data_1PY1
# 
_entry.id   1PY1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1PY1         
RCSB  RCSB019687   
WWPDB D_1000019687 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1PY1 
_pdbx_database_status.recvd_initial_deposition_date   2003-07-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhu, G.'     1 
'Zhang, X.C.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Biochemical and structural characterization of the interaction of memapsin 2 (beta-secretase)
cytosolic domain with the VHS domain of GGA proteins.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            42 
_citation.page_first                12174 
_citation.page_last                 12180 
_citation.year                      2003 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14567678 
_citation.pdbx_database_id_DOI      10.1021/bi035199h 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'He, X.'      1 
primary 'Zhu, G.'     2 
primary 'Koelsch, G.' 3 
primary 'Rodgers, K.' 4 
primary 'Zhang, X.C.' 5 
primary 'Tang, J.'    6 
# 
_cell.entry_id           1PY1 
_cell.length_a           70.140 
_cell.length_b           95.420 
_cell.length_c           107.970 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1PY1 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'ADP-ribosylation factor binding protein GGA1' 17958.586 4  ?        ? 'VHS Domain (Residues 2-157)'   ? 
2 polymer syn Beta-secretase                                 954.979   4  3.4.23.- ? 'C-TERMINUS (RESIDUES 494-501)' ? 
3 water   nat water                                          18.015    37 ?        ? ?                               ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Golgi-localized, gamma ear-containing, ARF-binding protein 1, Gamma-adaptin related protein 1' 
2 
;Beta-site APP cleaving enzyme, Beta-site amyloid precursor protein cleaving enzyme, Aspartyl protease 2, Asp 2, ASP2, Membrane-associated aspartic protease 2, Memapsin-2
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GSEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMKSCGK
RFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVKSDPKLPDDTTF
;
;GSEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMKSCGK
RFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVKSDPKLPDDTTF
;
A,B,C,D ? 
2 'polypeptide(L)' no yes 'ADDI(SEP)LLK' ADDISLLK E,F,G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   GLU n 
1 4   PRO n 
1 5   ALA n 
1 6   MET n 
1 7   GLU n 
1 8   PRO n 
1 9   GLU n 
1 10  THR n 
1 11  LEU n 
1 12  GLU n 
1 13  ALA n 
1 14  ARG n 
1 15  ILE n 
1 16  ASN n 
1 17  ARG n 
1 18  ALA n 
1 19  THR n 
1 20  ASN n 
1 21  PRO n 
1 22  LEU n 
1 23  ASN n 
1 24  LYS n 
1 25  GLU n 
1 26  LEU n 
1 27  ASP n 
1 28  TRP n 
1 29  ALA n 
1 30  SER n 
1 31  ILE n 
1 32  ASN n 
1 33  GLY n 
1 34  PHE n 
1 35  CYS n 
1 36  GLU n 
1 37  GLN n 
1 38  LEU n 
1 39  ASN n 
1 40  GLU n 
1 41  ASP n 
1 42  PHE n 
1 43  GLU n 
1 44  GLY n 
1 45  PRO n 
1 46  PRO n 
1 47  LEU n 
1 48  ALA n 
1 49  THR n 
1 50  ARG n 
1 51  LEU n 
1 52  LEU n 
1 53  ALA n 
1 54  HIS n 
1 55  LYS n 
1 56  ILE n 
1 57  GLN n 
1 58  SER n 
1 59  PRO n 
1 60  GLN n 
1 61  GLU n 
1 62  TRP n 
1 63  GLU n 
1 64  ALA n 
1 65  ILE n 
1 66  GLN n 
1 67  ALA n 
1 68  LEU n 
1 69  THR n 
1 70  VAL n 
1 71  LEU n 
1 72  GLU n 
1 73  THR n 
1 74  CYS n 
1 75  MET n 
1 76  LYS n 
1 77  SER n 
1 78  CYS n 
1 79  GLY n 
1 80  LYS n 
1 81  ARG n 
1 82  PHE n 
1 83  HIS n 
1 84  ASP n 
1 85  GLU n 
1 86  VAL n 
1 87  GLY n 
1 88  LYS n 
1 89  PHE n 
1 90  ARG n 
1 91  PHE n 
1 92  LEU n 
1 93  ASN n 
1 94  GLU n 
1 95  LEU n 
1 96  ILE n 
1 97  LYS n 
1 98  VAL n 
1 99  VAL n 
1 100 SER n 
1 101 PRO n 
1 102 LYS n 
1 103 TYR n 
1 104 LEU n 
1 105 GLY n 
1 106 SER n 
1 107 ARG n 
1 108 THR n 
1 109 SER n 
1 110 GLU n 
1 111 LYS n 
1 112 VAL n 
1 113 LYS n 
1 114 ASN n 
1 115 LYS n 
1 116 ILE n 
1 117 LEU n 
1 118 GLU n 
1 119 LEU n 
1 120 LEU n 
1 121 TYR n 
1 122 SER n 
1 123 TRP n 
1 124 THR n 
1 125 VAL n 
1 126 GLY n 
1 127 LEU n 
1 128 PRO n 
1 129 GLU n 
1 130 GLU n 
1 131 VAL n 
1 132 LYS n 
1 133 ILE n 
1 134 ALA n 
1 135 GLU n 
1 136 ALA n 
1 137 TYR n 
1 138 GLN n 
1 139 MET n 
1 140 LEU n 
1 141 LYS n 
1 142 LYS n 
1 143 GLN n 
1 144 GLY n 
1 145 ILE n 
1 146 VAL n 
1 147 LYS n 
1 148 SER n 
1 149 ASP n 
1 150 PRO n 
1 151 LYS n 
1 152 LEU n 
1 153 PRO n 
1 154 ASP n 
1 155 ASP n 
1 156 THR n 
1 157 THR n 
1 158 PHE n 
2 1   ALA n 
2 2   ASP n 
2 3   ASP n 
2 4   ILE n 
2 5   SEP n 
2 6   LEU n 
2 7   LEU n 
2 8   LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 GGA1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX2T 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                YES 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP GGA1_HUMAN  Q9UJY5 1 2   ? ? 
2 UNP BACE1_HUMAN P56817 2 494 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1PY1 A 2 ? 158 ? Q9UJY5 2   ? 157 ? 1 157 
2 1 1PY1 B 2 ? 158 ? Q9UJY5 2   ? 157 ? 1 157 
3 1 1PY1 C 2 ? 158 ? Q9UJY5 2   ? 157 ? 1 157 
4 1 1PY1 D 2 ? 158 ? Q9UJY5 2   ? 157 ? 1 157 
5 2 1PY1 E 1 ? 8   ? P56817 494 ? 501 ? 1 8   
6 2 1PY1 F 1 ? 8   ? P56817 494 ? 501 ? 1 8   
7 2 1PY1 G 1 ? 8   ? P56817 494 ? 501 ? 1 8   
8 2 1PY1 H 1 ? 8   ? P56817 494 ? 501 ? 1 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1PY1 GLY A 1 ? UNP Q9UJY5 ?   ?   'CLONING ARTIFACT' 0 1  
1 1PY1 SER A 2 ? UNP Q9UJY5 MET 1   'CLONING ARTIFACT' 1 2  
2 1PY1 GLY B 1 ? UNP Q9UJY5 ?   ?   'CLONING ARTIFACT' 0 3  
2 1PY1 SER B 2 ? UNP Q9UJY5 MET 1   'CLONING ARTIFACT' 1 4  
3 1PY1 GLY C 1 ? UNP Q9UJY5 ?   ?   'CLONING ARTIFACT' 0 5  
3 1PY1 SER C 2 ? UNP Q9UJY5 MET 1   'CLONING ARTIFACT' 1 6  
4 1PY1 GLY D 1 ? UNP Q9UJY5 ?   ?   'CLONING ARTIFACT' 0 7  
4 1PY1 SER D 2 ? UNP Q9UJY5 MET 1   'CLONING ARTIFACT' 1 8  
5 1PY1 SEP E 5 ? UNP P56817 SER 498 'MODIFIED RESIDUE' 5 9  
6 1PY1 SEP F 5 ? UNP P56817 SER 498 'MODIFIED RESIDUE' 5 10 
7 1PY1 SEP G 5 ? UNP P56817 SER 498 'MODIFIED RESIDUE' 5 11 
8 1PY1 SEP H 5 ? UNP P56817 SER 498 'MODIFIED RESIDUE' 5 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?               'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?               'C5 H9 N O2'     115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE   PHOSPHONOSERINE 'C3 H8 N O6 P'   185.072 
SER 'L-peptide linking' y SERINE          ?               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1PY1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.39 
_exptl_crystal.density_percent_sol   48.46 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.4 
_exptl_crystal_grow.pdbx_details    
'PEG 3350, AMMONIUM SULFATE, CACODYLATE, pH 6.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2003-03-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'OSMIC OPTICS' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1PY1 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             40.0 
_reflns.d_resolution_high            2.60 
_reflns.number_obs                   22025 
_reflns.number_all                   22869 
_reflns.percent_possible_obs         95.8 
_reflns.pdbx_Rmerge_I_obs            0.074 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        25.8 
_reflns.B_iso_Wilson_estimate        46.9 
_reflns.pdbx_redundancy              6.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.69 
_reflns_shell.percent_possible_all   98.9 
_reflns_shell.Rmerge_I_obs           0.373 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.0 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2229 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1PY1 
_refine.ls_number_reflns_obs                     22006 
_refine.ls_number_reflns_all                     22869 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.45 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    95.8 
_refine.ls_R_factor_obs                          0.236 
_refine.ls_R_factor_all                          0.24 
_refine.ls_R_factor_R_work                       0.236 
_refine.ls_R_factor_R_free                       0.288 
_refine.ls_R_factor_R_free_error                 0.010 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 3.9 
_refine.ls_number_reflns_R_free                  858 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               52.5 
_refine.aniso_B[1][1]                            4.50 
_refine.aniso_B[2][2]                            15.37 
_refine.aniso_B[3][3]                            -19.87 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.307058 
_refine.solvent_model_param_bsol                 25.6879 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1JWG' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1PY1 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.51 
_refine_analyze.Luzzati_sigma_a_free            0.53 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4739 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             37 
_refine_hist.number_atoms_total               4776 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        39.45 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.011 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 19.4  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.98  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.56  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.73  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.09  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.32  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.60 
_refine_ls_shell.d_res_low                        2.69 
_refine_ls_shell.number_reflns_R_work             1883 
_refine_ls_shell.R_factor_R_work                  0.392 
_refine_ls_shell.percent_reflns_obs               86.5 
_refine_ls_shell.R_factor_R_free                  0.511 
_refine_ls_shell.R_factor_R_free_error            0.062 
_refine_ls_shell.percent_reflns_R_free            3.4 
_refine_ls_shell.number_reflns_R_free             67 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
3 ION.PARAM         ?           'X-RAY DIFFRACTION' 
4 SEP.PAR           ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1PY1 
_struct.title                     'Complex of GGA1-VHS domain and beta-secretase C-terminal phosphopeptide' 
_struct.pdbx_descriptor           'ADP-ribosylation factor binding protein GGA1, Beta-secretase' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1PY1 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
_struct_keywords.text            'VHS DOMAIN OF GGA1, BETA-SECRETASE, PROTEIN-PEPTIDE COMPLEX, SUPER HELIX, PROTEIN TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 10  ? THR A 19  ? THR A 9   THR A 18  1 ? 10 
HELX_P HELX_P2  2  ASP A 27  ? LEU A 38  ? ASP A 26  LEU A 37  1 ? 12 
HELX_P HELX_P3  3  GLU A 43  ? GLN A 57  ? GLU A 42  GLN A 56  1 ? 15 
HELX_P HELX_P4  4  GLN A 60  ? CYS A 78  ? GLN A 59  CYS A 77  1 ? 19 
HELX_P HELX_P5  5  GLY A 79  ? GLY A 87  ? GLY A 78  GLY A 86  1 ? 9  
HELX_P HELX_P6  6  LYS A 88  ? SER A 100 ? LYS A 87  SER A 99  1 ? 13 
HELX_P HELX_P7  7  TYR A 103 ? THR A 108 ? TYR A 102 THR A 107 5 ? 6  
HELX_P HELX_P8  8  SER A 109 ? LEU A 127 ? SER A 108 LEU A 126 1 ? 19 
HELX_P HELX_P9  9  GLU A 130 ? GLN A 143 ? GLU A 129 GLN A 142 1 ? 14 
HELX_P HELX_P10 10 THR B 10  ? THR B 19  ? THR B 9   THR B 18  1 ? 10 
HELX_P HELX_P11 11 ASP B 27  ? ASN B 39  ? ASP B 26  ASN B 38  1 ? 13 
HELX_P HELX_P12 12 GLU B 43  ? GLN B 57  ? GLU B 42  GLN B 56  1 ? 15 
HELX_P HELX_P13 13 GLN B 60  ? SER B 77  ? GLN B 59  SER B 76  1 ? 18 
HELX_P HELX_P14 14 GLY B 79  ? LYS B 88  ? GLY B 78  LYS B 87  1 ? 10 
HELX_P HELX_P15 15 LYS B 88  ? SER B 100 ? LYS B 87  SER B 99  1 ? 13 
HELX_P HELX_P16 16 LEU B 104 ? THR B 108 ? LEU B 103 THR B 107 5 ? 5  
HELX_P HELX_P17 17 SER B 109 ? LEU B 127 ? SER B 108 LEU B 126 1 ? 19 
HELX_P HELX_P18 18 GLU B 130 ? GLN B 143 ? GLU B 129 GLN B 142 1 ? 14 
HELX_P HELX_P19 19 THR C 10  ? THR C 19  ? THR C 9   THR C 18  1 ? 10 
HELX_P HELX_P20 20 ASP C 27  ? ASN C 39  ? ASP C 26  ASN C 38  1 ? 13 
HELX_P HELX_P21 21 GLU C 43  ? GLN C 57  ? GLU C 42  GLN C 56  1 ? 15 
HELX_P HELX_P22 22 GLN C 60  ? SER C 77  ? GLN C 59  SER C 76  1 ? 18 
HELX_P HELX_P23 23 GLY C 79  ? GLY C 87  ? GLY C 78  GLY C 86  1 ? 9  
HELX_P HELX_P24 24 LYS C 88  ? SER C 100 ? LYS C 87  SER C 99  1 ? 13 
HELX_P HELX_P25 25 LEU C 104 ? THR C 108 ? LEU C 103 THR C 107 5 ? 5  
HELX_P HELX_P26 26 SER C 109 ? LEU C 127 ? SER C 108 LEU C 126 1 ? 19 
HELX_P HELX_P27 27 GLU C 130 ? GLN C 143 ? GLU C 129 GLN C 142 1 ? 14 
HELX_P HELX_P28 28 THR D 10  ? THR D 19  ? THR D 9   THR D 18  1 ? 10 
HELX_P HELX_P29 29 ASP D 27  ? ASN D 39  ? ASP D 26  ASN D 38  1 ? 13 
HELX_P HELX_P30 30 GLU D 43  ? GLN D 57  ? GLU D 42  GLN D 56  1 ? 15 
HELX_P HELX_P31 31 GLN D 60  ? CYS D 78  ? GLN D 59  CYS D 77  1 ? 19 
HELX_P HELX_P32 32 GLY D 79  ? GLY D 87  ? GLY D 78  GLY D 86  1 ? 9  
HELX_P HELX_P33 33 LYS D 88  ? SER D 100 ? LYS D 87  SER D 99  1 ? 13 
HELX_P HELX_P34 34 LEU D 104 ? THR D 108 ? LEU D 103 THR D 107 5 ? 5  
HELX_P HELX_P35 35 SER D 109 ? LEU D 127 ? SER D 108 LEU D 126 1 ? 19 
HELX_P HELX_P36 36 GLU D 130 ? GLN D 143 ? GLU D 129 GLN D 142 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 35 SG ? ? ? 1_555 A CYS 74 SG ? ? A CYS 34 A CYS 73 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf2 disulf ? ? B CYS 35 SG ? ? ? 1_555 B CYS 74 SG ? ? B CYS 34 B CYS 73 1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf3 disulf ? ? C CYS 35 SG ? ? ? 1_555 C CYS 74 SG ? ? C CYS 34 C CYS 73 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf4 disulf ? ? D CYS 35 SG ? ? ? 1_555 D CYS 74 SG ? ? D CYS 34 D CYS 73 1_555 ? ? ? ? ? ? ? 2.040 ? 
covale1 covale ? ? E ILE 4  C  ? ? ? 1_555 E SEP 5  N  ? ? E ILE 4  E SEP 5  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale2 covale ? ? E SEP 5  C  ? ? ? 1_555 E LEU 6  N  ? ? E SEP 5  E LEU 6  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale3 covale ? ? F ILE 4  C  ? ? ? 1_555 F SEP 5  N  ? ? F ILE 4  F SEP 5  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale4 covale ? ? F SEP 5  C  ? ? ? 1_555 F LEU 6  N  ? ? F SEP 5  F LEU 6  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale5 covale ? ? G ILE 4  C  ? ? ? 1_555 G SEP 5  N  ? ? G ILE 4  G SEP 5  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale6 covale ? ? G SEP 5  C  ? ? ? 1_555 G LEU 6  N  ? ? G SEP 5  G LEU 6  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale7 covale ? ? H ILE 4  C  ? ? ? 1_555 H SEP 5  N  ? ? H ILE 4  H SEP 5  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale8 covale ? ? H SEP 5  C  ? ? ? 1_555 H LEU 6  N  ? ? H SEP 5  H LEU 6  1_555 ? ? ? ? ? ? ? 1.326 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_database_PDB_matrix.entry_id          1PY1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1PY1 
_atom_sites.fract_transf_matrix[1][1]   0.014257 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010480 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009262 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 9   ? 32.066 8.834  53.383  1.00 54.40  ? 8   GLU A N   1 
ATOM   2    C CA  . GLU A 1 9   ? 30.703 9.441  53.552  1.00 55.13  ? 8   GLU A CA  1 
ATOM   3    C C   . GLU A 1 9   ? 30.759 10.780 54.320  1.00 53.34  ? 8   GLU A C   1 
ATOM   4    O O   . GLU A 1 9   ? 31.350 10.869 55.378  1.00 53.61  ? 8   GLU A O   1 
ATOM   5    C CB  . GLU A 1 9   ? 29.781 8.478  54.304  1.00 56.06  ? 8   GLU A CB  1 
ATOM   6    C CG  . GLU A 1 9   ? 29.313 7.306  53.493  1.00 59.23  ? 8   GLU A CG  1 
ATOM   7    C CD  . GLU A 1 9   ? 27.914 7.506  52.938  1.00 62.74  ? 8   GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 9   ? 27.715 8.461  52.149  1.00 61.86  ? 8   GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 9   ? 27.010 6.705  53.297  1.00 63.28  ? 8   GLU A OE2 1 
ATOM   10   N N   . THR A 1 10  ? 30.138 11.810 53.758  1.00 52.48  ? 9   THR A N   1 
ATOM   11   C CA  . THR A 1 10  ? 30.109 13.143 54.398  1.00 49.41  ? 9   THR A CA  1 
ATOM   12   C C   . THR A 1 10  ? 28.725 13.421 54.982  1.00 47.64  ? 9   THR A C   1 
ATOM   13   O O   . THR A 1 10  ? 27.790 12.676 54.731  1.00 46.46  ? 9   THR A O   1 
ATOM   14   C CB  . THR A 1 10  ? 30.423 14.259 53.383  1.00 49.40  ? 9   THR A CB  1 
ATOM   15   O OG1 . THR A 1 10  ? 29.481 14.200 52.302  1.00 50.52  ? 9   THR A OG1 1 
ATOM   16   C CG2 . THR A 1 10  ? 31.823 14.103 52.823  1.00 46.71  ? 9   THR A CG2 1 
ATOM   17   N N   . LEU A 1 11  ? 28.605 14.480 55.771  1.00 47.35  ? 10  LEU A N   1 
ATOM   18   C CA  . LEU A 1 11  ? 27.301 14.806 56.326  1.00 46.06  ? 10  LEU A CA  1 
ATOM   19   C C   . LEU A 1 11  ? 26.311 15.074 55.192  1.00 46.02  ? 10  LEU A C   1 
ATOM   20   O O   . LEU A 1 11  ? 25.185 14.625 55.235  1.00 45.13  ? 10  LEU A O   1 
ATOM   21   C CB  . LEU A 1 11  ? 27.377 16.023 57.232  1.00 47.50  ? 10  LEU A CB  1 
ATOM   22   C CG  . LEU A 1 11  ? 28.160 15.871 58.534  1.00 51.83  ? 10  LEU A CG  1 
ATOM   23   C CD1 . LEU A 1 11  ? 29.680 16.064 58.252  1.00 54.05  ? 10  LEU A CD1 1 
ATOM   24   C CD2 . LEU A 1 11  ? 27.669 16.921 59.535  1.00 49.62  ? 10  LEU A CD2 1 
ATOM   25   N N   . GLU A 1 12  ? 26.754 15.811 54.178  1.00 46.66  ? 11  GLU A N   1 
ATOM   26   C CA  . GLU A 1 12  ? 25.891 16.099 53.022  1.00 47.30  ? 11  GLU A CA  1 
ATOM   27   C C   . GLU A 1 12  ? 25.385 14.780 52.385  1.00 47.58  ? 11  GLU A C   1 
ATOM   28   O O   . GLU A 1 12  ? 24.183 14.607 52.135  1.00 47.62  ? 11  GLU A O   1 
ATOM   29   C CB  . GLU A 1 12  ? 26.643 16.910 51.950  1.00 46.25  ? 11  GLU A CB  1 
ATOM   30   C CG  . GLU A 1 12  ? 26.969 18.366 52.309  1.00 47.91  ? 11  GLU A CG  1 
ATOM   31   C CD  . GLU A 1 12  ? 28.284 18.540 53.068  1.00 48.34  ? 11  GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 12  ? 28.903 17.528 53.467  1.00 48.26  ? 11  GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 12  ? 28.699 19.700 53.270  1.00 48.72  ? 11  GLU A OE2 1 
ATOM   34   N N   . ALA A 1 13  ? 26.310 13.859 52.137  1.00 46.95  ? 12  ALA A N   1 
ATOM   35   C CA  . ALA A 1 13  ? 25.927 12.579 51.538  1.00 46.27  ? 12  ALA A CA  1 
ATOM   36   C C   . ALA A 1 13  ? 24.904 11.856 52.438  1.00 45.52  ? 12  ALA A C   1 
ATOM   37   O O   . ALA A 1 13  ? 23.896 11.331 51.963  1.00 44.15  ? 12  ALA A O   1 
ATOM   38   C CB  . ALA A 1 13  ? 27.157 11.717 51.317  1.00 47.04  ? 12  ALA A CB  1 
ATOM   39   N N   . ARG A 1 14  ? 25.185 11.861 53.735  1.00 45.30  ? 13  ARG A N   1 
ATOM   40   C CA  . ARG A 1 14  ? 24.295 11.252 54.717  1.00 46.45  ? 13  ARG A CA  1 
ATOM   41   C C   . ARG A 1 14  ? 22.908 11.937 54.688  1.00 45.80  ? 13  ARG A C   1 
ATOM   42   O O   . ARG A 1 14  ? 21.895 11.316 54.412  1.00 46.16  ? 13  ARG A O   1 
ATOM   43   C CB  . ARG A 1 14  ? 24.873 11.410 56.127  1.00 49.00  ? 13  ARG A CB  1 
ATOM   44   C CG  . ARG A 1 14  ? 25.427 10.159 56.780  1.00 53.30  ? 13  ARG A CG  1 
ATOM   45   C CD  . ARG A 1 14  ? 26.713 9.734  56.133  1.00 58.62  ? 13  ARG A CD  1 
ATOM   46   N NE  . ARG A 1 14  ? 27.681 9.218  57.100  1.00 61.63  ? 13  ARG A NE  1 
ATOM   47   C CZ  . ARG A 1 14  ? 27.500 8.134  57.847  1.00 63.43  ? 13  ARG A CZ  1 
ATOM   48   N NH1 . ARG A 1 14  ? 26.372 7.438  57.748  1.00 64.24  ? 13  ARG A NH1 1 
ATOM   49   N NH2 . ARG A 1 14  ? 28.459 7.737  58.679  1.00 64.51  ? 13  ARG A NH2 1 
ATOM   50   N N   . ILE A 1 15  ? 22.893 13.233 54.968  1.00 45.07  ? 14  ILE A N   1 
ATOM   51   C CA  . ILE A 1 15  ? 21.633 13.974 55.001  1.00 44.85  ? 14  ILE A CA  1 
ATOM   52   C C   . ILE A 1 15  ? 20.829 13.844 53.707  1.00 44.07  ? 14  ILE A C   1 
ATOM   53   O O   . ILE A 1 15  ? 19.612 13.810 53.740  1.00 45.76  ? 14  ILE A O   1 
ATOM   54   C CB  . ILE A 1 15  ? 21.859 15.465 55.306  1.00 45.28  ? 14  ILE A CB  1 
ATOM   55   C CG1 . ILE A 1 15  ? 20.531 16.110 55.704  1.00 47.90  ? 14  ILE A CG1 1 
ATOM   56   C CG2 . ILE A 1 15  ? 22.448 16.175 54.106  1.00 46.92  ? 14  ILE A CG2 1 
ATOM   57   C CD1 . ILE A 1 15  ? 19.973 15.592 57.018  1.00 47.25  ? 14  ILE A CD1 1 
ATOM   58   N N   . ASN A 1 16  ? 21.511 13.758 52.578  1.00 42.42  ? 15  ASN A N   1 
ATOM   59   C CA  . ASN A 1 16  ? 20.791 13.629 51.319  1.00 43.63  ? 15  ASN A CA  1 
ATOM   60   C C   . ASN A 1 16  ? 20.034 12.280 51.197  1.00 44.01  ? 15  ASN A C   1 
ATOM   61   O O   . ASN A 1 16  ? 18.978 12.197 50.546  1.00 42.90  ? 15  ASN A O   1 
ATOM   62   C CB  . ASN A 1 16  ? 21.747 13.796 50.137  1.00 43.87  ? 15  ASN A CB  1 
ATOM   63   C CG  . ASN A 1 16  ? 22.271 15.196 50.020  1.00 45.89  ? 15  ASN A CG  1 
ATOM   64   O OD1 . ASN A 1 16  ? 21.564 16.146 50.342  1.00 50.81  ? 15  ASN A OD1 1 
ATOM   65   N ND2 . ASN A 1 16  ? 23.506 15.343 49.538  1.00 44.50  ? 15  ASN A ND2 1 
ATOM   66   N N   . ARG A 1 17  ? 20.584 11.237 51.814  1.00 42.77  ? 16  ARG A N   1 
ATOM   67   C CA  . ARG A 1 17  ? 19.934 9.918  51.763  1.00 42.88  ? 16  ARG A CA  1 
ATOM   68   C C   . ARG A 1 17  ? 18.858 9.791  52.874  1.00 40.46  ? 16  ARG A C   1 
ATOM   69   O O   . ARG A 1 17  ? 17.829 9.144  52.701  1.00 39.63  ? 16  ARG A O   1 
ATOM   70   C CB  . ARG A 1 17  ? 20.981 8.803  51.897  1.00 45.92  ? 16  ARG A CB  1 
ATOM   71   C CG  . ARG A 1 17  ? 20.442 7.414  51.552  1.00 53.81  ? 16  ARG A CG  1 
ATOM   72   C CD  . ARG A 1 17  ? 21.449 6.265  51.813  1.00 56.10  ? 16  ARG A CD  1 
ATOM   73   N NE  . ARG A 1 17  ? 22.719 6.458  51.118  1.00 56.96  ? 16  ARG A NE  1 
ATOM   74   C CZ  . ARG A 1 17  ? 23.754 7.109  51.637  1.00 58.23  ? 16  ARG A CZ  1 
ATOM   75   N NH1 . ARG A 1 17  ? 24.875 7.251  50.944  1.00 59.69  ? 16  ARG A NH1 1 
ATOM   76   N NH2 . ARG A 1 17  ? 23.678 7.592  52.867  1.00 59.20  ? 16  ARG A NH2 1 
ATOM   77   N N   . ALA A 1 18  ? 19.115 10.441 54.000  1.00 37.16  ? 17  ALA A N   1 
ATOM   78   C CA  . ALA A 1 18  ? 18.175 10.413 55.102  1.00 36.67  ? 17  ALA A CA  1 
ATOM   79   C C   . ALA A 1 18  ? 16.908 11.258 54.817  1.00 38.71  ? 17  ALA A C   1 
ATOM   80   O O   . ALA A 1 18  ? 15.849 11.014 55.393  1.00 39.74  ? 17  ALA A O   1 
ATOM   81   C CB  . ALA A 1 18  ? 18.847 10.904 56.359  1.00 33.03  ? 17  ALA A CB  1 
ATOM   82   N N   . THR A 1 19  ? 17.027 12.242 53.928  1.00 38.74  ? 18  THR A N   1 
ATOM   83   C CA  . THR A 1 19  ? 15.884 13.106 53.616  1.00 38.17  ? 18  THR A CA  1 
ATOM   84   C C   . THR A 1 19  ? 15.481 13.055 52.141  1.00 40.14  ? 18  THR A C   1 
ATOM   85   O O   . THR A 1 19  ? 14.786 13.955 51.638  1.00 39.42  ? 18  THR A O   1 
ATOM   86   C CB  . THR A 1 19  ? 16.177 14.561 53.947  1.00 37.12  ? 18  THR A CB  1 
ATOM   87   O OG1 . THR A 1 19  ? 17.292 15.001 53.170  1.00 37.91  ? 18  THR A OG1 1 
ATOM   88   C CG2 . THR A 1 19  ? 16.467 14.737 55.416  1.00 34.12  ? 18  THR A CG2 1 
ATOM   89   N N   . ASN A 1 20  ? 15.920 11.995 51.469  1.00 39.37  ? 19  ASN A N   1 
ATOM   90   C CA  . ASN A 1 20  ? 15.629 11.801 50.048  1.00 40.41  ? 19  ASN A CA  1 
ATOM   91   C C   . ASN A 1 20  ? 14.135 11.639 49.780  1.00 42.59  ? 19  ASN A C   1 
ATOM   92   O O   . ASN A 1 20  ? 13.490 10.798 50.370  1.00 44.76  ? 19  ASN A O   1 
ATOM   93   C CB  . ASN A 1 20  ? 16.351 10.568 49.547  1.00 40.79  ? 19  ASN A CB  1 
ATOM   94   C CG  . ASN A 1 20  ? 16.438 10.530 48.050  1.00 41.22  ? 19  ASN A CG  1 
ATOM   95   O OD1 . ASN A 1 20  ? 15.427 10.537 47.353  1.00 41.80  ? 19  ASN A OD1 1 
ATOM   96   N ND2 . ASN A 1 20  ? 17.659 10.497 47.541  1.00 39.56  ? 19  ASN A ND2 1 
ATOM   97   N N   . PRO A 1 21  ? 13.574 12.455 48.880  1.00 44.04  ? 20  PRO A N   1 
ATOM   98   C CA  . PRO A 1 21  ? 12.142 12.393 48.541  1.00 45.21  ? 20  PRO A CA  1 
ATOM   99   C C   . PRO A 1 21  ? 11.675 11.021 47.937  1.00 47.58  ? 20  PRO A C   1 
ATOM   100  O O   . PRO A 1 21  ? 10.493 10.679 47.973  1.00 47.20  ? 20  PRO A O   1 
ATOM   101  C CB  . PRO A 1 21  ? 11.976 13.538 47.536  1.00 42.23  ? 20  PRO A CB  1 
ATOM   102  C CG  . PRO A 1 21  ? 12.982 14.525 47.971  1.00 42.24  ? 20  PRO A CG  1 
ATOM   103  C CD  . PRO A 1 21  ? 14.193 13.675 48.332  1.00 43.45  ? 20  PRO A CD  1 
ATOM   104  N N   . LEU A 1 22  ? 12.624 10.266 47.393  1.00 48.22  ? 21  LEU A N   1 
ATOM   105  C CA  . LEU A 1 22  ? 12.331 8.972  46.771  1.00 49.74  ? 21  LEU A CA  1 
ATOM   106  C C   . LEU A 1 22  ? 12.124 7.833  47.795  1.00 50.93  ? 21  LEU A C   1 
ATOM   107  O O   . LEU A 1 22  ? 11.624 6.765  47.447  1.00 51.90  ? 21  LEU A O   1 
ATOM   108  C CB  . LEU A 1 22  ? 13.471 8.581  45.820  1.00 50.56  ? 21  LEU A CB  1 
ATOM   109  C CG  . LEU A 1 22  ? 13.664 9.323  44.488  1.00 52.48  ? 21  LEU A CG  1 
ATOM   110  C CD1 . LEU A 1 22  ? 15.111 9.182  44.026  1.00 53.41  ? 21  LEU A CD1 1 
ATOM   111  C CD2 . LEU A 1 22  ? 12.697 8.789  43.444  1.00 49.91  ? 21  LEU A CD2 1 
ATOM   112  N N   . ASN A 1 23  ? 12.514 8.064  49.041  1.00 50.67  ? 22  ASN A N   1 
ATOM   113  C CA  . ASN A 1 23  ? 12.374 7.016  50.057  1.00 52.31  ? 22  ASN A CA  1 
ATOM   114  C C   . ASN A 1 23  ? 10.921 6.537  50.232  1.00 53.21  ? 22  ASN A C   1 
ATOM   115  O O   . ASN A 1 23  ? 10.025 7.328  50.462  1.00 54.34  ? 22  ASN A O   1 
ATOM   116  C CB  . ASN A 1 23  ? 12.936 7.496  51.399  1.00 52.32  ? 22  ASN A CB  1 
ATOM   117  C CG  . ASN A 1 23  ? 14.432 7.707  51.352  1.00 52.00  ? 22  ASN A CG  1 
ATOM   118  O OD1 . ASN A 1 23  ? 15.111 7.109  50.545  1.00 51.83  ? 22  ASN A OD1 1 
ATOM   119  N ND2 . ASN A 1 23  ? 14.947 8.549  52.235  1.00 51.97  ? 22  ASN A ND2 1 
ATOM   120  N N   . LYS A 1 24  ? 10.701 5.234  50.102  1.00 55.15  ? 23  LYS A N   1 
ATOM   121  C CA  . LYS A 1 24  ? 9.346  4.703  50.263  1.00 54.97  ? 23  LYS A CA  1 
ATOM   122  C C   . LYS A 1 24  ? 8.961  4.645  51.746  1.00 53.69  ? 23  LYS A C   1 
ATOM   123  O O   . LYS A 1 24  ? 7.799  4.527  52.087  1.00 51.96  ? 23  LYS A O   1 
ATOM   124  C CB  . LYS A 1 24  ? 9.236  3.320  49.625  1.00 56.98  ? 23  LYS A CB  1 
ATOM   125  C CG  . LYS A 1 24  ? 8.847  3.330  48.144  1.00 59.93  ? 23  LYS A CG  1 
ATOM   126  C CD  . LYS A 1 24  ? 7.492  2.622  47.921  1.00 63.22  ? 23  LYS A CD  1 
ATOM   127  C CE  . LYS A 1 24  ? 7.463  1.208  48.547  1.00 63.45  ? 23  LYS A CE  1 
ATOM   128  N NZ  . LYS A 1 24  ? 6.132  0.522  48.475  1.00 62.56  ? 23  LYS A NZ  1 
ATOM   129  N N   . GLU A 1 25  ? 9.981  4.735  52.598  1.00 54.41  ? 24  GLU A N   1 
ATOM   130  C CA  . GLU A 1 25  ? 9.835  4.737  54.064  1.00 55.29  ? 24  GLU A CA  1 
ATOM   131  C C   . GLU A 1 25  ? 11.089 5.356  54.710  1.00 54.04  ? 24  GLU A C   1 
ATOM   132  O O   . GLU A 1 25  ? 12.057 5.616  54.023  1.00 52.94  ? 24  GLU A O   1 
ATOM   133  C CB  . GLU A 1 25  ? 9.614  3.311  54.606  1.00 58.50  ? 24  GLU A CB  1 
ATOM   134  C CG  . GLU A 1 25  ? 10.848 2.603  55.155  1.00 63.82  ? 24  GLU A CG  1 
ATOM   135  C CD  . GLU A 1 25  ? 11.823 2.167  54.069  1.00 69.14  ? 24  GLU A CD  1 
ATOM   136  O OE1 . GLU A 1 25  ? 11.411 1.382  53.178  1.00 71.09  ? 24  GLU A OE1 1 
ATOM   137  O OE2 . GLU A 1 25  ? 13.005 2.603  54.106  1.00 71.75  ? 24  GLU A OE2 1 
ATOM   138  N N   . LEU A 1 26  ? 11.052 5.588  56.022  1.00 53.68  ? 25  LEU A N   1 
ATOM   139  C CA  . LEU A 1 26  ? 12.202 6.183  56.729  1.00 51.62  ? 25  LEU A CA  1 
ATOM   140  C C   . LEU A 1 26  ? 13.466 5.289  56.659  1.00 52.46  ? 25  LEU A C   1 
ATOM   141  O O   . LEU A 1 26  ? 13.403 4.082  56.864  1.00 53.95  ? 25  LEU A O   1 
ATOM   142  C CB  . LEU A 1 26  ? 11.832 6.477  58.198  1.00 47.76  ? 25  LEU A CB  1 
ATOM   143  C CG  . LEU A 1 26  ? 10.712 7.510  58.477  1.00 44.93  ? 25  LEU A CG  1 
ATOM   144  C CD1 . LEU A 1 26  ? 10.511 7.700  59.993  1.00 40.44  ? 25  LEU A CD1 1 
ATOM   145  C CD2 . LEU A 1 26  ? 11.051 8.838  57.821  1.00 41.72  ? 25  LEU A CD2 1 
ATOM   146  N N   . ASP A 1 27  ? 14.598 5.906  56.345  1.00 51.86  ? 26  ASP A N   1 
ATOM   147  C CA  . ASP A 1 27  ? 15.855 5.185  56.249  1.00 52.06  ? 26  ASP A CA  1 
ATOM   148  C C   . ASP A 1 27  ? 16.663 5.349  57.527  1.00 50.83  ? 26  ASP A C   1 
ATOM   149  O O   . ASP A 1 27  ? 17.606 6.114  57.571  1.00 51.97  ? 26  ASP A O   1 
ATOM   150  C CB  . ASP A 1 27  ? 16.655 5.702  55.047  1.00 54.79  ? 26  ASP A CB  1 
ATOM   151  C CG  . ASP A 1 27  ? 18.046 5.090  54.951  1.00 56.98  ? 26  ASP A CG  1 
ATOM   152  O OD1 . ASP A 1 27  ? 18.719 5.339  53.927  1.00 59.68  ? 26  ASP A OD1 1 
ATOM   153  O OD2 . ASP A 1 27  ? 18.469 4.372  55.887  1.00 57.71  ? 26  ASP A OD2 1 
ATOM   154  N N   . TRP A 1 28  ? 16.287 4.613  58.561  1.00 51.15  ? 27  TRP A N   1 
ATOM   155  C CA  . TRP A 1 28  ? 16.987 4.723  59.845  1.00 51.68  ? 27  TRP A CA  1 
ATOM   156  C C   . TRP A 1 28  ? 18.502 4.519  59.753  1.00 50.32  ? 27  TRP A C   1 
ATOM   157  O O   . TRP A 1 28  ? 19.250 5.132  60.493  1.00 50.72  ? 27  TRP A O   1 
ATOM   158  C CB  . TRP A 1 28  ? 16.366 3.775  60.874  1.00 52.27  ? 27  TRP A CB  1 
ATOM   159  C CG  . TRP A 1 28  ? 14.990 4.227  61.231  1.00 54.21  ? 27  TRP A CG  1 
ATOM   160  C CD1 . TRP A 1 28  ? 13.809 3.712  60.766  1.00 55.44  ? 27  TRP A CD1 1 
ATOM   161  C CD2 . TRP A 1 28  ? 14.642 5.374  62.018  1.00 54.17  ? 27  TRP A CD2 1 
ATOM   162  N NE1 . TRP A 1 28  ? 12.749 4.466  61.212  1.00 55.58  ? 27  TRP A NE1 1 
ATOM   163  C CE2 . TRP A 1 28  ? 13.231 5.495  61.991  1.00 55.03  ? 27  TRP A CE2 1 
ATOM   164  C CE3 . TRP A 1 28  ? 15.382 6.313  62.755  1.00 51.98  ? 27  TRP A CE3 1 
ATOM   165  C CZ2 . TRP A 1 28  ? 12.546 6.523  62.656  1.00 52.56  ? 27  TRP A CZ2 1 
ATOM   166  C CZ3 . TRP A 1 28  ? 14.699 7.339  63.420  1.00 52.00  ? 27  TRP A CZ3 1 
ATOM   167  C CH2 . TRP A 1 28  ? 13.297 7.428  63.369  1.00 52.07  ? 27  TRP A CH2 1 
ATOM   168  N N   . ALA A 1 29  ? 18.947 3.668  58.843  1.00 48.57  ? 28  ALA A N   1 
ATOM   169  C CA  . ALA A 1 29  ? 20.390 3.468  58.691  1.00 47.64  ? 28  ALA A CA  1 
ATOM   170  C C   . ALA A 1 29  ? 21.107 4.829  58.417  1.00 46.93  ? 28  ALA A C   1 
ATOM   171  O O   . ALA A 1 29  ? 22.165 5.109  58.954  1.00 45.14  ? 28  ALA A O   1 
ATOM   172  C CB  . ALA A 1 29  ? 20.663 2.490  57.531  1.00 48.58  ? 28  ALA A CB  1 
ATOM   173  N N   . SER A 1 30  ? 20.486 5.640  57.567  1.00 46.02  ? 29  SER A N   1 
ATOM   174  C CA  . SER A 1 30  ? 21.011 6.946  57.174  1.00 46.78  ? 29  SER A CA  1 
ATOM   175  C C   . SER A 1 30  ? 20.728 8.043  58.215  1.00 45.58  ? 29  SER A C   1 
ATOM   176  O O   . SER A 1 30  ? 21.571 8.885  58.499  1.00 44.51  ? 29  SER A O   1 
ATOM   177  C CB  . SER A 1 30  ? 20.410 7.335  55.831  1.00 48.76  ? 29  SER A CB  1 
ATOM   178  O OG  . SER A 1 30  ? 20.830 6.409  54.840  1.00 51.56  ? 29  SER A OG  1 
ATOM   179  N N   . ILE A 1 31  ? 19.528 8.017  58.765  1.00 44.20  ? 30  ILE A N   1 
ATOM   180  C CA  . ILE A 1 31  ? 19.170 8.978  59.776  1.00 45.13  ? 30  ILE A CA  1 
ATOM   181  C C   . ILE A 1 31  ? 20.125 8.857  60.982  1.00 46.12  ? 30  ILE A C   1 
ATOM   182  O O   . ILE A 1 31  ? 20.776 9.813  61.374  1.00 46.18  ? 30  ILE A O   1 
ATOM   183  C CB  . ILE A 1 31  ? 17.728 8.745  60.245  1.00 44.08  ? 30  ILE A CB  1 
ATOM   184  C CG1 . ILE A 1 31  ? 16.750 9.102  59.138  1.00 43.38  ? 30  ILE A CG1 1 
ATOM   185  C CG2 . ILE A 1 31  ? 17.426 9.589  61.447  1.00 43.46  ? 30  ILE A CG2 1 
ATOM   186  C CD1 . ILE A 1 31  ? 15.348 8.729  59.473  1.00 44.86  ? 30  ILE A CD1 1 
ATOM   187  N N   . ASN A 1 32  ? 20.216 7.665  61.555  1.00 47.92  ? 31  ASN A N   1 
ATOM   188  C CA  . ASN A 1 32  ? 21.107 7.498  62.712  1.00 47.94  ? 31  ASN A CA  1 
ATOM   189  C C   . ASN A 1 32  ? 22.565 7.667  62.305  1.00 46.00  ? 31  ASN A C   1 
ATOM   190  O O   . ASN A 1 32  ? 23.385 8.145  63.082  1.00 46.42  ? 31  ASN A O   1 
ATOM   191  C CB  . ASN A 1 32  ? 20.889 6.134  63.383  1.00 48.50  ? 31  ASN A CB  1 
ATOM   192  C CG  . ASN A 1 32  ? 19.462 5.944  63.853  1.00 47.98  ? 31  ASN A CG  1 
ATOM   193  O OD1 . ASN A 1 32  ? 18.960 6.717  64.642  1.00 50.26  ? 31  ASN A OD1 1 
ATOM   194  N ND2 . ASN A 1 32  ? 18.807 4.910  63.355  1.00 49.19  ? 31  ASN A ND2 1 
ATOM   195  N N   . GLY A 1 33  ? 22.871 7.281  61.075  1.00 43.55  ? 32  GLY A N   1 
ATOM   196  C CA  . GLY A 1 33  ? 24.229 7.440  60.610  1.00 43.06  ? 32  GLY A CA  1 
ATOM   197  C C   . GLY A 1 33  ? 24.611 8.914  60.608  1.00 43.17  ? 32  GLY A C   1 
ATOM   198  O O   . GLY A 1 33  ? 25.750 9.274  60.869  1.00 42.86  ? 32  GLY A O   1 
ATOM   199  N N   . PHE A 1 34  ? 23.644 9.777  60.320  1.00 42.50  ? 33  PHE A N   1 
ATOM   200  C CA  . PHE A 1 34  ? 23.918 11.209 60.274  1.00 42.50  ? 33  PHE A CA  1 
ATOM   201  C C   . PHE A 1 34  ? 24.155 11.798 61.650  1.00 42.98  ? 33  PHE A C   1 
ATOM   202  O O   . PHE A 1 34  ? 24.974 12.701 61.807  1.00 42.99  ? 33  PHE A O   1 
ATOM   203  C CB  . PHE A 1 34  ? 22.775 11.932 59.574  1.00 43.86  ? 33  PHE A CB  1 
ATOM   204  C CG  . PHE A 1 34  ? 22.897 13.421 59.583  1.00 41.25  ? 33  PHE A CG  1 
ATOM   205  C CD1 . PHE A 1 34  ? 22.372 14.164 60.625  1.00 39.89  ? 33  PHE A CD1 1 
ATOM   206  C CD2 . PHE A 1 34  ? 23.483 14.084 58.516  1.00 42.58  ? 33  PHE A CD2 1 
ATOM   207  C CE1 . PHE A 1 34  ? 22.437 15.555 60.615  1.00 42.46  ? 33  PHE A CE1 1 
ATOM   208  C CE2 . PHE A 1 34  ? 23.556 15.483 58.492  1.00 44.43  ? 33  PHE A CE2 1 
ATOM   209  C CZ  . PHE A 1 34  ? 23.025 16.218 59.540  1.00 43.23  ? 33  PHE A CZ  1 
ATOM   210  N N   . CYS A 1 35  ? 23.438 11.286 62.644  1.00 43.74  ? 34  CYS A N   1 
ATOM   211  C CA  . CYS A 1 35  ? 23.628 11.782 64.008  1.00 46.39  ? 34  CYS A CA  1 
ATOM   212  C C   . CYS A 1 35  ? 24.983 11.312 64.584  1.00 50.17  ? 34  CYS A C   1 
ATOM   213  O O   . CYS A 1 35  ? 25.649 12.043 65.328  1.00 50.25  ? 34  CYS A O   1 
ATOM   214  C CB  . CYS A 1 35  ? 22.482 11.331 64.904  1.00 43.34  ? 34  CYS A CB  1 
ATOM   215  S SG  . CYS A 1 35  ? 20.849 11.863 64.306  1.00 45.02  ? 34  CYS A SG  1 
ATOM   216  N N   . GLU A 1 36  ? 25.384 10.099 64.208  1.00 54.50  ? 35  GLU A N   1 
ATOM   217  C CA  . GLU A 1 36  ? 26.661 9.545  64.675  1.00 59.52  ? 35  GLU A CA  1 
ATOM   218  C C   . GLU A 1 36  ? 27.855 10.320 64.107  1.00 61.43  ? 35  GLU A C   1 
ATOM   219  O O   . GLU A 1 36  ? 28.795 10.638 64.815  1.00 61.33  ? 35  GLU A O   1 
ATOM   220  C CB  . GLU A 1 36  ? 26.795 8.080  64.261  1.00 61.53  ? 35  GLU A CB  1 
ATOM   221  C CG  . GLU A 1 36  ? 25.988 7.078  65.076  1.00 65.65  ? 35  GLU A CG  1 
ATOM   222  C CD  . GLU A 1 36  ? 25.632 5.827  64.260  1.00 68.22  ? 35  GLU A CD  1 
ATOM   223  O OE1 . GLU A 1 36  ? 26.492 5.370  63.452  1.00 65.74  ? 35  GLU A OE1 1 
ATOM   224  O OE2 . GLU A 1 36  ? 24.492 5.306  64.434  1.00 68.68  ? 35  GLU A OE2 1 
ATOM   225  N N   . GLN A 1 37  ? 27.784 10.627 62.820  1.00 64.41  ? 36  GLN A N   1 
ATOM   226  C CA  . GLN A 1 37  ? 28.866 11.328 62.156  1.00 67.54  ? 36  GLN A CA  1 
ATOM   227  C C   . GLN A 1 37  ? 28.968 12.835 62.504  1.00 68.75  ? 36  GLN A C   1 
ATOM   228  O O   . GLN A 1 37  ? 30.065 13.372 62.589  1.00 68.58  ? 36  GLN A O   1 
ATOM   229  C CB  . GLN A 1 37  ? 28.728 11.139 60.655  1.00 69.39  ? 36  GLN A CB  1 
ATOM   230  C CG  . GLN A 1 37  ? 29.979 11.417 59.865  1.00 74.35  ? 36  GLN A CG  1 
ATOM   231  C CD  . GLN A 1 37  ? 29.804 11.019 58.414  1.00 78.74  ? 36  GLN A CD  1 
ATOM   232  O OE1 . GLN A 1 37  ? 29.265 11.780 57.602  1.00 80.49  ? 36  GLN A OE1 1 
ATOM   233  N NE2 . GLN A 1 37  ? 30.231 9.797  58.086  1.00 80.75  ? 36  GLN A NE2 1 
ATOM   234  N N   . LEU A 1 38  ? 27.841 13.506 62.719  1.00 69.57  ? 37  LEU A N   1 
ATOM   235  C CA  . LEU A 1 38  ? 27.923 14.933 63.033  1.00 72.46  ? 37  LEU A CA  1 
ATOM   236  C C   . LEU A 1 38  ? 28.735 15.199 64.339  1.00 75.85  ? 37  LEU A C   1 
ATOM   237  O O   . LEU A 1 38  ? 29.160 16.326 64.599  1.00 76.52  ? 37  LEU A O   1 
ATOM   238  C CB  . LEU A 1 38  ? 26.520 15.540 63.116  1.00 69.48  ? 37  LEU A CB  1 
ATOM   239  C CG  . LEU A 1 38  ? 25.771 15.408 64.431  1.00 68.36  ? 37  LEU A CG  1 
ATOM   240  C CD1 . LEU A 1 38  ? 26.131 16.572 65.311  1.00 66.07  ? 37  LEU A CD1 1 
ATOM   241  C CD2 . LEU A 1 38  ? 24.274 15.383 64.173  1.00 67.89  ? 37  LEU A CD2 1 
ATOM   242  N N   . ASN A 1 39  ? 28.949 14.150 65.134  1.00 78.64  ? 38  ASN A N   1 
ATOM   243  C CA  . ASN A 1 39  ? 29.728 14.274 66.382  1.00 81.15  ? 38  ASN A CA  1 
ATOM   244  C C   . ASN A 1 39  ? 31.200 13.835 66.215  1.00 82.11  ? 38  ASN A C   1 
ATOM   245  O O   . ASN A 1 39  ? 32.039 14.193 67.021  1.00 82.78  ? 38  ASN A O   1 
ATOM   246  C CB  . ASN A 1 39  ? 29.099 13.450 67.512  1.00 82.69  ? 38  ASN A CB  1 
ATOM   247  C CG  . ASN A 1 39  ? 28.158 14.270 68.387  1.00 84.30  ? 38  ASN A CG  1 
ATOM   248  O OD1 . ASN A 1 39  ? 28.457 15.409 68.745  1.00 85.78  ? 38  ASN A OD1 1 
ATOM   249  N ND2 . ASN A 1 39  ? 27.023 13.682 68.749  1.00 84.48  ? 38  ASN A ND2 1 
ATOM   250  N N   . GLU A 1 40  ? 31.483 13.059 65.171  1.00 83.02  ? 39  GLU A N   1 
ATOM   251  C CA  . GLU A 1 40  ? 32.849 12.570 64.904  1.00 83.96  ? 39  GLU A CA  1 
ATOM   252  C C   . GLU A 1 40  ? 33.806 13.704 64.479  1.00 84.39  ? 39  GLU A C   1 
ATOM   253  O O   . GLU A 1 40  ? 35.008 13.500 64.342  1.00 83.77  ? 39  GLU A O   1 
ATOM   254  C CB  . GLU A 1 40  ? 32.829 11.483 63.820  1.00 84.05  ? 39  GLU A CB  1 
ATOM   255  C CG  . GLU A 1 40  ? 31.828 10.361 64.093  1.00 84.56  ? 39  GLU A CG  1 
ATOM   256  C CD  . GLU A 1 40  ? 31.905 9.217  63.088  1.00 85.03  ? 39  GLU A CD  1 
ATOM   257  O OE1 . GLU A 1 40  ? 32.095 9.492  61.878  1.00 84.97  ? 39  GLU A OE1 1 
ATOM   258  O OE2 . GLU A 1 40  ? 31.755 8.044  63.513  1.00 83.94  ? 39  GLU A OE2 1 
ATOM   259  N N   . ASP A 1 41  ? 33.243 14.888 64.273  1.00 85.33  ? 40  ASP A N   1 
ATOM   260  C CA  . ASP A 1 41  ? 34.035 16.061 63.890  1.00 86.93  ? 40  ASP A CA  1 
ATOM   261  C C   . ASP A 1 41  ? 33.610 17.289 64.708  1.00 86.71  ? 40  ASP A C   1 
ATOM   262  O O   . ASP A 1 41  ? 32.430 17.469 64.963  1.00 87.65  ? 40  ASP A O   1 
ATOM   263  C CB  . ASP A 1 41  ? 33.868 16.347 62.398  1.00 87.83  ? 40  ASP A CB  1 
ATOM   264  C CG  . ASP A 1 41  ? 34.632 17.576 61.961  1.00 89.34  ? 40  ASP A CG  1 
ATOM   265  O OD1 . ASP A 1 41  ? 35.727 17.812 62.517  1.00 89.95  ? 40  ASP A OD1 1 
ATOM   266  O OD2 . ASP A 1 41  ? 34.148 18.297 61.060  1.00 89.25  ? 40  ASP A OD2 1 
ATOM   267  N N   . PHE A 1 42  ? 34.569 18.118 65.118  1.00 85.78  ? 41  PHE A N   1 
ATOM   268  C CA  . PHE A 1 42  ? 34.231 19.313 65.925  1.00 85.06  ? 41  PHE A CA  1 
ATOM   269  C C   . PHE A 1 42  ? 33.550 20.440 65.092  1.00 83.44  ? 41  PHE A C   1 
ATOM   270  O O   . PHE A 1 42  ? 33.071 21.431 65.637  1.00 83.58  ? 41  PHE A O   1 
ATOM   271  C CB  . PHE A 1 42  ? 35.489 19.854 66.629  1.00 85.54  ? 41  PHE A CB  1 
ATOM   272  C CG  . PHE A 1 42  ? 36.391 20.663 65.742  1.00 84.86  ? 41  PHE A CG  1 
ATOM   273  C CD1 . PHE A 1 42  ? 36.374 22.054 65.794  1.00 84.46  ? 41  PHE A CD1 1 
ATOM   274  C CD2 . PHE A 1 42  ? 37.248 20.038 64.851  1.00 85.31  ? 41  PHE A CD2 1 
ATOM   275  C CE1 . PHE A 1 42  ? 37.197 22.810 64.968  1.00 84.39  ? 41  PHE A CE1 1 
ATOM   276  C CE2 . PHE A 1 42  ? 38.076 20.786 64.020  1.00 85.56  ? 41  PHE A CE2 1 
ATOM   277  C CZ  . PHE A 1 42  ? 38.049 22.177 64.080  1.00 85.05  ? 41  PHE A CZ  1 
ATOM   278  N N   . GLU A 1 43  ? 33.505 20.243 63.778  1.00 80.95  ? 42  GLU A N   1 
ATOM   279  C CA  . GLU A 1 43  ? 32.900 21.205 62.849  1.00 77.77  ? 42  GLU A CA  1 
ATOM   280  C C   . GLU A 1 43  ? 31.459 20.799 62.474  1.00 74.54  ? 42  GLU A C   1 
ATOM   281  O O   . GLU A 1 43  ? 30.648 21.630 62.102  1.00 73.11  ? 42  GLU A O   1 
ATOM   282  C CB  . GLU A 1 43  ? 33.735 21.261 61.574  1.00 80.42  ? 42  GLU A CB  1 
ATOM   283  C CG  . GLU A 1 43  ? 33.984 22.651 61.049  1.00 84.25  ? 42  GLU A CG  1 
ATOM   284  C CD  . GLU A 1 43  ? 35.027 23.400 61.860  1.00 86.73  ? 42  GLU A CD  1 
ATOM   285  O OE1 . GLU A 1 43  ? 34.740 23.743 63.032  1.00 87.90  ? 42  GLU A OE1 1 
ATOM   286  O OE2 . GLU A 1 43  ? 36.137 23.633 61.322  1.00 87.03  ? 42  GLU A OE2 1 
ATOM   287  N N   . GLY A 1 44  ? 31.191 19.502 62.584  1.00 71.79  ? 43  GLY A N   1 
ATOM   288  C CA  . GLY A 1 44  ? 29.896 18.941 62.248  1.00 68.36  ? 43  GLY A CA  1 
ATOM   289  C C   . GLY A 1 44  ? 28.652 19.619 62.786  1.00 65.15  ? 43  GLY A C   1 
ATOM   290  O O   . GLY A 1 44  ? 27.838 20.087 62.024  1.00 65.64  ? 43  GLY A O   1 
ATOM   291  N N   . PRO A 1 45  ? 28.480 19.685 64.104  1.00 62.56  ? 44  PRO A N   1 
ATOM   292  C CA  . PRO A 1 45  ? 27.294 20.323 64.672  1.00 60.17  ? 44  PRO A CA  1 
ATOM   293  C C   . PRO A 1 45  ? 26.824 21.633 63.974  1.00 58.02  ? 44  PRO A C   1 
ATOM   294  O O   . PRO A 1 45  ? 25.663 21.757 63.598  1.00 58.42  ? 44  PRO A O   1 
ATOM   295  C CB  . PRO A 1 45  ? 27.689 20.536 66.128  1.00 60.47  ? 44  PRO A CB  1 
ATOM   296  C CG  . PRO A 1 45  ? 28.526 19.344 66.409  1.00 61.53  ? 44  PRO A CG  1 
ATOM   297  C CD  . PRO A 1 45  ? 29.405 19.260 65.165  1.00 62.19  ? 44  PRO A CD  1 
ATOM   298  N N   . PRO A 1 46  ? 27.719 22.612 63.803  1.00 55.29  ? 45  PRO A N   1 
ATOM   299  C CA  . PRO A 1 46  ? 27.271 23.842 63.150  1.00 54.38  ? 45  PRO A CA  1 
ATOM   300  C C   . PRO A 1 46  ? 26.920 23.599 61.661  1.00 53.32  ? 45  PRO A C   1 
ATOM   301  O O   . PRO A 1 46  ? 26.087 24.280 61.086  1.00 53.94  ? 45  PRO A O   1 
ATOM   302  C CB  . PRO A 1 46  ? 28.471 24.768 63.307  1.00 53.41  ? 45  PRO A CB  1 
ATOM   303  C CG  . PRO A 1 46  ? 29.145 24.247 64.521  1.00 53.72  ? 45  PRO A CG  1 
ATOM   304  C CD  . PRO A 1 46  ? 29.085 22.770 64.308  1.00 53.50  ? 45  PRO A CD  1 
ATOM   305  N N   . LEU A 1 47  ? 27.570 22.620 61.055  1.00 52.07  ? 46  LEU A N   1 
ATOM   306  C CA  . LEU A 1 47  ? 27.317 22.334 59.653  1.00 51.90  ? 46  LEU A CA  1 
ATOM   307  C C   . LEU A 1 47  ? 26.035 21.535 59.460  1.00 50.83  ? 46  LEU A C   1 
ATOM   308  O O   . LEU A 1 47  ? 25.306 21.765 58.510  1.00 52.36  ? 46  LEU A O   1 
ATOM   309  C CB  . LEU A 1 47  ? 28.509 21.587 59.046  1.00 51.91  ? 46  LEU A CB  1 
ATOM   310  C CG  . LEU A 1 47  ? 28.497 21.254 57.550  1.00 52.47  ? 46  LEU A CG  1 
ATOM   311  C CD1 . LEU A 1 47  ? 27.872 19.903 57.337  1.00 52.29  ? 46  LEU A CD1 1 
ATOM   312  C CD2 . LEU A 1 47  ? 27.769 22.346 56.770  1.00 49.84  ? 46  LEU A CD2 1 
ATOM   313  N N   . ALA A 1 48  ? 25.785 20.599 60.373  1.00 49.31  ? 47  ALA A N   1 
ATOM   314  C CA  . ALA A 1 48  ? 24.585 19.756 60.326  1.00 46.57  ? 47  ALA A CA  1 
ATOM   315  C C   . ALA A 1 48  ? 23.320 20.606 60.487  1.00 45.85  ? 47  ALA A C   1 
ATOM   316  O O   . ALA A 1 48  ? 22.319 20.362 59.811  1.00 45.23  ? 47  ALA A O   1 
ATOM   317  C CB  . ALA A 1 48  ? 24.642 18.697 61.418  1.00 44.95  ? 47  ALA A CB  1 
ATOM   318  N N   . THR A 1 49  ? 23.378 21.611 61.363  1.00 43.60  ? 48  THR A N   1 
ATOM   319  C CA  . THR A 1 49  ? 22.202 22.441 61.546  1.00 43.33  ? 48  THR A CA  1 
ATOM   320  C C   . THR A 1 49  ? 21.894 23.255 60.286  1.00 42.97  ? 48  THR A C   1 
ATOM   321  O O   . THR A 1 49  ? 20.738 23.508 60.007  1.00 44.64  ? 48  THR A O   1 
ATOM   322  C CB  . THR A 1 49  ? 22.293 23.368 62.784  1.00 42.78  ? 48  THR A CB  1 
ATOM   323  O OG1 . THR A 1 49  ? 23.416 24.238 62.663  1.00 44.22  ? 48  THR A OG1 1 
ATOM   324  C CG2 . THR A 1 49  ? 22.411 22.544 64.049  1.00 40.82  ? 48  THR A CG2 1 
ATOM   325  N N   . ARG A 1 50  ? 22.914 23.635 59.522  1.00 41.68  ? 49  ARG A N   1 
ATOM   326  C CA  . ARG A 1 50  ? 22.647 24.382 58.276  1.00 42.00  ? 49  ARG A CA  1 
ATOM   327  C C   . ARG A 1 50  ? 22.077 23.452 57.205  1.00 39.92  ? 49  ARG A C   1 
ATOM   328  O O   . ARG A 1 50  ? 21.233 23.857 56.395  1.00 40.95  ? 49  ARG A O   1 
ATOM   329  C CB  . ARG A 1 50  ? 23.903 25.055 57.715  1.00 45.61  ? 49  ARG A CB  1 
ATOM   330  C CG  . ARG A 1 50  ? 24.365 26.270 58.510  1.00 53.84  ? 49  ARG A CG  1 
ATOM   331  C CD  . ARG A 1 50  ? 25.254 27.182 57.660  1.00 61.15  ? 49  ARG A CD  1 
ATOM   332  N NE  . ARG A 1 50  ? 26.384 26.463 57.064  1.00 66.76  ? 49  ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 50  ? 27.517 26.170 57.702  1.00 69.67  ? 49  ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 50  ? 28.485 25.502 57.077  1.00 70.44  ? 49  ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 50  ? 27.688 26.558 58.961  1.00 70.32  ? 49  ARG A NH2 1 
ATOM   336  N N   . LEU A 1 51  ? 22.555 22.212 57.188  1.00 35.11  ? 50  LEU A N   1 
ATOM   337  C CA  . LEU A 1 51  ? 22.032 21.274 56.213  1.00 33.07  ? 50  LEU A CA  1 
ATOM   338  C C   . LEU A 1 51  ? 20.553 20.928 56.565  1.00 32.91  ? 50  LEU A C   1 
ATOM   339  O O   . LEU A 1 51  ? 19.690 20.821 55.694  1.00 31.65  ? 50  LEU A O   1 
ATOM   340  C CB  . LEU A 1 51  ? 22.896 20.010 56.156  1.00 29.48  ? 50  LEU A CB  1 
ATOM   341  C CG  . LEU A 1 51  ? 24.277 20.163 55.522  1.00 31.82  ? 50  LEU A CG  1 
ATOM   342  C CD1 . LEU A 1 51  ? 25.112 18.900 55.676  1.00 30.54  ? 50  LEU A CD1 1 
ATOM   343  C CD2 . LEU A 1 51  ? 24.121 20.477 54.046  1.00 33.35  ? 50  LEU A CD2 1 
ATOM   344  N N   . LEU A 1 52  ? 20.274 20.768 57.849  1.00 32.02  ? 51  LEU A N   1 
ATOM   345  C CA  . LEU A 1 52  ? 18.910 20.455 58.230  1.00 32.49  ? 51  LEU A CA  1 
ATOM   346  C C   . LEU A 1 52  ? 17.950 21.630 57.956  1.00 33.41  ? 51  LEU A C   1 
ATOM   347  O O   . LEU A 1 52  ? 16.849 21.437 57.453  1.00 35.36  ? 51  LEU A O   1 
ATOM   348  C CB  . LEU A 1 52  ? 18.825 20.072 59.704  1.00 29.70  ? 51  LEU A CB  1 
ATOM   349  C CG  . LEU A 1 52  ? 19.400 18.730 60.134  1.00 29.88  ? 51  LEU A CG  1 
ATOM   350  C CD1 . LEU A 1 52  ? 19.346 18.693 61.635  1.00 30.43  ? 51  LEU A CD1 1 
ATOM   351  C CD2 . LEU A 1 52  ? 18.630 17.570 59.537  1.00 27.72  ? 51  LEU A CD2 1 
ATOM   352  N N   . ALA A 1 53  ? 18.387 22.841 58.275  1.00 32.33  ? 52  ALA A N   1 
ATOM   353  C CA  . ALA A 1 53  ? 17.533 23.995 58.073  1.00 30.95  ? 52  ALA A CA  1 
ATOM   354  C C   . ALA A 1 53  ? 17.132 24.124 56.601  1.00 31.14  ? 52  ALA A C   1 
ATOM   355  O O   . ALA A 1 53  ? 16.001 24.472 56.297  1.00 33.04  ? 52  ALA A O   1 
ATOM   356  C CB  . ALA A 1 53  ? 18.231 25.271 58.562  1.00 31.12  ? 52  ALA A CB  1 
ATOM   357  N N   . HIS A 1 54  ? 18.065 23.828 55.701  1.00 29.53  ? 53  HIS A N   1 
ATOM   358  C CA  . HIS A 1 54  ? 17.754 23.900 54.288  1.00 28.90  ? 53  HIS A CA  1 
ATOM   359  C C   . HIS A 1 54  ? 16.755 22.789 53.879  1.00 32.58  ? 53  HIS A C   1 
ATOM   360  O O   . HIS A 1 54  ? 15.823 23.038 53.108  1.00 35.01  ? 53  HIS A O   1 
ATOM   361  C CB  . HIS A 1 54  ? 19.016 23.812 53.453  1.00 25.92  ? 53  HIS A CB  1 
ATOM   362  C CG  . HIS A 1 54  ? 18.750 23.844 51.985  1.00 27.35  ? 53  HIS A CG  1 
ATOM   363  N ND1 . HIS A 1 54  ? 18.921 22.740 51.180  1.00 30.55  ? 53  HIS A ND1 1 
ATOM   364  C CD2 . HIS A 1 54  ? 18.189 24.795 51.202  1.00 28.08  ? 53  HIS A CD2 1 
ATOM   365  C CE1 . HIS A 1 54  ? 18.465 23.003 49.970  1.00 29.06  ? 53  HIS A CE1 1 
ATOM   366  N NE2 . HIS A 1 54  ? 18.013 24.242 49.958  1.00 28.93  ? 53  HIS A NE2 1 
ATOM   367  N N   . LYS A 1 55  ? 16.946 21.576 54.404  1.00 33.29  ? 54  LYS A N   1 
ATOM   368  C CA  . LYS A 1 55  ? 16.018 20.477 54.091  1.00 32.40  ? 54  LYS A CA  1 
ATOM   369  C C   . LYS A 1 55  ? 14.627 20.755 54.713  1.00 32.84  ? 54  LYS A C   1 
ATOM   370  O O   . LYS A 1 55  ? 13.599 20.549 54.067  1.00 32.14  ? 54  LYS A O   1 
ATOM   371  C CB  . LYS A 1 55  ? 16.554 19.128 54.602  1.00 32.34  ? 54  LYS A CB  1 
ATOM   372  C CG  . LYS A 1 55  ? 17.830 18.624 53.915  1.00 33.12  ? 54  LYS A CG  1 
ATOM   373  C CD  . LYS A 1 55  ? 17.673 18.444 52.396  1.00 33.16  ? 54  LYS A CD  1 
ATOM   374  C CE  . LYS A 1 55  ? 18.967 17.897 51.752  1.00 31.90  ? 54  LYS A CE  1 
ATOM   375  N NZ  . LYS A 1 55  ? 18.858 17.607 50.284  1.00 32.83  ? 54  LYS A NZ  1 
ATOM   376  N N   . ILE A 1 56  ? 14.620 21.238 55.952  1.00 31.47  ? 55  ILE A N   1 
ATOM   377  C CA  . ILE A 1 56  ? 13.367 21.544 56.635  1.00 32.23  ? 55  ILE A CA  1 
ATOM   378  C C   . ILE A 1 56  ? 12.518 22.626 55.887  1.00 34.41  ? 55  ILE A C   1 
ATOM   379  O O   . ILE A 1 56  ? 11.306 22.675 56.024  1.00 35.44  ? 55  ILE A O   1 
ATOM   380  C CB  . ILE A 1 56  ? 13.646 22.003 58.097  1.00 32.30  ? 55  ILE A CB  1 
ATOM   381  C CG1 . ILE A 1 56  ? 14.196 20.836 58.910  1.00 33.17  ? 55  ILE A CG1 1 
ATOM   382  C CG2 . ILE A 1 56  ? 12.371 22.498 58.771  1.00 34.51  ? 55  ILE A CG2 1 
ATOM   383  C CD1 . ILE A 1 56  ? 14.557 21.190 60.337  1.00 32.46  ? 55  ILE A CD1 1 
ATOM   384  N N   . GLN A 1 57  ? 13.168 23.457 55.081  1.00 35.55  ? 56  GLN A N   1 
ATOM   385  C CA  . GLN A 1 57  ? 12.458 24.527 54.340  1.00 36.95  ? 56  GLN A CA  1 
ATOM   386  C C   . GLN A 1 57  ? 12.182 24.140 52.886  1.00 37.96  ? 56  GLN A C   1 
ATOM   387  O O   . GLN A 1 57  ? 11.920 24.985 52.035  1.00 39.46  ? 56  GLN A O   1 
ATOM   388  C CB  . GLN A 1 57  ? 13.280 25.826 54.372  1.00 37.81  ? 56  GLN A CB  1 
ATOM   389  C CG  . GLN A 1 57  ? 13.728 26.187 55.764  1.00 38.38  ? 56  GLN A CG  1 
ATOM   390  C CD  . GLN A 1 57  ? 14.694 27.313 55.789  1.00 38.76  ? 56  GLN A CD  1 
ATOM   391  O OE1 . GLN A 1 57  ? 15.546 27.422 54.943  1.00 41.51  ? 56  GLN A OE1 1 
ATOM   392  N NE2 . GLN A 1 57  ? 14.578 28.154 56.791  1.00 40.70  ? 56  GLN A NE2 1 
ATOM   393  N N   . SER A 1 58  ? 12.277 22.849 52.620  1.00 36.88  ? 57  SER A N   1 
ATOM   394  C CA  . SER A 1 58  ? 12.036 22.320 51.283  1.00 37.18  ? 57  SER A CA  1 
ATOM   395  C C   . SER A 1 58  ? 10.535 22.354 50.906  1.00 37.92  ? 57  SER A C   1 
ATOM   396  O O   . SER A 1 58  ? 9.681  22.076 51.725  1.00 40.09  ? 57  SER A O   1 
ATOM   397  C CB  . SER A 1 58  ? 12.545 20.876 51.214  1.00 35.31  ? 57  SER A CB  1 
ATOM   398  O OG  . SER A 1 58  ? 12.112 20.272 50.022  1.00 36.98  ? 57  SER A OG  1 
ATOM   399  N N   . PRO A 1 59  ? 10.218 22.728 49.667  1.00 38.13  ? 58  PRO A N   1 
ATOM   400  C CA  . PRO A 1 59  ? 8.813  22.756 49.289  1.00 37.59  ? 58  PRO A CA  1 
ATOM   401  C C   . PRO A 1 59  ? 8.280  21.312 49.246  1.00 39.03  ? 58  PRO A C   1 
ATOM   402  O O   . PRO A 1 59  ? 7.086  21.082 49.311  1.00 40.06  ? 58  PRO A O   1 
ATOM   403  C CB  . PRO A 1 59  ? 8.838  23.376 47.896  1.00 36.14  ? 58  PRO A CB  1 
ATOM   404  C CG  . PRO A 1 59  ? 9.982  24.247 47.939  1.00 37.28  ? 58  PRO A CG  1 
ATOM   405  C CD  . PRO A 1 59  ? 11.027 23.424 48.661  1.00 38.15  ? 58  PRO A CD  1 
ATOM   406  N N   . GLN A 1 60  ? 9.191  20.353 49.137  1.00 39.53  ? 59  GLN A N   1 
ATOM   407  C CA  . GLN A 1 60  ? 8.800  18.944 49.048  1.00 40.49  ? 59  GLN A CA  1 
ATOM   408  C C   . GLN A 1 60  ? 8.569  18.351 50.445  1.00 41.32  ? 59  GLN A C   1 
ATOM   409  O O   . GLN A 1 60  ? 9.506  17.957 51.123  1.00 42.25  ? 59  GLN A O   1 
ATOM   410  C CB  . GLN A 1 60  ? 9.878  18.162 48.264  1.00 42.65  ? 59  GLN A CB  1 
ATOM   411  C CG  . GLN A 1 60  ? 10.106 18.711 46.853  1.00 43.33  ? 59  GLN A CG  1 
ATOM   412  C CD  . GLN A 1 60  ? 11.295 18.102 46.141  1.00 46.07  ? 59  GLN A CD  1 
ATOM   413  O OE1 . GLN A 1 60  ? 11.426 16.892 46.061  1.00 49.12  ? 59  GLN A OE1 1 
ATOM   414  N NE2 . GLN A 1 60  ? 12.160 18.951 45.599  1.00 45.38  ? 59  GLN A NE2 1 
ATOM   415  N N   . GLU A 1 61  ? 7.304  18.314 50.856  1.00 41.94  ? 60  GLU A N   1 
ATOM   416  C CA  . GLU A 1 61  ? 6.915  17.815 52.191  1.00 41.15  ? 60  GLU A CA  1 
ATOM   417  C C   . GLU A 1 61  ? 7.714  16.589 52.680  1.00 39.15  ? 60  GLU A C   1 
ATOM   418  O O   . GLU A 1 61  ? 8.336  16.646 53.730  1.00 38.79  ? 60  GLU A O   1 
ATOM   419  C CB  . GLU A 1 61  ? 5.431  17.482 52.217  1.00 42.87  ? 60  GLU A CB  1 
ATOM   420  C CG  . GLU A 1 61  ? 4.800  17.569 53.586  1.00 46.72  ? 60  GLU A CG  1 
ATOM   421  C CD  . GLU A 1 61  ? 3.342  17.161 53.542  1.00 51.92  ? 60  GLU A CD  1 
ATOM   422  O OE1 . GLU A 1 61  ? 2.590  17.447 54.503  1.00 53.43  ? 60  GLU A OE1 1 
ATOM   423  O OE2 . GLU A 1 61  ? 2.943  16.540 52.527  1.00 55.70  ? 60  GLU A OE2 1 
ATOM   424  N N   . TRP A 1 62  ? 7.699  15.498 51.923  1.00 37.40  ? 61  TRP A N   1 
ATOM   425  C CA  . TRP A 1 62  ? 8.425  14.286 52.361  1.00 37.29  ? 61  TRP A CA  1 
ATOM   426  C C   . TRP A 1 62  ? 9.908  14.570 52.688  1.00 38.18  ? 61  TRP A C   1 
ATOM   427  O O   . TRP A 1 62  ? 10.512 13.848 53.478  1.00 37.14  ? 61  TRP A O   1 
ATOM   428  C CB  . TRP A 1 62  ? 8.332  13.178 51.303  1.00 35.89  ? 61  TRP A CB  1 
ATOM   429  C CG  . TRP A 1 62  ? 8.851  11.834 51.763  1.00 36.46  ? 61  TRP A CG  1 
ATOM   430  C CD1 . TRP A 1 62  ? 9.601  10.960 51.033  1.00 35.84  ? 61  TRP A CD1 1 
ATOM   431  C CD2 . TRP A 1 62  ? 8.660  11.213 53.044  1.00 37.37  ? 61  TRP A CD2 1 
ATOM   432  N NE1 . TRP A 1 62  ? 9.895  9.844  51.776  1.00 36.06  ? 61  TRP A NE1 1 
ATOM   433  C CE2 . TRP A 1 62  ? 9.333  9.974  53.018  1.00 36.49  ? 61  TRP A CE2 1 
ATOM   434  C CE3 . TRP A 1 62  ? 7.989  11.585 54.218  1.00 39.38  ? 61  TRP A CE3 1 
ATOM   435  C CZ2 . TRP A 1 62  ? 9.356  9.102  54.101  1.00 39.66  ? 61  TRP A CZ2 1 
ATOM   436  C CZ3 . TRP A 1 62  ? 8.007  10.712 55.310  1.00 39.31  ? 61  TRP A CZ3 1 
ATOM   437  C CH2 . TRP A 1 62  ? 8.691  9.489  55.243  1.00 39.01  ? 61  TRP A CH2 1 
ATOM   438  N N   . GLU A 1 63  ? 10.469 15.620 52.073  1.00 39.18  ? 62  GLU A N   1 
ATOM   439  C CA  . GLU A 1 63  ? 11.884 15.997 52.312  1.00 38.88  ? 62  GLU A CA  1 
ATOM   440  C C   . GLU A 1 63  ? 12.065 16.725 53.667  1.00 39.03  ? 62  GLU A C   1 
ATOM   441  O O   . GLU A 1 63  ? 12.944 16.388 54.447  1.00 39.11  ? 62  GLU A O   1 
ATOM   442  C CB  . GLU A 1 63  ? 12.417 16.875 51.174  1.00 36.24  ? 62  GLU A CB  1 
ATOM   443  C CG  . GLU A 1 63  ? 13.853 17.288 51.393  1.00 38.52  ? 62  GLU A CG  1 
ATOM   444  C CD  . GLU A 1 63  ? 14.540 17.768 50.127  1.00 40.75  ? 62  GLU A CD  1 
ATOM   445  O OE1 . GLU A 1 63  ? 15.590 17.201 49.767  1.00 44.17  ? 62  GLU A OE1 1 
ATOM   446  O OE2 . GLU A 1 63  ? 14.045 18.705 49.487  1.00 42.33  ? 62  GLU A OE2 1 
ATOM   447  N N   . ALA A 1 64  ? 11.204 17.706 53.918  1.00 39.52  ? 63  ALA A N   1 
ATOM   448  C CA  . ALA A 1 64  ? 11.231 18.484 55.156  1.00 39.81  ? 63  ALA A CA  1 
ATOM   449  C C   . ALA A 1 64  ? 10.828 17.603 56.357  1.00 40.64  ? 63  ALA A C   1 
ATOM   450  O O   . ALA A 1 64  ? 11.386 17.730 57.444  1.00 40.42  ? 63  ALA A O   1 
ATOM   451  C CB  . ALA A 1 64  ? 10.281 19.687 55.032  1.00 41.91  ? 63  ALA A CB  1 
ATOM   452  N N   . ILE A 1 65  ? 9.854  16.718 56.129  1.00 39.41  ? 64  ILE A N   1 
ATOM   453  C CA  . ILE A 1 65  ? 9.392  15.802 57.173  1.00 37.29  ? 64  ILE A CA  1 
ATOM   454  C C   . ILE A 1 65  ? 10.521 14.853 57.598  1.00 36.81  ? 64  ILE A C   1 
ATOM   455  O O   . ILE A 1 65  ? 10.807 14.713 58.784  1.00 35.44  ? 64  ILE A O   1 
ATOM   456  C CB  . ILE A 1 65  ? 8.174  14.926 56.721  1.00 38.49  ? 64  ILE A CB  1 
ATOM   457  C CG1 . ILE A 1 65  ? 6.941  15.799 56.430  1.00 37.84  ? 64  ILE A CG1 1 
ATOM   458  C CG2 . ILE A 1 65  ? 7.833  13.912 57.825  1.00 33.39  ? 64  ILE A CG2 1 
ATOM   459  C CD1 . ILE A 1 65  ? 6.286  16.390 57.679  1.00 39.86  ? 64  ILE A CD1 1 
ATOM   460  N N   . GLN A 1 66  ? 11.157 14.196 56.630  1.00 37.12  ? 65  GLN A N   1 
ATOM   461  C CA  . GLN A 1 66  ? 12.243 13.286 57.003  1.00 36.74  ? 65  GLN A CA  1 
ATOM   462  C C   . GLN A 1 66  ? 13.330 14.072 57.723  1.00 36.45  ? 65  GLN A C   1 
ATOM   463  O O   . GLN A 1 66  ? 13.919 13.594 58.695  1.00 36.78  ? 65  GLN A O   1 
ATOM   464  C CB  . GLN A 1 66  ? 12.823 12.585 55.783  1.00 37.35  ? 65  GLN A CB  1 
ATOM   465  C CG  . GLN A 1 66  ? 11.813 11.713 55.071  1.00 41.49  ? 65  GLN A CG  1 
ATOM   466  C CD  . GLN A 1 66  ? 12.431 10.931 53.949  1.00 43.90  ? 65  GLN A CD  1 
ATOM   467  O OE1 . GLN A 1 66  ? 13.083 9.921  54.171  1.00 46.44  ? 65  GLN A OE1 1 
ATOM   468  N NE2 . GLN A 1 66  ? 12.250 11.412 52.731  1.00 42.16  ? 65  GLN A NE2 1 
ATOM   469  N N   . ALA A 1 67  ? 13.559 15.291 57.246  1.00 34.03  ? 66  ALA A N   1 
ATOM   470  C CA  . ALA A 1 67  ? 14.554 16.145 57.855  1.00 33.03  ? 66  ALA A CA  1 
ATOM   471  C C   . ALA A 1 67  ? 14.185 16.443 59.321  1.00 31.69  ? 66  ALA A C   1 
ATOM   472  O O   . ALA A 1 67  ? 15.045 16.519 60.164  1.00 30.12  ? 66  ALA A O   1 
ATOM   473  C CB  . ALA A 1 67  ? 14.694 17.451 57.058  1.00 34.90  ? 66  ALA A CB  1 
ATOM   474  N N   . LEU A 1 68  ? 12.898 16.615 59.602  1.00 32.36  ? 67  LEU A N   1 
ATOM   475  C CA  . LEU A 1 68  ? 12.479 16.873 60.979  1.00 32.02  ? 67  LEU A CA  1 
ATOM   476  C C   . LEU A 1 68  ? 12.668 15.613 61.844  1.00 33.45  ? 67  LEU A C   1 
ATOM   477  O O   . LEU A 1 68  ? 12.958 15.708 63.006  1.00 36.38  ? 67  LEU A O   1 
ATOM   478  C CB  . LEU A 1 68  ? 11.034 17.360 61.010  1.00 30.84  ? 67  LEU A CB  1 
ATOM   479  C CG  . LEU A 1 68  ? 10.884 18.790 60.479  1.00 32.58  ? 67  LEU A CG  1 
ATOM   480  C CD1 . LEU A 1 68  ? 9.410  19.129 60.323  1.00 34.59  ? 67  LEU A CD1 1 
ATOM   481  C CD2 . LEU A 1 68  ? 11.568 19.779 61.422  1.00 31.34  ? 67  LEU A CD2 1 
ATOM   482  N N   . THR A 1 69  ? 12.501 14.436 61.249  1.00 35.17  ? 68  THR A N   1 
ATOM   483  C CA  . THR A 1 69  ? 12.730 13.185 61.979  1.00 34.92  ? 68  THR A CA  1 
ATOM   484  C C   . THR A 1 69  ? 14.228 13.046 62.275  1.00 36.58  ? 68  THR A C   1 
ATOM   485  O O   . THR A 1 69  ? 14.616 12.510 63.299  1.00 37.50  ? 68  THR A O   1 
ATOM   486  C CB  . THR A 1 69  ? 12.273 11.980 61.155  1.00 35.39  ? 68  THR A CB  1 
ATOM   487  O OG1 . THR A 1 69  ? 10.854 12.038 61.023  1.00 39.13  ? 68  THR A OG1 1 
ATOM   488  C CG2 . THR A 1 69  ? 12.664 10.664 61.815  1.00 31.21  ? 68  THR A CG2 1 
ATOM   489  N N   . VAL A 1 70  ? 15.047 13.526 61.338  1.00 37.06  ? 69  VAL A N   1 
ATOM   490  C CA  . VAL A 1 70  ? 16.499 13.518 61.508  1.00 37.77  ? 69  VAL A CA  1 
ATOM   491  C C   . VAL A 1 70  ? 16.909 14.481 62.638  1.00 39.94  ? 69  VAL A C   1 
ATOM   492  O O   . VAL A 1 70  ? 17.722 14.151 63.470  1.00 44.19  ? 69  VAL A O   1 
ATOM   493  C CB  . VAL A 1 70  ? 17.226 13.964 60.244  1.00 36.44  ? 69  VAL A CB  1 
ATOM   494  C CG1 . VAL A 1 70  ? 18.707 14.092 60.527  1.00 35.78  ? 69  VAL A CG1 1 
ATOM   495  C CG2 . VAL A 1 70  ? 16.992 12.976 59.146  1.00 36.99  ? 69  VAL A CG2 1 
ATOM   496  N N   . LEU A 1 71  ? 16.321 15.669 62.645  1.00 39.75  ? 70  LEU A N   1 
ATOM   497  C CA  . LEU A 1 71  ? 16.620 16.659 63.668  1.00 37.69  ? 70  LEU A CA  1 
ATOM   498  C C   . LEU A 1 71  ? 16.191 16.138 65.036  1.00 39.57  ? 70  LEU A C   1 
ATOM   499  O O   . LEU A 1 71  ? 16.904 16.278 66.021  1.00 38.75  ? 70  LEU A O   1 
ATOM   500  C CB  . LEU A 1 71  ? 15.882 17.953 63.346  1.00 33.59  ? 70  LEU A CB  1 
ATOM   501  C CG  . LEU A 1 71  ? 15.559 18.937 64.461  1.00 32.24  ? 70  LEU A CG  1 
ATOM   502  C CD1 . LEU A 1 71  ? 16.811 19.515 65.076  1.00 30.07  ? 70  LEU A CD1 1 
ATOM   503  C CD2 . LEU A 1 71  ? 14.691 20.049 63.859  1.00 34.42  ? 70  LEU A CD2 1 
ATOM   504  N N   . GLU A 1 72  ? 15.018 15.514 65.050  1.00 40.24  ? 71  GLU A N   1 
ATOM   505  C CA  . GLU A 1 72  ? 14.434 14.955 66.267  1.00 41.04  ? 71  GLU A CA  1 
ATOM   506  C C   . GLU A 1 72  ? 15.310 13.885 66.857  1.00 41.54  ? 71  GLU A C   1 
ATOM   507  O O   . GLU A 1 72  ? 15.584 13.875 68.049  1.00 43.89  ? 71  GLU A O   1 
ATOM   508  C CB  . GLU A 1 72  ? 13.079 14.339 65.970  1.00 41.65  ? 71  GLU A CB  1 
ATOM   509  C CG  . GLU A 1 72  ? 12.345 13.884 67.205  1.00 43.96  ? 71  GLU A CG  1 
ATOM   510  C CD  . GLU A 1 72  ? 10.999 13.232 66.885  1.00 47.08  ? 71  GLU A CD  1 
ATOM   511  O OE1 . GLU A 1 72  ? 10.170 13.125 67.803  1.00 49.83  ? 71  GLU A OE1 1 
ATOM   512  O OE2 . GLU A 1 72  ? 10.760 12.818 65.729  1.00 47.78  ? 71  GLU A OE2 1 
ATOM   513  N N   . THR A 1 73  ? 15.739 12.981 65.991  1.00 41.03  ? 72  THR A N   1 
ATOM   514  C CA  . THR A 1 73  ? 16.568 11.881 66.404  1.00 39.81  ? 72  THR A CA  1 
ATOM   515  C C   . THR A 1 73  ? 17.899 12.355 66.940  1.00 41.24  ? 72  THR A C   1 
ATOM   516  O O   . THR A 1 73  ? 18.314 11.921 67.996  1.00 42.28  ? 72  THR A O   1 
ATOM   517  C CB  . THR A 1 73  ? 16.820 10.938 65.260  1.00 39.35  ? 72  THR A CB  1 
ATOM   518  O OG1 . THR A 1 73  ? 15.580 10.348 64.856  1.00 41.08  ? 72  THR A OG1 1 
ATOM   519  C CG2 . THR A 1 73  ? 17.774 9.865  65.685  1.00 39.43  ? 72  THR A CG2 1 
ATOM   520  N N   . CYS A 1 74  ? 18.571 13.241 66.207  1.00 41.42  ? 73  CYS A N   1 
ATOM   521  C CA  . CYS A 1 74  ? 19.870 13.735 66.690  1.00 41.25  ? 73  CYS A CA  1 
ATOM   522  C C   . CYS A 1 74  ? 19.749 14.461 68.042  1.00 41.70  ? 73  CYS A C   1 
ATOM   523  O O   . CYS A 1 74  ? 20.675 14.435 68.827  1.00 43.48  ? 73  CYS A O   1 
ATOM   524  C CB  . CYS A 1 74  ? 20.532 14.659 65.680  1.00 38.91  ? 73  CYS A CB  1 
ATOM   525  S SG  . CYS A 1 74  ? 20.980 13.889 64.091  1.00 44.49  ? 73  CYS A SG  1 
ATOM   526  N N   . MET A 1 75  ? 18.615 15.110 68.294  1.00 41.14  ? 74  MET A N   1 
ATOM   527  C CA  . MET A 1 75  ? 18.442 15.789 69.570  1.00 41.67  ? 74  MET A CA  1 
ATOM   528  C C   . MET A 1 75  ? 18.452 14.748 70.728  1.00 44.34  ? 74  MET A C   1 
ATOM   529  O O   . MET A 1 75  ? 19.084 14.930 71.749  1.00 43.44  ? 74  MET A O   1 
ATOM   530  C CB  . MET A 1 75  ? 17.139 16.589 69.585  1.00 40.47  ? 74  MET A CB  1 
ATOM   531  C CG  . MET A 1 75  ? 17.200 17.930 68.852  1.00 38.23  ? 74  MET A CG  1 
ATOM   532  S SD  . MET A 1 75  ? 18.448 19.090 69.446  1.00 38.76  ? 74  MET A SD  1 
ATOM   533  C CE  . MET A 1 75  ? 17.594 19.887 70.830  1.00 36.90  ? 74  MET A CE  1 
ATOM   534  N N   . LYS A 1 76  ? 17.767 13.639 70.526  1.00 48.62  ? 75  LYS A N   1 
ATOM   535  C CA  . LYS A 1 76  ? 17.739 12.606 71.541  1.00 53.59  ? 75  LYS A CA  1 
ATOM   536  C C   . LYS A 1 76  ? 19.105 11.896 71.686  1.00 56.81  ? 75  LYS A C   1 
ATOM   537  O O   . LYS A 1 76  ? 19.575 11.676 72.795  1.00 59.83  ? 75  LYS A O   1 
ATOM   538  C CB  . LYS A 1 76  ? 16.643 11.598 71.213  1.00 53.67  ? 75  LYS A CB  1 
ATOM   539  C CG  . LYS A 1 76  ? 15.307 12.284 70.941  1.00 57.34  ? 75  LYS A CG  1 
ATOM   540  C CD  . LYS A 1 76  ? 14.119 11.369 71.150  1.00 57.57  ? 75  LYS A CD  1 
ATOM   541  C CE  . LYS A 1 76  ? 14.271 10.094 70.359  1.00 60.04  ? 75  LYS A CE  1 
ATOM   542  N NZ  . LYS A 1 76  ? 13.252 9.103  70.784  1.00 61.24  ? 75  LYS A NZ  1 
ATOM   543  N N   . SER A 1 77  ? 19.736 11.584 70.557  1.00 58.53  ? 76  SER A N   1 
ATOM   544  C CA  . SER A 1 77  ? 21.042 10.883 70.534  1.00 60.88  ? 76  SER A CA  1 
ATOM   545  C C   . SER A 1 77  ? 22.246 11.707 71.053  1.00 62.37  ? 76  SER A C   1 
ATOM   546  O O   . SER A 1 77  ? 22.872 11.356 72.049  1.00 64.14  ? 76  SER A O   1 
ATOM   547  C CB  . SER A 1 77  ? 21.362 10.422 69.107  1.00 61.30  ? 76  SER A CB  1 
ATOM   548  O OG  . SER A 1 77  ? 20.265 9.736  68.532  1.00 62.24  ? 76  SER A OG  1 
ATOM   549  N N   . CYS A 1 78  ? 22.555 12.788 70.347  1.00 63.69  ? 77  CYS A N   1 
ATOM   550  C CA  . CYS A 1 78  ? 23.698 13.653 70.681  1.00 64.48  ? 77  CYS A CA  1 
ATOM   551  C C   . CYS A 1 78  ? 23.510 14.469 71.985  1.00 65.29  ? 77  CYS A C   1 
ATOM   552  O O   . CYS A 1 78  ? 22.393 14.627 72.483  1.00 64.47  ? 77  CYS A O   1 
ATOM   553  C CB  . CYS A 1 78  ? 23.982 14.573 69.484  1.00 64.07  ? 77  CYS A CB  1 
ATOM   554  S SG  . CYS A 1 78  ? 24.014 13.662 67.888  1.00 62.39  ? 77  CYS A SG  1 
ATOM   555  N N   . GLY A 1 79  ? 24.626 14.969 72.515  1.00 66.82  ? 78  GLY A N   1 
ATOM   556  C CA  . GLY A 1 79  ? 24.595 15.737 73.748  1.00 68.72  ? 78  GLY A CA  1 
ATOM   557  C C   . GLY A 1 79  ? 24.586 17.246 73.567  1.00 69.72  ? 78  GLY A C   1 
ATOM   558  O O   . GLY A 1 79  ? 23.962 17.769 72.644  1.00 69.56  ? 78  GLY A O   1 
ATOM   559  N N   . LYS A 1 80  ? 25.284 17.950 74.457  1.00 70.26  ? 79  LYS A N   1 
ATOM   560  C CA  . LYS A 1 80  ? 25.337 19.420 74.393  1.00 70.41  ? 79  LYS A CA  1 
ATOM   561  C C   . LYS A 1 80  ? 26.027 19.944 73.111  1.00 69.86  ? 79  LYS A C   1 
ATOM   562  O O   . LYS A 1 80  ? 25.702 21.020 72.624  1.00 70.18  ? 79  LYS A O   1 
ATOM   563  C CB  . LYS A 1 80  ? 26.053 19.991 75.619  1.00 70.22  ? 79  LYS A CB  1 
ATOM   564  C CG  . LYS A 1 80  ? 25.941 21.501 75.713  1.00 69.62  ? 79  LYS A CG  1 
ATOM   565  C CD  . LYS A 1 80  ? 26.927 22.082 76.704  1.00 69.69  ? 79  LYS A CD  1 
ATOM   566  C CE  . LYS A 1 80  ? 26.736 23.586 76.862  1.00 68.15  ? 79  LYS A CE  1 
ATOM   567  N NZ  . LYS A 1 80  ? 25.399 23.915 77.435  1.00 67.22  ? 79  LYS A NZ  1 
ATOM   568  N N   . ARG A 1 81  ? 26.980 19.180 72.590  1.00 68.96  ? 80  ARG A N   1 
ATOM   569  C CA  . ARG A 1 81  ? 27.681 19.581 71.368  1.00 68.12  ? 80  ARG A CA  1 
ATOM   570  C C   . ARG A 1 81  ? 26.670 20.050 70.304  1.00 66.36  ? 80  ARG A C   1 
ATOM   571  O O   . ARG A 1 81  ? 26.780 21.152 69.786  1.00 67.69  ? 80  ARG A O   1 
ATOM   572  C CB  . ARG A 1 81  ? 28.507 18.399 70.841  1.00 71.92  ? 80  ARG A CB  1 
ATOM   573  C CG  . ARG A 1 81  ? 29.672 17.987 71.764  1.00 75.02  ? 80  ARG A CG  1 
ATOM   574  C CD  . ARG A 1 81  ? 29.772 16.463 71.966  1.00 76.47  ? 80  ARG A CD  1 
ATOM   575  N NE  . ARG A 1 81  ? 28.687 15.910 72.787  1.00 78.39  ? 80  ARG A NE  1 
ATOM   576  C CZ  . ARG A 1 81  ? 28.592 16.028 74.110  1.00 80.21  ? 80  ARG A CZ  1 
ATOM   577  N NH1 . ARG A 1 81  ? 29.522 16.686 74.796  1.00 80.88  ? 80  ARG A NH1 1 
ATOM   578  N NH2 . ARG A 1 81  ? 27.566 15.477 74.752  1.00 79.54  ? 80  ARG A NH2 1 
ATOM   579  N N   . PHE A 1 82  ? 25.681 19.199 70.028  1.00 63.08  ? 81  PHE A N   1 
ATOM   580  C CA  . PHE A 1 82  ? 24.611 19.480 69.044  1.00 59.60  ? 81  PHE A CA  1 
ATOM   581  C C   . PHE A 1 82  ? 23.489 20.337 69.670  1.00 59.14  ? 81  PHE A C   1 
ATOM   582  O O   . PHE A 1 82  ? 22.997 21.271 69.044  1.00 59.38  ? 81  PHE A O   1 
ATOM   583  C CB  . PHE A 1 82  ? 24.014 18.161 68.529  1.00 60.15  ? 81  PHE A CB  1 
ATOM   584  C CG  . PHE A 1 82  ? 22.978 18.318 67.425  1.00 59.46  ? 81  PHE A CG  1 
ATOM   585  C CD1 . PHE A 1 82  ? 23.359 18.629 66.125  1.00 58.24  ? 81  PHE A CD1 1 
ATOM   586  C CD2 . PHE A 1 82  ? 21.622 18.121 67.687  1.00 58.56  ? 81  PHE A CD2 1 
ATOM   587  C CE1 . PHE A 1 82  ? 22.413 18.733 65.109  1.00 56.95  ? 81  PHE A CE1 1 
ATOM   588  C CE2 . PHE A 1 82  ? 20.673 18.225 66.667  1.00 57.37  ? 81  PHE A CE2 1 
ATOM   589  C CZ  . PHE A 1 82  ? 21.071 18.532 65.384  1.00 56.55  ? 81  PHE A CZ  1 
ATOM   590  N N   . HIS A 1 83  ? 23.091 20.002 70.895  1.00 56.67  ? 82  HIS A N   1 
ATOM   591  C CA  . HIS A 1 83  ? 22.037 20.767 71.595  1.00 55.42  ? 82  HIS A CA  1 
ATOM   592  C C   . HIS A 1 83  ? 22.293 22.295 71.573  1.00 54.35  ? 82  HIS A C   1 
ATOM   593  O O   . HIS A 1 83  ? 21.377 23.084 71.387  1.00 53.68  ? 82  HIS A O   1 
ATOM   594  C CB  . HIS A 1 83  ? 21.913 20.297 73.047  1.00 55.56  ? 82  HIS A CB  1 
ATOM   595  C CG  . HIS A 1 83  ? 21.294 18.945 73.193  1.00 56.86  ? 82  HIS A CG  1 
ATOM   596  N ND1 . HIS A 1 83  ? 21.642 18.072 74.199  1.00 57.25  ? 82  HIS A ND1 1 
ATOM   597  C CD2 . HIS A 1 83  ? 20.347 18.312 72.458  1.00 56.13  ? 82  HIS A CD2 1 
ATOM   598  C CE1 . HIS A 1 83  ? 20.941 16.959 74.077  1.00 57.37  ? 82  HIS A CE1 1 
ATOM   599  N NE2 . HIS A 1 83  ? 20.148 17.082 73.028  1.00 56.00  ? 82  HIS A NE2 1 
ATOM   600  N N   . ASP A 1 84  ? 23.544 22.687 71.770  1.00 52.41  ? 83  ASP A N   1 
ATOM   601  C CA  . ASP A 1 84  ? 23.892 24.103 71.753  1.00 50.53  ? 83  ASP A CA  1 
ATOM   602  C C   . ASP A 1 84  ? 23.667 24.728 70.374  1.00 48.10  ? 83  ASP A C   1 
ATOM   603  O O   . ASP A 1 84  ? 23.221 25.865 70.281  1.00 48.73  ? 83  ASP A O   1 
ATOM   604  C CB  . ASP A 1 84  ? 25.354 24.288 72.159  1.00 52.28  ? 83  ASP A CB  1 
ATOM   605  C CG  . ASP A 1 84  ? 25.548 24.238 73.662  1.00 54.30  ? 83  ASP A CG  1 
ATOM   606  O OD1 . ASP A 1 84  ? 26.714 24.231 74.117  1.00 56.36  ? 83  ASP A OD1 1 
ATOM   607  O OD2 . ASP A 1 84  ? 24.530 24.212 74.391  1.00 55.52  ? 83  ASP A OD2 1 
ATOM   608  N N   . GLU A 1 85  ? 23.980 23.969 69.325  1.00 43.66  ? 84  GLU A N   1 
ATOM   609  C CA  . GLU A 1 85  ? 23.824 24.456 67.960  1.00 42.46  ? 84  GLU A CA  1 
ATOM   610  C C   . GLU A 1 85  ? 22.340 24.666 67.578  1.00 41.93  ? 84  GLU A C   1 
ATOM   611  O O   . GLU A 1 85  ? 21.995 25.652 66.950  1.00 42.55  ? 84  GLU A O   1 
ATOM   612  C CB  . GLU A 1 85  ? 24.497 23.499 66.983  1.00 42.99  ? 84  GLU A CB  1 
ATOM   613  C CG  . GLU A 1 85  ? 25.200 24.213 65.860  1.00 44.51  ? 84  GLU A CG  1 
ATOM   614  C CD  . GLU A 1 85  ? 26.143 25.283 66.376  1.00 48.77  ? 84  GLU A CD  1 
ATOM   615  O OE1 . GLU A 1 85  ? 25.808 26.494 66.256  1.00 49.73  ? 84  GLU A OE1 1 
ATOM   616  O OE2 . GLU A 1 85  ? 27.227 24.918 66.911  1.00 49.08  ? 84  GLU A OE2 1 
ATOM   617  N N   . VAL A 1 86  ? 21.484 23.728 67.968  1.00 39.04  ? 85  VAL A N   1 
ATOM   618  C CA  . VAL A 1 86  ? 20.054 23.838 67.705  1.00 36.92  ? 85  VAL A CA  1 
ATOM   619  C C   . VAL A 1 86  ? 19.472 24.909 68.629  1.00 38.65  ? 85  VAL A C   1 
ATOM   620  O O   . VAL A 1 86  ? 18.446 25.512 68.351  1.00 39.52  ? 85  VAL A O   1 
ATOM   621  C CB  . VAL A 1 86  ? 19.324 22.506 68.015  1.00 37.62  ? 85  VAL A CB  1 
ATOM   622  C CG1 . VAL A 1 86  ? 17.814 22.718 68.077  1.00 35.03  ? 85  VAL A CG1 1 
ATOM   623  C CG2 . VAL A 1 86  ? 19.678 21.465 66.980  1.00 35.12  ? 85  VAL A CG2 1 
ATOM   624  N N   . GLY A 1 87  ? 20.163 25.120 69.744  1.00 39.12  ? 86  GLY A N   1 
ATOM   625  C CA  . GLY A 1 87  ? 19.724 26.096 70.721  1.00 38.36  ? 86  GLY A CA  1 
ATOM   626  C C   . GLY A 1 87  ? 20.119 27.520 70.385  1.00 38.26  ? 86  GLY A C   1 
ATOM   627  O O   . GLY A 1 87  ? 19.925 28.420 71.186  1.00 38.17  ? 86  GLY A O   1 
ATOM   628  N N   . LYS A 1 88  ? 20.707 27.736 69.218  1.00 38.81  ? 87  LYS A N   1 
ATOM   629  C CA  . LYS A 1 88  ? 21.066 29.119 68.847  1.00 41.49  ? 87  LYS A CA  1 
ATOM   630  C C   . LYS A 1 88  ? 19.998 29.699 67.923  1.00 41.30  ? 87  LYS A C   1 
ATOM   631  O O   . LYS A 1 88  ? 19.330 28.971 67.201  1.00 42.41  ? 87  LYS A O   1 
ATOM   632  C CB  . LYS A 1 88  ? 22.429 29.190 68.139  1.00 41.26  ? 87  LYS A CB  1 
ATOM   633  C CG  . LYS A 1 88  ? 23.627 29.194 69.064  1.00 44.04  ? 87  LYS A CG  1 
ATOM   634  C CD  . LYS A 1 88  ? 24.937 29.309 68.291  1.00 46.46  ? 87  LYS A CD  1 
ATOM   635  C CE  . LYS A 1 88  ? 26.020 30.016 69.135  1.00 49.02  ? 87  LYS A CE  1 
ATOM   636  N NZ  . LYS A 1 88  ? 27.233 30.489 68.367  1.00 48.76  ? 87  LYS A NZ  1 
ATOM   637  N N   . PHE A 1 89  ? 19.821 31.008 67.972  1.00 40.41  ? 88  PHE A N   1 
ATOM   638  C CA  . PHE A 1 89  ? 18.846 31.607 67.103  1.00 39.27  ? 88  PHE A CA  1 
ATOM   639  C C   . PHE A 1 89  ? 19.267 31.431 65.638  1.00 39.55  ? 88  PHE A C   1 
ATOM   640  O O   . PHE A 1 89  ? 18.445 31.469 64.739  1.00 38.17  ? 88  PHE A O   1 
ATOM   641  C CB  . PHE A 1 89  ? 18.675 33.076 67.450  1.00 38.51  ? 88  PHE A CB  1 
ATOM   642  C CG  . PHE A 1 89  ? 18.001 33.305 68.764  1.00 38.36  ? 88  PHE A CG  1 
ATOM   643  C CD1 . PHE A 1 89  ? 16.788 32.678 69.052  1.00 37.36  ? 88  PHE A CD1 1 
ATOM   644  C CD2 . PHE A 1 89  ? 18.547 34.185 69.697  1.00 38.39  ? 88  PHE A CD2 1 
ATOM   645  C CE1 . PHE A 1 89  ? 16.115 32.928 70.248  1.00 37.98  ? 88  PHE A CE1 1 
ATOM   646  C CE2 . PHE A 1 89  ? 17.885 34.448 70.901  1.00 39.41  ? 88  PHE A CE2 1 
ATOM   647  C CZ  . PHE A 1 89  ? 16.660 33.817 71.184  1.00 39.14  ? 88  PHE A CZ  1 
ATOM   648  N N   . ARG A 1 90  ? 20.559 31.226 65.420  1.00 40.81  ? 89  ARG A N   1 
ATOM   649  C CA  . ARG A 1 90  ? 21.045 31.020 64.052  1.00 43.52  ? 89  ARG A CA  1 
ATOM   650  C C   . ARG A 1 90  ? 20.267 29.866 63.424  1.00 43.07  ? 89  ARG A C   1 
ATOM   651  O O   . ARG A 1 90  ? 20.021 29.842 62.226  1.00 44.24  ? 89  ARG A O   1 
ATOM   652  C CB  . ARG A 1 90  ? 22.547 30.714 64.047  1.00 44.81  ? 89  ARG A CB  1 
ATOM   653  C CG  . ARG A 1 90  ? 23.064 30.182 62.732  1.00 47.00  ? 89  ARG A CG  1 
ATOM   654  C CD  . ARG A 1 90  ? 24.576 30.042 62.718  1.00 49.85  ? 89  ARG A CD  1 
ATOM   655  N NE  . ARG A 1 90  ? 25.174 31.304 62.319  1.00 54.68  ? 89  ARG A NE  1 
ATOM   656  C CZ  . ARG A 1 90  ? 25.399 32.326 63.136  1.00 54.24  ? 89  ARG A CZ  1 
ATOM   657  N NH1 . ARG A 1 90  ? 25.094 32.237 64.425  1.00 55.83  ? 89  ARG A NH1 1 
ATOM   658  N NH2 . ARG A 1 90  ? 25.894 33.454 62.646  1.00 53.11  ? 89  ARG A NH2 1 
ATOM   659  N N   . PHE A 1 91  ? 19.879 28.908 64.258  1.00 41.62  ? 90  PHE A N   1 
ATOM   660  C CA  . PHE A 1 91  ? 19.078 27.795 63.748  1.00 39.62  ? 90  PHE A CA  1 
ATOM   661  C C   . PHE A 1 91  ? 17.586 27.975 64.094  1.00 39.06  ? 90  PHE A C   1 
ATOM   662  O O   . PHE A 1 91  ? 16.729 27.728 63.264  1.00 39.93  ? 90  PHE A O   1 
ATOM   663  C CB  . PHE A 1 91  ? 19.558 26.458 64.293  1.00 34.70  ? 90  PHE A CB  1 
ATOM   664  C CG  . PHE A 1 91  ? 18.747 25.290 63.813  1.00 32.74  ? 90  PHE A CG  1 
ATOM   665  C CD1 . PHE A 1 91  ? 18.975 24.725 62.559  1.00 36.28  ? 90  PHE A CD1 1 
ATOM   666  C CD2 . PHE A 1 91  ? 17.796 24.716 64.636  1.00 30.18  ? 90  PHE A CD2 1 
ATOM   667  C CE1 . PHE A 1 91  ? 18.271 23.590 62.140  1.00 34.53  ? 90  PHE A CE1 1 
ATOM   668  C CE2 . PHE A 1 91  ? 17.090 23.593 64.234  1.00 32.85  ? 90  PHE A CE2 1 
ATOM   669  C CZ  . PHE A 1 91  ? 17.326 23.021 62.985  1.00 33.43  ? 90  PHE A CZ  1 
ATOM   670  N N   . LEU A 1 92  ? 17.287 28.410 65.313  1.00 37.06  ? 91  LEU A N   1 
ATOM   671  C CA  . LEU A 1 92  ? 15.879 28.574 65.673  1.00 37.14  ? 91  LEU A CA  1 
ATOM   672  C C   . LEU A 1 92  ? 15.176 29.545 64.714  1.00 37.90  ? 91  LEU A C   1 
ATOM   673  O O   . LEU A 1 92  ? 13.994 29.382 64.430  1.00 37.36  ? 91  LEU A O   1 
ATOM   674  C CB  . LEU A 1 92  ? 15.738 29.043 67.118  1.00 34.60  ? 91  LEU A CB  1 
ATOM   675  C CG  . LEU A 1 92  ? 16.373 28.058 68.093  1.00 36.95  ? 91  LEU A CG  1 
ATOM   676  C CD1 . LEU A 1 92  ? 16.443 28.655 69.492  1.00 35.76  ? 91  LEU A CD1 1 
ATOM   677  C CD2 . LEU A 1 92  ? 15.583 26.761 68.074  1.00 36.26  ? 91  LEU A CD2 1 
ATOM   678  N N   . ASN A 1 93  ? 15.902 30.544 64.215  1.00 37.49  ? 92  ASN A N   1 
ATOM   679  C CA  . ASN A 1 93  ? 15.253 31.478 63.265  1.00 38.97  ? 92  ASN A CA  1 
ATOM   680  C C   . ASN A 1 93  ? 14.750 30.702 62.007  1.00 38.50  ? 92  ASN A C   1 
ATOM   681  O O   . ASN A 1 93  ? 13.664 30.981 61.503  1.00 40.52  ? 92  ASN A O   1 
ATOM   682  C CB  . ASN A 1 93  ? 16.190 32.649 62.861  1.00 37.18  ? 92  ASN A CB  1 
ATOM   683  C CG  . ASN A 1 93  ? 16.249 33.763 63.921  1.00 38.15  ? 92  ASN A CG  1 
ATOM   684  O OD1 . ASN A 1 93  ? 15.416 33.829 64.809  1.00 36.39  ? 92  ASN A OD1 1 
ATOM   685  N ND2 . ASN A 1 93  ? 17.241 34.643 63.810  1.00 37.03  ? 92  ASN A ND2 1 
ATOM   686  N N   . GLU A 1 94  ? 15.535 29.725 61.544  1.00 36.45  ? 93  GLU A N   1 
ATOM   687  C CA  . GLU A 1 94  ? 15.135 28.906 60.388  1.00 38.27  ? 93  GLU A CA  1 
ATOM   688  C C   . GLU A 1 94  ? 13.797 28.129 60.679  1.00 38.66  ? 93  GLU A C   1 
ATOM   689  O O   . GLU A 1 94  ? 12.914 28.036 59.820  1.00 40.60  ? 93  GLU A O   1 
ATOM   690  C CB  . GLU A 1 94  ? 16.252 27.923 60.003  1.00 40.38  ? 93  GLU A CB  1 
ATOM   691  C CG  . GLU A 1 94  ? 17.618 28.561 59.591  1.00 43.29  ? 93  GLU A CG  1 
ATOM   692  C CD  . GLU A 1 94  ? 17.517 29.862 58.765  1.00 44.83  ? 93  GLU A CD  1 
ATOM   693  O OE1 . GLU A 1 94  ? 16.641 29.981 57.886  1.00 44.52  ? 93  GLU A OE1 1 
ATOM   694  O OE2 . GLU A 1 94  ? 18.345 30.773 58.990  1.00 48.07  ? 93  GLU A OE2 1 
ATOM   695  N N   . LEU A 1 95  ? 13.664 27.593 61.890  1.00 36.99  ? 94  LEU A N   1 
ATOM   696  C CA  . LEU A 1 95  ? 12.435 26.920 62.296  1.00 35.53  ? 94  LEU A CA  1 
ATOM   697  C C   . LEU A 1 95  ? 11.277 27.932 62.409  1.00 39.02  ? 94  LEU A C   1 
ATOM   698  O O   . LEU A 1 95  ? 10.121 27.603 62.125  1.00 43.30  ? 94  LEU A O   1 
ATOM   699  C CB  . LEU A 1 95  ? 12.620 26.250 63.651  1.00 32.55  ? 94  LEU A CB  1 
ATOM   700  C CG  . LEU A 1 95  ? 13.587 25.074 63.640  1.00 32.26  ? 94  LEU A CG  1 
ATOM   701  C CD1 . LEU A 1 95  ? 13.558 24.378 64.997  1.00 27.65  ? 94  LEU A CD1 1 
ATOM   702  C CD2 . LEU A 1 95  ? 13.180 24.110 62.516  1.00 27.80  ? 94  LEU A CD2 1 
ATOM   703  N N   . ILE A 1 96  ? 11.585 29.154 62.847  1.00 37.25  ? 95  ILE A N   1 
ATOM   704  C CA  . ILE A 1 96  ? 10.539 30.168 62.962  1.00 35.36  ? 95  ILE A CA  1 
ATOM   705  C C   . ILE A 1 96  ? 10.028 30.623 61.597  1.00 35.84  ? 95  ILE A C   1 
ATOM   706  O O   . ILE A 1 96  ? 8.849  30.867 61.430  1.00 36.45  ? 95  ILE A O   1 
ATOM   707  C CB  . ILE A 1 96  ? 11.002 31.392 63.705  1.00 34.09  ? 95  ILE A CB  1 
ATOM   708  C CG1 . ILE A 1 96  ? 11.258 31.026 65.150  1.00 34.67  ? 95  ILE A CG1 1 
ATOM   709  C CG2 . ILE A 1 96  ? 9.922  32.449 63.658  1.00 34.54  ? 95  ILE A CG2 1 
ATOM   710  C CD1 . ILE A 1 96  ? 11.904 32.155 65.939  1.00 33.51  ? 95  ILE A CD1 1 
ATOM   711  N N   . LYS A 1 97  ? 10.925 30.741 60.630  1.00 33.91  ? 96  LYS A N   1 
ATOM   712  C CA  . LYS A 1 97  ? 10.474 31.139 59.334  1.00 34.01  ? 96  LYS A CA  1 
ATOM   713  C C   . LYS A 1 97  ? 9.542  30.072 58.742  1.00 34.93  ? 96  LYS A C   1 
ATOM   714  O O   . LYS A 1 97  ? 8.654  30.374 57.978  1.00 35.19  ? 96  LYS A O   1 
ATOM   715  C CB  . LYS A 1 97  ? 11.642 31.341 58.384  1.00 35.67  ? 96  LYS A CB  1 
ATOM   716  C CG  . LYS A 1 97  ? 12.553 32.484 58.702  1.00 37.34  ? 96  LYS A CG  1 
ATOM   717  C CD  . LYS A 1 97  ? 13.694 32.467 57.702  1.00 40.38  ? 96  LYS A CD  1 
ATOM   718  C CE  . LYS A 1 97  ? 14.832 33.393 58.117  1.00 42.68  ? 96  LYS A CE  1 
ATOM   719  N NZ  . LYS A 1 97  ? 16.007 33.242 57.197  1.00 39.90  ? 96  LYS A NZ  1 
ATOM   720  N N   . VAL A 1 98  ? 9.742  28.818 59.108  1.00 34.56  ? 97  VAL A N   1 
ATOM   721  C CA  . VAL A 1 98  ? 8.876  27.780 58.531  1.00 35.97  ? 97  VAL A CA  1 
ATOM   722  C C   . VAL A 1 98  ? 7.420  27.783 59.084  1.00 38.98  ? 97  VAL A C   1 
ATOM   723  O O   . VAL A 1 98  ? 6.479  27.504 58.340  1.00 38.57  ? 97  VAL A O   1 
ATOM   724  C CB  . VAL A 1 98  ? 9.481  26.381 58.725  1.00 32.91  ? 97  VAL A CB  1 
ATOM   725  C CG1 . VAL A 1 98  ? 8.522  25.319 58.232  1.00 30.44  ? 97  VAL A CG1 1 
ATOM   726  C CG2 . VAL A 1 98  ? 10.766 26.306 57.959  1.00 33.84  ? 97  VAL A CG2 1 
ATOM   727  N N   . VAL A 1 99  ? 7.266  28.111 60.370  1.00 40.02  ? 98  VAL A N   1 
ATOM   728  C CA  . VAL A 1 99  ? 5.962  28.120 61.031  1.00 40.56  ? 98  VAL A CA  1 
ATOM   729  C C   . VAL A 1 99  ? 5.359  29.539 61.213  1.00 46.06  ? 98  VAL A C   1 
ATOM   730  O O   . VAL A 1 99  ? 4.165  29.670 61.426  1.00 47.60  ? 98  VAL A O   1 
ATOM   731  C CB  . VAL A 1 99  ? 6.055  27.458 62.422  1.00 37.74  ? 98  VAL A CB  1 
ATOM   732  C CG1 . VAL A 1 99  ? 6.739  26.118 62.322  1.00 37.45  ? 98  VAL A CG1 1 
ATOM   733  C CG2 . VAL A 1 99  ? 6.807  28.364 63.375  1.00 38.39  ? 98  VAL A CG2 1 
ATOM   734  N N   . SER A 1 100 ? 6.171  30.590 61.138  1.00 51.10  ? 99  SER A N   1 
ATOM   735  C CA  . SER A 1 100 ? 5.620  31.962 61.330  1.00 55.57  ? 99  SER A CA  1 
ATOM   736  C C   . SER A 1 100 ? 4.958  32.542 60.045  1.00 57.11  ? 99  SER A C   1 
ATOM   737  O O   . SER A 1 100 ? 5.581  32.624 59.008  1.00 57.88  ? 99  SER A O   1 
ATOM   738  C CB  . SER A 1 100 ? 6.716  32.905 61.829  1.00 56.15  ? 99  SER A CB  1 
ATOM   739  O OG  . SER A 1 100 ? 6.187  34.176 62.179  1.00 59.14  ? 99  SER A OG  1 
ATOM   740  N N   . PRO A 1 101 ? 3.675  32.937 60.131  1.00 58.42  ? 100 PRO A N   1 
ATOM   741  C CA  . PRO A 1 101 ? 2.960  33.491 58.977  1.00 59.33  ? 100 PRO A CA  1 
ATOM   742  C C   . PRO A 1 101 ? 3.729  34.642 58.310  1.00 60.58  ? 100 PRO A C   1 
ATOM   743  O O   . PRO A 1 101 ? 3.672  34.812 57.105  1.00 61.23  ? 100 PRO A O   1 
ATOM   744  C CB  . PRO A 1 101 ? 1.638  33.958 59.580  1.00 58.95  ? 100 PRO A CB  1 
ATOM   745  C CG  . PRO A 1 101 ? 1.415  32.964 60.695  1.00 59.69  ? 100 PRO A CG  1 
ATOM   746  C CD  . PRO A 1 101 ? 2.799  32.901 61.316  1.00 59.65  ? 100 PRO A CD  1 
ATOM   747  N N   . LYS A 1 102 ? 4.442  35.419 59.114  1.00 60.95  ? 101 LYS A N   1 
ATOM   748  C CA  . LYS A 1 102 ? 5.213  36.533 58.580  1.00 61.07  ? 101 LYS A CA  1 
ATOM   749  C C   . LYS A 1 102 ? 6.250  36.051 57.553  1.00 60.47  ? 101 LYS A C   1 
ATOM   750  O O   . LYS A 1 102 ? 6.922  36.858 56.947  1.00 59.91  ? 101 LYS A O   1 
ATOM   751  C CB  . LYS A 1 102 ? 5.949  37.267 59.706  1.00 64.37  ? 101 LYS A CB  1 
ATOM   752  C CG  . LYS A 1 102 ? 5.130  37.502 60.965  1.00 67.28  ? 101 LYS A CG  1 
ATOM   753  C CD  . LYS A 1 102 ? 5.917  38.265 62.034  1.00 68.61  ? 101 LYS A CD  1 
ATOM   754  C CE  . LYS A 1 102 ? 5.021  38.550 63.243  1.00 70.50  ? 101 LYS A CE  1 
ATOM   755  N NZ  . LYS A 1 102 ? 5.655  39.341 64.338  1.00 70.30  ? 101 LYS A NZ  1 
ATOM   756  N N   . TYR A 1 103 ? 6.389  34.733 57.397  1.00 60.23  ? 102 TYR A N   1 
ATOM   757  C CA  . TYR A 1 103 ? 7.360  34.164 56.423  1.00 60.49  ? 102 TYR A CA  1 
ATOM   758  C C   . TYR A 1 103 ? 6.791  32.936 55.673  1.00 60.73  ? 102 TYR A C   1 
ATOM   759  O O   . TYR A 1 103 ? 5.613  32.897 55.334  1.00 64.00  ? 102 TYR A O   1 
ATOM   760  C CB  . TYR A 1 103 ? 8.677  33.764 57.107  1.00 60.14  ? 102 TYR A CB  1 
ATOM   761  C CG  . TYR A 1 103 ? 9.159  34.735 58.157  1.00 60.99  ? 102 TYR A CG  1 
ATOM   762  C CD1 . TYR A 1 103 ? 8.659  34.680 59.453  1.00 61.38  ? 102 TYR A CD1 1 
ATOM   763  C CD2 . TYR A 1 103 ? 10.058 35.750 57.844  1.00 62.14  ? 102 TYR A CD2 1 
ATOM   764  C CE1 . TYR A 1 103 ? 9.029  35.614 60.412  1.00 61.81  ? 102 TYR A CE1 1 
ATOM   765  C CE2 . TYR A 1 103 ? 10.438 36.697 58.801  1.00 61.81  ? 102 TYR A CE2 1 
ATOM   766  C CZ  . TYR A 1 103 ? 9.911  36.623 60.081  1.00 62.48  ? 102 TYR A CZ  1 
ATOM   767  O OH  . TYR A 1 103 ? 10.210 37.577 61.027  1.00 63.18  ? 102 TYR A OH  1 
ATOM   768  N N   . LEU A 1 104 ? 7.635  31.943 55.425  1.00 58.46  ? 103 LEU A N   1 
ATOM   769  C CA  . LEU A 1 104 ? 7.195  30.741 54.715  1.00 57.62  ? 103 LEU A CA  1 
ATOM   770  C C   . LEU A 1 104 ? 5.916  30.104 55.321  1.00 58.26  ? 103 LEU A C   1 
ATOM   771  O O   . LEU A 1 104 ? 5.289  29.262 54.686  1.00 58.33  ? 103 LEU A O   1 
ATOM   772  C CB  . LEU A 1 104 ? 8.320  29.701 54.702  1.00 56.50  ? 103 LEU A CB  1 
ATOM   773  C CG  . LEU A 1 104 ? 9.570  29.983 53.866  1.00 54.37  ? 103 LEU A CG  1 
ATOM   774  C CD1 . LEU A 1 104 ? 10.148 31.321 54.247  1.00 54.18  ? 103 LEU A CD1 1 
ATOM   775  C CD2 . LEU A 1 104 ? 10.591 28.870 54.068  1.00 53.70  ? 103 LEU A CD2 1 
ATOM   776  N N   . GLY A 1 105 ? 5.553  30.522 56.537  1.00 58.48  ? 104 GLY A N   1 
ATOM   777  C CA  . GLY A 1 105 ? 4.381  29.984 57.218  1.00 59.16  ? 104 GLY A CA  1 
ATOM   778  C C   . GLY A 1 105 ? 3.174  29.687 56.340  1.00 60.06  ? 104 GLY A C   1 
ATOM   779  O O   . GLY A 1 105 ? 2.649  28.578 56.332  1.00 59.50  ? 104 GLY A O   1 
ATOM   780  N N   . SER A 1 106 ? 2.739  30.699 55.601  1.00 60.31  ? 105 SER A N   1 
ATOM   781  C CA  . SER A 1 106 ? 1.591  30.580 54.696  1.00 61.89  ? 105 SER A CA  1 
ATOM   782  C C   . SER A 1 106 ? 1.775  29.452 53.661  1.00 61.83  ? 105 SER A C   1 
ATOM   783  O O   . SER A 1 106 ? 0.873  28.689 53.401  1.00 61.74  ? 105 SER A O   1 
ATOM   784  C CB  . SER A 1 106 ? 1.385  31.905 53.951  1.00 63.20  ? 105 SER A CB  1 
ATOM   785  O OG  . SER A 1 106 ? 1.060  32.965 54.840  1.00 64.93  ? 105 SER A OG  1 
ATOM   786  N N   . ARG A 1 107 ? 2.974  29.371 53.098  1.00 62.55  ? 106 ARG A N   1 
ATOM   787  C CA  . ARG A 1 107 ? 3.313  28.378 52.067  1.00 61.53  ? 106 ARG A CA  1 
ATOM   788  C C   . ARG A 1 107 ? 3.859  27.041 52.614  1.00 59.70  ? 106 ARG A C   1 
ATOM   789  O O   . ARG A 1 107 ? 4.474  26.297 51.880  1.00 60.76  ? 106 ARG A O   1 
ATOM   790  C CB  . ARG A 1 107 ? 4.339  28.992 51.115  1.00 63.76  ? 106 ARG A CB  1 
ATOM   791  C CG  . ARG A 1 107 ? 3.860  30.302 50.495  1.00 68.92  ? 106 ARG A CG  1 
ATOM   792  C CD  . ARG A 1 107 ? 5.010  31.241 50.145  1.00 73.29  ? 106 ARG A CD  1 
ATOM   793  N NE  . ARG A 1 107 ? 6.066  30.576 49.377  1.00 78.35  ? 106 ARG A NE  1 
ATOM   794  C CZ  . ARG A 1 107 ? 7.199  30.110 49.898  1.00 80.24  ? 106 ARG A CZ  1 
ATOM   795  N NH1 . ARG A 1 107 ? 7.433  30.240 51.198  1.00 80.46  ? 106 ARG A NH1 1 
ATOM   796  N NH2 . ARG A 1 107 ? 8.092  29.503 49.121  1.00 81.08  ? 106 ARG A NH2 1 
ATOM   797  N N   . THR A 1 108 ? 3.606  26.739 53.882  1.00 56.66  ? 107 THR A N   1 
ATOM   798  C CA  . THR A 1 108 ? 4.116  25.492 54.479  1.00 53.65  ? 107 THR A CA  1 
ATOM   799  C C   . THR A 1 108 ? 2.994  24.549 55.000  1.00 51.96  ? 107 THR A C   1 
ATOM   800  O O   . THR A 1 108 ? 2.063  25.007 55.624  1.00 51.96  ? 107 THR A O   1 
ATOM   801  C CB  . THR A 1 108 ? 5.058  25.832 55.638  1.00 53.75  ? 107 THR A CB  1 
ATOM   802  O OG1 . THR A 1 108 ? 6.254  26.437 55.128  1.00 50.08  ? 107 THR A OG1 1 
ATOM   803  C CG2 . THR A 1 108 ? 5.388  24.590 56.430  1.00 53.29  ? 107 THR A CG2 1 
ATOM   804  N N   . SER A 1 109 ? 3.128  23.246 54.751  1.00 50.00  ? 108 SER A N   1 
ATOM   805  C CA  . SER A 1 109 ? 2.121  22.235 55.172  1.00 49.85  ? 108 SER A CA  1 
ATOM   806  C C   . SER A 1 109 ? 1.926  22.130 56.677  1.00 51.99  ? 108 SER A C   1 
ATOM   807  O O   . SER A 1 109 ? 2.890  22.069 57.433  1.00 54.05  ? 108 SER A O   1 
ATOM   808  C CB  . SER A 1 109 ? 2.493  20.848 54.660  1.00 48.86  ? 108 SER A CB  1 
ATOM   809  O OG  . SER A 1 109 ? 3.778  20.473 55.096  1.00 45.14  ? 108 SER A OG  1 
ATOM   810  N N   . GLU A 1 110 ? 0.665  22.072 57.092  1.00 52.48  ? 109 GLU A N   1 
ATOM   811  C CA  . GLU A 1 110 ? 0.334  21.974 58.516  1.00 52.65  ? 109 GLU A CA  1 
ATOM   812  C C   . GLU A 1 110 ? 1.044  20.784 59.179  1.00 51.40  ? 109 GLU A C   1 
ATOM   813  O O   . GLU A 1 110 ? 1.314  20.803 60.371  1.00 51.03  ? 109 GLU A O   1 
ATOM   814  C CB  . GLU A 1 110 ? -1.180 21.826 58.723  1.00 55.66  ? 109 GLU A CB  1 
ATOM   815  C CG  . GLU A 1 110 ? -2.052 22.719 57.834  1.00 63.09  ? 109 GLU A CG  1 
ATOM   816  C CD  . GLU A 1 110 ? -1.710 24.222 57.911  1.00 65.73  ? 109 GLU A CD  1 
ATOM   817  O OE1 . GLU A 1 110 ? -1.773 24.814 59.013  1.00 65.65  ? 109 GLU A OE1 1 
ATOM   818  O OE2 . GLU A 1 110 ? -1.390 24.811 56.851  1.00 67.75  ? 109 GLU A OE2 1 
ATOM   819  N N   . LYS A 1 111 ? 1.336  19.753 58.394  1.00 49.07  ? 110 LYS A N   1 
ATOM   820  C CA  . LYS A 1 111 ? 2.011  18.582 58.945  1.00 48.22  ? 110 LYS A CA  1 
ATOM   821  C C   . LYS A 1 111 ? 3.403  18.988 59.463  1.00 46.84  ? 110 LYS A C   1 
ATOM   822  O O   . LYS A 1 111 ? 3.738  18.770 60.611  1.00 46.10  ? 110 LYS A O   1 
ATOM   823  C CB  . LYS A 1 111 ? 2.124  17.487 57.874  1.00 49.33  ? 110 LYS A CB  1 
ATOM   824  C CG  . LYS A 1 111 ? 2.363  16.080 58.425  1.00 51.19  ? 110 LYS A CG  1 
ATOM   825  C CD  . LYS A 1 111 ? 2.437  15.020 57.322  1.00 53.96  ? 110 LYS A CD  1 
ATOM   826  C CE  . LYS A 1 111 ? 1.160  14.967 56.466  1.00 57.05  ? 110 LYS A CE  1 
ATOM   827  N NZ  . LYS A 1 111 ? -0.108 14.716 57.242  1.00 57.61  ? 110 LYS A NZ  1 
ATOM   828  N N   . VAL A 1 112 ? 4.185  19.599 58.584  1.00 44.75  ? 111 VAL A N   1 
ATOM   829  C CA  . VAL A 1 112 ? 5.505  20.069 58.939  1.00 41.83  ? 111 VAL A CA  1 
ATOM   830  C C   . VAL A 1 112 ? 5.432  21.129 60.056  1.00 41.05  ? 111 VAL A C   1 
ATOM   831  O O   . VAL A 1 112 ? 6.105  21.009 61.061  1.00 40.74  ? 111 VAL A O   1 
ATOM   832  C CB  . VAL A 1 112 ? 6.202  20.664 57.704  1.00 41.69  ? 111 VAL A CB  1 
ATOM   833  C CG1 . VAL A 1 112 ? 7.549  21.267 58.089  1.00 39.38  ? 111 VAL A CG1 1 
ATOM   834  C CG2 . VAL A 1 112 ? 6.389  19.576 56.655  1.00 39.66  ? 111 VAL A CG2 1 
ATOM   835  N N   . LYS A 1 113 ? 4.597  22.147 59.879  1.00 40.85  ? 112 LYS A N   1 
ATOM   836  C CA  . LYS A 1 113 ? 4.492  23.191 60.915  1.00 41.35  ? 112 LYS A CA  1 
ATOM   837  C C   . LYS A 1 113 ? 4.156  22.631 62.298  1.00 41.41  ? 112 LYS A C   1 
ATOM   838  O O   . LYS A 1 113 ? 4.757  23.024 63.300  1.00 41.98  ? 112 LYS A O   1 
ATOM   839  C CB  . LYS A 1 113 ? 3.450  24.239 60.541  1.00 41.37  ? 112 LYS A CB  1 
ATOM   840  C CG  . LYS A 1 113 ? 3.950  25.273 59.579  1.00 42.65  ? 112 LYS A CG  1 
ATOM   841  C CD  . LYS A 1 113 ? 2.927  26.351 59.406  1.00 44.80  ? 112 LYS A CD  1 
ATOM   842  C CE  . LYS A 1 113 ? 1.755  25.823 58.602  1.00 47.69  ? 112 LYS A CE  1 
ATOM   843  N NZ  . LYS A 1 113 ? 0.762  26.889 58.255  1.00 51.88  ? 112 LYS A NZ  1 
ATOM   844  N N   . ASN A 1 114 ? 3.186  21.728 62.360  1.00 40.92  ? 113 ASN A N   1 
ATOM   845  C CA  . ASN A 1 114 ? 2.849  21.157 63.672  1.00 41.51  ? 113 ASN A CA  1 
ATOM   846  C C   . ASN A 1 114 ? 4.011  20.302 64.207  1.00 39.04  ? 113 ASN A C   1 
ATOM   847  O O   . ASN A 1 114 ? 4.249  20.265 65.408  1.00 40.61  ? 113 ASN A O   1 
ATOM   848  C CB  . ASN A 1 114 ? 1.544  20.329 63.624  1.00 43.12  ? 113 ASN A CB  1 
ATOM   849  C CG  . ASN A 1 114 ? 0.301  21.197 63.358  1.00 45.92  ? 113 ASN A CG  1 
ATOM   850  O OD1 . ASN A 1 114 ? 0.273  22.394 63.695  1.00 47.37  ? 113 ASN A OD1 1 
ATOM   851  N ND2 . ASN A 1 114 ? -0.731 20.592 62.767  1.00 43.32  ? 113 ASN A ND2 1 
ATOM   852  N N   . LYS A 1 115 ? 4.731  19.641 63.309  1.00 35.13  ? 114 LYS A N   1 
ATOM   853  C CA  . LYS A 1 115 ? 5.868  18.832 63.733  1.00 35.57  ? 114 LYS A CA  1 
ATOM   854  C C   . LYS A 1 115 ? 6.956  19.718 64.394  1.00 37.35  ? 114 LYS A C   1 
ATOM   855  O O   . LYS A 1 115 ? 7.514  19.369 65.439  1.00 37.30  ? 114 LYS A O   1 
ATOM   856  C CB  . LYS A 1 115 ? 6.450  18.079 62.541  1.00 35.28  ? 114 LYS A CB  1 
ATOM   857  C CG  . LYS A 1 115 ? 7.618  17.177 62.876  1.00 37.82  ? 114 LYS A CG  1 
ATOM   858  C CD  . LYS A 1 115 ? 7.234  16.047 63.803  1.00 37.83  ? 114 LYS A CD  1 
ATOM   859  C CE  . LYS A 1 115 ? 8.366  15.031 63.872  1.00 39.72  ? 114 LYS A CE  1 
ATOM   860  N NZ  . LYS A 1 115 ? 8.373  14.234 65.135  1.00 37.06  ? 114 LYS A NZ  1 
ATOM   861  N N   . ILE A 1 116 ? 7.240  20.860 63.767  1.00 36.92  ? 115 ILE A N   1 
ATOM   862  C CA  . ILE A 1 116 ? 8.221  21.814 64.304  1.00 35.78  ? 115 ILE A CA  1 
ATOM   863  C C   . ILE A 1 116 ? 7.791  22.314 65.695  1.00 37.33  ? 115 ILE A C   1 
ATOM   864  O O   . ILE A 1 116 ? 8.607  22.406 66.606  1.00 37.48  ? 115 ILE A O   1 
ATOM   865  C CB  . ILE A 1 116 ? 8.380  23.015 63.352  1.00 34.94  ? 115 ILE A CB  1 
ATOM   866  C CG1 . ILE A 1 116 ? 9.295  22.609 62.202  1.00 32.85  ? 115 ILE A CG1 1 
ATOM   867  C CG2 . ILE A 1 116 ? 8.915  24.220 64.100  1.00 33.48  ? 115 ILE A CG2 1 
ATOM   868  C CD1 . ILE A 1 116 ? 9.198  23.516 61.034  1.00 31.35  ? 115 ILE A CD1 1 
ATOM   869  N N   . LEU A 1 117 ? 6.499  22.621 65.833  1.00 38.04  ? 116 LEU A N   1 
ATOM   870  C CA  . LEU A 1 117 ? 5.955  23.092 67.109  1.00 37.81  ? 116 LEU A CA  1 
ATOM   871  C C   . LEU A 1 117 ? 6.012  21.995 68.185  1.00 39.01  ? 116 LEU A C   1 
ATOM   872  O O   . LEU A 1 117 ? 6.186  22.279 69.350  1.00 40.19  ? 116 LEU A O   1 
ATOM   873  C CB  . LEU A 1 117 ? 4.523  23.579 66.926  1.00 37.30  ? 116 LEU A CB  1 
ATOM   874  C CG  . LEU A 1 117 ? 4.355  24.718 65.916  1.00 39.05  ? 116 LEU A CG  1 
ATOM   875  C CD1 . LEU A 1 117 ? 2.925  25.212 65.964  1.00 37.87  ? 116 LEU A CD1 1 
ATOM   876  C CD2 . LEU A 1 117 ? 5.305  25.849 66.232  1.00 37.71  ? 116 LEU A CD2 1 
ATOM   877  N N   . GLU A 1 118 ? 5.851  20.743 67.785  1.00 41.33  ? 117 GLU A N   1 
ATOM   878  C CA  . GLU A 1 118 ? 5.948  19.656 68.757  1.00 42.70  ? 117 GLU A CA  1 
ATOM   879  C C   . GLU A 1 118 ? 7.397  19.540 69.260  1.00 41.18  ? 117 GLU A C   1 
ATOM   880  O O   . GLU A 1 118 ? 7.639  19.422 70.448  1.00 40.49  ? 117 GLU A O   1 
ATOM   881  C CB  . GLU A 1 118 ? 5.551  18.329 68.127  1.00 45.87  ? 117 GLU A CB  1 
ATOM   882  C CG  . GLU A 1 118 ? 4.101  18.201 67.789  1.00 53.11  ? 117 GLU A CG  1 
ATOM   883  C CD  . GLU A 1 118 ? 3.770  16.831 67.214  1.00 57.23  ? 117 GLU A CD  1 
ATOM   884  O OE1 . GLU A 1 118 ? 3.920  16.643 65.982  1.00 59.48  ? 117 GLU A OE1 1 
ATOM   885  O OE2 . GLU A 1 118 ? 3.370  15.945 68.001  1.00 57.06  ? 117 GLU A OE2 1 
ATOM   886  N N   . LEU A 1 119 ? 8.351  19.579 68.335  1.00 40.38  ? 118 LEU A N   1 
ATOM   887  C CA  . LEU A 1 119 ? 9.754  19.478 68.727  1.00 40.87  ? 118 LEU A CA  1 
ATOM   888  C C   . LEU A 1 119 ? 10.148 20.690 69.573  1.00 41.48  ? 118 LEU A C   1 
ATOM   889  O O   . LEU A 1 119 ? 10.666 20.537 70.668  1.00 40.75  ? 118 LEU A O   1 
ATOM   890  C CB  . LEU A 1 119 ? 10.655 19.371 67.492  1.00 40.21  ? 118 LEU A CB  1 
ATOM   891  C CG  . LEU A 1 119 ? 10.362 18.158 66.615  1.00 40.49  ? 118 LEU A CG  1 
ATOM   892  C CD1 . LEU A 1 119 ? 11.150 18.222 65.316  1.00 39.15  ? 118 LEU A CD1 1 
ATOM   893  C CD2 . LEU A 1 119 ? 10.701 16.905 67.394  1.00 38.71  ? 118 LEU A CD2 1 
ATOM   894  N N   . LEU A 1 120 ? 9.875  21.890 69.063  1.00 42.29  ? 119 LEU A N   1 
ATOM   895  C CA  . LEU A 1 120 ? 10.217 23.093 69.834  1.00 42.90  ? 119 LEU A CA  1 
ATOM   896  C C   . LEU A 1 120 ? 9.744  22.951 71.292  1.00 44.18  ? 119 LEU A C   1 
ATOM   897  O O   . LEU A 1 120 ? 10.518 23.162 72.217  1.00 44.19  ? 119 LEU A O   1 
ATOM   898  C CB  . LEU A 1 120 ? 9.610  24.346 69.205  1.00 40.19  ? 119 LEU A CB  1 
ATOM   899  C CG  . LEU A 1 120 ? 10.402 24.959 68.038  1.00 37.72  ? 119 LEU A CG  1 
ATOM   900  C CD1 . LEU A 1 120 ? 9.597  26.072 67.401  1.00 33.00  ? 119 LEU A CD1 1 
ATOM   901  C CD2 . LEU A 1 120 ? 11.709 25.479 68.553  1.00 36.16  ? 119 LEU A CD2 1 
ATOM   902  N N   . TYR A 1 121 ? 8.488  22.561 71.481  1.00 44.77  ? 120 TYR A N   1 
ATOM   903  C CA  . TYR A 1 121 ? 7.981  22.386 72.838  1.00 47.28  ? 120 TYR A CA  1 
ATOM   904  C C   . TYR A 1 121 ? 8.708  21.236 73.596  1.00 46.84  ? 120 TYR A C   1 
ATOM   905  O O   . TYR A 1 121 ? 9.115  21.404 74.752  1.00 47.29  ? 120 TYR A O   1 
ATOM   906  C CB  . TYR A 1 121 ? 6.467  22.131 72.828  1.00 50.54  ? 120 TYR A CB  1 
ATOM   907  C CG  . TYR A 1 121 ? 5.898  21.856 74.205  1.00 53.88  ? 120 TYR A CG  1 
ATOM   908  C CD1 . TYR A 1 121 ? 5.889  22.840 75.198  1.00 54.85  ? 120 TYR A CD1 1 
ATOM   909  C CD2 . TYR A 1 121 ? 5.442  20.583 74.540  1.00 55.98  ? 120 TYR A CD2 1 
ATOM   910  C CE1 . TYR A 1 121 ? 5.447  22.549 76.490  1.00 55.99  ? 120 TYR A CE1 1 
ATOM   911  C CE2 . TYR A 1 121 ? 5.004  20.284 75.824  1.00 56.54  ? 120 TYR A CE2 1 
ATOM   912  C CZ  . TYR A 1 121 ? 5.013  21.267 76.791  1.00 57.21  ? 120 TYR A CZ  1 
ATOM   913  O OH  . TYR A 1 121 ? 4.619  20.947 78.068  1.00 59.56  ? 120 TYR A OH  1 
ATOM   914  N N   . SER A 1 122 ? 8.893  20.094 72.942  1.00 44.42  ? 121 SER A N   1 
ATOM   915  C CA  . SER A 1 122 ? 9.563  18.975 73.626  1.00 44.34  ? 121 SER A CA  1 
ATOM   916  C C   . SER A 1 122 ? 10.987 19.326 74.092  1.00 44.07  ? 121 SER A C   1 
ATOM   917  O O   . SER A 1 122 ? 11.568 18.609 74.894  1.00 45.93  ? 121 SER A O   1 
ATOM   918  C CB  . SER A 1 122 ? 9.619  17.731 72.733  1.00 44.26  ? 121 SER A CB  1 
ATOM   919  O OG  . SER A 1 122 ? 10.689 17.781 71.808  1.00 45.06  ? 121 SER A OG  1 
ATOM   920  N N   . TRP A 1 123 ? 11.546 20.415 73.577  1.00 43.41  ? 122 TRP A N   1 
ATOM   921  C CA  . TRP A 1 123 ? 12.902 20.803 73.983  1.00 42.88  ? 122 TRP A CA  1 
ATOM   922  C C   . TRP A 1 123 ? 12.859 21.745 75.177  1.00 44.05  ? 122 TRP A C   1 
ATOM   923  O O   . TRP A 1 123 ? 13.755 21.736 76.014  1.00 43.58  ? 122 TRP A O   1 
ATOM   924  C CB  . TRP A 1 123 ? 13.665 21.474 72.841  1.00 40.19  ? 122 TRP A CB  1 
ATOM   925  C CG  . TRP A 1 123 ? 13.828 20.629 71.650  1.00 40.66  ? 122 TRP A CG  1 
ATOM   926  C CD1 . TRP A 1 123 ? 13.891 19.270 71.614  1.00 40.58  ? 122 TRP A CD1 1 
ATOM   927  C CD2 . TRP A 1 123 ? 13.970 21.075 70.303  1.00 41.03  ? 122 TRP A CD2 1 
ATOM   928  N NE1 . TRP A 1 123 ? 14.059 18.837 70.329  1.00 41.90  ? 122 TRP A NE1 1 
ATOM   929  C CE2 . TRP A 1 123 ? 14.112 19.923 69.501  1.00 42.01  ? 122 TRP A CE2 1 
ATOM   930  C CE3 . TRP A 1 123 ? 13.984 22.334 69.695  1.00 39.94  ? 122 TRP A CE3 1 
ATOM   931  C CZ2 . TRP A 1 123 ? 14.276 19.995 68.118  1.00 41.58  ? 122 TRP A CZ2 1 
ATOM   932  C CZ3 . TRP A 1 123 ? 14.144 22.403 68.325  1.00 39.70  ? 122 TRP A CZ3 1 
ATOM   933  C CH2 . TRP A 1 123 ? 14.286 21.243 67.551  1.00 41.81  ? 122 TRP A CH2 1 
ATOM   934  N N   . THR A 1 124 ? 11.806 22.551 75.235  1.00 44.65  ? 123 THR A N   1 
ATOM   935  C CA  . THR A 1 124 ? 11.654 23.459 76.340  1.00 48.58  ? 123 THR A CA  1 
ATOM   936  C C   . THR A 1 124 ? 11.554 22.657 77.638  1.00 51.22  ? 123 THR A C   1 
ATOM   937  O O   . THR A 1 124 ? 11.895 23.146 78.712  1.00 53.38  ? 123 THR A O   1 
ATOM   938  C CB  . THR A 1 124 ? 10.387 24.307 76.225  1.00 48.91  ? 123 THR A CB  1 
ATOM   939  O OG1 . THR A 1 124 ? 10.247 24.795 74.891  1.00 50.37  ? 123 THR A OG1 1 
ATOM   940  C CG2 . THR A 1 124 ? 10.492 25.500 77.153  1.00 52.40  ? 123 THR A CG2 1 
ATOM   941  N N   . VAL A 1 125 ? 11.085 21.417 77.507  1.00 52.86  ? 124 VAL A N   1 
ATOM   942  C CA  . VAL A 1 125 ? 10.935 20.519 78.661  1.00 52.89  ? 124 VAL A CA  1 
ATOM   943  C C   . VAL A 1 125 ? 12.172 19.643 78.915  1.00 53.71  ? 124 VAL A C   1 
ATOM   944  O O   . VAL A 1 125 ? 12.636 19.538 80.037  1.00 56.04  ? 124 VAL A O   1 
ATOM   945  C CB  . VAL A 1 125 ? 9.740  19.571 78.501  1.00 53.15  ? 124 VAL A CB  1 
ATOM   946  C CG1 . VAL A 1 125 ? 9.557  18.785 79.784  1.00 52.30  ? 124 VAL A CG1 1 
ATOM   947  C CG2 . VAL A 1 125 ? 8.489  20.350 78.136  1.00 51.70  ? 124 VAL A CG2 1 
ATOM   948  N N   . GLY A 1 126 ? 12.700 19.025 77.867  1.00 51.35  ? 125 GLY A N   1 
ATOM   949  C CA  . GLY A 1 126 ? 13.849 18.163 78.058  1.00 50.26  ? 125 GLY A CA  1 
ATOM   950  C C   . GLY A 1 126 ? 15.152 18.904 78.216  1.00 49.01  ? 125 GLY A C   1 
ATOM   951  O O   . GLY A 1 126 ? 16.080 18.407 78.826  1.00 48.77  ? 125 GLY A O   1 
ATOM   952  N N   . LEU A 1 127 ? 15.209 20.105 77.655  1.00 47.89  ? 126 LEU A N   1 
ATOM   953  C CA  . LEU A 1 127 ? 16.420 20.917 77.715  1.00 47.62  ? 126 LEU A CA  1 
ATOM   954  C C   . LEU A 1 127 ? 16.137 22.365 78.170  1.00 46.99  ? 126 LEU A C   1 
ATOM   955  O O   . LEU A 1 127 ? 16.415 23.329 77.458  1.00 46.67  ? 126 LEU A O   1 
ATOM   956  C CB  . LEU A 1 127 ? 17.093 20.916 76.342  1.00 47.64  ? 126 LEU A CB  1 
ATOM   957  C CG  . LEU A 1 127 ? 17.684 19.609 75.807  1.00 47.43  ? 126 LEU A CG  1 
ATOM   958  C CD1 . LEU A 1 127 ? 17.912 19.744 74.313  1.00 46.59  ? 126 LEU A CD1 1 
ATOM   959  C CD2 . LEU A 1 127 ? 18.984 19.286 76.524  1.00 46.19  ? 126 LEU A CD2 1 
ATOM   960  N N   . PRO A 1 128 ? 15.595 22.520 79.382  1.00 46.93  ? 127 PRO A N   1 
ATOM   961  C CA  . PRO A 1 128 ? 15.288 23.863 79.894  1.00 47.34  ? 127 PRO A CA  1 
ATOM   962  C C   . PRO A 1 128 ? 16.520 24.822 79.957  1.00 47.52  ? 127 PRO A C   1 
ATOM   963  O O   . PRO A 1 128 ? 16.355 26.023 79.903  1.00 48.08  ? 127 PRO A O   1 
ATOM   964  C CB  . PRO A 1 128 ? 14.679 23.576 81.259  1.00 45.28  ? 127 PRO A CB  1 
ATOM   965  C CG  . PRO A 1 128 ? 15.425 22.340 81.693  1.00 45.66  ? 127 PRO A CG  1 
ATOM   966  C CD  . PRO A 1 128 ? 15.456 21.500 80.435  1.00 46.80  ? 127 PRO A CD  1 
ATOM   967  N N   . GLU A 1 129 ? 17.727 24.265 80.058  1.00 46.96  ? 128 GLU A N   1 
ATOM   968  C CA  . GLU A 1 129 ? 18.956 25.073 80.100  1.00 46.99  ? 128 GLU A CA  1 
ATOM   969  C C   . GLU A 1 129 ? 19.119 25.943 78.826  1.00 48.33  ? 128 GLU A C   1 
ATOM   970  O O   . GLU A 1 129 ? 19.729 27.028 78.858  1.00 47.83  ? 128 GLU A O   1 
ATOM   971  C CB  . GLU A 1 129 ? 20.197 24.182 80.222  1.00 47.51  ? 128 GLU A CB  1 
ATOM   972  C CG  . GLU A 1 129 ? 19.950 22.802 80.794  1.00 49.47  ? 128 GLU A CG  1 
ATOM   973  C CD  . GLU A 1 129 ? 19.410 21.826 79.777  1.00 49.09  ? 128 GLU A CD  1 
ATOM   974  O OE1 . GLU A 1 129 ? 18.577 20.985 80.146  1.00 49.71  ? 128 GLU A OE1 1 
ATOM   975  O OE2 . GLU A 1 129 ? 19.825 21.886 78.607  1.00 52.00  ? 128 GLU A OE2 1 
ATOM   976  N N   . GLU A 1 130 ? 18.587 25.441 77.714  1.00 46.82  ? 129 GLU A N   1 
ATOM   977  C CA  . GLU A 1 130 ? 18.663 26.163 76.441  1.00 45.49  ? 129 GLU A CA  1 
ATOM   978  C C   . GLU A 1 130 ? 17.681 27.313 76.438  1.00 44.74  ? 129 GLU A C   1 
ATOM   979  O O   . GLU A 1 130 ? 16.633 27.228 75.828  1.00 46.67  ? 129 GLU A O   1 
ATOM   980  C CB  . GLU A 1 130 ? 18.339 25.223 75.281  1.00 45.56  ? 129 GLU A CB  1 
ATOM   981  C CG  . GLU A 1 130 ? 19.286 24.052 75.157  1.00 44.20  ? 129 GLU A CG  1 
ATOM   982  C CD  . GLU A 1 130 ? 20.688 24.472 74.792  1.00 43.34  ? 129 GLU A CD  1 
ATOM   983  O OE1 . GLU A 1 130 ? 21.545 23.583 74.597  1.00 43.58  ? 129 GLU A OE1 1 
ATOM   984  O OE2 . GLU A 1 130 ? 20.937 25.691 74.693  1.00 44.23  ? 129 GLU A OE2 1 
ATOM   985  N N   . VAL A 1 131 ? 18.039 28.381 77.133  1.00 43.56  ? 130 VAL A N   1 
ATOM   986  C CA  . VAL A 1 131 ? 17.176 29.560 77.251  1.00 42.35  ? 130 VAL A CA  1 
ATOM   987  C C   . VAL A 1 131 ? 16.609 30.084 75.905  1.00 40.82  ? 130 VAL A C   1 
ATOM   988  O O   . VAL A 1 131 ? 15.478 30.529 75.850  1.00 41.61  ? 130 VAL A O   1 
ATOM   989  C CB  . VAL A 1 131 ? 17.930 30.712 77.991  1.00 44.15  ? 130 VAL A CB  1 
ATOM   990  C CG1 . VAL A 1 131 ? 18.262 30.283 79.409  1.00 44.10  ? 130 VAL A CG1 1 
ATOM   991  C CG2 . VAL A 1 131 ? 19.202 31.080 77.251  1.00 43.42  ? 130 VAL A CG2 1 
ATOM   992  N N   . LYS A 1 132 ? 17.410 30.025 74.844  1.00 40.73  ? 131 LYS A N   1 
ATOM   993  C CA  . LYS A 1 132 ? 16.986 30.491 73.504  1.00 39.54  ? 131 LYS A CA  1 
ATOM   994  C C   . LYS A 1 132 ? 15.747 29.728 73.016  1.00 38.38  ? 131 LYS A C   1 
ATOM   995  O O   . LYS A 1 132 ? 14.785 30.321 72.549  1.00 37.02  ? 131 LYS A O   1 
ATOM   996  C CB  . LYS A 1 132 ? 18.108 30.291 72.472  1.00 42.26  ? 131 LYS A CB  1 
ATOM   997  C CG  . LYS A 1 132 ? 19.467 30.937 72.801  1.00 43.96  ? 131 LYS A CG  1 
ATOM   998  C CD  . LYS A 1 132 ? 19.470 32.444 72.622  1.00 43.46  ? 131 LYS A CD  1 
ATOM   999  C CE  . LYS A 1 132 ? 20.830 33.037 72.939  1.00 41.83  ? 131 LYS A CE  1 
ATOM   1000 N NZ  . LYS A 1 132 ? 21.897 32.196 72.379  1.00 41.72  ? 131 LYS A NZ  1 
ATOM   1001 N N   . ILE A 1 133 ? 15.798 28.403 73.108  1.00 37.70  ? 132 ILE A N   1 
ATOM   1002 C CA  . ILE A 1 133 ? 14.662 27.605 72.680  1.00 37.24  ? 132 ILE A CA  1 
ATOM   1003 C C   . ILE A 1 133 ? 13.364 28.088 73.370  1.00 39.09  ? 132 ILE A C   1 
ATOM   1004 O O   . ILE A 1 133 ? 12.388 28.367 72.711  1.00 40.44  ? 132 ILE A O   1 
ATOM   1005 C CB  . ILE A 1 133 ? 14.888 26.119 72.979  1.00 35.84  ? 132 ILE A CB  1 
ATOM   1006 C CG1 . ILE A 1 133 ? 16.132 25.626 72.243  1.00 34.21  ? 132 ILE A CG1 1 
ATOM   1007 C CG2 . ILE A 1 133 ? 13.659 25.324 72.557  1.00 35.71  ? 132 ILE A CG2 1 
ATOM   1008 C CD1 . ILE A 1 133 ? 16.420 24.132 72.417  1.00 30.64  ? 132 ILE A CD1 1 
ATOM   1009 N N   . ALA A 1 134 ? 13.393 28.206 74.696  1.00 38.87  ? 133 ALA A N   1 
ATOM   1010 C CA  . ALA A 1 134 ? 12.218 28.670 75.446  1.00 38.91  ? 133 ALA A CA  1 
ATOM   1011 C C   . ALA A 1 134 ? 11.758 30.081 75.008  1.00 38.80  ? 133 ALA A C   1 
ATOM   1012 O O   . ALA A 1 134 ? 10.573 30.343 74.932  1.00 39.27  ? 133 ALA A O   1 
ATOM   1013 C CB  . ALA A 1 134 ? 12.513 28.668 76.951  1.00 37.52  ? 133 ALA A CB  1 
ATOM   1014 N N   . GLU A 1 135 ? 12.707 30.975 74.752  1.00 39.64  ? 134 GLU A N   1 
ATOM   1015 C CA  . GLU A 1 135 ? 12.377 32.361 74.321  1.00 41.44  ? 134 GLU A CA  1 
ATOM   1016 C C   . GLU A 1 135 ? 11.662 32.341 72.950  1.00 41.16  ? 134 GLU A C   1 
ATOM   1017 O O   . GLU A 1 135 ? 10.639 32.975 72.763  1.00 41.58  ? 134 GLU A O   1 
ATOM   1018 C CB  . GLU A 1 135 ? 13.659 33.208 74.217  1.00 42.14  ? 134 GLU A CB  1 
ATOM   1019 C CG  . GLU A 1 135 ? 13.421 34.722 74.312  1.00 43.56  ? 134 GLU A CG  1 
ATOM   1020 C CD  . GLU A 1 135 ? 14.652 35.592 73.974  1.00 44.87  ? 134 GLU A CD  1 
ATOM   1021 O OE1 . GLU A 1 135 ? 15.822 35.141 74.123  1.00 42.14  ? 134 GLU A OE1 1 
ATOM   1022 O OE2 . GLU A 1 135 ? 14.426 36.759 73.576  1.00 45.01  ? 134 GLU A OE2 1 
ATOM   1023 N N   . ALA A 1 136 ? 12.228 31.582 72.019  1.00 40.80  ? 135 ALA A N   1 
ATOM   1024 C CA  . ALA A 1 136 ? 11.666 31.454 70.693  1.00 40.52  ? 135 ALA A CA  1 
ATOM   1025 C C   . ALA A 1 136 ? 10.259 30.867 70.764  1.00 42.36  ? 135 ALA A C   1 
ATOM   1026 O O   . ALA A 1 136 ? 9.327  31.407 70.186  1.00 43.55  ? 135 ALA A O   1 
ATOM   1027 C CB  . ALA A 1 136 ? 12.552 30.570 69.846  1.00 40.51  ? 135 ALA A CB  1 
ATOM   1028 N N   . TYR A 1 137 ? 10.119 29.767 71.502  1.00 43.11  ? 136 TYR A N   1 
ATOM   1029 C CA  . TYR A 1 137 ? 8.812  29.094 71.641  1.00 44.19  ? 136 TYR A CA  1 
ATOM   1030 C C   . TYR A 1 137 ? 7.763  30.013 72.295  1.00 44.64  ? 136 TYR A C   1 
ATOM   1031 O O   . TYR A 1 137 ? 6.617  30.070 71.877  1.00 43.39  ? 136 TYR A O   1 
ATOM   1032 C CB  . TYR A 1 137 ? 8.962  27.822 72.468  1.00 43.17  ? 136 TYR A CB  1 
ATOM   1033 C CG  . TYR A 1 137 ? 7.680  27.048 72.590  1.00 43.84  ? 136 TYR A CG  1 
ATOM   1034 C CD1 . TYR A 1 137 ? 7.142  26.382 71.503  1.00 43.31  ? 136 TYR A CD1 1 
ATOM   1035 C CD2 . TYR A 1 137 ? 7.000  26.985 73.806  1.00 45.87  ? 136 TYR A CD2 1 
ATOM   1036 C CE1 . TYR A 1 137 ? 5.950  25.661 71.618  1.00 43.93  ? 136 TYR A CE1 1 
ATOM   1037 C CE2 . TYR A 1 137 ? 5.807  26.272 73.938  1.00 45.98  ? 136 TYR A CE2 1 
ATOM   1038 C CZ  . TYR A 1 137 ? 5.285  25.608 72.836  1.00 45.63  ? 136 TYR A CZ  1 
ATOM   1039 O OH  . TYR A 1 137 ? 4.105  24.900 72.967  1.00 42.48  ? 136 TYR A OH  1 
ATOM   1040 N N   . GLN A 1 138 ? 8.192  30.714 73.332  1.00 46.06  ? 137 GLN A N   1 
ATOM   1041 C CA  . GLN A 1 138 ? 7.328  31.634 74.020  1.00 48.35  ? 137 GLN A CA  1 
ATOM   1042 C C   . GLN A 1 138 ? 6.819  32.725 73.054  1.00 49.84  ? 137 GLN A C   1 
ATOM   1043 O O   . GLN A 1 138 ? 5.669  33.144 73.116  1.00 49.18  ? 137 GLN A O   1 
ATOM   1044 C CB  . GLN A 1 138 ? 8.081  32.285 75.167  1.00 49.46  ? 137 GLN A CB  1 
ATOM   1045 C CG  . GLN A 1 138 ? 7.201  33.188 75.939  1.00 52.53  ? 137 GLN A CG  1 
ATOM   1046 C CD  . GLN A 1 138 ? 6.018  32.426 76.474  1.00 55.66  ? 137 GLN A CD  1 
ATOM   1047 O OE1 . GLN A 1 138 ? 4.921  32.955 76.569  1.00 56.51  ? 137 GLN A OE1 1 
ATOM   1048 N NE2 . GLN A 1 138 ? 6.243  31.159 76.833  1.00 56.32  ? 137 GLN A NE2 1 
ATOM   1049 N N   . MET A 1 139 ? 7.692  33.176 72.162  1.00 50.08  ? 138 MET A N   1 
ATOM   1050 C CA  . MET A 1 139 ? 7.262  34.184 71.209  1.00 51.02  ? 138 MET A CA  1 
ATOM   1051 C C   . MET A 1 139 ? 6.134  33.634 70.313  1.00 51.17  ? 138 MET A C   1 
ATOM   1052 O O   . MET A 1 139 ? 5.091  34.267 70.164  1.00 52.81  ? 138 MET A O   1 
ATOM   1053 C CB  . MET A 1 139 ? 8.427  34.651 70.339  1.00 51.32  ? 138 MET A CB  1 
ATOM   1054 C CG  . MET A 1 139 ? 8.027  35.746 69.364  1.00 52.28  ? 138 MET A CG  1 
ATOM   1055 S SD  . MET A 1 139 ? 9.335  36.122 68.193  1.00 56.30  ? 138 MET A SD  1 
ATOM   1056 C CE  . MET A 1 139 ? 9.121  34.791 67.027  1.00 53.65  ? 138 MET A CE  1 
ATOM   1057 N N   . LEU A 1 140 ? 6.362  32.454 69.736  1.00 49.31  ? 139 LEU A N   1 
ATOM   1058 C CA  . LEU A 1 140 ? 5.357  31.803 68.868  1.00 49.14  ? 139 LEU A CA  1 
ATOM   1059 C C   . LEU A 1 140 ? 4.000  31.658 69.600  1.00 49.48  ? 139 LEU A C   1 
ATOM   1060 O O   . LEU A 1 140 ? 2.930  31.696 68.995  1.00 48.02  ? 139 LEU A O   1 
ATOM   1061 C CB  . LEU A 1 140 ? 5.844  30.410 68.436  1.00 46.64  ? 139 LEU A CB  1 
ATOM   1062 C CG  . LEU A 1 140 ? 7.110  30.330 67.569  1.00 45.50  ? 139 LEU A CG  1 
ATOM   1063 C CD1 . LEU A 1 140 ? 7.482  28.872 67.290  1.00 42.07  ? 139 LEU A CD1 1 
ATOM   1064 C CD2 . LEU A 1 140 ? 6.875  31.082 66.280  1.00 41.93  ? 139 LEU A CD2 1 
ATOM   1065 N N   . LYS A 1 141 ? 4.088  31.494 70.913  1.00 51.22  ? 140 LYS A N   1 
ATOM   1066 C CA  . LYS A 1 141 ? 2.912  31.335 71.739  1.00 53.05  ? 140 LYS A CA  1 
ATOM   1067 C C   . LYS A 1 141 ? 2.157  32.675 71.910  1.00 54.88  ? 140 LYS A C   1 
ATOM   1068 O O   . LYS A 1 141 ? 0.937  32.720 71.816  1.00 55.69  ? 140 LYS A O   1 
ATOM   1069 C CB  . LYS A 1 141 ? 3.317  30.746 73.091  1.00 52.77  ? 140 LYS A CB  1 
ATOM   1070 C CG  . LYS A 1 141 ? 2.159  30.194 73.886  1.00 54.88  ? 140 LYS A CG  1 
ATOM   1071 C CD  . LYS A 1 141 ? 2.546  28.965 74.681  1.00 56.29  ? 140 LYS A CD  1 
ATOM   1072 C CE  . LYS A 1 141 ? 3.593  29.250 75.746  1.00 55.67  ? 140 LYS A CE  1 
ATOM   1073 N NZ  . LYS A 1 141 ? 3.926  27.985 76.495  1.00 56.13  ? 140 LYS A NZ  1 
ATOM   1074 N N   . LYS A 1 142 ? 2.885  33.764 72.130  1.00 56.04  ? 141 LYS A N   1 
ATOM   1075 C CA  . LYS A 1 142 ? 2.209  35.047 72.280  1.00 57.54  ? 141 LYS A CA  1 
ATOM   1076 C C   . LYS A 1 142 ? 1.755  35.613 70.927  1.00 58.74  ? 141 LYS A C   1 
ATOM   1077 O O   . LYS A 1 142 ? 0.833  36.414 70.862  1.00 60.48  ? 141 LYS A O   1 
ATOM   1078 C CB  . LYS A 1 142 ? 3.094  36.056 72.999  1.00 57.81  ? 141 LYS A CB  1 
ATOM   1079 C CG  . LYS A 1 142 ? 4.436  36.239 72.374  1.00 61.70  ? 141 LYS A CG  1 
ATOM   1080 C CD  . LYS A 1 142 ? 5.071  37.543 72.838  1.00 64.04  ? 141 LYS A CD  1 
ATOM   1081 C CE  . LYS A 1 142 ? 4.397  38.770 72.195  1.00 65.95  ? 141 LYS A CE  1 
ATOM   1082 N NZ  . LYS A 1 142 ? 2.950  38.955 72.556  1.00 65.79  ? 141 LYS A NZ  1 
ATOM   1083 N N   . GLN A 1 143 ? 2.387  35.190 69.844  1.00 58.95  ? 142 GLN A N   1 
ATOM   1084 C CA  . GLN A 1 143 ? 1.947  35.695 68.539  1.00 59.36  ? 142 GLN A CA  1 
ATOM   1085 C C   . GLN A 1 143 ? 0.741  34.908 67.985  1.00 59.42  ? 142 GLN A C   1 
ATOM   1086 O O   . GLN A 1 143 ? 0.180  35.269 66.960  1.00 59.19  ? 142 GLN A O   1 
ATOM   1087 C CB  . GLN A 1 143 ? 3.077  35.635 67.530  1.00 59.65  ? 142 GLN A CB  1 
ATOM   1088 C CG  . GLN A 1 143 ? 4.286  36.388 67.957  1.00 61.22  ? 142 GLN A CG  1 
ATOM   1089 C CD  . GLN A 1 143 ? 5.285  36.468 66.855  1.00 62.25  ? 142 GLN A CD  1 
ATOM   1090 O OE1 . GLN A 1 143 ? 6.425  36.824 67.080  1.00 63.20  ? 142 GLN A OE1 1 
ATOM   1091 N NE2 . GLN A 1 143 ? 4.856  36.136 65.635  1.00 62.43  ? 142 GLN A NE2 1 
ATOM   1092 N N   . GLY A 1 144 ? 0.369  33.831 68.670  1.00 59.29  ? 143 GLY A N   1 
ATOM   1093 C CA  . GLY A 1 144 ? -0.766 33.046 68.226  1.00 60.55  ? 143 GLY A CA  1 
ATOM   1094 C C   . GLY A 1 144 ? -0.408 31.774 67.480  1.00 60.40  ? 143 GLY A C   1 
ATOM   1095 O O   . GLY A 1 144 ? -1.200 30.838 67.424  1.00 61.47  ? 143 GLY A O   1 
ATOM   1096 N N   . ILE A 1 145 ? 0.787  31.741 66.907  1.00 58.28  ? 144 ILE A N   1 
ATOM   1097 C CA  . ILE A 1 145 ? 1.237  30.574 66.165  1.00 56.04  ? 144 ILE A CA  1 
ATOM   1098 C C   . ILE A 1 145 ? 1.100  29.269 66.990  1.00 55.96  ? 144 ILE A C   1 
ATOM   1099 O O   . ILE A 1 145 ? 0.946  28.201 66.439  1.00 54.15  ? 144 ILE A O   1 
ATOM   1100 C CB  . ILE A 1 145 ? 2.686  30.766 65.729  1.00 54.56  ? 144 ILE A CB  1 
ATOM   1101 C CG1 . ILE A 1 145 ? 2.809  32.094 64.981  1.00 53.80  ? 144 ILE A CG1 1 
ATOM   1102 C CG2 . ILE A 1 145 ? 3.119  29.607 64.869  1.00 52.81  ? 144 ILE A CG2 1 
ATOM   1103 C CD1 . ILE A 1 145 ? 4.230  32.527 64.683  1.00 52.59  ? 144 ILE A CD1 1 
ATOM   1104 N N   . VAL A 1 146 ? 1.151  29.387 68.312  1.00 56.86  ? 145 VAL A N   1 
ATOM   1105 C CA  . VAL A 1 146 ? 1.017  28.212 69.195  1.00 58.23  ? 145 VAL A CA  1 
ATOM   1106 C C   . VAL A 1 146 ? -0.078 28.446 70.251  1.00 60.68  ? 145 VAL A C   1 
ATOM   1107 O O   . VAL A 1 146 ? 0.157  29.130 71.245  1.00 62.41  ? 145 VAL A O   1 
ATOM   1108 C CB  . VAL A 1 146 ? 2.323  27.913 69.951  1.00 57.64  ? 145 VAL A CB  1 
ATOM   1109 C CG1 . VAL A 1 146 ? 2.110  26.767 70.931  1.00 56.78  ? 145 VAL A CG1 1 
ATOM   1110 C CG2 . VAL A 1 146 ? 3.427  27.579 68.976  1.00 57.83  ? 145 VAL A CG2 1 
ATOM   1111 N N   . LYS A 1 147 ? -1.257 27.871 70.029  1.00 61.39  ? 146 LYS A N   1 
ATOM   1112 C CA  . LYS A 1 147 ? -2.373 28.054 70.964  1.00 62.48  ? 146 LYS A CA  1 
ATOM   1113 C C   . LYS A 1 147 ? -2.212 27.274 72.290  1.00 63.66  ? 146 LYS A C   1 
ATOM   1114 O O   . LYS A 1 147 ? -2.689 27.714 73.330  1.00 62.97  ? 146 LYS A O   1 
ATOM   1115 C CB  . LYS A 1 147 ? -3.691 27.677 70.291  1.00 61.67  ? 146 LYS A CB  1 
ATOM   1116 C CG  . LYS A 1 147 ? -4.224 28.717 69.322  1.00 60.20  ? 146 LYS A CG  1 
ATOM   1117 C CD  . LYS A 1 147 ? -3.300 28.928 68.150  1.00 59.48  ? 146 LYS A CD  1 
ATOM   1118 C CE  . LYS A 1 147 ? -4.004 29.685 67.040  1.00 60.48  ? 146 LYS A CE  1 
ATOM   1119 N NZ  . LYS A 1 147 ? -4.661 30.903 67.561  1.00 58.56  ? 146 LYS A NZ  1 
ATOM   1120 N N   . SER A 1 148 ? -1.540 26.129 72.240  1.00 65.28  ? 147 SER A N   1 
ATOM   1121 C CA  . SER A 1 148 ? -1.331 25.328 73.454  1.00 68.14  ? 147 SER A CA  1 
ATOM   1122 C C   . SER A 1 148 ? -0.212 24.281 73.282  1.00 70.43  ? 147 SER A C   1 
ATOM   1123 O O   . SER A 1 148 ? 0.164  23.944 72.168  1.00 70.16  ? 147 SER A O   1 
ATOM   1124 C CB  . SER A 1 148 ? -2.619 24.607 73.842  1.00 67.75  ? 147 SER A CB  1 
ATOM   1125 O OG  . SER A 1 148 ? -2.814 23.469 73.022  1.00 67.62  ? 147 SER A OG  1 
ATOM   1126 N N   . ASP A 1 149 ? 0.286  23.763 74.400  1.00 72.55  ? 148 ASP A N   1 
ATOM   1127 C CA  . ASP A 1 149 ? 1.364  22.769 74.358  1.00 76.45  ? 148 ASP A CA  1 
ATOM   1128 C C   . ASP A 1 149 ? 0.900  21.396 73.803  1.00 77.23  ? 148 ASP A C   1 
ATOM   1129 O O   . ASP A 1 149 ? 0.057  20.731 74.395  1.00 77.27  ? 148 ASP A O   1 
ATOM   1130 C CB  . ASP A 1 149 ? 1.974  22.582 75.760  1.00 78.76  ? 148 ASP A CB  1 
ATOM   1131 C CG  . ASP A 1 149 ? 2.435  23.905 76.396  1.00 81.06  ? 148 ASP A CG  1 
ATOM   1132 O OD1 . ASP A 1 149 ? 3.263  24.641 75.796  1.00 80.83  ? 148 ASP A OD1 1 
ATOM   1133 O OD2 . ASP A 1 149 ? 1.967  24.204 77.515  1.00 82.67  ? 148 ASP A OD2 1 
ATOM   1134 N N   . PRO A 1 150 ? 1.470  20.971 72.659  1.00 78.01  ? 149 PRO A N   1 
ATOM   1135 C CA  . PRO A 1 150 ? 1.089  19.682 72.063  1.00 78.01  ? 149 PRO A CA  1 
ATOM   1136 C C   . PRO A 1 150 ? 1.481  18.427 72.916  1.00 77.69  ? 149 PRO A C   1 
ATOM   1137 O O   . PRO A 1 150 ? 2.259  18.591 73.879  1.00 77.24  ? 149 PRO A O   1 
ATOM   1138 C CB  . PRO A 1 150 ? 1.778  19.722 70.693  1.00 78.11  ? 149 PRO A CB  1 
ATOM   1139 C CG  . PRO A 1 150 ? 2.974  20.613 70.921  1.00 77.79  ? 149 PRO A CG  1 
ATOM   1140 C CD  . PRO A 1 150 ? 2.435  21.698 71.806  1.00 77.41  ? 149 PRO A CD  1 
ATOM   1141 N N   . PRO B 1 8   ? 7.658  10.355 38.830  1.00 85.84  ? 7   PRO B N   1 
ATOM   1142 C CA  . PRO B 1 8   ? 8.713  10.122 37.802  1.00 84.71  ? 7   PRO B CA  1 
ATOM   1143 C C   . PRO B 1 8   ? 8.765  11.289 36.779  1.00 82.90  ? 7   PRO B C   1 
ATOM   1144 O O   . PRO B 1 8   ? 9.831  11.841 36.499  1.00 82.22  ? 7   PRO B O   1 
ATOM   1145 C CB  . PRO B 1 8   ? 8.375  8.807  37.104  1.00 85.79  ? 7   PRO B CB  1 
ATOM   1146 C CG  . PRO B 1 8   ? 7.542  8.086  38.176  1.00 86.10  ? 7   PRO B CG  1 
ATOM   1147 C CD  . PRO B 1 8   ? 6.731  9.206  38.875  1.00 86.76  ? 7   PRO B CD  1 
ATOM   1148 N N   . GLU B 1 9   ? 7.599  11.633 36.237  1.00 80.55  ? 8   GLU B N   1 
ATOM   1149 C CA  . GLU B 1 9   ? 7.482  12.722 35.262  1.00 77.99  ? 8   GLU B CA  1 
ATOM   1150 C C   . GLU B 1 9   ? 7.094  14.046 35.938  1.00 74.34  ? 8   GLU B C   1 
ATOM   1151 O O   . GLU B 1 9   ? 7.059  15.097 35.295  1.00 73.77  ? 8   GLU B O   1 
ATOM   1152 C CB  . GLU B 1 9   ? 6.457  12.374 34.167  1.00 81.00  ? 8   GLU B CB  1 
ATOM   1153 C CG  . GLU B 1 9   ? 5.598  11.159 34.457  1.00 85.98  ? 8   GLU B CG  1 
ATOM   1154 C CD  . GLU B 1 9   ? 4.775  11.332 35.713  1.00 89.38  ? 8   GLU B CD  1 
ATOM   1155 O OE1 . GLU B 1 9   ? 3.980  12.300 35.760  1.00 91.19  ? 8   GLU B OE1 1 
ATOM   1156 O OE2 . GLU B 1 9   ? 4.920  10.508 36.649  1.00 90.39  ? 8   GLU B OE2 1 
ATOM   1157 N N   . THR B 1 10  ? 6.818  13.982 37.237  1.00 68.58  ? 9   THR B N   1 
ATOM   1158 C CA  . THR B 1 10  ? 6.465  15.194 37.985  1.00 63.40  ? 9   THR B CA  1 
ATOM   1159 C C   . THR B 1 10  ? 7.669  16.152 38.107  1.00 58.84  ? 9   THR B C   1 
ATOM   1160 O O   . THR B 1 10  ? 8.819  15.718 38.181  1.00 55.97  ? 9   THR B O   1 
ATOM   1161 C CB  . THR B 1 10  ? 5.996  14.862 39.410  1.00 64.25  ? 9   THR B CB  1 
ATOM   1162 O OG1 . THR B 1 10  ? 7.076  14.275 40.145  1.00 65.72  ? 9   THR B OG1 1 
ATOM   1163 C CG2 . THR B 1 10  ? 4.843  13.893 39.373  1.00 64.25  ? 9   THR B CG2 1 
ATOM   1164 N N   . LEU B 1 11  ? 7.375  17.448 38.122  1.00 54.78  ? 10  LEU B N   1 
ATOM   1165 C CA  . LEU B 1 11  ? 8.417  18.475 38.241  1.00 51.21  ? 10  LEU B CA  1 
ATOM   1166 C C   . LEU B 1 11  ? 9.423  18.138 39.398  1.00 50.23  ? 10  LEU B C   1 
ATOM   1167 O O   . LEU B 1 11  ? 10.633 18.109 39.186  1.00 49.92  ? 10  LEU B O   1 
ATOM   1168 C CB  . LEU B 1 11  ? 7.754  19.847 38.451  1.00 47.76  ? 10  LEU B CB  1 
ATOM   1169 C CG  . LEU B 1 11  ? 7.919  20.919 37.356  1.00 47.42  ? 10  LEU B CG  1 
ATOM   1170 C CD1 . LEU B 1 11  ? 7.462  20.416 36.011  1.00 46.72  ? 10  LEU B CD1 1 
ATOM   1171 C CD2 . LEU B 1 11  ? 7.143  22.160 37.730  1.00 46.42  ? 10  LEU B CD2 1 
ATOM   1172 N N   . GLU B 1 12  ? 8.899  17.852 40.590  1.00 48.49  ? 11  GLU B N   1 
ATOM   1173 C CA  . GLU B 1 12  ? 9.738  17.503 41.758  1.00 47.47  ? 11  GLU B CA  1 
ATOM   1174 C C   . GLU B 1 12  ? 10.720 16.337 41.473  1.00 46.25  ? 11  GLU B C   1 
ATOM   1175 O O   . GLU B 1 12  ? 11.875 16.348 41.908  1.00 46.03  ? 11  GLU B O   1 
ATOM   1176 C CB  . GLU B 1 12  ? 8.860  17.138 42.957  1.00 47.70  ? 11  GLU B CB  1 
ATOM   1177 C CG  . GLU B 1 12  ? 8.020  18.288 43.467  1.00 50.24  ? 11  GLU B CG  1 
ATOM   1178 C CD  . GLU B 1 12  ? 6.671  18.372 42.793  1.00 52.69  ? 11  GLU B CD  1 
ATOM   1179 O OE1 . GLU B 1 12  ? 6.517  17.782 41.695  1.00 53.78  ? 11  GLU B OE1 1 
ATOM   1180 O OE2 . GLU B 1 12  ? 5.759  19.038 43.353  1.00 54.51  ? 11  GLU B OE2 1 
ATOM   1181 N N   . ALA B 1 13  ? 10.245 15.330 40.754  1.00 44.89  ? 12  ALA B N   1 
ATOM   1182 C CA  . ALA B 1 13  ? 11.115 14.203 40.422  1.00 42.57  ? 12  ALA B CA  1 
ATOM   1183 C C   . ALA B 1 13  ? 12.156 14.630 39.364  1.00 40.84  ? 12  ALA B C   1 
ATOM   1184 O O   . ALA B 1 13  ? 13.308 14.219 39.419  1.00 39.31  ? 12  ALA B O   1 
ATOM   1185 C CB  . ALA B 1 13  ? 10.294 13.020 39.919  1.00 40.82  ? 12  ALA B CB  1 
ATOM   1186 N N   . ARG B 1 14  ? 11.741 15.462 38.419  1.00 39.72  ? 13  ARG B N   1 
ATOM   1187 C CA  . ARG B 1 14  ? 12.687 15.905 37.397  1.00 40.45  ? 13  ARG B CA  1 
ATOM   1188 C C   . ARG B 1 14  ? 13.754 16.818 38.004  1.00 40.35  ? 13  ARG B C   1 
ATOM   1189 O O   . ARG B 1 14  ? 14.947 16.612 37.799  1.00 41.53  ? 13  ARG B O   1 
ATOM   1190 C CB  . ARG B 1 14  ? 11.965 16.629 36.267  1.00 39.75  ? 13  ARG B CB  1 
ATOM   1191 C CG  . ARG B 1 14  ? 11.118 15.720 35.396  1.00 41.75  ? 13  ARG B CG  1 
ATOM   1192 C CD  . ARG B 1 14  ? 10.268 16.576 34.467  1.00 43.82  ? 13  ARG B CD  1 
ATOM   1193 N NE  . ARG B 1 14  ? 9.442  15.827 33.519  1.00 42.10  ? 13  ARG B NE  1 
ATOM   1194 C CZ  . ARG B 1 14  ? 9.924  15.075 32.535  1.00 42.67  ? 13  ARG B CZ  1 
ATOM   1195 N NH1 . ARG B 1 14  ? 11.232 14.948 32.361  1.00 39.88  ? 13  ARG B NH1 1 
ATOM   1196 N NH2 . ARG B 1 14  ? 9.091  14.480 31.697  1.00 44.24  ? 13  ARG B NH2 1 
ATOM   1197 N N   . ILE B 1 15  ? 13.317 17.808 38.773  1.00 39.08  ? 14  ILE B N   1 
ATOM   1198 C CA  . ILE B 1 15  ? 14.278 18.711 39.386  1.00 37.91  ? 14  ILE B CA  1 
ATOM   1199 C C   . ILE B 1 15  ? 15.222 17.956 40.328  1.00 37.03  ? 14  ILE B C   1 
ATOM   1200 O O   . ILE B 1 15  ? 16.402 18.271 40.418  1.00 37.91  ? 14  ILE B O   1 
ATOM   1201 C CB  . ILE B 1 15  ? 13.596 19.857 40.168  1.00 36.90  ? 14  ILE B CB  1 
ATOM   1202 C CG1 . ILE B 1 15  ? 14.628 20.947 40.436  1.00 34.97  ? 14  ILE B CG1 1 
ATOM   1203 C CG2 . ILE B 1 15  ? 13.024 19.344 41.471  1.00 38.50  ? 14  ILE B CG2 1 
ATOM   1204 C CD1 . ILE B 1 15  ? 15.379 21.334 39.182  1.00 34.13  ? 14  ILE B CD1 1 
ATOM   1205 N N   . ASN B 1 16  ? 14.693 16.960 41.024  1.00 35.59  ? 15  ASN B N   1 
ATOM   1206 C CA  . ASN B 1 16  ? 15.558 16.189 41.903  1.00 37.49  ? 15  ASN B CA  1 
ATOM   1207 C C   . ASN B 1 16  ? 16.664 15.434 41.126  1.00 37.00  ? 15  ASN B C   1 
ATOM   1208 O O   . ASN B 1 16  ? 17.706 15.173 41.665  1.00 38.99  ? 15  ASN B O   1 
ATOM   1209 C CB  . ASN B 1 16  ? 14.752 15.219 42.759  1.00 36.52  ? 15  ASN B CB  1 
ATOM   1210 C CG  . ASN B 1 16  ? 13.923 15.932 43.789  1.00 39.99  ? 15  ASN B CG  1 
ATOM   1211 O OD1 . ASN B 1 16  ? 14.195 17.081 44.124  1.00 43.50  ? 15  ASN B OD1 1 
ATOM   1212 N ND2 . ASN B 1 16  ? 12.916 15.259 44.309  1.00 37.95  ? 15  ASN B ND2 1 
ATOM   1213 N N   . ARG B 1 17  ? 16.432 15.115 39.861  1.00 37.62  ? 16  ARG B N   1 
ATOM   1214 C CA  . ARG B 1 17  ? 17.452 14.427 39.082  1.00 40.23  ? 16  ARG B CA  1 
ATOM   1215 C C   . ARG B 1 17  ? 18.378 15.418 38.425  1.00 39.85  ? 16  ARG B C   1 
ATOM   1216 O O   . ARG B 1 17  ? 19.578 15.238 38.375  1.00 40.00  ? 16  ARG B O   1 
ATOM   1217 C CB  . ARG B 1 17  ? 16.811 13.565 37.999  1.00 45.54  ? 16  ARG B CB  1 
ATOM   1218 C CG  . ARG B 1 17  ? 16.974 12.062 38.206  1.00 51.76  ? 16  ARG B CG  1 
ATOM   1219 C CD  . ARG B 1 17  ? 16.298 11.261 37.083  1.00 57.44  ? 16  ARG B CD  1 
ATOM   1220 N NE  . ARG B 1 17  ? 14.858 11.528 36.997  1.00 62.26  ? 16  ARG B NE  1 
ATOM   1221 C CZ  . ARG B 1 17  ? 14.258 12.215 36.021  1.00 65.44  ? 16  ARG B CZ  1 
ATOM   1222 N NH1 . ARG B 1 17  ? 12.933 12.400 36.042  1.00 64.71  ? 16  ARG B NH1 1 
ATOM   1223 N NH2 . ARG B 1 17  ? 14.975 12.709 35.016  1.00 66.75  ? 16  ARG B NH2 1 
ATOM   1224 N N   . ALA B 1 18  ? 17.791 16.480 37.912  1.00 40.91  ? 17  ALA B N   1 
ATOM   1225 C CA  . ALA B 1 18  ? 18.583 17.491 37.241  1.00 42.46  ? 17  ALA B CA  1 
ATOM   1226 C C   . ALA B 1 18  ? 19.557 18.239 38.195  1.00 43.54  ? 17  ALA B C   1 
ATOM   1227 O O   . ALA B 1 18  ? 20.615 18.673 37.761  1.00 45.94  ? 17  ALA B O   1 
ATOM   1228 C CB  . ALA B 1 18  ? 17.661 18.473 36.539  1.00 41.53  ? 17  ALA B CB  1 
ATOM   1229 N N   . THR B 1 19  ? 19.202 18.376 39.473  1.00 41.03  ? 18  THR B N   1 
ATOM   1230 C CA  . THR B 1 19  ? 20.078 19.101 40.412  1.00 39.23  ? 18  THR B CA  1 
ATOM   1231 C C   . THR B 1 19  ? 20.691 18.181 41.492  1.00 40.37  ? 18  THR B C   1 
ATOM   1232 O O   . THR B 1 19  ? 21.199 18.623 42.532  1.00 40.68  ? 18  THR B O   1 
ATOM   1233 C CB  . THR B 1 19  ? 19.300 20.224 41.112  1.00 38.16  ? 18  THR B CB  1 
ATOM   1234 O OG1 . THR B 1 19  ? 18.388 19.666 42.086  1.00 35.53  ? 18  THR B OG1 1 
ATOM   1235 C CG2 . THR B 1 19  ? 18.553 21.025 40.080  1.00 31.42  ? 18  THR B CG2 1 
ATOM   1236 N N   . ASN B 1 20  ? 20.642 16.894 41.211  1.00 39.91  ? 19  ASN B N   1 
ATOM   1237 C CA  . ASN B 1 20  ? 21.163 15.895 42.124  1.00 40.90  ? 19  ASN B CA  1 
ATOM   1238 C C   . ASN B 1 20  ? 22.661 16.095 42.498  1.00 41.75  ? 19  ASN B C   1 
ATOM   1239 O O   . ASN B 1 20  ? 23.533 16.066 41.664  1.00 39.76  ? 19  ASN B O   1 
ATOM   1240 C CB  . ASN B 1 20  ? 20.934 14.519 41.522  1.00 40.29  ? 19  ASN B CB  1 
ATOM   1241 C CG  . ASN B 1 20  ? 20.926 13.452 42.559  1.00 40.94  ? 19  ASN B CG  1 
ATOM   1242 O OD1 . ASN B 1 20  ? 21.944 13.200 43.192  1.00 39.52  ? 19  ASN B OD1 1 
ATOM   1243 N ND2 . ASN B 1 20  ? 19.759 12.821 42.763  1.00 40.17  ? 19  ASN B ND2 1 
ATOM   1244 N N   . PRO B 1 21  ? 22.942 16.306 43.789  1.00 44.72  ? 20  PRO B N   1 
ATOM   1245 C CA  . PRO B 1 21  ? 24.298 16.517 44.306  1.00 46.58  ? 20  PRO B CA  1 
ATOM   1246 C C   . PRO B 1 21  ? 25.269 15.402 43.927  1.00 48.52  ? 20  PRO B C   1 
ATOM   1247 O O   . PRO B 1 21  ? 26.479 15.606 43.908  1.00 49.52  ? 20  PRO B O   1 
ATOM   1248 C CB  . PRO B 1 21  ? 24.090 16.576 45.812  1.00 46.22  ? 20  PRO B CB  1 
ATOM   1249 C CG  . PRO B 1 21  ? 22.755 17.203 45.942  1.00 47.95  ? 20  PRO B CG  1 
ATOM   1250 C CD  . PRO B 1 21  ? 21.946 16.490 44.855  1.00 46.17  ? 20  PRO B CD  1 
ATOM   1251 N N   . LEU B 1 22  ? 24.714 14.229 43.643  1.00 50.32  ? 21  LEU B N   1 
ATOM   1252 C CA  . LEU B 1 22  ? 25.509 13.045 43.283  1.00 52.20  ? 21  LEU B CA  1 
ATOM   1253 C C   . LEU B 1 22  ? 25.959 13.006 41.787  1.00 53.69  ? 21  LEU B C   1 
ATOM   1254 O O   . LEU B 1 22  ? 26.961 12.370 41.457  1.00 53.87  ? 21  LEU B O   1 
ATOM   1255 C CB  . LEU B 1 22  ? 24.718 11.785 43.637  1.00 51.52  ? 21  LEU B CB  1 
ATOM   1256 C CG  . LEU B 1 22  ? 25.382 10.812 44.619  1.00 54.06  ? 21  LEU B CG  1 
ATOM   1257 C CD1 . LEU B 1 22  ? 25.908 11.528 45.865  1.00 53.04  ? 21  LEU B CD1 1 
ATOM   1258 C CD2 . LEU B 1 22  ? 24.349 9.760  45.002  1.00 54.68  ? 21  LEU B CD2 1 
ATOM   1259 N N   . ASN B 1 23  ? 25.213 13.683 40.912  1.00 53.30  ? 22  ASN B N   1 
ATOM   1260 C CA  . ASN B 1 23  ? 25.562 13.731 39.487  1.00 52.68  ? 22  ASN B CA  1 
ATOM   1261 C C   . ASN B 1 23  ? 27.063 14.048 39.291  1.00 53.39  ? 22  ASN B C   1 
ATOM   1262 O O   . ASN B 1 23  ? 27.537 15.065 39.760  1.00 52.26  ? 22  ASN B O   1 
ATOM   1263 C CB  . ASN B 1 23  ? 24.737 14.802 38.770  1.00 50.45  ? 22  ASN B CB  1 
ATOM   1264 C CG  . ASN B 1 23  ? 23.297 14.366 38.500  1.00 50.83  ? 22  ASN B CG  1 
ATOM   1265 O OD1 . ASN B 1 23  ? 23.043 13.231 38.109  1.00 52.79  ? 22  ASN B OD1 1 
ATOM   1266 N ND2 . ASN B 1 23  ? 22.353 15.286 38.683  1.00 47.91  ? 22  ASN B ND2 1 
ATOM   1267 N N   . LYS B 1 24  ? 27.785 13.159 38.611  1.00 54.98  ? 23  LYS B N   1 
ATOM   1268 C CA  . LYS B 1 24  ? 29.222 13.365 38.347  1.00 56.97  ? 23  LYS B CA  1 
ATOM   1269 C C   . LYS B 1 24  ? 29.431 14.472 37.282  1.00 56.49  ? 23  LYS B C   1 
ATOM   1270 O O   . LYS B 1 24  ? 30.487 15.075 37.186  1.00 56.90  ? 23  LYS B O   1 
ATOM   1271 C CB  . LYS B 1 24  ? 29.857 12.049 37.880  1.00 58.73  ? 23  LYS B CB  1 
ATOM   1272 C CG  . LYS B 1 24  ? 29.075 11.379 36.761  1.00 63.70  ? 23  LYS B CG  1 
ATOM   1273 C CD  . LYS B 1 24  ? 28.708 9.914  37.074  1.00 66.20  ? 23  LYS B CD  1 
ATOM   1274 C CE  . LYS B 1 24  ? 29.917 8.980  37.003  1.00 66.92  ? 23  LYS B CE  1 
ATOM   1275 N NZ  . LYS B 1 24  ? 29.546 7.572  37.288  1.00 66.43  ? 23  LYS B NZ  1 
ATOM   1276 N N   . GLU B 1 25  ? 28.382 14.722 36.506  1.00 56.24  ? 24  GLU B N   1 
ATOM   1277 C CA  . GLU B 1 25  ? 28.394 15.758 35.451  1.00 56.03  ? 24  GLU B CA  1 
ATOM   1278 C C   . GLU B 1 25  ? 26.950 16.254 35.114  1.00 53.29  ? 24  GLU B C   1 
ATOM   1279 O O   . GLU B 1 25  ? 25.988 15.539 35.341  1.00 53.04  ? 24  GLU B O   1 
ATOM   1280 C CB  . GLU B 1 25  ? 29.031 15.192 34.186  1.00 59.14  ? 24  GLU B CB  1 
ATOM   1281 C CG  . GLU B 1 25  ? 28.500 13.809 33.838  1.00 65.42  ? 24  GLU B CG  1 
ATOM   1282 C CD  . GLU B 1 25  ? 28.342 13.579 32.350  1.00 68.52  ? 24  GLU B CD  1 
ATOM   1283 O OE1 . GLU B 1 25  ? 28.093 12.410 31.970  1.00 71.47  ? 24  GLU B OE1 1 
ATOM   1284 O OE2 . GLU B 1 25  ? 28.452 14.557 31.570  1.00 69.68  ? 24  GLU B OE2 1 
ATOM   1285 N N   . LEU B 1 26  ? 26.818 17.468 34.581  1.00 49.40  ? 25  LEU B N   1 
ATOM   1286 C CA  . LEU B 1 26  ? 25.489 17.967 34.223  1.00 44.59  ? 25  LEU B CA  1 
ATOM   1287 C C   . LEU B 1 26  ? 24.686 16.882 33.504  1.00 43.42  ? 25  LEU B C   1 
ATOM   1288 O O   . LEU B 1 26  ? 25.244 16.107 32.752  1.00 42.99  ? 25  LEU B O   1 
ATOM   1289 C CB  . LEU B 1 26  ? 25.587 19.201 33.329  1.00 42.04  ? 25  LEU B CB  1 
ATOM   1290 C CG  . LEU B 1 26  ? 26.016 20.511 33.997  1.00 41.97  ? 25  LEU B CG  1 
ATOM   1291 C CD1 . LEU B 1 26  ? 26.028 21.636 32.967  1.00 39.56  ? 25  LEU B CD1 1 
ATOM   1292 C CD2 . LEU B 1 26  ? 25.056 20.860 35.118  1.00 41.00  ? 25  LEU B CD2 1 
ATOM   1293 N N   . ASP B 1 27  ? 23.386 16.838 33.783  1.00 42.89  ? 26  ASP B N   1 
ATOM   1294 C CA  . ASP B 1 27  ? 22.453 15.869 33.202  1.00 40.49  ? 26  ASP B CA  1 
ATOM   1295 C C   . ASP B 1 27  ? 21.436 16.603 32.322  1.00 40.93  ? 26  ASP B C   1 
ATOM   1296 O O   . ASP B 1 27  ? 20.311 16.896 32.740  1.00 41.34  ? 26  ASP B O   1 
ATOM   1297 C CB  . ASP B 1 27  ? 21.721 15.139 34.325  1.00 41.88  ? 26  ASP B CB  1 
ATOM   1298 C CG  . ASP B 1 27  ? 20.661 14.161 33.815  1.00 45.10  ? 26  ASP B CG  1 
ATOM   1299 O OD1 . ASP B 1 27  ? 19.875 13.677 34.648  1.00 47.00  ? 26  ASP B OD1 1 
ATOM   1300 O OD2 . ASP B 1 27  ? 20.613 13.866 32.601  1.00 47.69  ? 26  ASP B OD2 1 
ATOM   1301 N N   . TRP B 1 28  ? 21.851 16.899 31.102  1.00 39.78  ? 27  TRP B N   1 
ATOM   1302 C CA  . TRP B 1 28  ? 20.999 17.628 30.165  1.00 38.62  ? 27  TRP B CA  1 
ATOM   1303 C C   . TRP B 1 28  ? 19.629 16.977 29.881  1.00 38.91  ? 27  TRP B C   1 
ATOM   1304 O O   . TRP B 1 28  ? 18.609 17.670 29.710  1.00 37.86  ? 27  TRP B O   1 
ATOM   1305 C CB  . TRP B 1 28  ? 21.772 17.838 28.884  1.00 35.18  ? 27  TRP B CB  1 
ATOM   1306 C CG  . TRP B 1 28  ? 22.834 18.815 29.093  1.00 36.03  ? 27  TRP B CG  1 
ATOM   1307 C CD1 . TRP B 1 28  ? 24.165 18.619 28.926  1.00 34.88  ? 27  TRP B CD1 1 
ATOM   1308 C CD2 . TRP B 1 28  ? 22.671 20.183 29.462  1.00 33.31  ? 27  TRP B CD2 1 
ATOM   1309 N NE1 . TRP B 1 28  ? 24.854 19.785 29.164  1.00 34.15  ? 27  TRP B NE1 1 
ATOM   1310 C CE2 . TRP B 1 28  ? 23.954 20.767 29.503  1.00 32.88  ? 27  TRP B CE2 1 
ATOM   1311 C CE3 . TRP B 1 28  ? 21.567 20.975 29.772  1.00 32.30  ? 27  TRP B CE3 1 
ATOM   1312 C CZ2 . TRP B 1 28  ? 24.169 22.092 29.818  1.00 29.85  ? 27  TRP B CZ2 1 
ATOM   1313 C CZ3 . TRP B 1 28  ? 21.775 22.303 30.091  1.00 34.44  ? 27  TRP B CZ3 1 
ATOM   1314 C CH2 . TRP B 1 28  ? 23.071 22.848 30.118  1.00 31.37  ? 27  TRP B CH2 1 
ATOM   1315 N N   . ALA B 1 29  ? 19.617 15.654 29.813  1.00 37.46  ? 28  ALA B N   1 
ATOM   1316 C CA  . ALA B 1 29  ? 18.365 14.966 29.557  1.00 35.90  ? 28  ALA B CA  1 
ATOM   1317 C C   . ALA B 1 29  ? 17.314 15.401 30.595  1.00 35.31  ? 28  ALA B C   1 
ATOM   1318 O O   . ALA B 1 29  ? 16.238 15.868 30.234  1.00 32.59  ? 28  ALA B O   1 
ATOM   1319 C CB  . ALA B 1 29  ? 18.580 13.459 29.624  1.00 35.70  ? 28  ALA B CB  1 
ATOM   1320 N N   . SER B 1 30  ? 17.675 15.260 31.874  1.00 34.03  ? 29  SER B N   1 
ATOM   1321 C CA  . SER B 1 30  ? 16.788 15.627 32.962  1.00 35.06  ? 29  SER B CA  1 
ATOM   1322 C C   . SER B 1 30  ? 16.528 17.146 33.031  1.00 35.83  ? 29  SER B C   1 
ATOM   1323 O O   . SER B 1 30  ? 15.418 17.571 33.379  1.00 35.05  ? 29  SER B O   1 
ATOM   1324 C CB  . SER B 1 30  ? 17.367 15.146 34.281  1.00 37.81  ? 29  SER B CB  1 
ATOM   1325 O OG  . SER B 1 30  ? 17.383 13.733 34.324  1.00 43.17  ? 29  SER B OG  1 
ATOM   1326 N N   . ILE B 1 31  ? 17.552 17.944 32.718  1.00 34.03  ? 30  ILE B N   1 
ATOM   1327 C CA  . ILE B 1 31  ? 17.371 19.382 32.745  1.00 34.51  ? 30  ILE B CA  1 
ATOM   1328 C C   . ILE B 1 31  ? 16.422 19.809 31.630  1.00 37.09  ? 30  ILE B C   1 
ATOM   1329 O O   . ILE B 1 31  ? 15.519 20.607 31.856  1.00 37.90  ? 30  ILE B O   1 
ATOM   1330 C CB  . ILE B 1 31  ? 18.662 20.162 32.543  1.00 35.04  ? 30  ILE B CB  1 
ATOM   1331 C CG1 . ILE B 1 31  ? 19.591 20.006 33.742  1.00 34.60  ? 30  ILE B CG1 1 
ATOM   1332 C CG2 . ILE B 1 31  ? 18.329 21.625 32.349  1.00 35.37  ? 30  ILE B CG2 1 
ATOM   1333 C CD1 . ILE B 1 31  ? 21.028 20.424 33.415  1.00 30.53  ? 30  ILE B CD1 1 
ATOM   1334 N N   . ASN B 1 32  ? 16.629 19.276 30.427  1.00 36.54  ? 31  ASN B N   1 
ATOM   1335 C CA  . ASN B 1 32  ? 15.724 19.649 29.334  1.00 37.56  ? 31  ASN B CA  1 
ATOM   1336 C C   . ASN B 1 32  ? 14.310 19.127 29.604  1.00 37.95  ? 31  ASN B C   1 
ATOM   1337 O O   . ASN B 1 32  ? 13.323 19.868 29.478  1.00 40.88  ? 31  ASN B O   1 
ATOM   1338 C CB  . ASN B 1 32  ? 16.233 19.161 27.970  1.00 36.95  ? 31  ASN B CB  1 
ATOM   1339 C CG  . ASN B 1 32  ? 17.403 20.006 27.451  1.00 39.91  ? 31  ASN B CG  1 
ATOM   1340 O OD1 . ASN B 1 32  ? 17.332 21.236 27.449  1.00 41.55  ? 31  ASN B OD1 1 
ATOM   1341 N ND2 . ASN B 1 32  ? 18.478 19.347 27.012  1.00 36.88  ? 31  ASN B ND2 1 
ATOM   1342 N N   . GLY B 1 33  ? 14.222 17.862 30.001  1.00 36.33  ? 32  GLY B N   1 
ATOM   1343 C CA  . GLY B 1 33  ? 12.929 17.273 30.313  1.00 34.44  ? 32  GLY B CA  1 
ATOM   1344 C C   . GLY B 1 33  ? 12.176 18.149 31.292  1.00 35.79  ? 32  GLY B C   1 
ATOM   1345 O O   . GLY B 1 33  ? 10.969 18.301 31.184  1.00 35.36  ? 32  GLY B O   1 
ATOM   1346 N N   . PHE B 1 34  ? 12.901 18.727 32.250  1.00 36.12  ? 33  PHE B N   1 
ATOM   1347 C CA  . PHE B 1 34  ? 12.296 19.604 33.253  1.00 36.43  ? 33  PHE B CA  1 
ATOM   1348 C C   . PHE B 1 34  ? 11.739 20.893 32.635  1.00 38.83  ? 33  PHE B C   1 
ATOM   1349 O O   . PHE B 1 34  ? 10.657 21.308 32.978  1.00 39.07  ? 33  PHE B O   1 
ATOM   1350 C CB  . PHE B 1 34  ? 13.317 19.967 34.343  1.00 36.62  ? 33  PHE B CB  1 
ATOM   1351 C CG  . PHE B 1 34  ? 12.788 20.936 35.387  1.00 34.14  ? 33  PHE B CG  1 
ATOM   1352 C CD1 . PHE B 1 34  ? 13.051 22.298 35.288  1.00 31.83  ? 33  PHE B CD1 1 
ATOM   1353 C CD2 . PHE B 1 34  ? 12.009 20.479 36.453  1.00 34.64  ? 33  PHE B CD2 1 
ATOM   1354 C CE1 . PHE B 1 34  ? 12.550 23.190 36.222  1.00 32.49  ? 33  PHE B CE1 1 
ATOM   1355 C CE2 . PHE B 1 34  ? 11.499 21.366 37.398  1.00 35.65  ? 33  PHE B CE2 1 
ATOM   1356 C CZ  . PHE B 1 34  ? 11.772 22.725 37.281  1.00 35.42  ? 33  PHE B CZ  1 
ATOM   1357 N N   . CYS B 1 35  ? 12.503 21.531 31.753  1.00 40.84  ? 34  CYS B N   1 
ATOM   1358 C CA  . CYS B 1 35  ? 12.020 22.754 31.107  1.00 42.84  ? 34  CYS B CA  1 
ATOM   1359 C C   . CYS B 1 35  ? 10.769 22.475 30.266  1.00 45.18  ? 34  CYS B C   1 
ATOM   1360 O O   . CYS B 1 35  ? 9.818  23.233 30.302  1.00 43.84  ? 34  CYS B O   1 
ATOM   1361 C CB  . CYS B 1 35  ? 13.090 23.361 30.203  1.00 42.19  ? 34  CYS B CB  1 
ATOM   1362 S SG  . CYS B 1 35  ? 14.562 23.972 31.078  1.00 42.83  ? 34  CYS B SG  1 
ATOM   1363 N N   . GLU B 1 36  ? 10.798 21.376 29.516  1.00 47.84  ? 35  GLU B N   1 
ATOM   1364 C CA  . GLU B 1 36  ? 9.659  21.013 28.678  1.00 53.24  ? 35  GLU B CA  1 
ATOM   1365 C C   . GLU B 1 36  ? 8.419  20.671 29.512  1.00 53.92  ? 35  GLU B C   1 
ATOM   1366 O O   . GLU B 1 36  ? 7.303  21.050 29.171  1.00 54.15  ? 35  GLU B O   1 
ATOM   1367 C CB  . GLU B 1 36  ? 9.983  19.804 27.806  1.00 57.43  ? 35  GLU B CB  1 
ATOM   1368 C CG  . GLU B 1 36  ? 11.133 19.981 26.848  1.00 63.85  ? 35  GLU B CG  1 
ATOM   1369 C CD  . GLU B 1 36  ? 11.394 18.717 26.041  1.00 69.25  ? 35  GLU B CD  1 
ATOM   1370 O OE1 . GLU B 1 36  ? 12.238 18.766 25.108  1.00 71.44  ? 35  GLU B OE1 1 
ATOM   1371 O OE2 . GLU B 1 36  ? 10.756 17.672 26.343  1.00 69.89  ? 35  GLU B OE2 1 
ATOM   1372 N N   . GLN B 1 37  ? 8.638  19.948 30.602  1.00 53.65  ? 36  GLN B N   1 
ATOM   1373 C CA  . GLN B 1 37  ? 7.544  19.546 31.466  1.00 55.95  ? 36  GLN B CA  1 
ATOM   1374 C C   . GLN B 1 37  ? 6.785  20.738 32.087  1.00 57.86  ? 36  GLN B C   1 
ATOM   1375 O O   . GLN B 1 37  ? 5.593  20.659 32.323  1.00 58.58  ? 36  GLN B O   1 
ATOM   1376 C CB  . GLN B 1 37  ? 8.070  18.644 32.569  1.00 54.76  ? 36  GLN B CB  1 
ATOM   1377 C CG  . GLN B 1 37  ? 7.016  18.172 33.504  1.00 55.93  ? 36  GLN B CG  1 
ATOM   1378 C CD  . GLN B 1 37  ? 5.940  17.402 32.794  1.00 58.68  ? 36  GLN B CD  1 
ATOM   1379 O OE1 . GLN B 1 37  ? 6.223  16.566 31.937  1.00 60.36  ? 36  GLN B OE1 1 
ATOM   1380 N NE2 . GLN B 1 37  ? 4.688  17.669 33.154  1.00 59.11  ? 36  GLN B NE2 1 
ATOM   1381 N N   . LEU B 1 38  ? 7.476  21.837 32.341  1.00 59.67  ? 37  LEU B N   1 
ATOM   1382 C CA  . LEU B 1 38  ? 6.796  22.976 32.931  1.00 63.56  ? 37  LEU B CA  1 
ATOM   1383 C C   . LEU B 1 38  ? 5.984  23.783 31.875  1.00 66.75  ? 37  LEU B C   1 
ATOM   1384 O O   . LEU B 1 38  ? 4.949  24.349 32.185  1.00 66.31  ? 37  LEU B O   1 
ATOM   1385 C CB  . LEU B 1 38  ? 7.812  23.859 33.653  1.00 61.83  ? 37  LEU B CB  1 
ATOM   1386 C CG  . LEU B 1 38  ? 8.596  24.874 32.837  1.00 62.70  ? 37  LEU B CG  1 
ATOM   1387 C CD1 . LEU B 1 38  ? 7.781  26.158 32.736  1.00 63.83  ? 37  LEU B CD1 1 
ATOM   1388 C CD2 . LEU B 1 38  ? 9.922  25.173 33.512  1.00 62.16  ? 37  LEU B CD2 1 
ATOM   1389 N N   . ASN B 1 39  ? 6.467  23.800 30.635  1.00 70.67  ? 38  ASN B N   1 
ATOM   1390 C CA  . ASN B 1 39  ? 5.781  24.513 29.535  1.00 74.63  ? 38  ASN B CA  1 
ATOM   1391 C C   . ASN B 1 39  ? 4.416  23.895 29.153  1.00 77.01  ? 38  ASN B C   1 
ATOM   1392 O O   . ASN B 1 39  ? 3.879  24.198 28.089  1.00 77.66  ? 38  ASN B O   1 
ATOM   1393 C CB  . ASN B 1 39  ? 6.652  24.545 28.269  1.00 75.34  ? 38  ASN B CB  1 
ATOM   1394 C CG  . ASN B 1 39  ? 7.723  25.633 28.312  1.00 76.07  ? 38  ASN B CG  1 
ATOM   1395 O OD1 . ASN B 1 39  ? 7.559  26.646 28.985  1.00 76.07  ? 38  ASN B OD1 1 
ATOM   1396 N ND2 . ASN B 1 39  ? 8.813  25.431 27.570  1.00 74.12  ? 38  ASN B ND2 1 
ATOM   1397 N N   . GLU B 1 40  ? 3.882  23.025 30.004  1.00 79.43  ? 39  GLU B N   1 
ATOM   1398 C CA  . GLU B 1 40  ? 2.588  22.409 29.718  1.00 81.65  ? 39  GLU B CA  1 
ATOM   1399 C C   . GLU B 1 40  ? 1.718  22.294 30.965  1.00 83.38  ? 39  GLU B C   1 
ATOM   1400 O O   . GLU B 1 40  ? 1.178  21.242 31.268  1.00 83.43  ? 39  GLU B O   1 
ATOM   1401 C CB  . GLU B 1 40  ? 2.767  21.034 29.084  1.00 82.39  ? 39  GLU B CB  1 
ATOM   1402 C CG  . GLU B 1 40  ? 3.359  19.987 30.002  1.00 83.39  ? 39  GLU B CG  1 
ATOM   1403 C CD  . GLU B 1 40  ? 3.184  18.578 29.453  1.00 83.76  ? 39  GLU B CD  1 
ATOM   1404 O OE1 . GLU B 1 40  ? 3.585  18.332 28.294  1.00 83.33  ? 39  GLU B OE1 1 
ATOM   1405 O OE2 . GLU B 1 40  ? 2.643  17.718 30.183  1.00 83.36  ? 39  GLU B OE2 1 
ATOM   1406 N N   . ASP B 1 41  ? 1.601  23.408 31.676  1.00 85.79  ? 40  ASP B N   1 
ATOM   1407 C CA  . ASP B 1 41  ? 0.778  23.472 32.883  1.00 87.07  ? 40  ASP B CA  1 
ATOM   1408 C C   . ASP B 1 41  ? 0.660  24.895 33.440  1.00 88.08  ? 40  ASP B C   1 
ATOM   1409 O O   . ASP B 1 41  ? 1.654  25.561 33.659  1.00 88.95  ? 40  ASP B O   1 
ATOM   1410 C CB  . ASP B 1 41  ? 1.347  22.558 33.953  1.00 86.94  ? 40  ASP B CB  1 
ATOM   1411 C CG  . ASP B 1 41  ? 0.351  21.550 34.413  1.00 87.59  ? 40  ASP B CG  1 
ATOM   1412 O OD1 . ASP B 1 41  ? 0.384  20.418 33.894  1.00 87.50  ? 40  ASP B OD1 1 
ATOM   1413 O OD2 . ASP B 1 41  ? -0.477 21.904 35.279  1.00 88.64  ? 40  ASP B OD2 1 
ATOM   1414 N N   . PHE B 1 42  ? -0.567 25.349 33.661  1.00 89.78  ? 41  PHE B N   1 
ATOM   1415 C CA  . PHE B 1 42  ? -0.773 26.698 34.197  1.00 90.38  ? 41  PHE B CA  1 
ATOM   1416 C C   . PHE B 1 42  ? -0.126 26.854 35.588  1.00 88.38  ? 41  PHE B C   1 
ATOM   1417 O O   . PHE B 1 42  ? 0.232  27.954 35.999  1.00 88.41  ? 41  PHE B O   1 
ATOM   1418 C CB  . PHE B 1 42  ? -2.276 27.032 34.249  1.00 95.00  ? 41  PHE B CB  1 
ATOM   1419 C CG  . PHE B 1 42  ? -3.165 25.846 34.545  1.00 99.19  ? 41  PHE B CG  1 
ATOM   1420 C CD1 . PHE B 1 42  ? -2.919 25.032 35.654  1.00 100.53 ? 41  PHE B CD1 1 
ATOM   1421 C CD2 . PHE B 1 42  ? -4.257 25.550 33.718  1.00 100.21 ? 41  PHE B CD2 1 
ATOM   1422 C CE1 . PHE B 1 42  ? -3.741 23.943 35.939  1.00 101.55 ? 41  PHE B CE1 1 
ATOM   1423 C CE2 . PHE B 1 42  ? -5.088 24.463 33.990  1.00 101.18 ? 41  PHE B CE2 1 
ATOM   1424 C CZ  . PHE B 1 42  ? -4.831 23.656 35.105  1.00 101.86 ? 41  PHE B CZ  1 
ATOM   1425 N N   . GLU B 1 43  ? 0.028  25.727 36.279  1.00 84.93  ? 42  GLU B N   1 
ATOM   1426 C CA  . GLU B 1 43  ? 0.651  25.704 37.605  1.00 81.83  ? 42  GLU B CA  1 
ATOM   1427 C C   . GLU B 1 43  ? 2.115  25.219 37.512  1.00 78.55  ? 42  GLU B C   1 
ATOM   1428 O O   . GLU B 1 43  ? 2.851  25.258 38.483  1.00 79.49  ? 42  GLU B O   1 
ATOM   1429 C CB  . GLU B 1 43  ? -0.114 24.770 38.531  1.00 82.73  ? 42  GLU B CB  1 
ATOM   1430 C CG  . GLU B 1 43  ? 0.018  23.324 38.132  1.00 84.93  ? 42  GLU B CG  1 
ATOM   1431 C CD  . GLU B 1 43  ? -0.094 22.387 39.313  1.00 86.77  ? 42  GLU B CD  1 
ATOM   1432 O OE1 . GLU B 1 43  ? -1.214 22.221 39.844  1.00 86.83  ? 42  GLU B OE1 1 
ATOM   1433 O OE2 . GLU B 1 43  ? 0.947  21.824 39.718  1.00 87.16  ? 42  GLU B OE2 1 
ATOM   1434 N N   . GLY B 1 44  ? 2.502  24.761 36.326  1.00 74.04  ? 43  GLY B N   1 
ATOM   1435 C CA  . GLY B 1 44  ? 3.852  24.278 36.111  1.00 68.29  ? 43  GLY B CA  1 
ATOM   1436 C C   . GLY B 1 44  ? 4.900  25.315 36.452  1.00 65.40  ? 43  GLY B C   1 
ATOM   1437 O O   . GLY B 1 44  ? 5.737  25.066 37.307  1.00 65.62  ? 43  GLY B O   1 
ATOM   1438 N N   . PRO B 1 45  ? 4.876  26.496 35.806  1.00 61.83  ? 44  PRO B N   1 
ATOM   1439 C CA  . PRO B 1 45  ? 5.855  27.552 36.073  1.00 58.73  ? 44  PRO B CA  1 
ATOM   1440 C C   . PRO B 1 45  ? 5.984  27.982 37.566  1.00 56.03  ? 44  PRO B C   1 
ATOM   1441 O O   . PRO B 1 45  ? 7.076  28.018 38.114  1.00 54.99  ? 44  PRO B O   1 
ATOM   1442 C CB  . PRO B 1 45  ? 5.376  28.693 35.174  1.00 59.14  ? 44  PRO B CB  1 
ATOM   1443 C CG  . PRO B 1 45  ? 4.770  27.979 34.035  1.00 59.12  ? 44  PRO B CG  1 
ATOM   1444 C CD  . PRO B 1 45  ? 3.978  26.899 34.711  1.00 59.55  ? 44  PRO B CD  1 
ATOM   1445 N N   . PRO B 1 46  ? 4.864  28.307 38.223  1.00 53.96  ? 45  PRO B N   1 
ATOM   1446 C CA  . PRO B 1 46  ? 4.967  28.717 39.628  1.00 51.33  ? 45  PRO B CA  1 
ATOM   1447 C C   . PRO B 1 46  ? 5.651  27.618 40.489  1.00 48.82  ? 45  PRO B C   1 
ATOM   1448 O O   . PRO B 1 46  ? 6.488  27.918 41.346  1.00 48.17  ? 45  PRO B O   1 
ATOM   1449 C CB  . PRO B 1 46  ? 3.514  28.957 40.021  1.00 52.18  ? 45  PRO B CB  1 
ATOM   1450 C CG  . PRO B 1 46  ? 2.878  29.340 38.710  1.00 54.09  ? 45  PRO B CG  1 
ATOM   1451 C CD  . PRO B 1 46  ? 3.466  28.339 37.769  1.00 52.60  ? 45  PRO B CD  1 
ATOM   1452 N N   . LEU B 1 47  ? 5.278  26.362 40.248  1.00 45.13  ? 46  LEU B N   1 
ATOM   1453 C CA  . LEU B 1 47  ? 5.879  25.246 40.982  1.00 41.83  ? 46  LEU B CA  1 
ATOM   1454 C C   . LEU B 1 47  ? 7.369  25.107 40.648  1.00 41.48  ? 46  LEU B C   1 
ATOM   1455 O O   . LEU B 1 47  ? 8.166  24.728 41.497  1.00 42.57  ? 46  LEU B O   1 
ATOM   1456 C CB  . LEU B 1 47  ? 5.174  23.928 40.661  1.00 39.46  ? 46  LEU B CB  1 
ATOM   1457 C CG  . LEU B 1 47  ? 5.870  22.687 41.251  1.00 39.86  ? 46  LEU B CG  1 
ATOM   1458 C CD1 . LEU B 1 47  ? 5.920  22.786 42.761  1.00 32.35  ? 46  LEU B CD1 1 
ATOM   1459 C CD2 . LEU B 1 47  ? 5.135  21.415 40.808  1.00 38.12  ? 46  LEU B CD2 1 
ATOM   1460 N N   . ALA B 1 48  ? 7.731  25.421 39.410  1.00 39.15  ? 47  ALA B N   1 
ATOM   1461 C CA  . ALA B 1 48  ? 9.124  25.322 39.018  1.00 38.42  ? 47  ALA B CA  1 
ATOM   1462 C C   . ALA B 1 48  ? 9.987  26.363 39.745  1.00 39.04  ? 47  ALA B C   1 
ATOM   1463 O O   . ALA B 1 48  ? 11.003 26.015 40.348  1.00 39.47  ? 47  ALA B O   1 
ATOM   1464 C CB  . ALA B 1 48  ? 9.269  25.474 37.512  1.00 36.42  ? 47  ALA B CB  1 
ATOM   1465 N N   . THR B 1 49  ? 9.566  27.626 39.688  1.00 38.82  ? 48  THR B N   1 
ATOM   1466 C CA  . THR B 1 49  ? 10.312 28.705 40.333  1.00 38.14  ? 48  THR B CA  1 
ATOM   1467 C C   . THR B 1 49  ? 10.443 28.480 41.842  1.00 39.26  ? 48  THR B C   1 
ATOM   1468 O O   . THR B 1 49  ? 11.473 28.782 42.432  1.00 40.46  ? 48  THR B O   1 
ATOM   1469 C CB  . THR B 1 49  ? 9.649  30.046 40.100  1.00 38.80  ? 48  THR B CB  1 
ATOM   1470 O OG1 . THR B 1 49  ? 8.321  30.026 40.639  1.00 40.81  ? 48  THR B OG1 1 
ATOM   1471 C CG2 . THR B 1 49  ? 9.591  30.330 38.629  1.00 39.52  ? 48  THR B CG2 1 
ATOM   1472 N N   . ARG B 1 50  ? 9.385  27.956 42.447  1.00 38.79  ? 49  ARG B N   1 
ATOM   1473 C CA  . ARG B 1 50  ? 9.400  27.660 43.868  1.00 39.13  ? 49  ARG B CA  1 
ATOM   1474 C C   . ARG B 1 50  ? 10.441 26.550 44.164  1.00 38.96  ? 49  ARG B C   1 
ATOM   1475 O O   . ARG B 1 50  ? 11.288 26.691 45.061  1.00 40.50  ? 49  ARG B O   1 
ATOM   1476 C CB  . ARG B 1 50  ? 7.998  27.232 44.307  1.00 43.67  ? 49  ARG B CB  1 
ATOM   1477 C CG  . ARG B 1 50  ? 7.954  26.476 45.596  1.00 48.98  ? 49  ARG B CG  1 
ATOM   1478 C CD  . ARG B 1 50  ? 7.045  27.160 46.586  1.00 57.38  ? 49  ARG B CD  1 
ATOM   1479 N NE  . ARG B 1 50  ? 5.631  26.851 46.388  1.00 62.08  ? 49  ARG B NE  1 
ATOM   1480 C CZ  . ARG B 1 50  ? 4.667  27.275 47.204  1.00 64.62  ? 49  ARG B CZ  1 
ATOM   1481 N NH1 . ARG B 1 50  ? 4.984  28.021 48.258  1.00 64.85  ? 49  ARG B NH1 1 
ATOM   1482 N NH2 . ARG B 1 50  ? 3.395  26.948 46.980  1.00 65.93  ? 49  ARG B NH2 1 
ATOM   1483 N N   . LEU B 1 51  ? 10.375 25.471 43.384  1.00 35.77  ? 50  LEU B N   1 
ATOM   1484 C CA  . LEU B 1 51  ? 11.318 24.351 43.524  1.00 33.36  ? 50  LEU B CA  1 
ATOM   1485 C C   . LEU B 1 51  ? 12.767 24.793 43.180  1.00 33.09  ? 50  LEU B C   1 
ATOM   1486 O O   . LEU B 1 51  ? 13.726 24.320 43.783  1.00 31.91  ? 50  LEU B O   1 
ATOM   1487 C CB  . LEU B 1 51  ? 10.910 23.187 42.612  1.00 30.52  ? 50  LEU B CB  1 
ATOM   1488 C CG  . LEU B 1 51  ? 9.650  22.412 42.987  1.00 30.27  ? 50  LEU B CG  1 
ATOM   1489 C CD1 . LEU B 1 51  ? 9.215  21.551 41.828  1.00 29.80  ? 50  LEU B CD1 1 
ATOM   1490 C CD2 . LEU B 1 51  ? 9.906  21.568 44.209  1.00 29.46  ? 50  LEU B CD2 1 
ATOM   1491 N N   . LEU B 1 52  ? 12.902 25.698 42.212  1.00 33.27  ? 51  LEU B N   1 
ATOM   1492 C CA  . LEU B 1 52  ? 14.233 26.186 41.830  1.00 34.47  ? 51  LEU B CA  1 
ATOM   1493 C C   . LEU B 1 52  ? 14.860 27.086 42.937  1.00 35.61  ? 51  LEU B C   1 
ATOM   1494 O O   . LEU B 1 52  ? 16.024 26.898 43.304  1.00 35.22  ? 51  LEU B O   1 
ATOM   1495 C CB  . LEU B 1 52  ? 14.175 26.934 40.492  1.00 31.53  ? 51  LEU B CB  1 
ATOM   1496 C CG  . LEU B 1 52  ? 14.000 26.022 39.276  1.00 31.73  ? 51  LEU B CG  1 
ATOM   1497 C CD1 . LEU B 1 52  ? 13.626 26.829 38.061  1.00 27.60  ? 51  LEU B CD1 1 
ATOM   1498 C CD2 . LEU B 1 52  ? 15.290 25.241 39.027  1.00 30.69  ? 51  LEU B CD2 1 
ATOM   1499 N N   . ALA B 1 53  ? 14.081 28.039 43.451  1.00 35.67  ? 52  ALA B N   1 
ATOM   1500 C CA  . ALA B 1 53  ? 14.560 28.933 44.523  1.00 35.47  ? 52  ALA B CA  1 
ATOM   1501 C C   . ALA B 1 53  ? 15.148 28.101 45.674  1.00 35.32  ? 52  ALA B C   1 
ATOM   1502 O O   . ALA B 1 53  ? 16.188 28.426 46.214  1.00 38.40  ? 52  ALA B O   1 
ATOM   1503 C CB  . ALA B 1 53  ? 13.416 29.799 45.052  1.00 33.94  ? 52  ALA B CB  1 
ATOM   1504 N N   . HIS B 1 54  ? 14.465 27.021 46.034  1.00 33.72  ? 53  HIS B N   1 
ATOM   1505 C CA  . HIS B 1 54  ? 14.981 26.156 47.103  1.00 31.77  ? 53  HIS B CA  1 
ATOM   1506 C C   . HIS B 1 54  ? 16.365 25.561 46.707  1.00 33.09  ? 53  HIS B C   1 
ATOM   1507 O O   . HIS B 1 54  ? 17.342 25.826 47.367  1.00 33.11  ? 53  HIS B O   1 
ATOM   1508 C CB  . HIS B 1 54  ? 13.986 25.039 47.415  1.00 27.83  ? 53  HIS B CB  1 
ATOM   1509 C CG  . HIS B 1 54  ? 14.392 24.188 48.573  1.00 28.80  ? 53  HIS B CG  1 
ATOM   1510 N ND1 . HIS B 1 54  ? 14.774 22.873 48.423  1.00 28.71  ? 53  HIS B ND1 1 
ATOM   1511 C CD2 . HIS B 1 54  ? 14.590 24.497 49.878  1.00 26.90  ? 53  HIS B CD2 1 
ATOM   1512 C CE1 . HIS B 1 54  ? 15.204 22.411 49.585  1.00 30.23  ? 53  HIS B CE1 1 
ATOM   1513 N NE2 . HIS B 1 54  ? 15.107 23.376 50.482  1.00 28.00  ? 53  HIS B NE2 1 
ATOM   1514 N N   . LYS B 1 55  ? 16.422 24.799 45.610  1.00 33.59  ? 54  LYS B N   1 
ATOM   1515 C CA  . LYS B 1 55  ? 17.681 24.193 45.138  1.00 33.38  ? 54  LYS B CA  1 
ATOM   1516 C C   . LYS B 1 55  ? 18.824 25.221 44.984  1.00 35.56  ? 54  LYS B C   1 
ATOM   1517 O O   . LYS B 1 55  ? 19.975 24.957 45.321  1.00 36.77  ? 54  LYS B O   1 
ATOM   1518 C CB  . LYS B 1 55  ? 17.478 23.509 43.788  1.00 32.72  ? 54  LYS B CB  1 
ATOM   1519 C CG  . LYS B 1 55  ? 16.400 22.440 43.771  1.00 34.18  ? 54  LYS B CG  1 
ATOM   1520 C CD  . LYS B 1 55  ? 16.719 21.307 44.738  1.00 33.65  ? 54  LYS B CD  1 
ATOM   1521 C CE  . LYS B 1 55  ? 15.687 20.179 44.648  1.00 32.93  ? 54  LYS B CE  1 
ATOM   1522 N NZ  . LYS B 1 55  ? 16.060 19.033 45.512  1.00 30.02  ? 54  LYS B NZ  1 
ATOM   1523 N N   . ILE B 1 56  ? 18.478 26.391 44.464  1.00 36.31  ? 55  ILE B N   1 
ATOM   1524 C CA  . ILE B 1 56  ? 19.445 27.457 44.231  1.00 34.55  ? 55  ILE B CA  1 
ATOM   1525 C C   . ILE B 1 56  ? 20.048 27.975 45.523  1.00 36.62  ? 55  ILE B C   1 
ATOM   1526 O O   . ILE B 1 56  ? 21.180 28.479 45.558  1.00 36.30  ? 55  ILE B O   1 
ATOM   1527 C CB  . ILE B 1 56  ? 18.773 28.582 43.453  1.00 33.58  ? 55  ILE B CB  1 
ATOM   1528 C CG1 . ILE B 1 56  ? 18.589 28.112 42.012  1.00 32.74  ? 55  ILE B CG1 1 
ATOM   1529 C CG2 . ILE B 1 56  ? 19.583 29.868 43.518  1.00 32.86  ? 55  ILE B CG2 1 
ATOM   1530 C CD1 . ILE B 1 56  ? 17.861 29.088 41.151  1.00 33.94  ? 55  ILE B CD1 1 
ATOM   1531 N N   . GLN B 1 57  ? 19.291 27.803 46.595  1.00 37.28  ? 56  GLN B N   1 
ATOM   1532 C CA  . GLN B 1 57  ? 19.731 28.248 47.912  1.00 38.50  ? 56  GLN B CA  1 
ATOM   1533 C C   . GLN B 1 57  ? 20.460 27.168 48.720  1.00 37.30  ? 56  GLN B C   1 
ATOM   1534 O O   . GLN B 1 57  ? 20.899 27.423 49.827  1.00 39.30  ? 56  GLN B O   1 
ATOM   1535 C CB  . GLN B 1 57  ? 18.519 28.765 48.692  1.00 40.16  ? 56  GLN B CB  1 
ATOM   1536 C CG  . GLN B 1 57  ? 17.921 30.002 48.050  1.00 46.14  ? 56  GLN B CG  1 
ATOM   1537 C CD  . GLN B 1 57  ? 16.713 30.533 48.778  1.00 47.95  ? 56  GLN B CD  1 
ATOM   1538 O OE1 . GLN B 1 57  ? 15.796 29.790 49.089  1.00 51.31  ? 56  GLN B OE1 1 
ATOM   1539 N NE2 . GLN B 1 57  ? 16.701 31.834 49.036  1.00 47.36  ? 56  GLN B NE2 1 
ATOM   1540 N N   . SER B 1 58  ? 20.599 25.977 48.158  1.00 37.28  ? 57  SER B N   1 
ATOM   1541 C CA  . SER B 1 58  ? 21.262 24.866 48.891  1.00 39.47  ? 57  SER B CA  1 
ATOM   1542 C C   . SER B 1 58  ? 22.741 25.131 49.292  1.00 38.73  ? 57  SER B C   1 
ATOM   1543 O O   . SER B 1 58  ? 23.502 25.696 48.548  1.00 39.50  ? 57  SER B O   1 
ATOM   1544 C CB  . SER B 1 58  ? 21.179 23.564 48.066  1.00 40.12  ? 57  SER B CB  1 
ATOM   1545 O OG  . SER B 1 58  ? 22.197 22.645 48.439  1.00 41.41  ? 57  SER B OG  1 
ATOM   1546 N N   . PRO B 1 59  ? 23.121 24.725 50.507  1.00 39.59  ? 58  PRO B N   1 
ATOM   1547 C CA  . PRO B 1 59  ? 24.496 24.915 50.978  1.00 39.08  ? 58  PRO B CA  1 
ATOM   1548 C C   . PRO B 1 59  ? 25.433 24.140 50.057  1.00 39.08  ? 58  PRO B C   1 
ATOM   1549 O O   . PRO B 1 59  ? 26.587 24.504 49.893  1.00 42.27  ? 58  PRO B O   1 
ATOM   1550 C CB  . PRO B 1 59  ? 24.473 24.320 52.385  1.00 39.34  ? 58  PRO B CB  1 
ATOM   1551 C CG  . PRO B 1 59  ? 23.089 24.643 52.837  1.00 40.04  ? 58  PRO B CG  1 
ATOM   1552 C CD  . PRO B 1 59  ? 22.244 24.298 51.611  1.00 38.88  ? 58  PRO B CD  1 
ATOM   1553 N N   . GLN B 1 60  ? 24.921 23.077 49.447  1.00 36.73  ? 59  GLN B N   1 
ATOM   1554 C CA  . GLN B 1 60  ? 25.752 22.282 48.540  1.00 35.71  ? 59  GLN B CA  1 
ATOM   1555 C C   . GLN B 1 60  ? 25.903 22.981 47.172  1.00 36.52  ? 59  GLN B C   1 
ATOM   1556 O O   . GLN B 1 60  ? 24.998 22.961 46.357  1.00 37.97  ? 59  GLN B O   1 
ATOM   1557 C CB  . GLN B 1 60  ? 25.147 20.889 48.392  1.00 34.46  ? 59  GLN B CB  1 
ATOM   1558 C CG  . GLN B 1 60  ? 24.925 20.216 49.736  1.00 34.47  ? 59  GLN B CG  1 
ATOM   1559 C CD  . GLN B 1 60  ? 24.283 18.846 49.617  1.00 36.52  ? 59  GLN B CD  1 
ATOM   1560 O OE1 . GLN B 1 60  ? 24.828 17.955 48.966  1.00 35.66  ? 59  GLN B OE1 1 
ATOM   1561 N NE2 . GLN B 1 60  ? 23.111 18.670 50.253  1.00 35.19  ? 59  GLN B NE2 1 
ATOM   1562 N N   . GLU B 1 61  ? 27.063 23.594 46.951  1.00 36.79  ? 60  GLU B N   1 
ATOM   1563 C CA  . GLU B 1 61  ? 27.338 24.336 45.709  1.00 36.17  ? 60  GLU B CA  1 
ATOM   1564 C C   . GLU B 1 61  ? 26.924 23.622 44.402  1.00 36.07  ? 60  GLU B C   1 
ATOM   1565 O O   . GLU B 1 61  ? 26.277 24.218 43.551  1.00 38.00  ? 60  GLU B O   1 
ATOM   1566 C CB  . GLU B 1 61  ? 28.821 24.699 45.622  1.00 36.56  ? 60  GLU B CB  1 
ATOM   1567 C CG  . GLU B 1 61  ? 29.141 25.613 44.463  1.00 40.32  ? 60  GLU B CG  1 
ATOM   1568 C CD  . GLU B 1 61  ? 30.568 25.458 43.969  1.00 44.12  ? 60  GLU B CD  1 
ATOM   1569 O OE1 . GLU B 1 61  ? 31.440 26.268 44.352  1.00 46.14  ? 60  GLU B OE1 1 
ATOM   1570 O OE2 . GLU B 1 61  ? 30.815 24.515 43.184  1.00 47.40  ? 60  GLU B OE2 1 
ATOM   1571 N N   . TRP B 1 62  ? 27.305 22.359 44.247  1.00 36.06  ? 61  TRP B N   1 
ATOM   1572 C CA  . TRP B 1 62  ? 26.998 21.583 43.001  1.00 34.04  ? 61  TRP B CA  1 
ATOM   1573 C C   . TRP B 1 62  ? 25.477 21.414 42.807  1.00 34.23  ? 61  TRP B C   1 
ATOM   1574 O O   . TRP B 1 62  ? 24.980 21.159 41.717  1.00 33.70  ? 61  TRP B O   1 
ATOM   1575 C CB  . TRP B 1 62  ? 27.716 20.214 43.064  1.00 34.56  ? 61  TRP B CB  1 
ATOM   1576 C CG  . TRP B 1 62  ? 27.562 19.362 41.856  1.00 34.95  ? 61  TRP B CG  1 
ATOM   1577 C CD1 . TRP B 1 62  ? 27.235 18.035 41.827  1.00 34.19  ? 61  TRP B CD1 1 
ATOM   1578 C CD2 . TRP B 1 62  ? 27.615 19.790 40.494  1.00 35.79  ? 61  TRP B CD2 1 
ATOM   1579 N NE1 . TRP B 1 62  ? 27.065 17.615 40.532  1.00 35.61  ? 61  TRP B NE1 1 
ATOM   1580 C CE2 . TRP B 1 62  ? 27.292 18.673 39.692  1.00 36.05  ? 61  TRP B CE2 1 
ATOM   1581 C CE3 . TRP B 1 62  ? 27.902 21.007 39.872  1.00 35.14  ? 61  TRP B CE3 1 
ATOM   1582 C CZ2 . TRP B 1 62  ? 27.236 18.744 38.294  1.00 37.70  ? 61  TRP B CZ2 1 
ATOM   1583 C CZ3 . TRP B 1 62  ? 27.849 21.079 38.478  1.00 37.21  ? 61  TRP B CZ3 1 
ATOM   1584 C CH2 . TRP B 1 62  ? 27.518 19.954 37.706  1.00 36.54  ? 61  TRP B CH2 1 
ATOM   1585 N N   . GLU B 1 63  ? 24.754 21.544 43.903  1.00 33.61  ? 62  GLU B N   1 
ATOM   1586 C CA  . GLU B 1 63  ? 23.336 21.461 43.817  1.00 33.83  ? 62  GLU B CA  1 
ATOM   1587 C C   . GLU B 1 63  ? 22.788 22.792 43.284  1.00 34.45  ? 62  GLU B C   1 
ATOM   1588 O O   . GLU B 1 63  ? 21.967 22.810 42.389  1.00 35.94  ? 62  GLU B O   1 
ATOM   1589 C CB  . GLU B 1 63  ? 22.756 21.166 45.180  1.00 33.25  ? 62  GLU B CB  1 
ATOM   1590 C CG  . GLU B 1 63  ? 21.265 21.181 45.195  1.00 35.97  ? 62  GLU B CG  1 
ATOM   1591 C CD  . GLU B 1 63  ? 20.740 20.396 46.339  1.00 37.42  ? 62  GLU B CD  1 
ATOM   1592 O OE1 . GLU B 1 63  ? 21.350 20.487 47.420  1.00 40.11  ? 62  GLU B OE1 1 
ATOM   1593 O OE2 . GLU B 1 63  ? 19.734 19.686 46.165  1.00 36.72  ? 62  GLU B OE2 1 
ATOM   1594 N N   . ALA B 1 64  ? 23.278 23.895 43.839  1.00 33.29  ? 63  ALA B N   1 
ATOM   1595 C CA  . ALA B 1 64  ? 22.844 25.227 43.420  1.00 33.32  ? 63  ALA B CA  1 
ATOM   1596 C C   . ALA B 1 64  ? 23.298 25.558 41.992  1.00 34.03  ? 63  ALA B C   1 
ATOM   1597 O O   . ALA B 1 64  ? 22.547 26.161 41.250  1.00 33.73  ? 63  ALA B O   1 
ATOM   1598 C CB  . ALA B 1 64  ? 23.365 26.275 44.388  1.00 33.31  ? 63  ALA B CB  1 
ATOM   1599 N N   . ILE B 1 65  ? 24.520 25.153 41.628  1.00 34.56  ? 64  ILE B N   1 
ATOM   1600 C CA  . ILE B 1 65  ? 25.038 25.401 40.264  1.00 33.62  ? 64  ILE B CA  1 
ATOM   1601 C C   . ILE B 1 65  ? 24.188 24.666 39.246  1.00 33.60  ? 64  ILE B C   1 
ATOM   1602 O O   . ILE B 1 65  ? 23.897 25.183 38.188  1.00 34.35  ? 64  ILE B O   1 
ATOM   1603 C CB  . ILE B 1 65  ? 26.494 24.900 40.058  1.00 36.56  ? 64  ILE B CB  1 
ATOM   1604 C CG1 . ILE B 1 65  ? 27.477 25.738 40.893  1.00 36.44  ? 64  ILE B CG1 1 
ATOM   1605 C CG2 . ILE B 1 65  ? 26.856 24.946 38.570  1.00 32.87  ? 64  ILE B CG2 1 
ATOM   1606 C CD1 . ILE B 1 65  ? 27.447 27.211 40.545  1.00 38.24  ? 64  ILE B CD1 1 
ATOM   1607 N N   . GLN B 1 66  ? 23.800 23.443 39.561  1.00 33.08  ? 65  GLN B N   1 
ATOM   1608 C CA  . GLN B 1 66  ? 22.971 22.741 38.603  1.00 33.34  ? 65  GLN B CA  1 
ATOM   1609 C C   . GLN B 1 66  ? 21.577 23.362 38.561  1.00 33.23  ? 65  GLN B C   1 
ATOM   1610 O O   . GLN B 1 66  ? 20.993 23.446 37.490  1.00 33.41  ? 65  GLN B O   1 
ATOM   1611 C CB  . GLN B 1 66  ? 22.870 21.266 38.926  1.00 32.33  ? 65  GLN B CB  1 
ATOM   1612 C CG  . GLN B 1 66  ? 24.171 20.530 38.912  1.00 33.96  ? 65  GLN B CG  1 
ATOM   1613 C CD  . GLN B 1 66  ? 23.911 19.065 38.896  1.00 35.96  ? 65  GLN B CD  1 
ATOM   1614 O OE1 . GLN B 1 66  ? 23.661 18.493 37.852  1.00 40.03  ? 65  GLN B OE1 1 
ATOM   1615 N NE2 . GLN B 1 66  ? 23.901 18.457 40.062  1.00 34.78  ? 65  GLN B NE2 1 
ATOM   1616 N N   . ALA B 1 67  ? 21.052 23.785 39.717  1.00 31.62  ? 66  ALA B N   1 
ATOM   1617 C CA  . ALA B 1 67  ? 19.720 24.443 39.721  1.00 31.55  ? 66  ALA B CA  1 
ATOM   1618 C C   . ALA B 1 67  ? 19.798 25.749 38.861  1.00 33.04  ? 66  ALA B C   1 
ATOM   1619 O O   . ALA B 1 67  ? 18.926 26.015 38.026  1.00 33.63  ? 66  ALA B O   1 
ATOM   1620 C CB  . ALA B 1 67  ? 19.266 24.760 41.142  1.00 29.70  ? 66  ALA B CB  1 
ATOM   1621 N N   . LEU B 1 68  ? 20.867 26.519 39.044  1.00 32.04  ? 67  LEU B N   1 
ATOM   1622 C CA  . LEU B 1 68  ? 21.053 27.715 38.221  1.00 34.96  ? 67  LEU B CA  1 
ATOM   1623 C C   . LEU B 1 68  ? 21.177 27.341 36.729  1.00 36.58  ? 67  LEU B C   1 
ATOM   1624 O O   . LEU B 1 68  ? 20.717 28.066 35.850  1.00 39.44  ? 67  LEU B O   1 
ATOM   1625 C CB  . LEU B 1 68  ? 22.304 28.475 38.622  1.00 33.23  ? 67  LEU B CB  1 
ATOM   1626 C CG  . LEU B 1 68  ? 22.143 29.189 39.945  1.00 34.89  ? 67  LEU B CG  1 
ATOM   1627 C CD1 . LEU B 1 68  ? 23.508 29.649 40.392  1.00 32.35  ? 67  LEU B CD1 1 
ATOM   1628 C CD2 . LEU B 1 68  ? 21.138 30.341 39.820  1.00 32.99  ? 67  LEU B CD2 1 
ATOM   1629 N N   . THR B 1 69  ? 21.814 26.214 36.457  1.00 35.48  ? 68  THR B N   1 
ATOM   1630 C CA  . THR B 1 69  ? 21.945 25.783 35.079  1.00 36.76  ? 68  THR B CA  1 
ATOM   1631 C C   . THR B 1 69  ? 20.554 25.484 34.493  1.00 36.96  ? 68  THR B C   1 
ATOM   1632 O O   . THR B 1 69  ? 20.301 25.701 33.322  1.00 36.96  ? 68  THR B O   1 
ATOM   1633 C CB  . THR B 1 69  ? 22.851 24.543 34.980  1.00 37.53  ? 68  THR B CB  1 
ATOM   1634 O OG1 . THR B 1 69  ? 24.169 24.921 35.368  1.00 38.18  ? 68  THR B OG1 1 
ATOM   1635 C CG2 . THR B 1 69  ? 22.900 23.993 33.557  1.00 38.42  ? 68  THR B CG2 1 
ATOM   1636 N N   . VAL B 1 70  ? 19.660 25.002 35.348  1.00 37.78  ? 69  VAL B N   1 
ATOM   1637 C CA  . VAL B 1 70  ? 18.293 24.709 34.928  1.00 36.26  ? 69  VAL B CA  1 
ATOM   1638 C C   . VAL B 1 70  ? 17.525 26.018 34.671  1.00 37.08  ? 69  VAL B C   1 
ATOM   1639 O O   . VAL B 1 70  ? 16.829 26.150 33.669  1.00 37.76  ? 69  VAL B O   1 
ATOM   1640 C CB  . VAL B 1 70  ? 17.552 23.883 35.985  1.00 33.80  ? 69  VAL B CB  1 
ATOM   1641 C CG1 . VAL B 1 70  ? 16.068 23.910 35.695  1.00 31.58  ? 69  VAL B CG1 1 
ATOM   1642 C CG2 . VAL B 1 70  ? 18.080 22.455 35.992  1.00 29.02  ? 69  VAL B CG2 1 
ATOM   1643 N N   . LEU B 1 71  ? 17.699 26.980 35.574  1.00 37.08  ? 70  LEU B N   1 
ATOM   1644 C CA  . LEU B 1 71  ? 17.039 28.293 35.442  1.00 35.98  ? 70  LEU B CA  1 
ATOM   1645 C C   . LEU B 1 71  ? 17.469 28.976 34.145  1.00 36.15  ? 70  LEU B C   1 
ATOM   1646 O O   . LEU B 1 71  ? 16.657 29.486 33.395  1.00 35.83  ? 70  LEU B O   1 
ATOM   1647 C CB  . LEU B 1 71  ? 17.395 29.203 36.616  1.00 32.61  ? 70  LEU B CB  1 
ATOM   1648 C CG  . LEU B 1 71  ? 16.707 30.563 36.573  1.00 32.96  ? 70  LEU B CG  1 
ATOM   1649 C CD1 . LEU B 1 71  ? 15.226 30.386 36.738  1.00 34.41  ? 70  LEU B CD1 1 
ATOM   1650 C CD2 . LEU B 1 71  ? 17.223 31.433 37.695  1.00 35.90  ? 70  LEU B CD2 1 
ATOM   1651 N N   . GLU B 1 72  ? 18.771 28.965 33.910  1.00 36.66  ? 71  GLU B N   1 
ATOM   1652 C CA  . GLU B 1 72  ? 19.318 29.565 32.724  1.00 38.31  ? 71  GLU B CA  1 
ATOM   1653 C C   . GLU B 1 72  ? 18.749 28.910 31.471  1.00 39.90  ? 71  GLU B C   1 
ATOM   1654 O O   . GLU B 1 72  ? 18.374 29.574 30.517  1.00 42.01  ? 71  GLU B O   1 
ATOM   1655 C CB  . GLU B 1 72  ? 20.827 29.407 32.724  1.00 38.06  ? 71  GLU B CB  1 
ATOM   1656 C CG  . GLU B 1 72  ? 21.474 29.990 31.507  1.00 40.17  ? 71  GLU B CG  1 
ATOM   1657 C CD  . GLU B 1 72  ? 22.966 29.908 31.555  1.00 44.82  ? 71  GLU B CD  1 
ATOM   1658 O OE1 . GLU B 1 72  ? 23.591 30.460 30.630  1.00 48.88  ? 71  GLU B OE1 1 
ATOM   1659 O OE2 . GLU B 1 72  ? 23.524 29.302 32.501  1.00 45.40  ? 71  GLU B OE2 1 
ATOM   1660 N N   . THR B 1 73  ? 18.688 27.588 31.506  1.00 39.34  ? 72  THR B N   1 
ATOM   1661 C CA  . THR B 1 73  ? 18.194 26.844 30.380  1.00 36.76  ? 72  THR B CA  1 
ATOM   1662 C C   . THR B 1 73  ? 16.710 27.064 30.123  1.00 38.07  ? 72  THR B C   1 
ATOM   1663 O O   . THR B 1 73  ? 16.321 27.346 29.005  1.00 38.35  ? 72  THR B O   1 
ATOM   1664 C CB  . THR B 1 73  ? 18.429 25.357 30.563  1.00 35.46  ? 72  THR B CB  1 
ATOM   1665 O OG1 . THR B 1 73  ? 19.818 25.123 30.829  1.00 35.12  ? 72  THR B OG1 1 
ATOM   1666 C CG2 . THR B 1 73  ? 18.031 24.628 29.311  1.00 32.07  ? 72  THR B CG2 1 
ATOM   1667 N N   . CYS B 1 74  ? 15.876 26.926 31.144  1.00 37.68  ? 73  CYS B N   1 
ATOM   1668 C CA  . CYS B 1 74  ? 14.457 27.116 30.885  1.00 38.92  ? 73  CYS B CA  1 
ATOM   1669 C C   . CYS B 1 74  ? 14.119 28.550 30.452  1.00 39.91  ? 73  CYS B C   1 
ATOM   1670 O O   . CYS B 1 74  ? 13.151 28.753 29.748  1.00 40.44  ? 73  CYS B O   1 
ATOM   1671 C CB  . CYS B 1 74  ? 13.615 26.724 32.093  1.00 38.92  ? 73  CYS B CB  1 
ATOM   1672 S SG  . CYS B 1 74  ? 13.818 25.002 32.648  1.00 40.53  ? 73  CYS B SG  1 
ATOM   1673 N N   . MET B 1 75  ? 14.913 29.533 30.869  1.00 41.23  ? 74  MET B N   1 
ATOM   1674 C CA  . MET B 1 75  ? 14.623 30.897 30.453  1.00 42.66  ? 74  MET B CA  1 
ATOM   1675 C C   . MET B 1 75  ? 14.779 31.022 28.939  1.00 45.06  ? 74  MET B C   1 
ATOM   1676 O O   . MET B 1 75  ? 14.022 31.747 28.298  1.00 47.38  ? 74  MET B O   1 
ATOM   1677 C CB  . MET B 1 75  ? 15.541 31.911 31.145  1.00 42.26  ? 74  MET B CB  1 
ATOM   1678 C CG  . MET B 1 75  ? 15.082 32.376 32.522  1.00 43.71  ? 74  MET B CG  1 
ATOM   1679 S SD  . MET B 1 75  ? 13.543 33.350 32.550  1.00 44.33  ? 74  MET B SD  1 
ATOM   1680 C CE  . MET B 1 75  ? 14.161 34.985 32.100  1.00 40.76  ? 74  MET B CE  1 
ATOM   1681 N N   . LYS B 1 76  ? 15.752 30.300 28.379  1.00 46.33  ? 75  LYS B N   1 
ATOM   1682 C CA  . LYS B 1 76  ? 15.991 30.328 26.906  1.00 49.10  ? 75  LYS B CA  1 
ATOM   1683 C C   . LYS B 1 76  ? 14.840 29.692 26.072  1.00 52.33  ? 75  LYS B C   1 
ATOM   1684 O O   . LYS B 1 76  ? 14.502 30.169 24.997  1.00 52.44  ? 75  LYS B O   1 
ATOM   1685 C CB  . LYS B 1 76  ? 17.276 29.580 26.531  1.00 45.70  ? 75  LYS B CB  1 
ATOM   1686 C CG  . LYS B 1 76  ? 18.547 30.131 27.094  1.00 46.84  ? 75  LYS B CG  1 
ATOM   1687 C CD  . LYS B 1 76  ? 19.733 29.442 26.451  1.00 44.54  ? 75  LYS B CD  1 
ATOM   1688 C CE  . LYS B 1 76  ? 21.016 29.720 27.213  1.00 45.15  ? 75  LYS B CE  1 
ATOM   1689 N NZ  . LYS B 1 76  ? 22.193 29.052 26.587  1.00 43.16  ? 75  LYS B NZ  1 
ATOM   1690 N N   . SER B 1 77  ? 14.259 28.612 26.578  1.00 56.99  ? 76  SER B N   1 
ATOM   1691 C CA  . SER B 1 77  ? 13.210 27.910 25.832  1.00 62.30  ? 76  SER B CA  1 
ATOM   1692 C C   . SER B 1 77  ? 11.856 27.869 26.534  1.00 65.06  ? 76  SER B C   1 
ATOM   1693 O O   . SER B 1 77  ? 11.361 26.790 26.884  1.00 65.69  ? 76  SER B O   1 
ATOM   1694 C CB  . SER B 1 77  ? 13.668 26.480 25.529  1.00 62.91  ? 76  SER B CB  1 
ATOM   1695 O OG  . SER B 1 77  ? 14.083 25.810 26.711  1.00 63.13  ? 76  SER B OG  1 
ATOM   1696 N N   . CYS B 1 78  ? 11.267 29.048 26.718  1.00 67.34  ? 77  CYS B N   1 
ATOM   1697 C CA  . CYS B 1 78  ? 9.958  29.163 27.374  1.00 68.68  ? 77  CYS B CA  1 
ATOM   1698 C C   . CYS B 1 78  ? 9.273  30.504 27.090  1.00 70.71  ? 77  CYS B C   1 
ATOM   1699 O O   . CYS B 1 78  ? 9.929  31.489 26.782  1.00 71.94  ? 77  CYS B O   1 
ATOM   1700 C CB  . CYS B 1 78  ? 10.096 28.953 28.887  1.00 66.43  ? 77  CYS B CB  1 
ATOM   1701 S SG  . CYS B 1 78  ? 10.468 27.244 29.365  1.00 61.99  ? 77  CYS B SG  1 
ATOM   1702 N N   . GLY B 1 79  ? 7.949  30.508 27.204  1.00 72.06  ? 78  GLY B N   1 
ATOM   1703 C CA  . GLY B 1 79  ? 7.177  31.705 26.937  1.00 73.78  ? 78  GLY B CA  1 
ATOM   1704 C C   . GLY B 1 79  ? 7.005  32.639 28.110  1.00 74.58  ? 78  GLY B C   1 
ATOM   1705 O O   . GLY B 1 79  ? 7.765  32.602 29.069  1.00 74.85  ? 78  GLY B O   1 
ATOM   1706 N N   . LYS B 1 80  ? 5.989  33.490 28.023  1.00 75.33  ? 79  LYS B N   1 
ATOM   1707 C CA  . LYS B 1 80  ? 5.736  34.455 29.092  1.00 75.51  ? 79  LYS B CA  1 
ATOM   1708 C C   . LYS B 1 80  ? 5.383  33.744 30.408  1.00 73.81  ? 79  LYS B C   1 
ATOM   1709 O O   . LYS B 1 80  ? 5.735  34.214 31.478  1.00 74.41  ? 79  LYS B O   1 
ATOM   1710 C CB  . LYS B 1 80  ? 4.617  35.434 28.684  1.00 77.74  ? 79  LYS B CB  1 
ATOM   1711 C CG  . LYS B 1 80  ? 4.935  36.915 29.018  1.00 80.58  ? 79  LYS B CG  1 
ATOM   1712 C CD  . LYS B 1 80  ? 3.944  37.897 28.382  1.00 81.17  ? 79  LYS B CD  1 
ATOM   1713 C CE  . LYS B 1 80  ? 4.437  39.347 28.445  1.00 81.16  ? 79  LYS B CE  1 
ATOM   1714 N NZ  . LYS B 1 80  ? 3.558  40.279 27.661  1.00 80.75  ? 79  LYS B NZ  1 
ATOM   1715 N N   . ARG B 1 81  ? 4.708  32.602 30.295  1.00 71.22  ? 80  ARG B N   1 
ATOM   1716 C CA  . ARG B 1 81  ? 4.307  31.816 31.469  1.00 68.92  ? 80  ARG B CA  1 
ATOM   1717 C C   . ARG B 1 81  ? 5.445  31.685 32.511  1.00 68.25  ? 80  ARG B C   1 
ATOM   1718 O O   . ARG B 1 81  ? 5.262  32.025 33.675  1.00 67.80  ? 80  ARG B O   1 
ATOM   1719 C CB  . ARG B 1 81  ? 3.841  30.429 31.023  1.00 67.83  ? 80  ARG B CB  1 
ATOM   1720 C CG  . ARG B 1 81  ? 2.459  30.425 30.392  1.00 67.23  ? 80  ARG B CG  1 
ATOM   1721 C CD  . ARG B 1 81  ? 2.281  29.257 29.420  1.00 66.43  ? 80  ARG B CD  1 
ATOM   1722 N NE  . ARG B 1 81  ? 3.182  29.371 28.274  1.00 63.86  ? 80  ARG B NE  1 
ATOM   1723 C CZ  . ARG B 1 81  ? 3.036  30.258 27.296  1.00 60.61  ? 80  ARG B CZ  1 
ATOM   1724 N NH1 . ARG B 1 81  ? 2.018  31.104 27.315  1.00 58.89  ? 80  ARG B NH1 1 
ATOM   1725 N NH2 . ARG B 1 81  ? 3.927  30.318 26.318  1.00 59.13  ? 80  ARG B NH2 1 
ATOM   1726 N N   . PHE B 1 82  ? 6.603  31.199 32.065  1.00 66.13  ? 81  PHE B N   1 
ATOM   1727 C CA  . PHE B 1 82  ? 7.772  31.030 32.940  1.00 63.87  ? 81  PHE B CA  1 
ATOM   1728 C C   . PHE B 1 82  ? 8.582  32.329 33.024  1.00 63.49  ? 81  PHE B C   1 
ATOM   1729 O O   . PHE B 1 82  ? 9.112  32.660 34.063  1.00 62.85  ? 81  PHE B O   1 
ATOM   1730 C CB  . PHE B 1 82  ? 8.672  29.892 32.431  1.00 62.91  ? 81  PHE B CB  1 
ATOM   1731 C CG  . PHE B 1 82  ? 9.845  29.590 33.328  1.00 60.06  ? 81  PHE B CG  1 
ATOM   1732 C CD1 . PHE B 1 82  ? 11.143 29.817 32.901  1.00 58.37  ? 81  PHE B CD1 1 
ATOM   1733 C CD2 . PHE B 1 82  ? 9.648  29.110 34.617  1.00 60.15  ? 81  PHE B CD2 1 
ATOM   1734 C CE1 . PHE B 1 82  ? 12.232 29.574 33.753  1.00 59.24  ? 81  PHE B CE1 1 
ATOM   1735 C CE2 . PHE B 1 82  ? 10.733 28.867 35.474  1.00 59.93  ? 81  PHE B CE2 1 
ATOM   1736 C CZ  . PHE B 1 82  ? 12.022 29.100 35.041  1.00 57.16  ? 81  PHE B CZ  1 
ATOM   1737 N N   . HIS B 1 83  ? 8.669  33.054 31.917  1.00 63.79  ? 82  HIS B N   1 
ATOM   1738 C CA  . HIS B 1 83  ? 9.400  34.326 31.941  1.00 65.15  ? 82  HIS B CA  1 
ATOM   1739 C C   . HIS B 1 83  ? 8.780  35.308 32.945  1.00 65.21  ? 82  HIS B C   1 
ATOM   1740 O O   . HIS B 1 83  ? 9.473  36.144 33.498  1.00 65.32  ? 82  HIS B O   1 
ATOM   1741 C CB  . HIS B 1 83  ? 9.422  34.982 30.566  1.00 65.02  ? 82  HIS B CB  1 
ATOM   1742 C CG  . HIS B 1 83  ? 10.336 34.322 29.589  1.00 66.04  ? 82  HIS B CG  1 
ATOM   1743 N ND1 . HIS B 1 83  ? 10.515 34.786 28.311  1.00 66.50  ? 82  HIS B ND1 1 
ATOM   1744 C CD2 . HIS B 1 83  ? 11.135 33.229 29.708  1.00 67.26  ? 82  HIS B CD2 1 
ATOM   1745 C CE1 . HIS B 1 83  ? 11.382 34.016 27.676  1.00 67.69  ? 82  HIS B CE1 1 
ATOM   1746 N NE2 . HIS B 1 83  ? 11.771 33.064 28.505  1.00 66.85  ? 82  HIS B NE2 1 
ATOM   1747 N N   . ASP B 1 84  ? 7.473  35.198 33.163  1.00 64.01  ? 83  ASP B N   1 
ATOM   1748 C CA  . ASP B 1 84  ? 6.814  36.091 34.110  1.00 63.71  ? 83  ASP B CA  1 
ATOM   1749 C C   . ASP B 1 84  ? 7.037  35.653 35.561  1.00 62.31  ? 83  ASP B C   1 
ATOM   1750 O O   . ASP B 1 84  ? 7.138  36.484 36.447  1.00 62.44  ? 83  ASP B O   1 
ATOM   1751 C CB  . ASP B 1 84  ? 5.309  36.187 33.837  1.00 65.08  ? 83  ASP B CB  1 
ATOM   1752 C CG  . ASP B 1 84  ? 4.986  36.920 32.534  1.00 67.71  ? 83  ASP B CG  1 
ATOM   1753 O OD1 . ASP B 1 84  ? 5.765  37.819 32.119  1.00 68.66  ? 83  ASP B OD1 1 
ATOM   1754 O OD2 . ASP B 1 84  ? 3.934  36.607 31.935  1.00 67.36  ? 83  ASP B OD2 1 
ATOM   1755 N N   . GLU B 1 85  ? 7.115  34.344 35.785  1.00 60.43  ? 84  GLU B N   1 
ATOM   1756 C CA  . GLU B 1 85  ? 7.329  33.828 37.146  1.00 58.23  ? 84  GLU B CA  1 
ATOM   1757 C C   . GLU B 1 85  ? 8.698  34.241 37.684  1.00 55.41  ? 84  GLU B C   1 
ATOM   1758 O O   . GLU B 1 85  ? 8.845  34.554 38.848  1.00 54.39  ? 84  GLU B O   1 
ATOM   1759 C CB  . GLU B 1 85  ? 7.201  32.307 37.172  1.00 58.50  ? 84  GLU B CB  1 
ATOM   1760 C CG  . GLU B 1 85  ? 5.772  31.840 37.135  1.00 61.56  ? 84  GLU B CG  1 
ATOM   1761 C CD  . GLU B 1 85  ? 4.959  32.383 38.299  1.00 64.73  ? 84  GLU B CD  1 
ATOM   1762 O OE1 . GLU B 1 85  ? 5.181  31.944 39.451  1.00 65.80  ? 84  GLU B OE1 1 
ATOM   1763 O OE2 . GLU B 1 85  ? 4.102  33.259 38.067  1.00 65.22  ? 84  GLU B OE2 1 
ATOM   1764 N N   . VAL B 1 86  ? 9.686  34.233 36.805  1.00 52.36  ? 85  VAL B N   1 
ATOM   1765 C CA  . VAL B 1 86  ? 11.027 34.626 37.186  1.00 51.57  ? 85  VAL B CA  1 
ATOM   1766 C C   . VAL B 1 86  ? 11.126 36.151 37.311  1.00 52.14  ? 85  VAL B C   1 
ATOM   1767 O O   . VAL B 1 86  ? 11.908 36.675 38.075  1.00 50.92  ? 85  VAL B O   1 
ATOM   1768 C CB  . VAL B 1 86  ? 12.033 34.166 36.151  1.00 50.00  ? 85  VAL B CB  1 
ATOM   1769 C CG1 . VAL B 1 86  ? 13.365 34.768 36.443  1.00 47.32  ? 85  VAL B CG1 1 
ATOM   1770 C CG2 . VAL B 1 86  ? 12.104 32.645 36.142  1.00 48.68  ? 85  VAL B CG2 1 
ATOM   1771 N N   . GLY B 1 87  ? 10.299 36.834 36.531  1.00 53.17  ? 86  GLY B N   1 
ATOM   1772 C CA  . GLY B 1 87  ? 10.272 38.278 36.554  1.00 52.13  ? 86  GLY B CA  1 
ATOM   1773 C C   . GLY B 1 87  ? 9.658  38.782 37.836  1.00 51.86  ? 86  GLY B C   1 
ATOM   1774 O O   . GLY B 1 87  ? 10.011 39.852 38.265  1.00 54.46  ? 86  GLY B O   1 
ATOM   1775 N N   . LYS B 1 88  ? 8.745  38.025 38.445  1.00 50.30  ? 87  LYS B N   1 
ATOM   1776 C CA  . LYS B 1 88  ? 8.120  38.474 39.709  1.00 50.08  ? 87  LYS B CA  1 
ATOM   1777 C C   . LYS B 1 88  ? 9.135  38.497 40.893  1.00 49.92  ? 87  LYS B C   1 
ATOM   1778 O O   . LYS B 1 88  ? 9.973  37.617 41.010  1.00 50.19  ? 87  LYS B O   1 
ATOM   1779 C CB  . LYS B 1 88  ? 6.934  37.570 40.085  1.00 50.10  ? 87  LYS B CB  1 
ATOM   1780 C CG  . LYS B 1 88  ? 5.689  37.706 39.214  1.00 51.36  ? 87  LYS B CG  1 
ATOM   1781 C CD  . LYS B 1 88  ? 4.584  36.745 39.686  1.00 53.55  ? 87  LYS B CD  1 
ATOM   1782 C CE  . LYS B 1 88  ? 3.337  36.790 38.795  1.00 53.62  ? 87  LYS B CE  1 
ATOM   1783 N NZ  . LYS B 1 88  ? 2.807  38.172 38.609  1.00 54.76  ? 87  LYS B NZ  1 
ATOM   1784 N N   . PHE B 1 89  ? 9.043  39.511 41.754  1.00 49.29  ? 88  PHE B N   1 
ATOM   1785 C CA  . PHE B 1 89  ? 9.955  39.616 42.924  1.00 47.40  ? 88  PHE B CA  1 
ATOM   1786 C C   . PHE B 1 89  ? 9.834  38.401 43.854  1.00 46.60  ? 88  PHE B C   1 
ATOM   1787 O O   . PHE B 1 89  ? 10.721 38.127 44.633  1.00 45.76  ? 88  PHE B O   1 
ATOM   1788 C CB  . PHE B 1 89  ? 9.682  40.901 43.713  1.00 45.30  ? 88  PHE B CB  1 
ATOM   1789 C CG  . PHE B 1 89  ? 10.028 42.151 42.962  1.00 45.90  ? 88  PHE B CG  1 
ATOM   1790 C CD1 . PHE B 1 89  ? 11.312 42.333 42.450  1.00 44.92  ? 88  PHE B CD1 1 
ATOM   1791 C CD2 . PHE B 1 89  ? 9.069  43.148 42.755  1.00 46.93  ? 88  PHE B CD2 1 
ATOM   1792 C CE1 . PHE B 1 89  ? 11.643 43.482 41.749  1.00 45.24  ? 88  PHE B CE1 1 
ATOM   1793 C CE2 . PHE B 1 89  ? 9.386  44.307 42.053  1.00 46.35  ? 88  PHE B CE2 1 
ATOM   1794 C CZ  . PHE B 1 89  ? 10.678 44.475 41.546  1.00 45.98  ? 88  PHE B CZ  1 
ATOM   1795 N N   . ARG B 1 90  ? 8.699  37.714 43.751  1.00 47.30  ? 89  ARG B N   1 
ATOM   1796 C CA  . ARG B 1 90  ? 8.416  36.489 44.507  1.00 46.27  ? 89  ARG B CA  1 
ATOM   1797 C C   . ARG B 1 90  ? 9.563  35.478 44.287  1.00 43.96  ? 89  ARG B C   1 
ATOM   1798 O O   . ARG B 1 90  ? 9.838  34.650 45.131  1.00 42.75  ? 89  ARG B O   1 
ATOM   1799 C CB  . ARG B 1 90  ? 7.099  35.889 44.003  1.00 52.56  ? 89  ARG B CB  1 
ATOM   1800 C CG  . ARG B 1 90  ? 6.858  34.418 44.331  1.00 58.06  ? 89  ARG B CG  1 
ATOM   1801 C CD  . ARG B 1 90  ? 6.071  34.264 45.623  1.00 64.75  ? 89  ARG B CD  1 
ATOM   1802 N NE  . ARG B 1 90  ? 4.821  35.028 45.600  1.00 68.89  ? 89  ARG B NE  1 
ATOM   1803 C CZ  . ARG B 1 90  ? 3.978  35.109 46.626  1.00 71.40  ? 89  ARG B CZ  1 
ATOM   1804 N NH1 . ARG B 1 90  ? 2.867  35.828 46.508  1.00 71.85  ? 89  ARG B NH1 1 
ATOM   1805 N NH2 . ARG B 1 90  ? 4.246  34.470 47.765  1.00 70.48  ? 89  ARG B NH2 1 
ATOM   1806 N N   . PHE B 1 91  ? 10.195 35.568 43.118  1.00 40.78  ? 90  PHE B N   1 
ATOM   1807 C CA  . PHE B 1 91  ? 11.326 34.716 42.782  1.00 38.95  ? 90  PHE B CA  1 
ATOM   1808 C C   . PHE B 1 91  ? 12.639 35.503 42.864  1.00 38.92  ? 90  PHE B C   1 
ATOM   1809 O O   . PHE B 1 91  ? 13.548 35.086 43.521  1.00 40.47  ? 90  PHE B O   1 
ATOM   1810 C CB  . PHE B 1 91  ? 11.201 34.131 41.373  1.00 36.15  ? 90  PHE B CB  1 
ATOM   1811 C CG  . PHE B 1 91  ? 12.373 33.273 40.973  1.00 33.04  ? 90  PHE B CG  1 
ATOM   1812 C CD1 . PHE B 1 91  ? 12.640 32.078 41.632  1.00 33.70  ? 90  PHE B CD1 1 
ATOM   1813 C CD2 . PHE B 1 91  ? 13.246 33.687 39.986  1.00 33.01  ? 90  PHE B CD2 1 
ATOM   1814 C CE1 . PHE B 1 91  ? 13.772 31.319 41.305  1.00 31.41  ? 90  PHE B CE1 1 
ATOM   1815 C CE2 . PHE B 1 91  ? 14.376 32.936 39.655  1.00 31.80  ? 90  PHE B CE2 1 
ATOM   1816 C CZ  . PHE B 1 91  ? 14.633 31.757 40.317  1.00 31.05  ? 90  PHE B CZ  1 
ATOM   1817 N N   . LEU B 1 92  ? 12.721 36.641 42.190  1.00 39.62  ? 91  LEU B N   1 
ATOM   1818 C CA  . LEU B 1 92  ? 13.951 37.424 42.243  1.00 41.28  ? 91  LEU B CA  1 
ATOM   1819 C C   . LEU B 1 92  ? 14.476 37.624 43.699  1.00 40.49  ? 91  LEU B C   1 
ATOM   1820 O O   . LEU B 1 92  ? 15.660 37.551 43.928  1.00 39.29  ? 91  LEU B O   1 
ATOM   1821 C CB  . LEU B 1 92  ? 13.752 38.779 41.556  1.00 41.68  ? 91  LEU B CB  1 
ATOM   1822 C CG  . LEU B 1 92  ? 13.510 38.705 40.050  1.00 42.70  ? 91  LEU B CG  1 
ATOM   1823 C CD1 . LEU B 1 92  ? 13.173 40.088 39.510  1.00 42.89  ? 91  LEU B CD1 1 
ATOM   1824 C CD2 . LEU B 1 92  ? 14.742 38.139 39.351  1.00 44.54  ? 91  LEU B CD2 1 
ATOM   1825 N N   . ASN B 1 93  ? 13.594 37.848 44.663  1.00 40.63  ? 92  ASN B N   1 
ATOM   1826 C CA  . ASN B 1 93  ? 14.076 38.027 46.039  1.00 42.16  ? 92  ASN B CA  1 
ATOM   1827 C C   . ASN B 1 93  ? 14.950 36.840 46.514  1.00 42.52  ? 92  ASN B C   1 
ATOM   1828 O O   . ASN B 1 93  ? 16.015 37.036 47.096  1.00 43.30  ? 92  ASN B O   1 
ATOM   1829 C CB  . ASN B 1 93  ? 12.913 38.225 47.017  1.00 42.40  ? 92  ASN B CB  1 
ATOM   1830 C CG  . ASN B 1 93  ? 12.285 39.598 46.904  1.00 42.96  ? 92  ASN B CG  1 
ATOM   1831 O OD1 . ASN B 1 93  ? 12.982 40.591 46.733  1.00 43.41  ? 92  ASN B OD1 1 
ATOM   1832 N ND2 . ASN B 1 93  ? 10.960 39.660 47.014  1.00 42.09  ? 92  ASN B ND2 1 
ATOM   1833 N N   . GLU B 1 94  ? 14.486 35.622 46.259  1.00 41.42  ? 93  GLU B N   1 
ATOM   1834 C CA  . GLU B 1 94  ? 15.256 34.433 46.641  1.00 42.34  ? 93  GLU B CA  1 
ATOM   1835 C C   . GLU B 1 94  ? 16.706 34.480 46.043  1.00 43.24  ? 93  GLU B C   1 
ATOM   1836 O O   . GLU B 1 94  ? 17.657 34.058 46.680  1.00 43.89  ? 93  GLU B O   1 
ATOM   1837 C CB  . GLU B 1 94  ? 14.519 33.174 46.189  1.00 41.41  ? 93  GLU B CB  1 
ATOM   1838 C CG  . GLU B 1 94  ? 13.098 33.105 46.701  1.00 40.58  ? 93  GLU B CG  1 
ATOM   1839 C CD  . GLU B 1 94  ? 13.019 33.289 48.209  1.00 42.36  ? 93  GLU B CD  1 
ATOM   1840 O OE1 . GLU B 1 94  ? 13.869 32.745 48.927  1.00 43.30  ? 93  GLU B OE1 1 
ATOM   1841 O OE2 . GLU B 1 94  ? 12.098 33.966 48.690  1.00 44.56  ? 93  GLU B OE2 1 
ATOM   1842 N N   . LEU B 1 95  ? 16.845 34.997 44.820  1.00 43.51  ? 94  LEU B N   1 
ATOM   1843 C CA  . LEU B 1 95  ? 18.176 35.165 44.213  1.00 41.86  ? 94  LEU B CA  1 
ATOM   1844 C C   . LEU B 1 95  ? 18.936 36.290 44.957  1.00 42.54  ? 94  LEU B C   1 
ATOM   1845 O O   . LEU B 1 95  ? 20.095 36.144 45.279  1.00 46.14  ? 94  LEU B O   1 
ATOM   1846 C CB  . LEU B 1 95  ? 18.069 35.534 42.732  1.00 36.89  ? 94  LEU B CB  1 
ATOM   1847 C CG  . LEU B 1 95  ? 17.370 34.516 41.843  1.00 36.43  ? 94  LEU B CG  1 
ATOM   1848 C CD1 . LEU B 1 95  ? 17.375 34.987 40.417  1.00 34.31  ? 94  LEU B CD1 1 
ATOM   1849 C CD2 . LEU B 1 95  ? 18.060 33.174 41.966  1.00 35.61  ? 94  LEU B CD2 1 
ATOM   1850 N N   . ILE B 1 96  ? 18.257 37.399 45.231  1.00 41.37  ? 95  ILE B N   1 
ATOM   1851 C CA  . ILE B 1 96  ? 18.890 38.511 45.944  1.00 40.64  ? 95  ILE B CA  1 
ATOM   1852 C C   . ILE B 1 96  ? 19.409 38.039 47.307  1.00 40.18  ? 95  ILE B C   1 
ATOM   1853 O O   . ILE B 1 96  ? 20.453 38.449 47.752  1.00 39.94  ? 95  ILE B O   1 
ATOM   1854 C CB  . ILE B 1 96  ? 17.892 39.689 46.148  1.00 39.38  ? 95  ILE B CB  1 
ATOM   1855 C CG1 . ILE B 1 96  ? 17.607 40.345 44.807  1.00 37.99  ? 95  ILE B CG1 1 
ATOM   1856 C CG2 . ILE B 1 96  ? 18.470 40.723 47.126  1.00 39.18  ? 95  ILE B CG2 1 
ATOM   1857 C CD1 . ILE B 1 96  ? 16.502 41.364 44.837  1.00 36.12  ? 95  ILE B CD1 1 
ATOM   1858 N N   . LYS B 1 97  ? 18.631 37.180 47.946  1.00 40.13  ? 96  LYS B N   1 
ATOM   1859 C CA  . LYS B 1 97  ? 18.990 36.622 49.240  1.00 40.99  ? 96  LYS B CA  1 
ATOM   1860 C C   . LYS B 1 97  ? 20.314 35.858 49.166  1.00 41.00  ? 96  LYS B C   1 
ATOM   1861 O O   . LYS B 1 97  ? 21.138 35.919 50.058  1.00 41.02  ? 96  LYS B O   1 
ATOM   1862 C CB  . LYS B 1 97  ? 17.902 35.661 49.693  1.00 42.24  ? 96  LYS B CB  1 
ATOM   1863 C CG  . LYS B 1 97  ? 16.645 36.332 50.194  1.00 46.90  ? 96  LYS B CG  1 
ATOM   1864 C CD  . LYS B 1 97  ? 15.613 35.288 50.520  1.00 49.61  ? 96  LYS B CD  1 
ATOM   1865 C CE  . LYS B 1 97  ? 14.589 35.781 51.514  1.00 51.07  ? 96  LYS B CE  1 
ATOM   1866 N NZ  . LYS B 1 97  ? 13.702 34.630 51.909  1.00 51.47  ? 96  LYS B NZ  1 
ATOM   1867 N N   . VAL B 1 98  ? 20.487 35.139 48.070  1.00 40.28  ? 97  VAL B N   1 
ATOM   1868 C CA  . VAL B 1 98  ? 21.671 34.329 47.865  1.00 40.24  ? 97  VAL B CA  1 
ATOM   1869 C C   . VAL B 1 98  ? 22.946 35.138 47.602  1.00 40.61  ? 97  VAL B C   1 
ATOM   1870 O O   . VAL B 1 98  ? 24.016 34.716 47.995  1.00 40.28  ? 97  VAL B O   1 
ATOM   1871 C CB  . VAL B 1 98  ? 21.443 33.371 46.693  1.00 38.83  ? 97  VAL B CB  1 
ATOM   1872 C CG1 . VAL B 1 98  ? 22.629 32.452 46.514  1.00 36.74  ? 97  VAL B CG1 1 
ATOM   1873 C CG2 . VAL B 1 98  ? 20.190 32.594 46.932  1.00 38.41  ? 97  VAL B CG2 1 
ATOM   1874 N N   . VAL B 1 99  ? 22.821 36.282 46.933  1.00 41.61  ? 98  VAL B N   1 
ATOM   1875 C CA  . VAL B 1 99  ? 24.015 37.092 46.620  1.00 44.09  ? 98  VAL B CA  1 
ATOM   1876 C C   . VAL B 1 99  ? 24.269 38.236 47.602  1.00 46.15  ? 98  VAL B C   1 
ATOM   1877 O O   . VAL B 1 99  ? 25.393 38.680 47.740  1.00 49.16  ? 98  VAL B O   1 
ATOM   1878 C CB  . VAL B 1 99  ? 23.959 37.688 45.214  1.00 40.70  ? 98  VAL B CB  1 
ATOM   1879 C CG1 . VAL B 1 99  ? 23.827 36.582 44.211  1.00 43.43  ? 98  VAL B CG1 1 
ATOM   1880 C CG2 . VAL B 1 99  ? 22.808 38.655 45.097  1.00 41.48  ? 98  VAL B CG2 1 
ATOM   1881 N N   . SER B 1 100 ? 23.228 38.702 48.278  1.00 47.76  ? 99  SER B N   1 
ATOM   1882 C CA  . SER B 1 100 ? 23.398 39.795 49.212  1.00 50.30  ? 99  SER B CA  1 
ATOM   1883 C C   . SER B 1 100 ? 23.924 39.300 50.563  1.00 52.40  ? 99  SER B C   1 
ATOM   1884 O O   . SER B 1 100 ? 23.345 38.418 51.175  1.00 52.48  ? 99  SER B O   1 
ATOM   1885 C CB  . SER B 1 100 ? 22.078 40.542 49.402  1.00 50.94  ? 99  SER B CB  1 
ATOM   1886 O OG  . SER B 1 100 ? 22.282 41.726 50.171  1.00 53.70  ? 99  SER B OG  1 
ATOM   1887 N N   . PRO B 1 101 ? 25.055 39.857 51.015  1.00 53.76  ? 100 PRO B N   1 
ATOM   1888 C CA  . PRO B 1 101 ? 25.684 39.492 52.291  1.00 54.43  ? 100 PRO B CA  1 
ATOM   1889 C C   . PRO B 1 101 ? 24.709 39.731 53.470  1.00 55.86  ? 100 PRO B C   1 
ATOM   1890 O O   . PRO B 1 101 ? 24.809 39.102 54.520  1.00 55.69  ? 100 PRO B O   1 
ATOM   1891 C CB  . PRO B 1 101 ? 26.878 40.434 52.361  1.00 54.90  ? 100 PRO B CB  1 
ATOM   1892 C CG  . PRO B 1 101 ? 27.224 40.658 50.925  1.00 53.85  ? 100 PRO B CG  1 
ATOM   1893 C CD  . PRO B 1 101 ? 25.885 40.820 50.269  1.00 53.30  ? 100 PRO B CD  1 
ATOM   1894 N N   . LYS B 1 102 ? 23.775 40.654 53.263  1.00 56.43  ? 101 LYS B N   1 
ATOM   1895 C CA  . LYS B 1 102 ? 22.796 41.011 54.292  1.00 57.79  ? 101 LYS B CA  1 
ATOM   1896 C C   . LYS B 1 102 ? 21.870 39.839 54.637  1.00 57.12  ? 101 LYS B C   1 
ATOM   1897 O O   . LYS B 1 102 ? 21.160 39.872 55.620  1.00 57.21  ? 101 LYS B O   1 
ATOM   1898 C CB  . LYS B 1 102 ? 21.981 42.215 53.806  1.00 60.18  ? 101 LYS B CB  1 
ATOM   1899 C CG  . LYS B 1 102 ? 21.106 42.867 54.866  1.00 63.91  ? 101 LYS B CG  1 
ATOM   1900 C CD  . LYS B 1 102 ? 20.829 44.348 54.539  1.00 66.36  ? 101 LYS B CD  1 
ATOM   1901 C CE  . LYS B 1 102 ? 20.240 44.544 53.138  1.00 66.86  ? 101 LYS B CE  1 
ATOM   1902 N NZ  . LYS B 1 102 ? 20.003 45.981 52.791  1.00 66.46  ? 101 LYS B NZ  1 
ATOM   1903 N N   . TYR B 1 103 ? 21.922 38.806 53.804  1.00 57.26  ? 102 TYR B N   1 
ATOM   1904 C CA  . TYR B 1 103 ? 21.092 37.592 53.955  1.00 55.20  ? 102 TYR B CA  1 
ATOM   1905 C C   . TYR B 1 103 ? 21.944 36.310 53.945  1.00 54.09  ? 102 TYR B C   1 
ATOM   1906 O O   . TYR B 1 103 ? 22.486 35.922 54.959  1.00 55.26  ? 102 TYR B O   1 
ATOM   1907 C CB  . TYR B 1 103 ? 20.086 37.542 52.814  1.00 54.31  ? 102 TYR B CB  1 
ATOM   1908 C CG  . TYR B 1 103 ? 19.247 38.789 52.735  1.00 53.88  ? 102 TYR B CG  1 
ATOM   1909 C CD1 . TYR B 1 103 ? 18.155 38.969 53.574  1.00 53.23  ? 102 TYR B CD1 1 
ATOM   1910 C CD2 . TYR B 1 103 ? 19.555 39.799 51.840  1.00 55.26  ? 102 TYR B CD2 1 
ATOM   1911 C CE1 . TYR B 1 103 ? 17.389 40.123 53.524  1.00 51.11  ? 102 TYR B CE1 1 
ATOM   1912 C CE2 . TYR B 1 103 ? 18.795 40.962 51.782  1.00 54.18  ? 102 TYR B CE2 1 
ATOM   1913 C CZ  . TYR B 1 103 ? 17.714 41.113 52.630  1.00 52.82  ? 102 TYR B CZ  1 
ATOM   1914 O OH  . TYR B 1 103 ? 16.966 42.258 52.581  1.00 50.81  ? 102 TYR B OH  1 
ATOM   1915 N N   . LEU B 1 104 ? 22.047 35.663 52.789  1.00 52.23  ? 103 LEU B N   1 
ATOM   1916 C CA  . LEU B 1 104 ? 22.851 34.443 52.696  1.00 51.13  ? 103 LEU B CA  1 
ATOM   1917 C C   . LEU B 1 104 ? 24.166 34.682 51.940  1.00 50.79  ? 103 LEU B C   1 
ATOM   1918 O O   . LEU B 1 104 ? 24.968 33.777 51.791  1.00 50.98  ? 103 LEU B O   1 
ATOM   1919 C CB  . LEU B 1 104 ? 22.070 33.340 51.989  1.00 49.28  ? 103 LEU B CB  1 
ATOM   1920 C CG  . LEU B 1 104 ? 20.652 33.054 52.466  1.00 48.97  ? 103 LEU B CG  1 
ATOM   1921 C CD1 . LEU B 1 104 ? 20.090 31.957 51.599  1.00 48.04  ? 103 LEU B CD1 1 
ATOM   1922 C CD2 . LEU B 1 104 ? 20.619 32.662 53.929  1.00 48.41  ? 103 LEU B CD2 1 
ATOM   1923 N N   . GLY B 1 105 ? 24.372 35.913 51.488  1.00 51.02  ? 104 GLY B N   1 
ATOM   1924 C CA  . GLY B 1 105 ? 25.565 36.240 50.723  1.00 52.24  ? 104 GLY B CA  1 
ATOM   1925 C C   . GLY B 1 105 ? 26.906 35.843 51.304  1.00 52.99  ? 104 GLY B C   1 
ATOM   1926 O O   . GLY B 1 105 ? 27.806 35.413 50.593  1.00 53.22  ? 104 GLY B O   1 
ATOM   1927 N N   . SER B 1 106 ? 27.034 35.984 52.611  1.00 54.73  ? 105 SER B N   1 
ATOM   1928 C CA  . SER B 1 106 ? 28.292 35.676 53.286  1.00 57.33  ? 105 SER B CA  1 
ATOM   1929 C C   . SER B 1 106 ? 28.673 34.196 53.260  1.00 57.74  ? 105 SER B C   1 
ATOM   1930 O O   . SER B 1 106 ? 29.836 33.864 53.155  1.00 58.27  ? 105 SER B O   1 
ATOM   1931 C CB  . SER B 1 106 ? 28.213 36.145 54.730  1.00 58.01  ? 105 SER B CB  1 
ATOM   1932 O OG  . SER B 1 106 ? 27.745 37.483 54.772  1.00 61.92  ? 105 SER B OG  1 
ATOM   1933 N N   . ARG B 1 107 ? 27.680 33.322 53.356  1.00 57.98  ? 106 ARG B N   1 
ATOM   1934 C CA  . ARG B 1 107 ? 27.945 31.891 53.386  1.00 57.55  ? 106 ARG B CA  1 
ATOM   1935 C C   . ARG B 1 107 ? 27.843 31.208 51.999  1.00 55.40  ? 106 ARG B C   1 
ATOM   1936 O O   . ARG B 1 107 ? 28.032 30.001 51.888  1.00 55.70  ? 106 ARG B O   1 
ATOM   1937 C CB  . ARG B 1 107 ? 26.993 31.225 54.393  1.00 61.63  ? 106 ARG B CB  1 
ATOM   1938 C CG  . ARG B 1 107 ? 27.079 31.809 55.833  1.00 67.00  ? 106 ARG B CG  1 
ATOM   1939 C CD  . ARG B 1 107 ? 26.071 31.154 56.811  1.00 71.44  ? 106 ARG B CD  1 
ATOM   1940 N NE  . ARG B 1 107 ? 24.666 31.402 56.439  1.00 76.36  ? 106 ARG B NE  1 
ATOM   1941 C CZ  . ARG B 1 107 ? 23.606 30.813 57.001  1.00 77.97  ? 106 ARG B CZ  1 
ATOM   1942 N NH1 . ARG B 1 107 ? 22.390 31.124 56.575  1.00 78.04  ? 106 ARG B NH1 1 
ATOM   1943 N NH2 . ARG B 1 107 ? 23.753 29.919 57.983  1.00 77.94  ? 106 ARG B NH2 1 
ATOM   1944 N N   . THR B 1 108 ? 27.576 31.995 50.961  1.00 52.60  ? 107 THR B N   1 
ATOM   1945 C CA  . THR B 1 108 ? 27.438 31.460 49.589  1.00 51.74  ? 107 THR B CA  1 
ATOM   1946 C C   . THR B 1 108 ? 28.734 31.526 48.735  1.00 50.98  ? 107 THR B C   1 
ATOM   1947 O O   . THR B 1 108 ? 29.411 32.539 48.702  1.00 49.74  ? 107 THR B O   1 
ATOM   1948 C CB  . THR B 1 108 ? 26.313 32.193 48.831  1.00 50.35  ? 107 THR B CB  1 
ATOM   1949 O OG1 . THR B 1 108 ? 25.071 31.937 49.487  1.00 48.43  ? 107 THR B OG1 1 
ATOM   1950 C CG2 . THR B 1 108 ? 26.219 31.709 47.397  1.00 48.33  ? 107 THR B CG2 1 
ATOM   1951 N N   . SER B 1 109 ? 29.031 30.436 48.030  1.00 51.11  ? 108 SER B N   1 
ATOM   1952 C CA  . SER B 1 109 ? 30.243 30.383 47.201  1.00 53.40  ? 108 SER B CA  1 
ATOM   1953 C C   . SER B 1 109 ? 30.271 31.473 46.113  1.00 54.57  ? 108 SER B C   1 
ATOM   1954 O O   . SER B 1 109 ? 29.289 31.722 45.424  1.00 53.82  ? 108 SER B O   1 
ATOM   1955 C CB  . SER B 1 109 ? 30.420 29.000 46.556  1.00 52.47  ? 108 SER B CB  1 
ATOM   1956 O OG  . SER B 1 109 ? 29.522 28.782 45.496  1.00 51.35  ? 108 SER B OG  1 
ATOM   1957 N N   . GLU B 1 110 ? 31.418 32.121 45.994  1.00 55.46  ? 109 GLU B N   1 
ATOM   1958 C CA  . GLU B 1 110 ? 31.561 33.172 45.028  1.00 57.30  ? 109 GLU B CA  1 
ATOM   1959 C C   . GLU B 1 110 ? 31.130 32.691 43.636  1.00 55.85  ? 109 GLU B C   1 
ATOM   1960 O O   . GLU B 1 110 ? 30.619 33.466 42.825  1.00 56.37  ? 109 GLU B O   1 
ATOM   1961 C CB  . GLU B 1 110 ? 33.008 33.662 44.992  1.00 61.31  ? 109 GLU B CB  1 
ATOM   1962 C CG  . GLU B 1 110 ? 33.147 35.152 44.679  1.00 67.07  ? 109 GLU B CG  1 
ATOM   1963 C CD  . GLU B 1 110 ? 32.753 36.032 45.861  1.00 70.22  ? 109 GLU B CD  1 
ATOM   1964 O OE1 . GLU B 1 110 ? 33.404 35.925 46.930  1.00 72.60  ? 109 GLU B OE1 1 
ATOM   1965 O OE2 . GLU B 1 110 ? 31.799 36.828 45.721  1.00 70.26  ? 109 GLU B OE2 1 
ATOM   1966 N N   . LYS B 1 111 ? 31.328 31.405 43.374  1.00 53.18  ? 110 LYS B N   1 
ATOM   1967 C CA  . LYS B 1 111 ? 30.942 30.848 42.066  1.00 50.63  ? 110 LYS B CA  1 
ATOM   1968 C C   . LYS B 1 111 ? 29.414 30.966 41.838  1.00 48.79  ? 110 LYS B C   1 
ATOM   1969 O O   . LYS B 1 111 ? 28.971 31.551 40.857  1.00 48.98  ? 110 LYS B O   1 
ATOM   1970 C CB  . LYS B 1 111 ? 31.393 29.389 41.955  1.00 50.65  ? 110 LYS B CB  1 
ATOM   1971 C CG  . LYS B 1 111 ? 31.271 28.835 40.554  1.00 51.36  ? 110 LYS B CG  1 
ATOM   1972 C CD  . LYS B 1 111 ? 32.207 27.670 40.347  1.00 52.39  ? 110 LYS B CD  1 
ATOM   1973 C CE  . LYS B 1 111 ? 31.981 26.585 41.371  1.00 51.51  ? 110 LYS B CE  1 
ATOM   1974 N NZ  . LYS B 1 111 ? 32.952 25.480 41.183  1.00 54.25  ? 110 LYS B NZ  1 
ATOM   1975 N N   . VAL B 1 112 ? 28.640 30.408 42.766  1.00 46.15  ? 111 VAL B N   1 
ATOM   1976 C CA  . VAL B 1 112 ? 27.181 30.477 42.714  1.00 44.09  ? 111 VAL B CA  1 
ATOM   1977 C C   . VAL B 1 112 ? 26.673 31.950 42.612  1.00 44.36  ? 111 VAL B C   1 
ATOM   1978 O O   . VAL B 1 112 ? 25.729 32.229 41.895  1.00 44.33  ? 111 VAL B O   1 
ATOM   1979 C CB  . VAL B 1 112 ? 26.559 29.804 43.965  1.00 41.91  ? 111 VAL B CB  1 
ATOM   1980 C CG1 . VAL B 1 112 ? 25.066 30.059 44.030  1.00 38.64  ? 111 VAL B CG1 1 
ATOM   1981 C CG2 . VAL B 1 112 ? 26.825 28.307 43.924  1.00 41.99  ? 111 VAL B CG2 1 
ATOM   1982 N N   . LYS B 1 113 ? 27.322 32.870 43.321  1.00 44.64  ? 112 LYS B N   1 
ATOM   1983 C CA  . LYS B 1 113 ? 26.926 34.278 43.272  1.00 45.07  ? 112 LYS B CA  1 
ATOM   1984 C C   . LYS B 1 113 ? 27.174 34.904 41.905  1.00 45.22  ? 112 LYS B C   1 
ATOM   1985 O O   . LYS B 1 113 ? 26.287 35.517 41.334  1.00 44.19  ? 112 LYS B O   1 
ATOM   1986 C CB  . LYS B 1 113 ? 27.654 35.087 44.353  1.00 48.46  ? 112 LYS B CB  1 
ATOM   1987 C CG  . LYS B 1 113 ? 26.944 35.056 45.712  1.00 51.77  ? 112 LYS B CG  1 
ATOM   1988 C CD  . LYS B 1 113 ? 27.644 35.881 46.778  1.00 53.53  ? 112 LYS B CD  1 
ATOM   1989 C CE  . LYS B 1 113 ? 28.901 35.179 47.280  1.00 56.68  ? 112 LYS B CE  1 
ATOM   1990 N NZ  . LYS B 1 113 ? 29.514 35.865 48.462  1.00 56.81  ? 112 LYS B NZ  1 
ATOM   1991 N N   . ASN B 1 114 ? 28.388 34.742 41.394  1.00 46.81  ? 113 ASN B N   1 
ATOM   1992 C CA  . ASN B 1 114 ? 28.732 35.291 40.085  1.00 47.52  ? 113 ASN B CA  1 
ATOM   1993 C C   . ASN B 1 114 ? 27.777 34.798 39.006  1.00 47.21  ? 113 ASN B C   1 
ATOM   1994 O O   . ASN B 1 114 ? 27.347 35.567 38.164  1.00 47.66  ? 113 ASN B O   1 
ATOM   1995 C CB  . ASN B 1 114 ? 30.159 34.913 39.719  1.00 49.34  ? 113 ASN B CB  1 
ATOM   1996 C CG  . ASN B 1 114 ? 31.181 35.695 40.511  1.00 54.62  ? 113 ASN B CG  1 
ATOM   1997 O OD1 . ASN B 1 114 ? 32.294 35.209 40.763  1.00 55.59  ? 113 ASN B OD1 1 
ATOM   1998 N ND2 . ASN B 1 114 ? 30.819 36.927 40.904  1.00 53.05  ? 113 ASN B ND2 1 
ATOM   1999 N N   . LYS B 1 115 ? 27.451 33.508 39.050  1.00 47.36  ? 114 LYS B N   1 
ATOM   2000 C CA  . LYS B 1 115 ? 26.534 32.922 38.061  1.00 46.37  ? 114 LYS B CA  1 
ATOM   2001 C C   . LYS B 1 115 ? 25.153 33.588 38.146  1.00 45.92  ? 114 LYS B C   1 
ATOM   2002 O O   . LYS B 1 115 ? 24.550 33.886 37.139  1.00 46.26  ? 114 LYS B O   1 
ATOM   2003 C CB  . LYS B 1 115 ? 26.411 31.419 38.281  1.00 46.64  ? 114 LYS B CB  1 
ATOM   2004 C CG  . LYS B 1 115 ? 25.812 30.694 37.111  1.00 48.02  ? 114 LYS B CG  1 
ATOM   2005 C CD  . LYS B 1 115 ? 25.889 29.185 37.304  1.00 50.49  ? 114 LYS B CD  1 
ATOM   2006 C CE  . LYS B 1 115 ? 25.169 28.460 36.160  1.00 52.33  ? 114 LYS B CE  1 
ATOM   2007 N NZ  . LYS B 1 115 ? 25.683 28.930 34.825  1.00 55.25  ? 114 LYS B NZ  1 
ATOM   2008 N N   . ILE B 1 116 ? 24.672 33.820 39.362  1.00 44.85  ? 115 ILE B N   1 
ATOM   2009 C CA  . ILE B 1 116 ? 23.386 34.498 39.526  1.00 44.28  ? 115 ILE B CA  1 
ATOM   2010 C C   . ILE B 1 116 ? 23.459 35.890 38.870  1.00 45.46  ? 115 ILE B C   1 
ATOM   2011 O O   . ILE B 1 116 ? 22.544 36.290 38.175  1.00 46.99  ? 115 ILE B O   1 
ATOM   2012 C CB  . ILE B 1 116 ? 23.000 34.654 41.027  1.00 40.80  ? 115 ILE B CB  1 
ATOM   2013 C CG1 . ILE B 1 116 ? 22.689 33.277 41.619  1.00 40.72  ? 115 ILE B CG1 1 
ATOM   2014 C CG2 . ILE B 1 116 ? 21.791 35.559 41.167  1.00 35.94  ? 115 ILE B CG2 1 
ATOM   2015 C CD1 . ILE B 1 116 ? 22.342 33.293 43.082  1.00 39.76  ? 115 ILE B CD1 1 
ATOM   2016 N N   . LEU B 1 117 ? 24.571 36.593 39.097  1.00 46.61  ? 116 LEU B N   1 
ATOM   2017 C CA  . LEU B 1 117 ? 24.788 37.932 38.526  1.00 47.13  ? 116 LEU B CA  1 
ATOM   2018 C C   . LEU B 1 117 ? 24.901 37.905 36.980  1.00 47.94  ? 116 LEU B C   1 
ATOM   2019 O O   . LEU B 1 117 ? 24.463 38.840 36.323  1.00 48.98  ? 116 LEU B O   1 
ATOM   2020 C CB  . LEU B 1 117 ? 26.041 38.561 39.124  1.00 46.27  ? 116 LEU B CB  1 
ATOM   2021 C CG  . LEU B 1 117 ? 25.956 38.830 40.617  1.00 46.39  ? 116 LEU B CG  1 
ATOM   2022 C CD1 . LEU B 1 117 ? 27.285 39.329 41.115  1.00 44.33  ? 116 LEU B CD1 1 
ATOM   2023 C CD2 . LEU B 1 117 ? 24.856 39.844 40.878  1.00 46.91  ? 116 LEU B CD2 1 
ATOM   2024 N N   . GLU B 1 118 ? 25.500 36.852 36.422  1.00 47.31  ? 117 GLU B N   1 
ATOM   2025 C CA  . GLU B 1 118 ? 25.591 36.743 34.962  1.00 48.20  ? 117 GLU B CA  1 
ATOM   2026 C C   . GLU B 1 118 ? 24.188 36.549 34.405  1.00 47.86  ? 117 GLU B C   1 
ATOM   2027 O O   . GLU B 1 118 ? 23.802 37.169 33.436  1.00 47.31  ? 117 GLU B O   1 
ATOM   2028 C CB  . GLU B 1 118 ? 26.442 35.547 34.543  1.00 51.50  ? 117 GLU B CB  1 
ATOM   2029 C CG  . GLU B 1 118 ? 27.888 35.665 34.950  1.00 60.71  ? 117 GLU B CG  1 
ATOM   2030 C CD  . GLU B 1 118 ? 28.653 34.334 34.958  1.00 66.23  ? 117 GLU B CD  1 
ATOM   2031 O OE1 . GLU B 1 118 ? 29.855 34.370 35.321  1.00 68.60  ? 117 GLU B OE1 1 
ATOM   2032 O OE2 . GLU B 1 118 ? 28.076 33.264 34.616  1.00 69.29  ? 117 GLU B OE2 1 
ATOM   2033 N N   . LEU B 1 119 ? 23.423 35.683 35.046  1.00 46.70  ? 118 LEU B N   1 
ATOM   2034 C CA  . LEU B 1 119 ? 22.092 35.455 34.570  1.00 48.63  ? 118 LEU B CA  1 
ATOM   2035 C C   . LEU B 1 119 ? 21.253 36.742 34.586  1.00 50.40  ? 118 LEU B C   1 
ATOM   2036 O O   . LEU B 1 119 ? 20.720 37.140 33.553  1.00 51.43  ? 118 LEU B O   1 
ATOM   2037 C CB  . LEU B 1 119 ? 21.399 34.376 35.398  1.00 47.95  ? 118 LEU B CB  1 
ATOM   2038 C CG  . LEU B 1 119 ? 22.031 32.993 35.391  1.00 48.35  ? 118 LEU B CG  1 
ATOM   2039 C CD1 . LEU B 1 119 ? 21.119 32.051 36.126  1.00 47.25  ? 118 LEU B CD1 1 
ATOM   2040 C CD2 . LEU B 1 119 ? 22.264 32.508 33.970  1.00 49.67  ? 118 LEU B CD2 1 
ATOM   2041 N N   . LEU B 1 120 ? 21.169 37.381 35.758  1.00 50.38  ? 119 LEU B N   1 
ATOM   2042 C CA  . LEU B 1 120 ? 20.372 38.610 35.927  1.00 49.82  ? 119 LEU B CA  1 
ATOM   2043 C C   . LEU B 1 120 ? 20.726 39.653 34.850  1.00 51.33  ? 119 LEU B C   1 
ATOM   2044 O O   . LEU B 1 120 ? 19.859 40.300 34.284  1.00 51.00  ? 119 LEU B O   1 
ATOM   2045 C CB  . LEU B 1 120 ? 20.568 39.184 37.342  1.00 47.28  ? 119 LEU B CB  1 
ATOM   2046 C CG  . LEU B 1 120 ? 19.923 38.405 38.506  1.00 44.70  ? 119 LEU B CG  1 
ATOM   2047 C CD1 . LEU B 1 120 ? 20.418 38.920 39.846  1.00 40.48  ? 119 LEU B CD1 1 
ATOM   2048 C CD2 . LEU B 1 120 ? 18.418 38.534 38.408  1.00 42.15  ? 119 LEU B CD2 1 
ATOM   2049 N N   . TYR B 1 121 ? 22.014 39.782 34.566  1.00 53.28  ? 120 TYR B N   1 
ATOM   2050 C CA  . TYR B 1 121 ? 22.459 40.701 33.532  1.00 55.24  ? 120 TYR B CA  1 
ATOM   2051 C C   . TYR B 1 121 ? 21.983 40.198 32.145  1.00 55.09  ? 120 TYR B C   1 
ATOM   2052 O O   . TYR B 1 121 ? 21.335 40.912 31.398  1.00 54.79  ? 120 TYR B O   1 
ATOM   2053 C CB  . TYR B 1 121 ? 23.973 40.800 33.558  1.00 57.47  ? 120 TYR B CB  1 
ATOM   2054 C CG  . TYR B 1 121 ? 24.480 41.740 32.527  1.00 59.66  ? 120 TYR B CG  1 
ATOM   2055 C CD1 . TYR B 1 121 ? 24.081 43.079 32.529  1.00 60.56  ? 120 TYR B CD1 1 
ATOM   2056 C CD2 . TYR B 1 121 ? 25.306 41.285 31.505  1.00 59.92  ? 120 TYR B CD2 1 
ATOM   2057 C CE1 . TYR B 1 121 ? 24.486 43.941 31.529  1.00 62.56  ? 120 TYR B CE1 1 
ATOM   2058 C CE2 . TYR B 1 121 ? 25.724 42.130 30.500  1.00 61.83  ? 120 TYR B CE2 1 
ATOM   2059 C CZ  . TYR B 1 121 ? 25.309 43.461 30.512  1.00 63.29  ? 120 TYR B CZ  1 
ATOM   2060 O OH  . TYR B 1 121 ? 25.697 44.309 29.502  1.00 63.68  ? 120 TYR B OH  1 
ATOM   2061 N N   . SER B 1 122 ? 22.315 38.949 31.847  1.00 55.80  ? 121 SER B N   1 
ATOM   2062 C CA  . SER B 1 122 ? 21.899 38.290 30.600  1.00 56.40  ? 121 SER B CA  1 
ATOM   2063 C C   . SER B 1 122 ? 20.387 38.510 30.315  1.00 56.35  ? 121 SER B C   1 
ATOM   2064 O O   . SER B 1 122 ? 19.987 38.713 29.184  1.00 57.20  ? 121 SER B O   1 
ATOM   2065 C CB  . SER B 1 122 ? 22.188 36.782 30.706  1.00 57.49  ? 121 SER B CB  1 
ATOM   2066 O OG  . SER B 1 122 ? 21.563 36.030 29.675  1.00 59.56  ? 121 SER B OG  1 
ATOM   2067 N N   . TRP B 1 123 ? 19.568 38.467 31.357  1.00 55.16  ? 122 TRP B N   1 
ATOM   2068 C CA  . TRP B 1 123 ? 18.143 38.657 31.169  1.00 56.39  ? 122 TRP B CA  1 
ATOM   2069 C C   . TRP B 1 123 ? 17.750 40.138 30.999  1.00 58.32  ? 122 TRP B C   1 
ATOM   2070 O O   . TRP B 1 123 ? 16.806 40.451 30.280  1.00 58.51  ? 122 TRP B O   1 
ATOM   2071 C CB  . TRP B 1 123 ? 17.368 38.060 32.337  1.00 55.45  ? 122 TRP B CB  1 
ATOM   2072 C CG  . TRP B 1 123 ? 17.616 36.600 32.546  1.00 55.72  ? 122 TRP B CG  1 
ATOM   2073 C CD1 . TRP B 1 123 ? 17.780 35.647 31.585  1.00 54.04  ? 122 TRP B CD1 1 
ATOM   2074 C CD2 . TRP B 1 123 ? 17.628 35.912 33.797  1.00 56.00  ? 122 TRP B CD2 1 
ATOM   2075 N NE1 . TRP B 1 123 ? 17.885 34.410 32.160  1.00 54.59  ? 122 TRP B NE1 1 
ATOM   2076 C CE2 . TRP B 1 123 ? 17.794 34.542 33.522  1.00 54.97  ? 122 TRP B CE2 1 
ATOM   2077 C CE3 . TRP B 1 123 ? 17.509 36.321 35.133  1.00 55.49  ? 122 TRP B CE3 1 
ATOM   2078 C CZ2 . TRP B 1 123 ? 17.842 33.579 34.520  1.00 56.13  ? 122 TRP B CZ2 1 
ATOM   2079 C CZ3 . TRP B 1 123 ? 17.557 35.361 36.126  1.00 54.22  ? 122 TRP B CZ3 1 
ATOM   2080 C CH2 . TRP B 1 123 ? 17.721 34.009 35.815  1.00 54.61  ? 122 TRP B CH2 1 
ATOM   2081 N N   . THR B 1 124 ? 18.464 41.038 31.668  1.00 58.56  ? 123 THR B N   1 
ATOM   2082 C CA  . THR B 1 124 ? 18.135 42.454 31.538  1.00 59.28  ? 123 THR B CA  1 
ATOM   2083 C C   . THR B 1 124 ? 18.425 42.930 30.115  1.00 61.54  ? 123 THR B C   1 
ATOM   2084 O O   . THR B 1 124 ? 17.856 43.899 29.642  1.00 62.83  ? 123 THR B O   1 
ATOM   2085 C CB  . THR B 1 124 ? 18.938 43.307 32.509  1.00 57.92  ? 123 THR B CB  1 
ATOM   2086 O OG1 . THR B 1 124 ? 20.322 42.999 32.366  1.00 55.61  ? 123 THR B OG1 1 
ATOM   2087 C CG2 . THR B 1 124 ? 18.502 43.041 33.935  1.00 57.64  ? 123 THR B CG2 1 
ATOM   2088 N N   . VAL B 1 125 ? 19.307 42.209 29.438  1.00 61.35  ? 124 VAL B N   1 
ATOM   2089 C CA  . VAL B 1 125 ? 19.675 42.557 28.073  1.00 62.04  ? 124 VAL B CA  1 
ATOM   2090 C C   . VAL B 1 125 ? 18.795 41.864 27.021  1.00 63.46  ? 124 VAL B C   1 
ATOM   2091 O O   . VAL B 1 125 ? 18.272 42.516 26.127  1.00 63.80  ? 124 VAL B O   1 
ATOM   2092 C CB  . VAL B 1 125 ? 21.140 42.194 27.803  1.00 61.08  ? 124 VAL B CB  1 
ATOM   2093 C CG1 . VAL B 1 125 ? 21.452 42.362 26.332  1.00 60.55  ? 124 VAL B CG1 1 
ATOM   2094 C CG2 . VAL B 1 125 ? 22.044 43.072 28.644  1.00 59.44  ? 124 VAL B CG2 1 
ATOM   2095 N N   . GLY B 1 126 ? 18.651 40.546 27.150  1.00 64.58  ? 125 GLY B N   1 
ATOM   2096 C CA  . GLY B 1 126 ? 17.852 39.778 26.209  1.00 65.44  ? 125 GLY B CA  1 
ATOM   2097 C C   . GLY B 1 126 ? 16.362 39.826 26.487  1.00 66.41  ? 125 GLY B C   1 
ATOM   2098 O O   . GLY B 1 126 ? 15.565 39.359 25.697  1.00 67.34  ? 125 GLY B O   1 
ATOM   2099 N N   . LEU B 1 127 ? 15.988 40.387 27.628  1.00 67.59  ? 126 LEU B N   1 
ATOM   2100 C CA  . LEU B 1 127 ? 14.573 40.502 27.996  1.00 68.34  ? 126 LEU B CA  1 
ATOM   2101 C C   . LEU B 1 127 ? 14.283 41.832 28.708  1.00 68.82  ? 126 LEU B C   1 
ATOM   2102 O O   . LEU B 1 127 ? 13.779 41.849 29.825  1.00 68.57  ? 126 LEU B O   1 
ATOM   2103 C CB  . LEU B 1 127 ? 14.155 39.336 28.898  1.00 67.98  ? 126 LEU B CB  1 
ATOM   2104 C CG  . LEU B 1 127 ? 13.998 37.979 28.215  1.00 68.49  ? 126 LEU B CG  1 
ATOM   2105 C CD1 . LEU B 1 127 ? 13.753 36.915 29.257  1.00 68.36  ? 126 LEU B CD1 1 
ATOM   2106 C CD2 . LEU B 1 127 ? 12.848 38.036 27.215  1.00 68.27  ? 126 LEU B CD2 1 
ATOM   2107 N N   . PRO B 1 128 ? 14.615 42.957 28.055  1.00 68.94  ? 127 PRO B N   1 
ATOM   2108 C CA  . PRO B 1 128 ? 14.366 44.259 28.668  1.00 69.92  ? 127 PRO B CA  1 
ATOM   2109 C C   . PRO B 1 128 ? 12.890 44.425 29.097  1.00 70.80  ? 127 PRO B C   1 
ATOM   2110 O O   . PRO B 1 128 ? 12.601 45.207 29.993  1.00 72.15  ? 127 PRO B O   1 
ATOM   2111 C CB  . PRO B 1 128 ? 14.789 45.244 27.578  1.00 68.81  ? 127 PRO B CB  1 
ATOM   2112 C CG  . PRO B 1 128 ? 14.542 44.482 26.321  1.00 68.53  ? 127 PRO B CG  1 
ATOM   2113 C CD  . PRO B 1 128 ? 15.085 43.120 26.671  1.00 68.96  ? 127 PRO B CD  1 
ATOM   2114 N N   . GLU B 1 129 ? 11.982 43.681 28.463  1.00 70.96  ? 128 GLU B N   1 
ATOM   2115 C CA  . GLU B 1 129 ? 10.542 43.752 28.817  1.00 71.55  ? 128 GLU B CA  1 
ATOM   2116 C C   . GLU B 1 129 ? 10.338 43.595 30.339  1.00 71.73  ? 128 GLU B C   1 
ATOM   2117 O O   . GLU B 1 129 ? 9.733  44.440 30.987  1.00 71.03  ? 128 GLU B O   1 
ATOM   2118 C CB  . GLU B 1 129 ? 9.742  42.650 28.111  1.00 72.89  ? 128 GLU B CB  1 
ATOM   2119 C CG  . GLU B 1 129 ? 10.023 42.527 26.639  1.00 77.18  ? 128 GLU B CG  1 
ATOM   2120 C CD  . GLU B 1 129 ? 11.250 41.685 26.364  1.00 79.71  ? 128 GLU B CD  1 
ATOM   2121 O OE1 . GLU B 1 129 ? 11.819 41.801 25.251  1.00 81.21  ? 128 GLU B OE1 1 
ATOM   2122 O OE2 . GLU B 1 129 ? 11.635 40.897 27.259  1.00 80.35  ? 128 GLU B OE2 1 
ATOM   2123 N N   . GLU B 1 130 ? 10.851 42.491 30.880  1.00 71.40  ? 129 GLU B N   1 
ATOM   2124 C CA  . GLU B 1 130 ? 10.761 42.207 32.322  1.00 69.67  ? 129 GLU B CA  1 
ATOM   2125 C C   . GLU B 1 130 ? 11.467 43.310 33.127  1.00 68.94  ? 129 GLU B C   1 
ATOM   2126 O O   . GLU B 1 130 ? 12.642 43.195 33.465  1.00 69.44  ? 129 GLU B O   1 
ATOM   2127 C CB  . GLU B 1 130 ? 11.413 40.863 32.621  1.00 69.26  ? 129 GLU B CB  1 
ATOM   2128 C CG  . GLU B 1 130 ? 10.831 39.717 31.822  1.00 69.90  ? 129 GLU B CG  1 
ATOM   2129 C CD  . GLU B 1 130 ? 9.459  39.320 32.306  1.00 71.51  ? 129 GLU B CD  1 
ATOM   2130 O OE1 . GLU B 1 130 ? 8.760  38.562 31.580  1.00 70.64  ? 129 GLU B OE1 1 
ATOM   2131 O OE2 . GLU B 1 130 ? 9.087  39.762 33.423  1.00 72.00  ? 129 GLU B OE2 1 
ATOM   2132 N N   . VAL B 1 131 ? 10.737 44.381 33.405  1.00 67.11  ? 130 VAL B N   1 
ATOM   2133 C CA  . VAL B 1 131 ? 11.302 45.504 34.154  1.00 66.01  ? 130 VAL B CA  1 
ATOM   2134 C C   . VAL B 1 131 ? 11.800 45.088 35.558  1.00 63.95  ? 130 VAL B C   1 
ATOM   2135 O O   . VAL B 1 131 ? 12.850 45.530 36.006  1.00 64.07  ? 130 VAL B O   1 
ATOM   2136 C CB  . VAL B 1 131 ? 10.264 46.643 34.308  1.00 66.24  ? 130 VAL B CB  1 
ATOM   2137 C CG1 . VAL B 1 131 ? 10.901 47.849 35.012  1.00 66.38  ? 130 VAL B CG1 1 
ATOM   2138 C CG2 . VAL B 1 131 ? 9.738  47.045 32.945  1.00 65.65  ? 130 VAL B CG2 1 
ATOM   2139 N N   . LYS B 1 132 ? 11.027 44.239 36.227  1.00 61.57  ? 131 LYS B N   1 
ATOM   2140 C CA  . LYS B 1 132 ? 11.383 43.771 37.572  1.00 58.76  ? 131 LYS B CA  1 
ATOM   2141 C C   . LYS B 1 132 ? 12.800 43.134 37.629  1.00 58.35  ? 131 LYS B C   1 
ATOM   2142 O O   . LYS B 1 132 ? 13.547 43.334 38.586  1.00 56.76  ? 131 LYS B O   1 
ATOM   2143 C CB  . LYS B 1 132 ? 10.309 42.798 38.072  1.00 56.52  ? 131 LYS B CB  1 
ATOM   2144 C CG  . LYS B 1 132 ? 9.023  43.507 38.484  1.00 54.95  ? 131 LYS B CG  1 
ATOM   2145 C CD  . LYS B 1 132 ? 7.886  42.542 38.809  1.00 54.64  ? 131 LYS B CD  1 
ATOM   2146 C CE  . LYS B 1 132 ? 6.624  43.272 39.299  1.00 50.57  ? 131 LYS B CE  1 
ATOM   2147 N NZ  . LYS B 1 132 ? 5.480  42.335 39.529  1.00 51.72  ? 131 LYS B NZ  1 
ATOM   2148 N N   . ILE B 1 133 ? 13.152 42.378 36.596  1.00 57.85  ? 132 ILE B N   1 
ATOM   2149 C CA  . ILE B 1 133 ? 14.472 41.768 36.542  1.00 57.79  ? 132 ILE B CA  1 
ATOM   2150 C C   . ILE B 1 133 ? 15.514 42.884 36.491  1.00 58.38  ? 132 ILE B C   1 
ATOM   2151 O O   . ILE B 1 133 ? 16.456 42.897 37.267  1.00 58.82  ? 132 ILE B O   1 
ATOM   2152 C CB  . ILE B 1 133 ? 14.629 40.856 35.294  1.00 57.03  ? 132 ILE B CB  1 
ATOM   2153 C CG1 . ILE B 1 133 ? 13.890 39.533 35.512  1.00 55.24  ? 132 ILE B CG1 1 
ATOM   2154 C CG2 . ILE B 1 133 ? 16.096 40.582 35.017  1.00 55.70  ? 132 ILE B CG2 1 
ATOM   2155 C CD1 . ILE B 1 133 ? 13.838 38.660 34.288  1.00 53.40  ? 132 ILE B CD1 1 
ATOM   2156 N N   . ALA B 1 134 ? 15.324 43.825 35.577  1.00 58.56  ? 133 ALA B N   1 
ATOM   2157 C CA  . ALA B 1 134 ? 16.266 44.951 35.480  1.00 58.35  ? 133 ALA B CA  1 
ATOM   2158 C C   . ALA B 1 134 ? 16.236 45.771 36.779  1.00 57.23  ? 133 ALA B C   1 
ATOM   2159 O O   . ALA B 1 134 ? 17.269 46.120 37.331  1.00 57.41  ? 133 ALA B O   1 
ATOM   2160 C CB  . ALA B 1 134 ? 15.907 45.836 34.297  1.00 57.89  ? 133 ALA B CB  1 
ATOM   2161 N N   . GLU B 1 135 ? 15.031 46.053 37.253  1.00 56.91  ? 134 GLU B N   1 
ATOM   2162 C CA  . GLU B 1 135 ? 14.854 46.821 38.488  1.00 57.46  ? 134 GLU B CA  1 
ATOM   2163 C C   . GLU B 1 135 ? 15.648 46.188 39.663  1.00 56.37  ? 134 GLU B C   1 
ATOM   2164 O O   . GLU B 1 135 ? 16.291 46.884 40.429  1.00 57.25  ? 134 GLU B O   1 
ATOM   2165 C CB  . GLU B 1 135 ? 13.369 46.886 38.823  1.00 57.22  ? 134 GLU B CB  1 
ATOM   2166 C CG  . GLU B 1 135 ? 13.017 47.876 39.886  1.00 59.43  ? 134 GLU B CG  1 
ATOM   2167 C CD  . GLU B 1 135 ? 11.531 47.896 40.172  1.00 62.22  ? 134 GLU B CD  1 
ATOM   2168 O OE1 . GLU B 1 135 ? 10.742 48.052 39.208  1.00 61.18  ? 134 GLU B OE1 1 
ATOM   2169 O OE2 . GLU B 1 135 ? 11.153 47.757 41.362  1.00 62.65  ? 134 GLU B OE2 1 
ATOM   2170 N N   . ALA B 1 136 ? 15.595 44.864 39.763  1.00 55.27  ? 135 ALA B N   1 
ATOM   2171 C CA  . ALA B 1 136 ? 16.312 44.136 40.807  1.00 54.57  ? 135 ALA B CA  1 
ATOM   2172 C C   . ALA B 1 136 ? 17.821 44.160 40.550  1.00 54.60  ? 135 ALA B C   1 
ATOM   2173 O O   . ALA B 1 136 ? 18.615 44.369 41.452  1.00 54.92  ? 135 ALA B O   1 
ATOM   2174 C CB  . ALA B 1 136 ? 15.833 42.704 40.854  1.00 56.05  ? 135 ALA B CB  1 
ATOM   2175 N N   . TYR B 1 137 ? 18.193 43.937 39.297  1.00 55.11  ? 136 TYR B N   1 
ATOM   2176 C CA  . TYR B 1 137 ? 19.604 43.934 38.909  1.00 55.69  ? 136 TYR B CA  1 
ATOM   2177 C C   . TYR B 1 137 ? 20.254 45.275 39.225  1.00 57.96  ? 136 TYR B C   1 
ATOM   2178 O O   . TYR B 1 137 ? 21.408 45.338 39.628  1.00 57.80  ? 136 TYR B O   1 
ATOM   2179 C CB  . TYR B 1 137 ? 19.745 43.666 37.411  1.00 52.32  ? 136 TYR B CB  1 
ATOM   2180 C CG  . TYR B 1 137 ? 21.183 43.644 36.948  1.00 49.35  ? 136 TYR B CG  1 
ATOM   2181 C CD1 . TYR B 1 137 ? 22.047 42.621 37.348  1.00 48.48  ? 136 TYR B CD1 1 
ATOM   2182 C CD2 . TYR B 1 137 ? 21.692 44.655 36.139  1.00 46.43  ? 136 TYR B CD2 1 
ATOM   2183 C CE1 . TYR B 1 137 ? 23.383 42.605 36.958  1.00 47.07  ? 136 TYR B CE1 1 
ATOM   2184 C CE2 . TYR B 1 137 ? 23.024 44.651 35.744  1.00 47.52  ? 136 TYR B CE2 1 
ATOM   2185 C CZ  . TYR B 1 137 ? 23.869 43.619 36.158  1.00 47.82  ? 136 TYR B CZ  1 
ATOM   2186 O OH  . TYR B 1 137 ? 25.195 43.609 35.773  1.00 46.54  ? 136 TYR B OH  1 
ATOM   2187 N N   . GLN B 1 138 ? 19.488 46.339 39.009  1.00 60.54  ? 137 GLN B N   1 
ATOM   2188 C CA  . GLN B 1 138 ? 19.974 47.682 39.260  1.00 63.24  ? 137 GLN B CA  1 
ATOM   2189 C C   . GLN B 1 138 ? 20.250 47.873 40.746  1.00 64.18  ? 137 GLN B C   1 
ATOM   2190 O O   . GLN B 1 138 ? 21.296 48.381 41.135  1.00 63.41  ? 137 GLN B O   1 
ATOM   2191 C CB  . GLN B 1 138 ? 18.949 48.711 38.801  1.00 65.34  ? 137 GLN B CB  1 
ATOM   2192 C CG  . GLN B 1 138 ? 19.558 50.063 38.495  1.00 70.60  ? 137 GLN B CG  1 
ATOM   2193 C CD  . GLN B 1 138 ? 20.138 50.132 37.083  1.00 74.12  ? 137 GLN B CD  1 
ATOM   2194 O OE1 . GLN B 1 138 ? 20.441 49.096 36.461  1.00 74.20  ? 137 GLN B OE1 1 
ATOM   2195 N NE2 . GLN B 1 138 ? 20.302 51.358 36.570  1.00 74.30  ? 137 GLN B NE2 1 
ATOM   2196 N N   . MET B 1 139 ? 19.302 47.443 41.571  1.00 65.21  ? 138 MET B N   1 
ATOM   2197 C CA  . MET B 1 139 ? 19.484 47.592 43.002  1.00 66.77  ? 138 MET B CA  1 
ATOM   2198 C C   . MET B 1 139 ? 20.766 46.879 43.488  1.00 66.67  ? 138 MET B C   1 
ATOM   2199 O O   . MET B 1 139 ? 21.499 47.425 44.295  1.00 67.27  ? 138 MET B O   1 
ATOM   2200 C CB  . MET B 1 139 ? 18.279 47.068 43.763  1.00 68.27  ? 138 MET B CB  1 
ATOM   2201 C CG  . MET B 1 139 ? 18.095 47.794 45.073  1.00 71.49  ? 138 MET B CG  1 
ATOM   2202 S SD  . MET B 1 139 ? 17.202 46.827 46.301  1.00 76.74  ? 138 MET B SD  1 
ATOM   2203 C CE  . MET B 1 139 ? 17.447 47.852 47.794  1.00 74.65  ? 138 MET B CE  1 
ATOM   2204 N N   . LEU B 1 140 ? 21.020 45.672 42.983  1.00 65.31  ? 139 LEU B N   1 
ATOM   2205 C CA  . LEU B 1 140 ? 22.234 44.935 43.364  1.00 63.97  ? 139 LEU B CA  1 
ATOM   2206 C C   . LEU B 1 140 ? 23.496 45.640 42.853  1.00 64.67  ? 139 LEU B C   1 
ATOM   2207 O O   . LEU B 1 140 ? 24.562 45.510 43.419  1.00 64.81  ? 139 LEU B O   1 
ATOM   2208 C CB  . LEU B 1 140 ? 22.216 43.521 42.804  1.00 60.38  ? 139 LEU B CB  1 
ATOM   2209 C CG  . LEU B 1 140 ? 21.252 42.520 43.409  1.00 58.29  ? 139 LEU B CG  1 
ATOM   2210 C CD1 . LEU B 1 140 ? 21.422 41.219 42.661  1.00 58.01  ? 139 LEU B CD1 1 
ATOM   2211 C CD2 . LEU B 1 140 ? 21.530 42.329 44.877  1.00 56.97  ? 139 LEU B CD2 1 
ATOM   2212 N N   . LYS B 1 141 ? 23.359 46.372 41.759  1.00 66.87  ? 140 LYS B N   1 
ATOM   2213 C CA  . LYS B 1 141 ? 24.505 47.097 41.213  1.00 69.54  ? 140 LYS B CA  1 
ATOM   2214 C C   . LYS B 1 141 ? 24.819 48.320 42.101  1.00 70.56  ? 140 LYS B C   1 
ATOM   2215 O O   . LYS B 1 141 ? 25.923 48.463 42.596  1.00 70.32  ? 140 LYS B O   1 
ATOM   2216 C CB  . LYS B 1 141 ? 24.213 47.545 39.774  1.00 70.12  ? 140 LYS B CB  1 
ATOM   2217 C CG  . LYS B 1 141 ? 25.404 48.157 39.051  1.00 69.34  ? 140 LYS B CG  1 
ATOM   2218 C CD  . LYS B 1 141 ? 25.149 48.310 37.557  1.00 70.05  ? 140 LYS B CD  1 
ATOM   2219 C CE  . LYS B 1 141 ? 24.064 49.332 37.254  1.00 70.98  ? 140 LYS B CE  1 
ATOM   2220 N NZ  . LYS B 1 141 ? 23.820 49.476 35.779  1.00 71.59  ? 140 LYS B NZ  1 
ATOM   2221 N N   . LYS B 1 142 ? 23.816 49.171 42.304  1.00 71.84  ? 141 LYS B N   1 
ATOM   2222 C CA  . LYS B 1 142 ? 23.976 50.368 43.142  1.00 72.66  ? 141 LYS B CA  1 
ATOM   2223 C C   . LYS B 1 142 ? 24.370 49.969 44.577  1.00 71.58  ? 141 LYS B C   1 
ATOM   2224 O O   . LYS B 1 142 ? 25.078 50.689 45.274  1.00 71.22  ? 141 LYS B O   1 
ATOM   2225 C CB  . LYS B 1 142 ? 22.669 51.177 43.158  1.00 75.06  ? 141 LYS B CB  1 
ATOM   2226 C CG  . LYS B 1 142 ? 22.314 51.861 41.820  1.00 77.91  ? 141 LYS B CG  1 
ATOM   2227 C CD  . LYS B 1 142 ? 20.883 51.514 41.347  1.00 81.10  ? 141 LYS B CD  1 
ATOM   2228 C CE  . LYS B 1 142 ? 19.816 51.856 42.408  1.00 83.37  ? 141 LYS B CE  1 
ATOM   2229 N NZ  . LYS B 1 142 ? 18.456 51.232 42.202  1.00 83.40  ? 141 LYS B NZ  1 
ATOM   2230 N N   . GLN B 1 143 ? 23.904 48.797 44.981  1.00 70.71  ? 142 GLN B N   1 
ATOM   2231 C CA  . GLN B 1 143 ? 24.201 48.276 46.305  1.00 70.19  ? 142 GLN B CA  1 
ATOM   2232 C C   . GLN B 1 143 ? 25.679 47.846 46.418  1.00 69.94  ? 142 GLN B C   1 
ATOM   2233 O O   . GLN B 1 143 ? 26.125 47.410 47.463  1.00 70.72  ? 142 GLN B O   1 
ATOM   2234 C CB  . GLN B 1 143 ? 23.275 47.100 46.601  1.00 69.94  ? 142 GLN B CB  1 
ATOM   2235 C CG  . GLN B 1 143 ? 22.699 47.123 47.991  1.00 69.67  ? 142 GLN B CG  1 
ATOM   2236 C CD  . GLN B 1 143 ? 21.310 46.532 48.042  1.00 69.72  ? 142 GLN B CD  1 
ATOM   2237 O OE1 . GLN B 1 143 ? 21.055 45.458 47.507  1.00 71.31  ? 142 GLN B OE1 1 
ATOM   2238 N NE2 . GLN B 1 143 ? 20.403 47.230 48.700  1.00 69.66  ? 142 GLN B NE2 1 
ATOM   2239 N N   . GLY B 1 144 ? 26.415 47.974 45.319  1.00 70.01  ? 143 GLY B N   1 
ATOM   2240 C CA  . GLY B 1 144 ? 27.824 47.626 45.327  1.00 69.95  ? 143 GLY B CA  1 
ATOM   2241 C C   . GLY B 1 144 ? 28.110 46.146 45.203  1.00 69.81  ? 143 GLY B C   1 
ATOM   2242 O O   . GLY B 1 144 ? 29.257 45.723 45.222  1.00 68.87  ? 143 GLY B O   1 
ATOM   2243 N N   . ILE B 1 145 ? 27.055 45.353 45.073  1.00 70.79  ? 144 ILE B N   1 
ATOM   2244 C CA  . ILE B 1 145 ? 27.202 43.894 44.946  1.00 71.11  ? 144 ILE B CA  1 
ATOM   2245 C C   . ILE B 1 145 ? 27.700 43.471 43.521  1.00 71.84  ? 144 ILE B C   1 
ATOM   2246 O O   . ILE B 1 145 ? 28.145 42.354 43.322  1.00 71.82  ? 144 ILE B O   1 
ATOM   2247 C CB  . ILE B 1 145 ? 25.862 43.202 45.311  1.00 69.09  ? 144 ILE B CB  1 
ATOM   2248 C CG1 . ILE B 1 145 ? 25.449 43.627 46.724  1.00 68.13  ? 144 ILE B CG1 1 
ATOM   2249 C CG2 . ILE B 1 145 ? 26.013 41.703 45.290  1.00 68.32  ? 144 ILE B CG2 1 
ATOM   2250 C CD1 . ILE B 1 145 ? 24.042 43.252 47.100  1.00 68.03  ? 144 ILE B CD1 1 
ATOM   2251 N N   . VAL B 1 146 ? 27.645 44.397 42.565  1.00 72.74  ? 145 VAL B N   1 
ATOM   2252 C CA  . VAL B 1 146 ? 28.105 44.127 41.188  1.00 73.95  ? 145 VAL B CA  1 
ATOM   2253 C C   . VAL B 1 146 ? 29.122 45.203 40.688  1.00 75.09  ? 145 VAL B C   1 
ATOM   2254 O O   . VAL B 1 146 ? 30.280 44.836 40.363  1.00 75.39  ? 145 VAL B O   1 
ATOM   2255 C CB  . VAL B 1 146 ? 26.905 44.079 40.203  1.00 74.43  ? 145 VAL B CB  1 
ATOM   2256 C CG1 . VAL B 1 146 ? 27.389 43.768 38.789  1.00 72.31  ? 145 VAL B CG1 1 
ATOM   2257 C CG2 . VAL B 1 146 ? 25.889 43.039 40.669  1.00 73.84  ? 145 VAL B CG2 1 
ATOM   2258 N N   . GLU C 1 9   ? 4.590  84.011 17.682  1.00 73.44  ? 8   GLU C N   1 
ATOM   2259 C CA  . GLU C 1 9   ? 3.129  84.107 17.989  1.00 72.98  ? 8   GLU C CA  1 
ATOM   2260 C C   . GLU C 1 9   ? 2.415  82.746 17.775  1.00 70.58  ? 8   GLU C C   1 
ATOM   2261 O O   . GLU C 1 9   ? 1.670  82.290 18.630  1.00 70.65  ? 8   GLU C O   1 
ATOM   2262 C CB  . GLU C 1 9   ? 2.468  85.158 17.089  1.00 75.75  ? 8   GLU C CB  1 
ATOM   2263 C CG  . GLU C 1 9   ? 2.612  84.866 15.601  1.00 78.30  ? 8   GLU C CG  1 
ATOM   2264 C CD  . GLU C 1 9   ? 1.423  85.352 14.794  1.00 81.52  ? 8   GLU C CD  1 
ATOM   2265 O OE1 . GLU C 1 9   ? 1.402  85.121 13.562  1.00 82.24  ? 8   GLU C OE1 1 
ATOM   2266 O OE2 . GLU C 1 9   ? 0.507  85.960 15.393  1.00 82.48  ? 8   GLU C OE2 1 
ATOM   2267 N N   . THR C 1 10  ? 2.656  82.134 16.616  1.00 66.68  ? 9   THR C N   1 
ATOM   2268 C CA  . THR C 1 10  ? 2.051  80.836 16.255  1.00 61.83  ? 9   THR C CA  1 
ATOM   2269 C C   . THR C 1 10  ? 3.105  79.741 16.020  1.00 57.92  ? 9   THR C C   1 
ATOM   2270 O O   . THR C 1 10  ? 4.289  80.036 15.885  1.00 56.56  ? 9   THR C O   1 
ATOM   2271 C CB  . THR C 1 10  ? 1.215  80.955 14.968  1.00 63.31  ? 9   THR C CB  1 
ATOM   2272 O OG1 . THR C 1 10  ? 1.979  81.627 13.950  1.00 61.70  ? 9   THR C OG1 1 
ATOM   2273 C CG2 . THR C 1 10  ? -0.057 81.714 15.248  1.00 64.92  ? 9   THR C CG2 1 
ATOM   2274 N N   . LEU C 1 11  ? 2.655  78.487 15.949  1.00 53.61  ? 10  LEU C N   1 
ATOM   2275 C CA  . LEU C 1 11  ? 3.590  77.371 15.734  1.00 49.34  ? 10  LEU C CA  1 
ATOM   2276 C C   . LEU C 1 11  ? 4.554  77.654 14.562  1.00 47.91  ? 10  LEU C C   1 
ATOM   2277 O O   . LEU C 1 11  ? 5.755  77.736 14.768  1.00 46.01  ? 10  LEU C O   1 
ATOM   2278 C CB  . LEU C 1 11  ? 2.834  76.057 15.516  1.00 47.41  ? 10  LEU C CB  1 
ATOM   2279 C CG  . LEU C 1 11  ? 2.227  75.424 16.782  1.00 47.17  ? 10  LEU C CG  1 
ATOM   2280 C CD1 . LEU C 1 11  ? 1.498  74.132 16.449  1.00 43.89  ? 10  LEU C CD1 1 
ATOM   2281 C CD2 . LEU C 1 11  ? 3.325  75.148 17.778  1.00 47.49  ? 10  LEU C CD2 1 
ATOM   2282 N N   . GLU C 1 12  ? 4.024  77.828 13.354  1.00 47.03  ? 11  GLU C N   1 
ATOM   2283 C CA  . GLU C 1 12  ? 4.893  78.120 12.188  1.00 47.20  ? 11  GLU C CA  1 
ATOM   2284 C C   . GLU C 1 12  ? 5.925  79.223 12.504  1.00 47.94  ? 11  GLU C C   1 
ATOM   2285 O O   . GLU C 1 12  ? 7.117  79.071 12.230  1.00 48.41  ? 11  GLU C O   1 
ATOM   2286 C CB  . GLU C 1 12  ? 4.072  78.561 10.978  1.00 46.29  ? 11  GLU C CB  1 
ATOM   2287 C CG  . GLU C 1 12  ? 3.157  77.496 10.418  1.00 47.54  ? 11  GLU C CG  1 
ATOM   2288 C CD  . GLU C 1 12  ? 1.862  77.376 11.183  1.00 49.29  ? 11  GLU C CD  1 
ATOM   2289 O OE1 . GLU C 1 12  ? 1.019  76.544 10.778  1.00 50.88  ? 11  GLU C OE1 1 
ATOM   2290 O OE2 . GLU C 1 12  ? 1.675  78.104 12.188  1.00 49.91  ? 11  GLU C OE2 1 
ATOM   2291 N N   . ALA C 1 13  ? 5.451  80.330 13.069  1.00 46.65  ? 12  ALA C N   1 
ATOM   2292 C CA  . ALA C 1 13  ? 6.359  81.424 13.415  1.00 44.89  ? 12  ALA C CA  1 
ATOM   2293 C C   . ALA C 1 13  ? 7.434  80.948 14.407  1.00 42.11  ? 12  ALA C C   1 
ATOM   2294 O O   . ALA C 1 13  ? 8.609  81.220 14.234  1.00 40.16  ? 12  ALA C O   1 
ATOM   2295 C CB  . ALA C 1 13  ? 5.581  82.578 14.018  1.00 46.30  ? 12  ALA C CB  1 
ATOM   2296 N N   . ARG C 1 14  ? 7.001  80.235 15.440  1.00 39.96  ? 13  ARG C N   1 
ATOM   2297 C CA  . ARG C 1 14  ? 7.937  79.743 16.454  1.00 39.55  ? 13  ARG C CA  1 
ATOM   2298 C C   . ARG C 1 14  ? 8.930  78.745 15.885  1.00 39.23  ? 13  ARG C C   1 
ATOM   2299 O O   . ARG C 1 14  ? 10.116 78.838 16.138  1.00 39.62  ? 13  ARG C O   1 
ATOM   2300 C CB  . ARG C 1 14  ? 7.190  79.098 17.610  1.00 39.43  ? 13  ARG C CB  1 
ATOM   2301 C CG  . ARG C 1 14  ? 6.387  80.068 18.430  1.00 42.72  ? 13  ARG C CG  1 
ATOM   2302 C CD  . ARG C 1 14  ? 5.491  79.305 19.400  1.00 48.31  ? 13  ARG C CD  1 
ATOM   2303 N NE  . ARG C 1 14  ? 4.957  80.164 20.454  1.00 49.82  ? 13  ARG C NE  1 
ATOM   2304 C CZ  . ARG C 1 14  ? 5.725  80.838 21.295  1.00 51.59  ? 13  ARG C CZ  1 
ATOM   2305 N NH1 . ARG C 1 14  ? 7.048  80.742 21.197  1.00 53.13  ? 13  ARG C NH1 1 
ATOM   2306 N NH2 . ARG C 1 14  ? 5.178  81.605 22.220  1.00 53.29  ? 13  ARG C NH2 1 
ATOM   2307 N N   . ILE C 1 15  ? 8.441  77.789 15.105  1.00 39.60  ? 14  ILE C N   1 
ATOM   2308 C CA  . ILE C 1 15  ? 9.350  76.815 14.548  1.00 36.58  ? 14  ILE C CA  1 
ATOM   2309 C C   . ILE C 1 15  ? 10.351 77.473 13.626  1.00 35.89  ? 14  ILE C C   1 
ATOM   2310 O O   . ILE C 1 15  ? 11.528 77.179 13.694  1.00 37.65  ? 14  ILE C O   1 
ATOM   2311 C CB  . ILE C 1 15  ? 8.622  75.686 13.795  1.00 34.01  ? 14  ILE C CB  1 
ATOM   2312 C CG1 . ILE C 1 15  ? 9.580  74.519 13.627  1.00 33.31  ? 14  ILE C CG1 1 
ATOM   2313 C CG2 . ILE C 1 15  ? 8.192  76.129 12.439  1.00 35.71  ? 14  ILE C CG2 1 
ATOM   2314 C CD1 . ILE C 1 15  ? 10.094 73.997 14.959  1.00 34.30  ? 14  ILE C CD1 1 
ATOM   2315 N N   . ASN C 1 16  ? 9.882  78.374 12.776  1.00 36.35  ? 15  ASN C N   1 
ATOM   2316 C CA  . ASN C 1 16  ? 10.812 79.042 11.865  1.00 39.61  ? 15  ASN C CA  1 
ATOM   2317 C C   . ASN C 1 16  ? 11.918 79.766 12.647  1.00 39.81  ? 15  ASN C C   1 
ATOM   2318 O O   . ASN C 1 16  ? 13.059 79.865 12.195  1.00 40.60  ? 15  ASN C O   1 
ATOM   2319 C CB  . ASN C 1 16  ? 10.069 80.014 10.944  1.00 42.42  ? 15  ASN C CB  1 
ATOM   2320 C CG  . ASN C 1 16  ? 9.058  79.302 10.066  1.00 47.17  ? 15  ASN C CG  1 
ATOM   2321 O OD1 . ASN C 1 16  ? 9.327  78.194 9.603   1.00 49.43  ? 15  ASN C OD1 1 
ATOM   2322 N ND2 . ASN C 1 16  ? 7.892  79.927 9.831   1.00 45.84  ? 15  ASN C ND2 1 
ATOM   2323 N N   . ARG C 1 17  ? 11.572 80.258 13.829  1.00 39.62  ? 16  ARG C N   1 
ATOM   2324 C CA  . ARG C 1 17  ? 12.573 80.911 14.649  1.00 41.19  ? 16  ARG C CA  1 
ATOM   2325 C C   . ARG C 1 17  ? 13.459 79.854 15.369  1.00 38.54  ? 16  ARG C C   1 
ATOM   2326 O O   . ARG C 1 17  ? 14.672 79.990 15.443  1.00 36.33  ? 16  ARG C O   1 
ATOM   2327 C CB  . ARG C 1 17  ? 11.912 81.822 15.676  1.00 45.68  ? 16  ARG C CB  1 
ATOM   2328 C CG  . ARG C 1 17  ? 12.806 82.957 16.119  1.00 53.33  ? 16  ARG C CG  1 
ATOM   2329 C CD  . ARG C 1 17  ? 12.178 83.668 17.289  1.00 61.32  ? 16  ARG C CD  1 
ATOM   2330 N NE  . ARG C 1 17  ? 10.774 83.985 17.027  1.00 66.59  ? 16  ARG C NE  1 
ATOM   2331 C CZ  . ARG C 1 17  ? 9.770  83.643 17.831  1.00 70.74  ? 16  ARG C CZ  1 
ATOM   2332 N NH1 . ARG C 1 17  ? 8.520  83.977 17.518  1.00 73.48  ? 16  ARG C NH1 1 
ATOM   2333 N NH2 . ARG C 1 17  ? 10.017 82.958 18.945  1.00 71.01  ? 16  ARG C NH2 1 
ATOM   2334 N N   . ALA C 1 18  ? 12.830 78.799 15.870  1.00 37.04  ? 17  ALA C N   1 
ATOM   2335 C CA  . ALA C 1 18  ? 13.574 77.739 16.565  1.00 37.63  ? 17  ALA C CA  1 
ATOM   2336 C C   . ALA C 1 18  ? 14.488 76.906 15.612  1.00 39.03  ? 17  ALA C C   1 
ATOM   2337 O O   . ALA C 1 18  ? 15.452 76.277 16.070  1.00 40.82  ? 17  ALA C O   1 
ATOM   2338 C CB  . ALA C 1 18  ? 12.610 76.816 17.311  1.00 37.07  ? 17  ALA C CB  1 
ATOM   2339 N N   . THR C 1 19  ? 14.179 76.873 14.318  1.00 36.74  ? 18  THR C N   1 
ATOM   2340 C CA  . THR C 1 19  ? 15.061 76.128 13.395  1.00 37.74  ? 18  THR C CA  1 
ATOM   2341 C C   . THR C 1 19  ? 15.678 77.048 12.306  1.00 39.23  ? 18  THR C C   1 
ATOM   2342 O O   . THR C 1 19  ? 16.047 76.616 11.212  1.00 41.46  ? 18  THR C O   1 
ATOM   2343 C CB  . THR C 1 19  ? 14.342 74.930 12.702  1.00 35.30  ? 18  THR C CB  1 
ATOM   2344 O OG1 . THR C 1 19  ? 13.402 75.405 11.718  1.00 32.94  ? 18  THR C OG1 1 
ATOM   2345 C CG2 . THR C 1 19  ? 13.650 74.075 13.747  1.00 30.79  ? 18  THR C CG2 1 
ATOM   2346 N N   . ASN C 1 20  ? 15.786 78.324 12.633  1.00 38.86  ? 19  ASN C N   1 
ATOM   2347 C CA  . ASN C 1 20  ? 16.357 79.265 11.693  1.00 38.40  ? 19  ASN C CA  1 
ATOM   2348 C C   . ASN C 1 20  ? 17.824 78.945 11.363  1.00 38.75  ? 19  ASN C C   1 
ATOM   2349 O O   . ASN C 1 20  ? 18.674 79.009 12.231  1.00 38.11  ? 19  ASN C O   1 
ATOM   2350 C CB  . ASN C 1 20  ? 16.276 80.672 12.244  1.00 37.49  ? 19  ASN C CB  1 
ATOM   2351 C CG  . ASN C 1 20  ? 16.504 81.701 11.183  1.00 37.29  ? 19  ASN C CG  1 
ATOM   2352 O OD1 . ASN C 1 20  ? 17.400 81.558 10.335  1.00 37.09  ? 19  ASN C OD1 1 
ATOM   2353 N ND2 . ASN C 1 20  ? 15.700 82.751 11.209  1.00 35.42  ? 19  ASN C ND2 1 
ATOM   2354 N N   . PRO C 1 21  ? 18.113 78.608 10.092  1.00 39.80  ? 20  PRO C N   1 
ATOM   2355 C CA  . PRO C 1 21  ? 19.435 78.265 9.556   1.00 40.51  ? 20  PRO C CA  1 
ATOM   2356 C C   . PRO C 1 21  ? 20.523 79.260 9.932   1.00 42.44  ? 20  PRO C C   1 
ATOM   2357 O O   . PRO C 1 21  ? 21.700 78.918 9.935   1.00 43.66  ? 20  PRO C O   1 
ATOM   2358 C CB  . PRO C 1 21  ? 19.203 78.246 8.054   1.00 38.99  ? 20  PRO C CB  1 
ATOM   2359 C CG  . PRO C 1 21  ? 17.837 77.705 7.961   1.00 40.60  ? 20  PRO C CG  1 
ATOM   2360 C CD  . PRO C 1 21  ? 17.093 78.480 9.042   1.00 39.14  ? 20  PRO C CD  1 
ATOM   2361 N N   . LEU C 1 22  ? 20.114 80.494 10.218  1.00 44.19  ? 21  LEU C N   1 
ATOM   2362 C CA  . LEU C 1 22  ? 21.071 81.554 10.602  1.00 45.83  ? 21  LEU C CA  1 
ATOM   2363 C C   . LEU C 1 22  ? 21.555 81.432 12.082  1.00 46.24  ? 21  LEU C C   1 
ATOM   2364 O O   . LEU C 1 22  ? 22.714 81.682 12.357  1.00 47.37  ? 21  LEU C O   1 
ATOM   2365 C CB  . LEU C 1 22  ? 20.462 82.955 10.375  1.00 45.15  ? 21  LEU C CB  1 
ATOM   2366 C CG  . LEU C 1 22  ? 20.095 83.408 8.949   1.00 47.25  ? 21  LEU C CG  1 
ATOM   2367 C CD1 . LEU C 1 22  ? 19.360 84.744 9.031   1.00 46.12  ? 21  LEU C CD1 1 
ATOM   2368 C CD2 . LEU C 1 22  ? 21.335 83.513 8.065   1.00 41.45  ? 21  LEU C CD2 1 
ATOM   2369 N N   . ASN C 1 23  ? 20.676 81.036 13.005  1.00 45.81  ? 22  ASN C N   1 
ATOM   2370 C CA  . ASN C 1 23  ? 21.073 80.929 14.422  1.00 45.90  ? 22  ASN C CA  1 
ATOM   2371 C C   . ASN C 1 23  ? 22.509 80.462 14.598  1.00 46.58  ? 22  ASN C C   1 
ATOM   2372 O O   . ASN C 1 23  ? 22.917 79.458 14.030  1.00 48.89  ? 22  ASN C O   1 
ATOM   2373 C CB  . ASN C 1 23  ? 20.140 80.000 15.189  1.00 42.77  ? 22  ASN C CB  1 
ATOM   2374 C CG  . ASN C 1 23  ? 18.714 80.489 15.177  1.00 44.13  ? 22  ASN C CG  1 
ATOM   2375 O OD1 . ASN C 1 23  ? 18.448 81.663 14.892  1.00 42.79  ? 22  ASN C OD1 1 
ATOM   2376 N ND2 . ASN C 1 23  ? 17.778 79.594 15.493  1.00 42.85  ? 22  ASN C ND2 1 
ATOM   2377 N N   . LYS C 1 24  ? 23.270 81.221 15.376  1.00 47.69  ? 23  LYS C N   1 
ATOM   2378 C CA  . LYS C 1 24  ? 24.666 80.885 15.621  1.00 48.86  ? 23  LYS C CA  1 
ATOM   2379 C C   . LYS C 1 24  ? 24.786 79.696 16.586  1.00 48.02  ? 23  LYS C C   1 
ATOM   2380 O O   . LYS C 1 24  ? 25.771 78.975 16.585  1.00 48.06  ? 23  LYS C O   1 
ATOM   2381 C CB  . LYS C 1 24  ? 25.403 82.120 16.150  1.00 52.68  ? 23  LYS C CB  1 
ATOM   2382 C CG  . LYS C 1 24  ? 25.646 83.198 15.081  1.00 54.78  ? 23  LYS C CG  1 
ATOM   2383 C CD  . LYS C 1 24  ? 26.099 84.533 15.688  1.00 59.92  ? 23  LYS C CD  1 
ATOM   2384 C CE  . LYS C 1 24  ? 27.390 84.419 16.527  1.00 61.72  ? 23  LYS C CE  1 
ATOM   2385 N NZ  . LYS C 1 24  ? 27.234 83.676 17.838  1.00 62.53  ? 23  LYS C NZ  1 
ATOM   2386 N N   . GLU C 1 25  ? 23.741 79.507 17.381  1.00 48.10  ? 24  GLU C N   1 
ATOM   2387 C CA  . GLU C 1 25  ? 23.646 78.408 18.349  1.00 47.47  ? 24  GLU C CA  1 
ATOM   2388 C C   . GLU C 1 25  ? 22.166 78.193 18.719  1.00 46.38  ? 24  GLU C C   1 
ATOM   2389 O O   . GLU C 1 25  ? 21.344 79.053 18.443  1.00 47.92  ? 24  GLU C O   1 
ATOM   2390 C CB  . GLU C 1 25  ? 24.415 78.759 19.605  1.00 51.06  ? 24  GLU C CB  1 
ATOM   2391 C CG  . GLU C 1 25  ? 23.736 79.844 20.404  1.00 57.17  ? 24  GLU C CG  1 
ATOM   2392 C CD  . GLU C 1 25  ? 24.624 80.370 21.499  1.00 61.32  ? 24  GLU C CD  1 
ATOM   2393 O OE1 . GLU C 1 25  ? 25.302 79.529 22.140  1.00 62.56  ? 24  GLU C OE1 1 
ATOM   2394 O OE2 . GLU C 1 25  ? 24.637 81.612 21.716  1.00 62.35  ? 24  GLU C OE2 1 
ATOM   2395 N N   . LEU C 1 26  ? 21.850 77.073 19.365  1.00 43.27  ? 25  LEU C N   1 
ATOM   2396 C CA  . LEU C 1 26  ? 20.463 76.762 19.745  1.00 39.22  ? 25  LEU C CA  1 
ATOM   2397 C C   . LEU C 1 26  ? 19.708 77.920 20.399  1.00 38.96  ? 25  LEU C C   1 
ATOM   2398 O O   . LEU C 1 26  ? 20.243 78.667 21.182  1.00 37.43  ? 25  LEU C O   1 
ATOM   2399 C CB  . LEU C 1 26  ? 20.428 75.547 20.665  1.00 35.95  ? 25  LEU C CB  1 
ATOM   2400 C CG  . LEU C 1 26  ? 20.793 74.273 19.928  1.00 34.64  ? 25  LEU C CG  1 
ATOM   2401 C CD1 . LEU C 1 26  ? 20.863 73.117 20.892  1.00 32.48  ? 25  LEU C CD1 1 
ATOM   2402 C CD2 . LEU C 1 26  ? 19.770 74.016 18.854  1.00 33.05  ? 25  LEU C CD2 1 
ATOM   2403 N N   . ASP C 1 27  ? 18.439 78.042 20.054  1.00 40.82  ? 26  ASP C N   1 
ATOM   2404 C CA  . ASP C 1 27  ? 17.614 79.100 20.609  1.00 41.61  ? 26  ASP C CA  1 
ATOM   2405 C C   . ASP C 1 27  ? 16.539 78.512 21.534  1.00 42.02  ? 26  ASP C C   1 
ATOM   2406 O O   . ASP C 1 27  ? 15.341 78.470 21.200  1.00 41.23  ? 26  ASP C O   1 
ATOM   2407 C CB  . ASP C 1 27  ? 16.967 79.879 19.475  1.00 43.93  ? 26  ASP C CB  1 
ATOM   2408 C CG  . ASP C 1 27  ? 16.086 80.998 19.970  1.00 48.86  ? 26  ASP C CG  1 
ATOM   2409 O OD1 . ASP C 1 27  ? 15.872 81.091 21.210  1.00 50.42  ? 26  ASP C OD1 1 
ATOM   2410 O OD2 . ASP C 1 27  ? 15.602 81.775 19.111  1.00 50.57  ? 26  ASP C OD2 1 
ATOM   2411 N N   . TRP C 1 28  ? 16.993 78.066 22.699  1.00 40.70  ? 27  TRP C N   1 
ATOM   2412 C CA  . TRP C 1 28  ? 16.105 77.450 23.678  1.00 39.82  ? 27  TRP C CA  1 
ATOM   2413 C C   . TRP C 1 28  ? 14.818 78.209 23.950  1.00 39.73  ? 27  TRP C C   1 
ATOM   2414 O O   . TRP C 1 28  ? 13.766 77.594 24.188  1.00 40.94  ? 27  TRP C O   1 
ATOM   2415 C CB  . TRP C 1 28  ? 16.851 77.213 24.968  1.00 36.44  ? 27  TRP C CB  1 
ATOM   2416 C CG  . TRP C 1 28  ? 17.789 76.110 24.800  1.00 36.24  ? 27  TRP C CG  1 
ATOM   2417 C CD1 . TRP C 1 28  ? 19.137 76.176 24.892  1.00 35.81  ? 27  TRP C CD1 1 
ATOM   2418 C CD2 . TRP C 1 28  ? 17.470 74.753 24.471  1.00 33.89  ? 27  TRP C CD2 1 
ATOM   2419 N NE1 . TRP C 1 28  ? 19.691 74.945 24.639  1.00 35.86  ? 27  TRP C NE1 1 
ATOM   2420 C CE2 . TRP C 1 28  ? 18.689 74.055 24.373  1.00 34.09  ? 27  TRP C CE2 1 
ATOM   2421 C CE3 . TRP C 1 28  ? 16.281 74.068 24.238  1.00 34.19  ? 27  TRP C CE3 1 
ATOM   2422 C CZ2 . TRP C 1 28  ? 18.752 72.706 24.074  1.00 31.86  ? 27  TRP C CZ2 1 
ATOM   2423 C CZ3 . TRP C 1 28  ? 16.342 72.718 23.936  1.00 34.80  ? 27  TRP C CZ3 1 
ATOM   2424 C CH2 . TRP C 1 28  ? 17.572 72.053 23.852  1.00 34.74  ? 27  TRP C CH2 1 
ATOM   2425 N N   . ALA C 1 29  ? 14.899 79.532 23.927  1.00 37.50  ? 28  ALA C N   1 
ATOM   2426 C CA  . ALA C 1 29  ? 13.698 80.334 24.164  1.00 36.42  ? 28  ALA C CA  1 
ATOM   2427 C C   . ALA C 1 29  ? 12.562 79.908 23.179  1.00 36.45  ? 28  ALA C C   1 
ATOM   2428 O O   . ALA C 1 29  ? 11.462 79.527 23.598  1.00 32.78  ? 28  ALA C O   1 
ATOM   2429 C CB  . ALA C 1 29  ? 14.032 81.815 23.997  1.00 35.67  ? 28  ALA C CB  1 
ATOM   2430 N N   . SER C 1 30  ? 12.870 79.965 21.881  1.00 34.83  ? 29  SER C N   1 
ATOM   2431 C CA  . SER C 1 30  ? 11.918 79.582 20.852  1.00 34.93  ? 29  SER C CA  1 
ATOM   2432 C C   . SER C 1 30  ? 11.528 78.088 20.946  1.00 34.49  ? 29  SER C C   1 
ATOM   2433 O O   . SER C 1 30  ? 10.375 77.749 20.818  1.00 33.77  ? 29  SER C O   1 
ATOM   2434 C CB  . SER C 1 30  ? 12.513 79.830 19.461  1.00 35.68  ? 29  SER C CB  1 
ATOM   2435 O OG  . SER C 1 30  ? 12.811 81.175 19.224  1.00 37.06  ? 29  SER C OG  1 
ATOM   2436 N N   . ILE C 1 31  ? 12.529 77.229 21.131  1.00 34.13  ? 30  ILE C N   1 
ATOM   2437 C CA  . ILE C 1 31  ? 12.309 75.788 21.205  1.00 36.16  ? 30  ILE C CA  1 
ATOM   2438 C C   . ILE C 1 31  ? 11.343 75.440 22.322  1.00 38.49  ? 30  ILE C C   1 
ATOM   2439 O O   . ILE C 1 31  ? 10.392 74.712 22.117  1.00 39.21  ? 30  ILE C O   1 
ATOM   2440 C CB  . ILE C 1 31  ? 13.623 75.007 21.449  1.00 36.65  ? 30  ILE C CB  1 
ATOM   2441 C CG1 . ILE C 1 31  ? 14.509 75.062 20.211  1.00 36.60  ? 30  ILE C CG1 1 
ATOM   2442 C CG2 . ILE C 1 31  ? 13.324 73.551 21.761  1.00 36.54  ? 30  ILE C CG2 1 
ATOM   2443 C CD1 . ILE C 1 31  ? 15.917 74.591 20.463  1.00 35.20  ? 30  ILE C CD1 1 
ATOM   2444 N N   . ASN C 1 32  ? 11.600 75.967 23.509  1.00 39.63  ? 31  ASN C N   1 
ATOM   2445 C CA  . ASN C 1 32  ? 10.701 75.695 24.627  1.00 41.18  ? 31  ASN C CA  1 
ATOM   2446 C C   . ASN C 1 32  ? 9.339  76.354 24.398  1.00 40.25  ? 31  ASN C C   1 
ATOM   2447 O O   . ASN C 1 32  ? 8.315  75.747 24.644  1.00 41.84  ? 31  ASN C O   1 
ATOM   2448 C CB  . ASN C 1 32  ? 11.309 76.182 25.939  1.00 43.01  ? 31  ASN C CB  1 
ATOM   2449 C CG  . ASN C 1 32  ? 12.370 75.248 26.459  1.00 44.21  ? 31  ASN C CG  1 
ATOM   2450 O OD1 . ASN C 1 32  ? 13.370 75.681 27.016  1.00 42.82  ? 31  ASN C OD1 1 
ATOM   2451 N ND2 . ASN C 1 32  ? 12.146 73.941 26.277  1.00 44.51  ? 31  ASN C ND2 1 
ATOM   2452 N N   . GLY C 1 33  ? 9.358  77.588 23.903  1.00 38.37  ? 32  GLY C N   1 
ATOM   2453 C CA  . GLY C 1 33  ? 8.114  78.278 23.617  1.00 38.98  ? 32  GLY C CA  1 
ATOM   2454 C C   . GLY C 1 33  ? 7.233  77.467 22.679  1.00 39.09  ? 32  GLY C C   1 
ATOM   2455 O O   . GLY C 1 33  ? 6.016  77.385 22.847  1.00 38.55  ? 32  GLY C O   1 
ATOM   2456 N N   . PHE C 1 34  ? 7.865  76.862 21.679  1.00 39.85  ? 33  PHE C N   1 
ATOM   2457 C CA  . PHE C 1 34  ? 7.169  76.020 20.686  1.00 39.73  ? 33  PHE C CA  1 
ATOM   2458 C C   . PHE C 1 34  ? 6.528  74.766 21.313  1.00 39.76  ? 33  PHE C C   1 
ATOM   2459 O O   . PHE C 1 34  ? 5.413  74.439 20.991  1.00 37.37  ? 33  PHE C O   1 
ATOM   2460 C CB  . PHE C 1 34  ? 8.153  75.596 19.584  1.00 36.26  ? 33  PHE C CB  1 
ATOM   2461 C CG  . PHE C 1 34  ? 7.600  74.569 18.614  1.00 36.13  ? 33  PHE C CG  1 
ATOM   2462 C CD1 . PHE C 1 34  ? 7.736  73.203 18.859  1.00 33.83  ? 33  PHE C CD1 1 
ATOM   2463 C CD2 . PHE C 1 34  ? 7.012  74.973 17.415  1.00 36.82  ? 33  PHE C CD2 1 
ATOM   2464 C CE1 . PHE C 1 34  ? 7.304  72.262 17.926  1.00 33.87  ? 33  PHE C CE1 1 
ATOM   2465 C CE2 . PHE C 1 34  ? 6.573  74.041 16.476  1.00 34.73  ? 33  PHE C CE2 1 
ATOM   2466 C CZ  . PHE C 1 34  ? 6.726  72.683 16.730  1.00 35.08  ? 33  PHE C CZ  1 
ATOM   2467 N N   . CYS C 1 35  ? 7.259  74.077 22.187  1.00 41.47  ? 34  CYS C N   1 
ATOM   2468 C CA  . CYS C 1 35  ? 6.722  72.877 22.811  1.00 45.44  ? 34  CYS C CA  1 
ATOM   2469 C C   . CYS C 1 35  ? 5.527  73.196 23.683  1.00 49.78  ? 34  CYS C C   1 
ATOM   2470 O O   . CYS C 1 35  ? 4.594  72.429 23.774  1.00 50.45  ? 34  CYS C O   1 
ATOM   2471 C CB  . CYS C 1 35  ? 7.773  72.185 23.664  1.00 42.19  ? 34  CYS C CB  1 
ATOM   2472 S SG  . CYS C 1 35  ? 9.188  71.518 22.740  1.00 41.51  ? 34  CYS C SG  1 
ATOM   2473 N N   . GLU C 1 36  ? 5.588  74.346 24.327  1.00 55.34  ? 35  GLU C N   1 
ATOM   2474 C CA  . GLU C 1 36  ? 4.509  74.767 25.189  1.00 61.86  ? 35  GLU C CA  1 
ATOM   2475 C C   . GLU C 1 36  ? 3.292  75.258 24.364  1.00 63.94  ? 35  GLU C C   1 
ATOM   2476 O O   . GLU C 1 36  ? 2.148  75.006 24.716  1.00 65.09  ? 35  GLU C O   1 
ATOM   2477 C CB  . GLU C 1 36  ? 5.001  75.874 26.130  1.00 64.77  ? 35  GLU C CB  1 
ATOM   2478 C CG  . GLU C 1 36  ? 3.996  76.249 27.205  1.00 70.24  ? 35  GLU C CG  1 
ATOM   2479 C CD  . GLU C 1 36  ? 4.126  77.691 27.649  1.00 73.63  ? 35  GLU C CD  1 
ATOM   2480 O OE1 . GLU C 1 36  ? 5.059  78.002 28.426  1.00 74.86  ? 35  GLU C OE1 1 
ATOM   2481 O OE2 . GLU C 1 36  ? 3.289  78.514 27.206  1.00 75.16  ? 35  GLU C OE2 1 
ATOM   2482 N N   . GLN C 1 37  ? 3.571  75.935 23.259  1.00 65.37  ? 36  GLN C N   1 
ATOM   2483 C CA  . GLN C 1 37  ? 2.520  76.460 22.381  1.00 67.69  ? 36  GLN C CA  1 
ATOM   2484 C C   . GLN C 1 37  ? 1.656  75.361 21.715  1.00 69.43  ? 36  GLN C C   1 
ATOM   2485 O O   . GLN C 1 37  ? 0.506  75.596 21.390  1.00 69.41  ? 36  GLN C O   1 
ATOM   2486 C CB  . GLN C 1 37  ? 3.153  77.328 21.291  1.00 68.59  ? 36  GLN C CB  1 
ATOM   2487 C CG  . GLN C 1 37  ? 2.167  77.925 20.312  1.00 69.93  ? 36  GLN C CG  1 
ATOM   2488 C CD  . GLN C 1 37  ? 1.097  78.715 21.012  1.00 70.93  ? 36  GLN C CD  1 
ATOM   2489 O OE1 . GLN C 1 37  ? 1.386  79.552 21.861  1.00 71.14  ? 36  GLN C OE1 1 
ATOM   2490 N NE2 . GLN C 1 37  ? -0.151 78.454 20.659  1.00 71.59  ? 36  GLN C NE2 1 
ATOM   2491 N N   . LEU C 1 38  ? 2.223  74.175 21.520  1.00 71.09  ? 37  LEU C N   1 
ATOM   2492 C CA  . LEU C 1 38  ? 1.475  73.094 20.874  1.00 73.61  ? 37  LEU C CA  1 
ATOM   2493 C C   . LEU C 1 38  ? 0.563  72.327 21.845  1.00 76.20  ? 37  LEU C C   1 
ATOM   2494 O O   . LEU C 1 38  ? -0.487 71.855 21.450  1.00 76.05  ? 37  LEU C O   1 
ATOM   2495 C CB  . LEU C 1 38  ? 2.435  72.125 20.182  1.00 72.30  ? 37  LEU C CB  1 
ATOM   2496 C CG  . LEU C 1 38  ? 3.272  71.184 21.040  1.00 71.38  ? 37  LEU C CG  1 
ATOM   2497 C CD1 . LEU C 1 38  ? 2.472  69.952 21.398  1.00 72.37  ? 37  LEU C CD1 1 
ATOM   2498 C CD2 . LEU C 1 38  ? 4.499  70.776 20.265  1.00 71.74  ? 37  LEU C CD2 1 
ATOM   2499 N N   . ASN C 1 39  ? 0.981  72.214 23.104  1.00 79.72  ? 38  ASN C N   1 
ATOM   2500 C CA  . ASN C 1 39  ? 0.182  71.500 24.124  1.00 83.56  ? 38  ASN C CA  1 
ATOM   2501 C C   . ASN C 1 39  ? -1.168 72.198 24.442  1.00 85.47  ? 38  ASN C C   1 
ATOM   2502 O O   . ASN C 1 39  ? -2.013 71.637 25.130  1.00 85.40  ? 38  ASN C O   1 
ATOM   2503 C CB  . ASN C 1 39  ? 0.980  71.330 25.427  1.00 84.14  ? 38  ASN C CB  1 
ATOM   2504 C CG  . ASN C 1 39  ? 1.913  70.125 25.395  1.00 84.31  ? 38  ASN C CG  1 
ATOM   2505 O OD1 . ASN C 1 39  ? 1.520  69.026 24.997  1.00 83.19  ? 38  ASN C OD1 1 
ATOM   2506 N ND2 . ASN C 1 39  ? 3.151  70.326 25.837  1.00 84.00  ? 38  ASN C ND2 1 
ATOM   2507 N N   . GLU C 1 40  ? -1.342 73.420 23.946  1.00 87.66  ? 39  GLU C N   1 
ATOM   2508 C CA  . GLU C 1 40  ? -2.591 74.159 24.167  1.00 89.55  ? 39  GLU C CA  1 
ATOM   2509 C C   . GLU C 1 40  ? -3.683 73.688 23.196  1.00 90.45  ? 39  GLU C C   1 
ATOM   2510 O O   . GLU C 1 40  ? -4.417 72.759 23.505  1.00 91.13  ? 39  GLU C O   1 
ATOM   2511 C CB  . GLU C 1 40  ? -2.359 75.661 24.004  1.00 90.19  ? 39  GLU C CB  1 
ATOM   2512 C CG  . GLU C 1 40  ? -1.436 76.232 25.066  1.00 91.05  ? 39  GLU C CG  1 
ATOM   2513 C CD  . GLU C 1 40  ? -1.339 77.737 25.011  1.00 91.75  ? 39  GLU C CD  1 
ATOM   2514 O OE1 . GLU C 1 40  ? -2.380 78.410 25.202  1.00 92.32  ? 39  GLU C OE1 1 
ATOM   2515 O OE2 . GLU C 1 40  ? -0.218 78.245 24.780  1.00 91.14  ? 39  GLU C OE2 1 
ATOM   2516 N N   . ASP C 1 41  ? -3.778 74.330 22.033  1.00 90.42  ? 40  ASP C N   1 
ATOM   2517 C CA  . ASP C 1 41  ? -4.782 73.924 21.038  1.00 90.85  ? 40  ASP C CA  1 
ATOM   2518 C C   . ASP C 1 41  ? -4.676 72.407 20.731  1.00 91.07  ? 40  ASP C C   1 
ATOM   2519 O O   . ASP C 1 41  ? -3.595 71.893 20.529  1.00 91.53  ? 40  ASP C O   1 
ATOM   2520 C CB  . ASP C 1 41  ? -4.611 74.728 19.742  1.00 90.71  ? 40  ASP C CB  1 
ATOM   2521 C CG  . ASP C 1 41  ? -5.812 75.619 19.440  1.00 91.05  ? 40  ASP C CG  1 
ATOM   2522 O OD1 . ASP C 1 41  ? -5.984 76.660 20.108  1.00 91.43  ? 40  ASP C OD1 1 
ATOM   2523 O OD2 . ASP C 1 41  ? -6.599 75.273 18.536  1.00 91.36  ? 40  ASP C OD2 1 
ATOM   2524 N N   . PHE C 1 42  ? -5.813 71.715 20.717  1.00 92.03  ? 41  PHE C N   1 
ATOM   2525 C CA  . PHE C 1 42  ? -5.852 70.258 20.449  1.00 92.20  ? 41  PHE C CA  1 
ATOM   2526 C C   . PHE C 1 42  ? -5.395 69.887 19.016  1.00 90.59  ? 41  PHE C C   1 
ATOM   2527 O O   . PHE C 1 42  ? -4.937 68.775 18.772  1.00 90.64  ? 41  PHE C O   1 
ATOM   2528 C CB  . PHE C 1 42  ? -7.265 69.712 20.712  1.00 94.59  ? 41  PHE C CB  1 
ATOM   2529 C CG  . PHE C 1 42  ? -7.361 68.833 21.938  1.00 97.05  ? 41  PHE C CG  1 
ATOM   2530 C CD1 . PHE C 1 42  ? -7.076 67.468 21.858  1.00 97.92  ? 41  PHE C CD1 1 
ATOM   2531 C CD2 . PHE C 1 42  ? -7.680 69.379 23.183  1.00 97.56  ? 41  PHE C CD2 1 
ATOM   2532 C CE1 . PHE C 1 42  ? -7.111 66.659 22.998  1.00 98.63  ? 41  PHE C CE1 1 
ATOM   2533 C CE2 . PHE C 1 42  ? -7.718 68.581 24.330  1.00 98.04  ? 41  PHE C CE2 1 
ATOM   2534 C CZ  . PHE C 1 42  ? -7.429 67.218 24.238  1.00 98.75  ? 41  PHE C CZ  1 
ATOM   2535 N N   . GLU C 1 43  ? -5.531 70.826 18.087  1.00 87.86  ? 42  GLU C N   1 
ATOM   2536 C CA  . GLU C 1 43  ? -5.101 70.585 16.709  1.00 84.91  ? 42  GLU C CA  1 
ATOM   2537 C C   . GLU C 1 43  ? -3.648 71.051 16.512  1.00 81.69  ? 42  GLU C C   1 
ATOM   2538 O O   . GLU C 1 43  ? -3.136 71.075 15.403  1.00 82.05  ? 42  GLU C O   1 
ATOM   2539 C CB  . GLU C 1 43  ? -5.991 71.341 15.732  1.00 87.13  ? 42  GLU C CB  1 
ATOM   2540 C CG  . GLU C 1 43  ? -5.801 72.842 15.778  1.00 90.03  ? 42  GLU C CG  1 
ATOM   2541 C CD  . GLU C 1 43  ? -6.010 73.486 14.423  1.00 92.51  ? 42  GLU C CD  1 
ATOM   2542 O OE1 . GLU C 1 43  ? -7.150 73.449 13.901  1.00 93.05  ? 42  GLU C OE1 1 
ATOM   2543 O OE2 . GLU C 1 43  ? -5.021 74.021 13.872  1.00 93.60  ? 42  GLU C OE2 1 
ATOM   2544 N N   . GLY C 1 44  ? -3.016 71.429 17.617  1.00 77.50  ? 43  GLY C N   1 
ATOM   2545 C CA  . GLY C 1 44  ? -1.644 71.893 17.581  1.00 71.44  ? 43  GLY C CA  1 
ATOM   2546 C C   . GLY C 1 44  ? -0.671 70.773 17.303  1.00 66.95  ? 43  GLY C C   1 
ATOM   2547 O O   . GLY C 1 44  ? 0.151  70.906 16.430  1.00 67.07  ? 43  GLY C O   1 
ATOM   2548 N N   . PRO C 1 45  ? -0.743 69.650 18.029  1.00 63.95  ? 44  PRO C N   1 
ATOM   2549 C CA  . PRO C 1 45  ? 0.195  68.550 17.772  1.00 61.64  ? 44  PRO C CA  1 
ATOM   2550 C C   . PRO C 1 45  ? 0.283  68.137 16.273  1.00 58.57  ? 44  PRO C C   1 
ATOM   2551 O O   . PRO C 1 45  ? 1.361  67.998 15.728  1.00 59.08  ? 44  PRO C O   1 
ATOM   2552 C CB  . PRO C 1 45  ? -0.335 67.434 18.663  1.00 62.22  ? 44  PRO C CB  1 
ATOM   2553 C CG  . PRO C 1 45  ? -0.909 68.197 19.817  1.00 62.13  ? 44  PRO C CG  1 
ATOM   2554 C CD  . PRO C 1 45  ? -1.650 69.315 19.136  1.00 61.72  ? 44  PRO C CD  1 
ATOM   2555 N N   . PRO C 1 46  ? -0.857 67.945 15.602  1.00 56.16  ? 45  PRO C N   1 
ATOM   2556 C CA  . PRO C 1 46  ? -0.753 67.560 14.186  1.00 52.90  ? 45  PRO C CA  1 
ATOM   2557 C C   . PRO C 1 46  ? 0.058  68.601 13.394  1.00 49.46  ? 45  PRO C C   1 
ATOM   2558 O O   . PRO C 1 46  ? 0.954  68.256 12.642  1.00 48.95  ? 45  PRO C O   1 
ATOM   2559 C CB  . PRO C 1 46  ? -2.205 67.512 13.730  1.00 54.27  ? 45  PRO C CB  1 
ATOM   2560 C CG  . PRO C 1 46  ? -2.935 67.136 14.996  1.00 56.25  ? 45  PRO C CG  1 
ATOM   2561 C CD  . PRO C 1 46  ? -2.260 67.994 16.039  1.00 54.77  ? 45  PRO C CD  1 
ATOM   2562 N N   . LEU C 1 47  ? -0.284 69.872 13.591  1.00 46.67  ? 46  LEU C N   1 
ATOM   2563 C CA  . LEU C 1 47  ? 0.393  70.978 12.901  1.00 43.67  ? 46  LEU C CA  1 
ATOM   2564 C C   . LEU C 1 47  ? 1.900  71.063 13.259  1.00 43.72  ? 46  LEU C C   1 
ATOM   2565 O O   . LEU C 1 47  ? 2.706  71.592 12.489  1.00 43.99  ? 46  LEU C O   1 
ATOM   2566 C CB  . LEU C 1 47  ? -0.315 72.295 13.219  1.00 40.32  ? 46  LEU C CB  1 
ATOM   2567 C CG  . LEU C 1 47  ? 0.036  73.527 12.383  1.00 40.14  ? 46  LEU C CG  1 
ATOM   2568 C CD1 . LEU C 1 47  ? 0.955  74.402 13.164  1.00 37.87  ? 46  LEU C CD1 1 
ATOM   2569 C CD2 . LEU C 1 47  ? 0.645  73.125 11.037  1.00 37.96  ? 46  LEU C CD2 1 
ATOM   2570 N N   . ALA C 1 48  ? 2.254  70.528 14.426  1.00 41.74  ? 47  ALA C N   1 
ATOM   2571 C CA  . ALA C 1 48  ? 3.651  70.511 14.860  1.00 41.27  ? 47  ALA C CA  1 
ATOM   2572 C C   . ALA C 1 48  ? 4.429  69.388 14.143  1.00 41.31  ? 47  ALA C C   1 
ATOM   2573 O O   . ALA C 1 48  ? 5.494  69.641 13.594  1.00 42.91  ? 47  ALA C O   1 
ATOM   2574 C CB  . ALA C 1 48  ? 3.746  70.332 16.370  1.00 39.11  ? 47  ALA C CB  1 
ATOM   2575 N N   . THR C 1 49  ? 3.886  68.166 14.147  1.00 40.10  ? 48  THR C N   1 
ATOM   2576 C CA  . THR C 1 49  ? 4.569  67.044 13.469  1.00 39.08  ? 48  THR C CA  1 
ATOM   2577 C C   . THR C 1 49  ? 4.714  67.310 11.978  1.00 38.84  ? 48  THR C C   1 
ATOM   2578 O O   . THR C 1 49  ? 5.753  67.051 11.410  1.00 39.78  ? 48  THR C O   1 
ATOM   2579 C CB  . THR C 1 49  ? 3.853  65.685 13.661  1.00 37.52  ? 48  THR C CB  1 
ATOM   2580 O OG1 . THR C 1 49  ? 2.464  65.847 13.410  1.00 39.94  ? 48  THR C OG1 1 
ATOM   2581 C CG2 . THR C 1 49  ? 4.053  65.164 15.074  1.00 35.27  ? 48  THR C CG2 1 
ATOM   2582 N N   . ARG C 1 50  ? 3.667  67.835 11.362  1.00 39.26  ? 49  ARG C N   1 
ATOM   2583 C CA  . ARG C 1 50  ? 3.730  68.153 9.947   1.00 41.08  ? 49  ARG C CA  1 
ATOM   2584 C C   . ARG C 1 50  ? 4.793  69.240 9.698   1.00 40.76  ? 49  ARG C C   1 
ATOM   2585 O O   . ARG C 1 50  ? 5.453  69.239 8.681   1.00 44.19  ? 49  ARG C O   1 
ATOM   2586 C CB  . ARG C 1 50  ? 2.368  68.646 9.460   1.00 45.06  ? 49  ARG C CB  1 
ATOM   2587 C CG  . ARG C 1 50  ? 2.400  69.406 8.144   1.00 50.49  ? 49  ARG C CG  1 
ATOM   2588 C CD  . ARG C 1 50  ? 1.030  69.973 7.847   1.00 56.42  ? 49  ARG C CD  1 
ATOM   2589 N NE  . ARG C 1 50  ? 0.013  68.969 8.134   1.00 62.72  ? 49  ARG C NE  1 
ATOM   2590 C CZ  . ARG C 1 50  ? -0.194 67.874 7.407   1.00 65.70  ? 49  ARG C CZ  1 
ATOM   2591 N NH1 . ARG C 1 50  ? -1.142 67.011 7.767   1.00 67.63  ? 49  ARG C NH1 1 
ATOM   2592 N NH2 . ARG C 1 50  ? 0.528  67.651 6.311   1.00 66.01  ? 49  ARG C NH2 1 
ATOM   2593 N N   . LEU C 1 51  ? 4.943  70.158 10.647  1.00 37.97  ? 50  LEU C N   1 
ATOM   2594 C CA  . LEU C 1 51  ? 5.936  71.218 10.509  1.00 35.97  ? 50  LEU C CA  1 
ATOM   2595 C C   . LEU C 1 51  ? 7.366  70.682 10.738  1.00 35.76  ? 50  LEU C C   1 
ATOM   2596 O O   . LEU C 1 51  ? 8.295  71.026 10.015  1.00 36.70  ? 50  LEU C O   1 
ATOM   2597 C CB  . LEU C 1 51  ? 5.650  72.335 11.501  1.00 35.03  ? 50  LEU C CB  1 
ATOM   2598 C CG  . LEU C 1 51  ? 5.257  73.724 11.004  1.00 37.07  ? 50  LEU C CG  1 
ATOM   2599 C CD1 . LEU C 1 51  ? 4.672  73.709 9.605   1.00 35.05  ? 50  LEU C CD1 1 
ATOM   2600 C CD2 . LEU C 1 51  ? 4.260  74.286 12.006  1.00 35.02  ? 50  LEU C CD2 1 
ATOM   2601 N N   . LEU C 1 52  ? 7.512  69.833 11.747  1.00 33.21  ? 51  LEU C N   1 
ATOM   2602 C CA  . LEU C 1 52  ? 8.803  69.253 12.074  1.00 32.29  ? 51  LEU C CA  1 
ATOM   2603 C C   . LEU C 1 52  ? 9.304  68.305 10.967  1.00 32.68  ? 51  LEU C C   1 
ATOM   2604 O O   . LEU C 1 52  ? 10.467 68.366 10.560  1.00 33.01  ? 51  LEU C O   1 
ATOM   2605 C CB  . LEU C 1 52  ? 8.725  68.506 13.418  1.00 29.42  ? 51  LEU C CB  1 
ATOM   2606 C CG  . LEU C 1 52  ? 8.610  69.388 14.663  1.00 27.51  ? 51  LEU C CG  1 
ATOM   2607 C CD1 . LEU C 1 52  ? 8.193  68.560 15.857  1.00 21.55  ? 51  LEU C CD1 1 
ATOM   2608 C CD2 . LEU C 1 52  ? 9.939  70.108 14.919  1.00 24.91  ? 51  LEU C CD2 1 
ATOM   2609 N N   . ALA C 1 53  ? 8.424  67.430 10.493  1.00 32.37  ? 52  ALA C N   1 
ATOM   2610 C CA  . ALA C 1 53  ? 8.814  66.501 9.415   1.00 30.55  ? 52  ALA C CA  1 
ATOM   2611 C C   . ALA C 1 53  ? 9.466  67.285 8.288   1.00 28.64  ? 52  ALA C C   1 
ATOM   2612 O O   . ALA C 1 53  ? 10.504 66.916 7.783   1.00 30.95  ? 52  ALA C O   1 
ATOM   2613 C CB  . ALA C 1 53  ? 7.598  65.763 8.874   1.00 27.41  ? 52  ALA C CB  1 
ATOM   2614 N N   . HIS C 1 54  ? 8.844  68.387 7.909   1.00 26.81  ? 53  HIS C N   1 
ATOM   2615 C CA  . HIS C 1 54  ? 9.416  69.176 6.841   1.00 26.21  ? 53  HIS C CA  1 
ATOM   2616 C C   . HIS C 1 54  ? 10.812 69.753 7.210   1.00 26.94  ? 53  HIS C C   1 
ATOM   2617 O O   . HIS C 1 54  ? 11.721 69.626 6.425   1.00 26.68  ? 53  HIS C O   1 
ATOM   2618 C CB  . HIS C 1 54  ? 8.453  70.282 6.403   1.00 22.72  ? 53  HIS C CB  1 
ATOM   2619 C CG  . HIS C 1 54  ? 8.980  71.103 5.274   1.00 23.23  ? 53  HIS C CG  1 
ATOM   2620 N ND1 . HIS C 1 54  ? 9.604  72.316 5.470   1.00 24.85  ? 53  HIS C ND1 1 
ATOM   2621 C CD2 . HIS C 1 54  ? 9.121  70.812 3.959   1.00 22.30  ? 53  HIS C CD2 1 
ATOM   2622 C CE1 . HIS C 1 54  ? 10.115 72.733 4.324   1.00 24.86  ? 53  HIS C CE1 1 
ATOM   2623 N NE2 . HIS C 1 54  ? 9.839  71.840 3.393   1.00 21.93  ? 53  HIS C NE2 1 
ATOM   2624 N N   . LYS C 1 55  ? 10.970 70.338 8.399   1.00 27.59  ? 54  LYS C N   1 
ATOM   2625 C CA  . LYS C 1 55  ? 12.275 70.911 8.804   1.00 30.99  ? 54  LYS C CA  1 
ATOM   2626 C C   . LYS C 1 55  ? 13.384 69.848 8.897   1.00 33.78  ? 54  LYS C C   1 
ATOM   2627 O O   . LYS C 1 55  ? 14.517 70.063 8.453   1.00 35.55  ? 54  LYS C O   1 
ATOM   2628 C CB  . LYS C 1 55  ? 12.189 71.614 10.167  1.00 32.26  ? 54  LYS C CB  1 
ATOM   2629 C CG  . LYS C 1 55  ? 11.226 72.782 10.241  1.00 34.80  ? 54  LYS C CG  1 
ATOM   2630 C CD  . LYS C 1 55  ? 11.572 73.842 9.236   1.00 36.40  ? 54  LYS C CD  1 
ATOM   2631 C CE  . LYS C 1 55  ? 10.619 74.998 9.376   1.00 39.69  ? 54  LYS C CE  1 
ATOM   2632 N NZ  . LYS C 1 55  ? 11.078 76.154 8.548   1.00 42.40  ? 54  LYS C NZ  1 
ATOM   2633 N N   . ILE C 1 56  ? 13.044 68.718 9.505   1.00 33.50  ? 55  ILE C N   1 
ATOM   2634 C CA  . ILE C 1 56  ? 13.988 67.628 9.671   1.00 33.14  ? 55  ILE C CA  1 
ATOM   2635 C C   . ILE C 1 56  ? 14.499 67.089 8.318   1.00 35.87  ? 55  ILE C C   1 
ATOM   2636 O O   . ILE C 1 56  ? 15.604 66.540 8.234   1.00 37.60  ? 55  ILE C O   1 
ATOM   2637 C CB  . ILE C 1 56  ? 13.339 66.481 10.470  1.00 32.57  ? 55  ILE C CB  1 
ATOM   2638 C CG1 . ILE C 1 56  ? 12.990 66.976 11.879  1.00 31.48  ? 55  ILE C CG1 1 
ATOM   2639 C CG2 . ILE C 1 56  ? 14.259 65.287 10.519  1.00 29.66  ? 55  ILE C CG2 1 
ATOM   2640 C CD1 . ILE C 1 56  ? 12.123 66.021 12.654  1.00 29.11  ? 55  ILE C CD1 1 
ATOM   2641 N N   . GLN C 1 57  ? 13.693 67.261 7.272   1.00 34.67  ? 56  GLN C N   1 
ATOM   2642 C CA  . GLN C 1 57  ? 14.063 66.782 5.920   1.00 35.18  ? 56  GLN C CA  1 
ATOM   2643 C C   . GLN C 1 57  ? 14.823 67.809 5.090   1.00 36.23  ? 56  GLN C C   1 
ATOM   2644 O O   . GLN C 1 57  ? 15.225 67.527 3.956   1.00 39.02  ? 56  GLN C O   1 
ATOM   2645 C CB  . GLN C 1 57  ? 12.809 66.360 5.150   1.00 35.22  ? 56  GLN C CB  1 
ATOM   2646 C CG  . GLN C 1 57  ? 12.160 65.145 5.755   1.00 39.90  ? 56  GLN C CG  1 
ATOM   2647 C CD  . GLN C 1 57  ? 10.909 64.723 5.046   1.00 42.00  ? 56  GLN C CD  1 
ATOM   2648 O OE1 . GLN C 1 57  ? 10.801 64.849 3.849   1.00 45.05  ? 56  GLN C OE1 1 
ATOM   2649 N NE2 . GLN C 1 57  ? 9.961  64.185 5.794   1.00 44.96  ? 56  GLN C NE2 1 
ATOM   2650 N N   . SER C 1 58  ? 15.011 68.996 5.647   1.00 35.44  ? 57  SER C N   1 
ATOM   2651 C CA  . SER C 1 58  ? 15.705 70.049 4.913   1.00 35.58  ? 57  SER C CA  1 
ATOM   2652 C C   . SER C 1 58  ? 17.139 69.675 4.545   1.00 35.54  ? 57  SER C C   1 
ATOM   2653 O O   . SER C 1 58  ? 17.796 68.962 5.251   1.00 35.57  ? 57  SER C O   1 
ATOM   2654 C CB  . SER C 1 58  ? 15.730 71.343 5.722   1.00 36.11  ? 57  SER C CB  1 
ATOM   2655 O OG  . SER C 1 58  ? 16.874 72.102 5.364   1.00 35.80  ? 57  SER C OG  1 
ATOM   2656 N N   . PRO C 1 59  ? 17.602 70.150 3.394   1.00 37.00  ? 58  PRO C N   1 
ATOM   2657 C CA  . PRO C 1 59  ? 18.958 69.894 2.909   1.00 37.37  ? 58  PRO C CA  1 
ATOM   2658 C C   . PRO C 1 59  ? 19.990 70.662 3.780   1.00 38.43  ? 58  PRO C C   1 
ATOM   2659 O O   . PRO C 1 59  ? 21.156 70.314 3.809   1.00 40.14  ? 58  PRO C O   1 
ATOM   2660 C CB  . PRO C 1 59  ? 18.928 70.429 1.478   1.00 36.13  ? 58  PRO C CB  1 
ATOM   2661 C CG  . PRO C 1 59  ? 17.523 70.207 1.071   1.00 36.30  ? 58  PRO C CG  1 
ATOM   2662 C CD  . PRO C 1 59  ? 16.743 70.631 2.301   1.00 37.48  ? 58  PRO C CD  1 
ATOM   2663 N N   . GLN C 1 60  ? 19.539 71.701 4.473   1.00 37.21  ? 59  GLN C N   1 
ATOM   2664 C CA  . GLN C 1 60  ? 20.435 72.486 5.338   1.00 37.26  ? 59  GLN C CA  1 
ATOM   2665 C C   . GLN C 1 60  ? 20.643 71.803 6.712   1.00 39.25  ? 59  GLN C C   1 
ATOM   2666 O O   . GLN C 1 60  ? 19.791 71.887 7.596   1.00 40.88  ? 59  GLN C O   1 
ATOM   2667 C CB  . GLN C 1 60  ? 19.855 73.886 5.498   1.00 37.00  ? 59  GLN C CB  1 
ATOM   2668 C CG  . GLN C 1 60  ? 19.668 74.539 4.147   1.00 39.45  ? 59  GLN C CG  1 
ATOM   2669 C CD  . GLN C 1 60  ? 19.091 75.926 4.218   1.00 40.75  ? 59  GLN C CD  1 
ATOM   2670 O OE1 . GLN C 1 60  ? 19.644 76.837 4.870   1.00 39.28  ? 59  GLN C OE1 1 
ATOM   2671 N NE2 . GLN C 1 60  ? 17.969 76.110 3.536   1.00 41.59  ? 59  GLN C NE2 1 
ATOM   2672 N N   . GLU C 1 61  ? 21.786 71.142 6.874   1.00 39.60  ? 60  GLU C N   1 
ATOM   2673 C CA  . GLU C 1 61  ? 22.079 70.399 8.113   1.00 42.01  ? 60  GLU C CA  1 
ATOM   2674 C C   . GLU C 1 61  ? 21.628 71.098 9.416   1.00 41.40  ? 60  GLU C C   1 
ATOM   2675 O O   . GLU C 1 61  ? 20.884 70.527 10.221  1.00 40.07  ? 60  GLU C O   1 
ATOM   2676 C CB  . GLU C 1 61  ? 23.571 70.084 8.224   1.00 43.93  ? 60  GLU C CB  1 
ATOM   2677 C CG  . GLU C 1 61  ? 23.876 69.100 9.342   1.00 48.86  ? 60  GLU C CG  1 
ATOM   2678 C CD  . GLU C 1 61  ? 25.335 69.102 9.765   1.00 52.56  ? 60  GLU C CD  1 
ATOM   2679 O OE1 . GLU C 1 61  ? 25.787 70.087 10.389  1.00 55.17  ? 60  GLU C OE1 1 
ATOM   2680 O OE2 . GLU C 1 61  ? 26.036 68.113 9.469   1.00 56.22  ? 60  GLU C OE2 1 
ATOM   2681 N N   . TRP C 1 62  ? 22.108 72.321 9.610   1.00 40.35  ? 61  TRP C N   1 
ATOM   2682 C CA  . TRP C 1 62  ? 21.786 73.099 10.809  1.00 39.63  ? 61  TRP C CA  1 
ATOM   2683 C C   . TRP C 1 62  ? 20.261 73.275 11.025  1.00 40.83  ? 61  TRP C C   1 
ATOM   2684 O O   . TRP C 1 62  ? 19.805 73.377 12.156  1.00 42.93  ? 61  TRP C O   1 
ATOM   2685 C CB  . TRP C 1 62  ? 22.460 74.469 10.731  1.00 38.42  ? 61  TRP C CB  1 
ATOM   2686 C CG  . TRP C 1 62  ? 22.298 75.290 11.955  1.00 37.12  ? 61  TRP C CG  1 
ATOM   2687 C CD1 . TRP C 1 62  ? 21.977 76.606 12.010  1.00 37.45  ? 61  TRP C CD1 1 
ATOM   2688 C CD2 . TRP C 1 62  ? 22.427 74.848 13.310  1.00 36.63  ? 61  TRP C CD2 1 
ATOM   2689 N NE1 . TRP C 1 62  ? 21.889 77.019 13.315  1.00 38.89  ? 61  TRP C NE1 1 
ATOM   2690 C CE2 . TRP C 1 62  ? 22.158 75.958 14.131  1.00 38.04  ? 61  TRP C CE2 1 
ATOM   2691 C CE3 . TRP C 1 62  ? 22.739 73.628 13.902  1.00 35.75  ? 61  TRP C CE3 1 
ATOM   2692 C CZ2 . TRP C 1 62  ? 22.193 75.875 15.516  1.00 37.87  ? 61  TRP C CZ2 1 
ATOM   2693 C CZ3 . TRP C 1 62  ? 22.774 73.544 15.270  1.00 35.92  ? 61  TRP C CZ3 1 
ATOM   2694 C CH2 . TRP C 1 62  ? 22.501 74.658 16.068  1.00 38.33  ? 61  TRP C CH2 1 
ATOM   2695 N N   . GLU C 1 63  ? 19.497 73.340 9.940   1.00 39.58  ? 62  GLU C N   1 
ATOM   2696 C CA  . GLU C 1 63  ? 18.041 73.479 10.069  1.00 38.00  ? 62  GLU C CA  1 
ATOM   2697 C C   . GLU C 1 63  ? 17.426 72.164 10.603  1.00 35.95  ? 62  GLU C C   1 
ATOM   2698 O O   . GLU C 1 63  ? 16.578 72.180 11.459  1.00 34.36  ? 62  GLU C O   1 
ATOM   2699 C CB  . GLU C 1 63  ? 17.442 73.865 8.713   1.00 38.72  ? 62  GLU C CB  1 
ATOM   2700 C CG  . GLU C 1 63  ? 15.946 73.775 8.611   1.00 40.75  ? 62  GLU C CG  1 
ATOM   2701 C CD  . GLU C 1 63  ? 15.385 74.631 7.476   1.00 42.96  ? 62  GLU C CD  1 
ATOM   2702 O OE1 . GLU C 1 63  ? 14.904 75.751 7.758   1.00 42.52  ? 62  GLU C OE1 1 
ATOM   2703 O OE2 . GLU C 1 63  ? 15.429 74.196 6.300   1.00 41.79  ? 62  GLU C OE2 1 
ATOM   2704 N N   . ALA C 1 64  ? 17.907 71.039 10.090  1.00 35.37  ? 63  ALA C N   1 
ATOM   2705 C CA  . ALA C 1 64  ? 17.412 69.722 10.518  1.00 35.54  ? 63  ALA C CA  1 
ATOM   2706 C C   . ALA C 1 64  ? 17.841 69.390 11.963  1.00 36.02  ? 63  ALA C C   1 
ATOM   2707 O O   . ALA C 1 64  ? 17.064 68.853 12.720  1.00 35.63  ? 63  ALA C O   1 
ATOM   2708 C CB  . ALA C 1 64  ? 17.904 68.619 9.558   1.00 33.04  ? 63  ALA C CB  1 
ATOM   2709 N N   . ILE C 1 65  ? 19.084 69.717 12.315  1.00 35.47  ? 64  ILE C N   1 
ATOM   2710 C CA  . ILE C 1 65  ? 19.581 69.452 13.664  1.00 31.97  ? 64  ILE C CA  1 
ATOM   2711 C C   . ILE C 1 65  ? 18.800 70.265 14.692  1.00 31.17  ? 64  ILE C C   1 
ATOM   2712 O O   . ILE C 1 65  ? 18.517 69.792 15.774  1.00 30.64  ? 64  ILE C O   1 
ATOM   2713 C CB  . ILE C 1 65  ? 21.080 69.814 13.821  1.00 33.78  ? 64  ILE C CB  1 
ATOM   2714 C CG1 . ILE C 1 65  ? 21.935 68.880 12.975  1.00 34.28  ? 64  ILE C CG1 1 
ATOM   2715 C CG2 . ILE C 1 65  ? 21.493 69.719 15.312  1.00 33.11  ? 64  ILE C CG2 1 
ATOM   2716 C CD1 . ILE C 1 65  ? 21.953 67.446 13.492  1.00 37.12  ? 64  ILE C CD1 1 
ATOM   2717 N N   . GLN C 1 66  ? 18.485 71.508 14.371  1.00 28.72  ? 65  GLN C N   1 
ATOM   2718 C CA  . GLN C 1 66  ? 17.704 72.244 15.334  1.00 28.17  ? 65  GLN C CA  1 
ATOM   2719 C C   . GLN C 1 66  ? 16.298 71.644 15.335  1.00 28.01  ? 65  GLN C C   1 
ATOM   2720 O O   . GLN C 1 66  ? 15.710 71.462 16.385  1.00 26.89  ? 65  GLN C O   1 
ATOM   2721 C CB  . GLN C 1 66  ? 17.651 73.739 15.019  1.00 27.16  ? 65  GLN C CB  1 
ATOM   2722 C CG  . GLN C 1 66  ? 18.977 74.491 15.159  1.00 29.32  ? 65  GLN C CG  1 
ATOM   2723 C CD  . GLN C 1 66  ? 18.865 75.903 14.619  1.00 33.05  ? 65  GLN C CD  1 
ATOM   2724 O OE1 . GLN C 1 66  ? 18.679 76.857 15.357  1.00 31.32  ? 65  GLN C OE1 1 
ATOM   2725 N NE2 . GLN C 1 66  ? 18.937 76.026 13.298  1.00 35.14  ? 65  GLN C NE2 1 
ATOM   2726 N N   . ALA C 1 67  ? 15.780 71.300 14.155  1.00 27.09  ? 66  ALA C N   1 
ATOM   2727 C CA  . ALA C 1 67  ? 14.434 70.691 14.106  1.00 26.72  ? 66  ALA C CA  1 
ATOM   2728 C C   . ALA C 1 67  ? 14.399 69.413 14.972  1.00 28.93  ? 66  ALA C C   1 
ATOM   2729 O O   . ALA C 1 67  ? 13.478 69.209 15.766  1.00 31.72  ? 66  ALA C O   1 
ATOM   2730 C CB  . ALA C 1 67  ? 14.046 70.375 12.678  1.00 24.85  ? 66  ALA C CB  1 
ATOM   2731 N N   . LEU C 1 68  ? 15.430 68.587 14.830  1.00 28.99  ? 67  LEU C N   1 
ATOM   2732 C CA  . LEU C 1 68  ? 15.550 67.355 15.613  1.00 29.36  ? 67  LEU C CA  1 
ATOM   2733 C C   . LEU C 1 68  ? 15.664 67.670 17.098  1.00 30.08  ? 67  LEU C C   1 
ATOM   2734 O O   . LEU C 1 68  ? 15.157 66.935 17.925  1.00 32.07  ? 67  LEU C O   1 
ATOM   2735 C CB  . LEU C 1 68  ? 16.779 66.556 15.183  1.00 29.16  ? 67  LEU C CB  1 
ATOM   2736 C CG  . LEU C 1 68  ? 16.572 65.766 13.900  1.00 31.65  ? 67  LEU C CG  1 
ATOM   2737 C CD1 . LEU C 1 68  ? 17.873 65.162 13.468  1.00 31.50  ? 67  LEU C CD1 1 
ATOM   2738 C CD2 . LEU C 1 68  ? 15.496 64.718 14.118  1.00 29.75  ? 67  LEU C CD2 1 
ATOM   2739 N N   . THR C 1 69  ? 16.341 68.765 17.418  1.00 29.39  ? 68  THR C N   1 
ATOM   2740 C CA  . THR C 1 69  ? 16.483 69.152 18.820  1.00 30.89  ? 68  THR C CA  1 
ATOM   2741 C C   . THR C 1 69  ? 15.142 69.629 19.391  1.00 33.05  ? 68  THR C C   1 
ATOM   2742 O O   . THR C 1 69  ? 14.910 69.555 20.584  1.00 34.77  ? 68  THR C O   1 
ATOM   2743 C CB  . THR C 1 69  ? 17.500 70.281 19.015  1.00 30.80  ? 68  THR C CB  1 
ATOM   2744 O OG1 . THR C 1 69  ? 18.789 69.841 18.599  1.00 30.59  ? 68  THR C OG1 1 
ATOM   2745 C CG2 . THR C 1 69  ? 17.571 70.667 20.473  1.00 33.70  ? 68  THR C CG2 1 
ATOM   2746 N N   . VAL C 1 70  ? 14.281 70.135 18.515  1.00 34.37  ? 69  VAL C N   1 
ATOM   2747 C CA  . VAL C 1 70  ? 12.967 70.599 18.941  1.00 34.09  ? 69  VAL C CA  1 
ATOM   2748 C C   . VAL C 1 70  ? 12.087 69.365 19.216  1.00 36.09  ? 69  VAL C C   1 
ATOM   2749 O O   . VAL C 1 70  ? 11.445 69.261 20.257  1.00 35.91  ? 69  VAL C O   1 
ATOM   2750 C CB  . VAL C 1 70  ? 12.334 71.504 17.863  1.00 33.58  ? 69  VAL C CB  1 
ATOM   2751 C CG1 . VAL C 1 70  ? 10.846 71.600 18.072  1.00 33.20  ? 69  VAL C CG1 1 
ATOM   2752 C CG2 . VAL C 1 70  ? 12.969 72.907 17.922  1.00 31.09  ? 69  VAL C CG2 1 
ATOM   2753 N N   . LEU C 1 71  ? 12.122 68.424 18.277  1.00 36.35  ? 70  LEU C N   1 
ATOM   2754 C CA  . LEU C 1 71  ? 11.376 67.162 18.406  1.00 35.39  ? 70  LEU C CA  1 
ATOM   2755 C C   . LEU C 1 71  ? 11.773 66.457 19.715  1.00 36.59  ? 70  LEU C C   1 
ATOM   2756 O O   . LEU C 1 71  ? 10.939 66.068 20.508  1.00 37.21  ? 70  LEU C O   1 
ATOM   2757 C CB  . LEU C 1 71  ? 11.700 66.233 17.225  1.00 33.19  ? 70  LEU C CB  1 
ATOM   2758 C CG  . LEU C 1 71  ? 11.223 64.781 17.308  1.00 31.63  ? 70  LEU C CG  1 
ATOM   2759 C CD1 . LEU C 1 71  ? 9.699  64.731 17.344  1.00 32.18  ? 70  LEU C CD1 1 
ATOM   2760 C CD2 . LEU C 1 71  ? 11.720 64.008 16.104  1.00 30.44  ? 70  LEU C CD2 1 
ATOM   2761 N N   . GLU C 1 72  ? 13.073 66.314 19.916  1.00 36.15  ? 71  GLU C N   1 
ATOM   2762 C CA  . GLU C 1 72  ? 13.560 65.673 21.107  1.00 36.15  ? 71  GLU C CA  1 
ATOM   2763 C C   . GLU C 1 72  ? 13.133 66.394 22.382  1.00 36.70  ? 71  GLU C C   1 
ATOM   2764 O O   . GLU C 1 72  ? 12.828 65.770 23.383  1.00 37.71  ? 71  GLU C O   1 
ATOM   2765 C CB  . GLU C 1 72  ? 15.067 65.610 21.079  1.00 36.38  ? 71  GLU C CB  1 
ATOM   2766 C CG  . GLU C 1 72  ? 15.642 65.329 22.429  1.00 36.37  ? 71  GLU C CG  1 
ATOM   2767 C CD  . GLU C 1 72  ? 17.104 65.188 22.362  1.00 38.29  ? 71  GLU C CD  1 
ATOM   2768 O OE1 . GLU C 1 72  ? 17.714 65.869 21.508  1.00 38.95  ? 71  GLU C OE1 1 
ATOM   2769 O OE2 . GLU C 1 72  ? 17.650 64.406 23.166  1.00 42.01  ? 71  GLU C OE2 1 
ATOM   2770 N N   . THR C 1 73  ? 13.137 67.717 22.331  1.00 36.65  ? 72  THR C N   1 
ATOM   2771 C CA  . THR C 1 73  ? 12.758 68.483 23.489  1.00 34.55  ? 72  THR C CA  1 
ATOM   2772 C C   . THR C 1 73  ? 11.254 68.354 23.804  1.00 35.96  ? 72  THR C C   1 
ATOM   2773 O O   . THR C 1 73  ? 10.883 68.117 24.939  1.00 36.31  ? 72  THR C O   1 
ATOM   2774 C CB  . THR C 1 73  ? 13.137 69.948 23.307  1.00 33.85  ? 72  THR C CB  1 
ATOM   2775 O OG1 . THR C 1 73  ? 14.564 70.070 23.267  1.00 32.10  ? 72  THR C OG1 1 
ATOM   2776 C CG2 . THR C 1 73  ? 12.599 70.766 24.440  1.00 33.57  ? 72  THR C CG2 1 
ATOM   2777 N N   . CYS C 1 74  ? 10.397 68.484 22.799  1.00 35.97  ? 73  CYS C N   1 
ATOM   2778 C CA  . CYS C 1 74  ? 8.955  68.371 23.064  1.00 37.52  ? 73  CYS C CA  1 
ATOM   2779 C C   . CYS C 1 74  ? 8.522  66.955 23.524  1.00 38.71  ? 73  CYS C C   1 
ATOM   2780 O O   . CYS C 1 74  ? 7.571  66.820 24.251  1.00 38.95  ? 73  CYS C O   1 
ATOM   2781 C CB  . CYS C 1 74  ? 8.133  68.771 21.835  1.00 37.35  ? 73  CYS C CB  1 
ATOM   2782 S SG  . CYS C 1 74  ? 8.388  70.469 21.208  1.00 40.87  ? 73  CYS C SG  1 
ATOM   2783 N N   . MET C 1 75  ? 9.216  65.915 23.089  1.00 40.07  ? 74  MET C N   1 
ATOM   2784 C CA  . MET C 1 75  ? 8.829  64.571 23.516  1.00 43.99  ? 74  MET C CA  1 
ATOM   2785 C C   . MET C 1 75  ? 9.019  64.415 25.016  1.00 47.73  ? 74  MET C C   1 
ATOM   2786 O O   . MET C 1 75  ? 8.329  63.637 25.653  1.00 49.51  ? 74  MET C O   1 
ATOM   2787 C CB  . MET C 1 75  ? 9.646  63.505 22.790  1.00 42.93  ? 74  MET C CB  1 
ATOM   2788 C CG  . MET C 1 75  ? 9.186  63.240 21.355  1.00 42.10  ? 74  MET C CG  1 
ATOM   2789 S SD  . MET C 1 75  ? 7.567  62.485 21.325  1.00 39.76  ? 74  MET C SD  1 
ATOM   2790 C CE  . MET C 1 75  ? 8.043  60.770 21.695  1.00 38.40  ? 74  MET C CE  1 
ATOM   2791 N N   . LYS C 1 76  ? 9.973  65.162 25.562  1.00 50.02  ? 75  LYS C N   1 
ATOM   2792 C CA  . LYS C 1 76  ? 10.233 65.123 27.001  1.00 51.96  ? 75  LYS C CA  1 
ATOM   2793 C C   . LYS C 1 76  ? 9.087  65.779 27.772  1.00 56.52  ? 75  LYS C C   1 
ATOM   2794 O O   . LYS C 1 76  ? 8.532  65.210 28.695  1.00 57.35  ? 75  LYS C O   1 
ATOM   2795 C CB  . LYS C 1 76  ? 11.512 65.885 27.341  1.00 46.56  ? 75  LYS C CB  1 
ATOM   2796 C CG  . LYS C 1 76  ? 12.776 65.258 26.863  1.00 42.00  ? 75  LYS C CG  1 
ATOM   2797 C CD  . LYS C 1 76  ? 13.967 66.002 27.419  1.00 38.05  ? 75  LYS C CD  1 
ATOM   2798 C CE  . LYS C 1 76  ? 15.249 65.404 26.908  1.00 37.49  ? 75  LYS C CE  1 
ATOM   2799 N NZ  . LYS C 1 76  ? 16.435 65.996 27.575  1.00 40.29  ? 75  LYS C NZ  1 
ATOM   2800 N N   . SER C 1 77  ? 8.764  66.997 27.355  1.00 62.84  ? 76  SER C N   1 
ATOM   2801 C CA  . SER C 1 77  ? 7.725  67.804 27.991  1.00 68.05  ? 76  SER C CA  1 
ATOM   2802 C C   . SER C 1 77  ? 6.389  67.729 27.279  1.00 71.22  ? 76  SER C C   1 
ATOM   2803 O O   . SER C 1 77  ? 5.865  68.730 26.802  1.00 71.16  ? 76  SER C O   1 
ATOM   2804 C CB  . SER C 1 77  ? 8.183  69.271 28.100  1.00 69.81  ? 76  SER C CB  1 
ATOM   2805 O OG  . SER C 1 77  ? 8.788  69.758 26.907  1.00 71.67  ? 76  SER C OG  1 
ATOM   2806 N N   . CYS C 1 78  ? 5.858  66.514 27.217  1.00 75.51  ? 77  CYS C N   1 
ATOM   2807 C CA  . CYS C 1 78  ? 4.558  66.269 26.587  1.00 79.38  ? 77  CYS C CA  1 
ATOM   2808 C C   . CYS C 1 78  ? 3.994  64.883 26.936  1.00 80.13  ? 77  CYS C C   1 
ATOM   2809 O O   . CYS C 1 78  ? 4.742  63.942 27.193  1.00 81.44  ? 77  CYS C O   1 
ATOM   2810 C CB  . CYS C 1 78  ? 4.652  66.453 25.065  1.00 80.54  ? 77  CYS C CB  1 
ATOM   2811 S SG  . CYS C 1 78  ? 4.588  68.205 24.529  1.00 83.89  ? 77  CYS C SG  1 
ATOM   2812 N N   . GLY C 1 79  ? 2.668  64.798 26.956  1.00 80.03  ? 78  GLY C N   1 
ATOM   2813 C CA  . GLY C 1 79  ? 2.005  63.557 27.286  1.00 79.61  ? 78  GLY C CA  1 
ATOM   2814 C C   . GLY C 1 79  ? 1.330  62.955 26.079  1.00 79.37  ? 78  GLY C C   1 
ATOM   2815 O O   . GLY C 1 79  ? 1.649  63.296 24.948  1.00 78.97  ? 78  GLY C O   1 
ATOM   2816 N N   . LYS C 1 80  ? 0.384  62.059 26.339  1.00 79.12  ? 79  LYS C N   1 
ATOM   2817 C CA  . LYS C 1 80  ? -0.358 61.365 25.279  1.00 78.94  ? 79  LYS C CA  1 
ATOM   2818 C C   . LYS C 1 80  ? -0.551 62.226 23.998  1.00 77.84  ? 79  LYS C C   1 
ATOM   2819 O O   . LYS C 1 80  ? -0.400 61.739 22.891  1.00 76.86  ? 79  LYS C O   1 
ATOM   2820 C CB  . LYS C 1 80  ? -1.715 60.887 25.837  1.00 79.58  ? 79  LYS C CB  1 
ATOM   2821 C CG  . LYS C 1 80  ? -2.617 60.132 24.851  1.00 80.31  ? 79  LYS C CG  1 
ATOM   2822 C CD  . LYS C 1 80  ? -3.765 59.412 25.566  1.00 79.76  ? 79  LYS C CD  1 
ATOM   2823 C CE  . LYS C 1 80  ? -4.870 58.992 24.606  1.00 79.27  ? 79  LYS C CE  1 
ATOM   2824 N NZ  . LYS C 1 80  ? -5.646 60.156 24.075  1.00 78.92  ? 79  LYS C NZ  1 
ATOM   2825 N N   . ARG C 1 81  ? -0.853 63.505 24.174  1.00 77.86  ? 80  ARG C N   1 
ATOM   2826 C CA  . ARG C 1 81  ? -1.076 64.406 23.030  1.00 77.55  ? 80  ARG C CA  1 
ATOM   2827 C C   . ARG C 1 81  ? -0.009 64.317 21.910  1.00 75.22  ? 80  ARG C C   1 
ATOM   2828 O O   . ARG C 1 81  ? -0.225 63.690 20.881  1.00 75.30  ? 80  ARG C O   1 
ATOM   2829 C CB  . ARG C 1 81  ? -1.178 65.850 23.523  1.00 81.72  ? 80  ARG C CB  1 
ATOM   2830 C CG  . ARG C 1 81  ? -2.606 66.281 23.825  1.00 88.32  ? 80  ARG C CG  1 
ATOM   2831 C CD  . ARG C 1 81  ? -3.409 66.524 22.530  1.00 92.62  ? 80  ARG C CD  1 
ATOM   2832 N NE  . ARG C 1 81  ? -3.198 65.479 21.525  1.00 96.09  ? 80  ARG C NE  1 
ATOM   2833 C CZ  . ARG C 1 81  ? -3.785 65.441 20.328  1.00 98.78  ? 80  ARG C CZ  1 
ATOM   2834 N NH1 . ARG C 1 81  ? -4.639 66.394 19.959  1.00 99.38  ? 80  ARG C NH1 1 
ATOM   2835 N NH2 . ARG C 1 81  ? -3.509 64.442 19.495  1.00 100.03 ? 80  ARG C NH2 1 
ATOM   2836 N N   . PHE C 1 82  ? 1.121  64.975 22.130  1.00 70.72  ? 81  PHE C N   1 
ATOM   2837 C CA  . PHE C 1 82  ? 2.201  64.982 21.155  1.00 65.96  ? 81  PHE C CA  1 
ATOM   2838 C C   . PHE C 1 82  ? 2.839  63.610 20.977  1.00 64.42  ? 81  PHE C C   1 
ATOM   2839 O O   . PHE C 1 82  ? 3.307  63.285 19.909  1.00 64.29  ? 81  PHE C O   1 
ATOM   2840 C CB  . PHE C 1 82  ? 3.280  65.957 21.581  1.00 63.08  ? 81  PHE C CB  1 
ATOM   2841 C CG  . PHE C 1 82  ? 4.368  66.115 20.574  1.00 59.74  ? 81  PHE C CG  1 
ATOM   2842 C CD1 . PHE C 1 82  ? 4.101  66.672 19.338  1.00 58.42  ? 81  PHE C CD1 1 
ATOM   2843 C CD2 . PHE C 1 82  ? 5.666  65.745 20.870  1.00 58.05  ? 81  PHE C CD2 1 
ATOM   2844 C CE1 . PHE C 1 82  ? 5.110  66.846 18.406  1.00 56.90  ? 81  PHE C CE1 1 
ATOM   2845 C CE2 . PHE C 1 82  ? 6.677  65.920 19.936  1.00 57.58  ? 81  PHE C CE2 1 
ATOM   2846 C CZ  . PHE C 1 82  ? 6.396  66.479 18.709  1.00 55.34  ? 81  PHE C CZ  1 
ATOM   2847 N N   . HIS C 1 83  ? 2.875  62.826 22.043  1.00 62.81  ? 82  HIS C N   1 
ATOM   2848 C CA  . HIS C 1 83  ? 3.461  61.507 21.947  1.00 61.74  ? 82  HIS C CA  1 
ATOM   2849 C C   . HIS C 1 83  ? 2.748  60.617 20.925  1.00 62.09  ? 82  HIS C C   1 
ATOM   2850 O O   . HIS C 1 83  ? 3.387  59.844 20.234  1.00 62.92  ? 82  HIS C O   1 
ATOM   2851 C CB  . HIS C 1 83  ? 3.453  60.820 23.299  1.00 60.41  ? 82  HIS C CB  1 
ATOM   2852 C CG  . HIS C 1 83  ? 4.496  61.333 24.235  1.00 59.77  ? 82  HIS C CG  1 
ATOM   2853 N ND1 . HIS C 1 83  ? 4.709  60.781 25.478  1.00 61.33  ? 82  HIS C ND1 1 
ATOM   2854 C CD2 . HIS C 1 83  ? 5.393  62.335 24.110  1.00 60.59  ? 82  HIS C CD2 1 
ATOM   2855 C CE1 . HIS C 1 83  ? 5.694  61.421 26.079  1.00 60.78  ? 82  HIS C CE1 1 
ATOM   2856 N NE2 . HIS C 1 83  ? 6.128  62.370 25.271  1.00 60.70  ? 82  HIS C NE2 1 
ATOM   2857 N N   . ASP C 1 84  ? 1.429  60.732 20.830  1.00 61.01  ? 83  ASP C N   1 
ATOM   2858 C CA  . ASP C 1 84  ? 0.696  59.900 19.872  1.00 59.95  ? 83  ASP C CA  1 
ATOM   2859 C C   . ASP C 1 84  ? 0.927  60.339 18.431  1.00 58.84  ? 83  ASP C C   1 
ATOM   2860 O O   . ASP C 1 84  ? 1.069  59.520 17.536  1.00 59.82  ? 83  ASP C O   1 
ATOM   2861 C CB  . ASP C 1 84  ? -0.809 59.916 20.160  1.00 61.69  ? 83  ASP C CB  1 
ATOM   2862 C CG  . ASP C 1 84  ? -1.169 59.240 21.476  1.00 63.64  ? 83  ASP C CG  1 
ATOM   2863 O OD1 . ASP C 1 84  ? -0.369 58.393 21.956  1.00 63.79  ? 83  ASP C OD1 1 
ATOM   2864 O OD2 . ASP C 1 84  ? -2.263 59.553 22.014  1.00 63.07  ? 83  ASP C OD2 1 
ATOM   2865 N N   . GLU C 1 85  ? 0.945  61.649 18.231  1.00 57.49  ? 84  GLU C N   1 
ATOM   2866 C CA  . GLU C 1 85  ? 1.155  62.225 16.908  1.00 55.82  ? 84  GLU C CA  1 
ATOM   2867 C C   . GLU C 1 85  ? 2.557  61.829 16.351  1.00 53.83  ? 84  GLU C C   1 
ATOM   2868 O O   . GLU C 1 85  ? 2.735  61.649 15.153  1.00 54.12  ? 84  GLU C O   1 
ATOM   2869 C CB  . GLU C 1 85  ? 1.003  63.749 17.006  1.00 57.67  ? 84  GLU C CB  1 
ATOM   2870 C CG  . GLU C 1 85  ? 0.344  64.410 15.790  1.00 60.71  ? 84  GLU C CG  1 
ATOM   2871 C CD  . GLU C 1 85  ? -1.065 63.902 15.521  1.00 61.40  ? 84  GLU C CD  1 
ATOM   2872 O OE1 . GLU C 1 85  ? -2.016 64.361 16.190  1.00 60.31  ? 84  GLU C OE1 1 
ATOM   2873 O OE2 . GLU C 1 85  ? -1.210 63.028 14.639  1.00 62.44  ? 84  GLU C OE2 1 
ATOM   2874 N N   . VAL C 1 86  ? 3.525  61.699 17.247  1.00 49.65  ? 85  VAL C N   1 
ATOM   2875 C CA  . VAL C 1 86  ? 4.860  61.305 16.859  1.00 48.27  ? 85  VAL C CA  1 
ATOM   2876 C C   . VAL C 1 86  ? 4.927  59.772 16.791  1.00 51.22  ? 85  VAL C C   1 
ATOM   2877 O O   . VAL C 1 86  ? 5.727  59.208 16.061  1.00 52.13  ? 85  VAL C O   1 
ATOM   2878 C CB  . VAL C 1 86  ? 5.920  61.794 17.882  1.00 46.56  ? 85  VAL C CB  1 
ATOM   2879 C CG1 . VAL C 1 86  ? 7.269  61.263 17.524  1.00 44.54  ? 85  VAL C CG1 1 
ATOM   2880 C CG2 . VAL C 1 86  ? 5.964  63.307 17.932  1.00 43.26  ? 85  VAL C CG2 1 
ATOM   2881 N N   . GLY C 1 87  ? 4.064  59.121 17.569  1.00 52.65  ? 86  GLY C N   1 
ATOM   2882 C CA  . GLY C 1 87  ? 4.024  57.674 17.596  1.00 52.78  ? 86  GLY C CA  1 
ATOM   2883 C C   . GLY C 1 87  ? 3.319  57.087 16.388  1.00 54.02  ? 86  GLY C C   1 
ATOM   2884 O O   . GLY C 1 87  ? 3.213  55.879 16.274  1.00 55.27  ? 86  GLY C O   1 
ATOM   2885 N N   . LYS C 1 88  ? 2.822  57.928 15.487  1.00 53.46  ? 87  LYS C N   1 
ATOM   2886 C CA  . LYS C 1 88  ? 2.138  57.395 14.293  1.00 54.48  ? 87  LYS C CA  1 
ATOM   2887 C C   . LYS C 1 88  ? 3.105  57.239 13.113  1.00 53.66  ? 87  LYS C C   1 
ATOM   2888 O O   . LYS C 1 88  ? 4.100  57.942 13.037  1.00 53.83  ? 87  LYS C O   1 
ATOM   2889 C CB  . LYS C 1 88  ? 0.969  58.295 13.878  1.00 56.84  ? 87  LYS C CB  1 
ATOM   2890 C CG  . LYS C 1 88  ? -0.217 58.241 14.831  1.00 61.49  ? 87  LYS C CG  1 
ATOM   2891 C CD  . LYS C 1 88  ? -1.355 59.141 14.372  1.00 64.07  ? 87  LYS C CD  1 
ATOM   2892 C CE  . LYS C 1 88  ? -2.555 59.078 15.331  1.00 66.63  ? 87  LYS C CE  1 
ATOM   2893 N NZ  . LYS C 1 88  ? -3.232 57.743 15.361  1.00 67.60  ? 87  LYS C NZ  1 
ATOM   2894 N N   . PHE C 1 89  ? 2.814  56.303 12.213  1.00 52.06  ? 88  PHE C N   1 
ATOM   2895 C CA  . PHE C 1 89  ? 3.686  56.104 11.050  1.00 50.16  ? 88  PHE C CA  1 
ATOM   2896 C C   . PHE C 1 89  ? 3.636  57.324 10.116  1.00 48.61  ? 88  PHE C C   1 
ATOM   2897 O O   . PHE C 1 89  ? 4.545  57.563 9.358   1.00 48.67  ? 88  PHE C O   1 
ATOM   2898 C CB  . PHE C 1 89  ? 3.305  54.831 10.286  1.00 50.71  ? 88  PHE C CB  1 
ATOM   2899 C CG  . PHE C 1 89  ? 3.607  53.562 11.031  1.00 49.84  ? 88  PHE C CG  1 
ATOM   2900 C CD1 . PHE C 1 89  ? 4.906  53.267 11.436  1.00 49.13  ? 88  PHE C CD1 1 
ATOM   2901 C CD2 . PHE C 1 89  ? 2.586  52.662 11.341  1.00 49.68  ? 88  PHE C CD2 1 
ATOM   2902 C CE1 . PHE C 1 89  ? 5.186  52.093 12.144  1.00 49.32  ? 88  PHE C CE1 1 
ATOM   2903 C CE2 . PHE C 1 89  ? 2.853  51.481 12.050  1.00 48.47  ? 88  PHE C CE2 1 
ATOM   2904 C CZ  . PHE C 1 89  ? 4.151  51.195 12.453  1.00 48.19  ? 88  PHE C CZ  1 
ATOM   2905 N N   . ARG C 1 90  ? 2.548  58.075 10.196  1.00 46.52  ? 89  ARG C N   1 
ATOM   2906 C CA  . ARG C 1 90  ? 2.421  59.290 9.408   1.00 44.14  ? 89  ARG C CA  1 
ATOM   2907 C C   . ARG C 1 90  ? 3.694  60.183 9.601   1.00 41.02  ? 89  ARG C C   1 
ATOM   2908 O O   . ARG C 1 90  ? 4.179  60.826 8.692   1.00 38.42  ? 89  ARG C O   1 
ATOM   2909 C CB  . ARG C 1 90  ? 1.171  60.053 9.853   1.00 48.16  ? 89  ARG C CB  1 
ATOM   2910 C CG  . ARG C 1 90  ? 0.857  61.300 9.045   1.00 55.78  ? 89  ARG C CG  1 
ATOM   2911 C CD  . ARG C 1 90  ? -0.133 61.018 7.922   1.00 63.11  ? 89  ARG C CD  1 
ATOM   2912 N NE  . ARG C 1 90  ? -1.456 60.633 8.438   1.00 68.57  ? 89  ARG C NE  1 
ATOM   2913 C CZ  . ARG C 1 90  ? -2.535 60.486 7.673   1.00 71.14  ? 89  ARG C CZ  1 
ATOM   2914 N NH1 . ARG C 1 90  ? -2.446 60.691 6.360   1.00 71.90  ? 89  ARG C NH1 1 
ATOM   2915 N NH2 . ARG C 1 90  ? -3.695 60.139 8.213   1.00 70.88  ? 89  ARG C NH2 1 
ATOM   2916 N N   . PHE C 1 91  ? 4.218  60.193 10.812  1.00 37.16  ? 90  PHE C N   1 
ATOM   2917 C CA  . PHE C 1 91  ? 5.411  60.960 11.082  1.00 35.23  ? 90  PHE C CA  1 
ATOM   2918 C C   . PHE C 1 91  ? 6.665  60.055 10.959  1.00 36.84  ? 90  PHE C C   1 
ATOM   2919 O O   . PHE C 1 91  ? 7.543  60.320 10.158  1.00 37.77  ? 90  PHE C O   1 
ATOM   2920 C CB  . PHE C 1 91  ? 5.312  61.573 12.479  1.00 30.57  ? 90  PHE C CB  1 
ATOM   2921 C CG  . PHE C 1 91  ? 6.519  62.348 12.895  1.00 27.29  ? 90  PHE C CG  1 
ATOM   2922 C CD1 . PHE C 1 91  ? 6.869  63.540 12.259  1.00 27.26  ? 90  PHE C CD1 1 
ATOM   2923 C CD2 . PHE C 1 91  ? 7.309  61.890 13.940  1.00 26.96  ? 90  PHE C CD2 1 
ATOM   2924 C CE1 . PHE C 1 91  ? 7.998  64.257 12.669  1.00 24.85  ? 90  PHE C CE1 1 
ATOM   2925 C CE2 . PHE C 1 91  ? 8.433  62.595 14.356  1.00 25.60  ? 90  PHE C CE2 1 
ATOM   2926 C CZ  . PHE C 1 91  ? 8.779  63.777 13.723  1.00 25.25  ? 90  PHE C CZ  1 
ATOM   2927 N N   . LEU C 1 92  ? 6.696  58.977 11.736  1.00 36.43  ? 91  LEU C N   1 
ATOM   2928 C CA  . LEU C 1 92  ? 7.821  58.033 11.732  1.00 37.21  ? 91  LEU C CA  1 
ATOM   2929 C C   . LEU C 1 92  ? 8.368  57.728 10.323  1.00 36.82  ? 91  LEU C C   1 
ATOM   2930 O O   . LEU C 1 92  ? 9.556  57.616 10.139  1.00 35.49  ? 91  LEU C O   1 
ATOM   2931 C CB  . LEU C 1 92  ? 7.409  56.732 12.421  1.00 37.89  ? 91  LEU C CB  1 
ATOM   2932 C CG  . LEU C 1 92  ? 7.134  56.935 13.909  1.00 40.52  ? 91  LEU C CG  1 
ATOM   2933 C CD1 . LEU C 1 92  ? 6.581  55.679 14.510  1.00 38.75  ? 91  LEU C CD1 1 
ATOM   2934 C CD2 . LEU C 1 92  ? 8.433  57.356 14.615  1.00 41.53  ? 91  LEU C CD2 1 
ATOM   2935 N N   . ASN C 1 93  ? 7.486  57.594 9.344   1.00 36.68  ? 92  ASN C N   1 
ATOM   2936 C CA  . ASN C 1 93  ? 7.949  57.336 7.999   1.00 37.20  ? 92  ASN C CA  1 
ATOM   2937 C C   . ASN C 1 93  ? 8.843  58.476 7.517   1.00 39.77  ? 92  ASN C C   1 
ATOM   2938 O O   . ASN C 1 93  ? 9.909  58.240 6.937   1.00 41.85  ? 92  ASN C O   1 
ATOM   2939 C CB  . ASN C 1 93  ? 6.775  57.179 7.035   1.00 37.42  ? 92  ASN C CB  1 
ATOM   2940 C CG  . ASN C 1 93  ? 6.119  55.804 7.119   1.00 38.19  ? 92  ASN C CG  1 
ATOM   2941 O OD1 . ASN C 1 93  ? 6.758  54.825 7.506   1.00 38.63  ? 92  ASN C OD1 1 
ATOM   2942 N ND2 . ASN C 1 93  ? 4.842  55.724 6.727   1.00 37.08  ? 92  ASN C ND2 1 
ATOM   2943 N N   . GLU C 1 94  ? 8.401  59.712 7.744   1.00 39.35  ? 93  GLU C N   1 
ATOM   2944 C CA  . GLU C 1 94  ? 9.216  60.869 7.330   1.00 38.91  ? 93  GLU C CA  1 
ATOM   2945 C C   . GLU C 1 94  ? 10.629 60.766 7.931   1.00 39.41  ? 93  GLU C C   1 
ATOM   2946 O O   . GLU C 1 94  ? 11.593 61.137 7.287   1.00 40.52  ? 93  GLU C O   1 
ATOM   2947 C CB  . GLU C 1 94  ? 8.576  62.188 7.767   1.00 38.39  ? 93  GLU C CB  1 
ATOM   2948 C CG  . GLU C 1 94  ? 7.138  62.381 7.338   1.00 37.47  ? 93  GLU C CG  1 
ATOM   2949 C CD  . GLU C 1 94  ? 6.884  62.000 5.889   1.00 38.72  ? 93  GLU C CD  1 
ATOM   2950 O OE1 . GLU C 1 94  ? 7.758  62.244 5.037   1.00 37.90  ? 93  GLU C OE1 1 
ATOM   2951 O OE2 . GLU C 1 94  ? 5.793  61.464 5.597   1.00 40.64  ? 93  GLU C OE2 1 
ATOM   2952 N N   . LEU C 1 95  ? 10.728 60.280 9.173   1.00 39.97  ? 94  LEU C N   1 
ATOM   2953 C CA  . LEU C 1 95  ? 12.046 60.095 9.816   1.00 39.94  ? 94  LEU C CA  1 
ATOM   2954 C C   . LEU C 1 95  ? 12.847 58.980 9.102   1.00 41.60  ? 94  LEU C C   1 
ATOM   2955 O O   . LEU C 1 95  ? 14.038 59.141 8.858   1.00 43.14  ? 94  LEU C O   1 
ATOM   2956 C CB  . LEU C 1 95  ? 11.893 59.749 11.296  1.00 37.44  ? 94  LEU C CB  1 
ATOM   2957 C CG  . LEU C 1 95  ? 11.499 60.900 12.224  1.00 39.76  ? 94  LEU C CG  1 
ATOM   2958 C CD1 . LEU C 1 95  ? 11.420 60.410 13.678  1.00 36.71  ? 94  LEU C CD1 1 
ATOM   2959 C CD2 . LEU C 1 95  ? 12.529 62.012 12.094  1.00 40.02  ? 94  LEU C CD2 1 
ATOM   2960 N N   . ILE C 1 96  ? 12.169 57.869 8.777   1.00 40.93  ? 95  ILE C N   1 
ATOM   2961 C CA  . ILE C 1 96  ? 12.792 56.748 8.070   1.00 39.92  ? 95  ILE C CA  1 
ATOM   2962 C C   . ILE C 1 96  ? 13.323 57.195 6.706   1.00 42.49  ? 95  ILE C C   1 
ATOM   2963 O O   . ILE C 1 96  ? 14.416 56.817 6.315   1.00 43.81  ? 95  ILE C O   1 
ATOM   2964 C CB  . ILE C 1 96  ? 11.807 55.596 7.842   1.00 38.50  ? 95  ILE C CB  1 
ATOM   2965 C CG1 . ILE C 1 96  ? 11.601 54.813 9.121   1.00 37.07  ? 95  ILE C CG1 1 
ATOM   2966 C CG2 . ILE C 1 96  ? 12.349 54.638 6.826   1.00 39.07  ? 95  ILE C CG2 1 
ATOM   2967 C CD1 . ILE C 1 96  ? 10.393 53.945 9.043   1.00 35.83  ? 95  ILE C CD1 1 
ATOM   2968 N N   . LYS C 1 97  ? 12.551 58.006 5.989   1.00 42.91  ? 96  LYS C N   1 
ATOM   2969 C CA  . LYS C 1 97  ? 13.033 58.462 4.686   1.00 43.26  ? 96  LYS C CA  1 
ATOM   2970 C C   . LYS C 1 97  ? 14.371 59.214 4.806   1.00 43.77  ? 96  LYS C C   1 
ATOM   2971 O O   . LYS C 1 97  ? 15.236 59.094 3.946   1.00 44.59  ? 96  LYS C O   1 
ATOM   2972 C CB  . LYS C 1 97  ? 12.032 59.383 4.013   1.00 43.15  ? 96  LYS C CB  1 
ATOM   2973 C CG  . LYS C 1 97  ? 10.711 58.762 3.682   1.00 45.61  ? 96  LYS C CG  1 
ATOM   2974 C CD  . LYS C 1 97  ? 9.858  59.785 2.949   1.00 44.40  ? 96  LYS C CD  1 
ATOM   2975 C CE  . LYS C 1 97  ? 8.407  59.393 2.970   1.00 46.91  ? 96  LYS C CE  1 
ATOM   2976 N NZ  . LYS C 1 97  ? 7.593  60.393 2.232   1.00 48.59  ? 96  LYS C NZ  1 
ATOM   2977 N N   . VAL C 1 98  ? 14.528 59.983 5.876   1.00 42.00  ? 97  VAL C N   1 
ATOM   2978 C CA  . VAL C 1 98  ? 15.767 60.753 6.065   1.00 42.77  ? 97  VAL C CA  1 
ATOM   2979 C C   . VAL C 1 98  ? 17.016 59.854 6.320   1.00 43.71  ? 97  VAL C C   1 
ATOM   2980 O O   . VAL C 1 98  ? 18.087 60.140 5.802   1.00 43.90  ? 97  VAL C O   1 
ATOM   2981 C CB  . VAL C 1 98  ? 15.605 61.782 7.226   1.00 40.20  ? 97  VAL C CB  1 
ATOM   2982 C CG1 . VAL C 1 98  ? 16.888 62.557 7.463   1.00 37.62  ? 97  VAL C CG1 1 
ATOM   2983 C CG2 . VAL C 1 98  ? 14.498 62.724 6.892   1.00 40.74  ? 97  VAL C CG2 1 
ATOM   2984 N N   . VAL C 1 99  ? 16.856 58.783 7.099   1.00 44.12  ? 98  VAL C N   1 
ATOM   2985 C CA  . VAL C 1 99  ? 17.994 57.886 7.407   1.00 46.44  ? 98  VAL C CA  1 
ATOM   2986 C C   . VAL C 1 99  ? 18.147 56.694 6.431   1.00 48.82  ? 98  VAL C C   1 
ATOM   2987 O O   . VAL C 1 99  ? 19.256 56.235 6.202   1.00 49.27  ? 98  VAL C O   1 
ATOM   2988 C CB  . VAL C 1 99  ? 17.931 57.313 8.855   1.00 43.58  ? 98  VAL C CB  1 
ATOM   2989 C CG1 . VAL C 1 99  ? 18.012 58.437 9.853   1.00 45.04  ? 98  VAL C CG1 1 
ATOM   2990 C CG2 . VAL C 1 99  ? 16.664 56.509 9.067   1.00 42.83  ? 98  VAL C CG2 1 
ATOM   2991 N N   . SER C 1 100 ? 17.037 56.218 5.870   1.00 51.18  ? 99  SER C N   1 
ATOM   2992 C CA  . SER C 1 100 ? 17.080 55.077 4.947   1.00 54.84  ? 99  SER C CA  1 
ATOM   2993 C C   . SER C 1 100 ? 17.750 55.437 3.604   1.00 58.57  ? 99  SER C C   1 
ATOM   2994 O O   . SER C 1 100 ? 17.295 56.317 2.890   1.00 59.32  ? 99  SER C O   1 
ATOM   2995 C CB  . SER C 1 100 ? 15.671 54.542 4.702   1.00 54.79  ? 99  SER C CB  1 
ATOM   2996 O OG  . SER C 1 100 ? 15.694 53.454 3.797   1.00 58.28  ? 99  SER C OG  1 
ATOM   2997 N N   . PRO C 1 101 ? 18.860 54.757 3.270   1.00 61.40  ? 100 PRO C N   1 
ATOM   2998 C CA  . PRO C 1 101 ? 19.572 55.022 2.018   1.00 62.52  ? 100 PRO C CA  1 
ATOM   2999 C C   . PRO C 1 101 ? 18.614 54.847 0.826   1.00 63.34  ? 100 PRO C C   1 
ATOM   3000 O O   . PRO C 1 101 ? 18.730 55.533 -0.185  1.00 64.42  ? 100 PRO C O   1 
ATOM   3001 C CB  . PRO C 1 101 ? 20.684 53.976 2.030   1.00 63.22  ? 100 PRO C CB  1 
ATOM   3002 C CG  . PRO C 1 101 ? 20.962 53.811 3.495   1.00 63.42  ? 100 PRO C CG  1 
ATOM   3003 C CD  . PRO C 1 101 ? 19.564 53.729 4.056   1.00 62.70  ? 100 PRO C CD  1 
ATOM   3004 N N   . LYS C 1 102 ? 17.667 53.925 0.978   1.00 63.23  ? 101 LYS C N   1 
ATOM   3005 C CA  . LYS C 1 102 ? 16.681 53.664 -0.070  1.00 62.53  ? 101 LYS C CA  1 
ATOM   3006 C C   . LYS C 1 102 ? 15.958 54.955 -0.492  1.00 60.67  ? 101 LYS C C   1 
ATOM   3007 O O   . LYS C 1 102 ? 15.437 55.039 -1.580  1.00 60.78  ? 101 LYS C O   1 
ATOM   3008 C CB  . LYS C 1 102 ? 15.659 52.627 0.416   1.00 64.40  ? 101 LYS C CB  1 
ATOM   3009 C CG  . LYS C 1 102 ? 14.617 52.252 -0.628  1.00 67.77  ? 101 LYS C CG  1 
ATOM   3010 C CD  . LYS C 1 102 ? 13.863 50.964 -0.266  1.00 70.39  ? 101 LYS C CD  1 
ATOM   3011 C CE  . LYS C 1 102 ? 12.887 50.556 -1.382  1.00 71.59  ? 101 LYS C CE  1 
ATOM   3012 N NZ  . LYS C 1 102 ? 12.387 49.158 -1.242  1.00 72.38  ? 101 LYS C NZ  1 
ATOM   3013 N N   . TYR C 1 103 ? 15.959 55.950 0.392   1.00 60.24  ? 102 TYR C N   1 
ATOM   3014 C CA  . TYR C 1 103 ? 15.291 57.238 0.130   1.00 58.69  ? 102 TYR C CA  1 
ATOM   3015 C C   . TYR C 1 103 ? 16.252 58.421 0.180   1.00 57.39  ? 102 TYR C C   1 
ATOM   3016 O O   . TYR C 1 103 ? 17.126 58.528 -0.653  1.00 58.04  ? 102 TYR C O   1 
ATOM   3017 C CB  . TYR C 1 103 ? 14.159 57.453 1.133   1.00 58.39  ? 102 TYR C CB  1 
ATOM   3018 C CG  . TYR C 1 103 ? 13.150 56.331 1.124   1.00 58.28  ? 102 TYR C CG  1 
ATOM   3019 C CD1 . TYR C 1 103 ? 13.400 55.138 1.798   1.00 58.27  ? 102 TYR C CD1 1 
ATOM   3020 C CD2 . TYR C 1 103 ? 11.972 56.438 0.397   1.00 57.31  ? 102 TYR C CD2 1 
ATOM   3021 C CE1 . TYR C 1 103 ? 12.503 54.082 1.742   1.00 57.59  ? 102 TYR C CE1 1 
ATOM   3022 C CE2 . TYR C 1 103 ? 11.074 55.386 0.337   1.00 57.70  ? 102 TYR C CE2 1 
ATOM   3023 C CZ  . TYR C 1 103 ? 11.344 54.216 1.008   1.00 56.78  ? 102 TYR C CZ  1 
ATOM   3024 O OH  . TYR C 1 103 ? 10.453 53.172 0.934   1.00 57.96  ? 102 TYR C OH  1 
ATOM   3025 N N   . LEU C 1 104 ? 16.079 59.304 1.155   1.00 56.50  ? 103 LEU C N   1 
ATOM   3026 C CA  . LEU C 1 104 ? 16.969 60.471 1.266   1.00 56.71  ? 103 LEU C CA  1 
ATOM   3027 C C   . LEU C 1 104 ? 18.285 60.129 1.969   1.00 58.09  ? 103 LEU C C   1 
ATOM   3028 O O   . LEU C 1 104 ? 19.213 60.932 1.982   1.00 57.55  ? 103 LEU C O   1 
ATOM   3029 C CB  . LEU C 1 104 ? 16.292 61.598 2.030   1.00 54.21  ? 103 LEU C CB  1 
ATOM   3030 C CG  . LEU C 1 104 ? 14.851 61.903 1.648   1.00 53.11  ? 103 LEU C CG  1 
ATOM   3031 C CD1 . LEU C 1 104 ? 14.414 63.120 2.450   1.00 51.89  ? 103 LEU C CD1 1 
ATOM   3032 C CD2 . LEU C 1 104 ? 14.719 62.140 0.153   1.00 51.70  ? 103 LEU C CD2 1 
ATOM   3033 N N   . GLY C 1 105 ? 18.338 58.926 2.538   1.00 60.07  ? 104 GLY C N   1 
ATOM   3034 C CA  . GLY C 1 105 ? 19.520 58.474 3.254   1.00 62.95  ? 104 GLY C CA  1 
ATOM   3035 C C   . GLY C 1 105 ? 20.851 58.739 2.571   1.00 64.87  ? 104 GLY C C   1 
ATOM   3036 O O   . GLY C 1 105 ? 21.780 59.253 3.185   1.00 64.93  ? 104 GLY C O   1 
ATOM   3037 N N   . SER C 1 106 ? 20.930 58.383 1.292   1.00 66.15  ? 105 SER C N   1 
ATOM   3038 C CA  . SER C 1 106 ? 22.149 58.555 0.483   1.00 67.26  ? 105 SER C CA  1 
ATOM   3039 C C   . SER C 1 106 ? 22.739 59.981 0.510   1.00 67.52  ? 105 SER C C   1 
ATOM   3040 O O   . SER C 1 106 ? 23.937 60.142 0.466   1.00 67.21  ? 105 SER C O   1 
ATOM   3041 C CB  . SER C 1 106 ? 21.851 58.191 -0.966  1.00 68.33  ? 105 SER C CB  1 
ATOM   3042 O OG  . SER C 1 106 ? 20.885 59.083 -1.505  1.00 71.99  ? 105 SER C OG  1 
ATOM   3043 N N   . ARG C 1 107 ? 21.883 60.997 0.572   1.00 69.29  ? 106 ARG C N   1 
ATOM   3044 C CA  . ARG C 1 107 ? 22.353 62.393 0.548   1.00 69.56  ? 106 ARG C CA  1 
ATOM   3045 C C   . ARG C 1 107 ? 22.151 63.147 1.887   1.00 68.28  ? 106 ARG C C   1 
ATOM   3046 O O   . ARG C 1 107 ? 22.270 64.366 1.951   1.00 67.66  ? 106 ARG C O   1 
ATOM   3047 C CB  . ARG C 1 107 ? 21.655 63.153 -0.596  1.00 73.04  ? 106 ARG C CB  1 
ATOM   3048 C CG  . ARG C 1 107 ? 21.596 62.398 -1.946  1.00 77.69  ? 106 ARG C CG  1 
ATOM   3049 C CD  . ARG C 1 107 ? 21.423 63.358 -3.136  1.00 82.29  ? 106 ARG C CD  1 
ATOM   3050 N NE  . ARG C 1 107 ? 20.317 64.304 -2.948  1.00 86.95  ? 106 ARG C NE  1 
ATOM   3051 C CZ  . ARG C 1 107 ? 19.031 64.022 -3.146  1.00 88.99  ? 106 ARG C CZ  1 
ATOM   3052 N NH1 . ARG C 1 107 ? 18.673 62.807 -3.553  1.00 89.49  ? 106 ARG C NH1 1 
ATOM   3053 N NH2 . ARG C 1 107 ? 18.106 64.953 -2.921  1.00 88.41  ? 106 ARG C NH2 1 
ATOM   3054 N N   . THR C 1 108 ? 21.854 62.400 2.944   1.00 67.03  ? 107 THR C N   1 
ATOM   3055 C CA  . THR C 1 108 ? 21.644 62.994 4.276   1.00 65.61  ? 107 THR C CA  1 
ATOM   3056 C C   . THR C 1 108 ? 22.924 63.025 5.147   1.00 65.22  ? 107 THR C C   1 
ATOM   3057 O O   . THR C 1 108 ? 23.661 62.053 5.224   1.00 64.75  ? 107 THR C O   1 
ATOM   3058 C CB  . THR C 1 108 ? 20.550 62.230 5.056   1.00 64.01  ? 107 THR C CB  1 
ATOM   3059 O OG1 . THR C 1 108 ? 19.269 62.591 4.542   1.00 62.73  ? 107 THR C OG1 1 
ATOM   3060 C CG2 . THR C 1 108 ? 20.604 62.556 6.526   1.00 62.54  ? 107 THR C CG2 1 
ATOM   3061 N N   . SER C 1 109 ? 23.154 64.167 5.787   1.00 64.92  ? 108 SER C N   1 
ATOM   3062 C CA  . SER C 1 109 ? 24.300 64.353 6.685   1.00 64.52  ? 108 SER C CA  1 
ATOM   3063 C C   . SER C 1 109 ? 24.421 63.174 7.690   1.00 64.52  ? 108 SER C C   1 
ATOM   3064 O O   . SER C 1 109 ? 23.445 62.802 8.319   1.00 65.10  ? 108 SER C O   1 
ATOM   3065 C CB  . SER C 1 109 ? 24.131 65.670 7.451   1.00 63.80  ? 108 SER C CB  1 
ATOM   3066 O OG  . SER C 1 109 ? 24.994 65.726 8.569   1.00 60.79  ? 108 SER C OG  1 
ATOM   3067 N N   . GLU C 1 110 ? 25.612 62.595 7.816   1.00 64.13  ? 109 GLU C N   1 
ATOM   3068 C CA  . GLU C 1 110 ? 25.814 61.468 8.751   1.00 62.80  ? 109 GLU C CA  1 
ATOM   3069 C C   . GLU C 1 110 ? 25.469 61.890 10.196  1.00 59.53  ? 109 GLU C C   1 
ATOM   3070 O O   . GLU C 1 110 ? 25.027 61.086 11.009  1.00 58.76  ? 109 GLU C O   1 
ATOM   3071 C CB  . GLU C 1 110 ? 27.265 60.975 8.680   1.00 65.65  ? 109 GLU C CB  1 
ATOM   3072 C CG  . GLU C 1 110 ? 27.495 59.577 9.265   1.00 70.63  ? 109 GLU C CG  1 
ATOM   3073 C CD  . GLU C 1 110 ? 26.820 58.470 8.455   1.00 73.85  ? 109 GLU C CD  1 
ATOM   3074 O OE1 . GLU C 1 110 ? 25.570 58.416 8.427   1.00 76.33  ? 109 GLU C OE1 1 
ATOM   3075 O OE2 . GLU C 1 110 ? 27.537 57.654 7.838   1.00 74.56  ? 109 GLU C OE2 1 
ATOM   3076 N N   . LYS C 1 111 ? 25.679 63.167 10.487  1.00 56.16  ? 110 LYS C N   1 
ATOM   3077 C CA  . LYS C 1 111 ? 25.366 63.701 11.806  1.00 53.49  ? 110 LYS C CA  1 
ATOM   3078 C C   . LYS C 1 111 ? 23.833 63.605 12.070  1.00 51.75  ? 110 LYS C C   1 
ATOM   3079 O O   . LYS C 1 111 ? 23.414 63.023 13.054  1.00 52.14  ? 110 LYS C O   1 
ATOM   3080 C CB  . LYS C 1 111 ? 25.829 65.166 11.901  1.00 53.97  ? 110 LYS C CB  1 
ATOM   3081 C CG  . LYS C 1 111 ? 25.801 65.747 13.314  1.00 55.70  ? 110 LYS C CG  1 
ATOM   3082 C CD  . LYS C 1 111 ? 25.854 67.266 13.328  1.00 55.80  ? 110 LYS C CD  1 
ATOM   3083 C CE  . LYS C 1 111 ? 27.195 67.801 12.887  1.00 57.71  ? 110 LYS C CE  1 
ATOM   3084 N NZ  . LYS C 1 111 ? 27.250 69.300 12.874  1.00 57.60  ? 110 LYS C NZ  1 
ATOM   3085 N N   . VAL C 1 112 ? 23.034 64.163 11.155  1.00 49.00  ? 111 VAL C N   1 
ATOM   3086 C CA  . VAL C 1 112 ? 21.554 64.169 11.243  1.00 45.83  ? 111 VAL C CA  1 
ATOM   3087 C C   . VAL C 1 112 ? 20.941 62.756 11.338  1.00 45.17  ? 111 VAL C C   1 
ATOM   3088 O O   . VAL C 1 112 ? 19.957 62.566 12.016  1.00 45.64  ? 111 VAL C O   1 
ATOM   3089 C CB  . VAL C 1 112 ? 20.929 64.927 10.028  1.00 44.37  ? 111 VAL C CB  1 
ATOM   3090 C CG1 . VAL C 1 112 ? 19.423 64.884 10.069  1.00 43.34  ? 111 VAL C CG1 1 
ATOM   3091 C CG2 . VAL C 1 112 ? 21.377 66.362 10.031  1.00 44.04  ? 111 VAL C CG2 1 
ATOM   3092 N N   . LYS C 1 113 ? 21.535 61.776 10.670  1.00 46.55  ? 112 LYS C N   1 
ATOM   3093 C CA  . LYS C 1 113 ? 21.016 60.396 10.736  1.00 47.42  ? 112 LYS C CA  1 
ATOM   3094 C C   . LYS C 1 113 ? 21.216 59.790 12.114  1.00 46.86  ? 112 LYS C C   1 
ATOM   3095 O O   . LYS C 1 113 ? 20.328 59.151 12.647  1.00 46.17  ? 112 LYS C O   1 
ATOM   3096 C CB  . LYS C 1 113 ? 21.694 59.491 9.693   1.00 51.26  ? 112 LYS C CB  1 
ATOM   3097 C CG  . LYS C 1 113 ? 21.139 59.608 8.267   1.00 54.17  ? 112 LYS C CG  1 
ATOM   3098 C CD  . LYS C 1 113 ? 21.586 58.440 7.401   1.00 56.91  ? 112 LYS C CD  1 
ATOM   3099 C CE  . LYS C 1 113 ? 22.982 58.644 6.841   1.00 58.12  ? 112 LYS C CE  1 
ATOM   3100 N NZ  . LYS C 1 113 ? 22.966 59.689 5.782   1.00 58.76  ? 112 LYS C NZ  1 
ATOM   3101 N N   . ASN C 1 114 ? 22.404 59.979 12.670  1.00 47.99  ? 113 ASN C N   1 
ATOM   3102 C CA  . ASN C 1 114 ? 22.679 59.450 14.008  1.00 50.19  ? 113 ASN C CA  1 
ATOM   3103 C C   . ASN C 1 114 ? 21.697 60.033 15.036  1.00 49.57  ? 113 ASN C C   1 
ATOM   3104 O O   . ASN C 1 114 ? 21.119 59.296 15.832  1.00 50.09  ? 113 ASN C O   1 
ATOM   3105 C CB  . ASN C 1 114 ? 24.107 59.783 14.438  1.00 51.71  ? 113 ASN C CB  1 
ATOM   3106 C CG  . ASN C 1 114 ? 25.137 59.065 13.615  1.00 54.95  ? 113 ASN C CG  1 
ATOM   3107 O OD1 . ASN C 1 114 ? 26.179 59.609 13.321  1.00 57.83  ? 113 ASN C OD1 1 
ATOM   3108 N ND2 . ASN C 1 114 ? 24.851 57.819 13.253  1.00 55.59  ? 113 ASN C ND2 1 
ATOM   3109 N N   . LYS C 1 115 ? 21.513 61.353 14.996  1.00 47.92  ? 114 LYS C N   1 
ATOM   3110 C CA  . LYS C 1 115 ? 20.608 62.006 15.941  1.00 46.82  ? 114 LYS C CA  1 
ATOM   3111 C C   . LYS C 1 115 ? 19.246 61.312 15.921  1.00 44.91  ? 114 LYS C C   1 
ATOM   3112 O O   . LYS C 1 115 ? 18.714 60.964 16.961  1.00 43.97  ? 114 LYS C O   1 
ATOM   3113 C CB  . LYS C 1 115 ? 20.455 63.489 15.605  1.00 48.48  ? 114 LYS C CB  1 
ATOM   3114 C CG  . LYS C 1 115 ? 19.826 64.305 16.710  1.00 51.26  ? 114 LYS C CG  1 
ATOM   3115 C CD  . LYS C 1 115 ? 20.630 64.204 18.002  1.00 56.05  ? 114 LYS C CD  1 
ATOM   3116 C CE  . LYS C 1 115 ? 20.018 65.047 19.136  1.00 56.71  ? 114 LYS C CE  1 
ATOM   3117 N NZ  . LYS C 1 115 ? 19.984 66.495 18.761  1.00 59.02  ? 114 LYS C NZ  1 
ATOM   3118 N N   . ILE C 1 116 ? 18.713 61.092 14.724  1.00 43.15  ? 115 ILE C N   1 
ATOM   3119 C CA  . ILE C 1 116 ? 17.415 60.406 14.592  1.00 42.67  ? 115 ILE C CA  1 
ATOM   3120 C C   . ILE C 1 116 ? 17.474 58.982 15.180  1.00 43.68  ? 115 ILE C C   1 
ATOM   3121 O O   . ILE C 1 116 ? 16.537 58.532 15.825  1.00 44.42  ? 115 ILE C O   1 
ATOM   3122 C CB  . ILE C 1 116 ? 16.985 60.305 13.114  1.00 40.54  ? 115 ILE C CB  1 
ATOM   3123 C CG1 . ILE C 1 116 ? 16.818 61.704 12.536  1.00 37.50  ? 115 ILE C CG1 1 
ATOM   3124 C CG2 . ILE C 1 116 ? 15.711 59.499 12.993  1.00 37.44  ? 115 ILE C CG2 1 
ATOM   3125 C CD1 . ILE C 1 116 ? 16.580 61.717 11.076  1.00 35.80  ? 115 ILE C CD1 1 
ATOM   3126 N N   . LEU C 1 117 ? 18.586 58.292 14.934  1.00 45.21  ? 116 LEU C N   1 
ATOM   3127 C CA  . LEU C 1 117 ? 18.763 56.924 15.460  1.00 47.12  ? 116 LEU C CA  1 
ATOM   3128 C C   . LEU C 1 117 ? 18.903 56.938 17.009  1.00 48.15  ? 116 LEU C C   1 
ATOM   3129 O O   . LEU C 1 117 ? 18.436 56.032 17.672  1.00 47.10  ? 116 LEU C O   1 
ATOM   3130 C CB  . LEU C 1 117 ? 19.973 56.252 14.804  1.00 46.31  ? 116 LEU C CB  1 
ATOM   3131 C CG  . LEU C 1 117 ? 19.864 56.006 13.293  1.00 45.54  ? 116 LEU C CG  1 
ATOM   3132 C CD1 . LEU C 1 117 ? 21.217 55.688 12.748  1.00 45.49  ? 116 LEU C CD1 1 
ATOM   3133 C CD2 . LEU C 1 117 ? 18.897 54.888 13.014  1.00 44.07  ? 116 LEU C CD2 1 
ATOM   3134 N N   . GLU C 1 118 ? 19.550 57.966 17.562  1.00 49.40  ? 117 GLU C N   1 
ATOM   3135 C CA  . GLU C 1 118 ? 19.630 58.062 19.022  1.00 50.80  ? 117 GLU C CA  1 
ATOM   3136 C C   . GLU C 1 118 ? 18.209 58.349 19.578  1.00 50.82  ? 117 GLU C C   1 
ATOM   3137 O O   . GLU C 1 118 ? 17.799 57.775 20.571  1.00 50.24  ? 117 GLU C O   1 
ATOM   3138 C CB  . GLU C 1 118 ? 20.545 59.196 19.462  1.00 53.48  ? 117 GLU C CB  1 
ATOM   3139 C CG  . GLU C 1 118 ? 21.982 59.073 19.016  1.00 59.50  ? 117 GLU C CG  1 
ATOM   3140 C CD  . GLU C 1 118 ? 22.815 60.276 19.468  1.00 61.59  ? 117 GLU C CD  1 
ATOM   3141 O OE1 . GLU C 1 118 ? 22.898 60.495 20.696  1.00 63.24  ? 117 GLU C OE1 1 
ATOM   3142 O OE2 . GLU C 1 118 ? 23.373 60.994 18.604  1.00 60.65  ? 117 GLU C OE2 1 
ATOM   3143 N N   . LEU C 1 119 ? 17.479 59.241 18.911  1.00 49.47  ? 118 LEU C N   1 
ATOM   3144 C CA  . LEU C 1 119 ? 16.133 59.567 19.349  1.00 49.55  ? 118 LEU C CA  1 
ATOM   3145 C C   . LEU C 1 119 ? 15.199 58.351 19.299  1.00 50.11  ? 118 LEU C C   1 
ATOM   3146 O O   . LEU C 1 119 ? 14.578 57.994 20.295  1.00 49.71  ? 118 LEU C O   1 
ATOM   3147 C CB  . LEU C 1 119 ? 15.540 60.681 18.498  1.00 49.13  ? 118 LEU C CB  1 
ATOM   3148 C CG  . LEU C 1 119 ? 15.864 62.104 18.901  1.00 49.24  ? 118 LEU C CG  1 
ATOM   3149 C CD1 . LEU C 1 119 ? 15.223 63.057 17.915  1.00 47.45  ? 118 LEU C CD1 1 
ATOM   3150 C CD2 . LEU C 1 119 ? 15.343 62.360 20.309  1.00 51.07  ? 118 LEU C CD2 1 
ATOM   3151 N N   . LEU C 1 120 ? 15.109 57.733 18.127  1.00 49.35  ? 119 LEU C N   1 
ATOM   3152 C CA  . LEU C 1 120 ? 14.247 56.575 17.981  1.00 48.44  ? 119 LEU C CA  1 
ATOM   3153 C C   . LEU C 1 120 ? 14.550 55.549 19.094  1.00 50.14  ? 119 LEU C C   1 
ATOM   3154 O O   . LEU C 1 120 ? 13.650 55.093 19.792  1.00 50.09  ? 119 LEU C O   1 
ATOM   3155 C CB  . LEU C 1 120 ? 14.420 55.963 16.585  1.00 44.52  ? 119 LEU C CB  1 
ATOM   3156 C CG  . LEU C 1 120 ? 13.944 56.840 15.403  1.00 43.25  ? 119 LEU C CG  1 
ATOM   3157 C CD1 . LEU C 1 120 ? 14.269 56.185 14.080  1.00 41.59  ? 119 LEU C CD1 1 
ATOM   3158 C CD2 . LEU C 1 120 ? 12.453 57.070 15.505  1.00 39.77  ? 119 LEU C CD2 1 
ATOM   3159 N N   . TYR C 1 121 ? 15.828 55.236 19.279  1.00 51.03  ? 120 TYR C N   1 
ATOM   3160 C CA  . TYR C 1 121 ? 16.224 54.280 20.316  1.00 52.83  ? 120 TYR C CA  1 
ATOM   3161 C C   . TYR C 1 121 ? 15.830 54.771 21.715  1.00 52.93  ? 120 TYR C C   1 
ATOM   3162 O O   . TYR C 1 121 ? 15.216 54.048 22.498  1.00 52.36  ? 120 TYR C O   1 
ATOM   3163 C CB  . TYR C 1 121 ? 17.731 54.045 20.283  1.00 54.68  ? 120 TYR C CB  1 
ATOM   3164 C CG  . TYR C 1 121 ? 18.194 53.083 21.347  1.00 58.22  ? 120 TYR C CG  1 
ATOM   3165 C CD1 . TYR C 1 121 ? 17.659 51.794 21.427  1.00 58.31  ? 120 TYR C CD1 1 
ATOM   3166 C CD2 . TYR C 1 121 ? 19.165 53.455 22.276  1.00 59.42  ? 120 TYR C CD2 1 
ATOM   3167 C CE1 . TYR C 1 121 ? 18.078 50.904 22.401  1.00 58.94  ? 120 TYR C CE1 1 
ATOM   3168 C CE2 . TYR C 1 121 ? 19.594 52.570 23.256  1.00 59.37  ? 120 TYR C CE2 1 
ATOM   3169 C CZ  . TYR C 1 121 ? 19.045 51.296 23.312  1.00 60.06  ? 120 TYR C CZ  1 
ATOM   3170 O OH  . TYR C 1 121 ? 19.458 50.416 24.284  1.00 61.01  ? 120 TYR C OH  1 
ATOM   3171 N N   . SER C 1 122 ? 16.229 56.006 21.997  1.00 53.09  ? 121 SER C N   1 
ATOM   3172 C CA  . SER C 1 122 ? 15.932 56.674 23.260  1.00 52.02  ? 121 SER C CA  1 
ATOM   3173 C C   . SER C 1 122 ? 14.442 56.538 23.600  1.00 51.56  ? 121 SER C C   1 
ATOM   3174 O O   . SER C 1 122 ? 14.089 56.347 24.749  1.00 52.77  ? 121 SER C O   1 
ATOM   3175 C CB  . SER C 1 122 ? 16.313 58.154 23.147  1.00 53.70  ? 121 SER C CB  1 
ATOM   3176 O OG  . SER C 1 122 ? 15.702 58.952 24.141  1.00 54.44  ? 121 SER C OG  1 
ATOM   3177 N N   . TRP C 1 123 ? 13.589 56.622 22.583  1.00 50.61  ? 122 TRP C N   1 
ATOM   3178 C CA  . TRP C 1 123 ? 12.144 56.501 22.801  1.00 52.34  ? 122 TRP C CA  1 
ATOM   3179 C C   . TRP C 1 123 ? 11.652 55.045 22.985  1.00 54.80  ? 122 TRP C C   1 
ATOM   3180 O O   . TRP C 1 123 ? 10.689 54.811 23.696  1.00 55.81  ? 122 TRP C O   1 
ATOM   3181 C CB  . TRP C 1 123 ? 11.362 57.158 21.664  1.00 49.74  ? 122 TRP C CB  1 
ATOM   3182 C CG  . TRP C 1 123 ? 11.643 58.635 21.513  1.00 49.31  ? 122 TRP C CG  1 
ATOM   3183 C CD1 . TRP C 1 123 ? 12.049 59.518 22.495  1.00 46.62  ? 122 TRP C CD1 1 
ATOM   3184 C CD2 . TRP C 1 123 ? 11.540 59.397 20.314  1.00 48.93  ? 122 TRP C CD2 1 
ATOM   3185 N NE1 . TRP C 1 123 ? 12.206 60.768 21.970  1.00 44.78  ? 122 TRP C NE1 1 
ATOM   3186 C CE2 . TRP C 1 123 ? 11.900 60.729 20.634  1.00 47.34  ? 122 TRP C CE2 1 
ATOM   3187 C CE3 . TRP C 1 123 ? 11.178 59.087 18.991  1.00 49.07  ? 122 TRP C CE3 1 
ATOM   3188 C CZ2 . TRP C 1 123 ? 11.907 61.746 19.681  1.00 47.60  ? 122 TRP C CZ2 1 
ATOM   3189 C CZ3 . TRP C 1 123 ? 11.188 60.100 18.048  1.00 47.52  ? 122 TRP C CZ3 1 
ATOM   3190 C CH2 . TRP C 1 123 ? 11.549 61.411 18.399  1.00 48.25  ? 122 TRP C CH2 1 
ATOM   3191 N N   . THR C 1 124 ? 12.296 54.081 22.335  1.00 56.21  ? 123 THR C N   1 
ATOM   3192 C CA  . THR C 1 124 ? 11.869 52.689 22.520  1.00 56.96  ? 123 THR C CA  1 
ATOM   3193 C C   . THR C 1 124 ? 12.115 52.273 23.997  1.00 58.34  ? 123 THR C C   1 
ATOM   3194 O O   . THR C 1 124 ? 11.331 51.547 24.592  1.00 58.70  ? 123 THR C O   1 
ATOM   3195 C CB  . THR C 1 124 ? 12.634 51.728 21.580  1.00 56.55  ? 123 THR C CB  1 
ATOM   3196 O OG1 . THR C 1 124 ? 14.045 51.878 21.779  1.00 56.66  ? 123 THR C OG1 1 
ATOM   3197 C CG2 . THR C 1 124 ? 12.297 52.021 20.129  1.00 55.67  ? 123 THR C CG2 1 
ATOM   3198 N N   . VAL C 1 125 ? 13.204 52.785 24.567  1.00 58.69  ? 124 VAL C N   1 
ATOM   3199 C CA  . VAL C 1 125 ? 13.576 52.504 25.964  1.00 58.58  ? 124 VAL C CA  1 
ATOM   3200 C C   . VAL C 1 125 ? 12.774 53.355 26.970  1.00 58.67  ? 124 VAL C C   1 
ATOM   3201 O O   . VAL C 1 125 ? 12.315 52.850 27.967  1.00 59.09  ? 124 VAL C O   1 
ATOM   3202 C CB  . VAL C 1 125 ? 15.083 52.781 26.216  1.00 58.51  ? 124 VAL C CB  1 
ATOM   3203 C CG1 . VAL C 1 125 ? 15.446 52.438 27.656  1.00 57.14  ? 124 VAL C CG1 1 
ATOM   3204 C CG2 . VAL C 1 125 ? 15.935 51.974 25.250  1.00 57.17  ? 124 VAL C CG2 1 
ATOM   3205 N N   . GLY C 1 126 ? 12.621 54.643 26.677  1.00 59.43  ? 125 GLY C N   1 
ATOM   3206 C CA  . GLY C 1 126 ? 11.898 55.536 27.570  1.00 59.93  ? 125 GLY C CA  1 
ATOM   3207 C C   . GLY C 1 126 ? 10.396 55.450 27.432  1.00 60.80  ? 125 GLY C C   1 
ATOM   3208 O O   . GLY C 1 126 ? 9.676  55.532 28.406  1.00 60.81  ? 125 GLY C O   1 
ATOM   3209 N N   . LEU C 1 127 ? 9.924  55.301 26.206  1.00 62.23  ? 126 LEU C N   1 
ATOM   3210 C CA  . LEU C 1 127 ? 8.491  55.181 25.960  1.00 63.93  ? 126 LEU C CA  1 
ATOM   3211 C C   . LEU C 1 127 ? 8.173  53.861 25.247  1.00 65.15  ? 126 LEU C C   1 
ATOM   3212 O O   . LEU C 1 127 ? 7.723  53.861 24.107  1.00 65.19  ? 126 LEU C O   1 
ATOM   3213 C CB  . LEU C 1 127 ? 7.999  56.348 25.109  1.00 64.20  ? 126 LEU C CB  1 
ATOM   3214 C CG  . LEU C 1 127 ? 8.009  57.735 25.743  1.00 64.69  ? 126 LEU C CG  1 
ATOM   3215 C CD1 . LEU C 1 127 ? 7.686  58.762 24.670  1.00 64.60  ? 126 LEU C CD1 1 
ATOM   3216 C CD2 . LEU C 1 127 ? 6.994  57.803 26.876  1.00 63.68  ? 126 LEU C CD2 1 
ATOM   3217 N N   . PRO C 1 128 ? 8.425  52.725 25.921  1.00 66.59  ? 127 PRO C N   1 
ATOM   3218 C CA  . PRO C 1 128 ? 8.163  51.403 25.346  1.00 67.55  ? 127 PRO C CA  1 
ATOM   3219 C C   . PRO C 1 128 ? 6.674  51.178 25.029  1.00 68.14  ? 127 PRO C C   1 
ATOM   3220 O O   . PRO C 1 128 ? 6.337  50.305 24.259  1.00 68.82  ? 127 PRO C O   1 
ATOM   3221 C CB  . PRO C 1 128 ? 8.694  50.448 26.415  1.00 67.33  ? 127 PRO C CB  1 
ATOM   3222 C CG  . PRO C 1 128 ? 8.494  51.216 27.681  1.00 67.39  ? 127 PRO C CG  1 
ATOM   3223 C CD  . PRO C 1 128 ? 8.958  52.596 27.288  1.00 67.52  ? 127 PRO C CD  1 
ATOM   3224 N N   . GLU C 1 129 ? 5.801  51.975 25.631  1.00 68.60  ? 128 GLU C N   1 
ATOM   3225 C CA  . GLU C 1 129 ? 4.371  51.836 25.354  1.00 70.01  ? 128 GLU C CA  1 
ATOM   3226 C C   . GLU C 1 129 ? 4.094  52.111 23.866  1.00 70.17  ? 128 GLU C C   1 
ATOM   3227 O O   . GLU C 1 129 ? 3.265  51.460 23.255  1.00 70.90  ? 128 GLU C O   1 
ATOM   3228 C CB  . GLU C 1 129 ? 3.553  52.814 26.198  1.00 71.47  ? 128 GLU C CB  1 
ATOM   3229 C CG  . GLU C 1 129 ? 4.242  53.255 27.465  1.00 73.41  ? 128 GLU C CG  1 
ATOM   3230 C CD  . GLU C 1 129 ? 5.355  54.245 27.193  1.00 73.83  ? 128 GLU C CD  1 
ATOM   3231 O OE1 . GLU C 1 129 ? 6.399  54.161 27.872  1.00 74.09  ? 128 GLU C OE1 1 
ATOM   3232 O OE2 . GLU C 1 129 ? 5.176  55.110 26.308  1.00 74.83  ? 128 GLU C OE2 1 
ATOM   3233 N N   . GLU C 1 130 ? 4.807  53.088 23.306  1.00 69.26  ? 129 GLU C N   1 
ATOM   3234 C CA  . GLU C 1 130 ? 4.644  53.441 21.887  1.00 67.07  ? 129 GLU C CA  1 
ATOM   3235 C C   . GLU C 1 130 ? 5.187  52.329 20.994  1.00 65.71  ? 129 GLU C C   1 
ATOM   3236 O O   . GLU C 1 130 ? 6.336  52.362 20.575  1.00 64.70  ? 129 GLU C O   1 
ATOM   3237 C CB  . GLU C 1 130 ? 5.368  54.752 21.577  1.00 66.98  ? 129 GLU C CB  1 
ATOM   3238 C CG  . GLU C 1 130 ? 4.804  55.959 22.316  1.00 66.20  ? 129 GLU C CG  1 
ATOM   3239 C CD  . GLU C 1 130 ? 3.438  56.368 21.814  1.00 66.97  ? 129 GLU C CD  1 
ATOM   3240 O OE1 . GLU C 1 130 ? 2.797  57.220 22.472  1.00 66.36  ? 129 GLU C OE1 1 
ATOM   3241 O OE2 . GLU C 1 130 ? 3.005  55.844 20.759  1.00 66.20  ? 129 GLU C OE2 1 
ATOM   3242 N N   . VAL C 1 131 ? 4.332  51.347 20.733  1.00 64.73  ? 130 VAL C N   1 
ATOM   3243 C CA  . VAL C 1 131 ? 4.689  50.194 19.907  1.00 64.69  ? 130 VAL C CA  1 
ATOM   3244 C C   . VAL C 1 131 ? 5.240  50.572 18.516  1.00 63.55  ? 130 VAL C C   1 
ATOM   3245 O O   . VAL C 1 131 ? 6.287  50.082 18.108  1.00 63.65  ? 130 VAL C O   1 
ATOM   3246 C CB  . VAL C 1 131 ? 3.478  49.259 19.725  1.00 65.05  ? 130 VAL C CB  1 
ATOM   3247 C CG1 . VAL C 1 131 ? 3.248  48.468 20.998  1.00 66.03  ? 130 VAL C CG1 1 
ATOM   3248 C CG2 . VAL C 1 131 ? 2.232  50.075 19.381  1.00 64.92  ? 130 VAL C CG2 1 
ATOM   3249 N N   . LYS C 1 132 ? 4.521  51.440 17.806  1.00 61.83  ? 131 LYS C N   1 
ATOM   3250 C CA  . LYS C 1 132 ? 4.947  51.868 16.463  1.00 59.47  ? 131 LYS C CA  1 
ATOM   3251 C C   . LYS C 1 132 ? 6.375  52.478 16.456  1.00 59.19  ? 131 LYS C C   1 
ATOM   3252 O O   . LYS C 1 132 ? 7.151  52.218 15.546  1.00 59.66  ? 131 LYS C O   1 
ATOM   3253 C CB  . LYS C 1 132 ? 3.928  52.851 15.878  1.00 56.03  ? 131 LYS C CB  1 
ATOM   3254 C CG  . LYS C 1 132 ? 2.632  52.183 15.432  1.00 53.84  ? 131 LYS C CG  1 
ATOM   3255 C CD  . LYS C 1 132 ? 1.543  53.199 15.134  1.00 52.21  ? 131 LYS C CD  1 
ATOM   3256 C CE  . LYS C 1 132 ? 0.290  52.544 14.551  1.00 49.26  ? 131 LYS C CE  1 
ATOM   3257 N NZ  . LYS C 1 132 ? -0.757 53.540 14.124  1.00 47.65  ? 131 LYS C NZ  1 
ATOM   3258 N N   . ILE C 1 133 ? 6.708  53.275 17.471  1.00 58.45  ? 132 ILE C N   1 
ATOM   3259 C CA  . ILE C 1 133 ? 8.053  53.864 17.542  1.00 57.53  ? 132 ILE C CA  1 
ATOM   3260 C C   . ILE C 1 133 ? 9.081  52.736 17.613  1.00 59.07  ? 132 ILE C C   1 
ATOM   3261 O O   . ILE C 1 133 ? 10.113 52.776 16.954  1.00 59.28  ? 132 ILE C O   1 
ATOM   3262 C CB  . ILE C 1 133 ? 8.237  54.790 18.787  1.00 55.82  ? 132 ILE C CB  1 
ATOM   3263 C CG1 . ILE C 1 133 ? 7.553  56.137 18.570  1.00 53.96  ? 132 ILE C CG1 1 
ATOM   3264 C CG2 . ILE C 1 133 ? 9.701  55.065 19.026  1.00 55.10  ? 132 ILE C CG2 1 
ATOM   3265 C CD1 . ILE C 1 133 ? 7.698  57.064 19.731  1.00 51.44  ? 132 ILE C CD1 1 
ATOM   3266 N N   . ALA C 1 134 ? 8.777  51.724 18.416  1.00 60.14  ? 133 ALA C N   1 
ATOM   3267 C CA  . ALA C 1 134 ? 9.683  50.575 18.539  1.00 60.37  ? 133 ALA C CA  1 
ATOM   3268 C C   . ALA C 1 134 ? 9.669  49.732 17.244  1.00 60.12  ? 133 ALA C C   1 
ATOM   3269 O O   . ALA C 1 134 ? 10.707 49.253 16.790  1.00 59.62  ? 133 ALA C O   1 
ATOM   3270 C CB  . ALA C 1 134 ? 9.278  49.717 19.735  1.00 59.37  ? 133 ALA C CB  1 
ATOM   3271 N N   . GLU C 1 135 ? 8.480  49.574 16.663  1.00 60.12  ? 134 GLU C N   1 
ATOM   3272 C CA  . GLU C 1 135 ? 8.332  48.794 15.423  1.00 59.96  ? 134 GLU C CA  1 
ATOM   3273 C C   . GLU C 1 135 ? 9.192  49.400 14.308  1.00 59.62  ? 134 GLU C C   1 
ATOM   3274 O O   . GLU C 1 135 ? 9.947  48.708 13.640  1.00 59.69  ? 134 GLU C O   1 
ATOM   3275 C CB  . GLU C 1 135 ? 6.875  48.785 14.988  1.00 60.16  ? 134 GLU C CB  1 
ATOM   3276 C CG  . GLU C 1 135 ? 6.503  47.588 14.155  1.00 62.23  ? 134 GLU C CG  1 
ATOM   3277 C CD  . GLU C 1 135 ? 5.030  47.578 13.820  1.00 63.39  ? 134 GLU C CD  1 
ATOM   3278 O OE1 . GLU C 1 135 ? 4.237  47.981 14.702  1.00 63.16  ? 134 GLU C OE1 1 
ATOM   3279 O OE2 . GLU C 1 135 ? 4.667  47.168 12.688  1.00 63.18  ? 134 GLU C OE2 1 
ATOM   3280 N N   . ALA C 1 136 ? 9.056  50.708 14.135  1.00 58.05  ? 135 ALA C N   1 
ATOM   3281 C CA  . ALA C 1 136 ? 9.830  51.427 13.141  1.00 56.96  ? 135 ALA C CA  1 
ATOM   3282 C C   . ALA C 1 136 ? 11.335 51.312 13.436  1.00 56.10  ? 135 ALA C C   1 
ATOM   3283 O O   . ALA C 1 136 ? 12.130 51.228 12.524  1.00 55.48  ? 135 ALA C O   1 
ATOM   3284 C CB  . ALA C 1 136 ? 9.416  52.890 13.124  1.00 59.22  ? 135 ALA C CB  1 
ATOM   3285 N N   . TYR C 1 137 ? 11.706 51.318 14.715  1.00 56.22  ? 136 TYR C N   1 
ATOM   3286 C CA  . TYR C 1 137 ? 13.129 51.197 15.079  1.00 58.20  ? 136 TYR C CA  1 
ATOM   3287 C C   . TYR C 1 137 ? 13.670 49.816 14.730  1.00 61.17  ? 136 TYR C C   1 
ATOM   3288 O O   . TYR C 1 137 ? 14.811 49.680 14.314  1.00 61.86  ? 136 TYR C O   1 
ATOM   3289 C CB  . TYR C 1 137 ? 13.357 51.431 16.573  1.00 57.06  ? 136 TYR C CB  1 
ATOM   3290 C CG  . TYR C 1 137 ? 14.824 51.396 16.973  1.00 55.70  ? 136 TYR C CG  1 
ATOM   3291 C CD1 . TYR C 1 137 ? 15.712 52.380 16.538  1.00 53.94  ? 136 TYR C CD1 1 
ATOM   3292 C CD2 . TYR C 1 137 ? 15.323 50.377 17.777  1.00 54.13  ? 136 TYR C CD2 1 
ATOM   3293 C CE1 . TYR C 1 137 ? 17.061 52.347 16.897  1.00 52.67  ? 136 TYR C CE1 1 
ATOM   3294 C CE2 . TYR C 1 137 ? 16.666 50.332 18.140  1.00 52.63  ? 136 TYR C CE2 1 
ATOM   3295 C CZ  . TYR C 1 137 ? 17.530 51.316 17.700  1.00 54.52  ? 136 TYR C CZ  1 
ATOM   3296 O OH  . TYR C 1 137 ? 18.864 51.270 18.062  1.00 55.63  ? 136 TYR C OH  1 
ATOM   3297 N N   . GLN C 1 138 ? 12.843 48.794 14.929  1.00 64.15  ? 137 GLN C N   1 
ATOM   3298 C CA  . GLN C 1 138 ? 13.262 47.438 14.603  1.00 66.53  ? 137 GLN C CA  1 
ATOM   3299 C C   . GLN C 1 138 ? 13.431 47.269 13.091  1.00 67.71  ? 137 GLN C C   1 
ATOM   3300 O O   . GLN C 1 138 ? 14.468 46.804 12.619  1.00 67.81  ? 137 GLN C O   1 
ATOM   3301 C CB  . GLN C 1 138 ? 12.259 46.432 15.158  1.00 67.78  ? 137 GLN C CB  1 
ATOM   3302 C CG  . GLN C 1 138 ? 12.436 46.248 16.647  1.00 70.86  ? 137 GLN C CG  1 
ATOM   3303 C CD  . GLN C 1 138 ? 13.828 45.732 16.991  1.00 72.29  ? 137 GLN C CD  1 
ATOM   3304 O OE1 . GLN C 1 138 ? 14.300 45.871 18.121  1.00 72.06  ? 137 GLN C OE1 1 
ATOM   3305 N NE2 . GLN C 1 138 ? 14.486 45.120 16.009  1.00 73.18  ? 137 GLN C NE2 1 
ATOM   3306 N N   . MET C 1 139 ? 12.410 47.670 12.344  1.00 68.30  ? 138 MET C N   1 
ATOM   3307 C CA  . MET C 1 139 ? 12.487 47.584 10.893  1.00 68.82  ? 138 MET C CA  1 
ATOM   3308 C C   . MET C 1 139 ? 13.749 48.312 10.388  1.00 68.15  ? 138 MET C C   1 
ATOM   3309 O O   . MET C 1 139 ? 14.342 47.922 9.406   1.00 68.91  ? 138 MET C O   1 
ATOM   3310 C CB  . MET C 1 139 ? 11.257 48.219 10.253  1.00 70.45  ? 138 MET C CB  1 
ATOM   3311 C CG  . MET C 1 139 ? 11.262 48.132 8.740   1.00 73.30  ? 138 MET C CG  1 
ATOM   3312 S SD  . MET C 1 139 ? 10.695 49.649 7.957   1.00 76.80  ? 138 MET C SD  1 
ATOM   3313 C CE  . MET C 1 139 ? 12.261 50.390 7.443   1.00 76.46  ? 138 MET C CE  1 
ATOM   3314 N N   . LEU C 1 140 ? 14.137 49.368 11.092  1.00 67.89  ? 139 LEU C N   1 
ATOM   3315 C CA  . LEU C 1 140 ? 15.322 50.146 10.724  1.00 67.79  ? 139 LEU C CA  1 
ATOM   3316 C C   . LEU C 1 140 ? 16.612 49.403 11.111  1.00 67.56  ? 139 LEU C C   1 
ATOM   3317 O O   . LEU C 1 140 ? 17.631 49.544 10.467  1.00 67.19  ? 139 LEU C O   1 
ATOM   3318 C CB  . LEU C 1 140 ? 15.291 51.499 11.427  1.00 66.73  ? 139 LEU C CB  1 
ATOM   3319 C CG  . LEU C 1 140 ? 15.837 52.713 10.688  1.00 66.20  ? 139 LEU C CG  1 
ATOM   3320 C CD1 . LEU C 1 140 ? 14.857 53.151 9.622   1.00 64.65  ? 139 LEU C CD1 1 
ATOM   3321 C CD2 . LEU C 1 140 ? 16.045 53.842 11.683  1.00 67.70  ? 139 LEU C CD2 1 
ATOM   3322 N N   . LYS C 1 141 ? 16.539 48.627 12.184  1.00 68.08  ? 140 LYS C N   1 
ATOM   3323 C CA  . LYS C 1 141 ? 17.697 47.865 12.631  1.00 69.18  ? 140 LYS C CA  1 
ATOM   3324 C C   . LYS C 1 141 ? 17.837 46.593 11.769  1.00 70.49  ? 140 LYS C C   1 
ATOM   3325 O O   . LYS C 1 141 ? 18.933 46.076 11.552  1.00 69.13  ? 140 LYS C O   1 
ATOM   3326 C CB  . LYS C 1 141 ? 17.554 47.499 14.116  1.00 68.76  ? 140 LYS C CB  1 
ATOM   3327 C CG  . LYS C 1 141 ? 18.770 46.767 14.700  1.00 68.81  ? 140 LYS C CG  1 
ATOM   3328 C CD  . LYS C 1 141 ? 18.825 46.832 16.226  1.00 68.18  ? 140 LYS C CD  1 
ATOM   3329 C CE  . LYS C 1 141 ? 17.588 46.200 16.873  1.00 67.99  ? 140 LYS C CE  1 
ATOM   3330 N NZ  . LYS C 1 141 ? 17.561 46.322 18.370  1.00 65.19  ? 140 LYS C NZ  1 
ATOM   3331 N N   . LYS C 1 142 ? 16.699 46.121 11.271  1.00 71.48  ? 141 LYS C N   1 
ATOM   3332 C CA  . LYS C 1 142 ? 16.678 44.943 10.419  1.00 72.50  ? 141 LYS C CA  1 
ATOM   3333 C C   . LYS C 1 142 ? 17.351 45.244 9.065   1.00 73.62  ? 141 LYS C C   1 
ATOM   3334 O O   . LYS C 1 142 ? 17.968 44.381 8.474   1.00 74.47  ? 141 LYS C O   1 
ATOM   3335 C CB  . LYS C 1 142 ? 15.236 44.469 10.196  1.00 71.92  ? 141 LYS C CB  1 
ATOM   3336 C CG  . LYS C 1 142 ? 15.137 43.097 9.549   1.00 71.04  ? 141 LYS C CG  1 
ATOM   3337 C CD  . LYS C 1 142 ? 13.785 42.441 9.782   1.00 69.88  ? 141 LYS C CD  1 
ATOM   3338 C CE  . LYS C 1 142 ? 12.688 43.139 9.023   1.00 68.68  ? 141 LYS C CE  1 
ATOM   3339 N NZ  . LYS C 1 142 ? 12.971 43.128 7.572   1.00 69.48  ? 141 LYS C NZ  1 
ATOM   3340 N N   . GLN C 1 143 ? 17.223 46.481 8.598   1.00 74.30  ? 142 GLN C N   1 
ATOM   3341 C CA  . GLN C 1 143 ? 17.843 46.873 7.324   1.00 75.57  ? 142 GLN C CA  1 
ATOM   3342 C C   . GLN C 1 143 ? 19.353 47.074 7.493   1.00 74.94  ? 142 GLN C C   1 
ATOM   3343 O O   . GLN C 1 143 ? 20.064 47.375 6.546   1.00 74.04  ? 142 GLN C O   1 
ATOM   3344 C CB  . GLN C 1 143 ? 17.213 48.166 6.785   1.00 76.75  ? 142 GLN C CB  1 
ATOM   3345 C CG  . GLN C 1 143 ? 15.723 48.065 6.488   1.00 78.85  ? 142 GLN C CG  1 
ATOM   3346 C CD  . GLN C 1 143 ? 15.188 49.289 5.771   1.00 81.19  ? 142 GLN C CD  1 
ATOM   3347 O OE1 . GLN C 1 143 ? 15.420 50.424 6.186   1.00 81.08  ? 142 GLN C OE1 1 
ATOM   3348 N NE2 . GLN C 1 143 ? 14.458 49.058 4.689   1.00 82.58  ? 142 GLN C NE2 1 
ATOM   3349 N N   . GLY C 1 144 ? 19.818 46.899 8.723   1.00 75.37  ? 143 GLY C N   1 
ATOM   3350 C CA  . GLY C 1 144 ? 21.230 47.065 9.003   1.00 76.85  ? 143 GLY C CA  1 
ATOM   3351 C C   . GLY C 1 144 ? 21.642 48.519 9.002   1.00 77.68  ? 143 GLY C C   1 
ATOM   3352 O O   . GLY C 1 144 ? 22.787 48.837 8.731   1.00 78.19  ? 143 GLY C O   1 
ATOM   3353 N N   . ILE C 1 145 ? 20.698 49.404 9.308   1.00 78.81  ? 144 ILE C N   1 
ATOM   3354 C CA  . ILE C 1 145 ? 20.983 50.838 9.349   1.00 79.71  ? 144 ILE C CA  1 
ATOM   3355 C C   . ILE C 1 145 ? 21.791 51.220 10.610  1.00 80.70  ? 144 ILE C C   1 
ATOM   3356 O O   . ILE C 1 145 ? 22.637 52.101 10.566  1.00 80.18  ? 144 ILE C O   1 
ATOM   3357 C CB  . ILE C 1 145 ? 19.681 51.660 9.319   1.00 80.14  ? 144 ILE C CB  1 
ATOM   3358 C CG1 . ILE C 1 145 ? 18.863 51.306 8.072   1.00 80.46  ? 144 ILE C CG1 1 
ATOM   3359 C CG2 . ILE C 1 145 ? 20.004 53.150 9.295   1.00 80.57  ? 144 ILE C CG2 1 
ATOM   3360 C CD1 . ILE C 1 145 ? 19.481 51.764 6.770   1.00 78.93  ? 144 ILE C CD1 1 
ATOM   3361 N N   . VAL C 1 146 ? 21.519 50.533 11.717  1.00 82.78  ? 145 VAL C N   1 
ATOM   3362 C CA  . VAL C 1 146 ? 22.220 50.793 12.996  1.00 85.00  ? 145 VAL C CA  1 
ATOM   3363 C C   . VAL C 1 146 ? 23.473 49.873 13.205  1.00 85.52  ? 145 VAL C C   1 
ATOM   3364 O O   . VAL C 1 146 ? 23.334 48.785 13.814  1.00 85.65  ? 145 VAL C O   1 
ATOM   3365 C CB  . VAL C 1 146 ? 21.244 50.629 14.206  1.00 85.76  ? 145 VAL C CB  1 
ATOM   3366 C CG1 . VAL C 1 146 ? 21.904 51.129 15.493  1.00 85.77  ? 145 VAL C CG1 1 
ATOM   3367 C CG2 . VAL C 1 146 ? 19.948 51.395 13.944  1.00 85.30  ? 145 VAL C CG2 1 
ATOM   3368 N N   . GLU D 1 9   ? 27.441 85.622 -0.956  1.00 69.25  ? 8   GLU D N   1 
ATOM   3369 C CA  . GLU D 1 9   ? 26.340 84.878 -0.270  1.00 69.69  ? 8   GLU D CA  1 
ATOM   3370 C C   . GLU D 1 9   ? 26.114 83.504 -0.894  1.00 68.50  ? 8   GLU D C   1 
ATOM   3371 O O   . GLU D 1 9   ? 26.137 83.357 -2.108  1.00 69.38  ? 8   GLU D O   1 
ATOM   3372 C CB  . GLU D 1 9   ? 25.019 85.637 -0.348  1.00 71.08  ? 8   GLU D CB  1 
ATOM   3373 C CG  . GLU D 1 9   ? 24.951 86.882 0.487   1.00 73.57  ? 8   GLU D CG  1 
ATOM   3374 C CD  . GLU D 1 9   ? 23.524 87.212 0.860   1.00 75.48  ? 8   GLU D CD  1 
ATOM   3375 O OE1 . GLU D 1 9   ? 22.904 86.392 1.569   1.00 74.78  ? 8   GLU D OE1 1 
ATOM   3376 O OE2 . GLU D 1 9   ? 23.021 88.278 0.445   1.00 76.02  ? 8   GLU D OE2 1 
ATOM   3377 N N   . THR D 1 10  ? 25.883 82.508 -0.051  1.00 65.76  ? 9   THR D N   1 
ATOM   3378 C CA  . THR D 1 10  ? 25.638 81.166 -0.561  1.00 62.56  ? 9   THR D CA  1 
ATOM   3379 C C   . THR D 1 10  ? 24.194 81.029 -1.109  1.00 60.60  ? 9   THR D C   1 
ATOM   3380 O O   . THR D 1 10  ? 23.311 81.864 -0.830  1.00 59.16  ? 9   THR D O   1 
ATOM   3381 C CB  . THR D 1 10  ? 25.845 80.107 0.535   1.00 61.99  ? 9   THR D CB  1 
ATOM   3382 O OG1 . THR D 1 10  ? 24.923 80.346 1.598   1.00 60.61  ? 9   THR D OG1 1 
ATOM   3383 C CG2 . THR D 1 10  ? 27.255 80.160 1.077   1.00 62.06  ? 9   THR D CG2 1 
ATOM   3384 N N   . LEU D 1 11  ? 23.985 79.986 -1.905  1.00 57.49  ? 10  LEU D N   1 
ATOM   3385 C CA  . LEU D 1 11  ? 22.670 79.709 -2.463  1.00 53.95  ? 10  LEU D CA  1 
ATOM   3386 C C   . LEU D 1 11  ? 21.620 79.569 -1.333  1.00 53.45  ? 10  LEU D C   1 
ATOM   3387 O O   . LEU D 1 11  ? 20.559 80.192 -1.392  1.00 52.98  ? 10  LEU D O   1 
ATOM   3388 C CB  . LEU D 1 11  ? 22.738 78.433 -3.303  1.00 52.06  ? 10  LEU D CB  1 
ATOM   3389 C CG  . LEU D 1 11  ? 22.424 78.586 -4.797  1.00 51.99  ? 10  LEU D CG  1 
ATOM   3390 C CD1 . LEU D 1 11  ? 23.119 79.813 -5.349  1.00 49.35  ? 10  LEU D CD1 1 
ATOM   3391 C CD2 . LEU D 1 11  ? 22.842 77.321 -5.546  1.00 48.99  ? 10  LEU D CD2 1 
ATOM   3392 N N   . GLU D 1 12  ? 21.947 78.770 -0.309  1.00 51.86  ? 11  GLU D N   1 
ATOM   3393 C CA  . GLU D 1 12  ? 21.032 78.561 0.846   1.00 51.46  ? 11  GLU D CA  1 
ATOM   3394 C C   . GLU D 1 12  ? 20.612 79.891 1.481   1.00 50.40  ? 11  GLU D C   1 
ATOM   3395 O O   . GLU D 1 12  ? 19.446 80.106 1.775   1.00 50.13  ? 11  GLU D O   1 
ATOM   3396 C CB  . GLU D 1 12  ? 21.671 77.706 1.947   1.00 51.22  ? 11  GLU D CB  1 
ATOM   3397 C CG  . GLU D 1 12  ? 21.784 76.216 1.667   1.00 54.85  ? 11  GLU D CG  1 
ATOM   3398 C CD  . GLU D 1 12  ? 23.003 75.890 0.851   1.00 56.43  ? 11  GLU D CD  1 
ATOM   3399 O OE1 . GLU D 1 12  ? 23.377 74.688 0.748   1.00 57.48  ? 11  GLU D OE1 1 
ATOM   3400 O OE2 . GLU D 1 12  ? 23.581 76.861 0.315   1.00 55.25  ? 11  GLU D OE2 1 
ATOM   3401 N N   . ALA D 1 13  ? 21.585 80.770 1.699   1.00 49.12  ? 12  ALA D N   1 
ATOM   3402 C CA  . ALA D 1 13  ? 21.293 82.076 2.293   1.00 47.64  ? 12  ALA D CA  1 
ATOM   3403 C C   . ALA D 1 13  ? 20.334 82.889 1.407   1.00 47.04  ? 12  ALA D C   1 
ATOM   3404 O O   . ALA D 1 13  ? 19.430 83.543 1.903   1.00 45.56  ? 12  ALA D O   1 
ATOM   3405 C CB  . ALA D 1 13  ? 22.573 82.836 2.507   1.00 46.55  ? 12  ALA D CB  1 
ATOM   3406 N N   . ARG D 1 14  ? 20.547 82.822 0.094   1.00 48.56  ? 13  ARG D N   1 
ATOM   3407 C CA  . ARG D 1 14  ? 19.693 83.561 -0.852  1.00 49.46  ? 13  ARG D CA  1 
ATOM   3408 C C   . ARG D 1 14  ? 18.251 83.013 -0.891  1.00 48.46  ? 13  ARG D C   1 
ATOM   3409 O O   . ARG D 1 14  ? 17.284 83.763 -0.726  1.00 47.84  ? 13  ARG D O   1 
ATOM   3410 C CB  . ARG D 1 14  ? 20.300 83.514 -2.253  1.00 51.98  ? 13  ARG D CB  1 
ATOM   3411 C CG  . ARG D 1 14  ? 21.613 84.257 -2.412  1.00 55.19  ? 13  ARG D CG  1 
ATOM   3412 C CD  . ARG D 1 14  ? 22.241 83.905 -3.766  1.00 58.94  ? 13  ARG D CD  1 
ATOM   3413 N NE  . ARG D 1 14  ? 23.447 84.663 -4.084  1.00 60.85  ? 13  ARG D NE  1 
ATOM   3414 C CZ  . ARG D 1 14  ? 23.485 85.981 -4.250  1.00 61.82  ? 13  ARG D CZ  1 
ATOM   3415 N NH1 . ARG D 1 14  ? 22.370 86.704 -4.126  1.00 59.37  ? 13  ARG D NH1 1 
ATOM   3416 N NH2 . ARG D 1 14  ? 24.643 86.565 -4.542  1.00 60.84  ? 13  ARG D NH2 1 
ATOM   3417 N N   . ILE D 1 15  ? 18.129 81.705 -1.097  1.00 48.33  ? 14  ILE D N   1 
ATOM   3418 C CA  . ILE D 1 15  ? 16.800 81.056 -1.149  1.00 48.74  ? 14  ILE D CA  1 
ATOM   3419 C C   . ILE D 1 15  ? 15.969 81.252 0.162   1.00 48.66  ? 14  ILE D C   1 
ATOM   3420 O O   . ILE D 1 15  ? 14.772 81.477 0.104   1.00 49.29  ? 14  ILE D O   1 
ATOM   3421 C CB  . ILE D 1 15  ? 16.928 79.543 -1.428  1.00 49.29  ? 14  ILE D CB  1 
ATOM   3422 C CG1 . ILE D 1 15  ? 15.559 78.958 -1.780  1.00 47.88  ? 14  ILE D CG1 1 
ATOM   3423 C CG2 . ILE D 1 15  ? 17.534 78.846 -0.233  1.00 48.41  ? 14  ILE D CG2 1 
ATOM   3424 C CD1 . ILE D 1 15  ? 15.035 79.455 -3.081  1.00 46.99  ? 14  ILE D CD1 1 
ATOM   3425 N N   . ASN D 1 16  ? 16.610 81.178 1.325   1.00 48.03  ? 15  ASN D N   1 
ATOM   3426 C CA  . ASN D 1 16  ? 15.857 81.355 2.561   1.00 48.03  ? 15  ASN D CA  1 
ATOM   3427 C C   . ASN D 1 16  ? 15.247 82.758 2.631   1.00 48.99  ? 15  ASN D C   1 
ATOM   3428 O O   . ASN D 1 16  ? 14.141 82.942 3.130   1.00 48.88  ? 15  ASN D O   1 
ATOM   3429 C CB  . ASN D 1 16  ? 16.742 81.103 3.781   1.00 48.34  ? 15  ASN D CB  1 
ATOM   3430 C CG  . ASN D 1 16  ? 17.283 79.678 3.830   1.00 50.48  ? 15  ASN D CG  1 
ATOM   3431 O OD1 . ASN D 1 16  ? 16.654 78.741 3.341   1.00 51.03  ? 15  ASN D OD1 1 
ATOM   3432 N ND2 . ASN D 1 16  ? 18.444 79.511 4.444   1.00 50.36  ? 15  ASN D ND2 1 
ATOM   3433 N N   . ARG D 1 17  ? 15.975 83.739 2.109   1.00 48.85  ? 16  ARG D N   1 
ATOM   3434 C CA  . ARG D 1 17  ? 15.485 85.120 2.114   1.00 49.39  ? 16  ARG D CA  1 
ATOM   3435 C C   . ARG D 1 17  ? 14.435 85.330 1.024   1.00 48.62  ? 16  ARG D C   1 
ATOM   3436 O O   . ARG D 1 17  ? 13.431 86.010 1.225   1.00 47.18  ? 16  ARG D O   1 
ATOM   3437 C CB  . ARG D 1 17  ? 16.651 86.088 1.919   1.00 51.82  ? 16  ARG D CB  1 
ATOM   3438 C CG  . ARG D 1 17  ? 16.249 87.554 1.989   1.00 59.14  ? 16  ARG D CG  1 
ATOM   3439 C CD  . ARG D 1 17  ? 17.286 88.387 2.758   1.00 62.37  ? 16  ARG D CD  1 
ATOM   3440 N NE  . ARG D 1 17  ? 18.639 87.831 2.654   1.00 66.91  ? 16  ARG D NE  1 
ATOM   3441 C CZ  . ARG D 1 17  ? 19.389 87.814 1.549   1.00 69.05  ? 16  ARG D CZ  1 
ATOM   3442 N NH1 . ARG D 1 17  ? 20.605 87.274 1.578   1.00 67.36  ? 16  ARG D NH1 1 
ATOM   3443 N NH2 . ARG D 1 17  ? 18.942 88.351 0.420   1.00 69.54  ? 16  ARG D NH2 1 
ATOM   3444 N N   . ALA D 1 18  ? 14.678 84.720 -0.129  1.00 48.36  ? 17  ALA D N   1 
ATOM   3445 C CA  . ALA D 1 18  ? 13.740 84.838 -1.243  1.00 48.66  ? 17  ALA D CA  1 
ATOM   3446 C C   . ALA D 1 18  ? 12.379 84.166 -0.947  1.00 48.77  ? 17  ALA D C   1 
ATOM   3447 O O   . ALA D 1 18  ? 11.350 84.615 -1.446  1.00 51.29  ? 17  ALA D O   1 
ATOM   3448 C CB  . ALA D 1 18  ? 14.349 84.239 -2.499  1.00 48.01  ? 17  ALA D CB  1 
ATOM   3449 N N   . THR D 1 19  ? 12.386 83.111 -0.133  1.00 46.29  ? 18  THR D N   1 
ATOM   3450 C CA  . THR D 1 19  ? 11.138 82.392 0.183   1.00 45.08  ? 18  THR D CA  1 
ATOM   3451 C C   . THR D 1 19  ? 10.714 82.510 1.659   1.00 46.14  ? 18  THR D C   1 
ATOM   3452 O O   . THR D 1 19  ? 9.846  81.778 2.136   1.00 45.30  ? 18  THR D O   1 
ATOM   3453 C CB  . THR D 1 19  ? 11.268 80.909 -0.142  1.00 44.10  ? 18  THR D CB  1 
ATOM   3454 O OG1 . THR D 1 19  ? 12.254 80.316 0.711   1.00 42.17  ? 18  THR D OG1 1 
ATOM   3455 C CG2 . THR D 1 19  ? 11.668 80.725 -1.591  1.00 43.04  ? 18  THR D CG2 1 
ATOM   3456 N N   . ASN D 1 20  ? 11.348 83.439 2.359   1.00 46.66  ? 19  ASN D N   1 
ATOM   3457 C CA  . ASN D 1 20  ? 11.070 83.678 3.761   1.00 46.48  ? 19  ASN D CA  1 
ATOM   3458 C C   . ASN D 1 20  ? 9.577  83.924 4.001   1.00 47.48  ? 19  ASN D C   1 
ATOM   3459 O O   . ASN D 1 20  ? 9.019  84.861 3.471   1.00 49.61  ? 19  ASN D O   1 
ATOM   3460 C CB  . ASN D 1 20  ? 11.862 84.889 4.229   1.00 45.64  ? 19  ASN D CB  1 
ATOM   3461 C CG  . ASN D 1 20  ? 12.026 84.925 5.727   1.00 46.01  ? 19  ASN D CG  1 
ATOM   3462 O OD1 . ASN D 1 20  ? 11.048 85.035 6.471   1.00 45.71  ? 19  ASN D OD1 1 
ATOM   3463 N ND2 . ASN D 1 20  ? 13.278 84.816 6.184   1.00 44.75  ? 19  ASN D ND2 1 
ATOM   3464 N N   . PRO D 1 21  ? 8.927  83.070 4.808   1.00 48.06  ? 20  PRO D N   1 
ATOM   3465 C CA  . PRO D 1 21  ? 7.497  83.208 5.112   1.00 48.31  ? 20  PRO D CA  1 
ATOM   3466 C C   . PRO D 1 21  ? 7.141  84.603 5.730   1.00 50.22  ? 20  PRO D C   1 
ATOM   3467 O O   . PRO D 1 21  ? 6.002  85.052 5.658   1.00 48.53  ? 20  PRO D O   1 
ATOM   3468 C CB  . PRO D 1 21  ? 7.246  82.055 6.084   1.00 47.59  ? 20  PRO D CB  1 
ATOM   3469 C CG  . PRO D 1 21  ? 8.276  81.029 5.668   1.00 46.69  ? 20  PRO D CG  1 
ATOM   3470 C CD  . PRO D 1 21  ? 9.492  81.869 5.449   1.00 45.78  ? 20  PRO D CD  1 
ATOM   3471 N N   . LEU D 1 22  ? 8.133  85.255 6.336   1.00 52.12  ? 21  LEU D N   1 
ATOM   3472 C CA  . LEU D 1 22  ? 7.920  86.592 6.946   1.00 55.80  ? 21  LEU D CA  1 
ATOM   3473 C C   . LEU D 1 22  ? 7.687  87.713 5.889   1.00 56.95  ? 21  LEU D C   1 
ATOM   3474 O O   . LEU D 1 22  ? 6.896  88.620 6.107   1.00 56.77  ? 21  LEU D O   1 
ATOM   3475 C CB  . LEU D 1 22  ? 9.113  86.978 7.832   1.00 53.18  ? 21  LEU D CB  1 
ATOM   3476 C CG  . LEU D 1 22  ? 9.250  86.246 9.174   1.00 54.42  ? 21  LEU D CG  1 
ATOM   3477 C CD1 . LEU D 1 22  ? 10.669 86.429 9.694   1.00 52.63  ? 21  LEU D CD1 1 
ATOM   3478 C CD2 . LEU D 1 22  ? 8.208  86.743 10.182  1.00 49.50  ? 21  LEU D CD2 1 
ATOM   3479 N N   . ASN D 1 23  ? 8.388  87.614 4.764   1.00 58.40  ? 22  ASN D N   1 
ATOM   3480 C CA  . ASN D 1 23  ? 8.275  88.599 3.689   1.00 60.40  ? 22  ASN D CA  1 
ATOM   3481 C C   . ASN D 1 23  ? 6.831  89.084 3.459   1.00 62.18  ? 22  ASN D C   1 
ATOM   3482 O O   . ASN D 1 23  ? 5.931  88.286 3.243   1.00 61.87  ? 22  ASN D O   1 
ATOM   3483 C CB  . ASN D 1 23  ? 8.821  88.026 2.378   1.00 60.62  ? 22  ASN D CB  1 
ATOM   3484 C CG  . ASN D 1 23  ? 10.292 87.620 2.471   1.00 61.71  ? 22  ASN D CG  1 
ATOM   3485 O OD1 . ASN D 1 23  ? 11.057 88.177 3.255   1.00 60.27  ? 22  ASN D OD1 1 
ATOM   3486 N ND2 . ASN D 1 23  ? 10.692 86.651 1.641   1.00 61.64  ? 22  ASN D ND2 1 
ATOM   3487 N N   . LYS D 1 24  ? 6.641  90.400 3.520   1.00 64.46  ? 23  LYS D N   1 
ATOM   3488 C CA  . LYS D 1 24  ? 5.319  91.011 3.292   1.00 66.96  ? 23  LYS D CA  1 
ATOM   3489 C C   . LYS D 1 24  ? 4.981  91.019 1.778   1.00 67.65  ? 23  LYS D C   1 
ATOM   3490 O O   . LYS D 1 24  ? 3.820  90.982 1.391   1.00 67.22  ? 23  LYS D O   1 
ATOM   3491 C CB  . LYS D 1 24  ? 5.292  92.445 3.848   1.00 67.71  ? 23  LYS D CB  1 
ATOM   3492 C CG  . LYS D 1 24  ? 4.914  92.577 5.335   1.00 69.27  ? 23  LYS D CG  1 
ATOM   3493 C CD  . LYS D 1 24  ? 3.439  92.207 5.613   1.00 70.38  ? 23  LYS D CD  1 
ATOM   3494 C CE  . LYS D 1 24  ? 3.206  90.688 5.688   1.00 70.93  ? 23  LYS D CE  1 
ATOM   3495 N NZ  . LYS D 1 24  ? 1.777  90.310 5.879   1.00 69.30  ? 23  LYS D NZ  1 
ATOM   3496 N N   . GLU D 1 25  ? 6.032  91.062 0.959   1.00 68.91  ? 24  GLU D N   1 
ATOM   3497 C CA  . GLU D 1 25  ? 5.925  91.049 -0.510  1.00 70.05  ? 24  GLU D CA  1 
ATOM   3498 C C   . GLU D 1 25  ? 7.149  90.313 -1.148  1.00 69.16  ? 24  GLU D C   1 
ATOM   3499 O O   . GLU D 1 25  ? 8.131  90.021 -0.468  1.00 69.00  ? 24  GLU D O   1 
ATOM   3500 C CB  . GLU D 1 25  ? 5.844  92.486 -1.060  1.00 72.79  ? 24  GLU D CB  1 
ATOM   3501 C CG  . GLU D 1 25  ? 7.195  93.202 -1.286  1.00 78.38  ? 24  GLU D CG  1 
ATOM   3502 C CD  . GLU D 1 25  ? 7.751  93.903 -0.049  1.00 81.96  ? 24  GLU D CD  1 
ATOM   3503 O OE1 . GLU D 1 25  ? 7.084  94.840 0.459   1.00 83.64  ? 24  GLU D OE1 1 
ATOM   3504 O OE2 . GLU D 1 25  ? 8.858  93.519 0.406   1.00 82.85  ? 24  GLU D OE2 1 
ATOM   3505 N N   . LEU D 1 26  ? 7.071  90.018 -2.442  1.00 66.89  ? 25  LEU D N   1 
ATOM   3506 C CA  . LEU D 1 26  ? 8.173  89.340 -3.127  1.00 64.24  ? 25  LEU D CA  1 
ATOM   3507 C C   . LEU D 1 26  ? 9.507  90.092 -2.975  1.00 62.38  ? 25  LEU D C   1 
ATOM   3508 O O   . LEU D 1 26  ? 9.576  91.287 -3.134  1.00 62.51  ? 25  LEU D O   1 
ATOM   3509 C CB  . LEU D 1 26  ? 7.856  89.173 -4.616  1.00 65.28  ? 25  LEU D CB  1 
ATOM   3510 C CG  . LEU D 1 26  ? 6.675  88.264 -4.974  1.00 65.59  ? 25  LEU D CG  1 
ATOM   3511 C CD1 . LEU D 1 26  ? 6.672  88.026 -6.477  1.00 64.92  ? 25  LEU D CD1 1 
ATOM   3512 C CD2 . LEU D 1 26  ? 6.794  86.932 -4.232  1.00 65.24  ? 25  LEU D CD2 1 
ATOM   3513 N N   . ASP D 1 27  ? 10.553 89.354 -2.659  1.00 61.24  ? 26  ASP D N   1 
ATOM   3514 C CA  . ASP D 1 27  ? 11.878 89.926 -2.477  1.00 60.48  ? 26  ASP D CA  1 
ATOM   3515 C C   . ASP D 1 27  ? 12.718 89.741 -3.747  1.00 60.20  ? 26  ASP D C   1 
ATOM   3516 O O   . ASP D 1 27  ? 13.681 88.974 -3.756  1.00 59.15  ? 26  ASP D O   1 
ATOM   3517 C CB  . ASP D 1 27  ? 12.548 89.236 -1.291  1.00 60.32  ? 26  ASP D CB  1 
ATOM   3518 C CG  . ASP D 1 27  ? 13.926 89.770 -0.994  1.00 60.94  ? 26  ASP D CG  1 
ATOM   3519 O OD1 . ASP D 1 27  ? 14.532 89.274 -0.020  1.00 62.88  ? 26  ASP D OD1 1 
ATOM   3520 O OD2 . ASP D 1 27  ? 14.412 90.674 -1.709  1.00 61.37  ? 26  ASP D OD2 1 
ATOM   3521 N N   . TRP D 1 28  ? 12.323 90.447 -4.808  1.00 60.07  ? 27  TRP D N   1 
ATOM   3522 C CA  . TRP D 1 28  ? 13.018 90.362 -6.109  1.00 58.62  ? 27  TRP D CA  1 
ATOM   3523 C C   . TRP D 1 28  ? 14.521 90.510 -5.984  1.00 58.80  ? 27  TRP D C   1 
ATOM   3524 O O   . TRP D 1 28  ? 15.282 89.880 -6.724  1.00 59.16  ? 27  TRP D O   1 
ATOM   3525 C CB  . TRP D 1 28  ? 12.478 91.407 -7.089  1.00 57.49  ? 27  TRP D CB  1 
ATOM   3526 C CG  . TRP D 1 28  ? 11.153 91.009 -7.620  1.00 56.25  ? 27  TRP D CG  1 
ATOM   3527 C CD1 . TRP D 1 28  ? 9.941  91.496 -7.239  1.00 56.17  ? 27  TRP D CD1 1 
ATOM   3528 C CD2 . TRP D 1 28  ? 10.888 89.924 -8.519  1.00 55.18  ? 27  TRP D CD2 1 
ATOM   3529 N NE1 . TRP D 1 28  ? 8.932  90.774 -7.834  1.00 57.14  ? 27  TRP D NE1 1 
ATOM   3530 C CE2 . TRP D 1 28  ? 9.487  89.798 -8.622  1.00 54.93  ? 27  TRP D CE2 1 
ATOM   3531 C CE3 . TRP D 1 28  ? 11.703 89.036 -9.240  1.00 55.24  ? 27  TRP D CE3 1 
ATOM   3532 C CZ2 . TRP D 1 28  ? 8.875  88.827 -9.412  1.00 54.08  ? 27  TRP D CZ2 1 
ATOM   3533 C CZ3 . TRP D 1 28  ? 11.094 88.066 -10.030 1.00 56.44  ? 27  TRP D CZ3 1 
ATOM   3534 C CH2 . TRP D 1 28  ? 9.688  87.970 -10.105 1.00 54.92  ? 27  TRP D CH2 1 
ATOM   3535 N N   . ALA D 1 29  ? 14.944 91.347 -5.047  1.00 59.12  ? 28  ALA D N   1 
ATOM   3536 C CA  . ALA D 1 29  ? 16.374 91.543 -4.831  1.00 59.72  ? 28  ALA D CA  1 
ATOM   3537 C C   . ALA D 1 29  ? 17.050 90.188 -4.512  1.00 58.74  ? 28  ALA D C   1 
ATOM   3538 O O   . ALA D 1 29  ? 18.061 89.833 -5.111  1.00 59.22  ? 28  ALA D O   1 
ATOM   3539 C CB  . ALA D 1 29  ? 16.587 92.532 -3.689  1.00 61.08  ? 28  ALA D CB  1 
ATOM   3540 N N   . SER D 1 30  ? 16.445 89.446 -3.586  1.00 58.03  ? 29  SER D N   1 
ATOM   3541 C CA  . SER D 1 30  ? 16.953 88.124 -3.160  1.00 58.41  ? 29  SER D CA  1 
ATOM   3542 C C   . SER D 1 30  ? 16.592 87.001 -4.167  1.00 57.73  ? 29  SER D C   1 
ATOM   3543 O O   . SER D 1 30  ? 17.333 86.033 -4.318  1.00 57.66  ? 29  SER D O   1 
ATOM   3544 C CB  . SER D 1 30  ? 16.391 87.776 -1.781  1.00 59.51  ? 29  SER D CB  1 
ATOM   3545 O OG  . SER D 1 30  ? 16.619 88.832 -0.857  1.00 59.98  ? 29  SER D OG  1 
ATOM   3546 N N   . ILE D 1 31  ? 15.448 87.147 -4.831  1.00 56.22  ? 30  ILE D N   1 
ATOM   3547 C CA  . ILE D 1 31  ? 15.020 86.169 -5.834  1.00 55.28  ? 30  ILE D CA  1 
ATOM   3548 C C   . ILE D 1 31  ? 15.973 86.138 -7.050  1.00 57.00  ? 30  ILE D C   1 
ATOM   3549 O O   . ILE D 1 31  ? 16.568 85.102 -7.372  1.00 56.32  ? 30  ILE D O   1 
ATOM   3550 C CB  . ILE D 1 31  ? 13.602 86.474 -6.338  1.00 53.20  ? 30  ILE D CB  1 
ATOM   3551 C CG1 . ILE D 1 31  ? 12.596 86.221 -5.216  1.00 49.45  ? 30  ILE D CG1 1 
ATOM   3552 C CG2 . ILE D 1 31  ? 13.304 85.622 -7.574  1.00 53.21  ? 30  ILE D CG2 1 
ATOM   3553 C CD1 . ILE D 1 31  ? 11.180 86.327 -5.629  1.00 46.93  ? 30  ILE D CD1 1 
ATOM   3554 N N   . ASN D 1 32  ? 16.110 87.288 -7.708  1.00 58.65  ? 31  ASN D N   1 
ATOM   3555 C CA  . ASN D 1 32  ? 16.999 87.386 -8.877  1.00 59.94  ? 31  ASN D CA  1 
ATOM   3556 C C   . ASN D 1 32  ? 18.461 87.058 -8.515  1.00 60.41  ? 31  ASN D C   1 
ATOM   3557 O O   . ASN D 1 32  ? 19.213 86.543 -9.341  1.00 61.32  ? 31  ASN D O   1 
ATOM   3558 C CB  . ASN D 1 32  ? 16.895 88.779 -9.495  1.00 60.49  ? 31  ASN D CB  1 
ATOM   3559 C CG  . ASN D 1 32  ? 15.607 88.968 -10.265 1.00 62.60  ? 31  ASN D CG  1 
ATOM   3560 O OD1 . ASN D 1 32  ? 15.399 88.320 -11.281 1.00 64.42  ? 31  ASN D OD1 1 
ATOM   3561 N ND2 . ASN D 1 32  ? 14.727 89.850 -9.777  1.00 61.42  ? 31  ASN D ND2 1 
ATOM   3562 N N   . GLY D 1 33  ? 18.833 87.361 -7.269  1.00 60.90  ? 32  GLY D N   1 
ATOM   3563 C CA  . GLY D 1 33  ? 20.176 87.076 -6.787  1.00 60.35  ? 32  GLY D CA  1 
ATOM   3564 C C   . GLY D 1 33  ? 20.442 85.578 -6.714  1.00 60.07  ? 32  GLY D C   1 
ATOM   3565 O O   . GLY D 1 33  ? 21.583 85.143 -6.850  1.00 59.41  ? 32  GLY D O   1 
ATOM   3566 N N   . PHE D 1 34  ? 19.383 84.796 -6.485  1.00 59.84  ? 33  PHE D N   1 
ATOM   3567 C CA  . PHE D 1 34  ? 19.492 83.323 -6.414  1.00 59.63  ? 33  PHE D CA  1 
ATOM   3568 C C   . PHE D 1 34  ? 19.719 82.743 -7.810  1.00 59.60  ? 33  PHE D C   1 
ATOM   3569 O O   . PHE D 1 34  ? 20.650 81.963 -8.019  1.00 57.65  ? 33  PHE D O   1 
ATOM   3570 C CB  . PHE D 1 34  ? 18.218 82.709 -5.806  1.00 60.30  ? 33  PHE D CB  1 
ATOM   3571 C CG  . PHE D 1 34  ? 18.222 81.192 -5.754  1.00 58.47  ? 33  PHE D CG  1 
ATOM   3572 C CD1 . PHE D 1 34  ? 17.668 80.439 -6.787  1.00 57.86  ? 33  PHE D CD1 1 
ATOM   3573 C CD2 . PHE D 1 34  ? 18.786 80.521 -4.675  1.00 57.92  ? 33  PHE D CD2 1 
ATOM   3574 C CE1 . PHE D 1 34  ? 17.674 79.033 -6.745  1.00 57.58  ? 33  PHE D CE1 1 
ATOM   3575 C CE2 . PHE D 1 34  ? 18.796 79.117 -4.624  1.00 58.08  ? 33  PHE D CE2 1 
ATOM   3576 C CZ  . PHE D 1 34  ? 18.240 78.375 -5.663  1.00 57.56  ? 33  PHE D CZ  1 
ATOM   3577 N N   . CYS D 1 35  ? 18.865 83.146 -8.753  1.00 59.95  ? 34  CYS D N   1 
ATOM   3578 C CA  . CYS D 1 35  ? 18.996 82.672 -10.149 1.00 61.75  ? 34  CYS D CA  1 
ATOM   3579 C C   . CYS D 1 35  ? 20.391 83.020 -10.739 1.00 63.34  ? 34  CYS D C   1 
ATOM   3580 O O   . CYS D 1 35  ? 21.063 82.189 -11.363 1.00 60.89  ? 34  CYS D O   1 
ATOM   3581 C CB  . CYS D 1 35  ? 17.911 83.293 -11.033 1.00 60.38  ? 34  CYS D CB  1 
ATOM   3582 S SG  . CYS D 1 35  ? 16.208 83.002 -10.466 1.00 59.33  ? 34  CYS D SG  1 
ATOM   3583 N N   . GLU D 1 36  ? 20.792 84.261 -10.505 1.00 66.13  ? 35  GLU D N   1 
ATOM   3584 C CA  . GLU D 1 36  ? 22.063 84.774 -10.978 1.00 70.07  ? 35  GLU D CA  1 
ATOM   3585 C C   . GLU D 1 36  ? 23.270 84.027 -10.351 1.00 71.56  ? 35  GLU D C   1 
ATOM   3586 O O   . GLU D 1 36  ? 24.334 83.954 -10.941 1.00 72.47  ? 35  GLU D O   1 
ATOM   3587 C CB  . GLU D 1 36  ? 22.130 86.272 -10.660 1.00 72.13  ? 35  GLU D CB  1 
ATOM   3588 C CG  . GLU D 1 36  ? 22.703 87.160 -11.769 1.00 75.90  ? 35  GLU D CG  1 
ATOM   3589 C CD  . GLU D 1 36  ? 24.189 87.430 -11.598 1.00 78.20  ? 35  GLU D CD  1 
ATOM   3590 O OE1 . GLU D 1 36  ? 24.563 88.014 -10.547 1.00 80.04  ? 35  GLU D OE1 1 
ATOM   3591 O OE2 . GLU D 1 36  ? 24.976 87.061 -12.507 1.00 77.55  ? 35  GLU D OE2 1 
ATOM   3592 N N   . GLN D 1 37  ? 23.083 83.460 -9.167  1.00 73.38  ? 36  GLN D N   1 
ATOM   3593 C CA  . GLN D 1 37  ? 24.190 82.762 -8.498  1.00 75.63  ? 36  GLN D CA  1 
ATOM   3594 C C   . GLN D 1 37  ? 24.223 81.245 -8.783  1.00 77.19  ? 36  GLN D C   1 
ATOM   3595 O O   . GLN D 1 37  ? 25.287 80.666 -8.970  1.00 76.93  ? 36  GLN D O   1 
ATOM   3596 C CB  . GLN D 1 37  ? 24.116 83.030 -6.982  1.00 76.57  ? 36  GLN D CB  1 
ATOM   3597 C CG  . GLN D 1 37  ? 25.296 82.521 -6.130  1.00 77.39  ? 36  GLN D CG  1 
ATOM   3598 C CD  . GLN D 1 37  ? 26.676 82.954 -6.650  1.00 78.50  ? 36  GLN D CD  1 
ATOM   3599 O OE1 . GLN D 1 37  ? 26.871 84.097 -7.109  1.00 77.39  ? 36  GLN D OE1 1 
ATOM   3600 N NE2 . GLN D 1 37  ? 27.645 82.039 -6.562  1.00 76.93  ? 36  GLN D NE2 1 
ATOM   3601 N N   . LEU D 1 38  ? 23.051 80.624 -8.831  1.00 78.90  ? 37  LEU D N   1 
ATOM   3602 C CA  . LEU D 1 38  ? 22.971 79.178 -9.066  1.00 81.62  ? 37  LEU D CA  1 
ATOM   3603 C C   . LEU D 1 38  ? 23.786 78.722 -10.296 1.00 84.35  ? 37  LEU D C   1 
ATOM   3604 O O   . LEU D 1 38  ? 24.090 77.549 -10.440 1.00 83.96  ? 37  LEU D O   1 
ATOM   3605 C CB  . LEU D 1 38  ? 21.506 78.759 -9.218  1.00 80.52  ? 37  LEU D CB  1 
ATOM   3606 C CG  . LEU D 1 38  ? 20.815 79.043 -10.549 1.00 79.92  ? 37  LEU D CG  1 
ATOM   3607 C CD1 . LEU D 1 38  ? 21.146 77.928 -11.530 1.00 78.78  ? 37  LEU D CD1 1 
ATOM   3608 C CD2 . LEU D 1 38  ? 19.313 79.113 -10.339 1.00 80.15  ? 37  LEU D CD2 1 
ATOM   3609 N N   . ASN D 1 39  ? 24.134 79.665 -11.165 1.00 87.87  ? 38  ASN D N   1 
ATOM   3610 C CA  . ASN D 1 39  ? 24.903 79.330 -12.374 1.00 91.63  ? 38  ASN D CA  1 
ATOM   3611 C C   . ASN D 1 39  ? 26.421 79.392 -12.152 1.00 92.74  ? 38  ASN D C   1 
ATOM   3612 O O   . ASN D 1 39  ? 27.151 78.567 -12.681 1.00 93.16  ? 38  ASN D O   1 
ATOM   3613 C CB  . ASN D 1 39  ? 24.525 80.273 -13.518 1.00 94.02  ? 38  ASN D CB  1 
ATOM   3614 C CG  . ASN D 1 39  ? 24.622 81.737 -13.120 1.00 96.19  ? 38  ASN D CG  1 
ATOM   3615 O OD1 . ASN D 1 39  ? 25.703 82.246 -12.843 1.00 97.29  ? 38  ASN D OD1 1 
ATOM   3616 N ND2 . ASN D 1 39  ? 23.477 82.416 -13.081 1.00 97.50  ? 38  ASN D ND2 1 
ATOM   3617 N N   . GLU D 1 40  ? 26.872 80.375 -11.372 1.00 94.46  ? 39  GLU D N   1 
ATOM   3618 C CA  . GLU D 1 40  ? 28.317 80.545 -11.091 1.00 95.09  ? 39  GLU D CA  1 
ATOM   3619 C C   . GLU D 1 40  ? 29.032 79.206 -10.815 1.00 94.99  ? 39  GLU D C   1 
ATOM   3620 O O   . GLU D 1 40  ? 29.784 78.716 -11.648 1.00 95.37  ? 39  GLU D O   1 
ATOM   3621 C CB  . GLU D 1 40  ? 28.531 81.501 -9.911  1.00 96.80  ? 39  GLU D CB  1 
ATOM   3622 C CG  . GLU D 1 40  ? 28.351 82.976 -10.266 1.00 99.28  ? 39  GLU D CG  1 
ATOM   3623 C CD  . GLU D 1 40  ? 29.431 83.500 -11.211 1.00 101.22 ? 39  GLU D CD  1 
ATOM   3624 O OE1 . GLU D 1 40  ? 29.383 84.702 -11.575 1.00 102.16 ? 39  GLU D OE1 1 
ATOM   3625 O OE2 . GLU D 1 40  ? 30.329 82.713 -11.587 1.00 100.97 ? 39  GLU D OE2 1 
ATOM   3626 N N   . ASP D 1 41  ? 28.792 78.626 -9.647  1.00 93.50  ? 40  ASP D N   1 
ATOM   3627 C CA  . ASP D 1 41  ? 29.420 77.354 -9.332  1.00 92.94  ? 40  ASP D CA  1 
ATOM   3628 C C   . ASP D 1 41  ? 29.165 76.317 -10.431 1.00 92.42  ? 40  ASP D C   1 
ATOM   3629 O O   . ASP D 1 41  ? 28.285 76.504 -11.253 1.00 92.49  ? 40  ASP D O   1 
ATOM   3630 C CB  . ASP D 1 41  ? 28.892 76.836 -8.006  1.00 93.84  ? 40  ASP D CB  1 
ATOM   3631 C CG  . ASP D 1 41  ? 29.938 76.870 -6.925  1.00 94.99  ? 40  ASP D CG  1 
ATOM   3632 O OD1 . ASP D 1 41  ? 30.907 76.090 -7.018  1.00 96.06  ? 40  ASP D OD1 1 
ATOM   3633 O OD2 . ASP D 1 41  ? 29.805 77.683 -5.990  1.00 95.42  ? 40  ASP D OD2 1 
ATOM   3634 N N   . PHE D 1 42  ? 29.958 75.249 -10.445 1.00 92.15  ? 41  PHE D N   1 
ATOM   3635 C CA  . PHE D 1 42  ? 29.785 74.183 -11.445 1.00 91.96  ? 41  PHE D CA  1 
ATOM   3636 C C   . PHE D 1 42  ? 28.703 73.152 -10.976 1.00 91.65  ? 41  PHE D C   1 
ATOM   3637 O O   . PHE D 1 42  ? 28.032 72.513 -11.799 1.00 92.35  ? 41  PHE D O   1 
ATOM   3638 C CB  . PHE D 1 42  ? 31.136 73.489 -11.731 1.00 92.03  ? 41  PHE D CB  1 
ATOM   3639 C CG  . PHE D 1 42  ? 31.619 72.600 -10.621 1.00 91.95  ? 41  PHE D CG  1 
ATOM   3640 C CD1 . PHE D 1 42  ? 31.563 71.214 -10.750 1.00 91.46  ? 41  PHE D CD1 1 
ATOM   3641 C CD2 . PHE D 1 42  ? 32.095 73.145 -9.433  1.00 92.49  ? 41  PHE D CD2 1 
ATOM   3642 C CE1 . PHE D 1 42  ? 31.971 70.379 -9.704  1.00 92.80  ? 41  PHE D CE1 1 
ATOM   3643 C CE2 . PHE D 1 42  ? 32.507 72.321 -8.376  1.00 93.40  ? 41  PHE D CE2 1 
ATOM   3644 C CZ  . PHE D 1 42  ? 32.443 70.934 -8.511  1.00 93.33  ? 41  PHE D CZ  1 
ATOM   3645 N N   . GLU D 1 43  ? 28.532 73.041 -9.655  1.00 89.36  ? 42  GLU D N   1 
ATOM   3646 C CA  . GLU D 1 43  ? 27.537 72.120 -9.056  1.00 86.52  ? 42  GLU D CA  1 
ATOM   3647 C C   . GLU D 1 43  ? 26.344 72.887 -8.427  1.00 83.33  ? 42  GLU D C   1 
ATOM   3648 O O   . GLU D 1 43  ? 25.565 72.323 -7.672  1.00 83.03  ? 42  GLU D O   1 
ATOM   3649 C CB  . GLU D 1 43  ? 28.188 71.230 -7.981  1.00 88.39  ? 42  GLU D CB  1 
ATOM   3650 C CG  . GLU D 1 43  ? 28.406 71.898 -6.609  1.00 90.66  ? 42  GLU D CG  1 
ATOM   3651 C CD  . GLU D 1 43  ? 29.574 72.876 -6.589  1.00 91.74  ? 42  GLU D CD  1 
ATOM   3652 O OE1 . GLU D 1 43  ? 29.561 73.850 -7.371  1.00 92.38  ? 42  GLU D OE1 1 
ATOM   3653 O OE2 . GLU D 1 43  ? 30.507 72.671 -5.784  1.00 92.81  ? 42  GLU D OE2 1 
ATOM   3654 N N   . GLY D 1 44  ? 26.238 74.170 -8.756  1.00 79.42  ? 43  GLY D N   1 
ATOM   3655 C CA  . GLY D 1 44  ? 25.161 74.996 -8.244  1.00 75.91  ? 43  GLY D CA  1 
ATOM   3656 C C   . GLY D 1 44  ? 23.779 74.623 -8.758  1.00 73.23  ? 43  GLY D C   1 
ATOM   3657 O O   . GLY D 1 44  ? 22.829 74.616 -7.986  1.00 74.79  ? 43  GLY D O   1 
ATOM   3658 N N   . PRO D 1 45  ? 23.620 74.330 -10.056 1.00 69.52  ? 44  PRO D N   1 
ATOM   3659 C CA  . PRO D 1 45  ? 22.299 73.968 -10.557 1.00 66.58  ? 44  PRO D CA  1 
ATOM   3660 C C   . PRO D 1 45  ? 21.690 72.774 -9.796  1.00 64.06  ? 44  PRO D C   1 
ATOM   3661 O O   . PRO D 1 45  ? 20.604 72.877 -9.281  1.00 63.87  ? 44  PRO D O   1 
ATOM   3662 C CB  . PRO D 1 45  ? 22.566 73.653 -12.022 1.00 67.92  ? 44  PRO D CB  1 
ATOM   3663 C CG  . PRO D 1 45  ? 23.629 74.622 -12.358 1.00 69.11  ? 44  PRO D CG  1 
ATOM   3664 C CD  . PRO D 1 45  ? 24.561 74.504 -11.172 1.00 69.27  ? 44  PRO D CD  1 
ATOM   3665 N N   . PRO D 1 46  ? 22.400 71.633 -9.727  1.00 62.39  ? 45  PRO D N   1 
ATOM   3666 C CA  . PRO D 1 46  ? 21.873 70.460 -9.013  1.00 61.46  ? 45  PRO D CA  1 
ATOM   3667 C C   . PRO D 1 46  ? 21.471 70.804 -7.553  1.00 60.92  ? 45  PRO D C   1 
ATOM   3668 O O   . PRO D 1 46  ? 20.536 70.231 -7.006  1.00 61.96  ? 45  PRO D O   1 
ATOM   3669 C CB  . PRO D 1 46  ? 23.037 69.480 -9.050  1.00 60.64  ? 45  PRO D CB  1 
ATOM   3670 C CG  . PRO D 1 46  ? 23.731 69.841 -10.298 1.00 60.64  ? 45  PRO D CG  1 
ATOM   3671 C CD  . PRO D 1 46  ? 23.729 71.338 -10.276 1.00 60.44  ? 45  PRO D CD  1 
ATOM   3672 N N   . LEU D 1 47  ? 22.210 71.733 -6.950  1.00 58.29  ? 46  LEU D N   1 
ATOM   3673 C CA  . LEU D 1 47  ? 21.947 72.173 -5.578  1.00 57.33  ? 46  LEU D CA  1 
ATOM   3674 C C   . LEU D 1 47  ? 20.759 73.121 -5.509  1.00 56.06  ? 46  LEU D C   1 
ATOM   3675 O O   . LEU D 1 47  ? 20.003 73.096 -4.555  1.00 57.50  ? 46  LEU D O   1 
ATOM   3676 C CB  . LEU D 1 47  ? 23.172 72.880 -4.983  1.00 56.11  ? 46  LEU D CB  1 
ATOM   3677 C CG  . LEU D 1 47  ? 22.916 73.783 -3.774  1.00 54.57  ? 46  LEU D CG  1 
ATOM   3678 C CD1 . LEU D 1 47  ? 22.300 73.007 -2.658  1.00 54.41  ? 46  LEU D CD1 1 
ATOM   3679 C CD2 . LEU D 1 47  ? 24.213 74.395 -3.327  1.00 57.03  ? 46  LEU D CD2 1 
ATOM   3680 N N   . ALA D 1 48  ? 20.620 73.962 -6.522  1.00 53.18  ? 47  ALA D N   1 
ATOM   3681 C CA  . ALA D 1 48  ? 19.515 74.895 -6.538  1.00 52.04  ? 47  ALA D CA  1 
ATOM   3682 C C   . ALA D 1 48  ? 18.185 74.151 -6.695  1.00 51.64  ? 47  ALA D C   1 
ATOM   3683 O O   . ALA D 1 48  ? 17.211 74.499 -6.057  1.00 53.47  ? 47  ALA D O   1 
ATOM   3684 C CB  . ALA D 1 48  ? 19.691 75.915 -7.660  1.00 54.05  ? 47  ALA D CB  1 
ATOM   3685 N N   . THR D 1 49  ? 18.149 73.119 -7.532  1.00 49.77  ? 48  THR D N   1 
ATOM   3686 C CA  . THR D 1 49  ? 16.894 72.397 -7.688  1.00 48.72  ? 48  THR D CA  1 
ATOM   3687 C C   . THR D 1 49  ? 16.513 71.673 -6.391  1.00 48.86  ? 48  THR D C   1 
ATOM   3688 O O   . THR D 1 49  ? 15.341 71.533 -6.083  1.00 49.97  ? 48  THR D O   1 
ATOM   3689 C CB  . THR D 1 49  ? 16.932 71.398 -8.860  1.00 46.98  ? 48  THR D CB  1 
ATOM   3690 O OG1 . THR D 1 49  ? 17.926 70.397 -8.630  1.00 48.10  ? 48  THR D OG1 1 
ATOM   3691 C CG2 . THR D 1 49  ? 17.223 72.130 -10.138 1.00 45.29  ? 48  THR D CG2 1 
ATOM   3692 N N   . ARG D 1 50  ? 17.525 71.244 -5.640  1.00 49.04  ? 49  ARG D N   1 
ATOM   3693 C CA  . ARG D 1 50  ? 17.317 70.556 -4.354  1.00 48.21  ? 49  ARG D CA  1 
ATOM   3694 C C   . ARG D 1 50  ? 16.759 71.507 -3.301  1.00 46.15  ? 49  ARG D C   1 
ATOM   3695 O O   . ARG D 1 50  ? 15.778 71.210 -2.637  1.00 47.11  ? 49  ARG D O   1 
ATOM   3696 C CB  . ARG D 1 50  ? 18.625 69.992 -3.833  1.00 50.77  ? 49  ARG D CB  1 
ATOM   3697 C CG  . ARG D 1 50  ? 19.060 68.722 -4.501  1.00 57.55  ? 49  ARG D CG  1 
ATOM   3698 C CD  . ARG D 1 50  ? 20.439 68.351 -3.987  1.00 63.44  ? 49  ARG D CD  1 
ATOM   3699 N NE  . ARG D 1 50  ? 20.525 68.462 -2.532  1.00 66.86  ? 49  ARG D NE  1 
ATOM   3700 C CZ  . ARG D 1 50  ? 21.672 68.532 -1.867  1.00 69.42  ? 49  ARG D CZ  1 
ATOM   3701 N NH1 . ARG D 1 50  ? 22.814 68.504 -2.544  1.00 70.18  ? 49  ARG D NH1 1 
ATOM   3702 N NH2 . ARG D 1 50  ? 21.677 68.626 -0.537  1.00 70.55  ? 49  ARG D NH2 1 
ATOM   3703 N N   . LEU D 1 51  ? 17.413 72.644 -3.138  1.00 41.83  ? 50  LEU D N   1 
ATOM   3704 C CA  . LEU D 1 51  ? 16.929 73.597 -2.184  1.00 40.36  ? 50  LEU D CA  1 
ATOM   3705 C C   . LEU D 1 51  ? 15.481 73.993 -2.502  1.00 39.77  ? 50  LEU D C   1 
ATOM   3706 O O   . LEU D 1 51  ? 14.653 74.113 -1.614  1.00 40.73  ? 50  LEU D O   1 
ATOM   3707 C CB  . LEU D 1 51  ? 17.827 74.824 -2.184  1.00 38.62  ? 50  LEU D CB  1 
ATOM   3708 C CG  . LEU D 1 51  ? 19.192 74.473 -1.606  1.00 39.34  ? 50  LEU D CG  1 
ATOM   3709 C CD1 . LEU D 1 51  ? 20.212 75.562 -1.892  1.00 38.28  ? 50  LEU D CD1 1 
ATOM   3710 C CD2 . LEU D 1 51  ? 19.035 74.250 -0.125  1.00 38.04  ? 50  LEU D CD2 1 
ATOM   3711 N N   . LEU D 1 52  ? 15.199 74.170 -3.788  1.00 38.42  ? 51  LEU D N   1 
ATOM   3712 C CA  . LEU D 1 52  ? 13.862 74.559 -4.242  1.00 36.46  ? 51  LEU D CA  1 
ATOM   3713 C C   . LEU D 1 52  ? 12.778 73.475 -4.018  1.00 35.93  ? 51  LEU D C   1 
ATOM   3714 O O   . LEU D 1 52  ? 11.661 73.787 -3.590  1.00 36.21  ? 51  LEU D O   1 
ATOM   3715 C CB  . LEU D 1 52  ? 13.902 74.926 -5.724  1.00 35.97  ? 51  LEU D CB  1 
ATOM   3716 C CG  . LEU D 1 52  ? 14.384 76.326 -6.108  1.00 36.84  ? 51  LEU D CG  1 
ATOM   3717 C CD1 . LEU D 1 52  ? 14.634 76.345 -7.615  1.00 38.52  ? 51  LEU D CD1 1 
ATOM   3718 C CD2 . LEU D 1 52  ? 13.371 77.377 -5.711  1.00 31.95  ? 51  LEU D CD2 1 
ATOM   3719 N N   . ALA D 1 53  ? 13.108 72.223 -4.332  1.00 34.06  ? 52  ALA D N   1 
ATOM   3720 C CA  . ALA D 1 53  ? 12.151 71.141 -4.156  1.00 33.24  ? 52  ALA D CA  1 
ATOM   3721 C C   . ALA D 1 53  ? 11.762 71.044 -2.687  1.00 33.93  ? 52  ALA D C   1 
ATOM   3722 O O   . ALA D 1 53  ? 10.614 70.782 -2.349  1.00 35.41  ? 52  ALA D O   1 
ATOM   3723 C CB  . ALA D 1 53  ? 12.732 69.814 -4.646  1.00 30.65  ? 52  ALA D CB  1 
ATOM   3724 N N   . HIS D 1 54  ? 12.728 71.288 -1.810  1.00 33.34  ? 53  HIS D N   1 
ATOM   3725 C CA  . HIS D 1 54  ? 12.406 71.237 -0.401  1.00 33.19  ? 53  HIS D CA  1 
ATOM   3726 C C   . HIS D 1 54  ? 11.490 72.394 -0.025  1.00 34.98  ? 53  HIS D C   1 
ATOM   3727 O O   . HIS D 1 54  ? 10.496 72.203 0.647   1.00 38.92  ? 53  HIS D O   1 
ATOM   3728 C CB  . HIS D 1 54  ? 13.656 71.270 0.469   1.00 28.73  ? 53  HIS D CB  1 
ATOM   3729 C CG  . HIS D 1 54  ? 13.352 71.319 1.932   1.00 27.58  ? 53  HIS D CG  1 
ATOM   3730 N ND1 . HIS D 1 54  ? 13.547 72.451 2.693   1.00 30.58  ? 53  HIS D ND1 1 
ATOM   3731 C CD2 . HIS D 1 54  ? 12.823 70.394 2.765   1.00 25.91  ? 53  HIS D CD2 1 
ATOM   3732 C CE1 . HIS D 1 54  ? 13.153 72.220 3.932   1.00 29.07  ? 53  HIS D CE1 1 
ATOM   3733 N NE2 . HIS D 1 54  ? 12.710 70.979 4.002   1.00 27.15  ? 53  HIS D NE2 1 
ATOM   3734 N N   . LYS D 1 55  ? 11.838 73.592 -0.475  1.00 36.65  ? 54  LYS D N   1 
ATOM   3735 C CA  . LYS D 1 55  ? 11.026 74.794 -0.191  1.00 37.68  ? 54  LYS D CA  1 
ATOM   3736 C C   . LYS D 1 55  ? 9.602  74.697 -0.815  1.00 37.85  ? 54  LYS D C   1 
ATOM   3737 O O   . LYS D 1 55  ? 8.637  75.172 -0.233  1.00 38.27  ? 54  LYS D O   1 
ATOM   3738 C CB  . LYS D 1 55  ? 11.755 76.033 -0.726  1.00 37.81  ? 54  LYS D CB  1 
ATOM   3739 C CG  . LYS D 1 55  ? 12.259 77.024 0.329   1.00 41.77  ? 54  LYS D CG  1 
ATOM   3740 C CD  . LYS D 1 55  ? 13.209 76.428 1.351   1.00 42.71  ? 54  LYS D CD  1 
ATOM   3741 C CE  . LYS D 1 55  ? 13.687 77.484 2.348   1.00 41.86  ? 54  LYS D CE  1 
ATOM   3742 N NZ  . LYS D 1 55  ? 14.069 76.874 3.654   1.00 46.40  ? 54  LYS D NZ  1 
ATOM   3743 N N   . ILE D 1 56  ? 9.496  74.064 -1.987  1.00 37.53  ? 55  ILE D N   1 
ATOM   3744 C CA  . ILE D 1 56  ? 8.196  73.913 -2.682  1.00 37.37  ? 55  ILE D CA  1 
ATOM   3745 C C   . ILE D 1 56  ? 7.218  72.922 -1.939  1.00 38.64  ? 55  ILE D C   1 
ATOM   3746 O O   . ILE D 1 56  ? 6.008  73.064 -1.994  1.00 39.87  ? 55  ILE D O   1 
ATOM   3747 C CB  . ILE D 1 56  ? 8.446  73.454 -4.159  1.00 36.65  ? 55  ILE D CB  1 
ATOM   3748 C CG1 . ILE D 1 56  ? 9.177  74.566 -4.925  1.00 36.83  ? 55  ILE D CG1 1 
ATOM   3749 C CG2 . ILE D 1 56  ? 7.139  73.149 -4.864  1.00 36.09  ? 55  ILE D CG2 1 
ATOM   3750 C CD1 . ILE D 1 56  ? 9.773  74.147 -6.259  1.00 33.63  ? 55  ILE D CD1 1 
ATOM   3751 N N   . GLN D 1 57  ? 7.780  71.953 -1.230  1.00 38.16  ? 56  GLN D N   1 
ATOM   3752 C CA  . GLN D 1 57  ? 6.987  70.963 -0.512  1.00 38.99  ? 56  GLN D CA  1 
ATOM   3753 C C   . GLN D 1 57  ? 6.670  71.412 0.921   1.00 40.57  ? 56  GLN D C   1 
ATOM   3754 O O   . GLN D 1 57  ? 6.128  70.652 1.713   1.00 43.17  ? 56  GLN D O   1 
ATOM   3755 C CB  . GLN D 1 57  ? 7.747  69.634 -0.492  1.00 37.73  ? 56  GLN D CB  1 
ATOM   3756 C CG  . GLN D 1 57  ? 8.217  69.252 -1.889  1.00 38.26  ? 56  GLN D CG  1 
ATOM   3757 C CD  . GLN D 1 57  ? 9.203  68.107 -1.912  1.00 37.96  ? 56  GLN D CD  1 
ATOM   3758 O OE1 . GLN D 1 57  ? 9.984  67.950 -1.001  1.00 39.65  ? 56  GLN D OE1 1 
ATOM   3759 N NE2 . GLN D 1 57  ? 9.181  67.317 -2.982  1.00 34.99  ? 56  GLN D NE2 1 
ATOM   3760 N N   . SER D 1 58  ? 7.008  72.656 1.231   1.00 39.53  ? 57  SER D N   1 
ATOM   3761 C CA  . SER D 1 58  ? 6.779  73.226 2.575   1.00 39.57  ? 57  SER D CA  1 
ATOM   3762 C C   . SER D 1 58  ? 5.299  73.291 3.007   1.00 39.38  ? 57  SER D C   1 
ATOM   3763 O O   . SER D 1 58  ? 4.455  73.750 2.267   1.00 41.11  ? 57  SER D O   1 
ATOM   3764 C CB  . SER D 1 58  ? 7.359  74.647 2.637   1.00 40.41  ? 57  SER D CB  1 
ATOM   3765 O OG  . SER D 1 58  ? 6.810  75.373 3.714   1.00 40.93  ? 57  SER D OG  1 
ATOM   3766 N N   . PRO D 1 59  ? 4.990  72.837 4.229   1.00 39.48  ? 58  PRO D N   1 
ATOM   3767 C CA  . PRO D 1 59  ? 3.616  72.868 4.736   1.00 38.68  ? 58  PRO D CA  1 
ATOM   3768 C C   . PRO D 1 59  ? 3.075  74.313 4.720   1.00 38.15  ? 58  PRO D C   1 
ATOM   3769 O O   . PRO D 1 59  ? 1.876  74.534 4.641   1.00 36.27  ? 58  PRO D O   1 
ATOM   3770 C CB  . PRO D 1 59  ? 3.761  72.356 6.170   1.00 38.21  ? 58  PRO D CB  1 
ATOM   3771 C CG  . PRO D 1 59  ? 4.860  71.415 6.078   1.00 39.29  ? 58  PRO D CG  1 
ATOM   3772 C CD  . PRO D 1 59  ? 5.864  72.114 5.164   1.00 39.60  ? 58  PRO D CD  1 
ATOM   3773 N N   . GLN D 1 60  ? 3.998  75.267 4.817   1.00 38.28  ? 59  GLN D N   1 
ATOM   3774 C CA  . GLN D 1 60  ? 3.656  76.701 4.824   1.00 40.47  ? 59  GLN D CA  1 
ATOM   3775 C C   . GLN D 1 60  ? 3.509  77.273 3.394   1.00 40.86  ? 59  GLN D C   1 
ATOM   3776 O O   . GLN D 1 60  ? 4.495  77.511 2.706   1.00 39.17  ? 59  GLN D O   1 
ATOM   3777 C CB  . GLN D 1 60  ? 4.719  77.478 5.593   1.00 41.85  ? 59  GLN D CB  1 
ATOM   3778 C CG  . GLN D 1 60  ? 4.912  76.990 7.020   1.00 41.39  ? 59  GLN D CG  1 
ATOM   3779 C CD  . GLN D 1 60  ? 6.033  77.725 7.720   1.00 42.12  ? 59  GLN D CD  1 
ATOM   3780 O OE1 . GLN D 1 60  ? 6.016  78.952 7.822   1.00 41.06  ? 59  GLN D OE1 1 
ATOM   3781 N NE2 . GLN D 1 60  ? 7.025  76.973 8.202   1.00 40.18  ? 59  GLN D NE2 1 
ATOM   3782 N N   . GLU D 1 61  ? 2.258  77.501 2.993   1.00 42.52  ? 60  GLU D N   1 
ATOM   3783 C CA  . GLU D 1 61  ? 1.921  77.966 1.633   1.00 42.89  ? 60  GLU D CA  1 
ATOM   3784 C C   . GLU D 1 61  ? 2.753  79.139 1.094   1.00 42.07  ? 60  GLU D C   1 
ATOM   3785 O O   . GLU D 1 61  ? 3.361  79.033 0.031   1.00 42.10  ? 60  GLU D O   1 
ATOM   3786 C CB  . GLU D 1 61  ? 0.449  78.326 1.558   1.00 44.27  ? 60  GLU D CB  1 
ATOM   3787 C CG  . GLU D 1 61  ? -0.083 78.261 0.153   1.00 50.11  ? 60  GLU D CG  1 
ATOM   3788 C CD  . GLU D 1 61  ? -1.462 78.860 0.041   1.00 53.50  ? 60  GLU D CD  1 
ATOM   3789 O OE1 . GLU D 1 61  ? -1.576 80.098 0.160   1.00 54.99  ? 60  GLU D OE1 1 
ATOM   3790 O OE2 . GLU D 1 61  ? -2.429 78.094 -0.155  1.00 55.55  ? 60  GLU D OE2 1 
ATOM   3791 N N   . TRP D 1 62  ? 2.753  80.253 1.816   1.00 41.72  ? 61  TRP D N   1 
ATOM   3792 C CA  . TRP D 1 62  ? 3.504  81.436 1.370   1.00 42.43  ? 61  TRP D CA  1 
ATOM   3793 C C   . TRP D 1 62  ? 4.993  81.099 1.052   1.00 42.03  ? 61  TRP D C   1 
ATOM   3794 O O   . TRP D 1 62  ? 5.629  81.745 0.213   1.00 40.51  ? 61  TRP D O   1 
ATOM   3795 C CB  . TRP D 1 62  ? 3.400  82.533 2.432   1.00 45.61  ? 61  TRP D CB  1 
ATOM   3796 C CG  . TRP D 1 62  ? 4.139  83.791 2.093   1.00 49.22  ? 61  TRP D CG  1 
ATOM   3797 C CD1 . TRP D 1 62  ? 4.973  84.494 2.915   1.00 52.11  ? 61  TRP D CD1 1 
ATOM   3798 C CD2 . TRP D 1 62  ? 4.147  84.477 0.840   1.00 50.20  ? 61  TRP D CD2 1 
ATOM   3799 N NE1 . TRP D 1 62  ? 5.504  85.571 2.252   1.00 52.26  ? 61  TRP D NE1 1 
ATOM   3800 C CE2 . TRP D 1 62  ? 5.013  85.589 0.977   1.00 50.57  ? 61  TRP D CE2 1 
ATOM   3801 C CE3 . TRP D 1 62  ? 3.506  84.269 -0.382  1.00 51.53  ? 61  TRP D CE3 1 
ATOM   3802 C CZ2 . TRP D 1 62  ? 5.262  86.478 -0.055  1.00 50.19  ? 61  TRP D CZ2 1 
ATOM   3803 C CZ3 . TRP D 1 62  ? 3.753  85.157 -1.417  1.00 52.29  ? 61  TRP D CZ3 1 
ATOM   3804 C CH2 . TRP D 1 62  ? 4.625  86.252 -1.244  1.00 52.01  ? 61  TRP D CH2 1 
ATOM   3805 N N   . GLU D 1 63  ? 5.523  80.084 1.735   1.00 41.74  ? 62  GLU D N   1 
ATOM   3806 C CA  . GLU D 1 63  ? 6.915  79.653 1.516   1.00 40.07  ? 62  GLU D CA  1 
ATOM   3807 C C   . GLU D 1 63  ? 7.072  78.877 0.187   1.00 40.10  ? 62  GLU D C   1 
ATOM   3808 O O   . GLU D 1 63  ? 8.020  79.096 -0.554  1.00 38.92  ? 62  GLU D O   1 
ATOM   3809 C CB  . GLU D 1 63  ? 7.399  78.763 2.661   1.00 39.17  ? 62  GLU D CB  1 
ATOM   3810 C CG  . GLU D 1 63  ? 8.872  78.429 2.516   1.00 41.89  ? 62  GLU D CG  1 
ATOM   3811 C CD  . GLU D 1 63  ? 9.465  77.710 3.714   1.00 43.33  ? 62  GLU D CD  1 
ATOM   3812 O OE1 . GLU D 1 63  ? 10.689 77.803 3.888   1.00 44.15  ? 62  GLU D OE1 1 
ATOM   3813 O OE2 . GLU D 1 63  ? 8.729  77.045 4.469   1.00 44.90  ? 62  GLU D OE2 1 
ATOM   3814 N N   . ALA D 1 64  ? 6.132  77.968 -0.068  1.00 39.38  ? 63  ALA D N   1 
ATOM   3815 C CA  . ALA D 1 64  ? 6.143  77.150 -1.267  1.00 40.41  ? 63  ALA D CA  1 
ATOM   3816 C C   . ALA D 1 64  ? 5.807  77.995 -2.508  1.00 42.46  ? 63  ALA D C   1 
ATOM   3817 O O   . ALA D 1 64  ? 6.451  77.851 -3.553  1.00 41.83  ? 63  ALA D O   1 
ATOM   3818 C CB  . ALA D 1 64  ? 5.148  75.991 -1.127  1.00 41.20  ? 63  ALA D CB  1 
ATOM   3819 N N   . ILE D 1 65  ? 4.809  78.872 -2.371  1.00 42.30  ? 64  ILE D N   1 
ATOM   3820 C CA  . ILE D 1 65  ? 4.426  79.749 -3.482  1.00 43.87  ? 64  ILE D CA  1 
ATOM   3821 C C   . ILE D 1 65  ? 5.600  80.655 -3.897  1.00 43.76  ? 64  ILE D C   1 
ATOM   3822 O O   . ILE D 1 65  ? 5.946  80.754 -5.085  1.00 43.35  ? 64  ILE D O   1 
ATOM   3823 C CB  . ILE D 1 65  ? 3.204  80.603 -3.126  1.00 46.12  ? 64  ILE D CB  1 
ATOM   3824 C CG1 . ILE D 1 65  ? 1.964  79.710 -3.121  1.00 48.49  ? 64  ILE D CG1 1 
ATOM   3825 C CG2 . ILE D 1 65  ? 3.033  81.733 -4.130  1.00 44.82  ? 64  ILE D CG2 1 
ATOM   3826 C CD1 . ILE D 1 65  ? 0.752  80.335 -2.468  1.00 54.04  ? 64  ILE D CD1 1 
ATOM   3827 N N   . GLN D 1 66  ? 6.218  81.304 -2.920  1.00 43.61  ? 65  GLN D N   1 
ATOM   3828 C CA  . GLN D 1 66  ? 7.364  82.121 -3.259  1.00 44.35  ? 65  GLN D CA  1 
ATOM   3829 C C   . GLN D 1 66  ? 8.413  81.237 -3.944  1.00 44.25  ? 65  GLN D C   1 
ATOM   3830 O O   . GLN D 1 66  ? 8.960  81.600 -4.986  1.00 45.25  ? 65  GLN D O   1 
ATOM   3831 C CB  . GLN D 1 66  ? 7.968  82.777 -2.019  1.00 44.70  ? 65  GLN D CB  1 
ATOM   3832 C CG  . GLN D 1 66  ? 7.313  84.069 -1.638  1.00 47.07  ? 65  GLN D CG  1 
ATOM   3833 C CD  . GLN D 1 66  ? 8.001  84.722 -0.468  1.00 51.77  ? 65  GLN D CD  1 
ATOM   3834 O OE1 . GLN D 1 66  ? 7.866  84.279 0.663   1.00 52.37  ? 65  GLN D OE1 1 
ATOM   3835 N NE2 . GLN D 1 66  ? 8.761  85.781 -0.741  1.00 52.16  ? 65  GLN D NE2 1 
ATOM   3836 N N   . ALA D 1 67  ? 8.654  80.061 -3.368  1.00 42.84  ? 66  ALA D N   1 
ATOM   3837 C CA  . ALA D 1 67  ? 9.641  79.143 -3.951  1.00 42.59  ? 66  ALA D CA  1 
ATOM   3838 C C   . ALA D 1 67  ? 9.297  78.820 -5.424  1.00 42.02  ? 66  ALA D C   1 
ATOM   3839 O O   . ALA D 1 67  ? 10.184 78.629 -6.246  1.00 42.03  ? 66  ALA D O   1 
ATOM   3840 C CB  . ALA D 1 67  ? 9.726  77.861 -3.132  1.00 41.76  ? 66  ALA D CB  1 
ATOM   3841 N N   . LEU D 1 68  ? 8.005  78.764 -5.738  1.00 40.55  ? 67  LEU D N   1 
ATOM   3842 C CA  . LEU D 1 68  ? 7.600  78.499 -7.119  1.00 39.79  ? 67  LEU D CA  1 
ATOM   3843 C C   . LEU D 1 68  ? 7.924  79.732 -7.981  1.00 40.60  ? 67  LEU D C   1 
ATOM   3844 O O   . LEU D 1 68  ? 8.486  79.620 -9.079  1.00 39.58  ? 67  LEU D O   1 
ATOM   3845 C CB  . LEU D 1 68  ? 6.111  78.117 -7.191  1.00 36.93  ? 67  LEU D CB  1 
ATOM   3846 C CG  . LEU D 1 68  ? 5.851  76.703 -6.619  1.00 34.74  ? 67  LEU D CG  1 
ATOM   3847 C CD1 . LEU D 1 68  ? 4.378  76.332 -6.677  1.00 33.37  ? 67  LEU D CD1 1 
ATOM   3848 C CD2 . LEU D 1 68  ? 6.677  75.709 -7.401  1.00 31.93  ? 67  LEU D CD2 1 
ATOM   3849 N N   . THR D 1 69  ? 7.606  80.909 -7.455  1.00 41.51  ? 68  THR D N   1 
ATOM   3850 C CA  . THR D 1 69  ? 7.947  82.132 -8.179  1.00 41.27  ? 68  THR D CA  1 
ATOM   3851 C C   . THR D 1 69  ? 9.476  82.149 -8.449  1.00 41.72  ? 68  THR D C   1 
ATOM   3852 O O   . THR D 1 69  ? 9.927  82.600 -9.504  1.00 42.25  ? 68  THR D O   1 
ATOM   3853 C CB  . THR D 1 69  ? 7.533  83.369 -7.383  1.00 42.10  ? 68  THR D CB  1 
ATOM   3854 O OG1 . THR D 1 69  ? 6.100  83.407 -7.277  1.00 42.49  ? 68  THR D OG1 1 
ATOM   3855 C CG2 . THR D 1 69  ? 8.023  84.626 -8.071  1.00 40.39  ? 68  THR D CG2 1 
ATOM   3856 N N   . VAL D 1 70  ? 10.257 81.636 -7.496  1.00 41.78  ? 69  VAL D N   1 
ATOM   3857 C CA  . VAL D 1 70  ? 11.729 81.559 -7.683  1.00 41.25  ? 69  VAL D CA  1 
ATOM   3858 C C   . VAL D 1 70  ? 12.081 80.528 -8.783  1.00 42.63  ? 69  VAL D C   1 
ATOM   3859 O O   . VAL D 1 70  ? 13.069 80.658 -9.486  1.00 45.49  ? 69  VAL D O   1 
ATOM   3860 C CB  . VAL D 1 70  ? 12.468 81.163 -6.377  1.00 38.26  ? 69  VAL D CB  1 
ATOM   3861 C CG1 . VAL D 1 70  ? 13.900 80.720 -6.687  1.00 35.87  ? 69  VAL D CG1 1 
ATOM   3862 C CG2 . VAL D 1 70  ? 12.502 82.333 -5.438  1.00 36.33  ? 69  VAL D CG2 1 
ATOM   3863 N N   . LEU D 1 71  ? 11.249 79.509 -8.914  1.00 41.84  ? 70  LEU D N   1 
ATOM   3864 C CA  . LEU D 1 71  ? 11.486 78.502 -9.921  1.00 42.24  ? 70  LEU D CA  1 
ATOM   3865 C C   . LEU D 1 71  ? 11.055 79.030 -11.295 1.00 43.63  ? 70  LEU D C   1 
ATOM   3866 O O   . LEU D 1 71  ? 11.745 78.870 -12.278 1.00 42.74  ? 70  LEU D O   1 
ATOM   3867 C CB  . LEU D 1 71  ? 10.706 77.248 -9.565  1.00 38.80  ? 70  LEU D CB  1 
ATOM   3868 C CG  . LEU D 1 71  ? 10.548 76.197 -10.645 1.00 36.70  ? 70  LEU D CG  1 
ATOM   3869 C CD1 . LEU D 1 71  ? 11.900 75.670 -11.121 1.00 30.84  ? 70  LEU D CD1 1 
ATOM   3870 C CD2 . LEU D 1 71  ? 9.686  75.103 -10.054 1.00 37.23  ? 70  LEU D CD2 1 
ATOM   3871 N N   . GLU D 1 72  ? 9.892  79.661 -11.320 1.00 46.14  ? 71  GLU D N   1 
ATOM   3872 C CA  . GLU D 1 72  ? 9.379  80.244 -12.540 1.00 49.38  ? 71  GLU D CA  1 
ATOM   3873 C C   . GLU D 1 72  ? 10.404 81.252 -13.095 1.00 50.43  ? 71  GLU D C   1 
ATOM   3874 O O   . GLU D 1 72  ? 10.888 81.124 -14.225 1.00 50.16  ? 71  GLU D O   1 
ATOM   3875 C CB  . GLU D 1 72  ? 8.046  80.922 -12.232 1.00 51.81  ? 71  GLU D CB  1 
ATOM   3876 C CG  . GLU D 1 72  ? 7.485  81.819 -13.313 1.00 54.21  ? 71  GLU D CG  1 
ATOM   3877 C CD  . GLU D 1 72  ? 6.030  82.187 -13.039 1.00 57.07  ? 71  GLU D CD  1 
ATOM   3878 O OE1 . GLU D 1 72  ? 5.651  82.316 -11.855 1.00 56.87  ? 71  GLU D OE1 1 
ATOM   3879 O OE2 . GLU D 1 72  ? 5.258  82.358 -14.006 1.00 59.88  ? 71  GLU D OE2 1 
ATOM   3880 N N   . THR D 1 73  ? 10.756 82.215 -12.252 1.00 51.87  ? 72  THR D N   1 
ATOM   3881 C CA  . THR D 1 73  ? 11.718 83.248 -12.618 1.00 52.51  ? 72  THR D CA  1 
ATOM   3882 C C   . THR D 1 73  ? 13.086 82.694 -13.083 1.00 53.92  ? 72  THR D C   1 
ATOM   3883 O O   . THR D 1 73  ? 13.605 83.140 -14.094 1.00 54.84  ? 72  THR D O   1 
ATOM   3884 C CB  . THR D 1 73  ? 11.927 84.235 -11.457 1.00 52.11  ? 72  THR D CB  1 
ATOM   3885 O OG1 . THR D 1 73  ? 10.759 85.058 -11.331 1.00 50.86  ? 72  THR D OG1 1 
ATOM   3886 C CG2 . THR D 1 73  ? 13.154 85.109 -11.701 1.00 49.04  ? 72  THR D CG2 1 
ATOM   3887 N N   . CYS D 1 74  ? 13.665 81.738 -12.362 1.00 54.40  ? 73  CYS D N   1 
ATOM   3888 C CA  . CYS D 1 74  ? 14.973 81.198 -12.802 1.00 54.96  ? 73  CYS D CA  1 
ATOM   3889 C C   . CYS D 1 74  ? 14.890 80.444 -14.141 1.00 55.38  ? 73  CYS D C   1 
ATOM   3890 O O   . CYS D 1 74  ? 15.856 80.430 -14.894 1.00 55.50  ? 73  CYS D O   1 
ATOM   3891 C CB  . CYS D 1 74  ? 15.584 80.251 -11.769 1.00 55.13  ? 73  CYS D CB  1 
ATOM   3892 S SG  . CYS D 1 74  ? 16.141 80.982 -10.192 1.00 59.47  ? 73  CYS D SG  1 
ATOM   3893 N N   . MET D 1 75  ? 13.751 79.804 -14.414 1.00 54.33  ? 74  MET D N   1 
ATOM   3894 C CA  . MET D 1 75  ? 13.608 79.063 -15.675 1.00 54.86  ? 74  MET D CA  1 
ATOM   3895 C C   . MET D 1 75  ? 13.684 80.021 -16.886 1.00 56.55  ? 74  MET D C   1 
ATOM   3896 O O   . MET D 1 75  ? 14.264 79.709 -17.935 1.00 56.45  ? 74  MET D O   1 
ATOM   3897 C CB  . MET D 1 75  ? 12.282 78.289 -15.712 1.00 53.69  ? 74  MET D CB  1 
ATOM   3898 C CG  . MET D 1 75  ? 12.280 76.953 -14.961 1.00 53.31  ? 74  MET D CG  1 
ATOM   3899 S SD  . MET D 1 75  ? 13.531 75.734 -15.520 1.00 52.00  ? 74  MET D SD  1 
ATOM   3900 C CE  . MET D 1 75  ? 12.672 74.960 -16.872 1.00 52.83  ? 74  MET D CE  1 
ATOM   3901 N N   . LYS D 1 76  ? 13.095 81.193 -16.701 1.00 56.82  ? 75  LYS D N   1 
ATOM   3902 C CA  . LYS D 1 76  ? 13.077 82.204 -17.731 1.00 58.26  ? 75  LYS D CA  1 
ATOM   3903 C C   . LYS D 1 76  ? 14.453 82.880 -17.930 1.00 59.85  ? 75  LYS D C   1 
ATOM   3904 O O   . LYS D 1 76  ? 14.922 83.015 -19.061 1.00 60.60  ? 75  LYS D O   1 
ATOM   3905 C CB  . LYS D 1 76  ? 12.020 83.244 -17.386 1.00 57.46  ? 75  LYS D CB  1 
ATOM   3906 C CG  . LYS D 1 76  ? 10.628 82.658 -17.302 1.00 59.91  ? 75  LYS D CG  1 
ATOM   3907 C CD  . LYS D 1 76  ? 9.588  83.727 -17.018 1.00 60.86  ? 75  LYS D CD  1 
ATOM   3908 C CE  . LYS D 1 76  ? 8.179  83.148 -17.043 1.00 61.60  ? 75  LYS D CE  1 
ATOM   3909 N NZ  . LYS D 1 76  ? 7.149  84.213 -16.826 1.00 62.16  ? 75  LYS D NZ  1 
ATOM   3910 N N   . SER D 1 77  ? 15.082 83.272 -16.822 1.00 60.52  ? 76  SER D N   1 
ATOM   3911 C CA  . SER D 1 77  ? 16.395 83.959 -16.839 1.00 61.51  ? 76  SER D CA  1 
ATOM   3912 C C   . SER D 1 77  ? 17.588 83.080 -17.263 1.00 62.95  ? 76  SER D C   1 
ATOM   3913 O O   . SER D 1 77  ? 18.301 83.401 -18.202 1.00 64.12  ? 76  SER D O   1 
ATOM   3914 C CB  . SER D 1 77  ? 16.707 84.547 -15.460 1.00 60.96  ? 76  SER D CB  1 
ATOM   3915 O OG  . SER D 1 77  ? 15.813 85.598 -15.133 1.00 60.22  ? 76  SER D OG  1 
ATOM   3916 N N   . CYS D 1 78  ? 17.791 81.984 -16.545 1.00 64.11  ? 77  CYS D N   1 
ATOM   3917 C CA  . CYS D 1 78  ? 18.911 81.074 -16.810 1.00 64.24  ? 77  CYS D CA  1 
ATOM   3918 C C   . CYS D 1 78  ? 18.797 80.320 -18.159 1.00 65.13  ? 77  CYS D C   1 
ATOM   3919 O O   . CYS D 1 78  ? 17.795 80.427 -18.859 1.00 64.39  ? 77  CYS D O   1 
ATOM   3920 C CB  . CYS D 1 78  ? 19.038 80.099 -15.636 1.00 64.37  ? 77  CYS D CB  1 
ATOM   3921 S SG  . CYS D 1 78  ? 19.017 80.951 -14.023 1.00 63.30  ? 77  CYS D SG  1 
ATOM   3922 N N   . GLY D 1 79  ? 19.843 79.574 -18.502 1.00 66.49  ? 78  GLY D N   1 
ATOM   3923 C CA  . GLY D 1 79  ? 19.841 78.848 -19.757 1.00 68.35  ? 78  GLY D CA  1 
ATOM   3924 C C   . GLY D 1 79  ? 19.912 77.343 -19.607 1.00 69.93  ? 78  GLY D C   1 
ATOM   3925 O O   . GLY D 1 79  ? 19.507 76.793 -18.588 1.00 70.59  ? 78  GLY D O   1 
ATOM   3926 N N   . LYS D 1 80  ? 20.431 76.686 -20.644 1.00 70.81  ? 79  LYS D N   1 
ATOM   3927 C CA  . LYS D 1 80  ? 20.578 75.217 -20.684 1.00 71.04  ? 79  LYS D CA  1 
ATOM   3928 C C   . LYS D 1 80  ? 21.049 74.638 -19.332 1.00 70.94  ? 79  LYS D C   1 
ATOM   3929 O O   . LYS D 1 80  ? 20.742 73.503 -19.000 1.00 71.66  ? 79  LYS D O   1 
ATOM   3930 C CB  . LYS D 1 80  ? 21.567 74.838 -21.792 1.00 71.51  ? 79  LYS D CB  1 
ATOM   3931 C CG  . LYS D 1 80  ? 21.762 73.351 -22.020 1.00 72.22  ? 79  LYS D CG  1 
ATOM   3932 C CD  . LYS D 1 80  ? 20.551 72.706 -22.660 1.00 73.30  ? 79  LYS D CD  1 
ATOM   3933 C CE  . LYS D 1 80  ? 20.831 71.248 -23.053 1.00 72.71  ? 79  LYS D CE  1 
ATOM   3934 N NZ  . LYS D 1 80  ? 19.588 70.568 -23.532 1.00 70.78  ? 79  LYS D NZ  1 
ATOM   3935 N N   . ARG D 1 81  ? 21.790 75.438 -18.569 1.00 70.37  ? 80  ARG D N   1 
ATOM   3936 C CA  . ARG D 1 81  ? 22.291 75.004 -17.247 1.00 69.09  ? 80  ARG D CA  1 
ATOM   3937 C C   . ARG D 1 81  ? 21.149 74.501 -16.334 1.00 65.81  ? 80  ARG D C   1 
ATOM   3938 O O   . ARG D 1 81  ? 20.983 73.302 -16.111 1.00 63.76  ? 80  ARG D O   1 
ATOM   3939 C CB  . ARG D 1 81  ? 23.024 76.166 -16.563 1.00 72.72  ? 80  ARG D CB  1 
ATOM   3940 C CG  . ARG D 1 81  ? 24.551 76.127 -16.694 1.00 77.81  ? 80  ARG D CG  1 
ATOM   3941 C CD  . ARG D 1 81  ? 25.170 75.108 -15.732 1.00 80.89  ? 80  ARG D CD  1 
ATOM   3942 N NE  . ARG D 1 81  ? 26.603 75.315 -15.544 1.00 84.43  ? 80  ARG D NE  1 
ATOM   3943 C CZ  . ARG D 1 81  ? 27.152 76.468 -15.169 1.00 86.93  ? 80  ARG D CZ  1 
ATOM   3944 N NH1 . ARG D 1 81  ? 26.387 77.533 -14.942 1.00 87.19  ? 80  ARG D NH1 1 
ATOM   3945 N NH2 . ARG D 1 81  ? 28.469 76.555 -15.017 1.00 87.84  ? 80  ARG D NH2 1 
ATOM   3946 N N   . PHE D 1 82  ? 20.391 75.457 -15.813 1.00 62.55  ? 81  PHE D N   1 
ATOM   3947 C CA  . PHE D 1 82  ? 19.254 75.182 -14.945 1.00 59.06  ? 81  PHE D CA  1 
ATOM   3948 C C   . PHE D 1 82  ? 18.219 74.299 -15.690 1.00 58.47  ? 81  PHE D C   1 
ATOM   3949 O O   . PHE D 1 82  ? 17.785 73.266 -15.184 1.00 57.83  ? 81  PHE D O   1 
ATOM   3950 C CB  . PHE D 1 82  ? 18.615 76.513 -14.542 1.00 56.38  ? 81  PHE D CB  1 
ATOM   3951 C CG  . PHE D 1 82  ? 17.619 76.412 -13.419 1.00 55.08  ? 81  PHE D CG  1 
ATOM   3952 C CD1 . PHE D 1 82  ? 16.368 77.004 -13.529 1.00 52.96  ? 81  PHE D CD1 1 
ATOM   3953 C CD2 . PHE D 1 82  ? 17.942 75.769 -12.232 1.00 54.02  ? 81  PHE D CD2 1 
ATOM   3954 C CE1 . PHE D 1 82  ? 15.467 76.967 -12.474 1.00 50.77  ? 81  PHE D CE1 1 
ATOM   3955 C CE2 . PHE D 1 82  ? 17.038 75.734 -11.178 1.00 52.99  ? 81  PHE D CE2 1 
ATOM   3956 C CZ  . PHE D 1 82  ? 15.801 76.332 -11.304 1.00 50.42  ? 81  PHE D CZ  1 
ATOM   3957 N N   . HIS D 1 83  ? 17.856 74.733 -16.896 1.00 57.26  ? 82  HIS D N   1 
ATOM   3958 C CA  . HIS D 1 83  ? 16.880 74.013 -17.734 1.00 57.28  ? 82  HIS D CA  1 
ATOM   3959 C C   . HIS D 1 83  ? 17.072 72.475 -17.691 1.00 55.42  ? 82  HIS D C   1 
ATOM   3960 O O   . HIS D 1 83  ? 16.128 71.740 -17.510 1.00 54.47  ? 82  HIS D O   1 
ATOM   3961 C CB  . HIS D 1 83  ? 16.957 74.524 -19.180 1.00 58.37  ? 82  HIS D CB  1 
ATOM   3962 C CG  . HIS D 1 83  ? 16.384 75.895 -19.366 1.00 59.68  ? 82  HIS D CG  1 
ATOM   3963 N ND1 . HIS D 1 83  ? 16.613 76.653 -20.500 1.00 60.61  ? 82  HIS D ND1 1 
ATOM   3964 C CD2 . HIS D 1 83  ? 15.564 76.639 -18.587 1.00 60.43  ? 82  HIS D CD2 1 
ATOM   3965 C CE1 . HIS D 1 83  ? 15.960 77.794 -20.408 1.00 60.82  ? 82  HIS D CE1 1 
ATOM   3966 N NE2 . HIS D 1 83  ? 15.313 77.814 -19.254 1.00 60.86  ? 82  HIS D NE2 1 
ATOM   3967 N N   . ASP D 1 84  ? 18.304 72.020 -17.858 1.00 54.10  ? 83  ASP D N   1 
ATOM   3968 C CA  . ASP D 1 84  ? 18.603 70.593 -17.806 1.00 53.14  ? 83  ASP D CA  1 
ATOM   3969 C C   . ASP D 1 84  ? 18.309 69.983 -16.423 1.00 52.44  ? 83  ASP D C   1 
ATOM   3970 O O   . ASP D 1 84  ? 17.778 68.877 -16.346 1.00 52.86  ? 83  ASP D O   1 
ATOM   3971 C CB  . ASP D 1 84  ? 20.072 70.356 -18.148 1.00 55.08  ? 83  ASP D CB  1 
ATOM   3972 C CG  . ASP D 1 84  ? 20.306 70.185 -19.635 1.00 58.64  ? 83  ASP D CG  1 
ATOM   3973 O OD1 . ASP D 1 84  ? 19.398 70.562 -20.419 1.00 58.25  ? 83  ASP D OD1 1 
ATOM   3974 O OD2 . ASP D 1 84  ? 21.399 69.680 -20.015 1.00 58.78  ? 83  ASP D OD2 1 
ATOM   3975 N N   . GLU D 1 85  ? 18.686 70.690 -15.351 1.00 49.16  ? 84  GLU D N   1 
ATOM   3976 C CA  . GLU D 1 85  ? 18.440 70.176 -13.984 1.00 48.39  ? 84  GLU D CA  1 
ATOM   3977 C C   . GLU D 1 85  ? 16.935 70.055 -13.703 1.00 46.82  ? 84  GLU D C   1 
ATOM   3978 O O   . GLU D 1 85  ? 16.482 69.057 -13.152 1.00 48.60  ? 84  GLU D O   1 
ATOM   3979 C CB  . GLU D 1 85  ? 19.077 71.060 -12.894 1.00 48.00  ? 84  GLU D CB  1 
ATOM   3980 C CG  . GLU D 1 85  ? 20.546 70.767 -12.586 1.00 49.82  ? 84  GLU D CG  1 
ATOM   3981 C CD  . GLU D 1 85  ? 20.858 69.270 -12.438 1.00 52.94  ? 84  GLU D CD  1 
ATOM   3982 O OE1 . GLU D 1 85  ? 20.235 68.581 -11.598 1.00 54.24  ? 84  GLU D OE1 1 
ATOM   3983 O OE2 . GLU D 1 85  ? 21.741 68.781 -13.170 1.00 52.34  ? 84  GLU D OE2 1 
ATOM   3984 N N   . VAL D 1 86  ? 16.172 71.076 -14.078 1.00 41.73  ? 85  VAL D N   1 
ATOM   3985 C CA  . VAL D 1 86  ? 14.742 71.001 -13.860 1.00 38.47  ? 85  VAL D CA  1 
ATOM   3986 C C   . VAL D 1 86  ? 14.131 69.932 -14.787 1.00 38.02  ? 85  VAL D C   1 
ATOM   3987 O O   . VAL D 1 86  ? 13.116 69.341 -14.487 1.00 37.91  ? 85  VAL D O   1 
ATOM   3988 C CB  . VAL D 1 86  ? 14.061 72.339 -14.131 1.00 36.09  ? 85  VAL D CB  1 
ATOM   3989 C CG1 . VAL D 1 86  ? 12.571 72.177 -14.055 1.00 34.67  ? 85  VAL D CG1 1 
ATOM   3990 C CG2 . VAL D 1 86  ? 14.519 73.358 -13.137 1.00 34.18  ? 85  VAL D CG2 1 
ATOM   3991 N N   . GLY D 1 87  ? 14.793 69.682 -15.905 1.00 36.58  ? 86  GLY D N   1 
ATOM   3992 C CA  . GLY D 1 87  ? 14.276 68.695 -16.825 1.00 37.18  ? 86  GLY D CA  1 
ATOM   3993 C C   . GLY D 1 87  ? 14.640 67.277 -16.447 1.00 38.30  ? 86  GLY D C   1 
ATOM   3994 O O   . GLY D 1 87  ? 14.580 66.378 -17.274 1.00 37.64  ? 86  GLY D O   1 
ATOM   3995 N N   . LYS D 1 88  ? 15.053 67.058 -15.208 1.00 38.89  ? 87  LYS D N   1 
ATOM   3996 C CA  . LYS D 1 88  ? 15.375 65.686 -14.826 1.00 40.16  ? 87  LYS D CA  1 
ATOM   3997 C C   . LYS D 1 88  ? 14.336 65.150 -13.862 1.00 39.54  ? 87  LYS D C   1 
ATOM   3998 O O   . LYS D 1 88  ? 13.737 65.900 -13.133 1.00 40.35  ? 87  LYS D O   1 
ATOM   3999 C CB  . LYS D 1 88  ? 16.756 65.594 -14.189 1.00 42.45  ? 87  LYS D CB  1 
ATOM   4000 C CG  . LYS D 1 88  ? 17.888 65.796 -15.147 1.00 44.34  ? 87  LYS D CG  1 
ATOM   4001 C CD  . LYS D 1 88  ? 19.203 65.839 -14.404 1.00 45.40  ? 87  LYS D CD  1 
ATOM   4002 C CE  . LYS D 1 88  ? 20.350 65.926 -15.392 1.00 50.26  ? 87  LYS D CE  1 
ATOM   4003 N NZ  . LYS D 1 88  ? 21.691 65.937 -14.741 1.00 51.97  ? 87  LYS D NZ  1 
ATOM   4004 N N   . PHE D 1 89  ? 14.120 63.846 -13.881 1.00 39.98  ? 88  PHE D N   1 
ATOM   4005 C CA  . PHE D 1 89  ? 13.137 63.275 -12.982 1.00 39.96  ? 88  PHE D CA  1 
ATOM   4006 C C   . PHE D 1 89  ? 13.579 63.447 -11.527 1.00 40.10  ? 88  PHE D C   1 
ATOM   4007 O O   . PHE D 1 89  ? 12.768 63.442 -10.617 1.00 40.13  ? 88  PHE D O   1 
ATOM   4008 C CB  . PHE D 1 89  ? 12.885 61.803 -13.330 1.00 37.63  ? 88  PHE D CB  1 
ATOM   4009 C CG  . PHE D 1 89  ? 12.262 61.607 -14.694 1.00 38.05  ? 88  PHE D CG  1 
ATOM   4010 C CD1 . PHE D 1 89  ? 11.141 62.346 -15.080 1.00 37.51  ? 88  PHE D CD1 1 
ATOM   4011 C CD2 . PHE D 1 89  ? 12.788 60.693 -15.590 1.00 37.02  ? 88  PHE D CD2 1 
ATOM   4012 C CE1 . PHE D 1 89  ? 10.560 62.169 -16.334 1.00 36.92  ? 88  PHE D CE1 1 
ATOM   4013 C CE2 . PHE D 1 89  ? 12.211 60.514 -16.841 1.00 37.90  ? 88  PHE D CE2 1 
ATOM   4014 C CZ  . PHE D 1 89  ? 11.094 61.255 -17.215 1.00 37.17  ? 88  PHE D CZ  1 
ATOM   4015 N N   . ARG D 1 90  ? 14.875 63.632 -11.328 1.00 41.15  ? 89  ARG D N   1 
ATOM   4016 C CA  . ARG D 1 90  ? 15.385 63.830 -9.969  1.00 43.44  ? 89  ARG D CA  1 
ATOM   4017 C C   . ARG D 1 90  ? 14.680 65.041 -9.326  1.00 42.44  ? 89  ARG D C   1 
ATOM   4018 O O   . ARG D 1 90  ? 14.463 65.095 -8.111  1.00 40.64  ? 89  ARG D O   1 
ATOM   4019 C CB  . ARG D 1 90  ? 16.900 64.050 -10.007 1.00 46.36  ? 89  ARG D CB  1 
ATOM   4020 C CG  . ARG D 1 90  ? 17.546 64.266 -8.653  1.00 47.96  ? 89  ARG D CG  1 
ATOM   4021 C CD  . ARG D 1 90  ? 19.034 64.337 -8.818  1.00 51.05  ? 89  ARG D CD  1 
ATOM   4022 N NE  . ARG D 1 90  ? 19.551 63.068 -9.318  1.00 53.53  ? 89  ARG D NE  1 
ATOM   4023 C CZ  . ARG D 1 90  ? 19.500 61.928 -8.637  1.00 56.58  ? 89  ARG D CZ  1 
ATOM   4024 N NH1 . ARG D 1 90  ? 19.997 60.816 -9.170  1.00 56.63  ? 89  ARG D NH1 1 
ATOM   4025 N NH2 . ARG D 1 90  ? 18.952 61.901 -7.424  1.00 56.65  ? 89  ARG D NH2 1 
ATOM   4026 N N   . PHE D 1 91  ? 14.339 66.009 -10.174 1.00 41.19  ? 90  PHE D N   1 
ATOM   4027 C CA  . PHE D 1 91  ? 13.611 67.183 -9.703  1.00 40.14  ? 90  PHE D CA  1 
ATOM   4028 C C   . PHE D 1 91  ? 12.134 67.124 -10.135 1.00 40.18  ? 90  PHE D C   1 
ATOM   4029 O O   . PHE D 1 91  ? 11.276 67.672 -9.466  1.00 41.86  ? 90  PHE D O   1 
ATOM   4030 C CB  . PHE D 1 91  ? 14.221 68.476 -10.234 1.00 38.61  ? 90  PHE D CB  1 
ATOM   4031 C CG  . PHE D 1 91  ? 13.434 69.715 -9.869  1.00 37.77  ? 90  PHE D CG  1 
ATOM   4032 C CD1 . PHE D 1 91  ? 13.501 70.255 -8.585  1.00 37.90  ? 90  PHE D CD1 1 
ATOM   4033 C CD2 . PHE D 1 91  ? 12.657 70.364 -10.824 1.00 36.42  ? 90  PHE D CD2 1 
ATOM   4034 C CE1 . PHE D 1 91  ? 12.810 71.428 -8.269  1.00 37.52  ? 90  PHE D CE1 1 
ATOM   4035 C CE2 . PHE D 1 91  ? 11.965 71.534 -10.514 1.00 37.27  ? 90  PHE D CE2 1 
ATOM   4036 C CZ  . PHE D 1 91  ? 12.038 72.072 -9.241  1.00 35.54  ? 90  PHE D CZ  1 
ATOM   4037 N N   . LEU D 1 92  ? 11.846 66.481 -11.262 1.00 38.59  ? 91  LEU D N   1 
ATOM   4038 C CA  . LEU D 1 92  ? 10.445 66.405 -11.695 1.00 38.58  ? 91  LEU D CA  1 
ATOM   4039 C C   . LEU D 1 92  ? 9.627  65.565 -10.721 1.00 38.11  ? 91  LEU D C   1 
ATOM   4040 O O   . LEU D 1 92  ? 8.494  65.911 -10.396 1.00 37.83  ? 91  LEU D O   1 
ATOM   4041 C CB  . LEU D 1 92  ? 10.332 65.835 -13.110 1.00 35.24  ? 91  LEU D CB  1 
ATOM   4042 C CG  . LEU D 1 92  ? 10.922 66.807 -14.124 1.00 35.96  ? 91  LEU D CG  1 
ATOM   4043 C CD1 . LEU D 1 92  ? 10.812 66.267 -15.557 1.00 33.11  ? 91  LEU D CD1 1 
ATOM   4044 C CD2 . LEU D 1 92  ? 10.196 68.129 -13.980 1.00 33.28  ? 91  LEU D CD2 1 
ATOM   4045 N N   . ASN D 1 93  ? 10.225 64.472 -10.253 1.00 37.05  ? 92  ASN D N   1 
ATOM   4046 C CA  . ASN D 1 93  ? 9.526  63.615 -9.290  1.00 36.99  ? 92  ASN D CA  1 
ATOM   4047 C C   . ASN D 1 93  ? 9.106  64.426 -8.020  1.00 36.74  ? 92  ASN D C   1 
ATOM   4048 O O   . ASN D 1 93  ? 8.063  64.173 -7.439  1.00 36.99  ? 92  ASN D O   1 
ATOM   4049 C CB  . ASN D 1 93  ? 10.392 62.408 -8.908  1.00 35.29  ? 92  ASN D CB  1 
ATOM   4050 C CG  . ASN D 1 93  ? 10.589 61.456 -10.063 1.00 36.74  ? 92  ASN D CG  1 
ATOM   4051 O OD1 . ASN D 1 93  ? 9.882  61.519 -11.042 1.00 39.67  ? 92  ASN D OD1 1 
ATOM   4052 N ND2 . ASN D 1 93  ? 11.554 60.564 -9.942  1.00 36.57  ? 92  ASN D ND2 1 
ATOM   4053 N N   . GLU D 1 94  ? 9.928  65.396 -7.628  1.00 35.52  ? 93  GLU D N   1 
ATOM   4054 C CA  . GLU D 1 94  ? 9.601  66.231 -6.480  1.00 36.75  ? 93  GLU D CA  1 
ATOM   4055 C C   . GLU D 1 94  ? 8.338  67.105 -6.753  1.00 36.77  ? 93  GLU D C   1 
ATOM   4056 O O   . GLU D 1 94  ? 7.585  67.410 -5.835  1.00 35.82  ? 93  GLU D O   1 
ATOM   4057 C CB  . GLU D 1 94  ? 10.785 67.123 -6.104  1.00 37.57  ? 93  GLU D CB  1 
ATOM   4058 C CG  . GLU D 1 94  ? 12.037 66.351 -5.655  1.00 41.12  ? 93  GLU D CG  1 
ATOM   4059 C CD  . GLU D 1 94  ? 11.740 65.267 -4.636  1.00 41.52  ? 93  GLU D CD  1 
ATOM   4060 O OE1 . GLU D 1 94  ? 11.073 65.547 -3.630  1.00 44.06  ? 93  GLU D OE1 1 
ATOM   4061 O OE2 . GLU D 1 94  ? 12.171 64.121 -4.839  1.00 45.23  ? 93  GLU D OE2 1 
ATOM   4062 N N   . LEU D 1 95  ? 8.134  67.492 -8.013  1.00 34.97  ? 94  LEU D N   1 
ATOM   4063 C CA  . LEU D 1 95  ? 6.958  68.270 -8.384  1.00 35.90  ? 94  LEU D CA  1 
ATOM   4064 C C   . LEU D 1 95  ? 5.741  67.343 -8.480  1.00 38.51  ? 94  LEU D C   1 
ATOM   4065 O O   . LEU D 1 95  ? 4.632  67.704 -8.081  1.00 43.34  ? 94  LEU D O   1 
ATOM   4066 C CB  . LEU D 1 95  ? 7.152  68.966 -9.728  1.00 35.20  ? 94  LEU D CB  1 
ATOM   4067 C CG  . LEU D 1 95  ? 8.082  70.167 -9.715  1.00 36.47  ? 94  LEU D CG  1 
ATOM   4068 C CD1 . LEU D 1 95  ? 8.089  70.812 -11.084 1.00 33.73  ? 94  LEU D CD1 1 
ATOM   4069 C CD2 . LEU D 1 95  ? 7.609  71.158 -8.642  1.00 35.25  ? 94  LEU D CD2 1 
ATOM   4070 N N   . ILE D 1 96  ? 5.959  66.154 -9.029  1.00 37.10  ? 95  ILE D N   1 
ATOM   4071 C CA  . ILE D 1 96  ? 4.885  65.182 -9.128  1.00 36.38  ? 95  ILE D CA  1 
ATOM   4072 C C   . ILE D 1 96  ? 4.387  64.815 -7.707  1.00 37.06  ? 95  ILE D C   1 
ATOM   4073 O O   . ILE D 1 96  ? 3.205  64.764 -7.446  1.00 37.43  ? 95  ILE D O   1 
ATOM   4074 C CB  . ILE D 1 96  ? 5.363  63.921 -9.857  1.00 35.16  ? 95  ILE D CB  1 
ATOM   4075 C CG1 . ILE D 1 96  ? 5.657  64.272 -11.302 1.00 34.12  ? 95  ILE D CG1 1 
ATOM   4076 C CG2 . ILE D 1 96  ? 4.311  62.819 -9.772  1.00 35.81  ? 95  ILE D CG2 1 
ATOM   4077 C CD1 . ILE D 1 96  ? 6.372  63.170 -12.063 1.00 33.39  ? 95  ILE D CD1 1 
ATOM   4078 N N   . LYS D 1 97  ? 5.320  64.593 -6.797  1.00 36.21  ? 96  LYS D N   1 
ATOM   4079 C CA  . LYS D 1 97  ? 4.941  64.275 -5.446  1.00 36.03  ? 96  LYS D CA  1 
ATOM   4080 C C   . LYS D 1 97  ? 4.058  65.384 -4.834  1.00 34.78  ? 96  LYS D C   1 
ATOM   4081 O O   . LYS D 1 97  ? 3.168  65.113 -4.060  1.00 33.44  ? 96  LYS D O   1 
ATOM   4082 C CB  . LYS D 1 97  ? 6.175  64.084 -4.566  1.00 37.66  ? 96  LYS D CB  1 
ATOM   4083 C CG  . LYS D 1 97  ? 7.049  62.881 -4.900  1.00 41.11  ? 96  LYS D CG  1 
ATOM   4084 C CD  . LYS D 1 97  ? 8.213  62.823 -3.918  1.00 43.06  ? 96  LYS D CD  1 
ATOM   4085 C CE  . LYS D 1 97  ? 9.261  61.801 -4.321  1.00 45.47  ? 96  LYS D CE  1 
ATOM   4086 N NZ  . LYS D 1 97  ? 10.402 61.752 -3.345  1.00 44.15  ? 96  LYS D NZ  1 
ATOM   4087 N N   . VAL D 1 98  ? 4.296  66.633 -5.194  1.00 33.01  ? 97  VAL D N   1 
ATOM   4088 C CA  . VAL D 1 98  ? 3.469  67.692 -4.595  1.00 31.48  ? 97  VAL D CA  1 
ATOM   4089 C C   . VAL D 1 98  ? 2.008  67.719 -5.134  1.00 32.92  ? 97  VAL D C   1 
ATOM   4090 O O   . VAL D 1 98  ? 1.095  67.932 -4.373  1.00 31.80  ? 97  VAL D O   1 
ATOM   4091 C CB  . VAL D 1 98  ? 4.117  69.089 -4.785  1.00 29.24  ? 97  VAL D CB  1 
ATOM   4092 C CG1 . VAL D 1 98  ? 3.223  70.180 -4.196  1.00 26.95  ? 97  VAL D CG1 1 
ATOM   4093 C CG2 . VAL D 1 98  ? 5.455  69.110 -4.112  1.00 28.50  ? 97  VAL D CG2 1 
ATOM   4094 N N   . VAL D 1 99  ? 1.824  67.469 -6.431  1.00 34.37  ? 98  VAL D N   1 
ATOM   4095 C CA  . VAL D 1 99  ? 0.486  67.516 -7.068  1.00 36.23  ? 98  VAL D CA  1 
ATOM   4096 C C   . VAL D 1 99  ? -0.243 66.157 -7.231  1.00 39.62  ? 98  VAL D C   1 
ATOM   4097 O O   . VAL D 1 99  ? -1.353 66.118 -7.722  1.00 40.08  ? 98  VAL D O   1 
ATOM   4098 C CB  . VAL D 1 99  ? 0.578  68.158 -8.474  1.00 33.97  ? 98  VAL D CB  1 
ATOM   4099 C CG1 . VAL D 1 99  ? 1.077  69.561 -8.376  1.00 35.55  ? 98  VAL D CG1 1 
ATOM   4100 C CG2 . VAL D 1 99  ? 1.510  67.345 -9.350  1.00 35.39  ? 98  VAL D CG2 1 
ATOM   4101 N N   . SER D 1 100 ? 0.378  65.057 -6.833  1.00 44.00  ? 99  SER D N   1 
ATOM   4102 C CA  . SER D 1 100 ? -0.288 63.754 -7.011  1.00 48.34  ? 99  SER D CA  1 
ATOM   4103 C C   . SER D 1 100 ? -0.860 63.147 -5.716  1.00 51.60  ? 99  SER D C   1 
ATOM   4104 O O   . SER D 1 100 ? -0.180 63.044 -4.711  1.00 53.24  ? 99  SER D O   1 
ATOM   4105 C CB  . SER D 1 100 ? 0.661  62.756 -7.651  1.00 47.62  ? 99  SER D CB  1 
ATOM   4106 O OG  . SER D 1 100 ? 0.071  61.471 -7.656  1.00 51.49  ? 99  SER D OG  1 
ATOM   4107 N N   . PRO D 1 101 ? -2.129 62.724 -5.756  1.00 54.32  ? 100 PRO D N   1 
ATOM   4108 C CA  . PRO D 1 101 ? -2.821 62.127 -4.612  1.00 56.13  ? 100 PRO D CA  1 
ATOM   4109 C C   . PRO D 1 101 ? -2.001 60.973 -3.980  1.00 58.55  ? 100 PRO D C   1 
ATOM   4110 O O   . PRO D 1 101 ? -1.947 60.834 -2.758  1.00 59.19  ? 100 PRO D O   1 
ATOM   4111 C CB  . PRO D 1 101 ? -4.124 61.622 -5.223  1.00 56.05  ? 100 PRO D CB  1 
ATOM   4112 C CG  . PRO D 1 101 ? -4.359 62.556 -6.358  1.00 55.16  ? 100 PRO D CG  1 
ATOM   4113 C CD  . PRO D 1 101 ? -2.985 62.689 -6.953  1.00 55.70  ? 100 PRO D CD  1 
ATOM   4114 N N   . LYS D 1 102 ? -1.382 60.156 -4.829  1.00 59.78  ? 101 LYS D N   1 
ATOM   4115 C CA  . LYS D 1 102 ? -0.572 59.029 -4.353  1.00 60.72  ? 101 LYS D CA  1 
ATOM   4116 C C   . LYS D 1 102 ? 0.555  59.478 -3.410  1.00 61.10  ? 101 LYS D C   1 
ATOM   4117 O O   . LYS D 1 102 ? 1.264  58.649 -2.885  1.00 62.32  ? 101 LYS D O   1 
ATOM   4118 C CB  . LYS D 1 102 ? 0.070  58.285 -5.526  1.00 62.80  ? 101 LYS D CB  1 
ATOM   4119 C CG  . LYS D 1 102 ? -0.892 57.794 -6.596  1.00 66.26  ? 101 LYS D CG  1 
ATOM   4120 C CD  . LYS D 1 102 ? -0.142 57.120 -7.756  1.00 66.78  ? 101 LYS D CD  1 
ATOM   4121 C CE  . LYS D 1 102 ? -1.094 56.713 -8.884  1.00 67.80  ? 101 LYS D CE  1 
ATOM   4122 N NZ  . LYS D 1 102 ? -0.387 56.156 -10.074 1.00 66.95  ? 101 LYS D NZ  1 
ATOM   4123 N N   . TYR D 1 103 ? 0.714  60.785 -3.215  1.00 61.21  ? 102 TYR D N   1 
ATOM   4124 C CA  . TYR D 1 103 ? 1.786  61.299 -2.349  1.00 60.34  ? 102 TYR D CA  1 
ATOM   4125 C C   . TYR D 1 103 ? 1.333  62.470 -1.447  1.00 60.52  ? 102 TYR D C   1 
ATOM   4126 O O   . TYR D 1 103 ? 0.473  62.311 -0.595  1.00 62.33  ? 102 TYR D O   1 
ATOM   4127 C CB  . TYR D 1 103 ? 2.968  61.748 -3.214  1.00 61.43  ? 102 TYR D CB  1 
ATOM   4128 C CG  . TYR D 1 103 ? 3.413  60.718 -4.235  1.00 61.71  ? 102 TYR D CG  1 
ATOM   4129 C CD1 . TYR D 1 103 ? 4.115  59.575 -3.853  1.00 61.90  ? 102 TYR D CD1 1 
ATOM   4130 C CD2 . TYR D 1 103 ? 3.069  60.851 -5.576  1.00 63.30  ? 102 TYR D CD2 1 
ATOM   4131 C CE1 . TYR D 1 103 ? 4.456  58.582 -4.789  1.00 61.51  ? 102 TYR D CE1 1 
ATOM   4132 C CE2 . TYR D 1 103 ? 3.400  59.868 -6.515  1.00 62.78  ? 102 TYR D CE2 1 
ATOM   4133 C CZ  . TYR D 1 103 ? 4.088  58.738 -6.114  1.00 62.53  ? 102 TYR D CZ  1 
ATOM   4134 O OH  . TYR D 1 103 ? 4.368  57.757 -7.040  1.00 61.37  ? 102 TYR D OH  1 
ATOM   4135 N N   . LEU D 1 104 ? 1.936  63.635 -1.650  1.00 59.36  ? 103 LEU D N   1 
ATOM   4136 C CA  . LEU D 1 104 ? 1.605  64.827 -0.862  1.00 57.71  ? 103 LEU D CA  1 
ATOM   4137 C C   . LEU D 1 104 ? 0.400  65.598 -1.434  1.00 57.26  ? 103 LEU D C   1 
ATOM   4138 O O   . LEU D 1 104 ? -0.101 66.529 -0.814  1.00 56.48  ? 103 LEU D O   1 
ATOM   4139 C CB  . LEU D 1 104 ? 2.824  65.751 -0.802  1.00 57.41  ? 103 LEU D CB  1 
ATOM   4140 C CG  . LEU D 1 104 ? 4.067  65.241 -0.065  1.00 57.12  ? 103 LEU D CG  1 
ATOM   4141 C CD1 . LEU D 1 104 ? 5.297  66.062 -0.448  1.00 55.64  ? 103 LEU D CD1 1 
ATOM   4142 C CD2 . LEU D 1 104 ? 3.813  65.313 1.431   1.00 57.22  ? 103 LEU D CD2 1 
ATOM   4143 N N   . GLY D 1 105 ? -0.049 65.195 -2.618  1.00 57.34  ? 104 GLY D N   1 
ATOM   4144 C CA  . GLY D 1 105 ? -1.176 65.860 -3.256  1.00 58.59  ? 104 GLY D CA  1 
ATOM   4145 C C   . GLY D 1 105 ? -2.330 66.203 -2.328  1.00 59.27  ? 104 GLY D C   1 
ATOM   4146 O O   . GLY D 1 105 ? -2.678 67.366 -2.160  1.00 59.25  ? 104 GLY D O   1 
ATOM   4147 N N   . SER D 1 106 ? -2.911 65.168 -1.729  1.00 59.51  ? 105 SER D N   1 
ATOM   4148 C CA  . SER D 1 106 ? -4.045 65.290 -0.804  1.00 60.45  ? 105 SER D CA  1 
ATOM   4149 C C   . SER D 1 106 ? -3.772 66.253 0.370   1.00 60.77  ? 105 SER D C   1 
ATOM   4150 O O   . SER D 1 106 ? -4.691 66.695 1.023   1.00 59.80  ? 105 SER D O   1 
ATOM   4151 C CB  . SER D 1 106 ? -4.389 63.911 -0.228  1.00 62.57  ? 105 SER D CB  1 
ATOM   4152 O OG  . SER D 1 106 ? -4.443 62.909 -1.239  1.00 65.10  ? 105 SER D OG  1 
ATOM   4153 N N   . ARG D 1 107 ? -2.502 66.558 0.627   1.00 61.73  ? 106 ARG D N   1 
ATOM   4154 C CA  . ARG D 1 107 ? -2.152 67.452 1.745   1.00 61.22  ? 106 ARG D CA  1 
ATOM   4155 C C   . ARG D 1 107 ? -1.557 68.800 1.312   1.00 60.32  ? 106 ARG D C   1 
ATOM   4156 O O   . ARG D 1 107 ? -1.163 69.597 2.151   1.00 61.17  ? 106 ARG D O   1 
ATOM   4157 C CB  . ARG D 1 107 ? -1.174 66.757 2.684   1.00 62.75  ? 106 ARG D CB  1 
ATOM   4158 C CG  . ARG D 1 107 ? -1.603 65.344 3.053   1.00 68.07  ? 106 ARG D CG  1 
ATOM   4159 C CD  . ARG D 1 107 ? -1.105 64.972 4.435   1.00 71.43  ? 106 ARG D CD  1 
ATOM   4160 N NE  . ARG D 1 107 ? 0.306  65.312 4.637   1.00 75.28  ? 106 ARG D NE  1 
ATOM   4161 C CZ  . ARG D 1 107 ? 1.303  64.932 3.839   1.00 76.63  ? 106 ARG D CZ  1 
ATOM   4162 N NH1 . ARG D 1 107 ? 2.553  65.290 4.118   1.00 77.00  ? 106 ARG D NH1 1 
ATOM   4163 N NH2 . ARG D 1 107 ? 1.055  64.205 2.758   1.00 76.54  ? 106 ARG D NH2 1 
ATOM   4164 N N   . THR D 1 108 ? -1.498 69.036 0.007   1.00 58.06  ? 107 THR D N   1 
ATOM   4165 C CA  . THR D 1 108 ? -0.954 70.293 -0.520  1.00 54.77  ? 107 THR D CA  1 
ATOM   4166 C C   . THR D 1 108 ? -2.087 71.243 -0.945  1.00 52.74  ? 107 THR D C   1 
ATOM   4167 O O   . THR D 1 108 ? -3.099 70.795 -1.418  1.00 52.02  ? 107 THR D O   1 
ATOM   4168 C CB  . THR D 1 108 ? -0.011 70.013 -1.716  1.00 54.23  ? 107 THR D CB  1 
ATOM   4169 O OG1 . THR D 1 108 ? 1.163  69.343 -1.244  1.00 50.79  ? 107 THR D OG1 1 
ATOM   4170 C CG2 . THR D 1 108 ? 0.398  71.307 -2.402  1.00 54.41  ? 107 THR D CG2 1 
ATOM   4171 N N   . SER D 1 109 ? -1.888 72.544 -0.754  1.00 52.26  ? 108 SER D N   1 
ATOM   4172 C CA  . SER D 1 109 ? -2.899 73.558 -1.086  1.00 53.66  ? 108 SER D CA  1 
ATOM   4173 C C   . SER D 1 109 ? -3.168 73.668 -2.581  1.00 56.57  ? 108 SER D C   1 
ATOM   4174 O O   . SER D 1 109 ? -2.253 73.642 -3.400  1.00 58.12  ? 108 SER D O   1 
ATOM   4175 C CB  . SER D 1 109 ? -2.480 74.928 -0.566  1.00 53.76  ? 108 SER D CB  1 
ATOM   4176 O OG  . SER D 1 109 ? -1.475 75.509 -1.372  1.00 53.11  ? 108 SER D OG  1 
ATOM   4177 N N   . GLU D 1 110 ? -4.442 73.806 -2.917  1.00 57.90  ? 109 GLU D N   1 
ATOM   4178 C CA  . GLU D 1 110 ? -4.866 73.914 -4.310  1.00 58.52  ? 109 GLU D CA  1 
ATOM   4179 C C   . GLU D 1 110 ? -4.069 75.018 -5.064  1.00 57.53  ? 109 GLU D C   1 
ATOM   4180 O O   . GLU D 1 110 ? -3.709 74.862 -6.225  1.00 56.73  ? 109 GLU D O   1 
ATOM   4181 C CB  . GLU D 1 110 ? -6.367 74.207 -4.344  1.00 61.50  ? 109 GLU D CB  1 
ATOM   4182 C CG  . GLU D 1 110 ? -7.074 73.922 -5.657  1.00 66.01  ? 109 GLU D CG  1 
ATOM   4183 C CD  . GLU D 1 110 ? -8.550 74.324 -5.604  1.00 69.28  ? 109 GLU D CD  1 
ATOM   4184 O OE1 . GLU D 1 110 ? -8.835 75.515 -5.306  1.00 68.83  ? 109 GLU D OE1 1 
ATOM   4185 O OE2 . GLU D 1 110 ? -9.420 73.453 -5.860  1.00 70.81  ? 109 GLU D OE2 1 
ATOM   4186 N N   . LYS D 1 111 ? -3.794 76.119 -4.378  1.00 55.98  ? 110 LYS D N   1 
ATOM   4187 C CA  . LYS D 1 111 ? -3.043 77.209 -4.995  1.00 55.34  ? 110 LYS D CA  1 
ATOM   4188 C C   . LYS D 1 111 ? -1.657 76.721 -5.446  1.00 53.17  ? 110 LYS D C   1 
ATOM   4189 O O   . LYS D 1 111 ? -1.274 76.884 -6.588  1.00 52.80  ? 110 LYS D O   1 
ATOM   4190 C CB  . LYS D 1 111 ? -2.902 78.363 -4.000  1.00 58.35  ? 110 LYS D CB  1 
ATOM   4191 C CG  . LYS D 1 111 ? -2.405 79.678 -4.588  1.00 60.40  ? 110 LYS D CG  1 
ATOM   4192 C CD  . LYS D 1 111 ? -2.494 80.823 -3.570  1.00 62.78  ? 110 LYS D CD  1 
ATOM   4193 C CE  . LYS D 1 111 ? -3.939 81.088 -3.113  1.00 64.64  ? 110 LYS D CE  1 
ATOM   4194 N NZ  . LYS D 1 111 ? -4.514 80.018 -2.232  1.00 64.53  ? 110 LYS D NZ  1 
ATOM   4195 N N   . VAL D 1 112 ? -0.927 76.109 -4.526  1.00 52.04  ? 111 VAL D N   1 
ATOM   4196 C CA  . VAL D 1 112 ? 0.392  75.580 -4.845  1.00 50.95  ? 111 VAL D CA  1 
ATOM   4197 C C   . VAL D 1 112 ? 0.342  74.535 -5.973  1.00 51.00  ? 111 VAL D C   1 
ATOM   4198 O O   . VAL D 1 112 ? 1.116  74.610 -6.913  1.00 51.22  ? 111 VAL D O   1 
ATOM   4199 C CB  . VAL D 1 112 ? 1.021  74.926 -3.632  1.00 49.79  ? 111 VAL D CB  1 
ATOM   4200 C CG1 . VAL D 1 112 ? 2.287  74.186 -4.039  1.00 48.39  ? 111 VAL D CG1 1 
ATOM   4201 C CG2 . VAL D 1 112 ? 1.322  75.984 -2.606  1.00 49.17  ? 111 VAL D CG2 1 
ATOM   4202 N N   . LYS D 1 113 ? -0.568 73.569 -5.862  1.00 49.98  ? 112 LYS D N   1 
ATOM   4203 C CA  . LYS D 1 113 ? -0.681 72.539 -6.895  1.00 49.12  ? 112 LYS D CA  1 
ATOM   4204 C C   . LYS D 1 113 ? -1.015 73.127 -8.261  1.00 48.78  ? 112 LYS D C   1 
ATOM   4205 O O   . LYS D 1 113 ? -0.378 72.788 -9.245  1.00 49.39  ? 112 LYS D O   1 
ATOM   4206 C CB  . LYS D 1 113 ? -1.718 71.478 -6.518  1.00 50.01  ? 112 LYS D CB  1 
ATOM   4207 C CG  . LYS D 1 113 ? -1.164 70.397 -5.605  1.00 49.84  ? 112 LYS D CG  1 
ATOM   4208 C CD  . LYS D 1 113 ? -2.104 69.215 -5.490  1.00 50.30  ? 112 LYS D CD  1 
ATOM   4209 C CE  . LYS D 1 113 ? -3.369 69.557 -4.727  1.00 50.54  ? 112 LYS D CE  1 
ATOM   4210 N NZ  . LYS D 1 113 ? -4.202 68.321 -4.579  1.00 50.57  ? 112 LYS D NZ  1 
ATOM   4211 N N   . ASN D 1 114 ? -2.004 74.011 -8.326  1.00 47.92  ? 113 ASN D N   1 
ATOM   4212 C CA  . ASN D 1 114 ? -2.315 74.588 -9.629  1.00 47.93  ? 113 ASN D CA  1 
ATOM   4213 C C   . ASN D 1 114 ? -1.134 75.384 -10.171 1.00 47.00  ? 113 ASN D C   1 
ATOM   4214 O O   . ASN D 1 114 ? -0.854 75.330 -11.356 1.00 50.00  ? 113 ASN D O   1 
ATOM   4215 C CB  . ASN D 1 114 ? -3.575 75.456 -9.585  1.00 48.43  ? 113 ASN D CB  1 
ATOM   4216 C CG  . ASN D 1 114 ? -4.847 74.624 -9.381  1.00 51.75  ? 113 ASN D CG  1 
ATOM   4217 O OD1 . ASN D 1 114 ? -4.934 73.462 -9.821  1.00 51.50  ? 113 ASN D OD1 1 
ATOM   4218 N ND2 . ASN D 1 114 ? -5.842 75.217 -8.723  1.00 53.31  ? 113 ASN D ND2 1 
ATOM   4219 N N   . LYS D 1 115 ? -0.429 76.102 -9.307  1.00 44.74  ? 114 LYS D N   1 
ATOM   4220 C CA  . LYS D 1 115 ? 0.719  76.856 -9.797  1.00 44.32  ? 114 LYS D CA  1 
ATOM   4221 C C   . LYS D 1 115 ? 1.761  75.920 -10.462 1.00 44.14  ? 114 LYS D C   1 
ATOM   4222 O O   . LYS D 1 115 ? 2.313  76.230 -11.522 1.00 44.16  ? 114 LYS D O   1 
ATOM   4223 C CB  . LYS D 1 115 ? 1.368  77.645 -8.660  1.00 44.97  ? 114 LYS D CB  1 
ATOM   4224 C CG  . LYS D 1 115 ? 2.609  78.431 -9.072  1.00 45.64  ? 114 LYS D CG  1 
ATOM   4225 C CD  . LYS D 1 115 ? 2.303  79.509 -10.087 1.00 46.12  ? 114 LYS D CD  1 
ATOM   4226 C CE  . LYS D 1 115 ? 3.573  80.289 -10.445 1.00 47.56  ? 114 LYS D CE  1 
ATOM   4227 N NZ  . LYS D 1 115 ? 3.332  81.483 -11.338 1.00 46.33  ? 114 LYS D NZ  1 
ATOM   4228 N N   . ILE D 1 116 ? 2.020  74.781 -9.829  1.00 42.10  ? 115 ILE D N   1 
ATOM   4229 C CA  . ILE D 1 116 ? 2.962  73.827 -10.396 1.00 40.89  ? 115 ILE D CA  1 
ATOM   4230 C C   . ILE D 1 116 ? 2.465  73.292 -11.759 1.00 41.34  ? 115 ILE D C   1 
ATOM   4231 O O   . ILE D 1 116 ? 3.243  73.149 -12.694 1.00 41.11  ? 115 ILE D O   1 
ATOM   4232 C CB  . ILE D 1 116 ? 3.198  72.654 -9.424  1.00 40.65  ? 115 ILE D CB  1 
ATOM   4233 C CG1 . ILE D 1 116 ? 4.015  73.167 -8.233  1.00 40.21  ? 115 ILE D CG1 1 
ATOM   4234 C CG2 . ILE D 1 116 ? 3.895  71.480 -10.139 1.00 37.63  ? 115 ILE D CG2 1 
ATOM   4235 C CD1 . ILE D 1 116 ? 4.074  72.221 -7.067  1.00 39.42  ? 115 ILE D CD1 1 
ATOM   4236 N N   . LEU D 1 117 ? 1.167  73.011 -11.850 1.00 40.45  ? 116 LEU D N   1 
ATOM   4237 C CA  . LEU D 1 117 ? 0.595  72.506 -13.099 1.00 40.12  ? 116 LEU D CA  1 
ATOM   4238 C C   . LEU D 1 117 ? 0.677  73.547 -14.221 1.00 41.28  ? 116 LEU D C   1 
ATOM   4239 O O   . LEU D 1 117 ? 0.723  73.203 -15.387 1.00 42.37  ? 116 LEU D O   1 
ATOM   4240 C CB  . LEU D 1 117 ? -0.857 72.052 -12.893 1.00 37.60  ? 116 LEU D CB  1 
ATOM   4241 C CG  . LEU D 1 117 ? -1.031 70.833 -11.959 1.00 38.69  ? 116 LEU D CG  1 
ATOM   4242 C CD1 . LEU D 1 117 ? -2.503 70.405 -11.898 1.00 37.28  ? 116 LEU D CD1 1 
ATOM   4243 C CD2 . LEU D 1 117 ? -0.178 69.682 -12.445 1.00 34.86  ? 116 LEU D CD2 1 
ATOM   4244 N N   . GLU D 1 118 ? 0.686  74.822 -13.866 1.00 42.57  ? 117 GLU D N   1 
ATOM   4245 C CA  . GLU D 1 118 ? 0.816  75.833 -14.901 1.00 43.24  ? 117 GLU D CA  1 
ATOM   4246 C C   . GLU D 1 118 ? 2.263  75.873 -15.406 1.00 41.39  ? 117 GLU D C   1 
ATOM   4247 O O   . GLU D 1 118 ? 2.506  75.915 -16.610 1.00 42.09  ? 117 GLU D O   1 
ATOM   4248 C CB  . GLU D 1 118 ? 0.463  77.215 -14.374 1.00 46.80  ? 117 GLU D CB  1 
ATOM   4249 C CG  . GLU D 1 118 ? -0.855 77.321 -13.652 1.00 51.19  ? 117 GLU D CG  1 
ATOM   4250 C CD  . GLU D 1 118 ? -1.328 78.762 -13.596 1.00 54.11  ? 117 GLU D CD  1 
ATOM   4251 O OE1 . GLU D 1 118 ? -0.486 79.637 -13.283 1.00 55.66  ? 117 GLU D OE1 1 
ATOM   4252 O OE2 . GLU D 1 118 ? -2.528 79.017 -13.868 1.00 55.34  ? 117 GLU D OE2 1 
ATOM   4253 N N   . LEU D 1 119 ? 3.215  75.861 -14.474 1.00 39.67  ? 118 LEU D N   1 
ATOM   4254 C CA  . LEU D 1 119 ? 4.644  75.907 -14.861 1.00 40.08  ? 118 LEU D CA  1 
ATOM   4255 C C   . LEU D 1 119 ? 5.037  74.699 -15.709 1.00 40.15  ? 118 LEU D C   1 
ATOM   4256 O O   . LEU D 1 119 ? 5.725  74.839 -16.736 1.00 39.84  ? 118 LEU D O   1 
ATOM   4257 C CB  . LEU D 1 119 ? 5.549  75.962 -13.634 1.00 40.42  ? 118 LEU D CB  1 
ATOM   4258 C CG  . LEU D 1 119 ? 5.347  77.146 -12.706 1.00 41.92  ? 118 LEU D CG  1 
ATOM   4259 C CD1 . LEU D 1 119 ? 5.980  76.828 -11.362 1.00 40.48  ? 118 LEU D CD1 1 
ATOM   4260 C CD2 . LEU D 1 119 ? 5.951  78.395 -13.329 1.00 42.86  ? 118 LEU D CD2 1 
ATOM   4261 N N   . LEU D 1 120 ? 4.606  73.518 -15.265 1.00 39.18  ? 119 LEU D N   1 
ATOM   4262 C CA  . LEU D 1 120 ? 4.918  72.302 -16.016 1.00 37.83  ? 119 LEU D CA  1 
ATOM   4263 C C   . LEU D 1 120 ? 4.449  72.476 -17.471 1.00 39.49  ? 119 LEU D C   1 
ATOM   4264 O O   . LEU D 1 120 ? 5.180  72.155 -18.418 1.00 40.16  ? 119 LEU D O   1 
ATOM   4265 C CB  . LEU D 1 120 ? 4.264  71.079 -15.371 1.00 34.13  ? 119 LEU D CB  1 
ATOM   4266 C CG  . LEU D 1 120 ? 4.943  70.503 -14.121 1.00 31.96  ? 119 LEU D CG  1 
ATOM   4267 C CD1 . LEU D 1 120 ? 4.030  69.505 -13.453 1.00 26.55  ? 119 LEU D CD1 1 
ATOM   4268 C CD2 . LEU D 1 120 ? 6.248  69.842 -14.523 1.00 32.03  ? 119 LEU D CD2 1 
ATOM   4269 N N   . TYR D 1 121 ? 3.247  73.021 -17.635 1.00 39.35  ? 120 TYR D N   1 
ATOM   4270 C CA  . TYR D 1 121 ? 2.732  73.243 -18.977 1.00 41.15  ? 120 TYR D CA  1 
ATOM   4271 C C   . TYR D 1 121 ? 3.579  74.280 -19.752 1.00 41.05  ? 120 TYR D C   1 
ATOM   4272 O O   . TYR D 1 121 ? 4.047  74.008 -20.869 1.00 38.11  ? 120 TYR D O   1 
ATOM   4273 C CB  . TYR D 1 121 ? 1.280  73.718 -18.948 1.00 42.94  ? 120 TYR D CB  1 
ATOM   4274 C CG  . TYR D 1 121 ? 0.727  73.924 -20.346 1.00 47.65  ? 120 TYR D CG  1 
ATOM   4275 C CD1 . TYR D 1 121 ? 0.529  72.842 -21.209 1.00 47.41  ? 120 TYR D CD1 1 
ATOM   4276 C CD2 . TYR D 1 121 ? 0.441  75.208 -20.826 1.00 49.54  ? 120 TYR D CD2 1 
ATOM   4277 C CE1 . TYR D 1 121 ? 0.061  73.035 -22.506 1.00 48.28  ? 120 TYR D CE1 1 
ATOM   4278 C CE2 . TYR D 1 121 ? -0.026 75.408 -22.126 1.00 49.83  ? 120 TYR D CE2 1 
ATOM   4279 C CZ  . TYR D 1 121 ? -0.212 74.316 -22.953 1.00 49.88  ? 120 TYR D CZ  1 
ATOM   4280 O OH  . TYR D 1 121 ? -0.672 74.507 -24.231 1.00 52.36  ? 120 TYR D OH  1 
ATOM   4281 N N   . SER D 1 122 ? 3.769  75.455 -19.149 1.00 41.04  ? 121 SER D N   1 
ATOM   4282 C CA  . SER D 1 122 ? 4.554  76.507 -19.817 1.00 41.20  ? 121 SER D CA  1 
ATOM   4283 C C   . SER D 1 122 ? 5.917  75.967 -20.296 1.00 41.10  ? 121 SER D C   1 
ATOM   4284 O O   . SER D 1 122 ? 6.429  76.411 -21.309 1.00 43.50  ? 121 SER D O   1 
ATOM   4285 C CB  . SER D 1 122 ? 4.752  77.730 -18.901 1.00 39.86  ? 121 SER D CB  1 
ATOM   4286 O OG  . SER D 1 122 ? 5.842  77.582 -18.011 1.00 41.05  ? 121 SER D OG  1 
ATOM   4287 N N   . TRP D 1 123 ? 6.482  75.000 -19.578 1.00 40.86  ? 122 TRP D N   1 
ATOM   4288 C CA  . TRP D 1 123 ? 7.773  74.443 -20.007 1.00 41.97  ? 122 TRP D CA  1 
ATOM   4289 C C   . TRP D 1 123 ? 7.636  73.491 -21.212 1.00 41.20  ? 122 TRP D C   1 
ATOM   4290 O O   . TRP D 1 123 ? 8.428  73.566 -22.135 1.00 41.19  ? 122 TRP D O   1 
ATOM   4291 C CB  . TRP D 1 123 ? 8.472  73.709 -18.864 1.00 42.75  ? 122 TRP D CB  1 
ATOM   4292 C CG  . TRP D 1 123 ? 8.714  74.554 -17.675 1.00 44.61  ? 122 TRP D CG  1 
ATOM   4293 C CD1 . TRP D 1 123 ? 8.934  75.898 -17.651 1.00 43.88  ? 122 TRP D CD1 1 
ATOM   4294 C CD2 . TRP D 1 123 ? 8.784  74.110 -16.318 1.00 45.61  ? 122 TRP D CD2 1 
ATOM   4295 N NE1 . TRP D 1 123 ? 9.133  76.320 -16.363 1.00 45.18  ? 122 TRP D NE1 1 
ATOM   4296 C CE2 . TRP D 1 123 ? 9.048  75.241 -15.524 1.00 45.59  ? 122 TRP D CE2 1 
ATOM   4297 C CE3 . TRP D 1 123 ? 8.647  72.862 -15.697 1.00 44.02  ? 122 TRP D CE3 1 
ATOM   4298 C CZ2 . TRP D 1 123 ? 9.183  75.163 -14.139 1.00 46.96  ? 122 TRP D CZ2 1 
ATOM   4299 C CZ3 . TRP D 1 123 ? 8.777  72.783 -14.327 1.00 44.10  ? 122 TRP D CZ3 1 
ATOM   4300 C CH2 . TRP D 1 123 ? 9.043  73.925 -13.559 1.00 47.04  ? 122 TRP D CH2 1 
ATOM   4301 N N   . THR D 1 124 ? 6.635  72.610 -21.187 1.00 40.94  ? 123 THR D N   1 
ATOM   4302 C CA  . THR D 1 124 ? 6.443  71.677 -22.305 1.00 43.56  ? 123 THR D CA  1 
ATOM   4303 C C   . THR D 1 124 ? 6.199  72.446 -23.616 1.00 45.51  ? 123 THR D C   1 
ATOM   4304 O O   . THR D 1 124 ? 6.337  71.909 -24.719 1.00 46.27  ? 123 THR D O   1 
ATOM   4305 C CB  . THR D 1 124 ? 5.255  70.722 -22.073 1.00 43.41  ? 123 THR D CB  1 
ATOM   4306 O OG1 . THR D 1 124 ? 4.048  71.474 -21.992 1.00 44.38  ? 123 THR D OG1 1 
ATOM   4307 C CG2 . THR D 1 124 ? 5.436  69.942 -20.787 1.00 45.56  ? 123 THR D CG2 1 
ATOM   4308 N N   . VAL D 1 125 ? 5.843  73.715 -23.468 1.00 45.95  ? 124 VAL D N   1 
ATOM   4309 C CA  . VAL D 1 125 ? 5.602  74.548 -24.622 1.00 46.63  ? 124 VAL D CA  1 
ATOM   4310 C C   . VAL D 1 125 ? 6.813  75.460 -24.974 1.00 47.47  ? 124 VAL D C   1 
ATOM   4311 O O   . VAL D 1 125 ? 7.187  75.566 -26.134 1.00 48.22  ? 124 VAL D O   1 
ATOM   4312 C CB  . VAL D 1 125 ? 4.350  75.407 -24.420 1.00 46.70  ? 124 VAL D CB  1 
ATOM   4313 C CG1 . VAL D 1 125 ? 4.236  76.426 -25.548 1.00 43.07  ? 124 VAL D CG1 1 
ATOM   4314 C CG2 . VAL D 1 125 ? 3.121  74.504 -24.378 1.00 45.60  ? 124 VAL D CG2 1 
ATOM   4315 N N   . GLY D 1 126 ? 7.417  76.092 -23.976 1.00 44.70  ? 125 GLY D N   1 
ATOM   4316 C CA  . GLY D 1 126 ? 8.535  76.962 -24.269 1.00 44.55  ? 125 GLY D CA  1 
ATOM   4317 C C   . GLY D 1 126 ? 9.838  76.210 -24.381 1.00 45.02  ? 125 GLY D C   1 
ATOM   4318 O O   . GLY D 1 126 ? 10.761 76.665 -25.039 1.00 44.60  ? 125 GLY D O   1 
ATOM   4319 N N   . LEU D 1 127 ? 9.900  75.047 -23.739 1.00 44.93  ? 126 LEU D N   1 
ATOM   4320 C CA  . LEU D 1 127 ? 11.111 74.220 -23.743 1.00 44.97  ? 126 LEU D CA  1 
ATOM   4321 C C   . LEU D 1 127 ? 10.869 72.746 -24.139 1.00 45.15  ? 126 LEU D C   1 
ATOM   4322 O O   . LEU D 1 127 ? 11.252 71.829 -23.416 1.00 44.39  ? 126 LEU D O   1 
ATOM   4323 C CB  . LEU D 1 127 ? 11.772 74.274 -22.366 1.00 45.98  ? 126 LEU D CB  1 
ATOM   4324 C CG  . LEU D 1 127 ? 12.629 75.489 -22.037 1.00 46.41  ? 126 LEU D CG  1 
ATOM   4325 C CD1 . LEU D 1 127 ? 12.698 75.655 -20.544 1.00 46.57  ? 126 LEU D CD1 1 
ATOM   4326 C CD2 . LEU D 1 127 ? 14.016 75.311 -22.633 1.00 46.42  ? 126 LEU D CD2 1 
ATOM   4327 N N   . PRO D 1 128 ? 10.248 72.514 -25.304 1.00 45.82  ? 127 PRO D N   1 
ATOM   4328 C CA  . PRO D 1 128 ? 9.983  71.144 -25.757 1.00 45.75  ? 127 PRO D CA  1 
ATOM   4329 C C   . PRO D 1 128 ? 11.259 70.252 -25.839 1.00 46.44  ? 127 PRO D C   1 
ATOM   4330 O O   . PRO D 1 128 ? 11.150 69.041 -25.863 1.00 48.36  ? 127 PRO D O   1 
ATOM   4331 C CB  . PRO D 1 128 ? 9.328  71.355 -27.112 1.00 43.93  ? 127 PRO D CB  1 
ATOM   4332 C CG  . PRO D 1 128 ? 10.004 72.598 -27.603 1.00 45.80  ? 127 PRO D CG  1 
ATOM   4333 C CD  . PRO D 1 128 ? 9.959  73.480 -26.376 1.00 46.03  ? 127 PRO D CD  1 
ATOM   4334 N N   . GLU D 1 129 ? 12.443 70.864 -25.886 1.00 47.71  ? 128 GLU D N   1 
ATOM   4335 C CA  . GLU D 1 129 ? 13.713 70.095 -25.949 1.00 48.59  ? 128 GLU D CA  1 
ATOM   4336 C C   . GLU D 1 129 ? 13.867 69.151 -24.740 1.00 48.69  ? 128 GLU D C   1 
ATOM   4337 O O   . GLU D 1 129 ? 14.552 68.139 -24.814 1.00 48.29  ? 128 GLU D O   1 
ATOM   4338 C CB  . GLU D 1 129 ? 14.948 71.000 -25.940 1.00 49.24  ? 128 GLU D CB  1 
ATOM   4339 C CG  . GLU D 1 129 ? 14.913 72.175 -26.840 1.00 52.07  ? 128 GLU D CG  1 
ATOM   4340 C CD  . GLU D 1 129 ? 14.187 73.338 -26.227 1.00 52.42  ? 128 GLU D CD  1 
ATOM   4341 O OE1 . GLU D 1 129 ? 12.967 73.241 -26.036 1.00 51.39  ? 128 GLU D OE1 1 
ATOM   4342 O OE2 . GLU D 1 129 ? 14.847 74.347 -25.931 1.00 55.13  ? 128 GLU D OE2 1 
ATOM   4343 N N   . GLU D 1 130 ? 13.249 69.535 -23.631 1.00 47.34  ? 129 GLU D N   1 
ATOM   4344 C CA  . GLU D 1 130 ? 13.291 68.745 -22.416 1.00 46.57  ? 129 GLU D CA  1 
ATOM   4345 C C   . GLU D 1 130 ? 12.163 67.692 -22.429 1.00 46.81  ? 129 GLU D C   1 
ATOM   4346 O O   . GLU D 1 130 ? 11.126 67.870 -21.806 1.00 46.27  ? 129 GLU D O   1 
ATOM   4347 C CB  . GLU D 1 130 ? 13.117 69.662 -21.211 1.00 49.54  ? 129 GLU D CB  1 
ATOM   4348 C CG  . GLU D 1 130 ? 14.124 70.803 -21.124 1.00 50.38  ? 129 GLU D CG  1 
ATOM   4349 C CD  . GLU D 1 130 ? 15.507 70.336 -20.728 1.00 52.46  ? 129 GLU D CD  1 
ATOM   4350 O OE1 . GLU D 1 130 ? 15.676 69.126 -20.462 1.00 55.54  ? 129 GLU D OE1 1 
ATOM   4351 O OE2 . GLU D 1 130 ? 16.433 71.175 -20.674 1.00 53.42  ? 129 GLU D OE2 1 
ATOM   4352 N N   . VAL D 1 131 ? 12.386 66.608 -23.161 1.00 46.68  ? 130 VAL D N   1 
ATOM   4353 C CA  . VAL D 1 131 ? 11.396 65.536 -23.274 1.00 44.76  ? 130 VAL D CA  1 
ATOM   4354 C C   . VAL D 1 131 ? 10.853 65.084 -21.914 1.00 42.90  ? 130 VAL D C   1 
ATOM   4355 O O   . VAL D 1 131 ? 9.654  64.902 -21.748 1.00 43.57  ? 130 VAL D O   1 
ATOM   4356 C CB  . VAL D 1 131 ? 11.991 64.315 -24.012 1.00 46.20  ? 130 VAL D CB  1 
ATOM   4357 C CG1 . VAL D 1 131 ? 12.443 64.727 -25.415 1.00 45.55  ? 130 VAL D CG1 1 
ATOM   4358 C CG2 . VAL D 1 131 ? 13.169 63.746 -23.220 1.00 46.96  ? 130 VAL D CG2 1 
ATOM   4359 N N   . LYS D 1 132 ? 11.747 64.917 -20.949 1.00 40.60  ? 131 LYS D N   1 
ATOM   4360 C CA  . LYS D 1 132 ? 11.336 64.479 -19.616 1.00 39.02  ? 131 LYS D CA  1 
ATOM   4361 C C   . LYS D 1 132 ? 10.217 65.355 -19.028 1.00 38.22  ? 131 LYS D C   1 
ATOM   4362 O O   . LYS D 1 132 ? 9.292  64.832 -18.440 1.00 40.38  ? 131 LYS D O   1 
ATOM   4363 C CB  . LYS D 1 132 ? 12.545 64.436 -18.678 1.00 38.09  ? 131 LYS D CB  1 
ATOM   4364 C CG  . LYS D 1 132 ? 13.404 63.201 -18.850 1.00 35.51  ? 131 LYS D CG  1 
ATOM   4365 C CD  . LYS D 1 132 ? 14.843 63.572 -18.695 1.00 37.60  ? 131 LYS D CD  1 
ATOM   4366 C CE  . LYS D 1 132 ? 15.771 62.409 -18.960 1.00 38.88  ? 131 LYS D CE  1 
ATOM   4367 N NZ  . LYS D 1 132 ? 15.826 61.494 -17.815 1.00 41.15  ? 131 LYS D NZ  1 
ATOM   4368 N N   . ILE D 1 133 ? 10.306 66.673 -19.193 1.00 36.65  ? 132 ILE D N   1 
ATOM   4369 C CA  . ILE D 1 133 ? 9.247  67.564 -18.677 1.00 34.48  ? 132 ILE D CA  1 
ATOM   4370 C C   . ILE D 1 133 ? 7.899  67.194 -19.317 1.00 36.28  ? 132 ILE D C   1 
ATOM   4371 O O   . ILE D 1 133 ? 6.902  67.054 -18.629 1.00 37.69  ? 132 ILE D O   1 
ATOM   4372 C CB  . ILE D 1 133 ? 9.566  69.052 -18.979 1.00 33.81  ? 132 ILE D CB  1 
ATOM   4373 C CG1 . ILE D 1 133 ? 10.841 69.477 -18.253 1.00 33.18  ? 132 ILE D CG1 1 
ATOM   4374 C CG2 . ILE D 1 133 ? 8.425  69.945 -18.556 1.00 31.56  ? 132 ILE D CG2 1 
ATOM   4375 C CD1 . ILE D 1 133 ? 11.197 70.936 -18.468 1.00 33.20  ? 132 ILE D CD1 1 
ATOM   4376 N N   . ALA D 1 134 ? 7.895  67.012 -20.639 1.00 37.76  ? 133 ALA D N   1 
ATOM   4377 C CA  . ALA D 1 134 ? 6.656  66.636 -21.371 1.00 36.24  ? 133 ALA D CA  1 
ATOM   4378 C C   . ALA D 1 134 ? 6.143  65.253 -20.925 1.00 35.00  ? 133 ALA D C   1 
ATOM   4379 O O   . ALA D 1 134 ? 4.963  65.088 -20.693 1.00 34.83  ? 133 ALA D O   1 
ATOM   4380 C CB  . ALA D 1 134 ? 6.905  66.643 -22.886 1.00 31.75  ? 133 ALA D CB  1 
ATOM   4381 N N   . GLU D 1 135 ? 7.051  64.283 -20.819 1.00 35.30  ? 134 GLU D N   1 
ATOM   4382 C CA  . GLU D 1 135 ? 6.677  62.921 -20.381 1.00 36.00  ? 134 GLU D CA  1 
ATOM   4383 C C   . GLU D 1 135 ? 5.948  62.963 -18.994 1.00 35.57  ? 134 GLU D C   1 
ATOM   4384 O O   . GLU D 1 135 ? 4.853  62.418 -18.839 1.00 33.17  ? 134 GLU D O   1 
ATOM   4385 C CB  . GLU D 1 135 ? 7.936  62.038 -20.319 1.00 37.42  ? 134 GLU D CB  1 
ATOM   4386 C CG  . GLU D 1 135 ? 7.711  60.621 -19.792 1.00 41.15  ? 134 GLU D CG  1 
ATOM   4387 C CD  . GLU D 1 135 ? 8.948  59.702 -19.887 1.00 44.45  ? 134 GLU D CD  1 
ATOM   4388 O OE1 . GLU D 1 135 ? 8.779  58.490 -19.610 1.00 44.97  ? 134 GLU D OE1 1 
ATOM   4389 O OE2 . GLU D 1 135 ? 10.068 60.173 -20.224 1.00 42.68  ? 134 GLU D OE2 1 
ATOM   4390 N N   . ALA D 1 136 ? 6.559  63.646 -18.024 1.00 34.98  ? 135 ALA D N   1 
ATOM   4391 C CA  . ALA D 1 136 ? 5.965  63.782 -16.681 1.00 36.80  ? 135 ALA D CA  1 
ATOM   4392 C C   . ALA D 1 136 ? 4.592  64.469 -16.764 1.00 38.95  ? 135 ALA D C   1 
ATOM   4393 O O   . ALA D 1 136 ? 3.615  64.010 -16.173 1.00 39.58  ? 135 ALA D O   1 
ATOM   4394 C CB  . ALA D 1 136 ? 6.890  64.580 -15.765 1.00 34.61  ? 135 ALA D CB  1 
ATOM   4395 N N   . TYR D 1 137 ? 4.540  65.568 -17.518 1.00 40.62  ? 136 TYR D N   1 
ATOM   4396 C CA  . TYR D 1 137 ? 3.286  66.308 -17.700 1.00 40.20  ? 136 TYR D CA  1 
ATOM   4397 C C   . TYR D 1 137 ? 2.222  65.409 -18.329 1.00 40.75  ? 136 TYR D C   1 
ATOM   4398 O O   . TYR D 1 137 ? 1.082  65.353 -17.863 1.00 40.13  ? 136 TYR D O   1 
ATOM   4399 C CB  . TYR D 1 137 ? 3.500  67.519 -18.596 1.00 38.29  ? 136 TYR D CB  1 
ATOM   4400 C CG  . TYR D 1 137 ? 2.273  68.385 -18.705 1.00 39.31  ? 136 TYR D CG  1 
ATOM   4401 C CD1 . TYR D 1 137 ? 1.776  69.062 -17.594 1.00 39.29  ? 136 TYR D CD1 1 
ATOM   4402 C CD2 . TYR D 1 137 ? 1.616  68.543 -19.924 1.00 39.50  ? 136 TYR D CD2 1 
ATOM   4403 C CE1 . TYR D 1 137 ? 0.653  69.885 -17.697 1.00 41.19  ? 136 TYR D CE1 1 
ATOM   4404 C CE2 . TYR D 1 137 ? 0.493  69.360 -20.043 1.00 41.18  ? 136 TYR D CE2 1 
ATOM   4405 C CZ  . TYR D 1 137 ? 0.017  70.031 -18.922 1.00 43.40  ? 136 TYR D CZ  1 
ATOM   4406 O OH  . TYR D 1 137 ? -1.091 70.850 -19.029 1.00 44.93  ? 136 TYR D OH  1 
ATOM   4407 N N   . GLN D 1 138 ? 2.621  64.712 -19.389 1.00 41.69  ? 137 GLN D N   1 
ATOM   4408 C CA  . GLN D 1 138 ? 1.718  63.789 -20.083 1.00 44.49  ? 137 GLN D CA  1 
ATOM   4409 C C   . GLN D 1 138 ? 1.182  62.695 -19.124 1.00 44.33  ? 137 GLN D C   1 
ATOM   4410 O O   . GLN D 1 138 ? 0.017  62.334 -19.176 1.00 43.29  ? 137 GLN D O   1 
ATOM   4411 C CB  . GLN D 1 138 ? 2.435  63.139 -21.264 1.00 47.11  ? 137 GLN D CB  1 
ATOM   4412 C CG  . GLN D 1 138 ? 1.513  62.357 -22.156 1.00 51.38  ? 137 GLN D CG  1 
ATOM   4413 C CD  . GLN D 1 138 ? 0.301  63.168 -22.540 1.00 54.95  ? 137 GLN D CD  1 
ATOM   4414 O OE1 . GLN D 1 138 ? 0.421  64.300 -23.020 1.00 56.85  ? 137 GLN D OE1 1 
ATOM   4415 N NE2 . GLN D 1 138 ? -0.883 62.596 -22.325 1.00 55.10  ? 137 GLN D NE2 1 
ATOM   4416 N N   . MET D 1 139 ? 2.049  62.171 -18.263 1.00 44.94  ? 138 MET D N   1 
ATOM   4417 C CA  . MET D 1 139 ? 1.576  61.175 -17.320 1.00 45.74  ? 138 MET D CA  1 
ATOM   4418 C C   . MET D 1 139 ? 0.530  61.819 -16.378 1.00 46.25  ? 138 MET D C   1 
ATOM   4419 O O   . MET D 1 139 ? -0.528 61.257 -16.154 1.00 48.06  ? 138 MET D O   1 
ATOM   4420 C CB  . MET D 1 139 ? 2.731  60.588 -16.509 1.00 44.15  ? 138 MET D CB  1 
ATOM   4421 C CG  . MET D 1 139 ? 2.287  59.580 -15.446 1.00 44.41  ? 138 MET D CG  1 
ATOM   4422 S SD  . MET D 1 139 ? 3.474  59.437 -14.055 1.00 47.44  ? 138 MET D SD  1 
ATOM   4423 C CE  . MET D 1 139 ? 3.089  60.927 -13.082 1.00 46.65  ? 138 MET D CE  1 
ATOM   4424 N N   . LEU D 1 140 ? 0.827  63.005 -15.855 1.00 45.91  ? 139 LEU D N   1 
ATOM   4425 C CA  . LEU D 1 140 ? -0.131 63.678 -14.963 1.00 46.12  ? 139 LEU D CA  1 
ATOM   4426 C C   . LEU D 1 140 ? -1.481 63.844 -15.654 1.00 46.44  ? 139 LEU D C   1 
ATOM   4427 O O   . LEU D 1 140 ? -2.520 63.762 -15.027 1.00 46.44  ? 139 LEU D O   1 
ATOM   4428 C CB  . LEU D 1 140 ? 0.381  65.055 -14.531 1.00 43.73  ? 139 LEU D CB  1 
ATOM   4429 C CG  . LEU D 1 140 ? 1.677  65.043 -13.721 1.00 44.21  ? 139 LEU D CG  1 
ATOM   4430 C CD1 . LEU D 1 140 ? 2.079  66.472 -13.330 1.00 42.22  ? 139 LEU D CD1 1 
ATOM   4431 C CD2 . LEU D 1 140 ? 1.486  64.190 -12.494 1.00 41.15  ? 139 LEU D CD2 1 
ATOM   4432 N N   . LYS D 1 141 ? -1.435 64.081 -16.957 1.00 47.78  ? 140 LYS D N   1 
ATOM   4433 C CA  . LYS D 1 141 ? -2.659 64.241 -17.738 1.00 49.42  ? 140 LYS D CA  1 
ATOM   4434 C C   . LYS D 1 141 ? -3.364 62.886 -17.904 1.00 49.32  ? 140 LYS D C   1 
ATOM   4435 O O   . LYS D 1 141 ? -4.569 62.792 -17.800 1.00 48.31  ? 140 LYS D O   1 
ATOM   4436 C CB  . LYS D 1 141 ? -2.338 64.833 -19.111 1.00 50.78  ? 140 LYS D CB  1 
ATOM   4437 C CG  . LYS D 1 141 ? -3.567 65.159 -19.918 1.00 54.14  ? 140 LYS D CG  1 
ATOM   4438 C CD  . LYS D 1 141 ? -3.502 66.550 -20.531 1.00 56.03  ? 140 LYS D CD  1 
ATOM   4439 C CE  . LYS D 1 141 ? -2.526 66.634 -21.697 1.00 57.63  ? 140 LYS D CE  1 
ATOM   4440 N NZ  . LYS D 1 141 ? -2.666 67.941 -22.412 1.00 57.00  ? 140 LYS D NZ  1 
ATOM   4441 N N   . LYS D 1 142 ? -2.580 61.840 -18.142 1.00 50.95  ? 141 LYS D N   1 
ATOM   4442 C CA  . LYS D 1 142 ? -3.150 60.501 -18.302 1.00 52.71  ? 141 LYS D CA  1 
ATOM   4443 C C   . LYS D 1 142 ? -3.824 60.030 -17.013 1.00 52.35  ? 141 LYS D C   1 
ATOM   4444 O O   . LYS D 1 142 ? -4.740 59.233 -17.049 1.00 53.57  ? 141 LYS D O   1 
ATOM   4445 C CB  . LYS D 1 142 ? -2.076 59.482 -18.697 1.00 55.43  ? 141 LYS D CB  1 
ATOM   4446 C CG  . LYS D 1 142 ? -2.668 58.123 -19.110 1.00 59.77  ? 141 LYS D CG  1 
ATOM   4447 C CD  . LYS D 1 142 ? -1.668 56.974 -19.032 1.00 62.26  ? 141 LYS D CD  1 
ATOM   4448 C CE  . LYS D 1 142 ? -1.306 56.648 -17.579 1.00 64.71  ? 141 LYS D CE  1 
ATOM   4449 N NZ  . LYS D 1 142 ? -0.346 55.496 -17.484 1.00 66.66  ? 141 LYS D NZ  1 
ATOM   4450 N N   . GLN D 1 143 ? -3.352 60.537 -15.881 1.00 51.68  ? 142 GLN D N   1 
ATOM   4451 C CA  . GLN D 1 143 ? -3.923 60.156 -14.582 1.00 51.08  ? 142 GLN D CA  1 
ATOM   4452 C C   . GLN D 1 143 ? -5.047 61.130 -14.122 1.00 50.98  ? 142 GLN D C   1 
ATOM   4453 O O   . GLN D 1 143 ? -5.635 60.974 -13.051 1.00 48.55  ? 142 GLN D O   1 
ATOM   4454 C CB  . GLN D 1 143 ? -2.812 60.101 -13.536 1.00 51.72  ? 142 GLN D CB  1 
ATOM   4455 C CG  . GLN D 1 143 ? -1.573 59.373 -14.025 1.00 52.96  ? 142 GLN D CG  1 
ATOM   4456 C CD  . GLN D 1 143 ? -0.570 59.099 -12.918 1.00 54.30  ? 142 GLN D CD  1 
ATOM   4457 O OE1 . GLN D 1 143 ? 0.465  58.486 -13.154 1.00 53.23  ? 142 GLN D OE1 1 
ATOM   4458 N NE2 . GLN D 1 143 ? -0.878 59.552 -11.702 1.00 53.75  ? 142 GLN D NE2 1 
ATOM   4459 N N   . GLY D 1 144 ? -5.325 62.127 -14.955 1.00 50.63  ? 143 GLY D N   1 
ATOM   4460 C CA  . GLY D 1 144 ? -6.366 63.074 -14.619 1.00 51.65  ? 143 GLY D CA  1 
ATOM   4461 C C   . GLY D 1 144 ? -5.923 64.185 -13.687 1.00 51.87  ? 143 GLY D C   1 
ATOM   4462 O O   . GLY D 1 144 ? -6.668 65.124 -13.481 1.00 53.19  ? 143 GLY D O   1 
ATOM   4463 N N   . ILE D 1 145 ? -4.730 64.080 -13.106 1.00 51.24  ? 144 ILE D N   1 
ATOM   4464 C CA  . ILE D 1 145 ? -4.254 65.147 -12.226 1.00 50.78  ? 144 ILE D CA  1 
ATOM   4465 C C   . ILE D 1 145 ? -4.328 66.492 -12.975 1.00 49.94  ? 144 ILE D C   1 
ATOM   4466 O O   . ILE D 1 145 ? -4.516 67.537 -12.387 1.00 49.67  ? 144 ILE D O   1 
ATOM   4467 C CB  . ILE D 1 145 ? -2.823 64.890 -11.775 1.00 51.71  ? 144 ILE D CB  1 
ATOM   4468 C CG1 . ILE D 1 145 ? -2.760 63.591 -10.979 1.00 52.32  ? 144 ILE D CG1 1 
ATOM   4469 C CG2 . ILE D 1 145 ? -2.342 66.024 -10.907 1.00 52.80  ? 144 ILE D CG2 1 
ATOM   4470 C CD1 . ILE D 1 145 ? -1.346 63.175 -10.620 1.00 52.31  ? 144 ILE D CD1 1 
ATOM   4471 N N   . VAL D 1 146 ? -4.177 66.409 -14.290 1.00 50.82  ? 145 VAL D N   1 
ATOM   4472 C CA  . VAL D 1 146 ? -4.284 67.556 -15.196 1.00 51.44  ? 145 VAL D CA  1 
ATOM   4473 C C   . VAL D 1 146 ? -5.542 67.334 -16.050 1.00 53.37  ? 145 VAL D C   1 
ATOM   4474 O O   . VAL D 1 146 ? -5.615 66.357 -16.772 1.00 56.44  ? 145 VAL D O   1 
ATOM   4475 C CB  . VAL D 1 146 ? -3.093 67.631 -16.150 1.00 50.70  ? 145 VAL D CB  1 
ATOM   4476 C CG1 . VAL D 1 146 ? -3.336 68.701 -17.201 1.00 51.57  ? 145 VAL D CG1 1 
ATOM   4477 C CG2 . VAL D 1 146 ? -1.833 67.931 -15.380 1.00 52.22  ? 145 VAL D CG2 1 
ATOM   4478 N N   . LYS D 1 147 ? -6.527 68.213 -15.963 1.00 53.68  ? 146 LYS D N   1 
ATOM   4479 C CA  . LYS D 1 147 ? -7.741 67.997 -16.746 1.00 53.78  ? 146 LYS D CA  1 
ATOM   4480 C C   . LYS D 1 147 ? -7.646 68.617 -18.161 1.00 54.68  ? 146 LYS D C   1 
ATOM   4481 O O   . LYS D 1 147 ? -8.091 68.034 -19.143 1.00 54.51  ? 146 LYS D O   1 
ATOM   4482 C CB  . LYS D 1 147 ? -8.931 68.537 -15.963 1.00 53.76  ? 146 LYS D CB  1 
ATOM   4483 C CG  . LYS D 1 147 ? -9.030 67.925 -14.566 1.00 52.83  ? 146 LYS D CG  1 
ATOM   4484 C CD  . LYS D 1 147 ? -9.539 66.487 -14.622 1.00 52.40  ? 146 LYS D CD  1 
ATOM   4485 C CE  . LYS D 1 147 ? -9.450 65.789 -13.273 1.00 48.95  ? 146 LYS D CE  1 
ATOM   4486 N NZ  . LYS D 1 147 ? -9.919 66.663 -12.177 1.00 49.92  ? 146 LYS D NZ  1 
ATOM   4487 N N   . SER D 1 148 ? -7.045 69.794 -18.240 1.00 55.55  ? 147 SER D N   1 
ATOM   4488 C CA  . SER D 1 148 ? -6.848 70.487 -19.521 1.00 57.49  ? 147 SER D CA  1 
ATOM   4489 C C   . SER D 1 148 ? -5.669 71.478 -19.406 1.00 59.18  ? 147 SER D C   1 
ATOM   4490 O O   . SER D 1 148 ? -5.236 71.800 -18.312 1.00 59.05  ? 147 SER D O   1 
ATOM   4491 C CB  . SER D 1 148 ? -8.119 71.242 -19.925 1.00 56.07  ? 147 SER D CB  1 
ATOM   4492 O OG  . SER D 1 148 ? -8.161 72.533 -19.340 1.00 55.09  ? 147 SER D OG  1 
ATOM   4493 N N   . ASP D 1 149 ? -5.169 71.965 -20.530 1.00 61.77  ? 148 ASP D N   1 
ATOM   4494 C CA  . ASP D 1 149 ? -4.034 72.900 -20.479 1.00 66.27  ? 148 ASP D CA  1 
ATOM   4495 C C   . ASP D 1 149 ? -4.432 74.343 -20.016 1.00 67.83  ? 148 ASP D C   1 
ATOM   4496 O O   . ASP D 1 149 ? -5.327 74.946 -20.594 1.00 68.16  ? 148 ASP D O   1 
ATOM   4497 C CB  . ASP D 1 149 ? -3.358 72.966 -21.859 1.00 67.05  ? 148 ASP D CB  1 
ATOM   4498 C CG  . ASP D 1 149 ? -3.034 71.583 -22.424 1.00 68.19  ? 148 ASP D CG  1 
ATOM   4499 O OD1 . ASP D 1 149 ? -2.534 70.702 -21.679 1.00 68.10  ? 148 ASP D OD1 1 
ATOM   4500 O OD2 . ASP D 1 149 ? -3.267 71.378 -23.630 1.00 69.28  ? 148 ASP D OD2 1 
ATOM   4501 N N   . PRO D 1 150 ? -3.766 74.886 -18.965 1.00 69.14  ? 149 PRO D N   1 
ATOM   4502 C CA  . PRO D 1 150 ? -4.076 76.240 -18.471 1.00 69.68  ? 149 PRO D CA  1 
ATOM   4503 C C   . PRO D 1 150 ? -3.885 77.358 -19.556 1.00 70.01  ? 149 PRO D C   1 
ATOM   4504 O O   . PRO D 1 150 ? -3.439 77.015 -20.674 1.00 69.30  ? 149 PRO D O   1 
ATOM   4505 C CB  . PRO D 1 150 ? -3.112 76.405 -17.292 1.00 69.39  ? 149 PRO D CB  1 
ATOM   4506 C CG  . PRO D 1 150 ? -2.962 75.007 -16.782 1.00 69.37  ? 149 PRO D CG  1 
ATOM   4507 C CD  . PRO D 1 150 ? -2.807 74.216 -18.063 1.00 69.43  ? 149 PRO D CD  1 
ATOM   4508 N N   . ASP E 2 2   ? 29.775 33.052 66.841  1.00 70.13  ? 2   ASP E N   1 
ATOM   4509 C CA  . ASP E 2 2   ? 28.811 33.869 67.627  1.00 70.00  ? 2   ASP E CA  1 
ATOM   4510 C C   . ASP E 2 2   ? 27.379 33.503 67.158  1.00 68.65  ? 2   ASP E C   1 
ATOM   4511 O O   . ASP E 2 2   ? 27.201 32.551 66.398  1.00 70.02  ? 2   ASP E O   1 
ATOM   4512 C CB  . ASP E 2 2   ? 29.089 35.367 67.405  1.00 72.08  ? 2   ASP E CB  1 
ATOM   4513 C CG  . ASP E 2 2   ? 28.755 36.228 68.637  1.00 74.78  ? 2   ASP E CG  1 
ATOM   4514 O OD1 . ASP E 2 2   ? 27.584 36.225 69.085  1.00 75.79  ? 2   ASP E OD1 1 
ATOM   4515 O OD2 . ASP E 2 2   ? 29.666 36.914 69.156  1.00 73.97  ? 2   ASP E OD2 1 
ATOM   4516 N N   . ASP E 2 3   ? 26.384 34.261 67.618  1.00 64.70  ? 3   ASP E N   1 
ATOM   4517 C CA  . ASP E 2 3   ? 24.970 34.003 67.265  1.00 60.51  ? 3   ASP E CA  1 
ATOM   4518 C C   . ASP E 2 3   ? 24.203 35.296 66.945  1.00 58.73  ? 3   ASP E C   1 
ATOM   4519 O O   . ASP E 2 3   ? 24.526 36.344 67.442  1.00 58.72  ? 3   ASP E O   1 
ATOM   4520 C CB  . ASP E 2 3   ? 24.276 33.249 68.421  1.00 58.45  ? 3   ASP E CB  1 
ATOM   4521 C CG  . ASP E 2 3   ? 22.816 32.907 68.126  1.00 57.10  ? 3   ASP E CG  1 
ATOM   4522 O OD1 . ASP E 2 3   ? 22.491 32.611 66.950  1.00 55.67  ? 3   ASP E OD1 1 
ATOM   4523 O OD2 . ASP E 2 3   ? 21.998 32.907 69.075  1.00 54.20  ? 3   ASP E OD2 1 
ATOM   4524 N N   . ILE E 2 4   ? 23.191 35.196 66.098  1.00 57.35  ? 4   ILE E N   1 
ATOM   4525 C CA  . ILE E 2 4   ? 22.411 36.366 65.744  1.00 56.60  ? 4   ILE E CA  1 
ATOM   4526 C C   . ILE E 2 4   ? 21.212 36.527 66.668  1.00 56.62  ? 4   ILE E C   1 
ATOM   4527 O O   . ILE E 2 4   ? 20.918 35.652 67.456  1.00 56.36  ? 4   ILE E O   1 
ATOM   4528 C CB  . ILE E 2 4   ? 21.916 36.266 64.314  1.00 56.67  ? 4   ILE E CB  1 
ATOM   4529 C CG1 . ILE E 2 4   ? 20.855 35.176 64.213  1.00 57.43  ? 4   ILE E CG1 1 
ATOM   4530 C CG2 . ILE E 2 4   ? 23.081 35.931 63.407  1.00 56.01  ? 4   ILE E CG2 1 
ATOM   4531 C CD1 . ILE E 2 4   ? 20.334 34.969 62.828  1.00 56.96  ? 4   ILE E CD1 1 
HETATM 4532 N N   . SEP E 2 5   ? 20.530 37.659 66.546  1.00 58.51  ? 5   SEP E N   1 
HETATM 4533 C CA  . SEP E 2 5   ? 19.361 37.966 67.388  1.00 59.67  ? 5   SEP E CA  1 
HETATM 4534 C CB  . SEP E 2 5   ? 19.081 39.481 67.302  1.00 63.97  ? 5   SEP E CB  1 
HETATM 4535 O OG  . SEP E 2 5   ? 18.932 40.051 66.281  1.00 72.67  ? 5   SEP E OG  1 
HETATM 4536 C C   . SEP E 2 5   ? 18.096 37.177 66.969  1.00 57.95  ? 5   SEP E C   1 
HETATM 4537 O O   . SEP E 2 5   ? 17.993 36.656 65.863  1.00 55.94  ? 5   SEP E O   1 
HETATM 4538 P P   . SEP E 2 5   ? 19.384 41.517 66.644  1.00 78.63  ? 5   SEP E P   1 
HETATM 4539 O O1P . SEP E 2 5   ? 18.572 42.444 67.622  1.00 76.39  ? 5   SEP E O1P 1 
HETATM 4540 O O2P . SEP E 2 5   ? 19.117 42.013 65.135  1.00 76.88  ? 5   SEP E O2P 1 
HETATM 4541 O O3P . SEP E 2 5   ? 20.937 41.421 66.980  1.00 77.76  ? 5   SEP E O3P 1 
ATOM   4542 N N   . LEU E 2 6   ? 17.155 37.083 67.898  1.00 57.93  ? 6   LEU E N   1 
ATOM   4543 C CA  . LEU E 2 6   ? 15.905 36.383 67.631  1.00 57.86  ? 6   LEU E CA  1 
ATOM   4544 C C   . LEU E 2 6   ? 15.109 37.080 66.534  1.00 58.27  ? 6   LEU E C   1 
ATOM   4545 O O   . LEU E 2 6   ? 14.998 38.288 66.516  1.00 57.12  ? 6   LEU E O   1 
ATOM   4546 C CB  . LEU E 2 6   ? 15.040 36.306 68.896  1.00 56.02  ? 6   LEU E CB  1 
ATOM   4547 C CG  . LEU E 2 6   ? 13.554 35.974 68.682  1.00 55.59  ? 6   LEU E CG  1 
ATOM   4548 C CD1 . LEU E 2 6   ? 13.396 34.581 68.114  1.00 54.52  ? 6   LEU E CD1 1 
ATOM   4549 C CD2 . LEU E 2 6   ? 12.814 36.087 69.995  1.00 54.42  ? 6   LEU E CD2 1 
ATOM   4550 N N   . LEU E 2 7   ? 14.578 36.286 65.617  1.00 60.47  ? 7   LEU E N   1 
ATOM   4551 C CA  . LEU E 2 7   ? 13.761 36.809 64.535  1.00 61.46  ? 7   LEU E CA  1 
ATOM   4552 C C   . LEU E 2 7   ? 12.488 37.448 65.140  1.00 62.45  ? 7   LEU E C   1 
ATOM   4553 O O   . LEU E 2 7   ? 12.007 37.013 66.182  1.00 62.09  ? 7   LEU E O   1 
ATOM   4554 C CB  . LEU E 2 7   ? 13.407 35.665 63.580  1.00 61.93  ? 7   LEU E CB  1 
ATOM   4555 C CG  . LEU E 2 7   ? 12.779 35.987 62.226  1.00 63.70  ? 7   LEU E CG  1 
ATOM   4556 C CD1 . LEU E 2 7   ? 13.661 36.983 61.489  1.00 64.01  ? 7   LEU E CD1 1 
ATOM   4557 C CD2 . LEU E 2 7   ? 12.602 34.707 61.411  1.00 61.48  ? 7   LEU E CD2 1 
ATOM   4558 N N   . LYS E 2 8   ? 11.977 38.490 64.496  1.00 64.32  ? 8   LYS E N   1 
ATOM   4559 C CA  . LYS E 2 8   ? 10.784 39.183 64.998  1.00 66.84  ? 8   LYS E CA  1 
ATOM   4560 C C   . LYS E 2 8   ? 9.469  38.527 64.529  1.00 67.78  ? 8   LYS E C   1 
ATOM   4561 O O   . LYS E 2 8   ? 9.491  37.813 63.502  1.00 68.37  ? 8   LYS E O   1 
ATOM   4562 C CB  . LYS E 2 8   ? 10.812 40.645 64.551  1.00 67.99  ? 8   LYS E CB  1 
ATOM   4563 C CG  . LYS E 2 8   ? 10.349 41.630 65.615  1.00 71.72  ? 8   LYS E CG  1 
ATOM   4564 C CD  . LYS E 2 8   ? 11.187 41.481 66.886  1.00 74.39  ? 8   LYS E CD  1 
ATOM   4565 C CE  . LYS E 2 8   ? 10.841 42.529 67.946  1.00 74.76  ? 8   LYS E CE  1 
ATOM   4566 N NZ  . LYS E 2 8   ? 11.203 43.923 67.537  1.00 75.21  ? 8   LYS E NZ  1 
ATOM   4567 O OXT . LYS E 2 8   ? 8.440  38.756 65.196  1.00 68.06  ? 8   LYS E OXT 1 
ATOM   4568 N N   . ASP F 2 2   ? -0.310 40.753 42.241  1.00 81.39  ? 2   ASP F N   1 
ATOM   4569 C CA  . ASP F 2 2   ? -0.039 39.285 42.242  1.00 81.24  ? 2   ASP F CA  1 
ATOM   4570 C C   . ASP F 2 2   ? 1.468  38.999 42.538  1.00 80.05  ? 2   ASP F C   1 
ATOM   4571 O O   . ASP F 2 2   ? 1.954  37.883 42.361  1.00 79.53  ? 2   ASP F O   1 
ATOM   4572 C CB  . ASP F 2 2   ? -0.432 38.666 40.886  1.00 82.06  ? 2   ASP F CB  1 
ATOM   4573 C CG  . ASP F 2 2   ? -1.957 38.573 40.679  1.00 82.60  ? 2   ASP F CG  1 
ATOM   4574 O OD1 . ASP F 2 2   ? -2.378 37.869 39.730  1.00 82.68  ? 2   ASP F OD1 1 
ATOM   4575 O OD2 . ASP F 2 2   ? -2.733 39.197 41.444  1.00 81.41  ? 2   ASP F OD2 1 
ATOM   4576 N N   . ASP F 2 3   ? 2.177  40.021 43.000  1.00 77.78  ? 3   ASP F N   1 
ATOM   4577 C CA  . ASP F 2 3   ? 3.601  39.879 43.302  1.00 75.80  ? 3   ASP F CA  1 
ATOM   4578 C C   . ASP F 2 3   ? 3.966  40.539 44.652  1.00 75.31  ? 3   ASP F C   1 
ATOM   4579 O O   . ASP F 2 3   ? 3.133  41.179 45.278  1.00 75.26  ? 3   ASP F O   1 
ATOM   4580 C CB  . ASP F 2 3   ? 4.418  40.490 42.155  1.00 74.90  ? 3   ASP F CB  1 
ATOM   4581 C CG  . ASP F 2 3   ? 5.899  40.164 42.235  1.00 73.54  ? 3   ASP F CG  1 
ATOM   4582 O OD1 . ASP F 2 3   ? 6.276  39.143 42.848  1.00 72.81  ? 3   ASP F OD1 1 
ATOM   4583 O OD2 . ASP F 2 3   ? 6.689  40.930 41.653  1.00 72.80  ? 3   ASP F OD2 1 
ATOM   4584 N N   . ILE F 2 4   ? 5.213  40.367 45.076  1.00 73.57  ? 4   ILE F N   1 
ATOM   4585 C CA  . ILE F 2 4   ? 5.677  40.921 46.339  1.00 71.59  ? 4   ILE F CA  1 
ATOM   4586 C C   . ILE F 2 4   ? 6.591  42.134 46.123  1.00 70.56  ? 4   ILE F C   1 
ATOM   4587 O O   . ILE F 2 4   ? 6.915  42.463 45.004  1.00 70.16  ? 4   ILE F O   1 
ATOM   4588 C CB  . ILE F 2 4   ? 6.439  39.848 47.123  1.00 72.82  ? 4   ILE F CB  1 
ATOM   4589 C CG1 . ILE F 2 4   ? 5.703  38.521 47.001  1.00 74.49  ? 4   ILE F CG1 1 
ATOM   4590 C CG2 . ILE F 2 4   ? 6.494  40.199 48.595  1.00 74.40  ? 4   ILE F CG2 1 
ATOM   4591 C CD1 . ILE F 2 4   ? 4.297  38.567 47.545  1.00 74.16  ? 4   ILE F CD1 1 
HETATM 4592 N N   . SEP F 2 5   ? 6.976  42.790 47.211  1.00 70.02  ? 5   SEP F N   1 
HETATM 4593 C CA  . SEP F 2 5   ? 7.865  43.952 47.148  1.00 70.23  ? 5   SEP F CA  1 
HETATM 4594 C CB  . SEP F 2 5   ? 7.616  44.791 48.419  1.00 74.50  ? 5   SEP F CB  1 
HETATM 4595 O OG  . SEP F 2 5   ? 6.604  44.750 49.019  1.00 78.58  ? 5   SEP F OG  1 
HETATM 4596 C C   . SEP F 2 5   ? 9.356  43.525 47.115  1.00 68.69  ? 5   SEP F C   1 
HETATM 4597 O O   . SEP F 2 5   ? 9.752  42.595 47.803  1.00 67.81  ? 5   SEP F O   1 
HETATM 4598 P P   . SEP F 2 5   ? 6.589  46.163 49.678  1.00 81.28  ? 5   SEP F P   1 
HETATM 4599 O O1P . SEP F 2 5   ? 7.611  46.582 50.796  1.00 79.92  ? 5   SEP F O1P 1 
HETATM 4600 O O2P . SEP F 2 5   ? 5.175  45.858 50.370  1.00 77.54  ? 5   SEP F O2P 1 
HETATM 4601 O O3P . SEP F 2 5   ? 6.479  47.195 48.470  1.00 78.13  ? 5   SEP F O3P 1 
ATOM   4602 N N   . LEU F 2 6   ? 10.157 44.220 46.315  1.00 67.41  ? 6   LEU F N   1 
ATOM   4603 C CA  . LEU F 2 6   ? 11.600 43.925 46.190  1.00 66.61  ? 6   LEU F CA  1 
ATOM   4604 C C   . LEU F 2 6   ? 12.327 43.995 47.544  1.00 66.65  ? 6   LEU F C   1 
ATOM   4605 O O   . LEU F 2 6   ? 12.207 44.968 48.240  1.00 67.15  ? 6   LEU F O   1 
ATOM   4606 C CB  . LEU F 2 6   ? 12.247 44.925 45.218  1.00 65.09  ? 6   LEU F CB  1 
ATOM   4607 C CG  . LEU F 2 6   ? 13.764 44.872 44.967  1.00 64.06  ? 6   LEU F CG  1 
ATOM   4608 C CD1 . LEU F 2 6   ? 14.146 43.566 44.307  1.00 62.77  ? 6   LEU F CD1 1 
ATOM   4609 C CD2 . LEU F 2 6   ? 14.175 46.032 44.083  1.00 62.10  ? 6   LEU F CD2 1 
ATOM   4610 N N   . LEU F 2 7   ? 13.077 42.960 47.895  1.00 68.11  ? 7   LEU F N   1 
ATOM   4611 C CA  . LEU F 2 7   ? 13.811 42.958 49.175  1.00 70.71  ? 7   LEU F CA  1 
ATOM   4612 C C   . LEU F 2 7   ? 14.613 44.222 49.397  1.00 72.16  ? 7   LEU F C   1 
ATOM   4613 O O   . LEU F 2 7   ? 15.457 44.563 48.594  1.00 73.02  ? 7   LEU F O   1 
ATOM   4614 C CB  . LEU F 2 7   ? 14.791 41.805 49.248  1.00 71.15  ? 7   LEU F CB  1 
ATOM   4615 C CG  . LEU F 2 7   ? 14.220 40.441 49.564  1.00 72.64  ? 7   LEU F CG  1 
ATOM   4616 C CD1 . LEU F 2 7   ? 15.385 39.479 49.637  1.00 73.07  ? 7   LEU F CD1 1 
ATOM   4617 C CD2 . LEU F 2 7   ? 13.437 40.471 50.874  1.00 72.60  ? 7   LEU F CD2 1 
ATOM   4618 N N   . LYS F 2 8   ? 14.361 44.880 50.518  1.00 74.75  ? 8   LYS F N   1 
ATOM   4619 C CA  . LYS F 2 8   ? 15.069 46.113 50.852  1.00 77.21  ? 8   LYS F CA  1 
ATOM   4620 C C   . LYS F 2 8   ? 16.565 45.855 51.232  1.00 77.51  ? 8   LYS F C   1 
ATOM   4621 O O   . LYS F 2 8   ? 16.943 44.676 51.405  1.00 76.81  ? 8   LYS F O   1 
ATOM   4622 C CB  . LYS F 2 8   ? 14.318 46.828 51.989  1.00 78.45  ? 8   LYS F CB  1 
ATOM   4623 C CG  . LYS F 2 8   ? 12.839 47.142 51.657  1.00 79.97  ? 8   LYS F CG  1 
ATOM   4624 C CD  . LYS F 2 8   ? 12.073 47.746 52.842  1.00 82.53  ? 8   LYS F CD  1 
ATOM   4625 C CE  . LYS F 2 8   ? 11.055 46.769 53.448  1.00 83.23  ? 8   LYS F CE  1 
ATOM   4626 N NZ  . LYS F 2 8   ? 9.945  46.445 52.500  1.00 82.88  ? 8   LYS F NZ  1 
ATOM   4627 O OXT . LYS F 2 8   ? 17.331 46.840 51.330  1.00 78.20  ? 8   LYS F OXT 1 
ATOM   4628 N N   . ASP G 2 3   ? -4.285 56.434 10.607  1.00 64.60  ? 3   ASP G N   1 
ATOM   4629 C CA  . ASP G 2 3   ? -2.818 56.439 10.345  1.00 64.97  ? 3   ASP G CA  1 
ATOM   4630 C C   . ASP G 2 3   ? -2.488 55.590 9.101   1.00 65.22  ? 3   ASP G C   1 
ATOM   4631 O O   . ASP G 2 3   ? -3.307 54.818 8.651   1.00 67.06  ? 3   ASP G O   1 
ATOM   4632 C CB  . ASP G 2 3   ? -2.082 55.907 11.576  1.00 64.74  ? 3   ASP G CB  1 
ATOM   4633 C CG  . ASP G 2 3   ? -0.569 55.885 11.406  1.00 65.19  ? 3   ASP G CG  1 
ATOM   4634 O OD1 . ASP G 2 3   ? -0.013 56.755 10.702  1.00 63.62  ? 3   ASP G OD1 1 
ATOM   4635 O OD2 . ASP G 2 3   ? 0.072  54.996 12.005  1.00 65.16  ? 3   ASP G OD2 1 
ATOM   4636 N N   . ILE G 2 4   ? -1.292 55.763 8.550   1.00 65.40  ? 4   ILE G N   1 
ATOM   4637 C CA  . ILE G 2 4   ? -0.882 55.000 7.365   1.00 63.64  ? 4   ILE G CA  1 
ATOM   4638 C C   . ILE G 2 4   ? 0.062  53.835 7.732   1.00 64.10  ? 4   ILE G C   1 
ATOM   4639 O O   . ILE G 2 4   ? 0.504  53.724 8.862   1.00 63.31  ? 4   ILE G O   1 
ATOM   4640 C CB  . ILE G 2 4   ? -0.179 55.908 6.356   1.00 63.42  ? 4   ILE G CB  1 
ATOM   4641 C CG1 . ILE G 2 4   ? 1.158  56.381 6.920   1.00 64.19  ? 4   ILE G CG1 1 
ATOM   4642 C CG2 . ILE G 2 4   ? -1.056 57.113 6.060   1.00 63.53  ? 4   ILE G CG2 1 
ATOM   4643 C CD1 . ILE G 2 4   ? 2.006  57.141 5.929   1.00 63.91  ? 4   ILE G CD1 1 
HETATM 4644 N N   . SEP G 2 5   ? 0.358  52.982 6.758   1.00 65.05  ? 5   SEP G N   1 
HETATM 4645 C CA  . SEP G 2 5   ? 1.232  51.813 6.983   1.00 66.70  ? 5   SEP G CA  1 
HETATM 4646 C CB  . SEP G 2 5   ? 1.042  50.835 5.803   1.00 70.06  ? 5   SEP G CB  1 
HETATM 4647 O OG  . SEP G 2 5   ? 1.324  51.122 4.696   1.00 75.34  ? 5   SEP G OG  1 
HETATM 4648 C C   . SEP G 2 5   ? 2.732  52.187 7.067   1.00 65.27  ? 5   SEP G C   1 
HETATM 4649 O O   . SEP G 2 5   ? 3.176  53.139 6.449   1.00 63.77  ? 5   SEP G O   1 
HETATM 4650 P P   . SEP G 2 5   ? 0.366  50.205 3.891   1.00 77.82  ? 5   SEP G P   1 
HETATM 4651 O O1P . SEP G 2 5   ? 0.526  48.645 3.860   1.00 78.33  ? 5   SEP G O1P 1 
HETATM 4652 O O2P . SEP G 2 5   ? 0.896  50.787 2.498   1.00 76.74  ? 5   SEP G O2P 1 
HETATM 4653 O O3P . SEP G 2 5   ? -1.085 50.715 4.258   1.00 76.29  ? 5   SEP G O3P 1 
ATOM   4654 N N   . LEU G 2 6   ? 3.486  51.406 7.835   1.00 64.63  ? 6   LEU G N   1 
ATOM   4655 C CA  . LEU G 2 6   ? 4.934  51.627 7.990   1.00 64.47  ? 6   LEU G CA  1 
ATOM   4656 C C   . LEU G 2 6   ? 5.673  51.522 6.661   1.00 64.89  ? 6   LEU G C   1 
ATOM   4657 O O   . LEU G 2 6   ? 5.421  50.629 5.862   1.00 65.43  ? 6   LEU G O   1 
ATOM   4658 C CB  . LEU G 2 6   ? 5.542  50.605 8.965   1.00 63.99  ? 6   LEU G CB  1 
ATOM   4659 C CG  . LEU G 2 6   ? 7.076  50.401 8.996   1.00 64.26  ? 6   LEU G CG  1 
ATOM   4660 C CD1 . LEU G 2 6   ? 7.803  51.675 9.411   1.00 62.48  ? 6   LEU G CD1 1 
ATOM   4661 C CD2 . LEU G 2 6   ? 7.408  49.274 9.972   1.00 63.72  ? 6   LEU G CD2 1 
ATOM   4662 N N   . LEU G 2 7   ? 6.589  52.450 6.447   1.00 66.12  ? 7   LEU G N   1 
ATOM   4663 C CA  . LEU G 2 7   ? 7.390  52.454 5.238   1.00 66.43  ? 7   LEU G CA  1 
ATOM   4664 C C   . LEU G 2 7   ? 8.198  51.148 5.147   1.00 67.50  ? 7   LEU G C   1 
ATOM   4665 O O   . LEU G 2 7   ? 8.009  50.249 5.940   1.00 69.11  ? 7   LEU G O   1 
ATOM   4666 C CB  . LEU G 2 7   ? 8.340  53.643 5.273   1.00 65.24  ? 7   LEU G CB  1 
ATOM   4667 C CG  . LEU G 2 7   ? 8.864  54.166 3.945   1.00 64.28  ? 7   LEU G CG  1 
ATOM   4668 C CD1 . LEU G 2 7   ? 7.722  54.823 3.194   1.00 63.72  ? 7   LEU G CD1 1 
ATOM   4669 C CD2 . LEU G 2 7   ? 9.990  55.157 4.189   1.00 63.54  ? 7   LEU G CD2 1 
ATOM   4670 N N   . LYS G 2 8   ? 9.101  51.069 4.182   1.00 72.99  ? 8   LYS G N   1 
ATOM   4671 C CA  . LYS G 2 8   ? 9.924  49.865 4.012   1.00 74.18  ? 8   LYS G CA  1 
ATOM   4672 C C   . LYS G 2 8   ? 11.389 50.185 3.581   1.00 74.83  ? 8   LYS G C   1 
ATOM   4673 O O   . LYS G 2 8   ? 11.807 49.715 2.495   1.00 75.90  ? 8   LYS G O   1 
ATOM   4674 C CB  . LYS G 2 8   ? 9.238  48.942 3.001   1.00 75.03  ? 8   LYS G CB  1 
ATOM   4675 C CG  . LYS G 2 8   ? 7.857  48.476 3.461   1.00 76.51  ? 8   LYS G CG  1 
ATOM   4676 C CD  . LYS G 2 8   ? 6.883  48.304 2.298   1.00 78.46  ? 8   LYS G CD  1 
ATOM   4677 C CE  . LYS G 2 8   ? 5.458  48.023 2.792   1.00 79.34  ? 8   LYS G CE  1 
ATOM   4678 N NZ  . LYS G 2 8   ? 4.437  48.102 1.696   1.00 78.48  ? 8   LYS G NZ  1 
ATOM   4679 O OXT . LYS G 2 8   ? 12.083 50.900 4.352   1.00 75.09  ? 8   LYS G OXT 1 
ATOM   4680 N N   . ASP H 2 2   ? 22.894 59.115 -14.515 1.00 75.26  ? 2   ASP H N   1 
ATOM   4681 C CA  . ASP H 2 2   ? 22.936 59.953 -13.277 1.00 74.76  ? 2   ASP H CA  1 
ATOM   4682 C C   . ASP H 2 2   ? 21.500 60.303 -12.785 1.00 72.92  ? 2   ASP H C   1 
ATOM   4683 O O   . ASP H 2 2   ? 21.289 60.541 -11.606 1.00 73.32  ? 2   ASP H O   1 
ATOM   4684 C CB  . ASP H 2 2   ? 23.714 61.255 -13.531 1.00 76.34  ? 2   ASP H CB  1 
ATOM   4685 C CG  . ASP H 2 2   ? 22.943 62.240 -14.410 1.00 78.97  ? 2   ASP H CG  1 
ATOM   4686 O OD1 . ASP H 2 2   ? 22.674 61.929 -15.598 1.00 79.68  ? 2   ASP H OD1 1 
ATOM   4687 O OD2 . ASP H 2 2   ? 22.599 63.329 -13.903 1.00 79.65  ? 2   ASP H OD2 1 
ATOM   4688 N N   . ASP H 2 3   ? 20.533 60.342 -13.699 1.00 69.65  ? 3   ASP H N   1 
ATOM   4689 C CA  . ASP H 2 3   ? 19.143 60.661 -13.311 1.00 65.97  ? 3   ASP H CA  1 
ATOM   4690 C C   . ASP H 2 3   ? 18.343 59.380 -13.003 1.00 63.77  ? 3   ASP H C   1 
ATOM   4691 O O   . ASP H 2 3   ? 18.674 58.308 -13.471 1.00 64.24  ? 3   ASP H O   1 
ATOM   4692 C CB  . ASP H 2 3   ? 18.471 61.489 -14.422 1.00 64.45  ? 3   ASP H CB  1 
ATOM   4693 C CG  . ASP H 2 3   ? 17.038 61.914 -14.085 1.00 63.68  ? 3   ASP H CG  1 
ATOM   4694 O OD1 . ASP H 2 3   ? 16.703 62.120 -12.894 1.00 62.22  ? 3   ASP H OD1 1 
ATOM   4695 O OD2 . ASP H 2 3   ? 16.248 62.073 -15.038 1.00 61.56  ? 3   ASP H OD2 1 
ATOM   4696 N N   . ILE H 2 4   ? 17.313 59.514 -12.184 1.00 61.35  ? 4   ILE H N   1 
ATOM   4697 C CA  . ILE H 2 4   ? 16.499 58.377 -11.816 1.00 59.64  ? 4   ILE H CA  1 
ATOM   4698 C C   . ILE H 2 4   ? 15.288 58.227 -12.734 1.00 60.24  ? 4   ILE H C   1 
ATOM   4699 O O   . ILE H 2 4   ? 15.045 59.057 -13.584 1.00 60.07  ? 4   ILE H O   1 
ATOM   4700 C CB  . ILE H 2 4   ? 16.006 58.509 -10.373 1.00 59.53  ? 4   ILE H CB  1 
ATOM   4701 C CG1 . ILE H 2 4   ? 15.140 59.760 -10.228 1.00 58.99  ? 4   ILE H CG1 1 
ATOM   4702 C CG2 . ILE H 2 4   ? 17.189 58.605 -9.442  1.00 58.50  ? 4   ILE H CG2 1 
ATOM   4703 C CD1 . ILE H 2 4   ? 14.599 59.956 -8.847  1.00 56.29  ? 4   ILE H CD1 1 
HETATM 4704 N N   . SEP H 2 5   ? 14.544 57.147 -12.538 1.00 62.27  ? 5   SEP H N   1 
HETATM 4705 C CA  . SEP H 2 5   ? 13.348 56.858 -13.339 1.00 63.49  ? 5   SEP H CA  1 
HETATM 4706 C CB  . SEP H 2 5   ? 12.955 55.388 -13.084 1.00 67.27  ? 5   SEP H CB  1 
HETATM 4707 O OG  . SEP H 2 5   ? 13.299 54.803 -12.119 1.00 73.10  ? 5   SEP H OG  1 
HETATM 4708 C C   . SEP H 2 5   ? 12.144 57.759 -12.950 1.00 62.88  ? 5   SEP H C   1 
HETATM 4709 O O   . SEP H 2 5   ? 12.034 58.215 -11.820 1.00 61.56  ? 5   SEP H O   1 
HETATM 4710 P P   . SEP H 2 5   ? 13.267 53.314 -12.581 1.00 76.87  ? 5   SEP H P   1 
HETATM 4711 O O1P . SEP H 2 5   ? 11.921 52.559 -12.915 1.00 74.73  ? 5   SEP H O1P 1 
HETATM 4712 O O2P . SEP H 2 5   ? 13.770 52.846 -11.129 1.00 73.20  ? 5   SEP H O2P 1 
HETATM 4713 O O3P . SEP H 2 5   ? 14.397 53.178 -13.696 1.00 73.37  ? 5   SEP H O3P 1 
ATOM   4714 N N   . LEU H 2 6   ? 11.257 57.989 -13.909 1.00 62.98  ? 6   LEU H N   1 
ATOM   4715 C CA  . LEU H 2 6   ? 10.068 58.802 -13.678 1.00 62.94  ? 6   LEU H CA  1 
ATOM   4716 C C   . LEU H 2 6   ? 9.170  58.203 -12.603 1.00 63.78  ? 6   LEU H C   1 
ATOM   4717 O O   . LEU H 2 6   ? 8.756  57.077 -12.710 1.00 64.72  ? 6   LEU H O   1 
ATOM   4718 C CB  . LEU H 2 6   ? 9.257  58.935 -14.971 1.00 62.60  ? 6   LEU H CB  1 
ATOM   4719 C CG  . LEU H 2 6   ? 7.723  59.055 -14.855 1.00 61.76  ? 6   LEU H CG  1 
ATOM   4720 C CD1 . LEU H 2 6   ? 7.318  60.282 -14.058 1.00 62.41  ? 6   LEU H CD1 1 
ATOM   4721 C CD2 . LEU H 2 6   ? 7.125  59.127 -16.240 1.00 60.57  ? 6   LEU H CD2 1 
ATOM   4722 N N   . LEU H 2 7   ? 8.873  58.977 -11.573 1.00 65.24  ? 7   LEU H N   1 
ATOM   4723 C CA  . LEU H 2 7   ? 7.992  58.498 -10.515 1.00 66.98  ? 7   LEU H CA  1 
ATOM   4724 C C   . LEU H 2 7   ? 6.608  58.096 -11.112 1.00 68.86  ? 7   LEU H C   1 
ATOM   4725 O O   . LEU H 2 7   ? 5.907  58.930 -11.651 1.00 69.58  ? 7   LEU H O   1 
ATOM   4726 C CB  . LEU H 2 7   ? 7.819  59.602 -9.475  1.00 65.83  ? 7   LEU H CB  1 
ATOM   4727 C CG  . LEU H 2 7   ? 7.284  59.170 -8.114  1.00 66.45  ? 7   LEU H CG  1 
ATOM   4728 C CD1 . LEU H 2 7   ? 8.269  58.203 -7.466  1.00 65.21  ? 7   LEU H CD1 1 
ATOM   4729 C CD2 . LEU H 2 7   ? 7.081  60.387 -7.235  1.00 66.85  ? 7   LEU H CD2 1 
ATOM   4730 N N   . LYS H 2 8   ? 6.252  56.818 -11.024 1.00 71.10  ? 8   LYS H N   1 
ATOM   4731 C CA  . LYS H 2 8   ? 4.969  56.320 -11.569 1.00 74.16  ? 8   LYS H CA  1 
ATOM   4732 C C   . LYS H 2 8   ? 3.758  56.668 -10.670 1.00 74.64  ? 8   LYS H C   1 
ATOM   4733 O O   . LYS H 2 8   ? 3.962  56.828 -9.449  1.00 74.94  ? 8   LYS H O   1 
ATOM   4734 C CB  . LYS H 2 8   ? 5.056  54.800 -11.755 1.00 76.96  ? 8   LYS H CB  1 
ATOM   4735 C CG  . LYS H 2 8   ? 5.573  54.062 -10.506 1.00 80.25  ? 8   LYS H CG  1 
ATOM   4736 C CD  . LYS H 2 8   ? 6.478  52.857 -10.835 1.00 81.30  ? 8   LYS H CD  1 
ATOM   4737 C CE  . LYS H 2 8   ? 7.129  52.279 -9.563  1.00 81.73  ? 8   LYS H CE  1 
ATOM   4738 N NZ  . LYS H 2 8   ? 7.916  53.285 -8.763  1.00 81.03  ? 8   LYS H NZ  1 
ATOM   4739 O OXT . LYS H 2 8   ? 2.630  56.758 -11.196 1.00 74.54  ? 8   LYS H OXT 1 
HETATM 4740 O O   . HOH I 3 .   ? -1.669 21.533 54.811  1.00 47.73  ? 203 HOH A O   1 
HETATM 4741 O O   . HOH I 3 .   ? -0.570 25.099 53.755  1.00 35.11  ? 206 HOH A O   1 
HETATM 4742 O O   . HOH I 3 .   ? 14.264 8.846  56.219  1.00 30.42  ? 207 HOH A O   1 
HETATM 4743 O O   . HOH I 3 .   ? 18.162 13.770 47.807  1.00 35.40  ? 215 HOH A O   1 
HETATM 4744 O O   . HOH I 3 .   ? 20.756 26.412 56.059  1.00 35.48  ? 220 HOH A O   1 
HETATM 4745 O O   . HOH I 3 .   ? 30.821 24.349 59.976  1.00 53.47  ? 222 HOH A O   1 
HETATM 4746 O O   . HOH I 3 .   ? 6.834  15.353 49.281  1.00 34.17  ? 224 HOH A O   1 
HETATM 4747 O O   . HOH I 3 .   ? 23.731 10.955 48.990  1.00 40.87  ? 225 HOH A O   1 
HETATM 4748 O O   . HOH I 3 .   ? 10.477 6.141  44.895  1.00 37.21  ? 226 HOH A O   1 
HETATM 4749 O O   . HOH I 3 .   ? 6.441  22.015 53.672  1.00 37.49  ? 227 HOH A O   1 
HETATM 4750 O O   . HOH I 3 .   ? 14.044 16.312 74.303  1.00 45.16  ? 229 HOH A O   1 
HETATM 4751 O O   . HOH I 3 .   ? 17.093 13.402 77.262  1.00 46.89  ? 230 HOH A O   1 
HETATM 4752 O O   . HOH I 3 .   ? 23.698 29.357 72.542  1.00 45.50  ? 231 HOH A O   1 
HETATM 4753 O O   . HOH I 3 .   ? 3.279  15.500 73.670  1.00 36.51  ? 232 HOH A O   1 
HETATM 4754 O O   . HOH I 3 .   ? 16.393 15.705 74.090  1.00 37.98  ? 236 HOH A O   1 
HETATM 4755 O O   . HOH J 3 .   ? 18.515 18.167 44.484  1.00 23.44  ? 201 HOH B O   1 
HETATM 4756 O O   . HOH J 3 .   ? 26.336 24.815 34.030  1.00 35.27  ? 209 HOH B O   1 
HETATM 4757 O O   . HOH J 3 .   ? 17.183 17.042 47.273  1.00 25.99  ? 210 HOH B O   1 
HETATM 4758 O O   . HOH J 3 .   ? 6.369  19.622 46.459  1.00 44.95  ? 228 HOH B O   1 
HETATM 4759 O O   . HOH J 3 .   ? 23.062 14.486 30.386  1.00 44.28  ? 233 HOH B O   1 
HETATM 4760 O O   . HOH K 3 .   ? 17.635 76.727 17.750  1.00 26.56  ? 204 HOH C O   1 
HETATM 4761 O O   . HOH K 3 .   ? 20.680 64.088 22.664  1.00 29.89  ? 205 HOH C O   1 
HETATM 4762 O O   . HOH K 3 .   ? 16.317 82.628 16.999  1.00 36.25  ? 211 HOH C O   1 
HETATM 4763 O O   . HOH K 3 .   ? 8.301  63.044 1.753   1.00 40.44  ? 212 HOH C O   1 
HETATM 4764 O O   . HOH K 3 .   ? 13.471 77.078 9.460   1.00 31.73  ? 213 HOH C O   1 
HETATM 4765 O O   . HOH K 3 .   ? 19.395 80.007 23.648  1.00 37.09  ? 214 HOH C O   1 
HETATM 4766 O O   . HOH K 3 .   ? 5.468  85.852 15.998  1.00 43.34  ? 216 HOH C O   1 
HETATM 4767 O O   . HOH L 3 .   ? 12.379 79.723 3.425   1.00 36.56  ? 202 HOH D O   1 
HETATM 4768 O O   . HOH L 3 .   ? -6.455 70.402 -11.707 1.00 40.99  ? 208 HOH D O   1 
HETATM 4769 O O   . HOH L 3 .   ? -6.956 74.912 -1.157  1.00 40.98  ? 217 HOH D O   1 
HETATM 4770 O O   . HOH L 3 .   ? 8.785  80.751 -23.994 1.00 42.88  ? 218 HOH D O   1 
HETATM 4771 O O   . HOH L 3 .   ? 31.616 79.510 -6.315  1.00 46.20  ? 219 HOH D O   1 
HETATM 4772 O O   . HOH L 3 .   ? 17.597 67.972 -9.232  1.00 43.59  ? 221 HOH D O   1 
HETATM 4773 O O   . HOH L 3 .   ? 12.165 79.235 -21.166 1.00 42.63  ? 234 HOH D O   1 
HETATM 4774 O O   . HOH L 3 .   ? 11.278 81.302 -23.316 1.00 40.25  ? 235 HOH D O   1 
HETATM 4775 O O   . HOH L 3 .   ? 9.681  79.144 -20.275 1.00 45.26  ? 237 HOH D O   1 
HETATM 4776 O O   . HOH M 3 .   ? 15.977 55.310 -10.313 1.00 37.65  ? 223 HOH H O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   0   ?   ?   ?   A . n 
A 1 2   SER 2   1   ?   ?   ?   A . n 
A 1 3   GLU 3   2   ?   ?   ?   A . n 
A 1 4   PRO 4   3   ?   ?   ?   A . n 
A 1 5   ALA 5   4   ?   ?   ?   A . n 
A 1 6   MET 6   5   ?   ?   ?   A . n 
A 1 7   GLU 7   6   ?   ?   ?   A . n 
A 1 8   PRO 8   7   ?   ?   ?   A . n 
A 1 9   GLU 9   8   8   GLU GLU A . n 
A 1 10  THR 10  9   9   THR THR A . n 
A 1 11  LEU 11  10  10  LEU LEU A . n 
A 1 12  GLU 12  11  11  GLU GLU A . n 
A 1 13  ALA 13  12  12  ALA ALA A . n 
A 1 14  ARG 14  13  13  ARG ARG A . n 
A 1 15  ILE 15  14  14  ILE ILE A . n 
A 1 16  ASN 16  15  15  ASN ASN A . n 
A 1 17  ARG 17  16  16  ARG ARG A . n 
A 1 18  ALA 18  17  17  ALA ALA A . n 
A 1 19  THR 19  18  18  THR THR A . n 
A 1 20  ASN 20  19  19  ASN ASN A . n 
A 1 21  PRO 21  20  20  PRO PRO A . n 
A 1 22  LEU 22  21  21  LEU LEU A . n 
A 1 23  ASN 23  22  22  ASN ASN A . n 
A 1 24  LYS 24  23  23  LYS LYS A . n 
A 1 25  GLU 25  24  24  GLU GLU A . n 
A 1 26  LEU 26  25  25  LEU LEU A . n 
A 1 27  ASP 27  26  26  ASP ASP A . n 
A 1 28  TRP 28  27  27  TRP TRP A . n 
A 1 29  ALA 29  28  28  ALA ALA A . n 
A 1 30  SER 30  29  29  SER SER A . n 
A 1 31  ILE 31  30  30  ILE ILE A . n 
A 1 32  ASN 32  31  31  ASN ASN A . n 
A 1 33  GLY 33  32  32  GLY GLY A . n 
A 1 34  PHE 34  33  33  PHE PHE A . n 
A 1 35  CYS 35  34  34  CYS CYS A . n 
A 1 36  GLU 36  35  35  GLU GLU A . n 
A 1 37  GLN 37  36  36  GLN GLN A . n 
A 1 38  LEU 38  37  37  LEU LEU A . n 
A 1 39  ASN 39  38  38  ASN ASN A . n 
A 1 40  GLU 40  39  39  GLU GLU A . n 
A 1 41  ASP 41  40  40  ASP ASP A . n 
A 1 42  PHE 42  41  41  PHE PHE A . n 
A 1 43  GLU 43  42  42  GLU GLU A . n 
A 1 44  GLY 44  43  43  GLY GLY A . n 
A 1 45  PRO 45  44  44  PRO PRO A . n 
A 1 46  PRO 46  45  45  PRO PRO A . n 
A 1 47  LEU 47  46  46  LEU LEU A . n 
A 1 48  ALA 48  47  47  ALA ALA A . n 
A 1 49  THR 49  48  48  THR THR A . n 
A 1 50  ARG 50  49  49  ARG ARG A . n 
A 1 51  LEU 51  50  50  LEU LEU A . n 
A 1 52  LEU 52  51  51  LEU LEU A . n 
A 1 53  ALA 53  52  52  ALA ALA A . n 
A 1 54  HIS 54  53  53  HIS HIS A . n 
A 1 55  LYS 55  54  54  LYS LYS A . n 
A 1 56  ILE 56  55  55  ILE ILE A . n 
A 1 57  GLN 57  56  56  GLN GLN A . n 
A 1 58  SER 58  57  57  SER SER A . n 
A 1 59  PRO 59  58  58  PRO PRO A . n 
A 1 60  GLN 60  59  59  GLN GLN A . n 
A 1 61  GLU 61  60  60  GLU GLU A . n 
A 1 62  TRP 62  61  61  TRP TRP A . n 
A 1 63  GLU 63  62  62  GLU GLU A . n 
A 1 64  ALA 64  63  63  ALA ALA A . n 
A 1 65  ILE 65  64  64  ILE ILE A . n 
A 1 66  GLN 66  65  65  GLN GLN A . n 
A 1 67  ALA 67  66  66  ALA ALA A . n 
A 1 68  LEU 68  67  67  LEU LEU A . n 
A 1 69  THR 69  68  68  THR THR A . n 
A 1 70  VAL 70  69  69  VAL VAL A . n 
A 1 71  LEU 71  70  70  LEU LEU A . n 
A 1 72  GLU 72  71  71  GLU GLU A . n 
A 1 73  THR 73  72  72  THR THR A . n 
A 1 74  CYS 74  73  73  CYS CYS A . n 
A 1 75  MET 75  74  74  MET MET A . n 
A 1 76  LYS 76  75  75  LYS LYS A . n 
A 1 77  SER 77  76  76  SER SER A . n 
A 1 78  CYS 78  77  77  CYS CYS A . n 
A 1 79  GLY 79  78  78  GLY GLY A . n 
A 1 80  LYS 80  79  79  LYS LYS A . n 
A 1 81  ARG 81  80  80  ARG ARG A . n 
A 1 82  PHE 82  81  81  PHE PHE A . n 
A 1 83  HIS 83  82  82  HIS HIS A . n 
A 1 84  ASP 84  83  83  ASP ASP A . n 
A 1 85  GLU 85  84  84  GLU GLU A . n 
A 1 86  VAL 86  85  85  VAL VAL A . n 
A 1 87  GLY 87  86  86  GLY GLY A . n 
A 1 88  LYS 88  87  87  LYS LYS A . n 
A 1 89  PHE 89  88  88  PHE PHE A . n 
A 1 90  ARG 90  89  89  ARG ARG A . n 
A 1 91  PHE 91  90  90  PHE PHE A . n 
A 1 92  LEU 92  91  91  LEU LEU A . n 
A 1 93  ASN 93  92  92  ASN ASN A . n 
A 1 94  GLU 94  93  93  GLU GLU A . n 
A 1 95  LEU 95  94  94  LEU LEU A . n 
A 1 96  ILE 96  95  95  ILE ILE A . n 
A 1 97  LYS 97  96  96  LYS LYS A . n 
A 1 98  VAL 98  97  97  VAL VAL A . n 
A 1 99  VAL 99  98  98  VAL VAL A . n 
A 1 100 SER 100 99  99  SER SER A . n 
A 1 101 PRO 101 100 100 PRO PRO A . n 
A 1 102 LYS 102 101 101 LYS LYS A . n 
A 1 103 TYR 103 102 102 TYR TYR A . n 
A 1 104 LEU 104 103 103 LEU LEU A . n 
A 1 105 GLY 105 104 104 GLY GLY A . n 
A 1 106 SER 106 105 105 SER SER A . n 
A 1 107 ARG 107 106 106 ARG ARG A . n 
A 1 108 THR 108 107 107 THR THR A . n 
A 1 109 SER 109 108 108 SER SER A . n 
A 1 110 GLU 110 109 109 GLU GLU A . n 
A 1 111 LYS 111 110 110 LYS LYS A . n 
A 1 112 VAL 112 111 111 VAL VAL A . n 
A 1 113 LYS 113 112 112 LYS LYS A . n 
A 1 114 ASN 114 113 113 ASN ASN A . n 
A 1 115 LYS 115 114 114 LYS LYS A . n 
A 1 116 ILE 116 115 115 ILE ILE A . n 
A 1 117 LEU 117 116 116 LEU LEU A . n 
A 1 118 GLU 118 117 117 GLU GLU A . n 
A 1 119 LEU 119 118 118 LEU LEU A . n 
A 1 120 LEU 120 119 119 LEU LEU A . n 
A 1 121 TYR 121 120 120 TYR TYR A . n 
A 1 122 SER 122 121 121 SER SER A . n 
A 1 123 TRP 123 122 122 TRP TRP A . n 
A 1 124 THR 124 123 123 THR THR A . n 
A 1 125 VAL 125 124 124 VAL VAL A . n 
A 1 126 GLY 126 125 125 GLY GLY A . n 
A 1 127 LEU 127 126 126 LEU LEU A . n 
A 1 128 PRO 128 127 127 PRO PRO A . n 
A 1 129 GLU 129 128 128 GLU GLU A . n 
A 1 130 GLU 130 129 129 GLU GLU A . n 
A 1 131 VAL 131 130 130 VAL VAL A . n 
A 1 132 LYS 132 131 131 LYS LYS A . n 
A 1 133 ILE 133 132 132 ILE ILE A . n 
A 1 134 ALA 134 133 133 ALA ALA A . n 
A 1 135 GLU 135 134 134 GLU GLU A . n 
A 1 136 ALA 136 135 135 ALA ALA A . n 
A 1 137 TYR 137 136 136 TYR TYR A . n 
A 1 138 GLN 138 137 137 GLN GLN A . n 
A 1 139 MET 139 138 138 MET MET A . n 
A 1 140 LEU 140 139 139 LEU LEU A . n 
A 1 141 LYS 141 140 140 LYS LYS A . n 
A 1 142 LYS 142 141 141 LYS LYS A . n 
A 1 143 GLN 143 142 142 GLN GLN A . n 
A 1 144 GLY 144 143 143 GLY GLY A . n 
A 1 145 ILE 145 144 144 ILE ILE A . n 
A 1 146 VAL 146 145 145 VAL VAL A . n 
A 1 147 LYS 147 146 146 LYS LYS A . n 
A 1 148 SER 148 147 147 SER SER A . n 
A 1 149 ASP 149 148 148 ASP ASP A . n 
A 1 150 PRO 150 149 149 PRO PRO A . n 
A 1 151 LYS 151 150 ?   ?   ?   A . n 
A 1 152 LEU 152 151 ?   ?   ?   A . n 
A 1 153 PRO 153 152 ?   ?   ?   A . n 
A 1 154 ASP 154 153 ?   ?   ?   A . n 
A 1 155 ASP 155 154 ?   ?   ?   A . n 
A 1 156 THR 156 155 ?   ?   ?   A . n 
A 1 157 THR 157 156 ?   ?   ?   A . n 
A 1 158 PHE 158 157 ?   ?   ?   A . n 
B 1 1   GLY 1   0   ?   ?   ?   B . n 
B 1 2   SER 2   1   ?   ?   ?   B . n 
B 1 3   GLU 3   2   ?   ?   ?   B . n 
B 1 4   PRO 4   3   ?   ?   ?   B . n 
B 1 5   ALA 5   4   ?   ?   ?   B . n 
B 1 6   MET 6   5   ?   ?   ?   B . n 
B 1 7   GLU 7   6   ?   ?   ?   B . n 
B 1 8   PRO 8   7   7   PRO PRO B . n 
B 1 9   GLU 9   8   8   GLU GLU B . n 
B 1 10  THR 10  9   9   THR THR B . n 
B 1 11  LEU 11  10  10  LEU LEU B . n 
B 1 12  GLU 12  11  11  GLU GLU B . n 
B 1 13  ALA 13  12  12  ALA ALA B . n 
B 1 14  ARG 14  13  13  ARG ARG B . n 
B 1 15  ILE 15  14  14  ILE ILE B . n 
B 1 16  ASN 16  15  15  ASN ASN B . n 
B 1 17  ARG 17  16  16  ARG ARG B . n 
B 1 18  ALA 18  17  17  ALA ALA B . n 
B 1 19  THR 19  18  18  THR THR B . n 
B 1 20  ASN 20  19  19  ASN ASN B . n 
B 1 21  PRO 21  20  20  PRO PRO B . n 
B 1 22  LEU 22  21  21  LEU LEU B . n 
B 1 23  ASN 23  22  22  ASN ASN B . n 
B 1 24  LYS 24  23  23  LYS LYS B . n 
B 1 25  GLU 25  24  24  GLU GLU B . n 
B 1 26  LEU 26  25  25  LEU LEU B . n 
B 1 27  ASP 27  26  26  ASP ASP B . n 
B 1 28  TRP 28  27  27  TRP TRP B . n 
B 1 29  ALA 29  28  28  ALA ALA B . n 
B 1 30  SER 30  29  29  SER SER B . n 
B 1 31  ILE 31  30  30  ILE ILE B . n 
B 1 32  ASN 32  31  31  ASN ASN B . n 
B 1 33  GLY 33  32  32  GLY GLY B . n 
B 1 34  PHE 34  33  33  PHE PHE B . n 
B 1 35  CYS 35  34  34  CYS CYS B . n 
B 1 36  GLU 36  35  35  GLU GLU B . n 
B 1 37  GLN 37  36  36  GLN GLN B . n 
B 1 38  LEU 38  37  37  LEU LEU B . n 
B 1 39  ASN 39  38  38  ASN ASN B . n 
B 1 40  GLU 40  39  39  GLU GLU B . n 
B 1 41  ASP 41  40  40  ASP ASP B . n 
B 1 42  PHE 42  41  41  PHE PHE B . n 
B 1 43  GLU 43  42  42  GLU GLU B . n 
B 1 44  GLY 44  43  43  GLY GLY B . n 
B 1 45  PRO 45  44  44  PRO PRO B . n 
B 1 46  PRO 46  45  45  PRO PRO B . n 
B 1 47  LEU 47  46  46  LEU LEU B . n 
B 1 48  ALA 48  47  47  ALA ALA B . n 
B 1 49  THR 49  48  48  THR THR B . n 
B 1 50  ARG 50  49  49  ARG ARG B . n 
B 1 51  LEU 51  50  50  LEU LEU B . n 
B 1 52  LEU 52  51  51  LEU LEU B . n 
B 1 53  ALA 53  52  52  ALA ALA B . n 
B 1 54  HIS 54  53  53  HIS HIS B . n 
B 1 55  LYS 55  54  54  LYS LYS B . n 
B 1 56  ILE 56  55  55  ILE ILE B . n 
B 1 57  GLN 57  56  56  GLN GLN B . n 
B 1 58  SER 58  57  57  SER SER B . n 
B 1 59  PRO 59  58  58  PRO PRO B . n 
B 1 60  GLN 60  59  59  GLN GLN B . n 
B 1 61  GLU 61  60  60  GLU GLU B . n 
B 1 62  TRP 62  61  61  TRP TRP B . n 
B 1 63  GLU 63  62  62  GLU GLU B . n 
B 1 64  ALA 64  63  63  ALA ALA B . n 
B 1 65  ILE 65  64  64  ILE ILE B . n 
B 1 66  GLN 66  65  65  GLN GLN B . n 
B 1 67  ALA 67  66  66  ALA ALA B . n 
B 1 68  LEU 68  67  67  LEU LEU B . n 
B 1 69  THR 69  68  68  THR THR B . n 
B 1 70  VAL 70  69  69  VAL VAL B . n 
B 1 71  LEU 71  70  70  LEU LEU B . n 
B 1 72  GLU 72  71  71  GLU GLU B . n 
B 1 73  THR 73  72  72  THR THR B . n 
B 1 74  CYS 74  73  73  CYS CYS B . n 
B 1 75  MET 75  74  74  MET MET B . n 
B 1 76  LYS 76  75  75  LYS LYS B . n 
B 1 77  SER 77  76  76  SER SER B . n 
B 1 78  CYS 78  77  77  CYS CYS B . n 
B 1 79  GLY 79  78  78  GLY GLY B . n 
B 1 80  LYS 80  79  79  LYS LYS B . n 
B 1 81  ARG 81  80  80  ARG ARG B . n 
B 1 82  PHE 82  81  81  PHE PHE B . n 
B 1 83  HIS 83  82  82  HIS HIS B . n 
B 1 84  ASP 84  83  83  ASP ASP B . n 
B 1 85  GLU 85  84  84  GLU GLU B . n 
B 1 86  VAL 86  85  85  VAL VAL B . n 
B 1 87  GLY 87  86  86  GLY GLY B . n 
B 1 88  LYS 88  87  87  LYS LYS B . n 
B 1 89  PHE 89  88  88  PHE PHE B . n 
B 1 90  ARG 90  89  89  ARG ARG B . n 
B 1 91  PHE 91  90  90  PHE PHE B . n 
B 1 92  LEU 92  91  91  LEU LEU B . n 
B 1 93  ASN 93  92  92  ASN ASN B . n 
B 1 94  GLU 94  93  93  GLU GLU B . n 
B 1 95  LEU 95  94  94  LEU LEU B . n 
B 1 96  ILE 96  95  95  ILE ILE B . n 
B 1 97  LYS 97  96  96  LYS LYS B . n 
B 1 98  VAL 98  97  97  VAL VAL B . n 
B 1 99  VAL 99  98  98  VAL VAL B . n 
B 1 100 SER 100 99  99  SER SER B . n 
B 1 101 PRO 101 100 100 PRO PRO B . n 
B 1 102 LYS 102 101 101 LYS LYS B . n 
B 1 103 TYR 103 102 102 TYR TYR B . n 
B 1 104 LEU 104 103 103 LEU LEU B . n 
B 1 105 GLY 105 104 104 GLY GLY B . n 
B 1 106 SER 106 105 105 SER SER B . n 
B 1 107 ARG 107 106 106 ARG ARG B . n 
B 1 108 THR 108 107 107 THR THR B . n 
B 1 109 SER 109 108 108 SER SER B . n 
B 1 110 GLU 110 109 109 GLU GLU B . n 
B 1 111 LYS 111 110 110 LYS LYS B . n 
B 1 112 VAL 112 111 111 VAL VAL B . n 
B 1 113 LYS 113 112 112 LYS LYS B . n 
B 1 114 ASN 114 113 113 ASN ASN B . n 
B 1 115 LYS 115 114 114 LYS LYS B . n 
B 1 116 ILE 116 115 115 ILE ILE B . n 
B 1 117 LEU 117 116 116 LEU LEU B . n 
B 1 118 GLU 118 117 117 GLU GLU B . n 
B 1 119 LEU 119 118 118 LEU LEU B . n 
B 1 120 LEU 120 119 119 LEU LEU B . n 
B 1 121 TYR 121 120 120 TYR TYR B . n 
B 1 122 SER 122 121 121 SER SER B . n 
B 1 123 TRP 123 122 122 TRP TRP B . n 
B 1 124 THR 124 123 123 THR THR B . n 
B 1 125 VAL 125 124 124 VAL VAL B . n 
B 1 126 GLY 126 125 125 GLY GLY B . n 
B 1 127 LEU 127 126 126 LEU LEU B . n 
B 1 128 PRO 128 127 127 PRO PRO B . n 
B 1 129 GLU 129 128 128 GLU GLU B . n 
B 1 130 GLU 130 129 129 GLU GLU B . n 
B 1 131 VAL 131 130 130 VAL VAL B . n 
B 1 132 LYS 132 131 131 LYS LYS B . n 
B 1 133 ILE 133 132 132 ILE ILE B . n 
B 1 134 ALA 134 133 133 ALA ALA B . n 
B 1 135 GLU 135 134 134 GLU GLU B . n 
B 1 136 ALA 136 135 135 ALA ALA B . n 
B 1 137 TYR 137 136 136 TYR TYR B . n 
B 1 138 GLN 138 137 137 GLN GLN B . n 
B 1 139 MET 139 138 138 MET MET B . n 
B 1 140 LEU 140 139 139 LEU LEU B . n 
B 1 141 LYS 141 140 140 LYS LYS B . n 
B 1 142 LYS 142 141 141 LYS LYS B . n 
B 1 143 GLN 143 142 142 GLN GLN B . n 
B 1 144 GLY 144 143 143 GLY GLY B . n 
B 1 145 ILE 145 144 144 ILE ILE B . n 
B 1 146 VAL 146 145 145 VAL VAL B . n 
B 1 147 LYS 147 146 ?   ?   ?   B . n 
B 1 148 SER 148 147 ?   ?   ?   B . n 
B 1 149 ASP 149 148 ?   ?   ?   B . n 
B 1 150 PRO 150 149 ?   ?   ?   B . n 
B 1 151 LYS 151 150 ?   ?   ?   B . n 
B 1 152 LEU 152 151 ?   ?   ?   B . n 
B 1 153 PRO 153 152 ?   ?   ?   B . n 
B 1 154 ASP 154 153 ?   ?   ?   B . n 
B 1 155 ASP 155 154 ?   ?   ?   B . n 
B 1 156 THR 156 155 ?   ?   ?   B . n 
B 1 157 THR 157 156 ?   ?   ?   B . n 
B 1 158 PHE 158 157 ?   ?   ?   B . n 
C 1 1   GLY 1   0   ?   ?   ?   C . n 
C 1 2   SER 2   1   ?   ?   ?   C . n 
C 1 3   GLU 3   2   ?   ?   ?   C . n 
C 1 4   PRO 4   3   ?   ?   ?   C . n 
C 1 5   ALA 5   4   ?   ?   ?   C . n 
C 1 6   MET 6   5   ?   ?   ?   C . n 
C 1 7   GLU 7   6   ?   ?   ?   C . n 
C 1 8   PRO 8   7   ?   ?   ?   C . n 
C 1 9   GLU 9   8   8   GLU GLU C . n 
C 1 10  THR 10  9   9   THR THR C . n 
C 1 11  LEU 11  10  10  LEU LEU C . n 
C 1 12  GLU 12  11  11  GLU GLU C . n 
C 1 13  ALA 13  12  12  ALA ALA C . n 
C 1 14  ARG 14  13  13  ARG ARG C . n 
C 1 15  ILE 15  14  14  ILE ILE C . n 
C 1 16  ASN 16  15  15  ASN ASN C . n 
C 1 17  ARG 17  16  16  ARG ARG C . n 
C 1 18  ALA 18  17  17  ALA ALA C . n 
C 1 19  THR 19  18  18  THR THR C . n 
C 1 20  ASN 20  19  19  ASN ASN C . n 
C 1 21  PRO 21  20  20  PRO PRO C . n 
C 1 22  LEU 22  21  21  LEU LEU C . n 
C 1 23  ASN 23  22  22  ASN ASN C . n 
C 1 24  LYS 24  23  23  LYS LYS C . n 
C 1 25  GLU 25  24  24  GLU GLU C . n 
C 1 26  LEU 26  25  25  LEU LEU C . n 
C 1 27  ASP 27  26  26  ASP ASP C . n 
C 1 28  TRP 28  27  27  TRP TRP C . n 
C 1 29  ALA 29  28  28  ALA ALA C . n 
C 1 30  SER 30  29  29  SER SER C . n 
C 1 31  ILE 31  30  30  ILE ILE C . n 
C 1 32  ASN 32  31  31  ASN ASN C . n 
C 1 33  GLY 33  32  32  GLY GLY C . n 
C 1 34  PHE 34  33  33  PHE PHE C . n 
C 1 35  CYS 35  34  34  CYS CYS C . n 
C 1 36  GLU 36  35  35  GLU GLU C . n 
C 1 37  GLN 37  36  36  GLN GLN C . n 
C 1 38  LEU 38  37  37  LEU LEU C . n 
C 1 39  ASN 39  38  38  ASN ASN C . n 
C 1 40  GLU 40  39  39  GLU GLU C . n 
C 1 41  ASP 41  40  40  ASP ASP C . n 
C 1 42  PHE 42  41  41  PHE PHE C . n 
C 1 43  GLU 43  42  42  GLU GLU C . n 
C 1 44  GLY 44  43  43  GLY GLY C . n 
C 1 45  PRO 45  44  44  PRO PRO C . n 
C 1 46  PRO 46  45  45  PRO PRO C . n 
C 1 47  LEU 47  46  46  LEU LEU C . n 
C 1 48  ALA 48  47  47  ALA ALA C . n 
C 1 49  THR 49  48  48  THR THR C . n 
C 1 50  ARG 50  49  49  ARG ARG C . n 
C 1 51  LEU 51  50  50  LEU LEU C . n 
C 1 52  LEU 52  51  51  LEU LEU C . n 
C 1 53  ALA 53  52  52  ALA ALA C . n 
C 1 54  HIS 54  53  53  HIS HIS C . n 
C 1 55  LYS 55  54  54  LYS LYS C . n 
C 1 56  ILE 56  55  55  ILE ILE C . n 
C 1 57  GLN 57  56  56  GLN GLN C . n 
C 1 58  SER 58  57  57  SER SER C . n 
C 1 59  PRO 59  58  58  PRO PRO C . n 
C 1 60  GLN 60  59  59  GLN GLN C . n 
C 1 61  GLU 61  60  60  GLU GLU C . n 
C 1 62  TRP 62  61  61  TRP TRP C . n 
C 1 63  GLU 63  62  62  GLU GLU C . n 
C 1 64  ALA 64  63  63  ALA ALA C . n 
C 1 65  ILE 65  64  64  ILE ILE C . n 
C 1 66  GLN 66  65  65  GLN GLN C . n 
C 1 67  ALA 67  66  66  ALA ALA C . n 
C 1 68  LEU 68  67  67  LEU LEU C . n 
C 1 69  THR 69  68  68  THR THR C . n 
C 1 70  VAL 70  69  69  VAL VAL C . n 
C 1 71  LEU 71  70  70  LEU LEU C . n 
C 1 72  GLU 72  71  71  GLU GLU C . n 
C 1 73  THR 73  72  72  THR THR C . n 
C 1 74  CYS 74  73  73  CYS CYS C . n 
C 1 75  MET 75  74  74  MET MET C . n 
C 1 76  LYS 76  75  75  LYS LYS C . n 
C 1 77  SER 77  76  76  SER SER C . n 
C 1 78  CYS 78  77  77  CYS CYS C . n 
C 1 79  GLY 79  78  78  GLY GLY C . n 
C 1 80  LYS 80  79  79  LYS LYS C . n 
C 1 81  ARG 81  80  80  ARG ARG C . n 
C 1 82  PHE 82  81  81  PHE PHE C . n 
C 1 83  HIS 83  82  82  HIS HIS C . n 
C 1 84  ASP 84  83  83  ASP ASP C . n 
C 1 85  GLU 85  84  84  GLU GLU C . n 
C 1 86  VAL 86  85  85  VAL VAL C . n 
C 1 87  GLY 87  86  86  GLY GLY C . n 
C 1 88  LYS 88  87  87  LYS LYS C . n 
C 1 89  PHE 89  88  88  PHE PHE C . n 
C 1 90  ARG 90  89  89  ARG ARG C . n 
C 1 91  PHE 91  90  90  PHE PHE C . n 
C 1 92  LEU 92  91  91  LEU LEU C . n 
C 1 93  ASN 93  92  92  ASN ASN C . n 
C 1 94  GLU 94  93  93  GLU GLU C . n 
C 1 95  LEU 95  94  94  LEU LEU C . n 
C 1 96  ILE 96  95  95  ILE ILE C . n 
C 1 97  LYS 97  96  96  LYS LYS C . n 
C 1 98  VAL 98  97  97  VAL VAL C . n 
C 1 99  VAL 99  98  98  VAL VAL C . n 
C 1 100 SER 100 99  99  SER SER C . n 
C 1 101 PRO 101 100 100 PRO PRO C . n 
C 1 102 LYS 102 101 101 LYS LYS C . n 
C 1 103 TYR 103 102 102 TYR TYR C . n 
C 1 104 LEU 104 103 103 LEU LEU C . n 
C 1 105 GLY 105 104 104 GLY GLY C . n 
C 1 106 SER 106 105 105 SER SER C . n 
C 1 107 ARG 107 106 106 ARG ARG C . n 
C 1 108 THR 108 107 107 THR THR C . n 
C 1 109 SER 109 108 108 SER SER C . n 
C 1 110 GLU 110 109 109 GLU GLU C . n 
C 1 111 LYS 111 110 110 LYS LYS C . n 
C 1 112 VAL 112 111 111 VAL VAL C . n 
C 1 113 LYS 113 112 112 LYS LYS C . n 
C 1 114 ASN 114 113 113 ASN ASN C . n 
C 1 115 LYS 115 114 114 LYS LYS C . n 
C 1 116 ILE 116 115 115 ILE ILE C . n 
C 1 117 LEU 117 116 116 LEU LEU C . n 
C 1 118 GLU 118 117 117 GLU GLU C . n 
C 1 119 LEU 119 118 118 LEU LEU C . n 
C 1 120 LEU 120 119 119 LEU LEU C . n 
C 1 121 TYR 121 120 120 TYR TYR C . n 
C 1 122 SER 122 121 121 SER SER C . n 
C 1 123 TRP 123 122 122 TRP TRP C . n 
C 1 124 THR 124 123 123 THR THR C . n 
C 1 125 VAL 125 124 124 VAL VAL C . n 
C 1 126 GLY 126 125 125 GLY GLY C . n 
C 1 127 LEU 127 126 126 LEU LEU C . n 
C 1 128 PRO 128 127 127 PRO PRO C . n 
C 1 129 GLU 129 128 128 GLU GLU C . n 
C 1 130 GLU 130 129 129 GLU GLU C . n 
C 1 131 VAL 131 130 130 VAL VAL C . n 
C 1 132 LYS 132 131 131 LYS LYS C . n 
C 1 133 ILE 133 132 132 ILE ILE C . n 
C 1 134 ALA 134 133 133 ALA ALA C . n 
C 1 135 GLU 135 134 134 GLU GLU C . n 
C 1 136 ALA 136 135 135 ALA ALA C . n 
C 1 137 TYR 137 136 136 TYR TYR C . n 
C 1 138 GLN 138 137 137 GLN GLN C . n 
C 1 139 MET 139 138 138 MET MET C . n 
C 1 140 LEU 140 139 139 LEU LEU C . n 
C 1 141 LYS 141 140 140 LYS LYS C . n 
C 1 142 LYS 142 141 141 LYS LYS C . n 
C 1 143 GLN 143 142 142 GLN GLN C . n 
C 1 144 GLY 144 143 143 GLY GLY C . n 
C 1 145 ILE 145 144 144 ILE ILE C . n 
C 1 146 VAL 146 145 145 VAL VAL C . n 
C 1 147 LYS 147 146 ?   ?   ?   C . n 
C 1 148 SER 148 147 ?   ?   ?   C . n 
C 1 149 ASP 149 148 ?   ?   ?   C . n 
C 1 150 PRO 150 149 ?   ?   ?   C . n 
C 1 151 LYS 151 150 ?   ?   ?   C . n 
C 1 152 LEU 152 151 ?   ?   ?   C . n 
C 1 153 PRO 153 152 ?   ?   ?   C . n 
C 1 154 ASP 154 153 ?   ?   ?   C . n 
C 1 155 ASP 155 154 ?   ?   ?   C . n 
C 1 156 THR 156 155 ?   ?   ?   C . n 
C 1 157 THR 157 156 ?   ?   ?   C . n 
C 1 158 PHE 158 157 ?   ?   ?   C . n 
D 1 1   GLY 1   0   ?   ?   ?   D . n 
D 1 2   SER 2   1   ?   ?   ?   D . n 
D 1 3   GLU 3   2   ?   ?   ?   D . n 
D 1 4   PRO 4   3   ?   ?   ?   D . n 
D 1 5   ALA 5   4   ?   ?   ?   D . n 
D 1 6   MET 6   5   ?   ?   ?   D . n 
D 1 7   GLU 7   6   ?   ?   ?   D . n 
D 1 8   PRO 8   7   ?   ?   ?   D . n 
D 1 9   GLU 9   8   8   GLU GLU D . n 
D 1 10  THR 10  9   9   THR THR D . n 
D 1 11  LEU 11  10  10  LEU LEU D . n 
D 1 12  GLU 12  11  11  GLU GLU D . n 
D 1 13  ALA 13  12  12  ALA ALA D . n 
D 1 14  ARG 14  13  13  ARG ARG D . n 
D 1 15  ILE 15  14  14  ILE ILE D . n 
D 1 16  ASN 16  15  15  ASN ASN D . n 
D 1 17  ARG 17  16  16  ARG ARG D . n 
D 1 18  ALA 18  17  17  ALA ALA D . n 
D 1 19  THR 19  18  18  THR THR D . n 
D 1 20  ASN 20  19  19  ASN ASN D . n 
D 1 21  PRO 21  20  20  PRO PRO D . n 
D 1 22  LEU 22  21  21  LEU LEU D . n 
D 1 23  ASN 23  22  22  ASN ASN D . n 
D 1 24  LYS 24  23  23  LYS LYS D . n 
D 1 25  GLU 25  24  24  GLU GLU D . n 
D 1 26  LEU 26  25  25  LEU LEU D . n 
D 1 27  ASP 27  26  26  ASP ASP D . n 
D 1 28  TRP 28  27  27  TRP TRP D . n 
D 1 29  ALA 29  28  28  ALA ALA D . n 
D 1 30  SER 30  29  29  SER SER D . n 
D 1 31  ILE 31  30  30  ILE ILE D . n 
D 1 32  ASN 32  31  31  ASN ASN D . n 
D 1 33  GLY 33  32  32  GLY GLY D . n 
D 1 34  PHE 34  33  33  PHE PHE D . n 
D 1 35  CYS 35  34  34  CYS CYS D . n 
D 1 36  GLU 36  35  35  GLU GLU D . n 
D 1 37  GLN 37  36  36  GLN GLN D . n 
D 1 38  LEU 38  37  37  LEU LEU D . n 
D 1 39  ASN 39  38  38  ASN ASN D . n 
D 1 40  GLU 40  39  39  GLU GLU D . n 
D 1 41  ASP 41  40  40  ASP ASP D . n 
D 1 42  PHE 42  41  41  PHE PHE D . n 
D 1 43  GLU 43  42  42  GLU GLU D . n 
D 1 44  GLY 44  43  43  GLY GLY D . n 
D 1 45  PRO 45  44  44  PRO PRO D . n 
D 1 46  PRO 46  45  45  PRO PRO D . n 
D 1 47  LEU 47  46  46  LEU LEU D . n 
D 1 48  ALA 48  47  47  ALA ALA D . n 
D 1 49  THR 49  48  48  THR THR D . n 
D 1 50  ARG 50  49  49  ARG ARG D . n 
D 1 51  LEU 51  50  50  LEU LEU D . n 
D 1 52  LEU 52  51  51  LEU LEU D . n 
D 1 53  ALA 53  52  52  ALA ALA D . n 
D 1 54  HIS 54  53  53  HIS HIS D . n 
D 1 55  LYS 55  54  54  LYS LYS D . n 
D 1 56  ILE 56  55  55  ILE ILE D . n 
D 1 57  GLN 57  56  56  GLN GLN D . n 
D 1 58  SER 58  57  57  SER SER D . n 
D 1 59  PRO 59  58  58  PRO PRO D . n 
D 1 60  GLN 60  59  59  GLN GLN D . n 
D 1 61  GLU 61  60  60  GLU GLU D . n 
D 1 62  TRP 62  61  61  TRP TRP D . n 
D 1 63  GLU 63  62  62  GLU GLU D . n 
D 1 64  ALA 64  63  63  ALA ALA D . n 
D 1 65  ILE 65  64  64  ILE ILE D . n 
D 1 66  GLN 66  65  65  GLN GLN D . n 
D 1 67  ALA 67  66  66  ALA ALA D . n 
D 1 68  LEU 68  67  67  LEU LEU D . n 
D 1 69  THR 69  68  68  THR THR D . n 
D 1 70  VAL 70  69  69  VAL VAL D . n 
D 1 71  LEU 71  70  70  LEU LEU D . n 
D 1 72  GLU 72  71  71  GLU GLU D . n 
D 1 73  THR 73  72  72  THR THR D . n 
D 1 74  CYS 74  73  73  CYS CYS D . n 
D 1 75  MET 75  74  74  MET MET D . n 
D 1 76  LYS 76  75  75  LYS LYS D . n 
D 1 77  SER 77  76  76  SER SER D . n 
D 1 78  CYS 78  77  77  CYS CYS D . n 
D 1 79  GLY 79  78  78  GLY GLY D . n 
D 1 80  LYS 80  79  79  LYS LYS D . n 
D 1 81  ARG 81  80  80  ARG ARG D . n 
D 1 82  PHE 82  81  81  PHE PHE D . n 
D 1 83  HIS 83  82  82  HIS HIS D . n 
D 1 84  ASP 84  83  83  ASP ASP D . n 
D 1 85  GLU 85  84  84  GLU GLU D . n 
D 1 86  VAL 86  85  85  VAL VAL D . n 
D 1 87  GLY 87  86  86  GLY GLY D . n 
D 1 88  LYS 88  87  87  LYS LYS D . n 
D 1 89  PHE 89  88  88  PHE PHE D . n 
D 1 90  ARG 90  89  89  ARG ARG D . n 
D 1 91  PHE 91  90  90  PHE PHE D . n 
D 1 92  LEU 92  91  91  LEU LEU D . n 
D 1 93  ASN 93  92  92  ASN ASN D . n 
D 1 94  GLU 94  93  93  GLU GLU D . n 
D 1 95  LEU 95  94  94  LEU LEU D . n 
D 1 96  ILE 96  95  95  ILE ILE D . n 
D 1 97  LYS 97  96  96  LYS LYS D . n 
D 1 98  VAL 98  97  97  VAL VAL D . n 
D 1 99  VAL 99  98  98  VAL VAL D . n 
D 1 100 SER 100 99  99  SER SER D . n 
D 1 101 PRO 101 100 100 PRO PRO D . n 
D 1 102 LYS 102 101 101 LYS LYS D . n 
D 1 103 TYR 103 102 102 TYR TYR D . n 
D 1 104 LEU 104 103 103 LEU LEU D . n 
D 1 105 GLY 105 104 104 GLY GLY D . n 
D 1 106 SER 106 105 105 SER SER D . n 
D 1 107 ARG 107 106 106 ARG ARG D . n 
D 1 108 THR 108 107 107 THR THR D . n 
D 1 109 SER 109 108 108 SER SER D . n 
D 1 110 GLU 110 109 109 GLU GLU D . n 
D 1 111 LYS 111 110 110 LYS LYS D . n 
D 1 112 VAL 112 111 111 VAL VAL D . n 
D 1 113 LYS 113 112 112 LYS LYS D . n 
D 1 114 ASN 114 113 113 ASN ASN D . n 
D 1 115 LYS 115 114 114 LYS LYS D . n 
D 1 116 ILE 116 115 115 ILE ILE D . n 
D 1 117 LEU 117 116 116 LEU LEU D . n 
D 1 118 GLU 118 117 117 GLU GLU D . n 
D 1 119 LEU 119 118 118 LEU LEU D . n 
D 1 120 LEU 120 119 119 LEU LEU D . n 
D 1 121 TYR 121 120 120 TYR TYR D . n 
D 1 122 SER 122 121 121 SER SER D . n 
D 1 123 TRP 123 122 122 TRP TRP D . n 
D 1 124 THR 124 123 123 THR THR D . n 
D 1 125 VAL 125 124 124 VAL VAL D . n 
D 1 126 GLY 126 125 125 GLY GLY D . n 
D 1 127 LEU 127 126 126 LEU LEU D . n 
D 1 128 PRO 128 127 127 PRO PRO D . n 
D 1 129 GLU 129 128 128 GLU GLU D . n 
D 1 130 GLU 130 129 129 GLU GLU D . n 
D 1 131 VAL 131 130 130 VAL VAL D . n 
D 1 132 LYS 132 131 131 LYS LYS D . n 
D 1 133 ILE 133 132 132 ILE ILE D . n 
D 1 134 ALA 134 133 133 ALA ALA D . n 
D 1 135 GLU 135 134 134 GLU GLU D . n 
D 1 136 ALA 136 135 135 ALA ALA D . n 
D 1 137 TYR 137 136 136 TYR TYR D . n 
D 1 138 GLN 138 137 137 GLN GLN D . n 
D 1 139 MET 139 138 138 MET MET D . n 
D 1 140 LEU 140 139 139 LEU LEU D . n 
D 1 141 LYS 141 140 140 LYS LYS D . n 
D 1 142 LYS 142 141 141 LYS LYS D . n 
D 1 143 GLN 143 142 142 GLN GLN D . n 
D 1 144 GLY 144 143 143 GLY GLY D . n 
D 1 145 ILE 145 144 144 ILE ILE D . n 
D 1 146 VAL 146 145 145 VAL VAL D . n 
D 1 147 LYS 147 146 146 LYS LYS D . n 
D 1 148 SER 148 147 147 SER SER D . n 
D 1 149 ASP 149 148 148 ASP ASP D . n 
D 1 150 PRO 150 149 149 PRO PRO D . n 
D 1 151 LYS 151 150 ?   ?   ?   D . n 
D 1 152 LEU 152 151 ?   ?   ?   D . n 
D 1 153 PRO 153 152 ?   ?   ?   D . n 
D 1 154 ASP 154 153 ?   ?   ?   D . n 
D 1 155 ASP 155 154 ?   ?   ?   D . n 
D 1 156 THR 156 155 ?   ?   ?   D . n 
D 1 157 THR 157 156 ?   ?   ?   D . n 
D 1 158 PHE 158 157 ?   ?   ?   D . n 
E 2 1   ALA 1   1   ?   ?   ?   E . n 
E 2 2   ASP 2   2   2   ASP ASP E . n 
E 2 3   ASP 3   3   3   ASP ASP E . n 
E 2 4   ILE 4   4   4   ILE ILE E . n 
E 2 5   SEP 5   5   5   SEP SEP E . n 
E 2 6   LEU 6   6   6   LEU LEU E . n 
E 2 7   LEU 7   7   7   LEU LEU E . n 
E 2 8   LYS 8   8   8   LYS LYS E . n 
F 2 1   ALA 1   1   ?   ?   ?   F . n 
F 2 2   ASP 2   2   2   ASP ASP F . n 
F 2 3   ASP 3   3   3   ASP ASP F . n 
F 2 4   ILE 4   4   4   ILE ILE F . n 
F 2 5   SEP 5   5   5   SEP SEP F . n 
F 2 6   LEU 6   6   6   LEU LEU F . n 
F 2 7   LEU 7   7   7   LEU LEU F . n 
F 2 8   LYS 8   8   8   LYS LYS F . n 
G 2 1   ALA 1   1   ?   ?   ?   G . n 
G 2 2   ASP 2   2   ?   ?   ?   G . n 
G 2 3   ASP 3   3   3   ASP ASP G . n 
G 2 4   ILE 4   4   4   ILE ILE G . n 
G 2 5   SEP 5   5   5   SEP SEP G . n 
G 2 6   LEU 6   6   6   LEU LEU G . n 
G 2 7   LEU 7   7   7   LEU LEU G . n 
G 2 8   LYS 8   8   8   LYS LYS G . n 
H 2 1   ALA 1   1   ?   ?   ?   H . n 
H 2 2   ASP 2   2   2   ASP ASP H . n 
H 2 3   ASP 3   3   3   ASP ASP H . n 
H 2 4   ILE 4   4   4   ILE ILE H . n 
H 2 5   SEP 5   5   5   SEP SEP H . n 
H 2 6   LEU 6   6   6   LEU LEU H . n 
H 2 7   LEU 7   7   7   LEU LEU H . n 
H 2 8   LYS 8   8   8   LYS LYS H . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I 3 HOH 1  203 203 HOH TIP A . 
I 3 HOH 2  206 206 HOH TIP A . 
I 3 HOH 3  207 207 HOH TIP A . 
I 3 HOH 4  215 215 HOH TIP A . 
I 3 HOH 5  220 220 HOH TIP A . 
I 3 HOH 6  222 222 HOH TIP A . 
I 3 HOH 7  224 224 HOH TIP A . 
I 3 HOH 8  225 225 HOH TIP A . 
I 3 HOH 9  226 226 HOH TIP A . 
I 3 HOH 10 227 227 HOH TIP A . 
I 3 HOH 11 229 229 HOH TIP A . 
I 3 HOH 12 230 230 HOH TIP A . 
I 3 HOH 13 231 231 HOH TIP A . 
I 3 HOH 14 232 232 HOH TIP A . 
I 3 HOH 15 236 236 HOH TIP A . 
J 3 HOH 1  201 201 HOH TIP B . 
J 3 HOH 2  209 209 HOH TIP B . 
J 3 HOH 3  210 210 HOH TIP B . 
J 3 HOH 4  228 228 HOH TIP B . 
J 3 HOH 5  233 233 HOH TIP B . 
K 3 HOH 1  204 204 HOH TIP C . 
K 3 HOH 2  205 205 HOH TIP C . 
K 3 HOH 3  211 211 HOH TIP C . 
K 3 HOH 4  212 212 HOH TIP C . 
K 3 HOH 5  213 213 HOH TIP C . 
K 3 HOH 6  214 214 HOH TIP C . 
K 3 HOH 7  216 216 HOH TIP C . 
L 3 HOH 1  202 202 HOH TIP D . 
L 3 HOH 2  208 208 HOH TIP D . 
L 3 HOH 3  217 217 HOH TIP D . 
L 3 HOH 4  218 218 HOH TIP D . 
L 3 HOH 5  219 219 HOH TIP D . 
L 3 HOH 6  221 221 HOH TIP D . 
L 3 HOH 7  234 234 HOH TIP D . 
L 3 HOH 8  235 235 HOH TIP D . 
L 3 HOH 9  237 237 HOH TIP D . 
M 3 HOH 1  223 223 HOH TIP H . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 E SEP 5 E SEP 5 ? SER PHOSPHOSERINE 
2 F SEP 5 F SEP 5 ? SER PHOSPHOSERINE 
3 G SEP 5 G SEP 5 ? SER PHOSPHOSERINE 
4 H SEP 5 H SEP 5 ? SER PHOSPHOSERINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? tetrameric 4 
2 author_defined_assembly ? tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,I,J   
2 1 C,D,G,H,K,L,M 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-11-04 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
AMoRE     phasing          .   ? 4 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O1P 
_pdbx_validate_symm_contact.auth_asym_id_1    G 
_pdbx_validate_symm_contact.auth_comp_id_1    SEP 
_pdbx_validate_symm_contact.auth_seq_id_1     5 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O1P 
_pdbx_validate_symm_contact.auth_asym_id_2    G 
_pdbx_validate_symm_contact.auth_comp_id_2    SEP 
_pdbx_validate_symm_contact.auth_seq_id_2     5 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_565 
_pdbx_validate_symm_contact.dist              2.15 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 101 ? ? -59.14  -6.27   
2  1 TYR A 102 ? ? -139.92 -142.17 
3  1 ASN B 38  ? ? -66.66  14.48   
4  1 ASP B 40  ? ? -173.14 127.35  
5  1 SER B 76  ? ? -118.63 64.23   
6  1 TYR B 102 ? ? -127.21 -96.83  
7  1 LEU B 126 ? ? -142.25 56.23   
8  1 GLU B 129 ? ? -60.54  85.38   
9  1 ASN C 22  ? ? -35.28  127.69  
10 1 ASP C 26  ? ? -111.97 72.95   
11 1 GLU C 39  ? ? -80.14  -90.69  
12 1 ARG C 80  ? ? -46.94  -80.15  
13 1 TYR C 102 ? ? -120.50 -113.95 
14 1 GLU C 129 ? ? -69.44  85.59   
15 1 ASN D 22  ? ? -39.49  124.72  
16 1 GLU D 39  ? ? -42.21  -73.41  
17 1 ARG D 80  ? ? -54.02  -75.53  
18 1 LYS D 101 ? ? -57.21  -4.23   
19 1 TYR D 102 ? ? -138.63 -116.93 
20 1 LEU G 7   ? ? -60.36  -172.07 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 0   ? A GLY 1   
2  1 Y 1 A SER 1   ? A SER 2   
3  1 Y 1 A GLU 2   ? A GLU 3   
4  1 Y 1 A PRO 3   ? A PRO 4   
5  1 Y 1 A ALA 4   ? A ALA 5   
6  1 Y 1 A MET 5   ? A MET 6   
7  1 Y 1 A GLU 6   ? A GLU 7   
8  1 Y 1 A PRO 7   ? A PRO 8   
9  1 Y 1 A LYS 150 ? A LYS 151 
10 1 Y 1 A LEU 151 ? A LEU 152 
11 1 Y 1 A PRO 152 ? A PRO 153 
12 1 Y 1 A ASP 153 ? A ASP 154 
13 1 Y 1 A ASP 154 ? A ASP 155 
14 1 Y 1 A THR 155 ? A THR 156 
15 1 Y 1 A THR 156 ? A THR 157 
16 1 Y 1 A PHE 157 ? A PHE 158 
17 1 Y 1 B GLY 0   ? B GLY 1   
18 1 Y 1 B SER 1   ? B SER 2   
19 1 Y 1 B GLU 2   ? B GLU 3   
20 1 Y 1 B PRO 3   ? B PRO 4   
21 1 Y 1 B ALA 4   ? B ALA 5   
22 1 Y 1 B MET 5   ? B MET 6   
23 1 Y 1 B GLU 6   ? B GLU 7   
24 1 Y 1 B LYS 146 ? B LYS 147 
25 1 Y 1 B SER 147 ? B SER 148 
26 1 Y 1 B ASP 148 ? B ASP 149 
27 1 Y 1 B PRO 149 ? B PRO 150 
28 1 Y 1 B LYS 150 ? B LYS 151 
29 1 Y 1 B LEU 151 ? B LEU 152 
30 1 Y 1 B PRO 152 ? B PRO 153 
31 1 Y 1 B ASP 153 ? B ASP 154 
32 1 Y 1 B ASP 154 ? B ASP 155 
33 1 Y 1 B THR 155 ? B THR 156 
34 1 Y 1 B THR 156 ? B THR 157 
35 1 Y 1 B PHE 157 ? B PHE 158 
36 1 Y 1 C GLY 0   ? C GLY 1   
37 1 Y 1 C SER 1   ? C SER 2   
38 1 Y 1 C GLU 2   ? C GLU 3   
39 1 Y 1 C PRO 3   ? C PRO 4   
40 1 Y 1 C ALA 4   ? C ALA 5   
41 1 Y 1 C MET 5   ? C MET 6   
42 1 Y 1 C GLU 6   ? C GLU 7   
43 1 Y 1 C PRO 7   ? C PRO 8   
44 1 Y 1 C LYS 146 ? C LYS 147 
45 1 Y 1 C SER 147 ? C SER 148 
46 1 Y 1 C ASP 148 ? C ASP 149 
47 1 Y 1 C PRO 149 ? C PRO 150 
48 1 Y 1 C LYS 150 ? C LYS 151 
49 1 Y 1 C LEU 151 ? C LEU 152 
50 1 Y 1 C PRO 152 ? C PRO 153 
51 1 Y 1 C ASP 153 ? C ASP 154 
52 1 Y 1 C ASP 154 ? C ASP 155 
53 1 Y 1 C THR 155 ? C THR 156 
54 1 Y 1 C THR 156 ? C THR 157 
55 1 Y 1 C PHE 157 ? C PHE 158 
56 1 Y 1 D GLY 0   ? D GLY 1   
57 1 Y 1 D SER 1   ? D SER 2   
58 1 Y 1 D GLU 2   ? D GLU 3   
59 1 Y 1 D PRO 3   ? D PRO 4   
60 1 Y 1 D ALA 4   ? D ALA 5   
61 1 Y 1 D MET 5   ? D MET 6   
62 1 Y 1 D GLU 6   ? D GLU 7   
63 1 Y 1 D PRO 7   ? D PRO 8   
64 1 Y 1 D LYS 150 ? D LYS 151 
65 1 Y 1 D LEU 151 ? D LEU 152 
66 1 Y 1 D PRO 152 ? D PRO 153 
67 1 Y 1 D ASP 153 ? D ASP 154 
68 1 Y 1 D ASP 154 ? D ASP 155 
69 1 Y 1 D THR 155 ? D THR 156 
70 1 Y 1 D THR 156 ? D THR 157 
71 1 Y 1 D PHE 157 ? D PHE 158 
72 1 Y 1 E ALA 1   ? E ALA 1   
73 1 Y 1 F ALA 1   ? F ALA 1   
74 1 Y 1 G ALA 1   ? G ALA 1   
75 1 Y 1 G ASP 2   ? G ASP 2   
76 1 Y 1 H ALA 1   ? H ALA 1   
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#