.00 13.61 ? 119 ARG B NH2 1 
ATOM   3127 N N   . ALA B 1 120 ? 47.879 63.931  16.798 1.00 8.28  ? 120 ALA B N   1 
ATOM   3128 C CA  . ALA B 1 120 ? 49.084 64.747  16.823 1.00 8.49  ? 120 ALA B CA  1 
ATOM   3129 C C   . ALA B 1 120 ? 48.857 66.035  17.610 1.00 9.86  ? 120 ALA B C   1 
ATOM   3130 O O   . ALA B 1 120 ? 49.716 66.457  18.383 1.00 10.32 ? 120 ALA B O   1 
ATOM   3131 C CB  . ALA B 1 120 ? 49.521 65.072  15.398 1.00 8.84  ? 120 ALA B CB  1 
ATOM   3132 N N   . ILE B 1 121 ? 47.702 66.659  17.407 1.00 9.66  ? 121 ILE B N   1 
ATOM   3133 C CA  . ILE B 1 121 ? 47.383 67.891  18.105 1.00 9.04  ? 121 ILE B CA  1 
ATOM   3134 C C   . ILE B 1 121 ? 47.191 67.594  19.591 1.00 10.23 ? 121 ILE B C   1 
ATOM   3135 O O   . ILE B 1 121 ? 47.647 68.358  20.446 1.00 9.66  ? 121 ILE B O   1 
ATOM   3136 C CB  . ILE B 1 121 ? 46.107 68.536  17.528 1.00 8.97  ? 121 ILE B CB  1 
ATOM   3137 C CG1 . ILE B 1 121 ? 46.370 68.994  16.097 1.00 8.17  ? 121 ILE B CG1 1 
ATOM   3138 C CG2 . ILE B 1 121 ? 45.689 69.731  18.371 1.00 7.78  ? 121 ILE B CG2 1 
ATOM   3139 C CD1 . ILE B 1 121 ? 45.145 69.538  15.392 1.00 8.37  ? 121 ILE B CD1 1 
ATOM   3140 N N   . LEU B 1 122 ? 46.493 66.463  19.860 1.00 8.57  ? 122 LEU B N   1 
ATOM   3141 C CA  . LEU B 1 122 ? 46.306 66.115  21.276 1.00 8.08  ? 122 LEU B CA  1 
ATOM   3142 C C   . LEU B 1 122 ? 47.601 65.802  21.985 1.00 9.90  ? 122 LEU B C   1 
ATOM   3143 O O   . LEU B 1 122 ? 47.752 65.939  23.210 1.00 9.66  ? 122 LEU B O   1 
ATOM   3144 C CB  . LEU B 1 122 ? 45.266 65.019  21.388 1.00 6.44  ? 122 LEU B CB  1 
ATOM   3145 C CG  . LEU B 1 122 ? 43.828 65.372  20.936 1.00 7.80  ? 122 LEU B CG  1 
ATOM   3146 C CD1 . LEU B 1 122 ? 42.938 64.148  21.194 1.00 4.01  ? 122 LEU B CD1 1 
ATOM   3147 C CD2 . LEU B 1 122 ? 43.335 66.500  21.860 1.00 7.68  ? 122 LEU B CD2 1 
ATOM   3148 N N   . GLY B 1 123 ? 48.521 65.186  21.245 1.00 12.41 ? 123 GLY B N   1 
ATOM   3149 C CA  . GLY B 1 123 ? 49.844 64.799  21.638 1.00 14.22 ? 123 GLY B CA  1 
ATOM   3150 C C   . GLY B 1 123 ? 50.786 65.938  21.948 1.00 15.39 ? 123 GLY B C   1 
ATOM   3151 O O   . GLY B 1 123 ? 51.836 65.752  22.577 1.00 16.85 ? 123 GLY B O   1 
ATOM   3152 N N   . GLN B 1 124 ? 50.343 67.160  21.637 1.00 15.97 ? 124 GLN B N   1 
ATOM   3153 C CA  . GLN B 1 124 ? 51.102 68.341  21.987 1.00 17.74 ? 124 GLN B CA  1 
ATOM   3154 C C   . GLN B 1 124 ? 51.136 68.582  23.518 1.00 18.34 ? 124 GLN B C   1 
ATOM   3155 O O   . GLN B 1 124 ? 50.080 68.531  24.153 1.00 19.34 ? 124 GLN B O   1 
ATOM   3156 C CB  . GLN B 1 124 ? 50.498 69.620  21.372 1.00 17.14 ? 124 GLN B CB  1 
ATOM   3157 C CG  . GLN B 1 124 ? 50.328 69.655  19.885 1.00 17.72 ? 124 GLN B CG  1 
ATOM   3158 C CD  . GLN B 1 124 ? 49.648 70.949  19.429 1.00 15.31 ? 124 GLN B CD  1 
ATOM   3159 O OE1 . GLN B 1 124 ? 48.968 71.603  20.227 1.00 13.03 ? 124 GLN B OE1 1 
ATOM   3160 N NE2 . GLN B 1 124 ? 49.809 71.304  18.171 1.00 13.29 ? 124 GLN B NE2 1 
ATOM   3161 N N   . LEU B 1 125 ? 52.356 68.598  23.996 1.00 19.35 ? 125 LEU B N   1 
ATOM   3162 C CA  . LEU B 1 125 ? 52.770 69.208  25.293 1.00 20.42 ? 125 LEU B CA  1 
ATOM   3163 C C   . LEU B 1 125 ? 52.304 68.314  26.399 1.00 18.26 ? 125 LEU B C   1 
ATOM   3164 O O   . LEU B 1 125 ? 52.367 68.531  27.592 1.00 18.84 ? 125 LEU B O   1 
ATOM   3165 C CB  . LEU B 1 125 ? 52.333 70.642  25.391 1.00 21.38 ? 125 LEU B CB  1 
ATOM   3166 C CG  . LEU B 1 125 ? 51.334 71.166  26.375 1.00 23.11 ? 125 LEU B CG  1 
ATOM   3167 C CD1 . LEU B 1 125 ? 51.111 72.657  26.270 1.00 22.17 ? 125 LEU B CD1 1 
ATOM   3168 C CD2 . LEU B 1 125 ? 50.055 70.409  26.503 1.00 23.60 ? 125 LEU B CD2 1 
ATOM   3169 N N   . VAL B 1 126 ? 52.177 67.048  25.971 1.00 17.03 ? 126 VAL B N   1 
ATOM   3170 C CA  . VAL B 1 126 ? 51.784 66.045  26.983 1.00 13.90 ? 126 VAL B CA  1 
ATOM   3171 C C   . VAL B 1 126 ? 52.460 64.726  26.752 1.00 12.75 ? 126 VAL B C   1 
ATOM   3172 O O   . VAL B 1 126 ? 52.962 64.421  25.667 1.00 11.88 ? 126 VAL B O   1 
ATOM   3173 C CB  . VAL B 1 126 ? 50.268 65.883  27.071 1.00 11.96 ? 126 VAL B CB  1 
ATOM   3174 C CG1 . VAL B 1 126 ? 49.579 67.126  27.588 1.00 12.31 ? 126 VAL B CG1 1 
ATOM   3175 C CG2 . VAL B 1 126 ? 49.640 65.380  25.794 1.00 11.40 ? 126 VAL B CG2 1 
ATOM   3176 N N   . SER B 1 127 ? 52.426 63.859  27.740 1.00 12.27 ? 127 SER B N   1 
ATOM   3177 C CA  . SER B 1 127 ? 53.034 62.544  27.607 1.00 12.01 ? 127 SER B CA  1 
ATOM   3178 C C   . SER B 1 127 ? 52.106 61.567  26.912 1.00 11.66 ? 127 SER B C   1 
ATOM   3179 O O   . SER B 1 127 ? 50.889 61.751  26.890 1.00 10.46 ? 127 SER B O   1 
ATOM   3180 C CB  . SER B 1 127 ? 53.389 61.979  28.982 1.00 12.44 ? 127 SER B CB  1 
ATOM   3181 O OG  . SER B 1 127 ? 52.216 61.662  29.711 1.00 12.02 ? 127 SER B OG  1 
ATOM   3182 N N   . VAL B 1 128 ? 52.699 60.511  26.370 1.00 10.69 ? 128 VAL B N   1 
ATOM   3183 C CA  . VAL B 1 128 ? 51.962 59.470  25.682 1.00 10.55 ? 128 VAL B CA  1 
ATOM   3184 C C   . VAL B 1 128 ? 50.716 59.041  26.450 1.00 12.17 ? 128 VAL B C   1 
ATOM   3185 O O   . VAL B 1 128 ? 49.641 58.914  25.870 1.00 13.22 ? 128 VAL B O   1 
ATOM   3186 C CB  . VAL B 1 128 ? 52.863 58.245  25.456 1.00 10.12 ? 128 VAL B CB  1 
ATOM   3187 C CG1 . VAL B 1 128 ? 52.044 57.077  24.957 1.00 6.81  ? 128 VAL B CG1 1 
ATOM   3188 C CG2 . VAL B 1 128 ? 53.954 58.598  24.460 1.00 10.62 ? 128 VAL B CG2 1 
ATOM   3189 N N   . ALA B 1 129 ? 50.862 58.826  27.755 1.00 13.36 ? 129 ALA B N   1 
ATOM   3190 C CA  . ALA B 1 129 ? 49.744 58.396  28.589 1.00 12.89 ? 129 ALA B CA  1 
ATOM   3191 C C   . ALA B 1 129 ? 48.648 59.456  28.714 1.00 13.38 ? 129 ALA B C   1 
ATOM   3192 O O   . ALA B 1 129 ? 47.467 59.141  28.574 1.00 11.40 ? 129 ALA B O   1 
ATOM   3193 C CB  . ALA B 1 129 ? 50.250 57.990  29.971 1.00 12.50 ? 129 ALA B CB  1 
ATOM   3194 N N   . MET B 1 130 ? 49.030 60.706  28.974 1.00 14.67 ? 130 MET B N   1 
ATOM   3195 C CA  . MET B 1 130 ? 48.037 61.776  29.099 1.00 16.40 ? 130 MET B CA  1 
ATOM   3196 C C   . MET B 1 130 ? 47.300 61.965  27.776 1.00 13.77 ? 130 MET B C   1 
ATOM   3197 O O   . MET B 1 130 ? 46.077 62.104  27.753 1.00 13.53 ? 130 MET B O   1 
ATOM   3198 C CB  . MET B 1 130 ? 48.697 63.093  29.528 1.00 20.91 ? 130 MET B CB  1 
ATOM   3199 C CG  . MET B 1 130 ? 49.400 63.015  30.878 1.00 27.44 ? 130 MET B CG  1 
ATOM   3200 S SD  . MET B 1 130 ? 49.525 64.617  31.723 1.00 37.47 ? 130 MET B SD  1 
ATOM   3201 C CE  . MET B 1 130 ? 47.825 64.827  32.326 1.00 33.71 ? 130 MET B CE  1 
ATOM   3202 N N   . ALA B 1 131 ? 48.050 61.959  26.679 1.00 11.85 ? 131 ALA B N   1 
ATOM   3203 C CA  . ALA B 1 131 ? 47.466 62.101  25.349 1.00 11.06 ? 131 ALA B CA  1 
ATOM   3204 C C   . ALA B 1 131 ? 46.384 61.033  25.116 1.00 8.88  ? 131 ALA B C   1 
ATOM   3205 O O   . ALA B 1 131 ? 45.261 61.362  24.733 1.00 6.39  ? 131 ALA B O   1 
ATOM   3206 C CB  . ALA B 1 131 ? 48.565 62.003  24.274 1.00 11.06 ? 131 ALA B CB  1 
ATOM   3207 N N   . ALA B 1 132 ? 46.724 59.768  25.363 1.00 8.00  ? 132 ALA B N   1 
ATOM   3208 C CA  . ALA B 1 132 ? 45.789 58.649  25.190 1.00 8.57  ? 132 ALA B CA  1 
ATOM   3209 C C   . ALA B 1 132 ? 44.549 58.842  26.045 1.00 9.44  ? 132 ALA B C   1 
ATOM   3210 O O   . ALA B 1 132 ? 43.425 58.556  25.619 1.00 9.75  ? 132 ALA B O   1 
ATOM   3211 C CB  . ALA B 1 132 ? 46.467 57.331  25.572 1.00 7.71  ? 132 ALA B CB  1 
ATOM   3212 N N   . LYS B 1 133 ? 44.771 59.311  27.267 1.00 10.54 ? 133 LYS B N   1 
ATOM   3213 C CA  . LYS B 1 133 ? 43.698 59.559  28.213 1.00 12.32 ? 133 LYS B CA  1 
ATOM   3214 C C   . LYS B 1 133 ? 42.771 60.627  27.652 1.00 13.27 ? 133 LYS B C   1 
ATOM   3215 O O   . LYS B 1 133 ? 41.558 60.448  27.611 1.00 12.76 ? 133 LYS B O   1 
ATOM   3216 C CB  . LYS B 1 133 ? 44.285 60.026  29.543 1.00 14.18 ? 133 LYS B CB  1 
ATOM   3217 C CG  . LYS B 1 133 ? 43.255 60.448  30.559 1.00 16.92 ? 133 LYS B CG  1 
ATOM   3218 C CD  . LYS B 1 133 ? 43.914 61.096  31.758 1.00 20.60 ? 133 LYS B CD  1 
ATOM   3219 C CE  . LYS B 1 133 ? 42.889 61.433  32.825 1.00 22.32 ? 133 LYS B CE  1 
ATOM   3220 N NZ  . LYS B 1 133 ? 43.517 62.178  33.949 1.00 25.25 ? 133 LYS B NZ  1 
ATOM   3221 N N   . LEU B 1 134 ? 43.353 61.740  27.214 1.00 14.92 ? 134 LEU B N   1 
ATOM   3222 C CA  . LEU B 1 134 ? 42.577 62.838  26.654 1.00 14.67 ? 134 LEU B CA  1 
ATOM   3223 C C   . LEU B 1 134 ? 41.784 62.388  25.427 1.00 14.76 ? 134 LEU B C   1 
ATOM   3224 O O   . LEU B 1 134 ? 40.561 62.581  25.360 1.00 15.31 ? 134 LEU B O   1 
ATOM   3225 C CB  . LEU B 1 134 ? 43.508 63.998  26.286 1.00 15.55 ? 134 LEU B CB  1 
ATOM   3226 C CG  . LEU B 1 134 ? 42.926 65.246  25.605 1.00 18.57 ? 134 LEU B CG  1 
ATOM   3227 C CD1 . LEU B 1 134 ? 41.731 65.788  26.393 1.00 18.80 ? 134 LEU B CD1 1 
ATOM   3228 C CD2 . LEU B 1 134 ? 44.014 66.311  25.498 1.00 18.27 ? 134 LEU B CD2 1 
ATOM   3229 N N   . THR B 1 135 ? 42.478 61.783  24.462 1.00 13.33 ? 135 THR B N   1 
ATOM   3230 C CA  . THR B 1 135 ? 41.842 61.303  23.234 1.00 11.18 ? 135 THR B CA  1 
ATOM   3231 C C   . THR B 1 135 ? 40.635 60.413  23.542 1.00 12.33 ? 135 THR B C   1 
ATOM   3232 O O   . THR B 1 135 ? 39.625 60.443  22.836 1.00 10.31 ? 135 THR B O   1 
ATOM   3233 C CB  . THR B 1 135 ? 42.836 60.494  22.371 1.00 10.57 ? 135 THR B CB  1 
ATOM   3234 O OG1 . THR B 1 135 ? 43.962 61.313  22.034 1.00 10.47 ? 135 THR B OG1 1 
ATOM   3235 C CG2 . THR B 1 135 ? 42.165 60.024  21.074 1.00 10.75 ? 135 THR B CG2 1 
ATOM   3236 N N   . ALA B 1 136 ? 40.742 59.624  24.604 1.00 11.87 ? 136 ALA B N   1 
ATOM   3237 C CA  . ALA B 1 136 ? 39.652 58.738  24.972 1.00 11.00 ? 136 ALA B CA  1 
ATOM   3238 C C   . ALA B 1 136 ? 38.422 59.539  25.375 1.00 9.86  ? 136 ALA B C   1 
ATOM   3239 O O   . ALA B 1 136 ? 37.289 59.175  25.041 1.00 9.33  ? 136 ALA B O   1 
ATOM   3240 C CB  . ALA B 1 136 ? 40.081 57.817  26.110 1.00 8.24  ? 136 ALA B CB  1 
ATOM   3241 N N   . ARG B 1 137 ? 38.647 60.631  26.094 1.00 9.33  ? 137 ARG B N   1 
ATOM   3242 C CA  . ARG B 1 137 ? 37.548 61.488  26.543 1.00 10.81 ? 137 ARG B CA  1 
ATOM   3243 C C   . ARG B 1 137 ? 36.842 62.097  25.344 1.00 9.49  ? 137 ARG B C   1 
ATOM   3244 O O   . ARG B 1 137 ? 35.613 62.090  25.244 1.00 5.79  ? 137 ARG B O   1 
ATOM   3245 C CB  . ARG B 1 137 ? 38.083 62.595  27.449 1.00 10.93 ? 137 ARG B CB  1 
ATOM   3246 C CG  . ARG B 1 137 ? 38.662 62.030  28.720 1.00 14.84 ? 137 ARG B CG  1 
ATOM   3247 C CD  . ARG B 1 137 ? 39.135 63.082  29.699 1.00 19.13 ? 137 ARG B CD  1 
ATOM   3248 N NE  . ARG B 1 137 ? 39.196 62.500  31.036 1.00 24.29 ? 137 ARG B NE  1 
ATOM   3249 C CZ  . ARG B 1 137 ? 39.598 63.143  32.128 1.00 27.85 ? 137 ARG B CZ  1 
ATOM   3250 N NH1 . ARG B 1 137 ? 39.991 64.410  32.054 1.00 28.86 ? 137 ARG B NH1 1 
ATOM   3251 N NH2 . ARG B 1 137 ? 39.593 62.517  33.304 1.00 30.34 ? 137 ARG B NH2 1 
ATOM   3252 N N   . VAL B 1 138 ? 37.636 62.619  24.424 1.00 9.31  ? 138 VAL B N   1 
ATOM   3253 C CA  . VAL B 1 138 ? 37.083 63.220  23.240 1.00 11.22 ? 138 VAL B CA  1 
ATOM   3254 C C   . VAL B 1 138 ? 36.244 62.212  22.460 1.00 10.02 ? 138 VAL B C   1 
ATOM   3255 O O   . VAL B 1 138 ? 35.129 62.520  22.052 1.00 9.95  ? 138 VAL B O   1 
ATOM   3256 C CB  . VAL B 1 138 ? 38.205 63.767  22.384 1.00 12.21 ? 138 VAL B CB  1 
ATOM   3257 C CG1 . VAL B 1 138 ? 37.629 64.532  21.207 1.00 14.40 ? 138 VAL B CG1 1 
ATOM   3258 C CG2 . VAL B 1 138 ? 39.086 64.670  23.240 1.00 12.98 ? 138 VAL B CG2 1 
ATOM   3259 N N   . ALA B 1 139 ? 36.773 61.007  22.272 1.00 9.44  ? 139 ALA B N   1 
ATOM   3260 C CA  . ALA B 1 139 ? 36.057 59.962  21.541 1.00 8.16  ? 139 ALA B CA  1 
ATOM   3261 C C   . ALA B 1 139 ? 34.849 59.473  22.320 1.00 7.79  ? 139 ALA B C   1 
ATOM   3262 O O   . ALA B 1 139 ? 33.862 59.016  21.747 1.00 6.63  ? 139 ALA B O   1 
ATOM   3263 C CB  . ALA B 1 139 ? 36.988 58.788  21.261 1.00 5.11  ? 139 ALA B CB  1 
ATOM   3264 N N   . GLN B 1 140 ? 34.941 59.558  23.638 1.00 10.13 ? 140 GLN B N   1 
ATOM   3265 C CA  . GLN B 1 140 ? 33.864 59.113  24.505 1.00 11.92 ? 140 GLN B CA  1 
ATOM   3266 C C   . GLN B 1 140 ? 32.659 60.035  24.342 1.00 11.25 ? 140 GLN B C   1 
ATOM   3267 O O   . GLN B 1 140 ? 31.508 59.597  24.348 1.00 12.52 ? 140 GLN B O   1 
ATOM   3268 C CB  . GLN B 1 140 ? 34.363 59.111  25.956 1.00 14.78 ? 140 GLN B CB  1 
ATOM   3269 C CG  . GLN B 1 140 ? 33.392 58.553  26.974 1.00 20.23 ? 140 GLN B CG  1 
ATOM   3270 C CD  . GLN B 1 140 ? 33.112 57.067  26.808 1.00 20.60 ? 140 GLN B CD  1 
ATOM   3271 O OE1 . GLN B 1 140 ? 32.119 56.560  27.327 1.00 22.88 ? 140 GLN B OE1 1 
ATOM   3272 N NE2 . GLN B 1 140 ? 33.987 56.362  26.097 1.00 21.89 ? 140 GLN B NE2 1 
ATOM   3273 N N   . LEU B 1 141 ? 32.942 61.315  24.156 1.00 12.06 ? 141 LEU B N   1 
ATOM   3274 C CA  . LEU B 1 141 ? 31.910 62.331  24.008 1.00 12.35 ? 141 LEU B CA  1 
ATOM   3275 C C   . LEU B 1 141 ? 31.460 62.614  22.556 1.00 12.64 ? 141 LEU B C   1 
ATOM   3276 O O   . LEU B 1 141 ? 30.296 62.961  22.316 1.00 8.93  ? 141 LEU B O   1 
ATOM   3277 C CB  . LEU B 1 141 ? 32.406 63.626  24.643 1.00 11.64 ? 141 LEU B CB  1 
ATOM   3278 C CG  . LEU B 1 141 ? 31.351 64.713  24.807 1.00 13.47 ? 141 LEU B CG  1 
ATOM   3279 C CD1 . LEU B 1 141 ? 30.386 64.298  25.907 1.00 10.47 ? 141 LEU B CD1 1 
ATOM   3280 C CD2 . LEU B 1 141 ? 32.017 66.040  25.127 1.00 11.11 ? 141 LEU B CD2 1 
ATOM   3281 N N   . TYR B 1 142 ? 32.379 62.476  21.601 1.00 13.30 ? 142 TYR B N   1 
ATOM   3282 C CA  . TYR B 1 142 ? 32.074 62.742  20.194 1.00 14.92 ? 142 TYR B CA  1 
ATOM   3283 C C   . TYR B 1 142 ? 32.048 61.519  19.276 1.00 17.69 ? 142 TYR B C   1 
ATOM   3284 O O   . TYR B 1 142 ? 31.764 61.639  18.083 1.00 17.65 ? 142 TYR B O   1 
ATOM   3285 C CB  . TYR B 1 142 ? 33.062 63.772  19.645 1.00 13.42 ? 142 TYR B CB  1 
ATOM   3286 C CG  . TYR B 1 142 ? 32.953 65.115  20.326 1.00 14.09 ? 142 TYR B CG  1 
ATOM   3287 C CD1 . TYR B 1 142 ? 31.814 65.912  20.168 1.00 14.95 ? 142 TYR B CD1 1 
ATOM   3288 C CD2 . TYR B 1 142 ? 33.960 65.568  21.173 1.00 14.53 ? 142 TYR B CD2 1 
ATOM   3289 C CE1 . TYR B 1 142 ? 31.683 67.128  20.846 1.00 14.50 ? 142 TYR B CE1 1 
ATOM   3290 C CE2 . TYR B 1 142 ? 33.846 66.777  21.852 1.00 15.27 ? 142 TYR B CE2 1 
ATOM   3291 C CZ  . TYR B 1 142 ? 32.707 67.550  21.687 1.00 15.39 ? 142 TYR B CZ  1 
ATOM   3292 O OH  . TYR B 1 142 ? 32.604 68.735  22.370 1.00 15.82 ? 142 TYR B OH  1 
ATOM   3293 N N   . GLY B 1 143 ? 32.347 60.344  19.825 1.00 20.22 ? 143 GLY B N   1 
ATOM   3294 C CA  . GLY B 1 143 ? 32.329 59.135  19.021 1.00 21.80 ? 143 GLY B CA  1 
ATOM   3295 C C   . GLY B 1 143 ? 31.021 58.374  19.173 1.00 23.96 ? 143 GLY B C   1 
ATOM   3296 O O   . GLY B 1 143 ? 30.267 58.614  20.119 1.00 23.92 ? 143 GLY B O   1 
ATOM   3297 N N   . GLU B 1 144 ? 30.745 57.462  18.239 1.00 25.54 ? 144 GLU B N   1 
ATOM   3298 C CA  . GLU B 1 144 ? 29.524 56.656  18.276 1.00 26.00 ? 144 GLU B CA  1 
ATOM   3299 C C   . GLU B 1 144 ? 29.857 55.172  18.410 1.00 25.69 ? 144 GLU B C   1 
ATOM   3300 O O   . GLU B 1 144 ? 30.779 54.674  17.770 1.00 24.72 ? 144 GLU B O   1 
ATOM   3301 C CB  . GLU B 1 144 ? 28.692 56.888  17.009 1.00 27.69 ? 144 GLU B CB  1 
ATOM   3302 C CG  . GLU B 1 144 ? 29.386 56.488  15.715 1.00 28.64 ? 144 GLU B CG  1 
ATOM   3303 C CD  . GLU B 1 144 ? 28.496 56.676  14.495 1.00 30.30 ? 144 GLU B CD  1 
ATOM   3304 O OE1 . GLU B 1 144 ? 28.126 57.835  14.201 1.00 30.42 ? 144 GLU B OE1 1 
ATOM   3305 O OE2 . GLU B 1 144 ? 28.166 55.666  13.833 1.00 30.49 ? 144 GLU B OE2 1 
ATOM   3306 N N   . ARG B 1 145 ? 29.094 54.474  19.245 1.00 26.18 ? 145 ARG B N   1 
ATOM   3307 C CA  . ARG B 1 145 ? 29.312 53.055  19.483 1.00 24.84 ? 145 ARG B CA  1 
ATOM   3308 C C   . ARG B 1 145 ? 28.863 52.207  18.307 1.00 24.34 ? 145 ARG B C   1 
ATOM   3309 O O   . ARG B 1 145 ? 28.059 52.643  17.481 1.00 24.21 ? 145 ARG B O   1 
ATOM   3310 C CB  . ARG B 1 145 ? 28.558 52.612  20.739 1.00 25.86 ? 145 ARG B CB  1 
ATOM   3311 C CG  . ARG B 1 145 ? 28.774 53.516  21.944 1.00 28.61 ? 145 ARG B CG  1 
ATOM   3312 C CD  . ARG B 1 145 ? 28.321 52.831  23.222 1.00 30.35 ? 145 ARG B CD  1 
ATOM   3313 N NE  . ARG B 1 145 ? 29.285 51.819  23.646 1.00 32.61 ? 145 ARG B NE  1 
ATOM   3314 C CZ  . ARG B 1 145 ? 30.332 52.066  24.428 1.00 31.51 ? 145 ARG B CZ  1 
ATOM   3315 N NH1 . ARG B 1 145 ? 30.547 53.292  24.883 1.00 32.89 ? 145 ARG B NH1 1 
ATOM   3316 N NH2 . ARG B 1 145 ? 31.174 51.092  24.744 1.00 30.91 ? 145 ARG B NH2 1 
ATOM   3317 N N   . LEU B 1 146 ? 29.398 50.994  18.231 1.00 23.70 ? 146 LEU B N   1 
ATOM   3318 C CA  . LEU B 1 146 ? 29.029 50.073  17.169 1.00 23.33 ? 146 LEU B CA  1 
ATOM   3319 C C   . LEU B 1 146 ? 27.829 49.273  17.657 1.00 24.58 ? 146 LEU B C   1 
ATOM   3320 O O   . LEU B 1 146 ? 27.836 48.742  18.770 1.00 23.20 ? 146 LEU B O   1 
ATOM   3321 C CB  . LEU B 1 146 ? 30.184 49.119  16.840 1.00 21.55 ? 146 LEU B CB  1 
ATOM   3322 C CG  . LEU B 1 146 ? 31.445 49.659  16.160 1.00 18.90 ? 146 LEU B CG  1 
ATOM   3323 C CD1 . LEU B 1 146 ? 32.439 48.524  15.997 1.00 18.38 ? 146 LEU B CD1 1 
ATOM   3324 C CD2 . LEU B 1 146 ? 31.101 50.264  14.806 1.00 17.85 ? 146 LEU B CD2 1 
ATOM   3325 N N   . ASP B 1 147 ? 26.801 49.197  16.818 1.00 26.29 ? 147 ASP B N   1 
ATOM   3326 C CA  . ASP B 1 147 ? 25.586 48.465  17.150 1.00 27.60 ? 147 ASP B CA  1 
ATOM   3327 C C   . ASP B 1 147 ? 25.860 46.997  17.465 1.00 27.31 ? 147 ASP B C   1 
ATOM   3328 O O   . ASP B 1 147 ? 25.520 46.514  18.543 1.00 28.27 ? 147 ASP B O   1 
ATOM   3329 C CB  . ASP B 1 147 ? 24.571 48.568  15.998 1.00 28.10 ? 147 ASP B CB  1 
ATOM   3330 C CG  . ASP B 1 147 ? 24.065 49.992  15.782 1.00 30.45 ? 147 ASP B CG  1 
ATOM   3331 O OD1 . ASP B 1 147 ? 23.667 50.639  16.776 1.00 28.33 ? 147 ASP B OD1 1 
ATOM   3332 O OD2 . ASP B 1 147 ? 24.050 50.459  14.619 1.00 31.00 ? 147 ASP B OD2 1 
ATOM   3333 N N   . ASP B 1 148 ? 26.485 46.292  16.528 1.00 28.09 ? 148 ASP B N   1 
ATOM   3334 C CA  . ASP B 1 148 ? 26.769 44.873  16.719 1.00 28.98 ? 148 ASP B CA  1 
ATOM   3335 C C   . ASP B 1 148 ? 27.934 44.559  17.659 1.00 27.53 ? 148 ASP B C   1 
ATOM   3336 O O   . ASP B 1 148 ? 28.131 43.409  18.045 1.00 25.66 ? 148 ASP B O   1 
ATOM   3337 C CB  . ASP B 1 148 ? 26.968 44.180  15.357 1.00 31.50 ? 148 ASP B CB  1 
ATOM   3338 C CG  . ASP B 1 148 ? 27.996 44.878  14.472 1.00 35.46 ? 148 ASP B CG  1 
ATOM   3339 O OD1 . ASP B 1 148 ? 27.900 46.113  14.291 1.00 37.61 ? 148 ASP B OD1 1 
ATOM   3340 O OD2 . ASP B 1 148 ? 28.890 44.182  13.936 1.00 37.51 ? 148 ASP B OD2 1 
ATOM   3341 N N   . PHE B 1 149 ? 28.694 45.583  18.033 1.00 27.56 ? 149 PHE B N   1 
ATOM   3342 C CA  . PHE B 1 149 ? 29.825 45.413  18.946 1.00 27.31 ? 149 PHE B CA  1 
ATOM   3343 C C   . PHE B 1 149 ? 29.835 46.579  19.937 1.00 27.72 ? 149 PHE B C   1 
ATOM   3344 O O   . PHE B 1 149 ? 30.732 47.426  19.911 1.00 27.54 ? 149 PHE B O   1 
ATOM   3345 C CB  . PHE B 1 149 ? 31.131 45.358  18.149 1.00 28.02 ? 149 PHE B CB  1 
ATOM   3346 C CG  . PHE B 1 149 ? 31.282 44.107  17.327 1.00 28.51 ? 149 PHE B CG  1 
ATOM   3347 C CD1 . PHE B 1 149 ? 31.446 42.872  17.950 1.00 29.13 ? 149 PHE B CD1 1 
ATOM   3348 C CD2 . PHE B 1 149 ? 31.218 44.151  15.938 1.00 28.43 ? 149 PHE B CD2 1 
ATOM   3349 C CE1 . PHE B 1 149 ? 31.541 41.693  17.203 1.00 30.31 ? 149 PHE B CE1 1 
ATOM   3350 C CE2 . PHE B 1 149 ? 31.312 42.977  15.178 1.00 29.04 ? 149 PHE B CE2 1 
ATOM   3351 C CZ  . PHE B 1 149 ? 31.473 41.745  15.813 1.00 29.48 ? 149 PHE B CZ  1 
ATOM   3352 N N   . PRO B 1 150 ? 28.839 46.615  20.846 1.00 27.36 ? 150 PRO B N   1 
ATOM   3353 C CA  . PRO B 1 150 ? 28.660 47.649  21.872 1.00 26.92 ? 150 PRO B CA  1 
ATOM   3354 C C   . PRO B 1 150 ? 29.870 48.013  22.724 1.00 25.98 ? 150 PRO B C   1 
ATOM   3355 O O   . PRO B 1 150 ? 29.889 49.078  23.332 1.00 28.12 ? 150 PRO B O   1 
ATOM   3356 C CB  . PRO B 1 150 ? 27.494 47.115  22.706 1.00 27.08 ? 150 PRO B CB  1 
ATOM   3357 C CG  . PRO B 1 150 ? 27.655 45.631  22.587 1.00 29.05 ? 150 PRO B CG  1 
ATOM   3358 C CD  . PRO B 1 150 ? 27.964 45.460  21.120 1.00 27.71 ? 150 PRO B CD  1 
ATOM   3359 N N   . GLU B 1 151 ? 30.877 47.150  22.771 1.00 24.58 ? 151 GLU B N   1 
ATOM   3360 C CA  . GLU B 1 151 ? 32.065 47.452  23.561 1.00 24.07 ? 151 GLU B CA  1 
ATOM   3361 C C   . GLU B 1 151 ? 33.001 48.426  22.832 1.00 22.41 ? 151 GLU B C   1 
ATOM   3362 O O   . GLU B 1 151 ? 33.794 49.116  23.472 1.00 21.69 ? 151 GLU B O   1 
ATOM   3363 C CB  . GLU B 1 151 ? 32.825 46.169  23.916 1.00 24.62 ? 151 GLU B CB  1 
ATOM   3364 C CG  . GLU B 1 151 ? 33.389 45.438  22.716 1.00 26.60 ? 151 GLU B CG  1 
ATOM   3365 C CD  . GLU B 1 151 ? 32.412 44.448  22.128 1.00 27.33 ? 151 GLU B CD  1 
ATOM   3366 O OE1 . GLU B 1 151 ? 31.241 44.823  21.904 1.00 27.33 ? 151 GLU B OE1 1 
ATOM   3367 O OE2 . GLU B 1 151 ? 32.822 43.292  21.886 1.00 29.16 ? 151 GLU B OE2 1 
ATOM   3368 N N   . TYR B 1 152 ? 32.901 48.482  21.502 1.00 20.56 ? 152 TYR B N   1 
ATOM   3369 C CA  . TYR B 1 152 ? 33.729 49.382  20.682 1.00 18.21 ? 152 TYR B CA  1 
ATOM   3370 C C   . TYR B 1 152 ? 33.071 50.716  20.318 1.00 15.64 ? 152 TYR B C   1 
ATOM   3371 O O   . TYR B 1 152 ? 31.872 50.774  20.055 1.00 15.48 ? 152 TYR B O   1 
ATOM   3372 C CB  . TYR B 1 152 ? 34.140 48.696  19.370 1.00 17.97 ? 152 TYR B CB  1 
ATOM   3373 C CG  . TYR B 1 152 ? 35.331 47.788  19.506 1.00 16.54 ? 152 TYR B CG  1 
ATOM   3374 C CD1 . TYR B 1 152 ? 36.602 48.307  19.759 1.00 15.49 ? 152 TYR B CD1 1 
ATOM   3375 C CD2 . TYR B 1 152 ? 35.183 46.410  19.429 1.00 15.06 ? 152 TYR B CD2 1 
ATOM   3376 C CE1 . TYR B 1 152 ? 37.695 47.466  19.935 1.00 15.98 ? 152 TYR B CE1 1 
ATOM   3377 C CE2 . TYR B 1 152 ? 36.264 45.564  19.605 1.00 15.39 ? 152 TYR B CE2 1 
ATOM   3378 C CZ  . TYR B 1 152 ? 37.513 46.096  19.857 1.00 15.55 ? 152 TYR B CZ  1 
ATOM   3379 O OH  . TYR B 1 152 ? 38.573 45.247  20.029 1.00 16.93 ? 152 TYR B OH  1 
ATOM   3380 N N   . ILE B 1 153 ? 33.883 51.773  20.295 1.00 13.48 ? 153 ILE B N   1 
ATOM   3381 C CA  . ILE B 1 153 ? 33.451 53.126  19.929 1.00 11.28 ? 153 ILE B CA  1 
ATOM   3382 C C   . ILE B 1 153 ? 34.283 53.536  18.698 1.00 8.72  ? 153 ILE B C   1 
ATOM   3383 O O   . ILE B 1 153 ? 35.454 53.174  18.596 1.00 8.35  ? 153 ILE B O   1 
ATOM   3384 C CB  . ILE B 1 153 ? 33.702 54.152  21.092 1.00 11.03 ? 153 ILE B CB  1 
ATOM   3385 C CG1 . ILE B 1 153 ? 32.825 53.819  22.304 1.00 13.74 ? 153 ILE B CG1 1 
ATOM   3386 C CG2 . ILE B 1 153 ? 33.365 55.561  20.642 1.00 10.99 ? 153 ILE B CG2 1 
ATOM   3387 C CD1 . ILE B 1 153 ? 32.911 54.854  23.439 1.00 11.55 ? 153 ILE B CD1 1 
ATOM   3388 N N   . CYS B 1 154 ? 33.676 54.265  17.764 1.00 7.48  ? 154 CYS B N   1 
ATOM   3389 C CA  . CYS B 1 154 ? 34.373 54.722  16.555 1.00 6.89  ? 154 CYS B CA  1 
ATOM   3390 C C   . CYS B 1 154 ? 35.046 56.051  16.817 1.00 6.60  ? 154 CYS B C   1 
ATOM   3391 O O   . CYS B 1 154 ? 34.479 56.907  17.496 1.00 8.84  ? 154 CYS B O   1 
ATOM   3392 C CB  . CYS B 1 154 ? 33.391 54.912  15.396 1.00 6.22  ? 154 CYS B CB  1 
ATOM   3393 S SG  . CYS B 1 154 ? 32.842 53.405  14.607 1.00 9.58  ? 154 CYS B SG  1 
ATOM   3394 N N   . PHE B 1 155 ? 36.240 56.245  16.276 1.00 6.39  ? 155 PHE B N   1 
ATOM   3395 C CA  . PHE B 1 155 ? 36.912 57.515  16.494 1.00 8.42  ? 155 PHE B CA  1 
ATOM   3396 C C   . PHE B 1 155 ? 35.944 58.599  16.020 1.00 7.58  ? 155 PHE B C   1 
ATOM   3397 O O   . PHE B 1 155 ? 35.120 58.353  15.146 1.00 7.20  ? 155 PHE B O   1 
ATOM   3398 C CB  . PHE B 1 155 ? 38.207 57.601  15.684 1.00 7.14  ? 155 PHE B CB  1 
ATOM   3399 C CG  . PHE B 1 155 ? 39.161 58.640  16.191 1.00 5.15  ? 155 PHE B CG  1 
ATOM   3400 C CD1 . PHE B 1 155 ? 40.053 58.338  17.218 1.00 3.96  ? 155 PHE B CD1 1 
ATOM   3401 C CD2 . PHE B 1 155 ? 39.132 59.932  15.683 1.00 4.52  ? 155 PHE B CD2 1 
ATOM   3402 C CE1 . PHE B 1 155 ? 40.898 59.308  17.733 1.00 3.13  ? 155 PHE B CE1 1 
ATOM   3403 C CE2 . PHE B 1 155 ? 39.971 60.912  16.189 1.00 5.49  ? 155 PHE B CE2 1 
ATOM   3404 C CZ  . PHE B 1 155 ? 40.856 60.605  17.216 1.00 4.04  ? 155 PHE B CZ  1 
ATOM   3405 N N   . PRO B 1 156 ? 36.005 59.796  16.620 1.00 6.96  ? 156 PRO B N   1 
ATOM   3406 C CA  . PRO B 1 156 ? 35.105 60.872  16.203 1.00 8.09  ? 156 PRO B CA  1 
ATOM   3407 C C   . PRO B 1 156 ? 35.250 61.195  14.716 1.00 8.33  ? 156 PRO B C   1 
ATOM   3408 O O   . PRO B 1 156 ? 36.357 61.211  14.169 1.00 5.17  ? 156 PRO B O   1 
ATOM   3409 C CB  . PRO B 1 156 ? 35.527 62.025  17.106 1.00 7.90  ? 156 PRO B CB  1 
ATOM   3410 C CG  . PRO B 1 156 ? 35.811 61.314  18.381 1.00 8.80  ? 156 PRO B CG  1 
ATOM   3411 C CD  . PRO B 1 156 ? 36.633 60.124  17.910 1.00 8.74  ? 156 PRO B CD  1 
ATOM   3412 N N   . THR B 1 157 ? 34.116 61.427  14.065 1.00 9.34  ? 157 THR B N   1 
ATOM   3413 C CA  . THR B 1 157 ? 34.105 61.759  12.645 1.00 9.28  ? 157 THR B CA  1 
ATOM   3414 C C   . THR B 1 157 ? 34.395 63.245  12.516 1.00 9.32  ? 157 THR B C   1 
ATOM   3415 O O   . THR B 1 157 ? 34.296 63.988  13.486 1.00 9.42  ? 157 THR B O   1 
ATOM   3416 C CB  . THR B 1 157 ? 32.727 61.491  12.020 1.00 8.25  ? 157 THR B CB  1 
ATOM   3417 O OG1 . THR B 1 157 ? 31.757 62.355  12.627 1.00 5.40  ? 157 THR B OG1 1 
ATOM   3418 C CG2 . THR B 1 157 ? 32.315 60.040  12.238 1.00 8.94  ? 157 THR B CG2 1 
ATOM   3419 N N   . PRO B 1 158 ? 34.775 63.696  11.318 1.00 9.78  ? 158 PRO B N   1 
ATOM   3420 C CA  . PRO B 1 158 ? 35.055 65.120  11.146 1.00 9.47  ? 158 PRO B CA  1 
ATOM   3421 C C   . PRO B 1 158 ? 33.775 65.948  11.243 1.00 9.45  ? 158 PRO B C   1 
ATOM   3422 O O   . PRO B 1 158 ? 33.821 67.136  11.564 1.00 9.67  ? 158 PRO B O   1 
ATOM   3423 C CB  . PRO B 1 158 ? 35.699 65.185  9.759  1.00 10.85 ? 158 PRO B CB  1 
ATOM   3424 C CG  . PRO B 1 158 ? 35.095 64.011  9.043  1.00 9.35  ? 158 PRO B CG  1 
ATOM   3425 C CD  . PRO B 1 158 ? 35.110 62.936  10.101 1.00 9.54  ? 158 PRO B CD  1 
ATOM   3426 N N   . GLN B 1 159 ? 32.637 65.318  10.967 1.00 11.72 ? 159 GLN B N   1 
ATOM   3427 C CA  . GLN B 1 159 ? 31.341 66.001  11.033 1.00 14.85 ? 159 GLN B CA  1 
ATOM   3428 C C   . GLN B 1 159 ? 31.002 66.388  12.473 1.00 16.61 ? 159 GLN B C   1 
ATOM   3429 O O   . GLN B 1 159 ? 30.523 67.495  12.731 1.00 18.69 ? 159 GLN B O   1 
ATOM   3430 C CB  . GLN B 1 159 ? 30.216 65.115  10.486 1.00 16.00 ? 159 GLN B CB  1 
ATOM   3431 C CG  . GLN B 1 159 ? 30.156 64.988  8.966  1.00 20.09 ? 159 GLN B CG  1 
ATOM   3432 C CD  . GLN B 1 159 ? 31.231 64.076  8.389  1.00 20.69 ? 159 GLN B CD  1 
ATOM   3433 O OE1 . GLN B 1 159 ? 31.998 63.447  9.123  1.00 19.13 ? 159 GLN B OE1 1 
ATOM   3434 N NE2 . GLN B 1 159 ? 31.287 64.000  7.062  1.00 21.18 ? 159 GLN B NE2 1 
ATOM   3435 N N   . ARG B 1 160 ? 31.248 65.473  13.409 1.00 16.61 ? 160 ARG B N   1 
ATOM   3436 C CA  . ARG B 1 160 ? 30.957 65.731  14.815 1.00 16.97 ? 160 ARG B CA  1 
ATOM   3437 C C   . ARG B 1 160 ? 31.883 66.752  15.461 1.00 16.17 ? 160 ARG B C   1 
ATOM   3438 O O   . ARG B 1 160 ? 31.422 67.643  16.169 1.00 17.66 ? 160 ARG B O   1 
ATOM   3439 C CB  . ARG B 1 160 ? 30.996 64.425  15.616 1.00 16.81 ? 160 ARG B CB  1 
ATOM   3440 C CG  . ARG B 1 160 ? 29.800 63.514  15.362 1.00 17.47 ? 160 ARG B CG  1 
ATOM   3441 C CD  . ARG B 1 160 ? 28.511 64.215  15.774 1.00 18.26 ? 160 ARG B CD  1 
ATOM   3442 N NE  . ARG B 1 160 ? 28.479 64.491  17.211 1.00 20.57 ? 160 ARG B NE  1 
ATOM   3443 C CZ  . ARG B 1 160 ? 28.354 63.557  18.149 1.00 20.93 ? 160 ARG B CZ  1 
ATOM   3444 N NH1 . ARG B 1 160 ? 28.241 62.276  17.806 1.00 19.80 ? 160 ARG B NH1 1 
ATOM   3445 N NH2 . ARG B 1 160 ? 28.346 63.901  19.430 1.00 21.90 ? 160 ARG B NH2 1 
ATOM   3446 N N   . LEU B 1 161 ? 33.182 66.624  15.220 1.00 16.14 ? 161 LEU B N   1 
ATOM   3447 C CA  . LEU B 1 161 ? 34.159 67.538  15.802 1.00 15.96 ? 161 LEU B CA  1 
ATOM   3448 C C   . LEU B 1 161 ? 34.080 68.947  15.237 1.00 15.88 ? 161 LEU B C   1 
ATOM   3449 O O   . LEU B 1 161 ? 34.500 69.905  15.886 1.00 16.64 ? 161 LEU B O   1 
ATOM   3450 C CB  . LEU B 1 161 ? 35.577 66.992  15.620 1.00 15.22 ? 161 LEU B CB  1 
ATOM   3451 C CG  . LEU B 1 161 ? 35.971 65.814  16.516 1.00 15.20 ? 161 LEU B CG  1 
ATOM   3452 C CD1 . LEU B 1 161 ? 37.430 65.477  16.277 1.00 15.15 ? 161 LEU B CD1 1 
ATOM   3453 C CD2 . LEU B 1 161 ? 35.755 66.171  17.985 1.00 14.79 ? 161 LEU B CD2 1 
ATOM   3454 N N   . ALA B 1 162 ? 33.542 69.071  14.029 1.00 16.83 ? 162 ALA B N   1 
ATOM   3455 C CA  . ALA B 1 162 ? 33.401 70.367  13.382 1.00 15.71 ? 162 ALA B CA  1 
ATOM   3456 C C   . ALA B 1 162 ? 32.339 71.196  14.094 1.00 14.67 ? 162 ALA B C   1 
ATOM   3457 O O   . ALA B 1 162 ? 32.490 72.403  14.244 1.00 15.40 ? 162 ALA B O   1 
ATOM   3458 C CB  . ALA B 1 162 ? 33.020 70.179  11.920 1.00 15.67 ? 162 ALA B CB  1 
ATOM   3459 N N   . ALA B 1 163 ? 31.271 70.542  14.535 1.00 13.00 ? 163 ALA B N   1 
ATOM   3460 C CA  . ALA B 1 163 ? 30.189 71.234  15.224 1.00 13.64 ? 163 ALA B CA  1 
ATOM   3461 C C   . ALA B 1 163 ? 30.357 71.159  16.731 1.00 15.15 ? 163 ALA B C   1 
ATOM   3462 O O   . ALA B 1 163 ? 29.395 71.322  17.481 1.00 14.89 ? 163 ALA B O   1 
ATOM   3463 C CB  . ALA B 1 163 ? 28.844 70.644  14.819 1.00 10.18 ? 163 ALA B CB  1 
ATOM   3464 N N   . ALA B 1 164 ? 31.581 70.905  17.180 1.00 16.12 ? 164 ALA B N   1 
ATOM   3465 C CA  . ALA B 1 164 ? 31.849 70.818  18.606 1.00 16.73 ? 164 ALA B CA  1 
ATOM   3466 C C   . ALA B 1 164 ? 32.103 72.204  19.192 1.00 17.42 ? 164 ALA B C   1 
ATOM   3467 O O   . ALA B 1 164 ? 32.721 73.064  18.556 1.00 17.86 ? 164 ALA B O   1 
ATOM   3468 C CB  . ALA B 1 164 ? 33.047 69.915  18.858 1.00 16.14 ? 164 ALA B CB  1 
ATOM   3469 N N   . ASP B 1 165 ? 31.612 72.408  20.408 1.00 16.84 ? 165 ASP B N   1 
ATOM   3470 C CA  . ASP B 1 165 ? 31.778 73.665  21.117 1.00 16.11 ? 165 ASP B CA  1 
ATOM   3471 C C   . ASP B 1 165 ? 33.226 73.782  21.582 1.00 16.02 ? 165 ASP B C   1 
ATOM   3472 O O   . ASP B 1 165 ? 33.768 72.875  22.215 1.00 14.76 ? 165 ASP B O   1 
ATOM   3473 C CB  . ASP B 1 165 ? 30.809 73.707  22.310 1.00 18.51 ? 165 ASP B CB  1 
ATOM   3474 C CG  . ASP B 1 165 ? 30.951 74.967  23.153 1.00 19.08 ? 165 ASP B CG  1 
ATOM   3475 O OD1 . ASP B 1 165 ? 31.281 76.030  22.599 1.00 19.45 ? 165 ASP B OD1 1 
ATOM   3476 O OD2 . ASP B 1 165 ? 30.714 74.893  24.380 1.00 22.10 ? 165 ASP B OD2 1 
ATOM   3477 N N   . PRO B 1 166 ? 33.881 74.898  21.241 1.00 16.04 ? 166 PRO B N   1 
ATOM   3478 C CA  . PRO B 1 166 ? 35.270 75.181  21.602 1.00 16.16 ? 166 PRO B CA  1 
ATOM   3479 C C   . PRO B 1 166 ? 35.513 75.054  23.105 1.00 17.22 ? 166 PRO B C   1 
ATOM   3480 O O   . PRO B 1 166 ? 36.516 74.473  23.533 1.00 16.55 ? 166 PRO B O   1 
ATOM   3481 C CB  . PRO B 1 166 ? 35.466 76.609  21.100 1.00 17.30 ? 166 PRO B CB  1 
ATOM   3482 C CG  . PRO B 1 166 ? 34.608 76.639  19.875 1.00 16.79 ? 166 PRO B CG  1 
ATOM   3483 C CD  . PRO B 1 166 ? 33.350 75.937  20.341 1.00 15.81 ? 166 PRO B CD  1 
ATOM   3484 N N   . GLN B 1 167 ? 34.593 75.595  23.902 1.00 18.25 ? 167 GLN B N   1 
ATOM   3485 C CA  . GLN B 1 167 ? 34.705 75.533  25.364 1.00 19.31 ? 167 GLN B CA  1 
ATOM   3486 C C   . GLN B 1 167 ? 34.552 74.117  25.889 1.00 18.40 ? 167 GLN B C   1 
ATOM   3487 O O   . GLN B 1 167 ? 35.183 73.738  26.880 1.00 17.86 ? 167 GLN B O   1 
ATOM   3488 C CB  . GLN B 1 167 ? 33.650 76.425  26.023 1.00 21.29 ? 167 GLN B CB  1 
ATOM   3489 C CG  . GLN B 1 167 ? 33.930 77.904  25.867 1.00 22.25 ? 167 GLN B CG  1 
ATOM   3490 C CD  . GLN B 1 167 ? 35.247 78.299  26.498 1.00 21.25 ? 167 GLN B CD  1 
ATOM   3491 O OE1 . GLN B 1 167 ? 35.493 78.022  27.671 1.00 22.60 ? 167 GLN B OE1 1 
ATOM   3492 N NE2 . GLN B 1 167 ? 36.099 78.955  25.724 1.00 21.06 ? 167 GLN B NE2 1 
ATOM   3493 N N   . ALA B 1 168 ? 33.704 73.339  25.226 1.00 17.90 ? 168 ALA B N   1 
ATOM   3494 C CA  . ALA B 1 168 ? 33.473 71.959  25.617 1.00 19.47 ? 168 ALA B CA  1 
ATOM   3495 C C   . ALA B 1 168 ? 34.793 71.199  25.464 1.00 20.40 ? 168 ALA B C   1 
ATOM   3496 O O   . ALA B 1 168 ? 35.319 70.647  26.436 1.00 21.12 ? 168 ALA B O   1 
ATOM   3497 C CB  . ALA B 1 168 ? 32.388 71.339  24.744 1.00 18.31 ? 168 ALA B CB  1 
ATOM   3498 N N   . LEU B 1 169 ? 35.331 71.172  24.249 1.00 19.52 ? 169 LEU B N   1 
ATOM   3499 C CA  . LEU B 1 169 ? 36.602 70.491  24.025 1.00 20.80 ? 169 LEU B CA  1 
ATOM   3500 C C   . LEU B 1 169 ? 37.609 71.008  25.042 1.00 21.61 ? 169 LEU B C   1 
ATOM   3501 O O   . LEU B 1 169 ? 38.213 70.234  25.787 1.00 20.18 ? 169 LEU B O   1 
ATOM   3502 C CB  . LEU B 1 169 ? 37.117 70.758  22.615 1.00 18.61 ? 169 LEU B CB  1 
ATOM   3503 C CG  . LEU B 1 169 ? 36.455 69.879  21.560 1.00 17.91 ? 169 LEU B CG  1 
ATOM   3504 C CD1 . LEU B 1 169 ? 36.828 70.372  20.176 1.00 16.31 ? 169 LEU B CD1 1 
ATOM   3505 C CD2 . LEU B 1 169 ? 36.880 68.425  21.772 1.00 16.33 ? 169 LEU B CD2 1 
ATOM   3506 N N   . LYS B 1 170 ? 37.776 72.328  25.058 1.00 22.52 ? 170 LYS B N   1 
ATOM   3507 C CA  . LYS B 1 170 ? 38.687 72.996  25.978 1.00 22.91 ? 170 LYS B CA  1 
ATOM   3508 C C   . LYS B 1 170 ? 38.488 72.494  27.407 1.00 23.49 ? 170 LYS B C   1 
ATOM   3509 O O   . LYS B 1 170 ? 39.446 72.381  28.176 1.00 22.61 ? 170 LYS B O   1 
ATOM   3510 C CB  . LYS B 1 170 ? 38.451 74.510  25.938 1.00 23.29 ? 170 LYS B CB  1 
ATOM   3511 C CG  . LYS B 1 170 ? 38.906 75.229  27.201 1.00 22.92 ? 170 LYS B CG  1 
ATOM   3512 C CD  . LYS B 1 170 ? 38.440 76.676  27.230 1.00 21.26 ? 170 LYS B CD  1 
ATOM   3513 C CE  . LYS B 1 170 ? 38.497 77.233  28.649 1.00 21.02 ? 170 LYS B CE  1 
ATOM   3514 N NZ  . LYS B 1 170 ? 39.862 77.179  29.238 1.00 15.94 ? 170 LYS B NZ  1 
ATOM   3515 N N   . ALA B 1 171 ? 37.239 72.199  27.754 1.00 22.49 ? 171 ALA B N   1 
ATOM   3516 C CA  . ALA B 1 171 ? 36.918 71.722  29.092 1.00 22.55 ? 171 ALA B CA  1 
ATOM   3517 C C   . ALA B 1 171 ? 37.373 70.282  29.342 1.00 22.62 ? 171 ALA B C   1 
ATOM   3518 O O   . ALA B 1 171 ? 37.428 69.839  30.491 1.00 23.16 ? 171 ALA B O   1 
ATOM   3519 C CB  . ALA B 1 171 ? 35.418 71.856  29.344 1.00 22.79 ? 171 ALA B CB  1 
ATOM   3520 N N   . LEU B 1 172 ? 37.704 69.554  28.275 1.00 21.68 ? 172 LEU B N   1 
ATOM   3521 C CA  . LEU B 1 172 ? 38.163 68.167  28.416 1.00 19.57 ? 172 LEU B CA  1 
ATOM   3522 C C   . LEU B 1 172 ? 39.614 68.111  28.895 1.00 18.12 ? 172 LEU B C   1 
ATOM   3523 O O   . LEU B 1 172 ? 40.127 67.045  29.263 1.00 15.32 ? 172 LEU B O   1 
ATOM   3524 C CB  . LEU B 1 172 ? 38.021 67.407  27.087 1.00 21.03 ? 172 LEU B CB  1 
ATOM   3525 C CG  . LEU B 1 172 ? 36.604 66.992  26.670 1.00 20.27 ? 172 LEU B CG  1 
ATOM   3526 C CD1 . LEU B 1 172 ? 36.628 66.327  25.307 1.00 20.52 ? 172 LEU B CD1 1 
ATOM   3527 C CD2 . LEU B 1 172 ? 36.029 66.038  27.708 1.00 21.03 ? 172 LEU B CD2 1 
ATOM   3528 N N   . GLY B 1 173 ? 40.269 69.268  28.893 1.00 16.63 ? 173 GLY B N   1 
ATOM   3529 C CA  . GLY B 1 173 ? 41.644 69.342  29.343 1.00 14.49 ? 173 GLY B CA  1 
ATOM   3530 C C   . GLY B 1 173 ? 42.641 69.817  28.296 1.00 14.18 ? 173 GLY B C   1 
ATOM   3531 O O   . GLY B 1 173 ? 43.656 69.164  28.070 1.00 12.37 ? 173 GLY B O   1 
ATOM   3532 N N   . MET B 1 174 ? 42.368 70.951  27.657 1.00 13.40 ? 174 MET B N   1 
ATOM   3533 C CA  . MET B 1 174 ? 43.287 71.478  26.657 1.00 13.72 ? 174 MET B CA  1 
ATOM   3534 C C   . MET B 1 174 ? 43.077 72.969  26.473 1.00 14.47 ? 174 MET B C   1 
ATOM   3535 O O   . MET B 1 174 ? 41.997 73.489  26.716 1.00 16.16 ? 174 MET B O   1 
ATOM   3536 C CB  . MET B 1 174 ? 43.084 70.779  25.302 1.00 13.24 ? 174 MET B CB  1 
ATOM   3537 C CG  . MET B 1 174 ? 41.784 71.180  24.596 1.00 11.70 ? 174 MET B CG  1 
ATOM   3538 S SD  . MET B 1 174 ? 41.492 70.396  22.986 1.00 9.74  ? 174 MET B SD  1 
ATOM   3539 C CE  . MET B 1 174 ? 40.785 68.765  23.482 1.00 6.15  ? 174 MET B CE  1 
ATOM   3540 N N   . PRO B 1 175 ? 44.124 73.684  26.056 1.00 16.39 ? 175 PRO B N   1 
ATOM   3541 C CA  . PRO B 1 175 ? 44.004 75.127  25.838 1.00 17.74 ? 175 PRO B CA  1 
ATOM   3542 C C   . PRO B 1 175 ? 42.964 75.434  24.741 1.00 18.87 ? 175 PRO B C   1 
ATOM   3543 O O   . PRO B 1 175 ? 42.734 74.624  23.837 1.00 18.72 ? 175 PRO B O   1 
ATOM   3544 C CB  . PRO B 1 175 ? 45.418 75.525  25.418 1.00 17.80 ? 175 PRO B CB  1 
ATOM   3545 C CG  . PRO B 1 175 ? 46.276 74.571  26.190 1.00 17.00 ? 175 PRO B CG  1 
ATOM   3546 C CD  . PRO B 1 175 ? 45.537 73.260  26.042 1.00 17.34 ? 175 PRO B CD  1 
ATOM   3547 N N   . LEU B 1 176 ? 42.336 76.603  24.827 1.00 20.06 ? 176 LEU B N   1 
ATOM   3548 C CA  . LEU B 1 176 ? 41.343 77.010  23.836 1.00 21.46 ? 176 LEU B CA  1 
ATOM   3549 C C   . LEU B 1 176 ? 41.948 76.909  22.438 1.00 22.69 ? 176 LEU B C   1 
ATOM   3550 O O   . LEU B 1 176 ? 41.283 76.498  21.487 1.00 22.55 ? 176 LEU B O   1 
ATOM   3551 C CB  . LEU B 1 176 ? 40.891 78.454  24.092 1.00 19.29 ? 176 LEU B CB  1 
ATOM   3552 C CG  . LEU B 1 176 ? 39.844 79.027  23.123 1.00 20.04 ? 176 LEU B CG  1 
ATOM   3553 C CD1 . LEU B 1 176 ? 38.547 78.226  23.232 1.00 17.37 ? 176 LEU B CD1 1 
ATOM   3554 C CD2 . LEU B 1 176 ? 39.582 80.500  23.442 1.00 20.54 ? 176 LEU B CD2 1 
ATOM   3555 N N   . LYS B 1 177 ? 43.218 77.286  22.329 1.00 23.29 ? 177 LYS B N   1 
ATOM   3556 C CA  . LYS B 1 177 ? 43.935 77.253  21.062 1.00 25.33 ? 177 LYS B CA  1 
ATOM   3557 C C   . LYS B 1 177 ? 43.908 75.848  20.449 1.00 25.90 ? 177 LYS B C   1 
ATOM   3558 O O   . LYS B 1 177 ? 43.680 75.685  19.245 1.00 25.57 ? 177 LYS B O   1 
ATOM   3559 C CB  . LYS B 1 177 ? 45.384 77.700  21.286 1.00 27.76 ? 177 LYS B CB  1 
ATOM   3560 C CG  . LYS B 1 177 ? 46.181 77.964  20.015 1.00 29.80 ? 177 LYS B CG  1 
ATOM   3561 C CD  . LYS B 1 177 ? 47.621 78.352  20.345 1.00 32.42 ? 177 LYS B CD  1 
ATOM   3562 C CE  . LYS B 1 177 ? 48.417 78.727  19.095 1.00 33.42 ? 177 LYS B CE  1 
ATOM   3563 N NZ  . LYS B 1 177 ? 47.902 79.966  18.427 1.00 35.89 ? 177 LYS B NZ  1 
ATOM   3564 N N   . ARG B 1 178 ? 44.127 74.837  21.283 1.00 24.70 ? 178 ARG B N   1 
ATOM   3565 C CA  . ARG B 1 178 ? 44.149 73.456  20.814 1.00 24.19 ? 178 ARG B CA  1 
ATOM   3566 C C   . ARG B 1 178 ? 42.764 73.002  20.354 1.00 23.06 ? 178 ARG B C   1 
ATOM   3567 O O   . ARG B 1 178 ? 42.634 72.292  19.351 1.00 23.60 ? 178 ARG B O   1 
ATOM   3568 C CB  . ARG B 1 178 ? 44.664 72.541  21.922 1.00 23.53 ? 178 ARG B CB  1 
ATOM   3569 C CG  . ARG B 1 178 ? 45.288 71.262  21.421 1.00 25.58 ? 178 ARG B CG  1 
ATOM   3570 C CD  . ARG B 1 178 ? 45.609 70.321  22.575 1.00 29.46 ? 178 ARG B CD  1 
ATOM   3571 N NE  . ARG B 1 178 ? 47.015 70.310  22.982 1.00 30.79 ? 178 ARG B NE  1 
ATOM   3572 C CZ  . ARG B 1 178 ? 47.680 71.346  23.484 1.00 31.28 ? 178 ARG B CZ  1 
ATOM   3573 N NH1 . ARG B 1 178 ? 47.079 72.514  23.647 1.00 32.49 ? 178 ARG B NH1 1 
ATOM   3574 N NH2 . ARG B 1 178 ? 48.949 71.202  23.844 1.00 31.75 ? 178 ARG B NH2 1 
ATOM   3575 N N   . ALA B 1 179 ? 41.729 73.410  21.078 1.00 20.45 ? 179 ALA B N   1 
ATOM   3576 C CA  . ALA B 1 179 ? 40.374 73.030  20.698 1.00 18.90 ? 179 ALA B CA  1 
ATOM   3577 C C   . ALA B 1 179 ? 40.037 73.606  19.326 1.00 16.45 ? 179 ALA B C   1 
ATOM   3578 O O   . ALA B 1 179 ? 39.616 72.884  18.430 1.00 15.39 ? 179 ALA B O   1 
ATOM   3579 C CB  . ALA B 1 179 ? 39.369 73.519  21.743 1.00 17.19 ? 179 ALA B CB  1 
ATOM   3580 N N   . GLU B 1 180 ? 40.239 74.908  19.168 1.00 17.28 ? 180 GLU B N   1 
ATOM   3581 C CA  . GLU B 1 180 ? 39.956 75.577  17.902 1.00 18.08 ? 180 GLU B CA  1 
ATOM   3582 C C   . GLU B 1 180 ? 40.745 74.941  16.761 1.00 18.21 ? 180 GLU B C   1 
ATOM   3583 O O   . GLU B 1 180 ? 40.251 74.833  15.640 1.00 18.51 ? 180 GLU B O   1 
ATOM   3584 C CB  . GLU B 1 180 ? 40.300 77.069  17.996 1.00 18.77 ? 180 GLU B CB  1 
ATOM   3585 C CG  . GLU B 1 180 ? 39.677 77.779  19.193 1.00 17.80 ? 180 GLU B CG  1 
ATOM   3586 C CD  . GLU B 1 180 ? 40.047 79.250  19.262 1.00 19.27 ? 180 GLU B CD  1 
ATOM   3587 O OE1 . GLU B 1 180 ? 41.179 79.604  18.862 1.00 18.69 ? 180 GLU B OE1 1 
ATOM   3588 O OE2 . GLU B 1 180 ? 39.213 80.049  19.738 1.00 21.49 ? 180 GLU B OE2 1 
ATOM   3589 N N   . ALA B 1 181 ? 41.976 74.527  17.046 1.00 17.64 ? 181 ALA B N   1 
ATOM   3590 C CA  . ALA B 1 181 ? 42.811 73.899  16.031 1.00 16.30 ? 181 ALA B CA  1 
ATOM   3591 C C   . ALA B 1 181 ? 42.112 72.634  15.550 1.00 16.34 ? 181 ALA B C   1 
ATOM   3592 O O   . ALA B 1 181 ? 41.993 72.397  14.347 1.00 15.79 ? 181 ALA B O   1 
ATOM   3593 C CB  . ALA B 1 181 ? 44.173 73.558  16.605 1.00 16.47 ? 181 ALA B CB  1 
ATOM   3594 N N   . LEU B 1 182 ? 41.636 71.834  16.498 1.00 15.29 ? 182 LEU B N   1 
ATOM   3595 C CA  . LEU B 1 182 ? 40.944 70.598  16.168 1.00 14.82 ? 182 LEU B CA  1 
ATOM   3596 C C   . LEU B 1 182 ? 39.726 70.863  15.295 1.00 14.36 ? 182 LEU B C   1 
ATOM   3597 O O   . LEU B 1 182 ? 39.518 70.185  14.291 1.00 13.05 ? 182 LEU B O   1 
ATOM   3598 C CB  . LEU B 1 182 ? 40.518 69.869  17.444 1.00 13.79 ? 182 LEU B CB  1 
ATOM   3599 C CG  . LEU B 1 182 ? 41.638 69.219  18.256 1.00 14.38 ? 182 LEU B CG  1 
ATOM   3600 C CD1 . LEU B 1 182 ? 41.111 68.848  19.616 1.00 15.36 ? 182 LEU B CD1 1 
ATOM   3601 C CD2 . LEU B 1 182 ? 42.174 67.998  17.529 1.00 14.22 ? 182 LEU B CD2 1 
ATOM   3602 N N   . ILE B 1 183 ? 38.923 71.849  15.680 1.00 15.76 ? 183 ILE B N   1 
ATOM   3603 C CA  . ILE B 1 183 ? 37.723 72.189  14.922 1.00 16.62 ? 183 ILE B CA  1 
ATOM   3604 C C   . ILE B 1 183 ? 38.107 72.594  13.503 1.00 16.41 ? 183 ILE B C   1 
ATOM   3605 O O   . ILE B 1 183 ? 37.426 72.261  12.538 1.00 16.92 ? 183 ILE B O   1 
ATOM   3606 C CB  . ILE B 1 183 ? 36.934 73.336  15.618 1.00 17.38 ? 183 ILE B CB  1 
ATOM   3607 C CG1 . ILE B 1 183 ? 36.417 72.838  16.978 1.00 17.72 ? 183 ILE B CG1 1 
ATOM   3608 C CG2 . ILE B 1 183 ? 35.772 73.797  14.740 1.00 16.96 ? 183 ILE B CG2 1 
ATOM   3609 C CD1 . ILE B 1 183 ? 35.630 73.861  17.781 1.00 14.58 ? 183 ILE B CD1 1 
ATOM   3610 N N   . HIS B 1 184 ? 39.216 73.302  13.374 1.00 17.40 ? 184 HIS B N   1 
ATOM   3611 C CA  . HIS B 1 184 ? 39.662 73.729  12.063 1.00 18.07 ? 184 HIS B CA  1 
ATOM   3612 C C   . HIS B 1 184 ? 40.172 72.542  11.238 1.00 17.40 ? 184 HIS B C   1 
ATOM   3613 O O   . HIS B 1 184 ? 40.035 72.522  10.012 1.00 16.56 ? 184 HIS B O   1 
ATOM   3614 C CB  . HIS B 1 184 ? 40.751 74.782  12.209 1.00 19.92 ? 184 HIS B CB  1 
ATOM   3615 C CG  . HIS B 1 184 ? 41.405 75.135  10.920 1.00 21.43 ? 184 HIS B CG  1 
ATOM   3616 N ND1 . HIS B 1 184 ? 40.692 75.578  9.826  1.00 22.90 ? 184 HIS B ND1 1 
ATOM   3617 C CD2 . HIS B 1 184 ? 42.696 75.073  10.529 1.00 22.02 ? 184 HIS B CD2 1 
ATOM   3618 C CE1 . HIS B 1 184 ? 41.520 75.771  8.817  1.00 23.34 ? 184 HIS B CE1 1 
ATOM   3619 N NE2 . HIS B 1 184 ? 42.742 75.471  9.217  1.00 23.68 ? 184 HIS B NE2 1 
ATOM   3620 N N   . LEU B 1 185 ? 40.757 71.557  11.916 1.00 15.01 ? 185 LEU B N   1 
ATOM   3621 C CA  . LEU B 1 185 ? 41.278 70.370  11.246 1.00 14.45 ? 185 LEU B CA  1 
ATOM   3622 C C   . LEU B 1 185 ? 40.107 69.627  10.621 1.00 13.75 ? 185 LEU B C   1 
ATOM   3623 O O   . LEU B 1 185 ? 40.163 69.198  9.463  1.00 12.45 ? 185 LEU B O   1 
ATOM   3624 C CB  . LEU B 1 185 ? 41.972 69.450  12.245 1.00 11.29 ? 185 LEU B CB  1 
ATOM   3625 C CG  . LEU B 1 185 ? 42.632 68.223  11.619 1.00 10.68 ? 185 LEU B CG  1 
ATOM   3626 C CD1 . LEU B 1 185 ? 43.865 68.674  10.850 1.00 10.55 ? 185 LEU B CD1 1 
ATOM   3627 C CD2 . LEU B 1 185 ? 43.030 67.228  12.698 1.00 11.05 ? 185 LEU B CD2 1 
ATOM   3628 N N   . ALA B 1 186 ? 39.047 69.482  11.409 1.00 12.10 ? 186 ALA B N   1 
ATOM   3629 C CA  . ALA B 1 186 ? 37.846 68.804  10.957 1.00 12.63 ? 186 ALA B CA  1 
ATOM   3630 C C   . ALA B 1 186 ? 37.297 69.425  9.669  1.00 11.94 ? 186 ALA B C   1 
ATOM   3631 O O   . ALA B 1 186 ? 37.066 68.712  8.702  1.00 12.38 ? 186 ALA B O   1 
ATOM   3632 C CB  . ALA B 1 186 ? 36.793 68.827  12.063 1.00 8.23  ? 186 ALA B CB  1 
ATOM   3633 N N   . ASN B 1 187 ? 37.108 70.742  9.638  1.00 13.43 ? 187 ASN B N   1 
ATOM   3634 C CA  . ASN B 1 187 ? 36.583 71.382  8.429  1.00 14.07 ? 187 ASN B CA  1 
ATOM   3635 C C   . ASN B 1 187 ? 37.484 71.214  7.223  1.00 14.25 ? 187 ASN B C   1 
ATOM   3636 O O   . ASN B 1 187 ? 37.008 71.128  6.094  1.00 13.82 ? 187 ASN B O   1 
ATOM   3637 C CB  . ASN B 1 187 ? 36.322 72.874  8.655  1.00 14.64 ? 187 ASN B CB  1 
ATOM   3638 C CG  . ASN B 1 187 ? 34.928 73.141  9.197  1.00 17.39 ? 187 ASN B CG  1 
ATOM   3639 O OD1 . ASN B 1 187 ? 34.740 73.382  10.394 1.00 17.39 ? 187 ASN B OD1 1 
ATOM   3640 N ND2 . ASN B 1 187 ? 33.935 73.082  8.313  1.00 17.51 ? 187 ASN B ND2 1 
ATOM   3641 N N   . ALA B 1 188 ? 38.790 71.188  7.463  1.00 14.93 ? 188 ALA B N   1 
ATOM   3642 C CA  . ALA B 1 188 ? 39.754 71.009  6.388  1.00 13.91 ? 188 ALA B CA  1 
ATOM   3643 C C   . ALA B 1 188 ? 39.610 69.576  5.880  1.00 15.95 ? 188 ALA B C   1 
ATOM   3644 O O   . ALA B 1 188 ? 39.845 69.292  4.706  1.00 15.63 ? 188 ALA B O   1 
ATOM   3645 C CB  . ALA B 1 188 ? 41.158 71.245  6.908  1.00 14.44 ? 188 ALA B CB  1 
ATOM   3646 N N   . ALA B 1 189 ? 39.222 68.668  6.775  1.00 14.98 ? 189 ALA B N   1 
ATOM   3647 C CA  . ALA B 1 189 ? 39.037 67.276  6.396  1.00 14.66 ? 189 ALA B CA  1 
ATOM   3648 C C   . ALA B 1 189 ? 37.790 67.174  5.519  1.00 15.50 ? 189 ALA B C   1 
ATOM   3649 O O   . ALA B 1 189 ? 37.758 66.393  4.567  1.00 17.68 ? 189 ALA B O   1 
ATOM   3650 C CB  . ALA B 1 189 ? 38.891 66.401  7.642  1.00 13.10 ? 189 ALA B CB  1 
ATOM   3651 N N   . LEU B 1 190 ? 36.769 67.970  5.842  1.00 13.43 ? 190 LEU B N   1 
ATOM   3652 C CA  . LEU B 1 190 ? 35.520 67.980  5.083  1.00 11.94 ? 190 LEU B CA  1 
ATOM   3653 C C   . LEU B 1 190 ? 35.662 68.612  3.693  1.00 12.01 ? 190 LEU B C   1 
ATOM   3654 O O   . LEU B 1 190 ? 35.092 68.122  2.726  1.00 11.89 ? 190 LEU B O   1 
ATOM   3655 C CB  . LEU B 1 190 ? 34.436 68.721  5.871  1.00 8.04  ? 190 LEU B CB  1 
ATOM   3656 C CG  . LEU B 1 190 ? 34.008 68.073  7.193  1.00 8.43  ? 190 LEU B CG  1 
ATOM   3657 C CD1 . LEU B 1 190 ? 33.275 69.083  8.057  1.00 7.31  ? 190 LEU B CD1 1 
ATOM   3658 C CD2 . LEU B 1 190 ? 33.125 66.864  6.907  1.00 6.04  ? 190 LEU B CD2 1 
ATOM   3659 N N   . GLU B 1 191 ? 36.420 69.699  3.598  1.00 12.83 ? 191 GLU B N   1 
ATOM   3660 C CA  . GLU B 1 191 ? 36.611 70.380  2.320  1.00 15.29 ? 191 GLU B CA  1 
ATOM   3661 C C   . GLU B 1 191 ? 37.669 69.695  1.464  1.00 15.64 ? 191 GLU B C   1 
ATOM   3662 O O   . GLU B 1 191 ? 37.791 69.975  0.273  1.00 17.06 ? 191 GLU B O   1 
ATOM   3663 C CB  . GLU B 1 191 ? 37.006 71.849  2.541  1.00 15.01 ? 191 GLU B CB  1 
ATOM   3664 C CG  . GLU B 1 191 ? 36.016 72.621  3.415  1.00 20.30 ? 191 GLU B CG  1 
ATOM   3665 C CD  . GLU B 1 191 ? 36.253 74.128  3.437  1.00 22.28 ? 191 GLU B CD  1 
ATOM   3666 O OE1 . GLU B 1 191 ? 35.630 74.796  4.294  1.00 22.85 ? 191 GLU B OE1 1 
ATOM   3667 O OE2 . GLU B 1 191 ? 37.040 74.642  2.605  1.00 22.92 ? 191 GLU B OE2 1 
ATOM   3668 N N   . GLY B 1 192 ? 38.439 68.805  2.078  1.00 16.28 ? 192 GLY B N   1 
ATOM   3669 C CA  . GLY B 1 192 ? 39.475 68.100  1.349  1.00 14.70 ? 192 GLY B CA  1 
ATOM   3670 C C   . GLY B 1 192 ? 40.788 68.860  1.247  1.00 14.36 ? 192 GLY B C   1 
ATOM   3671 O O   . GLY B 1 192 ? 41.575 68.599  0.342  1.00 13.68 ? 192 GLY B O   1 
ATOM   3672 N N   . THR B 1 193 ? 41.036 69.795  2.160  1.00 14.16 ? 193 THR B N   1 
ATOM   3673 C CA  . THR B 1 193 ? 42.280 70.559  2.124  1.00 13.83 ? 193 THR B CA  1 
ATOM   3674 C C   . THR B 1 193 ? 43.375 69.837  2.899  1.00 14.32 ? 193 THR B C   1 
ATOM   3675 O O   . THR B 1 193 ? 44.542 70.226  2.856  1.00 14.95 ? 193 THR B O   1 
ATOM   3676 C CB  . THR B 1 193 ? 42.106 71.970  2.712  1.00 12.96 ? 193 THR B CB  1 
ATOM   3677 O OG1 . THR B 1 193 ? 41.526 71.887  4.022  1.00 14.11 ? 193 THR B OG1 1 
ATOM   3678 C CG2 . THR B 1 193 ? 41.210 72.813  1.808  1.00 11.67 ? 193 THR B CG2 1 
ATOM   3679 N N   . LEU B 1 194 ? 42.984 68.775  3.600  1.00 13.96 ? 194 LEU B N   1 
ATOM   3680 C CA  . LEU B 1 194 ? 43.906 67.967  4.390  1.00 11.71 ? 194 LEU B CA  1 
ATOM   3681 C C   . LEU B 1 194 ? 44.295 66.715  3.620  1.00 10.32 ? 194 LEU B C   1 
ATOM   3682 O O   . LEU B 1 194 ? 43.468 65.832  3.401  1.00 10.93 ? 194 LEU B O   1 
ATOM   3683 C CB  . LEU B 1 194 ? 43.250 67.557  5.706  1.00 11.10 ? 194 LEU B CB  1 
ATOM   3684 C CG  . LEU B 1 194 ? 44.104 66.706  6.645  1.00 10.37 ? 194 LEU B CG  1 
ATOM   3685 C CD1 . LEU B 1 194 ? 45.317 67.509  7.097  1.00 9.70  ? 194 LEU B CD1 1 
ATOM   3686 C CD2 . LEU B 1 194 ? 43.270 66.272  7.841  1.00 9.65  ? 194 LEU B CD2 1 
ATOM   3687 N N   . PRO B 1 195 ? 45.559 66.624  3.189  1.00 10.45 ? 195 PRO B N   1 
ATOM   3688 C CA  . PRO B 1 195 ? 45.996 65.442  2.447  1.00 11.21 ? 195 PRO B CA  1 
ATOM   3689 C C   . PRO B 1 195 ? 45.804 64.170  3.277  1.00 12.31 ? 195 PRO B C   1 
ATOM   3690 O O   . PRO B 1 195 ? 46.362 64.040  4.368  1.00 11.76 ? 195 PRO B O   1 
ATOM   3691 C CB  . PRO B 1 195 ? 47.463 65.745  2.164  1.00 10.75 ? 195 PRO B CB  1 
ATOM   3692 C CG  . PRO B 1 195 ? 47.460 67.241  2.010  1.00 8.25  ? 195 PRO B CG  1 
ATOM   3693 C CD  . PRO B 1 195 ? 46.595 67.675  3.162  1.00 9.14  ? 195 PRO B CD  1 
ATOM   3694 N N   . MET B 1 196 ? 45.012 63.239  2.756  1.00 13.34 ? 196 MET B N   1 
ATOM   3695 C CA  . MET B 1 196 ? 44.734 61.990  3.450  1.00 14.96 ? 196 MET B CA  1 
ATOM   3696 C C   . MET B 1 196 ? 45.768 60.929  3.132  1.00 14.96 ? 196 MET B C   1 
ATOM   3697 O O   . MET B 1 196 ? 45.899 59.946  3.849  1.00 15.26 ? 196 MET B O   1 
ATOM   3698 C CB  . MET B 1 196 ? 43.337 61.491  3.084  1.00 16.37 ? 196 MET B CB  1 
ATOM   3699 C CG  . MET B 1 196 ? 42.245 62.471  3.443  1.00 15.27 ? 196 MET B CG  1 
ATOM   3700 S SD  . MET B 1 196 ? 42.337 62.978  5.169  1.00 21.66 ? 196 MET B SD  1 
ATOM   3701 C CE  . MET B 1 196 ? 41.224 61.825  5.926  1.00 20.38 ? 196 MET B CE  1 
ATOM   3702 N N   . THR B 1 197 ? 46.503 61.145  2.050  1.00 16.49 ? 197 THR B N   1 
ATOM   3703 C CA  . THR B 1 197 ? 47.542 60.224  1.619  1.00 15.50 ? 197 THR B CA  1 
ATOM   3704 C C   . THR B 1 197 ? 48.764 61.085  1.365  1.00 14.26 ? 197 THR B C   1 
ATOM   3705 O O   . THR B 1 197 ? 48.623 62.239  0.974  1.00 14.85 ? 197 THR B O   1 
ATOM   3706 C CB  . THR B 1 197 ? 47.132 59.502  0.327  1.00 16.82 ? 197 THR B CB  1 
ATOM   3707 O OG1 . THR B 1 197 ? 48.220 58.693  -0.137 1.00 17.52 ? 197 THR B OG1 1 
ATOM   3708 C CG2 . THR B 1 197 ? 46.759 60.513  -0.742 1.00 17.54 ? 197 THR B CG2 1 
ATOM   3709 N N   . ILE B 1 198 ? 49.955 60.531  1.584  1.00 13.43 ? 198 ILE B N   1 
ATOM   3710 C CA  . ILE B 1 198 ? 51.196 61.281  1.408  1.00 13.93 ? 198 ILE B CA  1 
ATOM   3711 C C   . ILE B 1 198 ? 51.318 61.998  0.065  1.00 15.57 ? 198 ILE B C   1 
ATOM   3712 O O   . ILE B 1 198 ? 51.212 61.387  -1.001 1.00 15.17 ? 198 ILE B O   1 
ATOM   3713 C CB  . ILE B 1 198 ? 52.453 60.370  1.619  1.00 14.14 ? 198 ILE B CB  1 
ATOM   3714 C CG1 . ILE B 1 198 ? 53.723 61.223  1.635  1.00 12.33 ? 198 ILE B CG1 1 
ATOM   3715 C CG2 . ILE B 1 198 ? 52.578 59.340  0.495  1.00 12.47 ? 198 ILE B CG2 1 
ATOM   3716 C CD1 . ILE B 1 198 ? 54.958 60.483  2.124  1.00 11.87 ? 198 ILE B CD1 1 
ATOM   3717 N N   . PRO B 1 199 ? 51.532 63.322  0.107  1.00 15.92 ? 199 PRO B N   1 
ATOM   3718 C CA  . PRO B 1 199 ? 51.679 64.149  -1.094 1.00 16.81 ? 199 PRO B CA  1 
ATOM   3719 C C   . PRO B 1 199 ? 53.056 63.975  -1.740 1.00 17.70 ? 199 PRO B C   1 
ATOM   3720 O O   . PRO B 1 199 ? 54.037 63.660  -1.065 1.00 17.85 ? 199 PRO B O   1 
ATOM   3721 C CB  . PRO B 1 199 ? 51.465 65.560  -0.562 1.00 16.05 ? 199 PRO B CB  1 
ATOM   3722 C CG  . PRO B 1 199 ? 52.044 65.478  0.819  1.00 17.55 ? 199 PRO B CG  1 
ATOM   3723 C CD  . PRO B 1 199 ? 51.497 64.159  1.321  1.00 16.94 ? 199 PRO B CD  1 
ATOM   3724 N N   . GLY B 1 200 ? 53.125 64.180  -3.049 1.00 17.69 ? 200 GLY B N   1 
ATOM   3725 C CA  . GLY B 1 200 ? 54.387 64.037  -3.749 1.00 19.65 ? 200 GLY B CA  1 
ATOM   3726 C C   . GLY B 1 200 ? 55.465 64.970  -3.222 1.00 20.70 ? 200 GLY B C   1 
ATOM   3727 O O   . GLY B 1 200 ? 56.652 64.678  -3.344 1.00 21.82 ? 200 GLY B O   1 
ATOM   3728 N N   . ASP B 1 201 ? 55.062 66.098  -2.649 1.00 20.45 ? 201 ASP B N   1 
ATOM   3729 C CA  . ASP B 1 201 ? 56.022 67.049  -2.102 1.00 20.96 ? 201 ASP B CA  1 
ATOM   3730 C C   . ASP B 1 201 ? 55.697 67.308  -0.635 1.00 19.38 ? 201 ASP B C   1 
ATOM   3731 O O   . ASP B 1 201 ? 54.977 68.249  -0.305 1.00 17.53 ? 201 ASP B O   1 
ATOM   3732 C CB  . ASP B 1 201 ? 55.996 68.358  -2.896 1.00 23.40 ? 201 ASP B CB  1 
ATOM   3733 C CG  . ASP B 1 201 ? 56.918 69.411  -2.308 1.00 24.26 ? 201 ASP B CG  1 
ATOM   3734 O OD1 . ASP B 1 201 ? 57.856 69.041  -1.568 1.00 28.29 ? 201 ASP B OD1 1 
ATOM   3735 O OD2 . ASP B 1 201 ? 56.721 70.604  -2.604 1.00 26.06 ? 201 ASP B OD2 1 
ATOM   3736 N N   . VAL B 1 202 ? 56.244 66.464  0.236  1.00 19.12 ? 202 VAL B N   1 
ATOM   3737 C CA  . VAL B 1 202 ? 56.004 66.554  1.674  1.00 19.99 ? 202 VAL B CA  1 
ATOM   3738 C C   . VAL B 1 202 ? 56.424 67.871  2.332  1.00 19.94 ? 202 VAL B C   1 
ATOM   3739 O O   . VAL B 1 202 ? 55.703 68.396  3.179  1.00 18.75 ? 202 VAL B O   1 
ATOM   3740 C CB  . VAL B 1 202 ? 56.673 65.363  2.406  1.00 19.41 ? 202 VAL B CB  1 
ATOM   3741 C CG1 . VAL B 1 202 ? 56.392 65.432  3.902  1.00 18.81 ? 202 VAL B CG1 1 
ATOM   3742 C CG2 . VAL B 1 202 ? 56.140 64.050  1.841  1.00 19.62 ? 202 VAL B CG2 1 
ATOM   3743 N N   . GLU B 1 203 ? 57.576 68.410  1.948  1.00 21.61 ? 203 GLU B N   1 
ATOM   3744 C CA  . GLU B 1 203 ? 58.030 69.663  2.535  1.00 23.30 ? 203 GLU B CA  1 
ATOM   3745 C C   . GLU B 1 203 ? 57.038 70.802  2.345  1.00 22.49 ? 203 GLU B C   1 
ATOM   3746 O O   . GLU B 1 203 ? 56.746 71.542  3.287  1.00 20.78 ? 203 GLU B O   1 
ATOM   3747 C CB  . GLU B 1 203 ? 59.389 70.068  1.961  1.00 26.19 ? 203 GLU B CB  1 
ATOM   3748 C CG  . GLU B 1 203 ? 60.545 69.282  2.547  1.00 30.33 ? 203 GLU B CG  1 
ATOM   3749 C CD  . GLU B 1 203 ? 60.500 69.251  4.065  1.00 33.72 ? 203 GLU B CD  1 
ATOM   3750 O OE1 . GLU B 1 203 ? 60.392 70.337  4.681  1.00 33.39 ? 203 GLU B OE1 1 
ATOM   3751 O OE2 . GLU B 1 203 ? 60.566 68.142  4.641  1.00 35.97 ? 203 GLU B OE2 1 
ATOM   3752 N N   . GLN B 1 204 ? 56.522 70.940  1.128  1.00 22.11 ? 204 GLN B N   1 
ATOM   3753 C CA  . GLN B 1 204 ? 55.569 72.006  0.820  1.00 22.93 ? 204 GLN B CA  1 
ATOM   3754 C C   . GLN B 1 204 ? 54.255 71.814  1.564  1.00 22.02 ? 204 GLN B C   1 
ATOM   3755 O O   . GLN B 1 204 ? 53.681 72.765  2.096  1.00 20.66 ? 204 GLN B O   1 
ATOM   3756 C CB  . GLN B 1 204 ? 55.288 72.056  -0.689 1.00 24.04 ? 204 GLN B CB  1 
ATOM   3757 C CG  . GLN B 1 204 ? 54.422 73.234  -1.115 1.00 25.14 ? 204 GLN B CG  1 
ATOM   3758 C CD  . GLN B 1 204 ? 55.146 74.563  -0.976 1.00 26.22 ? 204 GLN B CD  1 
ATOM   3759 O OE1 . GLN B 1 204 ? 56.005 74.909  -1.793 1.00 25.04 ? 204 GLN B OE1 1 
ATOM   3760 N NE2 . GLN B 1 204 ? 54.814 75.305  0.074  1.00 27.43 ? 204 GLN B NE2 1 
ATOM   3761 N N   . ALA B 1 205 ? 53.784 70.572  1.589  1.00 21.31 ? 205 ALA B N   1 
ATOM   3762 C CA  . ALA B 1 205 ? 52.533 70.244  2.254  1.00 20.77 ? 205 ALA B CA  1 
ATOM   3763 C C   . ALA B 1 205 ? 52.608 70.554  3.747  1.00 21.14 ? 205 ALA B C   1 
ATOM   3764 O O   . ALA B 1 205 ? 51.656 71.090  4.320  1.00 21.64 ? 205 ALA B O   1 
ATOM   3765 C CB  . ALA B 1 205 ? 52.194 68.774  2.033  1.00 19.64 ? 205 ALA B CB  1 
ATOM   3766 N N   . MET B 1 206 ? 53.733 70.214  4.376  1.00 20.66 ? 206 MET B N   1 
ATOM   3767 C CA  . MET B 1 206 ? 53.907 70.480  5.802  1.00 21.80 ? 206 MET B CA  1 
ATOM   3768 C C   . MET B 1 206 ? 53.881 71.978  6.059  1.00 23.19 ? 206 MET B C   1 
ATOM   3769 O O   . MET B 1 206 ? 53.169 72.450  6.954  1.00 22.21 ? 206 MET B O   1 
ATOM   3770 C CB  . MET B 1 206 ? 55.231 69.913  6.324  1.00 22.73 ? 206 MET B CB  1 
ATOM   3771 C CG  . MET B 1 206 ? 55.197 68.440  6.727  1.00 22.07 ? 206 MET B CG  1 
ATOM   3772 S SD  . MET B 1 206 ? 56.680 67.942  7.663  1.00 23.92 ? 206 MET B SD  1 
ATOM   3773 C CE  . MET B 1 206 ? 57.880 67.833  6.349  1.00 23.82 ? 206 MET B CE  1 
ATOM   3774 N N   . LYS B 1 207 ? 54.661 72.727  5.281  1.00 23.94 ? 207 LYS B N   1 
ATOM   3775 C CA  . LYS B 1 207 ? 54.698 74.176  5.449  1.00 25.62 ? 207 LYS B CA  1 
ATOM   3776 C C   . LYS B 1 207 ? 53.290 74.745  5.426  1.00 23.88 ? 207 LYS B C   1 
ATOM   3777 O O   . LYS B 1 207 ? 52.955 75.606  6.236  1.00 23.90 ? 207 LYS B O   1 
ATOM   3778 C CB  . LYS B 1 207 ? 55.561 74.838  4.367  1.00 27.63 ? 207 LYS B CB  1 
ATOM   3779 C CG  . LYS B 1 207 ? 57.059 74.662  4.603  1.00 29.74 ? 207 LYS B CG  1 
ATOM   3780 C CD  . LYS B 1 207 ? 57.884 75.772  3.966  1.00 29.73 ? 207 LYS B CD  1 
ATOM   3781 C CE  . LYS B 1 207 ? 57.774 75.763  2.449  1.00 29.76 ? 207 LYS B CE  1 
ATOM   3782 N NZ  . LYS B 1 207 ? 58.675 76.777  1.831  1.00 29.14 ? 207 LYS B NZ  1 
ATOM   3783 N N   . THR B 1 208 ? 52.470 74.249  4.506  1.00 22.70 ? 208 THR B N   1 
ATOM   3784 C CA  . THR B 1 208 ? 51.088 74.696  4.396  1.00 23.11 ? 208 THR B CA  1 
ATOM   3785 C C   . THR B 1 208 ? 50.358 74.415  5.718  1.00 24.46 ? 208 THR B C   1 
ATOM   3786 O O   . THR B 1 208 ? 49.643 75.274  6.232  1.00 23.56 ? 208 THR B O   1 
ATOM   3787 C CB  . THR B 1 208 ? 50.354 73.976  3.225  1.00 22.81 ? 208 THR B CB  1 
ATOM   3788 O OG1 . THR B 1 208 ? 50.981 74.318  1.980  1.00 22.60 ? 208 THR B OG1 1 
ATOM   3789 C CG2 . THR B 1 208 ? 48.891 74.384  3.167  1.00 19.36 ? 208 THR B CG2 1 
ATOM   3790 N N   . LEU B 1 209 ? 50.561 73.219  6.272  1.00 25.74 ? 209 LEU B N   1 
ATOM   3791 C CA  . LEU B 1 209 ? 49.927 72.823  7.533  1.00 27.14 ? 209 LEU B CA  1 
ATOM   3792 C C   . LEU B 1 209 ? 50.309 73.684  8.724  1.00 27.83 ? 209 LEU B C   1 
ATOM   3793 O O   . LEU B 1 209 ? 49.458 74.040  9.539  1.00 28.86 ? 209 LEU B O   1 
ATOM   3794 C CB  . LEU B 1 209 ? 50.267 71.372  7.872  1.00 27.13 ? 209 LEU B CB  1 
ATOM   3795 C CG  . LEU B 1 209 ? 49.143 70.352  7.709  1.00 27.30 ? 209 LEU B CG  1 
ATOM   3796 C CD1 . LEU B 1 209 ? 49.639 68.999  8.186  1.00 26.70 ? 209 LEU B CD1 1 
ATOM   3797 C CD2 . LEU B 1 209 ? 47.926 70.782  8.514  1.00 27.48 ? 209 LEU B CD2 1 
ATOM   3798 N N   . GLN B 1 210 ? 51.593 73.999  8.838  1.00 28.97 ? 210 GLN B N   1 
ATOM   3799 C CA  . GLN B 1 210 ? 52.074 74.814  9.943  1.00 30.93 ? 210 GLN B CA  1 
ATOM   3800 C C   . GLN B 1 210 ? 51.450 76.203  9.914  1.00 32.42 ? 210 GLN B C   1 
ATOM   3801 O O   . GLN B 1 210 ? 51.408 76.893  10.933 1.00 33.55 ? 210 GLN B O   1 
ATOM   3802 C CB  . GLN B 1 210 ? 53.594 74.918  9.893  1.00 31.33 ? 210 GLN B CB  1 
ATOM   3803 C CG  . GLN B 1 210 ? 54.282 73.588  10.057 1.00 31.61 ? 210 GLN B CG  1 
ATOM   3804 C CD  . GLN B 1 210 ? 55.780 73.726  10.160 1.00 33.35 ? 210 GLN B CD  1 
ATOM   3805 O OE1 . GLN B 1 210 ? 56.288 74.361  11.081 1.00 34.20 ? 210 GLN B OE1 1 
ATOM   3806 N NE2 . GLN B 1 210 ? 56.502 73.134  9.212  1.00 34.15 ? 210 GLN B NE2 1 
ATOM   3807 N N   . THR B 1 211 ? 50.968 76.599  8.739  1.00 33.71 ? 211 THR B N   1 
ATOM   3808 C CA  . THR B 1 211 ? 50.320 77.894  8.552  1.00 34.19 ? 211 THR B CA  1 
ATOM   3809 C C   . THR B 1 211 ? 48.996 77.910  9.307  1.00 34.80 ? 211 THR B C   1 
ATOM   3810 O O   . THR B 1 211 ? 48.516 78.969  9.712  1.00 35.03 ? 211 THR B O   1 
ATOM   3811 C CB  . THR B 1 211 ? 50.041 78.173  7.058  1.00 34.09 ? 211 THR B CB  1 
ATOM   3812 O OG1 . THR B 1 211 ? 51.283 78.334  6.363  1.00 34.41 ? 211 THR B OG1 1 
ATOM   3813 C CG2 . THR B 1 211 ? 49.207 79.431  6.891  1.00 34.48 ? 211 THR B CG2 1 
ATOM   3814 N N   . PHE B 1 212 ? 48.399 76.734  9.481  1.00 34.56 ? 212 PHE B N   1 
ATOM   3815 C CA  . PHE B 1 212 ? 47.139 76.630  10.207 1.00 34.54 ? 212 PHE B CA  1 
ATOM   3816 C C   . PHE B 1 212 ? 47.371 77.092  11.640 1.00 33.78 ? 212 PHE B C   1 
ATOM   3817 O O   . PHE B 1 212 ? 48.472 76.955  12.183 1.00 31.61 ? 212 PHE B O   1 
ATOM   3818 C CB  . PHE B 1 212 ? 46.628 75.182  10.229 1.00 36.00 ? 212 PHE B CB  1 
ATOM   3819 C CG  . PHE B 1 212 ? 45.913 74.755  8.970  1.00 37.60 ? 212 PHE B CG  1 
ATOM   3820 C CD1 . PHE B 1 212 ? 45.911 75.563  7.832  1.00 38.49 ? 212 PHE B CD1 1 
ATOM   3821 C CD2 . PHE B 1 212 ? 45.255 73.527  8.921  1.00 37.04 ? 212 PHE B CD2 1 
ATOM   3822 C CE1 . PHE B 1 212 ? 45.266 75.150  6.663  1.00 38.63 ? 212 PHE B CE1 1 
ATOM   3823 C CE2 . PHE B 1 212 ? 44.609 73.106  7.760  1.00 38.27 ? 212 PHE B CE2 1 
ATOM   3824 C CZ  . PHE B 1 212 ? 44.614 73.918  6.628  1.00 38.24 ? 212 PHE B CZ  1 
ATOM   3825 N N   . PRO B 1 213 ? 46.334 77.657  12.268 1.00 33.94 ? 213 PRO B N   1 
ATOM   3826 C CA  . PRO B 1 213 ? 46.412 78.143  13.646 1.00 32.92 ? 213 PRO B CA  1 
ATOM   3827 C C   . PRO B 1 213 ? 46.374 76.978  14.631 1.00 31.37 ? 213 PRO B C   1 
ATOM   3828 O O   . PRO B 1 213 ? 45.414 76.211  14.651 1.00 31.72 ? 213 PRO B O   1 
ATOM   3829 C CB  . PRO B 1 213 ? 45.178 79.028  13.757 1.00 33.55 ? 213 PRO B CB  1 
ATOM   3830 C CG  . PRO B 1 213 ? 44.180 78.279  12.916 1.00 34.79 ? 213 PRO B CG  1 
ATOM   3831 C CD  . PRO B 1 213 ? 45.005 77.933  11.690 1.00 35.03 ? 213 PRO B CD  1 
ATOM   3832 N N   . GLY B 1 214 ? 47.418 76.841  15.440 1.00 29.54 ? 214 GLY B N   1 
ATOM   3833 C CA  . GLY B 1 214 ? 47.443 75.762  16.408 1.00 29.03 ? 214 GLY B CA  1 
ATOM   3834 C C   . GLY B 1 214 ? 48.323 74.596  16.002 1.00 28.85 ? 214 GLY B C   1 
ATOM   3835 O O   . GLY B 1 214 ? 48.478 73.637  16.758 1.00 28.36 ? 214 GLY B O   1 
ATOM   3836 N N   . ILE B 1 215 ? 48.902 74.678  14.808 1.00 28.45 ? 215 ILE B N   1 
ATOM   3837 C CA  . ILE B 1 215 ? 49.774 73.619  14.304 1.00 28.38 ? 215 ILE B CA  1 
ATOM   3838 C C   . ILE B 1 215 ? 51.238 74.041  14.316 1.00 27.66 ? 215 ILE B C   1 
ATOM   3839 O O   . ILE B 1 215 ? 51.703 74.725  13.403 1.00 28.11 ? 215 ILE B O   1 
ATOM   3840 C CB  . ILE B 1 215 ? 49.423 73.237  12.858 1.00 27.74 ? 215 ILE B CB  1 
ATOM   3841 C CG1 . ILE B 1 215 ? 47.920 72.984  12.736 1.00 28.61 ? 215 ILE B CG1 1 
ATOM   3842 C CG2 . ILE B 1 215 ? 50.223 72.014  12.447 1.00 26.08 ? 215 ILE B CG2 1 
ATOM   3843 C CD1 . ILE B 1 215 ? 47.393 71.954  13.708 1.00 28.64 ? 215 ILE B CD1 1 
ATOM   3844 N N   . GLY B 1 216 ? 51.962 73.632  15.348 1.00 26.63 ? 216 GLY B N   1 
ATOM   3845 C CA  . GLY B 1 216 ? 53.367 73.985  15.427 1.00 25.04 ? 216 GLY B CA  1 
ATOM   3846 C C   . GLY B 1 216 ? 54.213 73.096  14.536 1.00 24.37 ? 216 GLY B C   1 
ATOM   3847 O O   . GLY B 1 216 ? 53.690 72.320  13.728 1.00 23.53 ? 216 GLY B O   1 
ATOM   3848 N N   . ARG B 1 217 ? 55.528 73.205  14.684 1.00 23.71 ? 217 ARG B N   1 
ATOM   3849 C CA  . ARG B 1 217 ? 56.448 72.409  13.887 1.00 23.07 ? 217 ARG B CA  1 
ATOM   3850 C C   . ARG B 1 217 ? 56.370 70.943  14.298 1.00 20.54 ? 217 ARG B C   1 
ATOM   3851 O O   . ARG B 1 217 ? 56.217 70.064  13.453 1.00 18.49 ? 217 ARG B O   1 
ATOM   3852 C CB  . ARG B 1 217 ? 57.880 72.921  14.059 1.00 27.25 ? 217 ARG B CB  1 
ATOM   3853 C CG  . ARG B 1 217 ? 58.789 72.613  12.876 1.00 32.79 ? 217 ARG B CG  1 
ATOM   3854 C CD  . ARG B 1 217 ? 60.165 73.233  13.056 1.00 37.35 ? 217 ARG B CD  1 
ATOM   3855 N NE  . ARG B 1 217 ? 60.813 73.497  11.772 1.00 40.79 ? 217 ARG B NE  1 
ATOM   3856 C CZ  . ARG B 1 217 ? 61.192 72.559  10.909 1.00 42.91 ? 217 ARG B CZ  1 
ATOM   3857 N NH1 . ARG B 1 217 ? 60.990 71.276  11.189 1.00 42.86 ? 217 ARG B NH1 1 
ATOM   3858 N NH2 . ARG B 1 217 ? 61.772 72.905  9.762  1.00 42.48 ? 217 ARG B NH2 1 
ATOM   3859 N N   . TRP B 1 218 ? 56.475 70.682  15.598 1.00 17.48 ? 218 TRP B N   1 
ATOM   3860 C CA  . TRP B 1 218 ? 56.412 69.312  16.088 1.00 15.44 ? 218 TRP B CA  1 
ATOM   3861 C C   . TRP B 1 218 ? 55.168 68.613  15.540 1.00 14.48 ? 218 TRP B C   1 
ATOM   3862 O O   . TRP B 1 218 ? 55.276 67.601  14.861 1.00 14.74 ? 218 TRP B O   1 
ATOM   3863 C CB  . TRP B 1 218 ? 56.394 69.277  17.617 1.00 12.43 ? 218 TRP B CB  1 
ATOM   3864 C CG  . TRP B 1 218 ? 56.523 67.884  18.160 1.00 10.37 ? 218 TRP B CG  1 
ATOM   3865 C CD1 . TRP B 1 218 ? 57.668 67.130  18.245 1.00 10.34 ? 218 TRP B CD1 1 
ATOM   3866 C CD2 . TRP B 1 218 ? 55.461 67.055  18.637 1.00 8.57  ? 218 TRP B CD2 1 
ATOM   3867 N NE1 . TRP B 1 218 ? 57.377 65.883  18.746 1.00 10.15 ? 218 TRP B NE1 1 
ATOM   3868 C CE2 . TRP B 1 218 ? 56.029 65.809  18.994 1.00 8.88  ? 218 TRP B CE2 1 
ATOM   3869 C CE3 . TRP B 1 218 ? 54.078 67.241  18.797 1.00 9.31  ? 218 TRP B CE3 1 
ATOM   3870 C CZ2 . TRP B 1 218 ? 55.264 64.753  19.503 1.00 7.32  ? 218 TRP B CZ2 1 
ATOM   3871 C CZ3 . TRP B 1 218 ? 53.315 66.188  19.304 1.00 10.80 ? 218 TRP B CZ3 1 
ATOM   3872 C CH2 . TRP B 1 218 ? 53.914 64.958  19.651 1.00 8.66  ? 218 TRP B CH2 1 
ATOM   3873 N N   . THR B 1 219 ? 53.988 69.152  15.835 1.00 13.72 ? 219 THR B N   1 
ATOM   3874 C CA  . THR B 1 219 ? 52.752 68.552  15.341 1.00 12.15 ? 219 THR B CA  1 
ATOM   3875 C C   . THR B 1 219 ? 52.858 68.254  13.832 1.00 12.47 ? 219 THR B C   1 
ATOM   3876 O O   . THR B 1 219 ? 52.641 67.115  13.404 1.00 12.98 ? 219 THR B O   1 
ATOM   3877 C CB  . THR B 1 219 ? 51.533 69.477  15.598 1.00 10.74 ? 219 THR B CB  1 
ATOM   3878 O OG1 . THR B 1 219 ? 51.414 69.735  17.002 1.00 9.24  ? 219 THR B OG1 1 
ATOM   3879 C CG2 . THR B 1 219 ? 50.251 68.818  15.114 1.00 9.92  ? 219 THR B CG2 1 
ATOM   3880 N N   . ALA B 1 220 ? 53.204 69.262  13.031 1.00 9.94  ? 220 ALA B N   1 
ATOM   3881 C CA  . ALA B 1 220 ? 53.332 69.086  11.582 1.00 9.32  ? 220 ALA B CA  1 
ATOM   3882 C C   . ALA B 1 220 ? 54.234 67.912  11.207 1.00 8.91  ? 220 ALA B C   1 
ATOM   3883 O O   . ALA B 1 220 ? 53.826 67.020  10.454 1.00 9.42  ? 220 ALA B O   1 
ATOM   3884 C CB  . ALA B 1 220 ? 53.859 70.370  10.940 1.00 8.67  ? 220 ALA B CB  1 
ATOM   3885 N N   . ASN B 1 221 ? 55.459 67.924  11.725 1.00 8.23  ? 221 ASN B N   1 
ATOM   3886 C CA  . ASN B 1 221 ? 56.435 66.866  11.464 1.00 7.87  ? 221 ASN B CA  1 
ATOM   3887 C C   . ASN B 1 221 ? 55.881 65.508  11.871 1.00 7.09  ? 221 ASN B C   1 
ATOM   3888 O O   . ASN B 1 221 ? 55.871 64.563  11.081 1.00 5.92  ? 221 ASN B O   1 
ATOM   3889 C CB  . ASN B 1 221 ? 57.724 67.093  12.262 1.00 7.40  ? 221 ASN B CB  1 
ATOM   3890 C CG  . ASN B 1 221 ? 58.494 68.335  11.828 1.00 13.07 ? 221 ASN B CG  1 
ATOM   3891 O OD1 . ASN B 1 221 ? 59.451 68.735  12.496 1.00 14.15 ? 221 ASN B OD1 1 
ATOM   3892 N ND2 . ASN B 1 221 ? 58.092 68.943  10.711 1.00 11.46 ? 221 ASN B ND2 1 
ATOM   3893 N N   . TYR B 1 222 ? 55.429 65.420  13.117 1.00 4.94  ? 222 TYR B N   1 
ATOM   3894 C CA  . TYR B 1 222 ? 54.910 64.171  13.643 1.00 6.81  ? 222 TYR B CA  1 
ATOM   3895 C C   . TYR B 1 222 ? 53.713 63.692  12.854 1.00 5.93  ? 222 TYR B C   1 
ATOM   3896 O O   . TYR B 1 222 ? 53.519 62.498  12.670 1.00 4.11  ? 222 TYR B O   1 
ATOM   3897 C CB  . TYR B 1 222 ? 54.535 64.326  15.112 1.00 8.14  ? 222 TYR B CB  1 
ATOM   3898 C CG  . TYR B 1 222 ? 54.213 63.013  15.791 1.00 11.37 ? 222 TYR B CG  1 
ATOM   3899 C CD1 . TYR B 1 222 ? 55.097 61.933  15.720 1.00 10.75 ? 222 TYR B CD1 1 
ATOM   3900 C CD2 . TYR B 1 222 ? 53.045 62.863  16.539 1.00 11.10 ? 222 TYR B CD2 1 
ATOM   3901 C CE1 . TYR B 1 222 ? 54.824 60.735  16.391 1.00 13.05 ? 222 TYR B CE1 1 
ATOM   3902 C CE2 . TYR B 1 222 ? 52.767 61.672  17.210 1.00 12.99 ? 222 TYR B CE2 1 
ATOM   3903 C CZ  . TYR B 1 222 ? 53.658 60.617  17.136 1.00 11.82 ? 222 TYR B CZ  1 
ATOM   3904 O OH  . TYR B 1 222 ? 53.389 59.457  17.827 1.00 12.57 ? 222 TYR B OH  1 
ATOM   3905 N N   . PHE B 1 223 ? 52.907 64.637  12.398 1.00 8.04  ? 223 PHE B N   1 
ATOM   3906 C CA  . PHE B 1 223 ? 51.736 64.287  11.610 1.00 9.42  ? 223 PHE B CA  1 
ATOM   3907 C C   . PHE B 1 223 ? 52.195 63.637  10.308 1.00 8.39  ? 223 PHE B C   1 
ATOM   3908 O O   . PHE B 1 223 ? 51.840 62.500  10.005 1.00 7.68  ? 223 PHE B O   1 
ATOM   3909 C CB  . PHE B 1 223 ? 50.898 65.529  11.294 1.00 9.42  ? 223 PHE B CB  1 
ATOM   3910 C CG  . PHE B 1 223 ? 49.796 65.259  10.326 1.00 10.44 ? 223 PHE B CG  1 
ATOM   3911 C CD1 . PHE B 1 223 ? 48.792 64.346  10.639 1.00 11.51 ? 223 PHE B CD1 1 
ATOM   3912 C CD2 . PHE B 1 223 ? 49.791 65.862  9.075  1.00 7.54  ? 223 PHE B CD2 1 
ATOM   3913 C CE1 . PHE B 1 223 ? 47.801 64.034  9.716  1.00 9.35  ? 223 PHE B CE1 1 
ATOM   3914 C CE2 . PHE B 1 223 ? 48.806 65.561  8.151  1.00 7.64  ? 223 PHE B CE2 1 
ATOM   3915 C CZ  . PHE B 1 223 ? 47.808 64.644  8.472  1.00 10.45 ? 223 PHE B CZ  1 
ATOM   3916 N N   . ALA B 1 224 ? 52.995 64.366  9.541  1.00 8.05  ? 224 ALA B N   1 
ATOM   3917 C CA  . ALA B 1 224 ? 53.502 63.843  8.280  1.00 8.01  ? 224 ALA B CA  1 
ATOM   3918 C C   . ALA B 1 224 ? 54.108 62.457  8.469  1.00 8.20  ? 224 ALA B C   1 
ATOM   3919 O O   . ALA B 1 224 ? 53.904 61.558  7.646  1.00 9.83  ? 224 ALA B O   1 
ATOM   3920 C CB  . ALA B 1 224 ? 54.545 64.788  7.702  1.00 7.00  ? 224 ALA B CB  1 
ATOM   3921 N N   . LEU B 1 225 ? 54.849 62.291  9.559  1.00 7.74  ? 225 LEU B N   1 
ATOM   3922 C CA  . LEU B 1 225 ? 55.511 61.027  9.874  1.00 6.27  ? 225 LEU B CA  1 
ATOM   3923 C C   . LEU B 1 225 ? 54.554 59.849  10.050 1.00 5.13  ? 225 LEU B C   1 
ATOM   3924 O O   . LEU B 1 225 ? 54.745 58.791  9.459  1.00 4.04  ? 225 LEU B O   1 
ATOM   3925 C CB  . LEU B 1 225 ? 56.363 61.196  11.132 1.00 6.82  ? 225 LEU B CB  1 
ATOM   3926 C CG  . LEU B 1 225 ? 57.381 60.101  11.433 1.00 8.11  ? 225 LEU B CG  1 
ATOM   3927 C CD1 . LEU B 1 225 ? 58.484 60.675  12.298 1.00 9.62  ? 225 LEU B CD1 1 
ATOM   3928 C CD2 . LEU B 1 225 ? 56.697 58.940  12.133 1.00 10.50 ? 225 LEU B CD2 1 
ATOM   3929 N N   . ARG B 1 226 ? 53.515 60.027  10.849 1.00 3.77  ? 226 ARG B N   1 
ATOM   3930 C CA  . ARG B 1 226 ? 52.583 58.937  11.067 1.00 3.06  ? 226 ARG B CA  1 
ATOM   3931 C C   . ARG B 1 226 ? 51.338 59.053  10.210 1.00 2.99  ? 226 ARG B C   1 
ATOM   3932 O O   . ARG B 1 226 ? 50.771 58.050  9.782  1.00 3.03  ? 226 ARG B O   1 
ATOM   3933 C CB  . ARG B 1 226 ? 52.217 58.873  12.545 1.00 2.19  ? 226 ARG B CB  1 
ATOM   3934 C CG  . ARG B 1 226 ? 53.434 58.610  13.411 1.00 3.16  ? 226 ARG B CG  1 
ATOM   3935 C CD  . ARG B 1 226 ? 53.033 58.134  14.770 1.00 2.44  ? 226 ARG B CD  1 
ATOM   3936 N NE  . ARG B 1 226 ? 52.113 57.013  14.657 1.00 5.00  ? 226 ARG B NE  1 
ATOM   3937 C CZ  . ARG B 1 226 ? 51.374 56.550  15.657 1.00 5.13  ? 226 ARG B CZ  1 
ATOM   3938 N NH1 . ARG B 1 226 ? 51.452 57.112  16.853 1.00 5.00  ? 226 ARG B NH1 1 
ATOM   3939 N NH2 . ARG B 1 226 ? 50.546 55.536  15.453 1.00 6.06  ? 226 ARG B NH2 1 
ATOM   3940 N N   . GLY B 1 227 ? 50.924 60.284  9.948  1.00 4.17  ? 227 GLY B N   1 
ATOM   3941 C CA  . GLY B 1 227 ? 49.741 60.511  9.142  1.00 5.92  ? 227 GLY B CA  1 
ATOM   3942 C C   . GLY B 1 227 ? 49.905 60.200  7.666  1.00 4.35  ? 227 GLY B C   1 
ATOM   3943 O O   . GLY B 1 227 ? 48.973 59.708  7.045  1.00 3.34  ? 227 GLY B O   1 
ATOM   3944 N N   . TRP B 1 228 ? 51.077 60.495  7.106  1.00 5.43  ? 228 TRP B N   1 
ATOM   3945 C CA  . TRP B 1 228 ? 51.352 60.238  5.690  1.00 6.15  ? 228 TRP B CA  1 
ATOM   3946 C C   . TRP B 1 228 ? 52.424 59.160  5.522  1.00 6.24  ? 228 TRP B C   1 
ATOM   3947 O O   . TRP B 1 228 ? 52.688 58.694  4.409  1.00 5.13  ? 228 TRP B O   1 
ATOM   3948 C CB  . TRP B 1 228 ? 51.845 61.511  4.992  1.00 6.40  ? 228 TRP B CB  1 
ATOM   3949 C CG  . TRP B 1 228 ? 50.891 62.670  5.013  1.00 6.56  ? 228 TRP B CG  1 
ATOM   3950 C CD1 . TRP B 1 228 ? 49.526 62.614  5.039  1.00 6.71  ? 228 TRP B CD1 1 
ATOM   3951 C CD2 . TRP B 1 228 ? 51.235 64.060  4.952  1.00 6.90  ? 228 TRP B CD2 1 
ATOM   3952 N NE1 . TRP B 1 228 ? 48.999 63.883  4.998  1.00 8.65  ? 228 TRP B NE1 1 
ATOM   3953 C CE2 . TRP B 1 228 ? 50.025 64.790  4.944  1.00 8.39  ? 228 TRP B CE2 1 
ATOM   3954 C CE3 . TRP B 1 228 ? 52.450 64.761  4.901  1.00 6.23  ? 228 TRP B CE3 1 
ATOM   3955 C CZ2 . TRP B 1 228 ? 49.992 66.191  4.890  1.00 8.01  ? 228 TRP B CZ2 1 
ATOM   3956 C CZ3 . TRP B 1 228 ? 52.418 66.157  4.848  1.00 6.62  ? 228 TRP B CZ3 1 
ATOM   3957 C CH2 . TRP B 1 228 ? 51.195 66.855  4.844  1.00 7.13  ? 228 TRP B CH2 1 
ATOM   3958 N N   . GLN B 1 229 ? 53.038 58.785  6.637  1.00 5.49  ? 229 GLN B N   1 
ATOM   3959 C CA  . GLN B 1 229 ? 54.111 57.794  6.660  1.00 5.04  ? 229 GLN B CA  1 
ATOM   3960 C C   . GLN B 1 229 ? 55.315 58.252  5.862  1.00 3.16  ? 229 GLN B C   1 
ATOM   3961 O O   . GLN B 1 229 ? 55.898 57.485  5.095  1.00 3.93  ? 229 GLN B O   1 
ATOM   3962 C CB  . GLN B 1 229 ? 53.638 56.437  6.142  1.00 5.69  ? 229 GLN B CB  1 
ATOM   3963 C CG  . GLN B 1 229 ? 52.501 55.842  6.937  1.00 6.56  ? 229 GLN B CG  1 
ATOM   3964 C CD  . GLN B 1 229 ? 51.150 56.150  6.306  1.00 10.29 ? 229 GLN B CD  1 
ATOM   3965 O OE1 . GLN B 1 229 ? 50.889 55.751  5.165  1.00 9.82  ? 229 GLN B OE1 1 
ATOM   3966 N NE2 . GLN B 1 229 ? 50.290 56.866  7.037  1.00 5.56  ? 229 GLN B NE2 1 
ATOM   3967 N N   . ALA B 1 230 ? 55.672 59.519  6.044  1.00 3.44  ? 230 ALA B N   1 
ATOM   3968 C CA  . ALA B 1 230 ? 56.832 60.114  5.393  1.00 3.38  ? 230 ALA B CA  1 
ATOM   3969 C C   . ALA B 1 230 ? 58.061 59.480  6.054  1.00 3.11  ? 230 ALA B C   1 
ATOM   3970 O O   . ALA B 1 230 ? 58.177 59.498  7.273  1.00 1.13  ? 230 ALA B O   1 
ATOM   3971 C CB  . ALA B 1 230 ? 56.827 61.624  5.615  1.00 3.83  ? 230 ALA B CB  1 
ATOM   3972 N N   . LYS B 1 231 ? 58.977 58.937  5.254  1.00 6.39  ? 231 LYS B N   1 
ATOM   3973 C CA  . LYS B 1 231 ? 60.162 58.259  5.788  1.00 5.69  ? 231 LYS B CA  1 
ATOM   3974 C C   . LYS B 1 231 ? 61.415 59.095  6.060  1.00 8.36  ? 231 LYS B C   1 
ATOM   3975 O O   . LYS B 1 231 ? 62.392 58.573  6.607  1.00 8.55  ? 231 LYS B O   1 
ATOM   3976 C CB  . LYS B 1 231 ? 60.546 57.098  4.865  1.00 5.03  ? 231 LYS B CB  1 
ATOM   3977 C CG  . LYS B 1 231 ? 59.424 56.096  4.584  1.00 6.19  ? 231 LYS B CG  1 
ATOM   3978 C CD  . LYS B 1 231 ? 58.777 55.581  5.865  1.00 4.05  ? 231 LYS B CD  1 
ATOM   3979 C CE  . LYS B 1 231 ? 57.741 54.488  5.588  1.00 5.81  ? 231 LYS B CE  1 
ATOM   3980 N NZ  . LYS B 1 231 ? 56.637 54.906  4.666  1.00 6.99  ? 231 LYS B NZ  1 
ATOM   3981 N N   . ASP B 1 232 ? 61.408 60.374  5.696  1.00 8.43  ? 232 ASP B N   1 
ATOM   3982 C CA  . ASP B 1 232 ? 62.586 61.213  5.912  1.00 9.23  ? 232 ASP B CA  1 
ATOM   3983 C C   . ASP B 1 232 ? 62.261 62.420  6.784  1.00 9.47  ? 232 ASP B C   1 
ATOM   3984 O O   . ASP B 1 232 ? 62.672 63.543  6.497  1.00 8.85  ? 232 ASP B O   1 
ATOM   3985 C CB  . ASP B 1 232 ? 63.158 61.657  4.557  1.00 10.46 ? 232 ASP B CB  1 
ATOM   3986 C CG  . ASP B 1 232 ? 64.581 62.191  4.658  1.00 10.68 ? 232 ASP B CG  1 
ATOM   3987 O OD1 . ASP B 1 232 ? 65.388 61.652  5.449  1.00 6.41  ? 232 ASP B OD1 1 
ATOM   3988 O OD2 . ASP B 1 232 ? 64.899 63.144  3.916  1.00 14.33 ? 232 ASP B OD2 1 
ATOM   3989 N N   . VAL B 1 233 ? 61.528 62.168  7.865  1.00 8.71  ? 233 VAL B N   1 
ATOM   3990 C CA  . VAL B 1 233 ? 61.138 63.214  8.798  1.00 10.14 ? 233 VAL B CA  1 
ATOM   3991 C C   . VAL B 1 233 ? 61.768 62.994  10.172 1.00 12.33 ? 233 VAL B C   1 
ATOM   3992 O O   . VAL B 1 233 ? 61.783 61.872  10.686 1.00 16.21 ? 233 VAL B O   1 
ATOM   3993 C CB  . VAL B 1 233 ? 59.601 63.249  8.991  1.00 11.11 ? 233 VAL B CB  1 
ATOM   3994 C CG1 . VAL B 1 233 ? 59.232 64.274  10.055 1.00 11.45 ? 233 VAL B CG1 1 
ATOM   3995 C CG2 . VAL B 1 233 ? 58.909 63.571  7.682  1.00 8.92  ? 233 VAL B CG2 1 
ATOM   3996 N N   . PHE B 1 234 ? 62.285 64.065  10.763 1.00 10.32 ? 234 PHE B N   1 
ATOM   3997 C CA  . PHE B 1 234 ? 62.869 63.995  12.100 1.00 9.49  ? 234 PHE B CA  1 
ATOM   3998 C C   . PHE B 1 234 ? 62.098 64.980  12.987 1.00 8.31  ? 234 PHE B C   1 
ATOM   3999 O O   . PHE B 1 234 ? 61.457 65.905  12.485 1.00 6.35  ? 234 PHE B O   1 
ATOM   4000 C CB  . PHE B 1 234 ? 64.352 64.376  12.075 1.00 10.14 ? 234 PHE B CB  1 
ATOM   4001 C CG  . PHE B 1 234 ? 65.147 63.787  13.210 1.00 7.90  ? 234 PHE B CG  1 
ATOM   4002 C CD1 . PHE B 1 234 ? 65.404 62.422  13.254 1.00 7.48  ? 234 PHE B CD1 1 
ATOM   4003 C CD2 . PHE B 1 234 ? 65.637 64.597  14.235 1.00 8.11  ? 234 PHE B CD2 1 
ATOM   4004 C CE1 . PHE B 1 234 ? 66.143 61.861  14.301 1.00 7.58  ? 234 PHE B CE1 1 
ATOM   4005 C CE2 . PHE B 1 234 ? 66.377 64.051  15.289 1.00 7.09  ? 234 PHE B CE2 1 
ATOM   4006 C CZ  . PHE B 1 234 ? 66.632 62.676  15.320 1.00 6.72  ? 234 PHE B CZ  1 
ATOM   4007 N N   . LEU B 1 235 ? 62.154 64.777  14.298 1.00 8.05  ? 235 LEU B N   1 
ATOM   4008 C CA  . LEU B 1 235 ? 61.463 65.644  15.249 1.00 9.76  ? 235 LEU B CA  1 
ATOM   4009 C C   . LEU B 1 235 ? 62.480 66.313  16.188 1.00 11.68 ? 235 LEU B C   1 
ATOM   4010 O O   . LEU B 1 235 ? 62.703 65.851  17.309 1.00 10.89 ? 235 LEU B O   1 
ATOM   4011 C CB  . LEU B 1 235 ? 60.462 64.817  16.059 1.00 10.18 ? 235 LEU B CB  1 
ATOM   4012 C CG  . LEU B 1 235 ? 59.055 64.548  15.501 1.00 12.94 ? 235 LEU B CG  1 
ATOM   4013 C CD1 . LEU B 1 235 ? 59.107 64.103  14.052 1.00 13.32 ? 235 LEU B CD1 1 
ATOM   4014 C CD2 . LEU B 1 235 ? 58.376 63.490  16.361 1.00 12.19 ? 235 LEU B CD2 1 
ATOM   4015 N N   . PRO B 1 236 ? 63.113 67.409  15.736 1.00 12.12 ? 236 PRO B N   1 
ATOM   4016 C CA  . PRO B 1 236 ? 64.110 68.130  16.540 1.00 15.46 ? 236 PRO B CA  1 
ATOM   4017 C C   . PRO B 1 236 ? 63.555 68.807  17.785 1.00 16.62 ? 236 PRO B C   1 
ATOM   4018 O O   . PRO B 1 236 ? 64.301 69.107  18.717 1.00 16.66 ? 236 PRO B O   1 
ATOM   4019 C CB  . PRO B 1 236 ? 64.686 69.143  15.549 1.00 14.35 ? 236 PRO B CB  1 
ATOM   4020 C CG  . PRO B 1 236 ? 64.533 68.451  14.240 1.00 15.12 ? 236 PRO B CG  1 
ATOM   4021 C CD  . PRO B 1 236 ? 63.133 67.903  14.351 1.00 13.58 ? 236 PRO B CD  1 
ATOM   4022 N N   . ASP B 1 237 ? 62.247 69.048  17.785 1.00 19.62 ? 237 ASP B N   1 
ATOM   4023 C CA  . ASP B 1 237 ? 61.572 69.697  18.901 1.00 21.61 ? 237 ASP B CA  1 
ATOM   4024 C C   . ASP B 1 237 ? 61.067 68.679  19.925 1.00 22.90 ? 237 ASP B C   1 
ATOM   4025 O O   . ASP B 1 237 ? 60.840 69.029  21.079 1.00 24.04 ? 237 ASP B O   1 
ATOM   4026 C CB  . ASP B 1 237 ? 60.381 70.529  18.397 1.00 23.94 ? 237 ASP B CB  1 
ATOM   4027 C CG  . ASP B 1 237 ? 60.787 71.610  17.394 1.00 27.03 ? 237 ASP B CG  1 
ATOM   4028 O OD1 . ASP B 1 237 ? 61.640 72.459  17.730 1.00 28.12 ? 237 ASP B OD1 1 
ATOM   4029 O OD2 . ASP B 1 237 ? 60.242 71.617  16.266 1.00 29.78 ? 237 ASP B OD2 1 
ATOM   4030 N N   . ASP B 1 238 ? 60.890 67.426  19.511 1.00 23.42 ? 238 ASP B N   1 
ATOM   4031 C CA  . ASP B 1 238 ? 60.393 66.395  20.427 1.00 24.29 ? 238 ASP B CA  1 
ATOM   4032 C C   . ASP B 1 238 ? 61.102 66.421  21.780 1.00 24.48 ? 238 ASP B C   1 
ATOM   4033 O O   . ASP B 1 238 ? 62.297 66.711  21.859 1.00 23.34 ? 238 ASP B O   1 
ATOM   4034 C CB  . ASP B 1 238 ? 60.542 65.003  19.813 1.00 23.56 ? 238 ASP B CB  1 
ATOM   4035 C CG  . ASP B 1 238 ? 59.778 63.946  20.592 1.00 25.46 ? 238 ASP B CG  1 
ATOM   4036 O OD1 . ASP B 1 238 ? 58.528 63.982  20.568 1.00 25.20 ? 238 ASP B OD1 1 
ATOM   4037 O OD2 . ASP B 1 238 ? 60.417 63.087  21.234 1.00 25.16 ? 238 ASP B OD2 1 
ATOM   4038 N N   . TYR B 1 239 ? 60.356 66.105  22.837 1.00 24.87 ? 239 TYR B N   1 
ATOM   4039 C CA  . TYR B 1 239 ? 60.885 66.097  24.206 1.00 25.47 ? 239 TYR B CA  1 
ATOM   4040 C C   . TYR B 1 239 ? 61.921 65.003  24.451 1.00 23.16 ? 239 TYR B C   1 
ATOM   4041 O O   . TYR B 1 239 ? 63.018 65.272  24.938 1.00 22.41 ? 239 TYR B O   1 
ATOM   4042 C CB  . TYR B 1 239 ? 59.733 65.944  25.207 1.00 27.96 ? 239 TYR B CB  1 
ATOM   4043 C CG  . TYR B 1 239 ? 58.788 67.129  25.258 1.00 32.77 ? 239 TYR B CG  1 
ATOM   4044 C CD1 . TYR B 1 239 ? 57.427 66.950  25.539 1.00 34.59 ? 239 TYR B CD1 1 
ATOM   4045 C CD2 . TYR B 1 239 ? 59.251 68.434  25.033 1.00 34.15 ? 239 TYR B CD2 1 
ATOM   4046 C CE1 . TYR B 1 239 ? 56.550 68.037  25.590 1.00 36.62 ? 239 TYR B CE1 1 
ATOM   4047 C CE2 . TYR B 1 239 ? 58.384 69.528  25.085 1.00 36.48 ? 239 TYR B CE2 1 
ATOM   4048 C CZ  . TYR B 1 239 ? 57.036 69.322  25.364 1.00 37.41 ? 239 TYR B CZ  1 
ATOM   4049 O OH  . TYR B 1 239 ? 56.178 70.402  25.415 1.00 39.42 ? 239 TYR B OH  1 
ATOM   4050 N N   . LEU B 1 240 ? 61.562 63.770  24.119 1.00 21.52 ? 240 LEU B N   1 
ATOM   4051 C CA  . LEU B 1 240 ? 62.462 62.642  24.302 1.00 20.56 ? 240 LEU B CA  1 
ATOM   4052 C C   . LEU B 1 240 ? 63.743 62.849  23.496 1.00 20.96 ? 240 LEU B C   1 
ATOM   4053 O O   . LEU B 1 240 ? 64.837 62.512  23.949 1.00 21.50 ? 240 LEU B O   1 
ATOM   4054 C CB  . LEU B 1 240 ? 61.760 61.353  23.875 1.00 17.13 ? 240 LEU B CB  1 
ATOM   4055 C CG  . LEU B 1 240 ? 62.533 60.038  23.997 1.00 18.60 ? 240 LEU B CG  1 
ATOM   4056 C CD1 . LEU B 1 240 ? 63.210 59.961  25.356 1.00 16.01 ? 240 LEU B CD1 1 
ATOM   4057 C CD2 . LEU B 1 240 ? 61.573 58.859  23.796 1.00 13.77 ? 240 LEU B CD2 1 
ATOM   4058 N N   . ILE B 1 241 ? 63.602 63.415  22.301 1.00 20.17 ? 241 ILE B N   1 
ATOM   4059 C CA  . ILE B 1 241 ? 64.744 63.676  21.433 1.00 20.02 ? 241 ILE B CA  1 
ATOM   4060 C C   . ILE B 1 241 ? 65.727 64.636  22.100 1.00 21.04 ? 241 ILE B C   1 
ATOM   4061 O O   . ILE B 1 241 ? 66.940 64.463  22.007 1.00 19.94 ? 241 ILE B O   1 
ATOM   4062 C CB  . ILE B 1 241 ? 64.280 64.279  20.088 1.00 18.98 ? 241 ILE B CB  1 
ATOM   4063 C CG1 . ILE B 1 241 ? 63.505 63.227  19.298 1.00 17.12 ? 241 ILE B CG1 1 
ATOM   4064 C CG2 . ILE B 1 241 ? 65.477 64.792  19.296 1.00 18.90 ? 241 ILE B CG2 1 
ATOM   4065 C CD1 . ILE B 1 241 ? 64.296 61.954  19.046 1.00 17.34 ? 241 ILE B CD1 1 
ATOM   4066 N N   . LYS B 1 242 ? 65.189 65.653  22.762 1.00 22.70 ? 242 LYS B N   1 
ATOM   4067 C CA  . LYS B 1 242 ? 66.008 66.638  23.450 1.00 24.99 ? 242 LYS B CA  1 
ATOM   4068 C C   . LYS B 1 242 ? 66.763 65.947  24.582 1.00 24.17 ? 242 LYS B C   1 
ATOM   4069 O O   . LYS B 1 242 ? 67.872 66.343  24.940 1.00 21.67 ? 242 LYS B O   1 
ATOM   4070 C CB  . LYS B 1 242 ? 65.121 67.761  24.001 1.00 26.14 ? 242 LYS B CB  1 
ATOM   4071 C CG  . LYS B 1 242 ? 64.564 68.703  22.928 1.00 30.47 ? 242 LYS B CG  1 
ATOM   4072 C CD  . LYS B 1 242 ? 63.322 69.470  23.415 1.00 33.51 ? 242 LYS B CD  1 
ATOM   4073 C CE  . LYS B 1 242 ? 63.541 70.169  24.757 1.00 33.68 ? 242 LYS B CE  1 
ATOM   4074 N NZ  . LYS B 1 242 ? 62.274 70.781  25.242 1.00 34.55 ? 242 LYS B NZ  1 
ATOM   4075 N N   . GLN B 1 243 ? 66.152 64.907  25.140 1.00 25.00 ? 243 GLN B N   1 
ATOM   4076 C CA  . GLN B 1 243 ? 66.780 64.154  26.218 1.00 25.98 ? 243 GLN B CA  1 
ATOM   4077 C C   . GLN B 1 243 ? 67.976 63.390  25.647 1.00 23.18 ? 243 GLN B C   1 
ATOM   4078 O O   . GLN B 1 243 ? 69.062 63.392  26.227 1.00 22.97 ? 243 GLN B O   1 
ATOM   4079 C CB  . GLN B 1 243 ? 65.775 63.178  26.839 1.00 29.40 ? 243 GLN B CB  1 
ATOM   4080 C CG  . GLN B 1 243 ? 65.706 63.263  28.355 1.00 35.84 ? 243 GLN B CG  1 
ATOM   4081 C CD  . GLN B 1 243 ? 65.213 64.614  28.845 1.00 37.70 ? 243 GLN B CD  1 
ATOM   4082 O OE1 . GLN B 1 243 ? 64.007 64.865  28.908 1.00 38.71 ? 243 GLN B OE1 1 
ATOM   4083 N NE2 . GLN B 1 243 ? 66.148 65.497  29.182 1.00 39.06 ? 243 GLN B NE2 1 
ATOM   4084 N N   . ARG B 1 244 ? 67.768 62.761  24.494 1.00 20.55 ? 244 ARG B N   1 
ATOM   4085 C CA  . ARG B 1 244 ? 68.808 61.994  23.819 1.00 19.36 ? 244 ARG B CA  1 
ATOM   4086 C C   . ARG B 1 244 ? 69.963 62.882  23.374 1.00 19.77 ? 244 ARG B C   1 
ATOM   4087 O O   . ARG B 1 244 ? 71.095 62.420  23.252 1.00 19.73 ? 244 ARG B O   1 
ATOM   4088 C CB  . ARG B 1 244 ? 68.210 61.278  22.611 1.00 17.38 ? 244 ARG B CB  1 
ATOM   4089 C CG  . ARG B 1 244 ? 67.202 60.207  22.973 1.00 15.30 ? 244 ARG B CG  1 
ATOM   4090 C CD  . ARG B 1 244 ? 67.891 58.873  23.228 1.00 15.62 ? 244 ARG B CD  1 
ATOM   4091 N NE  . ARG B 1 244 ? 66.943 57.820  23.580 1.00 13.73 ? 244 ARG B NE  1 
ATOM   4092 C CZ  . ARG B 1 244 ? 66.328 57.732  24.755 1.00 15.06 ? 244 ARG B CZ  1 
ATOM   4093 N NH1 . ARG B 1 244 ? 66.562 58.633  25.704 1.00 14.09 ? 244 ARG B NH1 1 
ATOM   4094 N NH2 . ARG B 1 244 ? 65.469 56.748  24.979 1.00 15.14 ? 244 ARG B NH2 1 
ATOM   4095 N N   . PHE B 1 245 ? 69.672 64.154  23.124 1.00 20.32 ? 245 PHE B N   1 
ATOM   4096 C CA  . PHE B 1 245 ? 70.693 65.109  22.704 1.00 22.77 ? 245 PHE B CA  1 
ATOM   4097 C C   . PHE B 1 245 ? 70.898 66.164  23.798 1.00 24.61 ? 245 PHE B C   1 
ATOM   4098 O O   . PHE B 1 245 ? 70.287 67.236  23.764 1.00 25.66 ? 245 PHE B O   1 
ATOM   4099 C CB  . PHE B 1 245 ? 70.286 65.797  21.393 1.00 21.00 ? 245 PHE B CB  1 
ATOM   4100 C CG  . PHE B 1 245 ? 70.193 64.866  20.211 1.00 19.31 ? 245 PHE B CG  1 
ATOM   4101 C CD1 . PHE B 1 245 ? 69.054 64.096  19.995 1.00 19.09 ? 245 PHE B CD1 1 
ATOM   4102 C CD2 . PHE B 1 245 ? 71.250 64.765  19.311 1.00 19.19 ? 245 PHE B CD2 1 
ATOM   4103 C CE1 . PHE B 1 245 ? 68.968 63.237  18.899 1.00 18.44 ? 245 PHE B CE1 1 
ATOM   4104 C CE2 . PHE B 1 245 ? 71.178 63.913  18.214 1.00 19.68 ? 245 PHE B CE2 1 
ATOM   4105 C CZ  . PHE B 1 245 ? 70.032 63.146  18.008 1.00 19.48 ? 245 PHE B CZ  1 
ATOM   4106 N N   . PRO B 1 246 ? 71.768 65.872  24.780 1.00 25.61 ? 246 PRO B N   1 
ATOM   4107 C CA  . PRO B 1 246 ? 72.063 66.781  25.898 1.00 26.09 ? 246 PRO B CA  1 
ATOM   4108 C C   . PRO B 1 246 ? 72.592 68.163  25.491 1.00 24.89 ? 246 PRO B C   1 
ATOM   4109 O O   . PRO B 1 246 ? 73.608 68.270  24.809 1.00 23.81 ? 246 PRO B O   1 
ATOM   4110 C CB  . PRO B 1 246 ? 73.101 66.000  26.711 1.00 26.64 ? 246 PRO B CB  1 
ATOM   4111 C CG  . PRO B 1 246 ? 72.806 64.562  26.378 1.00 25.92 ? 246 PRO B CG  1 
ATOM   4112 C CD  . PRO B 1 246 ? 72.560 64.635  24.898 1.00 26.18 ? 246 PRO B CD  1 
ATOM   4113 N N   . GLY B 1 247 ? 71.896 69.213  25.914 1.00 24.74 ? 247 GLY B N   1 
ATOM   4114 C CA  . GLY B 1 247 ? 72.334 70.566  25.612 1.00 24.95 ? 247 GLY B CA  1 
ATOM   4115 C C   . GLY B 1 247 ? 72.333 71.022  24.164 1.00 25.57 ? 247 GLY B C   1 
ATOM   4116 O O   . GLY B 1 247 ? 72.873 72.087  23.852 1.00 26.86 ? 247 GLY B O   1 
ATOM   4117 N N   . MET B 1 248 ? 71.745 70.235  23.268 1.00 23.77 ? 248 MET B N   1 
ATOM   4118 C CA  . MET B 1 248 ? 71.693 70.630  21.867 1.00 20.86 ? 248 MET B CA  1 
ATOM   4119 C C   . MET B 1 248 ? 70.338 71.220  21.513 1.00 19.70 ? 248 MET B C   1 
ATOM   4120 O O   . MET B 1 248 ? 69.296 70.650  21.839 1.00 19.92 ? 248 MET B O   1 
ATOM   4121 C CB  . MET B 1 248 ? 71.977 69.438  20.962 1.00 21.40 ? 248 MET B CB  1 
ATOM   4122 C CG  . MET B 1 248 ? 73.437 69.108  20.833 1.00 19.52 ? 248 MET B CG  1 
ATOM   4123 S SD  . MET B 1 248 ? 73.638 67.542  20.010 1.00 20.43 ? 248 MET B SD  1 
ATOM   4124 C CE  . MET B 1 248 ? 73.432 68.035  18.294 1.00 18.73 ? 248 MET B CE  1 
ATOM   4125 N N   . THR B 1 249 ? 70.371 72.372  20.849 1.00 17.47 ? 249 THR B N   1 
ATOM   4126 C CA  . THR B 1 249 ? 69.163 73.074  20.427 1.00 15.28 ? 249 THR B CA  1 
ATOM   4127 C C   . THR B 1 249 ? 68.530 72.333  19.252 1.00 13.47 ? 249 THR B C   1 
ATOM   4128 O O   . THR B 1 249 ? 69.182 71.528  18.593 1.00 13.64 ? 249 THR B O   1 
ATOM   4129 C CB  . THR B 1 249 ? 69.487 74.525  19.954 1.00 15.61 ? 249 THR B CB  1 
ATOM   4130 O OG1 . THR B 1 249 ? 70.067 74.489  18.640 1.00 11.48 ? 249 THR B OG1 1 
ATOM   4131 C CG2 . THR B 1 249 ? 70.476 75.194  20.914 1.00 15.44 ? 249 THR B CG2 1 
ATOM   4132 N N   . PRO B 1 250 ? 67.246 72.587  18.987 1.00 13.41 ? 250 PRO B N   1 
ATOM   4133 C CA  . PRO B 1 250 ? 66.528 71.946  17.880 1.00 14.15 ? 250 PRO B CA  1 
ATOM   4134 C C   . PRO B 1 250 ? 67.251 72.076  16.531 1.00 14.67 ? 250 PRO B C   1 
ATOM   4135 O O   . PRO B 1 250 ? 67.310 71.120  15.758 1.00 15.58 ? 250 PRO B O   1 
ATOM   4136 C CB  . PRO B 1 250 ? 65.188 72.670  17.891 1.00 13.39 ? 250 PRO B CB  1 
ATOM   4137 C CG  . PRO B 1 250 ? 64.948 72.863  19.350 1.00 14.49 ? 250 PRO B CG  1 
ATOM   4138 C CD  . PRO B 1 250 ? 66.311 73.337  19.848 1.00 14.55 ? 250 PRO B CD  1 
ATOM   4139 N N   . ALA B 1 251 ? 67.795 73.262  16.258 1.00 14.80 ? 251 ALA B N   1 
ATOM   4140 C CA  . ALA B 1 251 ? 68.509 73.528  15.011 1.00 13.82 ? 251 ALA B CA  1 
ATOM   4141 C C   . ALA B 1 251 ? 69.747 72.647  14.881 1.00 13.74 ? 251 ALA B C   1 
ATOM   4142 O O   . ALA B 1 251 ? 70.067 72.161  13.791 1.00 12.37 ? 251 ALA B O   1 
ATOM   4143 C CB  . ALA B 1 251 ? 68.907 74.998  14.941 1.00 12.18 ? 251 ALA B CB  1 
ATOM   4144 N N   . GLN B 1 252 ? 70.434 72.446  16.002 1.00 12.86 ? 252 GLN B N   1 
ATOM   4145 C CA  . GLN B 1 252 ? 71.641 71.621  16.041 1.00 12.61 ? 252 GLN B CA  1 
ATOM   4146 C C   . GLN B 1 252 ? 71.278 70.159  15.839 1.00 10.97 ? 252 GLN B C   1 
ATOM   4147 O O   . GLN B 1 252 ? 71.923 69.438  15.070 1.00 9.18  ? 252 GLN B O   1 
ATOM   4148 C CB  . GLN B 1 252 ? 72.358 71.783  17.389 1.00 13.40 ? 252 GLN B CB  1 
ATOM   4149 C CG  . GLN B 1 252 ? 72.934 73.169  17.629 1.00 16.81 ? 252 GLN B CG  1 
ATOM   4150 C CD  . GLN B 1 252 ? 73.686 73.279  18.947 1.00 17.50 ? 252 GLN B CD  1 
ATOM   4151 O OE1 . GLN B 1 252 ? 73.088 73.261  20.024 1.00 18.93 ? 252 GLN B OE1 1 
ATOM   4152 N NE2 . GLN B 1 252 ? 75.007 73.382  18.864 1.00 16.73 ? 252 GLN B NE2 1 
ATOM   4153 N N   . ILE B 1 253 ? 70.237 69.722  16.535 1.00 11.13 ? 253 ILE B N   1 
ATOM   4154 C CA  . ILE B 1 253 ? 69.793 68.345  16.416 1.00 12.68 ? 253 ILE B CA  1 
ATOM   4155 C C   . ILE B 1 253 ? 69.479 68.088  14.938 1.00 13.23 ? 253 ILE B C   1 
ATOM   4156 O O   . ILE B 1 253 ? 69.943 67.099  14.349 1.00 11.70 ? 253 ILE B O   1 
ATOM   4157 C CB  . ILE B 1 253 ? 68.555 68.095  17.304 1.00 13.07 ? 253 ILE B CB  1 
ATOM   4158 C CG1 . ILE B 1 253 ? 68.900 68.449  18.763 1.00 13.55 ? 253 ILE B CG1 1 
ATOM   4159 C CG2 . ILE B 1 253 ? 68.122 66.634  17.201 1.00 13.44 ? 253 ILE B CG2 1 
ATOM   4160 C CD1 . ILE B 1 253 ? 67.767 68.255  19.765 1.00 10.04 ? 253 ILE B CD1 1 
ATOM   4161 N N   . ARG B 1 254 ? 68.726 69.008  14.339 1.00 11.90 ? 254 ARG B N   1 
ATOM   4162 C CA  . ARG B 1 254 ? 68.352 68.912  12.929 1.00 13.68 ? 254 ARG B CA  1 
ATOM   4163 C C   . ARG B 1 254 ? 69.583 68.781  12.032 1.00 14.31 ? 254 ARG B C   1 
ATOM   4164 O O   . ARG B 1 254 ? 69.591 68.008  11.067 1.00 14.00 ? 254 ARG B O   1 
ATOM   4165 C CB  . ARG B 1 254 ? 67.558 70.152  12.518 1.00 15.20 ? 254 ARG B CB  1 
ATOM   4166 C CG  . ARG B 1 254 ? 67.109 70.171  11.063 1.00 13.62 ? 254 ARG B CG  1 
ATOM   4167 C CD  . ARG B 1 254 ? 66.367 71.468  10.770 1.00 16.35 ? 254 ARG B CD  1 
ATOM   4168 N NE  . ARG B 1 254 ? 65.250 71.676  11.695 1.00 15.71 ? 254 ARG B NE  1 
ATOM   4169 C CZ  . ARG B 1 254 ? 65.073 72.778  12.424 1.00 15.60 ? 254 ARG B CZ  1 
ATOM   4170 N NH1 . ARG B 1 254 ? 65.937 73.786  12.346 1.00 15.95 ? 254 ARG B NH1 1 
ATOM   4171 N NH2 . ARG B 1 254 ? 64.029 72.876  13.236 1.00 13.71 ? 254 ARG B NH2 1 
ATOM   4172 N N   . ARG B 1 255 ? 70.619 69.549  12.352 1.00 12.72 ? 255 ARG B N   1 
ATOM   4173 C CA  . ARG B 1 255 ? 71.849 69.520  11.577 1.00 11.69 ? 255 ARG B CA  1 
ATOM   4174 C C   . ARG B 1 255 ? 72.457 68.128  11.697 1.00 10.34 ? 255 ARG B C   1 
ATOM   4175 O O   . ARG B 1 255 ? 72.807 67.495  10.705 1.00 10.20 ? 255 ARG B O   1 
ATOM   4176 C CB  . ARG B 1 255 ? 72.829 70.565  12.109 1.00 11.95 ? 255 ARG B CB  1 
ATOM   4177 C CG  . ARG B 1 255 ? 73.750 71.179  11.061 1.00 14.23 ? 255 ARG B CG  1 
ATOM   4178 C CD  . ARG B 1 255 ? 74.947 70.311  10.699 1.00 15.04 ? 255 ARG B CD  1 
ATOM   4179 N NE  . ARG B 1 255 ? 74.700 69.455  9.545  1.00 18.95 ? 255 ARG B NE  1 
ATOM   4180 C CZ  . ARG B 1 255 ? 75.658 68.890  8.814  1.00 18.63 ? 255 ARG B CZ  1 
ATOM   4181 N NH1 . ARG B 1 255 ? 76.934 69.090  9.115  1.00 17.89 ? 255 ARG B NH1 1 
ATOM   4182 N NH2 . ARG B 1 255 ? 75.339 68.134  7.775  1.00 18.10 ? 255 ARG B NH2 1 
ATOM   4183 N N   . TYR B 1 256 ? 72.566 67.660  12.928 1.00 7.83  ? 256 TYR B N   1 
ATOM   4184 C CA  . TYR B 1 256 ? 73.130 66.352  13.194 1.00 6.89  ? 256 TYR B CA  1 
ATOM   4185 C C   . TYR B 1 256 ? 72.396 65.232  12.448 1.00 5.40  ? 256 TYR B C   1 
ATOM   4186 O O   . TYR B 1 256 ? 73.028 64.375  11.833 1.00 3.65  ? 256 TYR B O   1 
ATOM   4187 C CB  . TYR B 1 256 ? 73.099 66.095  14.707 1.00 6.84  ? 256 TYR B CB  1 
ATOM   4188 C CG  . TYR B 1 256 ? 73.836 64.855  15.139 1.00 8.32  ? 256 TYR B CG  1 
ATOM   4189 C CD1 . TYR B 1 256 ? 73.303 63.584  14.908 1.00 8.03  ? 256 TYR B CD1 1 
ATOM   4190 C CD2 . TYR B 1 256 ? 75.085 64.949  15.760 1.00 10.31 ? 256 TYR B CD2 1 
ATOM   4191 C CE1 . TYR B 1 256 ? 73.995 62.436  15.277 1.00 9.17  ? 256 TYR B CE1 1 
ATOM   4192 C CE2 . TYR B 1 256 ? 75.789 63.802  16.142 1.00 11.33 ? 256 TYR B CE2 1 
ATOM   4193 C CZ  . TYR B 1 256 ? 75.239 62.553  15.892 1.00 10.63 ? 256 TYR B CZ  1 
ATOM   4194 O OH  . TYR B 1 256 ? 75.948 61.427  16.235 1.00 11.57 ? 256 TYR B OH  1 
ATOM   4195 N N   . ALA B 1 257 ? 71.067 65.260  12.494 1.00 5.45  ? 257 ALA B N   1 
ATOM   4196 C CA  . ALA B 1 257 ? 70.234 64.226  11.871 1.00 8.16  ? 257 ALA B CA  1 
ATOM   4197 C C   . ALA B 1 257 ? 70.267 64.114  10.349 1.00 9.10  ? 257 ALA B C   1 
ATOM   4198 O O   . ALA B 1 257 ? 69.888 63.073  9.794  1.00 9.55  ? 257 ALA B O   1 
ATOM   4199 C CB  . ALA B 1 257 ? 68.798 64.387  12.336 1.00 7.24  ? 257 ALA B CB  1 
ATOM   4200 N N   . GLU B 1 258 ? 70.724 65.165  9.674  1.00 9.68  ? 258 GLU B N   1 
ATOM   4201 C CA  . GLU B 1 258 ? 70.792 65.167  8.216  1.00 11.34 ? 258 GLU B CA  1 
ATOM   4202 C C   . GLU B 1 258 ? 71.594 63.981  7.675  1.00 12.46 ? 258 GLU B C   1 
ATOM   4203 O O   . GLU B 1 258 ? 71.412 63.560  6.526  1.00 11.28 ? 258 GLU B O   1 
ATOM   4204 C CB  . GLU B 1 258 ? 71.412 66.478  7.721  1.00 13.68 ? 258 GLU B CB  1 
ATOM   4205 C CG  . GLU B 1 258 ? 70.697 67.737  8.212  1.00 17.87 ? 258 GLU B CG  1 
ATOM   4206 C CD  . GLU B 1 258 ? 71.124 68.990  7.459  1.00 20.90 ? 258 GLU B CD  1 
ATOM   4207 O OE1 . GLU B 1 258 ? 72.347 69.160  7.240  1.00 21.95 ? 258 GLU B OE1 1 
ATOM   4208 O OE2 . GLU B 1 258 ? 70.240 69.807  7.102  1.00 20.09 ? 258 GLU B OE2 1 
ATOM   4209 N N   . ARG B 1 259 ? 72.473 63.438  8.510  1.00 11.03 ? 259 ARG B N   1 
ATOM   4210 C CA  . ARG B 1 259 ? 73.304 62.313  8.113  1.00 12.19 ? 259 ARG B CA  1 
ATOM   4211 C C   . ARG B 1 259 ? 72.493 61.047  7.857  1.00 13.80 ? 259 ARG B C   1 
ATOM   4212 O O   . ARG B 1 259 ? 73.005 60.090  7.279  1.00 15.78 ? 259 ARG B O   1 
ATOM   4213 C CB  . ARG B 1 259 ? 74.349 62.022  9.192  1.00 12.88 ? 259 ARG B CB  1 
ATOM   4214 C CG  . ARG B 1 259 ? 73.780 61.466  10.495 1.00 11.93 ? 259 ARG B CG  1 
ATOM   4215 C CD  . ARG B 1 259 ? 74.868 61.333  11.550 1.00 12.22 ? 259 ARG B CD  1 
ATOM   4216 N NE  . ARG B 1 259 ? 75.409 62.635  11.935 1.00 15.19 ? 259 ARG B NE  1 
ATOM   4217 C CZ  . ARG B 1 259 ? 76.529 62.809  12.636 1.00 15.12 ? 259 ARG B CZ  1 
ATOM   4218 N NH1 . ARG B 1 259 ? 77.242 61.759  13.034 1.00 13.97 ? 259 ARG B NH1 1 
ATOM   4219 N NH2 . ARG B 1 259 ? 76.936 64.034  12.940 1.00 12.87 ? 259 ARG B NH2 1 
ATOM   4220 N N   . TRP B 1 260 ? 71.232 61.031  8.276  1.00 13.53 ? 260 TRP B N   1 
ATOM   4221 C CA  . TRP B 1 260 ? 70.425 59.837  8.080  1.00 11.75 ? 260 TRP B CA  1 
ATOM   4222 C C   . TRP B 1 260 ? 69.456 59.936  6.913  1.00 13.11 ? 260 TRP B C   1 
ATOM   4223 O O   . TRP B 1 260 ? 68.614 59.060  6.719  1.00 11.73 ? 260 TRP B O   1 
ATOM   4224 C CB  . TRP B 1 260 ? 69.670 59.510  9.363  1.00 9.65  ? 260 TRP B CB  1 
ATOM   4225 C CG  . TRP B 1 260 ? 70.578 59.241  10.522 1.00 7.63  ? 260 TRP B CG  1 
ATOM   4226 C CD1 . TRP B 1 260 ? 71.621 58.356  10.561 1.00 8.41  ? 260 TRP B CD1 1 
ATOM   4227 C CD2 . TRP B 1 260 ? 70.509 59.837  11.818 1.00 5.63  ? 260 TRP B CD2 1 
ATOM   4228 N NE1 . TRP B 1 260 ? 72.204 58.364  11.808 1.00 4.83  ? 260 TRP B NE1 1 
ATOM   4229 C CE2 . TRP B 1 260 ? 71.540 59.262  12.598 1.00 4.90  ? 260 TRP B CE2 1 
ATOM   4230 C CE3 . TRP B 1 260 ? 69.674 60.802  12.399 1.00 4.95  ? 260 TRP B CE3 1 
ATOM   4231 C CZ2 . TRP B 1 260 ? 71.760 59.619  13.934 1.00 4.21  ? 260 TRP B CZ2 1 
ATOM   4232 C CZ3 . TRP B 1 260 ? 69.891 61.158  13.728 1.00 5.27  ? 260 TRP B CZ3 1 
ATOM   4233 C CH2 . TRP B 1 260 ? 70.928 60.564  14.479 1.00 6.33  ? 260 TRP B CH2 1 
ATOM   4234 N N   . LYS B 1 261 ? 69.578 60.999  6.130  1.00 13.99 ? 261 LYS B N   1 
ATOM   4235 C CA  . LYS B 1 261 ? 68.722 61.180  4.973  1.00 14.92 ? 261 LYS B CA  1 
ATOM   4236 C C   . LYS B 1 261 ? 69.002 60.031  4.008  1.00 14.84 ? 261 LYS B C   1 
ATOM   4237 O O   . LYS B 1 261 ? 70.134 59.551  3.928  1.00 14.52 ? 261 LYS B O   1 
ATOM   4238 C CB  . LYS B 1 261 ? 69.046 62.521  4.321  1.00 16.48 ? 261 LYS B CB  1 
ATOM   4239 C CG  . LYS B 1 261 ? 68.245 62.819  3.085  1.00 20.25 ? 261 LYS B CG  1 
ATOM   4240 C CD  . LYS B 1 261 ? 68.478 64.254  2.645  1.00 23.88 ? 261 LYS B CD  1 
ATOM   4241 C CE  . LYS B 1 261 ? 67.643 64.593  1.421  1.00 24.21 ? 261 LYS B CE  1 
ATOM   4242 N NZ  . LYS B 1 261 ? 67.873 65.993  0.986  1.00 26.03 ? 261 LYS B NZ  1 
ATOM   4243 N N   . PRO B 1 262 ? 67.981 59.569  3.264  1.00 13.91 ? 262 PRO B N   1 
ATOM   4244 C CA  . PRO B 1 262 ? 66.590 60.016  3.227  1.00 14.72 ? 262 PRO B CA  1 
ATOM   4245 C C   . PRO B 1 262 ? 65.662 59.125  4.049  1.00 15.06 ? 262 PRO B C   1 
ATOM   4246 O O   . PRO B 1 262 ? 64.512 58.905  3.660  1.00 13.32 ? 262 PRO B O   1 
ATOM   4247 C CB  . PRO B 1 262 ? 66.258 59.922  1.756  1.00 13.95 ? 262 PRO B CB  1 
ATOM   4248 C CG  . PRO B 1 262 ? 66.870 58.598  1.423  1.00 14.68 ? 262 PRO B CG  1 
ATOM   4249 C CD  . PRO B 1 262 ? 68.242 58.675  2.119  1.00 15.62 ? 262 PRO B CD  1 
ATOM   4250 N N   . TRP B 1 263 ? 66.160 58.604  5.170  1.00 14.11 ? 263 TRP B N   1 
ATOM   4251 C CA  . TRP B 1 263 ? 65.352 57.748  6.035  1.00 11.24 ? 263 TRP B CA  1 
ATOM   4252 C C   . TRP B 1 263 ? 65.315 58.284  7.468  1.00 10.55 ? 263 TRP B C   1 
ATOM   4253 O O   . TRP B 1 263 ? 65.369 57.513  8.421  1.00 9.32  ? 263 TRP B O   1 
ATOM   4254 C CB  . TRP B 1 263 ? 65.909 56.318  6.030  1.00 11.57 ? 263 TRP B CB  1 
ATOM   4255 C CG  . TRP B 1 263 ? 66.025 55.709  4.657  1.00 10.40 ? 263 TRP B CG  1 
ATOM   4256 C CD1 . TRP B 1 263 ? 67.169 55.284  4.044  1.00 11.82 ? 263 TRP B CD1 1 
ATOM   4257 C CD2 . TRP B 1 263 ? 64.966 55.493  3.719  1.00 11.39 ? 263 TRP B CD2 1 
ATOM   4258 N NE1 . TRP B 1 263 ? 66.888 54.820  2.777  1.00 10.20 ? 263 TRP B NE1 1 
ATOM   4259 C CE2 . TRP B 1 263 ? 65.544 54.939  2.553  1.00 11.11 ? 263 TRP B CE2 1 
ATOM   4260 C CE3 . TRP B 1 263 ? 63.583 55.717  3.748  1.00 11.90 ? 263 TRP B CE3 1 
ATOM   4261 C CZ2 . TRP B 1 263 ? 64.788 54.606  1.427  1.00 10.41 ? 263 TRP B CZ2 1 
ATOM   4262 C CZ3 . TRP B 1 263 ? 62.833 55.386  2.630  1.00 12.86 ? 263 TRP B CZ3 1 
ATOM   4263 C CH2 . TRP B 1 263 ? 63.438 54.836  1.484  1.00 12.38 ? 263 TRP B CH2 1 
ATOM   4264 N N   . ARG B 1 264 ? 65.212 59.603  7.618  1.00 10.32 ? 264 ARG B N   1 
ATOM   4265 C CA  . ARG B 1 264 ? 65.187 60.218  8.944  1.00 9.55  ? 264 ARG B CA  1 
ATOM   4266 C C   . ARG B 1 264 ? 64.089 59.720  9.875  1.00 9.61  ? 264 ARG B C   1 
ATOM   4267 O O   . ARG B 1 264 ? 64.268 59.708  11.097 1.00 7.61  ? 264 ARG B O   1 
ATOM   4268 C CB  . ARG B 1 264 ? 65.095 61.737  8.819  1.00 12.21 ? 264 ARG B CB  1 
ATOM   4269 C CG  . ARG B 1 264 ? 66.414 62.450  9.117  1.00 12.72 ? 264 ARG B CG  1 
ATOM   4270 C CD  . ARG B 1 264 ? 66.413 63.861  8.572  1.00 11.71 ? 264 ARG B CD  1 
ATOM   4271 N NE  . ARG B 1 264 ? 66.551 63.874  7.119  1.00 12.67 ? 264 ARG B NE  1 
ATOM   4272 C CZ  . ARG B 1 264 ? 66.584 64.982  6.380  1.00 13.42 ? 264 ARG B CZ  1 
ATOM   4273 N NH1 . ARG B 1 264 ? 66.487 66.171  6.955  1.00 10.45 ? 264 ARG B NH1 1 
ATOM   4274 N NH2 . ARG B 1 264 ? 66.722 64.901  5.064  1.00 13.23 ? 264 ARG B NH2 1 
ATOM   4275 N N   . SER B 1 265 ? 62.955 59.315  9.308  1.00 8.16  ? 265 SER B N   1 
ATOM   4276 C CA  . SER B 1 265 ? 61.849 58.817  10.114 1.00 7.44  ? 265 SER B CA  1 
ATOM   4277 C C   . SER B 1 265 ? 62.251 57.529  10.810 1.00 6.70  ? 265 SER B C   1 
ATOM   4278 O O   . SER B 1 265 ? 61.960 57.339  11.987 1.00 5.37  ? 265 SER B O   1 
ATOM   4279 C CB  . SER B 1 265 ? 60.611 58.583  9.245  1.00 5.67  ? 265 SER B CB  1 
ATOM   4280 O OG  . SER B 1 265 ? 60.096 59.811  8.767  1.00 1.13  ? 265 SER B OG  1 
ATOM   4281 N N   . TYR B 1 266 ? 62.915 56.641  10.080 1.00 7.85  ? 266 TYR B N   1 
ATOM   4282 C CA  . TYR B 1 266 ? 63.374 55.383  10.667 1.00 9.48  ? 266 TYR B CA  1 
ATOM   4283 C C   . TYR B 1 266 ? 64.484 55.690  11.675 1.00 11.24 ? 266 TYR B C   1 
ATOM   4284 O O   . TYR B 1 266 ? 64.667 54.963  12.655 1.00 12.31 ? 266 TYR B O   1 
ATOM   4285 C CB  . TYR B 1 266 ? 63.907 54.433  9.589  1.00 8.38  ? 266 TYR B CB  1 
ATOM   4286 C CG  . TYR B 1 266 ? 62.818 53.805  8.738  1.00 8.65  ? 266 TYR B CG  1 
ATOM   4287 C CD1 . TYR B 1 266 ? 61.977 52.825  9.263  1.00 7.37  ? 266 TYR B CD1 1 
ATOM   4288 C CD2 . TYR B 1 266 ? 62.603 54.221  7.425  1.00 6.55  ? 266 TYR B CD2 1 
ATOM   4289 C CE1 . TYR B 1 266 ? 60.949 52.281  8.503  1.00 7.90  ? 266 TYR B CE1 1 
ATOM   4290 C CE2 . TYR B 1 266 ? 61.575 53.683  6.655  1.00 6.83  ? 266 TYR B CE2 1 
ATOM   4291 C CZ  . TYR B 1 266 ? 60.754 52.718  7.201  1.00 5.76  ? 266 TYR B CZ  1 
ATOM   4292 O OH  . TYR B 1 266 ? 59.727 52.185  6.462  1.00 6.20  ? 266 TYR B OH  1 
ATOM   4293 N N   . ALA B 1 267 ? 65.220 56.772  11.432 1.00 9.50  ? 267 ALA B N   1 
ATOM   4294 C CA  . ALA B 1 267 ? 66.294 57.175  12.327 1.00 9.43  ? 267 ALA B CA  1 
ATOM   4295 C C   . ALA B 1 267 ? 65.675 57.585  13.659 1.00 10.41 ? 267 ALA B C   1 
ATOM   4296 O O   . ALA B 1 267 ? 66.087 57.112  14.720 1.00 8.53  ? 267 ALA B O   1 
ATOM   4297 C CB  . ALA B 1 267 ? 67.075 58.339  11.722 1.00 7.12  ? 267 ALA B CB  1 
ATOM   4298 N N   . LEU B 1 268 ? 64.681 58.464  13.583 1.00 10.95 ? 268 LEU B N   1 
ATOM   4299 C CA  . LEU B 1 268 ? 63.981 58.956  14.756 1.00 11.02 ? 268 LEU B CA  1 
ATOM   4300 C C   . LEU B 1 268 ? 63.515 57.795  15.630 1.00 12.22 ? 268 LEU B C   1 
ATOM   4301 O O   . LEU B 1 268 ? 63.751 57.783  16.839 1.00 14.73 ? 268 LEU B O   1 
ATOM   4302 C CB  . LEU B 1 268 ? 62.773 59.781  14.333 1.00 9.08  ? 268 LEU B CB  1 
ATOM   4303 C CG  . LEU B 1 268 ? 61.907 60.278  15.492 1.00 10.94 ? 268 LEU B CG  1 
ATOM   4304 C CD1 . LEU B 1 268 ? 62.526 61.527  16.109 1.00 10.36 ? 268 LEU B CD1 1 
ATOM   4305 C CD2 . LEU B 1 268 ? 60.514 60.580  14.980 1.00 11.22 ? 268 LEU B CD2 1 
ATOM   4306 N N   . LEU B 1 269 ? 62.858 56.819  15.013 1.00 11.63 ? 269 LEU B N   1 
ATOM   4307 C CA  . LEU B 1 269 ? 62.354 55.653  15.740 1.00 10.71 ? 269 LEU B CA  1 
ATOM   4308 C C   . LEU B 1 269 ? 63.428 54.915  16.530 1.00 11.35 ? 269 LEU B C   1 
ATOM   4309 O O   . LEU B 1 269 ? 63.243 54.639  17.717 1.00 8.18  ? 269 LEU B O   1 
ATOM   4310 C CB  . LEU B 1 269 ? 61.657 54.692  14.769 1.00 9.30  ? 269 LEU B CB  1 
ATOM   4311 C CG  . LEU B 1 269 ? 60.263 55.153  14.333 1.00 5.81  ? 269 LEU B CG  1 
ATOM   4312 C CD1 . LEU B 1 269 ? 59.720 54.281  13.231 1.00 7.88  ? 269 LEU B CD1 1 
ATOM   4313 C CD2 . LEU B 1 269 ? 59.346 55.104  15.538 1.00 9.61  ? 269 LEU B CD2 1 
ATOM   4314 N N   . HIS B 1 270 ? 64.544 54.589  15.880 1.00 12.25 ? 270 HIS B N   1 
ATOM   4315 C CA  . HIS B 1 270 ? 65.627 53.891  16.563 1.00 16.28 ? 270 HIS B CA  1 
ATOM   4316 C C   . HIS B 1 270 ? 66.213 54.698  17.720 1.00 18.42 ? 270 HIS B C   1 
ATOM   4317 O O   . HIS B 1 270 ? 66.585 54.136  18.755 1.00 20.00 ? 270 HIS B O   1 
ATOM   4318 C CB  . HIS B 1 270 ? 66.754 53.539  15.596 1.00 18.16 ? 270 HIS B CB  1 
ATOM   4319 C CG  . HIS B 1 270 ? 66.457 52.364  14.717 1.00 22.10 ? 270 HIS B CG  1 
ATOM   4320 N ND1 . HIS B 1 270 ? 65.676 52.459  13.585 1.00 22.25 ? 270 HIS B ND1 1 
ATOM   4321 C CD2 . HIS B 1 270 ? 66.857 51.072  14.791 1.00 22.31 ? 270 HIS B CD2 1 
ATOM   4322 C CE1 . HIS B 1 270 ? 65.613 51.280  12.997 1.00 22.25 ? 270 HIS B CE1 1 
ATOM   4323 N NE2 . HIS B 1 270 ? 66.322 50.421  13.708 1.00 22.41 ? 270 HIS B NE2 1 
ATOM   4324 N N   . ILE B 1 271 ? 66.297 56.013  17.552 1.00 18.56 ? 271 ILE B N   1 
ATOM   4325 C CA  . ILE B 1 271 ? 66.846 56.865  18.596 1.00 19.04 ? 271 ILE B CA  1 
ATOM   4326 C C   . ILE B 1 271 ? 65.883 56.873  19.767 1.00 20.09 ? 271 ILE B C   1 
ATOM   4327 O O   . ILE B 1 271 ? 66.291 56.838  20.933 1.00 19.50 ? 271 ILE B O   1 
ATOM   4328 C CB  . ILE B 1 271 ? 67.076 58.291  18.067 1.00 18.61 ? 271 ILE B CB  1 
ATOM   4329 C CG1 . ILE B 1 271 ? 68.162 58.246  16.990 1.00 18.86 ? 271 ILE B CG1 1 
ATOM   4330 C CG2 . ILE B 1 271 ? 67.489 59.224  19.201 1.00 17.97 ? 271 ILE B CG2 1 
ATOM   4331 C CD1 . ILE B 1 271 ? 68.338 59.535  16.232 1.00 21.63 ? 271 ILE B CD1 1 
ATOM   4332 N N   . TRP B 1 272 ? 64.597 56.895  19.440 1.00 20.11 ? 272 TRP B N   1 
ATOM   4333 C CA  . TRP B 1 272 ? 63.554 56.885  20.447 1.00 21.27 ? 272 TRP B CA  1 
ATOM   4334 C C   . TRP B 1 272 ? 63.608 55.622  21.297 1.00 22.34 ? 272 TRP B C   1 
ATOM   4335 O O   . TRP B 1 272 ? 63.350 55.666  22.503 1.00 21.31 ? 272 TRP B O   1 
ATOM   4336 C CB  . TRP B 1 272 ? 62.184 56.996  19.782 1.00 21.63 ? 272 TRP B CB  1 
ATOM   4337 C CG  . TRP B 1 272 ? 61.614 58.374  19.830 1.00 21.74 ? 272 TRP B CG  1 
ATOM   4338 C CD1 . TRP B 1 272 ? 62.198 59.483  20.374 1.00 21.60 ? 272 TRP B CD1 1 
ATOM   4339 C CD2 . TRP B 1 272 ? 60.332 58.789  19.353 1.00 22.01 ? 272 TRP B CD2 1 
ATOM   4340 N NE1 . TRP B 1 272 ? 61.359 60.562  20.271 1.00 22.13 ? 272 TRP B NE1 1 
ATOM   4341 C CE2 . TRP B 1 272 ? 60.203 60.166  19.649 1.00 23.39 ? 272 TRP B CE2 1 
ATOM   4342 C CE3 . TRP B 1 272 ? 59.275 58.133  18.708 1.00 22.28 ? 272 TRP B CE3 1 
ATOM   4343 C CZ2 . TRP B 1 272 ? 59.056 60.902  19.320 1.00 22.87 ? 272 TRP B CZ2 1 
ATOM   4344 C CZ3 . TRP B 1 272 ? 58.133 58.864  18.380 1.00 21.95 ? 272 TRP B CZ3 1 
ATOM   4345 C CH2 . TRP B 1 272 ? 58.035 60.236  18.689 1.00 23.07 ? 272 TRP B CH2 1 
ATOM   4346 N N   . TYR B 1 273 ? 63.965 54.502  20.672 1.00 22.84 ? 273 TYR B N   1 
ATOM   4347 C CA  . TYR B 1 273 ? 64.009 53.236  21.371 1.00 23.68 ? 273 TYR B CA  1 
ATOM   4348 C C   . TYR B 1 273 ? 65.354 52.719  21.746 1.00 22.46 ? 273 TYR B C   1 
ATOM   4349 O O   . TYR B 1 273 ? 65.640 51.520  22.000 1.00 22.32 ? 273 TYR B O   1 
ATOM   4350 C CB  . TYR B 1 273 ? 63.055 52.270  20.709 1.00 24.42 ? 273 TYR B CB  1 
ATOM   4351 C CG  . TYR B 1 273 ? 61.581 52.547  20.916 1.00 28.51 ? 273 TYR B CG  1 
ATOM   4352 C CD1 . TYR B 1 273 ? 60.838 53.439  20.191 1.00 28.29 ? 273 TYR B CD1 1 
ATOM   4353 C CD2 . TYR B 1 273 ? 60.919 51.845  21.937 1.00 28.86 ? 273 TYR B CD2 1 
ATOM   4354 C CE1 . TYR B 1 273 ? 59.500 53.671  20.491 1.00 28.87 ? 273 TYR B CE1 1 
ATOM   4355 C CE2 . TYR B 1 273 ? 59.594 52.047  22.227 1.00 29.54 ? 273 TYR B CE2 1 
ATOM   4356 C CZ  . TYR B 1 273 ? 58.879 52.978  21.499 1.00 30.06 ? 273 TYR B CZ  1 
ATOM   4357 O OH  . TYR B 1 273 ? 57.551 53.174  21.787 1.00 29.97 ? 273 TYR B OH  1 
ATOM   4358 N N   . THR B 1 274 ? 66.384 53.610  21.774 1.00 22.29 ? 274 THR B N   1 
ATOM   4359 C CA  . THR B 1 274 ? 67.677 53.171  22.368 1.00 20.90 ? 274 THR B CA  1 
ATOM   4360 C C   . THR B 1 274 ? 68.035 53.970  23.581 1.00 21.06 ? 274 THR B C   1 
ATOM   4361 O O   . THR B 1 274 ? 68.699 55.040  23.572 1.00 19.91 ? 274 THR B O   1 
ATOM   4362 C CB  . THR B 1 274 ? 68.715 53.148  21.263 1.00 19.74 ? 274 THR B CB  1 
ATOM   4363 O OG1 . THR B 1 274 ? 68.277 52.501  20.085 1.00 18.81 ? 274 THR B OG1 1 
ATOM   4364 C CG2 . THR B 1 274 ? 70.105 52.783  21.674 1.00 17.04 ? 274 THR B CG2 1 
ATOM   4365 N N   . GLU B 1 275 ? 67.545 53.565  24.764 1.00 22.13 ? 275 GLU B N   1 
ATOM   4366 C CA  . GLU B 1 275 ? 67.737 54.294  26.003 1.00 24.34 ? 275 GLU B CA  1 
ATOM   4367 C C   . GLU B 1 275 ? 69.098 54.868  26.239 1.00 22.53 ? 275 GLU B C   1 
ATOM   4368 O O   . GLU B 1 275 ? 69.177 56.105  26.482 1.00 22.47 ? 275 GLU B O   1 
ATOM   4369 C CB  . GLU B 1 275 ? 67.235 53.510  27.209 1.00 27.80 ? 275 GLU B CB  1 
ATOM   4370 C CG  . GLU B 1 275 ? 67.947 52.201  27.485 1.00 32.09 ? 275 GLU B CG  1 
ATOM   4371 C CD  . GLU B 1 275 ? 67.460 51.492  28.724 1.00 36.12 ? 275 GLU B CD  1 
ATOM   4372 O OE1 . GLU B 1 275 ? 67.334 52.153  29.780 1.00 37.33 ? 275 GLU B OE1 1 
ATOM   4373 O OE2 . GLU B 1 275 ? 67.226 50.265  28.656 1.00 37.99 ? 275 GLU B OE2 1 
ATOM   4374 N N   . GLY B 1 276 ? 70.176 54.170  26.007 1.00 21.26 ? 276 GLY B N   1 
ATOM   4375 C CA  . GLY B 1 276 ? 71.508 54.755  26.265 1.00 21.30 ? 276 GLY B CA  1 
ATOM   4376 C C   . GLY B 1 276 ? 72.199 55.281  25.052 1.00 19.65 ? 276 GLY B C   1 
ATOM   4377 O O   . GLY B 1 276 ? 73.414 55.462  25.010 1.00 16.41 ? 276 GLY B O   1 
ATOM   4378 N N   . TRP B 1 277 ? 71.433 55.692  24.083 1.00 20.61 ? 277 TRP B N   1 
ATOM   4379 C CA  . TRP B 1 277 ? 71.977 56.386  22.901 1.00 20.01 ? 277 TRP B CA  1 
ATOM   4380 C C   . TRP B 1 277 ? 72.386 57.830  23.218 1.00 20.26 ? 277 TRP B C   1 
ATOM   4381 O O   . TRP B 1 277 ? 71.865 58.490  24.098 1.00 18.98 ? 277 TRP B O   1 
ATOM   4382 C CB  . TRP B 1 277 ? 70.882 56.452  21.808 1.00 18.72 ? 277 TRP B CB  1 
ATOM   4383 C CG  . TRP B 1 277 ? 71.446 56.914  20.489 1.00 17.82 ? 277 TRP B CG  1 
ATOM   4384 C CD1 . TRP B 1 277 ? 72.003 56.048  19.569 1.00 17.09 ? 277 TRP B CD1 1 
ATOM   4385 C CD2 . TRP B 1 277 ? 71.598 58.220  19.967 1.00 15.77 ? 277 TRP B CD2 1 
ATOM   4386 N NE1 . TRP B 1 277 ? 72.477 56.756  18.499 1.00 15.51 ? 277 TRP B NE1 1 
ATOM   4387 C CE2 . TRP B 1 277 ? 72.241 58.088  18.711 1.00 16.02 ? 277 TRP B CE2 1 
ATOM   4388 C CE3 . TRP B 1 277 ? 71.277 59.504  20.425 1.00 16.02 ? 277 TRP B CE3 1 
ATOM   4389 C CZ2 . TRP B 1 277 ? 72.555 59.181  17.914 1.00 15.70 ? 277 TRP B CZ2 1 
ATOM   4390 C CZ3 . TRP B 1 277 ? 71.584 60.580  19.624 1.00 16.32 ? 277 TRP B CZ3 1 
ATOM   4391 C CH2 . TRP B 1 277 ? 72.212 60.417  18.385 1.00 16.09 ? 277 TRP B CH2 1 
ATOM   4392 N N   . GLN B 1 278 ? 73.377 58.270  22.442 1.00 21.55 ? 278 GLN B N   1 
ATOM   4393 C CA  . GLN B 1 278 ? 74.025 59.567  22.535 1.00 22.36 ? 278 GLN B CA  1 
ATOM   4394 C C   . GLN B 1 278 ? 74.723 59.900  21.213 1.00 22.11 ? 278 GLN B C   1 
ATOM   4395 O O   . GLN B 1 278 ? 75.095 59.018  20.451 1.00 22.38 ? 278 GLN B O   1 
ATOM   4396 C CB  . GLN B 1 278 ? 74.994 59.657  23.695 1.00 20.53 ? 278 GLN B CB  1 
ATOM   4397 C CG  . GLN B 1 278 ? 76.191 58.740  23.660 1.00 19.44 ? 278 GLN B CG  1 
ATOM   4398 C CD  . GLN B 1 278 ? 77.136 58.880  24.828 1.00 20.37 ? 278 GLN B CD  1 
ATOM   4399 O OE1 . GLN B 1 278 ? 77.677 59.936  25.142 1.00 22.33 ? 278 GLN B OE1 1 
ATOM   4400 N NE2 . GLN B 1 278 ? 77.383 57.751  25.499 1.00 19.68 ? 278 GLN B NE2 1 
ATOM   4401 N N   . PRO B 1 279 ? 74.888 61.186  20.893 1.00 22.63 ? 279 PRO B N   1 
ATOM   4402 C CA  . PRO B 1 279 ? 75.528 61.554  19.630 1.00 23.91 ? 279 PRO B CA  1 
ATOM   4403 C C   . PRO B 1 279 ? 77.043 61.357  19.682 1.00 26.66 ? 279 PRO B C   1 
ATOM   4404 O O   . PRO B 1 279 ? 77.623 61.221  20.768 1.00 27.13 ? 279 PRO B O   1 
ATOM   4405 C CB  . PRO B 1 279 ? 75.131 63.016  19.473 1.00 23.67 ? 279 PRO B CB  1 
ATOM   4406 C CG  . PRO B 1 279 ? 75.064 63.489  20.891 1.00 22.65 ? 279 PRO B CG  1 
ATOM   4407 C CD  . PRO B 1 279 ? 74.329 62.371  21.566 1.00 22.15 ? 279 PRO B CD  1 
ATOM   4408 N N   . ASP B 1 280 ? 77.680 61.325  18.512 1.00 28.88 ? 280 ASP B N   1 
ATOM   4409 C CA  . ASP B 1 280 ? 79.133 61.167  18.439 1.00 32.43 ? 280 ASP B CA  1 
ATOM   4410 C C   . ASP B 1 280 ? 79.793 62.504  18.771 1.00 33.73 ? 280 ASP B C   1 
ATOM   4411 O O   . ASP B 1 280 ? 79.385 63.191  19.708 1.00 35.12 ? 280 ASP B O   1 
ATOM   4412 C CB  . ASP B 1 280 ? 79.579 60.710  17.042 1.00 32.51 ? 280 ASP B CB  1 
ATOM   4413 C CG  . ASP B 1 280 ? 79.100 59.310  16.699 1.00 33.15 ? 280 ASP B CG  1 
ATOM   4414 O OD1 . ASP B 1 280 ? 79.164 58.415  17.571 1.00 33.92 ? 280 ASP B OD1 1 
ATOM   4415 O OD2 . ASP B 1 280 ? 78.675 59.095  15.546 1.00 32.13 ? 280 ASP B OD2 1 
ATOM   4416 N N   . GLU B 1 281 ? 80.813 62.876  18.013 1.00 35.93 ? 281 GLU B N   1 
ATOM   4417 C CA  . GLU B 1 281 ? 81.487 64.141  18.263 1.00 37.50 ? 281 GLU B CA  1 
ATOM   4418 C C   . GLU B 1 281 ? 82.041 64.768  16.996 1.00 38.08 ? 281 GLU B C   1 
ATOM   4419 O O   . GLU B 1 281 ? 82.049 64.141  15.935 1.00 39.22 ? 281 GLU B O   1 
ATOM   4420 C CB  . GLU B 1 281 ? 82.591 63.946  19.305 1.00 37.88 ? 281 GLU B CB  1 
ATOM   4421 C CG  . GLU B 1 281 ? 82.077 64.091  20.736 1.00 39.23 ? 281 GLU B CG  1 
ATOM   4422 C CD  . GLU B 1 281 ? 82.911 63.334  21.745 1.00 39.92 ? 281 GLU B CD  1 
ATOM   4423 O OE1 . GLU B 1 281 ? 82.863 62.083  21.739 1.00 39.50 ? 281 GLU B OE1 1 
ATOM   4424 O OE2 . GLU B 1 281 ? 83.616 63.990  22.542 1.00 40.86 ? 281 GLU B OE2 1 
ATOM   4425 N N   . ALA B 1 282 ? 82.485 66.018  17.113 1.00 38.04 ? 282 ALA B N   1 
ATOM   4426 C CA  . ALA B 1 282 ? 83.033 66.766  15.984 1.00 37.18 ? 282 ALA B CA  1 
ATOM   4427 C C   . ALA B 1 282 ? 84.328 67.484  16.363 1.00 37.26 ? 282 ALA B C   1 
ATOM   4428 O O   . ALA B 1 282 ? 85.273 67.467  15.541 1.00 35.91 ? 282 ALA B O   1 
ATOM   4429 C CB  . ALA B 1 282 ? 82.001 67.777  15.478 1.00 36.69 ? 282 ALA B CB  1 
ATOM   4430 O OXT . ALA B 1 282 ? 84.372 68.075  17.462 1.00 14.63 ? 282 ALA B OXT 1 
HETATM 4431 C C9  . 7HP C 2 .   ? 26.818 26.907  23.129 1.00 33.95 ? 800 7HP A C9  1 
HETATM 4432 C C4  . 7HP C 2 .   ? 27.015 28.190  22.626 1.00 33.34 ? 800 7HP A C4  1 
HETATM 4433 N N3  . 7HP C 2 .   ? 28.199 28.726  22.190 1.00 33.51 ? 800 7HP A N3  1 
HETATM 4434 C C2  . 7HP C 2 .   ? 28.043 30.032  21.754 1.00 33.63 ? 800 7HP A C2  1 
HETATM 4435 N N1  . 7HP C 2 .   ? 26.809 30.687  21.774 1.00 34.92 ? 800 7HP A N1  1 
HETATM 4436 C C6  . 7HP C 2 .   ? 25.612 30.131  22.220 1.00 33.81 ? 800 7HP A C6  1 
HETATM 4437 O O6  . 7HP C 2 .   ? 24.596 30.784  22.194 1.00 34.22 ? 800 7HP A O6  1 
HETATM 4438 C C5  . 7HP C 2 .   ? 25.770 28.816  22.660 1.00 34.49 ? 800 7HP A C5  1 
HETATM 4439 N N7  . 7HP C 2 .   ? 24.864 27.918  23.170 1.00 34.23 ? 800 7HP A N7  1 
HETATM 4440 N N8  . 7HP C 2 .   ? 25.536 26.835  23.420 1.00 35.07 ? 800 7HP A N8  1 
HETATM 4441 C C9  . 7HP D 2 .   ? 56.465 65.521  22.791 1.00 32.82 ? 700 7HP B C9  1 
HETATM 4442 C C4  . 7HP D 2 .   ? 56.662 66.809  22.297 1.00 33.49 ? 700 7HP B C4  1 
HETATM 4443 N N3  . 7HP D 2 .   ? 57.857 67.373  21.921 1.00 33.97 ? 700 7HP B N3  1 
HETATM 4444 C C2  . 7HP D 2 .   ? 57.695 68.678  21.474 1.00 35.72 ? 700 7HP B C2  1 
HETATM 4445 N N1  . 7HP D 2 .   ? 56.449 69.306  21.432 1.00 35.64 ? 700 7HP B N1  1 
HETATM 4446 C C6  . 7HP D 2 .   ? 55.241 68.719  21.818 1.00 35.14 ? 700 7HP B C6  1 
HETATM 4447 O O6  . 7HP D 2 .   ? 54.208 69.348  21.743 1.00 36.53 ? 700 7HP B O6  1 
HETATM 4448 C C5  . 7HP D 2 .   ? 55.406 67.407  22.270 1.00 33.86 ? 700 7HP B C5  1 
HETATM 4449 N N7  . 7HP D 2 .   ? 54.496 66.488  22.733 1.00 34.42 ? 700 7HP B N7  1 
HETATM 4450 N N8  . 7HP D 2 .   ? 55.175 65.420  23.017 1.00 33.79 ? 700 7HP B N8  1 
HETATM 4451 O O   . HOH E 3 .   ? 8.458  0.369   7.096  1.00 3.31  ? 801 HOH A O   1 
HETATM 4452 O O   . HOH E 3 .   ? 23.717 33.650  17.840 1.00 1.13  ? 802 HOH A O   1 
HETATM 4453 O O   . HOH E 3 .   ? 14.319 17.693  5.233  1.00 8.58  ? 803 HOH A O   1 
HETATM 4454 O O   . HOH E 3 .   ? 7.856  7.049   -1.569 1.00 1.13  ? 804 HOH A O   1 
HETATM 4455 O O   . HOH E 3 .   ? 30.354 30.617  15.650 1.00 6.36  ? 805 HOH A O   1 
HETATM 4456 O O   . HOH E 3 .   ? -3.952 11.649  0.662  1.00 5.85  ? 806 HOH A O   1 
HETATM 4457 O O   . HOH E 3 .   ? 0.572  15.942  2.655  1.00 4.86  ? 807 HOH A O   1 
HETATM 4458 O O   . HOH E 3 .   ? 15.957 14.181  14.417 1.00 1.13  ? 808 HOH A O   1 
HETATM 4459 O O   . HOH E 3 .   ? 28.066 10.582  22.034 1.00 16.12 ? 809 HOH A O   1 
HETATM 4460 O O   . HOH E 3 .   ? 1.374  6.153   11.333 1.00 7.36  ? 810 HOH A O   1 
HETATM 4461 O O   . HOH E 3 .   ? 23.953 33.251  20.634 1.00 7.50  ? 811 HOH A O   1 
HETATM 4462 O O   . HOH E 3 .   ? 29.247 21.173  2.534  1.00 1.13  ? 812 HOH A O   1 
HETATM 4463 O O   . HOH E 3 .   ? 10.731 2.000   16.899 1.00 17.39 ? 813 HOH A O   1 
HETATM 4464 O O   . HOH E 3 .   ? 24.009 19.999  28.358 1.00 19.25 ? 814 HOH A O   1 
HETATM 4465 O O   . HOH E 3 .   ? 35.408 6.118   15.414 1.00 13.76 ? 815 HOH A O   1 
HETATM 4466 O O   . HOH E 3 .   ? 30.084 24.475  4.039  1.00 9.08  ? 816 HOH A O   1 
HETATM 4467 O O   . HOH E 3 .   ? 17.964 15.150  26.188 1.00 15.88 ? 817 HOH A O   1 
HETATM 4468 O O   . HOH E 3 .   ? 2.091  21.768  15.585 1.00 1.46  ? 818 HOH A O   1 
HETATM 4469 O O   . HOH E 3 .   ? 30.686 0.757   9.766  1.00 13.16 ? 819 HOH A O   1 
HETATM 4470 O O   . HOH E 3 .   ? 24.664 14.824  8.188  1.00 1.13  ? 820 HOH A O   1 
HETATM 4471 O O   . HOH E 3 .   ? 23.872 11.584  3.730  1.00 8.76  ? 821 HOH A O   1 
HETATM 4472 O O   . HOH E 3 .   ? 32.105 14.774  3.134  1.00 11.99 ? 822 HOH A O   1 
HETATM 4473 O O   . HOH E 3 .   ? 25.632 14.736  5.638  1.00 1.13  ? 823 HOH A O   1 
HETATM 4474 O O   . HOH E 3 .   ? 22.763 24.548  23.508 1.00 1.13  ? 824 HOH A O   1 
HETATM 4475 O O   . HOH E 3 .   ? 8.740  3.123   13.132 1.00 2.26  ? 825 HOH A O   1 
HETATM 4476 O O   . HOH E 3 .   ? 13.761 10.878  24.941 1.00 2.11  ? 826 HOH A O   1 
HETATM 4477 O O   . HOH E 3 .   ? 29.186 6.727   4.593  1.00 6.48  ? 827 HOH A O   1 
HETATM 4478 O O   . HOH E 3 .   ? 20.974 -2.017  15.679 1.00 17.52 ? 828 HOH A O   1 
HETATM 4479 O O   . HOH E 3 .   ? 8.636  10.585  -0.553 1.00 8.21  ? 829 HOH A O   1 
HETATM 4480 O O   . HOH E 3 .   ? 8.157  15.335  14.768 1.00 13.46 ? 830 HOH A O   1 
HETATM 4481 O O   . HOH E 3 .   ? 43.268 12.533  16.928 1.00 18.40 ? 831 HOH A O   1 
HETATM 4482 O O   . HOH E 3 .   ? 34.090 13.312  1.422  1.00 7.93  ? 832 HOH A O   1 
HETATM 4483 O O   . HOH E 3 .   ? 17.104 21.473  20.725 1.00 1.13  ? 833 HOH A O   1 
HETATM 4484 O O   . HOH E 3 .   ? -5.551 12.519  -1.027 1.00 4.55  ? 834 HOH A O   1 
HETATM 4485 O O   . HOH E 3 .   ? 6.340  9.293   -2.041 1.00 12.39 ? 835 HOH A O   1 
HETATM 4486 O O   . HOH E 3 .   ? 6.065  5.046   -1.263 1.00 1.13  ? 836 HOH A O   1 
HETATM 4487 O O   . HOH E 3 .   ? 6.339  2.202   14.373 1.00 15.94 ? 837 HOH A O   1 
HETATM 4488 O O   . HOH E 3 .   ? 4.400  0.459   13.462 1.00 6.94  ? 838 HOH A O   1 
HETATM 4489 O O   . HOH E 3 .   ? 3.013  19.086  15.621 1.00 5.47  ? 839 HOH A O   1 
HETATM 4490 O O   . HOH E 3 .   ? 7.596  16.232  12.130 1.00 6.50  ? 840 HOH A O   1 
HETATM 4491 O O   . HOH E 3 .   ? 17.497 19.312  22.254 1.00 1.13  ? 841 HOH A O   1 
HETATM 4492 O O   . HOH E 3 .   ? 30.785 8.250   0.139  1.00 22.90 ? 842 HOH A O   1 
HETATM 4493 O O   . HOH E 3 .   ? 22.426 21.039  20.114 1.00 5.01  ? 843 HOH A O   1 
HETATM 4494 O O   . HOH E 3 .   ? 10.932 2.426   21.686 1.00 30.50 ? 844 HOH A O   1 
HETATM 4495 O O   . HOH E 3 .   ? 19.675 20.111  18.063 1.00 1.13  ? 845 HOH A O   1 
HETATM 4496 O O   . HOH E 3 .   ? 18.943 23.282  20.944 1.00 4.98  ? 846 HOH A O   1 
HETATM 4497 O O   . HOH E 3 .   ? 21.473 22.398  22.153 1.00 5.16  ? 847 HOH A O   1 
HETATM 4498 O O   . HOH E 3 .   ? 13.748 17.049  26.717 1.00 25.87 ? 848 HOH A O   1 
HETATM 4499 O O   . HOH E 3 .   ? 16.618 16.530  6.294  1.00 14.94 ? 849 HOH A O   1 
HETATM 4500 O O   . HOH E 3 .   ? 9.561  3.726   19.481 1.00 9.66  ? 850 HOH A O   1 
HETATM 4501 O O   . HOH E 3 .   ? 24.809 21.654  20.799 1.00 17.96 ? 851 HOH A O   1 
HETATM 4502 O O   . HOH E 3 .   ? 8.223  19.110  28.515 1.00 14.32 ? 852 HOH A O   1 
HETATM 4503 O O   . HOH E 3 .   ? 10.769 19.413  29.352 1.00 13.64 ? 853 HOH A O   1 
HETATM 4504 O O   . HOH E 3 .   ? 16.176 16.382  27.903 1.00 9.85  ? 854 HOH A O   1 
HETATM 4505 O O   . HOH E 3 .   ? 29.847 0.797   1.590  1.00 22.46 ? 855 HOH A O   1 
HETATM 4506 O O   . HOH E 3 .   ? 20.167 20.277  23.126 1.00 2.64  ? 856 HOH A O   1 
HETATM 4507 O O   . HOH E 3 .   ? 20.770 19.483  3.021  1.00 1.13  ? 857 HOH A O   1 
HETATM 4508 O O   . HOH E 3 .   ? 11.524 28.044  3.906  1.00 13.64 ? 858 HOH A O   1 
HETATM 4509 O O   . HOH E 3 .   ? 0.561  20.479  5.369  1.00 15.28 ? 859 HOH A O   1 
HETATM 4510 O O   . HOH E 3 .   ? 39.000 6.112   7.584  1.00 13.05 ? 860 HOH A O   1 
HETATM 4511 O O   . HOH E 3 .   ? 14.566 15.604  0.137  1.00 10.38 ? 861 HOH A O   1 
HETATM 4512 O O   . HOH E 3 .   ? 17.016 18.130  29.740 1.00 24.93 ? 862 HOH A O   1 
HETATM 4513 O O   . HOH E 3 .   ? 24.532 11.009  25.543 1.00 5.65  ? 863 HOH A O   1 
HETATM 4514 O O   . HOH E 3 .   ? 14.278 12.982  26.253 1.00 14.92 ? 864 HOH A O   1 
HETATM 4515 O O   . HOH E 3 .   ? -0.201 9.858   8.252  1.00 13.51 ? 865 HOH A O   1 
HETATM 4516 O O   . HOH E 3 .   ? 7.437  17.034  24.530 1.00 8.79  ? 866 HOH A O   1 
HETATM 4517 O O   . HOH E 3 .   ? -6.049 14.434  1.291  1.00 24.32 ? 867 HOH A O   1 
HETATM 4518 O O   . HOH E 3 .   ? 21.790 3.226   0.436  1.00 7.29  ? 868 HOH A O   1 
HETATM 4519 O O   . HOH E 3 .   ? 14.116 18.254  -0.107 1.00 12.00 ? 869 HOH A O   1 
HETATM 4520 O O   . HOH E 3 .   ? -1.603 28.036  12.965 1.00 18.94 ? 870 HOH A O   1 
HETATM 4521 O O   . HOH E 3 .   ? 39.331 22.075  26.467 1.00 5.13  ? 871 HOH A O   1 
HETATM 4522 O O   . HOH E 3 .   ? 35.313 14.806  -1.199 1.00 30.82 ? 872 HOH A O   1 
HETATM 4523 O O   . HOH E 3 .   ? 17.819 15.874  16.291 1.00 25.54 ? 873 HOH A O   1 
HETATM 4524 O O   . HOH E 3 .   ? 16.715 34.811  19.885 1.00 15.99 ? 874 HOH A O   1 
HETATM 4525 O O   . HOH E 3 .   ? 47.322 21.090  13.877 1.00 23.43 ? 875 HOH A O   1 
HETATM 4526 O O   . HOH E 3 .   ? 27.591 33.422  20.720 1.00 39.35 ? 876 HOH A O   1 
HETATM 4527 O O   . HOH E 3 .   ? 22.916 23.413  -3.020 1.00 19.29 ? 877 HOH A O   1 
HETATM 4528 O O   . HOH E 3 .   ? 27.181 19.633  1.591  1.00 33.18 ? 878 HOH A O   1 
HETATM 4529 O O   . HOH E 3 .   ? 17.905 19.771  6.183  1.00 22.91 ? 879 HOH A O   1 
HETATM 4530 O O   . HOH E 3 .   ? 45.163 32.477  15.247 1.00 15.14 ? 880 HOH A O   1 
HETATM 4531 O O   . HOH E 3 .   ? 15.300 28.110  29.756 1.00 21.54 ? 881 HOH A O   1 
HETATM 4532 O O   . HOH E 3 .   ? 23.661 16.838  28.005 1.00 16.66 ? 882 HOH A O   1 
HETATM 4533 O O   . HOH E 3 .   ? 31.107 -2.126  9.870  1.00 19.27 ? 883 HOH A O   1 
HETATM 4534 O O   . HOH E 3 .   ? 31.165 27.417  4.160  1.00 25.58 ? 884 HOH A O   1 
HETATM 4535 O O   . HOH E 3 .   ? 11.411 36.391  5.518  1.00 19.99 ? 885 HOH A O   1 
HETATM 4536 O O   . HOH E 3 .   ? 21.854 18.254  0.706  1.00 41.22 ? 886 HOH A O   1 
HETATM 4537 O O   . HOH E 3 .   ? 2.799  17.872  12.307 1.00 33.59 ? 887 HOH A O   1 
HETATM 4538 O O   . HOH E 3 .   ? 28.067 16.754  1.810  1.00 20.70 ? 888 HOH A O   1 
HETATM 4539 O O   . HOH E 3 .   ? 2.218  34.864  16.552 1.00 26.14 ? 889 HOH A O   1 
HETATM 4540 O O   . HOH E 3 .   ? 7.736  8.718   23.436 1.00 20.31 ? 890 HOH A O   1 
HETATM 4541 O O   . HOH E 3 .   ? 37.371 38.684  17.109 1.00 12.61 ? 891 HOH A O   1 
HETATM 4542 O O   . HOH E 3 .   ? 45.198 17.679  16.898 1.00 27.50 ? 892 HOH A O   1 
HETATM 4543 O O   . HOH E 3 .   ? 34.213 3.932   14.294 1.00 39.34 ? 893 HOH A O   1 
HETATM 4544 O O   . HOH E 3 .   ? 24.962 18.966  3.054  1.00 22.44 ? 894 HOH A O   1 
HETATM 4545 O O   . HOH E 3 .   ? 20.840 23.347  15.230 1.00 26.81 ? 895 HOH A O   1 
HETATM 4546 O O   . HOH E 3 .   ? 19.812 16.723  18.008 1.00 10.97 ? 896 HOH A O   1 
HETATM 4547 O O   . HOH E 3 .   ? 15.717 8.856   24.509 1.00 18.83 ? 897 HOH A O   1 
HETATM 4548 O O   . HOH E 3 .   ? 4.282  22.836  27.633 1.00 28.22 ? 898 HOH A O   1 
HETATM 4549 O O   . HOH E 3 .   ? 14.051 20.469  5.400  1.00 23.98 ? 899 HOH A O   1 
HETATM 4550 O O   . HOH E 3 .   ? 19.256 32.521  3.920  1.00 26.65 ? 900 HOH A O   1 
HETATM 4551 O O   . HOH E 3 .   ? 22.983 39.419  13.085 1.00 22.70 ? 901 HOH A O   1 
HETATM 4552 O O   . HOH E 3 .   ? 33.283 8.924   9.561  1.00 24.07 ? 902 HOH A O   1 
HETATM 4553 O O   . HOH E 3 .   ? 5.729  18.449  12.734 1.00 16.79 ? 903 HOH A O   1 
HETATM 4554 O O   . HOH E 3 .   ? 14.373 28.881  0.256  1.00 28.80 ? 904 HOH A O   1 
HETATM 4555 O O   . HOH E 3 .   ? 17.668 10.526  25.348 1.00 22.34 ? 905 HOH A O   1 
HETATM 4556 O O   . HOH E 3 .   ? 30.641 16.521  1.510  1.00 19.17 ? 906 HOH A O   1 
HETATM 4557 O O   . HOH E 3 .   ? 40.921 13.947  24.692 1.00 30.48 ? 907 HOH A O   1 
HETATM 4558 O O   . HOH E 3 .   ? 36.185 11.898  10.573 1.00 29.99 ? 908 HOH A O   1 
HETATM 4559 O O   . HOH E 3 .   ? 37.663 29.017  9.931  1.00 21.96 ? 909 HOH A O   1 
HETATM 4560 O O   . HOH E 3 .   ? 13.720 38.661  18.022 1.00 15.51 ? 910 HOH A O   1 
HETATM 4561 O O   . HOH E 3 .   ? 12.523 18.837  2.427  1.00 36.73 ? 911 HOH A O   1 
HETATM 4562 O O   . HOH E 3 .   ? 17.429 29.324  24.966 1.00 18.78 ? 912 HOH A O   1 
HETATM 4563 O O   . HOH E 3 .   ? -2.653 16.355  20.506 1.00 25.01 ? 913 HOH A O   1 
HETATM 4564 O O   . HOH E 3 .   ? 33.633 27.893  8.654  1.00 28.46 ? 914 HOH A O   1 
HETATM 4565 O O   . HOH E 3 .   ? 19.393 33.306  27.961 1.00 34.40 ? 915 HOH A O   1 
HETATM 4566 O O   . HOH E 3 .   ? 33.095 29.300  6.648  1.00 25.17 ? 916 HOH A O   1 
HETATM 4567 O O   . HOH E 3 .   ? 19.097 21.678  -3.621 1.00 30.00 ? 917 HOH A O   1 
HETATM 4568 O O   . HOH E 3 .   ? -2.933 12.410  5.605  1.00 25.34 ? 918 HOH A O   1 
HETATM 4569 O O   . HOH E 3 .   ? 47.768 23.724  25.419 1.00 30.16 ? 919 HOH A O   1 
HETATM 4570 O O   . HOH F 3 .   ? 48.953 57.913  18.244 1.00 1.13  ? 701 HOH B O   1 
HETATM 4571 O O   . HOH F 3 .   ? 53.423 71.823  17.509 1.00 1.13  ? 702 HOH B O   1 
HETATM 4572 O O   . HOH F 3 .   ? 53.040 49.566  3.913  1.00 2.71  ? 703 HOH B O   1 
HETATM 4573 O O   . HOH F 3 .   ? 47.219 53.996  25.672 1.00 7.77  ? 704 HOH B O   1 
HETATM 4574 O O   . HOH F 3 .   ? 46.412 59.965  20.529 1.00 1.13  ? 705 HOH B O   1 
HETATM 4575 O O   . HOH F 3 .   ? 45.188 52.607  14.343 1.00 1.13  ? 706 HOH B O   1 
HETATM 4576 O O   . HOH F 3 .   ? 46.000 54.987  6.267  1.00 5.14  ? 707 HOH B O   1 
HETATM 4577 O O   . HOH F 3 .   ? 37.263 54.227  14.764 1.00 7.60  ? 708 HOH B O   1 
HETATM 4578 O O   . HOH F 3 .   ? 35.319 47.796  -1.795 1.00 2.42  ? 709 HOH B O   1 
HETATM 4579 O O   . HOH F 3 .   ? 30.239 70.266  21.641 1.00 18.01 ? 710 HOH B O   1 
HETATM 4580 O O   . HOH F 3 .   ? 47.919 53.146  19.190 1.00 1.21  ? 711 HOH B O   1 
HETATM 4581 O O   . HOH F 3 .   ? 48.460 61.587  20.853 1.00 1.13  ? 712 HOH B O   1 
HETATM 4582 O O   . HOH F 3 .   ? 49.408 58.804  22.826 1.00 1.13  ? 713 HOH B O   1 
HETATM 4583 O O   . HOH F 3 .   ? 60.084 68.751  15.773 1.00 6.74  ? 714 HOH B O   1 
HETATM 4584 O O   . HOH F 3 .   ? 42.970 55.999  26.573 1.00 6.95  ? 715 HOH B O   1 
HETATM 4585 O O   . HOH F 3 .   ? 58.730 59.162  2.424  1.00 1.13  ? 716 HOH B O   1 
HETATM 4586 O O   . HOH F 3 .   ? 62.693 74.455  14.675 1.00 18.95 ? 717 HOH B O   1 
HETATM 4587 O O   . HOH F 3 .   ? 43.055 49.631  24.805 1.00 14.65 ? 718 HOH B O   1 
HETATM 4588 O O   . HOH F 3 .   ? 57.311 48.971  22.059 1.00 10.21 ? 719 HOH B O   1 
HETATM 4589 O O   . HOH F 3 .   ? 60.653 52.796  3.413  1.00 7.24  ? 720 HOH B O   1 
HETATM 4590 O O   . HOH F 3 .   ? 28.584 49.019  8.283  1.00 13.19 ? 721 HOH B O   1 
HETATM 4591 O O   . HOH F 3 .   ? 51.659 59.518  20.007 1.00 1.13  ? 722 HOH B O   1 
HETATM 4592 O O   . HOH F 3 .   ? 30.685 39.626  11.924 1.00 7.09  ? 723 HOH B O   1 
HETATM 4593 O O   . HOH F 3 .   ? 36.993 54.820  12.295 1.00 1.13  ? 724 HOH B O   1 
HETATM 4594 O O   . HOH F 3 .   ? 59.845 62.641  4.372  1.00 8.40  ? 725 HOH B O   1 
HETATM 4595 O O   . HOH F 3 .   ? 37.677 41.799  13.329 1.00 3.04  ? 726 HOH B O   1 
HETATM 4596 O O   . HOH F 3 .   ? 44.349 56.056  12.519 1.00 12.34 ? 727 HOH B O   1 
HETATM 4597 O O   . HOH F 3 .   ? 46.711 57.745  22.140 1.00 1.64  ? 728 HOH B O   1 
HETATM 4598 O O   . HOH F 3 .   ? 32.505 58.242  15.180 1.00 1.13  ? 729 HOH B O   1 
HETATM 4599 O O   . HOH F 3 .   ? 57.212 54.674  2.014  1.00 7.10  ? 730 HOH B O   1 
HETATM 4600 O O   . HOH F 3 .   ? 54.845 52.893  5.631  1.00 2.82  ? 731 HOH B O   1 
HETATM 4601 O O   . HOH F 3 .   ? 61.318 67.410  7.069  1.00 24.98 ? 732 HOH B O   1 
HETATM 4602 O O   . HOH F 3 .   ? 43.728 55.935  5.531  1.00 3.13  ? 733 HOH B O   1 
HETATM 4603 O O   . HOH F 3 .   ? 36.876 56.305  24.732 1.00 27.92 ? 734 HOH B O   1 
HETATM 4604 O O   . HOH F 3 .   ? 53.829 52.753  8.058  1.00 9.79  ? 735 HOH B O   1 
HETATM 4605 O O   . HOH F 3 .   ? 37.426 48.990  -0.550 1.00 8.09  ? 736 HOH B O   1 
HETATM 4606 O O   . HOH F 3 .   ? 62.906 76.444  7.779  1.00 8.45  ? 737 HOH B O   1 
HETATM 4607 O O   . HOH F 3 .   ? 36.698 45.551  -1.184 1.00 3.13  ? 738 HOH B O   1 
HETATM 4608 O O   . HOH F 3 .   ? 31.513 60.707  15.568 1.00 9.27  ? 739 HOH B O   1 
HETATM 4609 O O   . HOH F 3 .   ? 58.500 72.040  6.034  1.00 11.27 ? 740 HOH B O   1 
HETATM 4610 O O   . HOH F 3 .   ? 32.718 56.818  12.530 1.00 13.12 ? 741 HOH B O   1 
HETATM 4611 O O   . HOH F 3 .   ? 57.808 44.458  4.879  1.00 12.01 ? 742 HOH B O   1 
HETATM 4612 O O   . HOH F 3 .   ? 59.841 54.324  1.177  1.00 3.71  ? 743 HOH B O   1 
HETATM 4613 O O   . HOH F 3 .   ? 30.051 45.102  11.798 1.00 16.46 ? 744 HOH B O   1 
HETATM 4614 O O   . HOH F 3 .   ? 50.563 41.003  0.655  1.00 12.80 ? 745 HOH B O   1 
HETATM 4615 O O   . HOH F 3 .   ? 32.277 74.234  16.119 1.00 7.88  ? 746 HOH B O   1 
HETATM 4616 O O   . HOH F 3 .   ? 34.856 43.521  -0.982 1.00 1.13  ? 747 HOH B O   1 
HETATM 4617 O O   . HOH F 3 .   ? 65.180 49.715  10.596 1.00 23.68 ? 748 HOH B O   1 
HETATM 4618 O O   . HOH F 3 .   ? 60.675 65.124  4.028  1.00 16.69 ? 749 HOH B O   1 
HETATM 4619 O O   . HOH F 3 .   ? 60.608 57.285  1.481  1.00 19.14 ? 750 HOH B O   1 
HETATM 4620 O O   . HOH F 3 .   ? 59.584 61.711  1.927  1.00 14.51 ? 751 HOH B O   1 
HETATM 4621 O O   . HOH F 3 .   ? 53.296 58.611  28.551 1.00 18.05 ? 752 HOH B O   1 
HETATM 4622 O O   . HOH F 3 .   ? 61.393 50.564  1.883  1.00 5.78  ? 753 HOH B O   1 
HETATM 4623 O O   . HOH F 3 .   ? 37.382 38.724  7.450  1.00 12.58 ? 754 HOH B O   1 
HETATM 4624 O O   . HOH F 3 .   ? 43.572 52.169  26.082 1.00 9.51  ? 755 HOH B O   1 
HETATM 4625 O O   . HOH F 3 .   ? 52.435 62.626  23.353 1.00 1.14  ? 756 HOH B O   1 
HETATM 4626 O O   . HOH F 3 .   ? 48.873 55.033  17.605 1.00 13.08 ? 757 HOH B O   1 
HETATM 4627 O O   . HOH F 3 .   ? 61.818 46.004  9.764  1.00 21.44 ? 758 HOH B O   1 
HETATM 4628 O O   . HOH F 3 .   ? 55.590 60.031  26.540 1.00 21.32 ? 759 HOH B O   1 
HETATM 4629 O O   . HOH F 3 .   ? 37.445 59.601  12.056 1.00 10.31 ? 760 HOH B O   1 
HETATM 4630 O O   . HOH F 3 .   ? 54.212 59.492  20.605 1.00 10.76 ? 761 HOH B O   1 
HETATM 4631 O O   . HOH F 3 .   ? 68.671 69.095  23.601 1.00 18.46 ? 762 HOH B O   1 
HETATM 4632 O O   . HOH F 3 .   ? 62.818 58.386  1.482  1.00 13.59 ? 763 HOH B O   1 
HETATM 4633 O O   . HOH F 3 .   ? 33.751 38.365  7.929  1.00 6.44  ? 764 HOH B O   1 
HETATM 4634 O O   . HOH F 3 .   ? 68.857 59.651  26.364 1.00 12.11 ? 765 HOH B O   1 
HETATM 4635 O O   . HOH F 3 .   ? 76.851 59.043  13.666 1.00 8.78  ? 766 HOH B O   1 
HETATM 4636 O O   . HOH F 3 .   ? 59.646 35.460  10.188 1.00 19.20 ? 767 HOH B O   1 
HETATM 4637 O O   . HOH F 3 .   ? 70.498 51.881  24.778 1.00 29.99 ? 768 HOH B O   1 
HETATM 4638 O O   . HOH F 3 .   ? 50.696 54.732  27.864 1.00 9.38  ? 769 HOH B O   1 
HETATM 4639 O O   . HOH F 3 .   ? 39.031 57.253  12.176 1.00 23.80 ? 770 HOH B O   1 
HETATM 4640 O O   . HOH F 3 .   ? 30.655 59.203  27.767 1.00 44.33 ? 771 HOH B O   1 
HETATM 4641 O O   . HOH F 3 .   ? 46.828 68.257  25.117 1.00 24.11 ? 772 HOH B O   1 
HETATM 4642 O O   . HOH F 3 .   ? 40.914 66.232  3.663  1.00 15.65 ? 773 HOH B O   1 
HETATM 4643 O O   . HOH F 3 .   ? 50.035 57.911  2.883  1.00 18.83 ? 774 HOH B O   1 
HETATM 4644 O O   . HOH F 3 .   ? 64.356 44.050  15.672 1.00 22.92 ? 775 HOH B O   1 
HETATM 4645 O O   . HOH F 3 .   ? 28.930 73.037  25.173 1.00 21.83 ? 776 HOH B O   1 
HETATM 4646 O O   . HOH F 3 .   ? 59.963 38.619  10.321 1.00 18.71 ? 777 HOH B O   1 
HETATM 4647 O O   . HOH F 3 .   ? 52.318 60.994  -3.317 1.00 19.88 ? 778 HOH B O   1 
HETATM 4648 O O   . HOH F 3 .   ? 50.239 77.583  14.681 1.00 25.28 ? 779 HOH B O   1 
HETATM 4649 O O   . HOH F 3 .   ? 48.838 53.291  0.465  1.00 30.29 ? 780 HOH B O   1 
HETATM 4650 O O   . HOH F 3 .   ? 45.286 54.449  27.883 1.00 25.13 ? 781 HOH B O   1 
HETATM 4651 O O   . HOH F 3 .   ? 46.388 56.590  29.549 1.00 21.59 ? 782 HOH B O   1 
HETATM 4652 O O   . HOH F 3 .   ? 40.329 58.639  29.197 1.00 24.79 ? 783 HOH B O   1 
HETATM 4653 O O   . HOH F 3 .   ? 38.322 42.736  19.453 1.00 15.13 ? 784 HOH B O   1 
HETATM 4654 O O   . HOH F 3 .   ? 48.832 70.548  3.724  1.00 17.92 ? 785 HOH B O   1 
HETATM 4655 O O   . HOH F 3 .   ? 62.365 68.934  11.610 1.00 30.82 ? 786 HOH B O   1 
HETATM 4656 O O   . HOH F 3 .   ? 56.953 44.161  1.829  1.00 24.97 ? 787 HOH B O   1 
HETATM 4657 O O   . HOH F 3 .   ? 71.325 56.954  4.223  1.00 21.80 ? 788 HOH B O   1 
HETATM 4658 O O   . HOH F 3 .   ? 53.586 49.261  25.733 1.00 19.47 ? 789 HOH B O   1 
HETATM 4659 O O   . HOH F 3 .   ? 30.929 73.786  27.250 1.00 34.92 ? 790 HOH B O   1 
HETATM 4660 O O   . HOH F 3 .   ? 28.372 53.124  14.659 1.00 17.83 ? 791 HOH B O   1 
HETATM 4661 O O   . HOH F 3 .   ? 63.444 63.601  1.110  1.00 37.59 ? 792 HOH B O   1 
HETATM 4662 O O   . HOH F 3 .   ? 47.479 57.853  5.830  1.00 28.58 ? 793 HOH B O   1 
HETATM 4663 O O   . HOH F 3 .   ? 56.364 57.290  1.656  1.00 28.43 ? 794 HOH B O   1 
HETATM 4664 O O   . HOH F 3 .   ? 55.509 42.277  0.250  1.00 22.93 ? 795 HOH B O   1 
HETATM 4665 O O   . HOH F 3 .   ? 56.342 51.883  24.145 1.00 25.97 ? 796 HOH B O   1 
HETATM 4666 O O   . HOH F 3 .   ? 68.029 44.027  7.591  1.00 39.03 ? 797 HOH B O   1 
HETATM 4667 O O   . HOH F 3 .   ? 37.459 60.400  9.190  1.00 27.79 ? 798 HOH B O   1 
HETATM 4668 O O   . HOH F 3 .   ? 25.202 59.503  17.655 1.00 21.63 ? 799 HOH B O   1 
HETATM 4669 O O   . HOH F 3 .   ? 35.896 75.604  28.885 1.00 27.30 ? 800 HOH B O   1 
HETATM 4670 O O   . HOH F 3 .   ? 34.093 38.366  11.481 1.00 27.36 ? 801 HOH B O   1 
HETATM 4671 O O   . HOH F 3 .   ? 44.753 42.629  25.292 1.00 26.03 ? 802 HOH B O   1 
HETATM 4672 O O   . HOH F 3 .   ? 62.644 61.294  0.527  1.00 18.92 ? 803 HOH B O   1 
HETATM 4673 O O   . HOH F 3 .   ? 39.460 40.746  17.398 1.00 31.12 ? 804 HOH B O   1 
HETATM 4674 O O   . HOH F 3 .   ? 68.025 41.392  9.514  1.00 25.42 ? 805 HOH B O   1 
HETATM 4675 O O   . HOH F 3 .   ? 72.610 60.855  3.981  1.00 18.57 ? 806 HOH B O   1 
HETATM 4676 O O   . HOH F 3 .   ? 66.630 76.000  16.814 1.00 22.14 ? 807 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   TYR 2   2   2   TYR TYR A . n 
A 1 3   THR 3   3   3   THR THR A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   ASN 5   5   5   ASN ASN A . n 
A 1 6   TRP 6   6   6   TRP TRP A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  TYR 10  10  10  TYR TYR A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  TRP 12  12  12  TRP TRP A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  TRP 14  14  14  TRP TRP A . n 
A 1 15  MET 15  15  15  MET MET A . n 
A 1 16  LEU 16  16  16  LEU LEU A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  PHE 18  18  18  PHE PHE A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  ARG 22  22  22  ARG ARG A . n 
A 1 23  ALA 23  23  23  ALA ALA A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  SER 26  26  26  SER SER A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  ASP 32  32  32  ASP ASP A . n 
A 1 33  SER 33  33  33  SER SER A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  TYR 35  35  35  TYR TYR A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  TYR 44  44  44  TYR TYR A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  THR 49  49  49  THR THR A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  ILE 51  51  51  ILE ILE A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  HIS 57  57  57  HIS HIS A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  HIS 60  60  60  HIS HIS A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  ASN 62  62  62  ASN ASN A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  GLU 68  68  68  GLU GLU A . n 
A 1 69  PRO 69  69  69  PRO PRO A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  CYS 74  74  74  CYS CYS A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  ALA 76  76  76  ALA ALA A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  MET 78  78  78  MET MET A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  PHE 82  82  82  PHE PHE A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  CYS 86  86  86  CYS CYS A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  ASN 92  92  92  ASN ASN A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 ARG 102 102 102 ARG ARG A . n 
A 1 103 PRO 103 103 103 PRO PRO A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 CYS 110 110 110 CYS CYS A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 PHE 114 114 114 PHE PHE A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 GLN 116 116 116 GLN GLN A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 GLN 124 124 124 GLN GLN A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 SER 127 127 127 SER SER A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 MET 130 130 130 MET MET A . n 
A 1 131 ALA 131 131 131 ALA ALA A . n 
A 1 132 ALA 132 132 132 ALA ALA A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 THR 135 135 135 THR THR A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 VAL 138 138 138 VAL VAL A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 TYR 142 142 142 TYR TYR A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 ASP 148 148 148 ASP ASP A . n 
A 1 149 PHE 149 149 149 PHE PHE A . n 
A 1 150 PRO 150 150 150 PRO PRO A . n 
A 1 151 GLU 151 151 151 GLU GLU A . n 
A 1 152 TYR 152 152 152 TYR TYR A . n 
A 1 153 ILE 153 153 153 ILE ILE A . n 
A 1 154 CYS 154 154 154 CYS CYS A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 PRO 156 156 156 PRO PRO A . n 
A 1 157 THR 157 157 157 THR THR A . n 
A 1 158 PRO 158 158 158 PRO PRO A . n 
A 1 159 GLN 159 159 159 GLN GLN A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 ALA 162 162 162 ALA ALA A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 ASP 165 165 165 ASP ASP A . n 
A 1 166 PRO 166 166 166 PRO PRO A . n 
A 1 167 GLN 167 167 167 GLN GLN A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 LYS 170 170 170 LYS LYS A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 GLY 173 173 173 GLY GLY A . n 
A 1 174 MET 174 174 174 MET MET A . n 
A 1 175 PRO 175 175 175 PRO PRO A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 LYS 177 177 177 LYS LYS A . n 
A 1 178 ARG 178 178 178 ARG ARG A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 GLU 180 180 180 GLU GLU A . n 
A 1 181 ALA 181 181 181 ALA ALA A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 ILE 183 183 183 ILE ILE A . n 
A 1 184 HIS 184 184 184 HIS HIS A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 ASN 187 187 187 ASN ASN A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 GLU 191 191 191 GLU GLU A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 LEU 194 194 194 LEU LEU A . n 
A 1 195 PRO 195 195 195 PRO PRO A . n 
A 1 196 MET 196 196 196 MET MET A . n 
A 1 197 THR 197 197 197 THR THR A . n 
A 1 198 ILE 198 198 198 ILE ILE A . n 
A 1 199 PRO 199 199 199 PRO PRO A . n 
A 1 200 GLY 200 200 200 GLY GLY A . n 
A 1 201 ASP 201 201 201 ASP ASP A . n 
A 1 202 VAL 202 202 202 VAL VAL A . n 
A 1 203 GLU 203 203 203 GLU GLU A . n 
A 1 204 GLN 204 204 204 GLN GLN A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 MET 206 206 206 MET MET A . n 
A 1 207 LYS 207 207 207 LYS LYS A . n 
A 1 208 THR 208 208 208 THR THR A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 GLN 210 210 210 GLN GLN A . n 
A 1 211 THR 211 211 211 THR THR A . n 
A 1 212 PHE 212 212 212 PHE PHE A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 ILE 215 215 215 ILE ILE A . n 
A 1 216 GLY 216 216 216 GLY GLY A . n 
A 1 217 ARG 217 217 217 ARG ARG A . n 
A 1 218 TRP 218 218 218 TRP TRP A . n 
A 1 219 THR 219 219 219 THR THR A . n 
A 1 220 ALA 220 220 220 ALA ALA A . n 
A 1 221 ASN 221 221 221 ASN ASN A . n 
A 1 222 TYR 222 222 222 TYR TYR A . n 
A 1 223 PHE 223 223 223 PHE PHE A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 LEU 225 225 225 LEU LEU A . n 
A 1 226 ARG 226 226 226 ARG ARG A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 TRP 228 228 228 TRP TRP A . n 
A 1 229 GLN 229 229 229 GLN GLN A . n 
A 1 230 ALA 230 230 230 ALA ALA A . n 
A 1 231 LYS 231 231 231 LYS LYS A . n 
A 1 232 ASP 232 232 232 ASP ASP A . n 
A 1 233 VAL 233 233 233 VAL VAL A . n 
A 1 234 PHE 234 234 234 PHE PHE A . n 
A 1 235 LEU 235 235 235 LEU LEU A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 ASP 237 237 237 ASP ASP A . n 
A 1 238 ASP 238 238 238 ASP ASP A . n 
A 1 239 TYR 239 239 239 TYR TYR A . n 
A 1 240 LEU 240 240 240 LEU LEU A . n 
A 1 241 ILE 241 241 241 ILE ILE A . n 
A 1 242 LYS 242 242 242 LYS LYS A . n 
A 1 243 GLN 243 243 243 GLN GLN A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 PHE 245 245 245 PHE PHE A . n 
A 1 246 PRO 246 246 246 PRO PRO A . n 
A 1 247 GLY 247 247 247 GLY GLY A . n 
A 1 248 MET 248 248 248 MET MET A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 PRO 250 250 250 PRO PRO A . n 
A 1 251 ALA 251 251 251 ALA ALA A . n 
A 1 252 GLN 252 252 252 GLN GLN A . n 
A 1 253 ILE 253 253 253 ILE ILE A . n 
A 1 254 ARG 254 254 254 ARG ARG A . n 
A 1 255 ARG 255 255 255 ARG ARG A . n 
A 1 256 TYR 256 256 256 TYR TYR A . n 
A 1 257 ALA 257 257 257 ALA ALA A . n 
A 1 258 GLU 258 258 258 GLU GLU A . n 
A 1 259 ARG 259 259 259 ARG ARG A . n 
A 1 260 TRP 260 260 260 TRP TRP A . n 
A 1 261 LYS 261 261 261 LYS LYS A . n 
A 1 262 PRO 262 262 262 PRO PRO A . n 
A 1 263 TRP 263 263 263 TRP TRP A . n 
A 1 264 ARG 264 264 264 ARG ARG A . n 
A 1 265 SER 265 265 265 SER SER A . n 
A 1 266 TYR 266 266 266 TYR TYR A . n 
A 1 267 ALA 267 267 267 ALA ALA A . n 
A 1 268 LEU 268 268 268 LEU LEU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 HIS 270 270 270 HIS HIS A . n 
A 1 271 ILE 271 271 271 ILE ILE A . n 
A 1 272 TRP 272 272 272 TRP TRP A . n 
A 1 273 TYR 273 273 273 TYR TYR A . n 
A 1 274 THR 274 274 274 THR THR A . n 
A 1 275 GLU 275 275 275 GLU GLU A . n 
A 1 276 GLY 276 276 276 GLY GLY A . n 
A 1 277 TRP 277 277 277 TRP TRP A . n 
A 1 278 GLN 278 278 278 GLN GLN A . n 
A 1 279 PRO 279 279 279 PRO PRO A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 GLU 281 281 281 GLU GLU A . n 
A 1 282 ALA 282 282 282 ALA ALA A . n 
B 1 1   MET 1   1   1   MET MET B . n 
B 1 2   TYR 2   2   2   TYR TYR B . n 
B 1 3   THR 3   3   3   THR THR B . n 
B 1 4   LEU 4   4   4   LEU LEU B . n 
B 1 5   ASN 5   5   5   ASN ASN B . n 
B 1 6   TRP 6   6   6   TRP TRP B . n 
B 1 7   GLN 7   7   7   GLN GLN B . n 
B 1 8   PRO 8   8   8   PRO PRO B . n 
B 1 9   PRO 9   9   9   PRO PRO B . n 
B 1 10  TYR 10  10  10  TYR TYR B . n 
B 1 11  ASP 11  11  11  ASP ASP B . n 
B 1 12  TRP 12  12  12  TRP TRP B . n 
B 1 13  SER 13  13  13  SER SER B . n 
B 1 14  TRP 14  14  14  TRP TRP B . n 
B 1 15  MET 15  15  15  MET MET B . n 
B 1 16  LEU 16  16  16  LEU LEU B . n 
B 1 17  GLY 17  17  17  GLY GLY B . n 
B 1 18  PHE 18  18  18  PHE PHE B . n 
B 1 19  LEU 19  19  19  LEU LEU B . n 
B 1 20  ALA 20  20  20  ALA ALA B . n 
B 1 21  ALA 21  21  21  ALA ALA B . n 
B 1 22  ARG 22  22  22  ARG ARG B . n 
B 1 23  ALA 23  23  23  ALA ALA B . n 
B 1 24  VAL 24  24  24  VAL VAL B . n 
B 1 25  SER 25  25  25  SER SER B . n 
B 1 26  SER 26  26  26  SER SER B . n 
B 1 27  VAL 27  27  27  VAL VAL B . n 
B 1 28  GLU 28  28  28  GLU GLU B . n 
B 1 29  THR 29  29  29  THR THR B . n 
B 1 30  VAL 30  30  30  VAL VAL B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  ASP 32  32  32  ASP ASP B . n 
B 1 33  SER 33  33  33  SER SER B . n 
B 1 34  TYR 34  34  34  TYR TYR B . n 
B 1 35  TYR 35  35  35  TYR TYR B . n 
B 1 36  ALA 36  36  36  ALA ALA B . n 
B 1 37  ARG 37  37  37  ARG ARG B . n 
B 1 38  SER 38  38  38  SER SER B . n 
B 1 39  LEU 39  39  39  LEU LEU B . n 
B 1 40  ALA 40  40  40  ALA ALA B . n 
B 1 41  VAL 41  41  41  VAL VAL B . n 
B 1 42  GLY 42  42  42  GLY GLY B . n 
B 1 43  GLU 43  43  43  GLU GLU B . n 
B 1 44  TYR 44  44  44  TYR TYR B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  GLY 46  46  46  GLY GLY B . n 
B 1 47  VAL 47  47  47  VAL VAL B . n 
B 1 48  VAL 48  48  48  VAL VAL B . n 
B 1 49  THR 49  49  49  THR THR B . n 
B 1 50  ALA 50  50  50  ALA ALA B . n 
B 1 51  ILE 51  51  51  ILE ILE B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  ASP 53  53  53  ASP ASP B . n 
B 1 54  ILE 54  54  54  ILE ILE B . n 
B 1 55  ALA 55  55  55  ALA ALA B . n 
B 1 56  ARG 56  56  56  ARG ARG B . n 
B 1 57  HIS 57  57  57  HIS HIS B . n 
B 1 58  THR 58  58  58  THR THR B . n 
B 1 59  LEU 59  59  59  LEU LEU B . n 
B 1 60  HIS 60  60  60  HIS HIS B . n 
B 1 61  ILE 61  61  61  ILE ILE B . n 
B 1 62  ASN 62  62  62  ASN ASN B . n 
B 1 63  LEU 63  63  63  LEU LEU B . n 
B 1 64  SER 64  64  64  SER SER B . n 
B 1 65  ALA 65  65  65  ALA ALA B . n 
B 1 66  GLY 66  66  66  GLY GLY B . n 
B 1 67  LEU 67  67  67  LEU LEU B . n 
B 1 68  GLU 68  68  68  GLU GLU B . n 
B 1 69  PRO 69  69  69  PRO PRO B . n 
B 1 70  VAL 70  70  70  VAL VAL B . n 
B 1 71  ALA 71  71  71  ALA ALA B . n 
B 1 72  ALA 72  72  72  ALA ALA B . n 
B 1 73  GLU 73  73  73  GLU GLU B . n 
B 1 74  CYS 74  74  74  CYS CYS B . n 
B 1 75  LEU 75  75  75  LEU LEU B . n 
B 1 76  ALA 76  76  76  ALA ALA B . n 
B 1 77  LYS 77  77  77  LYS LYS B . n 
B 1 78  MET 78  78  78  MET MET B . n 
B 1 79  SER 79  79  79  SER SER B . n 
B 1 80  ARG 80  80  80  ARG ARG B . n 
B 1 81  LEU 81  81  81  LEU LEU B . n 
B 1 82  PHE 82  82  82  PHE PHE B . n 
B 1 83  ASP 83  83  83  ASP ASP B . n 
B 1 84  LEU 84  84  84  LEU LEU B . n 
B 1 85  GLN 85  85  85  GLN GLN B . n 
B 1 86  CYS 86  86  86  CYS CYS B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  GLN 89  89  89  GLN GLN B . n 
B 1 90  ILE 90  90  90  ILE ILE B . n 
B 1 91  VAL 91  91  91  VAL VAL B . n 
B 1 92  ASN 92  92  92  ASN ASN B . n 
B 1 93  GLY 93  93  93  GLY GLY B . n 
B 1 94  ALA 94  94  94  ALA ALA B . n 
B 1 95  LEU 95  95  95  LEU LEU B . n 
B 1 96  GLY 96  96  96  GLY GLY B . n 
B 1 97  ARG 97  97  97  ARG ARG B . n 
B 1 98  LEU 98  98  98  LEU LEU B . n 
B 1 99  GLY 99  99  99  GLY GLY B . n 
B 1 100 ALA 100 100 100 ALA ALA B . n 
B 1 101 ALA 101 101 101 ALA ALA B . n 
B 1 102 ARG 102 102 102 ARG ARG B . n 
B 1 103 PRO 103 103 103 PRO PRO B . n 
B 1 104 GLY 104 104 104 GLY GLY B . n 
B 1 105 LEU 105 105 105 LEU LEU B . n 
B 1 106 ARG 106 106 106 ARG ARG B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 PRO 108 108 108 PRO PRO B . n 
B 1 109 GLY 109 109 109 GLY GLY B . n 
B 1 110 CYS 110 110 110 CYS CYS B . n 
B 1 111 VAL 111 111 111 VAL VAL B . n 
B 1 112 ASP 112 112 112 ASP ASP B . n 
B 1 113 ALA 113 113 113 ALA ALA B . n 
B 1 114 PHE 114 114 114 PHE PHE B . n 
B 1 115 GLU 115 115 115 GLU GLU B . n 
B 1 116 GLN 116 116 116 GLN GLN B . n 
B 1 117 GLY 117 117 117 GLY GLY B . n 
B 1 118 VAL 118 118 118 VAL VAL B . n 
B 1 119 ARG 119 119 119 ARG ARG B . n 
B 1 120 ALA 120 120 120 ALA ALA B . n 
B 1 121 ILE 121 121 121 ILE ILE B . n 
B 1 122 LEU 122 122 122 LEU LEU B . n 
B 1 123 GLY 123 123 123 GLY GLY B . n 
B 1 124 GLN 124 124 124 GLN GLN B . n 
B 1 125 LEU 125 125 125 LEU LEU B . n 
B 1 126 VAL 126 126 126 VAL VAL B . n 
B 1 127 SER 127 127 127 SER SER B . n 
B 1 128 VAL 128 128 128 VAL VAL B . n 
B 1 129 ALA 129 129 129 ALA ALA B . n 
B 1 130 MET 130 130 130 MET MET B . n 
B 1 131 ALA 131 131 131 ALA ALA B . n 
B 1 132 ALA 132 132 132 ALA ALA B . n 
B 1 133 LYS 133 133 133 LYS LYS B . n 
B 1 134 LEU 134 134 134 LEU LEU B . n 
B 1 135 THR 135 135 135 THR THR B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 ARG 137 137 137 ARG ARG B . n 
B 1 138 VAL 138 138 138 VAL VAL B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 GLN 140 140 140 GLN GLN B . n 
B 1 141 LEU 141 141 141 LEU LEU B . n 
B 1 142 TYR 142 142 142 TYR TYR B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 GLU 144 144 144 GLU GLU B . n 
B 1 145 ARG 145 145 145 ARG ARG B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 ASP 147 147 147 ASP ASP B . n 
B 1 148 ASP 148 148 148 ASP ASP B . n 
B 1 149 PHE 149 149 149 PHE PHE B . n 
B 1 150 PRO 150 150 150 PRO PRO B . n 
B 1 151 GLU 151 151 151 GLU GLU B . n 
B 1 152 TYR 152 152 152 TYR TYR B . n 
B 1 153 ILE 153 153 153 ILE ILE B . n 
B 1 154 CYS 154 154 154 CYS CYS B . n 
B 1 155 PHE 155 155 155 PHE PHE B . n 
B 1 156 PRO 156 156 156 PRO PRO B . n 
B 1 157 THR 157 157 157 THR THR B . n 
B 1 158 PRO 158 158 158 PRO PRO B . n 
B 1 159 GLN 159 159 159 GLN GLN B . n 
B 1 160 ARG 160 160 160 ARG ARG B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 ALA 162 162 162 ALA ALA B . n 
B 1 163 ALA 163 163 163 ALA ALA B . n 
B 1 164 ALA 164 164 164 ALA ALA B . n 
B 1 165 ASP 165 165 165 ASP ASP B . n 
B 1 166 PRO 166 166 166 PRO PRO B . n 
B 1 167 GLN 167 167 167 GLN GLN B . n 
B 1 168 ALA 168 168 168 ALA ALA B . n 
B 1 169 LEU 169 169 169 LEU LEU B . n 
B 1 170 LYS 170 170 170 LYS LYS B . n 
B 1 171 ALA 171 171 171 ALA ALA B . n 
B 1 172 LEU 172 172 172 LEU LEU B . n 
B 1 173 GLY 173 173 173 GLY GLY B . n 
B 1 174 MET 174 174 174 MET MET B . n 
B 1 175 PRO 175 175 175 PRO PRO B . n 
B 1 176 LEU 176 176 176 LEU LEU B . n 
B 1 177 LYS 177 177 177 LYS LYS B . n 
B 1 178 ARG 178 178 178 ARG ARG B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 GLU 180 180 180 GLU GLU B . n 
B 1 181 ALA 181 181 181 ALA ALA B . n 
B 1 182 LEU 182 182 182 LEU LEU B . n 
B 1 183 ILE 183 183 183 ILE ILE B . n 
B 1 184 HIS 184 184 184 HIS HIS B . n 
B 1 185 LEU 185 185 185 LEU LEU B . n 
B 1 186 ALA 186 186 186 ALA ALA B . n 
B 1 187 ASN 187 187 187 ASN ASN B . n 
B 1 188 ALA 188 188 188 ALA ALA B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 LEU 190 190 190 LEU LEU B . n 
B 1 191 GLU 191 191 191 GLU GLU B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 THR 193 193 193 THR THR B . n 
B 1 194 LEU 194 194 194 LEU LEU B . n 
B 1 195 PRO 195 195 195 PRO PRO B . n 
B 1 196 MET 196 196 196 MET MET B . n 
B 1 197 THR 197 197 197 THR THR B . n 
B 1 198 ILE 198 198 198 ILE ILE B . n 
B 1 199 PRO 199 199 199 PRO PRO B . n 
B 1 200 GLY 200 200 200 GLY GLY B . n 
B 1 201 ASP 201 201 201 ASP ASP B . n 
B 1 202 VAL 202 202 202 VAL VAL B . n 
B 1 203 GLU 203 203 203 GLU GLU B . n 
B 1 204 GLN 204 204 204 GLN GLN B . n 
B 1 205 ALA 205 205 205 ALA ALA B . n 
B 1 206 MET 206 206 206 MET MET B . n 
B 1 207 LYS 207 207 207 LYS LYS B . n 
B 1 208 THR 208 208 208 THR THR B . n 
B 1 209 LEU 209 209 209 LEU LEU B . n 
B 1 210 GLN 210 210 210 GLN GLN B . n 
B 1 211 THR 211 211 211 THR THR B . n 
B 1 212 PHE 212 212 212 PHE PHE B . n 
B 1 213 PRO 213 213 213 PRO PRO B . n 
B 1 214 GLY 214 214 214 GLY GLY B . n 
B 1 215 ILE 215 215 215 ILE ILE B . n 
B 1 216 GLY 216 216 216 GLY GLY B . n 
B 1 217 ARG 217 217 217 ARG ARG B . n 
B 1 218 TRP 218 218 218 TRP TRP B . n 
B 1 219 THR 219 219 219 THR THR B . n 
B 1 220 ALA 220 220 220 ALA ALA B . n 
B 1 221 ASN 221 221 221 ASN ASN B . n 
B 1 222 TYR 222 222 222 TYR TYR B . n 
B 1 223 PHE 223 223 223 PHE PHE B . n 
B 1 224 ALA 224 224 224 ALA ALA B . n 
B 1 225 LEU 225 225 225 LEU LEU B . n 
B 1 226 ARG 226 226 226 ARG ARG B . n 
B 1 227 GLY 227 227 227 GLY GLY B . n 
B 1 228 TRP 228 228 228 TRP TRP B . n 
B 1 229 GLN 229 229 229 GLN GLN B . n 
B 1 230 ALA 230 230 230 ALA ALA B . n 
B 1 231 LYS 231 231 231 LYS LYS B . n 
B 1 232 ASP 232 232 232 ASP ASP B . n 
B 1 233 VAL 233 233 233 VAL VAL B . n 
B 1 234 PHE 234 234 234 PHE PHE B . n 
B 1 235 LEU 235 235 235 LEU LEU B . n 
B 1 236 PRO 236 236 236 PRO PRO B . n 
B 1 237 ASP 237 237 237 ASP ASP B . n 
B 1 238 ASP 238 238 238 ASP ASP B . n 
B 1 239 TYR 239 239 239 TYR TYR B . n 
B 1 240 LEU 240 240 240 LEU LEU B . n 
B 1 241 ILE 241 241 241 ILE ILE B . n 
B 1 242 LYS 242 242 242 LYS LYS B . n 
B 1 243 GLN 243 243 243 GLN GLN B . n 
B 1 244 ARG 244 244 244 ARG ARG B . n 
B 1 245 PHE 245 245 245 PHE PHE B . n 
B 1 246 PRO 246 246 246 PRO PRO B . n 
B 1 247 GLY 247 247 247 GLY GLY B . n 
B 1 248 MET 248 248 248 MET MET B . n 
B 1 249 THR 249 249 249 THR THR B . n 
B 1 250 PRO 250 250 250 PRO PRO B . n 
B 1 251 ALA 251 251 251 ALA ALA B . n 
B 1 252 GLN 252 252 252 GLN GLN B . n 
B 1 253 ILE 253 253 253 ILE ILE B . n 
B 1 254 ARG 254 254 254 ARG ARG B . n 
B 1 255 ARG 255 255 255 ARG ARG B . n 
B 1 256 TYR 256 256 256 TYR TYR B . n 
B 1 257 ALA 257 257 257 ALA ALA B . n 
B 1 258 GLU 258 258 258 GLU GLU B . n 
B 1 259 ARG 259 259 259 ARG ARG B . n 
B 1 260 TRP 260 260 260 TRP TRP B . n 
B 1 261 LYS 261 261 261 LYS LYS B . n 
B 1 262 PRO 262 262 262 PRO PRO B . n 
B 1 263 TRP 263 263 263 TRP TRP B . n 
B 1 264 ARG 264 264 264 ARG ARG B . n 
B 1 265 SER 265 265 265 SER SER B . n 
B 1 266 TYR 266 266 266 TYR TYR B . n 
B 1 267 ALA 267 267 267 ALA ALA B . n 
B 1 268 LEU 268 268 268 LEU LEU B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 HIS 270 270 270 HIS HIS B . n 
B 1 271 ILE 271 271 271 ILE ILE B . n 
B 1 272 TRP 272 272 272 TRP TRP B . n 
B 1 273 TYR 273 273 273 TYR TYR B . n 
B 1 274 THR 274 274 274 THR THR B . n 
B 1 275 GLU 275 275 275 GLU GLU B . n 
B 1 276 GLY 276 276 276 GLY GLY B . n 
B 1 277 TRP 277 277 277 TRP TRP B . n 
B 1 278 GLN 278 278 278 GLN GLN B . n 
B 1 279 PRO 279 279 279 PRO PRO B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 GLU 281 281 281 GLU GLU B . n 
B 1 282 ALA 282 282 282 ALA ALA B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-06-08 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.location 
_software.classification 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
CNS       1.0 1998 package 'Axel T. Brunger' axel.brunger@yale.edu . refinement       Fortran ? 1 
DENZO     .   ?    ?       ?                 ?                     ? 'data reduction' ?       ? 2 
SCALEPACK .   ?    ?       ?                 ?                     ? 'data scaling'   ?       ? 3 
X-PLOR    .   ?    ?       ?                 ?                     ? phasing          ?       ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A TYR 273 ? ? CG A TYR 273 ? ? CD1 A TYR 273 ? ? 124.97 121.00 3.97 0.60 N 
2 1 CB B TYR 273 ? ? CG B TYR 273 ? ? CD1 B TYR 273 ? ? 125.12 121.00 4.12 0.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 27  ? ? -126.51 -53.56  
2  1 HIS A 57  ? ? 37.59   52.35   
3  1 LEU A 125 ? ? 35.39   49.27   
4  1 PHE A 245 ? ? -119.61 72.02   
5  1 PRO A 262 ? ? -99.72  39.06   
6  1 ASP A 280 ? ? -79.03  -156.26 
7  1 SER B 26  ? ? 82.18   -0.88   
8  1 ALA B 31  ? ? -127.90 -164.58 
9  1 HIS B 57  ? ? 37.24   43.13   
10 1 PRO B 150 ? ? -49.28  -18.90  
11 1 PRO B 262 ? ? -99.66  35.16   
12 1 ASP B 280 ? ? -77.56  -136.96 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             SER 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              26 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   -18.36 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '7-HYDROXY-PYRAZOLO[4,3-D]PYRIMIDINE' 7HP 
3 water                                 HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 7HP 1   800 800 7HP 7HP A . 
D 2 7HP 1   700 700 7HP 7HP B . 
E 3 HOH 1   801 2   HOH TIP A . 
E 3 HOH 2   802 3   HOH TIP A . 
E 3 HOH 3   803 13  HOH TIP A . 
E 3 HOH 4   804 14  HOH TIP A . 
E 3 HOH 5   805 15  HOH TIP A . 
E 3 HOH 6   806 21  HOH TIP A . 
E 3 HOH 7   807 23  HOH TIP A . 
E 3 HOH 8   808 24  HOH TIP A . 
E 3 HOH 9   809 25  HOH TIP A . 
E 3 HOH 10  810 30  HOH TIP A . 
E 3 HOH 11  811 32  HOH TIP A . 
E 3 HOH 12  812 33  HOH TIP A . 
E 3 HOH 13  813 34  HOH TIP A . 
E 3 HOH 14  814 35  HOH TIP A . 
E 3 HOH 15  815 36  HOH TIP A . 
E 3 HOH 16  816 37  HOH TIP A . 
E 3 HOH 17  817 41  HOH TIP A . 
E 3 HOH 18  818 43  HOH TIP A . 
E 3 HOH 19  819 44  HOH TIP A . 
E 3 HOH 20  820 47  HOH TIP A . 
E 3 HOH 21  821 49  HOH TIP A . 
E 3 HOH 22  822 51  HOH TIP A . 
E 3 HOH 23  823 53  HOH TIP A . 
E 3 HOH 24  824 55  HOH TIP A . 
E 3 HOH 25  825 58  HOH TIP A . 
E 3 HOH 26  826 59  HOH TIP A . 
E 3 HOH 27  827 60  HOH TIP A . 
E 3 HOH 28  828 62  HOH TIP A . 
E 3 HOH 29  829 63  HOH TIP A . 
E 3 HOH 30  830 64  HOH TIP A . 
E 3 HOH 31  831 65  HOH TIP A . 
E 3 HOH 32  832 67  HOH TIP A . 
E 3 HOH 33  833 68  HOH TIP A . 
E 3 HOH 34  834 70  HOH TIP A . 
E 3 HOH 35  835 71  HOH TIP A . 
E 3 HOH 36  836 72  HOH TIP A . 
E 3 HOH 37  837 74  HOH TIP A . 
E 3 HOH 38  838 75  HOH TIP A . 
E 3 HOH 39  839 76  HOH TIP A . 
E 3 HOH 40  840 79  HOH TIP A . 
E 3 HOH 41  841 82  HOH TIP A . 
E 3 HOH 42  842 83  HOH TIP A . 
E 3 HOH 43  843 85  HOH TIP A . 
E 3 HOH 44  844 87  HOH TIP A . 
E 3 HOH 45  845 88  HOH TIP A . 
E 3 HOH 46  846 89  HOH TIP A . 
E 3 HOH 47  847 93  HOH TIP A . 
E 3 HOH 48  848 95  HOH TIP A . 
E 3 HOH 49  849 99  HOH TIP A . 
E 3 HOH 50  850 100 HOH TIP A . 
E 3 HOH 51  851 101 HOH TIP A . 
E 3 HOH 52  852 103 HOH TIP A . 
E 3 HOH 53  853 104 HOH TIP A . 
E 3 HOH 54  854 107 HOH TIP A . 
E 3 HOH 55  855 109 HOH TIP A . 
E 3 HOH 56  856 110 HOH TIP A . 
E 3 HOH 57  857 113 HOH TIP A . 
E 3 HOH 58  858 115 HOH TIP A . 
E 3 HOH 59  859 116 HOH TIP A . 
E 3 HOH 60  860 117 HOH TIP A . 
E 3 HOH 61  861 118 HOH TIP A . 
E 3 HOH 62  862 122 HOH TIP A . 
E 3 HOH 63  863 123 HOH TIP A . 
E 3 HOH 64  864 124 HOH TIP A . 
E 3 HOH 65  865 125 HOH TIP A . 
E 3 HOH 66  866 130 HOH TIP A . 
E 3 HOH 67  867 131 HOH TIP A . 
E 3 HOH 68  868 133 HOH TIP A . 
E 3 HOH 69  869 134 HOH TIP A . 
E 3 HOH 70  870 137 HOH TIP A . 
E 3 HOH 71  871 138 HOH TIP A . 
E 3 HOH 72  872 139 HOH TIP A . 
E 3 HOH 73  873 140 HOH TIP A . 
E 3 HOH 74  874 141 HOH TIP A . 
E 3 HOH 75  875 142 HOH TIP A . 
E 3 HOH 76  876 144 HOH TIP A . 
E 3 HOH 77  877 146 HOH TIP A . 
E 3 HOH 78  878 147 HOH TIP A . 
E 3 HOH 79  879 148 HOH TIP A . 
E 3 HOH 80  880 149 HOH TIP A . 
E 3 HOH 81  881 150 HOH TIP A . 
E 3 HOH 82  882 151 HOH TIP A . 
E 3 HOH 83  883 152 HOH TIP A . 
E 3 HOH 84  884 156 HOH TIP A . 
E 3 HOH 85  885 158 HOH TIP A . 
E 3 HOH 86  886 160 HOH TIP A . 
E 3 HOH 87  887 163 HOH TIP A . 
E 3 HOH 88  888 164 HOH TIP A . 
E 3 HOH 89  889 166 HOH TIP A . 
E 3 HOH 90  890 170 HOH TIP A . 
E 3 HOH 91  891 172 HOH TIP A . 
E 3 HOH 92  892 173 HOH TIP A . 
E 3 HOH 93  893 174 HOH TIP A . 
E 3 HOH 94  894 176 HOH TIP A . 
E 3 HOH 95  895 179 HOH TIP A . 
E 3 HOH 96  896 181 HOH TIP A . 
E 3 HOH 97  897 182 HOH TIP A . 
E 3 HOH 98  898 186 HOH TIP A . 
E 3 HOH 99  899 187 HOH TIP A . 
E 3 HOH 100 900 188 HOH TIP A . 
E 3 HOH 101 901 191 HOH TIP A . 
E 3 HOH 102 902 194 HOH TIP A . 
E 3 HOH 103 903 198 HOH TIP A . 
E 3 HOH 104 904 200 HOH TIP A . 
E 3 HOH 105 905 203 HOH TIP A . 
E 3 HOH 106 906 204 HOH TIP A . 
E 3 HOH 107 907 206 HOH TIP A . 
E 3 HOH 108 908 207 HOH TIP A . 
E 3 HOH 109 909 208 HOH TIP A . 
E 3 HOH 110 910 209 HOH TIP A . 
E 3 HOH 111 911 211 HOH TIP A . 
E 3 HOH 112 912 212 HOH TIP A . 
E 3 HOH 113 913 213 HOH TIP A . 
E 3 HOH 114 914 216 HOH TIP A . 
E 3 HOH 115 915 220 HOH TIP A . 
E 3 HOH 116 916 222 HOH TIP A . 
E 3 HOH 117 917 223 HOH TIP A . 
E 3 HOH 118 918 224 HOH TIP A . 
E 3 HOH 119 919 226 HOH TIP A . 
F 3 HOH 1   701 1   HOH TIP B . 
F 3 HOH 2   702 4   HOH TIP B . 
F 3 HOH 3   703 5   HOH TIP B . 
F 3 HOH 4   704 6   HOH TIP B . 
F 3 HOH 5   705 7   HOH TIP B . 
F 3 HOH 6   706 8   HOH TIP B . 
F 3 HOH 7   707 9   HOH TIP B . 
F 3 HOH 8   708 10  HOH TIP B . 
F 3 HOH 9   709 11  HOH TIP B . 
F 3 HOH 10  710 12  HOH TIP B . 
F 3 HOH 11  711 16  HOH TIP B . 
F 3 HOH 12  712 17  HOH TIP B . 
F 3 HOH 13  713 18  HOH TIP B . 
F 3 HOH 14  714 19  HOH TIP B . 
F 3 HOH 15  715 20  HOH TIP B . 
F 3 HOH 16  716 22  HOH TIP B . 
F 3 HOH 17  717 26  HOH TIP B . 
F 3 HOH 18  718 27  HOH TIP B . 
F 3 HOH 19  719 28  HOH TIP B . 
F 3 HOH 20  720 29  HOH TIP B . 
F 3 HOH 21  721 31  HOH TIP B . 
F 3 HOH 22  722 38  HOH TIP B . 
F 3 HOH 23  723 39  HOH TIP B . 
F 3 HOH 24  724 40  HOH TIP B . 
F 3 HOH 25  725 42  HOH TIP B . 
F 3 HOH 26  726 45  HOH TIP B . 
F 3 HOH 27  727 46  HOH TIP B . 
F 3 HOH 28  728 48  HOH TIP B . 
F 3 HOH 29  729 50  HOH TIP B . 
F 3 HOH 30  730 52  HOH TIP B . 
F 3 HOH 31  731 54  HOH TIP B . 
F 3 HOH 32  732 56  HOH TIP B . 
F 3 HOH 33  733 57  HOH TIP B . 
F 3 HOH 34  734 61  HOH TIP B . 
F 3 HOH 35  735 66  HOH TIP B . 
F 3 HOH 36  736 69  HOH TIP B . 
F 3 HOH 37  737 73  HOH TIP B . 
F 3 HOH 38  738 77  HOH TIP B . 
F 3 HOH 39  739 78  HOH TIP B . 
F 3 HOH 40  740 80  HOH TIP B . 
F 3 HOH 41  741 81  HOH TIP B . 
F 3 HOH 42  742 84  HOH TIP B . 
F 3 HOH 43  743 86  HOH TIP B . 
F 3 HOH 44  744 90  HOH TIP B . 
F 3 HOH 45  745 91  HOH TIP B . 
F 3 HOH 46  746 92  HOH TIP B . 
F 3 HOH 47  747 94  HOH TIP B . 
F 3 HOH 48  748 96  HOH TIP B . 
F 3 HOH 49  749 97  HOH TIP B . 
F 3 HOH 50  750 98  HOH TIP B . 
F 3 HOH 51  751 102 HOH TIP B . 
F 3 HOH 52  752 105 HOH TIP B . 
F 3 HOH 53  753 106 HOH TIP B . 
F 3 HOH 54  754 108 HOH TIP B . 
F 3 HOH 55  755 111 HOH TIP B . 
F 3 HOH 56  756 112 HOH TIP B . 
F 3 HOH 57  757 114 HOH TIP B . 
F 3 HOH 58  758 119 HOH TIP B . 
F 3 HOH 59  759 120 HOH TIP B . 
F 3 HOH 60  760 121 HOH TIP B . 
F 3 HOH 61  761 126 HOH TIP B . 
F 3 HOH 62  762 127 HOH TIP B . 
F 3 HOH 63  763 128 HOH TIP B . 
F 3 HOH 64  764 129 HOH TIP B . 
F 3 HOH 65  765 132 HOH TIP B . 
F 3 HOH 66  766 135 HOH TIP B . 
F 3 HOH 67  767 136 HOH TIP B . 
F 3 HOH 68  768 143 HOH TIP B . 
F 3 HOH 69  769 145 HOH TIP B . 
F 3 HOH 70  770 153 HOH TIP B . 
F 3 HOH 71  771 154 HOH TIP B . 
F 3 HOH 72  772 155 HOH TIP B . 
F 3 HOH 73  773 157 HOH TIP B . 
F 3 HOH 74  774 159 HOH TIP B . 
F 3 HOH 75  775 161 HOH TIP B . 
F 3 HOH 76  776 162 HOH TIP B . 
F 3 HOH 77  777 165 HOH TIP B . 
F 3 HOH 78  778 167 HOH TIP B . 
F 3 HOH 79  779 168 HOH TIP B . 
F 3 HOH 80  780 169 HOH TIP B . 
F 3 HOH 81  781 171 HOH TIP B . 
F 3 HOH 82  782 175 HOH TIP B . 
F 3 HOH 83  783 177 HOH TIP B . 
F 3 HOH 84  784 178 HOH TIP B . 
F 3 HOH 85  785 180 HOH TIP B . 
F 3 HOH 86  786 183 HOH TIP B . 
F 3 HOH 87  787 184 HOH TIP B . 
F 3 HOH 88  788 185 HOH TIP B . 
F 3 HOH 89  789 189 HOH TIP B . 
F 3 HOH 90  790 190 HOH TIP B . 
F 3 HOH 91  791 192 HOH TIP B . 
F 3 HOH 92  792 193 HOH TIP B . 
F 3 HOH 93  793 195 HOH TIP B . 
F 3 HOH 94  794 196 HOH TIP B . 
F 3 HOH 95  795 197 HOH TIP B . 
F 3 HOH 96  796 199 HOH TIP B . 
F 3 HOH 97  797 201 HOH TIP B . 
F 3 HOH 98  798 202 HOH TIP B . 
F 3 HOH 99  799 205 HOH TIP B . 
F 3 HOH 100 800 210 HOH TIP B . 
F 3 HOH 101 801 214 HOH TIP B . 
F 3 HOH 102 802 215 HOH TIP B . 
F 3 HOH 103 803 217 HOH TIP B . 
F 3 HOH 104 804 218 HOH TIP B . 
F 3 HOH 105 805 219 HOH TIP B . 
F 3 HOH 106 806 221 HOH TIP B . 
F 3 HOH 107 807 225 HOH TIP B . 
#