data_1Q41
# 
_entry.id   1Q41 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1Q41         
RCSB  RCSB019888   
WWPDB D_1000019888 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1PYX 'GSK-3 BETA COMPLEXED WITH ANP'            unspecified 
PDB 1Q3D 'GSK-3 BETA COMPLEXED WITH STAUROSPORINE'  unspecified 
PDB 1Q3W 'GSK-3 BETA COMPLEXED WITH ALSTERPAULLONE' unspecified 
PDB 1Q4L 'GSK-3 BETA COMPLEXED WITH I-5'            unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1Q41 
_pdbx_database_status.recvd_initial_deposition_date   2003-08-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bertrand, J.A.' 1 
'Thieffine, S.'  2 
'Vulpetti, A.'   3 
'Cristiani, C.'  4 
'Valsasina, B.'  5 
'Knapp, S.'      6 
'Kalisz, H.M.'   7 
'Flocco, M.'     8 
# 
_citation.id                        primary 
_citation.title                     
'Structural Characterization of the Gsk-3Beta Active Site Using Selective and Non-selective ATP-Mimetic Inhibitors' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            333 
_citation.page_first                393 
_citation.page_last                 407 
_citation.year                      2003 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14529625 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2003.08.031 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bertrand, J.A.' 1 
primary 'Thieffine, S.'  2 
primary 'Vulpetti, A.'   3 
primary 'Cristiani, C.'  4 
primary 'Valsasina, B.'  5 
primary 'Knapp, S.'      6 
primary 'Kalisz, H.M.'   7 
primary 'Flocco, M.'     8 
# 
_cell.entry_id           1Q41 
_cell.length_a           83.438 
_cell.length_b           86.443 
_cell.length_c           178.825 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1Q41 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GLYCOGEN SYNTHASE KINASE-3 BETA'                    47081.473 2   2.7.1.37 ? ? ? 
2 non-polymer syn "(Z)-1H,1'H-[2,3']BIINDOLYLIDENE-3,2'-DIONE-3-OXIME" 277.277   2   ?        ? ? ? 
3 water       nat water                                                18.015    147 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GSK-3 BETA' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLC
DSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVI
YVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTS
SIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIAL
CSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATA
ASDANTGDRGQTNNAASASASNST
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLC
DSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVI
YVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTS
SIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIAL
CSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATA
ASDANTGDRGQTNNAASASASNST
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   ARG n 
1 9   PRO n 
1 10  ARG n 
1 11  THR n 
1 12  THR n 
1 13  SER n 
1 14  PHE n 
1 15  ALA n 
1 16  GLU n 
1 17  SER n 
1 18  CYS n 
1 19  LYS n 
1 20  PRO n 
1 21  VAL n 
1 22  GLN n 
1 23  GLN n 
1 24  PRO n 
1 25  SER n 
1 26  ALA n 
1 27  PHE n 
1 28  GLY n 
1 29  SER n 
1 30  MET n 
1 31  LYS n 
1 32  VAL n 
1 33  SER n 
1 34  ARG n 
1 35  ASP n 
1 36  LYS n 
1 37  ASP n 
1 38  GLY n 
1 39  SER n 
1 40  LYS n 
1 41  VAL n 
1 42  THR n 
1 43  THR n 
1 44  VAL n 
1 45  VAL n 
1 46  ALA n 
1 47  THR n 
1 48  PRO n 
1 49  GLY n 
1 50  GLN n 
1 51  GLY n 
1 52  PRO n 
1 53  ASP n 
1 54  ARG n 
1 55  PRO n 
1 56  GLN n 
1 57  GLU n 
1 58  VAL n 
1 59  SER n 
1 60  TYR n 
1 61  THR n 
1 62  ASP n 
1 63  THR n 
1 64  LYS n 
1 65  VAL n 
1 66  ILE n 
1 67  GLY n 
1 68  ASN n 
1 69  GLY n 
1 70  SER n 
1 71  PHE n 
1 72  GLY n 
1 73  VAL n 
1 74  VAL n 
1 75  TYR n 
1 76  GLN n 
1 77  ALA n 
1 78  LYS n 
1 79  LEU n 
1 80  CYS n 
1 81  ASP n 
1 82  SER n 
1 83  GLY n 
1 84  GLU n 
1 85  LEU n 
1 86  VAL n 
1 87  ALA n 
1 88  ILE n 
1 89  LYS n 
1 90  LYS n 
1 91  VAL n 
1 92  LEU n 
1 93  GLN n 
1 94  ASP n 
1 95  LYS n 
1 96  ARG n 
1 97  PHE n 
1 98  LYS n 
1 99  ASN n 
1 100 ARG n 
1 101 GLU n 
1 102 LEU n 
1 103 GLN n 
1 104 ILE n 
1 105 MET n 
1 106 ARG n 
1 107 LYS n 
1 108 LEU n 
1 109 ASP n 
1 110 HIS n 
1 111 CYS n 
1 112 ASN n 
1 113 ILE n 
1 114 VAL n 
1 115 ARG n 
1 116 LEU n 
1 117 ARG n 
1 118 TYR n 
1 119 PHE n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 SER n 
1 124 GLY n 
1 125 GLU n 
1 126 LYS n 
1 127 LYS n 
1 128 ASP n 
1 129 GLU n 
1 130 VAL n 
1 131 TYR n 
1 132 LEU n 
1 133 ASN n 
1 134 LEU n 
1 135 VAL n 
1 136 LEU n 
1 137 ASP n 
1 138 TYR n 
1 139 VAL n 
1 140 PRO n 
1 141 GLU n 
1 142 THR n 
1 143 VAL n 
1 144 TYR n 
1 145 ARG n 
1 146 VAL n 
1 147 ALA n 
1 148 ARG n 
1 149 HIS n 
1 150 TYR n 
1 151 SER n 
1 152 ARG n 
1 153 ALA n 
1 154 LYS n 
1 155 GLN n 
1 156 THR n 
1 157 LEU n 
1 158 PRO n 
1 159 VAL n 
1 160 ILE n 
1 161 TYR n 
1 162 VAL n 
1 163 LYS n 
1 164 LEU n 
1 165 TYR n 
1 166 MET n 
1 167 TYR n 
1 168 GLN n 
1 169 LEU n 
1 170 PHE n 
1 171 ARG n 
1 172 SER n 
1 173 LEU n 
1 174 ALA n 
1 175 TYR n 
1 176 ILE n 
1 177 HIS n 
1 178 SER n 
1 179 PHE n 
1 180 GLY n 
1 181 ILE n 
1 182 CYS n 
1 183 HIS n 
1 184 ARG n 
1 185 ASP n 
1 186 ILE n 
1 187 LYS n 
1 188 PRO n 
1 189 GLN n 
1 190 ASN n 
1 191 LEU n 
1 192 LEU n 
1 193 LEU n 
1 194 ASP n 
1 195 PRO n 
1 196 ASP n 
1 197 THR n 
1 198 ALA n 
1 199 VAL n 
1 200 LEU n 
1 201 LYS n 
1 202 LEU n 
1 203 CYS n 
1 204 ASP n 
1 205 PHE n 
1 206 GLY n 
1 207 SER n 
1 208 ALA n 
1 209 LYS n 
1 210 GLN n 
1 211 LEU n 
1 212 VAL n 
1 213 ARG n 
1 214 GLY n 
1 215 GLU n 
1 216 PRO n 
1 217 ASN n 
1 218 VAL n 
1 219 SER n 
1 220 TYR n 
1 221 ILE n 
1 222 CYS n 
1 223 SER n 
1 224 ARG n 
1 225 TYR n 
1 226 TYR n 
1 227 ARG n 
1 228 ALA n 
1 229 PRO n 
1 230 GLU n 
1 231 LEU n 
1 232 ILE n 
1 233 PHE n 
1 234 GLY n 
1 235 ALA n 
1 236 THR n 
1 237 ASP n 
1 238 TYR n 
1 239 THR n 
1 240 SER n 
1 241 SER n 
1 242 ILE n 
1 243 ASP n 
1 244 VAL n 
1 245 TRP n 
1 246 SER n 
1 247 ALA n 
1 248 GLY n 
1 249 CYS n 
1 250 VAL n 
1 251 LEU n 
1 252 ALA n 
1 253 GLU n 
1 254 LEU n 
1 255 LEU n 
1 256 LEU n 
1 257 GLY n 
1 258 GLN n 
1 259 PRO n 
1 260 ILE n 
1 261 PHE n 
1 262 PRO n 
1 263 GLY n 
1 264 ASP n 
1 265 SER n 
1 266 GLY n 
1 267 VAL n 
1 268 ASP n 
1 269 GLN n 
1 270 LEU n 
1 271 VAL n 
1 272 GLU n 
1 273 ILE n 
1 274 ILE n 
1 275 LYS n 
1 276 VAL n 
1 277 LEU n 
1 278 GLY n 
1 279 THR n 
1 280 PRO n 
1 281 THR n 
1 282 ARG n 
1 283 GLU n 
1 284 GLN n 
1 285 ILE n 
1 286 ARG n 
1 287 GLU n 
1 288 MET n 
1 289 ASN n 
1 290 PRO n 
1 291 ASN n 
1 292 TYR n 
1 293 THR n 
1 294 GLU n 
1 295 PHE n 
1 296 LYS n 
1 297 PHE n 
1 298 PRO n 
1 299 GLN n 
1 300 ILE n 
1 301 LYS n 
1 302 ALA n 
1 303 HIS n 
1 304 PRO n 
1 305 TRP n 
1 306 THR n 
1 307 LYS n 
1 308 VAL n 
1 309 PHE n 
1 310 ARG n 
1 311 PRO n 
1 312 ARG n 
1 313 THR n 
1 314 PRO n 
1 315 PRO n 
1 316 GLU n 
1 317 ALA n 
1 318 ILE n 
1 319 ALA n 
1 320 LEU n 
1 321 CYS n 
1 322 SER n 
1 323 ARG n 
1 324 LEU n 
1 325 LEU n 
1 326 GLU n 
1 327 TYR n 
1 328 THR n 
1 329 PRO n 
1 330 THR n 
1 331 ALA n 
1 332 ARG n 
1 333 LEU n 
1 334 THR n 
1 335 PRO n 
1 336 LEU n 
1 337 GLU n 
1 338 ALA n 
1 339 CYS n 
1 340 ALA n 
1 341 HIS n 
1 342 SER n 
1 343 PHE n 
1 344 PHE n 
1 345 ASP n 
1 346 GLU n 
1 347 LEU n 
1 348 ARG n 
1 349 ASP n 
1 350 PRO n 
1 351 ASN n 
1 352 VAL n 
1 353 LYS n 
1 354 LEU n 
1 355 PRO n 
1 356 ASN n 
1 357 GLY n 
1 358 ARG n 
1 359 ASP n 
1 360 THR n 
1 361 PRO n 
1 362 ALA n 
1 363 LEU n 
1 364 PHE n 
1 365 ASN n 
1 366 PHE n 
1 367 THR n 
1 368 THR n 
1 369 GLN n 
1 370 GLU n 
1 371 LEU n 
1 372 SER n 
1 373 SER n 
1 374 ASN n 
1 375 PRO n 
1 376 PRO n 
1 377 LEU n 
1 378 ALA n 
1 379 THR n 
1 380 ILE n 
1 381 LEU n 
1 382 ILE n 
1 383 PRO n 
1 384 PRO n 
1 385 HIS n 
1 386 ALA n 
1 387 ARG n 
1 388 ILE n 
1 389 GLN n 
1 390 ALA n 
1 391 ALA n 
1 392 ALA n 
1 393 SER n 
1 394 THR n 
1 395 PRO n 
1 396 THR n 
1 397 ASN n 
1 398 ALA n 
1 399 THR n 
1 400 ALA n 
1 401 ALA n 
1 402 SER n 
1 403 ASP n 
1 404 ALA n 
1 405 ASN n 
1 406 THR n 
1 407 GLY n 
1 408 ASP n 
1 409 ARG n 
1 410 GLY n 
1 411 GLN n 
1 412 THR n 
1 413 ASN n 
1 414 ASN n 
1 415 ALA n 
1 416 ALA n 
1 417 SER n 
1 418 ALA n 
1 419 SER n 
1 420 ALA n 
1 421 SER n 
1 422 ASN n 
1 423 SER n 
1 424 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 GSK3B 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            H5 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               BACULOVIRUS 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PVL-GST-GSK3BETA 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GSK3B_HUMAN 
_struct_ref.pdbx_db_accession          P49841 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGEL
VAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLY
MYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVW
SAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLL
EYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDAN
TGDRGQTNNAASASASNST
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1Q41 A 6 ? 424 ? P49841 2 ? 420 ? 2 420 
2 1 1Q41 B 6 ? 424 ? P49841 2 ? 420 ? 2 420 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1Q41 GLY A 1 ? UNP P49841 ? ? 'CLONING ARTIFACT' -3 1  
1 1Q41 PRO A 2 ? UNP P49841 ? ? 'CLONING ARTIFACT' -2 2  
1 1Q41 LEU A 3 ? UNP P49841 ? ? 'CLONING ARTIFACT' -1 3  
1 1Q41 GLY A 4 ? UNP P49841 ? ? 'CLONING ARTIFACT' 0  4  
1 1Q41 SER A 5 ? UNP P49841 ? ? 'CLONING ARTIFACT' 1  5  
2 1Q41 GLY B 1 ? UNP P49841 ? ? 'CLONING ARTIFACT' -3 6  
2 1Q41 PRO B 2 ? UNP P49841 ? ? 'CLONING ARTIFACT' -2 7  
2 1Q41 LEU B 3 ? UNP P49841 ? ? 'CLONING ARTIFACT' -1 8  
2 1Q41 GLY B 4 ? UNP P49841 ? ? 'CLONING ARTIFACT' 0  9  
2 1Q41 SER B 5 ? UNP P49841 ? ? 'CLONING ARTIFACT' 1  10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                              ?                       'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                             ?                       'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                           ?                       'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                      ?                       'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                             ?                       'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                            ?                       'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                      ?                       'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                              ?                       'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                            ?                       'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                ?                       'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                           ?                       'C6 H13 N O2'    131.173 
IXM non-polymer         . "(Z)-1H,1'H-[2,3']BIINDOLYLIDENE-3,2'-DIONE-3-OXIME" "INDIRUBIN-3'-MONOXIME" 'C16 H11 N3 O2'  277.277 
LEU 'L-peptide linking' y LEUCINE                                              ?                       'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                               ?                       'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                           ?                       'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                        ?                       'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                              ?                       'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                               ?                       'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                            ?                       'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                           ?                       'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                             ?                       'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                               ?                       'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1Q41 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.42 
_exptl_crystal.density_percent_sol   64.06 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.00 
_exptl_crystal_grow.pdbx_details    
'PEG 3350 MONODISPERSE, GLYCEROL, MAGNESIUM CHLORIDE, HEPES, pH 7.00, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2002-07-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-1 
_diffrn_source.pdbx_wavelength             0.933 
_diffrn_source.pdbx_wavelength_list        0.933 
# 
_reflns.entry_id                     1Q41 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            2.100 
_reflns.number_obs                   76152 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.06 
_reflns.pdbx_netI_over_sigmaI        21.3325 
_reflns.B_iso_Wilson_estimate        23.4 
_reflns.pdbx_redundancy              4.390 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.18 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.423 
_reflns_shell.meanI_over_sigI_obs    3.592 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1Q41 
_refine.ls_number_reflns_obs                     76076 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               2340596.15 
_refine.pdbx_data_cutoff_low_absF                0 
_refine.pdbx_data_cutoff_high_rms_absF           2340596.15 
_refine.ls_d_res_low                             28.76 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.229 
_refine.ls_R_factor_R_free                       0.245 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3844 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               48.9 
_refine.aniso_B[1][1]                            3.21 
_refine.aniso_B[2][2]                            14.60 
_refine.aniso_B[3][3]                            -17.81 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.359701 
_refine.solvent_model_param_bsol                 50.4047 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1H8F' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1Q41 
_refine_analyze.Luzzati_coordinate_error_obs    0.28 
_refine_analyze.Luzzati_sigma_a_obs             0.29 
_refine_analyze.Luzzati_d_res_low_obs           5 
_refine_analyze.Luzzati_coordinate_error_free   0.31 
_refine_analyze.Luzzati_sigma_a_free            0.29 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5428 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         42 
_refine_hist.number_atoms_solvent             147 
_refine_hist.number_atoms_total               5617 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        28.76 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.012 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.5   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.9  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.00  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.56  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.54  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.16  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.28  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.10 
_refine_ls_shell.d_res_low                        2.23 
_refine_ls_shell.number_reflns_R_work             11841 
_refine_ls_shell.R_factor_R_work                  0.296 
_refine_ls_shell.percent_reflns_obs               100.0 
_refine_ls_shell.R_factor_R_free                  0.319 
_refine_ls_shell.R_factor_R_free_error            0.012 
_refine_ls_shell.percent_reflns_R_free            5.5 
_refine_ls_shell.number_reflns_R_free             684 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1Q41 
_struct.title                     
;GSK-3 Beta complexed with Indirubin-3'-monoxime
;
_struct.pdbx_descriptor           'Glycogen synthase kinase-3 beta (E.C.2.7.1.37)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1Q41 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;KINASE, INSULIN PATHWAY, Indirubin-3'-monoxime, TRANSFERASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 99  ? LYS A 107 ? ASN A 95  LYS A 103 1 ? 9  
HELX_P HELX_P2  2  VAL A 143 ? ARG A 152 ? VAL A 139 ARG A 148 1 ? 10 
HELX_P HELX_P3  3  PRO A 158 ? SER A 178 ? PRO A 154 SER A 174 1 ? 21 
HELX_P HELX_P4  4  LYS A 187 ? GLN A 189 ? LYS A 183 GLN A 185 5 ? 3  
HELX_P HELX_P5  5  SER A 223 ? ARG A 227 ? SER A 219 ARG A 223 5 ? 5  
HELX_P HELX_P6  6  ALA A 228 ? PHE A 233 ? ALA A 224 PHE A 229 1 ? 6  
HELX_P HELX_P7  7  SER A 240 ? GLY A 257 ? SER A 236 GLY A 253 1 ? 18 
HELX_P HELX_P8  8  SER A 265 ? GLY A 278 ? SER A 261 GLY A 274 1 ? 14 
HELX_P HELX_P9  9  THR A 281 ? MET A 288 ? THR A 277 MET A 284 1 ? 8  
HELX_P HELX_P10 10 PRO A 304 ? PHE A 309 ? PRO A 300 PHE A 305 1 ? 6  
HELX_P HELX_P11 11 PRO A 314 ? LEU A 325 ? PRO A 310 LEU A 321 1 ? 12 
HELX_P HELX_P12 12 THR A 328 ? ARG A 332 ? THR A 324 ARG A 328 5 ? 5  
HELX_P HELX_P13 13 THR A 334 ? ALA A 340 ? THR A 330 ALA A 336 1 ? 7  
HELX_P HELX_P14 14 HIS A 341 ? ASP A 349 ? HIS A 337 ASP A 345 5 ? 9  
HELX_P HELX_P15 15 THR A 367 ? SER A 372 ? THR A 363 SER A 368 1 ? 6  
HELX_P HELX_P16 16 ASN A 374 ? PRO A 376 ? ASN A 370 PRO A 372 5 ? 3  
HELX_P HELX_P17 17 LEU A 377 ? ILE A 382 ? LEU A 373 ILE A 378 1 ? 6  
HELX_P HELX_P18 18 PRO A 383 ? ILE A 388 ? PRO A 379 ILE A 384 5 ? 6  
HELX_P HELX_P19 19 ASN B 99  ? LEU B 108 ? ASN B 95  LEU B 104 1 ? 10 
HELX_P HELX_P20 20 VAL B 143 ? ARG B 152 ? VAL B 139 ARG B 148 1 ? 10 
HELX_P HELX_P21 21 PRO B 158 ? SER B 178 ? PRO B 154 SER B 174 1 ? 21 
HELX_P HELX_P22 22 LYS B 187 ? GLN B 189 ? LYS B 183 GLN B 185 5 ? 3  
HELX_P HELX_P23 23 SER B 223 ? ARG B 227 ? SER B 219 ARG B 223 5 ? 5  
HELX_P HELX_P24 24 ALA B 228 ? PHE B 233 ? ALA B 224 PHE B 229 1 ? 6  
HELX_P HELX_P25 25 SER B 240 ? GLY B 257 ? SER B 236 GLY B 253 1 ? 18 
HELX_P HELX_P26 26 SER B 265 ? GLY B 278 ? SER B 261 GLY B 274 1 ? 14 
HELX_P HELX_P27 27 THR B 281 ? ASN B 289 ? THR B 277 ASN B 285 1 ? 9  
HELX_P HELX_P28 28 PRO B 304 ? VAL B 308 ? PRO B 300 VAL B 304 5 ? 5  
HELX_P HELX_P29 29 PRO B 314 ? LEU B 325 ? PRO B 310 LEU B 321 1 ? 12 
HELX_P HELX_P30 30 THR B 328 ? ARG B 332 ? THR B 324 ARG B 328 5 ? 5  
HELX_P HELX_P31 31 THR B 334 ? ALA B 340 ? THR B 330 ALA B 336 1 ? 7  
HELX_P HELX_P32 32 HIS B 341 ? ASP B 349 ? HIS B 337 ASP B 345 5 ? 9  
HELX_P HELX_P33 33 THR B 367 ? SER B 372 ? THR B 363 SER B 368 1 ? 6  
HELX_P HELX_P34 34 ASN B 374 ? PRO B 376 ? ASN B 370 PRO B 372 5 ? 3  
HELX_P HELX_P35 35 LEU B 377 ? ILE B 382 ? LEU B 373 ILE B 378 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 3 ? 
C ? 2 ? 
D ? 7 ? 
E ? 3 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
D 6 7 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 42  ? PRO A 48  ? THR A 38  PRO A 44  
A 2 GLN A 56  ? GLY A 67  ? GLN A 52  GLY A 63  
A 3 VAL A 74  ? LEU A 79  ? VAL A 70  LEU A 75  
A 4 LEU A 85  ? LEU A 92  ? LEU A 81  LEU A 88  
A 5 TYR A 131 ? ASP A 137 ? TYR A 127 ASP A 133 
A 6 LEU A 116 ? SER A 122 ? LEU A 112 SER A 118 
A 7 THR A 42  ? PRO A 48  ? THR A 38  PRO A 44  
B 1 GLU A 141 ? THR A 142 ? GLU A 137 THR A 138 
B 2 LEU A 191 ? LEU A 193 ? LEU A 187 LEU A 189 
B 3 LEU A 200 ? LEU A 202 ? LEU A 196 LEU A 198 
C 1 ILE A 181 ? CYS A 182 ? ILE A 177 CYS A 178 
C 2 LYS A 209 ? GLN A 210 ? LYS A 205 GLN A 206 
D 1 THR B 42  ? PRO B 48  ? THR B 38  PRO B 44  
D 2 GLN B 56  ? GLY B 67  ? GLN B 52  GLY B 63  
D 3 VAL B 73  ? LEU B 79  ? VAL B 69  LEU B 75  
D 4 LEU B 85  ? LEU B 92  ? LEU B 81  LEU B 88  
D 5 TYR B 131 ? ASP B 137 ? TYR B 127 ASP B 133 
D 6 LEU B 116 ? SER B 122 ? LEU B 112 SER B 118 
D 7 THR B 42  ? PRO B 48  ? THR B 38  PRO B 44  
E 1 GLU B 141 ? THR B 142 ? GLU B 137 THR B 138 
E 2 LEU B 191 ? ASP B 194 ? LEU B 187 ASP B 190 
E 3 VAL B 199 ? LEU B 202 ? VAL B 195 LEU B 198 
F 1 ILE B 181 ? CYS B 182 ? ILE B 177 CYS B 178 
F 2 LYS B 209 ? GLN B 210 ? LYS B 205 GLN B 206 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 46  ? N ALA A 42  O GLN A 56  ? O GLN A 52  
A 2 3 N THR A 61  ? N THR A 57  O LYS A 78  ? O LYS A 74  
A 3 4 N TYR A 75  ? N TYR A 71  O ILE A 88  ? O ILE A 84  
A 4 5 N ALA A 87  ? N ALA A 83  O LEU A 136 ? O LEU A 132 
A 5 6 O TYR A 131 ? O TYR A 127 N SER A 122 ? N SER A 118 
A 6 7 O PHE A 119 ? O PHE A 115 N THR A 47  ? N THR A 43  
B 1 2 N GLU A 141 ? N GLU A 137 O LEU A 193 ? O LEU A 189 
B 2 3 N LEU A 192 ? N LEU A 188 O LYS A 201 ? O LYS A 197 
C 1 2 N CYS A 182 ? N CYS A 178 O LYS A 209 ? O LYS A 205 
D 1 2 N VAL B 44  ? N VAL B 40  O VAL B 58  ? O VAL B 54  
D 2 3 N THR B 61  ? N THR B 57  O LYS B 78  ? O LYS B 74  
D 3 4 N VAL B 73  ? N VAL B 69  O LYS B 90  ? O LYS B 86  
D 4 5 N ALA B 87  ? N ALA B 83  O LEU B 136 ? O LEU B 132 
D 5 6 O TYR B 131 ? O TYR B 127 N SER B 122 ? N SER B 118 
D 6 7 O PHE B 119 ? O PHE B 115 N THR B 47  ? N THR B 43  
E 1 2 N GLU B 141 ? N GLU B 137 O LEU B 193 ? O LEU B 189 
E 2 3 N LEU B 192 ? N LEU B 188 O LYS B 201 ? O LYS B 197 
F 1 2 N CYS B 182 ? N CYS B 178 O LYS B 209 ? O LYS B 205 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE IXM A 451' 
AC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE IXM B 452' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8 ILE A 66  ? ILE A 62  . ? 1_555 ? 
2  AC1 8 ALA A 87  ? ALA A 83  . ? 1_555 ? 
3  AC1 8 ASP A 137 ? ASP A 133 . ? 1_555 ? 
4  AC1 8 TYR A 138 ? TYR A 134 . ? 1_555 ? 
5  AC1 8 VAL A 139 ? VAL A 135 . ? 1_555 ? 
6  AC1 8 PRO A 140 ? PRO A 136 . ? 1_555 ? 
7  AC1 8 ARG A 145 ? ARG A 141 . ? 1_555 ? 
8  AC1 8 LEU A 192 ? LEU A 188 . ? 1_555 ? 
9  AC2 8 ILE B 66  ? ILE B 62  . ? 1_555 ? 
10 AC2 8 ALA B 87  ? ALA B 83  . ? 1_555 ? 
11 AC2 8 ASP B 137 ? ASP B 133 . ? 1_555 ? 
12 AC2 8 TYR B 138 ? TYR B 134 . ? 1_555 ? 
13 AC2 8 VAL B 139 ? VAL B 135 . ? 1_555 ? 
14 AC2 8 PRO B 140 ? PRO B 136 . ? 1_555 ? 
15 AC2 8 ARG B 145 ? ARG B 141 . ? 1_555 ? 
16 AC2 8 LEU B 192 ? LEU B 188 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1Q41 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1Q41 
_atom_sites.fract_transf_matrix[1][1]   0.011985 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011568 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005592 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 39  ? 63.398 12.811  35.045  1.00 82.50  ? 35  SER A N   1 
ATOM   2    C CA  . SER A 1 39  ? 61.954 12.627  34.688  1.00 82.54  ? 35  SER A CA  1 
ATOM   3    C C   . SER A 1 39  ? 61.225 13.968  34.525  1.00 81.80  ? 35  SER A C   1 
ATOM   4    O O   . SER A 1 39  ? 61.277 14.821  35.414  1.00 81.98  ? 35  SER A O   1 
ATOM   5    C CB  . SER A 1 39  ? 61.250 11.779  35.759  1.00 83.05  ? 35  SER A CB  1 
ATOM   6    O OG  . SER A 1 39  ? 61.312 12.388  37.039  1.00 83.04  ? 35  SER A OG  1 
ATOM   7    N N   . LYS A 1 40  ? 60.550 14.133  33.385  1.00 80.51  ? 36  LYS A N   1 
ATOM   8    C CA  . LYS A 1 40  ? 59.802 15.350  33.051  1.00 78.63  ? 36  LYS A CA  1 
ATOM   9    C C   . LYS A 1 40  ? 58.778 15.773  34.111  1.00 76.82  ? 36  LYS A C   1 
ATOM   10   O O   . LYS A 1 40  ? 57.955 14.969  34.569  1.00 77.02  ? 36  LYS A O   1 
ATOM   11   C CB  . LYS A 1 40  ? 59.089 15.169  31.702  1.00 79.93  ? 36  LYS A CB  1 
ATOM   12   C CG  . LYS A 1 40  ? 58.283 16.385  31.242  1.00 80.98  ? 36  LYS A CG  1 
ATOM   13   C CD  . LYS A 1 40  ? 57.519 16.114  29.942  1.00 81.50  ? 36  LYS A CD  1 
ATOM   14   C CE  . LYS A 1 40  ? 58.467 15.802  28.783  1.00 82.38  ? 36  LYS A CE  1 
ATOM   15   N NZ  . LYS A 1 40  ? 57.756 15.675  27.479  1.00 81.85  ? 36  LYS A NZ  1 
ATOM   16   N N   . VAL A 1 41  ? 58.842 17.050  34.485  1.00 73.65  ? 37  VAL A N   1 
ATOM   17   C CA  . VAL A 1 41  ? 57.954 17.633  35.477  1.00 69.80  ? 37  VAL A CA  1 
ATOM   18   C C   . VAL A 1 41  ? 57.154 18.783  34.875  1.00 68.07  ? 37  VAL A C   1 
ATOM   19   O O   . VAL A 1 41  ? 57.714 19.696  34.270  1.00 66.89  ? 37  VAL A O   1 
ATOM   20   C CB  . VAL A 1 41  ? 58.744 18.189  36.672  1.00 69.72  ? 37  VAL A CB  1 
ATOM   21   C CG1 . VAL A 1 41  ? 57.817 18.992  37.563  1.00 69.63  ? 37  VAL A CG1 1 
ATOM   22   C CG2 . VAL A 1 41  ? 59.380 17.059  37.452  1.00 69.02  ? 37  VAL A CG2 1 
ATOM   23   N N   . THR A 1 42  ? 55.840 18.734  35.046  1.00 65.37  ? 38  THR A N   1 
ATOM   24   C CA  . THR A 1 42  ? 54.985 19.783  34.527  1.00 62.83  ? 38  THR A CA  1 
ATOM   25   C C   . THR A 1 42  ? 54.434 20.632  35.665  1.00 61.37  ? 38  THR A C   1 
ATOM   26   O O   . THR A 1 42  ? 53.905 20.104  36.648  1.00 60.70  ? 38  THR A O   1 
ATOM   27   C CB  . THR A 1 42  ? 53.809 19.196  33.752  1.00 62.65  ? 38  THR A CB  1 
ATOM   28   O OG1 . THR A 1 42  ? 54.306 18.332  32.729  1.00 63.89  ? 38  THR A OG1 1 
ATOM   29   C CG2 . THR A 1 42  ? 52.992 20.298  33.116  1.00 61.36  ? 38  THR A CG2 1 
ATOM   30   N N   . THR A 1 43  ? 54.567 21.950  35.531  1.00 59.33  ? 39  THR A N   1 
ATOM   31   C CA  . THR A 1 43  ? 54.061 22.867  36.540  1.00 56.46  ? 39  THR A CA  1 
ATOM   32   C C   . THR A 1 43  ? 53.084 23.805  35.858  1.00 54.56  ? 39  THR A C   1 
ATOM   33   O O   . THR A 1 43  ? 53.402 24.406  34.834  1.00 52.93  ? 39  THR A O   1 
ATOM   34   C CB  . THR A 1 43  ? 55.197 23.680  37.179  1.00 57.41  ? 39  THR A CB  1 
ATOM   35   O OG1 . THR A 1 43  ? 56.188 22.776  37.688  1.00 57.17  ? 39  THR A OG1 1 
ATOM   36   C CG2 . THR A 1 43  ? 54.654 24.531  38.337  1.00 56.64  ? 39  THR A CG2 1 
ATOM   37   N N   . VAL A 1 44  ? 51.890 23.915  36.429  1.00 52.03  ? 40  VAL A N   1 
ATOM   38   C CA  . VAL A 1 44  ? 50.839 24.748  35.869  1.00 49.49  ? 40  VAL A CA  1 
ATOM   39   C C   . VAL A 1 44  ? 50.233 25.586  36.992  1.00 48.42  ? 40  VAL A C   1 
ATOM   40   O O   . VAL A 1 44  ? 50.432 25.289  38.156  1.00 47.86  ? 40  VAL A O   1 
ATOM   41   C CB  . VAL A 1 44  ? 49.710 23.861  35.259  1.00 50.46  ? 40  VAL A CB  1 
ATOM   42   C CG1 . VAL A 1 44  ? 50.291 22.852  34.285  1.00 50.22  ? 40  VAL A CG1 1 
ATOM   43   C CG2 . VAL A 1 44  ? 48.978 23.120  36.369  1.00 49.93  ? 40  VAL A CG2 1 
ATOM   44   N N   . VAL A 1 45  ? 49.497 26.632  36.645  1.00 47.41  ? 41  VAL A N   1 
ATOM   45   C CA  . VAL A 1 45  ? 48.849 27.439  37.658  1.00 48.21  ? 41  VAL A CA  1 
ATOM   46   C C   . VAL A 1 45  ? 47.391 27.070  37.505  1.00 48.74  ? 41  VAL A C   1 
ATOM   47   O O   . VAL A 1 45  ? 46.795 27.291  36.446  1.00 49.39  ? 41  VAL A O   1 
ATOM   48   C CB  . VAL A 1 45  ? 49.066 28.953  37.422  1.00 48.33  ? 41  VAL A CB  1 
ATOM   49   C CG1 . VAL A 1 45  ? 48.211 29.752  38.391  1.00 47.54  ? 41  VAL A CG1 1 
ATOM   50   C CG2 . VAL A 1 45  ? 50.543 29.299  37.645  1.00 46.91  ? 41  VAL A CG2 1 
ATOM   51   N N   . ALA A 1 46  ? 46.810 26.496  38.555  1.00 48.98  ? 42  ALA A N   1 
ATOM   52   C CA  . ALA A 1 46  ? 45.428 26.041  38.468  1.00 49.34  ? 42  ALA A CA  1 
ATOM   53   C C   . ALA A 1 46  ? 44.435 26.643  39.455  1.00 49.64  ? 42  ALA A C   1 
ATOM   54   O O   . ALA A 1 46  ? 44.807 27.105  40.531  1.00 49.93  ? 42  ALA A O   1 
ATOM   55   C CB  . ALA A 1 46  ? 45.403 24.516  38.586  1.00 49.67  ? 42  ALA A CB  1 
ATOM   56   N N   . THR A 1 47  ? 43.163 26.628  39.068  1.00 49.65  ? 43  THR A N   1 
ATOM   57   C CA  . THR A 1 47  ? 42.083 27.126  39.908  1.00 51.10  ? 43  THR A CA  1 
ATOM   58   C C   . THR A 1 47  ? 41.567 25.993  40.779  1.00 53.04  ? 43  THR A C   1 
ATOM   59   O O   . THR A 1 47  ? 41.325 24.891  40.281  1.00 52.23  ? 43  THR A O   1 
ATOM   60   C CB  . THR A 1 47  ? 40.906 27.591  39.077  1.00 50.42  ? 43  THR A CB  1 
ATOM   61   O OG1 . THR A 1 47  ? 41.351 28.569  38.145  1.00 51.46  ? 43  THR A OG1 1 
ATOM   62   C CG2 . THR A 1 47  ? 39.818 28.178  39.965  1.00 51.00  ? 43  THR A CG2 1 
ATOM   63   N N   . PRO A 1 48  ? 41.391 26.247  42.091  1.00 54.46  ? 44  PRO A N   1 
ATOM   64   C CA  . PRO A 1 48  ? 40.887 25.227  43.024  1.00 54.87  ? 44  PRO A CA  1 
ATOM   65   C C   . PRO A 1 48  ? 39.493 24.738  42.604  1.00 56.81  ? 44  PRO A C   1 
ATOM   66   O O   . PRO A 1 48  ? 38.676 25.511  42.087  1.00 53.73  ? 44  PRO A O   1 
ATOM   67   C CB  . PRO A 1 48  ? 40.846 25.962  44.370  1.00 55.65  ? 44  PRO A CB  1 
ATOM   68   C CG  . PRO A 1 48  ? 41.965 26.986  44.242  1.00 55.64  ? 44  PRO A CG  1 
ATOM   69   C CD  . PRO A 1 48  ? 41.800 27.473  42.804  1.00 54.57  ? 44  PRO A CD  1 
ATOM   70   N N   . GLY A 1 49  ? 39.233 23.450  42.834  1.00 58.89  ? 45  GLY A N   1 
ATOM   71   C CA  . GLY A 1 49  ? 37.953 22.878  42.474  1.00 62.38  ? 45  GLY A CA  1 
ATOM   72   C C   . GLY A 1 49  ? 36.753 23.575  43.086  1.00 64.91  ? 45  GLY A C   1 
ATOM   73   O O   . GLY A 1 49  ? 35.773 23.845  42.394  1.00 64.91  ? 45  GLY A O   1 
ATOM   74   N N   . GLN A 1 50  ? 36.822 23.903  44.373  1.00 67.84  ? 46  GLN A N   1 
ATOM   75   C CA  . GLN A 1 50  ? 35.673 24.538  45.008  1.00 70.99  ? 46  GLN A CA  1 
ATOM   76   C C   . GLN A 1 50  ? 35.873 25.728  45.951  1.00 72.09  ? 46  GLN A C   1 
ATOM   77   O O   . GLN A 1 50  ? 34.924 26.480  46.197  1.00 73.11  ? 46  GLN A O   1 
ATOM   78   C CB  . GLN A 1 50  ? 34.871 23.458  45.723  1.00 71.93  ? 46  GLN A CB  1 
ATOM   79   C CG  . GLN A 1 50  ? 35.766 22.431  46.389  1.00 74.54  ? 46  GLN A CG  1 
ATOM   80   C CD  . GLN A 1 50  ? 35.205 21.027  46.291  1.00 76.13  ? 46  GLN A CD  1 
ATOM   81   O OE1 . GLN A 1 50  ? 35.831 20.062  46.746  1.00 76.27  ? 46  GLN A OE1 1 
ATOM   82   N NE2 . GLN A 1 50  ? 34.014 20.904  45.695  1.00 76.74  ? 46  GLN A NE2 1 
ATOM   83   N N   . GLY A 1 51  ? 37.073 25.923  46.481  1.00 72.44  ? 47  GLY A N   1 
ATOM   84   C CA  . GLY A 1 51  ? 37.242 27.043  47.399  1.00 73.56  ? 47  GLY A CA  1 
ATOM   85   C C   . GLY A 1 51  ? 37.111 28.393  46.714  1.00 73.67  ? 47  GLY A C   1 
ATOM   86   O O   . GLY A 1 51  ? 36.461 28.502  45.673  1.00 73.46  ? 47  GLY A O   1 
ATOM   87   N N   . PRO A 1 52  ? 37.670 29.459  47.308  1.00 73.63  ? 48  PRO A N   1 
ATOM   88   C CA  . PRO A 1 52  ? 37.601 30.789  46.687  1.00 72.66  ? 48  PRO A CA  1 
ATOM   89   C C   . PRO A 1 52  ? 38.631 30.708  45.558  1.00 71.38  ? 48  PRO A C   1 
ATOM   90   O O   . PRO A 1 52  ? 39.506 29.848  45.608  1.00 70.56  ? 48  PRO A O   1 
ATOM   91   C CB  . PRO A 1 52  ? 38.060 31.717  47.805  1.00 74.23  ? 48  PRO A CB  1 
ATOM   92   C CG  . PRO A 1 52  ? 37.689 30.944  49.075  1.00 74.36  ? 48  PRO A CG  1 
ATOM   93   C CD  . PRO A 1 52  ? 38.090 29.547  48.719  1.00 73.70  ? 48  PRO A CD  1 
ATOM   94   N N   . ASP A 1 53  ? 38.549 31.572  44.551  1.00 70.49  ? 49  ASP A N   1 
ATOM   95   C CA  . ASP A 1 53  ? 39.516 31.499  43.449  1.00 69.39  ? 49  ASP A CA  1 
ATOM   96   C C   . ASP A 1 53  ? 40.919 31.989  43.813  1.00 67.12  ? 49  ASP A C   1 
ATOM   97   O O   . ASP A 1 53  ? 41.272 33.141  43.571  1.00 67.23  ? 49  ASP A O   1 
ATOM   98   C CB  . ASP A 1 53  ? 39.026 32.285  42.229  1.00 71.42  ? 49  ASP A CB  1 
ATOM   99   C CG  . ASP A 1 53  ? 39.817 31.957  40.967  1.00 73.28  ? 49  ASP A CG  1 
ATOM   100  O OD1 . ASP A 1 53  ? 41.058 31.813  41.043  1.00 73.97  ? 49  ASP A OD1 1 
ATOM   101  O OD2 . ASP A 1 53  ? 39.196 31.848  39.889  1.00 75.51  ? 49  ASP A OD2 1 
ATOM   102  N N   . ARG A 1 54  ? 41.711 31.104  44.394  1.00 64.08  ? 50  ARG A N   1 
ATOM   103  C CA  . ARG A 1 54  ? 43.078 31.419  44.767  1.00 62.06  ? 50  ARG A CA  1 
ATOM   104  C C   . ARG A 1 54  ? 43.985 30.453  44.001  1.00 58.31  ? 50  ARG A C   1 
ATOM   105  O O   . ARG A 1 54  ? 44.205 29.324  44.428  1.00 57.11  ? 50  ARG A O   1 
ATOM   106  C CB  . ARG A 1 54  ? 43.254 31.260  46.282  1.00 64.27  ? 50  ARG A CB  1 
ATOM   107  C CG  . ARG A 1 54  ? 42.796 32.484  47.088  1.00 69.12  ? 50  ARG A CG  1 
ATOM   108  C CD  . ARG A 1 54  ? 43.836 33.616  46.988  1.00 73.21  ? 50  ARG A CD  1 
ATOM   109  N NE  . ARG A 1 54  ? 43.488 34.831  47.735  1.00 75.93  ? 50  ARG A NE  1 
ATOM   110  C CZ  . ARG A 1 54  ? 42.668 35.779  47.284  1.00 77.73  ? 50  ARG A CZ  1 
ATOM   111  N NH1 . ARG A 1 54  ? 42.106 35.654  46.083  1.00 78.44  ? 50  ARG A NH1 1 
ATOM   112  N NH2 . ARG A 1 54  ? 42.417 36.858  48.024  1.00 77.57  ? 50  ARG A NH2 1 
ATOM   113  N N   . PRO A 1 55  ? 44.530 30.898  42.858  1.00 55.92  ? 51  PRO A N   1 
ATOM   114  C CA  . PRO A 1 55  ? 45.410 30.084  42.014  1.00 53.89  ? 51  PRO A CA  1 
ATOM   115  C C   . PRO A 1 55  ? 46.512 29.388  42.785  1.00 53.32  ? 51  PRO A C   1 
ATOM   116  O O   . PRO A 1 55  ? 47.086 29.952  43.711  1.00 52.17  ? 51  PRO A O   1 
ATOM   117  C CB  . PRO A 1 55  ? 45.962 31.092  41.012  1.00 54.31  ? 51  PRO A CB  1 
ATOM   118  C CG  . PRO A 1 55  ? 44.873 32.109  40.919  1.00 55.15  ? 51  PRO A CG  1 
ATOM   119  C CD  . PRO A 1 55  ? 44.483 32.286  42.364  1.00 55.51  ? 51  PRO A CD  1 
ATOM   120  N N   . GLN A 1 56  ? 46.802 28.151  42.402  1.00 53.44  ? 52  GLN A N   1 
ATOM   121  C CA  . GLN A 1 56  ? 47.852 27.383  43.059  1.00 54.22  ? 52  GLN A CA  1 
ATOM   122  C C   . GLN A 1 56  ? 48.781 26.795  42.020  1.00 53.29  ? 52  GLN A C   1 
ATOM   123  O O   . GLN A 1 56  ? 48.368 26.503  40.895  1.00 52.33  ? 52  GLN A O   1 
ATOM   124  C CB  . GLN A 1 56  ? 47.264 26.228  43.872  1.00 58.61  ? 52  GLN A CB  1 
ATOM   125  C CG  . GLN A 1 56  ? 46.028 26.561  44.708  1.00 64.56  ? 52  GLN A CG  1 
ATOM   126  C CD  . GLN A 1 56  ? 45.605 25.383  45.606  1.00 68.96  ? 52  GLN A CD  1 
ATOM   127  O OE1 . GLN A 1 56  ? 44.524 25.405  46.211  1.00 71.44  ? 52  GLN A OE1 1 
ATOM   128  N NE2 . GLN A 1 56  ? 46.470 24.356  45.704  1.00 68.54  ? 52  GLN A NE2 1 
ATOM   129  N N   . GLU A 1 57  ? 50.035 26.608  42.403  1.00 53.11  ? 53  GLU A N   1 
ATOM   130  C CA  . GLU A 1 57  ? 51.004 26.032  41.493  1.00 54.41  ? 53  GLU A CA  1 
ATOM   131  C C   . GLU A 1 57  ? 50.971 24.541  41.715  1.00 53.57  ? 53  GLU A C   1 
ATOM   132  O O   . GLU A 1 57  ? 51.145 24.075  42.836  1.00 52.76  ? 53  GLU A O   1 
ATOM   133  C CB  . GLU A 1 57  ? 52.401 26.576  41.775  1.00 55.70  ? 53  GLU A CB  1 
ATOM   134  C CG  . GLU A 1 57  ? 53.076 27.124  40.535  1.00 58.96  ? 53  GLU A CG  1 
ATOM   135  C CD  . GLU A 1 57  ? 54.351 27.896  40.840  1.00 61.34  ? 53  GLU A CD  1 
ATOM   136  O OE1 . GLU A 1 57  ? 55.303 27.289  41.373  1.00 63.77  ? 53  GLU A OE1 1 
ATOM   137  O OE2 . GLU A 1 57  ? 54.402 29.109  40.544  1.00 61.52  ? 53  GLU A OE2 1 
ATOM   138  N N   . VAL A 1 58  ? 50.721 23.794  40.645  1.00 53.27  ? 54  VAL A N   1 
ATOM   139  C CA  . VAL A 1 58  ? 50.657 22.337  40.732  1.00 52.07  ? 54  VAL A CA  1 
ATOM   140  C C   . VAL A 1 58  ? 51.700 21.722  39.804  1.00 51.64  ? 54  VAL A C   1 
ATOM   141  O O   . VAL A 1 58  ? 51.760 22.041  38.620  1.00 51.65  ? 54  VAL A O   1 
ATOM   142  C CB  . VAL A 1 58  ? 49.248 21.805  40.334  1.00 52.54  ? 54  VAL A CB  1 
ATOM   143  C CG1 . VAL A 1 58  ? 49.196 20.295  40.498  1.00 51.18  ? 54  VAL A CG1 1 
ATOM   144  C CG2 . VAL A 1 58  ? 48.181 22.445  41.182  1.00 51.48  ? 54  VAL A CG2 1 
ATOM   145  N N   . SER A 1 59  ? 52.532 20.856  40.364  1.00 52.27  ? 55  SER A N   1 
ATOM   146  C CA  . SER A 1 59  ? 53.579 20.166  39.615  1.00 53.75  ? 55  SER A CA  1 
ATOM   147  C C   . SER A 1 59  ? 53.322 18.662  39.648  1.00 54.01  ? 55  SER A C   1 
ATOM   148  O O   . SER A 1 59  ? 53.084 18.081  40.712  1.00 52.43  ? 55  SER A O   1 
ATOM   149  C CB  . SER A 1 59  ? 54.961 20.442  40.229  1.00 54.76  ? 55  SER A CB  1 
ATOM   150  O OG  . SER A 1 59  ? 55.387 21.769  39.973  1.00 56.97  ? 55  SER A OG  1 
ATOM   151  N N   . TYR A 1 60  ? 53.388 18.021  38.490  1.00 54.77  ? 56  TYR A N   1 
ATOM   152  C CA  . TYR A 1 60  ? 53.159 16.584  38.458  1.00 56.57  ? 56  TYR A CA  1 
ATOM   153  C C   . TYR A 1 60  ? 54.076 15.896  37.462  1.00 57.41  ? 56  TYR A C   1 
ATOM   154  O O   . TYR A 1 60  ? 54.717 16.550  36.637  1.00 57.62  ? 56  TYR A O   1 
ATOM   155  C CB  . TYR A 1 60  ? 51.688 16.290  38.135  1.00 54.00  ? 56  TYR A CB  1 
ATOM   156  C CG  . TYR A 1 60  ? 51.209 16.877  36.827  1.00 53.90  ? 56  TYR A CG  1 
ATOM   157  C CD1 . TYR A 1 60  ? 51.450 16.227  35.614  1.00 53.74  ? 56  TYR A CD1 1 
ATOM   158  C CD2 . TYR A 1 60  ? 50.507 18.080  36.798  1.00 53.44  ? 56  TYR A CD2 1 
ATOM   159  C CE1 . TYR A 1 60  ? 51.001 16.758  34.411  1.00 52.07  ? 56  TYR A CE1 1 
ATOM   160  C CE2 . TYR A 1 60  ? 50.059 18.616  35.603  1.00 52.82  ? 56  TYR A CE2 1 
ATOM   161  C CZ  . TYR A 1 60  ? 50.309 17.947  34.419  1.00 53.38  ? 56  TYR A CZ  1 
ATOM   162  O OH  . TYR A 1 60  ? 49.853 18.473  33.237  1.00 54.82  ? 56  TYR A OH  1 
ATOM   163  N N   . THR A 1 61  ? 54.129 14.573  37.550  1.00 58.80  ? 57  THR A N   1 
ATOM   164  C CA  . THR A 1 61  ? 54.978 13.775  36.674  1.00 60.48  ? 57  THR A CA  1 
ATOM   165  C C   . THR A 1 61  ? 54.388 12.371  36.441  1.00 61.71  ? 57  THR A C   1 
ATOM   166  O O   . THR A 1 61  ? 53.253 12.091  36.839  1.00 61.99  ? 57  THR A O   1 
ATOM   167  C CB  . THR A 1 61  ? 56.381 13.635  37.298  1.00 59.95  ? 57  THR A CB  1 
ATOM   168  O OG1 . THR A 1 61  ? 57.217 12.862  36.429  1.00 62.35  ? 57  THR A OG1 1 
ATOM   169  C CG2 . THR A 1 61  ? 56.296 12.958  38.665  1.00 58.17  ? 57  THR A CG2 1 
ATOM   170  N N   . ASP A 1 62  ? 55.172 11.506  35.795  1.00 62.97  ? 58  ASP A N   1 
ATOM   171  C CA  . ASP A 1 62  ? 54.795 10.116  35.503  1.00 63.81  ? 58  ASP A CA  1 
ATOM   172  C C   . ASP A 1 62  ? 53.402 9.967   34.895  1.00 63.30  ? 58  ASP A C   1 
ATOM   173  O O   . ASP A 1 62  ? 52.570 9.218   35.404  1.00 62.81  ? 58  ASP A O   1 
ATOM   174  C CB  . ASP A 1 62  ? 54.890 9.265   36.780  1.00 66.35  ? 58  ASP A CB  1 
ATOM   175  C CG  . ASP A 1 62  ? 56.283 9.317   37.431  1.00 70.33  ? 58  ASP A CG  1 
ATOM   176  O OD1 . ASP A 1 62  ? 57.298 9.148   36.709  1.00 71.73  ? 58  ASP A OD1 1 
ATOM   177  O OD2 . ASP A 1 62  ? 56.366 9.517   38.669  1.00 71.85  ? 58  ASP A OD2 1 
ATOM   178  N N   . THR A 1 63  ? 53.159 10.664  33.794  1.00 63.21  ? 59  THR A N   1 
ATOM   179  C CA  . THR A 1 63  ? 51.863 10.627  33.134  1.00 64.36  ? 59  THR A CA  1 
ATOM   180  C C   . THR A 1 63  ? 51.635 9.457   32.177  1.00 64.70  ? 59  THR A C   1 
ATOM   181  O O   . THR A 1 63  ? 52.490 9.133   31.367  1.00 64.74  ? 59  THR A O   1 
ATOM   182  C CB  . THR A 1 63  ? 51.630 11.936  32.378  1.00 64.48  ? 59  THR A CB  1 
ATOM   183  O OG1 . THR A 1 63  ? 51.281 12.959  33.319  1.00 66.36  ? 59  THR A OG1 1 
ATOM   184  C CG2 . THR A 1 63  ? 50.524 11.785  31.362  1.00 65.81  ? 59  THR A CG2 1 
ATOM   185  N N   . LYS A 1 64  ? 50.465 8.833   32.268  1.00 64.97  ? 60  LYS A N   1 
ATOM   186  C CA  . LYS A 1 64  ? 50.133 7.719   31.385  1.00 64.89  ? 60  LYS A CA  1 
ATOM   187  C C   . LYS A 1 64  ? 48.621 7.623   31.221  1.00 64.09  ? 60  LYS A C   1 
ATOM   188  O O   . LYS A 1 64  ? 47.863 7.936   32.148  1.00 64.95  ? 60  LYS A O   1 
ATOM   189  C CB  . LYS A 1 64  ? 50.691 6.406   31.946  1.00 65.68  ? 60  LYS A CB  1 
ATOM   190  C CG  . LYS A 1 64  ? 50.045 5.962   33.242  1.00 68.05  ? 60  LYS A CG  1 
ATOM   191  C CD  . LYS A 1 64  ? 50.665 4.683   33.776  1.00 69.56  ? 60  LYS A CD  1 
ATOM   192  C CE  . LYS A 1 64  ? 49.885 4.175   34.983  1.00 71.79  ? 60  LYS A CE  1 
ATOM   193  N NZ  . LYS A 1 64  ? 50.578 3.071   35.724  1.00 73.61  ? 60  LYS A NZ  1 
ATOM   194  N N   . VAL A 1 65  ? 48.178 7.204   30.042  1.00 61.99  ? 61  VAL A N   1 
ATOM   195  C CA  . VAL A 1 65  ? 46.754 7.078   29.782  1.00 60.23  ? 61  VAL A CA  1 
ATOM   196  C C   . VAL A 1 65  ? 46.188 5.879   30.515  1.00 59.41  ? 61  VAL A C   1 
ATOM   197  O O   . VAL A 1 65  ? 46.777 4.800   30.485  1.00 58.37  ? 61  VAL A O   1 
ATOM   198  C CB  . VAL A 1 65  ? 46.476 6.910   28.292  1.00 59.90  ? 61  VAL A CB  1 
ATOM   199  C CG1 . VAL A 1 65  ? 44.985 6.729   28.071  1.00 58.97  ? 61  VAL A CG1 1 
ATOM   200  C CG2 . VAL A 1 65  ? 46.988 8.125   27.536  1.00 59.32  ? 61  VAL A CG2 1 
ATOM   201  N N   . ILE A 1 66  ? 45.063 6.077   31.200  1.00 58.92  ? 62  ILE A N   1 
ATOM   202  C CA  . ILE A 1 66  ? 44.422 4.994   31.935  1.00 58.99  ? 62  ILE A CA  1 
ATOM   203  C C   . ILE A 1 66  ? 43.023 4.803   31.408  1.00 60.67  ? 62  ILE A C   1 
ATOM   204  O O   . ILE A 1 66  ? 42.345 3.840   31.754  1.00 60.33  ? 62  ILE A O   1 
ATOM   205  C CB  . ILE A 1 66  ? 44.309 5.267   33.459  1.00 57.81  ? 62  ILE A CB  1 
ATOM   206  C CG1 . ILE A 1 66  ? 43.485 6.536   33.710  1.00 57.43  ? 62  ILE A CG1 1 
ATOM   207  C CG2 . ILE A 1 66  ? 45.693 5.304   34.091  1.00 56.59  ? 62  ILE A CG2 1 
ATOM   208  C CD1 . ILE A 1 66  ? 43.447 6.964   35.172  1.00 55.98  ? 62  ILE A CD1 1 
ATOM   209  N N   . GLY A 1 67  ? 42.590 5.735   30.575  1.00 62.78  ? 63  GLY A N   1 
ATOM   210  C CA  . GLY A 1 67  ? 41.258 5.642   30.029  1.00 66.44  ? 63  GLY A CA  1 
ATOM   211  C C   . GLY A 1 67  ? 41.116 6.539   28.827  1.00 69.94  ? 63  GLY A C   1 
ATOM   212  O O   . GLY A 1 67  ? 41.704 7.614   28.766  1.00 69.49  ? 63  GLY A O   1 
ATOM   213  N N   . ASN A 1 68  ? 40.345 6.081   27.852  1.00 73.20  ? 64  ASN A N   1 
ATOM   214  C CA  . ASN A 1 68  ? 40.124 6.866   26.660  1.00 76.68  ? 64  ASN A CA  1 
ATOM   215  C C   . ASN A 1 68  ? 38.633 6.854   26.399  1.00 78.20  ? 64  ASN A C   1 
ATOM   216  O O   . ASN A 1 68  ? 37.867 6.183   27.099  1.00 78.73  ? 64  ASN A O   1 
ATOM   217  C CB  . ASN A 1 68  ? 40.880 6.268   25.473  1.00 78.24  ? 64  ASN A CB  1 
ATOM   218  C CG  . ASN A 1 68  ? 41.283 7.320   24.450  1.00 80.73  ? 64  ASN A CG  1 
ATOM   219  O OD1 . ASN A 1 68  ? 40.436 8.040   23.907  1.00 81.43  ? 64  ASN A OD1 1 
ATOM   220  N ND2 . ASN A 1 68  ? 42.592 7.417   24.180  1.00 81.99  ? 64  ASN A ND2 1 
ATOM   221  N N   . GLY A 1 69  ? 38.221 7.612   25.397  1.00 79.74  ? 65  GLY A N   1 
ATOM   222  C CA  . GLY A 1 69  ? 36.815 7.681   25.060  1.00 81.28  ? 65  GLY A CA  1 
ATOM   223  C C   . GLY A 1 69  ? 36.608 8.784   24.050  1.00 82.54  ? 65  GLY A C   1 
ATOM   224  O O   . GLY A 1 69  ? 37.519 9.582   23.793  1.00 82.47  ? 65  GLY A O   1 
ATOM   225  N N   . SER A 1 70  ? 35.419 8.826   23.460  1.00 83.10  ? 66  SER A N   1 
ATOM   226  C CA  . SER A 1 70  ? 35.113 9.857   22.485  1.00 83.87  ? 66  SER A CA  1 
ATOM   227  C C   . SER A 1 70  ? 35.158 11.231  23.178  1.00 84.33  ? 66  SER A C   1 
ATOM   228  O O   . SER A 1 70  ? 35.513 12.240  22.547  1.00 83.84  ? 66  SER A O   1 
ATOM   229  C CB  . SER A 1 70  ? 33.728 9.602   21.859  1.00 83.91  ? 66  SER A CB  1 
ATOM   230  O OG  . SER A 1 70  ? 32.709 9.554   22.845  1.00 83.50  ? 66  SER A OG  1 
ATOM   231  N N   . PHE A 1 71  ? 34.826 11.244  24.478  1.00 84.21  ? 67  PHE A N   1 
ATOM   232  C CA  . PHE A 1 71  ? 34.794 12.466  25.295  1.00 84.06  ? 67  PHE A CA  1 
ATOM   233  C C   . PHE A 1 71  ? 36.157 13.149  25.334  1.00 82.42  ? 67  PHE A C   1 
ATOM   234  O O   . PHE A 1 71  ? 36.340 14.269  24.851  1.00 82.25  ? 67  PHE A O   1 
ATOM   235  C CB  . PHE A 1 71  ? 34.381 12.138  26.741  1.00 87.08  ? 67  PHE A CB  1 
ATOM   236  C CG  . PHE A 1 71  ? 33.013 11.497  26.871  1.00 90.56  ? 67  PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 71  ? 32.770 10.214  26.367  1.00 91.55  ? 67  PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 71  ? 31.964 12.176  27.506  1.00 91.76  ? 67  PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 71  ? 31.497 9.614   26.495  1.00 92.39  ? 67  PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 71  ? 30.689 11.588  27.638  1.00 92.39  ? 67  PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 71  ? 30.458 10.303  27.130  1.00 92.49  ? 67  PHE A CZ  1 
ATOM   242  N N   . GLY A 1 72  ? 37.108 12.446  25.931  1.00 79.96  ? 68  GLY A N   1 
ATOM   243  C CA  . GLY A 1 72  ? 38.451 12.958  26.068  1.00 75.78  ? 68  GLY A CA  1 
ATOM   244  C C   . GLY A 1 72  ? 39.207 12.005  26.971  1.00 73.00  ? 68  GLY A C   1 
ATOM   245  O O   . GLY A 1 72  ? 38.608 11.297  27.793  1.00 74.01  ? 68  GLY A O   1 
ATOM   246  N N   . VAL A 1 73  ? 40.526 12.015  26.819  1.00 68.59  ? 69  VAL A N   1 
ATOM   247  C CA  . VAL A 1 73  ? 41.454 11.164  27.550  1.00 63.47  ? 69  VAL A CA  1 
ATOM   248  C C   . VAL A 1 73  ? 41.613 11.418  29.056  1.00 60.14  ? 69  VAL A C   1 
ATOM   249  O O   . VAL A 1 73  ? 41.693 12.559  29.505  1.00 59.38  ? 69  VAL A O   1 
ATOM   250  C CB  . VAL A 1 73  ? 42.846 11.274  26.891  1.00 63.65  ? 69  VAL A CB  1 
ATOM   251  C CG1 . VAL A 1 73  ? 43.754 10.154  27.359  1.00 63.14  ? 69  VAL A CG1 1 
ATOM   252  C CG2 . VAL A 1 73  ? 42.687 11.265  25.379  1.00 63.79  ? 69  VAL A CG2 1 
ATOM   253  N N   . VAL A 1 74  ? 41.674 10.339  29.827  1.00 55.93  ? 70  VAL A N   1 
ATOM   254  C CA  . VAL A 1 74  ? 41.881 10.437  31.263  1.00 52.64  ? 70  VAL A CA  1 
ATOM   255  C C   . VAL A 1 74  ? 43.266 9.876   31.561  1.00 52.09  ? 70  VAL A C   1 
ATOM   256  O O   . VAL A 1 74  ? 43.586 8.736   31.178  1.00 50.57  ? 70  VAL A O   1 
ATOM   257  C CB  . VAL A 1 74  ? 40.836 9.619   32.062  1.00 52.10  ? 70  VAL A CB  1 
ATOM   258  C CG1 . VAL A 1 74  ? 41.128 9.719   33.553  1.00 50.56  ? 70  VAL A CG1 1 
ATOM   259  C CG2 . VAL A 1 74  ? 39.427 10.147  31.783  1.00 52.24  ? 70  VAL A CG2 1 
ATOM   260  N N   . TYR A 1 75  ? 44.093 10.681  32.227  1.00 50.45  ? 71  TYR A N   1 
ATOM   261  C CA  . TYR A 1 75  ? 45.436 10.258  32.592  1.00 49.54  ? 71  TYR A CA  1 
ATOM   262  C C   . TYR A 1 75  ? 45.574 10.064  34.082  1.00 49.85  ? 71  TYR A C   1 
ATOM   263  O O   . TYR A 1 75  ? 44.767 10.573  34.875  1.00 48.28  ? 71  TYR A O   1 
ATOM   264  C CB  . TYR A 1 75  ? 46.492 11.295  32.220  1.00 49.79  ? 71  TYR A CB  1 
ATOM   265  C CG  . TYR A 1 75  ? 46.502 11.718  30.784  1.00 51.49  ? 71  TYR A CG  1 
ATOM   266  C CD1 . TYR A 1 75  ? 45.567 12.624  30.304  1.00 51.28  ? 71  TYR A CD1 1 
ATOM   267  C CD2 . TYR A 1 75  ? 47.455 11.212  29.896  1.00 52.54  ? 71  TYR A CD2 1 
ATOM   268  C CE1 . TYR A 1 75  ? 45.578 13.024  28.982  1.00 53.01  ? 71  TYR A CE1 1 
ATOM   269  C CE2 . TYR A 1 75  ? 47.474 11.599  28.564  1.00 51.37  ? 71  TYR A CE2 1 
ATOM   270  C CZ  . TYR A 1 75  ? 46.535 12.505  28.115  1.00 53.95  ? 71  TYR A CZ  1 
ATOM   271  O OH  . TYR A 1 75  ? 46.538 12.906  26.798  1.00 56.59  ? 71  TYR A OH  1 
ATOM   272  N N   . GLN A 1 76  ? 46.592 9.293   34.445  1.00 48.96  ? 72  GLN A N   1 
ATOM   273  C CA  . GLN A 1 76  ? 46.942 9.111   35.831  1.00 50.42  ? 72  GLN A CA  1 
ATOM   274  C C   . GLN A 1 76  ? 48.223 9.957   35.877  1.00 50.88  ? 72  GLN A C   1 
ATOM   275  O O   . GLN A 1 76  ? 48.931 10.072  34.871  1.00 50.24  ? 72  GLN A O   1 
ATOM   276  C CB  . GLN A 1 76  ? 47.301 7.673   36.171  1.00 50.95  ? 72  GLN A CB  1 
ATOM   277  C CG  . GLN A 1 76  ? 47.986 7.568   37.536  1.00 52.39  ? 72  GLN A CG  1 
ATOM   278  C CD  . GLN A 1 76  ? 48.613 6.195   37.793  1.00 55.21  ? 72  GLN A CD  1 
ATOM   279  O OE1 . GLN A 1 76  ? 47.919 5.225   38.148  1.00 56.13  ? 72  GLN A OE1 1 
ATOM   280  N NE2 . GLN A 1 76  ? 49.929 6.107   37.611  1.00 51.63  ? 72  GLN A NE2 1 
ATOM   281  N N   . ALA A 1 77  ? 48.503 10.567  37.020  1.00 50.87  ? 73  ALA A N   1 
ATOM   282  C CA  . ALA A 1 77  ? 49.702 11.381  37.157  1.00 51.77  ? 73  ALA A CA  1 
ATOM   283  C C   . ALA A 1 77  ? 50.068 11.393  38.623  1.00 52.28  ? 73  ALA A C   1 
ATOM   284  O O   . ALA A 1 77  ? 49.231 11.106  39.480  1.00 51.49  ? 73  ALA A O   1 
ATOM   285  C CB  . ALA A 1 77  ? 49.456 12.812  36.649  1.00 51.20  ? 73  ALA A CB  1 
ATOM   286  N N   . LYS A 1 78  ? 51.327 11.719  38.896  1.00 53.79  ? 74  LYS A N   1 
ATOM   287  C CA  . LYS A 1 78  ? 51.843 11.755  40.251  1.00 55.03  ? 74  LYS A CA  1 
ATOM   288  C C   . LYS A 1 78  ? 52.238 13.185  40.639  1.00 55.83  ? 74  LYS A C   1 
ATOM   289  O O   . LYS A 1 78  ? 53.032 13.836  39.950  1.00 55.99  ? 74  LYS A O   1 
ATOM   290  C CB  . LYS A 1 78  ? 53.052 10.817  40.346  1.00 56.55  ? 74  LYS A CB  1 
ATOM   291  C CG  . LYS A 1 78  ? 53.728 10.759  41.705  1.00 58.76  ? 74  LYS A CG  1 
ATOM   292  C CD  . LYS A 1 78  ? 54.925 9.815   41.654  1.00 61.69  ? 74  LYS A CD  1 
ATOM   293  C CE  . LYS A 1 78  ? 55.896 10.068  42.801  1.00 64.70  ? 74  LYS A CE  1 
ATOM   294  N NZ  . LYS A 1 78  ? 56.546 11.432  42.739  1.00 67.49  ? 74  LYS A NZ  1 
ATOM   295  N N   . LEU A 1 79  ? 51.666 13.675  41.732  1.00 55.65  ? 75  LEU A N   1 
ATOM   296  C CA  . LEU A 1 79  ? 51.985 15.008  42.210  1.00 57.30  ? 75  LEU A CA  1 
ATOM   297  C C   . LEU A 1 79  ? 53.406 14.966  42.790  1.00 59.51  ? 75  LEU A C   1 
ATOM   298  O O   . LEU A 1 79  ? 53.731 14.095  43.600  1.00 59.76  ? 75  LEU A O   1 
ATOM   299  C CB  . LEU A 1 79  ? 50.971 15.440  43.273  1.00 53.34  ? 75  LEU A CB  1 
ATOM   300  C CG  . LEU A 1 79  ? 49.535 15.589  42.754  1.00 51.51  ? 75  LEU A CG  1 
ATOM   301  C CD1 . LEU A 1 79  ? 48.634 16.154  43.844  1.00 51.05  ? 75  LEU A CD1 1 
ATOM   302  C CD2 . LEU A 1 79  ? 49.525 16.500  41.534  1.00 49.02  ? 75  LEU A CD2 1 
ATOM   303  N N   . CYS A 1 80  ? 54.247 15.903  42.359  1.00 62.17  ? 76  CYS A N   1 
ATOM   304  C CA  . CYS A 1 80  ? 55.636 15.981  42.809  1.00 65.00  ? 76  CYS A CA  1 
ATOM   305  C C   . CYS A 1 80  ? 55.812 16.060  44.310  1.00 67.52  ? 76  CYS A C   1 
ATOM   306  O O   . CYS A 1 80  ? 56.548 15.270  44.909  1.00 69.09  ? 76  CYS A O   1 
ATOM   307  C CB  . CYS A 1 80  ? 56.314 17.189  42.187  1.00 64.73  ? 76  CYS A CB  1 
ATOM   308  S SG  . CYS A 1 80  ? 56.529 17.020  40.436  1.00 66.69  ? 76  CYS A SG  1 
ATOM   309  N N   . ASP A 1 81  ? 55.138 17.025  44.917  1.00 69.39  ? 77  ASP A N   1 
ATOM   310  C CA  . ASP A 1 81  ? 55.231 17.227  46.349  1.00 71.62  ? 77  ASP A CA  1 
ATOM   311  C C   . ASP A 1 81  ? 54.893 15.974  47.172  1.00 71.82  ? 77  ASP A C   1 
ATOM   312  O O   . ASP A 1 81  ? 55.792 15.255  47.619  1.00 72.00  ? 77  ASP A O   1 
ATOM   313  C CB  . ASP A 1 81  ? 54.333 18.411  46.747  1.00 73.72  ? 77  ASP A CB  1 
ATOM   314  C CG  . ASP A 1 81  ? 53.074 18.509  45.889  1.00 76.00  ? 77  ASP A CG  1 
ATOM   315  O OD1 . ASP A 1 81  ? 53.210 18.683  44.651  1.00 77.08  ? 77  ASP A OD1 1 
ATOM   316  O OD2 . ASP A 1 81  ? 51.952 18.411  46.446  1.00 75.94  ? 77  ASP A OD2 1 
ATOM   317  N N   . SER A 1 82  ? 53.603 15.716  47.363  1.00 71.13  ? 78  SER A N   1 
ATOM   318  C CA  . SER A 1 82  ? 53.151 14.574  48.151  1.00 70.59  ? 78  SER A CA  1 
ATOM   319  C C   . SER A 1 82  ? 53.371 13.202  47.506  1.00 70.00  ? 78  SER A C   1 
ATOM   320  O O   . SER A 1 82  ? 53.200 12.169  48.158  1.00 69.62  ? 78  SER A O   1 
ATOM   321  C CB  . SER A 1 82  ? 51.666 14.754  48.502  1.00 71.30  ? 78  SER A CB  1 
ATOM   322  O OG  . SER A 1 82  ? 50.901 15.143  47.365  1.00 72.19  ? 78  SER A OG  1 
ATOM   323  N N   . GLY A 1 83  ? 53.762 13.185  46.235  1.00 69.36  ? 79  GLY A N   1 
ATOM   324  C CA  . GLY A 1 83  ? 53.971 11.917  45.556  1.00 67.27  ? 79  GLY A CA  1 
ATOM   325  C C   . GLY A 1 83  ? 52.654 11.177  45.363  1.00 66.19  ? 79  GLY A C   1 
ATOM   326  O O   . GLY A 1 83  ? 52.625 10.017  44.939  1.00 67.18  ? 79  GLY A O   1 
ATOM   327  N N   . GLU A 1 84  ? 51.552 11.851  45.667  1.00 63.38  ? 80  GLU A N   1 
ATOM   328  C CA  . GLU A 1 84  ? 50.230 11.256  45.537  1.00 61.68  ? 80  GLU A CA  1 
ATOM   329  C C   . GLU A 1 84  ? 49.717 11.195  44.089  1.00 58.57  ? 80  GLU A C   1 
ATOM   330  O O   . GLU A 1 84  ? 49.997 12.066  43.279  1.00 57.66  ? 80  GLU A O   1 
ATOM   331  C CB  . GLU A 1 84  ? 49.264 12.027  46.424  1.00 62.77  ? 80  GLU A CB  1 
ATOM   332  C CG  . GLU A 1 84  ? 47.837 11.929  46.013  1.00 65.47  ? 80  GLU A CG  1 
ATOM   333  C CD  . GLU A 1 84  ? 47.006 12.979  46.696  1.00 67.81  ? 80  GLU A CD  1 
ATOM   334  O OE1 . GLU A 1 84  ? 47.496 14.132  46.808  1.00 69.05  ? 80  GLU A OE1 1 
ATOM   335  O OE2 . GLU A 1 84  ? 45.869 12.655  47.108  1.00 68.38  ? 80  GLU A OE2 1 
ATOM   336  N N   . LEU A 1 85  ? 48.953 10.156  43.777  1.00 56.03  ? 81  LEU A N   1 
ATOM   337  C CA  . LEU A 1 85  ? 48.421 9.969   42.427  1.00 53.57  ? 81  LEU A CA  1 
ATOM   338  C C   . LEU A 1 85  ? 47.098 10.697  42.193  1.00 50.68  ? 81  LEU A C   1 
ATOM   339  O O   . LEU A 1 85  ? 46.283 10.798  43.097  1.00 51.24  ? 81  LEU A O   1 
ATOM   340  C CB  . LEU A 1 85  ? 48.235 8.471   42.160  1.00 53.67  ? 81  LEU A CB  1 
ATOM   341  C CG  . LEU A 1 85  ? 49.521 7.639   42.137  1.00 55.23  ? 81  LEU A CG  1 
ATOM   342  C CD1 . LEU A 1 85  ? 49.175 6.155   42.036  1.00 55.35  ? 81  LEU A CD1 1 
ATOM   343  C CD2 . LEU A 1 85  ? 50.386 8.069   40.948  1.00 53.90  ? 81  LEU A CD2 1 
ATOM   344  N N   . VAL A 1 86  ? 46.897 11.226  40.990  1.00 47.53  ? 82  VAL A N   1 
ATOM   345  C CA  . VAL A 1 86  ? 45.643 11.896  40.671  1.00 46.15  ? 82  VAL A CA  1 
ATOM   346  C C   . VAL A 1 86  ? 45.280 11.504  39.258  1.00 45.24  ? 82  VAL A C   1 
ATOM   347  O O   . VAL A 1 86  ? 46.079 10.910  38.545  1.00 44.81  ? 82  VAL A O   1 
ATOM   348  C CB  . VAL A 1 86  ? 45.725 13.478  40.721  1.00 46.04  ? 82  VAL A CB  1 
ATOM   349  C CG1 . VAL A 1 86  ? 46.023 13.967  42.135  1.00 45.00  ? 82  VAL A CG1 1 
ATOM   350  C CG2 . VAL A 1 86  ? 46.769 13.975  39.760  1.00 45.19  ? 82  VAL A CG2 1 
ATOM   351  N N   . ALA A 1 87  ? 44.061 11.837  38.857  1.00 44.02  ? 83  ALA A N   1 
ATOM   352  C CA  . ALA A 1 87  ? 43.620 11.554  37.501  1.00 43.27  ? 83  ALA A CA  1 
ATOM   353  C C   . ALA A 1 87  ? 43.439 12.912  36.850  1.00 42.90  ? 83  ALA A C   1 
ATOM   354  O O   . ALA A 1 87  ? 43.028 13.864  37.521  1.00 42.95  ? 83  ALA A O   1 
ATOM   355  C CB  . ALA A 1 87  ? 42.289 10.806  37.519  1.00 41.57  ? 83  ALA A CB  1 
ATOM   356  N N   . ILE A 1 88  ? 43.754 13.009  35.565  1.00 43.24  ? 84  ILE A N   1 
ATOM   357  C CA  . ILE A 1 88  ? 43.571 14.254  34.833  1.00 44.04  ? 84  ILE A CA  1 
ATOM   358  C C   . ILE A 1 88  ? 42.706 13.958  33.610  1.00 45.42  ? 84  ILE A C   1 
ATOM   359  O O   . ILE A 1 88  ? 43.100 13.174  32.754  1.00 46.23  ? 84  ILE A O   1 
ATOM   360  C CB  . ILE A 1 88  ? 44.922 14.842  34.352  1.00 45.03  ? 84  ILE A CB  1 
ATOM   361  C CG1 . ILE A 1 88  ? 45.819 15.153  35.558  1.00 45.15  ? 84  ILE A CG1 1 
ATOM   362  C CG2 . ILE A 1 88  ? 44.672 16.115  33.522  1.00 42.61  ? 84  ILE A CG2 1 
ATOM   363  C CD1 . ILE A 1 88  ? 47.180 15.775  35.162  1.00 47.32  ? 84  ILE A CD1 1 
ATOM   364  N N   . LYS A 1 89  ? 41.521 14.559  33.535  1.00 45.59  ? 85  LYS A N   1 
ATOM   365  C CA  . LYS A 1 89  ? 40.645 14.336  32.391  1.00 46.79  ? 85  LYS A CA  1 
ATOM   366  C C   . LYS A 1 89  ? 40.774 15.556  31.507  1.00 48.57  ? 85  LYS A C   1 
ATOM   367  O O   . LYS A 1 89  ? 40.474 16.678  31.909  1.00 48.84  ? 85  LYS A O   1 
ATOM   368  C CB  . LYS A 1 89  ? 39.192 14.126  32.820  1.00 45.43  ? 85  LYS A CB  1 
ATOM   369  C CG  . LYS A 1 89  ? 38.209 14.058  31.656  1.00 45.85  ? 85  LYS A CG  1 
ATOM   370  C CD  . LYS A 1 89  ? 36.802 13.652  32.123  1.00 48.03  ? 85  LYS A CD  1 
ATOM   371  C CE  . LYS A 1 89  ? 35.785 13.715  30.975  1.00 47.38  ? 85  LYS A CE  1 
ATOM   372  N NZ  . LYS A 1 89  ? 34.472 13.103  31.357  1.00 49.30  ? 85  LYS A NZ  1 
ATOM   373  N N   . LYS A 1 90  ? 41.237 15.317  30.296  1.00 48.62  ? 86  LYS A N   1 
ATOM   374  C CA  . LYS A 1 90  ? 41.483 16.372  29.350  1.00 51.93  ? 86  LYS A CA  1 
ATOM   375  C C   . LYS A 1 90  ? 40.538 16.306  28.170  1.00 53.29  ? 86  LYS A C   1 
ATOM   376  O O   . LYS A 1 90  ? 40.445 15.277  27.499  1.00 53.31  ? 86  LYS A O   1 
ATOM   377  C CB  . LYS A 1 90  ? 42.933 16.242  28.889  1.00 51.67  ? 86  LYS A CB  1 
ATOM   378  C CG  . LYS A 1 90  ? 43.389 17.246  27.877  1.00 52.55  ? 86  LYS A CG  1 
ATOM   379  C CD  . LYS A 1 90  ? 44.883 17.050  27.673  1.00 54.47  ? 86  LYS A CD  1 
ATOM   380  C CE  . LYS A 1 90  ? 45.515 18.201  26.906  1.00 54.59  ? 86  LYS A CE  1 
ATOM   381  N NZ  . LYS A 1 90  ? 46.982 17.959  26.798  1.00 56.56  ? 86  LYS A NZ  1 
ATOM   382  N N   . VAL A 1 91  ? 39.835 17.401  27.924  1.00 55.62  ? 87  VAL A N   1 
ATOM   383  C CA  . VAL A 1 91  ? 38.903 17.481  26.811  1.00 59.13  ? 87  VAL A CA  1 
ATOM   384  C C   . VAL A 1 91  ? 39.074 18.805  26.079  1.00 61.58  ? 87  VAL A C   1 
ATOM   385  O O   . VAL A 1 91  ? 39.534 19.798  26.653  1.00 60.13  ? 87  VAL A O   1 
ATOM   386  C CB  . VAL A 1 91  ? 37.417 17.389  27.277  1.00 59.52  ? 87  VAL A CB  1 
ATOM   387  C CG1 . VAL A 1 91  ? 37.124 16.016  27.886  1.00 58.51  ? 87  VAL A CG1 1 
ATOM   388  C CG2 . VAL A 1 91  ? 37.124 18.506  28.282  1.00 59.25  ? 87  VAL A CG2 1 
ATOM   389  N N   . LEU A 1 92  ? 38.676 18.808  24.809  1.00 64.91  ? 88  LEU A N   1 
ATOM   390  C CA  . LEU A 1 92  ? 38.754 19.998  23.963  1.00 68.41  ? 88  LEU A CA  1 
ATOM   391  C C   . LEU A 1 92  ? 37.730 20.998  24.508  1.00 70.13  ? 88  LEU A C   1 
ATOM   392  O O   . LEU A 1 92  ? 36.615 20.607  24.857  1.00 69.88  ? 88  LEU A O   1 
ATOM   393  C CB  . LEU A 1 92  ? 38.394 19.617  22.526  1.00 69.03  ? 88  LEU A CB  1 
ATOM   394  C CG  . LEU A 1 92  ? 39.091 20.313  21.359  1.00 69.82  ? 88  LEU A CG  1 
ATOM   395  C CD1 . LEU A 1 92  ? 40.548 19.877  21.298  1.00 69.01  ? 88  LEU A CD1 1 
ATOM   396  C CD2 . LEU A 1 92  ? 38.376 19.945  20.061  1.00 69.94  ? 88  LEU A CD2 1 
ATOM   397  N N   . GLN A 1 93  ? 38.085 22.277  24.585  1.00 72.07  ? 89  GLN A N   1 
ATOM   398  C CA  . GLN A 1 93  ? 37.133 23.246  25.115  1.00 74.68  ? 89  GLN A CA  1 
ATOM   399  C C   . GLN A 1 93  ? 36.731 24.358  24.170  1.00 76.05  ? 89  GLN A C   1 
ATOM   400  O O   . GLN A 1 93  ? 37.513 25.269  23.892  1.00 76.60  ? 89  GLN A O   1 
ATOM   401  C CB  . GLN A 1 93  ? 37.651 23.859  26.421  1.00 75.46  ? 89  GLN A CB  1 
ATOM   402  C CG  . GLN A 1 93  ? 36.595 24.670  27.180  1.00 75.22  ? 89  GLN A CG  1 
ATOM   403  C CD  . GLN A 1 93  ? 35.176 24.136  26.977  1.00 75.54  ? 89  GLN A CD  1 
ATOM   404  O OE1 . GLN A 1 93  ? 34.941 22.920  26.968  1.00 75.18  ? 89  GLN A OE1 1 
ATOM   405  N NE2 . GLN A 1 93  ? 34.224 25.049  26.819  1.00 74.76  ? 89  GLN A NE2 1 
ATOM   406  N N   . ASP A 1 94  ? 35.486 24.281  23.706  1.00 77.67  ? 90  ASP A N   1 
ATOM   407  C CA  . ASP A 1 94  ? 34.956 25.280  22.796  1.00 80.01  ? 90  ASP A CA  1 
ATOM   408  C C   . ASP A 1 94  ? 34.836 26.629  23.473  1.00 81.67  ? 90  ASP A C   1 
ATOM   409  O O   . ASP A 1 94  ? 34.637 26.709  24.686  1.00 81.31  ? 90  ASP A O   1 
ATOM   410  N N   . LYS A 1 95  ? 34.958 27.700  22.699  1.00 83.16  ? 91  LYS A N   1 
ATOM   411  C CA  . LYS A 1 95  ? 34.857 29.025  23.285  1.00 84.66  ? 91  LYS A CA  1 
ATOM   412  C C   . LYS A 1 95  ? 33.435 29.556  23.223  1.00 84.37  ? 91  LYS A C   1 
ATOM   413  O O   . LYS A 1 95  ? 33.155 30.654  23.700  1.00 84.68  ? 91  LYS A O   1 
ATOM   414  C CB  . LYS A 1 95  ? 35.841 29.979  22.603  1.00 85.98  ? 91  LYS A CB  1 
ATOM   415  C CG  . LYS A 1 95  ? 37.290 29.535  22.792  1.00 88.20  ? 91  LYS A CG  1 
ATOM   416  C CD  . LYS A 1 95  ? 37.550 29.186  24.262  1.00 89.67  ? 91  LYS A CD  1 
ATOM   417  C CE  . LYS A 1 95  ? 38.890 28.487  24.478  1.00 90.22  ? 91  LYS A CE  1 
ATOM   418  N NZ  . LYS A 1 95  ? 39.059 28.077  25.910  1.00 90.36  ? 91  LYS A NZ  1 
ATOM   419  N N   . ARG A 1 96  ? 32.536 28.756  22.654  1.00 83.82  ? 92  ARG A N   1 
ATOM   420  C CA  . ARG A 1 96  ? 31.129 29.140  22.550  1.00 83.34  ? 92  ARG A CA  1 
ATOM   421  C C   . ARG A 1 96  ? 30.445 28.984  23.911  1.00 82.56  ? 92  ARG A C   1 
ATOM   422  O O   . ARG A 1 96  ? 29.670 29.851  24.327  1.00 82.86  ? 92  ARG A O   1 
ATOM   423  C CB  . ARG A 1 96  ? 30.412 28.279  21.490  1.00 82.95  ? 92  ARG A CB  1 
ATOM   424  N N   . PHE A 1 97  ? 30.738 27.883  24.603  1.00 81.24  ? 93  PHE A N   1 
ATOM   425  C CA  . PHE A 1 97  ? 30.143 27.619  25.914  1.00 79.82  ? 93  PHE A CA  1 
ATOM   426  C C   . PHE A 1 97  ? 31.193 27.278  26.976  1.00 76.99  ? 93  PHE A C   1 
ATOM   427  O O   . PHE A 1 97  ? 32.345 26.952  26.673  1.00 76.84  ? 93  PHE A O   1 
ATOM   428  C CB  . PHE A 1 97  ? 29.160 26.428  25.867  1.00 82.93  ? 93  PHE A CB  1 
ATOM   429  C CG  . PHE A 1 97  ? 28.211 26.433  24.692  1.00 86.36  ? 93  PHE A CG  1 
ATOM   430  C CD1 . PHE A 1 97  ? 28.570 25.828  23.482  1.00 87.42  ? 93  PHE A CD1 1 
ATOM   431  C CD2 . PHE A 1 97  ? 26.945 27.019  24.802  1.00 87.87  ? 93  PHE A CD2 1 
ATOM   432  C CE1 . PHE A 1 97  ? 27.680 25.804  22.397  1.00 88.62  ? 93  PHE A CE1 1 
ATOM   433  C CE2 . PHE A 1 97  ? 26.042 27.003  23.722  1.00 89.02  ? 93  PHE A CE2 1 
ATOM   434  C CZ  . PHE A 1 97  ? 26.412 26.393  22.517  1.00 89.18  ? 93  PHE A CZ  1 
ATOM   435  N N   . LYS A 1 98  ? 30.773 27.353  28.231  1.00 72.88  ? 94  LYS A N   1 
ATOM   436  C CA  . LYS A 1 98  ? 31.630 26.987  29.348  1.00 68.48  ? 94  LYS A CA  1 
ATOM   437  C C   . LYS A 1 98  ? 31.348 25.470  29.466  1.00 63.58  ? 94  LYS A C   1 
ATOM   438  O O   . LYS A 1 98  ? 30.229 25.024  29.191  1.00 61.31  ? 94  LYS A O   1 
ATOM   439  C CB  . LYS A 1 98  ? 31.179 27.748  30.600  1.00 70.04  ? 94  LYS A CB  1 
ATOM   440  C CG  . LYS A 1 98  ? 32.041 27.557  31.842  1.00 72.91  ? 94  LYS A CG  1 
ATOM   441  C CD  . LYS A 1 98  ? 33.364 28.322  31.826  1.00 73.68  ? 94  LYS A CD  1 
ATOM   442  C CE  . LYS A 1 98  ? 34.061 28.168  33.190  1.00 74.82  ? 94  LYS A CE  1 
ATOM   443  N NZ  . LYS A 1 98  ? 35.471 28.688  33.253  1.00 74.31  ? 94  LYS A NZ  1 
ATOM   444  N N   . ASN A 1 99  ? 32.353 24.681  29.836  1.00 58.53  ? 95  ASN A N   1 
ATOM   445  C CA  . ASN A 1 99  ? 32.183 23.223  29.945  1.00 54.46  ? 95  ASN A CA  1 
ATOM   446  C C   . ASN A 1 99  ? 31.125 22.778  30.987  1.00 51.93  ? 95  ASN A C   1 
ATOM   447  O O   . ASN A 1 99  ? 31.248 23.076  32.173  1.00 50.78  ? 95  ASN A O   1 
ATOM   448  C CB  . ASN A 1 99  ? 33.546 22.609  30.248  1.00 53.33  ? 95  ASN A CB  1 
ATOM   449  C CG  . ASN A 1 99  ? 33.519 21.101  30.264  1.00 52.51  ? 95  ASN A CG  1 
ATOM   450  O OD1 . ASN A 1 99  ? 33.086 20.482  31.239  1.00 49.80  ? 95  ASN A OD1 1 
ATOM   451  N ND2 . ASN A 1 99  ? 33.983 20.496  29.179  1.00 51.22  ? 95  ASN A ND2 1 
ATOM   452  N N   . ARG A 1 100 ? 30.090 22.064  30.547  1.00 49.69  ? 96  ARG A N   1 
ATOM   453  C CA  . ARG A 1 100 ? 29.029 21.625  31.464  1.00 48.78  ? 96  ARG A CA  1 
ATOM   454  C C   . ARG A 1 100 ? 29.481 20.660  32.569  1.00 45.88  ? 96  ARG A C   1 
ATOM   455  O O   . ARG A 1 100 ? 29.004 20.748  33.696  1.00 44.68  ? 96  ARG A O   1 
ATOM   456  C CB  . ARG A 1 100 ? 27.847 21.015  30.693  1.00 49.46  ? 96  ARG A CB  1 
ATOM   457  C CG  . ARG A 1 100 ? 26.660 20.648  31.592  1.00 53.82  ? 96  ARG A CG  1 
ATOM   458  C CD  . ARG A 1 100 ? 25.477 20.021  30.808  1.00 56.83  ? 96  ARG A CD  1 
ATOM   459  N NE  . ARG A 1 100 ? 24.643 21.033  30.149  1.00 60.16  ? 96  ARG A NE  1 
ATOM   460  C CZ  . ARG A 1 100 ? 23.852 20.813  29.095  1.00 61.13  ? 96  ARG A CZ  1 
ATOM   461  N NH1 . ARG A 1 100 ? 23.767 19.606  28.541  1.00 60.41  ? 96  ARG A NH1 1 
ATOM   462  N NH2 . ARG A 1 100 ? 23.136 21.818  28.591  1.00 62.06  ? 96  ARG A NH2 1 
ATOM   463  N N   . GLU A 1 101 ? 30.407 19.754  32.260  1.00 43.59  ? 97  GLU A N   1 
ATOM   464  C CA  . GLU A 1 101 ? 30.898 18.821  33.272  1.00 41.78  ? 97  GLU A CA  1 
ATOM   465  C C   . GLU A 1 101 ? 31.593 19.625  34.394  1.00 40.86  ? 97  GLU A C   1 
ATOM   466  O O   . GLU A 1 101 ? 31.397 19.358  35.582  1.00 38.71  ? 97  GLU A O   1 
ATOM   467  C CB  . GLU A 1 101 ? 31.884 17.801  32.646  1.00 40.60  ? 97  GLU A CB  1 
ATOM   468  C CG  . GLU A 1 101 ? 32.488 16.807  33.659  1.00 42.20  ? 97  GLU A CG  1 
ATOM   469  C CD  . GLU A 1 101 ? 33.322 15.668  33.013  1.00 45.51  ? 97  GLU A CD  1 
ATOM   470  O OE1 . GLU A 1 101 ? 33.753 15.811  31.848  1.00 46.43  ? 97  GLU A OE1 1 
ATOM   471  O OE2 . GLU A 1 101 ? 33.549 14.625  33.679  1.00 46.31  ? 97  GLU A OE2 1 
ATOM   472  N N   . LEU A 1 102 ? 32.396 20.612  33.995  1.00 40.65  ? 98  LEU A N   1 
ATOM   473  C CA  . LEU A 1 102 ? 33.124 21.459  34.934  1.00 41.42  ? 98  LEU A CA  1 
ATOM   474  C C   . LEU A 1 102 ? 32.189 22.202  35.865  1.00 41.97  ? 98  LEU A C   1 
ATOM   475  O O   . LEU A 1 102 ? 32.385 22.185  37.074  1.00 41.38  ? 98  LEU A O   1 
ATOM   476  C CB  . LEU A 1 102 ? 33.982 22.482  34.175  1.00 43.05  ? 98  LEU A CB  1 
ATOM   477  C CG  . LEU A 1 102 ? 34.698 23.529  35.033  1.00 41.56  ? 98  LEU A CG  1 
ATOM   478  C CD1 . LEU A 1 102 ? 35.599 22.852  36.055  1.00 41.54  ? 98  LEU A CD1 1 
ATOM   479  C CD2 . LEU A 1 102 ? 35.519 24.430  34.117  1.00 42.93  ? 98  LEU A CD2 1 
ATOM   480  N N   . GLN A 1 103 ? 31.172 22.856  35.305  1.00 42.32  ? 99  GLN A N   1 
ATOM   481  C CA  . GLN A 1 103 ? 30.246 23.613  36.136  1.00 44.86  ? 99  GLN A CA  1 
ATOM   482  C C   . GLN A 1 103 ? 29.540 22.688  37.131  1.00 44.87  ? 99  GLN A C   1 
ATOM   483  O O   . GLN A 1 103 ? 29.373 23.034  38.304  1.00 44.30  ? 99  GLN A O   1 
ATOM   484  C CB  . GLN A 1 103 ? 29.215 24.370  35.270  1.00 47.27  ? 99  GLN A CB  1 
ATOM   485  C CG  . GLN A 1 103 ? 29.825 25.341  34.221  1.00 53.27  ? 99  GLN A CG  1 
ATOM   486  C CD  . GLN A 1 103 ? 31.220 25.907  34.607  1.00 57.47  ? 99  GLN A CD  1 
ATOM   487  O OE1 . GLN A 1 103 ? 31.399 26.547  35.656  1.00 58.13  ? 99  GLN A OE1 1 
ATOM   488  N NE2 . GLN A 1 103 ? 32.211 25.657  33.745  1.00 60.18  ? 99  GLN A NE2 1 
ATOM   489  N N   . ILE A 1 104 ? 29.122 21.506  36.675  1.00 44.76  ? 100 ILE A N   1 
ATOM   490  C CA  . ILE A 1 104 ? 28.469 20.572  37.582  1.00 43.14  ? 100 ILE A CA  1 
ATOM   491  C C   . ILE A 1 104 ? 29.420 20.055  38.667  1.00 43.17  ? 100 ILE A C   1 
ATOM   492  O O   . ILE A 1 104 ? 29.060 19.985  39.840  1.00 44.69  ? 100 ILE A O   1 
ATOM   493  C CB  . ILE A 1 104 ? 27.893 19.382  36.821  1.00 44.38  ? 100 ILE A CB  1 
ATOM   494  C CG1 . ILE A 1 104 ? 26.590 19.822  36.138  1.00 43.70  ? 100 ILE A CG1 1 
ATOM   495  C CG2 . ILE A 1 104 ? 27.721 18.168  37.786  1.00 41.70  ? 100 ILE A CG2 1 
ATOM   496  C CD1 . ILE A 1 104 ? 26.072 18.849  35.100  1.00 45.82  ? 100 ILE A CD1 1 
ATOM   497  N N   . MET A 1 105 ? 30.641 19.716  38.299  1.00 41.56  ? 101 MET A N   1 
ATOM   498  C CA  . MET A 1 105 ? 31.553 19.202  39.303  1.00 44.86  ? 101 MET A CA  1 
ATOM   499  C C   . MET A 1 105 ? 32.096 20.208  40.327  1.00 46.70  ? 101 MET A C   1 
ATOM   500  O O   . MET A 1 105 ? 32.575 19.818  41.398  1.00 44.60  ? 101 MET A O   1 
ATOM   501  C CB  . MET A 1 105 ? 32.688 18.471  38.612  1.00 46.58  ? 101 MET A CB  1 
ATOM   502  C CG  . MET A 1 105 ? 32.146 17.202  37.938  1.00 49.77  ? 101 MET A CG  1 
ATOM   503  S SD  . MET A 1 105 ? 33.407 16.014  37.840  1.00 55.65  ? 101 MET A SD  1 
ATOM   504  C CE  . MET A 1 105 ? 33.575 15.515  39.581  1.00 52.00  ? 101 MET A CE  1 
ATOM   505  N N   . ARG A 1 106 ? 32.022 21.497  40.008  1.00 47.68  ? 102 ARG A N   1 
ATOM   506  C CA  . ARG A 1 106 ? 32.494 22.506  40.946  1.00 49.96  ? 102 ARG A CA  1 
ATOM   507  C C   . ARG A 1 106 ? 31.535 22.571  42.121  1.00 49.62  ? 102 ARG A C   1 
ATOM   508  O O   . ARG A 1 106 ? 31.940 22.903  43.221  1.00 50.68  ? 102 ARG A O   1 
ATOM   509  C CB  . ARG A 1 106 ? 32.602 23.873  40.263  1.00 51.43  ? 102 ARG A CB  1 
ATOM   510  C CG  . ARG A 1 106 ? 33.637 23.861  39.179  1.00 55.15  ? 102 ARG A CG  1 
ATOM   511  C CD  . ARG A 1 106 ? 33.882 25.227  38.649  1.00 57.94  ? 102 ARG A CD  1 
ATOM   512  N NE  . ARG A 1 106 ? 34.529 26.057  39.654  1.00 60.62  ? 102 ARG A NE  1 
ATOM   513  C CZ  . ARG A 1 106 ? 34.825 27.334  39.463  1.00 61.34  ? 102 ARG A CZ  1 
ATOM   514  N NH1 . ARG A 1 106 ? 34.524 27.913  38.302  1.00 61.19  ? 102 ARG A NH1 1 
ATOM   515  N NH2 . ARG A 1 106 ? 35.418 28.022  40.429  1.00 62.06  ? 102 ARG A NH2 1 
ATOM   516  N N   . LYS A 1 107 ? 30.271 22.226  41.903  1.00 49.61  ? 103 LYS A N   1 
ATOM   517  C CA  . LYS A 1 107 ? 29.326 22.262  43.009  1.00 50.45  ? 103 LYS A CA  1 
ATOM   518  C C   . LYS A 1 107 ? 29.114 20.933  43.749  1.00 48.21  ? 103 LYS A C   1 
ATOM   519  O O   . LYS A 1 107 ? 28.321 20.875  44.678  1.00 48.95  ? 103 LYS A O   1 
ATOM   520  C CB  . LYS A 1 107 ? 27.970 22.810  42.542  1.00 53.18  ? 103 LYS A CB  1 
ATOM   521  C CG  . LYS A 1 107 ? 27.411 22.184  41.288  1.00 58.22  ? 103 LYS A CG  1 
ATOM   522  C CD  . LYS A 1 107 ? 26.000 22.706  40.989  1.00 61.10  ? 103 LYS A CD  1 
ATOM   523  C CE  . LYS A 1 107 ? 24.993 22.264  42.065  1.00 63.80  ? 103 LYS A CE  1 
ATOM   524  N NZ  . LYS A 1 107 ? 23.556 22.626  41.732  1.00 65.29  ? 103 LYS A NZ  1 
ATOM   525  N N   . LEU A 1 108 ? 29.822 19.874  43.370  1.00 46.47  ? 104 LEU A N   1 
ATOM   526  C CA  . LEU A 1 108 ? 29.628 18.581  44.047  1.00 44.46  ? 104 LEU A CA  1 
ATOM   527  C C   . LEU A 1 108 ? 30.682 18.303  45.104  1.00 43.28  ? 104 LEU A C   1 
ATOM   528  O O   . LEU A 1 108 ? 31.862 18.552  44.891  1.00 42.63  ? 104 LEU A O   1 
ATOM   529  C CB  . LEU A 1 108 ? 29.622 17.424  43.030  1.00 43.04  ? 104 LEU A CB  1 
ATOM   530  C CG  . LEU A 1 108 ? 28.630 17.486  41.859  1.00 42.34  ? 104 LEU A CG  1 
ATOM   531  C CD1 . LEU A 1 108 ? 28.749 16.211  41.038  1.00 42.17  ? 104 LEU A CD1 1 
ATOM   532  C CD2 . LEU A 1 108 ? 27.211 17.680  42.362  1.00 41.49  ? 104 LEU A CD2 1 
ATOM   533  N N   . ASP A 1 109 ? 30.246 17.778  46.243  1.00 43.90  ? 105 ASP A N   1 
ATOM   534  C CA  . ASP A 1 109 ? 31.148 17.434  47.339  1.00 45.20  ? 105 ASP A CA  1 
ATOM   535  C C   . ASP A 1 109 ? 30.513 16.217  48.044  1.00 44.15  ? 105 ASP A C   1 
ATOM   536  O O   . ASP A 1 109 ? 29.544 16.362  48.776  1.00 43.87  ? 105 ASP A O   1 
ATOM   537  C CB  . ASP A 1 109 ? 31.261 18.618  48.317  1.00 48.55  ? 105 ASP A CB  1 
ATOM   538  C CG  . ASP A 1 109 ? 32.181 18.325  49.501  1.00 52.83  ? 105 ASP A CG  1 
ATOM   539  O OD1 . ASP A 1 109 ? 32.040 19.010  50.542  1.00 54.93  ? 105 ASP A OD1 1 
ATOM   540  O OD2 . ASP A 1 109 ? 33.048 17.420  49.397  1.00 54.41  ? 105 ASP A OD2 1 
ATOM   541  N N   . HIS A 1 110 ? 31.051 15.020  47.823  1.00 42.70  ? 106 HIS A N   1 
ATOM   542  C CA  . HIS A 1 110 ? 30.469 13.810  48.424  1.00 39.99  ? 106 HIS A CA  1 
ATOM   543  C C   . HIS A 1 110 ? 31.499 12.690  48.406  1.00 38.07  ? 106 HIS A C   1 
ATOM   544  O O   . HIS A 1 110 ? 32.251 12.546  47.441  1.00 37.75  ? 106 HIS A O   1 
ATOM   545  C CB  . HIS A 1 110 ? 29.226 13.385  47.629  1.00 38.66  ? 106 HIS A CB  1 
ATOM   546  C CG  . HIS A 1 110 ? 28.479 12.231  48.227  1.00 38.11  ? 106 HIS A CG  1 
ATOM   547  N ND1 . HIS A 1 110 ? 27.328 12.395  48.973  1.00 38.44  ? 106 HIS A ND1 1 
ATOM   548  C CD2 . HIS A 1 110 ? 28.687 10.896  48.146  1.00 34.74  ? 106 HIS A CD2 1 
ATOM   549  C CE1 . HIS A 1 110 ? 26.853 11.213  49.322  1.00 38.08  ? 106 HIS A CE1 1 
ATOM   550  N NE2 . HIS A 1 110 ? 27.661 10.285  48.832  1.00 41.04  ? 106 HIS A NE2 1 
ATOM   551  N N   . CYS A 1 111 ? 31.509 11.886  49.464  1.00 38.07  ? 107 CYS A N   1 
ATOM   552  C CA  . CYS A 1 111 ? 32.466 10.782  49.608  1.00 39.62  ? 107 CYS A CA  1 
ATOM   553  C C   . CYS A 1 111 ? 32.356 9.721   48.485  1.00 38.05  ? 107 CYS A C   1 
ATOM   554  O O   . CYS A 1 111 ? 33.333 9.034   48.191  1.00 38.16  ? 107 CYS A O   1 
ATOM   555  C CB  . CYS A 1 111 ? 32.285 10.124  50.994  1.00 41.62  ? 107 CYS A CB  1 
ATOM   556  S SG  . CYS A 1 111 ? 30.588 9.363   51.338  1.00 51.60  ? 107 CYS A SG  1 
ATOM   557  N N   . ASN A 1 112 ? 31.183 9.584   47.865  1.00 35.55  ? 108 ASN A N   1 
ATOM   558  C CA  . ASN A 1 112 ? 31.017 8.597   46.778  1.00 35.21  ? 108 ASN A CA  1 
ATOM   559  C C   . ASN A 1 112 ? 30.997 9.202   45.366  1.00 35.81  ? 108 ASN A C   1 
ATOM   560  O O   . ASN A 1 112 ? 30.393 8.649   44.453  1.00 35.43  ? 108 ASN A O   1 
ATOM   561  C CB  . ASN A 1 112 ? 29.766 7.731   47.021  1.00 33.11  ? 108 ASN A CB  1 
ATOM   562  C CG  . ASN A 1 112 ? 29.894 6.873   48.279  1.00 33.96  ? 108 ASN A CG  1 
ATOM   563  O OD1 . ASN A 1 112 ? 30.799 6.044   48.395  1.00 34.37  ? 108 ASN A OD1 1 
ATOM   564  N ND2 . ASN A 1 112 ? 29.014 7.085   49.227  1.00 34.51  ? 108 ASN A ND2 1 
ATOM   565  N N   . ILE A 1 113 ? 31.667 10.342  45.195  1.00 35.95  ? 109 ILE A N   1 
ATOM   566  C CA  . ILE A 1 113 ? 31.764 10.992  43.898  1.00 35.94  ? 109 ILE A CA  1 
ATOM   567  C C   . ILE A 1 113 ? 33.204 11.477  43.823  1.00 38.50  ? 109 ILE A C   1 
ATOM   568  O O   . ILE A 1 113 ? 33.723 12.065  44.774  1.00 38.23  ? 109 ILE A O   1 
ATOM   569  C CB  . ILE A 1 113 ? 30.793 12.200  43.768  1.00 36.67  ? 109 ILE A CB  1 
ATOM   570  C CG1 . ILE A 1 113 ? 29.333 11.710  43.846  1.00 35.50  ? 109 ILE A CG1 1 
ATOM   571  C CG2 . ILE A 1 113 ? 31.051 12.939  42.441  1.00 35.73  ? 109 ILE A CG2 1 
ATOM   572  C CD1 . ILE A 1 113 ? 28.300 12.812  43.608  1.00 38.32  ? 109 ILE A CD1 1 
ATOM   573  N N   . VAL A 1 114 ? 33.853 11.244  42.695  1.00 37.49  ? 110 VAL A N   1 
ATOM   574  C CA  . VAL A 1 114 ? 35.236 11.629  42.578  1.00 40.11  ? 110 VAL A CA  1 
ATOM   575  C C   . VAL A 1 114 ? 35.347 13.166  42.679  1.00 40.40  ? 110 VAL A C   1 
ATOM   576  O O   . VAL A 1 114 ? 34.560 13.914  42.100  1.00 37.62  ? 110 VAL A O   1 
ATOM   577  C CB  . VAL A 1 114 ? 35.823 11.022  41.274  1.00 40.90  ? 110 VAL A CB  1 
ATOM   578  C CG1 . VAL A 1 114 ? 35.332 11.789  40.042  1.00 41.15  ? 110 VAL A CG1 1 
ATOM   579  C CG2 . VAL A 1 114 ? 37.297 10.956  41.378  1.00 43.52  ? 110 VAL A CG2 1 
ATOM   580  N N   . ARG A 1 115 ? 36.318 13.626  43.454  1.00 41.31  ? 111 ARG A N   1 
ATOM   581  C CA  . ARG A 1 115 ? 36.466 15.057  43.679  1.00 44.00  ? 111 ARG A CA  1 
ATOM   582  C C   . ARG A 1 115 ? 37.278 15.827  42.647  1.00 41.53  ? 111 ARG A C   1 
ATOM   583  O O   . ARG A 1 115 ? 38.342 15.383  42.200  1.00 41.47  ? 111 ARG A O   1 
ATOM   584  C CB  . ARG A 1 115 ? 37.061 15.310  45.082  1.00 46.70  ? 111 ARG A CB  1 
ATOM   585  C CG  . ARG A 1 115 ? 37.112 16.801  45.478  1.00 53.41  ? 111 ARG A CG  1 
ATOM   586  C CD  . ARG A 1 115 ? 37.764 17.019  46.849  1.00 57.03  ? 111 ARG A CD  1 
ATOM   587  N NE  . ARG A 1 115 ? 39.094 16.412  46.898  1.00 63.00  ? 111 ARG A NE  1 
ATOM   588  C CZ  . ARG A 1 115 ? 40.115 16.903  47.599  1.00 66.49  ? 111 ARG A CZ  1 
ATOM   589  N NH1 . ARG A 1 115 ? 39.953 18.013  48.312  1.00 68.56  ? 111 ARG A NH1 1 
ATOM   590  N NH2 . ARG A 1 115 ? 41.298 16.291  47.587  1.00 66.13  ? 111 ARG A NH2 1 
ATOM   591  N N   . LEU A 1 116 ? 36.752 16.977  42.251  1.00 40.72  ? 112 LEU A N   1 
ATOM   592  C CA  . LEU A 1 116 ? 37.494 17.841  41.341  1.00 42.03  ? 112 LEU A CA  1 
ATOM   593  C C   . LEU A 1 116 ? 38.432 18.673  42.242  1.00 43.19  ? 112 LEU A C   1 
ATOM   594  O O   . LEU A 1 116 ? 37.971 19.502  43.033  1.00 43.52  ? 112 LEU A O   1 
ATOM   595  C CB  . LEU A 1 116 ? 36.553 18.774  40.581  1.00 41.07  ? 112 LEU A CB  1 
ATOM   596  C CG  . LEU A 1 116 ? 37.251 19.834  39.717  1.00 41.23  ? 112 LEU A CG  1 
ATOM   597  C CD1 . LEU A 1 116 ? 37.855 19.165  38.495  1.00 39.46  ? 112 LEU A CD1 1 
ATOM   598  C CD2 . LEU A 1 116 ? 36.245 20.900  39.300  1.00 38.62  ? 112 LEU A CD2 1 
ATOM   599  N N   . ARG A 1 117 ? 39.733 18.428  42.152  1.00 44.03  ? 113 ARG A N   1 
ATOM   600  C CA  . ARG A 1 117 ? 40.691 19.179  42.955  1.00 47.23  ? 113 ARG A CA  1 
ATOM   601  C C   . ARG A 1 117 ? 41.017 20.536  42.315  1.00 47.55  ? 113 ARG A C   1 
ATOM   602  O O   . ARG A 1 117 ? 40.915 21.573  42.969  1.00 47.38  ? 113 ARG A O   1 
ATOM   603  C CB  . ARG A 1 117 ? 41.967 18.374  43.126  1.00 47.91  ? 113 ARG A CB  1 
ATOM   604  C CG  . ARG A 1 117 ? 41.712 17.003  43.684  1.00 51.29  ? 113 ARG A CG  1 
ATOM   605  C CD  . ARG A 1 117 ? 43.018 16.306  43.958  1.00 54.30  ? 113 ARG A CD  1 
ATOM   606  N NE  . ARG A 1 117 ? 42.812 15.014  44.599  1.00 57.68  ? 113 ARG A NE  1 
ATOM   607  C CZ  . ARG A 1 117 ? 43.733 14.414  45.351  1.00 59.17  ? 113 ARG A CZ  1 
ATOM   608  N NH1 . ARG A 1 117 ? 44.913 14.998  45.551  1.00 57.19  ? 113 ARG A NH1 1 
ATOM   609  N NH2 . ARG A 1 117 ? 43.474 13.233  45.901  1.00 58.49  ? 113 ARG A NH2 1 
ATOM   610  N N   . TYR A 1 118 ? 41.379 20.520  41.035  1.00 47.06  ? 114 TYR A N   1 
ATOM   611  C CA  . TYR A 1 118 ? 41.711 21.749  40.297  1.00 47.98  ? 114 TYR A CA  1 
ATOM   612  C C   . TYR A 1 118 ? 41.323 21.594  38.849  1.00 47.50  ? 114 TYR A C   1 
ATOM   613  O O   . TYR A 1 118 ? 40.994 20.494  38.403  1.00 47.65  ? 114 TYR A O   1 
ATOM   614  C CB  . TYR A 1 118 ? 43.219 22.008  40.247  1.00 47.52  ? 114 TYR A CB  1 
ATOM   615  C CG  . TYR A 1 118 ? 43.967 21.756  41.498  1.00 49.09  ? 114 TYR A CG  1 
ATOM   616  C CD1 . TYR A 1 118 ? 44.673 20.562  41.691  1.00 50.08  ? 114 TYR A CD1 1 
ATOM   617  C CD2 . TYR A 1 118 ? 44.000 22.715  42.490  1.00 50.76  ? 114 TYR A CD2 1 
ATOM   618  C CE1 . TYR A 1 118 ? 45.398 20.341  42.859  1.00 51.25  ? 114 TYR A CE1 1 
ATOM   619  C CE2 . TYR A 1 118 ? 44.712 22.518  43.648  1.00 53.12  ? 114 TYR A CE2 1 
ATOM   620  C CZ  . TYR A 1 118 ? 45.410 21.339  43.834  1.00 53.99  ? 114 TYR A CZ  1 
ATOM   621  O OH  . TYR A 1 118 ? 46.133 21.209  44.997  1.00 57.49  ? 114 TYR A OH  1 
ATOM   622  N N   . PHE A 1 119 ? 41.392 22.707  38.127  1.00 46.36  ? 115 PHE A N   1 
ATOM   623  C CA  . PHE A 1 119 ? 41.165 22.739  36.693  1.00 47.79  ? 115 PHE A CA  1 
ATOM   624  C C   . PHE A 1 119 ? 41.994 23.884  36.115  1.00 50.09  ? 115 PHE A C   1 
ATOM   625  O O   . PHE A 1 119 ? 42.197 24.923  36.767  1.00 50.26  ? 115 PHE A O   1 
ATOM   626  C CB  . PHE A 1 119 ? 39.682 22.878  36.339  1.00 47.78  ? 115 PHE A CB  1 
ATOM   627  C CG  . PHE A 1 119 ? 39.089 24.226  36.622  1.00 48.71  ? 115 PHE A CG  1 
ATOM   628  C CD1 . PHE A 1 119 ? 39.043 25.201  35.627  1.00 49.32  ? 115 PHE A CD1 1 
ATOM   629  C CD2 . PHE A 1 119 ? 38.505 24.498  37.861  1.00 48.49  ? 115 PHE A CD2 1 
ATOM   630  C CE1 . PHE A 1 119 ? 38.412 26.433  35.861  1.00 50.49  ? 115 PHE A CE1 1 
ATOM   631  C CE2 . PHE A 1 119 ? 37.872 25.719  38.112  1.00 48.59  ? 115 PHE A CE2 1 
ATOM   632  C CZ  . PHE A 1 119 ? 37.821 26.691  37.113  1.00 49.18  ? 115 PHE A CZ  1 
ATOM   633  N N   . PHE A 1 120 ? 42.523 23.665  34.916  1.00 50.98  ? 116 PHE A N   1 
ATOM   634  C CA  . PHE A 1 120 ? 43.336 24.659  34.233  1.00 51.56  ? 116 PHE A CA  1 
ATOM   635  C C   . PHE A 1 120 ? 43.244 24.424  32.738  1.00 53.83  ? 116 PHE A C   1 
ATOM   636  O O   . PHE A 1 120 ? 42.893 23.319  32.290  1.00 54.11  ? 116 PHE A O   1 
ATOM   637  C CB  . PHE A 1 120 ? 44.794 24.562  34.693  1.00 49.59  ? 116 PHE A CB  1 
ATOM   638  C CG  . PHE A 1 120 ? 45.463 23.259  34.356  1.00 48.27  ? 116 PHE A CG  1 
ATOM   639  C CD1 . PHE A 1 120 ? 46.145 23.102  33.154  1.00 49.30  ? 116 PHE A CD1 1 
ATOM   640  C CD2 . PHE A 1 120 ? 45.423 22.195  35.244  1.00 47.12  ? 116 PHE A CD2 1 
ATOM   641  C CE1 . PHE A 1 120 ? 46.781 21.899  32.847  1.00 49.51  ? 116 PHE A CE1 1 
ATOM   642  C CE2 . PHE A 1 120 ? 46.051 20.989  34.950  1.00 48.21  ? 116 PHE A CE2 1 
ATOM   643  C CZ  . PHE A 1 120 ? 46.732 20.838  33.752  1.00 49.22  ? 116 PHE A CZ  1 
ATOM   644  N N   . TYR A 1 121 ? 43.548 25.457  31.967  1.00 54.66  ? 117 TYR A N   1 
ATOM   645  C CA  . TYR A 1 121 ? 43.506 25.333  30.523  1.00 56.72  ? 117 TYR A CA  1 
ATOM   646  C C   . TYR A 1 121 ? 44.913 25.226  29.944  1.00 58.98  ? 117 TYR A C   1 
ATOM   647  O O   . TYR A 1 121 ? 45.885 25.663  30.564  1.00 58.40  ? 117 TYR A O   1 
ATOM   648  C CB  . TYR A 1 121 ? 42.767 26.516  29.914  1.00 55.33  ? 117 TYR A CB  1 
ATOM   649  C CG  . TYR A 1 121 ? 41.321 26.622  30.347  1.00 54.79  ? 117 TYR A CG  1 
ATOM   650  C CD1 . TYR A 1 121 ? 40.964 27.331  31.494  1.00 53.93  ? 117 TYR A CD1 1 
ATOM   651  C CD2 . TYR A 1 121 ? 40.307 26.018  29.603  1.00 54.19  ? 117 TYR A CD2 1 
ATOM   652  C CE1 . TYR A 1 121 ? 39.629 27.438  31.886  1.00 52.60  ? 117 TYR A CE1 1 
ATOM   653  C CE2 . TYR A 1 121 ? 38.979 26.121  29.983  1.00 53.34  ? 117 TYR A CE2 1 
ATOM   654  C CZ  . TYR A 1 121 ? 38.648 26.831  31.124  1.00 52.98  ? 117 TYR A CZ  1 
ATOM   655  O OH  . TYR A 1 121 ? 37.327 26.929  31.500  1.00 53.16  ? 117 TYR A OH  1 
ATOM   656  N N   . SER A 1 122 ? 45.016 24.621  28.764  1.00 61.04  ? 118 SER A N   1 
ATOM   657  C CA  . SER A 1 122 ? 46.300 24.442  28.101  1.00 63.67  ? 118 SER A CA  1 
ATOM   658  C C   . SER A 1 122 ? 46.108 24.173  26.607  1.00 65.83  ? 118 SER A C   1 
ATOM   659  O O   . SER A 1 122 ? 44.981 24.177  26.099  1.00 65.31  ? 118 SER A O   1 
ATOM   660  C CB  . SER A 1 122 ? 47.061 23.269  28.723  1.00 63.41  ? 118 SER A CB  1 
ATOM   661  O OG  . SER A 1 122 ? 46.450 22.030  28.386  1.00 63.99  ? 118 SER A OG  1 
ATOM   662  N N   . SER A 1 123 ? 47.223 23.930  25.918  1.00 68.50  ? 119 SER A N   1 
ATOM   663  C CA  . SER A 1 123 ? 47.226 23.645  24.481  1.00 70.98  ? 119 SER A CA  1 
ATOM   664  C C   . SER A 1 123 ? 48.657 23.538  23.974  1.00 71.84  ? 119 SER A C   1 
ATOM   665  O O   . SER A 1 123 ? 49.343 22.550  24.243  1.00 73.69  ? 119 SER A O   1 
ATOM   666  C CB  . SER A 1 123 ? 46.486 24.742  23.701  1.00 71.73  ? 119 SER A CB  1 
ATOM   667  O OG  . SER A 1 123 ? 46.945 26.036  24.066  1.00 73.44  ? 119 SER A OG  1 
ATOM   668  N N   . VAL A 1 130 ? 42.726 24.715  22.385  1.00 60.09  ? 126 VAL A N   1 
ATOM   669  C CA  . VAL A 1 130 ? 42.652 24.865  23.845  1.00 60.80  ? 126 VAL A CA  1 
ATOM   670  C C   . VAL A 1 130 ? 41.998 23.685  24.574  1.00 59.87  ? 126 VAL A C   1 
ATOM   671  O O   . VAL A 1 130 ? 40.901 23.245  24.224  1.00 59.92  ? 126 VAL A O   1 
ATOM   672  C CB  . VAL A 1 130 ? 41.880 26.132  24.236  1.00 61.08  ? 126 VAL A CB  1 
ATOM   673  C CG1 . VAL A 1 130 ? 41.818 26.254  25.749  1.00 60.55  ? 126 VAL A CG1 1 
ATOM   674  C CG2 . VAL A 1 130 ? 42.558 27.355  23.626  1.00 62.17  ? 126 VAL A CG2 1 
ATOM   675  N N   . TYR A 1 131 ? 42.667 23.188  25.605  1.00 59.18  ? 127 TYR A N   1 
ATOM   676  C CA  . TYR A 1 131 ? 42.129 22.063  26.356  1.00 58.94  ? 127 TYR A CA  1 
ATOM   677  C C   . TYR A 1 131 ? 41.814 22.388  27.804  1.00 57.63  ? 127 TYR A C   1 
ATOM   678  O O   . TYR A 1 131 ? 42.563 23.105  28.470  1.00 57.70  ? 127 TYR A O   1 
ATOM   679  C CB  . TYR A 1 131 ? 43.098 20.887  26.347  1.00 60.63  ? 127 TYR A CB  1 
ATOM   680  C CG  . TYR A 1 131 ? 43.294 20.222  25.003  1.00 64.00  ? 127 TYR A CG  1 
ATOM   681  C CD1 . TYR A 1 131 ? 44.286 20.655  24.115  1.00 65.18  ? 127 TYR A CD1 1 
ATOM   682  C CD2 . TYR A 1 131 ? 42.512 19.128  24.634  1.00 64.76  ? 127 TYR A CD2 1 
ATOM   683  C CE1 . TYR A 1 131 ? 44.496 19.999  22.887  1.00 66.35  ? 127 TYR A CE1 1 
ATOM   684  C CE2 . TYR A 1 131 ? 42.707 18.471  23.419  1.00 66.15  ? 127 TYR A CE2 1 
ATOM   685  C CZ  . TYR A 1 131 ? 43.697 18.906  22.549  1.00 66.68  ? 127 TYR A CZ  1 
ATOM   686  O OH  . TYR A 1 131 ? 43.863 18.246  21.345  1.00 66.88  ? 127 TYR A OH  1 
ATOM   687  N N   . LEU A 1 132 ? 40.688 21.859  28.277  1.00 55.06  ? 128 LEU A N   1 
ATOM   688  C CA  . LEU A 1 132 ? 40.288 22.016  29.662  1.00 51.52  ? 128 LEU A CA  1 
ATOM   689  C C   . LEU A 1 132 ? 40.829 20.755  30.348  1.00 51.32  ? 128 LEU A C   1 
ATOM   690  O O   . LEU A 1 132 ? 40.631 19.627  29.863  1.00 50.32  ? 128 LEU A O   1 
ATOM   691  C CB  . LEU A 1 132 ? 38.761 22.090  29.780  1.00 50.43  ? 128 LEU A CB  1 
ATOM   692  C CG  . LEU A 1 132 ? 38.159 21.825  31.168  1.00 50.10  ? 128 LEU A CG  1 
ATOM   693  C CD1 . LEU A 1 132 ? 38.772 22.758  32.214  1.00 49.45  ? 128 LEU A CD1 1 
ATOM   694  C CD2 . LEU A 1 132 ? 36.665 22.033  31.106  1.00 48.90  ? 128 LEU A CD2 1 
ATOM   695  N N   . ASN A 1 133 ? 41.544 20.944  31.451  1.00 48.26  ? 129 ASN A N   1 
ATOM   696  C CA  . ASN A 1 133 ? 42.103 19.829  32.194  1.00 46.90  ? 129 ASN A CA  1 
ATOM   697  C C   . ASN A 1 133 ? 41.475 19.796  33.572  1.00 46.46  ? 129 ASN A C   1 
ATOM   698  O O   . ASN A 1 133 ? 41.545 20.786  34.308  1.00 45.02  ? 129 ASN A O   1 
ATOM   699  C CB  . ASN A 1 133 ? 43.614 19.978  32.350  1.00 46.65  ? 129 ASN A CB  1 
ATOM   700  C CG  . ASN A 1 133 ? 44.321 20.110  31.029  1.00 49.06  ? 129 ASN A CG  1 
ATOM   701  O OD1 . ASN A 1 133 ? 44.199 21.127  30.334  1.00 49.90  ? 129 ASN A OD1 1 
ATOM   702  N ND2 . ASN A 1 133 ? 45.068 19.075  30.660  1.00 49.09  ? 129 ASN A ND2 1 
ATOM   703  N N   . LEU A 1 134 ? 40.858 18.672  33.920  1.00 44.37  ? 130 LEU A N   1 
ATOM   704  C CA  . LEU A 1 134 ? 40.243 18.525  35.226  1.00 43.32  ? 130 LEU A CA  1 
ATOM   705  C C   . LEU A 1 134 ? 41.120 17.594  36.047  1.00 43.55  ? 130 LEU A C   1 
ATOM   706  O O   . LEU A 1 134 ? 41.383 16.472  35.630  1.00 43.74  ? 130 LEU A O   1 
ATOM   707  C CB  . LEU A 1 134 ? 38.855 17.929  35.087  1.00 43.90  ? 130 LEU A CB  1 
ATOM   708  C CG  . LEU A 1 134 ? 37.882 18.647  34.159  1.00 44.40  ? 130 LEU A CG  1 
ATOM   709  C CD1 . LEU A 1 134 ? 36.634 17.800  34.050  1.00 45.83  ? 130 LEU A CD1 1 
ATOM   710  C CD2 . LEU A 1 134 ? 37.527 20.014  34.690  1.00 44.79  ? 130 LEU A CD2 1 
ATOM   711  N N   . VAL A 1 135 ? 41.587 18.063  37.204  1.00 43.00  ? 131 VAL A N   1 
ATOM   712  C CA  . VAL A 1 135 ? 42.433 17.250  38.074  1.00 42.48  ? 131 VAL A CA  1 
ATOM   713  C C   . VAL A 1 135 ? 41.500 16.660  39.129  1.00 43.24  ? 131 VAL A C   1 
ATOM   714  O O   . VAL A 1 135 ? 40.829 17.386  39.884  1.00 42.26  ? 131 VAL A O   1 
ATOM   715  C CB  . VAL A 1 135 ? 43.567 18.091  38.740  1.00 42.65  ? 131 VAL A CB  1 
ATOM   716  C CG1 . VAL A 1 135 ? 44.573 17.168  39.423  1.00 41.03  ? 131 VAL A CG1 1 
ATOM   717  C CG2 . VAL A 1 135 ? 44.279 18.929  37.691  1.00 42.27  ? 131 VAL A CG2 1 
ATOM   718  N N   . LEU A 1 136 ? 41.463 15.333  39.164  1.00 43.02  ? 132 LEU A N   1 
ATOM   719  C CA  . LEU A 1 136 ? 40.558 14.603  40.043  1.00 43.21  ? 132 LEU A CA  1 
ATOM   720  C C   . LEU A 1 136 ? 41.234 13.526  40.867  1.00 43.99  ? 132 LEU A C   1 
ATOM   721  O O   . LEU A 1 136 ? 42.385 13.153  40.596  1.00 44.18  ? 132 LEU A O   1 
ATOM   722  C CB  . LEU A 1 136 ? 39.482 13.952  39.186  1.00 42.06  ? 132 LEU A CB  1 
ATOM   723  C CG  . LEU A 1 136 ? 38.694 14.883  38.274  1.00 42.87  ? 132 LEU A CG  1 
ATOM   724  C CD1 . LEU A 1 136 ? 38.745 14.341  36.852  1.00 44.12  ? 132 LEU A CD1 1 
ATOM   725  C CD2 . LEU A 1 136 ? 37.246 14.993  38.755  1.00 41.39  ? 132 LEU A CD2 1 
ATOM   726  N N   . ASP A 1 137 ? 40.515 13.014  41.867  1.00 45.41  ? 133 ASP A N   1 
ATOM   727  C CA  . ASP A 1 137 ? 41.069 11.937  42.682  1.00 46.96  ? 133 ASP A CA  1 
ATOM   728  C C   . ASP A 1 137 ? 41.302 10.761  41.744  1.00 46.06  ? 133 ASP A C   1 
ATOM   729  O O   . ASP A 1 137 ? 40.608 10.599  40.733  1.00 45.72  ? 133 ASP A O   1 
ATOM   730  C CB  . ASP A 1 137 ? 40.096 11.411  43.749  1.00 48.56  ? 133 ASP A CB  1 
ATOM   731  C CG  . ASP A 1 137 ? 39.681 12.444  44.773  1.00 52.70  ? 133 ASP A CG  1 
ATOM   732  O OD1 . ASP A 1 137 ? 40.543 13.215  45.264  1.00 52.44  ? 133 ASP A OD1 1 
ATOM   733  O OD2 . ASP A 1 137 ? 38.459 12.440  45.100  1.00 55.40  ? 133 ASP A OD2 1 
ATOM   734  N N   . TYR A 1 138 ? 42.261 9.926   42.105  1.00 46.92  ? 134 TYR A N   1 
ATOM   735  C CA  . TYR A 1 138 ? 42.553 8.723   41.343  1.00 48.22  ? 134 TYR A CA  1 
ATOM   736  C C   . TYR A 1 138 ? 42.080 7.529   42.182  1.00 46.34  ? 134 TYR A C   1 
ATOM   737  O O   . TYR A 1 138 ? 42.226 7.537   43.397  1.00 46.05  ? 134 TYR A O   1 
ATOM   738  C CB  . TYR A 1 138 ? 44.048 8.586   41.101  1.00 48.94  ? 134 TYR A CB  1 
ATOM   739  C CG  . TYR A 1 138 ? 44.420 7.236   40.539  1.00 50.66  ? 134 TYR A CG  1 
ATOM   740  C CD1 . TYR A 1 138 ? 44.136 6.911   39.215  1.00 51.13  ? 134 TYR A CD1 1 
ATOM   741  C CD2 . TYR A 1 138 ? 45.032 6.271   41.342  1.00 51.97  ? 134 TYR A CD2 1 
ATOM   742  C CE1 . TYR A 1 138 ? 44.447 5.664   38.698  1.00 51.93  ? 134 TYR A CE1 1 
ATOM   743  C CE2 . TYR A 1 138 ? 45.349 5.015   40.838  1.00 53.01  ? 134 TYR A CE2 1 
ATOM   744  C CZ  . TYR A 1 138 ? 45.053 4.721   39.516  1.00 53.21  ? 134 TYR A CZ  1 
ATOM   745  O OH  . TYR A 1 138 ? 45.357 3.482   39.015  1.00 56.07  ? 134 TYR A OH  1 
ATOM   746  N N   . VAL A 1 139 ? 41.489 6.530   41.538  1.00 45.44  ? 135 VAL A N   1 
ATOM   747  C CA  . VAL A 1 139 ? 41.031 5.304   42.214  1.00 44.13  ? 135 VAL A CA  1 
ATOM   748  C C   . VAL A 1 139 ? 41.616 4.209   41.288  1.00 44.63  ? 135 VAL A C   1 
ATOM   749  O O   . VAL A 1 139 ? 41.497 4.296   40.068  1.00 43.95  ? 135 VAL A O   1 
ATOM   750  C CB  . VAL A 1 139 ? 39.490 5.259   42.284  1.00 44.38  ? 135 VAL A CB  1 
ATOM   751  C CG1 . VAL A 1 139 ? 39.023 4.086   43.156  1.00 41.09  ? 135 VAL A CG1 1 
ATOM   752  C CG2 . VAL A 1 139 ? 38.975 6.580   42.842  1.00 43.12  ? 135 VAL A CG2 1 
ATOM   753  N N   . PRO A 1 140 ? 42.243 3.160   41.853  1.00 45.18  ? 136 PRO A N   1 
ATOM   754  C CA  . PRO A 1 140 ? 42.845 2.124   40.999  1.00 44.73  ? 136 PRO A CA  1 
ATOM   755  C C   . PRO A 1 140 ? 42.009 1.066   40.264  1.00 44.38  ? 136 PRO A C   1 
ATOM   756  O O   . PRO A 1 140 ? 42.511 0.414   39.342  1.00 44.83  ? 136 PRO A O   1 
ATOM   757  C CB  . PRO A 1 140 ? 43.895 1.505   41.928  1.00 44.51  ? 136 PRO A CB  1 
ATOM   758  C CG  . PRO A 1 140 ? 43.215 1.530   43.251  1.00 44.31  ? 136 PRO A CG  1 
ATOM   759  C CD  . PRO A 1 140 ? 42.407 2.830   43.283  1.00 44.85  ? 136 PRO A CD  1 
ATOM   760  N N   . GLU A 1 141 ? 40.751 0.882   40.637  1.00 41.93  ? 137 GLU A N   1 
ATOM   761  C CA  . GLU A 1 141 ? 39.956 -0.122  39.954  1.00 41.05  ? 137 GLU A CA  1 
ATOM   762  C C   . GLU A 1 141 ? 38.609 0.420   39.527  1.00 40.07  ? 137 GLU A C   1 
ATOM   763  O O   . GLU A 1 141 ? 38.218 1.513   39.925  1.00 39.05  ? 137 GLU A O   1 
ATOM   764  C CB  . GLU A 1 141 ? 39.733 -1.328  40.865  1.00 42.62  ? 137 GLU A CB  1 
ATOM   765  C CG  . GLU A 1 141 ? 40.878 -2.310  40.868  1.00 45.36  ? 137 GLU A CG  1 
ATOM   766  C CD  . GLU A 1 141 ? 41.175 -2.839  39.472  1.00 46.53  ? 137 GLU A CD  1 
ATOM   767  O OE1 . GLU A 1 141 ? 40.276 -2.805  38.598  1.00 45.40  ? 137 GLU A OE1 1 
ATOM   768  O OE2 . GLU A 1 141 ? 42.311 -3.310  39.251  1.00 49.87  ? 137 GLU A OE2 1 
ATOM   769  N N   . THR A 1 142 ? 37.917 -0.356  38.705  1.00 38.11  ? 138 THR A N   1 
ATOM   770  C CA  . THR A 1 142 ? 36.583 -0.006  38.261  1.00 37.77  ? 138 THR A CA  1 
ATOM   771  C C   . THR A 1 142 ? 35.752 -1.274  38.412  1.00 37.98  ? 138 THR A C   1 
ATOM   772  O O   . THR A 1 142 ? 36.292 -2.401  38.391  1.00 37.11  ? 138 THR A O   1 
ATOM   773  C CB  . THR A 1 142 ? 36.547 0.429   36.765  1.00 37.13  ? 138 THR A CB  1 
ATOM   774  O OG1 . THR A 1 142 ? 36.848 -0.694  35.922  1.00 36.01  ? 138 THR A OG1 1 
ATOM   775  C CG2 . THR A 1 142 ? 37.547 1.573   36.509  1.00 35.18  ? 138 THR A CG2 1 
ATOM   776  N N   . VAL A 1 143 ? 34.452 -1.104  38.577  1.00 35.85  ? 139 VAL A N   1 
ATOM   777  C CA  . VAL A 1 143 ? 33.560 -2.247  38.686  1.00 35.59  ? 139 VAL A CA  1 
ATOM   778  C C   . VAL A 1 143 ? 33.661 -3.071  37.396  1.00 36.84  ? 139 VAL A C   1 
ATOM   779  O O   . VAL A 1 143 ? 33.548 -4.307  37.419  1.00 37.86  ? 139 VAL A O   1 
ATOM   780  C CB  . VAL A 1 143 ? 32.078 -1.802  38.879  1.00 34.73  ? 139 VAL A CB  1 
ATOM   781  C CG1 . VAL A 1 143 ? 31.127 -3.009  38.664  1.00 31.98  ? 139 VAL A CG1 1 
ATOM   782  C CG2 . VAL A 1 143 ? 31.874 -1.243  40.299  1.00 32.62  ? 139 VAL A CG2 1 
ATOM   783  N N   . TYR A 1 144 ? 33.837 -2.391  36.269  1.00 34.60  ? 140 TYR A N   1 
ATOM   784  C CA  . TYR A 1 144 ? 33.951 -3.080  34.999  1.00 36.02  ? 140 TYR A CA  1 
ATOM   785  C C   . TYR A 1 144 ? 35.105 -4.133  35.011  1.00 37.12  ? 140 TYR A C   1 
ATOM   786  O O   . TYR A 1 144 ? 34.896 -5.288  34.672  1.00 34.86  ? 140 TYR A O   1 
ATOM   787  C CB  . TYR A 1 144 ? 34.218 -2.075  33.890  1.00 36.69  ? 140 TYR A CB  1 
ATOM   788  C CG  . TYR A 1 144 ? 34.398 -2.738  32.536  1.00 41.24  ? 140 TYR A CG  1 
ATOM   789  C CD1 . TYR A 1 144 ? 33.305 -3.242  31.838  1.00 42.38  ? 140 TYR A CD1 1 
ATOM   790  C CD2 . TYR A 1 144 ? 35.669 -2.902  31.982  1.00 42.64  ? 140 TYR A CD2 1 
ATOM   791  C CE1 . TYR A 1 144 ? 33.455 -3.892  30.620  1.00 46.18  ? 140 TYR A CE1 1 
ATOM   792  C CE2 . TYR A 1 144 ? 35.836 -3.559  30.766  1.00 46.19  ? 140 TYR A CE2 1 
ATOM   793  C CZ  . TYR A 1 144 ? 34.724 -4.050  30.090  1.00 47.88  ? 140 TYR A CZ  1 
ATOM   794  O OH  . TYR A 1 144 ? 34.883 -4.704  28.885  1.00 51.97  ? 140 TYR A OH  1 
ATOM   795  N N   . ARG A 1 145 ? 36.306 -3.695  35.390  1.00 36.83  ? 141 ARG A N   1 
ATOM   796  C CA  . ARG A 1 145 ? 37.493 -4.562  35.460  1.00 40.36  ? 141 ARG A CA  1 
ATOM   797  C C   . ARG A 1 145 ? 37.319 -5.649  36.520  1.00 39.18  ? 141 ARG A C   1 
ATOM   798  O O   . ARG A 1 145 ? 37.582 -6.814  36.257  1.00 39.35  ? 141 ARG A O   1 
ATOM   799  C CB  . ARG A 1 145 ? 38.738 -3.724  35.760  1.00 40.56  ? 141 ARG A CB  1 
ATOM   800  C CG  . ARG A 1 145 ? 39.183 -2.882  34.567  1.00 44.20  ? 141 ARG A CG  1 
ATOM   801  C CD  . ARG A 1 145 ? 40.024 -1.696  35.016  1.00 47.50  ? 141 ARG A CD  1 
ATOM   802  N NE  . ARG A 1 145 ? 41.047 -2.060  35.997  1.00 51.06  ? 141 ARG A NE  1 
ATOM   803  C CZ  . ARG A 1 145 ? 42.335 -2.228  35.697  1.00 54.03  ? 141 ARG A CZ  1 
ATOM   804  N NH1 . ARG A 1 145 ? 42.752 -2.074  34.445  1.00 54.70  ? 141 ARG A NH1 1 
ATOM   805  N NH2 . ARG A 1 145 ? 43.213 -2.514  36.650  1.00 55.44  ? 141 ARG A NH2 1 
ATOM   806  N N   . VAL A 1 146 ? 36.845 -5.288  37.704  1.00 38.46  ? 142 VAL A N   1 
ATOM   807  C CA  . VAL A 1 146 ? 36.639 -6.298  38.728  1.00 39.95  ? 142 VAL A CA  1 
ATOM   808  C C   . VAL A 1 146 ? 35.620 -7.339  38.267  1.00 40.92  ? 142 VAL A C   1 
ATOM   809  O O   . VAL A 1 146 ? 35.878 -8.537  38.362  1.00 41.27  ? 142 VAL A O   1 
ATOM   810  C CB  . VAL A 1 146 ? 36.191 -5.673  40.075  1.00 40.75  ? 142 VAL A CB  1 
ATOM   811  C CG1 . VAL A 1 146 ? 35.892 -6.777  41.113  1.00 38.88  ? 142 VAL A CG1 1 
ATOM   812  C CG2 . VAL A 1 146 ? 37.297 -4.778  40.591  1.00 39.90  ? 142 VAL A CG2 1 
ATOM   813  N N   . ALA A 1 147 ? 34.476 -6.910  37.745  1.00 39.50  ? 143 ALA A N   1 
ATOM   814  C CA  . ALA A 1 147 ? 33.488 -7.891  37.293  1.00 41.37  ? 143 ALA A CA  1 
ATOM   815  C C   . ALA A 1 147 ? 34.050 -8.827  36.191  1.00 43.75  ? 143 ALA A C   1 
ATOM   816  O O   . ALA A 1 147 ? 33.711 -10.011 36.149  1.00 42.05  ? 143 ALA A O   1 
ATOM   817  C CB  . ALA A 1 147 ? 32.228 -7.195  36.777  1.00 38.88  ? 143 ALA A CB  1 
ATOM   818  N N   . ARG A 1 148 ? 34.878 -8.287  35.297  1.00 45.13  ? 144 ARG A N   1 
ATOM   819  C CA  . ARG A 1 148 ? 35.444 -9.082  34.215  1.00 48.53  ? 144 ARG A CA  1 
ATOM   820  C C   . ARG A 1 148 ? 36.433 -10.121 34.768  1.00 48.86  ? 144 ARG A C   1 
ATOM   821  O O   . ARG A 1 148 ? 36.514 -11.227 34.256  1.00 48.04  ? 144 ARG A O   1 
ATOM   822  C CB  . ARG A 1 148 ? 36.138 -8.188  33.184  1.00 50.10  ? 144 ARG A CB  1 
ATOM   823  C CG  . ARG A 1 148 ? 36.901 -8.981  32.126  1.00 54.49  ? 144 ARG A CG  1 
ATOM   824  C CD  . ARG A 1 148 ? 37.466 -8.095  31.028  1.00 58.91  ? 144 ARG A CD  1 
ATOM   825  N NE  . ARG A 1 148 ? 38.386 -7.087  31.556  1.00 63.05  ? 144 ARG A NE  1 
ATOM   826  C CZ  . ARG A 1 148 ? 38.763 -5.998  30.887  1.00 65.28  ? 144 ARG A CZ  1 
ATOM   827  N NH1 . ARG A 1 148 ? 38.294 -5.779  29.656  1.00 66.10  ? 144 ARG A NH1 1 
ATOM   828  N NH2 . ARG A 1 148 ? 39.592 -5.121  31.451  1.00 64.58  ? 144 ARG A NH2 1 
ATOM   829  N N   . HIS A 1 149 ? 37.177 -9.758  35.809  1.00 50.01  ? 145 HIS A N   1 
ATOM   830  C CA  . HIS A 1 149 ? 38.112 -10.694 36.418  1.00 51.71  ? 145 HIS A CA  1 
ATOM   831  C C   . HIS A 1 149 ? 37.350 -11.894 36.948  1.00 50.95  ? 145 HIS A C   1 
ATOM   832  O O   . HIS A 1 149 ? 37.750 -13.033 36.718  1.00 51.18  ? 145 HIS A O   1 
ATOM   833  C CB  . HIS A 1 149 ? 38.884 -10.041 37.558  1.00 54.17  ? 145 HIS A CB  1 
ATOM   834  C CG  . HIS A 1 149 ? 40.009 -9.164  37.095  1.00 60.35  ? 145 HIS A CG  1 
ATOM   835  N ND1 . HIS A 1 149 ? 40.962 -9.590  36.188  1.00 62.88  ? 145 HIS A ND1 1 
ATOM   836  C CD2 . HIS A 1 149 ? 40.333 -7.883  37.408  1.00 61.82  ? 145 HIS A CD2 1 
ATOM   837  C CE1 . HIS A 1 149 ? 41.820 -8.608  35.960  1.00 63.64  ? 145 HIS A CE1 1 
ATOM   838  N NE2 . HIS A 1 149 ? 41.460 -7.563  36.687  1.00 64.07  ? 145 HIS A NE2 1 
ATOM   839  N N   . TYR A 1 150 ? 36.246 -11.657 37.647  1.00 48.18  ? 146 TYR A N   1 
ATOM   840  C CA  . TYR A 1 150 ? 35.476 -12.765 38.177  1.00 47.76  ? 146 TYR A CA  1 
ATOM   841  C C   . TYR A 1 150 ? 34.800 -13.560 37.098  1.00 50.55  ? 146 TYR A C   1 
ATOM   842  O O   . TYR A 1 150 ? 34.809 -14.791 37.117  1.00 52.05  ? 146 TYR A O   1 
ATOM   843  C CB  . TYR A 1 150 ? 34.415 -12.292 39.170  1.00 43.99  ? 146 TYR A CB  1 
ATOM   844  C CG  . TYR A 1 150 ? 34.974 -11.961 40.528  1.00 39.81  ? 146 TYR A CG  1 
ATOM   845  C CD1 . TYR A 1 150 ? 35.665 -10.775 40.746  1.00 39.66  ? 146 TYR A CD1 1 
ATOM   846  C CD2 . TYR A 1 150 ? 34.826 -12.839 41.595  1.00 38.83  ? 146 TYR A CD2 1 
ATOM   847  C CE1 . TYR A 1 150 ? 36.202 -10.467 42.003  1.00 37.76  ? 146 TYR A CE1 1 
ATOM   848  C CE2 . TYR A 1 150 ? 35.352 -12.546 42.853  1.00 36.87  ? 146 TYR A CE2 1 
ATOM   849  C CZ  . TYR A 1 150 ? 36.039 -11.362 43.047  1.00 38.03  ? 146 TYR A CZ  1 
ATOM   850  O OH  . TYR A 1 150 ? 36.591 -11.073 44.269  1.00 35.44  ? 146 TYR A OH  1 
ATOM   851  N N   . SER A 1 151 ? 34.215 -12.850 36.147  1.00 52.16  ? 147 SER A N   1 
ATOM   852  C CA  . SER A 1 151 ? 33.491 -13.483 35.062  1.00 54.88  ? 147 SER A CA  1 
ATOM   853  C C   . SER A 1 151 ? 34.341 -14.439 34.215  1.00 57.13  ? 147 SER A C   1 
ATOM   854  O O   . SER A 1 151 ? 33.901 -15.545 33.869  1.00 54.97  ? 147 SER A O   1 
ATOM   855  C CB  . SER A 1 151 ? 32.886 -12.410 34.160  1.00 54.56  ? 147 SER A CB  1 
ATOM   856  O OG  . SER A 1 151 ? 31.948 -12.989 33.286  1.00 58.04  ? 147 SER A OG  1 
ATOM   857  N N   . ARG A 1 152 ? 35.553 -14.026 33.865  1.00 59.11  ? 148 ARG A N   1 
ATOM   858  C CA  . ARG A 1 152 ? 36.348 -14.915 33.054  1.00 63.41  ? 148 ARG A CA  1 
ATOM   859  C C   . ARG A 1 152 ? 37.029 -16.001 33.882  1.00 63.93  ? 148 ARG A C   1 
ATOM   860  O O   . ARG A 1 152 ? 37.815 -16.790 33.363  1.00 64.49  ? 148 ARG A O   1 
ATOM   861  C CB  . ARG A 1 152 ? 37.344 -14.135 32.189  1.00 65.14  ? 148 ARG A CB  1 
ATOM   862  C CG  . ARG A 1 152 ? 38.329 -13.270 32.903  1.00 69.41  ? 148 ARG A CG  1 
ATOM   863  C CD  . ARG A 1 152 ? 39.022 -12.379 31.874  1.00 73.08  ? 148 ARG A CD  1 
ATOM   864  N NE  . ARG A 1 152 ? 39.708 -11.246 32.492  1.00 77.48  ? 148 ARG A NE  1 
ATOM   865  C CZ  . ARG A 1 152 ? 40.234 -10.227 31.816  1.00 79.24  ? 148 ARG A CZ  1 
ATOM   866  N NH1 . ARG A 1 152 ? 40.161 -10.188 30.484  1.00 80.04  ? 148 ARG A NH1 1 
ATOM   867  N NH2 . ARG A 1 152 ? 40.826 -9.237  32.474  1.00 79.27  ? 148 ARG A NH2 1 
ATOM   868  N N   . ALA A 1 153 ? 36.706 -16.050 35.168  1.00 63.34  ? 149 ALA A N   1 
ATOM   869  C CA  . ALA A 1 153 ? 37.250 -17.080 36.036  1.00 63.45  ? 149 ALA A CA  1 
ATOM   870  C C   . ALA A 1 153 ? 36.082 -17.950 36.485  1.00 63.34  ? 149 ALA A C   1 
ATOM   871  O O   . ALA A 1 153 ? 36.208 -18.755 37.397  1.00 63.81  ? 149 ALA A O   1 
ATOM   872  C CB  . ALA A 1 153 ? 37.957 -16.460 37.241  1.00 63.51  ? 149 ALA A CB  1 
ATOM   873  N N   . LYS A 1 154 ? 34.944 -17.779 35.818  1.00 64.73  ? 150 LYS A N   1 
ATOM   874  C CA  . LYS A 1 154 ? 33.730 -18.534 36.115  1.00 65.79  ? 150 LYS A CA  1 
ATOM   875  C C   . LYS A 1 154 ? 33.220 -18.371 37.552  1.00 65.52  ? 150 LYS A C   1 
ATOM   876  O O   . LYS A 1 154 ? 32.658 -19.304 38.138  1.00 65.57  ? 150 LYS A O   1 
ATOM   877  C CB  . LYS A 1 154 ? 33.963 -20.016 35.821  1.00 68.26  ? 150 LYS A CB  1 
ATOM   878  C CG  . LYS A 1 154 ? 34.255 -20.315 34.361  1.00 70.43  ? 150 LYS A CG  1 
ATOM   879  C CD  . LYS A 1 154 ? 33.013 -20.208 33.492  1.00 72.56  ? 150 LYS A CD  1 
ATOM   880  C CE  . LYS A 1 154 ? 33.366 -20.530 32.041  1.00 74.36  ? 150 LYS A CE  1 
ATOM   881  N NZ  . LYS A 1 154 ? 32.174 -20.758 31.169  1.00 75.53  ? 150 LYS A NZ  1 
ATOM   882  N N   . GLN A 1 155 ? 33.411 -17.187 38.122  1.00 64.39  ? 151 GLN A N   1 
ATOM   883  C CA  . GLN A 1 155 ? 32.947 -16.932 39.479  1.00 63.11  ? 151 GLN A CA  1 
ATOM   884  C C   . GLN A 1 155 ? 32.194 -15.613 39.528  1.00 60.59  ? 151 GLN A C   1 
ATOM   885  O O   . GLN A 1 155 ? 32.272 -14.807 38.603  1.00 60.40  ? 151 GLN A O   1 
ATOM   886  C CB  . GLN A 1 155 ? 34.125 -16.807 40.431  1.00 65.75  ? 151 GLN A CB  1 
ATOM   887  C CG  . GLN A 1 155 ? 35.144 -17.907 40.368  1.00 69.20  ? 151 GLN A CG  1 
ATOM   888  C CD  . GLN A 1 155 ? 36.468 -17.433 40.935  1.00 72.33  ? 151 GLN A CD  1 
ATOM   889  O OE1 . GLN A 1 155 ? 36.505 -16.776 41.984  1.00 74.18  ? 151 GLN A OE1 1 
ATOM   890  N NE2 . GLN A 1 155 ? 37.561 -17.753 40.249  1.00 72.62  ? 151 GLN A NE2 1 
ATOM   891  N N   . THR A 1 156 ? 31.475 -15.388 40.620  1.00 57.94  ? 152 THR A N   1 
ATOM   892  C CA  . THR A 1 156 ? 30.773 -14.125 40.792  1.00 53.96  ? 152 THR A CA  1 
ATOM   893  C C   . THR A 1 156 ? 31.336 -13.450 42.034  1.00 51.22  ? 152 THR A C   1 
ATOM   894  O O   . THR A 1 156 ? 31.854 -14.097 42.951  1.00 49.57  ? 152 THR A O   1 
ATOM   895  C CB  . THR A 1 156 ? 29.245 -14.298 40.951  1.00 53.95  ? 152 THR A CB  1 
ATOM   896  O OG1 . THR A 1 156 ? 28.991 -15.316 41.912  1.00 54.11  ? 152 THR A OG1 1 
ATOM   897  C CG2 . THR A 1 156 ? 28.575 -14.664 39.595  1.00 53.37  ? 152 THR A CG2 1 
ATOM   898  N N   . LEU A 1 157 ? 31.279 -12.131 42.030  1.00 48.14  ? 153 LEU A N   1 
ATOM   899  C CA  . LEU A 1 157 ? 31.758 -11.344 43.148  1.00 45.99  ? 153 LEU A CA  1 
ATOM   900  C C   . LEU A 1 157 ? 30.960 -11.742 44.408  1.00 43.27  ? 153 LEU A C   1 
ATOM   901  O O   . LEU A 1 157 ? 29.745 -11.912 44.335  1.00 41.65  ? 153 LEU A O   1 
ATOM   902  C CB  . LEU A 1 157 ? 31.511 -9.870  42.827  1.00 46.01  ? 153 LEU A CB  1 
ATOM   903  C CG  . LEU A 1 157 ? 31.913 -8.772  43.806  1.00 46.59  ? 153 LEU A CG  1 
ATOM   904  C CD1 . LEU A 1 157 ? 33.449 -8.644  43.879  1.00 44.79  ? 153 LEU A CD1 1 
ATOM   905  C CD2 . LEU A 1 157 ? 31.287 -7.463  43.297  1.00 44.84  ? 153 LEU A CD2 1 
ATOM   906  N N   . PRO A 1 158 ? 31.640 -11.915 45.563  1.00 40.72  ? 154 PRO A N   1 
ATOM   907  C CA  . PRO A 1 158 ? 30.964 -12.273 46.807  1.00 40.33  ? 154 PRO A CA  1 
ATOM   908  C C   . PRO A 1 158 ? 29.903 -11.209 47.072  1.00 42.24  ? 154 PRO A C   1 
ATOM   909  O O   . PRO A 1 158 ? 30.139 -9.992  46.875  1.00 40.52  ? 154 PRO A O   1 
ATOM   910  C CB  . PRO A 1 158 ? 32.081 -12.214 47.848  1.00 41.31  ? 154 PRO A CB  1 
ATOM   911  C CG  . PRO A 1 158 ? 33.307 -12.578 47.040  1.00 41.22  ? 154 PRO A CG  1 
ATOM   912  C CD  . PRO A 1 158 ? 33.094 -11.807 45.764  1.00 40.23  ? 154 PRO A CD  1 
ATOM   913  N N   . VAL A 1 159 ? 28.753 -11.659 47.551  1.00 41.68  ? 155 VAL A N   1 
ATOM   914  C CA  . VAL A 1 159 ? 27.632 -10.769 47.802  1.00 43.00  ? 155 VAL A CA  1 
ATOM   915  C C   . VAL A 1 159 ? 27.871 -9.571  48.734  1.00 41.59  ? 155 VAL A C   1 
ATOM   916  O O   . VAL A 1 159 ? 27.285 -8.508  48.527  1.00 42.34  ? 155 VAL A O   1 
ATOM   917  C CB  . VAL A 1 159 ? 26.417 -11.592 48.239  1.00 42.89  ? 155 VAL A CB  1 
ATOM   918  C CG1 . VAL A 1 159 ? 25.205 -10.706 48.415  1.00 44.45  ? 155 VAL A CG1 1 
ATOM   919  C CG2 . VAL A 1 159 ? 26.131 -12.639 47.139  1.00 44.50  ? 155 VAL A CG2 1 
ATOM   920  N N   . ILE A 1 160 ? 28.742 -9.714  49.721  1.00 39.43  ? 156 ILE A N   1 
ATOM   921  C CA  . ILE A 1 160 ? 29.028 -8.617  50.618  1.00 39.69  ? 156 ILE A CA  1 
ATOM   922  C C   . ILE A 1 160 ? 29.551 -7.409  49.821  1.00 38.85  ? 156 ILE A C   1 
ATOM   923  O O   . ILE A 1 160 ? 29.252 -6.260  50.167  1.00 37.73  ? 156 ILE A O   1 
ATOM   924  C CB  . ILE A 1 160 ? 30.046 -9.042  51.712  1.00 40.98  ? 156 ILE A CB  1 
ATOM   925  C CG1 . ILE A 1 160 ? 30.365 -7.870  52.650  1.00 41.16  ? 156 ILE A CG1 1 
ATOM   926  C CG2 . ILE A 1 160 ? 31.320 -9.547  51.055  1.00 41.23  ? 156 ILE A CG2 1 
ATOM   927  C CD1 . ILE A 1 160 ? 29.154 -7.310  53.375  1.00 41.92  ? 156 ILE A CD1 1 
ATOM   928  N N   . TYR A 1 161 ? 30.317 -7.665  48.757  1.00 38.03  ? 157 TYR A N   1 
ATOM   929  C CA  . TYR A 1 161 ? 30.830 -6.583  47.904  1.00 37.88  ? 157 TYR A CA  1 
ATOM   930  C C   . TYR A 1 161 ? 29.724 -6.020  47.004  1.00 37.03  ? 157 TYR A C   1 
ATOM   931  O O   . TYR A 1 161 ? 29.726 -4.818  46.706  1.00 36.89  ? 157 TYR A O   1 
ATOM   932  C CB  . TYR A 1 161 ? 31.986 -7.053  47.019  1.00 37.22  ? 157 TYR A CB  1 
ATOM   933  C CG  . TYR A 1 161 ? 33.225 -7.353  47.793  1.00 41.21  ? 157 TYR A CG  1 
ATOM   934  C CD1 . TYR A 1 161 ? 33.889 -6.347  48.515  1.00 43.08  ? 157 TYR A CD1 1 
ATOM   935  C CD2 . TYR A 1 161 ? 33.730 -8.652  47.842  1.00 42.94  ? 157 TYR A CD2 1 
ATOM   936  C CE1 . TYR A 1 161 ? 35.027 -6.634  49.268  1.00 45.39  ? 157 TYR A CE1 1 
ATOM   937  C CE2 . TYR A 1 161 ? 34.860 -8.948  48.587  1.00 45.82  ? 157 TYR A CE2 1 
ATOM   938  C CZ  . TYR A 1 161 ? 35.505 -7.938  49.292  1.00 46.33  ? 157 TYR A CZ  1 
ATOM   939  O OH  . TYR A 1 161 ? 36.656 -8.223  49.977  1.00 50.84  ? 157 TYR A OH  1 
ATOM   940  N N   . VAL A 1 162 ? 28.799 -6.875  46.560  1.00 34.47  ? 158 VAL A N   1 
ATOM   941  C CA  . VAL A 1 162 ? 27.697 -6.380  45.735  1.00 35.92  ? 158 VAL A CA  1 
ATOM   942  C C   . VAL A 1 162 ? 26.911 -5.376  46.596  1.00 36.01  ? 158 VAL A C   1 
ATOM   943  O O   . VAL A 1 162 ? 26.533 -4.293  46.116  1.00 34.80  ? 158 VAL A O   1 
ATOM   944  C CB  . VAL A 1 162 ? 26.750 -7.517  45.284  1.00 36.47  ? 158 VAL A CB  1 
ATOM   945  C CG1 . VAL A 1 162 ? 25.548 -6.935  44.487  1.00 35.91  ? 158 VAL A CG1 1 
ATOM   946  C CG2 . VAL A 1 162 ? 27.534 -8.536  44.436  1.00 35.98  ? 158 VAL A CG2 1 
ATOM   947  N N   . LYS A 1 163 ? 26.679 -5.740  47.862  1.00 33.14  ? 159 LYS A N   1 
ATOM   948  C CA  . LYS A 1 163 ? 25.959 -4.879  48.805  1.00 34.27  ? 159 LYS A CA  1 
ATOM   949  C C   . LYS A 1 163 ? 26.678 -3.550  49.003  1.00 34.25  ? 159 LYS A C   1 
ATOM   950  O O   . LYS A 1 163 ? 26.079 -2.495  48.830  1.00 34.32  ? 159 LYS A O   1 
ATOM   951  C CB  . LYS A 1 163 ? 25.800 -5.559  50.171  1.00 34.41  ? 159 LYS A CB  1 
ATOM   952  C CG  . LYS A 1 163 ? 24.728 -6.644  50.184  1.00 35.28  ? 159 LYS A CG  1 
ATOM   953  C CD  . LYS A 1 163 ? 24.660 -7.355  51.523  1.00 36.90  ? 159 LYS A CD  1 
ATOM   954  C CE  . LYS A 1 163 ? 23.813 -8.633  51.400  1.00 35.23  ? 159 LYS A CE  1 
ATOM   955  N NZ  . LYS A 1 163 ? 23.641 -9.256  52.724  1.00 37.46  ? 159 LYS A NZ  1 
ATOM   956  N N   . LEU A 1 164 ? 27.955 -3.608  49.359  1.00 32.52  ? 160 LEU A N   1 
ATOM   957  C CA  . LEU A 1 164 ? 28.744 -2.398  49.575  1.00 34.99  ? 160 LEU A CA  1 
ATOM   958  C C   . LEU A 1 164 ? 28.824 -1.474  48.366  1.00 34.85  ? 160 LEU A C   1 
ATOM   959  O O   . LEU A 1 164 ? 28.663 -0.248  48.501  1.00 34.41  ? 160 LEU A O   1 
ATOM   960  C CB  . LEU A 1 164 ? 30.182 -2.733  49.984  1.00 36.35  ? 160 LEU A CB  1 
ATOM   961  C CG  . LEU A 1 164 ? 30.445 -3.219  51.403  1.00 40.49  ? 160 LEU A CG  1 
ATOM   962  C CD1 . LEU A 1 164 ? 31.866 -3.901  51.502  1.00 40.16  ? 160 LEU A CD1 1 
ATOM   963  C CD2 . LEU A 1 164 ? 30.335 -2.016  52.344  1.00 40.05  ? 160 LEU A CD2 1 
ATOM   964  N N   . TYR A 1 165 ? 29.106 -2.040  47.196  1.00 31.78  ? 161 TYR A N   1 
ATOM   965  C CA  . TYR A 1 165 ? 29.238 -1.207  46.011  1.00 32.73  ? 161 TYR A CA  1 
ATOM   966  C C   . TYR A 1 165 ? 27.920 -0.585  45.594  1.00 31.92  ? 161 TYR A C   1 
ATOM   967  O O   . TYR A 1 165 ? 27.864 0.623   45.286  1.00 31.27  ? 161 TYR A O   1 
ATOM   968  C CB  . TYR A 1 165 ? 29.839 -2.017  44.836  1.00 34.29  ? 161 TYR A CB  1 
ATOM   969  C CG  . TYR A 1 165 ? 31.224 -2.572  45.133  1.00 37.00  ? 161 TYR A CG  1 
ATOM   970  C CD1 . TYR A 1 165 ? 32.024 -2.009  46.116  1.00 37.21  ? 161 TYR A CD1 1 
ATOM   971  C CD2 . TYR A 1 165 ? 31.740 -3.647  44.398  1.00 39.13  ? 161 TYR A CD2 1 
ATOM   972  C CE1 . TYR A 1 165 ? 33.318 -2.500  46.367  1.00 41.59  ? 161 TYR A CE1 1 
ATOM   973  C CE2 . TYR A 1 165 ? 33.007 -4.139  44.632  1.00 40.34  ? 161 TYR A CE2 1 
ATOM   974  C CZ  . TYR A 1 165 ? 33.793 -3.574  45.606  1.00 41.18  ? 161 TYR A CZ  1 
ATOM   975  O OH  . TYR A 1 165 ? 35.060 -4.082  45.819  1.00 43.99  ? 161 TYR A OH  1 
ATOM   976  N N   . MET A 1 166 ? 26.863 -1.392  45.575  1.00 28.41  ? 162 MET A N   1 
ATOM   977  C CA  . MET A 1 166 ? 25.555 -0.888  45.156  1.00 30.46  ? 162 MET A CA  1 
ATOM   978  C C   . MET A 1 166 ? 24.991 0.151   46.135  1.00 30.41  ? 162 MET A C   1 
ATOM   979  O O   . MET A 1 166 ? 24.369 1.137   45.721  1.00 29.38  ? 162 MET A O   1 
ATOM   980  C CB  . MET A 1 166 ? 24.576 -2.039  44.978  1.00 29.58  ? 162 MET A CB  1 
ATOM   981  C CG  . MET A 1 166 ? 24.913 -2.926  43.741  1.00 34.88  ? 162 MET A CG  1 
ATOM   982  S SD  . MET A 1 166 ? 25.057 -2.029  42.148  1.00 33.38  ? 162 MET A SD  1 
ATOM   983  C CE  . MET A 1 166 ? 23.342 -1.165  42.186  1.00 35.30  ? 162 MET A CE  1 
ATOM   984  N N   . TYR A 1 167 ? 25.196 -0.076  47.430  1.00 30.28  ? 163 TYR A N   1 
ATOM   985  C CA  . TYR A 1 167 ? 24.727 0.880   48.412  1.00 30.77  ? 163 TYR A CA  1 
ATOM   986  C C   . TYR A 1 167 ? 25.397 2.241   48.188  1.00 32.07  ? 163 TYR A C   1 
ATOM   987  O O   . TYR A 1 167 ? 24.732 3.300   48.249  1.00 31.29  ? 163 TYR A O   1 
ATOM   988  C CB  . TYR A 1 167 ? 25.044 0.389   49.819  1.00 29.31  ? 163 TYR A CB  1 
ATOM   989  C CG  . TYR A 1 167 ? 24.667 1.370   50.926  1.00 31.50  ? 163 TYR A CG  1 
ATOM   990  C CD1 . TYR A 1 167 ? 23.407 1.329   51.526  1.00 28.63  ? 163 TYR A CD1 1 
ATOM   991  C CD2 . TYR A 1 167 ? 25.590 2.328   51.372  1.00 29.15  ? 163 TYR A CD2 1 
ATOM   992  C CE1 . TYR A 1 167 ? 23.069 2.221   52.565  1.00 32.58  ? 163 TYR A CE1 1 
ATOM   993  C CE2 . TYR A 1 167 ? 25.269 3.220   52.394  1.00 30.76  ? 163 TYR A CE2 1 
ATOM   994  C CZ  . TYR A 1 167 ? 24.003 3.157   52.994  1.00 32.88  ? 163 TYR A CZ  1 
ATOM   995  O OH  . TYR A 1 167 ? 23.700 3.971   54.078  1.00 35.14  ? 163 TYR A OH  1 
ATOM   996  N N   . GLN A 1 168 ? 26.712 2.222   47.961  1.00 30.34  ? 164 GLN A N   1 
ATOM   997  C CA  . GLN A 1 168 ? 27.432 3.472   47.738  1.00 32.00  ? 164 GLN A CA  1 
ATOM   998  C C   . GLN A 1 168 ? 27.015 4.153   46.426  1.00 32.51  ? 164 GLN A C   1 
ATOM   999  O O   . GLN A 1 168 ? 26.995 5.401   46.340  1.00 29.24  ? 164 GLN A O   1 
ATOM   1000 C CB  . GLN A 1 168 ? 28.957 3.242   47.769  1.00 31.36  ? 164 GLN A CB  1 
ATOM   1001 C CG  . GLN A 1 168 ? 29.448 2.845   49.187  1.00 32.67  ? 164 GLN A CG  1 
ATOM   1002 C CD  . GLN A 1 168 ? 30.913 2.434   49.190  1.00 34.52  ? 164 GLN A CD  1 
ATOM   1003 O OE1 . GLN A 1 168 ? 31.798 3.276   49.302  1.00 33.52  ? 164 GLN A OE1 1 
ATOM   1004 N NE2 . GLN A 1 168 ? 31.171 1.134   49.038  1.00 33.28  ? 164 GLN A NE2 1 
ATOM   1005 N N   . LEU A 1 169 ? 26.679 3.358   45.407  1.00 29.70  ? 165 LEU A N   1 
ATOM   1006 C CA  . LEU A 1 169 ? 26.256 3.960   44.145  1.00 30.79  ? 165 LEU A CA  1 
ATOM   1007 C C   . LEU A 1 169 ? 24.901 4.674   44.392  1.00 29.72  ? 165 LEU A C   1 
ATOM   1008 O O   . LEU A 1 169 ? 24.689 5.799   43.930  1.00 29.51  ? 165 LEU A O   1 
ATOM   1009 C CB  . LEU A 1 169 ? 26.118 2.901   43.030  1.00 28.29  ? 165 LEU A CB  1 
ATOM   1010 C CG  . LEU A 1 169 ? 25.288 3.286   41.784  1.00 31.46  ? 165 LEU A CG  1 
ATOM   1011 C CD1 . LEU A 1 169 ? 25.859 4.558   41.161  1.00 29.06  ? 165 LEU A CD1 1 
ATOM   1012 C CD2 . LEU A 1 169 ? 25.299 2.099   40.730  1.00 30.16  ? 165 LEU A CD2 1 
ATOM   1013 N N   . PHE A 1 170 ? 24.002 4.023   45.118  1.00 30.14  ? 166 PHE A N   1 
ATOM   1014 C CA  . PHE A 1 170 ? 22.706 4.633   45.399  1.00 33.50  ? 166 PHE A CA  1 
ATOM   1015 C C   . PHE A 1 170 ? 22.833 5.901   46.253  1.00 33.13  ? 166 PHE A C   1 
ATOM   1016 O O   . PHE A 1 170 ? 22.042 6.837   46.069  1.00 33.93  ? 166 PHE A O   1 
ATOM   1017 C CB  . PHE A 1 170 ? 21.759 3.632   46.046  1.00 31.85  ? 166 PHE A CB  1 
ATOM   1018 C CG  . PHE A 1 170 ? 21.193 2.646   45.074  1.00 35.27  ? 166 PHE A CG  1 
ATOM   1019 C CD1 . PHE A 1 170 ? 20.491 3.087   43.945  1.00 33.52  ? 166 PHE A CD1 1 
ATOM   1020 C CD2 . PHE A 1 170 ? 21.322 1.270   45.294  1.00 34.75  ? 166 PHE A CD2 1 
ATOM   1021 C CE1 . PHE A 1 170 ? 19.919 2.177   43.049  1.00 34.23  ? 166 PHE A CE1 1 
ATOM   1022 C CE2 . PHE A 1 170 ? 20.756 0.351   44.394  1.00 34.23  ? 166 PHE A CE2 1 
ATOM   1023 C CZ  . PHE A 1 170 ? 20.058 0.804   43.279  1.00 34.47  ? 166 PHE A CZ  1 
ATOM   1024 N N   . ARG A 1 171 ? 23.817 5.937   47.152  1.00 31.58  ? 167 ARG A N   1 
ATOM   1025 C CA  . ARG A 1 171 ? 24.049 7.145   47.945  1.00 34.38  ? 167 ARG A CA  1 
ATOM   1026 C C   . ARG A 1 171 ? 24.482 8.273   47.014  1.00 33.59  ? 167 ARG A C   1 
ATOM   1027 O O   . ARG A 1 171 ? 23.968 9.378   47.129  1.00 33.49  ? 167 ARG A O   1 
ATOM   1028 C CB  . ARG A 1 171 ? 25.146 6.976   49.011  1.00 33.53  ? 167 ARG A CB  1 
ATOM   1029 C CG  . ARG A 1 171 ? 24.658 6.458   50.355  1.00 41.10  ? 167 ARG A CG  1 
ATOM   1030 C CD  . ARG A 1 171 ? 25.719 6.673   51.461  1.00 42.15  ? 167 ARG A CD  1 
ATOM   1031 N NE  . ARG A 1 171 ? 25.827 8.073   51.879  1.00 42.39  ? 167 ARG A NE  1 
ATOM   1032 C CZ  . ARG A 1 171 ? 26.712 8.526   52.770  1.00 44.63  ? 167 ARG A CZ  1 
ATOM   1033 N NH1 . ARG A 1 171 ? 27.608 7.712   53.344  1.00 38.95  ? 167 ARG A NH1 1 
ATOM   1034 N NH2 . ARG A 1 171 ? 26.652 9.792   53.156  1.00 44.61  ? 167 ARG A NH2 1 
ATOM   1035 N N   . SER A 1 172 ? 25.438 8.007   46.118  1.00 32.62  ? 168 SER A N   1 
ATOM   1036 C CA  . SER A 1 172 ? 25.887 9.037   45.193  1.00 32.45  ? 168 SER A CA  1 
ATOM   1037 C C   . SER A 1 172 ? 24.719 9.574   44.325  1.00 32.98  ? 168 SER A C   1 
ATOM   1038 O O   . SER A 1 172 ? 24.663 10.779  44.041  1.00 31.27  ? 168 SER A O   1 
ATOM   1039 C CB  . SER A 1 172 ? 27.043 8.529   44.304  1.00 32.22  ? 168 SER A CB  1 
ATOM   1040 O OG  . SER A 1 172 ? 26.585 7.633   43.302  1.00 35.07  ? 168 SER A OG  1 
ATOM   1041 N N   . LEU A 1 173 ? 23.796 8.693   43.924  1.00 31.29  ? 169 LEU A N   1 
ATOM   1042 C CA  . LEU A 1 173 ? 22.636 9.094   43.113  1.00 33.37  ? 169 LEU A CA  1 
ATOM   1043 C C   . LEU A 1 173 ? 21.628 9.933   43.928  1.00 33.79  ? 169 LEU A C   1 
ATOM   1044 O O   . LEU A 1 173 ? 21.067 10.895  43.412  1.00 33.80  ? 169 LEU A O   1 
ATOM   1045 C CB  . LEU A 1 173 ? 21.929 7.867   42.508  1.00 32.32  ? 169 LEU A CB  1 
ATOM   1046 C CG  . LEU A 1 173 ? 22.754 7.070   41.466  1.00 34.36  ? 169 LEU A CG  1 
ATOM   1047 C CD1 . LEU A 1 173 ? 21.925 5.916   40.919  1.00 31.44  ? 169 LEU A CD1 1 
ATOM   1048 C CD2 . LEU A 1 173 ? 23.222 8.010   40.334  1.00 31.45  ? 169 LEU A CD2 1 
ATOM   1049 N N   . ALA A 1 174 ? 21.384 9.561   45.183  1.00 34.35  ? 170 ALA A N   1 
ATOM   1050 C CA  . ALA A 1 174 ? 20.469 10.333  46.032  1.00 33.99  ? 170 ALA A CA  1 
ATOM   1051 C C   . ALA A 1 174 ? 21.045 11.757  46.132  1.00 35.80  ? 170 ALA A C   1 
ATOM   1052 O O   . ALA A 1 174 ? 20.315 12.758  46.079  1.00 36.15  ? 170 ALA A O   1 
ATOM   1053 C CB  . ALA A 1 174 ? 20.360 9.692   47.434  1.00 32.55  ? 170 ALA A CB  1 
ATOM   1054 N N   . TYR A 1 175 ? 22.364 11.848  46.246  1.00 34.65  ? 171 TYR A N   1 
ATOM   1055 C CA  . TYR A 1 175 ? 22.991 13.163  46.333  1.00 36.87  ? 171 TYR A CA  1 
ATOM   1056 C C   . TYR A 1 175 ? 22.873 14.006  45.062  1.00 38.46  ? 171 TYR A C   1 
ATOM   1057 O O   . TYR A 1 175 ? 22.388 15.164  45.129  1.00 37.95  ? 171 TYR A O   1 
ATOM   1058 C CB  . TYR A 1 175 ? 24.460 13.040  46.747  1.00 36.52  ? 171 TYR A CB  1 
ATOM   1059 C CG  . TYR A 1 175 ? 25.217 14.353  46.809  1.00 38.47  ? 171 TYR A CG  1 
ATOM   1060 C CD1 . TYR A 1 175 ? 26.087 14.724  45.777  1.00 39.54  ? 171 TYR A CD1 1 
ATOM   1061 C CD2 . TYR A 1 175 ? 25.076 15.230  47.906  1.00 39.10  ? 171 TYR A CD2 1 
ATOM   1062 C CE1 . TYR A 1 175 ? 26.803 15.923  45.811  1.00 39.36  ? 171 TYR A CE1 1 
ATOM   1063 C CE2 . TYR A 1 175 ? 25.797 16.450  47.960  1.00 39.42  ? 171 TYR A CE2 1 
ATOM   1064 C CZ  . TYR A 1 175 ? 26.652 16.786  46.910  1.00 41.41  ? 171 TYR A CZ  1 
ATOM   1065 O OH  . TYR A 1 175 ? 27.363 17.969  46.925  1.00 42.17  ? 171 TYR A OH  1 
ATOM   1066 N N   . ILE A 1 176 ? 23.300 13.483  43.902  1.00 35.87  ? 172 ILE A N   1 
ATOM   1067 C CA  . ILE A 1 176 ? 23.178 14.313  42.702  1.00 35.15  ? 172 ILE A CA  1 
ATOM   1068 C C   . ILE A 1 176 ? 21.720 14.600  42.330  1.00 35.40  ? 172 ILE A C   1 
ATOM   1069 O O   . ILE A 1 176 ? 21.408 15.707  41.874  1.00 38.25  ? 172 ILE A O   1 
ATOM   1070 C CB  . ILE A 1 176 ? 23.954 13.751  41.468  1.00 33.99  ? 172 ILE A CB  1 
ATOM   1071 C CG1 . ILE A 1 176 ? 23.454 12.362  41.081  1.00 33.41  ? 172 ILE A CG1 1 
ATOM   1072 C CG2 . ILE A 1 176 ? 25.437 13.784  41.759  1.00 35.87  ? 172 ILE A CG2 1 
ATOM   1073 C CD1 . ILE A 1 176 ? 24.016 11.881  39.713  1.00 34.91  ? 172 ILE A CD1 1 
ATOM   1074 N N   . HIS A 1 177 ? 20.825 13.646  42.565  1.00 32.65  ? 173 HIS A N   1 
ATOM   1075 C CA  . HIS A 1 177 ? 19.427 13.847  42.258  1.00 33.46  ? 173 HIS A CA  1 
ATOM   1076 C C   . HIS A 1 177 ? 18.753 14.902  43.163  1.00 37.40  ? 173 HIS A C   1 
ATOM   1077 O O   . HIS A 1 177 ? 17.776 15.529  42.745  1.00 36.26  ? 173 HIS A O   1 
ATOM   1078 C CB  . HIS A 1 177 ? 18.640 12.544  42.370  1.00 31.80  ? 173 HIS A CB  1 
ATOM   1079 C CG  . HIS A 1 177 ? 18.952 11.549  41.284  1.00 34.09  ? 173 HIS A CG  1 
ATOM   1080 N ND1 . HIS A 1 177 ? 18.283 10.350  41.159  1.00 35.33  ? 173 HIS A ND1 1 
ATOM   1081 C CD2 . HIS A 1 177 ? 19.876 11.568  40.294  1.00 33.34  ? 173 HIS A CD2 1 
ATOM   1082 C CE1 . HIS A 1 177 ? 18.782 9.678   40.139  1.00 33.72  ? 173 HIS A CE1 1 
ATOM   1083 N NE2 . HIS A 1 177 ? 19.748 10.396  39.597  1.00 31.95  ? 173 HIS A NE2 1 
ATOM   1084 N N   . SER A 1 178 ? 19.248 15.079  44.392  1.00 38.43  ? 174 SER A N   1 
ATOM   1085 C CA  . SER A 1 178 ? 18.652 16.064  45.288  1.00 39.92  ? 174 SER A CA  1 
ATOM   1086 C C   . SER A 1 178 ? 18.903 17.469  44.720  1.00 42.21  ? 174 SER A C   1 
ATOM   1087 O O   . SER A 1 178 ? 18.274 18.431  45.150  1.00 41.65  ? 174 SER A O   1 
ATOM   1088 C CB  . SER A 1 178 ? 19.228 15.954  46.698  1.00 36.25  ? 174 SER A CB  1 
ATOM   1089 O OG  . SER A 1 178 ? 20.520 16.512  46.760  1.00 37.00  ? 174 SER A OG  1 
ATOM   1090 N N   . PHE A 1 179 ? 19.832 17.581  43.766  1.00 42.56  ? 175 PHE A N   1 
ATOM   1091 C CA  . PHE A 1 179 ? 20.102 18.866  43.104  1.00 42.64  ? 175 PHE A CA  1 
ATOM   1092 C C   . PHE A 1 179 ? 19.443 18.873  41.725  1.00 41.42  ? 175 PHE A C   1 
ATOM   1093 O O   . PHE A 1 179 ? 19.668 19.788  40.940  1.00 41.58  ? 175 PHE A O   1 
ATOM   1094 C CB  . PHE A 1 179 ? 21.597 19.103  42.882  1.00 43.19  ? 175 PHE A CB  1 
ATOM   1095 C CG  . PHE A 1 179 ? 22.368 19.348  44.132  1.00 48.37  ? 175 PHE A CG  1 
ATOM   1096 C CD1 . PHE A 1 179 ? 23.210 18.357  44.652  1.00 46.58  ? 175 PHE A CD1 1 
ATOM   1097 C CD2 . PHE A 1 179 ? 22.245 20.568  44.814  1.00 48.17  ? 175 PHE A CD2 1 
ATOM   1098 C CE1 . PHE A 1 179 ? 23.922 18.565  45.833  1.00 48.08  ? 175 PHE A CE1 1 
ATOM   1099 C CE2 . PHE A 1 179 ? 22.953 20.793  46.003  1.00 49.18  ? 175 PHE A CE2 1 
ATOM   1100 C CZ  . PHE A 1 179 ? 23.796 19.785  46.515  1.00 50.68  ? 175 PHE A CZ  1 
ATOM   1101 N N   . GLY A 1 180 ? 18.644 17.849  41.426  1.00 41.84  ? 176 GLY A N   1 
ATOM   1102 C CA  . GLY A 1 180 ? 18.013 17.750  40.117  1.00 40.31  ? 176 GLY A CA  1 
ATOM   1103 C C   . GLY A 1 180 ? 18.972 17.315  38.995  1.00 40.32  ? 176 GLY A C   1 
ATOM   1104 O O   . GLY A 1 180 ? 18.612 17.336  37.806  1.00 40.00  ? 176 GLY A O   1 
ATOM   1105 N N   . ILE A 1 181 ? 20.196 16.936  39.357  1.00 37.80  ? 177 ILE A N   1 
ATOM   1106 C CA  . ILE A 1 181 ? 21.194 16.503  38.380  1.00 37.37  ? 177 ILE A CA  1 
ATOM   1107 C C   . ILE A 1 181 ? 21.091 14.980  38.109  1.00 36.98  ? 177 ILE A C   1 
ATOM   1108 O O   . ILE A 1 181 ? 21.069 14.169  39.047  1.00 35.34  ? 177 ILE A O   1 
ATOM   1109 C CB  . ILE A 1 181 ? 22.602 16.836  38.878  1.00 39.32  ? 177 ILE A CB  1 
ATOM   1110 C CG1 . ILE A 1 181 ? 22.767 18.359  38.991  1.00 39.80  ? 177 ILE A CG1 1 
ATOM   1111 C CG2 . ILE A 1 181 ? 23.661 16.262  37.942  1.00 37.39  ? 177 ILE A CG2 1 
ATOM   1112 C CD1 . ILE A 1 181 ? 24.089 18.772  39.637  1.00 39.09  ? 177 ILE A CD1 1 
ATOM   1113 N N   . CYS A 1 182 ? 20.999 14.617  36.825  1.00 36.47  ? 178 CYS A N   1 
ATOM   1114 C CA  . CYS A 1 182 ? 20.891 13.211  36.383  1.00 34.51  ? 178 CYS A CA  1 
ATOM   1115 C C   . CYS A 1 182 ? 22.223 12.882  35.727  1.00 33.58  ? 178 CYS A C   1 
ATOM   1116 O O   . CYS A 1 182 ? 22.706 13.645  34.884  1.00 34.26  ? 178 CYS A O   1 
ATOM   1117 C CB  . CYS A 1 182 ? 19.756 13.038  35.361  1.00 34.41  ? 178 CYS A CB  1 
ATOM   1118 S SG  . CYS A 1 182 ? 19.431 11.262  34.814  1.00 36.74  ? 178 CYS A SG  1 
ATOM   1119 N N   . HIS A 1 183 ? 22.821 11.748  36.092  1.00 30.95  ? 179 HIS A N   1 
ATOM   1120 C CA  . HIS A 1 183 ? 24.136 11.387  35.531  1.00 28.91  ? 179 HIS A CA  1 
ATOM   1121 C C   . HIS A 1 183 ? 24.022 11.015  34.039  1.00 29.22  ? 179 HIS A C   1 
ATOM   1122 O O   . HIS A 1 183 ? 24.849 11.431  33.211  1.00 27.84  ? 179 HIS A O   1 
ATOM   1123 C CB  . HIS A 1 183 ? 24.728 10.221  36.348  1.00 29.69  ? 179 HIS A CB  1 
ATOM   1124 C CG  . HIS A 1 183 ? 26.103 9.819   35.912  1.00 30.44  ? 179 HIS A CG  1 
ATOM   1125 N ND1 . HIS A 1 183 ? 26.336 9.061   34.785  1.00 30.66  ? 179 HIS A ND1 1 
ATOM   1126 C CD2 . HIS A 1 183 ? 27.319 10.094  36.438  1.00 30.45  ? 179 HIS A CD2 1 
ATOM   1127 C CE1 . HIS A 1 183 ? 27.636 8.877   34.642  1.00 29.01  ? 179 HIS A CE1 1 
ATOM   1128 N NE2 . HIS A 1 183 ? 28.255 9.491   35.631  1.00 31.80  ? 179 HIS A NE2 1 
ATOM   1129 N N   . ARG A 1 184 ? 22.992 10.227  33.719  1.00 28.74  ? 180 ARG A N   1 
ATOM   1130 C CA  . ARG A 1 184 ? 22.693 9.777   32.360  1.00 31.94  ? 180 ARG A CA  1 
ATOM   1131 C C   . ARG A 1 184 ? 23.660 8.779   31.709  1.00 32.58  ? 180 ARG A C   1 
ATOM   1132 O O   . ARG A 1 184 ? 23.461 8.438   30.541  1.00 34.44  ? 180 ARG A O   1 
ATOM   1133 C CB  . ARG A 1 184 ? 22.478 10.979  31.406  1.00 31.56  ? 180 ARG A CB  1 
ATOM   1134 C CG  . ARG A 1 184 ? 21.385 11.952  31.908  1.00 33.92  ? 180 ARG A CG  1 
ATOM   1135 C CD  . ARG A 1 184 ? 20.795 12.822  30.787  1.00 32.39  ? 180 ARG A CD  1 
ATOM   1136 N NE  . ARG A 1 184 ? 21.793 13.696  30.176  1.00 32.33  ? 180 ARG A NE  1 
ATOM   1137 C CZ  . ARG A 1 184 ? 21.532 14.545  29.183  1.00 31.62  ? 180 ARG A CZ  1 
ATOM   1138 N NH1 . ARG A 1 184 ? 20.311 14.637  28.687  1.00 31.23  ? 180 ARG A NH1 1 
ATOM   1139 N NH2 . ARG A 1 184 ? 22.500 15.297  28.682  1.00 30.58  ? 180 ARG A NH2 1 
ATOM   1140 N N   . ASP A 1 185 ? 24.694 8.320   32.421  1.00 34.08  ? 181 ASP A N   1 
ATOM   1141 C CA  . ASP A 1 185 ? 25.604 7.315   31.829  1.00 33.04  ? 181 ASP A CA  1 
ATOM   1142 C C   . ASP A 1 185 ? 26.136 6.371   32.913  1.00 30.70  ? 181 ASP A C   1 
ATOM   1143 O O   . ASP A 1 185 ? 27.343 6.140   33.019  1.00 32.64  ? 181 ASP A O   1 
ATOM   1144 C CB  . ASP A 1 185 ? 26.762 8.008   31.079  1.00 36.66  ? 181 ASP A CB  1 
ATOM   1145 C CG  . ASP A 1 185 ? 27.485 7.073   30.065  1.00 39.90  ? 181 ASP A CG  1 
ATOM   1146 O OD1 . ASP A 1 185 ? 26.906 6.050   29.621  1.00 40.55  ? 181 ASP A OD1 1 
ATOM   1147 O OD2 . ASP A 1 185 ? 28.646 7.381   29.704  1.00 42.94  ? 181 ASP A OD2 1 
ATOM   1148 N N   . ILE A 1 186 ? 25.225 5.844   33.725  1.00 29.49  ? 182 ILE A N   1 
ATOM   1149 C CA  . ILE A 1 186 ? 25.607 4.926   34.779  1.00 30.32  ? 182 ILE A CA  1 
ATOM   1150 C C   . ILE A 1 186 ? 25.951 3.571   34.118  1.00 31.27  ? 182 ILE A C   1 
ATOM   1151 O O   . ILE A 1 186 ? 25.131 2.989   33.420  1.00 30.99  ? 182 ILE A O   1 
ATOM   1152 C CB  . ILE A 1 186 ? 24.464 4.741   35.799  1.00 29.39  ? 182 ILE A CB  1 
ATOM   1153 C CG1 . ILE A 1 186 ? 24.189 6.082   36.529  1.00 28.02  ? 182 ILE A CG1 1 
ATOM   1154 C CG2 . ILE A 1 186 ? 24.824 3.618   36.825  1.00 27.84  ? 182 ILE A CG2 1 
ATOM   1155 C CD1 . ILE A 1 186 ? 25.345 6.613   37.333  1.00 27.66  ? 182 ILE A CD1 1 
ATOM   1156 N N   . LYS A 1 187 ? 27.174 3.107   34.326  1.00 32.38  ? 183 LYS A N   1 
ATOM   1157 C CA  . LYS A 1 187 ? 27.629 1.815   33.782  1.00 33.75  ? 183 LYS A CA  1 
ATOM   1158 C C   . LYS A 1 187 ? 28.866 1.385   34.581  1.00 32.83  ? 183 LYS A C   1 
ATOM   1159 O O   . LYS A 1 187 ? 29.515 2.226   35.222  1.00 32.95  ? 183 LYS A O   1 
ATOM   1160 C CB  . LYS A 1 187 ? 27.955 1.949   32.282  1.00 32.47  ? 183 LYS A CB  1 
ATOM   1161 C CG  . LYS A 1 187 ? 29.086 2.925   31.984  1.00 33.42  ? 183 LYS A CG  1 
ATOM   1162 C CD  . LYS A 1 187 ? 29.208 3.148   30.490  1.00 38.07  ? 183 LYS A CD  1 
ATOM   1163 C CE  . LYS A 1 187 ? 30.305 4.132   30.153  1.00 39.40  ? 183 LYS A CE  1 
ATOM   1164 N NZ  . LYS A 1 187 ? 30.404 4.150   28.679  1.00 45.60  ? 183 LYS A NZ  1 
ATOM   1165 N N   . PRO A 1 188 ? 29.216 0.079   34.560  1.00 32.49  ? 184 PRO A N   1 
ATOM   1166 C CA  . PRO A 1 188 ? 30.388 -0.407  35.316  1.00 32.11  ? 184 PRO A CA  1 
ATOM   1167 C C   . PRO A 1 188 ? 31.693 0.367   35.115  1.00 32.41  ? 184 PRO A C   1 
ATOM   1168 O O   . PRO A 1 188 ? 32.453 0.573   36.051  1.00 30.23  ? 184 PRO A O   1 
ATOM   1169 C CB  . PRO A 1 188 ? 30.512 -1.869  34.878  1.00 32.80  ? 184 PRO A CB  1 
ATOM   1170 C CG  . PRO A 1 188 ? 29.055 -2.252  34.630  1.00 31.53  ? 184 PRO A CG  1 
ATOM   1171 C CD  . PRO A 1 188 ? 28.540 -1.032  33.857  1.00 30.00  ? 184 PRO A CD  1 
ATOM   1172 N N   . GLN A 1 189 ? 31.960 0.805   33.897  1.00 33.65  ? 185 GLN A N   1 
ATOM   1173 C CA  . GLN A 1 189 ? 33.194 1.555   33.673  1.00 35.95  ? 185 GLN A CA  1 
ATOM   1174 C C   . GLN A 1 189 ? 33.234 2.922   34.377  1.00 34.41  ? 185 GLN A C   1 
ATOM   1175 O O   . GLN A 1 189 ? 34.295 3.497   34.503  1.00 31.58  ? 185 GLN A O   1 
ATOM   1176 C CB  . GLN A 1 189 ? 33.407 1.766   32.180  1.00 40.62  ? 185 GLN A CB  1 
ATOM   1177 C CG  . GLN A 1 189 ? 33.564 0.461   31.431  1.00 47.92  ? 185 GLN A CG  1 
ATOM   1178 C CD  . GLN A 1 189 ? 33.487 0.645   29.941  1.00 52.42  ? 185 GLN A CD  1 
ATOM   1179 O OE1 . GLN A 1 189 ? 34.412 1.183   29.323  1.00 57.73  ? 185 GLN A OE1 1 
ATOM   1180 N NE2 . GLN A 1 189 ? 32.380 0.213   29.346  1.00 53.74  ? 185 GLN A NE2 1 
ATOM   1181 N N   . ASN A 1 190 ? 32.079 3.437   34.806  1.00 32.37  ? 186 ASN A N   1 
ATOM   1182 C CA  . ASN A 1 190 ? 32.044 4.736   35.495  1.00 33.66  ? 186 ASN A CA  1 
ATOM   1183 C C   . ASN A 1 190 ? 31.924 4.640   37.003  1.00 31.77  ? 186 ASN A C   1 
ATOM   1184 O O   . ASN A 1 190 ? 31.648 5.644   37.669  1.00 31.44  ? 186 ASN A O   1 
ATOM   1185 C CB  . ASN A 1 190 ? 30.910 5.621   34.946  1.00 32.11  ? 186 ASN A CB  1 
ATOM   1186 C CG  . ASN A 1 190 ? 31.209 6.111   33.551  1.00 33.89  ? 186 ASN A CG  1 
ATOM   1187 O OD1 . ASN A 1 190 ? 32.370 6.187   33.175  1.00 36.45  ? 186 ASN A OD1 1 
ATOM   1188 N ND2 . ASN A 1 190 ? 30.176 6.447   32.772  1.00 34.38  ? 186 ASN A ND2 1 
ATOM   1189 N N   . LEU A 1 191 ? 32.130 3.437   37.534  1.00 31.86  ? 187 LEU A N   1 
ATOM   1190 C CA  . LEU A 1 191 ? 32.071 3.185   38.970  1.00 32.10  ? 187 LEU A CA  1 
ATOM   1191 C C   . LEU A 1 191 ? 33.477 2.784   39.404  1.00 34.86  ? 187 LEU A C   1 
ATOM   1192 O O   . LEU A 1 191 ? 33.923 1.655   39.129  1.00 33.66  ? 187 LEU A O   1 
ATOM   1193 C CB  . LEU A 1 191 ? 31.071 2.062   39.268  1.00 30.95  ? 187 LEU A CB  1 
ATOM   1194 C CG  . LEU A 1 191 ? 29.709 2.299   38.618  1.00 33.88  ? 187 LEU A CG  1 
ATOM   1195 C CD1 . LEU A 1 191 ? 28.776 1.104   38.862  1.00 30.49  ? 187 LEU A CD1 1 
ATOM   1196 C CD2 . LEU A 1 191 ? 29.108 3.619   39.192  1.00 33.82  ? 187 LEU A CD2 1 
ATOM   1197 N N   . LEU A 1 192 ? 34.169 3.713   40.075  1.00 35.70  ? 188 LEU A N   1 
ATOM   1198 C CA  . LEU A 1 192 ? 35.533 3.487   40.538  1.00 37.08  ? 188 LEU A CA  1 
ATOM   1199 C C   . LEU A 1 192 ? 35.526 2.785   41.880  1.00 37.71  ? 188 LEU A C   1 
ATOM   1200 O O   . LEU A 1 192 ? 34.653 3.033   42.708  1.00 36.70  ? 188 LEU A O   1 
ATOM   1201 C CB  . LEU A 1 192 ? 36.288 4.817   40.645  1.00 36.66  ? 188 LEU A CB  1 
ATOM   1202 C CG  . LEU A 1 192 ? 36.248 5.672   39.372  1.00 39.61  ? 188 LEU A CG  1 
ATOM   1203 C CD1 . LEU A 1 192 ? 37.054 6.960   39.595  1.00 39.20  ? 188 LEU A CD1 1 
ATOM   1204 C CD2 . LEU A 1 192 ? 36.798 4.890   38.182  1.00 38.36  ? 188 LEU A CD2 1 
ATOM   1205 N N   . LEU A 1 193 ? 36.515 1.920   42.091  1.00 37.82  ? 189 LEU A N   1 
ATOM   1206 C CA  . LEU A 1 193 ? 36.617 1.135   43.324  1.00 40.32  ? 189 LEU A CA  1 
ATOM   1207 C C   . LEU A 1 193 ? 37.993 1.096   43.935  1.00 39.69  ? 189 LEU A C   1 
ATOM   1208 O O   . LEU A 1 193 ? 38.971 0.942   43.224  1.00 37.60  ? 189 LEU A O   1 
ATOM   1209 C CB  . LEU A 1 193 ? 36.293 -0.336  43.058  1.00 41.68  ? 189 LEU A CB  1 
ATOM   1210 C CG  . LEU A 1 193 ? 34.947 -0.799  42.549  1.00 45.48  ? 189 LEU A CG  1 
ATOM   1211 C CD1 . LEU A 1 193 ? 35.020 -2.279  42.153  1.00 43.48  ? 189 LEU A CD1 1 
ATOM   1212 C CD2 . LEU A 1 193 ? 33.915 -0.562  43.654  1.00 46.66  ? 189 LEU A CD2 1 
ATOM   1213 N N   . ASP A 1 194 ? 38.066 1.198   45.254  1.00 43.29  ? 190 ASP A N   1 
ATOM   1214 C CA  . ASP A 1 194 ? 39.349 1.021   45.898  1.00 46.61  ? 190 ASP A CA  1 
ATOM   1215 C C   . ASP A 1 194 ? 39.280 -0.395  46.478  1.00 48.07  ? 190 ASP A C   1 
ATOM   1216 O O   . ASP A 1 194 ? 38.494 -0.679  47.377  1.00 47.42  ? 190 ASP A O   1 
ATOM   1217 C CB  . ASP A 1 194 ? 39.595 2.007   47.018  1.00 49.49  ? 190 ASP A CB  1 
ATOM   1218 C CG  . ASP A 1 194 ? 40.949 1.783   47.672  1.00 53.29  ? 190 ASP A CG  1 
ATOM   1219 O OD1 . ASP A 1 194 ? 41.124 0.740   48.332  1.00 53.57  ? 190 ASP A OD1 1 
ATOM   1220 O OD2 . ASP A 1 194 ? 41.842 2.636   47.505  1.00 55.68  ? 190 ASP A OD2 1 
ATOM   1221 N N   . PRO A 1 195 ? 40.087 -1.311  45.934  1.00 51.39  ? 191 PRO A N   1 
ATOM   1222 C CA  . PRO A 1 195 ? 40.195 -2.724  46.326  1.00 52.81  ? 191 PRO A CA  1 
ATOM   1223 C C   . PRO A 1 195 ? 40.320 -2.955  47.828  1.00 53.17  ? 191 PRO A C   1 
ATOM   1224 O O   . PRO A 1 195 ? 39.645 -3.807  48.395  1.00 54.67  ? 191 PRO A O   1 
ATOM   1225 C CB  . PRO A 1 195 ? 41.454 -3.185  45.602  1.00 53.72  ? 191 PRO A CB  1 
ATOM   1226 C CG  . PRO A 1 195 ? 41.436 -2.365  44.356  1.00 54.57  ? 191 PRO A CG  1 
ATOM   1227 C CD  . PRO A 1 195 ? 41.039 -0.989  44.853  1.00 52.30  ? 191 PRO A CD  1 
ATOM   1228 N N   . ASP A 1 196 ? 41.162 -2.173  48.486  1.00 52.79  ? 192 ASP A N   1 
ATOM   1229 C CA  . ASP A 1 196 ? 41.362 -2.378  49.909  1.00 52.65  ? 192 ASP A CA  1 
ATOM   1230 C C   . ASP A 1 196 ? 40.355 -1.773  50.884  1.00 52.76  ? 192 ASP A C   1 
ATOM   1231 O O   . ASP A 1 196 ? 40.082 -2.380  51.928  1.00 53.00  ? 192 ASP A O   1 
ATOM   1232 C CB  . ASP A 1 196 ? 42.781 -1.945  50.287  1.00 54.60  ? 192 ASP A CB  1 
ATOM   1233 C CG  . ASP A 1 196 ? 43.850 -2.628  49.417  1.00 57.33  ? 192 ASP A CG  1 
ATOM   1234 O OD1 . ASP A 1 196 ? 43.734 -3.858  49.166  1.00 55.05  ? 192 ASP A OD1 1 
ATOM   1235 O OD2 . ASP A 1 196 ? 44.799 -1.930  48.985  1.00 58.77  ? 192 ASP A OD2 1 
ATOM   1236 N N   . THR A 1 197 ? 39.790 -0.608  50.568  1.00 49.60  ? 193 THR A N   1 
ATOM   1237 C CA  . THR A 1 197 ? 38.839 0.018   51.488  1.00 47.75  ? 193 THR A CA  1 
ATOM   1238 C C   . THR A 1 197 ? 37.386 -0.247  51.132  1.00 45.50  ? 193 THR A C   1 
ATOM   1239 O O   . THR A 1 197 ? 36.483 0.043   51.922  1.00 45.05  ? 193 THR A O   1 
ATOM   1240 C CB  . THR A 1 197 ? 39.030 1.533   51.533  1.00 48.71  ? 193 THR A CB  1 
ATOM   1241 O OG1 . THR A 1 197 ? 38.858 2.064   50.212  1.00 49.58  ? 193 THR A OG1 1 
ATOM   1242 C CG2 . THR A 1 197 ? 40.434 1.879   52.041  1.00 48.79  ? 193 THR A CG2 1 
ATOM   1243 N N   . ALA A 1 198 ? 37.175 -0.786  49.935  1.00 44.14  ? 194 ALA A N   1 
ATOM   1244 C CA  . ALA A 1 198 ? 35.850 -1.095  49.409  1.00 42.07  ? 194 ALA A CA  1 
ATOM   1245 C C   . ALA A 1 198 ? 35.009 0.170   49.166  1.00 40.08  ? 194 ALA A C   1 
ATOM   1246 O O   . ALA A 1 198 ? 33.779 0.118   49.138  1.00 37.95  ? 194 ALA A O   1 
ATOM   1247 C CB  . ALA A 1 198 ? 35.113 -2.069  50.343  1.00 40.35  ? 194 ALA A CB  1 
ATOM   1248 N N   . VAL A 1 199 ? 35.692 1.299   48.998  1.00 39.55  ? 195 VAL A N   1 
ATOM   1249 C CA  . VAL A 1 199 ? 35.040 2.577   48.708  1.00 38.52  ? 195 VAL A CA  1 
ATOM   1250 C C   . VAL A 1 199 ? 34.746 2.653   47.210  1.00 37.57  ? 195 VAL A C   1 
ATOM   1251 O O   . VAL A 1 199 ? 35.590 2.292   46.374  1.00 38.86  ? 195 VAL A O   1 
ATOM   1252 C CB  . VAL A 1 199 ? 35.958 3.775   49.072  1.00 40.41  ? 195 VAL A CB  1 
ATOM   1253 C CG1 . VAL A 1 199 ? 35.394 5.083   48.462  1.00 39.01  ? 195 VAL A CG1 1 
ATOM   1254 C CG2 . VAL A 1 199 ? 36.065 3.893   50.600  1.00 37.33  ? 195 VAL A CG2 1 
ATOM   1255 N N   . LEU A 1 200 ? 33.541 3.098   46.866  1.00 35.99  ? 196 LEU A N   1 
ATOM   1256 C CA  . LEU A 1 200 ? 33.167 3.248   45.472  1.00 34.31  ? 196 LEU A CA  1 
ATOM   1257 C C   . LEU A 1 200 ? 32.923 4.742   45.170  1.00 36.33  ? 196 LEU A C   1 
ATOM   1258 O O   . LEU A 1 200 ? 32.299 5.450   45.968  1.00 37.03  ? 196 LEU A O   1 
ATOM   1259 C CB  . LEU A 1 200 ? 31.898 2.449   45.147  1.00 33.14  ? 196 LEU A CB  1 
ATOM   1260 C CG  . LEU A 1 200 ? 31.324 2.677   43.724  1.00 35.58  ? 196 LEU A CG  1 
ATOM   1261 C CD1 . LEU A 1 200 ? 30.642 1.400   43.201  1.00 34.65  ? 196 LEU A CD1 1 
ATOM   1262 C CD2 . LEU A 1 200 ? 30.315 3.844   43.759  1.00 33.37  ? 196 LEU A CD2 1 
ATOM   1263 N N   . LYS A 1 201 ? 33.400 5.209   44.022  1.00 34.29  ? 197 LYS A N   1 
ATOM   1264 C CA  . LYS A 1 201 ? 33.179 6.593   43.629  1.00 34.53  ? 197 LYS A CA  1 
ATOM   1265 C C   . LYS A 1 201 ? 32.640 6.653   42.204  1.00 32.73  ? 197 LYS A C   1 
ATOM   1266 O O   . LYS A 1 201 ? 33.174 6.025   41.292  1.00 30.40  ? 197 LYS A O   1 
ATOM   1267 C CB  . LYS A 1 201 ? 34.473 7.427   43.708  1.00 36.65  ? 197 LYS A CB  1 
ATOM   1268 C CG  . LYS A 1 201 ? 35.009 7.688   45.130  1.00 38.27  ? 197 LYS A CG  1 
ATOM   1269 C CD  . LYS A 1 201 ? 36.310 8.505   45.063  1.00 42.59  ? 197 LYS A CD  1 
ATOM   1270 C CE  . LYS A 1 201 ? 37.012 8.602   46.434  1.00 43.80  ? 197 LYS A CE  1 
ATOM   1271 N NZ  . LYS A 1 201 ? 36.104 9.076   47.500  1.00 48.44  ? 197 LYS A NZ  1 
ATOM   1272 N N   . LEU A 1 202 ? 31.558 7.406   42.037  1.00 31.43  ? 198 LEU A N   1 
ATOM   1273 C CA  . LEU A 1 202 ? 30.935 7.622   40.739  1.00 31.20  ? 198 LEU A CA  1 
ATOM   1274 C C   . LEU A 1 202 ? 31.816 8.649   39.997  1.00 33.50  ? 198 LEU A C   1 
ATOM   1275 O O   . LEU A 1 202 ? 32.325 9.594   40.615  1.00 33.66  ? 198 LEU A O   1 
ATOM   1276 C CB  . LEU A 1 202 ? 29.516 8.171   40.958  1.00 30.21  ? 198 LEU A CB  1 
ATOM   1277 C CG  . LEU A 1 202 ? 28.703 8.586   39.733  1.00 34.06  ? 198 LEU A CG  1 
ATOM   1278 C CD1 . LEU A 1 202 ? 28.501 7.375   38.804  1.00 31.56  ? 198 LEU A CD1 1 
ATOM   1279 C CD2 . LEU A 1 202 ? 27.347 9.157   40.189  1.00 33.65  ? 198 LEU A CD2 1 
ATOM   1280 N N   . CYS A 1 203 ? 32.028 8.462   38.697  1.00 32.73  ? 199 CYS A N   1 
ATOM   1281 C CA  . CYS A 1 203 ? 32.831 9.400   37.923  1.00 35.88  ? 199 CYS A CA  1 
ATOM   1282 C C   . CYS A 1 203 ? 32.228 9.632   36.540  1.00 36.19  ? 199 CYS A C   1 
ATOM   1283 O O   . CYS A 1 203 ? 31.208 9.025   36.178  1.00 35.17  ? 199 CYS A O   1 
ATOM   1284 C CB  . CYS A 1 203 ? 34.282 8.906   37.758  1.00 38.14  ? 199 CYS A CB  1 
ATOM   1285 S SG  . CYS A 1 203 ? 34.465 7.529   36.590  1.00 38.66  ? 199 CYS A SG  1 
ATOM   1286 N N   . ASP A 1 204 ? 32.883 10.513  35.785  1.00 36.74  ? 200 ASP A N   1 
ATOM   1287 C CA  . ASP A 1 204 ? 32.510 10.907  34.415  1.00 37.92  ? 200 ASP A CA  1 
ATOM   1288 C C   . ASP A 1 204 ? 31.162 11.599  34.318  1.00 38.67  ? 200 ASP A C   1 
ATOM   1289 O O   . ASP A 1 204 ? 30.126 10.969  34.048  1.00 38.12  ? 200 ASP A O   1 
ATOM   1290 C CB  . ASP A 1 204 ? 32.516 9.714   33.452  1.00 43.77  ? 200 ASP A CB  1 
ATOM   1291 C CG  . ASP A 1 204 ? 32.350 10.145  31.987  1.00 51.89  ? 200 ASP A CG  1 
ATOM   1292 O OD1 . ASP A 1 204 ? 32.178 11.372  31.718  1.00 52.75  ? 200 ASP A OD1 1 
ATOM   1293 O OD2 . ASP A 1 204 ? 32.390 9.257   31.098  1.00 53.29  ? 200 ASP A OD2 1 
ATOM   1294 N N   . PHE A 1 205 ? 31.167 12.910  34.537  1.00 36.32  ? 201 PHE A N   1 
ATOM   1295 C CA  . PHE A 1 205 ? 29.932 13.667  34.456  1.00 35.88  ? 201 PHE A CA  1 
ATOM   1296 C C   . PHE A 1 205 ? 29.763 14.356  33.097  1.00 35.52  ? 201 PHE A C   1 
ATOM   1297 O O   . PHE A 1 205 ? 29.043 15.352  32.970  1.00 37.09  ? 201 PHE A O   1 
ATOM   1298 C CB  . PHE A 1 205 ? 29.866 14.668  35.628  1.00 36.14  ? 201 PHE A CB  1 
ATOM   1299 C CG  . PHE A 1 205 ? 29.550 14.010  36.943  1.00 35.76  ? 201 PHE A CG  1 
ATOM   1300 C CD1 . PHE A 1 205 ? 30.501 13.230  37.593  1.00 37.14  ? 201 PHE A CD1 1 
ATOM   1301 C CD2 . PHE A 1 205 ? 28.279 14.092  37.478  1.00 34.71  ? 201 PHE A CD2 1 
ATOM   1302 C CE1 . PHE A 1 205 ? 30.176 12.540  38.754  1.00 37.22  ? 201 PHE A CE1 1 
ATOM   1303 C CE2 . PHE A 1 205 ? 27.939 13.403  38.647  1.00 34.72  ? 201 PHE A CE2 1 
ATOM   1304 C CZ  . PHE A 1 205 ? 28.879 12.629  39.282  1.00 36.82  ? 201 PHE A CZ  1 
ATOM   1305 N N   . GLY A 1 206 ? 30.409 13.796  32.082  1.00 35.04  ? 202 GLY A N   1 
ATOM   1306 C CA  . GLY A 1 206 ? 30.336 14.329  30.729  1.00 33.78  ? 202 GLY A CA  1 
ATOM   1307 C C   . GLY A 1 206 ? 28.965 14.277  30.084  1.00 35.92  ? 202 GLY A C   1 
ATOM   1308 O O   . GLY A 1 206 ? 28.736 14.959  29.096  1.00 34.80  ? 202 GLY A O   1 
ATOM   1309 N N   . SER A 1 207 ? 28.039 13.479  30.612  1.00 35.60  ? 203 SER A N   1 
ATOM   1310 C CA  . SER A 1 207 ? 26.681 13.425  30.043  1.00 34.79  ? 203 SER A CA  1 
ATOM   1311 C C   . SER A 1 207 ? 25.665 13.995  31.041  1.00 33.65  ? 203 SER A C   1 
ATOM   1312 O O   . SER A 1 207 ? 24.483 14.112  30.721  1.00 32.79  ? 203 SER A O   1 
ATOM   1313 C CB  . SER A 1 207 ? 26.258 11.962  29.766  1.00 35.99  ? 203 SER A CB  1 
ATOM   1314 O OG  . SER A 1 207 ? 27.086 11.326  28.824  1.00 38.93  ? 203 SER A OG  1 
ATOM   1315 N N   . ALA A 1 208 ? 26.123 14.324  32.248  1.00 33.23  ? 204 ALA A N   1 
ATOM   1316 C CA  . ALA A 1 208 ? 25.223 14.782  33.290  1.00 35.69  ? 204 ALA A CA  1 
ATOM   1317 C C   . ALA A 1 208 ? 24.524 16.086  32.923  1.00 36.73  ? 204 ALA A C   1 
ATOM   1318 O O   . ALA A 1 208 ? 25.087 16.918  32.214  1.00 36.28  ? 204 ALA A O   1 
ATOM   1319 C CB  . ALA A 1 208 ? 25.987 14.955  34.614  1.00 33.82  ? 204 ALA A CB  1 
ATOM   1320 N N   . LYS A 1 209 ? 23.314 16.257  33.441  1.00 37.59  ? 205 LYS A N   1 
ATOM   1321 C CA  . LYS A 1 209 ? 22.547 17.453  33.167  1.00 39.79  ? 205 LYS A CA  1 
ATOM   1322 C C   . LYS A 1 209 ? 21.429 17.660  34.173  1.00 40.62  ? 205 LYS A C   1 
ATOM   1323 O O   . LYS A 1 209 ? 20.822 16.697  34.660  1.00 39.05  ? 205 LYS A O   1 
ATOM   1324 C CB  . LYS A 1 209 ? 21.942 17.370  31.774  1.00 42.90  ? 205 LYS A CB  1 
ATOM   1325 C CG  . LYS A 1 209 ? 21.330 18.677  31.305  1.00 46.21  ? 205 LYS A CG  1 
ATOM   1326 C CD  . LYS A 1 209 ? 20.441 18.447  30.101  1.00 50.43  ? 205 LYS A CD  1 
ATOM   1327 C CE  . LYS A 1 209 ? 19.685 19.727  29.714  1.00 49.81  ? 205 LYS A CE  1 
ATOM   1328 N NZ  . LYS A 1 209 ? 18.620 19.367  28.746  1.00 50.78  ? 205 LYS A NZ  1 
ATOM   1329 N N   . GLN A 1 210 ? 21.150 18.918  34.509  1.00 42.65  ? 206 GLN A N   1 
ATOM   1330 C CA  . GLN A 1 210 ? 20.054 19.173  35.428  1.00 44.98  ? 206 GLN A CA  1 
ATOM   1331 C C   . GLN A 1 210 ? 18.777 18.998  34.648  1.00 43.65  ? 206 GLN A C   1 
ATOM   1332 O O   . GLN A 1 210 ? 18.584 19.654  33.649  1.00 47.32  ? 206 GLN A O   1 
ATOM   1333 C CB  . GLN A 1 210 ? 20.117 20.586  35.999  1.00 49.18  ? 206 GLN A CB  1 
ATOM   1334 C CG  . GLN A 1 210 ? 18.870 20.907  36.820  1.00 56.25  ? 206 GLN A CG  1 
ATOM   1335 C CD  . GLN A 1 210 ? 19.038 22.118  37.710  1.00 59.11  ? 206 GLN A CD  1 
ATOM   1336 O OE1 . GLN A 1 210 ? 19.775 23.046  37.379  1.00 59.82  ? 206 GLN A OE1 1 
ATOM   1337 N NE2 . GLN A 1 210 ? 18.339 22.121  38.844  1.00 60.20  ? 206 GLN A NE2 1 
ATOM   1338 N N   . LEU A 1 211 ? 17.894 18.113  35.079  1.00 43.84  ? 207 LEU A N   1 
ATOM   1339 C CA  . LEU A 1 211 ? 16.658 17.909  34.344  1.00 44.42  ? 207 LEU A CA  1 
ATOM   1340 C C   . LEU A 1 211 ? 15.575 18.820  34.904  1.00 47.73  ? 207 LEU A C   1 
ATOM   1341 O O   . LEU A 1 211 ? 15.329 18.833  36.104  1.00 48.27  ? 207 LEU A O   1 
ATOM   1342 C CB  . LEU A 1 211 ? 16.210 16.447  34.431  1.00 41.90  ? 207 LEU A CB  1 
ATOM   1343 C CG  . LEU A 1 211 ? 17.247 15.408  33.930  1.00 39.50  ? 207 LEU A CG  1 
ATOM   1344 C CD1 . LEU A 1 211 ? 16.599 14.042  33.892  1.00 38.13  ? 207 LEU A CD1 1 
ATOM   1345 C CD2 . LEU A 1 211 ? 17.775 15.786  32.546  1.00 36.83  ? 207 LEU A CD2 1 
ATOM   1346 N N   . VAL A 1 212 ? 14.942 19.586  34.023  1.00 49.83  ? 208 VAL A N   1 
ATOM   1347 C CA  . VAL A 1 212 ? 13.889 20.513  34.416  1.00 51.81  ? 208 VAL A CA  1 
ATOM   1348 C C   . VAL A 1 212 ? 12.558 20.141  33.790  1.00 52.47  ? 208 VAL A C   1 
ATOM   1349 O O   . VAL A 1 212 ? 12.465 19.956  32.582  1.00 51.74  ? 208 VAL A O   1 
ATOM   1350 C CB  . VAL A 1 212 ? 14.232 21.955  33.986  1.00 52.58  ? 208 VAL A CB  1 
ATOM   1351 C CG1 . VAL A 1 212 ? 13.044 22.895  34.276  1.00 53.30  ? 208 VAL A CG1 1 
ATOM   1352 C CG2 . VAL A 1 212 ? 15.465 22.433  34.725  1.00 50.99  ? 208 VAL A CG2 1 
ATOM   1353 N N   . ARG A 1 213 ? 11.532 20.025  34.621  1.00 55.61  ? 209 ARG A N   1 
ATOM   1354 C CA  . ARG A 1 213 ? 10.179 19.716  34.157  1.00 59.74  ? 209 ARG A CA  1 
ATOM   1355 C C   . ARG A 1 213 ? 9.828  20.528  32.919  1.00 59.68  ? 209 ARG A C   1 
ATOM   1356 O O   . ARG A 1 213 ? 10.118 21.726  32.851  1.00 58.78  ? 209 ARG A O   1 
ATOM   1357 C CB  . ARG A 1 213 ? 9.157  20.083  35.223  1.00 63.69  ? 209 ARG A CB  1 
ATOM   1358 C CG  . ARG A 1 213 ? 9.020  19.104  36.341  1.00 68.91  ? 209 ARG A CG  1 
ATOM   1359 C CD  . ARG A 1 213 ? 8.186  17.954  35.890  1.00 73.95  ? 209 ARG A CD  1 
ATOM   1360 N NE  . ARG A 1 213 ? 7.516  17.330  37.026  1.00 78.05  ? 209 ARG A NE  1 
ATOM   1361 C CZ  . ARG A 1 213 ? 6.585  16.385  36.906  1.00 80.73  ? 209 ARG A CZ  1 
ATOM   1362 N NH1 . ARG A 1 213 ? 6.219  15.954  35.693  1.00 82.02  ? 209 ARG A NH1 1 
ATOM   1363 N NH2 . ARG A 1 213 ? 6.000  15.886  37.995  1.00 81.61  ? 209 ARG A NH2 1 
ATOM   1364 N N   . GLY A 1 214 ? 9.198  19.875  31.950  1.00 59.71  ? 210 GLY A N   1 
ATOM   1365 C CA  . GLY A 1 214 ? 8.803  20.566  30.741  1.00 59.23  ? 210 GLY A CA  1 
ATOM   1366 C C   . GLY A 1 214 ? 9.890  20.844  29.724  1.00 59.29  ? 210 GLY A C   1 
ATOM   1367 O O   . GLY A 1 214 ? 9.586  21.263  28.608  1.00 60.39  ? 210 GLY A O   1 
ATOM   1368 N N   . GLU A 1 215 ? 11.155 20.649  30.080  1.00 58.10  ? 211 GLU A N   1 
ATOM   1369 C CA  . GLU A 1 215 ? 12.214 20.892  29.105  1.00 57.02  ? 211 GLU A CA  1 
ATOM   1370 C C   . GLU A 1 215 ? 12.635 19.551  28.502  1.00 54.41  ? 211 GLU A C   1 
ATOM   1371 O O   . GLU A 1 215 ? 12.884 18.584  29.228  1.00 53.59  ? 211 GLU A O   1 
ATOM   1372 C CB  . GLU A 1 215 ? 13.416 21.566  29.762  1.00 59.05  ? 211 GLU A CB  1 
ATOM   1373 C CG  . GLU A 1 215 ? 13.066 22.783  30.576  1.00 64.85  ? 211 GLU A CG  1 
ATOM   1374 C CD  . GLU A 1 215 ? 14.300 23.542  31.052  1.00 68.30  ? 211 GLU A CD  1 
ATOM   1375 O OE1 . GLU A 1 215 ? 15.369 22.899  31.212  1.00 70.66  ? 211 GLU A OE1 1 
ATOM   1376 O OE2 . GLU A 1 215 ? 14.196 24.772  31.278  1.00 70.17  ? 211 GLU A OE2 1 
ATOM   1377 N N   . PRO A 1 216 ? 12.716 19.477  27.163  1.00 52.04  ? 212 PRO A N   1 
ATOM   1378 C CA  . PRO A 1 216 ? 13.105 18.239  26.469  1.00 48.60  ? 212 PRO A CA  1 
ATOM   1379 C C   . PRO A 1 216 ? 14.582 17.901  26.625  1.00 45.43  ? 212 PRO A C   1 
ATOM   1380 O O   . PRO A 1 216 ? 15.417 18.790  26.718  1.00 43.45  ? 212 PRO A O   1 
ATOM   1381 C CB  . PRO A 1 216 ? 12.757 18.528  24.997  1.00 49.44  ? 212 PRO A CB  1 
ATOM   1382 C CG  . PRO A 1 216 ? 11.783 19.707  25.072  1.00 52.00  ? 212 PRO A CG  1 
ATOM   1383 C CD  . PRO A 1 216 ? 12.339 20.524  26.198  1.00 50.85  ? 212 PRO A CD  1 
ATOM   1384 N N   . ASN A 1 217 ? 14.894 16.610  26.628  1.00 43.30  ? 213 ASN A N   1 
ATOM   1385 C CA  . ASN A 1 217 ? 16.280 16.152  26.728  1.00 40.78  ? 213 ASN A CA  1 
ATOM   1386 C C   . ASN A 1 217 ? 16.526 15.061  25.675  1.00 38.37  ? 213 ASN A C   1 
ATOM   1387 O O   . ASN A 1 217 ? 15.623 14.289  25.351  1.00 37.30  ? 213 ASN A O   1 
ATOM   1388 C CB  . ASN A 1 217 ? 16.530 15.640  28.151  1.00 39.35  ? 213 ASN A CB  1 
ATOM   1389 C CG  . ASN A 1 217 ? 16.392 16.761  29.192  1.00 41.14  ? 213 ASN A CG  1 
ATOM   1390 O OD1 . ASN A 1 217 ? 17.190 17.697  29.219  1.00 40.91  ? 213 ASN A OD1 1 
ATOM   1391 N ND2 . ASN A 1 217 ? 15.371 16.674  30.025  1.00 41.02  ? 213 ASN A ND2 1 
ATOM   1392 N N   . VAL A 1 218 ? 17.741 14.990  25.145  1.00 37.34  ? 214 VAL A N   1 
ATOM   1393 C CA  . VAL A 1 218 ? 18.037 13.996  24.118  1.00 38.52  ? 214 VAL A CA  1 
ATOM   1394 C C   . VAL A 1 218 ? 17.884 12.550  24.621  1.00 38.70  ? 214 VAL A C   1 
ATOM   1395 O O   . VAL A 1 218 ? 18.186 12.235  25.771  1.00 37.57  ? 214 VAL A O   1 
ATOM   1396 C CB  . VAL A 1 218 ? 19.444 14.217  23.503  1.00 37.63  ? 214 VAL A CB  1 
ATOM   1397 C CG1 . VAL A 1 218 ? 19.492 15.616  22.857  1.00 37.28  ? 214 VAL A CG1 1 
ATOM   1398 C CG2 . VAL A 1 218 ? 20.530 14.057  24.547  1.00 35.86  ? 214 VAL A CG2 1 
ATOM   1399 N N   . SER A 1 219 ? 17.364 11.673  23.771  1.00 39.30  ? 215 SER A N   1 
ATOM   1400 C CA  . SER A 1 219 ? 17.198 10.299  24.219  1.00 41.01  ? 215 SER A CA  1 
ATOM   1401 C C   . SER A 1 219 ? 18.390 9.431   23.832  1.00 39.73  ? 215 SER A C   1 
ATOM   1402 O O   . SER A 1 219 ? 18.418 8.250   24.160  1.00 41.30  ? 215 SER A O   1 
ATOM   1403 C CB  . SER A 1 219 ? 15.911 9.699   23.648  1.00 43.34  ? 215 SER A CB  1 
ATOM   1404 O OG  . SER A 1 219 ? 15.850 9.897   22.240  1.00 48.23  ? 215 SER A OG  1 
ATOM   1405 N N   . TYR A 1 220 ? 19.391 10.005  23.178  1.00 37.35  ? 216 TYR A N   1 
ATOM   1406 C CA  . TYR A 1 220 ? 20.532 9.187   22.772  1.00 37.90  ? 216 TYR A CA  1 
ATOM   1407 C C   . TYR A 1 220 ? 21.722 9.113   23.734  1.00 36.49  ? 216 TYR A C   1 
ATOM   1408 O O   . TYR A 1 220 ? 22.823 8.769   23.321  1.00 35.05  ? 216 TYR A O   1 
ATOM   1409 C CB  . TYR A 1 220 ? 21.010 9.581   21.364  1.00 36.77  ? 216 TYR A CB  1 
ATOM   1410 C CG  . TYR A 1 220 ? 21.309 11.055  21.178  1.00 39.50  ? 216 TYR A CG  1 
ATOM   1411 C CD1 . TYR A 1 220 ? 22.530 11.583  21.556  1.00 39.72  ? 216 TYR A CD1 1 
ATOM   1412 C CD2 . TYR A 1 220 ? 20.367 11.912  20.605  1.00 39.57  ? 216 TYR A CD2 1 
ATOM   1413 C CE1 . TYR A 1 220 ? 22.821 12.931  21.361  1.00 41.17  ? 216 TYR A CE1 1 
ATOM   1414 C CE2 . TYR A 1 220 ? 20.643 13.256  20.408  1.00 39.53  ? 216 TYR A CE2 1 
ATOM   1415 C CZ  . TYR A 1 220 ? 21.873 13.746  20.783  1.00 41.57  ? 216 TYR A CZ  1 
ATOM   1416 O OH  . TYR A 1 220 ? 22.189 15.046  20.538  1.00 44.03  ? 216 TYR A OH  1 
ATOM   1417 N N   . ILE A 1 221 ? 21.507 9.463   25.002  1.00 36.33  ? 217 ILE A N   1 
ATOM   1418 C CA  . ILE A 1 221 ? 22.576 9.333   25.988  1.00 35.41  ? 217 ILE A CA  1 
ATOM   1419 C C   . ILE A 1 221 ? 22.445 7.926   26.611  1.00 34.47  ? 217 ILE A C   1 
ATOM   1420 O O   . ILE A 1 221 ? 21.488 7.195   26.332  1.00 32.60  ? 217 ILE A O   1 
ATOM   1421 C CB  . ILE A 1 221 ? 22.484 10.425  27.150  1.00 35.54  ? 217 ILE A CB  1 
ATOM   1422 C CG1 . ILE A 1 221 ? 21.030 10.781  27.486  1.00 34.60  ? 217 ILE A CG1 1 
ATOM   1423 C CG2 . ILE A 1 221 ? 23.267 11.695  26.742  1.00 37.25  ? 217 ILE A CG2 1 
ATOM   1424 C CD1 . ILE A 1 221 ? 20.214 9.693   28.128  1.00 31.91  ? 217 ILE A CD1 1 
ATOM   1425 N N   . CYS A 1 222 ? 23.416 7.557   27.435  1.00 35.05  ? 218 CYS A N   1 
ATOM   1426 C CA  . CYS A 1 222 ? 23.416 6.277   28.148  1.00 36.32  ? 218 CYS A CA  1 
ATOM   1427 C C   . CYS A 1 222 ? 23.885 5.095   27.285  1.00 36.30  ? 218 CYS A C   1 
ATOM   1428 O O   . CYS A 1 222 ? 23.472 4.943   26.132  1.00 36.05  ? 218 CYS A O   1 
ATOM   1429 C CB  . CYS A 1 222 ? 22.034 5.989   28.717  1.00 35.24  ? 218 CYS A CB  1 
ATOM   1430 S SG  . CYS A 1 222 ? 22.098 4.772   30.037  1.00 41.39  ? 218 CYS A SG  1 
ATOM   1431 N N   . SER A 1 223 ? 24.744 4.263   27.861  1.00 35.51  ? 219 SER A N   1 
ATOM   1432 C CA  . SER A 1 223 ? 25.307 3.118   27.146  1.00 38.46  ? 219 SER A CA  1 
ATOM   1433 C C   . SER A 1 223 ? 24.388 1.928   26.952  1.00 38.01  ? 219 SER A C   1 
ATOM   1434 O O   . SER A 1 223 ? 23.635 1.559   27.850  1.00 35.07  ? 219 SER A O   1 
ATOM   1435 C CB  . SER A 1 223 ? 26.595 2.711   27.822  1.00 37.17  ? 219 SER A CB  1 
ATOM   1436 O OG  . SER A 1 223 ? 27.446 3.850   27.695  1.00 43.53  ? 219 SER A OG  1 
ATOM   1437 N N   . ARG A 1 224 ? 24.480 1.360   25.752  1.00 39.34  ? 220 ARG A N   1 
ATOM   1438 C CA  . ARG A 1 224 ? 23.682 0.221   25.272  1.00 43.79  ? 220 ARG A CA  1 
ATOM   1439 C C   . ARG A 1 224 ? 22.851 -0.635  26.251  1.00 41.66  ? 220 ARG A C   1 
ATOM   1440 O O   . ARG A 1 224 ? 21.587 -0.513  26.356  1.00 43.39  ? 220 ARG A O   1 
ATOM   1441 C CB  . ARG A 1 224 ? 24.600 -0.718  24.441  1.00 48.71  ? 220 ARG A CB  1 
ATOM   1442 C CG  . ARG A 1 224 ? 26.008 -0.898  25.051  1.00 55.84  ? 220 ARG A CG  1 
ATOM   1443 C CD  . ARG A 1 224 ? 25.927 -1.144  26.589  1.00 58.60  ? 220 ARG A CD  1 
ATOM   1444 N NE  . ARG A 1 224 ? 27.097 -0.677  27.337  1.00 64.20  ? 220 ARG A NE  1 
ATOM   1445 C CZ  . ARG A 1 224 ? 28.316 -1.206  27.254  1.00 65.69  ? 220 ARG A CZ  1 
ATOM   1446 N NH1 . ARG A 1 224 ? 28.539 -2.237  26.445  1.00 66.13  ? 220 ARG A NH1 1 
ATOM   1447 N NH2 . ARG A 1 224 ? 29.313 -0.694  27.981  1.00 66.44  ? 220 ARG A NH2 1 
ATOM   1448 N N   . TYR A 1 225 ? 23.554 -1.514  26.945  1.00 36.63  ? 221 TYR A N   1 
ATOM   1449 C CA  . TYR A 1 225 ? 22.932 -2.443  27.889  1.00 36.82  ? 221 TYR A CA  1 
ATOM   1450 C C   . TYR A 1 225 ? 22.273 -1.821  29.115  1.00 35.40  ? 221 TYR A C   1 
ATOM   1451 O O   . TYR A 1 225 ? 21.449 -2.466  29.769  1.00 31.91  ? 221 TYR A O   1 
ATOM   1452 C CB  . TYR A 1 225 ? 23.988 -3.443  28.420  1.00 39.54  ? 221 TYR A CB  1 
ATOM   1453 C CG  . TYR A 1 225 ? 24.754 -4.201  27.363  1.00 42.98  ? 221 TYR A CG  1 
ATOM   1454 C CD1 . TYR A 1 225 ? 25.914 -4.905  27.695  1.00 45.83  ? 221 TYR A CD1 1 
ATOM   1455 C CD2 . TYR A 1 225 ? 24.336 -4.209  26.038  1.00 45.40  ? 221 TYR A CD2 1 
ATOM   1456 C CE1 . TYR A 1 225 ? 26.643 -5.601  26.731  1.00 47.08  ? 221 TYR A CE1 1 
ATOM   1457 C CE2 . TYR A 1 225 ? 25.057 -4.905  25.055  1.00 50.56  ? 221 TYR A CE2 1 
ATOM   1458 C CZ  . TYR A 1 225 ? 26.211 -5.600  25.418  1.00 50.07  ? 221 TYR A CZ  1 
ATOM   1459 O OH  . TYR A 1 225 ? 26.923 -6.300  24.462  1.00 54.39  ? 221 TYR A OH  1 
ATOM   1460 N N   . TYR A 1 226 ? 22.631 -0.579  29.434  1.00 33.68  ? 222 TYR A N   1 
ATOM   1461 C CA  . TYR A 1 226 ? 22.124 0.054   30.669  1.00 34.55  ? 222 TYR A CA  1 
ATOM   1462 C C   . TYR A 1 226 ? 21.003 1.078   30.496  1.00 33.68  ? 222 TYR A C   1 
ATOM   1463 O O   . TYR A 1 226 ? 20.582 1.711   31.462  1.00 34.13  ? 222 TYR A O   1 
ATOM   1464 C CB  . TYR A 1 226 ? 23.321 0.681   31.405  1.00 31.76  ? 222 TYR A CB  1 
ATOM   1465 C CG  . TYR A 1 226 ? 24.444 -0.328  31.542  1.00 33.82  ? 222 TYR A CG  1 
ATOM   1466 C CD1 . TYR A 1 226 ? 24.423 -1.298  32.566  1.00 32.29  ? 222 TYR A CD1 1 
ATOM   1467 C CD2 . TYR A 1 226 ? 25.470 -0.394  30.587  1.00 32.81  ? 222 TYR A CD2 1 
ATOM   1468 C CE1 . TYR A 1 226 ? 25.383 -2.303  32.625  1.00 33.52  ? 222 TYR A CE1 1 
ATOM   1469 C CE2 . TYR A 1 226 ? 26.452 -1.409  30.639  1.00 33.96  ? 222 TYR A CE2 1 
ATOM   1470 C CZ  . TYR A 1 226 ? 26.393 -2.357  31.658  1.00 33.90  ? 222 TYR A CZ  1 
ATOM   1471 O OH  . TYR A 1 226 ? 27.325 -3.376  31.691  1.00 33.90  ? 222 TYR A OH  1 
ATOM   1472 N N   . ARG A 1 227 ? 20.500 1.206   29.276  1.00 34.34  ? 223 ARG A N   1 
ATOM   1473 C CA  . ARG A 1 227 ? 19.445 2.183   28.964  1.00 34.71  ? 223 ARG A CA  1 
ATOM   1474 C C   . ARG A 1 227 ? 18.042 1.787   29.396  1.00 33.05  ? 223 ARG A C   1 
ATOM   1475 O O   . ARG A 1 227 ? 17.576 0.684   29.118  1.00 30.52  ? 223 ARG A O   1 
ATOM   1476 C CB  . ARG A 1 227 ? 19.421 2.463   27.463  1.00 35.58  ? 223 ARG A CB  1 
ATOM   1477 C CG  . ARG A 1 227 ? 20.777 2.504   26.858  1.00 43.50  ? 223 ARG A CG  1 
ATOM   1478 C CD  . ARG A 1 227 ? 20.872 3.503   25.733  1.00 48.50  ? 223 ARG A CD  1 
ATOM   1479 N NE  . ARG A 1 227 ? 19.874 3.351   24.687  1.00 49.76  ? 223 ARG A NE  1 
ATOM   1480 C CZ  . ARG A 1 227 ? 19.290 4.396   24.094  1.00 52.14  ? 223 ARG A CZ  1 
ATOM   1481 N NH1 . ARG A 1 227 ? 19.614 5.636   24.465  1.00 49.57  ? 223 ARG A NH1 1 
ATOM   1482 N NH2 . ARG A 1 227 ? 18.391 4.212   23.134  1.00 51.51  ? 223 ARG A NH2 1 
ATOM   1483 N N   . ALA A 1 228 ? 17.360 2.714   30.059  1.00 33.17  ? 224 ALA A N   1 
ATOM   1484 C CA  . ALA A 1 228 ? 15.992 2.476   30.510  1.00 33.29  ? 224 ALA A CA  1 
ATOM   1485 C C   . ALA A 1 228 ? 15.106 2.311   29.284  1.00 32.68  ? 224 ALA A C   1 
ATOM   1486 O O   . ALA A 1 228 ? 15.378 2.888   28.240  1.00 32.39  ? 224 ALA A O   1 
ATOM   1487 C CB  . ALA A 1 228 ? 15.485 3.672   31.373  1.00 33.92  ? 224 ALA A CB  1 
ATOM   1488 N N   . PRO A 1 229 ? 14.035 1.513   29.401  1.00 33.51  ? 225 PRO A N   1 
ATOM   1489 C CA  . PRO A 1 229 ? 13.101 1.272   28.294  1.00 36.50  ? 225 PRO A CA  1 
ATOM   1490 C C   . PRO A 1 229 ? 12.597 2.575   27.663  1.00 38.05  ? 225 PRO A C   1 
ATOM   1491 O O   . PRO A 1 229 ? 12.535 2.685   26.431  1.00 37.73  ? 225 PRO A O   1 
ATOM   1492 C CB  . PRO A 1 229 ? 11.944 0.496   28.934  1.00 36.43  ? 225 PRO A CB  1 
ATOM   1493 C CG  . PRO A 1 229 ? 12.469 0.006   30.235  1.00 37.50  ? 225 PRO A CG  1 
ATOM   1494 C CD  . PRO A 1 229 ? 13.557 0.937   30.671  1.00 34.53  ? 225 PRO A CD  1 
ATOM   1495 N N   . GLU A 1 230 ? 12.265 3.567   28.490  1.00 37.35  ? 226 GLU A N   1 
ATOM   1496 C CA  . GLU A 1 230 ? 11.764 4.837   27.939  1.00 36.82  ? 226 GLU A CA  1 
ATOM   1497 C C   . GLU A 1 230 ? 12.789 5.503   27.025  1.00 38.15  ? 226 GLU A C   1 
ATOM   1498 O O   . GLU A 1 230 ? 12.407 6.185   26.067  1.00 38.03  ? 226 GLU A O   1 
ATOM   1499 C CB  . GLU A 1 230 ? 11.311 5.828   29.048  1.00 35.77  ? 226 GLU A CB  1 
ATOM   1500 C CG  . GLU A 1 230 ? 12.408 6.265   30.044  1.00 37.96  ? 226 GLU A CG  1 
ATOM   1501 C CD  . GLU A 1 230 ? 12.490 5.373   31.279  1.00 37.14  ? 226 GLU A CD  1 
ATOM   1502 O OE1 . GLU A 1 230 ? 12.229 4.152   31.145  1.00 37.72  ? 226 GLU A OE1 1 
ATOM   1503 O OE2 . GLU A 1 230 ? 12.833 5.890   32.375  1.00 36.91  ? 226 GLU A OE2 1 
ATOM   1504 N N   . LEU A 1 231 ? 14.088 5.332   27.292  1.00 35.87  ? 227 LEU A N   1 
ATOM   1505 C CA  . LEU A 1 231 ? 15.078 5.922   26.377  1.00 35.64  ? 227 LEU A CA  1 
ATOM   1506 C C   . LEU A 1 231 ? 15.085 5.117   25.061  1.00 36.75  ? 227 LEU A C   1 
ATOM   1507 O O   . LEU A 1 231 ? 15.206 5.687   23.973  1.00 36.21  ? 227 LEU A O   1 
ATOM   1508 C CB  . LEU A 1 231 ? 16.493 5.907   26.981  1.00 34.32  ? 227 LEU A CB  1 
ATOM   1509 C CG  . LEU A 1 231 ? 16.731 6.745   28.256  1.00 36.28  ? 227 LEU A CG  1 
ATOM   1510 C CD1 . LEU A 1 231 ? 18.193 6.530   28.725  1.00 32.72  ? 227 LEU A CD1 1 
ATOM   1511 C CD2 . LEU A 1 231 ? 16.469 8.247   27.997  1.00 31.64  ? 227 LEU A CD2 1 
ATOM   1512 N N   . ILE A 1 232 ? 14.949 3.793   25.164  1.00 36.76  ? 228 ILE A N   1 
ATOM   1513 C CA  . ILE A 1 232 ? 14.947 2.956   23.973  1.00 37.41  ? 228 ILE A CA  1 
ATOM   1514 C C   . ILE A 1 232 ? 13.744 3.391   23.142  1.00 37.84  ? 228 ILE A C   1 
ATOM   1515 O O   . ILE A 1 232 ? 13.854 3.546   21.943  1.00 39.05  ? 228 ILE A O   1 
ATOM   1516 C CB  . ILE A 1 232 ? 14.853 1.439   24.330  1.00 36.18  ? 228 ILE A CB  1 
ATOM   1517 C CG1 . ILE A 1 232 ? 16.090 1.017   25.140  1.00 36.13  ? 228 ILE A CG1 1 
ATOM   1518 C CG2 . ILE A 1 232 ? 14.805 0.602   23.043  1.00 35.43  ? 228 ILE A CG2 1 
ATOM   1519 C CD1 . ILE A 1 232 ? 16.028 -0.421  25.688  1.00 37.37  ? 228 ILE A CD1 1 
ATOM   1520 N N   . PHE A 1 233 ? 12.602 3.605   23.786  1.00 39.73  ? 229 PHE A N   1 
ATOM   1521 C CA  . PHE A 1 233 ? 11.405 4.063   23.074  1.00 41.34  ? 229 PHE A CA  1 
ATOM   1522 C C   . PHE A 1 233 ? 11.500 5.508   22.572  1.00 40.89  ? 229 PHE A C   1 
ATOM   1523 O O   . PHE A 1 233 ? 10.561 6.009   21.969  1.00 42.40  ? 229 PHE A O   1 
ATOM   1524 C CB  . PHE A 1 233 ? 10.156 3.909   23.946  1.00 41.81  ? 229 PHE A CB  1 
ATOM   1525 C CG  . PHE A 1 233 ? 9.701  2.479   24.107  1.00 44.05  ? 229 PHE A CG  1 
ATOM   1526 C CD1 . PHE A 1 233 ? 9.303  1.733   22.999  1.00 44.93  ? 229 PHE A CD1 1 
ATOM   1527 C CD2 . PHE A 1 233 ? 9.656  1.878   25.362  1.00 43.90  ? 229 PHE A CD2 1 
ATOM   1528 C CE1 . PHE A 1 233 ? 8.864  0.400   23.139  1.00 44.83  ? 229 PHE A CE1 1 
ATOM   1529 C CE2 . PHE A 1 233 ? 9.220  0.551   25.505  1.00 44.55  ? 229 PHE A CE2 1 
ATOM   1530 C CZ  . PHE A 1 233 ? 8.825  -0.185  24.386  1.00 43.60  ? 229 PHE A CZ  1 
ATOM   1531 N N   . GLY A 1 234 ? 12.628 6.171   22.810  1.00 40.24  ? 230 GLY A N   1 
ATOM   1532 C CA  . GLY A 1 234 ? 12.811 7.530   22.326  1.00 39.83  ? 230 GLY A CA  1 
ATOM   1533 C C   . GLY A 1 234 ? 12.214 8.713   23.096  1.00 40.76  ? 230 GLY A C   1 
ATOM   1534 O O   . GLY A 1 234 ? 12.102 9.807   22.548  1.00 39.56  ? 230 GLY A O   1 
ATOM   1535 N N   . ALA A 1 235 ? 11.870 8.528   24.364  1.00 39.28  ? 231 ALA A N   1 
ATOM   1536 C CA  . ALA A 1 235 ? 11.279 9.625   25.114  1.00 40.99  ? 231 ALA A CA  1 
ATOM   1537 C C   . ALA A 1 235 ? 12.273 10.743  25.341  1.00 40.72  ? 231 ALA A C   1 
ATOM   1538 O O   . ALA A 1 235 ? 13.479 10.505  25.462  1.00 39.70  ? 231 ALA A O   1 
ATOM   1539 C CB  . ALA A 1 235 ? 10.742 9.132   26.462  1.00 40.76  ? 231 ALA A CB  1 
ATOM   1540 N N   . THR A 1 236 ? 11.761 11.971  25.370  1.00 40.75  ? 232 THR A N   1 
ATOM   1541 C CA  . THR A 1 236 ? 12.587 13.147  25.634  1.00 41.57  ? 232 THR A CA  1 
ATOM   1542 C C   . THR A 1 236 ? 12.089 13.816  26.932  1.00 40.87  ? 232 THR A C   1 
ATOM   1543 O O   . THR A 1 236 ? 12.611 14.845  27.352  1.00 40.14  ? 232 THR A O   1 
ATOM   1544 C CB  . THR A 1 236 ? 12.509 14.176  24.486  1.00 42.74  ? 232 THR A CB  1 
ATOM   1545 O OG1 . THR A 1 236 ? 11.149 14.603  24.343  1.00 42.81  ? 232 THR A OG1 1 
ATOM   1546 C CG2 . THR A 1 236 ? 13.006 13.560  23.179  1.00 41.00  ? 232 THR A CG2 1 
ATOM   1547 N N   . ASP A 1 237 ? 11.084 13.224  27.566  1.00 41.27  ? 233 ASP A N   1 
ATOM   1548 C CA  . ASP A 1 237 ? 10.559 13.776  28.813  1.00 43.28  ? 233 ASP A CA  1 
ATOM   1549 C C   . ASP A 1 237 ? 10.900 12.876  30.028  1.00 41.77  ? 233 ASP A C   1 
ATOM   1550 O O   . ASP A 1 237 ? 10.182 12.889  31.028  1.00 40.29  ? 233 ASP A O   1 
ATOM   1551 C CB  . ASP A 1 237 ? 9.032  13.938  28.728  1.00 45.31  ? 233 ASP A CB  1 
ATOM   1552 C CG  . ASP A 1 237 ? 8.329  12.612  28.627  1.00 49.74  ? 233 ASP A CG  1 
ATOM   1553 O OD1 . ASP A 1 237 ? 7.106  12.556  28.874  1.00 54.09  ? 233 ASP A OD1 1 
ATOM   1554 O OD2 . ASP A 1 237 ? 9.004  11.609  28.300  1.00 51.09  ? 233 ASP A OD2 1 
ATOM   1555 N N   . TYR A 1 238 ? 11.986 12.101  29.934  1.00 38.37  ? 234 TYR A N   1 
ATOM   1556 C CA  . TYR A 1 238 ? 12.390 11.220  31.035  1.00 36.79  ? 234 TYR A CA  1 
ATOM   1557 C C   . TYR A 1 238 ? 12.911 11.989  32.260  1.00 37.63  ? 234 TYR A C   1 
ATOM   1558 O O   . TYR A 1 238 ? 13.281 13.168  32.175  1.00 36.66  ? 234 TYR A O   1 
ATOM   1559 C CB  . TYR A 1 238 ? 13.471 10.239  30.558  1.00 32.41  ? 234 TYR A CB  1 
ATOM   1560 C CG  . TYR A 1 238 ? 14.673 10.931  29.971  1.00 30.69  ? 234 TYR A CG  1 
ATOM   1561 C CD1 . TYR A 1 238 ? 15.693 11.379  30.781  1.00 29.12  ? 234 TYR A CD1 1 
ATOM   1562 C CD2 . TYR A 1 238 ? 14.793 11.127  28.583  1.00 31.65  ? 234 TYR A CD2 1 
ATOM   1563 C CE1 . TYR A 1 238 ? 16.834 12.002  30.229  1.00 30.64  ? 234 TYR A CE1 1 
ATOM   1564 C CE2 . TYR A 1 238 ? 15.922 11.757  28.022  1.00 27.39  ? 234 TYR A CE2 1 
ATOM   1565 C CZ  . TYR A 1 238 ? 16.938 12.183  28.859  1.00 29.54  ? 234 TYR A CZ  1 
ATOM   1566 O OH  . TYR A 1 238 ? 18.068 12.793  28.326  1.00 30.41  ? 234 TYR A OH  1 
ATOM   1567 N N   . THR A 1 239 ? 12.940 11.295  33.395  1.00 38.51  ? 235 THR A N   1 
ATOM   1568 C CA  . THR A 1 239 ? 13.410 11.859  34.657  1.00 39.35  ? 235 THR A CA  1 
ATOM   1569 C C   . THR A 1 239 ? 14.698 11.154  35.122  1.00 38.93  ? 235 THR A C   1 
ATOM   1570 O O   . THR A 1 239 ? 15.254 10.295  34.424  1.00 37.27  ? 235 THR A O   1 
ATOM   1571 C CB  . THR A 1 239 ? 12.383 11.667  35.757  1.00 40.00  ? 235 THR A CB  1 
ATOM   1572 O OG1 . THR A 1 239 ? 12.240 10.258  36.012  1.00 41.21  ? 235 THR A OG1 1 
ATOM   1573 C CG2 . THR A 1 239 ? 11.003 12.249  35.324  1.00 40.24  ? 235 THR A CG2 1 
ATOM   1574 N N   . SER A 1 240 ? 15.147 11.533  36.309  1.00 37.08  ? 236 SER A N   1 
ATOM   1575 C CA  . SER A 1 240 ? 16.346 10.982  36.911  1.00 37.38  ? 236 SER A CA  1 
ATOM   1576 C C   . SER A 1 240 ? 16.204 9.496   37.200  1.00 34.95  ? 236 SER A C   1 
ATOM   1577 O O   . SER A 1 240 ? 17.181 8.830   37.523  1.00 35.62  ? 236 SER A O   1 
ATOM   1578 C CB  . SER A 1 240 ? 16.649 11.724  38.210  1.00 40.13  ? 236 SER A CB  1 
ATOM   1579 O OG  . SER A 1 240 ? 17.164 13.014  37.923  1.00 44.72  ? 236 SER A OG  1 
ATOM   1580 N N   . SER A 1 241 ? 14.990 8.973   37.115  1.00 32.21  ? 237 SER A N   1 
ATOM   1581 C CA  . SER A 1 241 ? 14.820 7.566   37.378  1.00 33.52  ? 237 SER A CA  1 
ATOM   1582 C C   . SER A 1 241 ? 15.482 6.687   36.280  1.00 33.66  ? 237 SER A C   1 
ATOM   1583 O O   . SER A 1 241 ? 15.509 5.454   36.424  1.00 35.37  ? 237 SER A O   1 
ATOM   1584 C CB  . SER A 1 241 ? 13.343 7.221   37.546  1.00 32.32  ? 237 SER A CB  1 
ATOM   1585 O OG  . SER A 1 241 ? 12.631 7.349   36.327  1.00 35.50  ? 237 SER A OG  1 
ATOM   1586 N N   . ILE A 1 242 ? 15.998 7.292   35.199  1.00 31.37  ? 238 ILE A N   1 
ATOM   1587 C CA  . ILE A 1 242 ? 16.696 6.474   34.200  1.00 30.85  ? 238 ILE A CA  1 
ATOM   1588 C C   . ILE A 1 242 ? 18.022 5.979   34.831  1.00 31.37  ? 238 ILE A C   1 
ATOM   1589 O O   . ILE A 1 242 ? 18.513 4.913   34.460  1.00 30.39  ? 238 ILE A O   1 
ATOM   1590 C CB  . ILE A 1 242 ? 17.040 7.232   32.864  1.00 29.38  ? 238 ILE A CB  1 
ATOM   1591 C CG1 . ILE A 1 242 ? 17.927 8.450   33.156  1.00 30.35  ? 238 ILE A CG1 1 
ATOM   1592 C CG2 . ILE A 1 242 ? 15.724 7.621   32.115  1.00 28.76  ? 238 ILE A CG2 1 
ATOM   1593 C CD1 . ILE A 1 242 ? 18.596 9.033   31.897  1.00 31.80  ? 238 ILE A CD1 1 
ATOM   1594 N N   . ASP A 1 243 ? 18.566 6.734   35.799  1.00 30.90  ? 239 ASP A N   1 
ATOM   1595 C CA  . ASP A 1 243 ? 19.795 6.350   36.488  1.00 32.10  ? 239 ASP A CA  1 
ATOM   1596 C C   . ASP A 1 243 ? 19.505 5.142   37.384  1.00 33.41  ? 239 ASP A C   1 
ATOM   1597 O O   . ASP A 1 243 ? 20.376 4.272   37.588  1.00 29.68  ? 239 ASP A O   1 
ATOM   1598 C CB  . ASP A 1 243 ? 20.335 7.463   37.394  1.00 31.49  ? 239 ASP A CB  1 
ATOM   1599 C CG  . ASP A 1 243 ? 21.038 8.571   36.632  1.00 31.60  ? 239 ASP A CG  1 
ATOM   1600 O OD1 . ASP A 1 243 ? 21.370 8.422   35.437  1.00 30.54  ? 239 ASP A OD1 1 
ATOM   1601 O OD2 . ASP A 1 243 ? 21.289 9.622   37.259  1.00 33.33  ? 239 ASP A OD2 1 
ATOM   1602 N N   . VAL A 1 244 ? 18.296 5.109   37.939  1.00 32.02  ? 240 VAL A N   1 
ATOM   1603 C CA  . VAL A 1 244 ? 17.917 4.008   38.806  1.00 32.69  ? 240 VAL A CA  1 
ATOM   1604 C C   . VAL A 1 244 ? 17.818 2.717   38.010  1.00 32.04  ? 240 VAL A C   1 
ATOM   1605 O O   . VAL A 1 244 ? 18.283 1.676   38.482  1.00 30.79  ? 240 VAL A O   1 
ATOM   1606 C CB  . VAL A 1 244 ? 16.599 4.288   39.553  1.00 32.79  ? 240 VAL A CB  1 
ATOM   1607 C CG1 . VAL A 1 244 ? 16.079 3.019   40.185  1.00 31.68  ? 240 VAL A CG1 1 
ATOM   1608 C CG2 . VAL A 1 244 ? 16.861 5.328   40.652  1.00 34.46  ? 240 VAL A CG2 1 
ATOM   1609 N N   . TRP A 1 245 ? 17.227 2.786   36.817  1.00 30.61  ? 241 TRP A N   1 
ATOM   1610 C CA  . TRP A 1 245 ? 17.155 1.595   35.939  1.00 30.57  ? 241 TRP A CA  1 
ATOM   1611 C C   . TRP A 1 245 ? 18.600 1.138   35.646  1.00 29.37  ? 241 TRP A C   1 
ATOM   1612 O O   . TRP A 1 245 ? 18.920 -0.052  35.765  1.00 29.46  ? 241 TRP A O   1 
ATOM   1613 C CB  . TRP A 1 245 ? 16.455 1.922   34.614  1.00 30.32  ? 241 TRP A CB  1 
ATOM   1614 C CG  . TRP A 1 245 ? 16.476 0.766   33.619  1.00 31.58  ? 241 TRP A CG  1 
ATOM   1615 C CD1 . TRP A 1 245 ? 17.502 0.413   32.779  1.00 29.74  ? 241 TRP A CD1 1 
ATOM   1616 C CD2 . TRP A 1 245 ? 15.443 -0.215  33.422  1.00 31.46  ? 241 TRP A CD2 1 
ATOM   1617 N NE1 . TRP A 1 245 ? 17.166 -0.725  32.075  1.00 31.10  ? 241 TRP A NE1 1 
ATOM   1618 C CE2 . TRP A 1 245 ? 15.912 -1.131  32.448  1.00 32.00  ? 241 TRP A CE2 1 
ATOM   1619 C CE3 . TRP A 1 245 ? 14.169 -0.405  33.974  1.00 32.87  ? 241 TRP A CE3 1 
ATOM   1620 C CZ2 . TRP A 1 245 ? 15.145 -2.228  32.005  1.00 31.40  ? 241 TRP A CZ2 1 
ATOM   1621 C CZ3 . TRP A 1 245 ? 13.398 -1.507  33.531  1.00 35.35  ? 241 TRP A CZ3 1 
ATOM   1622 C CH2 . TRP A 1 245 ? 13.900 -2.398  32.554  1.00 33.84  ? 241 TRP A CH2 1 
ATOM   1623 N N   . SER A 1 246 ? 19.467 2.079   35.271  1.00 27.05  ? 242 SER A N   1 
ATOM   1624 C CA  . SER A 1 246 ? 20.853 1.743   34.990  1.00 28.67  ? 242 SER A CA  1 
ATOM   1625 C C   . SER A 1 246 ? 21.520 1.058   36.192  1.00 29.78  ? 242 SER A C   1 
ATOM   1626 O O   . SER A 1 246 ? 22.244 0.063   36.016  1.00 28.35  ? 242 SER A O   1 
ATOM   1627 C CB  . SER A 1 246 ? 21.659 2.996   34.605  1.00 29.56  ? 242 SER A CB  1 
ATOM   1628 O OG  . SER A 1 246 ? 21.198 3.521   33.382  1.00 31.48  ? 242 SER A OG  1 
ATOM   1629 N N   . ALA A 1 247 ? 21.290 1.589   37.403  1.00 26.56  ? 243 ALA A N   1 
ATOM   1630 C CA  . ALA A 1 247 ? 21.877 0.995   38.589  1.00 27.71  ? 243 ALA A CA  1 
ATOM   1631 C C   . ALA A 1 247 ? 21.354 -0.453  38.778  1.00 29.04  ? 243 ALA A C   1 
ATOM   1632 O O   . ALA A 1 247 ? 22.130 -1.355  39.150  1.00 29.33  ? 243 ALA A O   1 
ATOM   1633 C CB  . ALA A 1 247 ? 21.593 1.859   39.848  1.00 25.61  ? 243 ALA A CB  1 
ATOM   1634 N N   . GLY A 1 248 ? 20.061 -0.666  38.529  1.00 28.99  ? 244 GLY A N   1 
ATOM   1635 C CA  . GLY A 1 248 ? 19.481 -2.002  38.618  1.00 29.68  ? 244 GLY A CA  1 
ATOM   1636 C C   . GLY A 1 248 ? 20.161 -2.969  37.631  1.00 31.88  ? 244 GLY A C   1 
ATOM   1637 O O   . GLY A 1 248 ? 20.367 -4.162  37.925  1.00 31.55  ? 244 GLY A O   1 
ATOM   1638 N N   . CYS A 1 249 ? 20.514 -2.473  36.448  1.00 31.24  ? 245 CYS A N   1 
ATOM   1639 C CA  . CYS A 1 249 ? 21.185 -3.311  35.454  1.00 32.38  ? 245 CYS A CA  1 
ATOM   1640 C C   . CYS A 1 249 ? 22.582 -3.710  35.957  1.00 32.89  ? 245 CYS A C   1 
ATOM   1641 O O   . CYS A 1 249 ? 23.041 -4.841  35.702  1.00 32.47  ? 245 CYS A O   1 
ATOM   1642 C CB  . CYS A 1 249 ? 21.311 -2.573  34.113  1.00 31.46  ? 245 CYS A CB  1 
ATOM   1643 S SG  . CYS A 1 249 ? 19.756 -2.417  33.204  1.00 35.41  ? 245 CYS A SG  1 
ATOM   1644 N N   . VAL A 1 250 ? 23.252 -2.794  36.670  1.00 29.39  ? 246 VAL A N   1 
ATOM   1645 C CA  . VAL A 1 250 ? 24.573 -3.087  37.213  1.00 29.77  ? 246 VAL A CA  1 
ATOM   1646 C C   . VAL A 1 250 ? 24.450 -4.137  38.336  1.00 31.51  ? 246 VAL A C   1 
ATOM   1647 O O   . VAL A 1 250 ? 25.243 -5.098  38.392  1.00 31.70  ? 246 VAL A O   1 
ATOM   1648 C CB  . VAL A 1 250 ? 25.266 -1.809  37.753  1.00 29.64  ? 246 VAL A CB  1 
ATOM   1649 C CG1 . VAL A 1 250 ? 26.565 -2.162  38.510  1.00 27.25  ? 246 VAL A CG1 1 
ATOM   1650 C CG2 . VAL A 1 250 ? 25.578 -0.858  36.561  1.00 28.28  ? 246 VAL A CG2 1 
ATOM   1651 N N   . LEU A 1 251 ? 23.475 -3.970  39.224  1.00 30.80  ? 247 LEU A N   1 
ATOM   1652 C CA  . LEU A 1 251 ? 23.273 -4.943  40.293  1.00 32.97  ? 247 LEU A CA  1 
ATOM   1653 C C   . LEU A 1 251 ? 23.013 -6.347  39.678  1.00 33.90  ? 247 LEU A C   1 
ATOM   1654 O O   . LEU A 1 251 ? 23.663 -7.343  40.039  1.00 32.72  ? 247 LEU A O   1 
ATOM   1655 C CB  . LEU A 1 251 ? 22.081 -4.549  41.177  1.00 33.38  ? 247 LEU A CB  1 
ATOM   1656 C CG  . LEU A 1 251 ? 21.511 -5.615  42.137  1.00 33.54  ? 247 LEU A CG  1 
ATOM   1657 C CD1 . LEU A 1 251 ? 22.540 -6.005  43.172  1.00 32.08  ? 247 LEU A CD1 1 
ATOM   1658 C CD2 . LEU A 1 251 ? 20.232 -5.087  42.839  1.00 33.89  ? 247 LEU A CD2 1 
ATOM   1659 N N   . ALA A 1 252 ? 22.056 -6.417  38.771  1.00 32.48  ? 248 ALA A N   1 
ATOM   1660 C CA  . ALA A 1 252 ? 21.722 -7.690  38.136  1.00 33.66  ? 248 ALA A CA  1 
ATOM   1661 C C   . ALA A 1 252 ? 22.968 -8.314  37.490  1.00 35.87  ? 248 ALA A C   1 
ATOM   1662 O O   . ALA A 1 252 ? 23.183 -9.514  37.625  1.00 36.18  ? 248 ALA A O   1 
ATOM   1663 C CB  . ALA A 1 252 ? 20.647 -7.486  37.102  1.00 30.87  ? 248 ALA A CB  1 
ATOM   1664 N N   . GLU A 1 253 ? 23.787 -7.495  36.813  1.00 35.83  ? 249 GLU A N   1 
ATOM   1665 C CA  . GLU A 1 253 ? 25.004 -7.964  36.159  1.00 35.35  ? 249 GLU A CA  1 
ATOM   1666 C C   . GLU A 1 253 ? 26.037 -8.546  37.147  1.00 35.81  ? 249 GLU A C   1 
ATOM   1667 O O   . GLU A 1 253 ? 26.715 -9.544  36.839  1.00 33.98  ? 249 GLU A O   1 
ATOM   1668 C CB  . GLU A 1 253 ? 25.660 -6.821  35.349  1.00 36.87  ? 249 GLU A CB  1 
ATOM   1669 C CG  . GLU A 1 253 ? 26.894 -7.243  34.550  1.00 35.91  ? 249 GLU A CG  1 
ATOM   1670 C CD  . GLU A 1 253 ? 27.326 -6.219  33.493  1.00 39.32  ? 249 GLU A CD  1 
ATOM   1671 O OE1 . GLU A 1 253 ? 26.503 -5.362  33.083  1.00 39.40  ? 249 GLU A OE1 1 
ATOM   1672 O OE2 . GLU A 1 253 ? 28.492 -6.284  33.038  1.00 38.14  ? 249 GLU A OE2 1 
ATOM   1673 N N   . LEU A 1 254 ? 26.186 -7.907  38.307  1.00 33.97  ? 250 LEU A N   1 
ATOM   1674 C CA  . LEU A 1 254 ? 27.122 -8.378  39.305  1.00 35.26  ? 250 LEU A CA  1 
ATOM   1675 C C   . LEU A 1 254 ? 26.616 -9.710  39.889  1.00 38.17  ? 250 LEU A C   1 
ATOM   1676 O O   . LEU A 1 254 ? 27.412 -10.587 40.201  1.00 39.56  ? 250 LEU A O   1 
ATOM   1677 C CB  . LEU A 1 254 ? 27.284 -7.343  40.417  1.00 34.35  ? 250 LEU A CB  1 
ATOM   1678 C CG  . LEU A 1 254 ? 28.000 -6.059  40.008  1.00 33.65  ? 250 LEU A CG  1 
ATOM   1679 C CD1 . LEU A 1 254 ? 28.019 -5.104  41.177  1.00 36.17  ? 250 LEU A CD1 1 
ATOM   1680 C CD2 . LEU A 1 254 ? 29.413 -6.366  39.527  1.00 34.63  ? 250 LEU A CD2 1 
ATOM   1681 N N   . LEU A 1 255 ? 25.299 -9.864  40.010  1.00 37.28  ? 251 LEU A N   1 
ATOM   1682 C CA  . LEU A 1 255 ? 24.722 -11.093 40.547  1.00 39.06  ? 251 LEU A CA  1 
ATOM   1683 C C   . LEU A 1 255 ? 24.835 -12.222 39.533  1.00 39.44  ? 251 LEU A C   1 
ATOM   1684 O O   . LEU A 1 255 ? 25.192 -13.351 39.875  1.00 39.98  ? 251 LEU A O   1 
ATOM   1685 C CB  . LEU A 1 255 ? 23.247 -10.881 40.914  1.00 36.83  ? 251 LEU A CB  1 
ATOM   1686 C CG  . LEU A 1 255 ? 23.052 -9.926  42.092  1.00 38.73  ? 251 LEU A CG  1 
ATOM   1687 C CD1 . LEU A 1 255 ? 21.562 -9.649  42.282  1.00 39.17  ? 251 LEU A CD1 1 
ATOM   1688 C CD2 . LEU A 1 255 ? 23.683 -10.531 43.366  1.00 38.78  ? 251 LEU A CD2 1 
ATOM   1689 N N   . LEU A 1 256 ? 24.575 -11.899 38.277  1.00 40.04  ? 252 LEU A N   1 
ATOM   1690 C CA  . LEU A 1 256 ? 24.606 -12.876 37.209  1.00 41.10  ? 252 LEU A CA  1 
ATOM   1691 C C   . LEU A 1 256 ? 25.947 -13.261 36.609  1.00 40.89  ? 252 LEU A C   1 
ATOM   1692 O O   . LEU A 1 256 ? 26.107 -14.391 36.187  1.00 41.75  ? 252 LEU A O   1 
ATOM   1693 C CB  . LEU A 1 256 ? 23.713 -12.409 36.070  1.00 43.41  ? 252 LEU A CB  1 
ATOM   1694 C CG  . LEU A 1 256 ? 22.236 -12.739 36.205  1.00 49.11  ? 252 LEU A CG  1 
ATOM   1695 C CD1 . LEU A 1 256 ? 21.413 -11.790 35.310  1.00 49.24  ? 252 LEU A CD1 1 
ATOM   1696 C CD2 . LEU A 1 256 ? 22.012 -14.219 35.829  1.00 48.15  ? 252 LEU A CD2 1 
ATOM   1697 N N   . GLY A 1 257 ? 26.890 -12.329 36.525  1.00 39.52  ? 253 GLY A N   1 
ATOM   1698 C CA  . GLY A 1 257 ? 28.170 -12.645 35.922  1.00 38.97  ? 253 GLY A CA  1 
ATOM   1699 C C   . GLY A 1 257 ? 28.227 -12.173 34.472  1.00 40.01  ? 253 GLY A C   1 
ATOM   1700 O O   . GLY A 1 257 ? 29.254 -12.339 33.800  1.00 40.49  ? 253 GLY A O   1 
ATOM   1701 N N   . GLN A 1 258 ? 27.122 -11.602 33.981  1.00 38.64  ? 254 GLN A N   1 
ATOM   1702 C CA  . GLN A 1 258 ? 27.040 -11.052 32.615  1.00 37.59  ? 254 GLN A CA  1 
ATOM   1703 C C   . GLN A 1 258 ? 25.880 -10.032 32.544  1.00 36.32  ? 254 GLN A C   1 
ATOM   1704 O O   . GLN A 1 258 ? 24.989 -10.037 33.390  1.00 34.21  ? 254 GLN A O   1 
ATOM   1705 C CB  . GLN A 1 258 ? 26.785 -12.165 31.582  1.00 39.98  ? 254 GLN A CB  1 
ATOM   1706 C CG  . GLN A 1 258 ? 25.566 -13.036 31.896  1.00 45.35  ? 254 GLN A CG  1 
ATOM   1707 C CD  . GLN A 1 258 ? 25.381 -14.199 30.888  1.00 51.91  ? 254 GLN A CD  1 
ATOM   1708 O OE1 . GLN A 1 258 ? 24.658 -14.073 29.889  1.00 52.84  ? 254 GLN A OE1 1 
ATOM   1709 N NE2 . GLN A 1 258 ? 26.044 -15.330 31.151  1.00 51.67  ? 254 GLN A NE2 1 
ATOM   1710 N N   . PRO A 1 259 ? 25.874 -9.162  31.523  1.00 35.95  ? 255 PRO A N   1 
ATOM   1711 C CA  . PRO A 1 259 ? 24.799 -8.160  31.385  1.00 35.84  ? 255 PRO A CA  1 
ATOM   1712 C C   . PRO A 1 259 ? 23.426 -8.832  31.358  1.00 36.92  ? 255 PRO A C   1 
ATOM   1713 O O   . PRO A 1 259 ? 23.245 -9.883  30.745  1.00 36.79  ? 255 PRO A O   1 
ATOM   1714 C CB  . PRO A 1 259 ? 25.127 -7.478  30.066  1.00 35.11  ? 255 PRO A CB  1 
ATOM   1715 C CG  . PRO A 1 259 ? 26.637 -7.572  30.011  1.00 37.03  ? 255 PRO A CG  1 
ATOM   1716 C CD  . PRO A 1 259 ? 26.915 -8.983  30.495  1.00 33.79  ? 255 PRO A CD  1 
ATOM   1717 N N   . ILE A 1 260 ? 22.443 -8.245  32.016  1.00 36.96  ? 256 ILE A N   1 
ATOM   1718 C CA  . ILE A 1 260 ? 21.138 -8.887  32.013  1.00 37.92  ? 256 ILE A CA  1 
ATOM   1719 C C   . ILE A 1 260 ? 20.286 -8.589  30.779  1.00 38.46  ? 256 ILE A C   1 
ATOM   1720 O O   . ILE A 1 260 ? 19.456 -9.427  30.385  1.00 36.94  ? 256 ILE A O   1 
ATOM   1721 C CB  . ILE A 1 260 ? 20.340 -8.544  33.281  1.00 39.79  ? 256 ILE A CB  1 
ATOM   1722 C CG1 . ILE A 1 260 ? 19.098 -9.438  33.349  1.00 40.60  ? 256 ILE A CG1 1 
ATOM   1723 C CG2 . ILE A 1 260 ? 19.966 -7.036  33.303  1.00 39.86  ? 256 ILE A CG2 1 
ATOM   1724 C CD1 . ILE A 1 260 ? 18.326 -9.290  34.614  1.00 42.01  ? 256 ILE A CD1 1 
ATOM   1725 N N   . PHE A 1 261 ? 20.491 -7.430  30.149  1.00 35.28  ? 257 PHE A N   1 
ATOM   1726 C CA  . PHE A 1 261 ? 19.687 -7.096  28.968  1.00 38.42  ? 257 PHE A CA  1 
ATOM   1727 C C   . PHE A 1 261 ? 20.547 -6.757  27.750  1.00 38.78  ? 257 PHE A C   1 
ATOM   1728 O O   . PHE A 1 261 ? 20.505 -5.631  27.241  1.00 40.82  ? 257 PHE A O   1 
ATOM   1729 C CB  . PHE A 1 261 ? 18.760 -5.903  29.288  1.00 36.27  ? 257 PHE A CB  1 
ATOM   1730 C CG  . PHE A 1 261 ? 17.798 -6.158  30.427  1.00 37.27  ? 257 PHE A CG  1 
ATOM   1731 C CD1 . PHE A 1 261 ? 17.060 -7.359  30.491  1.00 37.09  ? 257 PHE A CD1 1 
ATOM   1732 C CD2 . PHE A 1 261 ? 17.579 -5.182  31.409  1.00 36.15  ? 257 PHE A CD2 1 
ATOM   1733 C CE1 . PHE A 1 261 ? 16.119 -7.581  31.513  1.00 35.96  ? 257 PHE A CE1 1 
ATOM   1734 C CE2 . PHE A 1 261 ? 16.635 -5.390  32.446  1.00 37.07  ? 257 PHE A CE2 1 
ATOM   1735 C CZ  . PHE A 1 261 ? 15.902 -6.592  32.497  1.00 36.35  ? 257 PHE A CZ  1 
ATOM   1736 N N   . PRO A 1 262 ? 21.335 -7.720  27.256  1.00 39.33  ? 258 PRO A N   1 
ATOM   1737 C CA  . PRO A 1 262 ? 22.184 -7.417  26.092  1.00 38.69  ? 258 PRO A CA  1 
ATOM   1738 C C   . PRO A 1 262 ? 21.382 -7.375  24.798  1.00 37.69  ? 258 PRO A C   1 
ATOM   1739 O O   . PRO A 1 262 ? 20.206 -7.735  24.779  1.00 36.63  ? 258 PRO A O   1 
ATOM   1740 C CB  . PRO A 1 262 ? 23.206 -8.562  26.104  1.00 39.43  ? 258 PRO A CB  1 
ATOM   1741 C CG  . PRO A 1 262 ? 22.323 -9.744  26.524  1.00 40.14  ? 258 PRO A CG  1 
ATOM   1742 C CD  . PRO A 1 262 ? 21.479 -9.130  27.672  1.00 40.88  ? 258 PRO A CD  1 
ATOM   1743 N N   . GLY A 1 263 ? 22.028 -6.915  23.730  1.00 38.63  ? 259 GLY A N   1 
ATOM   1744 C CA  . GLY A 1 263 ? 21.402 -6.828  22.422  1.00 38.85  ? 259 GLY A CA  1 
ATOM   1745 C C   . GLY A 1 263 ? 22.095 -5.744  21.619  1.00 41.33  ? 259 GLY A C   1 
ATOM   1746 O O   . GLY A 1 263 ? 22.469 -4.703  22.166  1.00 41.12  ? 259 GLY A O   1 
ATOM   1747 N N   . ASP A 1 264 ? 22.284 -5.985  20.327  1.00 42.23  ? 260 ASP A N   1 
ATOM   1748 C CA  . ASP A 1 264 ? 22.937 -5.016  19.447  1.00 42.73  ? 260 ASP A CA  1 
ATOM   1749 C C   . ASP A 1 264 ? 21.986 -3.950  18.919  1.00 39.77  ? 260 ASP A C   1 
ATOM   1750 O O   . ASP A 1 264 ? 22.434 -2.916  18.452  1.00 39.87  ? 260 ASP A O   1 
ATOM   1751 C CB  . ASP A 1 264 ? 23.597 -5.741  18.269  1.00 49.08  ? 260 ASP A CB  1 
ATOM   1752 C CG  . ASP A 1 264 ? 24.730 -6.663  18.721  1.00 54.41  ? 260 ASP A CG  1 
ATOM   1753 O OD1 . ASP A 1 264 ? 25.167 -7.514  17.910  1.00 58.02  ? 260 ASP A OD1 1 
ATOM   1754 O OD2 . ASP A 1 264 ? 25.178 -6.527  19.891  1.00 55.89  ? 260 ASP A OD2 1 
ATOM   1755 N N   . SER A 1 265 ? 20.682 -4.208  18.968  1.00 37.76  ? 261 SER A N   1 
ATOM   1756 C CA  . SER A 1 265 ? 19.696 -3.225  18.536  1.00 36.25  ? 261 SER A CA  1 
ATOM   1757 C C   . SER A 1 265 ? 18.723 -2.959  19.680  1.00 34.93  ? 261 SER A C   1 
ATOM   1758 O O   . SER A 1 265 ? 18.633 -3.748  20.625  1.00 34.29  ? 261 SER A O   1 
ATOM   1759 C CB  . SER A 1 265 ? 18.904 -3.739  17.326  1.00 35.80  ? 261 SER A CB  1 
ATOM   1760 O OG  . SER A 1 265 ? 18.040 -4.799  17.723  1.00 38.28  ? 261 SER A OG  1 
ATOM   1761 N N   . GLY A 1 266 ? 17.988 -1.846  19.594  1.00 35.28  ? 262 GLY A N   1 
ATOM   1762 C CA  . GLY A 1 266 ? 17.009 -1.535  20.619  1.00 33.96  ? 262 GLY A CA  1 
ATOM   1763 C C   . GLY A 1 266 ? 15.968 -2.660  20.666  1.00 35.72  ? 262 GLY A C   1 
ATOM   1764 O O   . GLY A 1 266 ? 15.492 -3.045  21.735  1.00 32.70  ? 262 GLY A O   1 
ATOM   1765 N N   . VAL A 1 267 ? 15.611 -3.189  19.504  1.00 36.14  ? 263 VAL A N   1 
ATOM   1766 C CA  . VAL A 1 267 ? 14.642 -4.284  19.420  1.00 39.02  ? 263 VAL A CA  1 
ATOM   1767 C C   . VAL A 1 267 ? 15.164 -5.504  20.198  1.00 39.21  ? 263 VAL A C   1 
ATOM   1768 O O   . VAL A 1 267 ? 14.438 -6.102  20.996  1.00 39.93  ? 263 VAL A O   1 
ATOM   1769 C CB  . VAL A 1 267 ? 14.392 -4.732  17.933  1.00 41.23  ? 263 VAL A CB  1 
ATOM   1770 C CG1 . VAL A 1 267 ? 13.408 -5.902  17.903  1.00 42.49  ? 263 VAL A CG1 1 
ATOM   1771 C CG2 . VAL A 1 267 ? 13.844 -3.588  17.121  1.00 42.32  ? 263 VAL A CG2 1 
ATOM   1772 N N   . ASP A 1 268 ? 16.411 -5.893  19.962  1.00 39.57  ? 264 ASP A N   1 
ATOM   1773 C CA  . ASP A 1 268 ? 16.950 -7.048  20.696  1.00 41.21  ? 264 ASP A CA  1 
ATOM   1774 C C   . ASP A 1 268 ? 16.957 -6.798  22.213  1.00 41.17  ? 264 ASP A C   1 
ATOM   1775 O O   . ASP A 1 268 ? 16.644 -7.701  22.998  1.00 40.16  ? 264 ASP A O   1 
ATOM   1776 C CB  . ASP A 1 268 ? 18.361 -7.394  20.214  1.00 43.44  ? 264 ASP A CB  1 
ATOM   1777 C CG  . ASP A 1 268 ? 18.368 -7.905  18.772  1.00 48.28  ? 264 ASP A CG  1 
ATOM   1778 O OD1 . ASP A 1 268 ? 17.333 -8.466  18.341  1.00 48.43  ? 264 ASP A OD1 1 
ATOM   1779 O OD2 . ASP A 1 268 ? 19.402 -7.756  18.079  1.00 51.74  ? 264 ASP A OD2 1 
ATOM   1780 N N   . GLN A 1 269 ? 17.289 -5.572  22.614  1.00 37.49  ? 265 GLN A N   1 
ATOM   1781 C CA  . GLN A 1 269 ? 17.313 -5.230  24.021  1.00 37.55  ? 265 GLN A CA  1 
ATOM   1782 C C   . GLN A 1 269 ? 15.917 -5.368  24.626  1.00 36.70  ? 265 GLN A C   1 
ATOM   1783 O O   . GLN A 1 269 ? 15.752 -5.979  25.694  1.00 34.37  ? 265 GLN A O   1 
ATOM   1784 C CB  . GLN A 1 269 ? 17.863 -3.798  24.231  1.00 36.78  ? 265 GLN A CB  1 
ATOM   1785 C CG  . GLN A 1 269 ? 19.370 -3.704  23.985  1.00 38.52  ? 265 GLN A CG  1 
ATOM   1786 C CD  . GLN A 1 269 ? 19.861 -2.289  23.655  1.00 43.24  ? 265 GLN A CD  1 
ATOM   1787 O OE1 . GLN A 1 269 ? 19.209 -1.294  23.978  1.00 41.10  ? 265 GLN A OE1 1 
ATOM   1788 N NE2 . GLN A 1 269 ? 21.024 -2.202  22.995  1.00 44.94  ? 265 GLN A NE2 1 
ATOM   1789 N N   . LEU A 1 270 ? 14.922 -4.804  23.951  1.00 36.01  ? 266 LEU A N   1 
ATOM   1790 C CA  . LEU A 1 270 ? 13.548 -4.868  24.432  1.00 38.89  ? 266 LEU A CA  1 
ATOM   1791 C C   . LEU A 1 270 ? 13.055 -6.327  24.551  1.00 39.99  ? 266 LEU A C   1 
ATOM   1792 O O   . LEU A 1 270 ? 12.293 -6.663  25.454  1.00 39.02  ? 266 LEU A O   1 
ATOM   1793 C CB  . LEU A 1 270 ? 12.625 -4.058  23.522  1.00 38.87  ? 266 LEU A CB  1 
ATOM   1794 C CG  . LEU A 1 270 ? 12.781 -2.536  23.641  1.00 40.45  ? 266 LEU A CG  1 
ATOM   1795 C CD1 . LEU A 1 270 ? 11.962 -1.846  22.572  1.00 40.51  ? 266 LEU A CD1 1 
ATOM   1796 C CD2 . LEU A 1 270 ? 12.335 -2.069  25.022  1.00 39.45  ? 266 LEU A CD2 1 
ATOM   1797 N N   . VAL A 1 271 ? 13.504 -7.197  23.659  1.00 41.18  ? 267 VAL A N   1 
ATOM   1798 C CA  . VAL A 1 271 ? 13.103 -8.596  23.755  1.00 42.87  ? 267 VAL A CA  1 
ATOM   1799 C C   . VAL A 1 271 ? 13.678 -9.250  25.026  1.00 41.84  ? 267 VAL A C   1 
ATOM   1800 O O   . VAL A 1 271 ? 12.989 -10.030 25.702  1.00 42.11  ? 267 VAL A O   1 
ATOM   1801 C CB  . VAL A 1 271 ? 13.547 -9.372  22.502  1.00 43.43  ? 267 VAL A CB  1 
ATOM   1802 C CG1 . VAL A 1 271 ? 13.450 -10.878 22.747  1.00 43.39  ? 267 VAL A CG1 1 
ATOM   1803 C CG2 . VAL A 1 271 ? 12.677 -8.931  21.318  1.00 42.99  ? 267 VAL A CG2 1 
ATOM   1804 N N   . GLU A 1 272 ? 14.927 -8.938  25.362  1.00 40.00  ? 268 GLU A N   1 
ATOM   1805 C CA  . GLU A 1 272 ? 15.511 -9.502  26.579  1.00 40.39  ? 268 GLU A CA  1 
ATOM   1806 C C   . GLU A 1 272 ? 14.783 -8.942  27.797  1.00 40.02  ? 268 GLU A C   1 
ATOM   1807 O O   . GLU A 1 272 ? 14.586 -9.638  28.807  1.00 39.61  ? 268 GLU A O   1 
ATOM   1808 C CB  . GLU A 1 272 ? 17.013 -9.172  26.672  1.00 42.92  ? 268 GLU A CB  1 
ATOM   1809 C CG  . GLU A 1 272 ? 17.831 -9.782  25.553  1.00 45.72  ? 268 GLU A CG  1 
ATOM   1810 C CD  . GLU A 1 272 ? 17.640 -11.302 25.473  1.00 50.77  ? 268 GLU A CD  1 
ATOM   1811 O OE1 . GLU A 1 272 ? 17.567 -11.844 24.343  1.00 52.90  ? 268 GLU A OE1 1 
ATOM   1812 O OE2 . GLU A 1 272 ? 17.563 -11.957 26.543  1.00 51.23  ? 268 GLU A OE2 1 
ATOM   1813 N N   . ILE A 1 273 ? 14.375 -7.679  27.711  1.00 38.64  ? 269 ILE A N   1 
ATOM   1814 C CA  . ILE A 1 273 ? 13.669 -7.066  28.827  1.00 38.48  ? 269 ILE A CA  1 
ATOM   1815 C C   . ILE A 1 273 ? 12.291 -7.714  28.999  1.00 40.74  ? 269 ILE A C   1 
ATOM   1816 O O   . ILE A 1 273 ? 11.870 -8.012  30.121  1.00 41.59  ? 269 ILE A O   1 
ATOM   1817 C CB  . ILE A 1 273 ? 13.507 -5.543  28.622  1.00 35.50  ? 269 ILE A CB  1 
ATOM   1818 C CG1 . ILE A 1 273 ? 14.882 -4.862  28.725  1.00 34.41  ? 269 ILE A CG1 1 
ATOM   1819 C CG2 . ILE A 1 273 ? 12.544 -4.979  29.654  1.00 34.64  ? 269 ILE A CG2 1 
ATOM   1820 C CD1 . ILE A 1 273 ? 14.907 -3.423  28.262  1.00 32.22  ? 269 ILE A CD1 1 
ATOM   1821 N N   . ILE A 1 274 ? 11.598 -7.937  27.890  1.00 41.76  ? 270 ILE A N   1 
ATOM   1822 C CA  . ILE A 1 274 ? 10.268 -8.527  27.934  1.00 44.03  ? 270 ILE A CA  1 
ATOM   1823 C C   . ILE A 1 274 ? 10.320 -9.954  28.475  1.00 43.51  ? 270 ILE A C   1 
ATOM   1824 O O   . ILE A 1 274 ? 9.477  -10.336 29.265  1.00 45.60  ? 270 ILE A O   1 
ATOM   1825 C CB  . ILE A 1 274 ? 9.596  -8.441  26.533  1.00 46.55  ? 270 ILE A CB  1 
ATOM   1826 C CG1 . ILE A 1 274 ? 9.250  -6.972  26.247  1.00 45.88  ? 270 ILE A CG1 1 
ATOM   1827 C CG2 . ILE A 1 274 ? 8.312  -9.314  26.477  1.00 46.64  ? 270 ILE A CG2 1 
ATOM   1828 C CD1 . ILE A 1 274 ? 8.868  -6.678  24.805  1.00 46.00  ? 270 ILE A CD1 1 
ATOM   1829 N N   . LYS A 1 275 ? 11.334 -10.721 28.100  1.00 44.85  ? 271 LYS A N   1 
ATOM   1830 C CA  . LYS A 1 275 ? 11.465 -12.081 28.610  1.00 46.48  ? 271 LYS A CA  1 
ATOM   1831 C C   . LYS A 1 275 ? 11.492 -12.101 30.141  1.00 47.79  ? 271 LYS A C   1 
ATOM   1832 O O   . LYS A 1 275 ? 11.029 -13.058 30.772  1.00 47.38  ? 271 LYS A O   1 
ATOM   1833 C CB  . LYS A 1 275 ? 12.746 -12.735 28.104  1.00 47.48  ? 271 LYS A CB  1 
ATOM   1834 C CG  . LYS A 1 275 ? 12.720 -13.115 26.624  1.00 51.23  ? 271 LYS A CG  1 
ATOM   1835 C CD  . LYS A 1 275 ? 14.057 -13.739 26.238  1.00 54.52  ? 271 LYS A CD  1 
ATOM   1836 C CE  . LYS A 1 275 ? 14.115 -14.113 24.759  1.00 57.12  ? 271 LYS A CE  1 
ATOM   1837 N NZ  . LYS A 1 275 ? 15.493 -14.546 24.373  1.00 58.75  ? 271 LYS A NZ  1 
ATOM   1838 N N   . VAL A 1 276 ? 12.024 -11.047 30.749  1.00 46.20  ? 272 VAL A N   1 
ATOM   1839 C CA  . VAL A 1 276 ? 12.079 -11.014 32.192  1.00 45.26  ? 272 VAL A CA  1 
ATOM   1840 C C   . VAL A 1 276 ? 10.912 -10.306 32.834  1.00 46.41  ? 272 VAL A C   1 
ATOM   1841 O O   . VAL A 1 276 ? 10.311 -10.852 33.756  1.00 46.82  ? 272 VAL A O   1 
ATOM   1842 C CB  . VAL A 1 276 ? 13.396 -10.379 32.698  1.00 44.76  ? 272 VAL A CB  1 
ATOM   1843 C CG1 . VAL A 1 276 ? 13.369 -10.260 34.212  1.00 44.46  ? 272 VAL A CG1 1 
ATOM   1844 C CG2 . VAL A 1 276 ? 14.578 -11.251 32.275  1.00 44.00  ? 272 VAL A CG2 1 
ATOM   1845 N N   . LEU A 1 277 ? 10.566 -9.116  32.347  1.00 47.29  ? 273 LEU A N   1 
ATOM   1846 C CA  . LEU A 1 277 ? 9.481  -8.347  32.945  1.00 49.33  ? 273 LEU A CA  1 
ATOM   1847 C C   . LEU A 1 277 ? 8.116  -8.693  32.397  1.00 53.06  ? 273 LEU A C   1 
ATOM   1848 O O   . LEU A 1 277 ? 7.102  -8.316  32.977  1.00 55.51  ? 273 LEU A O   1 
ATOM   1849 C CB  . LEU A 1 277 ? 9.687  -6.838  32.737  1.00 47.91  ? 273 LEU A CB  1 
ATOM   1850 C CG  . LEU A 1 277 ? 10.986 -6.144  33.183  1.00 48.10  ? 273 LEU A CG  1 
ATOM   1851 C CD1 . LEU A 1 277 ? 10.711 -4.647  33.324  1.00 43.34  ? 273 LEU A CD1 1 
ATOM   1852 C CD2 . LEU A 1 277 ? 11.459 -6.708  34.502  1.00 49.48  ? 273 LEU A CD2 1 
ATOM   1853 N N   . GLY A 1 278 ? 8.078  -9.393  31.273  1.00 54.88  ? 274 GLY A N   1 
ATOM   1854 C CA  . GLY A 1 278 ? 6.795  -9.690  30.672  1.00 57.22  ? 274 GLY A CA  1 
ATOM   1855 C C   . GLY A 1 278 ? 6.455  -8.539  29.735  1.00 58.73  ? 274 GLY A C   1 
ATOM   1856 O O   . GLY A 1 278 ? 7.124  -7.490  29.735  1.00 56.59  ? 274 GLY A O   1 
ATOM   1857 N N   . THR A 1 279 ? 5.408  -8.722  28.941  1.00 59.61  ? 275 THR A N   1 
ATOM   1858 C CA  . THR A 1 279 ? 4.998  -7.703  27.988  1.00 61.26  ? 275 THR A CA  1 
ATOM   1859 C C   . THR A 1 279 ? 4.428  -6.460  28.657  1.00 61.30  ? 275 THR A C   1 
ATOM   1860 O O   . THR A 1 279 ? 3.569  -6.547  29.538  1.00 60.50  ? 275 THR A O   1 
ATOM   1861 C CB  . THR A 1 279 ? 3.955  -8.268  26.996  1.00 62.38  ? 275 THR A CB  1 
ATOM   1862 O OG1 . THR A 1 279 ? 4.560  -9.324  26.233  1.00 63.73  ? 275 THR A OG1 1 
ATOM   1863 C CG2 . THR A 1 279 ? 3.463  -7.175  26.049  1.00 62.39  ? 275 THR A CG2 1 
ATOM   1864 N N   . PRO A 1 280 ? 4.911  -5.281  28.245  1.00 61.52  ? 276 PRO A N   1 
ATOM   1865 C CA  . PRO A 1 280 ? 4.457  -3.997  28.791  1.00 63.69  ? 276 PRO A CA  1 
ATOM   1866 C C   . PRO A 1 280 ? 2.971  -3.830  28.516  1.00 65.21  ? 276 PRO A C   1 
ATOM   1867 O O   . PRO A 1 280 ? 2.518  -4.142  27.414  1.00 64.98  ? 276 PRO A O   1 
ATOM   1868 C CB  . PRO A 1 280 ? 5.253  -2.964  27.991  1.00 62.53  ? 276 PRO A CB  1 
ATOM   1869 C CG  . PRO A 1 280 ? 6.422  -3.718  27.475  1.00 62.73  ? 276 PRO A CG  1 
ATOM   1870 C CD  . PRO A 1 280 ? 5.897  -5.081  27.173  1.00 61.49  ? 276 PRO A CD  1 
ATOM   1871 N N   . THR A 1 281 ? 2.216  -3.343  29.497  1.00 67.63  ? 277 THR A N   1 
ATOM   1872 C CA  . THR A 1 281 ? 0.792  -3.112  29.285  1.00 68.93  ? 277 THR A CA  1 
ATOM   1873 C C   . THR A 1 281 ? 0.721  -1.826  28.468  1.00 70.77  ? 277 THR A C   1 
ATOM   1874 O O   . THR A 1 281 ? 1.703  -1.080  28.381  1.00 70.50  ? 277 THR A O   1 
ATOM   1875 C CB  . THR A 1 281 ? 0.022  -2.909  30.613  1.00 69.05  ? 277 THR A CB  1 
ATOM   1876 O OG1 . THR A 1 281 ? 0.375  -1.644  31.190  1.00 68.03  ? 277 THR A OG1 1 
ATOM   1877 C CG2 . THR A 1 281 ? 0.348  -4.035  31.598  1.00 67.56  ? 277 THR A CG2 1 
ATOM   1878 N N   . ARG A 1 282 ? -0.426 -1.565  27.856  1.00 72.52  ? 278 ARG A N   1 
ATOM   1879 C CA  . ARG A 1 282 ? -0.571 -0.361  27.047  1.00 74.19  ? 278 ARG A CA  1 
ATOM   1880 C C   . ARG A 1 282 ? -0.322 0.866   27.908  1.00 73.27  ? 278 ARG A C   1 
ATOM   1881 O O   . ARG A 1 282 ? 0.233  1.865   27.442  1.00 73.38  ? 278 ARG A O   1 
ATOM   1882 C CB  . ARG A 1 282 ? -1.977 -0.276  26.453  1.00 77.05  ? 278 ARG A CB  1 
ATOM   1883 C CG  . ARG A 1 282 ? -2.147 0.855   25.445  1.00 80.79  ? 278 ARG A CG  1 
ATOM   1884 C CD  . ARG A 1 282 ? -3.618 1.216   25.298  1.00 83.91  ? 278 ARG A CD  1 
ATOM   1885 N NE  . ARG A 1 282 ? -4.443 0.028   25.092  1.00 86.53  ? 278 ARG A NE  1 
ATOM   1886 C CZ  . ARG A 1 282 ? -5.772 0.040   25.044  1.00 87.55  ? 278 ARG A CZ  1 
ATOM   1887 N NH1 . ARG A 1 282 ? -6.431 1.187   25.190  1.00 88.04  ? 278 ARG A NH1 1 
ATOM   1888 N NH2 . ARG A 1 282 ? -6.440 -1.093  24.847  1.00 87.92  ? 278 ARG A NH2 1 
ATOM   1889 N N   . GLU A 1 283 ? -0.740 0.779   29.165  1.00 72.29  ? 279 GLU A N   1 
ATOM   1890 C CA  . GLU A 1 283 ? -0.572 1.875   30.101  1.00 72.29  ? 279 GLU A CA  1 
ATOM   1891 C C   . GLU A 1 283 ? 0.907  2.102   30.417  1.00 70.67  ? 279 GLU A C   1 
ATOM   1892 O O   . GLU A 1 283 ? 1.369  3.243   30.465  1.00 70.06  ? 279 GLU A O   1 
ATOM   1893 C CB  . GLU A 1 283 ? -1.354 1.591   31.390  1.00 74.26  ? 279 GLU A CB  1 
ATOM   1894 C CG  . GLU A 1 283 ? -1.465 2.795   32.323  1.00 77.76  ? 279 GLU A CG  1 
ATOM   1895 C CD  . GLU A 1 283 ? -1.755 4.095   31.568  1.00 80.07  ? 279 GLU A CD  1 
ATOM   1896 O OE1 . GLU A 1 283 ? -2.607 4.076   30.651  1.00 81.54  ? 279 GLU A OE1 1 
ATOM   1897 O OE2 . GLU A 1 283 ? -1.139 5.139   31.890  1.00 80.89  ? 279 GLU A OE2 1 
ATOM   1898 N N   . GLN A 1 284 ? 1.646  1.016   30.626  1.00 68.79  ? 280 GLN A N   1 
ATOM   1899 C CA  . GLN A 1 284 ? 3.069  1.123   30.923  1.00 67.52  ? 280 GLN A CA  1 
ATOM   1900 C C   . GLN A 1 284 ? 3.807  1.792   29.763  1.00 67.54  ? 280 GLN A C   1 
ATOM   1901 O O   . GLN A 1 284 ? 4.659  2.657   29.967  1.00 66.18  ? 280 GLN A O   1 
ATOM   1902 C CB  . GLN A 1 284 ? 3.646  -0.262  31.217  1.00 66.37  ? 280 GLN A CB  1 
ATOM   1903 C CG  . GLN A 1 284 ? 3.150  -0.838  32.532  1.00 64.63  ? 280 GLN A CG  1 
ATOM   1904 C CD  . GLN A 1 284 ? 3.574  -2.273  32.741  1.00 64.44  ? 280 GLN A CD  1 
ATOM   1905 O OE1 . GLN A 1 284 ? 3.436  -3.108  31.843  1.00 64.65  ? 280 GLN A OE1 1 
ATOM   1906 N NE2 . GLN A 1 284 ? 4.083  -2.578  33.934  1.00 62.87  ? 280 GLN A NE2 1 
ATOM   1907 N N   . ILE A 1 285 ? 3.466  1.400   28.543  1.00 68.43  ? 281 ILE A N   1 
ATOM   1908 C CA  . ILE A 1 285 ? 4.090  1.988   27.370  1.00 69.80  ? 281 ILE A CA  1 
ATOM   1909 C C   . ILE A 1 285 ? 3.838  3.490   27.361  1.00 70.35  ? 281 ILE A C   1 
ATOM   1910 O O   . ILE A 1 285 ? 4.725  4.284   27.042  1.00 69.29  ? 281 ILE A O   1 
ATOM   1911 C CB  . ILE A 1 285 ? 3.524  1.370   26.087  1.00 70.59  ? 281 ILE A CB  1 
ATOM   1912 C CG1 . ILE A 1 285 ? 3.956  -0.095  26.007  1.00 71.94  ? 281 ILE A CG1 1 
ATOM   1913 C CG2 . ILE A 1 285 ? 4.008  2.145   24.876  1.00 69.91  ? 281 ILE A CG2 1 
ATOM   1914 C CD1 . ILE A 1 285 ? 3.377  -0.856  24.840  1.00 72.35  ? 281 ILE A CD1 1 
ATOM   1915 N N   . ARG A 1 286 ? 2.617  3.869   27.726  1.00 71.62  ? 282 ARG A N   1 
ATOM   1916 C CA  . ARG A 1 286 ? 2.226  5.272   27.770  1.00 72.46  ? 282 ARG A CA  1 
ATOM   1917 C C   . ARG A 1 286 ? 3.110  6.055   28.733  1.00 71.51  ? 282 ARG A C   1 
ATOM   1918 O O   . ARG A 1 286 ? 3.581  7.144   28.412  1.00 69.75  ? 282 ARG A O   1 
ATOM   1919 C CB  . ARG A 1 286 ? 0.763  5.393   28.208  1.00 75.28  ? 282 ARG A CB  1 
ATOM   1920 C CG  . ARG A 1 286 ? 0.296  6.823   28.471  1.00 79.33  ? 282 ARG A CG  1 
ATOM   1921 C CD  . ARG A 1 286 ? -1.142 6.857   28.990  1.00 82.89  ? 282 ARG A CD  1 
ATOM   1922 N NE  . ARG A 1 286 ? -2.082 6.337   28.000  1.00 85.97  ? 282 ARG A NE  1 
ATOM   1923 C CZ  . ARG A 1 286 ? -3.396 6.241   28.186  1.00 88.22  ? 282 ARG A CZ  1 
ATOM   1924 N NH1 . ARG A 1 286 ? -3.941 6.630   29.336  1.00 89.56  ? 282 ARG A NH1 1 
ATOM   1925 N NH2 . ARG A 1 286 ? -4.170 5.763   27.217  1.00 88.88  ? 282 ARG A NH2 1 
ATOM   1926 N N   . GLU A 1 287 ? 3.333  5.486   29.913  1.00 70.84  ? 283 GLU A N   1 
ATOM   1927 C CA  . GLU A 1 287 ? 4.156  6.124   30.935  1.00 70.57  ? 283 GLU A CA  1 
ATOM   1928 C C   . GLU A 1 287 ? 5.628  6.242   30.544  1.00 68.72  ? 283 GLU A C   1 
ATOM   1929 O O   . GLU A 1 287 ? 6.325  7.142   31.014  1.00 67.53  ? 283 GLU A O   1 
ATOM   1930 C CB  . GLU A 1 287 ? 4.010  5.368   32.252  1.00 73.00  ? 283 GLU A CB  1 
ATOM   1931 C CG  . GLU A 1 287 ? 2.598  5.449   32.798  1.00 76.77  ? 283 GLU A CG  1 
ATOM   1932 C CD  . GLU A 1 287 ? 2.356  4.516   33.959  1.00 79.33  ? 283 GLU A CD  1 
ATOM   1933 O OE1 . GLU A 1 287 ? 2.581  3.289   33.795  1.00 79.83  ? 283 GLU A OE1 1 
ATOM   1934 O OE2 . GLU A 1 287 ? 1.934  5.017   35.030  1.00 80.02  ? 283 GLU A OE2 1 
ATOM   1935 N N   . MET A 1 288 ? 6.086  5.344   29.673  1.00 66.88  ? 284 MET A N   1 
ATOM   1936 C CA  . MET A 1 288 ? 7.467  5.361   29.200  1.00 65.19  ? 284 MET A CA  1 
ATOM   1937 C C   . MET A 1 288 ? 7.621  6.352   28.052  1.00 64.84  ? 284 MET A C   1 
ATOM   1938 O O   . MET A 1 288 ? 8.545  7.159   28.041  1.00 64.06  ? 284 MET A O   1 
ATOM   1939 C CB  . MET A 1 288 ? 7.894  3.965   28.730  1.00 63.65  ? 284 MET A CB  1 
ATOM   1940 C CG  . MET A 1 288 ? 7.952  2.925   29.834  1.00 61.12  ? 284 MET A CG  1 
ATOM   1941 S SD  . MET A 1 288 ? 8.724  1.374   29.326  1.00 59.48  ? 284 MET A SD  1 
ATOM   1942 C CE  . MET A 1 288 ? 7.307  0.386   28.821  1.00 58.40  ? 284 MET A CE  1 
ATOM   1943 N N   . LYS A 1 296 ? 4.888  -3.902  18.737  1.00 102.67 ? 292 LYS A N   1 
ATOM   1944 C CA  . LYS A 1 296 ? 4.651  -5.083  17.918  1.00 103.32 ? 292 LYS A CA  1 
ATOM   1945 C C   . LYS A 1 296 ? 5.465  -6.286  18.394  1.00 103.76 ? 292 LYS A C   1 
ATOM   1946 O O   . LYS A 1 296 ? 5.920  -7.091  17.581  1.00 103.84 ? 292 LYS A O   1 
ATOM   1947 C CB  . LYS A 1 296 ? 4.984  -4.774  16.472  1.00 102.91 ? 292 LYS A CB  1 
ATOM   1948 N N   . PHE A 1 297 ? 5.634  -6.414  19.710  1.00 104.38 ? 293 PHE A N   1 
ATOM   1949 C CA  . PHE A 1 297 ? 6.404  -7.515  20.292  1.00 104.71 ? 293 PHE A CA  1 
ATOM   1950 C C   . PHE A 1 297 ? 5.568  -8.711  20.734  1.00 105.45 ? 293 PHE A C   1 
ATOM   1951 O O   . PHE A 1 297 ? 4.408  -8.566  21.125  1.00 104.99 ? 293 PHE A O   1 
ATOM   1952 C CB  . PHE A 1 297 ? 7.200  -7.041  21.510  1.00 104.32 ? 293 PHE A CB  1 
ATOM   1953 C CG  . PHE A 1 297 ? 8.319  -6.104  21.186  1.00 103.90 ? 293 PHE A CG  1 
ATOM   1954 C CD1 . PHE A 1 297 ? 8.070  -4.764  20.932  1.00 103.50 ? 293 PHE A CD1 1 
ATOM   1955 C CD2 . PHE A 1 297 ? 9.628  -6.569  21.124  1.00 103.74 ? 293 PHE A CD2 1 
ATOM   1956 C CE1 . PHE A 1 297 ? 9.107  -3.898  20.620  1.00 103.61 ? 293 PHE A CE1 1 
ATOM   1957 C CE2 . PHE A 1 297 ? 10.673 -5.713  20.812  1.00 103.57 ? 293 PHE A CE2 1 
ATOM   1958 C CZ  . PHE A 1 297 ? 10.413 -4.373  20.558  1.00 103.79 ? 293 PHE A CZ  1 
ATOM   1959 N N   . PRO A 1 298 ? 6.159  -9.916  20.675  1.00 106.19 ? 294 PRO A N   1 
ATOM   1960 C CA  . PRO A 1 298 ? 5.492  -11.160 21.076  1.00 106.96 ? 294 PRO A CA  1 
ATOM   1961 C C   . PRO A 1 298 ? 5.102  -11.121 22.555  1.00 107.55 ? 294 PRO A C   1 
ATOM   1962 O O   . PRO A 1 298 ? 5.940  -10.899 23.433  1.00 107.45 ? 294 PRO A O   1 
ATOM   1963 C CB  . PRO A 1 298 ? 6.539  -12.221 20.766  1.00 106.86 ? 294 PRO A CB  1 
ATOM   1964 C CG  . PRO A 1 298 ? 7.178  -11.665 19.526  1.00 106.97 ? 294 PRO A CG  1 
ATOM   1965 C CD  . PRO A 1 298 ? 7.381  -10.211 19.905  1.00 106.57 ? 294 PRO A CD  1 
ATOM   1966 N N   . GLN A 1 299 ? 3.817  -11.350 22.811  1.00 108.19 ? 295 GLN A N   1 
ATOM   1967 C CA  . GLN A 1 299 ? 3.240  -11.314 24.153  1.00 108.53 ? 295 GLN A CA  1 
ATOM   1968 C C   . GLN A 1 299 ? 3.690  -12.389 25.153  1.00 108.17 ? 295 GLN A C   1 
ATOM   1969 O O   . GLN A 1 299 ? 2.876  -13.187 25.629  1.00 108.17 ? 295 GLN A O   1 
ATOM   1970 C CB  . GLN A 1 299 ? 1.713  -11.338 24.032  1.00 109.29 ? 295 GLN A CB  1 
ATOM   1971 C CG  . GLN A 1 299 ? 0.962  -11.031 25.315  1.00 110.95 ? 295 GLN A CG  1 
ATOM   1972 C CD  . GLN A 1 299 ? -0.540 -11.139 25.133  1.00 111.96 ? 295 GLN A CD  1 
ATOM   1973 O OE1 . GLN A 1 299 ? -1.115 -10.512 24.237  1.00 112.30 ? 295 GLN A OE1 1 
ATOM   1974 N NE2 . GLN A 1 299 ? -1.187 -11.936 25.982  1.00 112.21 ? 295 GLN A NE2 1 
ATOM   1975 N N   . ILE A 1 300 ? 4.979  -12.413 25.475  1.00 107.55 ? 296 ILE A N   1 
ATOM   1976 C CA  . ILE A 1 300 ? 5.474  -13.374 26.453  1.00 106.97 ? 296 ILE A CA  1 
ATOM   1977 C C   . ILE A 1 300 ? 5.101  -12.769 27.813  1.00 106.85 ? 296 ILE A C   1 
ATOM   1978 O O   . ILE A 1 300 ? 5.035  -11.547 27.950  1.00 106.73 ? 296 ILE A O   1 
ATOM   1979 C CB  . ILE A 1 300 ? 7.011  -13.588 26.304  1.00 106.27 ? 296 ILE A CB  1 
ATOM   1980 C CG1 . ILE A 1 300 ? 7.299  -14.319 24.984  1.00 105.41 ? 296 ILE A CG1 1 
ATOM   1981 C CG2 . ILE A 1 300 ? 7.555  -14.388 27.477  1.00 106.45 ? 296 ILE A CG2 1 
ATOM   1982 C CD1 . ILE A 1 300 ? 8.733  -14.757 24.802  1.00 104.25 ? 296 ILE A CD1 1 
ATOM   1983 N N   . LYS A 1 301 ? 4.829  -13.614 28.805  1.00 106.72 ? 297 LYS A N   1 
ATOM   1984 C CA  . LYS A 1 301 ? 4.416  -13.129 30.123  1.00 106.41 ? 297 LYS A CA  1 
ATOM   1985 C C   . LYS A 1 301 ? 5.516  -12.916 31.167  1.00 106.06 ? 297 LYS A C   1 
ATOM   1986 O O   . LYS A 1 301 ? 6.711  -12.917 30.845  1.00 106.47 ? 297 LYS A O   1 
ATOM   1987 C CB  . LYS A 1 301 ? 3.327  -14.049 30.693  1.00 106.30 ? 297 LYS A CB  1 
ATOM   1988 C CG  . LYS A 1 301 ? 2.043  -14.020 29.878  1.00 106.07 ? 297 LYS A CG  1 
ATOM   1989 C CD  . LYS A 1 301 ? 0.936  -14.848 30.502  1.00 105.86 ? 297 LYS A CD  1 
ATOM   1990 C CE  . LYS A 1 301 ? -0.351 -14.719 29.697  1.00 105.49 ? 297 LYS A CE  1 
ATOM   1991 N NZ  . LYS A 1 301 ? -1.459 -15.526 30.273  1.00 104.90 ? 297 LYS A NZ  1 
ATOM   1992 N N   . ALA A 1 302 ? 5.088  -12.729 32.418  1.00 104.96 ? 298 ALA A N   1 
ATOM   1993 C CA  . ALA A 1 302 ? 5.984  -12.479 33.551  1.00 103.69 ? 298 ALA A CA  1 
ATOM   1994 C C   . ALA A 1 302 ? 6.920  -13.635 33.910  1.00 102.63 ? 298 ALA A C   1 
ATOM   1995 O O   . ALA A 1 302 ? 6.470  -14.730 34.256  1.00 102.30 ? 298 ALA A O   1 
ATOM   1996 C CB  . ALA A 1 302 ? 5.156  -12.082 34.778  1.00 103.53 ? 298 ALA A CB  1 
ATOM   1997 N N   . HIS A 1 303 ? 8.226  -13.372 33.837  1.00 101.43 ? 299 HIS A N   1 
ATOM   1998 C CA  . HIS A 1 303 ? 9.253  -14.369 34.157  1.00 99.74  ? 299 HIS A CA  1 
ATOM   1999 C C   . HIS A 1 303 ? 9.677  -14.300 35.625  1.00 97.25  ? 299 HIS A C   1 
ATOM   2000 O O   . HIS A 1 303 ? 10.264 -13.302 36.064  1.00 96.99  ? 299 HIS A O   1 
ATOM   2001 C CB  . HIS A 1 303 ? 10.491 -14.160 33.285  1.00 101.20 ? 299 HIS A CB  1 
ATOM   2002 C CG  . HIS A 1 303 ? 11.597 -15.126 33.570  1.00 101.97 ? 299 HIS A CG  1 
ATOM   2003 N ND1 . HIS A 1 303 ? 11.529 -16.457 33.222  1.00 102.87 ? 299 HIS A ND1 1 
ATOM   2004 C CD2 . HIS A 1 303 ? 12.790 -14.958 34.187  1.00 102.73 ? 299 HIS A CD2 1 
ATOM   2005 C CE1 . HIS A 1 303 ? 12.633 -17.069 33.612  1.00 103.50 ? 299 HIS A CE1 1 
ATOM   2006 N NE2 . HIS A 1 303 ? 13.415 -16.181 34.201  1.00 103.70 ? 299 HIS A NE2 1 
ATOM   2007 N N   . PRO A 1 304 ? 9.401  -15.368 36.397  1.00 94.71  ? 300 PRO A N   1 
ATOM   2008 C CA  . PRO A 1 304 ? 9.763  -15.409 37.819  1.00 92.11  ? 300 PRO A CA  1 
ATOM   2009 C C   . PRO A 1 304 ? 11.245 -15.080 38.014  1.00 88.74  ? 300 PRO A C   1 
ATOM   2010 O O   . PRO A 1 304 ? 12.115 -15.934 37.817  1.00 89.11  ? 300 PRO A O   1 
ATOM   2011 C CB  . PRO A 1 304 ? 9.429  -16.847 38.224  1.00 92.76  ? 300 PRO A CB  1 
ATOM   2012 C CG  . PRO A 1 304 ? 8.305  -17.207 37.298  1.00 93.80  ? 300 PRO A CG  1 
ATOM   2013 C CD  . PRO A 1 304 ? 8.791  -16.644 35.979  1.00 94.52  ? 300 PRO A CD  1 
ATOM   2014 N N   . TRP A 1 305 ? 11.515 -13.830 38.376  1.00 83.94  ? 301 TRP A N   1 
ATOM   2015 C CA  . TRP A 1 305 ? 12.868 -13.368 38.603  1.00 78.53  ? 301 TRP A CA  1 
ATOM   2016 C C   . TRP A 1 305 ? 13.756 -14.428 39.266  1.00 78.00  ? 301 TRP A C   1 
ATOM   2017 O O   . TRP A 1 305 ? 14.968 -14.424 39.070  1.00 78.14  ? 301 TRP A O   1 
ATOM   2018 C CB  . TRP A 1 305 ? 12.843 -12.114 39.469  1.00 73.97  ? 301 TRP A CB  1 
ATOM   2019 C CG  . TRP A 1 305 ? 12.680 -10.820 38.725  1.00 68.96  ? 301 TRP A CG  1 
ATOM   2020 C CD1 . TRP A 1 305 ? 11.530 -10.095 38.569  1.00 67.30  ? 301 TRP A CD1 1 
ATOM   2021 C CD2 . TRP A 1 305 ? 13.725 -10.047 38.119  1.00 65.50  ? 301 TRP A CD2 1 
ATOM   2022 N NE1 . TRP A 1 305 ? 11.800 -8.914  37.917  1.00 65.46  ? 301 TRP A NE1 1 
ATOM   2023 C CE2 . TRP A 1 305 ? 13.138 -8.859  37.629  1.00 64.63  ? 301 TRP A CE2 1 
ATOM   2024 C CE3 . TRP A 1 305 ? 15.103 -10.242 37.947  1.00 63.82  ? 301 TRP A CE3 1 
ATOM   2025 C CZ2 . TRP A 1 305 ? 13.879 -7.872  36.981  1.00 63.04  ? 301 TRP A CZ2 1 
ATOM   2026 C CZ3 . TRP A 1 305 ? 15.841 -9.262  37.304  1.00 62.82  ? 301 TRP A CZ3 1 
ATOM   2027 C CH2 . TRP A 1 305 ? 15.226 -8.089  36.828  1.00 62.57  ? 301 TRP A CH2 1 
ATOM   2028 N N   . THR A 1 306 ? 13.159 -15.334 40.041  1.00 77.21  ? 302 THR A N   1 
ATOM   2029 C CA  . THR A 1 306 ? 13.927 -16.386 40.721  1.00 76.41  ? 302 THR A CA  1 
ATOM   2030 C C   . THR A 1 306 ? 14.623 -17.297 39.723  1.00 75.00  ? 302 THR A C   1 
ATOM   2031 O O   . THR A 1 306 ? 15.732 -17.783 39.969  1.00 76.19  ? 302 THR A O   1 
ATOM   2032 C CB  . THR A 1 306 ? 13.043 -17.279 41.612  1.00 77.37  ? 302 THR A CB  1 
ATOM   2033 O OG1 . THR A 1 306 ? 12.264 -16.461 42.496  1.00 78.20  ? 302 THR A OG1 1 
ATOM   2034 C CG2 . THR A 1 306 ? 13.920 -18.217 42.448  1.00 77.68  ? 302 THR A CG2 1 
ATOM   2035 N N   . LYS A 1 307 ? 13.962 -17.518 38.595  1.00 72.21  ? 303 LYS A N   1 
ATOM   2036 C CA  . LYS A 1 307 ? 14.490 -18.356 37.527  1.00 69.38  ? 303 LYS A CA  1 
ATOM   2037 C C   . LYS A 1 307 ? 15.697 -17.664 36.856  1.00 65.51  ? 303 LYS A C   1 
ATOM   2038 O O   . LYS A 1 307 ? 16.470 -18.291 36.139  1.00 64.92  ? 303 LYS A O   1 
ATOM   2039 C CB  . LYS A 1 307 ? 13.369 -18.597 36.499  1.00 72.02  ? 303 LYS A CB  1 
ATOM   2040 C CG  . LYS A 1 307 ? 13.554 -19.803 35.570  1.00 75.54  ? 303 LYS A CG  1 
ATOM   2041 C CD  . LYS A 1 307 ? 13.274 -21.136 36.283  1.00 77.09  ? 303 LYS A CD  1 
ATOM   2042 C CE  . LYS A 1 307 ? 13.503 -22.330 35.350  1.00 77.74  ? 303 LYS A CE  1 
ATOM   2043 N NZ  . LYS A 1 307 ? 13.305 -23.645 36.041  1.00 77.64  ? 303 LYS A NZ  1 
ATOM   2044 N N   . VAL A 1 308 ? 15.860 -16.369 37.107  1.00 60.47  ? 304 VAL A N   1 
ATOM   2045 C CA  . VAL A 1 308 ? 16.944 -15.600 36.502  1.00 54.52  ? 304 VAL A CA  1 
ATOM   2046 C C   . VAL A 1 308 ? 18.335 -15.855 37.085  1.00 52.66  ? 304 VAL A C   1 
ATOM   2047 O O   . VAL A 1 308 ? 19.294 -16.047 36.343  1.00 50.56  ? 304 VAL A O   1 
ATOM   2048 C CB  . VAL A 1 308 ? 16.647 -14.068 36.597  1.00 54.25  ? 304 VAL A CB  1 
ATOM   2049 C CG1 . VAL A 1 308 ? 17.830 -13.262 36.096  1.00 50.53  ? 304 VAL A CG1 1 
ATOM   2050 C CG2 . VAL A 1 308 ? 15.386 -13.727 35.800  1.00 52.75  ? 304 VAL A CG2 1 
ATOM   2051 N N   . PHE A 1 309 ? 18.442 -15.873 38.411  1.00 51.30  ? 305 PHE A N   1 
ATOM   2052 C CA  . PHE A 1 309 ? 19.739 -16.031 39.054  1.00 50.91  ? 305 PHE A CA  1 
ATOM   2053 C C   . PHE A 1 309 ? 20.108 -17.449 39.496  1.00 52.77  ? 305 PHE A C   1 
ATOM   2054 O O   . PHE A 1 309 ? 19.261 -18.341 39.554  1.00 51.40  ? 305 PHE A O   1 
ATOM   2055 C CB  . PHE A 1 309 ? 19.808 -15.049 40.226  1.00 48.43  ? 305 PHE A CB  1 
ATOM   2056 C CG  . PHE A 1 309 ? 19.565 -13.605 39.814  1.00 45.61  ? 305 PHE A CG  1 
ATOM   2057 C CD1 . PHE A 1 309 ? 20.581 -12.857 39.220  1.00 43.37  ? 305 PHE A CD1 1 
ATOM   2058 C CD2 . PHE A 1 309 ? 18.305 -13.019 39.975  1.00 44.22  ? 305 PHE A CD2 1 
ATOM   2059 C CE1 . PHE A 1 309 ? 20.347 -11.537 38.787  1.00 42.12  ? 305 PHE A CE1 1 
ATOM   2060 C CE2 . PHE A 1 309 ? 18.058 -11.702 39.549  1.00 44.47  ? 305 PHE A CE2 1 
ATOM   2061 C CZ  . PHE A 1 309 ? 19.084 -10.961 38.954  1.00 42.27  ? 305 PHE A CZ  1 
ATOM   2062 N N   . ARG A 1 310 ? 21.384 -17.653 39.796  1.00 54.24  ? 306 ARG A N   1 
ATOM   2063 C CA  . ARG A 1 310 ? 21.843 -18.966 40.218  1.00 58.10  ? 306 ARG A CA  1 
ATOM   2064 C C   . ARG A 1 310 ? 21.200 -19.339 41.552  1.00 58.78  ? 306 ARG A C   1 
ATOM   2065 O O   . ARG A 1 310 ? 20.722 -18.473 42.296  1.00 58.48  ? 306 ARG A O   1 
ATOM   2066 C CB  . ARG A 1 310 ? 23.364 -18.982 40.349  1.00 59.88  ? 306 ARG A CB  1 
ATOM   2067 C CG  . ARG A 1 310 ? 23.852 -18.162 41.513  1.00 63.92  ? 306 ARG A CG  1 
ATOM   2068 C CD  . ARG A 1 310 ? 25.352 -18.139 41.604  1.00 67.17  ? 306 ARG A CD  1 
ATOM   2069 N NE  . ARG A 1 310 ? 25.758 -17.364 42.771  1.00 71.98  ? 306 ARG A NE  1 
ATOM   2070 C CZ  . ARG A 1 310 ? 27.021 -17.133 43.114  1.00 74.68  ? 306 ARG A CZ  1 
ATOM   2071 N NH1 . ARG A 1 310 ? 28.010 -17.626 42.366  1.00 76.50  ? 306 ARG A NH1 1 
ATOM   2072 N NH2 . ARG A 1 310 ? 27.294 -16.407 44.200  1.00 75.03  ? 306 ARG A NH2 1 
ATOM   2073 N N   . PRO A 1 311 ? 21.152 -20.642 41.865  1.00 59.82  ? 307 PRO A N   1 
ATOM   2074 C CA  . PRO A 1 311 ? 20.542 -21.024 43.139  1.00 59.85  ? 307 PRO A CA  1 
ATOM   2075 C C   . PRO A 1 311 ? 21.357 -20.462 44.310  1.00 59.51  ? 307 PRO A C   1 
ATOM   2076 O O   . PRO A 1 311 ? 22.588 -20.378 44.243  1.00 59.07  ? 307 PRO A O   1 
ATOM   2077 C CB  . PRO A 1 311 ? 20.555 -22.554 43.078  1.00 61.16  ? 307 PRO A CB  1 
ATOM   2078 C CG  . PRO A 1 311 ? 21.814 -22.844 42.296  1.00 61.05  ? 307 PRO A CG  1 
ATOM   2079 C CD  . PRO A 1 311 ? 21.737 -21.811 41.178  1.00 60.50  ? 307 PRO A CD  1 
ATOM   2080 N N   . ARG A 1 312 ? 20.652 -20.070 45.367  1.00 59.36  ? 308 ARG A N   1 
ATOM   2081 C CA  . ARG A 1 312 ? 21.252 -19.508 46.579  1.00 60.60  ? 308 ARG A CA  1 
ATOM   2082 C C   . ARG A 1 312 ? 21.461 -17.991 46.499  1.00 58.22  ? 308 ARG A C   1 
ATOM   2083 O O   . ARG A 1 312 ? 22.043 -17.383 47.397  1.00 57.80  ? 308 ARG A O   1 
ATOM   2084 C CB  . ARG A 1 312 ? 22.576 -20.216 46.928  1.00 63.44  ? 308 ARG A CB  1 
ATOM   2085 C CG  . ARG A 1 312 ? 22.429 -21.720 47.180  1.00 70.10  ? 308 ARG A CG  1 
ATOM   2086 C CD  . ARG A 1 312 ? 21.403 -22.015 48.290  1.00 75.59  ? 308 ARG A CD  1 
ATOM   2087 N NE  . ARG A 1 312 ? 20.741 -23.322 48.134  1.00 80.18  ? 308 ARG A NE  1 
ATOM   2088 C CZ  . ARG A 1 312 ? 19.569 -23.520 47.520  1.00 81.46  ? 308 ARG A CZ  1 
ATOM   2089 N NH1 . ARG A 1 312 ? 18.898 -22.497 46.995  1.00 81.54  ? 308 ARG A NH1 1 
ATOM   2090 N NH2 . ARG A 1 312 ? 19.066 -24.749 47.423  1.00 81.68  ? 308 ARG A NH2 1 
ATOM   2091 N N   . THR A 1 313 ? 20.996 -17.384 45.415  1.00 55.88  ? 309 THR A N   1 
ATOM   2092 C CA  . THR A 1 313 ? 21.089 -15.938 45.283  1.00 53.62  ? 309 THR A CA  1 
ATOM   2093 C C   . THR A 1 313 ? 20.133 -15.443 46.359  1.00 52.41  ? 309 THR A C   1 
ATOM   2094 O O   . THR A 1 313 ? 19.015 -15.935 46.481  1.00 52.59  ? 309 THR A O   1 
ATOM   2095 C CB  . THR A 1 313 ? 20.593 -15.458 43.900  1.00 52.36  ? 309 THR A CB  1 
ATOM   2096 O OG1 . THR A 1 313 ? 21.485 -15.935 42.889  1.00 49.38  ? 309 THR A OG1 1 
ATOM   2097 C CG2 . THR A 1 313 ? 20.533 -13.927 43.841  1.00 51.78  ? 309 THR A CG2 1 
ATOM   2098 N N   . PRO A 1 314 ? 20.563 -14.478 47.167  1.00 51.78  ? 310 PRO A N   1 
ATOM   2099 C CA  . PRO A 1 314 ? 19.700 -13.944 48.233  1.00 51.26  ? 310 PRO A CA  1 
ATOM   2100 C C   . PRO A 1 314 ? 18.352 -13.440 47.692  1.00 50.43  ? 310 PRO A C   1 
ATOM   2101 O O   . PRO A 1 314 ? 18.305 -12.687 46.720  1.00 49.50  ? 310 PRO A O   1 
ATOM   2102 C CB  . PRO A 1 314 ? 20.539 -12.812 48.823  1.00 50.23  ? 310 PRO A CB  1 
ATOM   2103 C CG  . PRO A 1 314 ? 21.943 -13.291 48.595  1.00 51.85  ? 310 PRO A CG  1 
ATOM   2104 C CD  . PRO A 1 314 ? 21.900 -13.863 47.197  1.00 51.63  ? 310 PRO A CD  1 
ATOM   2105 N N   . PRO A 1 315 ? 17.246 -13.853 48.320  1.00 49.69  ? 311 PRO A N   1 
ATOM   2106 C CA  . PRO A 1 315 ? 15.906 -13.438 47.895  1.00 49.30  ? 311 PRO A CA  1 
ATOM   2107 C C   . PRO A 1 315 ? 15.737 -11.921 47.943  1.00 48.23  ? 311 PRO A C   1 
ATOM   2108 O O   . PRO A 1 315 ? 14.995 -11.365 47.144  1.00 48.28  ? 311 PRO A O   1 
ATOM   2109 C CB  . PRO A 1 315 ? 14.979 -14.133 48.901  1.00 49.89  ? 311 PRO A CB  1 
ATOM   2110 C CG  . PRO A 1 315 ? 15.809 -15.318 49.392  1.00 50.67  ? 311 PRO A CG  1 
ATOM   2111 C CD  . PRO A 1 315 ? 17.180 -14.708 49.521  1.00 50.58  ? 311 PRO A CD  1 
ATOM   2112 N N   . GLU A 1 316 ? 16.401 -11.263 48.896  1.00 46.90  ? 312 GLU A N   1 
ATOM   2113 C CA  . GLU A 1 316 ? 16.302 -9.803  49.007  1.00 46.60  ? 312 GLU A CA  1 
ATOM   2114 C C   . GLU A 1 316 ? 16.958 -9.123  47.796  1.00 44.16  ? 312 GLU A C   1 
ATOM   2115 O O   . GLU A 1 316 ? 16.541 -8.041  47.384  1.00 41.29  ? 312 GLU A O   1 
ATOM   2116 C CB  . GLU A 1 316 ? 16.980 -9.296  50.290  1.00 47.86  ? 312 GLU A CB  1 
ATOM   2117 C CG  . GLU A 1 316 ? 16.391 -9.839  51.582  1.00 50.96  ? 312 GLU A CG  1 
ATOM   2118 C CD  . GLU A 1 316 ? 16.919 -11.245 51.970  1.00 55.44  ? 312 GLU A CD  1 
ATOM   2119 O OE1 . GLU A 1 316 ? 16.508 -11.725 53.052  1.00 58.85  ? 312 GLU A OE1 1 
ATOM   2120 O OE2 . GLU A 1 316 ? 17.733 -11.869 51.229  1.00 53.04  ? 312 GLU A OE2 1 
ATOM   2121 N N   . ALA A 1 317 ? 17.988 -9.769  47.244  1.00 42.96  ? 313 ALA A N   1 
ATOM   2122 C CA  . ALA A 1 317 ? 18.711 -9.238  46.088  1.00 42.29  ? 313 ALA A CA  1 
ATOM   2123 C C   . ALA A 1 317 ? 17.777 -9.259  44.904  1.00 42.40  ? 313 ALA A C   1 
ATOM   2124 O O   . ALA A 1 317 ? 17.697 -8.303  44.130  1.00 41.56  ? 313 ALA A O   1 
ATOM   2125 C CB  . ALA A 1 317 ? 19.963 -10.082 45.801  1.00 40.96  ? 313 ALA A CB  1 
ATOM   2126 N N   . ILE A 1 318 ? 17.041 -10.356 44.779  1.00 43.57  ? 314 ILE A N   1 
ATOM   2127 C CA  . ILE A 1 318 ? 16.105 -10.496 43.683  1.00 44.33  ? 314 ILE A CA  1 
ATOM   2128 C C   . ILE A 1 318 ? 14.950 -9.500  43.804  1.00 43.63  ? 314 ILE A C   1 
ATOM   2129 O O   . ILE A 1 318 ? 14.521 -8.930  42.798  1.00 43.15  ? 314 ILE A O   1 
ATOM   2130 C CB  . ILE A 1 318 ? 15.552 -11.940 43.624  1.00 46.18  ? 314 ILE A CB  1 
ATOM   2131 C CG1 . ILE A 1 318 ? 16.708 -12.918 43.405  1.00 47.88  ? 314 ILE A CG1 1 
ATOM   2132 C CG2 . ILE A 1 318 ? 14.567 -12.082 42.494  1.00 46.87  ? 314 ILE A CG2 1 
ATOM   2133 C CD1 . ILE A 1 318 ? 16.311 -14.396 43.493  1.00 47.74  ? 314 ILE A CD1 1 
ATOM   2134 N N   . ALA A 1 319 ? 14.444 -9.294  45.018  1.00 42.35  ? 315 ALA A N   1 
ATOM   2135 C CA  . ALA A 1 319 ? 13.329 -8.356  45.218  1.00 42.78  ? 315 ALA A CA  1 
ATOM   2136 C C   . ALA A 1 319 ? 13.790 -6.931  44.891  1.00 41.45  ? 315 ALA A C   1 
ATOM   2137 O O   . ALA A 1 319 ? 13.062 -6.162  44.256  1.00 41.41  ? 315 ALA A O   1 
ATOM   2138 C CB  . ALA A 1 319 ? 12.814 -8.437  46.666  1.00 42.25  ? 315 ALA A CB  1 
ATOM   2139 N N   . LEU A 1 320 ? 14.994 -6.570  45.334  1.00 39.85  ? 316 LEU A N   1 
ATOM   2140 C CA  . LEU A 1 320 ? 15.514 -5.225  45.022  1.00 39.38  ? 316 LEU A CA  1 
ATOM   2141 C C   . LEU A 1 320 ? 15.597 -5.049  43.476  1.00 38.45  ? 316 LEU A C   1 
ATOM   2142 O O   . LEU A 1 320 ? 15.156 -4.038  42.929  1.00 37.36  ? 316 LEU A O   1 
ATOM   2143 C CB  . LEU A 1 320 ? 16.895 -5.007  45.665  1.00 36.02  ? 316 LEU A CB  1 
ATOM   2144 C CG  . LEU A 1 320 ? 17.564 -3.673  45.299  1.00 37.94  ? 316 LEU A CG  1 
ATOM   2145 C CD1 . LEU A 1 320 ? 16.622 -2.488  45.599  1.00 34.07  ? 316 LEU A CD1 1 
ATOM   2146 C CD2 . LEU A 1 320 ? 18.870 -3.553  46.072  1.00 36.23  ? 316 LEU A CD2 1 
ATOM   2147 N N   . CYS A 1 321 ? 16.153 -6.036  42.774  1.00 38.94  ? 317 CYS A N   1 
ATOM   2148 C CA  . CYS A 1 321 ? 16.222 -5.939  41.318  1.00 40.01  ? 317 CYS A CA  1 
ATOM   2149 C C   . CYS A 1 321 ? 14.846 -5.695  40.712  1.00 40.89  ? 317 CYS A C   1 
ATOM   2150 O O   . CYS A 1 321 ? 14.720 -4.858  39.817  1.00 39.55  ? 317 CYS A O   1 
ATOM   2151 C CB  . CYS A 1 321 ? 16.770 -7.210  40.668  1.00 42.57  ? 317 CYS A CB  1 
ATOM   2152 S SG  . CYS A 1 321 ? 18.554 -7.446  40.685  1.00 44.93  ? 317 CYS A SG  1 
ATOM   2153 N N   . SER A 1 322 ? 13.818 -6.414  41.181  1.00 40.10  ? 318 SER A N   1 
ATOM   2154 C CA  . SER A 1 322 ? 12.481 -6.229  40.612  1.00 41.47  ? 318 SER A CA  1 
ATOM   2155 C C   . SER A 1 322 ? 11.872 -4.857  40.894  1.00 41.12  ? 318 SER A C   1 
ATOM   2156 O O   . SER A 1 322 ? 11.014 -4.383  40.135  1.00 41.55  ? 318 SER A O   1 
ATOM   2157 C CB  . SER A 1 322 ? 11.511 -7.319  41.093  1.00 42.47  ? 318 SER A CB  1 
ATOM   2158 O OG  . SER A 1 322 ? 11.267 -7.218  42.486  1.00 45.49  ? 318 SER A OG  1 
ATOM   2159 N N   . ARG A 1 323 ? 12.302 -4.212  41.974  1.00 40.82  ? 319 ARG A N   1 
ATOM   2160 C CA  . ARG A 1 323 ? 11.769 -2.881  42.292  1.00 41.45  ? 319 ARG A CA  1 
ATOM   2161 C C   . ARG A 1 323 ? 12.551 -1.767  41.581  1.00 40.51  ? 319 ARG A C   1 
ATOM   2162 O O   . ARG A 1 323 ? 12.140 -0.592  41.572  1.00 39.87  ? 319 ARG A O   1 
ATOM   2163 C CB  . ARG A 1 323 ? 11.780 -2.639  43.802  1.00 41.92  ? 319 ARG A CB  1 
ATOM   2164 C CG  . ARG A 1 323 ? 10.867 -3.562  44.623  1.00 46.48  ? 319 ARG A CG  1 
ATOM   2165 C CD  . ARG A 1 323 ? 9.399  -3.543  44.160  1.00 50.37  ? 319 ARG A CD  1 
ATOM   2166 N NE  . ARG A 1 323 ? 8.873  -2.193  43.932  1.00 55.95  ? 319 ARG A NE  1 
ATOM   2167 C CZ  . ARG A 1 323 ? 8.675  -1.278  44.878  1.00 58.29  ? 319 ARG A CZ  1 
ATOM   2168 N NH1 . ARG A 1 323 ? 8.957  -1.552  46.148  1.00 60.55  ? 319 ARG A NH1 1 
ATOM   2169 N NH2 . ARG A 1 323 ? 8.188  -0.080  44.557  1.00 60.56  ? 319 ARG A NH2 1 
ATOM   2170 N N   . LEU A 1 324 ? 13.683 -2.128  40.985  1.00 38.61  ? 320 LEU A N   1 
ATOM   2171 C CA  . LEU A 1 324 ? 14.477 -1.142  40.266  1.00 37.81  ? 320 LEU A CA  1 
ATOM   2172 C C   . LEU A 1 324 ? 14.146 -1.194  38.783  1.00 37.15  ? 320 LEU A C   1 
ATOM   2173 O O   . LEU A 1 324 ? 13.926 -0.165  38.135  1.00 38.95  ? 320 LEU A O   1 
ATOM   2174 C CB  . LEU A 1 324 ? 15.972 -1.412  40.470  1.00 36.21  ? 320 LEU A CB  1 
ATOM   2175 C CG  . LEU A 1 324 ? 16.498 -1.358  41.911  1.00 34.91  ? 320 LEU A CG  1 
ATOM   2176 C CD1 . LEU A 1 324 ? 17.964 -1.838  41.947  1.00 30.95  ? 320 LEU A CD1 1 
ATOM   2177 C CD2 . LEU A 1 324 ? 16.391 0.057   42.453  1.00 31.92  ? 320 LEU A CD2 1 
ATOM   2178 N N   . LEU A 1 325 ? 14.092 -2.408  38.258  1.00 37.17  ? 321 LEU A N   1 
ATOM   2179 C CA  . LEU A 1 325 ? 13.830 -2.642  36.850  1.00 37.68  ? 321 LEU A CA  1 
ATOM   2180 C C   . LEU A 1 325 ? 12.329 -2.816  36.568  1.00 38.50  ? 321 LEU A C   1 
ATOM   2181 O O   . LEU A 1 325 ? 11.842 -3.919  36.319  1.00 38.05  ? 321 LEU A O   1 
ATOM   2182 C CB  . LEU A 1 325 ? 14.636 -3.871  36.393  1.00 36.03  ? 321 LEU A CB  1 
ATOM   2183 C CG  . LEU A 1 325 ? 16.131 -3.735  36.737  1.00 36.58  ? 321 LEU A CG  1 
ATOM   2184 C CD1 . LEU A 1 325 ? 16.853 -5.060  36.537  1.00 36.43  ? 321 LEU A CD1 1 
ATOM   2185 C CD2 . LEU A 1 325 ? 16.762 -2.625  35.851  1.00 35.71  ? 321 LEU A CD2 1 
ATOM   2186 N N   . GLU A 1 326 ? 11.622 -1.699  36.609  1.00 38.43  ? 322 GLU A N   1 
ATOM   2187 C CA  . GLU A 1 326 ? 10.179 -1.634  36.348  1.00 41.64  ? 322 GLU A CA  1 
ATOM   2188 C C   . GLU A 1 326 ? 9.956  -0.768  35.114  1.00 40.71  ? 322 GLU A C   1 
ATOM   2189 O O   . GLU A 1 326 ? 10.646 0.231   34.933  1.00 39.00  ? 322 GLU A O   1 
ATOM   2190 C CB  . GLU A 1 326 ? 9.446  -0.937  37.499  1.00 41.98  ? 322 GLU A CB  1 
ATOM   2191 C CG  . GLU A 1 326 ? 9.597  -1.573  38.856  1.00 47.72  ? 322 GLU A CG  1 
ATOM   2192 C CD  . GLU A 1 326 ? 8.438  -2.518  39.208  1.00 50.78  ? 322 GLU A CD  1 
ATOM   2193 O OE1 . GLU A 1 326 ? 8.236  -2.758  40.417  1.00 52.10  ? 322 GLU A OE1 1 
ATOM   2194 O OE2 . GLU A 1 326 ? 7.746  -3.025  38.287  1.00 53.22  ? 322 GLU A OE2 1 
ATOM   2195 N N   . TYR A 1 327 ? 8.979  -1.129  34.292  1.00 41.12  ? 323 TYR A N   1 
ATOM   2196 C CA  . TYR A 1 327 ? 8.672  -0.338  33.096  1.00 42.11  ? 323 TYR A CA  1 
ATOM   2197 C C   . TYR A 1 327 ? 8.257  1.092   33.444  1.00 41.59  ? 323 TYR A C   1 
ATOM   2198 O O   . TYR A 1 327 ? 8.791  2.073   32.915  1.00 41.74  ? 323 TYR A O   1 
ATOM   2199 C CB  . TYR A 1 327 ? 7.530  -0.976  32.303  1.00 42.15  ? 323 TYR A CB  1 
ATOM   2200 C CG  . TYR A 1 327 ? 7.913  -2.199  31.513  1.00 43.50  ? 323 TYR A CG  1 
ATOM   2201 C CD1 . TYR A 1 327 ? 7.263  -3.421  31.723  1.00 43.54  ? 323 TYR A CD1 1 
ATOM   2202 C CD2 . TYR A 1 327 ? 8.891  -2.126  30.522  1.00 42.15  ? 323 TYR A CD2 1 
ATOM   2203 C CE1 . TYR A 1 327 ? 7.580  -4.539  30.950  1.00 45.01  ? 323 TYR A CE1 1 
ATOM   2204 C CE2 . TYR A 1 327 ? 9.216  -3.232  29.758  1.00 44.37  ? 323 TYR A CE2 1 
ATOM   2205 C CZ  . TYR A 1 327 ? 8.559  -4.433  29.972  1.00 45.36  ? 323 TYR A CZ  1 
ATOM   2206 O OH  . TYR A 1 327 ? 8.880  -5.531  29.210  1.00 47.72  ? 323 TYR A OH  1 
ATOM   2207 N N   . THR A 1 328 ? 7.294  1.210   34.341  1.00 41.42  ? 324 THR A N   1 
ATOM   2208 C CA  . THR A 1 328 ? 6.778  2.525   34.722  1.00 41.86  ? 324 THR A CA  1 
ATOM   2209 C C   . THR A 1 328 ? 7.843  3.262   35.513  1.00 41.47  ? 324 THR A C   1 
ATOM   2210 O O   . THR A 1 328 ? 8.161  2.871   36.629  1.00 41.33  ? 324 THR A O   1 
ATOM   2211 C CB  . THR A 1 328 ? 5.477  2.363   35.565  1.00 43.38  ? 324 THR A CB  1 
ATOM   2212 O OG1 . THR A 1 328 ? 4.535  1.555   34.830  1.00 45.33  ? 324 THR A OG1 1 
ATOM   2213 C CG2 . THR A 1 328 ? 4.856  3.724   35.858  1.00 42.06  ? 324 THR A CG2 1 
ATOM   2214 N N   . PRO A 1 329 ? 8.394  4.354   34.955  1.00 41.54  ? 325 PRO A N   1 
ATOM   2215 C CA  . PRO A 1 329 ? 9.442  5.094   35.657  1.00 40.42  ? 325 PRO A CA  1 
ATOM   2216 C C   . PRO A 1 329 ? 9.150  5.541   37.092  1.00 42.28  ? 325 PRO A C   1 
ATOM   2217 O O   . PRO A 1 329 ? 10.013 5.402   37.982  1.00 41.77  ? 325 PRO A O   1 
ATOM   2218 C CB  . PRO A 1 329 ? 9.737  6.259   34.714  1.00 40.02  ? 325 PRO A CB  1 
ATOM   2219 C CG  . PRO A 1 329 ? 9.417  5.724   33.372  1.00 41.19  ? 325 PRO A CG  1 
ATOM   2220 C CD  . PRO A 1 329 ? 8.134  4.948   33.628  1.00 40.94  ? 325 PRO A CD  1 
ATOM   2221 N N   . THR A 1 330 ? 7.948  6.064   37.329  1.00 41.31  ? 326 THR A N   1 
ATOM   2222 C CA  . THR A 1 330 ? 7.570  6.530   38.659  1.00 41.10  ? 326 THR A CA  1 
ATOM   2223 C C   . THR A 1 330 ? 7.389  5.371   39.625  1.00 40.00  ? 326 THR A C   1 
ATOM   2224 O O   . THR A 1 330 ? 7.345  5.579   40.838  1.00 39.72  ? 326 THR A O   1 
ATOM   2225 C CB  . THR A 1 330 ? 6.229  7.358   38.655  1.00 41.75  ? 326 THR A CB  1 
ATOM   2226 O OG1 . THR A 1 330 ? 5.179  6.561   38.087  1.00 44.71  ? 326 THR A OG1 1 
ATOM   2227 C CG2 . THR A 1 330 ? 6.381  8.651   37.860  1.00 40.11  ? 326 THR A CG2 1 
ATOM   2228 N N   . ALA A 1 331 ? 7.283  4.153   39.108  1.00 39.60  ? 327 ALA A N   1 
ATOM   2229 C CA  . ALA A 1 331 ? 7.115  2.992   39.988  1.00 40.00  ? 327 ALA A CA  1 
ATOM   2230 C C   . ALA A 1 331 ? 8.458  2.488   40.567  1.00 41.43  ? 327 ALA A C   1 
ATOM   2231 O O   . ALA A 1 331 ? 8.478  1.732   41.544  1.00 41.74  ? 327 ALA A O   1 
ATOM   2232 C CB  . ALA A 1 331 ? 6.412  1.842   39.233  1.00 38.70  ? 327 ALA A CB  1 
ATOM   2233 N N   . ARG A 1 332 ? 9.576  2.903   39.980  1.00 39.67  ? 328 ARG A N   1 
ATOM   2234 C CA  . ARG A 1 332 ? 10.884 2.466   40.471  1.00 39.09  ? 328 ARG A CA  1 
ATOM   2235 C C   . ARG A 1 332 ? 11.241 3.121   41.811  1.00 40.12  ? 328 ARG A C   1 
ATOM   2236 O O   . ARG A 1 332 ? 10.884 4.282   42.062  1.00 40.11  ? 328 ARG A O   1 
ATOM   2237 C CB  . ARG A 1 332 ? 11.985 2.841   39.466  1.00 35.26  ? 328 ARG A CB  1 
ATOM   2238 C CG  . ARG A 1 332 ? 11.743 2.332   38.078  1.00 33.15  ? 328 ARG A CG  1 
ATOM   2239 C CD  . ARG A 1 332 ? 12.777 2.802   37.068  1.00 33.11  ? 328 ARG A CD  1 
ATOM   2240 N NE  . ARG A 1 332 ? 12.308 2.382   35.754  1.00 32.02  ? 328 ARG A NE  1 
ATOM   2241 C CZ  . ARG A 1 332 ? 12.486 3.050   34.628  1.00 32.86  ? 328 ARG A CZ  1 
ATOM   2242 N NH1 . ARG A 1 332 ? 13.158 4.201   34.614  1.00 31.57  ? 328 ARG A NH1 1 
ATOM   2243 N NH2 . ARG A 1 332 ? 11.930 2.581   33.518  1.00 31.12  ? 328 ARG A NH2 1 
ATOM   2244 N N   . LEU A 1 333 ? 11.972 2.403   42.656  1.00 37.85  ? 329 LEU A N   1 
ATOM   2245 C CA  . LEU A 1 333 ? 12.416 2.971   43.934  1.00 38.26  ? 329 LEU A CA  1 
ATOM   2246 C C   . LEU A 1 333 ? 13.289 4.198   43.661  1.00 37.69  ? 329 LEU A C   1 
ATOM   2247 O O   . LEU A 1 333 ? 13.951 4.276   42.616  1.00 35.98  ? 329 LEU A O   1 
ATOM   2248 C CB  . LEU A 1 333 ? 13.310 1.983   44.686  1.00 39.20  ? 329 LEU A CB  1 
ATOM   2249 C CG  . LEU A 1 333 ? 12.752 0.633   45.105  1.00 41.93  ? 329 LEU A CG  1 
ATOM   2250 C CD1 . LEU A 1 333 ? 13.869 -0.161  45.777  1.00 42.90  ? 329 LEU A CD1 1 
ATOM   2251 C CD2 . LEU A 1 333 ? 11.590 0.825   46.090  1.00 42.86  ? 329 LEU A CD2 1 
ATOM   2252 N N   . THR A 1 334 ? 13.319 5.138   44.601  1.00 35.19  ? 330 THR A N   1 
ATOM   2253 C CA  . THR A 1 334 ? 14.197 6.298   44.456  1.00 35.09  ? 330 THR A CA  1 
ATOM   2254 C C   . THR A 1 334 ? 15.542 5.787   45.034  1.00 35.74  ? 330 THR A C   1 
ATOM   2255 O O   . THR A 1 334 ? 15.586 4.751   45.700  1.00 34.43  ? 330 THR A O   1 
ATOM   2256 C CB  . THR A 1 334 ? 13.757 7.471   45.348  1.00 35.51  ? 330 THR A CB  1 
ATOM   2257 O OG1 . THR A 1 334 ? 13.713 7.004   46.712  1.00 35.01  ? 330 THR A OG1 1 
ATOM   2258 C CG2 . THR A 1 334 ? 12.342 7.986   44.935  1.00 34.11  ? 330 THR A CG2 1 
ATOM   2259 N N   . PRO A 1 335 ? 16.643 6.511   44.791  1.00 35.17  ? 331 PRO A N   1 
ATOM   2260 C CA  . PRO A 1 335 ? 17.944 6.089   45.314  1.00 34.88  ? 331 PRO A CA  1 
ATOM   2261 C C   . PRO A 1 335 ? 17.922 5.893   46.835  1.00 36.87  ? 331 PRO A C   1 
ATOM   2262 O O   . PRO A 1 335 ? 18.448 4.893   47.357  1.00 34.37  ? 331 PRO A O   1 
ATOM   2263 C CB  . PRO A 1 335 ? 18.857 7.238   44.915  1.00 33.86  ? 331 PRO A CB  1 
ATOM   2264 C CG  . PRO A 1 335 ? 18.292 7.655   43.599  1.00 33.51  ? 331 PRO A CG  1 
ATOM   2265 C CD  . PRO A 1 335 ? 16.794 7.608   43.814  1.00 34.21  ? 331 PRO A CD  1 
ATOM   2266 N N   . LEU A 1 336 ? 17.320 6.848   47.550  1.00 36.22  ? 332 LEU A N   1 
ATOM   2267 C CA  . LEU A 1 336 ? 17.258 6.778   49.009  1.00 36.62  ? 332 LEU A CA  1 
ATOM   2268 C C   . LEU A 1 336 ? 16.444 5.566   49.450  1.00 37.64  ? 332 LEU A C   1 
ATOM   2269 O O   . LEU A 1 336 ? 16.846 4.822   50.371  1.00 38.73  ? 332 LEU A O   1 
ATOM   2270 C CB  . LEU A 1 336 ? 16.670 8.082   49.564  1.00 40.41  ? 332 LEU A CB  1 
ATOM   2271 C CG  . LEU A 1 336 ? 17.147 8.556   50.934  1.00 41.93  ? 332 LEU A CG  1 
ATOM   2272 C CD1 . LEU A 1 336 ? 18.655 8.744   50.918  1.00 39.24  ? 332 LEU A CD1 1 
ATOM   2273 C CD2 . LEU A 1 336 ? 16.422 9.876   51.306  1.00 42.76  ? 332 LEU A CD2 1 
ATOM   2274 N N   . GLU A 1 337 ? 15.310 5.327   48.801  1.00 37.55  ? 333 GLU A N   1 
ATOM   2275 C CA  . GLU A 1 337 ? 14.512 4.150   49.157  1.00 38.41  ? 333 GLU A CA  1 
ATOM   2276 C C   . GLU A 1 337 ? 15.323 2.859   48.913  1.00 39.46  ? 333 GLU A C   1 
ATOM   2277 O O   . GLU A 1 337 ? 15.196 1.891   49.648  1.00 40.18  ? 333 GLU A O   1 
ATOM   2278 C CB  . GLU A 1 337 ? 13.217 4.113   48.344  1.00 38.89  ? 333 GLU A CB  1 
ATOM   2279 C CG  . GLU A 1 337 ? 12.212 5.204   48.755  1.00 42.34  ? 333 GLU A CG  1 
ATOM   2280 C CD  . GLU A 1 337 ? 11.045 5.364   47.781  1.00 45.15  ? 333 GLU A CD  1 
ATOM   2281 O OE1 . GLU A 1 337 ? 10.098 6.117   48.131  1.00 48.22  ? 333 GLU A OE1 1 
ATOM   2282 O OE2 . GLU A 1 337 ? 11.075 4.767   46.674  1.00 43.15  ? 333 GLU A OE2 1 
ATOM   2283 N N   . ALA A 1 338 ? 16.154 2.855   47.874  1.00 37.92  ? 334 ALA A N   1 
ATOM   2284 C CA  . ALA A 1 338 ? 16.977 1.682   47.559  1.00 37.84  ? 334 ALA A CA  1 
ATOM   2285 C C   . ALA A 1 338 ? 17.986 1.466   48.699  1.00 35.39  ? 334 ALA A C   1 
ATOM   2286 O O   . ALA A 1 338 ? 18.160 0.347   49.166  1.00 33.41  ? 334 ALA A O   1 
ATOM   2287 C CB  . ALA A 1 338 ? 17.717 1.881   46.181  1.00 34.24  ? 334 ALA A CB  1 
ATOM   2288 N N   . CYS A 1 339 ? 18.633 2.536   49.156  1.00 34.98  ? 335 CYS A N   1 
ATOM   2289 C CA  . CYS A 1 339 ? 19.574 2.423   50.264  1.00 35.80  ? 335 CYS A CA  1 
ATOM   2290 C C   . CYS A 1 339 ? 18.942 1.797   51.498  1.00 37.04  ? 335 CYS A C   1 
ATOM   2291 O O   . CYS A 1 339 ? 19.610 1.080   52.262  1.00 38.11  ? 335 CYS A O   1 
ATOM   2292 C CB  . CYS A 1 339 ? 20.120 3.800   50.671  1.00 36.90  ? 335 CYS A CB  1 
ATOM   2293 S SG  . CYS A 1 339 ? 21.386 4.495   49.575  1.00 38.16  ? 335 CYS A SG  1 
ATOM   2294 N N   . ALA A 1 340 ? 17.657 2.077   51.696  1.00 37.00  ? 336 ALA A N   1 
ATOM   2295 C CA  . ALA A 1 340 ? 16.918 1.615   52.861  1.00 35.53  ? 336 ALA A CA  1 
ATOM   2296 C C   . ALA A 1 340 ? 16.365 0.214   52.690  1.00 35.94  ? 336 ALA A C   1 
ATOM   2297 O O   . ALA A 1 340 ? 15.797 -0.330  53.608  1.00 35.04  ? 336 ALA A O   1 
ATOM   2298 C CB  . ALA A 1 340 ? 15.763 2.596   53.156  1.00 34.34  ? 336 ALA A CB  1 
ATOM   2299 N N   . HIS A 1 341 ? 16.528 -0.365  51.507  1.00 36.34  ? 337 HIS A N   1 
ATOM   2300 C CA  . HIS A 1 341 ? 16.020 -1.707  51.229  1.00 36.41  ? 337 HIS A CA  1 
ATOM   2301 C C   . HIS A 1 341 ? 16.671 -2.804  52.114  1.00 38.44  ? 337 HIS A C   1 
ATOM   2302 O O   . HIS A 1 341 ? 17.843 -2.705  52.504  1.00 36.33  ? 337 HIS A O   1 
ATOM   2303 C CB  . HIS A 1 341 ? 16.221 -2.021  49.741  1.00 36.00  ? 337 HIS A CB  1 
ATOM   2304 C CG  . HIS A 1 341 ? 15.470 -3.231  49.269  1.00 35.11  ? 337 HIS A CG  1 
ATOM   2305 N ND1 . HIS A 1 341 ? 15.970 -4.513  49.378  1.00 36.82  ? 337 HIS A ND1 1 
ATOM   2306 C CD2 . HIS A 1 341 ? 14.249 -3.351  48.697  1.00 34.70  ? 337 HIS A CD2 1 
ATOM   2307 C CE1 . HIS A 1 341 ? 15.088 -5.374  48.891  1.00 36.29  ? 337 HIS A CE1 1 
ATOM   2308 N NE2 . HIS A 1 341 ? 14.034 -4.692  48.473  1.00 38.68  ? 337 HIS A NE2 1 
ATOM   2309 N N   . SER A 1 342 ? 15.909 -3.855  52.416  1.00 39.09  ? 338 SER A N   1 
ATOM   2310 C CA  . SER A 1 342 ? 16.407 -4.918  53.279  1.00 42.14  ? 338 SER A CA  1 
ATOM   2311 C C   . SER A 1 342 ? 17.656 -5.632  52.754  1.00 41.23  ? 338 SER A C   1 
ATOM   2312 O O   . SER A 1 342 ? 18.412 -6.206  53.537  1.00 41.20  ? 338 SER A O   1 
ATOM   2313 C CB  . SER A 1 342 ? 15.293 -5.936  53.539  1.00 44.08  ? 338 SER A CB  1 
ATOM   2314 O OG  . SER A 1 342 ? 14.871 -6.484  52.308  1.00 48.49  ? 338 SER A OG  1 
ATOM   2315 N N   . PHE A 1 343 ? 17.885 -5.603  51.440  1.00 41.85  ? 339 PHE A N   1 
ATOM   2316 C CA  . PHE A 1 343 ? 19.082 -6.233  50.869  1.00 39.19  ? 339 PHE A CA  1 
ATOM   2317 C C   . PHE A 1 343 ? 20.323 -5.606  51.533  1.00 38.78  ? 339 PHE A C   1 
ATOM   2318 O O   . PHE A 1 343 ? 21.377 -6.258  51.674  1.00 36.13  ? 339 PHE A O   1 
ATOM   2319 C CB  . PHE A 1 343 ? 19.128 -6.020  49.332  1.00 40.70  ? 339 PHE A CB  1 
ATOM   2320 C CG  . PHE A 1 343 ? 20.412 -6.510  48.675  1.00 41.40  ? 339 PHE A CG  1 
ATOM   2321 C CD1 . PHE A 1 343 ? 20.790 -7.855  48.761  1.00 41.03  ? 339 PHE A CD1 1 
ATOM   2322 C CD2 . PHE A 1 343 ? 21.245 -5.625  47.982  1.00 40.99  ? 339 PHE A CD2 1 
ATOM   2323 C CE1 . PHE A 1 343 ? 21.975 -8.322  48.168  1.00 39.57  ? 339 PHE A CE1 1 
ATOM   2324 C CE2 . PHE A 1 343 ? 22.442 -6.075  47.377  1.00 40.92  ? 339 PHE A CE2 1 
ATOM   2325 C CZ  . PHE A 1 343 ? 22.810 -7.422  47.466  1.00 38.83  ? 339 PHE A CZ  1 
ATOM   2326 N N   . PHE A 1 344 ? 20.213 -4.348  51.960  1.00 37.14  ? 340 PHE A N   1 
ATOM   2327 C CA  . PHE A 1 344 ? 21.351 -3.705  52.619  1.00 37.55  ? 340 PHE A CA  1 
ATOM   2328 C C   . PHE A 1 344 ? 21.386 -3.811  54.155  1.00 37.77  ? 340 PHE A C   1 
ATOM   2329 O O   . PHE A 1 344 ? 22.277 -3.234  54.794  1.00 39.32  ? 340 PHE A O   1 
ATOM   2330 C CB  . PHE A 1 344 ? 21.459 -2.234  52.195  1.00 34.64  ? 340 PHE A CB  1 
ATOM   2331 C CG  . PHE A 1 344 ? 21.597 -2.046  50.693  1.00 36.04  ? 340 PHE A CG  1 
ATOM   2332 C CD1 . PHE A 1 344 ? 22.716 -2.536  50.019  1.00 32.15  ? 340 PHE A CD1 1 
ATOM   2333 C CD2 . PHE A 1 344 ? 20.597 -1.407  49.956  1.00 33.20  ? 340 PHE A CD2 1 
ATOM   2334 C CE1 . PHE A 1 344 ? 22.848 -2.399  48.623  1.00 32.58  ? 340 PHE A CE1 1 
ATOM   2335 C CE2 . PHE A 1 344 ? 20.718 -1.266  48.572  1.00 34.41  ? 340 PHE A CE2 1 
ATOM   2336 C CZ  . PHE A 1 344 ? 21.865 -1.774  47.903  1.00 32.35  ? 340 PHE A CZ  1 
ATOM   2337 N N   . ASP A 1 345 ? 20.477 -4.569  54.757  1.00 37.83  ? 341 ASP A N   1 
ATOM   2338 C CA  . ASP A 1 345 ? 20.477 -4.660  56.243  1.00 40.16  ? 341 ASP A CA  1 
ATOM   2339 C C   . ASP A 1 345 ? 21.799 -5.118  56.866  1.00 39.83  ? 341 ASP A C   1 
ATOM   2340 O O   . ASP A 1 345 ? 22.206 -4.609  57.917  1.00 39.42  ? 341 ASP A O   1 
ATOM   2341 C CB  . ASP A 1 345 ? 19.331 -5.549  56.751  1.00 41.16  ? 341 ASP A CB  1 
ATOM   2342 C CG  . ASP A 1 345 ? 17.953 -4.901  56.556  1.00 44.47  ? 341 ASP A CG  1 
ATOM   2343 O OD1 . ASP A 1 345 ? 17.894 -3.662  56.327  1.00 44.44  ? 341 ASP A OD1 1 
ATOM   2344 O OD2 . ASP A 1 345 ? 16.938 -5.638  56.636  1.00 46.81  ? 341 ASP A OD2 1 
ATOM   2345 N N   . GLU A 1 346 ? 22.480 -6.057  56.211  1.00 39.54  ? 342 GLU A N   1 
ATOM   2346 C CA  . GLU A 1 346 ? 23.752 -6.527  56.715  1.00 39.85  ? 342 GLU A CA  1 
ATOM   2347 C C   . GLU A 1 346 ? 24.743 -5.362  56.909  1.00 39.70  ? 342 GLU A C   1 
ATOM   2348 O O   . GLU A 1 346 ? 25.559 -5.368  57.848  1.00 37.34  ? 342 GLU A O   1 
ATOM   2349 C CB  . GLU A 1 346 ? 24.362 -7.543  55.750  1.00 42.62  ? 342 GLU A CB  1 
ATOM   2350 C CG  . GLU A 1 346 ? 25.563 -8.246  56.363  1.00 47.65  ? 342 GLU A CG  1 
ATOM   2351 C CD  . GLU A 1 346 ? 26.282 -9.212  55.417  1.00 49.00  ? 342 GLU A CD  1 
ATOM   2352 O OE1 . GLU A 1 346 ? 25.759 -9.534  54.324  1.00 49.61  ? 342 GLU A OE1 1 
ATOM   2353 O OE2 . GLU A 1 346 ? 27.386 -9.654  55.793  1.00 51.45  ? 342 GLU A OE2 1 
ATOM   2354 N N   . LEU A 1 347 ? 24.674 -4.350  56.039  1.00 37.00  ? 343 LEU A N   1 
ATOM   2355 C CA  . LEU A 1 347 ? 25.588 -3.212  56.167  1.00 36.40  ? 343 LEU A CA  1 
ATOM   2356 C C   . LEU A 1 347 ? 25.278 -2.368  57.407  1.00 34.94  ? 343 LEU A C   1 
ATOM   2357 O O   . LEU A 1 347 ? 26.122 -1.618  57.874  1.00 34.20  ? 343 LEU A O   1 
ATOM   2358 C CB  . LEU A 1 347 ? 25.521 -2.318  54.919  1.00 34.97  ? 343 LEU A CB  1 
ATOM   2359 C CG  . LEU A 1 347 ? 25.836 -2.994  53.579  1.00 36.77  ? 343 LEU A CG  1 
ATOM   2360 C CD1 . LEU A 1 347 ? 25.783 -1.911  52.453  1.00 33.35  ? 343 LEU A CD1 1 
ATOM   2361 C CD2 . LEU A 1 347 ? 27.229 -3.683  53.654  1.00 32.69  ? 343 LEU A CD2 1 
ATOM   2362 N N   . ARG A 1 348 ? 24.068 -2.499  57.926  1.00 34.85  ? 344 ARG A N   1 
ATOM   2363 C CA  . ARG A 1 348 ? 23.670 -1.740  59.116  1.00 39.76  ? 344 ARG A CA  1 
ATOM   2364 C C   . ARG A 1 348 ? 23.923 -2.502  60.428  1.00 41.84  ? 344 ARG A C   1 
ATOM   2365 O O   . ARG A 1 348 ? 23.693 -1.965  61.509  1.00 41.90  ? 344 ARG A O   1 
ATOM   2366 C CB  . ARG A 1 348 ? 22.185 -1.339  59.013  1.00 37.29  ? 344 ARG A CB  1 
ATOM   2367 C CG  . ARG A 1 348 ? 21.936 -0.210  57.989  1.00 35.64  ? 344 ARG A CG  1 
ATOM   2368 C CD  . ARG A 1 348 ? 20.458 0.168   57.892  1.00 33.51  ? 344 ARG A CD  1 
ATOM   2369 N NE  . ARG A 1 348 ? 19.711 -0.730  57.010  1.00 35.58  ? 344 ARG A NE  1 
ATOM   2370 C CZ  . ARG A 1 348 ? 19.599 -0.584  55.692  1.00 35.36  ? 344 ARG A CZ  1 
ATOM   2371 N NH1 . ARG A 1 348 ? 20.189 0.443   55.071  1.00 34.69  ? 344 ARG A NH1 1 
ATOM   2372 N NH2 . ARG A 1 348 ? 18.887 -1.463  55.001  1.00 34.65  ? 344 ARG A NH2 1 
ATOM   2373 N N   . ASP A 1 349 ? 24.397 -3.748  60.322  1.00 44.69  ? 345 ASP A N   1 
ATOM   2374 C CA  . ASP A 1 349 ? 24.702 -4.565  61.498  1.00 45.03  ? 345 ASP A CA  1 
ATOM   2375 C C   . ASP A 1 349 ? 25.966 -3.995  62.147  1.00 45.18  ? 345 ASP A C   1 
ATOM   2376 O O   . ASP A 1 349 ? 26.975 -3.791  61.475  1.00 45.26  ? 345 ASP A O   1 
ATOM   2377 C CB  . ASP A 1 349 ? 24.940 -6.014  61.075  1.00 47.31  ? 345 ASP A CB  1 
ATOM   2378 C CG  . ASP A 1 349 ? 25.206 -6.952  62.266  1.00 49.71  ? 345 ASP A CG  1 
ATOM   2379 O OD1 . ASP A 1 349 ? 26.082 -6.649  63.112  1.00 49.07  ? 345 ASP A OD1 1 
ATOM   2380 O OD2 . ASP A 1 349 ? 24.540 -8.004  62.336  1.00 50.37  ? 345 ASP A OD2 1 
ATOM   2381 N N   . PRO A 1 350 ? 25.927 -3.736  63.468  1.00 46.02  ? 346 PRO A N   1 
ATOM   2382 C CA  . PRO A 1 350 ? 27.038 -3.186  64.260  1.00 46.70  ? 346 PRO A CA  1 
ATOM   2383 C C   . PRO A 1 350 ? 28.368 -3.955  64.123  1.00 47.06  ? 346 PRO A C   1 
ATOM   2384 O O   . PRO A 1 350 ? 29.438 -3.371  64.248  1.00 47.44  ? 346 PRO A O   1 
ATOM   2385 C CB  . PRO A 1 350 ? 26.531 -3.276  65.711  1.00 46.93  ? 346 PRO A CB  1 
ATOM   2386 C CG  . PRO A 1 350 ? 25.072 -3.418  65.596  1.00 49.80  ? 346 PRO A CG  1 
ATOM   2387 C CD  . PRO A 1 350 ? 24.842 -4.211  64.344  1.00 47.48  ? 346 PRO A CD  1 
ATOM   2388 N N   . ASN A 1 351 ? 28.308 -5.257  63.872  1.00 47.43  ? 347 ASN A N   1 
ATOM   2389 C CA  . ASN A 1 351 ? 29.549 -6.034  63.804  1.00 50.89  ? 347 ASN A CA  1 
ATOM   2390 C C   . ASN A 1 351 ? 30.092 -6.355  62.421  1.00 50.23  ? 347 ASN A C   1 
ATOM   2391 O O   . ASN A 1 351 ? 31.115 -7.030  62.310  1.00 49.05  ? 347 ASN A O   1 
ATOM   2392 C CB  . ASN A 1 351 ? 29.379 -7.352  64.584  1.00 53.45  ? 347 ASN A CB  1 
ATOM   2393 C CG  . ASN A 1 351 ? 28.834 -7.133  65.987  1.00 55.97  ? 347 ASN A CG  1 
ATOM   2394 O OD1 . ASN A 1 351 ? 29.403 -6.373  66.783  1.00 56.45  ? 347 ASN A OD1 1 
ATOM   2395 N ND2 . ASN A 1 351 ? 27.718 -7.794  66.295  1.00 58.16  ? 347 ASN A ND2 1 
ATOM   2396 N N   . VAL A 1 352 ? 29.429 -5.869  61.373  1.00 49.36  ? 348 VAL A N   1 
ATOM   2397 C CA  . VAL A 1 352 ? 29.876 -6.155  60.012  1.00 48.12  ? 348 VAL A CA  1 
ATOM   2398 C C   . VAL A 1 352 ? 31.321 -5.716  59.766  1.00 49.06  ? 348 VAL A C   1 
ATOM   2399 O O   . VAL A 1 352 ? 31.743 -4.649  60.205  1.00 48.52  ? 348 VAL A O   1 
ATOM   2400 C CB  . VAL A 1 352 ? 28.946 -5.476  58.945  1.00 47.40  ? 348 VAL A CB  1 
ATOM   2401 C CG1 . VAL A 1 352 ? 29.098 -3.941  58.990  1.00 40.74  ? 348 VAL A CG1 1 
ATOM   2402 C CG2 . VAL A 1 352 ? 29.274 -6.019  57.544  1.00 44.86  ? 348 VAL A CG2 1 
ATOM   2403 N N   . LYS A 1 353 ? 32.078 -6.554  59.063  1.00 50.77  ? 349 LYS A N   1 
ATOM   2404 C CA  . LYS A 1 353 ? 33.469 -6.237  58.738  1.00 52.82  ? 349 LYS A CA  1 
ATOM   2405 C C   . LYS A 1 353 ? 33.739 -6.600  57.276  1.00 52.25  ? 349 LYS A C   1 
ATOM   2406 O O   . LYS A 1 353 ? 32.991 -7.371  56.679  1.00 50.30  ? 349 LYS A O   1 
ATOM   2407 C CB  . LYS A 1 353 ? 34.422 -7.039  59.646  1.00 55.09  ? 349 LYS A CB  1 
ATOM   2408 C CG  . LYS A 1 353 ? 34.445 -6.585  61.108  1.00 59.12  ? 349 LYS A CG  1 
ATOM   2409 C CD  . LYS A 1 353 ? 35.165 -5.241  61.243  1.00 62.10  ? 349 LYS A CD  1 
ATOM   2410 C CE  . LYS A 1 353 ? 35.075 -4.687  62.659  1.00 65.52  ? 349 LYS A CE  1 
ATOM   2411 N NZ  . LYS A 1 353 ? 35.881 -5.488  63.634  1.00 68.11  ? 349 LYS A NZ  1 
ATOM   2412 N N   . LEU A 1 354 ? 34.787 -6.034  56.687  1.00 52.62  ? 350 LEU A N   1 
ATOM   2413 C CA  . LEU A 1 354 ? 35.137 -6.412  55.322  1.00 54.44  ? 350 LEU A CA  1 
ATOM   2414 C C   . LEU A 1 354 ? 35.826 -7.786  55.431  1.00 56.16  ? 350 LEU A C   1 
ATOM   2415 O O   . LEU A 1 354 ? 36.347 -8.142  56.488  1.00 56.10  ? 350 LEU A O   1 
ATOM   2416 C CB  . LEU A 1 354 ? 36.124 -5.414  54.705  1.00 54.57  ? 350 LEU A CB  1 
ATOM   2417 C CG  . LEU A 1 354 ? 35.672 -3.963  54.578  1.00 54.77  ? 350 LEU A CG  1 
ATOM   2418 C CD1 . LEU A 1 354 ? 36.762 -3.147  53.902  1.00 54.56  ? 350 LEU A CD1 1 
ATOM   2419 C CD2 . LEU A 1 354 ? 34.379 -3.918  53.791  1.00 53.82  ? 350 LEU A CD2 1 
ATOM   2420 N N   . PRO A 1 355 ? 35.814 -8.582  54.352  1.00 58.15  ? 351 PRO A N   1 
ATOM   2421 C CA  . PRO A 1 355 ? 36.469 -9.894  54.417  1.00 59.34  ? 351 PRO A CA  1 
ATOM   2422 C C   . PRO A 1 355 ? 37.952 -9.759  54.781  1.00 60.77  ? 351 PRO A C   1 
ATOM   2423 O O   . PRO A 1 355 ? 38.502 -10.643 55.411  1.00 61.12  ? 351 PRO A O   1 
ATOM   2424 C CB  . PRO A 1 355 ? 36.258 -10.455 53.013  1.00 58.65  ? 351 PRO A CB  1 
ATOM   2425 C CG  . PRO A 1 355 ? 34.900 -9.908  52.664  1.00 58.17  ? 351 PRO A CG  1 
ATOM   2426 C CD  . PRO A 1 355 ? 35.013 -8.458  53.120  1.00 57.64  ? 351 PRO A CD  1 
ATOM   2427 N N   . ASN A 1 356 ? 38.594 -8.653  54.396  1.00 63.10  ? 352 ASN A N   1 
ATOM   2428 C CA  . ASN A 1 356 ? 40.008 -8.457  54.723  1.00 63.89  ? 352 ASN A CA  1 
ATOM   2429 C C   . ASN A 1 356 ? 40.204 -8.042  56.186  1.00 64.69  ? 352 ASN A C   1 
ATOM   2430 O O   . ASN A 1 356 ? 41.312 -7.683  56.597  1.00 65.46  ? 352 ASN A O   1 
ATOM   2431 C CB  . ASN A 1 356 ? 40.661 -7.416  53.787  1.00 64.15  ? 352 ASN A CB  1 
ATOM   2432 C CG  . ASN A 1 356 ? 40.142 -5.985  54.003  1.00 64.43  ? 352 ASN A CG  1 
ATOM   2433 O OD1 . ASN A 1 356 ? 39.380 -5.708  54.938  1.00 65.23  ? 352 ASN A OD1 1 
ATOM   2434 N ND2 . ASN A 1 356 ? 40.575 -5.067  53.136  1.00 62.59  ? 352 ASN A ND2 1 
ATOM   2435 N N   . GLY A 1 357 ? 39.125 -8.090  56.966  1.00 64.78  ? 353 GLY A N   1 
ATOM   2436 C CA  . GLY A 1 357 ? 39.207 -7.730  58.372  1.00 63.80  ? 353 GLY A CA  1 
ATOM   2437 C C   . GLY A 1 357 ? 39.040 -6.257  58.736  1.00 62.68  ? 353 GLY A C   1 
ATOM   2438 O O   . GLY A 1 357 ? 38.774 -5.942  59.895  1.00 62.66  ? 353 GLY A O   1 
ATOM   2439 N N   . ARG A 1 358 ? 39.198 -5.345  57.780  1.00 61.60  ? 354 ARG A N   1 
ATOM   2440 C CA  . ARG A 1 358 ? 39.045 -3.916  58.093  1.00 60.72  ? 354 ARG A CA  1 
ATOM   2441 C C   . ARG A 1 358 ? 37.579 -3.548  58.306  1.00 58.05  ? 354 ARG A C   1 
ATOM   2442 O O   . ARG A 1 358 ? 36.680 -4.326  57.995  1.00 57.16  ? 354 ARG A O   1 
ATOM   2443 C CB  . ARG A 1 358 ? 39.575 -3.039  56.958  1.00 62.59  ? 354 ARG A CB  1 
ATOM   2444 C CG  . ARG A 1 358 ? 40.971 -3.347  56.481  1.00 65.04  ? 354 ARG A CG  1 
ATOM   2445 C CD  . ARG A 1 358 ? 41.432 -2.228  55.555  1.00 68.64  ? 354 ARG A CD  1 
ATOM   2446 N NE  . ARG A 1 358 ? 42.692 -2.528  54.881  1.00 72.01  ? 354 ARG A NE  1 
ATOM   2447 C CZ  . ARG A 1 358 ? 43.461 -1.609  54.302  1.00 73.91  ? 354 ARG A CZ  1 
ATOM   2448 N NH1 . ARG A 1 358 ? 43.095 -0.327  54.322  1.00 73.59  ? 354 ARG A NH1 1 
ATOM   2449 N NH2 . ARG A 1 358 ? 44.592 -1.970  53.698  1.00 75.79  ? 354 ARG A NH2 1 
ATOM   2450 N N   . ASP A 1 359 ? 37.334 -2.356  58.836  1.00 56.76  ? 355 ASP A N   1 
ATOM   2451 C CA  . ASP A 1 359 ? 35.960 -1.905  59.022  1.00 56.41  ? 355 ASP A CA  1 
ATOM   2452 C C   . ASP A 1 359 ? 35.410 -1.446  57.677  1.00 53.83  ? 355 ASP A C   1 
ATOM   2453 O O   . ASP A 1 359 ? 36.158 -1.172  56.746  1.00 52.51  ? 355 ASP A O   1 
ATOM   2454 C CB  . ASP A 1 359 ? 35.878 -0.723  59.983  1.00 59.07  ? 355 ASP A CB  1 
ATOM   2455 C CG  . ASP A 1 359 ? 36.216 -1.101  61.397  1.00 61.11  ? 355 ASP A CG  1 
ATOM   2456 O OD1 . ASP A 1 359 ? 35.568 -2.019  61.955  1.00 62.41  ? 355 ASP A OD1 1 
ATOM   2457 O OD2 . ASP A 1 359 ? 37.139 -0.467  61.943  1.00 64.67  ? 355 ASP A OD2 1 
ATOM   2458 N N   . THR A 1 360 ? 34.093 -1.363  57.576  1.00 51.97  ? 356 THR A N   1 
ATOM   2459 C CA  . THR A 1 360 ? 33.476 -0.893  56.339  1.00 50.15  ? 356 THR A CA  1 
ATOM   2460 C C   . THR A 1 360 ? 33.724 0.611   56.249  1.00 47.30  ? 356 THR A C   1 
ATOM   2461 O O   . THR A 1 360 ? 34.071 1.248   57.239  1.00 45.05  ? 356 THR A O   1 
ATOM   2462 C CB  . THR A 1 360 ? 31.954 -1.102  56.359  1.00 50.79  ? 356 THR A CB  1 
ATOM   2463 O OG1 . THR A 1 360 ? 31.430 -0.558  57.576  1.00 52.92  ? 356 THR A OG1 1 
ATOM   2464 C CG2 . THR A 1 360 ? 31.609 -2.577  56.275  1.00 51.67  ? 356 THR A CG2 1 
ATOM   2465 N N   . PRO A 1 361 ? 33.570 1.192   55.048  1.00 45.80  ? 357 PRO A N   1 
ATOM   2466 C CA  . PRO A 1 361 ? 33.772 2.637   54.864  1.00 45.62  ? 357 PRO A CA  1 
ATOM   2467 C C   . PRO A 1 361 ? 32.594 3.350   55.553  1.00 43.91  ? 357 PRO A C   1 
ATOM   2468 O O   . PRO A 1 361 ? 31.636 2.704   55.989  1.00 41.21  ? 357 PRO A O   1 
ATOM   2469 C CB  . PRO A 1 361 ? 33.705 2.820   53.346  1.00 45.08  ? 357 PRO A CB  1 
ATOM   2470 C CG  . PRO A 1 361 ? 33.802 1.416   52.770  1.00 44.16  ? 357 PRO A CG  1 
ATOM   2471 C CD  . PRO A 1 361 ? 33.160 0.547   53.788  1.00 45.59  ? 357 PRO A CD  1 
ATOM   2472 N N   . ALA A 1 362 ? 32.646 4.672   55.637  1.00 45.11  ? 358 ALA A N   1 
ATOM   2473 C CA  . ALA A 1 362 ? 31.559 5.423   56.294  1.00 45.22  ? 358 ALA A CA  1 
ATOM   2474 C C   . ALA A 1 362 ? 30.270 5.249   55.478  1.00 45.12  ? 358 ALA A C   1 
ATOM   2475 O O   . ALA A 1 362 ? 30.237 5.550   54.298  1.00 46.81  ? 358 ALA A O   1 
ATOM   2476 C CB  . ALA A 1 362 ? 31.939 6.904   56.399  1.00 47.65  ? 358 ALA A CB  1 
ATOM   2477 N N   . LEU A 1 363 ? 29.206 4.746   56.094  1.00 43.56  ? 359 LEU A N   1 
ATOM   2478 C CA  . LEU A 1 363 ? 27.995 4.509   55.326  1.00 42.96  ? 359 LEU A CA  1 
ATOM   2479 C C   . LEU A 1 363 ? 26.780 5.275   55.800  1.00 42.03  ? 359 LEU A C   1 
ATOM   2480 O O   . LEU A 1 363 ? 25.762 5.335   55.104  1.00 40.65  ? 359 LEU A O   1 
ATOM   2481 C CB  . LEU A 1 363 ? 27.662 3.014   55.352  1.00 42.08  ? 359 LEU A CB  1 
ATOM   2482 C CG  . LEU A 1 363 ? 28.702 2.038   54.770  1.00 44.70  ? 359 LEU A CG  1 
ATOM   2483 C CD1 . LEU A 1 363 ? 28.219 0.577   54.969  1.00 43.85  ? 359 LEU A CD1 1 
ATOM   2484 C CD2 . LEU A 1 363 ? 28.904 2.336   53.299  1.00 41.56  ? 359 LEU A CD2 1 
ATOM   2485 N N   . PHE A 1 364 ? 26.899 5.878   56.973  1.00 40.70  ? 360 PHE A N   1 
ATOM   2486 C CA  . PHE A 1 364 ? 25.777 6.547   57.599  1.00 42.42  ? 360 PHE A CA  1 
ATOM   2487 C C   . PHE A 1 364 ? 25.863 8.043   57.830  1.00 43.25  ? 360 PHE A C   1 
ATOM   2488 O O   . PHE A 1 364 ? 24.964 8.602   58.439  1.00 43.37  ? 360 PHE A O   1 
ATOM   2489 C CB  . PHE A 1 364 ? 25.502 5.856   58.940  1.00 43.53  ? 360 PHE A CB  1 
ATOM   2490 C CG  . PHE A 1 364 ? 25.605 4.355   58.869  1.00 43.21  ? 360 PHE A CG  1 
ATOM   2491 C CD1 . PHE A 1 364 ? 26.565 3.674   59.607  1.00 44.62  ? 360 PHE A CD1 1 
ATOM   2492 C CD2 . PHE A 1 364 ? 24.755 3.635   58.055  1.00 40.97  ? 360 PHE A CD2 1 
ATOM   2493 C CE1 . PHE A 1 364 ? 26.671 2.280   59.536  1.00 44.83  ? 360 PHE A CE1 1 
ATOM   2494 C CE2 . PHE A 1 364 ? 24.849 2.246   57.974  1.00 45.86  ? 360 PHE A CE2 1 
ATOM   2495 C CZ  . PHE A 1 364 ? 25.814 1.565   58.721  1.00 43.00  ? 360 PHE A CZ  1 
ATOM   2496 N N   . ASN A 1 365 ? 26.913 8.694   57.350  1.00 43.50  ? 361 ASN A N   1 
ATOM   2497 C CA  . ASN A 1 365 ? 27.045 10.128  57.559  1.00 44.08  ? 361 ASN A CA  1 
ATOM   2498 C C   . ASN A 1 365 ? 26.168 10.939  56.581  1.00 42.99  ? 361 ASN A C   1 
ATOM   2499 O O   . ASN A 1 365 ? 26.672 11.782  55.842  1.00 41.34  ? 361 ASN A O   1 
ATOM   2500 C CB  . ASN A 1 365 ? 28.533 10.519  57.440  1.00 45.99  ? 361 ASN A CB  1 
ATOM   2501 C CG  . ASN A 1 365 ? 29.178 9.987   56.176  1.00 49.04  ? 361 ASN A CG  1 
ATOM   2502 O OD1 . ASN A 1 365 ? 28.642 9.095   55.520  1.00 50.41  ? 361 ASN A OD1 1 
ATOM   2503 N ND2 . ASN A 1 365 ? 30.346 10.526  55.834  1.00 52.02  ? 361 ASN A ND2 1 
ATOM   2504 N N   . PHE A 1 366 ? 24.860 10.678  56.583  1.00 42.16  ? 362 PHE A N   1 
ATOM   2505 C CA  . PHE A 1 366 ? 23.944 11.384  55.686  1.00 45.20  ? 362 PHE A CA  1 
ATOM   2506 C C   . PHE A 1 366 ? 23.754 12.875  56.071  1.00 47.06  ? 362 PHE A C   1 
ATOM   2507 O O   . PHE A 1 366 ? 23.688 13.208  57.265  1.00 46.99  ? 362 PHE A O   1 
ATOM   2508 C CB  . PHE A 1 366 ? 22.558 10.714  55.681  1.00 44.81  ? 362 PHE A CB  1 
ATOM   2509 C CG  . PHE A 1 366 ? 22.509 9.377   54.972  1.00 44.53  ? 362 PHE A CG  1 
ATOM   2510 C CD1 . PHE A 1 366 ? 22.739 8.192   55.664  1.00 43.96  ? 362 PHE A CD1 1 
ATOM   2511 C CD2 . PHE A 1 366 ? 22.231 9.308   53.602  1.00 43.40  ? 362 PHE A CD2 1 
ATOM   2512 C CE1 . PHE A 1 366 ? 22.693 6.940   55.003  1.00 43.05  ? 362 PHE A CE1 1 
ATOM   2513 C CE2 . PHE A 1 366 ? 22.183 8.077   52.931  1.00 44.02  ? 362 PHE A CE2 1 
ATOM   2514 C CZ  . PHE A 1 366 ? 22.415 6.883   53.632  1.00 42.18  ? 362 PHE A CZ  1 
ATOM   2515 N N   . THR A 1 367 ? 23.678 13.759  55.070  1.00 48.05  ? 363 THR A N   1 
ATOM   2516 C CA  . THR A 1 367 ? 23.434 15.191  55.324  1.00 49.25  ? 363 THR A CA  1 
ATOM   2517 C C   . THR A 1 367 ? 21.944 15.450  55.094  1.00 50.34  ? 363 THR A C   1 
ATOM   2518 O O   . THR A 1 367 ? 21.227 14.577  54.568  1.00 51.90  ? 363 THR A O   1 
ATOM   2519 C CB  . THR A 1 367 ? 24.179 16.111  54.350  1.00 47.99  ? 363 THR A CB  1 
ATOM   2520 O OG1 . THR A 1 367 ? 23.707 15.856  53.018  1.00 48.14  ? 363 THR A OG1 1 
ATOM   2521 C CG2 . THR A 1 367 ? 25.689 15.907  54.443  1.00 46.61  ? 363 THR A CG2 1 
ATOM   2522 N N   . THR A 1 368 ? 21.480 16.644  55.476  1.00 50.30  ? 364 THR A N   1 
ATOM   2523 C CA  . THR A 1 368 ? 20.076 17.018  55.288  1.00 49.01  ? 364 THR A CA  1 
ATOM   2524 C C   . THR A 1 368 ? 19.786 17.038  53.782  1.00 47.59  ? 364 THR A C   1 
ATOM   2525 O O   . THR A 1 368 ? 18.737 16.593  53.341  1.00 48.25  ? 364 THR A O   1 
ATOM   2526 C CB  . THR A 1 368 ? 19.779 18.442  55.877  1.00 50.66  ? 364 THR A CB  1 
ATOM   2527 O OG1 . THR A 1 368 ? 20.077 18.453  57.279  1.00 50.17  ? 364 THR A OG1 1 
ATOM   2528 C CG2 . THR A 1 368 ? 18.300 18.820  55.684  1.00 49.66  ? 364 THR A CG2 1 
ATOM   2529 N N   . GLN A 1 369 ? 20.731 17.560  53.012  1.00 46.88  ? 365 GLN A N   1 
ATOM   2530 C CA  . GLN A 1 369 ? 20.603 17.641  51.557  1.00 49.03  ? 365 GLN A CA  1 
ATOM   2531 C C   . GLN A 1 369 ? 20.377 16.232  50.989  1.00 48.75  ? 365 GLN A C   1 
ATOM   2532 O O   . GLN A 1 369 ? 19.454 15.999  50.205  1.00 48.76  ? 365 GLN A O   1 
ATOM   2533 C CB  . GLN A 1 369 ? 21.879 18.252  50.971  1.00 50.02  ? 365 GLN A CB  1 
ATOM   2534 C CG  . GLN A 1 369 ? 21.938 18.297  49.448  1.00 53.68  ? 365 GLN A CG  1 
ATOM   2535 C CD  . GLN A 1 369 ? 20.942 19.275  48.826  1.00 55.52  ? 365 GLN A CD  1 
ATOM   2536 O OE1 . GLN A 1 369 ? 20.604 19.161  47.643  1.00 55.81  ? 365 GLN A OE1 1 
ATOM   2537 N NE2 . GLN A 1 369 ? 20.483 20.248  49.618  1.00 55.99  ? 365 GLN A NE2 1 
ATOM   2538 N N   . GLU A 1 370 ? 21.219 15.296  51.423  1.00 48.12  ? 366 GLU A N   1 
ATOM   2539 C CA  . GLU A 1 370 ? 21.133 13.904  50.991  1.00 46.83  ? 366 GLU A CA  1 
ATOM   2540 C C   . GLU A 1 370 ? 19.788 13.278  51.307  1.00 44.89  ? 366 GLU A C   1 
ATOM   2541 O O   . GLU A 1 370 ? 19.248 12.497  50.510  1.00 43.07  ? 366 GLU A O   1 
ATOM   2542 C CB  . GLU A 1 370 ? 22.241 13.076  51.659  1.00 47.21  ? 366 GLU A CB  1 
ATOM   2543 C CG  . GLU A 1 370 ? 23.086 12.289  50.680  1.00 52.02  ? 366 GLU A CG  1 
ATOM   2544 C CD  . GLU A 1 370 ? 24.168 11.444  51.355  1.00 51.46  ? 366 GLU A CD  1 
ATOM   2545 O OE1 . GLU A 1 370 ? 24.865 11.969  52.253  1.00 48.79  ? 366 GLU A OE1 1 
ATOM   2546 O OE2 . GLU A 1 370 ? 24.320 10.260  50.971  1.00 54.76  ? 366 GLU A OE2 1 
ATOM   2547 N N   . LEU A 1 371 ? 19.243 13.617  52.475  1.00 44.76  ? 367 LEU A N   1 
ATOM   2548 C CA  . LEU A 1 371 ? 17.959 13.059  52.910  1.00 44.78  ? 367 LEU A CA  1 
ATOM   2549 C C   . LEU A 1 371 ? 16.735 13.850  52.442  1.00 45.23  ? 367 LEU A C   1 
ATOM   2550 O O   . LEU A 1 371 ? 15.602 13.389  52.579  1.00 45.14  ? 367 LEU A O   1 
ATOM   2551 C CB  . LEU A 1 371 ? 17.935 12.961  54.439  1.00 44.37  ? 367 LEU A CB  1 
ATOM   2552 C CG  . LEU A 1 371 ? 18.944 12.001  55.114  1.00 46.14  ? 367 LEU A CG  1 
ATOM   2553 C CD1 . LEU A 1 371 ? 19.204 12.443  56.575  1.00 44.23  ? 367 LEU A CD1 1 
ATOM   2554 C CD2 . LEU A 1 371 ? 18.407 10.553  55.054  1.00 43.38  ? 367 LEU A CD2 1 
ATOM   2555 N N   . SER A 1 372 ? 16.958 15.019  51.849  1.00 47.20  ? 368 SER A N   1 
ATOM   2556 C CA  . SER A 1 372 ? 15.827 15.875  51.448  1.00 49.74  ? 368 SER A CA  1 
ATOM   2557 C C   . SER A 1 372 ? 14.657 15.250  50.684  1.00 51.09  ? 368 SER A C   1 
ATOM   2558 O O   . SER A 1 372 ? 13.518 15.693  50.847  1.00 51.77  ? 368 SER A O   1 
ATOM   2559 C CB  . SER A 1 372 ? 16.337 17.109  50.698  1.00 49.63  ? 368 SER A CB  1 
ATOM   2560 O OG  . SER A 1 372 ? 17.035 16.771  49.516  1.00 51.02  ? 368 SER A OG  1 
ATOM   2561 N N   . SER A 1 373 ? 14.896 14.227  49.867  1.00 51.08  ? 369 SER A N   1 
ATOM   2562 C CA  . SER A 1 373 ? 13.771 13.620  49.150  1.00 52.08  ? 369 SER A CA  1 
ATOM   2563 C C   . SER A 1 373 ? 12.813 12.828  50.059  1.00 51.93  ? 369 SER A C   1 
ATOM   2564 O O   . SER A 1 373 ? 11.712 12.470  49.626  1.00 52.61  ? 369 SER A O   1 
ATOM   2565 C CB  . SER A 1 373 ? 14.263 12.690  48.017  1.00 51.92  ? 369 SER A CB  1 
ATOM   2566 O OG  . SER A 1 373 ? 14.605 11.392  48.512  1.00 50.18  ? 369 SER A OG  1 
ATOM   2567 N N   . ASN A 1 374 ? 13.218 12.545  51.299  1.00 52.02  ? 370 ASN A N   1 
ATOM   2568 C CA  . ASN A 1 374 ? 12.365 11.780  52.217  1.00 51.90  ? 370 ASN A CA  1 
ATOM   2569 C C   . ASN A 1 374 ? 13.029 11.661  53.611  1.00 52.74  ? 370 ASN A C   1 
ATOM   2570 O O   . ASN A 1 374 ? 13.503 10.587  54.002  1.00 51.76  ? 370 ASN A O   1 
ATOM   2571 C CB  . ASN A 1 374 ? 12.106 10.389  51.612  1.00 51.31  ? 370 ASN A CB  1 
ATOM   2572 C CG  . ASN A 1 374 ? 10.972 9.633   52.304  1.00 54.13  ? 370 ASN A CG  1 
ATOM   2573 O OD1 . ASN A 1 374 ? 10.460 8.644   51.766  1.00 55.41  ? 370 ASN A OD1 1 
ATOM   2574 N ND2 . ASN A 1 374 ? 10.583 10.081  53.496  1.00 53.20  ? 370 ASN A ND2 1 
ATOM   2575 N N   . PRO A 1 375 ? 13.063 12.771  54.379  1.00 53.06  ? 371 PRO A N   1 
ATOM   2576 C CA  . PRO A 1 375 ? 13.666 12.797  55.721  1.00 52.01  ? 371 PRO A CA  1 
ATOM   2577 C C   . PRO A 1 375 ? 13.359 11.617  56.651  1.00 51.42  ? 371 PRO A C   1 
ATOM   2578 O O   . PRO A 1 375 ? 14.262 11.096  57.285  1.00 52.35  ? 371 PRO A O   1 
ATOM   2579 C CB  . PRO A 1 375 ? 13.186 14.130  56.278  1.00 52.61  ? 371 PRO A CB  1 
ATOM   2580 C CG  . PRO A 1 375 ? 13.200 15.008  55.035  1.00 52.59  ? 371 PRO A CG  1 
ATOM   2581 C CD  . PRO A 1 375 ? 12.514 14.097  54.030  1.00 52.33  ? 371 PRO A CD  1 
ATOM   2582 N N   . PRO A 1 376 ? 12.091 11.178  56.738  1.00 51.17  ? 372 PRO A N   1 
ATOM   2583 C CA  . PRO A 1 376 ? 11.745 10.051  57.614  1.00 50.78  ? 372 PRO A CA  1 
ATOM   2584 C C   . PRO A 1 376 ? 12.555 8.765   57.388  1.00 49.69  ? 372 PRO A C   1 
ATOM   2585 O O   . PRO A 1 376 ? 12.614 7.908   58.275  1.00 48.05  ? 372 PRO A O   1 
ATOM   2586 C CB  . PRO A 1 376 ? 10.262 9.825   57.329  1.00 51.23  ? 372 PRO A CB  1 
ATOM   2587 C CG  . PRO A 1 376 ? 9.778  11.193  56.938  1.00 51.67  ? 372 PRO A CG  1 
ATOM   2588 C CD  . PRO A 1 376 ? 10.891 11.705  56.064  1.00 51.63  ? 372 PRO A CD  1 
ATOM   2589 N N   . LEU A 1 377 ? 13.160 8.614   56.213  1.00 48.64  ? 373 LEU A N   1 
ATOM   2590 C CA  . LEU A 1 377 ? 13.939 7.399   55.948  1.00 48.92  ? 373 LEU A CA  1 
ATOM   2591 C C   . LEU A 1 377 ? 15.162 7.321   56.847  1.00 47.14  ? 373 LEU A C   1 
ATOM   2592 O O   . LEU A 1 377 ? 15.740 6.251   57.017  1.00 45.35  ? 373 LEU A O   1 
ATOM   2593 C CB  . LEU A 1 377 ? 14.368 7.317   54.466  1.00 48.17  ? 373 LEU A CB  1 
ATOM   2594 C CG  . LEU A 1 377 ? 13.268 6.915   53.487  1.00 49.27  ? 373 LEU A CG  1 
ATOM   2595 C CD1 . LEU A 1 377 ? 13.873 6.733   52.088  1.00 50.20  ? 373 LEU A CD1 1 
ATOM   2596 C CD2 . LEU A 1 377 ? 12.593 5.618   53.946  1.00 48.75  ? 373 LEU A CD2 1 
ATOM   2597 N N   . ALA A 1 378 ? 15.550 8.454   57.424  1.00 48.61  ? 374 ALA A N   1 
ATOM   2598 C CA  . ALA A 1 378 ? 16.699 8.468   58.326  1.00 49.58  ? 374 ALA A CA  1 
ATOM   2599 C C   . ALA A 1 378 ? 16.537 7.452   59.471  1.00 49.39  ? 374 ALA A C   1 
ATOM   2600 O O   . ALA A 1 378 ? 17.522 6.931   59.963  1.00 49.65  ? 374 ALA A O   1 
ATOM   2601 C CB  . ALA A 1 378 ? 16.916 9.879   58.887  1.00 48.66  ? 374 ALA A CB  1 
ATOM   2602 N N   . THR A 1 379 ? 15.304 7.155   59.881  1.00 50.08  ? 375 THR A N   1 
ATOM   2603 C CA  . THR A 1 379 ? 15.107 6.210   60.986  1.00 51.98  ? 375 THR A CA  1 
ATOM   2604 C C   . THR A 1 379 ? 15.551 4.787   60.633  1.00 51.15  ? 375 THR A C   1 
ATOM   2605 O O   . THR A 1 379 ? 15.742 3.955   61.519  1.00 48.89  ? 375 THR A O   1 
ATOM   2606 C CB  . THR A 1 379 ? 13.637 6.168   61.474  1.00 52.95  ? 375 THR A CB  1 
ATOM   2607 O OG1 . THR A 1 379 ? 12.806 5.583   60.461  1.00 54.49  ? 375 THR A OG1 1 
ATOM   2608 C CG2 . THR A 1 379 ? 13.139 7.580   61.797  1.00 52.28  ? 375 THR A CG2 1 
ATOM   2609 N N   . ILE A 1 380 ? 15.672 4.507   59.338  1.00 50.92  ? 376 ILE A N   1 
ATOM   2610 C CA  . ILE A 1 380 ? 16.171 3.211   58.876  1.00 49.76  ? 376 ILE A CA  1 
ATOM   2611 C C   . ILE A 1 380 ? 17.636 3.381   58.447  1.00 48.34  ? 376 ILE A C   1 
ATOM   2612 O O   . ILE A 1 380 ? 18.505 2.600   58.823  1.00 48.75  ? 376 ILE A O   1 
ATOM   2613 C CB  . ILE A 1 380 ? 15.393 2.706   57.664  1.00 52.80  ? 376 ILE A CB  1 
ATOM   2614 C CG1 . ILE A 1 380 ? 13.974 2.349   58.072  1.00 52.62  ? 376 ILE A CG1 1 
ATOM   2615 C CG2 . ILE A 1 380 ? 16.096 1.500   57.050  1.00 52.68  ? 376 ILE A CG2 1 
ATOM   2616 C CD1 . ILE A 1 380 ? 13.082 2.143   56.880  1.00 55.07  ? 376 ILE A CD1 1 
ATOM   2617 N N   . LEU A 1 381 ? 17.902 4.427   57.671  1.00 46.40  ? 377 LEU A N   1 
ATOM   2618 C CA  . LEU A 1 381 ? 19.240 4.698   57.157  1.00 44.73  ? 377 LEU A CA  1 
ATOM   2619 C C   . LEU A 1 381 ? 20.351 4.881   58.181  1.00 44.94  ? 377 LEU A C   1 
ATOM   2620 O O   . LEU A 1 381 ? 21.479 4.459   57.944  1.00 44.59  ? 377 LEU A O   1 
ATOM   2621 C CB  . LEU A 1 381 ? 19.188 5.911   56.230  1.00 43.29  ? 377 LEU A CB  1 
ATOM   2622 C CG  . LEU A 1 381 ? 18.322 5.668   54.992  1.00 43.74  ? 377 LEU A CG  1 
ATOM   2623 C CD1 . LEU A 1 381 ? 18.182 6.990   54.220  1.00 43.41  ? 377 LEU A CD1 1 
ATOM   2624 C CD2 . LEU A 1 381 ? 18.966 4.563   54.102  1.00 42.53  ? 377 LEU A CD2 1 
ATOM   2625 N N   . ILE A 1 382 ? 20.060 5.543   59.297  1.00 44.39  ? 378 ILE A N   1 
ATOM   2626 C CA  . ILE A 1 382 ? 21.082 5.729   60.320  1.00 44.35  ? 378 ILE A CA  1 
ATOM   2627 C C   . ILE A 1 382 ? 20.739 4.738   61.430  1.00 43.30  ? 378 ILE A C   1 
ATOM   2628 O O   . ILE A 1 382 ? 19.811 4.949   62.197  1.00 44.38  ? 378 ILE A O   1 
ATOM   2629 C CB  . ILE A 1 382 ? 21.070 7.171   60.841  1.00 45.53  ? 378 ILE A CB  1 
ATOM   2630 C CG1 . ILE A 1 382 ? 21.221 8.127   59.658  1.00 44.94  ? 378 ILE A CG1 1 
ATOM   2631 C CG2 . ILE A 1 382 ? 22.182 7.369   61.830  1.00 43.78  ? 378 ILE A CG2 1 
ATOM   2632 C CD1 . ILE A 1 382 ? 21.251 9.599   60.032  1.00 46.88  ? 378 ILE A CD1 1 
ATOM   2633 N N   . PRO A 1 383 ? 21.465 3.619   61.498  1.00 41.80  ? 379 PRO A N   1 
ATOM   2634 C CA  . PRO A 1 383 ? 21.195 2.605   62.525  1.00 42.09  ? 379 PRO A CA  1 
ATOM   2635 C C   . PRO A 1 383 ? 21.445 3.093   63.966  1.00 41.33  ? 379 PRO A C   1 
ATOM   2636 O O   . PRO A 1 383 ? 22.201 4.050   64.198  1.00 44.87  ? 379 PRO A O   1 
ATOM   2637 C CB  . PRO A 1 383 ? 22.101 1.440   62.092  1.00 41.15  ? 379 PRO A CB  1 
ATOM   2638 C CG  . PRO A 1 383 ? 23.314 2.157   61.566  1.00 40.78  ? 379 PRO A CG  1 
ATOM   2639 C CD  . PRO A 1 383 ? 22.677 3.282   60.723  1.00 41.75  ? 379 PRO A CD  1 
ATOM   2640 N N   . PRO A 1 384 ? 20.791 2.461   64.949  1.00 41.00  ? 380 PRO A N   1 
ATOM   2641 C CA  . PRO A 1 384 ? 20.969 2.864   66.358  1.00 41.88  ? 380 PRO A CA  1 
ATOM   2642 C C   . PRO A 1 384 ? 22.408 3.099   66.790  1.00 41.90  ? 380 PRO A C   1 
ATOM   2643 O O   . PRO A 1 384 ? 22.690 4.126   67.394  1.00 43.48  ? 380 PRO A O   1 
ATOM   2644 C CB  . PRO A 1 384 ? 20.311 1.722   67.140  1.00 41.85  ? 380 PRO A CB  1 
ATOM   2645 C CG  . PRO A 1 384 ? 19.148 1.350   66.242  1.00 42.52  ? 380 PRO A CG  1 
ATOM   2646 C CD  . PRO A 1 384 ? 19.772 1.404   64.819  1.00 39.89  ? 380 PRO A CD  1 
ATOM   2647 N N   . HIS A 1 385 ? 23.322 2.172   66.476  1.00 41.84  ? 381 HIS A N   1 
ATOM   2648 C CA  . HIS A 1 385 ? 24.714 2.343   66.905  1.00 43.55  ? 381 HIS A CA  1 
ATOM   2649 C C   . HIS A 1 385 ? 25.402 3.530   66.279  1.00 44.29  ? 381 HIS A C   1 
ATOM   2650 O O   . HIS A 1 385 ? 26.389 4.027   66.812  1.00 44.13  ? 381 HIS A O   1 
ATOM   2651 C CB  . HIS A 1 385 ? 25.544 1.081   66.650  1.00 43.13  ? 381 HIS A CB  1 
ATOM   2652 C CG  . HIS A 1 385 ? 25.809 0.802   65.197  1.00 42.90  ? 381 HIS A CG  1 
ATOM   2653 N ND1 . HIS A 1 385 ? 24.934 0.094   64.398  1.00 42.48  ? 381 HIS A ND1 1 
ATOM   2654 C CD2 . HIS A 1 385 ? 26.863 1.124   64.410  1.00 42.40  ? 381 HIS A CD2 1 
ATOM   2655 C CE1 . HIS A 1 385 ? 25.443 -0.012  63.180  1.00 42.76  ? 381 HIS A CE1 1 
ATOM   2656 N NE2 . HIS A 1 385 ? 26.612 0.605   63.161  1.00 42.88  ? 381 HIS A NE2 1 
ATOM   2657 N N   . ALA A 1 386 ? 24.862 4.002   65.157  1.00 46.23  ? 382 ALA A N   1 
ATOM   2658 C CA  . ALA A 1 386 ? 25.438 5.163   64.492  1.00 47.64  ? 382 ALA A CA  1 
ATOM   2659 C C   . ALA A 1 386 ? 24.924 6.458   65.167  1.00 48.80  ? 382 ALA A C   1 
ATOM   2660 O O   . ALA A 1 386 ? 25.413 7.551   64.895  1.00 46.60  ? 382 ALA A O   1 
ATOM   2661 C CB  . ALA A 1 386 ? 25.068 5.145   63.008  1.00 48.09  ? 382 ALA A CB  1 
ATOM   2662 N N   . ARG A 1 387 ? 23.944 6.318   66.059  1.00 50.96  ? 383 ARG A N   1 
ATOM   2663 C CA  . ARG A 1 387 ? 23.383 7.473   66.775  1.00 53.11  ? 383 ARG A CA  1 
ATOM   2664 C C   . ARG A 1 387 ? 23.910 7.582   68.206  1.00 55.04  ? 383 ARG A C   1 
ATOM   2665 O O   . ARG A 1 387 ? 23.518 8.485   68.954  1.00 53.69  ? 383 ARG A O   1 
ATOM   2666 C CB  . ARG A 1 387 ? 21.862 7.384   66.837  1.00 53.19  ? 383 ARG A CB  1 
ATOM   2667 C CG  . ARG A 1 387 ? 21.162 7.470   65.511  1.00 53.78  ? 383 ARG A CG  1 
ATOM   2668 C CD  . ARG A 1 387 ? 19.682 7.310   65.720  1.00 55.85  ? 383 ARG A CD  1 
ATOM   2669 N NE  . ARG A 1 387 ? 19.083 6.453   64.709  1.00 58.21  ? 383 ARG A NE  1 
ATOM   2670 C CZ  . ARG A 1 387 ? 17.842 5.981   64.788  1.00 61.89  ? 383 ARG A CZ  1 
ATOM   2671 N NH1 . ARG A 1 387 ? 17.080 6.289   65.838  1.00 61.44  ? 383 ARG A NH1 1 
ATOM   2672 N NH2 . ARG A 1 387 ? 17.361 5.198   63.825  1.00 62.23  ? 383 ARG A NH2 1 
ATOM   2673 N N   . ILE A 1 388 ? 24.775 6.649   68.592  1.00 56.37  ? 384 ILE A N   1 
ATOM   2674 C CA  . ILE A 1 388 ? 25.350 6.651   69.931  1.00 57.49  ? 384 ILE A CA  1 
ATOM   2675 C C   . ILE A 1 388 ? 26.147 7.939   70.139  1.00 61.04  ? 384 ILE A C   1 
ATOM   2676 O O   . ILE A 1 388 ? 26.964 8.318   69.302  1.00 62.14  ? 384 ILE A O   1 
ATOM   2677 C CB  . ILE A 1 388 ? 26.239 5.403   70.123  1.00 55.07  ? 384 ILE A CB  1 
ATOM   2678 C CG1 . ILE A 1 388 ? 25.334 4.176   70.250  1.00 53.01  ? 384 ILE A CG1 1 
ATOM   2679 C CG2 . ILE A 1 388 ? 27.168 5.570   71.322  1.00 54.93  ? 384 ILE A CG2 1 
ATOM   2680 C CD1 . ILE A 1 388 ? 26.067 2.853   70.253  1.00 51.06  ? 384 ILE A CD1 1 
ATOM   2681 N N   . GLN A 1 389 ? 25.889 8.614   71.258  1.00 64.56  ? 385 GLN A N   1 
ATOM   2682 C CA  . GLN A 1 389 ? 26.556 9.870   71.606  1.00 67.75  ? 385 GLN A CA  1 
ATOM   2683 C C   . GLN A 1 389 ? 28.060 9.716   71.855  1.00 69.24  ? 385 GLN A C   1 
ATOM   2684 O O   . GLN A 1 389 ? 28.504 8.755   72.500  1.00 69.10  ? 385 GLN A O   1 
ATOM   2685 C CB  . GLN A 1 389 ? 25.905 10.481  72.859  1.00 69.10  ? 385 GLN A CB  1 
ATOM   2686 C CG  . GLN A 1 389 ? 26.345 11.924  73.140  1.00 71.03  ? 385 GLN A CG  1 
ATOM   2687 C CD  . GLN A 1 389 ? 25.977 12.413  74.532  1.00 72.52  ? 385 GLN A CD  1 
ATOM   2688 O OE1 . GLN A 1 389 ? 24.804 12.406  74.926  1.00 73.46  ? 385 GLN A OE1 1 
ATOM   2689 N NE2 . GLN A 1 389 ? 26.983 12.853  75.285  1.00 72.60  ? 385 GLN A NE2 1 
ATOM   2690 N N   . ALA A 1 390 ? 28.833 10.678  71.351  1.00 71.41  ? 386 ALA A N   1 
ATOM   2691 C CA  . ALA A 1 390 ? 30.290 10.684  71.520  1.00 73.02  ? 386 ALA A CA  1 
ATOM   2692 C C   . ALA A 1 390 ? 30.685 11.134  72.946  1.00 73.87  ? 386 ALA A C   1 
ATOM   2693 O O   . ALA A 1 390 ? 29.844 11.770  73.626  1.00 74.25  ? 386 ALA A O   1 
ATOM   2694 C CB  . ALA A 1 390 ? 30.925 11.613  70.475  1.00 72.78  ? 386 ALA A CB  1 
ATOM   2695 N N   . SER B 1 39  ? 19.677 -41.872 10.780  1.00 83.13  ? 35  SER B N   1 
ATOM   2696 C CA  . SER B 1 39  ? 19.443 -40.828 11.823  1.00 82.71  ? 35  SER B CA  1 
ATOM   2697 C C   . SER B 1 39  ? 17.969 -40.429 11.876  1.00 81.70  ? 35  SER B C   1 
ATOM   2698 O O   . SER B 1 39  ? 17.146 -40.950 11.114  1.00 81.79  ? 35  SER B O   1 
ATOM   2699 C CB  . SER B 1 39  ? 20.322 -39.599 11.545  1.00 83.64  ? 35  SER B CB  1 
ATOM   2700 O OG  . SER B 1 39  ? 20.334 -39.274 10.160  1.00 85.42  ? 35  SER B OG  1 
ATOM   2701 N N   . LYS B 1 40  ? 17.633 -39.513 12.779  1.00 79.74  ? 36  LYS B N   1 
ATOM   2702 C CA  . LYS B 1 40  ? 16.252 -39.073 12.916  1.00 78.18  ? 36  LYS B CA  1 
ATOM   2703 C C   . LYS B 1 40  ? 15.741 -38.352 11.666  1.00 76.24  ? 36  LYS B C   1 
ATOM   2704 O O   . LYS B 1 40  ? 16.308 -37.342 11.244  1.00 76.17  ? 36  LYS B O   1 
ATOM   2705 C CB  . LYS B 1 40  ? 16.115 -38.143 14.124  1.00 79.30  ? 36  LYS B CB  1 
ATOM   2706 C CG  . LYS B 1 40  ? 14.685 -37.690 14.383  1.00 80.73  ? 36  LYS B CG  1 
ATOM   2707 C CD  . LYS B 1 40  ? 14.617 -36.561 15.402  1.00 82.15  ? 36  LYS B CD  1 
ATOM   2708 C CE  . LYS B 1 40  ? 15.212 -36.966 16.746  1.00 83.80  ? 36  LYS B CE  1 
ATOM   2709 N NZ  . LYS B 1 40  ? 15.033 -35.903 17.788  1.00 85.30  ? 36  LYS B NZ  1 
ATOM   2710 N N   . VAL B 1 41  ? 14.679 -38.878 11.063  1.00 73.48  ? 37  VAL B N   1 
ATOM   2711 C CA  . VAL B 1 41  ? 14.093 -38.238 9.889   1.00 70.65  ? 37  VAL B CA  1 
ATOM   2712 C C   . VAL B 1 41  ? 12.782 -37.574 10.294  1.00 68.61  ? 37  VAL B C   1 
ATOM   2713 O O   . VAL B 1 41  ? 11.914 -38.212 10.885  1.00 69.04  ? 37  VAL B O   1 
ATOM   2714 C CB  . VAL B 1 41  ? 13.812 -39.249 8.751   1.00 70.58  ? 37  VAL B CB  1 
ATOM   2715 C CG1 . VAL B 1 41  ? 12.971 -38.594 7.669   1.00 69.56  ? 37  VAL B CG1 1 
ATOM   2716 C CG2 . VAL B 1 41  ? 15.127 -39.735 8.151   1.00 70.53  ? 37  VAL B CG2 1 
ATOM   2717 N N   . THR B 1 42  ? 12.657 -36.285 10.005  1.00 65.25  ? 38  THR B N   1 
ATOM   2718 C CA  . THR B 1 42  ? 11.441 -35.551 10.320  1.00 62.23  ? 38  THR B CA  1 
ATOM   2719 C C   . THR B 1 42  ? 10.660 -35.280 9.035   1.00 59.92  ? 38  THR B C   1 
ATOM   2720 O O   . THR B 1 42  ? 11.223 -34.804 8.038   1.00 58.46  ? 38  THR B O   1 
ATOM   2721 C CB  . THR B 1 42  ? 11.746 -34.195 10.985  1.00 62.58  ? 38  THR B CB  1 
ATOM   2722 O OG1 . THR B 1 42  ? 12.420 -34.412 12.233  1.00 62.91  ? 38  THR B OG1 1 
ATOM   2723 C CG2 . THR B 1 42  ? 10.453 -33.420 11.232  1.00 61.71  ? 38  THR B CG2 1 
ATOM   2724 N N   . THR B 1 43  ? 9.369  -35.608 9.064   1.00 57.02  ? 39  THR B N   1 
ATOM   2725 C CA  . THR B 1 43  ? 8.485  -35.380 7.923   1.00 54.16  ? 39  THR B CA  1 
ATOM   2726 C C   . THR B 1 43  ? 7.360  -34.445 8.347   1.00 51.54  ? 39  THR B C   1 
ATOM   2727 O O   . THR B 1 43  ? 6.722  -34.648 9.385   1.00 49.02  ? 39  THR B O   1 
ATOM   2728 C CB  . THR B 1 43  ? 7.855  -36.676 7.411   1.00 55.62  ? 39  THR B CB  1 
ATOM   2729 O OG1 . THR B 1 43  ? 8.886  -37.558 6.957   1.00 56.35  ? 39  THR B OG1 1 
ATOM   2730 C CG2 . THR B 1 43  ? 6.903  -36.373 6.253   1.00 55.03  ? 39  THR B CG2 1 
ATOM   2731 N N   . VAL B 1 44  ? 7.121  -33.424 7.534   1.00 47.11  ? 40  VAL B N   1 
ATOM   2732 C CA  . VAL B 1 44  ? 6.094  -32.448 7.844   1.00 44.00  ? 40  VAL B CA  1 
ATOM   2733 C C   . VAL B 1 44  ? 5.351  -32.159 6.572   1.00 42.75  ? 40  VAL B C   1 
ATOM   2734 O O   . VAL B 1 44  ? 5.775  -32.569 5.499   1.00 43.15  ? 40  VAL B O   1 
ATOM   2735 C CB  . VAL B 1 44  ? 6.705  -31.091 8.363   1.00 44.14  ? 40  VAL B CB  1 
ATOM   2736 C CG1 . VAL B 1 44  ? 7.522  -31.320 9.640   1.00 44.55  ? 40  VAL B CG1 1 
ATOM   2737 C CG2 . VAL B 1 44  ? 7.579  -30.470 7.292   1.00 41.50  ? 40  VAL B CG2 1 
ATOM   2738 N N   . VAL B 1 45  ? 4.230  -31.458 6.679   1.00 42.28  ? 41  VAL B N   1 
ATOM   2739 C CA  . VAL B 1 45  ? 3.503  -31.095 5.481   1.00 42.53  ? 41  VAL B CA  1 
ATOM   2740 C C   . VAL B 1 45  ? 3.732  -29.609 5.399   1.00 42.08  ? 41  VAL B C   1 
ATOM   2741 O O   . VAL B 1 45  ? 3.249  -28.869 6.237   1.00 43.17  ? 41  VAL B O   1 
ATOM   2742 C CB  . VAL B 1 45  ? 2.001  -31.407 5.613   1.00 42.53  ? 41  VAL B CB  1 
ATOM   2743 C CG1 . VAL B 1 45  ? 1.284  -30.999 4.335   1.00 41.25  ? 41  VAL B CG1 1 
ATOM   2744 C CG2 . VAL B 1 45  ? 1.821  -32.906 5.880   1.00 41.36  ? 41  VAL B CG2 1 
ATOM   2745 N N   . ALA B 1 46  ? 4.455  -29.170 4.381   1.00 41.28  ? 42  ALA B N   1 
ATOM   2746 C CA  . ALA B 1 46  ? 4.791  -27.763 4.275   1.00 40.00  ? 42  ALA B CA  1 
ATOM   2747 C C   . ALA B 1 46  ? 4.304  -27.066 3.035   1.00 38.82  ? 42  ALA B C   1 
ATOM   2748 O O   . ALA B 1 46  ? 4.165  -27.654 1.975   1.00 39.04  ? 42  ALA B O   1 
ATOM   2749 C CB  . ALA B 1 46  ? 6.307  -27.585 4.394   1.00 40.36  ? 42  ALA B CB  1 
ATOM   2750 N N   . THR B 1 47  ? 4.102  -25.772 3.188   1.00 37.30  ? 43  THR B N   1 
ATOM   2751 C CA  . THR B 1 47  ? 3.619  -24.917 2.135   1.00 38.94  ? 43  THR B CA  1 
ATOM   2752 C C   . THR B 1 47  ? 4.750  -24.234 1.392   1.00 40.57  ? 43  THR B C   1 
ATOM   2753 O O   . THR B 1 47  ? 5.584  -23.580 2.023   1.00 40.06  ? 43  THR B O   1 
ATOM   2754 C CB  . THR B 1 47  ? 2.751  -23.841 2.746   1.00 38.05  ? 43  THR B CB  1 
ATOM   2755 O OG1 . THR B 1 47  ? 1.806  -24.467 3.633   1.00 40.71  ? 43  THR B OG1 1 
ATOM   2756 C CG2 . THR B 1 47  ? 2.072  -23.044 1.678   1.00 35.49  ? 43  THR B CG2 1 
ATOM   2757 N N   . PRO B 1 48  ? 4.795  -24.371 0.050   1.00 41.69  ? 44  PRO B N   1 
ATOM   2758 C CA  . PRO B 1 48  ? 5.828  -23.758 -0.802  1.00 43.47  ? 44  PRO B CA  1 
ATOM   2759 C C   . PRO B 1 48  ? 5.863  -22.240 -0.606  1.00 44.83  ? 44  PRO B C   1 
ATOM   2760 O O   . PRO B 1 48  ? 4.823  -21.603 -0.445  1.00 41.80  ? 44  PRO B O   1 
ATOM   2761 C CB  . PRO B 1 48  ? 5.388  -24.135 -2.223  1.00 44.48  ? 44  PRO B CB  1 
ATOM   2762 C CG  . PRO B 1 48  ? 4.725  -25.462 -2.017  1.00 45.48  ? 44  PRO B CG  1 
ATOM   2763 C CD  . PRO B 1 48  ? 3.905  -25.232 -0.752  1.00 43.26  ? 44  PRO B CD  1 
ATOM   2764 N N   . GLY B 1 49  ? 7.068  -21.670 -0.633  1.00 46.97  ? 45  GLY B N   1 
ATOM   2765 C CA  . GLY B 1 49  ? 7.223  -20.244 -0.439  1.00 50.09  ? 45  GLY B CA  1 
ATOM   2766 C C   . GLY B 1 49  ? 6.508  -19.384 -1.457  1.00 53.47  ? 45  GLY B C   1 
ATOM   2767 O O   . GLY B 1 49  ? 5.889  -18.380 -1.096  1.00 53.35  ? 45  GLY B O   1 
ATOM   2768 N N   . GLN B 1 50  ? 6.602  -19.775 -2.724  1.00 57.04  ? 46  GLN B N   1 
ATOM   2769 C CA  . GLN B 1 50  ? 5.970  -19.048 -3.823  1.00 61.36  ? 46  GLN B CA  1 
ATOM   2770 C C   . GLN B 1 50  ? 4.819  -19.830 -4.431  1.00 62.78  ? 46  GLN B C   1 
ATOM   2771 O O   . GLN B 1 50  ? 4.507  -20.946 -4.011  1.00 64.40  ? 46  GLN B O   1 
ATOM   2772 C CB  . GLN B 1 50  ? 6.984  -18.748 -4.938  1.00 63.15  ? 46  GLN B CB  1 
ATOM   2773 C CG  . GLN B 1 50  ? 7.787  -17.462 -4.760  1.00 65.77  ? 46  GLN B CG  1 
ATOM   2774 C CD  . GLN B 1 50  ? 8.827  -17.567 -3.671  1.00 67.44  ? 46  GLN B CD  1 
ATOM   2775 O OE1 . GLN B 1 50  ? 9.726  -18.415 -3.739  1.00 68.19  ? 46  GLN B OE1 1 
ATOM   2776 N NE2 . GLN B 1 50  ? 8.718  -16.708 -2.655  1.00 67.23  ? 46  GLN B NE2 1 
ATOM   2777 N N   . GLY B 1 51  ? 4.184  -19.226 -5.428  1.00 64.09  ? 47  GLY B N   1 
ATOM   2778 C CA  . GLY B 1 51  ? 3.087  -19.883 -6.109  1.00 64.63  ? 47  GLY B CA  1 
ATOM   2779 C C   . GLY B 1 51  ? 1.821  -20.088 -5.300  1.00 65.31  ? 47  GLY B C   1 
ATOM   2780 O O   . GLY B 1 51  ? 1.627  -19.479 -4.247  1.00 65.07  ? 47  GLY B O   1 
ATOM   2781 N N   . PRO B 1 52  ? 0.930  -20.967 -5.787  1.00 65.69  ? 48  PRO B N   1 
ATOM   2782 C CA  . PRO B 1 52  ? -0.340 -21.270 -5.123  1.00 64.85  ? 48  PRO B CA  1 
ATOM   2783 C C   . PRO B 1 52  ? -0.126 -21.976 -3.793  1.00 62.98  ? 48  PRO B C   1 
ATOM   2784 O O   . PRO B 1 52  ? 0.818  -22.743 -3.627  1.00 64.07  ? 48  PRO B O   1 
ATOM   2785 C CB  . PRO B 1 52  ? -1.050 -22.163 -6.139  1.00 65.85  ? 48  PRO B CB  1 
ATOM   2786 C CG  . PRO B 1 52  ? 0.096  -22.933 -6.740  1.00 66.27  ? 48  PRO B CG  1 
ATOM   2787 C CD  . PRO B 1 52  ? 1.127  -21.834 -6.966  1.00 65.89  ? 48  PRO B CD  1 
ATOM   2788 N N   . ASP B 1 53  ? -1.019 -21.724 -2.855  1.00 60.02  ? 49  ASP B N   1 
ATOM   2789 C CA  . ASP B 1 53  ? -0.941 -22.329 -1.539  1.00 58.76  ? 49  ASP B CA  1 
ATOM   2790 C C   . ASP B 1 53  ? -1.271 -23.845 -1.516  1.00 56.56  ? 49  ASP B C   1 
ATOM   2791 O O   . ASP B 1 53  ? -2.346 -24.237 -1.058  1.00 55.97  ? 49  ASP B O   1 
ATOM   2792 C CB  . ASP B 1 53  ? -1.886 -21.557 -0.633  1.00 61.26  ? 49  ASP B CB  1 
ATOM   2793 C CG  . ASP B 1 53  ? -1.610 -21.793 0.820   1.00 64.89  ? 49  ASP B CG  1 
ATOM   2794 O OD1 . ASP B 1 53  ? -1.547 -22.985 1.209   1.00 66.14  ? 49  ASP B OD1 1 
ATOM   2795 O OD2 . ASP B 1 53  ? -1.462 -20.788 1.566   1.00 66.94  ? 49  ASP B OD2 1 
ATOM   2796 N N   . ARG B 1 54  ? -0.347 -24.690 -1.989  1.00 52.96  ? 50  ARG B N   1 
ATOM   2797 C CA  . ARG B 1 54  ? -0.567 -26.147 -2.033  1.00 49.43  ? 50  ARG B CA  1 
ATOM   2798 C C   . ARG B 1 54  ? 0.525  -26.961 -1.309  1.00 46.03  ? 50  ARG B C   1 
ATOM   2799 O O   . ARG B 1 54  ? 1.525  -27.401 -1.906  1.00 44.64  ? 50  ARG B O   1 
ATOM   2800 C CB  . ARG B 1 54  ? -0.683 -26.603 -3.491  1.00 50.46  ? 50  ARG B CB  1 
ATOM   2801 C CG  . ARG B 1 54  ? -1.820 -25.940 -4.287  1.00 54.02  ? 50  ARG B CG  1 
ATOM   2802 C CD  . ARG B 1 54  ? -3.218 -26.499 -3.917  1.00 56.56  ? 50  ARG B CD  1 
ATOM   2803 N NE  . ARG B 1 54  ? -4.295 -25.823 -4.645  1.00 57.86  ? 50  ARG B NE  1 
ATOM   2804 C CZ  . ARG B 1 54  ? -5.044 -24.830 -4.153  1.00 58.40  ? 50  ARG B CZ  1 
ATOM   2805 N NH1 . ARG B 1 54  ? -4.855 -24.383 -2.912  1.00 57.53  ? 50  ARG B NH1 1 
ATOM   2806 N NH2 . ARG B 1 54  ? -5.978 -24.266 -4.910  1.00 57.51  ? 50  ARG B NH2 1 
ATOM   2807 N N   . PRO B 1 55  ? 0.312  -27.222 -0.021  1.00 44.38  ? 51  PRO B N   1 
ATOM   2808 C CA  . PRO B 1 55  ? 1.238  -27.967 0.843   1.00 43.70  ? 51  PRO B CA  1 
ATOM   2809 C C   . PRO B 1 55  ? 1.658  -29.339 0.337   1.00 44.78  ? 51  PRO B C   1 
ATOM   2810 O O   . PRO B 1 55  ? 0.890  -30.024 -0.338  1.00 43.43  ? 51  PRO B O   1 
ATOM   2811 C CB  . PRO B 1 55  ? 0.483  -28.059 2.174   1.00 42.42  ? 51  PRO B CB  1 
ATOM   2812 C CG  . PRO B 1 55  ? -0.436 -26.841 2.147   1.00 43.04  ? 51  PRO B CG  1 
ATOM   2813 C CD  . PRO B 1 55  ? -0.915 -26.852 0.716   1.00 43.67  ? 51  PRO B CD  1 
ATOM   2814 N N   . GLN B 1 56  ? 2.889  -29.738 0.654   1.00 44.17  ? 52  GLN B N   1 
ATOM   2815 C CA  . GLN B 1 56  ? 3.362  -31.058 0.255   1.00 46.26  ? 52  GLN B CA  1 
ATOM   2816 C C   . GLN B 1 56  ? 4.149  -31.639 1.391   1.00 47.05  ? 52  GLN B C   1 
ATOM   2817 O O   . GLN B 1 56  ? 4.620  -30.911 2.274   1.00 45.93  ? 52  GLN B O   1 
ATOM   2818 C CB  . GLN B 1 56  ? 4.216  -30.999 -1.020  1.00 49.37  ? 52  GLN B CB  1 
ATOM   2819 C CG  . GLN B 1 56  ? 4.950  -29.693 -1.232  1.00 53.69  ? 52  GLN B CG  1 
ATOM   2820 C CD  . GLN B 1 56  ? 5.661  -29.621 -2.588  1.00 56.01  ? 52  GLN B CD  1 
ATOM   2821 O OE1 . GLN B 1 56  ? 6.813  -30.073 -2.733  1.00 56.15  ? 52  GLN B OE1 1 
ATOM   2822 N NE2 . GLN B 1 56  ? 4.968  -29.061 -3.591  1.00 56.67  ? 52  GLN B NE2 1 
ATOM   2823 N N   . GLU B 1 57  ? 4.259  -32.961 1.394   1.00 48.23  ? 53  GLU B N   1 
ATOM   2824 C CA  . GLU B 1 57  ? 4.999  -33.649 2.439   1.00 49.54  ? 53  GLU B CA  1 
ATOM   2825 C C   . GLU B 1 57  ? 6.479  -33.394 2.148   1.00 49.07  ? 53  GLU B C   1 
ATOM   2826 O O   . GLU B 1 57  ? 6.929  -33.486 0.997   1.00 47.47  ? 53  GLU B O   1 
ATOM   2827 C CB  . GLU B 1 57  ? 4.642  -35.152 2.426   1.00 52.90  ? 53  GLU B CB  1 
ATOM   2828 C CG  . GLU B 1 57  ? 3.102  -35.385 2.632   1.00 57.94  ? 53  GLU B CG  1 
ATOM   2829 C CD  . GLU B 1 57  ? 2.590  -36.806 2.297   1.00 61.11  ? 53  GLU B CD  1 
ATOM   2830 O OE1 . GLU B 1 57  ? 3.163  -37.480 1.399   1.00 63.44  ? 53  GLU B OE1 1 
ATOM   2831 O OE2 . GLU B 1 57  ? 1.585  -37.241 2.917   1.00 59.99  ? 53  GLU B OE2 1 
ATOM   2832 N N   . VAL B 1 58  ? 7.220  -33.022 3.186   1.00 47.67  ? 54  VAL B N   1 
ATOM   2833 C CA  . VAL B 1 58  ? 8.637  -32.741 3.044   1.00 46.86  ? 54  VAL B CA  1 
ATOM   2834 C C   . VAL B 1 58  ? 9.384  -33.440 4.159   1.00 46.57  ? 54  VAL B C   1 
ATOM   2835 O O   . VAL B 1 58  ? 9.005  -33.329 5.324   1.00 45.75  ? 54  VAL B O   1 
ATOM   2836 C CB  . VAL B 1 58  ? 8.917  -31.222 3.146   1.00 47.19  ? 54  VAL B CB  1 
ATOM   2837 C CG1 . VAL B 1 58  ? 10.438 -30.973 3.215   1.00 47.25  ? 54  VAL B CG1 1 
ATOM   2838 C CG2 . VAL B 1 58  ? 8.311  -30.508 1.951   1.00 44.85  ? 54  VAL B CG2 1 
ATOM   2839 N N   . SER B 1 59  ? 10.446 -34.160 3.808   1.00 46.44  ? 55  SER B N   1 
ATOM   2840 C CA  . SER B 1 59  ? 11.232 -34.848 4.827   1.00 48.28  ? 55  SER B CA  1 
ATOM   2841 C C   . SER B 1 59  ? 12.658 -34.330 4.900   1.00 47.14  ? 55  SER B C   1 
ATOM   2842 O O   . SER B 1 59  ? 13.275 -34.045 3.878   1.00 46.90  ? 55  SER B O   1 
ATOM   2843 C CB  . SER B 1 59  ? 11.244 -36.354 4.564   1.00 49.84  ? 55  SER B CB  1 
ATOM   2844 O OG  . SER B 1 59  ? 9.962  -36.907 4.835   1.00 52.29  ? 55  SER B OG  1 
ATOM   2845 N N   . TYR B 1 60  ? 13.177 -34.208 6.117   1.00 48.67  ? 56  TYR B N   1 
ATOM   2846 C CA  . TYR B 1 60  ? 14.539 -33.729 6.296   1.00 50.49  ? 56  TYR B CA  1 
ATOM   2847 C C   . TYR B 1 60  ? 15.251 -34.365 7.485   1.00 53.18  ? 56  TYR B C   1 
ATOM   2848 O O   . TYR B 1 60  ? 14.627 -34.957 8.361   1.00 52.44  ? 56  TYR B O   1 
ATOM   2849 C CB  . TYR B 1 60  ? 14.541 -32.205 6.437   1.00 46.12  ? 56  TYR B CB  1 
ATOM   2850 C CG  . TYR B 1 60  ? 13.838 -31.704 7.668   1.00 43.69  ? 56  TYR B CG  1 
ATOM   2851 C CD1 . TYR B 1 60  ? 14.468 -31.716 8.908   1.00 41.19  ? 56  TYR B CD1 1 
ATOM   2852 C CD2 . TYR B 1 60  ? 12.537 -31.181 7.588   1.00 42.87  ? 56  TYR B CD2 1 
ATOM   2853 C CE1 . TYR B 1 60  ? 13.828 -31.209 10.039  1.00 40.49  ? 56  TYR B CE1 1 
ATOM   2854 C CE2 . TYR B 1 60  ? 11.894 -30.682 8.711   1.00 38.76  ? 56  TYR B CE2 1 
ATOM   2855 C CZ  . TYR B 1 60  ? 12.540 -30.691 9.914   1.00 40.22  ? 56  TYR B CZ  1 
ATOM   2856 O OH  . TYR B 1 60  ? 11.926 -30.123 10.985  1.00 40.54  ? 56  TYR B OH  1 
ATOM   2857 N N   . THR B 1 61  ? 16.573 -34.226 7.512   1.00 56.43  ? 57  THR B N   1 
ATOM   2858 C CA  . THR B 1 61  ? 17.364 -34.803 8.591   1.00 58.79  ? 57  THR B CA  1 
ATOM   2859 C C   . THR B 1 61  ? 18.679 -34.036 8.826   1.00 60.45  ? 57  THR B C   1 
ATOM   2860 O O   . THR B 1 61  ? 18.918 -32.997 8.196   1.00 60.30  ? 57  THR B O   1 
ATOM   2861 C CB  . THR B 1 61  ? 17.677 -36.275 8.263   1.00 58.57  ? 57  THR B CB  1 
ATOM   2862 O OG1 . THR B 1 61  ? 18.331 -36.882 9.381   1.00 60.82  ? 57  THR B OG1 1 
ATOM   2863 C CG2 . THR B 1 61  ? 18.568 -36.371 7.028   1.00 57.87  ? 57  THR B CG2 1 
ATOM   2864 N N   . ASP B 1 62  ? 19.517 -34.555 9.729   1.00 61.45  ? 58  ASP B N   1 
ATOM   2865 C CA  . ASP B 1 62  ? 20.816 -33.960 10.058  1.00 63.05  ? 58  ASP B CA  1 
ATOM   2866 C C   . ASP B 1 62  ? 20.696 -32.544 10.592  1.00 63.70  ? 58  ASP B C   1 
ATOM   2867 O O   . ASP B 1 62  ? 21.419 -31.645 10.156  1.00 63.25  ? 58  ASP B O   1 
ATOM   2868 C CB  . ASP B 1 62  ? 21.740 -33.934 8.831   1.00 64.59  ? 58  ASP B CB  1 
ATOM   2869 C CG  . ASP B 1 62  ? 22.125 -35.324 8.352   1.00 67.55  ? 58  ASP B CG  1 
ATOM   2870 O OD1 . ASP B 1 62  ? 21.874 -36.308 9.094   1.00 68.95  ? 58  ASP B OD1 1 
ATOM   2871 O OD2 . ASP B 1 62  ? 22.690 -35.429 7.234   1.00 67.69  ? 58  ASP B OD2 1 
ATOM   2872 N N   . THR B 1 63  ? 19.796 -32.359 11.548  1.00 64.46  ? 59  THR B N   1 
ATOM   2873 C CA  . THR B 1 63  ? 19.550 -31.053 12.141  1.00 65.93  ? 59  THR B CA  1 
ATOM   2874 C C   . THR B 1 63  ? 20.658 -30.618 13.099  1.00 66.40  ? 59  THR B C   1 
ATOM   2875 O O   . THR B 1 63  ? 21.238 -31.442 13.801  1.00 66.79  ? 59  THR B O   1 
ATOM   2876 C CB  . THR B 1 63  ? 18.195 -31.055 12.895  1.00 66.51  ? 59  THR B CB  1 
ATOM   2877 O OG1 . THR B 1 63  ? 17.124 -31.140 11.946  1.00 66.96  ? 59  THR B OG1 1 
ATOM   2878 C CG2 . THR B 1 63  ? 18.029 -29.794 13.723  1.00 67.74  ? 59  THR B CG2 1 
ATOM   2879 N N   . LYS B 1 64  ? 20.948 -29.319 13.117  1.00 66.40  ? 60  LYS B N   1 
ATOM   2880 C CA  . LYS B 1 64  ? 21.971 -28.775 14.007  1.00 66.37  ? 60  LYS B CA  1 
ATOM   2881 C C   . LYS B 1 64  ? 21.861 -27.259 14.003  1.00 65.12  ? 60  LYS B C   1 
ATOM   2882 O O   . LYS B 1 64  ? 21.568 -26.661 12.973  1.00 65.28  ? 60  LYS B O   1 
ATOM   2883 C CB  . LYS B 1 64  ? 23.367 -29.206 13.542  1.00 68.00  ? 60  LYS B CB  1 
ATOM   2884 C CG  . LYS B 1 64  ? 23.869 -28.495 12.298  1.00 69.93  ? 60  LYS B CG  1 
ATOM   2885 C CD  . LYS B 1 64  ? 25.104 -29.188 11.736  1.00 72.72  ? 60  LYS B CD  1 
ATOM   2886 C CE  . LYS B 1 64  ? 24.780 -30.627 11.315  1.00 74.34  ? 60  LYS B CE  1 
ATOM   2887 N NZ  . LYS B 1 64  ? 25.934 -31.328 10.656  1.00 75.87  ? 60  LYS B NZ  1 
ATOM   2888 N N   . VAL B 1 65  ? 22.088 -26.634 15.150  1.00 64.20  ? 61  VAL B N   1 
ATOM   2889 C CA  . VAL B 1 65  ? 21.990 -25.184 15.235  1.00 63.57  ? 61  VAL B CA  1 
ATOM   2890 C C   . VAL B 1 65  ? 23.135 -24.522 14.500  1.00 63.67  ? 61  VAL B C   1 
ATOM   2891 O O   . VAL B 1 65  ? 24.219 -25.086 14.423  1.00 64.06  ? 61  VAL B O   1 
ATOM   2892 C CB  . VAL B 1 65  ? 22.025 -24.706 16.694  1.00 63.54  ? 61  VAL B CB  1 
ATOM   2893 C CG1 . VAL B 1 65  ? 22.016 -23.168 16.740  1.00 62.75  ? 61  VAL B CG1 1 
ATOM   2894 C CG2 . VAL B 1 65  ? 20.841 -25.295 17.458  1.00 61.69  ? 61  VAL B CG2 1 
ATOM   2895 N N   . ILE B 1 66  ? 22.892 -23.341 13.936  1.00 63.67  ? 62  ILE B N   1 
ATOM   2896 C CA  . ILE B 1 66  ? 23.944 -22.601 13.245  1.00 64.49  ? 62  ILE B CA  1 
ATOM   2897 C C   . ILE B 1 66  ? 23.835 -21.116 13.560  1.00 66.51  ? 62  ILE B C   1 
ATOM   2898 O O   . ILE B 1 66  ? 24.718 -20.334 13.200  1.00 67.08  ? 62  ILE B O   1 
ATOM   2899 C CB  . ILE B 1 66  ? 23.903 -22.777 11.694  1.00 63.39  ? 62  ILE B CB  1 
ATOM   2900 C CG1 . ILE B 1 66  ? 22.652 -22.124 11.108  1.00 62.08  ? 62  ILE B CG1 1 
ATOM   2901 C CG2 . ILE B 1 66  ? 23.963 -24.262 11.329  1.00 63.05  ? 62  ILE B CG2 1 
ATOM   2902 C CD1 . ILE B 1 66  ? 22.489 -22.367 9.606   1.00 61.05  ? 62  ILE B CD1 1 
ATOM   2903 N N   . GLY B 1 67  ? 22.758 -20.731 14.240  1.00 68.19  ? 63  GLY B N   1 
ATOM   2904 C CA  . GLY B 1 67  ? 22.565 -19.332 14.580  1.00 70.82  ? 63  GLY B CA  1 
ATOM   2905 C C   . GLY B 1 67  ? 21.504 -19.133 15.647  1.00 72.64  ? 63  GLY B C   1 
ATOM   2906 O O   . GLY B 1 67  ? 20.626 -19.977 15.821  1.00 72.47  ? 63  GLY B O   1 
ATOM   2907 N N   . ASN B 1 68  ? 21.581 -18.017 16.367  1.00 74.43  ? 64  ASN B N   1 
ATOM   2908 C CA  . ASN B 1 68  ? 20.612 -17.738 17.421  1.00 76.92  ? 64  ASN B CA  1 
ATOM   2909 C C   . ASN B 1 68  ? 19.953 -16.370 17.324  1.00 77.50  ? 64  ASN B C   1 
ATOM   2910 O O   . ASN B 1 68  ? 19.297 -16.053 16.327  1.00 77.94  ? 64  ASN B O   1 
ATOM   2911 C CB  . ASN B 1 68  ? 21.263 -17.923 18.797  1.00 77.49  ? 64  ASN B CB  1 
ATOM   2912 C CG  . ASN B 1 68  ? 21.050 -19.324 19.352  1.00 79.62  ? 64  ASN B CG  1 
ATOM   2913 O OD1 . ASN B 1 68  ? 19.928 -19.696 19.708  1.00 80.01  ? 64  ASN B OD1 1 
ATOM   2914 N ND2 . ASN B 1 68  ? 22.120 -20.112 19.419  1.00 80.28  ? 64  ASN B ND2 1 
ATOM   2915 N N   . GLY B 1 69  ? 20.117 -15.567 18.368  1.00 78.31  ? 65  GLY B N   1 
ATOM   2916 C CA  . GLY B 1 69  ? 19.514 -14.244 18.385  1.00 78.64  ? 65  GLY B CA  1 
ATOM   2917 C C   . GLY B 1 69  ? 18.207 -14.194 19.167  1.00 78.76  ? 65  GLY B C   1 
ATOM   2918 O O   . GLY B 1 69  ? 17.610 -15.231 19.492  1.00 78.61  ? 65  GLY B O   1 
ATOM   2919 N N   . SER B 1 70  ? 17.758 -12.979 19.466  1.00 78.24  ? 66  SER B N   1 
ATOM   2920 C CA  . SER B 1 70  ? 16.522 -12.767 20.213  1.00 77.96  ? 66  SER B CA  1 
ATOM   2921 C C   . SER B 1 70  ? 15.303 -13.359 19.491  1.00 77.59  ? 66  SER B C   1 
ATOM   2922 O O   . SER B 1 70  ? 14.387 -13.891 20.132  1.00 77.07  ? 66  SER B O   1 
ATOM   2923 C CB  . SER B 1 70  ? 16.306 -11.266 20.433  1.00 78.16  ? 66  SER B CB  1 
ATOM   2924 O OG  . SER B 1 70  ? 16.099 -10.598 19.196  1.00 77.18  ? 66  SER B OG  1 
ATOM   2925 N N   . PHE B 1 71  ? 15.315 -13.259 18.161  1.00 76.77  ? 67  PHE B N   1 
ATOM   2926 C CA  . PHE B 1 71  ? 14.243 -13.741 17.285  1.00 75.90  ? 67  PHE B CA  1 
ATOM   2927 C C   . PHE B 1 71  ? 13.862 -15.207 17.501  1.00 73.49  ? 67  PHE B C   1 
ATOM   2928 O O   . PHE B 1 71  ? 12.693 -15.547 17.653  1.00 72.74  ? 67  PHE B O   1 
ATOM   2929 C CB  . PHE B 1 71  ? 14.657 -13.548 15.815  1.00 78.74  ? 67  PHE B CB  1 
ATOM   2930 C CG  . PHE B 1 71  ? 14.663 -12.102 15.350  1.00 82.49  ? 67  PHE B CG  1 
ATOM   2931 C CD1 . PHE B 1 71  ? 14.821 -11.046 16.261  1.00 83.77  ? 67  PHE B CD1 1 
ATOM   2932 C CD2 . PHE B 1 71  ? 14.533 -11.796 13.989  1.00 83.21  ? 67  PHE B CD2 1 
ATOM   2933 C CE1 . PHE B 1 71  ? 14.850 -9.706  15.824  1.00 84.65  ? 67  PHE B CE1 1 
ATOM   2934 C CE2 . PHE B 1 71  ? 14.562 -10.465 13.542  1.00 84.16  ? 67  PHE B CE2 1 
ATOM   2935 C CZ  . PHE B 1 71  ? 14.720 -9.417  14.459  1.00 84.73  ? 67  PHE B CZ  1 
ATOM   2936 N N   . GLY B 1 72  ? 14.866 -16.071 17.495  1.00 70.97  ? 68  GLY B N   1 
ATOM   2937 C CA  . GLY B 1 72  ? 14.639 -17.490 17.665  1.00 67.67  ? 68  GLY B CA  1 
ATOM   2938 C C   . GLY B 1 72  ? 15.896 -18.225 17.237  1.00 65.48  ? 68  GLY B C   1 
ATOM   2939 O O   . GLY B 1 72  ? 16.999 -17.697 17.384  1.00 66.54  ? 68  GLY B O   1 
ATOM   2940 N N   . VAL B 1 73  ? 15.746 -19.423 16.685  1.00 62.44  ? 69  VAL B N   1 
ATOM   2941 C CA  . VAL B 1 73  ? 16.904 -20.206 16.276  1.00 58.51  ? 69  VAL B CA  1 
ATOM   2942 C C   . VAL B 1 73  ? 16.919 -20.561 14.787  1.00 56.63  ? 69  VAL B C   1 
ATOM   2943 O O   . VAL B 1 73  ? 15.873 -20.771 14.171  1.00 54.84  ? 69  VAL B O   1 
ATOM   2944 C CB  . VAL B 1 73  ? 16.987 -21.529 17.093  1.00 58.15  ? 69  VAL B CB  1 
ATOM   2945 C CG1 . VAL B 1 73  ? 18.267 -22.286 16.751  1.00 58.28  ? 69  VAL B CG1 1 
ATOM   2946 C CG2 . VAL B 1 73  ? 16.936 -21.227 18.582  1.00 57.12  ? 69  VAL B CG2 1 
ATOM   2947 N N   . VAL B 1 74  ? 18.122 -20.637 14.225  1.00 53.52  ? 70  VAL B N   1 
ATOM   2948 C CA  . VAL B 1 74  ? 18.303 -21.006 12.830  1.00 51.18  ? 70  VAL B CA  1 
ATOM   2949 C C   . VAL B 1 74  ? 19.039 -22.349 12.812  1.00 50.73  ? 70  VAL B C   1 
ATOM   2950 O O   . VAL B 1 74  ? 20.108 -22.486 13.406  1.00 48.85  ? 70  VAL B O   1 
ATOM   2951 C CB  . VAL B 1 74  ? 19.120 -19.937 12.075  1.00 51.09  ? 70  VAL B CB  1 
ATOM   2952 C CG1 . VAL B 1 74  ? 19.269 -20.314 10.607  1.00 49.90  ? 70  VAL B CG1 1 
ATOM   2953 C CG2 . VAL B 1 74  ? 18.431 -18.587 12.205  1.00 51.48  ? 70  VAL B CG2 1 
ATOM   2954 N N   . TYR B 1 75  ? 18.455 -23.338 12.139  1.00 49.93  ? 71  TYR B N   1 
ATOM   2955 C CA  . TYR B 1 75  ? 19.046 -24.668 12.053  1.00 49.38  ? 71  TYR B CA  1 
ATOM   2956 C C   . TYR B 1 75  ? 19.458 -24.988 10.647  1.00 49.28  ? 71  TYR B C   1 
ATOM   2957 O O   . TYR B 1 75  ? 18.969 -24.396 9.691   1.00 48.95  ? 71  TYR B O   1 
ATOM   2958 C CB  . TYR B 1 75  ? 18.051 -25.757 12.452  1.00 49.80  ? 71  TYR B CB  1 
ATOM   2959 C CG  . TYR B 1 75  ? 17.468 -25.590 13.820  1.00 53.57  ? 71  TYR B CG  1 
ATOM   2960 C CD1 . TYR B 1 75  ? 16.522 -24.601 14.075  1.00 53.10  ? 71  TYR B CD1 1 
ATOM   2961 C CD2 . TYR B 1 75  ? 17.900 -26.388 14.882  1.00 54.97  ? 71  TYR B CD2 1 
ATOM   2962 C CE1 . TYR B 1 75  ? 16.022 -24.401 15.352  1.00 55.45  ? 71  TYR B CE1 1 
ATOM   2963 C CE2 . TYR B 1 75  ? 17.404 -26.199 16.171  1.00 55.11  ? 71  TYR B CE2 1 
ATOM   2964 C CZ  . TYR B 1 75  ? 16.466 -25.200 16.398  1.00 56.38  ? 71  TYR B CZ  1 
ATOM   2965 O OH  . TYR B 1 75  ? 15.988 -24.980 17.674  1.00 56.78  ? 71  TYR B OH  1 
ATOM   2966 N N   . GLN B 1 76  ? 20.375 -25.934 10.517  1.00 48.79  ? 72  GLN B N   1 
ATOM   2967 C CA  . GLN B 1 76  ? 20.757 -26.391 9.192   1.00 48.41  ? 72  GLN B CA  1 
ATOM   2968 C C   . GLN B 1 76  ? 20.112 -27.766 9.159   1.00 47.12  ? 72  GLN B C   1 
ATOM   2969 O O   . GLN B 1 76  ? 19.967 -28.406 10.199  1.00 45.45  ? 72  GLN B O   1 
ATOM   2970 C CB  . GLN B 1 76  ? 22.265 -26.549 9.040   1.00 48.01  ? 72  GLN B CB  1 
ATOM   2971 C CG  . GLN B 1 76  ? 22.623 -27.333 7.799   1.00 50.77  ? 72  GLN B CG  1 
ATOM   2972 C CD  . GLN B 1 76  ? 24.077 -27.764 7.775   1.00 52.00  ? 72  GLN B CD  1 
ATOM   2973 O OE1 . GLN B 1 76  ? 24.919 -27.111 7.163   1.00 54.48  ? 72  GLN B OE1 1 
ATOM   2974 N NE2 . GLN B 1 76  ? 24.376 -28.856 8.447   1.00 50.28  ? 72  GLN B NE2 1 
ATOM   2975 N N   . ALA B 1 77  ? 19.707 -28.206 7.978   1.00 46.99  ? 73  ALA B N   1 
ATOM   2976 C CA  . ALA B 1 77  ? 19.098 -29.523 7.842   1.00 47.03  ? 73  ALA B CA  1 
ATOM   2977 C C   . ALA B 1 77  ? 19.335 -29.964 6.425   1.00 46.37  ? 73  ALA B C   1 
ATOM   2978 O O   . ALA B 1 77  ? 19.724 -29.159 5.580   1.00 46.56  ? 73  ALA B O   1 
ATOM   2979 C CB  . ALA B 1 77  ? 17.591 -29.462 8.144   1.00 46.95  ? 73  ALA B CB  1 
ATOM   2980 N N   . LYS B 1 78  ? 19.120 -31.244 6.167   1.00 47.46  ? 74  LYS B N   1 
ATOM   2981 C CA  . LYS B 1 78  ? 19.303 -31.785 4.828   1.00 49.13  ? 74  LYS B CA  1 
ATOM   2982 C C   . LYS B 1 78  ? 17.976 -32.381 4.347   1.00 49.59  ? 74  LYS B C   1 
ATOM   2983 O O   . LYS B 1 78  ? 17.332 -33.141 5.079   1.00 49.00  ? 74  LYS B O   1 
ATOM   2984 C CB  . LYS B 1 78  ? 20.385 -32.872 4.840   1.00 50.39  ? 74  LYS B CB  1 
ATOM   2985 C CG  . LYS B 1 78  ? 20.631 -33.528 3.498   1.00 53.72  ? 74  LYS B CG  1 
ATOM   2986 C CD  . LYS B 1 78  ? 21.331 -34.877 3.694   1.00 58.81  ? 74  LYS B CD  1 
ATOM   2987 C CE  . LYS B 1 78  ? 22.782 -34.846 3.231   1.00 62.32  ? 74  LYS B CE  1 
ATOM   2988 N NZ  . LYS B 1 78  ? 22.902 -34.881 1.733   1.00 66.00  ? 74  LYS B NZ  1 
ATOM   2989 N N   . LEU B 1 79  ? 17.582 -32.030 3.125   1.00 50.08  ? 75  LEU B N   1 
ATOM   2990 C CA  . LEU B 1 79  ? 16.339 -32.521 2.541   1.00 52.45  ? 75  LEU B CA  1 
ATOM   2991 C C   . LEU B 1 79  ? 16.546 -33.946 2.035   1.00 55.05  ? 75  LEU B C   1 
ATOM   2992 O O   . LEU B 1 79  ? 17.442 -34.186 1.220   1.00 54.34  ? 75  LEU B O   1 
ATOM   2993 C CB  . LEU B 1 79  ? 15.914 -31.623 1.380   1.00 50.41  ? 75  LEU B CB  1 
ATOM   2994 C CG  . LEU B 1 79  ? 15.517 -30.189 1.737   1.00 49.00  ? 75  LEU B CG  1 
ATOM   2995 C CD1 . LEU B 1 79  ? 15.165 -29.444 0.461   1.00 47.10  ? 75  LEU B CD1 1 
ATOM   2996 C CD2 . LEU B 1 79  ? 14.342 -30.203 2.702   1.00 47.01  ? 75  LEU B CD2 1 
ATOM   2997 N N   . CYS B 1 80  ? 15.723 -34.880 2.515   1.00 57.21  ? 76  CYS B N   1 
ATOM   2998 C CA  . CYS B 1 80  ? 15.841 -36.281 2.110   1.00 59.26  ? 76  CYS B CA  1 
ATOM   2999 C C   . CYS B 1 80  ? 15.715 -36.470 0.619   1.00 60.94  ? 76  CYS B C   1 
ATOM   3000 O O   . CYS B 1 80  ? 16.431 -37.274 0.029   1.00 61.30  ? 76  CYS B O   1 
ATOM   3001 C CB  . CYS B 1 80  ? 14.798 -37.130 2.813   1.00 58.16  ? 76  CYS B CB  1 
ATOM   3002 S SG  . CYS B 1 80  ? 15.043 -37.181 4.561   1.00 60.90  ? 76  CYS B SG  1 
ATOM   3003 N N   . ASP B 1 81  ? 14.805 -35.741 -0.005  1.00 63.37  ? 77  ASP B N   1 
ATOM   3004 C CA  . ASP B 1 81  ? 14.657 -35.872 -1.442  1.00 66.22  ? 77  ASP B CA  1 
ATOM   3005 C C   . ASP B 1 81  ? 15.999 -35.583 -2.124  1.00 66.63  ? 77  ASP B C   1 
ATOM   3006 O O   . ASP B 1 81  ? 16.802 -36.490 -2.353  1.00 67.54  ? 77  ASP B O   1 
ATOM   3007 C CB  . ASP B 1 81  ? 13.573 -34.915 -1.964  1.00 68.85  ? 77  ASP B CB  1 
ATOM   3008 C CG  . ASP B 1 81  ? 13.434 -33.647 -1.111  1.00 72.28  ? 77  ASP B CG  1 
ATOM   3009 O OD1 . ASP B 1 81  ? 12.991 -33.760 0.068   1.00 73.35  ? 77  ASP B OD1 1 
ATOM   3010 O OD2 . ASP B 1 81  ? 13.761 -32.540 -1.620  1.00 73.61  ? 77  ASP B OD2 1 
ATOM   3011 N N   . SER B 1 82  ? 16.237 -34.306 -2.400  1.00 65.62  ? 78  SER B N   1 
ATOM   3012 C CA  . SER B 1 82  ? 17.425 -33.806 -3.087  1.00 64.22  ? 78  SER B CA  1 
ATOM   3013 C C   . SER B 1 82  ? 18.794 -33.883 -2.411  1.00 63.59  ? 78  SER B C   1 
ATOM   3014 O O   . SER B 1 82  ? 19.806 -33.691 -3.081  1.00 63.82  ? 78  SER B O   1 
ATOM   3015 C CB  . SER B 1 82  ? 17.191 -32.343 -3.453  1.00 64.77  ? 78  SER B CB  1 
ATOM   3016 O OG  . SER B 1 82  ? 17.043 -31.575 -2.265  1.00 64.37  ? 78  SER B OG  1 
ATOM   3017 N N   . GLY B 1 83  ? 18.847 -34.130 -1.107  1.00 61.84  ? 79  GLY B N   1 
ATOM   3018 C CA  . GLY B 1 83  ? 20.140 -34.157 -0.438  1.00 60.10  ? 79  GLY B CA  1 
ATOM   3019 C C   . GLY B 1 83  ? 20.643 -32.734 -0.175  1.00 59.10  ? 79  GLY B C   1 
ATOM   3020 O O   . GLY B 1 83  ? 21.711 -32.517 0.408   1.00 59.09  ? 79  GLY B O   1 
ATOM   3021 N N   . GLU B 1 84  ? 19.858 -31.754 -0.606  1.00 57.40  ? 80  GLU B N   1 
ATOM   3022 C CA  . GLU B 1 84  ? 20.196 -30.351 -0.423  1.00 56.12  ? 80  GLU B CA  1 
ATOM   3023 C C   . GLU B 1 84  ? 20.162 -29.886 1.025   1.00 54.09  ? 80  GLU B C   1 
ATOM   3024 O O   . GLU B 1 84  ? 19.312 -30.315 1.822   1.00 52.09  ? 80  GLU B O   1 
ATOM   3025 C CB  . GLU B 1 84  ? 19.224 -29.479 -1.191  1.00 59.33  ? 80  GLU B CB  1 
ATOM   3026 C CG  . GLU B 1 84  ? 19.762 -28.845 -2.423  1.00 63.89  ? 80  GLU B CG  1 
ATOM   3027 C CD  . GLU B 1 84  ? 18.740 -27.912 -3.030  1.00 67.65  ? 80  GLU B CD  1 
ATOM   3028 O OE1 . GLU B 1 84  ? 17.652 -28.405 -3.421  1.00 68.99  ? 80  GLU B OE1 1 
ATOM   3029 O OE2 . GLU B 1 84  ? 19.022 -26.691 -3.102  1.00 68.81  ? 80  GLU B OE2 1 
ATOM   3030 N N   . LEU B 1 85  ? 21.089 -28.985 1.346   1.00 51.08  ? 81  LEU B N   1 
ATOM   3031 C CA  . LEU B 1 85  ? 21.167 -28.398 2.672   1.00 48.24  ? 81  LEU B CA  1 
ATOM   3032 C C   . LEU B 1 85  ? 20.268 -27.163 2.672   1.00 44.45  ? 81  LEU B C   1 
ATOM   3033 O O   . LEU B 1 85  ? 20.222 -26.416 1.701   1.00 43.66  ? 81  LEU B O   1 
ATOM   3034 C CB  . LEU B 1 85  ? 22.606 -27.993 2.996   1.00 49.31  ? 81  LEU B CB  1 
ATOM   3035 C CG  . LEU B 1 85  ? 23.576 -29.174 3.136   1.00 51.21  ? 81  LEU B CG  1 
ATOM   3036 C CD1 . LEU B 1 85  ? 25.016 -28.659 3.206   1.00 52.54  ? 81  LEU B CD1 1 
ATOM   3037 C CD2 . LEU B 1 85  ? 23.233 -29.970 4.387   1.00 49.87  ? 81  LEU B CD2 1 
ATOM   3038 N N   . VAL B 1 86  ? 19.548 -26.969 3.762   1.00 41.47  ? 82  VAL B N   1 
ATOM   3039 C CA  . VAL B 1 86  ? 18.675 -25.831 3.891   1.00 39.81  ? 82  VAL B CA  1 
ATOM   3040 C C   . VAL B 1 86  ? 18.794 -25.338 5.308   1.00 39.41  ? 82  VAL B C   1 
ATOM   3041 O O   . VAL B 1 86  ? 19.305 -26.032 6.187   1.00 38.94  ? 82  VAL B O   1 
ATOM   3042 C CB  . VAL B 1 86  ? 17.169 -26.209 3.635   1.00 39.62  ? 82  VAL B CB  1 
ATOM   3043 C CG1 . VAL B 1 86  ? 16.940 -26.568 2.177   1.00 35.74  ? 82  VAL B CG1 1 
ATOM   3044 C CG2 . VAL B 1 86  ? 16.774 -27.351 4.548   1.00 38.42  ? 82  VAL B CG2 1 
ATOM   3045 N N   . ALA B 1 87  ? 18.293 -24.135 5.534   1.00 38.88  ? 83  ALA B N   1 
ATOM   3046 C CA  . ALA B 1 87  ? 18.308 -23.572 6.860   1.00 40.06  ? 83  ALA B CA  1 
ATOM   3047 C C   . ALA B 1 87  ? 16.842 -23.454 7.316   1.00 40.15  ? 83  ALA B C   1 
ATOM   3048 O O   . ALA B 1 87  ? 15.963 -23.135 6.522   1.00 41.07  ? 83  ALA B O   1 
ATOM   3049 C CB  . ALA B 1 87  ? 18.986 -22.170 6.827   1.00 40.19  ? 83  ALA B CB  1 
ATOM   3050 N N   . ILE B 1 88  ? 16.575 -23.725 8.583   1.00 40.61  ? 84  ILE B N   1 
ATOM   3051 C CA  . ILE B 1 88  ? 15.218 -23.593 9.085   1.00 40.90  ? 84  ILE B CA  1 
ATOM   3052 C C   . ILE B 1 88  ? 15.218 -22.552 10.196  1.00 41.00  ? 84  ILE B C   1 
ATOM   3053 O O   . ILE B 1 88  ? 15.855 -22.753 11.216  1.00 42.17  ? 84  ILE B O   1 
ATOM   3054 C CB  . ILE B 1 88  ? 14.678 -24.947 9.647   1.00 40.02  ? 84  ILE B CB  1 
ATOM   3055 C CG1 . ILE B 1 88  ? 14.687 -26.021 8.550   1.00 39.51  ? 84  ILE B CG1 1 
ATOM   3056 C CG2 . ILE B 1 88  ? 13.267 -24.768 10.174  1.00 39.27  ? 84  ILE B CG2 1 
ATOM   3057 C CD1 . ILE B 1 88  ? 14.140 -27.384 9.019   1.00 41.29  ? 84  ILE B CD1 1 
ATOM   3058 N N   . LYS B 1 89  ? 14.530 -21.432 9.986   1.00 40.91  ? 85  LYS B N   1 
ATOM   3059 C CA  . LYS B 1 89  ? 14.441 -20.398 11.005  1.00 41.78  ? 85  LYS B CA  1 
ATOM   3060 C C   . LYS B 1 89  ? 13.119 -20.610 11.751  1.00 43.91  ? 85  LYS B C   1 
ATOM   3061 O O   . LYS B 1 89  ? 12.015 -20.474 11.185  1.00 42.08  ? 85  LYS B O   1 
ATOM   3062 C CB  . LYS B 1 89  ? 14.494 -18.999 10.383  1.00 42.01  ? 85  LYS B CB  1 
ATOM   3063 C CG  . LYS B 1 89  ? 14.330 -17.889 11.394  1.00 43.19  ? 85  LYS B CG  1 
ATOM   3064 C CD  . LYS B 1 89  ? 14.531 -16.510 10.771  1.00 44.64  ? 85  LYS B CD  1 
ATOM   3065 C CE  . LYS B 1 89  ? 14.288 -15.427 11.821  1.00 46.67  ? 85  LYS B CE  1 
ATOM   3066 N NZ  . LYS B 1 89  ? 14.410 -14.030 11.284  1.00 47.52  ? 85  LYS B NZ  1 
ATOM   3067 N N   . LYS B 1 90  ? 13.244 -20.947 13.028  1.00 44.24  ? 86  LYS B N   1 
ATOM   3068 C CA  . LYS B 1 90  ? 12.101 -21.230 13.879  1.00 46.76  ? 86  LYS B CA  1 
ATOM   3069 C C   . LYS B 1 90  ? 11.789 -20.111 14.873  1.00 47.62  ? 86  LYS B C   1 
ATOM   3070 O O   . LYS B 1 90  ? 12.644 -19.733 15.683  1.00 49.09  ? 86  LYS B O   1 
ATOM   3071 C CB  . LYS B 1 90  ? 12.389 -22.533 14.606  1.00 46.99  ? 86  LYS B CB  1 
ATOM   3072 C CG  . LYS B 1 90  ? 11.302 -23.059 15.509  1.00 49.73  ? 86  LYS B CG  1 
ATOM   3073 C CD  . LYS B 1 90  ? 11.759 -24.416 16.024  1.00 50.00  ? 86  LYS B CD  1 
ATOM   3074 C CE  . LYS B 1 90  ? 10.624 -25.254 16.552  1.00 50.12  ? 86  LYS B CE  1 
ATOM   3075 N NZ  . LYS B 1 90  ? 11.148 -26.630 16.845  1.00 51.99  ? 86  LYS B NZ  1 
ATOM   3076 N N   . VAL B 1 91  ? 10.578 -19.564 14.804  1.00 47.17  ? 87  VAL B N   1 
ATOM   3077 C CA  . VAL B 1 91  ? 10.179 -18.510 15.730  1.00 48.86  ? 87  VAL B CA  1 
ATOM   3078 C C   . VAL B 1 91  ? 8.798  -18.778 16.345  1.00 50.76  ? 87  VAL B C   1 
ATOM   3079 O O   . VAL B 1 91  ? 7.897  -19.316 15.701  1.00 49.69  ? 87  VAL B O   1 
ATOM   3080 C CB  . VAL B 1 91  ? 10.148 -17.107 15.055  1.00 48.67  ? 87  VAL B CB  1 
ATOM   3081 C CG1 . VAL B 1 91  ? 11.519 -16.774 14.443  1.00 48.04  ? 87  VAL B CG1 1 
ATOM   3082 C CG2 . VAL B 1 91  ? 9.051  -17.065 13.990  1.00 48.00  ? 87  VAL B CG2 1 
ATOM   3083 N N   . LEU B 1 92  ? 8.649  -18.406 17.608  1.00 53.37  ? 88  LEU B N   1 
ATOM   3084 C CA  . LEU B 1 92  ? 7.393  -18.570 18.324  1.00 57.12  ? 88  LEU B CA  1 
ATOM   3085 C C   . LEU B 1 92  ? 6.381  -17.687 17.595  1.00 58.88  ? 88  LEU B C   1 
ATOM   3086 O O   . LEU B 1 92  ? 6.664  -16.515 17.343  1.00 59.28  ? 88  LEU B O   1 
ATOM   3087 C CB  . LEU B 1 92  ? 7.572  -18.074 19.755  1.00 58.41  ? 88  LEU B CB  1 
ATOM   3088 C CG  . LEU B 1 92  ? 6.589  -18.522 20.831  1.00 61.17  ? 88  LEU B CG  1 
ATOM   3089 C CD1 . LEU B 1 92  ? 6.715  -20.046 21.024  1.00 61.19  ? 88  LEU B CD1 1 
ATOM   3090 C CD2 . LEU B 1 92  ? 6.902  -17.766 22.150  1.00 61.75  ? 88  LEU B CD2 1 
ATOM   3091 N N   . GLN B 1 93  ? 5.215  -18.219 17.245  1.00 60.08  ? 89  GLN B N   1 
ATOM   3092 C CA  . GLN B 1 93  ? 4.243  -17.387 16.539  1.00 63.52  ? 89  GLN B CA  1 
ATOM   3093 C C   . GLN B 1 93  ? 2.895  -17.304 17.239  1.00 65.54  ? 89  GLN B C   1 
ATOM   3094 O O   . GLN B 1 93  ? 2.268  -18.330 17.511  1.00 66.33  ? 89  GLN B O   1 
ATOM   3095 C CB  . GLN B 1 93  ? 4.048  -17.895 15.099  1.00 64.01  ? 89  GLN B CB  1 
ATOM   3096 C CG  . GLN B 1 93  ? 3.142  -17.023 14.196  1.00 63.09  ? 89  GLN B CG  1 
ATOM   3097 C CD  . GLN B 1 93  ? 3.530  -15.541 14.189  1.00 64.28  ? 89  GLN B CD  1 
ATOM   3098 O OE1 . GLN B 1 93  ? 4.719  -15.184 14.244  1.00 61.54  ? 89  GLN B OE1 1 
ATOM   3099 N NE2 . GLN B 1 93  ? 2.523  -14.670 14.107  1.00 62.46  ? 89  GLN B NE2 1 
ATOM   3100 N N   . ASP B 1 94  ? 2.466  -16.078 17.533  1.00 67.45  ? 90  ASP B N   1 
ATOM   3101 C CA  . ASP B 1 94  ? 1.181  -15.872 18.176  1.00 70.22  ? 90  ASP B CA  1 
ATOM   3102 C C   . ASP B 1 94  ? 0.115  -16.030 17.107  1.00 72.70  ? 90  ASP B C   1 
ATOM   3103 O O   . ASP B 1 94  ? -0.094 -15.124 16.299  1.00 72.25  ? 90  ASP B O   1 
ATOM   3104 N N   . LYS B 1 95  ? -0.543 -17.191 17.101  1.00 74.72  ? 91  LYS B N   1 
ATOM   3105 C CA  . LYS B 1 95  ? -1.591 -17.530 16.127  1.00 76.41  ? 91  LYS B CA  1 
ATOM   3106 C C   . LYS B 1 95  ? -2.588 -16.439 15.755  1.00 76.27  ? 91  LYS B C   1 
ATOM   3107 O O   . LYS B 1 95  ? -3.080 -16.408 14.625  1.00 76.42  ? 91  LYS B O   1 
ATOM   3108 C CB  . LYS B 1 95  ? -2.369 -18.763 16.599  1.00 78.05  ? 91  LYS B CB  1 
ATOM   3109 C CG  . LYS B 1 95  ? -1.752 -20.071 16.137  1.00 80.55  ? 91  LYS B CG  1 
ATOM   3110 C CD  . LYS B 1 95  ? -1.826 -20.189 14.618  1.00 82.02  ? 91  LYS B CD  1 
ATOM   3111 C CE  . LYS B 1 95  ? -0.854 -21.232 14.101  1.00 82.41  ? 91  LYS B CE  1 
ATOM   3112 N NZ  . LYS B 1 95  ? 0.539  -20.780 14.351  1.00 83.82  ? 91  LYS B NZ  1 
ATOM   3113 N N   . ARG B 1 96  ? -2.883 -15.548 16.693  1.00 75.70  ? 92  ARG B N   1 
ATOM   3114 C CA  . ARG B 1 96  ? -3.830 -14.473 16.440  1.00 75.58  ? 92  ARG B CA  1 
ATOM   3115 C C   . ARG B 1 96  ? -3.342 -13.396 15.452  1.00 75.25  ? 92  ARG B C   1 
ATOM   3116 O O   . ARG B 1 96  ? -4.073 -12.444 15.163  1.00 75.87  ? 92  ARG B O   1 
ATOM   3117 C CB  . ARG B 1 96  ? -4.229 -13.828 17.769  1.00 76.38  ? 92  ARG B CB  1 
ATOM   3118 N N   . PHE B 1 97  ? -2.121 -13.530 14.931  1.00 74.11  ? 93  PHE B N   1 
ATOM   3119 C CA  . PHE B 1 97  ? -1.598 -12.536 13.982  1.00 72.75  ? 93  PHE B CA  1 
ATOM   3120 C C   . PHE B 1 97  ? -0.660 -13.126 12.920  1.00 69.85  ? 93  PHE B C   1 
ATOM   3121 O O   . PHE B 1 97  ? -0.020 -14.160 13.134  1.00 69.37  ? 93  PHE B O   1 
ATOM   3122 C CB  . PHE B 1 97  ? -0.875 -11.407 14.734  1.00 75.36  ? 93  PHE B CB  1 
ATOM   3123 C CG  . PHE B 1 97  ? -1.516 -11.047 16.050  1.00 77.92  ? 93  PHE B CG  1 
ATOM   3124 C CD1 . PHE B 1 97  ? -1.092 -11.656 17.234  1.00 78.96  ? 93  PHE B CD1 1 
ATOM   3125 C CD2 . PHE B 1 97  ? -2.581 -10.148 16.102  1.00 78.91  ? 93  PHE B CD2 1 
ATOM   3126 C CE1 . PHE B 1 97  ? -1.723 -11.380 18.449  1.00 79.51  ? 93  PHE B CE1 1 
ATOM   3127 C CE2 . PHE B 1 97  ? -3.219 -9.866  17.314  1.00 79.25  ? 93  PHE B CE2 1 
ATOM   3128 C CZ  . PHE B 1 97  ? -2.789 -10.484 18.488  1.00 79.48  ? 93  PHE B CZ  1 
ATOM   3129 N N   . LYS B 1 98  ? -0.587 -12.459 11.773  1.00 66.93  ? 94  LYS B N   1 
ATOM   3130 C CA  . LYS B 1 98  ? 0.264  -12.912 10.675  1.00 64.20  ? 94  LYS B CA  1 
ATOM   3131 C C   . LYS B 1 98  ? 1.708  -12.475 10.861  1.00 59.76  ? 94  LYS B C   1 
ATOM   3132 O O   . LYS B 1 98  ? 1.981  -11.298 11.117  1.00 58.63  ? 94  LYS B O   1 
ATOM   3133 C CB  . LYS B 1 98  ? -0.240 -12.360 9.339   1.00 67.82  ? 94  LYS B CB  1 
ATOM   3134 C CG  . LYS B 1 98  ? -1.471 -13.060 8.790   1.00 72.27  ? 94  LYS B CG  1 
ATOM   3135 C CD  . LYS B 1 98  ? -1.202 -14.543 8.553   1.00 74.73  ? 94  LYS B CD  1 
ATOM   3136 C CE  . LYS B 1 98  ? -2.433 -15.222 7.972   1.00 76.17  ? 94  LYS B CE  1 
ATOM   3137 N NZ  . LYS B 1 98  ? -2.274 -16.706 7.955   1.00 78.24  ? 94  LYS B NZ  1 
ATOM   3138 N N   . ASN B 1 99  ? 2.628  -13.426 10.737  1.00 55.28  ? 95  ASN B N   1 
ATOM   3139 C CA  . ASN B 1 99  ? 4.045  -13.106 10.872  1.00 50.43  ? 95  ASN B CA  1 
ATOM   3140 C C   . ASN B 1 99  ? 4.459  -12.200 9.705   1.00 48.29  ? 95  ASN B C   1 
ATOM   3141 O O   . ASN B 1 99  ? 4.315  -12.565 8.528   1.00 46.14  ? 95  ASN B O   1 
ATOM   3142 C CB  . ASN B 1 99  ? 4.874  -14.377 10.886  1.00 47.87  ? 95  ASN B CB  1 
ATOM   3143 C CG  . ASN B 1 99  ? 6.339  -14.084 11.035  1.00 46.48  ? 95  ASN B CG  1 
ATOM   3144 O OD1 . ASN B 1 99  ? 6.992  -13.656 10.084  1.00 44.90  ? 95  ASN B OD1 1 
ATOM   3145 N ND2 . ASN B 1 99  ? 6.863  -14.281 12.236  1.00 43.74  ? 95  ASN B ND2 1 
ATOM   3146 N N   . ARG B 1 100 ? 4.953  -11.010 10.036  1.00 46.42  ? 96  ARG B N   1 
ATOM   3147 C CA  . ARG B 1 100 ? 5.332  -10.031 9.019   1.00 45.36  ? 96  ARG B CA  1 
ATOM   3148 C C   . ARG B 1 100 ? 6.521  -10.448 8.178   1.00 43.19  ? 96  ARG B C   1 
ATOM   3149 O O   . ARG B 1 100 ? 6.572  -10.135 6.984   1.00 42.55  ? 96  ARG B O   1 
ATOM   3150 C CB  . ARG B 1 100 ? 5.610  -8.669  9.654   1.00 47.25  ? 96  ARG B CB  1 
ATOM   3151 C CG  . ARG B 1 100 ? 6.040  -7.607  8.643   1.00 51.81  ? 96  ARG B CG  1 
ATOM   3152 C CD  . ARG B 1 100 ? 6.459  -6.306  9.353   1.00 55.93  ? 96  ARG B CD  1 
ATOM   3153 N NE  . ARG B 1 100 ? 5.309  -5.463  9.688   1.00 59.67  ? 96  ARG B NE  1 
ATOM   3154 C CZ  . ARG B 1 100 ? 5.301  -4.522  10.637  1.00 61.21  ? 96  ARG B CZ  1 
ATOM   3155 N NH1 . ARG B 1 100 ? 6.381  -4.282  11.380  1.00 60.98  ? 96  ARG B NH1 1 
ATOM   3156 N NH2 . ARG B 1 100 ? 4.203  -3.800  10.831  1.00 62.52  ? 96  ARG B NH2 1 
ATOM   3157 N N   . GLU B 1 101 ? 7.474  -11.150 8.789   1.00 40.72  ? 97  GLU B N   1 
ATOM   3158 C CA  . GLU B 1 101 ? 8.645  -11.609 8.036   1.00 39.08  ? 97  GLU B CA  1 
ATOM   3159 C C   . GLU B 1 101 ? 8.183  -12.591 6.942   1.00 37.19  ? 97  GLU B C   1 
ATOM   3160 O O   . GLU B 1 101 ? 8.584  -12.486 5.784   1.00 34.50  ? 97  GLU B O   1 
ATOM   3161 C CB  . GLU B 1 101 ? 9.650  -12.297 8.975   1.00 39.46  ? 97  GLU B CB  1 
ATOM   3162 C CG  . GLU B 1 101 ? 10.987 -12.633 8.284   1.00 42.06  ? 97  GLU B CG  1 
ATOM   3163 C CD  . GLU B 1 101 ? 12.029 -13.313 9.196   1.00 44.10  ? 97  GLU B CD  1 
ATOM   3164 O OE1 . GLU B 1 101 ? 11.761 -13.589 10.391  1.00 44.59  ? 97  GLU B OE1 1 
ATOM   3165 O OE2 . GLU B 1 101 ? 13.140 -13.580 8.692   1.00 48.59  ? 97  GLU B OE2 1 
ATOM   3166 N N   . LEU B 1 102 ? 7.342  -13.550 7.322   1.00 36.70  ? 98  LEU B N   1 
ATOM   3167 C CA  . LEU B 1 102 ? 6.802  -14.535 6.383   1.00 37.02  ? 98  LEU B CA  1 
ATOM   3168 C C   . LEU B 1 102 ? 6.075  -13.848 5.227   1.00 37.83  ? 98  LEU B C   1 
ATOM   3169 O O   . LEU B 1 102 ? 6.293  -14.162 4.048   1.00 36.69  ? 98  LEU B O   1 
ATOM   3170 C CB  . LEU B 1 102 ? 5.818  -15.478 7.112   1.00 37.84  ? 98  LEU B CB  1 
ATOM   3171 C CG  . LEU B 1 102 ? 4.998  -16.419 6.202   1.00 41.13  ? 98  LEU B CG  1 
ATOM   3172 C CD1 . LEU B 1 102 ? 5.943  -17.260 5.370   1.00 40.70  ? 98  LEU B CD1 1 
ATOM   3173 C CD2 . LEU B 1 102 ? 4.096  -17.338 7.018   1.00 41.89  ? 98  LEU B CD2 1 
ATOM   3174 N N   . GLN B 1 103 ? 5.198  -12.902 5.564   1.00 38.39  ? 99  GLN B N   1 
ATOM   3175 C CA  . GLN B 1 103 ? 4.445  -12.196 4.536   1.00 39.92  ? 99  GLN B CA  1 
ATOM   3176 C C   . GLN B 1 103 ? 5.384  -11.479 3.559   1.00 38.88  ? 99  GLN B C   1 
ATOM   3177 O O   . GLN B 1 103 ? 5.140  -11.453 2.345   1.00 35.65  ? 99  GLN B O   1 
ATOM   3178 C CB  . GLN B 1 103 ? 3.466  -11.194 5.183   1.00 44.15  ? 99  GLN B CB  1 
ATOM   3179 C CG  . GLN B 1 103 ? 2.140  -11.785 5.768   1.00 51.21  ? 99  GLN B CG  1 
ATOM   3180 C CD  . GLN B 1 103 ? 2.059  -13.339 5.872   1.00 55.91  ? 99  GLN B CD  1 
ATOM   3181 O OE1 . GLN B 1 103 ? 1.936  -14.060 4.856   1.00 58.28  ? 99  GLN B OE1 1 
ATOM   3182 N NE2 . GLN B 1 103 ? 2.106  -13.850 7.114   1.00 57.65  ? 99  GLN B NE2 1 
ATOM   3183 N N   . ILE B 1 104 ? 6.455  -10.882 4.078   1.00 37.40  ? 100 ILE B N   1 
ATOM   3184 C CA  . ILE B 1 104 ? 7.400  -10.207 3.189   1.00 37.28  ? 100 ILE B CA  1 
ATOM   3185 C C   . ILE B 1 104 ? 8.198  -11.230 2.346   1.00 36.66  ? 100 ILE B C   1 
ATOM   3186 O O   . ILE B 1 104 ? 8.337  -11.078 1.134   1.00 34.67  ? 100 ILE B O   1 
ATOM   3187 C CB  . ILE B 1 104 ? 8.346  -9.275  4.022   1.00 39.06  ? 100 ILE B CB  1 
ATOM   3188 C CG1 . ILE B 1 104 ? 7.589  -7.980  4.363   1.00 37.01  ? 100 ILE B CG1 1 
ATOM   3189 C CG2 . ILE B 1 104 ? 9.630  -8.959  3.256   1.00 36.65  ? 100 ILE B CG2 1 
ATOM   3190 C CD1 . ILE B 1 104 ? 8.174  -7.212  5.539   1.00 37.63  ? 100 ILE B CD1 1 
ATOM   3191 N N   . MET B 1 105 ? 8.671  -12.303 2.971   1.00 37.48  ? 101 MET B N   1 
ATOM   3192 C CA  . MET B 1 105 ? 9.456  -13.315 2.251   1.00 38.25  ? 101 MET B CA  1 
ATOM   3193 C C   . MET B 1 105 ? 8.699  -14.005 1.114   1.00 39.95  ? 101 MET B C   1 
ATOM   3194 O O   . MET B 1 105 ? 9.289  -14.324 0.086   1.00 37.39  ? 101 MET B O   1 
ATOM   3195 C CB  . MET B 1 105 ? 9.921  -14.396 3.206   1.00 39.42  ? 101 MET B CB  1 
ATOM   3196 C CG  . MET B 1 105 ? 10.659 -13.863 4.402   1.00 45.86  ? 101 MET B CG  1 
ATOM   3197 S SD  . MET B 1 105 ? 12.404 -14.045 4.197   1.00 53.11  ? 101 MET B SD  1 
ATOM   3198 C CE  . MET B 1 105 ? 12.656 -12.895 3.003   1.00 45.69  ? 101 MET B CE  1 
ATOM   3199 N N   . ARG B 1 106 ? 7.402  -14.251 1.305   1.00 39.36  ? 102 ARG B N   1 
ATOM   3200 C CA  . ARG B 1 106 ? 6.624  -14.930 0.277   1.00 41.22  ? 102 ARG B CA  1 
ATOM   3201 C C   . ARG B 1 106 ? 6.591  -14.159 -1.027  1.00 42.12  ? 102 ARG B C   1 
ATOM   3202 O O   . ARG B 1 106 ? 6.382  -14.757 -2.083  1.00 42.42  ? 102 ARG B O   1 
ATOM   3203 C CB  . ARG B 1 106 ? 5.193  -15.207 0.760   1.00 42.15  ? 102 ARG B CB  1 
ATOM   3204 C CG  . ARG B 1 106 ? 5.116  -16.092 1.981   1.00 45.93  ? 102 ARG B CG  1 
ATOM   3205 C CD  . ARG B 1 106 ? 3.686  -16.619 2.190   1.00 49.57  ? 102 ARG B CD  1 
ATOM   3206 N NE  . ARG B 1 106 ? 3.330  -17.557 1.124   1.00 53.12  ? 102 ARG B NE  1 
ATOM   3207 C CZ  . ARG B 1 106 ? 2.185  -18.234 1.051   1.00 52.44  ? 102 ARG B CZ  1 
ATOM   3208 N NH1 . ARG B 1 106 ? 1.258  -18.080 1.982   1.00 50.00  ? 102 ARG B NH1 1 
ATOM   3209 N NH2 . ARG B 1 106 ? 1.989  -19.093 0.055   1.00 54.58  ? 102 ARG B NH2 1 
ATOM   3210 N N   . LYS B 1 107 ? 6.813  -12.846 -0.960  1.00 41.80  ? 103 LYS B N   1 
ATOM   3211 C CA  . LYS B 1 107 ? 6.819  -11.999 -2.159  1.00 44.33  ? 103 LYS B CA  1 
ATOM   3212 C C   . LYS B 1 107 ? 8.189  -11.776 -2.819  1.00 42.98  ? 103 LYS B C   1 
ATOM   3213 O O   . LYS B 1 107 ? 8.257  -11.342 -3.962  1.00 43.81  ? 103 LYS B O   1 
ATOM   3214 C CB  . LYS B 1 107 ? 6.240  -10.614 -1.820  1.00 47.35  ? 103 LYS B CB  1 
ATOM   3215 C CG  . LYS B 1 107 ? 4.764  -10.646 -1.503  1.00 55.38  ? 103 LYS B CG  1 
ATOM   3216 C CD  . LYS B 1 107 ? 4.230  -9.313  -0.943  1.00 59.92  ? 103 LYS B CD  1 
ATOM   3217 C CE  . LYS B 1 107 ? 2.712  -9.424  -0.722  1.00 62.31  ? 103 LYS B CE  1 
ATOM   3218 N NZ  . LYS B 1 107 ? 2.182  -8.341  0.159   1.00 64.55  ? 103 LYS B NZ  1 
ATOM   3219 N N   . LEU B 1 108 ? 9.280  -12.065 -2.117  1.00 41.76  ? 104 LEU B N   1 
ATOM   3220 C CA  . LEU B 1 108 ? 10.615 -11.802 -2.674  1.00 39.90  ? 104 LEU B CA  1 
ATOM   3221 C C   . LEU B 1 108 ? 11.161 -12.914 -3.550  1.00 38.21  ? 104 LEU B C   1 
ATOM   3222 O O   . LEU B 1 108 ? 11.055 -14.087 -3.209  1.00 37.94  ? 104 LEU B O   1 
ATOM   3223 C CB  . LEU B 1 108 ? 11.614 -11.511 -1.543  1.00 37.70  ? 104 LEU B CB  1 
ATOM   3224 C CG  . LEU B 1 108 ? 11.152 -10.427 -0.552  1.00 39.38  ? 104 LEU B CG  1 
ATOM   3225 C CD1 . LEU B 1 108 ? 12.199 -10.236 0.541   1.00 38.89  ? 104 LEU B CD1 1 
ATOM   3226 C CD2 . LEU B 1 108 ? 10.860 -9.136  -1.294  1.00 38.34  ? 104 LEU B CD2 1 
ATOM   3227 N N   . ASP B 1 109 ? 11.744 -12.528 -4.679  1.00 38.36  ? 105 ASP B N   1 
ATOM   3228 C CA  . ASP B 1 109 ? 12.339 -13.481 -5.608  1.00 39.36  ? 105 ASP B CA  1 
ATOM   3229 C C   . ASP B 1 109 ? 13.507 -12.796 -6.283  1.00 36.64  ? 105 ASP B C   1 
ATOM   3230 O O   . ASP B 1 109 ? 13.340 -12.145 -7.316  1.00 37.01  ? 105 ASP B O   1 
ATOM   3231 C CB  . ASP B 1 109 ? 11.337 -13.909 -6.679  1.00 42.72  ? 105 ASP B CB  1 
ATOM   3232 C CG  . ASP B 1 109 ? 11.957 -14.870 -7.691  1.00 47.17  ? 105 ASP B CG  1 
ATOM   3233 O OD1 . ASP B 1 109 ? 11.567 -14.832 -8.873  1.00 50.83  ? 105 ASP B OD1 1 
ATOM   3234 O OD2 . ASP B 1 109 ? 12.839 -15.670 -7.297  1.00 50.46  ? 105 ASP B OD2 1 
ATOM   3235 N N   . HIS B 1 110 ? 14.701 -12.955 -5.712  1.00 36.93  ? 106 HIS B N   1 
ATOM   3236 C CA  . HIS B 1 110 ? 15.894 -12.277 -6.245  1.00 33.31  ? 106 HIS B CA  1 
ATOM   3237 C C   . HIS B 1 110 ? 17.166 -13.105 -5.996  1.00 32.34  ? 106 HIS B C   1 
ATOM   3238 O O   . HIS B 1 110 ? 17.319 -13.666 -4.937  1.00 29.19  ? 106 HIS B O   1 
ATOM   3239 C CB  . HIS B 1 110 ? 16.036 -10.903 -5.576  1.00 31.49  ? 106 HIS B CB  1 
ATOM   3240 C CG  . HIS B 1 110 ? 17.181 -10.096 -6.109  1.00 33.33  ? 106 HIS B CG  1 
ATOM   3241 N ND1 . HIS B 1 110 ? 17.049 -9.225  -7.173  1.00 35.11  ? 106 HIS B ND1 1 
ATOM   3242 C CD2 . HIS B 1 110 ? 18.495 -10.083 -5.774  1.00 31.91  ? 106 HIS B CD2 1 
ATOM   3243 C CE1 . HIS B 1 110 ? 18.232 -8.709  -7.469  1.00 33.98  ? 106 HIS B CE1 1 
ATOM   3244 N NE2 . HIS B 1 110 ? 19.127 -9.214  -6.632  1.00 35.15  ? 106 HIS B NE2 1 
ATOM   3245 N N   . CYS B 1 111 ? 18.086 -13.145 -6.961  1.00 32.87  ? 107 CYS B N   1 
ATOM   3246 C CA  . CYS B 1 111 ? 19.308 -13.957 -6.783  1.00 34.61  ? 107 CYS B CA  1 
ATOM   3247 C C   . CYS B 1 111 ? 20.179 -13.523 -5.585  1.00 35.02  ? 107 CYS B C   1 
ATOM   3248 O O   . CYS B 1 111 ? 20.988 -14.304 -5.082  1.00 35.42  ? 107 CYS B O   1 
ATOM   3249 C CB  . CYS B 1 111 ? 20.140 -13.948 -8.083  1.00 37.15  ? 107 CYS B CB  1 
ATOM   3250 S SG  . CYS B 1 111 ? 20.802 -12.279 -8.565  1.00 45.03  ? 107 CYS B SG  1 
ATOM   3251 N N   . ASN B 1 112 ? 20.004 -12.299 -5.093  1.00 33.22  ? 108 ASN B N   1 
ATOM   3252 C CA  . ASN B 1 112 ? 20.805 -11.851 -3.945  1.00 30.89  ? 108 ASN B CA  1 
ATOM   3253 C C   . ASN B 1 112 ? 20.068 -11.756 -2.614  1.00 31.23  ? 108 ASN B C   1 
ATOM   3254 O O   . ASN B 1 112 ? 20.442 -10.990 -1.721  1.00 30.03  ? 108 ASN B O   1 
ATOM   3255 C CB  . ASN B 1 112 ? 21.502 -10.523 -4.295  1.00 31.78  ? 108 ASN B CB  1 
ATOM   3256 C CG  . ASN B 1 112 ? 22.523 -10.702 -5.397  1.00 30.10  ? 108 ASN B CG  1 
ATOM   3257 O OD1 . ASN B 1 112 ? 23.449 -11.533 -5.275  1.00 34.26  ? 108 ASN B OD1 1 
ATOM   3258 N ND2 . ASN B 1 112 ? 22.366 -9.969  -6.477  1.00 28.21  ? 108 ASN B ND2 1 
ATOM   3259 N N   . ILE B 1 113 ? 19.026 -12.566 -2.479  1.00 30.88  ? 109 ILE B N   1 
ATOM   3260 C CA  . ILE B 1 113 ? 18.237 -12.618 -1.271  1.00 30.37  ? 109 ILE B CA  1 
ATOM   3261 C C   . ILE B 1 113 ? 17.935 -14.071 -0.999  1.00 32.16  ? 109 ILE B C   1 
ATOM   3262 O O   . ILE B 1 113 ? 17.549 -14.804 -1.902  1.00 33.20  ? 109 ILE B O   1 
ATOM   3263 C CB  . ILE B 1 113 ? 16.878 -11.874 -1.423  1.00 31.05  ? 109 ILE B CB  1 
ATOM   3264 C CG1 . ILE B 1 113 ? 17.122 -10.367 -1.620  1.00 32.98  ? 109 ILE B CG1 1 
ATOM   3265 C CG2 . ILE B 1 113 ? 16.011 -12.146 -0.186  1.00 30.64  ? 109 ILE B CG2 1 
ATOM   3266 C CD1 . ILE B 1 113 ? 15.806 -9.564  -1.874  1.00 31.23  ? 109 ILE B CD1 1 
ATOM   3267 N N   . VAL B 1 114 ? 18.094 -14.487 0.247   1.00 33.65  ? 110 VAL B N   1 
ATOM   3268 C CA  . VAL B 1 114 ? 17.841 -15.861 0.597   1.00 35.15  ? 110 VAL B CA  1 
ATOM   3269 C C   . VAL B 1 114 ? 16.375 -16.257 0.284   1.00 36.30  ? 110 VAL B C   1 
ATOM   3270 O O   . VAL B 1 114 ? 15.416 -15.580 0.685   1.00 32.84  ? 110 VAL B O   1 
ATOM   3271 C CB  . VAL B 1 114 ? 18.194 -16.086 2.083   1.00 38.18  ? 110 VAL B CB  1 
ATOM   3272 C CG1 . VAL B 1 114 ? 17.069 -15.645 2.969   1.00 37.56  ? 110 VAL B CG1 1 
ATOM   3273 C CG2 . VAL B 1 114 ? 18.538 -17.524 2.308   1.00 41.61  ? 110 VAL B CG2 1 
ATOM   3274 N N   . ARG B 1 115 ? 16.210 -17.362 -0.430  1.00 36.10  ? 111 ARG B N   1 
ATOM   3275 C CA  . ARG B 1 115 ? 14.876 -17.798 -0.830  1.00 38.42  ? 111 ARG B CA  1 
ATOM   3276 C C   . ARG B 1 115 ? 14.060 -18.570 0.190   1.00 36.59  ? 111 ARG B C   1 
ATOM   3277 O O   . ARG B 1 115 ? 14.552 -19.471 0.851   1.00 36.18  ? 111 ARG B O   1 
ATOM   3278 C CB  . ARG B 1 115 ? 14.960 -18.625 -2.116  1.00 39.98  ? 111 ARG B CB  1 
ATOM   3279 C CG  . ARG B 1 115 ? 13.591 -19.118 -2.630  1.00 46.16  ? 111 ARG B CG  1 
ATOM   3280 C CD  . ARG B 1 115 ? 13.678 -19.617 -4.074  1.00 50.41  ? 111 ARG B CD  1 
ATOM   3281 N NE  . ARG B 1 115 ? 14.591 -20.755 -4.203  1.00 54.43  ? 111 ARG B NE  1 
ATOM   3282 C CZ  . ARG B 1 115 ? 14.197 -22.028 -4.187  1.00 57.67  ? 111 ARG B CZ  1 
ATOM   3283 N NH1 . ARG B 1 115 ? 12.897 -22.316 -4.048  1.00 55.85  ? 111 ARG B NH1 1 
ATOM   3284 N NH2 . ARG B 1 115 ? 15.102 -23.011 -4.316  1.00 57.39  ? 111 ARG B NH2 1 
ATOM   3285 N N   . LEU B 1 116 ? 12.798 -18.199 0.324   1.00 36.98  ? 112 LEU B N   1 
ATOM   3286 C CA  . LEU B 1 116 ? 11.922 -18.929 1.222   1.00 37.14  ? 112 LEU B CA  1 
ATOM   3287 C C   . LEU B 1 116 ? 11.436 -20.162 0.431   1.00 37.64  ? 112 LEU B C   1 
ATOM   3288 O O   . LEU B 1 116 ? 10.637 -20.024 -0.493  1.00 37.08  ? 112 LEU B O   1 
ATOM   3289 C CB  . LEU B 1 116 ? 10.714 -18.075 1.614   1.00 36.99  ? 112 LEU B CB  1 
ATOM   3290 C CG  . LEU B 1 116 ? 9.697  -18.855 2.463   1.00 37.25  ? 112 LEU B CG  1 
ATOM   3291 C CD1 . LEU B 1 116 ? 10.353 -19.302 3.789   1.00 36.11  ? 112 LEU B CD1 1 
ATOM   3292 C CD2 . LEU B 1 116 ? 8.456  -17.982 2.723   1.00 36.61  ? 112 LEU B CD2 1 
ATOM   3293 N N   . ARG B 1 117 ? 11.921 -21.347 0.783   1.00 37.68  ? 113 ARG B N   1 
ATOM   3294 C CA  . ARG B 1 117 ? 11.509 -22.588 0.106   1.00 39.99  ? 113 ARG B CA  1 
ATOM   3295 C C   . ARG B 1 117 ? 10.137 -23.101 0.582   1.00 39.22  ? 113 ARG B C   1 
ATOM   3296 O O   . ARG B 1 117 ? 9.282  -23.420 -0.237  1.00 38.60  ? 113 ARG B O   1 
ATOM   3297 C CB  . ARG B 1 117 ? 12.573 -23.680 0.318   1.00 40.67  ? 113 ARG B CB  1 
ATOM   3298 C CG  . ARG B 1 117 ? 13.852 -23.344 -0.424  1.00 43.48  ? 113 ARG B CG  1 
ATOM   3299 C CD  . ARG B 1 117 ? 15.017 -24.216 -0.046  1.00 45.52  ? 113 ARG B CD  1 
ATOM   3300 N NE  . ARG B 1 117 ? 16.180 -23.818 -0.837  1.00 48.20  ? 113 ARG B NE  1 
ATOM   3301 C CZ  . ARG B 1 117 ? 16.842 -24.642 -1.637  1.00 50.91  ? 113 ARG B CZ  1 
ATOM   3302 N NH1 . ARG B 1 117 ? 16.457 -25.919 -1.754  1.00 47.85  ? 113 ARG B NH1 1 
ATOM   3303 N NH2 . ARG B 1 117 ? 17.886 -24.186 -2.318  1.00 51.38  ? 113 ARG B NH2 1 
ATOM   3304 N N   . TYR B 1 118 ? 9.948  -23.182 1.899   1.00 38.55  ? 114 TYR B N   1 
ATOM   3305 C CA  . TYR B 1 118 ? 8.689  -23.633 2.484   1.00 39.46  ? 114 TYR B CA  1 
ATOM   3306 C C   . TYR B 1 118 ? 8.548  -23.019 3.871   1.00 40.75  ? 114 TYR B C   1 
ATOM   3307 O O   . TYR B 1 118 ? 9.499  -22.401 4.405   1.00 38.97  ? 114 TYR B O   1 
ATOM   3308 C CB  . TYR B 1 118 ? 8.668  -25.148 2.728   1.00 40.53  ? 114 TYR B CB  1 
ATOM   3309 C CG  . TYR B 1 118 ? 9.016  -26.036 1.577   1.00 42.80  ? 114 TYR B CG  1 
ATOM   3310 C CD1 . TYR B 1 118 ? 10.310 -26.513 1.417   1.00 45.51  ? 114 TYR B CD1 1 
ATOM   3311 C CD2 . TYR B 1 118 ? 8.042  -26.440 0.660   1.00 44.99  ? 114 TYR B CD2 1 
ATOM   3312 C CE1 . TYR B 1 118 ? 10.639 -27.381 0.371   1.00 46.89  ? 114 TYR B CE1 1 
ATOM   3313 C CE2 . TYR B 1 118 ? 8.356  -27.306 -0.391  1.00 47.11  ? 114 TYR B CE2 1 
ATOM   3314 C CZ  . TYR B 1 118 ? 9.663  -27.773 -0.523  1.00 48.34  ? 114 TYR B CZ  1 
ATOM   3315 O OH  . TYR B 1 118 ? 9.989  -28.646 -1.539  1.00 51.14  ? 114 TYR B OH  1 
ATOM   3316 N N   . PHE B 1 119 ? 7.354  -23.193 4.446   1.00 38.38  ? 115 PHE B N   1 
ATOM   3317 C CA  . PHE B 1 119 ? 7.098  -22.796 5.821   1.00 38.16  ? 115 PHE B CA  1 
ATOM   3318 C C   . PHE B 1 119 ? 6.084  -23.801 6.385   1.00 39.18  ? 115 PHE B C   1 
ATOM   3319 O O   . PHE B 1 119 ? 5.273  -24.371 5.638   1.00 38.33  ? 115 PHE B O   1 
ATOM   3320 C CB  . PHE B 1 119 ? 6.605  -21.347 5.920   1.00 38.71  ? 115 PHE B CB  1 
ATOM   3321 C CG  . PHE B 1 119 ? 5.242  -21.099 5.337   1.00 39.71  ? 115 PHE B CG  1 
ATOM   3322 C CD1 . PHE B 1 119 ? 4.101  -21.189 6.137   1.00 41.40  ? 115 PHE B CD1 1 
ATOM   3323 C CD2 . PHE B 1 119 ? 5.101  -20.695 4.013   1.00 38.55  ? 115 PHE B CD2 1 
ATOM   3324 C CE1 . PHE B 1 119 ? 2.835  -20.865 5.624   1.00 41.03  ? 115 PHE B CE1 1 
ATOM   3325 C CE2 . PHE B 1 119 ? 3.847  -20.372 3.490   1.00 41.27  ? 115 PHE B CE2 1 
ATOM   3326 C CZ  . PHE B 1 119 ? 2.706  -20.456 4.306   1.00 39.89  ? 115 PHE B CZ  1 
ATOM   3327 N N   . PHE B 1 120 ? 6.172  -24.072 7.679   1.00 38.11  ? 116 PHE B N   1 
ATOM   3328 C CA  . PHE B 1 120 ? 5.249  -25.004 8.316   1.00 41.71  ? 116 PHE B CA  1 
ATOM   3329 C C   . PHE B 1 120 ? 5.170  -24.692 9.796   1.00 43.20  ? 116 PHE B C   1 
ATOM   3330 O O   . PHE B 1 120 ? 6.060  -24.016 10.348  1.00 44.62  ? 116 PHE B O   1 
ATOM   3331 C CB  . PHE B 1 120 ? 5.688  -26.459 8.081   1.00 41.07  ? 116 PHE B CB  1 
ATOM   3332 C CG  . PHE B 1 120 ? 7.018  -26.816 8.694   1.00 41.37  ? 116 PHE B CG  1 
ATOM   3333 C CD1 . PHE B 1 120 ? 7.090  -27.289 9.994   1.00 41.87  ? 116 PHE B CD1 1 
ATOM   3334 C CD2 . PHE B 1 120 ? 8.196  -26.713 7.953   1.00 41.98  ? 116 PHE B CD2 1 
ATOM   3335 C CE1 . PHE B 1 120 ? 8.319  -27.663 10.554  1.00 43.23  ? 116 PHE B CE1 1 
ATOM   3336 C CE2 . PHE B 1 120 ? 9.441  -27.083 8.502   1.00 40.36  ? 116 PHE B CE2 1 
ATOM   3337 C CZ  . PHE B 1 120 ? 9.503  -27.558 9.799   1.00 42.14  ? 116 PHE B CZ  1 
ATOM   3338 N N   . TYR B 1 121 ? 4.101  -25.148 10.439  1.00 43.55  ? 117 TYR B N   1 
ATOM   3339 C CA  . TYR B 1 121 ? 3.937  -24.918 11.869  1.00 44.41  ? 117 TYR B CA  1 
ATOM   3340 C C   . TYR B 1 121 ? 4.208  -26.174 12.663  1.00 46.11  ? 117 TYR B C   1 
ATOM   3341 O O   . TYR B 1 121 ? 3.925  -27.279 12.200  1.00 47.68  ? 117 TYR B O   1 
ATOM   3342 C CB  . TYR B 1 121 ? 2.538  -24.409 12.170  1.00 42.95  ? 117 TYR B CB  1 
ATOM   3343 C CG  . TYR B 1 121 ? 2.230  -23.126 11.442  1.00 42.82  ? 117 TYR B CG  1 
ATOM   3344 C CD1 . TYR B 1 121 ? 1.634  -23.137 10.176  1.00 42.07  ? 117 TYR B CD1 1 
ATOM   3345 C CD2 . TYR B 1 121 ? 2.577  -21.902 11.998  1.00 42.01  ? 117 TYR B CD2 1 
ATOM   3346 C CE1 . TYR B 1 121 ? 1.398  -21.943 9.486   1.00 42.56  ? 117 TYR B CE1 1 
ATOM   3347 C CE2 . TYR B 1 121 ? 2.347  -20.706 11.324  1.00 42.08  ? 117 TYR B CE2 1 
ATOM   3348 C CZ  . TYR B 1 121 ? 1.767  -20.728 10.080  1.00 42.60  ? 117 TYR B CZ  1 
ATOM   3349 O OH  . TYR B 1 121 ? 1.581  -19.539 9.433   1.00 42.16  ? 117 TYR B OH  1 
ATOM   3350 N N   . SER B 1 122 ? 4.750  -26.002 13.864  1.00 47.68  ? 118 SER B N   1 
ATOM   3351 C CA  . SER B 1 122 ? 5.068  -27.127 14.745  1.00 50.64  ? 118 SER B CA  1 
ATOM   3352 C C   . SER B 1 122 ? 4.993  -26.678 16.195  1.00 53.14  ? 118 SER B C   1 
ATOM   3353 O O   . SER B 1 122 ? 4.756  -25.500 16.483  1.00 54.01  ? 118 SER B O   1 
ATOM   3354 C CB  . SER B 1 122 ? 6.486  -27.637 14.477  1.00 50.81  ? 118 SER B CB  1 
ATOM   3355 O OG  . SER B 1 122 ? 7.447  -26.692 14.935  1.00 49.98  ? 118 SER B OG  1 
ATOM   3356 N N   . SER B 1 123 ? 5.200  -27.621 17.105  1.00 55.88  ? 119 SER B N   1 
ATOM   3357 C CA  . SER B 1 123 ? 5.197  -27.320 18.535  1.00 59.74  ? 119 SER B CA  1 
ATOM   3358 C C   . SER B 1 123 ? 5.703  -28.528 19.293  1.00 60.60  ? 119 SER B C   1 
ATOM   3359 O O   . SER B 1 123 ? 5.981  -29.564 18.680  1.00 61.99  ? 119 SER B O   1 
ATOM   3360 C CB  . SER B 1 123 ? 3.790  -26.938 19.012  1.00 61.90  ? 119 SER B CB  1 
ATOM   3361 O OG  . SER B 1 123 ? 2.815  -27.872 18.568  1.00 65.10  ? 119 SER B OG  1 
ATOM   3362 N N   . VAL B 1 130 ? 3.182  -22.976 19.806  1.00 51.16  ? 126 VAL B N   1 
ATOM   3363 C CA  . VAL B 1 130 ? 3.202  -22.993 18.332  1.00 51.69  ? 126 VAL B CA  1 
ATOM   3364 C C   . VAL B 1 130 ? 4.304  -22.166 17.643  1.00 50.72  ? 126 VAL B C   1 
ATOM   3365 O O   . VAL B 1 130 ? 4.398  -20.933 17.795  1.00 48.42  ? 126 VAL B O   1 
ATOM   3366 C CB  . VAL B 1 130 ? 1.838  -22.555 17.727  1.00 52.74  ? 126 VAL B CB  1 
ATOM   3367 C CG1 . VAL B 1 130 ? 1.950  -22.448 16.204  1.00 51.24  ? 126 VAL B CG1 1 
ATOM   3368 C CG2 . VAL B 1 130 ? 0.760  -23.580 18.082  1.00 53.62  ? 126 VAL B CG2 1 
ATOM   3369 N N   . TYR B 1 131 ? 5.105  -22.874 16.846  1.00 49.99  ? 127 TYR B N   1 
ATOM   3370 C CA  . TYR B 1 131 ? 6.207  -22.273 16.109  1.00 49.29  ? 127 TYR B CA  1 
ATOM   3371 C C   . TYR B 1 131 ? 6.016  -22.238 14.599  1.00 47.20  ? 127 TYR B C   1 
ATOM   3372 O O   . TYR B 1 131 ? 5.486  -23.175 14.006  1.00 45.10  ? 127 TYR B O   1 
ATOM   3373 C CB  . TYR B 1 131 ? 7.511  -23.030 16.376  1.00 52.01  ? 127 TYR B CB  1 
ATOM   3374 C CG  . TYR B 1 131 ? 8.035  -22.918 17.775  1.00 55.00  ? 127 TYR B CG  1 
ATOM   3375 C CD1 . TYR B 1 131 ? 7.587  -23.771 18.780  1.00 56.57  ? 127 TYR B CD1 1 
ATOM   3376 C CD2 . TYR B 1 131 ? 8.973  -21.939 18.101  1.00 57.71  ? 127 TYR B CD2 1 
ATOM   3377 C CE1 . TYR B 1 131 ? 8.062  -23.653 20.093  1.00 58.83  ? 127 TYR B CE1 1 
ATOM   3378 C CE2 . TYR B 1 131 ? 9.460  -21.805 19.408  1.00 59.78  ? 127 TYR B CE2 1 
ATOM   3379 C CZ  . TYR B 1 131 ? 8.998  -22.664 20.399  1.00 60.48  ? 127 TYR B CZ  1 
ATOM   3380 O OH  . TYR B 1 131 ? 9.462  -22.510 21.684  1.00 61.79  ? 127 TYR B OH  1 
ATOM   3381 N N   . LEU B 1 132 ? 6.472  -21.138 14.000  1.00 44.35  ? 128 LEU B N   1 
ATOM   3382 C CA  . LEU B 1 132 ? 6.469  -20.952 12.566  1.00 42.41  ? 128 LEU B CA  1 
ATOM   3383 C C   . LEU B 1 132 ? 7.885  -21.367 12.184  1.00 42.04  ? 128 LEU B C   1 
ATOM   3384 O O   . LEU B 1 132 ? 8.851  -20.969 12.847  1.00 43.30  ? 128 LEU B O   1 
ATOM   3385 C CB  . LEU B 1 132 ? 6.249  -19.490 12.214  1.00 41.97  ? 128 LEU B CB  1 
ATOM   3386 C CG  . LEU B 1 132 ? 6.542  -19.055 10.772  1.00 41.23  ? 128 LEU B CG  1 
ATOM   3387 C CD1 . LEU B 1 132 ? 5.653  -19.811 9.774   1.00 39.49  ? 128 LEU B CD1 1 
ATOM   3388 C CD2 . LEU B 1 132 ? 6.311  -17.550 10.664  1.00 39.14  ? 128 LEU B CD2 1 
ATOM   3389 N N   . ASN B 1 133 ? 8.003  -22.183 11.149  1.00 40.10  ? 129 ASN B N   1 
ATOM   3390 C CA  . ASN B 1 133 ? 9.288  -22.663 10.669  1.00 39.29  ? 129 ASN B CA  1 
ATOM   3391 C C   . ASN B 1 133 ? 9.475  -22.179 9.230   1.00 39.73  ? 129 ASN B C   1 
ATOM   3392 O O   . ASN B 1 133 ? 8.686  -22.516 8.343   1.00 37.14  ? 129 ASN B O   1 
ATOM   3393 C CB  . ASN B 1 133 ? 9.350  -24.197 10.677  1.00 39.46  ? 129 ASN B CB  1 
ATOM   3394 C CG  . ASN B 1 133 ? 9.240  -24.791 12.078  1.00 44.02  ? 129 ASN B CG  1 
ATOM   3395 O OD1 . ASN B 1 133 ? 8.136  -24.925 12.643  1.00 45.29  ? 129 ASN B OD1 1 
ATOM   3396 N ND2 . ASN B 1 133 ? 10.388 -25.145 12.652  1.00 41.49  ? 129 ASN B ND2 1 
ATOM   3397 N N   . LEU B 1 134 ? 10.514 -21.380 8.999   1.00 38.22  ? 130 LEU B N   1 
ATOM   3398 C CA  . LEU B 1 134 ? 10.801 -20.892 7.660   1.00 38.28  ? 130 LEU B CA  1 
ATOM   3399 C C   . LEU B 1 134 ? 11.940 -21.740 7.104   1.00 39.18  ? 130 LEU B C   1 
ATOM   3400 O O   . LEU B 1 134 ? 13.036 -21.744 7.679   1.00 39.42  ? 130 LEU B O   1 
ATOM   3401 C CB  . LEU B 1 134 ? 11.231 -19.417 7.698   1.00 37.65  ? 130 LEU B CB  1 
ATOM   3402 C CG  . LEU B 1 134 ? 10.235 -18.438 8.332   1.00 42.07  ? 130 LEU B CG  1 
ATOM   3403 C CD1 . LEU B 1 134 ? 10.816 -17.014 8.292   1.00 43.64  ? 130 LEU B CD1 1 
ATOM   3404 C CD2 . LEU B 1 134 ? 8.900  -18.486 7.563   1.00 40.83  ? 130 LEU B CD2 1 
ATOM   3405 N N   . VAL B 1 135 ? 11.686 -22.456 6.005   1.00 37.90  ? 131 VAL B N   1 
ATOM   3406 C CA  . VAL B 1 135 ? 12.709 -23.285 5.366   1.00 38.45  ? 131 VAL B CA  1 
ATOM   3407 C C   . VAL B 1 135 ? 13.321 -22.437 4.253   1.00 38.52  ? 131 VAL B C   1 
ATOM   3408 O O   . VAL B 1 135 ? 12.670 -22.122 3.262   1.00 38.33  ? 131 VAL B O   1 
ATOM   3409 C CB  . VAL B 1 135 ? 12.122 -24.587 4.775   1.00 39.52  ? 131 VAL B CB  1 
ATOM   3410 C CG1 . VAL B 1 135 ? 13.232 -25.414 4.176   1.00 38.10  ? 131 VAL B CG1 1 
ATOM   3411 C CG2 . VAL B 1 135 ? 11.425 -25.396 5.867   1.00 37.76  ? 131 VAL B CG2 1 
ATOM   3412 N N   . LEU B 1 136 ? 14.595 -22.094 4.421   1.00 38.06  ? 132 LEU B N   1 
ATOM   3413 C CA  . LEU B 1 136 ? 15.282 -21.194 3.507   1.00 37.30  ? 132 LEU B CA  1 
ATOM   3414 C C   . LEU B 1 136 ? 16.573 -21.764 2.917   1.00 38.51  ? 132 LEU B C   1 
ATOM   3415 O O   . LEU B 1 136 ? 17.063 -22.791 3.398   1.00 39.46  ? 132 LEU B O   1 
ATOM   3416 C CB  . LEU B 1 136 ? 15.624 -19.941 4.304   1.00 35.73  ? 132 LEU B CB  1 
ATOM   3417 C CG  . LEU B 1 136 ? 14.446 -19.207 4.944   1.00 33.96  ? 132 LEU B CG  1 
ATOM   3418 C CD1 . LEU B 1 136 ? 14.758 -18.803 6.370   1.00 33.67  ? 132 LEU B CD1 1 
ATOM   3419 C CD2 . LEU B 1 136 ? 14.138 -17.998 4.083   1.00 33.72  ? 132 LEU B CD2 1 
ATOM   3420 N N   . ASP B 1 137 ? 17.121 -21.086 1.896   1.00 39.34  ? 133 ASP B N   1 
ATOM   3421 C CA  . ASP B 1 137 ? 18.407 -21.496 1.303   1.00 40.69  ? 133 ASP B CA  1 
ATOM   3422 C C   . ASP B 1 137 ? 19.441 -21.473 2.452   1.00 40.06  ? 133 ASP B C   1 
ATOM   3423 O O   . ASP B 1 137 ? 19.375 -20.634 3.366   1.00 39.36  ? 133 ASP B O   1 
ATOM   3424 C CB  . ASP B 1 137 ? 18.979 -20.488 0.278   1.00 42.49  ? 133 ASP B CB  1 
ATOM   3425 C CG  . ASP B 1 137 ? 18.166 -20.340 -0.990  1.00 45.70  ? 133 ASP B CG  1 
ATOM   3426 O OD1 . ASP B 1 137 ? 17.619 -21.355 -1.516  1.00 45.46  ? 133 ASP B OD1 1 
ATOM   3427 O OD2 . ASP B 1 137 ? 18.126 -19.165 -1.479  1.00 45.91  ? 133 ASP B OD2 1 
ATOM   3428 N N   . TYR B 1 138 ? 20.389 -22.395 2.395   1.00 40.95  ? 134 TYR B N   1 
ATOM   3429 C CA  . TYR B 1 138 ? 21.482 -22.429 3.356   1.00 41.01  ? 134 TYR B CA  1 
ATOM   3430 C C   . TYR B 1 138 ? 22.726 -21.892 2.610   1.00 39.47  ? 134 TYR B C   1 
ATOM   3431 O O   . TYR B 1 138 ? 22.967 -22.253 1.466   1.00 38.74  ? 134 TYR B O   1 
ATOM   3432 C CB  . TYR B 1 138 ? 21.739 -23.860 3.821   1.00 43.68  ? 134 TYR B CB  1 
ATOM   3433 C CG  . TYR B 1 138 ? 23.052 -24.000 4.540   1.00 44.32  ? 134 TYR B CG  1 
ATOM   3434 C CD1 . TYR B 1 138 ? 23.211 -23.521 5.837   1.00 44.73  ? 134 TYR B CD1 1 
ATOM   3435 C CD2 . TYR B 1 138 ? 24.146 -24.560 3.902   1.00 45.17  ? 134 TYR B CD2 1 
ATOM   3436 C CE1 . TYR B 1 138 ? 24.425 -23.596 6.483   1.00 46.51  ? 134 TYR B CE1 1 
ATOM   3437 C CE2 . TYR B 1 138 ? 25.383 -24.639 4.540   1.00 47.49  ? 134 TYR B CE2 1 
ATOM   3438 C CZ  . TYR B 1 138 ? 25.513 -24.157 5.822   1.00 46.90  ? 134 TYR B CZ  1 
ATOM   3439 O OH  . TYR B 1 138 ? 26.733 -24.229 6.442   1.00 47.75  ? 134 TYR B OH  1 
ATOM   3440 N N   . VAL B 1 139 ? 23.476 -21.001 3.239   1.00 39.40  ? 135 VAL B N   1 
ATOM   3441 C CA  . VAL B 1 139 ? 24.698 -20.422 2.649   1.00 38.12  ? 135 VAL B CA  1 
ATOM   3442 C C   . VAL B 1 139 ? 25.739 -20.673 3.769   1.00 37.25  ? 135 VAL B C   1 
ATOM   3443 O O   . VAL B 1 139 ? 25.475 -20.386 4.935   1.00 36.60  ? 135 VAL B O   1 
ATOM   3444 C CB  . VAL B 1 139 ? 24.507 -18.902 2.352   1.00 39.08  ? 135 VAL B CB  1 
ATOM   3445 C CG1 . VAL B 1 139 ? 25.724 -18.346 1.590   1.00 38.36  ? 135 VAL B CG1 1 
ATOM   3446 C CG2 . VAL B 1 139 ? 23.257 -18.702 1.487   1.00 37.71  ? 135 VAL B CG2 1 
ATOM   3447 N N   . PRO B 1 140 ? 26.930 -21.200 3.424   1.00 36.29  ? 136 PRO B N   1 
ATOM   3448 C CA  . PRO B 1 140 ? 27.914 -21.484 4.478   1.00 36.68  ? 136 PRO B CA  1 
ATOM   3449 C C   . PRO B 1 140 ? 28.709 -20.419 5.227   1.00 36.59  ? 136 PRO B C   1 
ATOM   3450 O O   . PRO B 1 140 ? 29.237 -20.718 6.291   1.00 37.12  ? 136 PRO B O   1 
ATOM   3451 C CB  . PRO B 1 140 ? 28.799 -22.580 3.849   1.00 35.80  ? 136 PRO B CB  1 
ATOM   3452 C CG  . PRO B 1 140 ? 28.766 -22.279 2.372   1.00 38.01  ? 136 PRO B CG  1 
ATOM   3453 C CD  . PRO B 1 140 ? 27.384 -21.652 2.091   1.00 37.24  ? 136 PRO B CD  1 
ATOM   3454 N N   . GLU B 1 141 ? 28.782 -19.190 4.727   1.00 35.02  ? 137 GLU B N   1 
ATOM   3455 C CA  . GLU B 1 141 ? 29.525 -18.146 5.440   1.00 35.98  ? 137 GLU B CA  1 
ATOM   3456 C C   . GLU B 1 141 ? 28.755 -16.827 5.534   1.00 35.10  ? 137 GLU B C   1 
ATOM   3457 O O   . GLU B 1 141 ? 27.679 -16.687 4.962   1.00 33.90  ? 137 GLU B O   1 
ATOM   3458 C CB  . GLU B 1 141 ? 30.858 -17.870 4.727   1.00 38.88  ? 137 GLU B CB  1 
ATOM   3459 C CG  . GLU B 1 141 ? 31.948 -18.869 5.002   1.00 43.50  ? 137 GLU B CG  1 
ATOM   3460 C CD  . GLU B 1 141 ? 32.334 -18.888 6.468   1.00 47.88  ? 137 GLU B CD  1 
ATOM   3461 O OE1 . GLU B 1 141 ? 32.119 -17.857 7.157   1.00 46.04  ? 137 GLU B OE1 1 
ATOM   3462 O OE2 . GLU B 1 141 ? 32.848 -19.933 6.930   1.00 51.26  ? 137 GLU B OE2 1 
ATOM   3463 N N   . THR B 1 142 ? 29.321 -15.871 6.262   1.00 35.34  ? 138 THR B N   1 
ATOM   3464 C CA  . THR B 1 142 ? 28.726 -14.544 6.390   1.00 35.25  ? 138 THR B CA  1 
ATOM   3465 C C   . THR B 1 142 ? 29.843 -13.525 6.199   1.00 34.02  ? 138 THR B C   1 
ATOM   3466 O O   . THR B 1 142 ? 31.015 -13.853 6.382   1.00 33.35  ? 138 THR B O   1 
ATOM   3467 C CB  . THR B 1 142 ? 28.094 -14.293 7.778   1.00 34.71  ? 138 THR B CB  1 
ATOM   3468 O OG1 . THR B 1 142 ? 29.122 -14.234 8.781   1.00 36.00  ? 138 THR B OG1 1 
ATOM   3469 C CG2 . THR B 1 142 ? 27.069 -15.371 8.106   1.00 35.79  ? 138 THR B CG2 1 
ATOM   3470 N N   . VAL B 1 143 ? 29.490 -12.297 5.824   1.00 33.19  ? 139 VAL B N   1 
ATOM   3471 C CA  . VAL B 1 143 ? 30.492 -11.267 5.638   1.00 32.41  ? 139 VAL B CA  1 
ATOM   3472 C C   . VAL B 1 143 ? 31.140 -11.058 7.001   1.00 35.37  ? 139 VAL B C   1 
ATOM   3473 O O   . VAL B 1 143 ? 32.335 -10.797 7.102   1.00 36.55  ? 139 VAL B O   1 
ATOM   3474 C CB  . VAL B 1 143 ? 29.875 -9.939  5.128   1.00 32.34  ? 139 VAL B CB  1 
ATOM   3475 C CG1 . VAL B 1 143 ? 30.844 -8.759  5.391   1.00 29.53  ? 139 VAL B CG1 1 
ATOM   3476 C CG2 . VAL B 1 143 ? 29.591 -10.041 3.628   1.00 29.58  ? 139 VAL B CG2 1 
ATOM   3477 N N   . TYR B 1 144 ? 30.347 -11.178 8.052   1.00 35.77  ? 140 TYR B N   1 
ATOM   3478 C CA  . TYR B 1 144 ? 30.858 -11.025 9.409   1.00 37.61  ? 140 TYR B CA  1 
ATOM   3479 C C   . TYR B 1 144 ? 32.031 -11.985 9.707   1.00 37.87  ? 140 TYR B C   1 
ATOM   3480 O O   . TYR B 1 144 ? 33.095 -11.567 10.175  1.00 36.30  ? 140 TYR B O   1 
ATOM   3481 C CB  . TYR B 1 144 ? 29.752 -11.304 10.424  1.00 36.48  ? 140 TYR B CB  1 
ATOM   3482 C CG  . TYR B 1 144 ? 30.222 -11.197 11.853  1.00 41.54  ? 140 TYR B CG  1 
ATOM   3483 C CD1 . TYR B 1 144 ? 30.354 -9.961  12.465  1.00 43.15  ? 140 TYR B CD1 1 
ATOM   3484 C CD2 . TYR B 1 144 ? 30.523 -12.335 12.595  1.00 43.94  ? 140 TYR B CD2 1 
ATOM   3485 C CE1 . TYR B 1 144 ? 30.760 -9.852  13.777  1.00 45.95  ? 140 TYR B CE1 1 
ATOM   3486 C CE2 . TYR B 1 144 ? 30.944 -12.243 13.922  1.00 46.35  ? 140 TYR B CE2 1 
ATOM   3487 C CZ  . TYR B 1 144 ? 31.054 -10.992 14.503  1.00 48.66  ? 140 TYR B CZ  1 
ATOM   3488 O OH  . TYR B 1 144 ? 31.453 -10.869 15.815  1.00 51.74  ? 140 TYR B OH  1 
ATOM   3489 N N   . ARG B 1 145 ? 31.828 -13.272 9.456   1.00 36.70  ? 141 ARG B N   1 
ATOM   3490 C CA  . ARG B 1 145 ? 32.889 -14.244 9.724   1.00 38.20  ? 141 ARG B CA  1 
ATOM   3491 C C   . ARG B 1 145 ? 34.116 -14.068 8.823   1.00 37.72  ? 141 ARG B C   1 
ATOM   3492 O O   . ARG B 1 145 ? 35.246 -14.141 9.300   1.00 38.17  ? 141 ARG B O   1 
ATOM   3493 C CB  . ARG B 1 145 ? 32.324 -15.653 9.614   1.00 38.02  ? 141 ARG B CB  1 
ATOM   3494 C CG  . ARG B 1 145 ? 31.469 -16.015 10.814  1.00 42.65  ? 141 ARG B CG  1 
ATOM   3495 C CD  . ARG B 1 145 ? 30.425 -17.060 10.457  1.00 45.42  ? 141 ARG B CD  1 
ATOM   3496 N NE  . ARG B 1 145 ? 31.002 -18.171 9.719   1.00 49.75  ? 141 ARG B NE  1 
ATOM   3497 C CZ  . ARG B 1 145 ? 31.294 -19.360 10.250  1.00 54.06  ? 141 ARG B CZ  1 
ATOM   3498 N NH1 . ARG B 1 145 ? 31.059 -19.594 11.538  1.00 53.35  ? 141 ARG B NH1 1 
ATOM   3499 N NH2 . ARG B 1 145 ? 31.814 -20.321 9.482   1.00 55.10  ? 141 ARG B NH2 1 
ATOM   3500 N N   . VAL B 1 146 ? 33.899 -13.824 7.534   1.00 37.17  ? 142 VAL B N   1 
ATOM   3501 C CA  . VAL B 1 146 ? 34.987 -13.623 6.600   1.00 38.14  ? 142 VAL B CA  1 
ATOM   3502 C C   . VAL B 1 146 ? 35.819 -12.395 6.969   1.00 40.53  ? 142 VAL B C   1 
ATOM   3503 O O   . VAL B 1 146 ? 37.052 -12.468 6.983   1.00 39.52  ? 142 VAL B O   1 
ATOM   3504 C CB  . VAL B 1 146 ? 34.469 -13.495 5.157   1.00 39.21  ? 142 VAL B CB  1 
ATOM   3505 C CG1 . VAL B 1 146 ? 35.556 -12.930 4.237   1.00 39.62  ? 142 VAL B CG1 1 
ATOM   3506 C CG2 . VAL B 1 146 ? 33.992 -14.883 4.657   1.00 38.90  ? 142 VAL B CG2 1 
ATOM   3507 N N   . ALA B 1 147 ? 35.165 -11.280 7.287   1.00 39.12  ? 143 ALA B N   1 
ATOM   3508 C CA  . ALA B 1 147 ? 35.899 -10.076 7.659   1.00 40.15  ? 143 ALA B CA  1 
ATOM   3509 C C   . ALA B 1 147 ? 36.722 -10.313 8.937   1.00 41.05  ? 143 ALA B C   1 
ATOM   3510 O O   . ALA B 1 147 ? 37.814 -9.757  9.099   1.00 40.01  ? 143 ALA B O   1 
ATOM   3511 C CB  . ALA B 1 147 ? 34.940 -8.913  7.891   1.00 38.68  ? 143 ALA B CB  1 
ATOM   3512 N N   . ARG B 1 148 ? 36.179 -11.110 9.843   1.00 40.34  ? 144 ARG B N   1 
ATOM   3513 C CA  . ARG B 1 148 ? 36.852 -11.375 11.090  1.00 44.54  ? 144 ARG B CA  1 
ATOM   3514 C C   . ARG B 1 148 ? 38.098 -12.223 10.817  1.00 45.61  ? 144 ARG B C   1 
ATOM   3515 O O   . ARG B 1 148 ? 39.133 -12.009 11.429  1.00 44.33  ? 144 ARG B O   1 
ATOM   3516 C CB  . ARG B 1 148 ? 35.912 -12.078 12.062  1.00 45.09  ? 144 ARG B CB  1 
ATOM   3517 C CG  . ARG B 1 148 ? 36.355 -12.010 13.512  1.00 51.31  ? 144 ARG B CG  1 
ATOM   3518 C CD  . ARG B 1 148 ? 35.412 -12.820 14.401  1.00 56.35  ? 144 ARG B CD  1 
ATOM   3519 N NE  . ARG B 1 148 ? 35.127 -14.122 13.793  1.00 61.38  ? 144 ARG B NE  1 
ATOM   3520 C CZ  . ARG B 1 148 ? 34.180 -14.961 14.204  1.00 63.76  ? 144 ARG B CZ  1 
ATOM   3521 N NH1 . ARG B 1 148 ? 33.407 -14.641 15.242  1.00 65.43  ? 144 ARG B NH1 1 
ATOM   3522 N NH2 . ARG B 1 148 ? 34.005 -16.121 13.572  1.00 64.07  ? 144 ARG B NH2 1 
ATOM   3523 N N   . HIS B 1 149 ? 37.994 -13.174 9.893   1.00 46.86  ? 145 HIS B N   1 
ATOM   3524 C CA  . HIS B 1 149 ? 39.144 -13.992 9.532   1.00 47.99  ? 145 HIS B CA  1 
ATOM   3525 C C   . HIS B 1 149 ? 40.275 -13.087 9.051   1.00 47.97  ? 145 HIS B C   1 
ATOM   3526 O O   . HIS B 1 149 ? 41.415 -13.219 9.519   1.00 46.33  ? 145 HIS B O   1 
ATOM   3527 C CB  . HIS B 1 149 ? 38.830 -14.968 8.399   1.00 50.47  ? 145 HIS B CB  1 
ATOM   3528 C CG  . HIS B 1 149 ? 40.057 -15.420 7.655   1.00 54.96  ? 145 HIS B CG  1 
ATOM   3529 N ND1 . HIS B 1 149 ? 40.833 -16.486 8.067   1.00 56.74  ? 145 HIS B ND1 1 
ATOM   3530 C CD2 . HIS B 1 149 ? 40.708 -14.874 6.596   1.00 56.64  ? 145 HIS B CD2 1 
ATOM   3531 C CE1 . HIS B 1 149 ? 41.908 -16.574 7.300   1.00 56.59  ? 145 HIS B CE1 1 
ATOM   3532 N NE2 . HIS B 1 149 ? 41.857 -15.607 6.401   1.00 57.82  ? 145 HIS B NE2 1 
ATOM   3533 N N   . TYR B 1 150 ? 39.977 -12.191 8.103   1.00 45.61  ? 146 TYR B N   1 
ATOM   3534 C CA  . TYR B 1 150 ? 41.011 -11.305 7.589   1.00 46.40  ? 146 TYR B CA  1 
ATOM   3535 C C   . TYR B 1 150 ? 41.552 -10.413 8.682   1.00 49.77  ? 146 TYR B C   1 
ATOM   3536 O O   . TYR B 1 150 ? 42.770 -10.233 8.828   1.00 49.85  ? 146 TYR B O   1 
ATOM   3537 C CB  . TYR B 1 150 ? 40.498 -10.458 6.418   1.00 43.48  ? 146 TYR B CB  1 
ATOM   3538 C CG  . TYR B 1 150 ? 40.443 -11.246 5.124   1.00 42.35  ? 146 TYR B CG  1 
ATOM   3539 C CD1 . TYR B 1 150 ? 39.337 -12.048 4.818   1.00 40.81  ? 146 TYR B CD1 1 
ATOM   3540 C CD2 . TYR B 1 150 ? 41.549 -11.280 4.257   1.00 40.29  ? 146 TYR B CD2 1 
ATOM   3541 C CE1 . TYR B 1 150 ? 39.329 -12.876 3.690   1.00 38.95  ? 146 TYR B CE1 1 
ATOM   3542 C CE2 . TYR B 1 150 ? 41.557 -12.091 3.131   1.00 39.79  ? 146 TYR B CE2 1 
ATOM   3543 C CZ  . TYR B 1 150 ? 40.445 -12.891 2.852   1.00 41.27  ? 146 TYR B CZ  1 
ATOM   3544 O OH  . TYR B 1 150 ? 40.443 -13.696 1.740   1.00 40.44  ? 146 TYR B OH  1 
ATOM   3545 N N   . SER B 1 151 ? 40.633 -9.870  9.463   1.00 51.62  ? 147 SER B N   1 
ATOM   3546 C CA  . SER B 1 151 ? 40.959 -8.986  10.563  1.00 54.60  ? 147 SER B CA  1 
ATOM   3547 C C   . SER B 1 151 ? 41.994 -9.582  11.535  1.00 57.39  ? 147 SER B C   1 
ATOM   3548 O O   . SER B 1 151 ? 43.043 -8.983  11.774  1.00 56.65  ? 147 SER B O   1 
ATOM   3549 C CB  . SER B 1 151 ? 39.677 -8.642  11.315  1.00 55.02  ? 147 SER B CB  1 
ATOM   3550 O OG  . SER B 1 151 ? 39.938 -7.644  12.262  1.00 57.23  ? 147 SER B OG  1 
ATOM   3551 N N   . ARG B 1 152 ? 41.725 -10.751 12.103  1.00 59.49  ? 148 ARG B N   1 
ATOM   3552 C CA  . ARG B 1 152 ? 42.707 -11.288 13.019  1.00 63.20  ? 148 ARG B CA  1 
ATOM   3553 C C   . ARG B 1 152 ? 43.836 -12.068 12.357  1.00 64.34  ? 148 ARG B C   1 
ATOM   3554 O O   . ARG B 1 152 ? 44.454 -12.938 12.973  1.00 65.98  ? 148 ARG B O   1 
ATOM   3555 C CB  . ARG B 1 152 ? 42.041 -12.107 14.130  1.00 65.75  ? 148 ARG B CB  1 
ATOM   3556 C CG  . ARG B 1 152 ? 41.128 -13.220 13.723  1.00 68.42  ? 148 ARG B CG  1 
ATOM   3557 C CD  . ARG B 1 152 ? 40.190 -13.505 14.896  1.00 71.30  ? 148 ARG B CD  1 
ATOM   3558 N NE  . ARG B 1 152 ? 39.287 -14.626 14.641  1.00 75.19  ? 148 ARG B NE  1 
ATOM   3559 C CZ  . ARG B 1 152 ? 38.271 -14.964 15.434  1.00 77.23  ? 148 ARG B CZ  1 
ATOM   3560 N NH1 . ARG B 1 152 ? 38.021 -14.263 16.540  1.00 78.08  ? 148 ARG B NH1 1 
ATOM   3561 N NH2 . ARG B 1 152 ? 37.504 -16.007 15.125  1.00 77.42  ? 148 ARG B NH2 1 
ATOM   3562 N N   . ALA B 1 153 ? 44.101 -11.736 11.098  1.00 64.44  ? 149 ALA B N   1 
ATOM   3563 C CA  . ALA B 1 153 ? 45.183 -12.340 10.334  1.00 64.12  ? 149 ALA B CA  1 
ATOM   3564 C C   . ALA B 1 153 ? 45.999 -11.156 9.846   1.00 64.22  ? 149 ALA B C   1 
ATOM   3565 O O   . ALA B 1 153 ? 46.949 -11.307 9.087   1.00 65.76  ? 149 ALA B O   1 
ATOM   3566 C CB  . ALA B 1 153 ? 44.648 -13.126 9.159   1.00 63.72  ? 149 ALA B CB  1 
ATOM   3567 N N   . LYS B 1 154 ? 45.605 -9.966  10.286  1.00 63.49  ? 150 LYS B N   1 
ATOM   3568 C CA  . LYS B 1 154 ? 46.297 -8.745  9.920   1.00 63.63  ? 150 LYS B CA  1 
ATOM   3569 C C   . LYS B 1 154 ? 46.245 -8.452  8.423   1.00 63.10  ? 150 LYS B C   1 
ATOM   3570 O O   . LYS B 1 154 ? 47.062 -7.684  7.916   1.00 63.22  ? 150 LYS B O   1 
ATOM   3571 C CB  . LYS B 1 154 ? 47.757 -8.829  10.367  1.00 65.37  ? 150 LYS B CB  1 
ATOM   3572 C CG  . LYS B 1 154 ? 47.947 -9.220  11.829  1.00 67.14  ? 150 LYS B CG  1 
ATOM   3573 C CD  . LYS B 1 154 ? 47.425 -8.135  12.754  1.00 69.19  ? 150 LYS B CD  1 
ATOM   3574 C CE  . LYS B 1 154 ? 47.798 -8.394  14.213  1.00 69.37  ? 150 LYS B CE  1 
ATOM   3575 N NZ  . LYS B 1 154 ? 47.402 -7.236  15.064  1.00 69.12  ? 150 LYS B NZ  1 
ATOM   3576 N N   . GLN B 1 155 ? 45.293 -9.064  7.719   1.00 61.57  ? 151 GLN B N   1 
ATOM   3577 C CA  . GLN B 1 155 ? 45.127 -8.859  6.278   1.00 59.75  ? 151 GLN B CA  1 
ATOM   3578 C C   . GLN B 1 155 ? 43.783 -8.154  6.017   1.00 58.89  ? 151 GLN B C   1 
ATOM   3579 O O   . GLN B 1 155 ? 42.868 -8.205  6.848   1.00 58.51  ? 151 GLN B O   1 
ATOM   3580 C CB  . GLN B 1 155 ? 45.101 -10.207 5.538   1.00 61.16  ? 151 GLN B CB  1 
ATOM   3581 C CG  . GLN B 1 155 ? 46.391 -11.010 5.496   1.00 63.37  ? 151 GLN B CG  1 
ATOM   3582 C CD  . GLN B 1 155 ? 47.510 -10.295 4.744   1.00 66.28  ? 151 GLN B CD  1 
ATOM   3583 O OE1 . GLN B 1 155 ? 47.290 -9.683  3.686   1.00 67.26  ? 151 GLN B OE1 1 
ATOM   3584 N NE2 . GLN B 1 155 ? 48.727 -10.381 5.282   1.00 67.23  ? 151 GLN B NE2 1 
ATOM   3585 N N   . THR B 1 156 ? 43.661 -7.481  4.880   1.00 56.49  ? 152 THR B N   1 
ATOM   3586 C CA  . THR B 1 156 ? 42.380 -6.865  4.548   1.00 55.14  ? 152 THR B CA  1 
ATOM   3587 C C   . THR B 1 156 ? 41.786 -7.675  3.411   1.00 51.39  ? 152 THR B C   1 
ATOM   3588 O O   . THR B 1 156 ? 42.509 -8.323  2.640   1.00 49.63  ? 152 THR B O   1 
ATOM   3589 C CB  . THR B 1 156 ? 42.481 -5.398  4.068   1.00 56.51  ? 152 THR B CB  1 
ATOM   3590 O OG1 . THR B 1 156 ? 43.568 -5.272  3.146   1.00 58.05  ? 152 THR B OG1 1 
ATOM   3591 C CG2 . THR B 1 156 ? 42.628 -4.440  5.265   1.00 58.12  ? 152 THR B CG2 1 
ATOM   3592 N N   . LEU B 1 157 ? 40.465 -7.648  3.320   1.00 47.01  ? 153 LEU B N   1 
ATOM   3593 C CA  . LEU B 1 157 ? 39.800 -8.381  2.279   1.00 43.63  ? 153 LEU B CA  1 
ATOM   3594 C C   . LEU B 1 157 ? 40.206 -7.785  0.944   1.00 41.28  ? 153 LEU B C   1 
ATOM   3595 O O   . LEU B 1 157 ? 40.147 -6.571  0.764   1.00 41.65  ? 153 LEU B O   1 
ATOM   3596 C CB  . LEU B 1 157 ? 38.281 -8.291  2.463   1.00 43.47  ? 153 LEU B CB  1 
ATOM   3597 C CG  . LEU B 1 157 ? 37.393 -9.013  1.445   1.00 43.40  ? 153 LEU B CG  1 
ATOM   3598 C CD1 . LEU B 1 157 ? 37.620 -10.532 1.479   1.00 42.09  ? 153 LEU B CD1 1 
ATOM   3599 C CD2 . LEU B 1 157 ? 35.937 -8.694  1.772   1.00 44.22  ? 153 LEU B CD2 1 
ATOM   3600 N N   . PRO B 1 158 ? 40.671 -8.628  -0.002  1.00 40.24  ? 154 PRO B N   1 
ATOM   3601 C CA  . PRO B 1 158 ? 41.062 -8.115  -1.320  1.00 39.01  ? 154 PRO B CA  1 
ATOM   3602 C C   . PRO B 1 158 ? 39.881 -7.291  -1.891  1.00 40.46  ? 154 PRO B C   1 
ATOM   3603 O O   . PRO B 1 158 ? 38.705 -7.692  -1.791  1.00 38.49  ? 154 PRO B O   1 
ATOM   3604 C CB  . PRO B 1 158 ? 41.322 -9.386  -2.128  1.00 37.60  ? 154 PRO B CB  1 
ATOM   3605 C CG  . PRO B 1 158 ? 41.803 -10.361 -1.081  1.00 40.83  ? 154 PRO B CG  1 
ATOM   3606 C CD  . PRO B 1 158 ? 40.940 -10.075 0.123   1.00 39.00  ? 154 PRO B CD  1 
ATOM   3607 N N   . VAL B 1 159 ? 40.201 -6.161  -2.505  1.00 39.52  ? 155 VAL B N   1 
ATOM   3608 C CA  . VAL B 1 159 ? 39.195 -5.271  -3.056  1.00 41.02  ? 155 VAL B CA  1 
ATOM   3609 C C   . VAL B 1 159 ? 38.234 -5.893  -4.063  1.00 40.07  ? 155 VAL B C   1 
ATOM   3610 O O   . VAL B 1 159 ? 37.095 -5.432  -4.208  1.00 38.78  ? 155 VAL B O   1 
ATOM   3611 C CB  . VAL B 1 159 ? 39.868 -4.045  -3.706  1.00 43.88  ? 155 VAL B CB  1 
ATOM   3612 C CG1 . VAL B 1 159 ? 38.838 -2.940  -3.933  1.00 44.90  ? 155 VAL B CG1 1 
ATOM   3613 C CG2 . VAL B 1 159 ? 40.960 -3.517  -2.773  1.00 47.37  ? 155 VAL B CG2 1 
ATOM   3614 N N   . ILE B 1 160 ? 38.677 -6.932  -4.765  1.00 38.03  ? 156 ILE B N   1 
ATOM   3615 C CA  . ILE B 1 160 ? 37.816 -7.541  -5.750  1.00 36.99  ? 156 ILE B CA  1 
ATOM   3616 C C   . ILE B 1 160 ? 36.594 -8.135  -5.026  1.00 35.41  ? 156 ILE B C   1 
ATOM   3617 O O   . ILE B 1 160 ? 35.487 -8.080  -5.541  1.00 34.59  ? 156 ILE B O   1 
ATOM   3618 C CB  . ILE B 1 160 ? 38.573 -8.629  -6.584  1.00 39.02  ? 156 ILE B CB  1 
ATOM   3619 C CG1 . ILE B 1 160 ? 37.607 -9.282  -7.587  1.00 38.79  ? 156 ILE B CG1 1 
ATOM   3620 C CG2 . ILE B 1 160 ? 39.136 -9.696  -5.665  1.00 37.65  ? 156 ILE B CG2 1 
ATOM   3621 C CD1 . ILE B 1 160 ? 36.978 -8.316  -8.564  1.00 41.77  ? 156 ILE B CD1 1 
ATOM   3622 N N   . TYR B 1 161 ? 36.797 -8.686  -3.834  1.00 34.39  ? 157 TYR B N   1 
ATOM   3623 C CA  . TYR B 1 161 ? 35.687 -9.251  -3.051  1.00 34.39  ? 157 TYR B CA  1 
ATOM   3624 C C   . TYR B 1 161 ? 34.840 -8.124  -2.445  1.00 34.16  ? 157 TYR B C   1 
ATOM   3625 O O   . TYR B 1 161 ? 33.615 -8.250  -2.354  1.00 31.83  ? 157 TYR B O   1 
ATOM   3626 C CB  . TYR B 1 161 ? 36.190 -10.161 -1.922  1.00 35.72  ? 157 TYR B CB  1 
ATOM   3627 C CG  . TYR B 1 161 ? 36.804 -11.454 -2.414  1.00 39.18  ? 157 TYR B CG  1 
ATOM   3628 C CD1 . TYR B 1 161 ? 36.047 -12.380 -3.127  1.00 40.66  ? 157 TYR B CD1 1 
ATOM   3629 C CD2 . TYR B 1 161 ? 38.158 -11.728 -2.196  1.00 41.48  ? 157 TYR B CD2 1 
ATOM   3630 C CE1 . TYR B 1 161 ? 36.622 -13.559 -3.613  1.00 44.60  ? 157 TYR B CE1 1 
ATOM   3631 C CE2 . TYR B 1 161 ? 38.752 -12.902 -2.676  1.00 43.40  ? 157 TYR B CE2 1 
ATOM   3632 C CZ  . TYR B 1 161 ? 37.990 -13.809 -3.371  1.00 44.99  ? 157 TYR B CZ  1 
ATOM   3633 O OH  . TYR B 1 161 ? 38.589 -14.977 -3.762  1.00 46.59  ? 157 TYR B OH  1 
ATOM   3634 N N   . VAL B 1 162 ? 35.478 -7.028  -2.030  1.00 30.98  ? 158 VAL B N   1 
ATOM   3635 C CA  . VAL B 1 162 ? 34.715 -5.900  -1.489  1.00 32.84  ? 158 VAL B CA  1 
ATOM   3636 C C   . VAL B 1 162 ? 33.750 -5.418  -2.593  1.00 32.95  ? 158 VAL B C   1 
ATOM   3637 O O   . VAL B 1 162 ? 32.582 -5.107  -2.317  1.00 32.36  ? 158 VAL B O   1 
ATOM   3638 C CB  . VAL B 1 162 ? 35.619 -4.708  -1.076  1.00 32.87  ? 158 VAL B CB  1 
ATOM   3639 C CG1 . VAL B 1 162 ? 34.733 -3.535  -0.570  1.00 32.39  ? 158 VAL B CG1 1 
ATOM   3640 C CG2 . VAL B 1 162 ? 36.617 -5.160  0.023   1.00 33.52  ? 158 VAL B CG2 1 
ATOM   3641 N N   . LYS B 1 163 ? 34.252 -5.347  -3.834  1.00 32.70  ? 159 LYS B N   1 
ATOM   3642 C CA  . LYS B 1 163 ? 33.454 -4.924  -4.983  1.00 31.93  ? 159 LYS B CA  1 
ATOM   3643 C C   . LYS B 1 163 ? 32.295 -5.897  -5.232  1.00 32.30  ? 159 LYS B C   1 
ATOM   3644 O O   . LYS B 1 163 ? 31.143 -5.482  -5.353  1.00 31.58  ? 159 LYS B O   1 
ATOM   3645 C CB  . LYS B 1 163 ? 34.313 -4.861  -6.253  1.00 32.74  ? 159 LYS B CB  1 
ATOM   3646 C CG  . LYS B 1 163 ? 35.229 -3.637  -6.320  1.00 33.84  ? 159 LYS B CG  1 
ATOM   3647 C CD  . LYS B 1 163 ? 36.110 -3.640  -7.548  1.00 32.24  ? 159 LYS B CD  1 
ATOM   3648 C CE  . LYS B 1 163 ? 37.237 -2.577  -7.397  1.00 33.49  ? 159 LYS B CE  1 
ATOM   3649 N NZ  . LYS B 1 163 ? 38.072 -2.518  -8.643  1.00 33.52  ? 159 LYS B NZ  1 
ATOM   3650 N N   . LEU B 1 164 ? 32.609 -7.190  -5.315  1.00 30.88  ? 160 LEU B N   1 
ATOM   3651 C CA  . LEU B 1 164 ? 31.585 -8.200  -5.552  1.00 31.29  ? 160 LEU B CA  1 
ATOM   3652 C C   . LEU B 1 164 ? 30.484 -8.239  -4.486  1.00 31.22  ? 160 LEU B C   1 
ATOM   3653 O O   . LEU B 1 164 ? 29.291 -8.300  -4.820  1.00 30.47  ? 160 LEU B O   1 
ATOM   3654 C CB  . LEU B 1 164 ? 32.218 -9.593  -5.622  1.00 30.41  ? 160 LEU B CB  1 
ATOM   3655 C CG  . LEU B 1 164 ? 32.936 -9.977  -6.931  1.00 34.17  ? 160 LEU B CG  1 
ATOM   3656 C CD1 . LEU B 1 164 ? 33.836 -11.236 -6.671  1.00 32.68  ? 160 LEU B CD1 1 
ATOM   3657 C CD2 . LEU B 1 164 ? 31.906 -10.240 -8.035  1.00 32.76  ? 160 LEU B CD2 1 
ATOM   3658 N N   . TYR B 1 165 ? 30.885 -8.223  -3.211  1.00 29.60  ? 161 TYR B N   1 
ATOM   3659 C CA  . TYR B 1 165 ? 29.926 -8.332  -2.125  1.00 30.34  ? 161 TYR B CA  1 
ATOM   3660 C C   . TYR B 1 165 ? 29.048 -7.097  -2.013  1.00 30.55  ? 161 TYR B C   1 
ATOM   3661 O O   . TYR B 1 165 ? 27.835 -7.234  -1.886  1.00 28.19  ? 161 TYR B O   1 
ATOM   3662 C CB  . TYR B 1 165 ? 30.625 -8.608  -0.788  1.00 31.13  ? 161 TYR B CB  1 
ATOM   3663 C CG  . TYR B 1 165 ? 31.438 -9.905  -0.780  1.00 35.80  ? 161 TYR B CG  1 
ATOM   3664 C CD1 . TYR B 1 165 ? 31.152 -10.933 -1.680  1.00 34.23  ? 161 TYR B CD1 1 
ATOM   3665 C CD2 . TYR B 1 165 ? 32.466 -10.107 0.163   1.00 35.90  ? 161 TYR B CD2 1 
ATOM   3666 C CE1 . TYR B 1 165 ? 31.856 -12.142 -1.640  1.00 40.01  ? 161 TYR B CE1 1 
ATOM   3667 C CE2 . TYR B 1 165 ? 33.184 -11.310 0.203   1.00 38.63  ? 161 TYR B CE2 1 
ATOM   3668 C CZ  . TYR B 1 165 ? 32.869 -12.321 -0.697  1.00 41.52  ? 161 TYR B CZ  1 
ATOM   3669 O OH  . TYR B 1 165 ? 33.561 -13.524 -0.658  1.00 45.38  ? 161 TYR B OH  1 
ATOM   3670 N N   . MET B 1 166 ? 29.658 -5.913  -2.076  1.00 27.76  ? 162 MET B N   1 
ATOM   3671 C CA  . MET B 1 166 ? 28.918 -4.662  -1.976  1.00 29.30  ? 162 MET B CA  1 
ATOM   3672 C C   . MET B 1 166 ? 27.978 -4.435  -3.153  1.00 29.05  ? 162 MET B C   1 
ATOM   3673 O O   . MET B 1 166 ? 26.855 -3.953  -2.972  1.00 29.59  ? 162 MET B O   1 
ATOM   3674 C CB  . MET B 1 166 ? 29.889 -3.481  -1.828  1.00 29.79  ? 162 MET B CB  1 
ATOM   3675 C CG  . MET B 1 166 ? 30.598 -3.478  -0.450  1.00 32.03  ? 162 MET B CG  1 
ATOM   3676 S SD  . MET B 1 166 ? 29.524 -3.482  0.995   1.00 35.78  ? 162 MET B SD  1 
ATOM   3677 C CE  . MET B 1 166 ? 28.430 -2.016  0.618   1.00 30.85  ? 162 MET B CE  1 
ATOM   3678 N N   . TYR B 1 167 ? 28.425 -4.765  -4.361  1.00 29.76  ? 163 TYR B N   1 
ATOM   3679 C CA  . TYR B 1 167 ? 27.567 -4.630  -5.534  1.00 29.23  ? 163 TYR B CA  1 
ATOM   3680 C C   . TYR B 1 167 ? 26.308 -5.501  -5.388  1.00 29.89  ? 163 TYR B C   1 
ATOM   3681 O O   . TYR B 1 167 ? 25.184 -5.062  -5.707  1.00 29.71  ? 163 TYR B O   1 
ATOM   3682 C CB  . TYR B 1 167 ? 28.322 -5.061  -6.800  1.00 30.40  ? 163 TYR B CB  1 
ATOM   3683 C CG  . TYR B 1 167 ? 27.475 -5.040  -8.054  1.00 28.98  ? 163 TYR B CG  1 
ATOM   3684 C CD1 . TYR B 1 167 ? 27.380 -3.893  -8.837  1.00 30.75  ? 163 TYR B CD1 1 
ATOM   3685 C CD2 . TYR B 1 167 ? 26.790 -6.181  -8.465  1.00 30.61  ? 163 TYR B CD2 1 
ATOM   3686 C CE1 . TYR B 1 167 ? 26.633 -3.883  -10.027 1.00 30.21  ? 163 TYR B CE1 1 
ATOM   3687 C CE2 . TYR B 1 167 ? 26.030 -6.190  -9.637  1.00 30.97  ? 163 TYR B CE2 1 
ATOM   3688 C CZ  . TYR B 1 167 ? 25.962 -5.043  -10.421 1.00 30.94  ? 163 TYR B CZ  1 
ATOM   3689 O OH  . TYR B 1 167 ? 25.275 -5.119  -11.625 1.00 29.67  ? 163 TYR B OH  1 
ATOM   3690 N N   . GLN B 1 168 ? 26.486 -6.741  -4.928  1.00 28.37  ? 164 GLN B N   1 
ATOM   3691 C CA  . GLN B 1 168 ? 25.344 -7.643  -4.752  1.00 28.04  ? 164 GLN B CA  1 
ATOM   3692 C C   . GLN B 1 168 ? 24.430 -7.155  -3.624  1.00 27.48  ? 164 GLN B C   1 
ATOM   3693 O O   . GLN B 1 168 ? 23.219 -7.300  -3.710  1.00 26.71  ? 164 GLN B O   1 
ATOM   3694 C CB  . GLN B 1 168 ? 25.832 -9.088  -4.497  1.00 28.32  ? 164 GLN B CB  1 
ATOM   3695 C CG  . GLN B 1 168 ? 26.554 -9.686  -5.759  1.00 27.72  ? 164 GLN B CG  1 
ATOM   3696 C CD  . GLN B 1 168 ? 27.151 -11.057 -5.469  1.00 31.72  ? 164 GLN B CD  1 
ATOM   3697 O OE1 . GLN B 1 168 ? 26.452 -12.080 -5.548  1.00 30.63  ? 164 GLN B OE1 1 
ATOM   3698 N NE2 . GLN B 1 168 ? 28.445 -11.083 -5.085  1.00 29.34  ? 164 GLN B NE2 1 
ATOM   3699 N N   . LEU B 1 169 ? 24.996 -6.574  -2.563  1.00 27.85  ? 165 LEU B N   1 
ATOM   3700 C CA  . LEU B 1 169 ? 24.148 -6.048  -1.489  1.00 27.69  ? 165 LEU B CA  1 
ATOM   3701 C C   . LEU B 1 169 ? 23.273 -4.887  -2.076  1.00 29.26  ? 165 LEU B C   1 
ATOM   3702 O O   . LEU B 1 169 ? 22.063 -4.812  -1.832  1.00 29.50  ? 165 LEU B O   1 
ATOM   3703 C CB  . LEU B 1 169 ? 25.009 -5.512  -0.340  1.00 27.19  ? 165 LEU B CB  1 
ATOM   3704 C CG  . LEU B 1 169 ? 24.315 -4.633  0.735   1.00 29.87  ? 165 LEU B CG  1 
ATOM   3705 C CD1 . LEU B 1 169 ? 23.128 -5.417  1.306   1.00 28.00  ? 165 LEU B CD1 1 
ATOM   3706 C CD2 . LEU B 1 169 ? 25.304 -4.235  1.891   1.00 26.41  ? 165 LEU B CD2 1 
ATOM   3707 N N   . PHE B 1 170 ? 23.888 -4.004  -2.855  1.00 28.53  ? 166 PHE B N   1 
ATOM   3708 C CA  . PHE B 1 170 ? 23.141 -2.899  -3.428  1.00 31.88  ? 166 PHE B CA  1 
ATOM   3709 C C   . PHE B 1 170 ? 22.051 -3.376  -4.396  1.00 31.87  ? 166 PHE B C   1 
ATOM   3710 O O   . PHE B 1 170 ? 20.988 -2.757  -4.475  1.00 30.32  ? 166 PHE B O   1 
ATOM   3711 C CB  . PHE B 1 170 ? 24.088 -1.894  -4.104  1.00 31.03  ? 166 PHE B CB  1 
ATOM   3712 C CG  . PHE B 1 170 ? 24.819 -1.008  -3.127  1.00 31.90  ? 166 PHE B CG  1 
ATOM   3713 C CD1 . PHE B 1 170 ? 24.105 -0.225  -2.214  1.00 32.23  ? 166 PHE B CD1 1 
ATOM   3714 C CD2 . PHE B 1 170 ? 26.221 -0.936  -3.131  1.00 32.75  ? 166 PHE B CD2 1 
ATOM   3715 C CE1 . PHE B 1 170 ? 24.783 0.628   -1.314  1.00 32.82  ? 166 PHE B CE1 1 
ATOM   3716 C CE2 . PHE B 1 170 ? 26.902 -0.093  -2.241  1.00 32.82  ? 166 PHE B CE2 1 
ATOM   3717 C CZ  . PHE B 1 170 ? 26.185 0.690   -1.334  1.00 31.32  ? 166 PHE B CZ  1 
ATOM   3718 N N   . ARG B 1 171 ? 22.304 -4.469  -5.117  1.00 31.12  ? 167 ARG B N   1 
ATOM   3719 C CA  . ARG B 1 171 ? 21.290 -5.001  -6.011  1.00 31.24  ? 167 ARG B CA  1 
ATOM   3720 C C   . ARG B 1 171 ? 20.126 -5.482  -5.149  1.00 30.95  ? 167 ARG B C   1 
ATOM   3721 O O   . ARG B 1 171 ? 18.973 -5.188  -5.470  1.00 30.74  ? 167 ARG B O   1 
ATOM   3722 C CB  . ARG B 1 171 ? 21.801 -6.191  -6.852  1.00 30.93  ? 167 ARG B CB  1 
ATOM   3723 C CG  . ARG B 1 171 ? 22.461 -5.780  -8.189  1.00 33.45  ? 167 ARG B CG  1 
ATOM   3724 C CD  . ARG B 1 171 ? 22.584 -6.991  -9.146  1.00 34.15  ? 167 ARG B CD  1 
ATOM   3725 N NE  . ARG B 1 171 ? 21.304 -7.420  -9.691  1.00 32.46  ? 167 ARG B NE  1 
ATOM   3726 C CZ  . ARG B 1 171 ? 21.109 -8.536  -10.397 1.00 36.54  ? 167 ARG B CZ  1 
ATOM   3727 N NH1 . ARG B 1 171 ? 22.114 -9.384  -10.636 1.00 33.35  ? 167 ARG B NH1 1 
ATOM   3728 N NH2 . ARG B 1 171 ? 19.924 -8.758  -10.960 1.00 33.29  ? 167 ARG B NH2 1 
ATOM   3729 N N   . SER B 1 172 ? 20.409 -6.208  -4.060  1.00 28.81  ? 168 SER B N   1 
ATOM   3730 C CA  . SER B 1 172 ? 19.312 -6.688  -3.219  1.00 28.84  ? 168 SER B CA  1 
ATOM   3731 C C   . SER B 1 172 ? 18.471 -5.509  -2.629  1.00 30.74  ? 168 SER B C   1 
ATOM   3732 O O   . SER B 1 172 ? 17.243 -5.619  -2.497  1.00 28.28  ? 168 SER B O   1 
ATOM   3733 C CB  . SER B 1 172 ? 19.818 -7.600  -2.082  1.00 28.90  ? 168 SER B CB  1 
ATOM   3734 O OG  . SER B 1 172 ? 20.450 -6.887  -1.016  1.00 29.51  ? 168 SER B OG  1 
ATOM   3735 N N   . LEU B 1 173 ? 19.138 -4.402  -2.286  1.00 28.24  ? 169 LEU B N   1 
ATOM   3736 C CA  . LEU B 1 173 ? 18.464 -3.230  -1.741  1.00 29.57  ? 169 LEU B CA  1 
ATOM   3737 C C   . LEU B 1 173 ? 17.632 -2.501  -2.822  1.00 29.46  ? 169 LEU B C   1 
ATOM   3738 O O   . LEU B 1 173 ? 16.538 -2.024  -2.528  1.00 31.86  ? 169 LEU B O   1 
ATOM   3739 C CB  . LEU B 1 173 ? 19.475 -2.249  -1.106  1.00 26.25  ? 169 LEU B CB  1 
ATOM   3740 C CG  . LEU B 1 173 ? 20.195 -2.748  0.150   1.00 28.20  ? 169 LEU B CG  1 
ATOM   3741 C CD1 . LEU B 1 173 ? 21.100 -1.665  0.679   1.00 27.93  ? 169 LEU B CD1 1 
ATOM   3742 C CD2 . LEU B 1 173 ? 19.178 -3.204  1.212   1.00 27.48  ? 169 LEU B CD2 1 
ATOM   3743 N N   . ALA B 1 174 ? 18.152 -2.406  -4.053  1.00 29.69  ? 170 ALA B N   1 
ATOM   3744 C CA  . ALA B 1 174 ? 17.389 -1.778  -5.146  1.00 31.44  ? 170 ALA B CA  1 
ATOM   3745 C C   . ALA B 1 174 ? 16.093 -2.579  -5.335  1.00 31.85  ? 170 ALA B C   1 
ATOM   3746 O O   . ALA B 1 174 ? 15.013 -2.007  -5.542  1.00 29.31  ? 170 ALA B O   1 
ATOM   3747 C CB  . ALA B 1 174 ? 18.191 -1.779  -6.456  1.00 29.78  ? 170 ALA B CB  1 
ATOM   3748 N N   . TYR B 1 175 ? 16.206 -3.903  -5.239  1.00 30.08  ? 171 TYR B N   1 
ATOM   3749 C CA  . TYR B 1 175 ? 15.038 -4.755  -5.392  1.00 31.12  ? 171 TYR B CA  1 
ATOM   3750 C C   . TYR B 1 175 ? 13.994 -4.582  -4.256  1.00 32.34  ? 171 TYR B C   1 
ATOM   3751 O O   . TYR B 1 175 ? 12.825 -4.309  -4.537  1.00 31.13  ? 171 TYR B O   1 
ATOM   3752 C CB  . TYR B 1 175 ? 15.461 -6.241  -5.515  1.00 29.73  ? 171 TYR B CB  1 
ATOM   3753 C CG  . TYR B 1 175 ? 14.302 -7.220  -5.624  1.00 32.85  ? 171 TYR B CG  1 
ATOM   3754 C CD1 . TYR B 1 175 ? 13.883 -7.946  -4.515  1.00 33.26  ? 171 TYR B CD1 1 
ATOM   3755 C CD2 . TYR B 1 175 ? 13.609 -7.407  -6.842  1.00 33.31  ? 171 TYR B CD2 1 
ATOM   3756 C CE1 . TYR B 1 175 ? 12.802 -8.848  -4.583  1.00 33.70  ? 171 TYR B CE1 1 
ATOM   3757 C CE2 . TYR B 1 175 ? 12.506 -8.318  -6.925  1.00 35.43  ? 171 TYR B CE2 1 
ATOM   3758 C CZ  . TYR B 1 175 ? 12.119 -9.029  -5.788  1.00 35.81  ? 171 TYR B CZ  1 
ATOM   3759 O OH  . TYR B 1 175 ? 11.070 -9.925  -5.838  1.00 36.19  ? 171 TYR B OH  1 
ATOM   3760 N N   . ILE B 1 176 ? 14.384 -4.728  -2.986  1.00 30.17  ? 172 ILE B N   1 
ATOM   3761 C CA  . ILE B 1 176 ? 13.372 -4.595  -1.951  1.00 30.90  ? 172 ILE B CA  1 
ATOM   3762 C C   . ILE B 1 176 ? 12.810 -3.168  -1.886  1.00 32.36  ? 172 ILE B C   1 
ATOM   3763 O O   . ILE B 1 176 ? 11.612 -2.998  -1.693  1.00 32.41  ? 172 ILE B O   1 
ATOM   3764 C CB  . ILE B 1 176 ? 13.851 -5.065  -0.542  1.00 30.20  ? 172 ILE B CB  1 
ATOM   3765 C CG1 . ILE B 1 176 ? 15.103 -4.296  -0.079  1.00 29.53  ? 172 ILE B CG1 1 
ATOM   3766 C CG2 . ILE B 1 176 ? 14.069 -6.600  -0.564  1.00 30.94  ? 172 ILE B CG2 1 
ATOM   3767 C CD1 . ILE B 1 176 ? 15.432 -4.543  1.447   1.00 28.76  ? 172 ILE B CD1 1 
ATOM   3768 N N   . HIS B 1 177 ? 13.661 -2.168  -2.102  1.00 30.90  ? 173 HIS B N   1 
ATOM   3769 C CA  . HIS B 1 177 ? 13.223 -0.782  -2.079  1.00 32.46  ? 173 HIS B CA  1 
ATOM   3770 C C   . HIS B 1 177 ? 12.237 -0.446  -3.219  1.00 34.76  ? 173 HIS B C   1 
ATOM   3771 O O   . HIS B 1 177 ? 11.412 0.456   -3.072  1.00 32.85  ? 173 HIS B O   1 
ATOM   3772 C CB  . HIS B 1 177 ? 14.426 0.170   -2.159  1.00 29.71  ? 173 HIS B CB  1 
ATOM   3773 C CG  . HIS B 1 177 ? 15.255 0.205   -0.906  1.00 31.92  ? 173 HIS B CG  1 
ATOM   3774 N ND1 . HIS B 1 177 ? 16.307 1.076   -0.737  1.00 29.28  ? 173 HIS B ND1 1 
ATOM   3775 C CD2 . HIS B 1 177 ? 15.201 -0.542  0.225   1.00 30.58  ? 173 HIS B CD2 1 
ATOM   3776 C CE1 . HIS B 1 177 ? 16.871 0.863   0.437   1.00 31.23  ? 173 HIS B CE1 1 
ATOM   3777 N NE2 . HIS B 1 177 ? 16.217 -0.117  1.041   1.00 33.27  ? 173 HIS B NE2 1 
ATOM   3778 N N   . SER B 1 178 ? 12.323 -1.150  -4.350  1.00 33.85  ? 174 SER B N   1 
ATOM   3779 C CA  . SER B 1 178 ? 11.408 -0.867  -5.438  1.00 34.95  ? 174 SER B CA  1 
ATOM   3780 C C   . SER B 1 178 ? 9.994  -1.256  -5.022  1.00 37.65  ? 174 SER B C   1 
ATOM   3781 O O   . SER B 1 178 ? 9.033  -0.852  -5.662  1.00 39.77  ? 174 SER B O   1 
ATOM   3782 C CB  . SER B 1 178 ? 11.821 -1.612  -6.716  1.00 33.33  ? 174 SER B CB  1 
ATOM   3783 O OG  . SER B 1 178 ? 11.477 -2.979  -6.622  1.00 31.32  ? 174 SER B OG  1 
ATOM   3784 N N   . PHE B 1 179 ? 9.859  -2.045  -3.958  1.00 37.44  ? 175 PHE B N   1 
ATOM   3785 C CA  . PHE B 1 179 ? 8.542  -2.419  -3.450  1.00 37.29  ? 175 PHE B CA  1 
ATOM   3786 C C   . PHE B 1 179 ? 8.233  -1.578  -2.199  1.00 38.21  ? 175 PHE B C   1 
ATOM   3787 O O   . PHE B 1 179 ? 7.269  -1.864  -1.490  1.00 38.98  ? 175 PHE B O   1 
ATOM   3788 C CB  . PHE B 1 179 ? 8.487  -3.895  -3.012  1.00 37.92  ? 175 PHE B CB  1 
ATOM   3789 C CG  . PHE B 1 179 ? 8.556  -4.872  -4.140  1.00 42.09  ? 175 PHE B CG  1 
ATOM   3790 C CD1 . PHE B 1 179 ? 9.733  -5.590  -4.388  1.00 42.80  ? 175 PHE B CD1 1 
ATOM   3791 C CD2 . PHE B 1 179 ? 7.452  -5.070  -4.970  1.00 42.33  ? 175 PHE B CD2 1 
ATOM   3792 C CE1 . PHE B 1 179 ? 9.816  -6.490  -5.445  1.00 44.32  ? 175 PHE B CE1 1 
ATOM   3793 C CE2 . PHE B 1 179 ? 7.519  -5.976  -6.044  1.00 45.71  ? 175 PHE B CE2 1 
ATOM   3794 C CZ  . PHE B 1 179 ? 8.714  -6.689  -6.281  1.00 45.95  ? 175 PHE B CZ  1 
ATOM   3795 N N   . GLY B 1 180 ? 9.065  -0.578  -1.909  1.00 37.05  ? 176 GLY B N   1 
ATOM   3796 C CA  . GLY B 1 180 ? 8.851  0.239   -0.720  1.00 36.85  ? 176 GLY B CA  1 
ATOM   3797 C C   . GLY B 1 180 ? 9.250  -0.444  0.591   1.00 37.40  ? 176 GLY B C   1 
ATOM   3798 O O   . GLY B 1 180 ? 8.973  0.064   1.679   1.00 37.42  ? 176 GLY B O   1 
ATOM   3799 N N   . ILE B 1 181 ? 9.902  -1.598  0.494   1.00 36.08  ? 177 ILE B N   1 
ATOM   3800 C CA  . ILE B 1 181 ? 10.310 -2.361  1.668   1.00 35.47  ? 177 ILE B CA  1 
ATOM   3801 C C   . ILE B 1 181 ? 11.742 -1.965  2.096   1.00 35.93  ? 177 ILE B C   1 
ATOM   3802 O O   . ILE B 1 181 ? 12.673 -1.955  1.282   1.00 32.98  ? 177 ILE B O   1 
ATOM   3803 C CB  . ILE B 1 181 ? 10.262 -3.892  1.367   1.00 36.15  ? 177 ILE B CB  1 
ATOM   3804 C CG1 . ILE B 1 181 ? 8.809  -4.325  1.100   1.00 38.44  ? 177 ILE B CG1 1 
ATOM   3805 C CG2 . ILE B 1 181 ? 10.879 -4.693  2.529   1.00 34.97  ? 177 ILE B CG2 1 
ATOM   3806 C CD1 . ILE B 1 181 ? 8.674  -5.774  0.671   1.00 41.58  ? 177 ILE B CD1 1 
ATOM   3807 N N   . CYS B 1 182 ? 11.883 -1.644  3.385   1.00 35.39  ? 178 CYS B N   1 
ATOM   3808 C CA  . CYS B 1 182 ? 13.165 -1.261  3.984   1.00 34.60  ? 178 CYS B CA  1 
ATOM   3809 C C   . CYS B 1 182 ? 13.555 -2.419  4.900   1.00 31.44  ? 178 CYS B C   1 
ATOM   3810 O O   . CYS B 1 182 ? 12.737 -2.897  5.700   1.00 30.15  ? 178 CYS B O   1 
ATOM   3811 C CB  . CYS B 1 182 ? 13.011 0.031   4.813   1.00 35.90  ? 178 CYS B CB  1 
ATOM   3812 S SG  . CYS B 1 182 ? 14.572 0.708   5.490   1.00 38.73  ? 178 CYS B SG  1 
ATOM   3813 N N   . HIS B 1 183 ? 14.812 -2.855  4.807   1.00 30.89  ? 179 HIS B N   1 
ATOM   3814 C CA  . HIS B 1 183 ? 15.277 -3.996  5.616   1.00 27.24  ? 179 HIS B CA  1 
ATOM   3815 C C   . HIS B 1 183 ? 15.391 -3.614  7.094   1.00 29.34  ? 179 HIS B C   1 
ATOM   3816 O O   . HIS B 1 183 ? 14.941 -4.370  7.985   1.00 27.00  ? 179 HIS B O   1 
ATOM   3817 C CB  . HIS B 1 183 ? 16.634 -4.485  5.080   1.00 28.40  ? 179 HIS B CB  1 
ATOM   3818 C CG  . HIS B 1 183 ? 17.162 -5.698  5.779   1.00 27.24  ? 179 HIS B CG  1 
ATOM   3819 N ND1 . HIS B 1 183 ? 17.778 -5.634  7.008   1.00 27.92  ? 179 HIS B ND1 1 
ATOM   3820 C CD2 . HIS B 1 183 ? 17.165 -7.009  5.419   1.00 27.14  ? 179 HIS B CD2 1 
ATOM   3821 C CE1 . HIS B 1 183 ? 18.144 -6.853  7.378   1.00 29.20  ? 179 HIS B CE1 1 
ATOM   3822 N NE2 . HIS B 1 183 ? 17.782 -7.705  6.433   1.00 27.20  ? 179 HIS B NE2 1 
ATOM   3823 N N   . ARG B 1 184 ? 16.008 -2.446  7.339   1.00 28.20  ? 180 ARG B N   1 
ATOM   3824 C CA  . ARG B 1 184 ? 16.177 -1.886  8.674   1.00 31.10  ? 180 ARG B CA  1 
ATOM   3825 C C   . ARG B 1 184 ? 17.182 -2.581  9.616   1.00 32.45  ? 180 ARG B C   1 
ATOM   3826 O O   . ARG B 1 184 ? 17.266 -2.238  10.795  1.00 34.01  ? 180 ARG B O   1 
ATOM   3827 C CB  . ARG B 1 184 ? 14.811 -1.753  9.383   1.00 30.11  ? 180 ARG B CB  1 
ATOM   3828 C CG  . ARG B 1 184 ? 13.777 -0.897  8.598   1.00 29.55  ? 180 ARG B CG  1 
ATOM   3829 C CD  . ARG B 1 184 ? 12.707 -0.292  9.527   1.00 29.48  ? 180 ARG B CD  1 
ATOM   3830 N NE  . ARG B 1 184 ? 11.900 -1.322  10.174  1.00 29.91  ? 180 ARG B NE  1 
ATOM   3831 C CZ  . ARG B 1 184 ? 10.864 -1.074  10.973  1.00 32.66  ? 180 ARG B CZ  1 
ATOM   3832 N NH1 . ARG B 1 184 ? 10.504 0.185   11.236  1.00 30.95  ? 180 ARG B NH1 1 
ATOM   3833 N NH2 . ARG B 1 184 ? 10.180 -2.092  11.503  1.00 30.01  ? 180 ARG B NH2 1 
ATOM   3834 N N   . ASP B 1 185 ? 17.928 -3.564  9.129   1.00 32.41  ? 181 ASP B N   1 
ATOM   3835 C CA  . ASP B 1 185 ? 18.926 -4.205  10.003  1.00 34.39  ? 181 ASP B CA  1 
ATOM   3836 C C   . ASP B 1 185 ? 20.094 -4.714  9.150   1.00 33.36  ? 181 ASP B C   1 
ATOM   3837 O O   . ASP B 1 185 ? 20.536 -5.849  9.294   1.00 32.47  ? 181 ASP B O   1 
ATOM   3838 C CB  . ASP B 1 185 ? 18.309 -5.353  10.829  1.00 36.28  ? 181 ASP B CB  1 
ATOM   3839 C CG  . ASP B 1 185 ? 19.158 -5.739  12.058  1.00 40.38  ? 181 ASP B CG  1 
ATOM   3840 O OD1 . ASP B 1 185 ? 19.968 -4.916  12.567  1.00 42.69  ? 181 ASP B OD1 1 
ATOM   3841 O OD2 . ASP B 1 185 ? 19.001 -6.878  12.538  1.00 42.30  ? 181 ASP B OD2 1 
ATOM   3842 N N   . ILE B 1 186 ? 20.584 -3.846  8.265   1.00 30.63  ? 182 ILE B N   1 
ATOM   3843 C CA  . ILE B 1 186 ? 21.700 -4.197  7.414   1.00 31.54  ? 182 ILE B CA  1 
ATOM   3844 C C   . ILE B 1 186 ? 22.984 -4.189  8.270   1.00 32.60  ? 182 ILE B C   1 
ATOM   3845 O O   . ILE B 1 186 ? 23.360 -3.148  8.844   1.00 30.42  ? 182 ILE B O   1 
ATOM   3846 C CB  . ILE B 1 186 ? 21.847 -3.208  6.251   1.00 31.13  ? 182 ILE B CB  1 
ATOM   3847 C CG1 . ILE B 1 186 ? 20.603 -3.274  5.339   1.00 29.13  ? 182 ILE B CG1 1 
ATOM   3848 C CG2 . ILE B 1 186 ? 23.141 -3.499  5.477   1.00 30.31  ? 182 ILE B CG2 1 
ATOM   3849 C CD1 . ILE B 1 186 ? 20.376 -4.639  4.634   1.00 28.29  ? 182 ILE B CD1 1 
ATOM   3850 N N   . LYS B 1 187 ? 23.640 -5.352  8.346   1.00 30.65  ? 183 LYS B N   1 
ATOM   3851 C CA  . LYS B 1 187 ? 24.871 -5.513  9.123   1.00 31.03  ? 183 LYS B CA  1 
ATOM   3852 C C   . LYS B 1 187 ? 25.607 -6.768  8.601   1.00 31.37  ? 183 LYS B C   1 
ATOM   3853 O O   . LYS B 1 187 ? 24.996 -7.637  7.963   1.00 30.34  ? 183 LYS B O   1 
ATOM   3854 C CB  . LYS B 1 187 ? 24.518 -5.625  10.618  1.00 28.71  ? 183 LYS B CB  1 
ATOM   3855 C CG  . LYS B 1 187 ? 23.683 -6.844  10.982  1.00 31.87  ? 183 LYS B CG  1 
ATOM   3856 C CD  . LYS B 1 187 ? 23.306 -6.796  12.442  1.00 33.43  ? 183 LYS B CD  1 
ATOM   3857 C CE  . LYS B 1 187 ? 22.463 -7.992  12.851  1.00 39.69  ? 183 LYS B CE  1 
ATOM   3858 N NZ  . LYS B 1 187 ? 22.279 -7.891  14.327  1.00 42.24  ? 183 LYS B NZ  1 
ATOM   3859 N N   . PRO B 1 188 ? 26.925 -6.877  8.859   1.00 31.68  ? 184 PRO B N   1 
ATOM   3860 C CA  . PRO B 1 188 ? 27.685 -8.049  8.363   1.00 30.96  ? 184 PRO B CA  1 
ATOM   3861 C C   . PRO B 1 188 ? 27.107 -9.416  8.636   1.00 29.54  ? 184 PRO B C   1 
ATOM   3862 O O   . PRO B 1 188 ? 27.193 -10.291 7.787   1.00 28.08  ? 184 PRO B O   1 
ATOM   3863 C CB  . PRO B 1 188 ? 29.078 -7.881  8.995   1.00 29.74  ? 184 PRO B CB  1 
ATOM   3864 C CG  . PRO B 1 188 ? 29.216 -6.335  9.089   1.00 29.94  ? 184 PRO B CG  1 
ATOM   3865 C CD  . PRO B 1 188 ? 27.804 -5.921  9.576   1.00 29.53  ? 184 PRO B CD  1 
ATOM   3866 N N   . GLN B 1 189 ? 26.543 -9.608  9.818   1.00 31.41  ? 185 GLN B N   1 
ATOM   3867 C CA  . GLN B 1 189 ? 25.957 -10.897 10.173  1.00 34.14  ? 185 GLN B CA  1 
ATOM   3868 C C   . GLN B 1 189 ? 24.750 -11.280 9.321   1.00 33.58  ? 185 GLN B C   1 
ATOM   3869 O O   . GLN B 1 189 ? 24.380 -12.436 9.296   1.00 33.35  ? 185 GLN B O   1 
ATOM   3870 C CB  . GLN B 1 189 ? 25.550 -10.888 11.654  1.00 37.44  ? 185 GLN B CB  1 
ATOM   3871 C CG  . GLN B 1 189 ? 26.717 -10.725 12.578  1.00 46.97  ? 185 GLN B CG  1 
ATOM   3872 C CD  . GLN B 1 189 ? 26.295 -10.476 14.017  1.00 54.89  ? 185 GLN B CD  1 
ATOM   3873 O OE1 . GLN B 1 189 ? 25.791 -11.385 14.706  1.00 58.55  ? 185 GLN B OE1 1 
ATOM   3874 N NE2 . GLN B 1 189 ? 26.486 -9.236  14.481  1.00 55.17  ? 185 GLN B NE2 1 
ATOM   3875 N N   . ASN B 1 190 ? 24.145 -10.318 8.622   1.00 32.65  ? 186 ASN B N   1 
ATOM   3876 C CA  . ASN B 1 190 ? 22.967 -10.592 7.797   1.00 33.53  ? 186 ASN B CA  1 
ATOM   3877 C C   . ASN B 1 190 ? 23.271 -10.680 6.318   1.00 31.71  ? 186 ASN B C   1 
ATOM   3878 O O   . ASN B 1 190 ? 22.359 -10.691 5.477   1.00 31.54  ? 186 ASN B O   1 
ATOM   3879 C CB  . ASN B 1 190 ? 21.876 -9.528  8.038   1.00 34.85  ? 186 ASN B CB  1 
ATOM   3880 C CG  . ASN B 1 190 ? 21.216 -9.705  9.381   1.00 38.04  ? 186 ASN B CG  1 
ATOM   3881 O OD1 . ASN B 1 190 ? 21.267 -10.812 9.947   1.00 34.56  ? 186 ASN B OD1 1 
ATOM   3882 N ND2 . ASN B 1 190 ? 20.585 -8.642  9.904   1.00 33.34  ? 186 ASN B ND2 1 
ATOM   3883 N N   . LEU B 1 191 ? 24.554 -10.733 5.999   1.00 30.43  ? 187 LEU B N   1 
ATOM   3884 C CA  . LEU B 1 191 ? 25.011 -10.830 4.620   1.00 30.09  ? 187 LEU B CA  1 
ATOM   3885 C C   . LEU B 1 191 ? 25.683 -12.194 4.458   1.00 31.61  ? 187 LEU B C   1 
ATOM   3886 O O   . LEU B 1 191 ? 26.830 -12.376 4.906   1.00 30.24  ? 187 LEU B O   1 
ATOM   3887 C CB  . LEU B 1 191 ? 26.005 -9.710  4.323   1.00 27.42  ? 187 LEU B CB  1 
ATOM   3888 C CG  . LEU B 1 191 ? 25.463 -8.319  4.692   1.00 32.64  ? 187 LEU B CG  1 
ATOM   3889 C CD1 . LEU B 1 191 ? 26.535 -7.252  4.394   1.00 29.35  ? 187 LEU B CD1 1 
ATOM   3890 C CD2 . LEU B 1 191 ? 24.159 -8.045  3.890   1.00 30.16  ? 187 LEU B CD2 1 
ATOM   3891 N N   . LEU B 1 192 ? 24.964 -13.139 3.833   1.00 32.12  ? 188 LEU B N   1 
ATOM   3892 C CA  . LEU B 1 192 ? 25.458 -14.512 3.625   1.00 32.05  ? 188 LEU B CA  1 
ATOM   3893 C C   . LEU B 1 192 ? 26.341 -14.585 2.394   1.00 31.84  ? 188 LEU B C   1 
ATOM   3894 O O   . LEU B 1 192 ? 26.104 -13.906 1.393   1.00 29.75  ? 188 LEU B O   1 
ATOM   3895 C CB  . LEU B 1 192 ? 24.280 -15.496 3.498   1.00 31.94  ? 188 LEU B CB  1 
ATOM   3896 C CG  . LEU B 1 192 ? 23.228 -15.394 4.624   1.00 33.53  ? 188 LEU B CG  1 
ATOM   3897 C CD1 . LEU B 1 192 ? 22.114 -16.451 4.409   1.00 31.86  ? 188 LEU B CD1 1 
ATOM   3898 C CD2 . LEU B 1 192 ? 23.869 -15.571 5.982   1.00 34.42  ? 188 LEU B CD2 1 
ATOM   3899 N N   . LEU B 1 193 ? 27.371 -15.418 2.475   1.00 32.34  ? 189 LEU B N   1 
ATOM   3900 C CA  . LEU B 1 193 ? 28.341 -15.557 1.389   1.00 34.82  ? 189 LEU B CA  1 
ATOM   3901 C C   . LEU B 1 193 ? 28.665 -16.982 1.030   1.00 33.01  ? 189 LEU B C   1 
ATOM   3902 O O   . LEU B 1 193 ? 28.820 -17.799 1.895   1.00 31.96  ? 189 LEU B O   1 
ATOM   3903 C CB  . LEU B 1 193 ? 29.693 -14.960 1.796   1.00 38.43  ? 189 LEU B CB  1 
ATOM   3904 C CG  . LEU B 1 193 ? 29.864 -13.498 2.134   1.00 42.80  ? 189 LEU B CG  1 
ATOM   3905 C CD1 . LEU B 1 193 ? 31.267 -13.267 2.727   1.00 43.21  ? 189 LEU B CD1 1 
ATOM   3906 C CD2 . LEU B 1 193 ? 29.667 -12.687 0.852   1.00 45.00  ? 189 LEU B CD2 1 
ATOM   3907 N N   . ASP B 1 194 ? 28.784 -17.269 -0.251  1.00 35.21  ? 190 ASP B N   1 
ATOM   3908 C CA  . ASP B 1 194 ? 29.232 -18.590 -0.621  1.00 39.37  ? 190 ASP B CA  1 
ATOM   3909 C C   . ASP B 1 194 ? 30.697 -18.367 -1.045  1.00 40.96  ? 190 ASP B C   1 
ATOM   3910 O O   . ASP B 1 194 ? 30.971 -17.723 -2.060  1.00 39.80  ? 190 ASP B O   1 
ATOM   3911 C CB  . ASP B 1 194 ? 28.468 -19.171 -1.794  1.00 41.94  ? 190 ASP B CB  1 
ATOM   3912 C CG  . ASP B 1 194 ? 29.004 -20.549 -2.191  1.00 45.87  ? 190 ASP B CG  1 
ATOM   3913 O OD1 . ASP B 1 194 ? 30.147 -20.647 -2.681  1.00 47.60  ? 190 ASP B OD1 1 
ATOM   3914 O OD2 . ASP B 1 194 ? 28.295 -21.544 -2.000  1.00 48.68  ? 190 ASP B OD2 1 
ATOM   3915 N N   . PRO B 1 195 ? 31.646 -18.880 -0.247  1.00 43.24  ? 191 PRO B N   1 
ATOM   3916 C CA  . PRO B 1 195 ? 33.105 -18.807 -0.434  1.00 45.77  ? 191 PRO B CA  1 
ATOM   3917 C C   . PRO B 1 195 ? 33.567 -19.117 -1.857  1.00 45.40  ? 191 PRO B C   1 
ATOM   3918 O O   . PRO B 1 195 ? 34.383 -18.386 -2.428  1.00 48.13  ? 191 PRO B O   1 
ATOM   3919 C CB  . PRO B 1 195 ? 33.635 -19.859 0.545   1.00 45.44  ? 191 PRO B CB  1 
ATOM   3920 C CG  . PRO B 1 195 ? 32.647 -19.807 1.638   1.00 48.18  ? 191 PRO B CG  1 
ATOM   3921 C CD  . PRO B 1 195 ? 31.312 -19.710 0.921   1.00 44.05  ? 191 PRO B CD  1 
ATOM   3922 N N   . ASP B 1 196 ? 33.028 -20.178 -2.447  1.00 44.27  ? 192 ASP B N   1 
ATOM   3923 C CA  . ASP B 1 196 ? 33.463 -20.557 -3.787  1.00 43.58  ? 192 ASP B CA  1 
ATOM   3924 C C   . ASP B 1 196 ? 32.869 -19.831 -4.985  1.00 41.57  ? 192 ASP B C   1 
ATOM   3925 O O   . ASP B 1 196 ? 33.567 -19.631 -5.980  1.00 41.35  ? 192 ASP B O   1 
ATOM   3926 C CB  . ASP B 1 196 ? 33.309 -22.068 -3.967  1.00 47.34  ? 192 ASP B CB  1 
ATOM   3927 C CG  . ASP B 1 196 ? 34.003 -22.855 -2.852  1.00 51.40  ? 192 ASP B CG  1 
ATOM   3928 O OD1 . ASP B 1 196 ? 35.132 -22.473 -2.457  1.00 54.28  ? 192 ASP B OD1 1 
ATOM   3929 O OD2 . ASP B 1 196 ? 33.426 -23.848 -2.364  1.00 54.01  ? 192 ASP B OD2 1 
ATOM   3930 N N   . THR B 1 197 ? 31.603 -19.434 -4.917  1.00 37.72  ? 193 THR B N   1 
ATOM   3931 C CA  . THR B 1 197 ? 30.993 -18.736 -6.054  1.00 36.21  ? 193 THR B CA  1 
ATOM   3932 C C   . THR B 1 197 ? 30.993 -17.215 -5.912  1.00 33.83  ? 193 THR B C   1 
ATOM   3933 O O   . THR B 1 197 ? 30.718 -16.489 -6.877  1.00 33.71  ? 193 THR B O   1 
ATOM   3934 C CB  . THR B 1 197 ? 29.554 -19.186 -6.244  1.00 37.34  ? 193 THR B CB  1 
ATOM   3935 O OG1 . THR B 1 197 ? 28.843 -18.906 -5.042  1.00 35.95  ? 193 THR B OG1 1 
ATOM   3936 C CG2 . THR B 1 197 ? 29.487 -20.692 -6.530  1.00 35.89  ? 193 THR B CG2 1 
ATOM   3937 N N   . ALA B 1 198 ? 31.308 -16.750 -4.709  1.00 33.43  ? 194 ALA B N   1 
ATOM   3938 C CA  . ALA B 1 198 ? 31.334 -15.326 -4.384  1.00 35.02  ? 194 ALA B CA  1 
ATOM   3939 C C   . ALA B 1 198 ? 29.912 -14.683 -4.444  1.00 36.01  ? 194 ALA B C   1 
ATOM   3940 O O   . ALA B 1 198 ? 29.761 -13.464 -4.594  1.00 34.74  ? 194 ALA B O   1 
ATOM   3941 C CB  . ALA B 1 198 ? 32.315 -14.589 -5.302  1.00 33.88  ? 194 ALA B CB  1 
ATOM   3942 N N   . VAL B 1 199 ? 28.885 -15.525 -4.311  1.00 34.60  ? 195 VAL B N   1 
ATOM   3943 C CA  . VAL B 1 199 ? 27.504 -15.077 -4.299  1.00 35.02  ? 195 VAL B CA  1 
ATOM   3944 C C   . VAL B 1 199 ? 27.172 -14.577 -2.899  1.00 34.41  ? 195 VAL B C   1 
ATOM   3945 O O   . VAL B 1 199 ? 27.552 -15.206 -1.910  1.00 35.02  ? 195 VAL B O   1 
ATOM   3946 C CB  . VAL B 1 199 ? 26.527 -16.231 -4.643  1.00 35.65  ? 195 VAL B CB  1 
ATOM   3947 C CG1 . VAL B 1 199 ? 25.074 -15.810 -4.304  1.00 35.62  ? 195 VAL B CG1 1 
ATOM   3948 C CG2 . VAL B 1 199 ? 26.641 -16.587 -6.150  1.00 33.36  ? 195 VAL B CG2 1 
ATOM   3949 N N   . LEU B 1 200 ? 26.504 -13.427 -2.819  1.00 32.65  ? 196 LEU B N   1 
ATOM   3950 C CA  . LEU B 1 200 ? 26.092 -12.878 -1.535  1.00 30.51  ? 196 LEU B CA  1 
ATOM   3951 C C   . LEU B 1 200 ? 24.552 -12.865 -1.485  1.00 29.20  ? 196 LEU B C   1 
ATOM   3952 O O   . LEU B 1 200 ? 23.899 -12.539 -2.475  1.00 30.80  ? 196 LEU B O   1 
ATOM   3953 C CB  . LEU B 1 200 ? 26.635 -11.441 -1.348  1.00 29.52  ? 196 LEU B CB  1 
ATOM   3954 C CG  . LEU B 1 200 ? 26.099 -10.704 -0.094  1.00 31.60  ? 196 LEU B CG  1 
ATOM   3955 C CD1 . LEU B 1 200 ? 27.168 -9.726  0.455   1.00 29.19  ? 196 LEU B CD1 1 
ATOM   3956 C CD2 . LEU B 1 200 ? 24.793 -9.956  -0.438  1.00 29.13  ? 196 LEU B CD2 1 
ATOM   3957 N N   . LYS B 1 201 ? 23.982 -13.223 -0.342  1.00 29.54  ? 197 LYS B N   1 
ATOM   3958 C CA  . LYS B 1 201 ? 22.535 -13.188 -0.167  1.00 29.61  ? 197 LYS B CA  1 
ATOM   3959 C C   . LYS B 1 201 ? 22.161 -12.476 1.126   1.00 30.24  ? 197 LYS B C   1 
ATOM   3960 O O   . LYS B 1 201 ? 22.663 -12.805 2.216   1.00 27.78  ? 197 LYS B O   1 
ATOM   3961 C CB  . LYS B 1 201 ? 21.935 -14.596 -0.129  1.00 32.06  ? 197 LYS B CB  1 
ATOM   3962 C CG  . LYS B 1 201 ? 21.978 -15.364 -1.479  1.00 36.37  ? 197 LYS B CG  1 
ATOM   3963 C CD  . LYS B 1 201 ? 21.321 -16.750 -1.307  1.00 38.16  ? 197 LYS B CD  1 
ATOM   3964 C CE  . LYS B 1 201 ? 21.522 -17.646 -2.530  1.00 38.61  ? 197 LYS B CE  1 
ATOM   3965 N NZ  . LYS B 1 201 ? 21.167 -16.945 -3.788  1.00 44.36  ? 197 LYS B NZ  1 
ATOM   3966 N N   . LEU B 1 202 ? 21.260 -11.501 0.995   1.00 29.35  ? 198 LEU B N   1 
ATOM   3967 C CA  . LEU B 1 202 ? 20.748 -10.752 2.123   1.00 28.81  ? 198 LEU B CA  1 
ATOM   3968 C C   . LEU B 1 202 ? 19.778 -11.674 2.851   1.00 29.61  ? 198 LEU B C   1 
ATOM   3969 O O   . LEU B 1 202 ? 19.025 -12.394 2.197   1.00 29.33  ? 198 LEU B O   1 
ATOM   3970 C CB  . LEU B 1 202 ? 19.981 -9.517  1.609   1.00 28.83  ? 198 LEU B CB  1 
ATOM   3971 C CG  . LEU B 1 202 ? 19.307 -8.622  2.653   1.00 29.30  ? 198 LEU B CG  1 
ATOM   3972 C CD1 . LEU B 1 202 ? 20.347 -8.122  3.664   1.00 27.45  ? 198 LEU B CD1 1 
ATOM   3973 C CD2 . LEU B 1 202 ? 18.643 -7.409  1.926   1.00 30.76  ? 198 LEU B CD2 1 
ATOM   3974 N N   . CYS B 1 203 ? 19.804 -11.666 4.186   1.00 29.60  ? 199 CYS B N   1 
ATOM   3975 C CA  . CYS B 1 203 ? 18.899 -12.492 4.977   1.00 33.36  ? 199 CYS B CA  1 
ATOM   3976 C C   . CYS B 1 203 ? 18.374 -11.744 6.203   1.00 33.45  ? 199 CYS B C   1 
ATOM   3977 O O   . CYS B 1 203 ? 18.763 -10.592 6.467   1.00 31.96  ? 199 CYS B O   1 
ATOM   3978 C CB  . CYS B 1 203 ? 19.583 -13.795 5.447   1.00 33.73  ? 199 CYS B CB  1 
ATOM   3979 S SG  . CYS B 1 203 ? 20.746 -13.540 6.779   1.00 37.70  ? 199 CYS B SG  1 
ATOM   3980 N N   . ASP B 1 204 ? 17.502 -12.430 6.943   1.00 34.57  ? 200 ASP B N   1 
ATOM   3981 C CA  . ASP B 1 204 ? 16.842 -11.931 8.156   1.00 37.10  ? 200 ASP B CA  1 
ATOM   3982 C C   . ASP B 1 204 ? 15.941 -10.720 7.926   1.00 37.74  ? 200 ASP B C   1 
ATOM   3983 O O   . ASP B 1 204 ? 16.358 -9.570  8.088   1.00 38.82  ? 200 ASP B O   1 
ATOM   3984 C CB  . ASP B 1 204 ? 17.855 -11.593 9.256   1.00 41.33  ? 200 ASP B CB  1 
ATOM   3985 C CG  . ASP B 1 204 ? 17.178 -11.321 10.612  1.00 45.79  ? 200 ASP B CG  1 
ATOM   3986 O OD1 . ASP B 1 204 ? 15.917 -11.364 10.708  1.00 46.54  ? 200 ASP B OD1 1 
ATOM   3987 O OD2 . ASP B 1 204 ? 17.909 -11.057 11.589  1.00 48.58  ? 200 ASP B OD2 1 
ATOM   3988 N N   . PHE B 1 205 ? 14.694 -10.980 7.551   1.00 36.73  ? 201 PHE B N   1 
ATOM   3989 C CA  . PHE B 1 205 ? 13.754 -9.894  7.333   1.00 36.35  ? 201 PHE B CA  1 
ATOM   3990 C C   . PHE B 1 205 ? 12.850 -9.657  8.543   1.00 35.15  ? 201 PHE B C   1 
ATOM   3991 O O   . PHE B 1 205 ? 11.747 -9.132  8.415   1.00 35.99  ? 201 PHE B O   1 
ATOM   3992 C CB  . PHE B 1 205 ? 12.944 -10.163 6.062   1.00 34.96  ? 201 PHE B CB  1 
ATOM   3993 C CG  . PHE B 1 205 ? 13.732 -9.930  4.808   1.00 34.64  ? 201 PHE B CG  1 
ATOM   3994 C CD1 . PHE B 1 205 ? 14.768 -10.798 4.451   1.00 35.24  ? 201 PHE B CD1 1 
ATOM   3995 C CD2 . PHE B 1 205 ? 13.515 -8.804  4.045   1.00 33.78  ? 201 PHE B CD2 1 
ATOM   3996 C CE1 . PHE B 1 205 ? 15.568 -10.530 3.364   1.00 33.56  ? 201 PHE B CE1 1 
ATOM   3997 C CE2 . PHE B 1 205 ? 14.316 -8.517  2.936   1.00 35.05  ? 201 PHE B CE2 1 
ATOM   3998 C CZ  . PHE B 1 205 ? 15.346 -9.376  2.595   1.00 35.48  ? 201 PHE B CZ  1 
ATOM   3999 N N   . GLY B 1 206 ? 13.343 -10.051 9.713   1.00 34.68  ? 202 GLY B N   1 
ATOM   4000 C CA  . GLY B 1 206 ? 12.612 -9.868  10.955  1.00 35.16  ? 202 GLY B CA  1 
ATOM   4001 C C   . GLY B 1 206 ? 12.348 -8.420  11.373  1.00 35.58  ? 202 GLY B C   1 
ATOM   4002 O O   . GLY B 1 206 ? 11.497 -8.193  12.228  1.00 36.34  ? 202 GLY B O   1 
ATOM   4003 N N   . SER B 1 207 ? 13.069 -7.447  10.817  1.00 34.99  ? 203 SER B N   1 
ATOM   4004 C CA  . SER B 1 207 ? 12.837 -6.031  11.144  1.00 35.55  ? 203 SER B CA  1 
ATOM   4005 C C   . SER B 1 207 ? 12.288 -5.285  9.909   1.00 34.40  ? 203 SER B C   1 
ATOM   4006 O O   . SER B 1 207 ? 11.985 -4.080  9.983   1.00 35.41  ? 203 SER B O   1 
ATOM   4007 C CB  . SER B 1 207 ? 14.159 -5.328  11.535  1.00 35.26  ? 203 SER B CB  1 
ATOM   4008 O OG  . SER B 1 207 ? 14.754 -5.860  12.701  1.00 40.09  ? 203 SER B OG  1 
ATOM   4009 N N   . ALA B 1 208 ? 12.203 -5.978  8.775   1.00 32.14  ? 204 ALA B N   1 
ATOM   4010 C CA  . ALA B 1 208 ? 11.777 -5.350  7.536   1.00 33.56  ? 204 ALA B CA  1 
ATOM   4011 C C   . ALA B 1 208 ? 10.350 -4.817  7.607   1.00 34.71  ? 204 ALA B C   1 
ATOM   4012 O O   . ALA B 1 208 ? 9.503  -5.383  8.289   1.00 34.77  ? 204 ALA B O   1 
ATOM   4013 C CB  . ALA B 1 208 ? 11.913 -6.323  6.376   1.00 32.19  ? 204 ALA B CB  1 
ATOM   4014 N N   . LYS B 1 209 ? 10.096 -3.739  6.881   1.00 36.11  ? 205 LYS B N   1 
ATOM   4015 C CA  . LYS B 1 209 ? 8.760  -3.144  6.873   1.00 37.54  ? 205 LYS B CA  1 
ATOM   4016 C C   . LYS B 1 209 ? 8.551  -2.246  5.662   1.00 37.46  ? 205 LYS B C   1 
ATOM   4017 O O   . LYS B 1 209 ? 9.481  -1.581  5.193   1.00 35.73  ? 205 LYS B O   1 
ATOM   4018 C CB  . LYS B 1 209 ? 8.555  -2.318  8.146   1.00 38.09  ? 205 LYS B CB  1 
ATOM   4019 C CG  . LYS B 1 209 ? 7.111  -1.867  8.337   1.00 41.88  ? 205 LYS B CG  1 
ATOM   4020 C CD  . LYS B 1 209 ? 6.998  -0.815  9.418   1.00 44.99  ? 205 LYS B CD  1 
ATOM   4021 C CE  . LYS B 1 209 ? 5.566  -0.239  9.482   1.00 44.68  ? 205 LYS B CE  1 
ATOM   4022 N NZ  . LYS B 1 209 ? 5.640  0.990   10.293  1.00 46.99  ? 205 LYS B NZ  1 
ATOM   4023 N N   . GLN B 1 210 ? 7.334  -2.233  5.125   1.00 39.82  ? 206 GLN B N   1 
ATOM   4024 C CA  . GLN B 1 210 ? 7.068  -1.343  4.012   1.00 41.93  ? 206 GLN B CA  1 
ATOM   4025 C C   . GLN B 1 210 ? 6.920  0.048   4.599   1.00 42.07  ? 206 GLN B C   1 
ATOM   4026 O O   . GLN B 1 210 ? 6.078  0.252   5.457   1.00 42.43  ? 206 GLN B O   1 
ATOM   4027 C CB  . GLN B 1 210 ? 5.775  -1.709  3.297   1.00 46.84  ? 206 GLN B CB  1 
ATOM   4028 C CG  . GLN B 1 210 ? 5.420  -0.683  2.225   1.00 52.33  ? 206 GLN B CG  1 
ATOM   4029 C CD  . GLN B 1 210 ? 4.400  -1.186  1.237   1.00 56.07  ? 206 GLN B CD  1 
ATOM   4030 O OE1 . GLN B 1 210 ? 3.560  -2.024  1.570   1.00 60.22  ? 206 GLN B OE1 1 
ATOM   4031 N NE2 . GLN B 1 210 ? 4.454  -0.668  0.012   1.00 57.49  ? 206 GLN B NE2 1 
ATOM   4032 N N   . LEU B 1 211 ? 7.738  0.999   4.166   1.00 42.12  ? 207 LEU B N   1 
ATOM   4033 C CA  . LEU B 1 211 ? 7.625  2.346   4.699   1.00 44.75  ? 207 LEU B CA  1 
ATOM   4034 C C   . LEU B 1 211 ? 6.651  3.146   3.833   1.00 48.04  ? 207 LEU B C   1 
ATOM   4035 O O   . LEU B 1 211 ? 6.772  3.162   2.607   1.00 49.72  ? 207 LEU B O   1 
ATOM   4036 C CB  . LEU B 1 211 ? 8.993  3.039   4.742   1.00 42.26  ? 207 LEU B CB  1 
ATOM   4037 C CG  . LEU B 1 211 ? 10.092 2.288   5.527   1.00 40.61  ? 207 LEU B CG  1 
ATOM   4038 C CD1 . LEU B 1 211 ? 11.319 3.151   5.602   1.00 38.00  ? 207 LEU B CD1 1 
ATOM   4039 C CD2 . LEU B 1 211 ? 9.617  1.939   6.932   1.00 38.13  ? 207 LEU B CD2 1 
ATOM   4040 N N   . VAL B 1 212 ? 5.678  3.783   4.481   1.00 48.55  ? 208 VAL B N   1 
ATOM   4041 C CA  . VAL B 1 212 ? 4.676  4.590   3.792   1.00 50.07  ? 208 VAL B CA  1 
ATOM   4042 C C   . VAL B 1 212 ? 4.753  6.050   4.230   1.00 50.61  ? 208 VAL B C   1 
ATOM   4043 O O   . VAL B 1 212 ? 4.760  6.349   5.422   1.00 48.87  ? 208 VAL B O   1 
ATOM   4044 C CB  . VAL B 1 212 ? 3.256  4.077   4.094   1.00 51.26  ? 208 VAL B CB  1 
ATOM   4045 C CG1 . VAL B 1 212 ? 2.207  5.024   3.464   1.00 52.65  ? 208 VAL B CG1 1 
ATOM   4046 C CG2 . VAL B 1 212 ? 3.086  2.677   3.553   1.00 49.38  ? 208 VAL B CG2 1 
ATOM   4047 N N   . ARG B 1 213 ? 4.828  6.954   3.262   1.00 53.11  ? 209 ARG B N   1 
ATOM   4048 C CA  . ARG B 1 213 ? 4.871  8.394   3.544   1.00 55.82  ? 209 ARG B CA  1 
ATOM   4049 C C   . ARG B 1 213 ? 3.838  8.784   4.592   1.00 54.61  ? 209 ARG B C   1 
ATOM   4050 O O   . ARG B 1 213 ? 2.698  8.315   4.552   1.00 52.87  ? 209 ARG B O   1 
ATOM   4051 C CB  . ARG B 1 213 ? 4.542  9.175   2.293   1.00 60.21  ? 209 ARG B CB  1 
ATOM   4052 C CG  . ARG B 1 213 ? 5.652  9.295   1.331   1.00 65.88  ? 209 ARG B CG  1 
ATOM   4053 C CD  . ARG B 1 213 ? 6.537  10.412  1.780   1.00 70.97  ? 209 ARG B CD  1 
ATOM   4054 N NE  . ARG B 1 213 ? 7.229  11.007  0.643   1.00 75.92  ? 209 ARG B NE  1 
ATOM   4055 C CZ  . ARG B 1 213 ? 8.008  12.084  0.729   1.00 79.18  ? 209 ARG B CZ  1 
ATOM   4056 N NH1 . ARG B 1 213 ? 8.192  12.679  1.913   1.00 79.28  ? 209 ARG B NH1 1 
ATOM   4057 N NH2 . ARG B 1 213 ? 8.596  12.576  -0.368  1.00 81.07  ? 209 ARG B NH2 1 
ATOM   4058 N N   . GLY B 1 214 ? 4.241  9.643   5.519   1.00 54.71  ? 210 GLY B N   1 
ATOM   4059 C CA  . GLY B 1 214 ? 3.332  10.088  6.554   1.00 54.89  ? 210 GLY B CA  1 
ATOM   4060 C C   . GLY B 1 214 ? 3.057  9.120   7.687   1.00 54.83  ? 210 GLY B C   1 
ATOM   4061 O O   . GLY B 1 214 ? 2.433  9.504   8.665   1.00 56.05  ? 210 GLY B O   1 
ATOM   4062 N N   . GLU B 1 215 ? 3.480  7.867   7.575   1.00 54.62  ? 211 GLU B N   1 
ATOM   4063 C CA  . GLU B 1 215 ? 3.245  6.932   8.673   1.00 54.59  ? 211 GLU B CA  1 
ATOM   4064 C C   . GLU B 1 215 ? 4.528  6.839   9.505   1.00 53.45  ? 211 GLU B C   1 
ATOM   4065 O O   . GLU B 1 215 ? 5.627  6.681   8.960   1.00 52.41  ? 211 GLU B O   1 
ATOM   4066 C CB  . GLU B 1 215 ? 2.867  5.551   8.149   1.00 57.57  ? 211 GLU B CB  1 
ATOM   4067 C CG  . GLU B 1 215 ? 1.749  5.566   7.129   1.00 62.58  ? 211 GLU B CG  1 
ATOM   4068 C CD  . GLU B 1 215 ? 1.270  4.170   6.776   1.00 65.58  ? 211 GLU B CD  1 
ATOM   4069 O OE1 . GLU B 1 215 ? 2.085  3.219   6.884   1.00 67.46  ? 211 GLU B OE1 1 
ATOM   4070 O OE2 . GLU B 1 215 ? 0.088  4.028   6.379   1.00 67.04  ? 211 GLU B OE2 1 
ATOM   4071 N N   . PRO B 1 216 ? 4.404  6.952   10.839  1.00 51.14  ? 212 PRO B N   1 
ATOM   4072 C CA  . PRO B 1 216 ? 5.563  6.889   11.737  1.00 48.20  ? 212 PRO B CA  1 
ATOM   4073 C C   . PRO B 1 216 ? 6.138  5.483   11.895  1.00 44.98  ? 212 PRO B C   1 
ATOM   4074 O O   . PRO B 1 216 ? 5.409  4.500   11.869  1.00 41.94  ? 212 PRO B O   1 
ATOM   4075 C CB  . PRO B 1 216 ? 5.009  7.416   13.067  1.00 48.56  ? 212 PRO B CB  1 
ATOM   4076 C CG  . PRO B 1 216 ? 3.750  8.161   12.675  1.00 51.16  ? 212 PRO B CG  1 
ATOM   4077 C CD  . PRO B 1 216 ? 3.184  7.287   11.592  1.00 50.82  ? 212 PRO B CD  1 
ATOM   4078 N N   . ASN B 1 217 ? 7.452  5.403   12.068  1.00 43.06  ? 213 ASN B N   1 
ATOM   4079 C CA  . ASN B 1 217 ? 8.124  4.118   12.272  1.00 40.76  ? 213 ASN B CA  1 
ATOM   4080 C C   . ASN B 1 217 ? 9.055  4.210   13.477  1.00 39.49  ? 213 ASN B C   1 
ATOM   4081 O O   . ASN B 1 217 ? 9.617  5.277   13.741  1.00 39.39  ? 213 ASN B O   1 
ATOM   4082 C CB  . ASN B 1 217 ? 8.874  3.768   10.998  1.00 38.85  ? 213 ASN B CB  1 
ATOM   4083 C CG  . ASN B 1 217 ? 7.922  3.580   9.840   1.00 40.53  ? 213 ASN B CG  1 
ATOM   4084 O OD1 . ASN B 1 217 ? 7.105  2.652   9.839   1.00 39.59  ? 213 ASN B OD1 1 
ATOM   4085 N ND2 . ASN B 1 217 ? 8.001  4.467   8.867   1.00 38.55  ? 213 ASN B ND2 1 
ATOM   4086 N N   . VAL B 1 218 ? 9.221  3.112   14.214  1.00 38.62  ? 214 VAL B N   1 
ATOM   4087 C CA  . VAL B 1 218 ? 10.075 3.164   15.407  1.00 37.57  ? 214 VAL B CA  1 
ATOM   4088 C C   . VAL B 1 218 ? 11.522 3.480   15.071  1.00 38.12  ? 214 VAL B C   1 
ATOM   4089 O O   . VAL B 1 218 ? 12.051 3.069   14.012  1.00 37.12  ? 214 VAL B O   1 
ATOM   4090 C CB  . VAL B 1 218 ? 9.993  1.845   16.217  1.00 39.05  ? 214 VAL B CB  1 
ATOM   4091 C CG1 . VAL B 1 218 ? 8.541  1.615   16.661  1.00 40.64  ? 214 VAL B CG1 1 
ATOM   4092 C CG2 . VAL B 1 218 ? 10.499 0.664   15.377  1.00 38.48  ? 214 VAL B CG2 1 
ATOM   4093 N N   . SER B 1 219 ? 12.178 4.242   15.940  1.00 37.35  ? 215 SER B N   1 
ATOM   4094 C CA  . SER B 1 219 ? 13.560 4.578   15.650  1.00 39.56  ? 215 SER B CA  1 
ATOM   4095 C C   . SER B 1 219 ? 14.534 3.620   16.320  1.00 38.61  ? 215 SER B C   1 
ATOM   4096 O O   . SER B 1 219 ? 15.737 3.749   16.134  1.00 39.22  ? 215 SER B O   1 
ATOM   4097 C CB  . SER B 1 219 ? 13.868 6.013   16.078  1.00 42.46  ? 215 SER B CB  1 
ATOM   4098 O OG  . SER B 1 219 ? 13.508 6.215   17.433  1.00 46.66  ? 215 SER B OG  1 
ATOM   4099 N N   . TYR B 1 220 ? 14.026 2.642   17.066  1.00 37.59  ? 216 TYR B N   1 
ATOM   4100 C CA  . TYR B 1 220 ? 14.931 1.727   17.756  1.00 37.32  ? 216 TYR B CA  1 
ATOM   4101 C C   . TYR B 1 220 ? 15.309 0.436   17.017  1.00 37.71  ? 216 TYR B C   1 
ATOM   4102 O O   . TYR B 1 220 ? 15.740 -0.546  17.644  1.00 37.35  ? 216 TYR B O   1 
ATOM   4103 C CB  . TYR B 1 220 ? 14.400 1.413   19.166  1.00 36.57  ? 216 TYR B CB  1 
ATOM   4104 C CG  . TYR B 1 220 ? 12.984 0.895   19.198  1.00 37.51  ? 216 TYR B CG  1 
ATOM   4105 C CD1 . TYR B 1 220 ? 12.711 -0.461  18.984  1.00 39.32  ? 216 TYR B CD1 1 
ATOM   4106 C CD2 . TYR B 1 220 ? 11.917 1.752   19.472  1.00 37.18  ? 216 TYR B CD2 1 
ATOM   4107 C CE1 . TYR B 1 220 ? 11.416 -0.949  19.061  1.00 38.99  ? 216 TYR B CE1 1 
ATOM   4108 C CE2 . TYR B 1 220 ? 10.613 1.278   19.544  1.00 36.84  ? 216 TYR B CE2 1 
ATOM   4109 C CZ  . TYR B 1 220 ? 10.375 -0.073  19.346  1.00 39.75  ? 216 TYR B CZ  1 
ATOM   4110 O OH  . TYR B 1 220 ? 9.101  -0.569  19.465  1.00 43.06  ? 216 TYR B OH  1 
ATOM   4111 N N   . ILE B 1 221 ? 15.140 0.416   15.688  1.00 36.21  ? 217 ILE B N   1 
ATOM   4112 C CA  . ILE B 1 221 ? 15.569 -0.753  14.922  1.00 33.97  ? 217 ILE B CA  1 
ATOM   4113 C C   . ILE B 1 221 ? 17.004 -0.476  14.474  1.00 33.10  ? 217 ILE B C   1 
ATOM   4114 O O   . ILE B 1 221 ? 17.508 0.632   14.650  1.00 33.57  ? 217 ILE B O   1 
ATOM   4115 C CB  . ILE B 1 221 ? 14.669 -1.025  13.635  1.00 34.20  ? 217 ILE B CB  1 
ATOM   4116 C CG1 . ILE B 1 221 ? 14.138 0.284   13.014  1.00 31.62  ? 217 ILE B CG1 1 
ATOM   4117 C CG2 . ILE B 1 221 ? 13.504 -1.935  14.004  1.00 33.03  ? 217 ILE B CG2 1 
ATOM   4118 C CD1 . ILE B 1 221 ? 15.188 1.200   12.363  1.00 29.36  ? 217 ILE B CD1 1 
ATOM   4119 N N   . CYS B 1 222 ? 17.656 -1.481  13.902  1.00 35.03  ? 218 CYS B N   1 
ATOM   4120 C CA  . CYS B 1 222 ? 19.020 -1.359  13.368  1.00 34.61  ? 218 CYS B CA  1 
ATOM   4121 C C   . CYS B 1 222 ? 20.101 -1.499  14.444  1.00 35.33  ? 218 CYS B C   1 
ATOM   4122 O O   . CYS B 1 222 ? 20.043 -0.877  15.524  1.00 34.06  ? 218 CYS B O   1 
ATOM   4123 C CB  . CYS B 1 222 ? 19.187 -0.038  12.620  1.00 34.62  ? 218 CYS B CB  1 
ATOM   4124 S SG  . CYS B 1 222 ? 20.601 -0.037  11.495  1.00 37.29  ? 218 CYS B SG  1 
ATOM   4125 N N   . SER B 1 223 ? 21.074 -2.349  14.156  1.00 34.71  ? 219 SER B N   1 
ATOM   4126 C CA  . SER B 1 223 ? 22.137 -2.619  15.092  1.00 37.38  ? 219 SER B CA  1 
ATOM   4127 C C   . SER B 1 223 ? 23.146 -1.495  15.281  1.00 37.08  ? 219 SER B C   1 
ATOM   4128 O O   . SER B 1 223 ? 23.569 -0.848  14.344  1.00 34.43  ? 219 SER B O   1 
ATOM   4129 C CB  . SER B 1 223 ? 22.837 -3.917  14.701  1.00 36.65  ? 219 SER B CB  1 
ATOM   4130 O OG  . SER B 1 223 ? 21.865 -4.971  14.781  1.00 41.12  ? 219 SER B OG  1 
ATOM   4131 N N   . ARG B 1 224 ? 23.537 -1.333  16.537  1.00 38.44  ? 220 ARG B N   1 
ATOM   4132 C CA  . ARG B 1 224 ? 24.468 -0.311  16.998  1.00 44.20  ? 220 ARG B CA  1 
ATOM   4133 C C   . ARG B 1 224 ? 25.291 0.528   15.997  1.00 43.07  ? 220 ARG B C   1 
ATOM   4134 O O   . ARG B 1 224 ? 24.885 1.678   15.630  1.00 46.32  ? 220 ARG B O   1 
ATOM   4135 C CB  . ARG B 1 224 ? 25.396 -0.932  18.068  1.00 48.71  ? 220 ARG B CB  1 
ATOM   4136 C CG  . ARG B 1 224 ? 25.839 -2.383  17.753  1.00 55.71  ? 220 ARG B CG  1 
ATOM   4137 C CD  . ARG B 1 224 ? 26.435 -2.506  16.327  1.00 58.44  ? 220 ARG B CD  1 
ATOM   4138 N NE  . ARG B 1 224 ? 26.786 -3.889  15.950  1.00 65.36  ? 220 ARG B NE  1 
ATOM   4139 C CZ  . ARG B 1 224 ? 27.377 -4.796  16.742  1.00 68.69  ? 220 ARG B CZ  1 
ATOM   4140 N NH1 . ARG B 1 224 ? 27.703 -4.514  18.007  1.00 69.89  ? 220 ARG B NH1 1 
ATOM   4141 N NH2 . ARG B 1 224 ? 27.660 -6.005  16.257  1.00 71.08  ? 220 ARG B NH2 1 
ATOM   4142 N N   . TYR B 1 225 ? 26.427 -0.009  15.560  1.00 39.51  ? 221 TYR B N   1 
ATOM   4143 C CA  . TYR B 1 225 ? 27.356 0.704   14.645  1.00 37.63  ? 221 TYR B CA  1 
ATOM   4144 C C   . TYR B 1 225 ? 26.856 1.059   13.229  1.00 36.14  ? 221 TYR B C   1 
ATOM   4145 O O   . TYR B 1 225 ? 27.500 1.841   12.518  1.00 33.94  ? 221 TYR B O   1 
ATOM   4146 C CB  . TYR B 1 225 ? 28.605 -0.161  14.431  1.00 42.03  ? 221 TYR B CB  1 
ATOM   4147 C CG  . TYR B 1 225 ? 29.258 -0.690  15.676  1.00 45.63  ? 221 TYR B CG  1 
ATOM   4148 C CD1 . TYR B 1 225 ? 30.070 -1.824  15.621  1.00 47.57  ? 221 TYR B CD1 1 
ATOM   4149 C CD2 . TYR B 1 225 ? 29.148 -0.012  16.895  1.00 48.29  ? 221 TYR B CD2 1 
ATOM   4150 C CE1 . TYR B 1 225 ? 30.777 -2.263  16.755  1.00 50.00  ? 221 TYR B CE1 1 
ATOM   4151 C CE2 . TYR B 1 225 ? 29.851 -0.446  18.038  1.00 51.31  ? 221 TYR B CE2 1 
ATOM   4152 C CZ  . TYR B 1 225 ? 30.664 -1.564  17.949  1.00 50.73  ? 221 TYR B CZ  1 
ATOM   4153 O OH  . TYR B 1 225 ? 31.392 -1.950  19.049  1.00 54.48  ? 221 TYR B OH  1 
ATOM   4154 N N   . TYR B 1 226 ? 25.734 0.471   12.816  1.00 33.57  ? 222 TYR B N   1 
ATOM   4155 C CA  . TYR B 1 226 ? 25.227 0.661   11.450  1.00 33.82  ? 222 TYR B CA  1 
ATOM   4156 C C   . TYR B 1 226 ? 24.019 1.586   11.302  1.00 33.57  ? 222 TYR B C   1 
ATOM   4157 O O   . TYR B 1 226 ? 23.471 1.719   10.199  1.00 33.92  ? 222 TYR B O   1 
ATOM   4158 C CB  . TYR B 1 226 ? 24.907 -0.724  10.856  1.00 31.27  ? 222 TYR B CB  1 
ATOM   4159 C CG  . TYR B 1 226 ? 26.082 -1.678  11.014  1.00 31.70  ? 222 TYR B CG  1 
ATOM   4160 C CD1 . TYR B 1 226 ? 27.181 -1.624  10.142  1.00 31.74  ? 222 TYR B CD1 1 
ATOM   4161 C CD2 . TYR B 1 226 ? 26.159 -2.530  12.124  1.00 32.30  ? 222 TYR B CD2 1 
ATOM   4162 C CE1 . TYR B 1 226 ? 28.333 -2.389  10.378  1.00 32.76  ? 222 TYR B CE1 1 
ATOM   4163 C CE2 . TYR B 1 226 ? 27.325 -3.307  12.384  1.00 33.14  ? 222 TYR B CE2 1 
ATOM   4164 C CZ  . TYR B 1 226 ? 28.398 -3.229  11.509  1.00 34.52  ? 222 TYR B CZ  1 
ATOM   4165 O OH  . TYR B 1 226 ? 29.536 -3.992  11.769  1.00 34.59  ? 222 TYR B OH  1 
ATOM   4166 N N   . ARG B 1 227 ? 23.626 2.234   12.396  1.00 33.06  ? 223 ARG B N   1 
ATOM   4167 C CA  . ARG B 1 227 ? 22.461 3.119   12.411  1.00 34.08  ? 223 ARG B CA  1 
ATOM   4168 C C   . ARG B 1 227 ? 22.724 4.500   11.806  1.00 33.03  ? 223 ARG B C   1 
ATOM   4169 O O   . ARG B 1 227 ? 23.737 5.169   12.118  1.00 31.56  ? 223 ARG B O   1 
ATOM   4170 C CB  . ARG B 1 227 ? 21.949 3.301   13.851  1.00 35.48  ? 223 ARG B CB  1 
ATOM   4171 C CG  . ARG B 1 227 ? 22.045 2.063   14.682  1.00 43.09  ? 223 ARG B CG  1 
ATOM   4172 C CD  . ARG B 1 227 ? 20.901 1.938   15.631  1.00 46.58  ? 223 ARG B CD  1 
ATOM   4173 N NE  . ARG B 1 227 ? 20.733 3.082   16.509  1.00 49.81  ? 223 ARG B NE  1 
ATOM   4174 C CZ  . ARG B 1 227 ? 19.534 3.544   16.859  1.00 49.81  ? 223 ARG B CZ  1 
ATOM   4175 N NH1 . ARG B 1 227 ? 18.447 2.948   16.385  1.00 47.49  ? 223 ARG B NH1 1 
ATOM   4176 N NH2 . ARG B 1 227 ? 19.425 4.573   17.687  1.00 48.56  ? 223 ARG B NH2 1 
ATOM   4177 N N   . ALA B 1 228 ? 21.809 4.914   10.936  1.00 32.48  ? 224 ALA B N   1 
ATOM   4178 C CA  . ALA B 1 228 ? 21.901 6.227   10.296  1.00 34.04  ? 224 ALA B CA  1 
ATOM   4179 C C   . ALA B 1 228 ? 21.731 7.294   11.391  1.00 33.04  ? 224 ALA B C   1 
ATOM   4180 O O   . ALA B 1 228 ? 21.053 7.057   12.375  1.00 32.96  ? 224 ALA B O   1 
ATOM   4181 C CB  . ALA B 1 228 ? 20.796 6.375   9.222   1.00 31.16  ? 224 ALA B CB  1 
ATOM   4182 N N   . PRO B 1 229 ? 22.366 8.464   11.231  1.00 35.52  ? 225 PRO B N   1 
ATOM   4183 C CA  . PRO B 1 229 ? 22.284 9.571   12.201  1.00 36.21  ? 225 PRO B CA  1 
ATOM   4184 C C   . PRO B 1 229 ? 20.826 9.919   12.539  1.00 35.93  ? 225 PRO B C   1 
ATOM   4185 O O   . PRO B 1 229 ? 20.480 10.137  13.699  1.00 37.14  ? 225 PRO B O   1 
ATOM   4186 C CB  . PRO B 1 229 ? 22.957 10.744  11.487  1.00 37.20  ? 225 PRO B CB  1 
ATOM   4187 C CG  . PRO B 1 229 ? 23.737 10.142  10.394  1.00 38.12  ? 225 PRO B CG  1 
ATOM   4188 C CD  . PRO B 1 229 ? 23.037 8.880   9.988   1.00 36.51  ? 225 PRO B CD  1 
ATOM   4189 N N   . GLU B 1 230 ? 19.961 9.962   11.537  1.00 35.68  ? 226 GLU B N   1 
ATOM   4190 C CA  . GLU B 1 230 ? 18.569 10.304  11.818  1.00 36.52  ? 226 GLU B CA  1 
ATOM   4191 C C   . GLU B 1 230 ? 17.920 9.325   12.805  1.00 36.74  ? 226 GLU B C   1 
ATOM   4192 O O   . GLU B 1 230 ? 17.027 9.730   13.565  1.00 36.72  ? 226 GLU B O   1 
ATOM   4193 C CB  . GLU B 1 230 ? 17.722 10.429  10.521  1.00 37.84  ? 226 GLU B CB  1 
ATOM   4194 C CG  . GLU B 1 230 ? 17.573 9.152   9.666   1.00 37.32  ? 226 GLU B CG  1 
ATOM   4195 C CD  . GLU B 1 230 ? 18.650 9.055   8.596   1.00 38.43  ? 226 GLU B CD  1 
ATOM   4196 O OE1 . GLU B 1 230 ? 19.783 9.516   8.864   1.00 38.20  ? 226 GLU B OE1 1 
ATOM   4197 O OE2 . GLU B 1 230 ? 18.369 8.514   7.489   1.00 37.07  ? 226 GLU B OE2 1 
ATOM   4198 N N   . LEU B 1 231 ? 18.341 8.054   12.809  1.00 34.25  ? 227 LEU B N   1 
ATOM   4199 C CA  . LEU B 1 231 ? 17.769 7.102   13.772  1.00 33.62  ? 227 LEU B CA  1 
ATOM   4200 C C   . LEU B 1 231 ? 18.342 7.405   15.169  1.00 33.04  ? 227 LEU B C   1 
ATOM   4201 O O   . LEU B 1 231 ? 17.633 7.330   16.178  1.00 30.65  ? 227 LEU B O   1 
ATOM   4202 C CB  . LEU B 1 231 ? 18.094 5.643   13.393  1.00 32.16  ? 227 LEU B CB  1 
ATOM   4203 C CG  . LEU B 1 231 ? 17.506 5.085   12.089  1.00 32.52  ? 227 LEU B CG  1 
ATOM   4204 C CD1 . LEU B 1 231 ? 18.065 3.676   11.904  1.00 30.81  ? 227 LEU B CD1 1 
ATOM   4205 C CD2 . LEU B 1 231 ? 15.956 5.064   12.110  1.00 28.62  ? 227 LEU B CD2 1 
ATOM   4206 N N   . ILE B 1 232 ? 19.635 7.739   15.222  1.00 33.48  ? 228 ILE B N   1 
ATOM   4207 C CA  . ILE B 1 232 ? 20.260 8.066   16.491  1.00 34.62  ? 228 ILE B CA  1 
ATOM   4208 C C   . ILE B 1 232 ? 19.529 9.294   17.071  1.00 36.23  ? 228 ILE B C   1 
ATOM   4209 O O   . ILE B 1 232 ? 19.262 9.352   18.277  1.00 34.00  ? 228 ILE B O   1 
ATOM   4210 C CB  . ILE B 1 232 ? 21.756 8.379   16.317  1.00 35.90  ? 228 ILE B CB  1 
ATOM   4211 C CG1 . ILE B 1 232 ? 22.489 7.117   15.789  1.00 37.31  ? 228 ILE B CG1 1 
ATOM   4212 C CG2 . ILE B 1 232 ? 22.360 8.780   17.678  1.00 34.85  ? 228 ILE B CG2 1 
ATOM   4213 C CD1 . ILE B 1 232 ? 23.985 7.323   15.467  1.00 33.31  ? 228 ILE B CD1 1 
ATOM   4214 N N   . PHE B 1 233 ? 19.200 10.257  16.212  1.00 35.40  ? 229 PHE B N   1 
ATOM   4215 C CA  . PHE B 1 233 ? 18.477 11.451  16.647  1.00 38.60  ? 229 PHE B CA  1 
ATOM   4216 C C   . PHE B 1 233 ? 17.011 11.187  16.959  1.00 40.02  ? 229 PHE B C   1 
ATOM   4217 O O   . PHE B 1 233 ? 16.298 12.103  17.316  1.00 41.59  ? 229 PHE B O   1 
ATOM   4218 C CB  . PHE B 1 233 ? 18.583 12.569  15.598  1.00 38.06  ? 229 PHE B CB  1 
ATOM   4219 C CG  . PHE B 1 233 ? 19.918 13.247  15.569  1.00 40.71  ? 229 PHE B CG  1 
ATOM   4220 C CD1 . PHE B 1 233 ? 20.406 13.905  16.697  1.00 42.33  ? 229 PHE B CD1 1 
ATOM   4221 C CD2 . PHE B 1 233 ? 20.685 13.254  14.412  1.00 42.75  ? 229 PHE B CD2 1 
ATOM   4222 C CE1 . PHE B 1 233 ? 21.640 14.562  16.666  1.00 44.23  ? 229 PHE B CE1 1 
ATOM   4223 C CE2 . PHE B 1 233 ? 21.920 13.906  14.370  1.00 44.30  ? 229 PHE B CE2 1 
ATOM   4224 C CZ  . PHE B 1 233 ? 22.398 14.564  15.504  1.00 43.59  ? 229 PHE B CZ  1 
ATOM   4225 N N   . GLY B 1 234 ? 16.556 9.944   16.796  1.00 40.68  ? 230 GLY B N   1 
ATOM   4226 C CA  . GLY B 1 234 ? 15.182 9.597   17.121  1.00 38.74  ? 230 GLY B CA  1 
ATOM   4227 C C   . GLY B 1 234 ? 14.041 9.865   16.138  1.00 39.88  ? 230 GLY B C   1 
ATOM   4228 O O   . GLY B 1 234 ? 12.869 9.851   16.515  1.00 39.64  ? 230 GLY B O   1 
ATOM   4229 N N   . ALA B 1 235 ? 14.358 10.087  14.874  1.00 40.37  ? 231 ALA B N   1 
ATOM   4230 C CA  . ALA B 1 235 ? 13.331 10.350  13.886  1.00 38.24  ? 231 ALA B CA  1 
ATOM   4231 C C   . ALA B 1 235 ? 12.448 9.141   13.670  1.00 38.71  ? 231 ALA B C   1 
ATOM   4232 O O   . ALA B 1 235 ? 12.901 7.997   13.764  1.00 38.79  ? 231 ALA B O   1 
ATOM   4233 C CB  . ALA B 1 235 ? 13.973 10.759  12.585  1.00 37.13  ? 231 ALA B CB  1 
ATOM   4234 N N   . THR B 1 236 ? 11.171 9.401   13.413  1.00 39.22  ? 232 THR B N   1 
ATOM   4235 C CA  . THR B 1 236 ? 10.196 8.358   13.136  1.00 39.37  ? 232 THR B CA  1 
ATOM   4236 C C   . THR B 1 236 ? 9.672  8.544   11.694  1.00 39.16  ? 232 THR B C   1 
ATOM   4237 O O   . THR B 1 236 ? 8.811  7.796   11.244  1.00 37.11  ? 232 THR B O   1 
ATOM   4238 C CB  . THR B 1 236 ? 9.012  8.426   14.098  1.00 41.07  ? 232 THR B CB  1 
ATOM   4239 O OG1 . THR B 1 236 ? 8.419  9.725   13.997  1.00 44.16  ? 232 THR B OG1 1 
ATOM   4240 C CG2 . THR B 1 236 ? 9.464  8.190   15.550  1.00 41.33  ? 232 THR B CG2 1 
ATOM   4241 N N   . ASP B 1 237 ? 10.200 9.536   10.978  1.00 39.13  ? 233 ASP B N   1 
ATOM   4242 C CA  . ASP B 1 237 ? 9.776  9.775   9.600   1.00 42.53  ? 233 ASP B CA  1 
ATOM   4243 C C   . ASP B 1 237 ? 10.888 9.441   8.580   1.00 42.05  ? 233 ASP B C   1 
ATOM   4244 O O   . ASP B 1 237 ? 10.919 10.007  7.481   1.00 41.77  ? 233 ASP B O   1 
ATOM   4245 C CB  . ASP B 1 237 ? 9.375  11.245  9.408   1.00 45.24  ? 233 ASP B CB  1 
ATOM   4246 C CG  . ASP B 1 237 ? 10.550 12.184  9.571   1.00 50.22  ? 233 ASP B CG  1 
ATOM   4247 O OD1 . ASP B 1 237 ? 10.456 13.368  9.157   1.00 53.75  ? 233 ASP B OD1 1 
ATOM   4248 O OD2 . ASP B 1 237 ? 11.579 11.738  10.124  1.00 52.97  ? 233 ASP B OD2 1 
ATOM   4249 N N   . TYR B 1 238 ? 11.805 8.548   8.950   1.00 39.38  ? 234 TYR B N   1 
ATOM   4250 C CA  . TYR B 1 238 ? 12.905 8.169   8.069   1.00 37.95  ? 234 TYR B CA  1 
ATOM   4251 C C   . TYR B 1 238 ? 12.430 7.357   6.863   1.00 36.71  ? 234 TYR B C   1 
ATOM   4252 O O   . TYR B 1 238 ? 11.331 6.800   6.859   1.00 35.36  ? 234 TYR B O   1 
ATOM   4253 C CB  . TYR B 1 238 ? 13.961 7.369   8.868   1.00 35.73  ? 234 TYR B CB  1 
ATOM   4254 C CG  . TYR B 1 238 ? 13.392 6.133   9.532   1.00 34.82  ? 234 TYR B CG  1 
ATOM   4255 C CD1 . TYR B 1 238 ? 13.230 4.946   8.825   1.00 34.07  ? 234 TYR B CD1 1 
ATOM   4256 C CD2 . TYR B 1 238 ? 13.023 6.149   10.884  1.00 34.69  ? 234 TYR B CD2 1 
ATOM   4257 C CE1 . TYR B 1 238 ? 12.717 3.793   9.450   1.00 33.26  ? 234 TYR B CE1 1 
ATOM   4258 C CE2 . TYR B 1 238 ? 12.518 5.001   11.509  1.00 33.96  ? 234 TYR B CE2 1 
ATOM   4259 C CZ  . TYR B 1 238 ? 12.370 3.818   10.780  1.00 33.18  ? 234 TYR B CZ  1 
ATOM   4260 O OH  . TYR B 1 238 ? 11.865 2.669   11.393  1.00 31.72  ? 234 TYR B OH  1 
ATOM   4261 N N   . THR B 1 239 ? 13.286 7.290   5.846   1.00 38.76  ? 235 THR B N   1 
ATOM   4262 C CA  . THR B 1 239 ? 13.007 6.556   4.608   1.00 38.65  ? 235 THR B CA  1 
ATOM   4263 C C   . THR B 1 239 ? 13.967 5.360   4.453   1.00 38.31  ? 235 THR B C   1 
ATOM   4264 O O   . THR B 1 239 ? 14.762 5.066   5.354   1.00 35.88  ? 235 THR B O   1 
ATOM   4265 C CB  . THR B 1 239 ? 13.206 7.442   3.377   1.00 38.81  ? 235 THR B CB  1 
ATOM   4266 O OG1 . THR B 1 239 ? 14.587 7.809   3.288   1.00 38.04  ? 235 THR B OG1 1 
ATOM   4267 C CG2 . THR B 1 239 ? 12.340 8.715   3.491   1.00 41.62  ? 235 THR B CG2 1 
ATOM   4268 N N   . SER B 1 240 ? 13.885 4.710   3.290   1.00 36.28  ? 236 SER B N   1 
ATOM   4269 C CA  . SER B 1 240 ? 14.691 3.538   2.973   1.00 36.63  ? 236 SER B CA  1 
ATOM   4270 C C   . SER B 1 240 ? 16.159 3.884   2.880   1.00 35.36  ? 236 SER B C   1 
ATOM   4271 O O   . SER B 1 240 ? 17.009 2.998   2.866   1.00 32.55  ? 236 SER B O   1 
ATOM   4272 C CB  . SER B 1 240 ? 14.225 2.908   1.647   1.00 37.54  ? 236 SER B CB  1 
ATOM   4273 O OG  . SER B 1 240 ? 13.004 2.219   1.850   1.00 42.46  ? 236 SER B OG  1 
ATOM   4274 N N   . SER B 1 241 ? 16.467 5.175   2.803   1.00 33.66  ? 237 SER B N   1 
ATOM   4275 C CA  . SER B 1 241 ? 17.866 5.550   2.734   1.00 32.97  ? 237 SER B CA  1 
ATOM   4276 C C   . SER B 1 241 ? 18.621 5.186   4.026   1.00 31.27  ? 237 SER B C   1 
ATOM   4277 O O   . SER B 1 241 ? 19.854 5.316   4.065   1.00 30.70  ? 237 SER B O   1 
ATOM   4278 C CB  . SER B 1 241 ? 18.023 7.058   2.407   1.00 33.15  ? 237 SER B CB  1 
ATOM   4279 O OG  . SER B 1 241 ? 17.524 7.860   3.456   1.00 36.59  ? 237 SER B OG  1 
ATOM   4280 N N   . ILE B 1 242 ? 17.919 4.763   5.092   1.00 30.38  ? 238 ILE B N   1 
ATOM   4281 C CA  . ILE B 1 242 ? 18.679 4.349   6.292   1.00 29.92  ? 238 ILE B CA  1 
ATOM   4282 C C   . ILE B 1 242 ? 19.491 3.056   5.949   1.00 31.72  ? 238 ILE B C   1 
ATOM   4283 O O   . ILE B 1 242 ? 20.562 2.831   6.517   1.00 30.18  ? 238 ILE B O   1 
ATOM   4284 C CB  . ILE B 1 242 ? 17.794 4.065   7.548   1.00 29.89  ? 238 ILE B CB  1 
ATOM   4285 C CG1 . ILE B 1 242 ? 16.788 2.944   7.253   1.00 27.36  ? 238 ILE B CG1 1 
ATOM   4286 C CG2 . ILE B 1 242 ? 17.070 5.371   8.010   1.00 29.09  ? 238 ILE B CG2 1 
ATOM   4287 C CD1 . ILE B 1 242 ? 16.188 2.350   8.516   1.00 26.88  ? 238 ILE B CD1 1 
ATOM   4288 N N   . ASP B 1 243 ? 18.976 2.231   5.022   1.00 32.26  ? 239 ASP B N   1 
ATOM   4289 C CA  . ASP B 1 243 ? 19.676 1.006   4.582   1.00 31.95  ? 239 ASP B CA  1 
ATOM   4290 C C   . ASP B 1 243 ? 20.924 1.408   3.803   1.00 31.75  ? 239 ASP B C   1 
ATOM   4291 O O   . ASP B 1 243 ? 21.943 0.702   3.831   1.00 31.11  ? 239 ASP B O   1 
ATOM   4292 C CB  . ASP B 1 243 ? 18.825 0.144   3.627   1.00 29.76  ? 239 ASP B CB  1 
ATOM   4293 C CG  . ASP B 1 243 ? 17.738 -0.637  4.329   1.00 29.63  ? 239 ASP B CG  1 
ATOM   4294 O OD1 . ASP B 1 243 ? 17.799 -0.804  5.559   1.00 31.39  ? 239 ASP B OD1 1 
ATOM   4295 O OD2 . ASP B 1 243 ? 16.805 -1.120  3.632   1.00 31.77  ? 239 ASP B OD2 1 
ATOM   4296 N N   . VAL B 1 244 ? 20.851 2.530   3.089   1.00 29.67  ? 240 VAL B N   1 
ATOM   4297 C CA  . VAL B 1 244 ? 22.011 2.963   2.323   1.00 31.35  ? 240 VAL B CA  1 
ATOM   4298 C C   . VAL B 1 244 ? 23.143 3.398   3.260   1.00 31.94  ? 240 VAL B C   1 
ATOM   4299 O O   . VAL B 1 244 ? 24.323 3.075   3.026   1.00 31.05  ? 240 VAL B O   1 
ATOM   4300 C CB  . VAL B 1 244 ? 21.647 4.085   1.315   1.00 31.53  ? 240 VAL B CB  1 
ATOM   4301 C CG1 . VAL B 1 244 ? 22.911 4.771   0.802   1.00 31.39  ? 240 VAL B CG1 1 
ATOM   4302 C CG2 . VAL B 1 244 ? 20.887 3.483   0.142   1.00 31.53  ? 240 VAL B CG2 1 
ATOM   4303 N N   . TRP B 1 245 ? 22.792 4.119   4.324   1.00 31.51  ? 241 TRP B N   1 
ATOM   4304 C CA  . TRP B 1 245 ? 23.807 4.516   5.302   1.00 30.26  ? 241 TRP B CA  1 
ATOM   4305 C C   . TRP B 1 245 ? 24.437 3.217   5.882   1.00 30.07  ? 241 TRP B C   1 
ATOM   4306 O O   . TRP B 1 245 ? 25.663 3.098   5.971   1.00 27.65  ? 241 TRP B O   1 
ATOM   4307 C CB  . TRP B 1 245 ? 23.167 5.327   6.436   1.00 30.63  ? 241 TRP B CB  1 
ATOM   4308 C CG  . TRP B 1 245 ? 24.136 5.635   7.561   1.00 31.51  ? 241 TRP B CG  1 
ATOM   4309 C CD1 . TRP B 1 245 ? 24.515 4.802   8.590   1.00 32.70  ? 241 TRP B CD1 1 
ATOM   4310 C CD2 . TRP B 1 245 ? 24.895 6.849   7.728   1.00 32.83  ? 241 TRP B CD2 1 
ATOM   4311 N NE1 . TRP B 1 245 ? 25.464 5.427   9.377   1.00 31.68  ? 241 TRP B NE1 1 
ATOM   4312 C CE2 . TRP B 1 245 ? 25.714 6.679   8.877   1.00 32.51  ? 241 TRP B CE2 1 
ATOM   4313 C CE3 . TRP B 1 245 ? 24.963 8.062   7.016   1.00 33.47  ? 241 TRP B CE3 1 
ATOM   4314 C CZ2 . TRP B 1 245 ? 26.596 7.683   9.339   1.00 32.86  ? 241 TRP B CZ2 1 
ATOM   4315 C CZ3 . TRP B 1 245 ? 25.849 9.072   7.475   1.00 34.47  ? 241 TRP B CZ3 1 
ATOM   4316 C CH2 . TRP B 1 245 ? 26.654 8.861   8.633   1.00 34.05  ? 241 TRP B CH2 1 
ATOM   4317 N N   . SER B 1 246 ? 23.585 2.261   6.280   1.00 27.73  ? 242 SER B N   1 
ATOM   4318 C CA  . SER B 1 246 ? 24.079 0.988   6.825   1.00 29.30  ? 242 SER B CA  1 
ATOM   4319 C C   . SER B 1 246 ? 25.021 0.292   5.858   1.00 29.07  ? 242 SER B C   1 
ATOM   4320 O O   . SER B 1 246 ? 26.070 -0.226  6.277   1.00 32.04  ? 242 SER B O   1 
ATOM   4321 C CB  . SER B 1 246 ? 22.928 0.032   7.182   1.00 28.52  ? 242 SER B CB  1 
ATOM   4322 O OG  . SER B 1 246 ? 22.122 0.556   8.238   1.00 29.21  ? 242 SER B OG  1 
ATOM   4323 N N   . ALA B 1 247 ? 24.664 0.266   4.572   1.00 28.48  ? 243 ALA B N   1 
ATOM   4324 C CA  . ALA B 1 247 ? 25.541 -0.354  3.567   1.00 29.81  ? 243 ALA B CA  1 
ATOM   4325 C C   . ALA B 1 247 ? 26.892 0.397   3.488   1.00 30.20  ? 243 ALA B C   1 
ATOM   4326 O O   . ALA B 1 247 ? 27.966 -0.227  3.331   1.00 29.48  ? 243 ALA B O   1 
ATOM   4327 C CB  . ALA B 1 247 ? 24.861 -0.370  2.177   1.00 27.56  ? 243 ALA B CB  1 
ATOM   4328 N N   . GLY B 1 248 ? 26.842 1.725   3.589   1.00 30.46  ? 244 GLY B N   1 
ATOM   4329 C CA  . GLY B 1 248 ? 28.082 2.515   3.548   1.00 30.90  ? 244 GLY B CA  1 
ATOM   4330 C C   . GLY B 1 248 ? 28.962 2.164   4.746   1.00 31.86  ? 244 GLY B C   1 
ATOM   4331 O O   . GLY B 1 248 ? 30.175 2.151   4.641   1.00 32.89  ? 244 GLY B O   1 
ATOM   4332 N N   . CYS B 1 249 ? 28.348 1.862   5.898   1.00 32.45  ? 245 CYS B N   1 
ATOM   4333 C CA  . CYS B 1 249 ? 29.134 1.491   7.083   1.00 30.67  ? 245 CYS B CA  1 
ATOM   4334 C C   . CYS B 1 249 ? 29.814 0.131   6.862   1.00 31.47  ? 245 CYS B C   1 
ATOM   4335 O O   . CYS B 1 249 ? 30.941 -0.094  7.325   1.00 29.49  ? 245 CYS B O   1 
ATOM   4336 C CB  . CYS B 1 249 ? 28.256 1.425   8.332   1.00 32.37  ? 245 CYS B CB  1 
ATOM   4337 S SG  . CYS B 1 249 ? 27.664 3.059   8.920   1.00 32.60  ? 245 CYS B SG  1 
ATOM   4338 N N   . VAL B 1 250 ? 29.120 -0.778  6.180   1.00 29.47  ? 246 VAL B N   1 
ATOM   4339 C CA  . VAL B 1 250 ? 29.698 -2.092  5.886   1.00 30.19  ? 246 VAL B CA  1 
ATOM   4340 C C   . VAL B 1 250 ? 30.878 -1.913  4.911   1.00 30.20  ? 246 VAL B C   1 
ATOM   4341 O O   . VAL B 1 250 ? 31.938 -2.483  5.128   1.00 30.74  ? 246 VAL B O   1 
ATOM   4342 C CB  . VAL B 1 250 ? 28.635 -3.060  5.284   1.00 29.84  ? 246 VAL B CB  1 
ATOM   4343 C CG1 . VAL B 1 250 ? 29.315 -4.352  4.786   1.00 30.19  ? 246 VAL B CG1 1 
ATOM   4344 C CG2 . VAL B 1 250 ? 27.569 -3.384  6.370   1.00 27.67  ? 246 VAL B CG2 1 
ATOM   4345 N N   . LEU B 1 251 ? 30.700 -1.129  3.844   1.00 29.94  ? 247 LEU B N   1 
ATOM   4346 C CA  . LEU B 1 251 ? 31.789 -0.885  2.905   1.00 33.55  ? 247 LEU B CA  1 
ATOM   4347 C C   . LEU B 1 251 ? 33.007 -0.291  3.651   1.00 36.04  ? 247 LEU B C   1 
ATOM   4348 O O   . LEU B 1 251 ? 34.136 -0.767  3.515   1.00 35.79  ? 247 LEU B O   1 
ATOM   4349 C CB  . LEU B 1 251 ? 31.351 0.102   1.791   1.00 33.86  ? 247 LEU B CB  1 
ATOM   4350 C CG  . LEU B 1 251 ? 32.454 0.713   0.890   1.00 35.10  ? 247 LEU B CG  1 
ATOM   4351 C CD1 . LEU B 1 251 ? 33.161 -0.365  0.091   1.00 34.72  ? 247 LEU B CD1 1 
ATOM   4352 C CD2 . LEU B 1 251 ? 31.848 1.739   -0.069  1.00 35.31  ? 247 LEU B CD2 1 
ATOM   4353 N N   . ALA B 1 252 ? 32.771 0.753   4.437   1.00 35.93  ? 248 ALA B N   1 
ATOM   4354 C CA  . ALA B 1 252 ? 33.878 1.383   5.156   1.00 37.00  ? 248 ALA B CA  1 
ATOM   4355 C C   . ALA B 1 252 ? 34.578 0.368   6.047   1.00 35.43  ? 248 ALA B C   1 
ATOM   4356 O O   . ALA B 1 252 ? 35.807 0.335   6.106   1.00 35.12  ? 248 ALA B O   1 
ATOM   4357 C CB  . ALA B 1 252 ? 33.374 2.569   5.985   1.00 34.66  ? 248 ALA B CB  1 
ATOM   4358 N N   . GLU B 1 253 ? 33.795 -0.479  6.718   1.00 34.72  ? 249 GLU B N   1 
ATOM   4359 C CA  . GLU B 1 253 ? 34.348 -1.490  7.613   1.00 32.51  ? 249 GLU B CA  1 
ATOM   4360 C C   . GLU B 1 253 ? 35.239 -2.507  6.878   1.00 32.48  ? 249 GLU B C   1 
ATOM   4361 O O   . GLU B 1 253 ? 36.296 -2.915  7.390   1.00 31.80  ? 249 GLU B O   1 
ATOM   4362 C CB  . GLU B 1 253 ? 33.218 -2.224  8.355   1.00 34.04  ? 249 GLU B CB  1 
ATOM   4363 C CG  . GLU B 1 253 ? 33.691 -3.255  9.382   1.00 34.32  ? 249 GLU B CG  1 
ATOM   4364 C CD  . GLU B 1 253 ? 32.584 -3.715  10.362  1.00 37.76  ? 249 GLU B CD  1 
ATOM   4365 O OE1 . GLU B 1 253 ? 31.538 -3.017  10.517  1.00 36.95  ? 249 GLU B OE1 1 
ATOM   4366 O OE2 . GLU B 1 253 ? 32.781 -4.778  10.996  1.00 35.07  ? 249 GLU B OE2 1 
ATOM   4367 N N   . LEU B 1 254 ? 34.812 -2.926  5.692   1.00 32.45  ? 250 LEU B N   1 
ATOM   4368 C CA  . LEU B 1 254 ? 35.595 -3.895  4.923   1.00 35.73  ? 250 LEU B CA  1 
ATOM   4369 C C   . LEU B 1 254 ? 36.911 -3.249  4.449   1.00 36.88  ? 250 LEU B C   1 
ATOM   4370 O O   . LEU B 1 254 ? 37.934 -3.922  4.363   1.00 36.95  ? 250 LEU B O   1 
ATOM   4371 C CB  . LEU B 1 254 ? 34.792 -4.401  3.717   1.00 33.27  ? 250 LEU B CB  1 
ATOM   4372 C CG  . LEU B 1 254 ? 33.555 -5.250  4.091   1.00 35.30  ? 250 LEU B CG  1 
ATOM   4373 C CD1 . LEU B 1 254 ? 32.785 -5.605  2.809   1.00 33.60  ? 250 LEU B CD1 1 
ATOM   4374 C CD2 . LEU B 1 254 ? 33.955 -6.510  4.828   1.00 31.32  ? 250 LEU B CD2 1 
ATOM   4375 N N   . LEU B 1 255 ? 36.873 -1.954  4.138   1.00 36.53  ? 251 LEU B N   1 
ATOM   4376 C CA  . LEU B 1 255 ? 38.068 -1.239  3.689   1.00 39.67  ? 251 LEU B CA  1 
ATOM   4377 C C   . LEU B 1 255 ? 39.019 -1.004  4.847   1.00 41.48  ? 251 LEU B C   1 
ATOM   4378 O O   . LEU B 1 255 ? 40.220 -1.168  4.696   1.00 42.29  ? 251 LEU B O   1 
ATOM   4379 C CB  . LEU B 1 255 ? 37.700 0.107   3.063   1.00 39.11  ? 251 LEU B CB  1 
ATOM   4380 C CG  . LEU B 1 255 ? 36.902 -0.043  1.772   1.00 39.28  ? 251 LEU B CG  1 
ATOM   4381 C CD1 . LEU B 1 255 ? 36.393 1.303   1.292   1.00 38.79  ? 251 LEU B CD1 1 
ATOM   4382 C CD2 . LEU B 1 255 ? 37.792 -0.728  0.737   1.00 39.74  ? 251 LEU B CD2 1 
ATOM   4383 N N   . LEU B 1 256 ? 38.470 -0.668  6.011   1.00 42.32  ? 252 LEU B N   1 
ATOM   4384 C CA  . LEU B 1 256 ? 39.261 -0.383  7.199   1.00 42.75  ? 252 LEU B CA  1 
ATOM   4385 C C   . LEU B 1 256 ? 39.741 -1.561  8.041   1.00 42.70  ? 252 LEU B C   1 
ATOM   4386 O O   . LEU B 1 256 ? 40.822 -1.492  8.630   1.00 42.23  ? 252 LEU B O   1 
ATOM   4387 C CB  . LEU B 1 256 ? 38.477 0.558   8.111   1.00 44.61  ? 252 LEU B CB  1 
ATOM   4388 C CG  . LEU B 1 256 ? 38.566 2.044   7.765   1.00 49.85  ? 252 LEU B CG  1 
ATOM   4389 C CD1 . LEU B 1 256 ? 37.378 2.786   8.385   1.00 49.90  ? 252 LEU B CD1 1 
ATOM   4390 C CD2 . LEU B 1 256 ? 39.919 2.611   8.269   1.00 49.70  ? 252 LEU B CD2 1 
ATOM   4391 N N   . GLY B 1 257 ? 38.951 -2.633  8.123   1.00 40.09  ? 253 GLY B N   1 
ATOM   4392 C CA  . GLY B 1 257 ? 39.348 -3.751  8.960   1.00 38.68  ? 253 GLY B CA  1 
ATOM   4393 C C   . GLY B 1 257 ? 38.670 -3.681  10.327  1.00 38.49  ? 253 GLY B C   1 
ATOM   4394 O O   . GLY B 1 257 ? 38.870 -4.551  11.170  1.00 38.41  ? 253 GLY B O   1 
ATOM   4395 N N   . GLN B 1 258 ? 37.855 -2.646  10.544  1.00 37.66  ? 254 GLN B N   1 
ATOM   4396 C CA  . GLN B 1 258 ? 37.111 -2.474  11.810  1.00 39.64  ? 254 GLN B CA  1 
ATOM   4397 C C   . GLN B 1 258 ? 35.933 -1.509  11.581  1.00 37.63  ? 254 GLN B C   1 
ATOM   4398 O O   . GLN B 1 258 ? 35.925 -0.758  10.614  1.00 36.13  ? 254 GLN B O   1 
ATOM   4399 C CB  . GLN B 1 258 ? 38.028 -1.901  12.912  1.00 41.95  ? 254 GLN B CB  1 
ATOM   4400 C CG  . GLN B 1 258 ? 38.699 -0.573  12.529  1.00 44.67  ? 254 GLN B CG  1 
ATOM   4401 C CD  . GLN B 1 258 ? 39.652 -0.065  13.622  1.00 50.57  ? 254 GLN B CD  1 
ATOM   4402 O OE1 . GLN B 1 258 ? 39.282 0.761   14.461  1.00 52.33  ? 254 GLN B OE1 1 
ATOM   4403 N NE2 . GLN B 1 258 ? 40.879 -0.576  13.619  1.00 51.20  ? 254 GLN B NE2 1 
ATOM   4404 N N   . PRO B 1 259 ? 34.926 -1.526  12.464  1.00 38.31  ? 255 PRO B N   1 
ATOM   4405 C CA  . PRO B 1 259 ? 33.765 -0.621  12.297  1.00 38.71  ? 255 PRO B CA  1 
ATOM   4406 C C   . PRO B 1 259 ? 34.215 0.840   12.177  1.00 39.18  ? 255 PRO B C   1 
ATOM   4407 O O   . PRO B 1 259 ? 35.136 1.268   12.868  1.00 38.69  ? 255 PRO B O   1 
ATOM   4408 C CB  . PRO B 1 259 ? 32.949 -0.866  13.558  1.00 37.80  ? 255 PRO B CB  1 
ATOM   4409 C CG  . PRO B 1 259 ? 33.247 -2.345  13.866  1.00 39.06  ? 255 PRO B CG  1 
ATOM   4410 C CD  . PRO B 1 259 ? 34.752 -2.424  13.620  1.00 36.14  ? 255 PRO B CD  1 
ATOM   4411 N N   . ILE B 1 260 ? 33.590 1.610   11.303  1.00 38.70  ? 256 ILE B N   1 
ATOM   4412 C CA  . ILE B 1 260 ? 34.015 2.998   11.184  1.00 39.59  ? 256 ILE B CA  1 
ATOM   4413 C C   . ILE B 1 260 ? 33.391 3.947   12.215  1.00 39.91  ? 256 ILE B C   1 
ATOM   4414 O O   . ILE B 1 260 ? 34.001 4.961   12.577  1.00 41.65  ? 256 ILE B O   1 
ATOM   4415 C CB  . ILE B 1 260 ? 33.757 3.563   9.766   1.00 41.14  ? 256 ILE B CB  1 
ATOM   4416 C CG1 . ILE B 1 260 ? 34.409 4.943   9.655   1.00 40.79  ? 256 ILE B CG1 1 
ATOM   4417 C CG2 . ILE B 1 260 ? 32.254 3.628   9.472   1.00 39.67  ? 256 ILE B CG2 1 
ATOM   4418 C CD1 . ILE B 1 260 ? 34.362 5.520   8.265   1.00 44.51  ? 256 ILE B CD1 1 
ATOM   4419 N N   . PHE B 1 261 ? 32.205 3.622   12.715  1.00 38.05  ? 257 PHE B N   1 
ATOM   4420 C CA  . PHE B 1 261 ? 31.549 4.505   13.694  1.00 37.57  ? 257 PHE B CA  1 
ATOM   4421 C C   . PHE B 1 261 ? 31.160 3.774   14.993  1.00 38.31  ? 257 PHE B C   1 
ATOM   4422 O O   . PHE B 1 261 ? 29.994 3.709   15.355  1.00 38.85  ? 257 PHE B O   1 
ATOM   4423 C CB  . PHE B 1 261 ? 30.301 5.150   13.062  1.00 34.98  ? 257 PHE B CB  1 
ATOM   4424 C CG  . PHE B 1 261 ? 30.585 5.996   11.835  1.00 34.98  ? 257 PHE B CG  1 
ATOM   4425 C CD1 . PHE B 1 261 ? 31.649 6.924   11.819  1.00 36.62  ? 257 PHE B CD1 1 
ATOM   4426 C CD2 . PHE B 1 261 ? 29.769 5.906   10.709  1.00 34.71  ? 257 PHE B CD2 1 
ATOM   4427 C CE1 . PHE B 1 261 ? 31.881 7.739   10.691  1.00 33.75  ? 257 PHE B CE1 1 
ATOM   4428 C CE2 . PHE B 1 261 ? 29.989 6.715   9.582   1.00 35.07  ? 257 PHE B CE2 1 
ATOM   4429 C CZ  . PHE B 1 261 ? 31.053 7.635   9.577   1.00 33.74  ? 257 PHE B CZ  1 
ATOM   4430 N N   . PRO B 1 262 ? 32.140 3.218   15.718  1.00 38.84  ? 258 PRO B N   1 
ATOM   4431 C CA  . PRO B 1 262 ? 31.804 2.513   16.954  1.00 37.53  ? 258 PRO B CA  1 
ATOM   4432 C C   . PRO B 1 262 ? 31.431 3.467   18.086  1.00 37.01  ? 258 PRO B C   1 
ATOM   4433 O O   . PRO B 1 262 ? 31.614 4.682   17.976  1.00 36.85  ? 258 PRO B O   1 
ATOM   4434 C CB  . PRO B 1 262 ? 33.090 1.740   17.257  1.00 39.59  ? 258 PRO B CB  1 
ATOM   4435 C CG  . PRO B 1 262 ? 34.154 2.763   16.877  1.00 39.50  ? 258 PRO B CG  1 
ATOM   4436 C CD  . PRO B 1 262 ? 33.608 3.302   15.538  1.00 40.18  ? 258 PRO B CD  1 
ATOM   4437 N N   . GLY B 1 263 ? 30.908 2.903   19.171  1.00 37.01  ? 259 GLY B N   1 
ATOM   4438 C CA  . GLY B 1 263 ? 30.516 3.682   20.340  1.00 36.47  ? 259 GLY B CA  1 
ATOM   4439 C C   . GLY B 1 263 ? 29.441 2.942   21.101  1.00 38.14  ? 259 GLY B C   1 
ATOM   4440 O O   . GLY B 1 263 ? 28.561 2.333   20.487  1.00 39.40  ? 259 GLY B O   1 
ATOM   4441 N N   . ASP B 1 264 ? 29.500 2.978   22.424  1.00 38.88  ? 260 ASP B N   1 
ATOM   4442 C CA  . ASP B 1 264 ? 28.523 2.293   23.253  1.00 42.02  ? 260 ASP B CA  1 
ATOM   4443 C C   . ASP B 1 264 ? 27.236 3.090   23.466  1.00 40.51  ? 260 ASP B C   1 
ATOM   4444 O O   . ASP B 1 264 ? 26.215 2.518   23.831  1.00 40.73  ? 260 ASP B O   1 
ATOM   4445 C CB  . ASP B 1 264 ? 29.143 1.931   24.602  1.00 48.19  ? 260 ASP B CB  1 
ATOM   4446 C CG  . ASP B 1 264 ? 30.280 0.922   24.466  1.00 54.51  ? 260 ASP B CG  1 
ATOM   4447 O OD1 . ASP B 1 264 ? 31.054 0.762   25.446  1.00 59.50  ? 260 ASP B OD1 1 
ATOM   4448 O OD2 . ASP B 1 264 ? 30.393 0.288   23.383  1.00 58.07  ? 260 ASP B OD2 1 
ATOM   4449 N N   . SER B 1 265 ? 27.285 4.401   23.243  1.00 38.74  ? 261 SER B N   1 
ATOM   4450 C CA  . SER B 1 265 ? 26.100 5.248   23.375  1.00 36.54  ? 261 SER B CA  1 
ATOM   4451 C C   . SER B 1 265 ? 25.897 6.002   22.066  1.00 35.55  ? 261 SER B C   1 
ATOM   4452 O O   . SER B 1 265 ? 26.823 6.116   21.257  1.00 34.55  ? 261 SER B O   1 
ATOM   4453 C CB  . SER B 1 265 ? 26.276 6.281   24.483  1.00 36.29  ? 261 SER B CB  1 
ATOM   4454 O OG  . SER B 1 265 ? 27.280 7.220   24.126  1.00 36.01  ? 261 SER B OG  1 
ATOM   4455 N N   . GLY B 1 266 ? 24.685 6.516   21.875  1.00 35.02  ? 262 GLY B N   1 
ATOM   4456 C CA  . GLY B 1 266 ? 24.386 7.292   20.690  1.00 36.10  ? 262 GLY B CA  1 
ATOM   4457 C C   . GLY B 1 266 ? 25.320 8.491   20.626  1.00 36.81  ? 262 GLY B C   1 
ATOM   4458 O O   . GLY B 1 266 ? 25.790 8.870   19.549  1.00 35.05  ? 262 GLY B O   1 
ATOM   4459 N N   . VAL B 1 267 ? 25.601 9.084   21.787  1.00 38.00  ? 263 VAL B N   1 
ATOM   4460 C CA  . VAL B 1 267 ? 26.515 10.224  21.853  1.00 39.75  ? 263 VAL B CA  1 
ATOM   4461 C C   . VAL B 1 267 ? 27.897 9.831   21.340  1.00 39.37  ? 263 VAL B C   1 
ATOM   4462 O O   . VAL B 1 267 ? 28.486 10.539  20.522  1.00 41.79  ? 263 VAL B O   1 
ATOM   4463 C CB  . VAL B 1 267 ? 26.664 10.768  23.323  1.00 42.22  ? 263 VAL B CB  1 
ATOM   4464 C CG1 . VAL B 1 267 ? 27.662 11.941  23.358  1.00 42.36  ? 263 VAL B CG1 1 
ATOM   4465 C CG2 . VAL B 1 267 ? 25.328 11.228  23.840  1.00 41.35  ? 263 VAL B CG2 1 
ATOM   4466 N N   . ASP B 1 268 ? 28.435 8.714   21.818  1.00 39.10  ? 264 ASP B N   1 
ATOM   4467 C CA  . ASP B 1 268 ? 29.756 8.307   21.355  1.00 40.31  ? 264 ASP B CA  1 
ATOM   4468 C C   . ASP B 1 268 ? 29.778 8.056   19.849  1.00 40.20  ? 264 ASP B C   1 
ATOM   4469 O O   . ASP B 1 268 ? 30.741 8.434   19.163  1.00 41.41  ? 264 ASP B O   1 
ATOM   4470 C CB  . ASP B 1 268 ? 30.251 7.069   22.106  1.00 41.22  ? 264 ASP B CB  1 
ATOM   4471 C CG  . ASP B 1 268 ? 30.501 7.350   23.576  1.00 47.15  ? 264 ASP B CG  1 
ATOM   4472 O OD1 . ASP B 1 268 ? 30.759 8.533   23.901  1.00 46.42  ? 264 ASP B OD1 1 
ATOM   4473 O OD2 . ASP B 1 268 ? 30.436 6.394   24.402  1.00 50.73  ? 264 ASP B OD2 1 
ATOM   4474 N N   . GLN B 1 269 ? 28.719 7.434   19.341  1.00 37.97  ? 265 GLN B N   1 
ATOM   4475 C CA  . GLN B 1 269 ? 28.612 7.149   17.906  1.00 38.54  ? 265 GLN B CA  1 
ATOM   4476 C C   . GLN B 1 269 ? 28.612 8.463   17.108  1.00 37.92  ? 265 GLN B C   1 
ATOM   4477 O O   . GLN B 1 269 ? 29.333 8.581   16.122  1.00 38.52  ? 265 GLN B O   1 
ATOM   4478 C CB  . GLN B 1 269 ? 27.322 6.347   17.618  1.00 35.92  ? 265 GLN B CB  1 
ATOM   4479 C CG  . GLN B 1 269 ? 27.415 4.900   18.083  1.00 39.84  ? 265 GLN B CG  1 
ATOM   4480 C CD  . GLN B 1 269 ? 26.045 4.205   18.277  1.00 41.21  ? 265 GLN B CD  1 
ATOM   4481 O OE1 . GLN B 1 269 ? 25.029 4.616   17.730  1.00 40.49  ? 265 GLN B OE1 1 
ATOM   4482 N NE2 . GLN B 1 269 ? 26.042 3.142   19.067  1.00 41.76  ? 265 GLN B NE2 1 
ATOM   4483 N N   . LEU B 1 270 ? 27.805 9.437   17.537  1.00 37.49  ? 266 LEU B N   1 
ATOM   4484 C CA  . LEU B 1 270 ? 27.729 10.728  16.849  1.00 38.99  ? 266 LEU B CA  1 
ATOM   4485 C C   . LEU B 1 270 ? 29.079 11.455  16.846  1.00 39.68  ? 266 LEU B C   1 
ATOM   4486 O O   . LEU B 1 270 ? 29.428 12.136  15.898  1.00 39.55  ? 266 LEU B O   1 
ATOM   4487 C CB  . LEU B 1 270 ? 26.644 11.602  17.484  1.00 38.21  ? 266 LEU B CB  1 
ATOM   4488 C CG  . LEU B 1 270 ? 25.204 11.166  17.194  1.00 40.88  ? 266 LEU B CG  1 
ATOM   4489 C CD1 . LEU B 1 270 ? 24.228 11.988  18.023  1.00 41.59  ? 266 LEU B CD1 1 
ATOM   4490 C CD2 . LEU B 1 270 ? 24.894 11.354  15.710  1.00 42.05  ? 266 LEU B CD2 1 
ATOM   4491 N N   . VAL B 1 271 ? 29.861 11.288  17.897  1.00 42.54  ? 267 VAL B N   1 
ATOM   4492 C CA  . VAL B 1 271 ? 31.173 11.921  17.932  1.00 43.12  ? 267 VAL B CA  1 
ATOM   4493 C C   . VAL B 1 271 ? 32.096 11.301  16.864  1.00 44.37  ? 267 VAL B C   1 
ATOM   4494 O O   . VAL B 1 271 ? 32.865 12.023  16.199  1.00 42.37  ? 267 VAL B O   1 
ATOM   4495 C CB  . VAL B 1 271 ? 31.788 11.798  19.354  1.00 43.62  ? 267 VAL B CB  1 
ATOM   4496 C CG1 . VAL B 1 271 ? 33.293 12.132  19.339  1.00 43.66  ? 267 VAL B CG1 1 
ATOM   4497 C CG2 . VAL B 1 271 ? 31.019 12.738  20.300  1.00 42.10  ? 267 VAL B CG2 1 
ATOM   4498 N N   . GLU B 1 272 ? 32.027 9.976   16.691  1.00 43.37  ? 268 GLU B N   1 
ATOM   4499 C CA  . GLU B 1 272 ? 32.861 9.329   15.678  1.00 42.48  ? 268 GLU B CA  1 
ATOM   4500 C C   . GLU B 1 272 ? 32.401 9.774   14.296  1.00 40.79  ? 268 GLU B C   1 
ATOM   4501 O O   . GLU B 1 272 ? 33.207 9.961   13.391  1.00 40.86  ? 268 GLU B O   1 
ATOM   4502 C CB  . GLU B 1 272 ? 32.783 7.803   15.792  1.00 43.60  ? 268 GLU B CB  1 
ATOM   4503 C CG  . GLU B 1 272 ? 33.334 7.276   17.099  1.00 47.23  ? 268 GLU B CG  1 
ATOM   4504 C CD  . GLU B 1 272 ? 34.772 7.733   17.342  1.00 49.78  ? 268 GLU B CD  1 
ATOM   4505 O OE1 . GLU B 1 272 ? 35.108 8.033   18.507  1.00 53.59  ? 268 GLU B OE1 1 
ATOM   4506 O OE2 . GLU B 1 272 ? 35.565 7.787   16.374  1.00 51.60  ? 268 GLU B OE2 1 
ATOM   4507 N N   . ILE B 1 273 ? 31.095 9.950   14.133  1.00 39.19  ? 269 ILE B N   1 
ATOM   4508 C CA  . ILE B 1 273 ? 30.570 10.391  12.853  1.00 39.26  ? 269 ILE B CA  1 
ATOM   4509 C C   . ILE B 1 273 ? 31.024 11.839  12.568  1.00 41.73  ? 269 ILE B C   1 
ATOM   4510 O O   . ILE B 1 273 ? 31.475 12.145  11.463  1.00 41.49  ? 269 ILE B O   1 
ATOM   4511 C CB  . ILE B 1 273 ? 29.036 10.305  12.820  1.00 36.62  ? 269 ILE B CB  1 
ATOM   4512 C CG1 . ILE B 1 273 ? 28.604 8.840   12.852  1.00 36.73  ? 269 ILE B CG1 1 
ATOM   4513 C CG2 . ILE B 1 273 ? 28.487 10.977  11.565  1.00 36.21  ? 269 ILE B CG2 1 
ATOM   4514 C CD1 . ILE B 1 273 ? 27.098 8.666   13.065  1.00 31.55  ? 269 ILE B CD1 1 
ATOM   4515 N N   . ILE B 1 274 ? 30.915 12.712  13.564  1.00 42.55  ? 270 ILE B N   1 
ATOM   4516 C CA  . ILE B 1 274 ? 31.327 14.106  13.402  1.00 44.96  ? 270 ILE B CA  1 
ATOM   4517 C C   . ILE B 1 274 ? 32.820 14.229  13.078  1.00 45.07  ? 270 ILE B C   1 
ATOM   4518 O O   . ILE B 1 274 ? 33.197 15.011  12.214  1.00 46.30  ? 270 ILE B O   1 
ATOM   4519 C CB  . ILE B 1 274 ? 30.924 14.936  14.658  1.00 44.96  ? 270 ILE B CB  1 
ATOM   4520 C CG1 . ILE B 1 274 ? 29.395 15.066  14.672  1.00 44.67  ? 270 ILE B CG1 1 
ATOM   4521 C CG2 . ILE B 1 274 ? 31.582 16.331  14.633  1.00 45.10  ? 270 ILE B CG2 1 
ATOM   4522 C CD1 . ILE B 1 274 ? 28.804 15.586  15.972  1.00 46.50  ? 270 ILE B CD1 1 
ATOM   4523 N N   . LYS B 1 275 ? 33.665 13.428  13.719  1.00 47.24  ? 271 LYS B N   1 
ATOM   4524 C CA  . LYS B 1 275 ? 35.093 13.472  13.414  1.00 49.11  ? 271 LYS B CA  1 
ATOM   4525 C C   . LYS B 1 275 ? 35.353 13.221  11.923  1.00 50.81  ? 271 LYS B C   1 
ATOM   4526 O O   . LYS B 1 275 ? 36.349 13.706  11.372  1.00 51.73  ? 271 LYS B O   1 
ATOM   4527 C CB  . LYS B 1 275 ? 35.861 12.422  14.210  1.00 49.95  ? 271 LYS B CB  1 
ATOM   4528 C CG  . LYS B 1 275 ? 35.960 12.682  15.702  1.00 51.04  ? 271 LYS B CG  1 
ATOM   4529 C CD  . LYS B 1 275 ? 36.736 11.556  16.354  1.00 52.58  ? 271 LYS B CD  1 
ATOM   4530 C CE  . LYS B 1 275 ? 36.891 11.758  17.837  1.00 55.62  ? 271 LYS B CE  1 
ATOM   4531 N NZ  . LYS B 1 275 ? 37.428 10.517  18.495  1.00 57.99  ? 271 LYS B NZ  1 
ATOM   4532 N N   . VAL B 1 276 ? 34.476 12.464  11.259  1.00 49.46  ? 272 VAL B N   1 
ATOM   4533 C CA  . VAL B 1 276 ? 34.711 12.200  9.847   1.00 48.14  ? 272 VAL B CA  1 
ATOM   4534 C C   . VAL B 1 276 ? 33.934 13.133  8.935   1.00 49.32  ? 272 VAL B C   1 
ATOM   4535 O O   . VAL B 1 276 ? 34.506 13.708  8.022   1.00 49.38  ? 272 VAL B O   1 
ATOM   4536 C CB  . VAL B 1 276 ? 34.386 10.731  9.477   1.00 47.36  ? 272 VAL B CB  1 
ATOM   4537 C CG1 . VAL B 1 276 ? 34.487 10.529  7.968   1.00 46.83  ? 272 VAL B CG1 1 
ATOM   4538 C CG2 . VAL B 1 276 ? 35.355 9.801   10.185  1.00 46.38  ? 272 VAL B CG2 1 
ATOM   4539 N N   . LEU B 1 277 ? 32.641 13.304  9.186   1.00 49.23  ? 273 LEU B N   1 
ATOM   4540 C CA  . LEU B 1 277 ? 31.822 14.156  8.335   1.00 51.28  ? 273 LEU B CA  1 
ATOM   4541 C C   . LEU B 1 277 ? 31.862 15.623  8.713   1.00 52.69  ? 273 LEU B C   1 
ATOM   4542 O O   . LEU B 1 277 ? 31.428 16.467  7.939   1.00 52.61  ? 273 LEU B O   1 
ATOM   4543 C CB  . LEU B 1 277 ? 30.348 13.726  8.358   1.00 49.07  ? 273 LEU B CB  1 
ATOM   4544 C CG  . LEU B 1 277 ? 29.965 12.276  8.041   1.00 50.06  ? 273 LEU B CG  1 
ATOM   4545 C CD1 . LEU B 1 277 ? 28.472 12.220  7.668   1.00 47.80  ? 273 LEU B CD1 1 
ATOM   4546 C CD2 . LEU B 1 277 ? 30.803 11.769  6.907   1.00 49.53  ? 273 LEU B CD2 1 
ATOM   4547 N N   . GLY B 1 278 ? 32.368 15.933  9.897   1.00 53.81  ? 274 GLY B N   1 
ATOM   4548 C CA  . GLY B 1 278 ? 32.370 17.320  10.314  1.00 55.11  ? 274 GLY B CA  1 
ATOM   4549 C C   . GLY B 1 278 ? 31.049 17.590  11.008  1.00 56.43  ? 274 GLY B C   1 
ATOM   4550 O O   . GLY B 1 278 ? 30.127 16.767  10.958  1.00 57.22  ? 274 GLY B O   1 
ATOM   4551 N N   . THR B 1 279 ? 30.946 18.738  11.663  1.00 56.79  ? 275 THR B N   1 
ATOM   4552 C CA  . THR B 1 279 ? 29.734 19.092  12.388  1.00 57.46  ? 275 THR B CA  1 
ATOM   4553 C C   . THR B 1 279 ? 28.548 19.341  11.482  1.00 58.26  ? 275 THR B C   1 
ATOM   4554 O O   . THR B 1 279 ? 28.637 20.094  10.516  1.00 58.84  ? 275 THR B O   1 
ATOM   4555 C CB  . THR B 1 279 ? 29.959 20.348  13.264  1.00 58.16  ? 275 THR B CB  1 
ATOM   4556 O OG1 . THR B 1 279 ? 30.958 20.061  14.248  1.00 57.75  ? 275 THR B OG1 1 
ATOM   4557 C CG2 . THR B 1 279 ? 28.668 20.754  13.970  1.00 56.61  ? 275 THR B CG2 1 
ATOM   4558 N N   . PRO B 1 280 ? 27.410 18.706  11.788  1.00 58.91  ? 276 PRO B N   1 
ATOM   4559 C CA  . PRO B 1 280 ? 26.185 18.856  11.003  1.00 60.44  ? 276 PRO B CA  1 
ATOM   4560 C C   . PRO B 1 280 ? 25.753 20.315  11.014  1.00 63.05  ? 276 PRO B C   1 
ATOM   4561 O O   . PRO B 1 280 ? 25.822 20.957  12.054  1.00 63.68  ? 276 PRO B O   1 
ATOM   4562 C CB  . PRO B 1 280 ? 25.167 18.003  11.761  1.00 59.21  ? 276 PRO B CB  1 
ATOM   4563 C CG  . PRO B 1 280 ? 25.994 17.073  12.572  1.00 59.63  ? 276 PRO B CG  1 
ATOM   4564 C CD  . PRO B 1 280 ? 27.184 17.862  12.972  1.00 59.05  ? 276 PRO B CD  1 
ATOM   4565 N N   . THR B 1 281 ? 25.305 20.837  9.875   1.00 65.89  ? 277 THR B N   1 
ATOM   4566 C CA  . THR B 1 281 ? 24.824 22.214  9.829   1.00 67.60  ? 277 THR B CA  1 
ATOM   4567 C C   . THR B 1 281 ? 23.437 22.164  10.449  1.00 70.15  ? 277 THR B C   1 
ATOM   4568 O O   . THR B 1 281 ? 22.858 21.081  10.600  1.00 70.19  ? 277 THR B O   1 
ATOM   4569 C CB  . THR B 1 281 ? 24.709 22.765  8.383   1.00 66.67  ? 277 THR B CB  1 
ATOM   4570 O OG1 . THR B 1 281 ? 23.609 22.144  7.704   1.00 65.73  ? 277 THR B OG1 1 
ATOM   4571 C CG2 . THR B 1 281 ? 26.001 22.506  7.611   1.00 66.26  ? 277 THR B CG2 1 
ATOM   4572 N N   . ARG B 1 282 ? 22.903 23.322  10.819  1.00 72.81  ? 278 ARG B N   1 
ATOM   4573 C CA  . ARG B 1 282 ? 21.581 23.357  11.435  1.00 75.24  ? 278 ARG B CA  1 
ATOM   4574 C C   . ARG B 1 282 ? 20.556 22.780  10.468  1.00 74.54  ? 278 ARG B C   1 
ATOM   4575 O O   . ARG B 1 282 ? 19.590 22.125  10.879  1.00 74.41  ? 278 ARG B O   1 
ATOM   4576 C CB  . ARG B 1 282 ? 21.189 24.790  11.788  1.00 78.28  ? 278 ARG B CB  1 
ATOM   4577 C CG  . ARG B 1 282 ? 19.900 24.888  12.599  1.00 83.27  ? 278 ARG B CG  1 
ATOM   4578 C CD  . ARG B 1 282 ? 19.296 26.280  12.465  1.00 87.49  ? 278 ARG B CD  1 
ATOM   4579 N NE  . ARG B 1 282 ? 20.295 27.324  12.691  1.00 90.73  ? 278 ARG B NE  1 
ATOM   4580 C CZ  . ARG B 1 282 ? 20.072 28.623  12.519  1.00 92.15  ? 278 ARG B CZ  1 
ATOM   4581 N NH1 . ARG B 1 282 ? 18.876 29.045  12.115  1.00 92.58  ? 278 ARG B NH1 1 
ATOM   4582 N NH2 . ARG B 1 282 ? 21.045 29.500  12.753  1.00 92.88  ? 278 ARG B NH2 1 
ATOM   4583 N N   . GLU B 1 283 ? 20.779 23.032  9.183   1.00 73.75  ? 279 GLU B N   1 
ATOM   4584 C CA  . GLU B 1 283 ? 19.883 22.547  8.149   1.00 73.67  ? 279 GLU B CA  1 
ATOM   4585 C C   . GLU B 1 283 ? 19.933 21.019  8.052   1.00 72.05  ? 279 GLU B C   1 
ATOM   4586 O O   . GLU B 1 283 ? 18.896 20.365  7.935   1.00 72.17  ? 279 GLU B O   1 
ATOM   4587 C CB  . GLU B 1 283 ? 20.247 23.177  6.800   1.00 75.06  ? 279 GLU B CB  1 
ATOM   4588 C CG  . GLU B 1 283 ? 19.204 22.950  5.707   1.00 77.30  ? 279 GLU B CG  1 
ATOM   4589 C CD  . GLU B 1 283 ? 17.774 23.100  6.221   1.00 79.34  ? 279 GLU B CD  1 
ATOM   4590 O OE1 . GLU B 1 283 ? 17.507 24.056  6.985   1.00 80.69  ? 279 GLU B OE1 1 
ATOM   4591 O OE2 . GLU B 1 283 ? 16.912 22.264  5.858   1.00 79.91  ? 279 GLU B OE2 1 
ATOM   4592 N N   . GLN B 1 284 ? 21.138 20.458  8.102   1.00 69.78  ? 280 GLN B N   1 
ATOM   4593 C CA  . GLN B 1 284 ? 21.304 19.013  8.030   1.00 67.87  ? 280 GLN B CA  1 
ATOM   4594 C C   . GLN B 1 284 ? 20.582 18.334  9.190   1.00 67.65  ? 280 GLN B C   1 
ATOM   4595 O O   . GLN B 1 284 ? 19.893 17.330  9.003   1.00 67.45  ? 280 GLN B O   1 
ATOM   4596 C CB  . GLN B 1 284 ? 22.790 18.656  8.027   1.00 66.30  ? 280 GLN B CB  1 
ATOM   4597 C CG  . GLN B 1 284 ? 23.479 19.059  6.736   1.00 64.60  ? 280 GLN B CG  1 
ATOM   4598 C CD  . GLN B 1 284 ? 24.972 18.872  6.784   1.00 64.50  ? 280 GLN B CD  1 
ATOM   4599 O OE1 . GLN B 1 284 ? 25.628 19.287  7.744   1.00 64.56  ? 280 GLN B OE1 1 
ATOM   4600 N NE2 . GLN B 1 284 ? 25.529 18.258  5.740   1.00 63.36  ? 280 GLN B NE2 1 
ATOM   4601 N N   . ILE B 1 285 ? 20.724 18.892  10.385  1.00 67.44  ? 281 ILE B N   1 
ATOM   4602 C CA  . ILE B 1 285 ? 20.057 18.340  11.552  1.00 67.46  ? 281 ILE B CA  1 
ATOM   4603 C C   . ILE B 1 285 ? 18.550 18.332  11.324  1.00 68.00  ? 281 ILE B C   1 
ATOM   4604 O O   . ILE B 1 285 ? 17.859 17.377  11.681  1.00 67.08  ? 281 ILE B O   1 
ATOM   4605 C CB  . ILE B 1 285 ? 20.367 19.170  12.800  1.00 67.74  ? 281 ILE B CB  1 
ATOM   4606 C CG1 . ILE B 1 285 ? 21.847 19.024  13.144  1.00 67.82  ? 281 ILE B CG1 1 
ATOM   4607 C CG2 . ILE B 1 285 ? 19.484 18.725  13.952  1.00 67.34  ? 281 ILE B CG2 1 
ATOM   4608 C CD1 . ILE B 1 285 ? 22.307 19.884  14.286  1.00 68.67  ? 281 ILE B CD1 1 
ATOM   4609 N N   . ARG B 1 286 ? 18.050 19.407  10.723  1.00 69.36  ? 282 ARG B N   1 
ATOM   4610 C CA  . ARG B 1 286 ? 16.629 19.541  10.436  1.00 70.14  ? 282 ARG B CA  1 
ATOM   4611 C C   . ARG B 1 286 ? 16.157 18.407  9.529   1.00 69.10  ? 282 ARG B C   1 
ATOM   4612 O O   . ARG B 1 286 ? 15.119 17.796  9.770   1.00 67.33  ? 282 ARG B O   1 
ATOM   4613 C CB  . ARG B 1 286 ? 16.358 20.893  9.759   1.00 73.28  ? 282 ARG B CB  1 
ATOM   4614 C CG  . ARG B 1 286 ? 14.931 21.060  9.230   1.00 76.85  ? 282 ARG B CG  1 
ATOM   4615 C CD  . ARG B 1 286 ? 14.752 22.379  8.488   1.00 81.36  ? 282 ARG B CD  1 
ATOM   4616 N NE  . ARG B 1 286 ? 14.966 23.522  9.375   1.00 85.20  ? 282 ARG B NE  1 
ATOM   4617 C CZ  . ARG B 1 286 ? 14.876 24.797  9.000   1.00 87.56  ? 282 ARG B CZ  1 
ATOM   4618 N NH1 . ARG B 1 286 ? 14.574 25.104  7.738   1.00 88.62  ? 282 ARG B NH1 1 
ATOM   4619 N NH2 . ARG B 1 286 ? 15.080 25.767  9.890   1.00 87.63  ? 282 ARG B NH2 1 
ATOM   4620 N N   . GLU B 1 287 ? 16.934 18.136  8.484   1.00 68.54  ? 283 GLU B N   1 
ATOM   4621 C CA  . GLU B 1 287 ? 16.605 17.081  7.527   1.00 68.90  ? 283 GLU B CA  1 
ATOM   4622 C C   . GLU B 1 287 ? 16.656 15.666  8.108   1.00 67.48  ? 283 GLU B C   1 
ATOM   4623 O O   . GLU B 1 287 ? 15.919 14.785  7.663   1.00 66.52  ? 283 GLU B O   1 
ATOM   4624 C CB  . GLU B 1 287 ? 17.531 17.189  6.321   1.00 70.49  ? 283 GLU B CB  1 
ATOM   4625 C CG  . GLU B 1 287 ? 17.322 18.474  5.548   1.00 72.99  ? 283 GLU B CG  1 
ATOM   4626 C CD  . GLU B 1 287 ? 18.371 18.699  4.492   1.00 75.19  ? 283 GLU B CD  1 
ATOM   4627 O OE1 . GLU B 1 287 ? 19.570 18.704  4.854   1.00 76.09  ? 283 GLU B OE1 1 
ATOM   4628 O OE2 . GLU B 1 287 ? 17.998 18.877  3.306   1.00 76.81  ? 283 GLU B OE2 1 
ATOM   4629 N N   . MET B 1 288 ? 17.527 15.449  9.089   1.00 66.79  ? 284 MET B N   1 
ATOM   4630 C CA  . MET B 1 288 ? 17.636 14.138  9.731   1.00 66.49  ? 284 MET B CA  1 
ATOM   4631 C C   . MET B 1 288 ? 16.432 13.906  10.637  1.00 68.67  ? 284 MET B C   1 
ATOM   4632 O O   . MET B 1 288 ? 15.734 12.902  10.517  1.00 67.68  ? 284 MET B O   1 
ATOM   4633 C CB  . MET B 1 288 ? 18.930 14.050  10.533  1.00 62.32  ? 284 MET B CB  1 
ATOM   4634 C CG  . MET B 1 288 ? 20.157 14.020  9.641   1.00 59.24  ? 284 MET B CG  1 
ATOM   4635 S SD  . MET B 1 288 ? 21.718 13.691  10.464  1.00 55.23  ? 284 MET B SD  1 
ATOM   4636 C CE  . MET B 1 288 ? 22.273 15.358  10.851  1.00 55.34  ? 284 MET B CE  1 
ATOM   4637 N N   . ASN B 1 289 ? 16.188 14.846  11.543  1.00 71.96  ? 285 ASN B N   1 
ATOM   4638 C CA  . ASN B 1 289 ? 15.052 14.745  12.454  1.00 75.17  ? 285 ASN B CA  1 
ATOM   4639 C C   . ASN B 1 289 ? 14.431 16.113  12.664  1.00 78.16  ? 285 ASN B C   1 
ATOM   4640 O O   . ASN B 1 289 ? 14.973 16.953  13.397  1.00 77.05  ? 285 ASN B O   1 
ATOM   4641 C CB  . ASN B 1 289 ? 15.459 14.164  13.807  1.00 74.56  ? 285 ASN B CB  1 
ATOM   4642 C CG  . ASN B 1 289 ? 14.275 14.014  14.749  1.00 74.77  ? 285 ASN B CG  1 
ATOM   4643 O OD1 . ASN B 1 289 ? 13.124 13.986  14.314  1.00 74.79  ? 285 ASN B OD1 1 
ATOM   4644 N ND2 . ASN B 1 289 ? 14.551 13.903  16.039  1.00 73.92  ? 285 ASN B ND2 1 
ATOM   4645 N N   . PRO B 1 290 ? 13.279 16.351  12.011  1.00 81.20  ? 286 PRO B N   1 
ATOM   4646 C CA  . PRO B 1 290 ? 12.503 17.593  12.061  1.00 83.81  ? 286 PRO B CA  1 
ATOM   4647 C C   . PRO B 1 290 ? 12.296 18.057  13.502  1.00 86.65  ? 286 PRO B C   1 
ATOM   4648 O O   . PRO B 1 290 ? 12.282 19.257  13.791  1.00 86.62  ? 286 PRO B O   1 
ATOM   4649 C CB  . PRO B 1 290 ? 11.186 17.196  11.398  1.00 83.43  ? 286 PRO B CB  1 
ATOM   4650 C CG  . PRO B 1 290 ? 11.607 16.166  10.404  1.00 82.39  ? 286 PRO B CG  1 
ATOM   4651 C CD  . PRO B 1 290 ? 12.580 15.335  11.200  1.00 81.58  ? 286 PRO B CD  1 
ATOM   4652 N N   . ASN B 1 291 ? 12.154 17.086  14.400  1.00 89.44  ? 287 ASN B N   1 
ATOM   4653 C CA  . ASN B 1 291 ? 11.920 17.368  15.806  1.00 92.49  ? 287 ASN B CA  1 
ATOM   4654 C C   . ASN B 1 291 ? 13.148 17.133  16.677  1.00 94.24  ? 287 ASN B C   1 
ATOM   4655 O O   . ASN B 1 291 ? 13.057 16.440  17.690  1.00 94.93  ? 287 ASN B O   1 
ATOM   4656 C CB  . ASN B 1 291 ? 10.766 16.495  16.317  1.00 93.43  ? 287 ASN B CB  1 
ATOM   4657 C CG  . ASN B 1 291 ? 9.555  16.524  15.397  1.00 94.45  ? 287 ASN B CG  1 
ATOM   4658 O OD1 . ASN B 1 291 ? 9.621  16.081  14.248  1.00 95.27  ? 287 ASN B OD1 1 
ATOM   4659 N ND2 . ASN B 1 291 ? 8.440  17.049  15.900  1.00 94.83  ? 287 ASN B ND2 1 
ATOM   4660 N N   . TYR B 1 292 ? 14.292 17.701  16.306  1.00 96.27  ? 288 TYR B N   1 
ATOM   4661 C CA  . TYR B 1 292 ? 15.490 17.502  17.119  1.00 98.61  ? 288 TYR B CA  1 
ATOM   4662 C C   . TYR B 1 292 ? 15.353 18.252  18.447  1.00 99.25  ? 288 TYR B C   1 
ATOM   4663 O O   . TYR B 1 292 ? 14.766 19.336  18.500  1.00 99.29  ? 288 TYR B O   1 
ATOM   4664 C CB  . TYR B 1 292 ? 16.750 17.935  16.351  1.00 99.82  ? 288 TYR B CB  1 
ATOM   4665 C CG  . TYR B 1 292 ? 16.895 19.418  16.078  1.00 101.52 ? 288 TYR B CG  1 
ATOM   4666 C CD1 . TYR B 1 292 ? 17.522 20.262  17.002  1.00 101.72 ? 288 TYR B CD1 1 
ATOM   4667 C CD2 . TYR B 1 292 ? 16.454 19.971  14.871  1.00 102.19 ? 288 TYR B CD2 1 
ATOM   4668 C CE1 . TYR B 1 292 ? 17.714 21.617  16.726  1.00 102.50 ? 288 TYR B CE1 1 
ATOM   4669 C CE2 . TYR B 1 292 ? 16.639 21.327  14.585  1.00 102.73 ? 288 TYR B CE2 1 
ATOM   4670 C CZ  . TYR B 1 292 ? 17.272 22.142  15.515  1.00 103.02 ? 288 TYR B CZ  1 
ATOM   4671 O OH  . TYR B 1 292 ? 17.482 23.474  15.224  1.00 103.56 ? 288 TYR B OH  1 
ATOM   4672 N N   . THR B 1 293 ? 15.880 17.656  19.516  1.00 99.78  ? 289 THR B N   1 
ATOM   4673 C CA  . THR B 1 293 ? 15.793 18.234  20.857  1.00 100.40 ? 289 THR B CA  1 
ATOM   4674 C C   . THR B 1 293 ? 16.873 19.262  21.197  1.00 100.99 ? 289 THR B C   1 
ATOM   4675 O O   . THR B 1 293 ? 16.686 20.077  22.102  1.00 101.35 ? 289 THR B O   1 
ATOM   4676 C CB  . THR B 1 293 ? 15.809 17.120  21.930  1.00 99.99  ? 289 THR B CB  1 
ATOM   4677 O OG1 . THR B 1 293 ? 14.685 16.257  21.734  1.00 99.80  ? 289 THR B OG1 1 
ATOM   4678 C CG2 . THR B 1 293 ? 15.727 17.709  23.323  1.00 99.70  ? 289 THR B CG2 1 
ATOM   4679 N N   . GLU B 1 294 ? 17.993 19.218  20.478  1.00 101.20 ? 290 GLU B N   1 
ATOM   4680 C CA  . GLU B 1 294 ? 19.114 20.143  20.685  1.00 101.49 ? 290 GLU B CA  1 
ATOM   4681 C C   . GLU B 1 294 ? 20.147 19.679  21.695  1.00 100.68 ? 290 GLU B C   1 
ATOM   4682 O O   . GLU B 1 294 ? 19.856 19.488  22.876  1.00 99.95  ? 290 GLU B O   1 
ATOM   4683 C CB  . GLU B 1 294 ? 18.624 21.534  21.091  1.00 102.97 ? 290 GLU B CB  1 
ATOM   4684 C CG  . GLU B 1 294 ? 18.235 22.421  19.925  1.00 105.37 ? 290 GLU B CG  1 
ATOM   4685 C CD  . GLU B 1 294 ? 17.552 23.692  20.380  1.00 106.62 ? 290 GLU B CD  1 
ATOM   4686 O OE1 . GLU B 1 294 ? 18.180 24.471  21.130  1.00 107.45 ? 290 GLU B OE1 1 
ATOM   4687 O OE2 . GLU B 1 294 ? 16.384 23.910  19.990  1.00 107.59 ? 290 GLU B OE2 1 
ATOM   4688 N N   . PHE B 1 295 ? 21.368 19.520  21.205  1.00 100.30 ? 291 PHE B N   1 
ATOM   4689 C CA  . PHE B 1 295 ? 22.488 19.086  22.020  1.00 99.91  ? 291 PHE B CA  1 
ATOM   4690 C C   . PHE B 1 295 ? 23.667 19.936  21.575  1.00 99.62  ? 291 PHE B C   1 
ATOM   4691 O O   . PHE B 1 295 ? 23.686 20.451  20.454  1.00 99.09  ? 291 PHE B O   1 
ATOM   4692 C CB  . PHE B 1 295 ? 22.781 17.604  21.768  1.00 99.43  ? 291 PHE B CB  1 
ATOM   4693 C CG  . PHE B 1 295 ? 23.471 16.907  22.913  1.00 99.45  ? 291 PHE B CG  1 
ATOM   4694 C CD1 . PHE B 1 295 ? 22.894 16.880  24.182  1.00 99.67  ? 291 PHE B CD1 1 
ATOM   4695 C CD2 . PHE B 1 295 ? 24.677 16.239  22.714  1.00 99.15  ? 291 PHE B CD2 1 
ATOM   4696 C CE1 . PHE B 1 295 ? 23.507 16.194  25.235  1.00 99.03  ? 291 PHE B CE1 1 
ATOM   4697 C CE2 . PHE B 1 295 ? 25.297 15.550  23.761  1.00 98.72  ? 291 PHE B CE2 1 
ATOM   4698 C CZ  . PHE B 1 295 ? 24.711 15.528  25.021  1.00 98.37  ? 291 PHE B CZ  1 
ATOM   4699 N N   . LYS B 1 296 ? 24.640 20.093  22.458  1.00 99.40  ? 292 LYS B N   1 
ATOM   4700 C CA  . LYS B 1 296 ? 25.806 20.887  22.139  1.00 99.34  ? 292 LYS B CA  1 
ATOM   4701 C C   . LYS B 1 296 ? 26.930 19.968  21.692  1.00 99.30  ? 292 LYS B C   1 
ATOM   4702 O O   . LYS B 1 296 ? 27.477 19.203  22.486  1.00 99.57  ? 292 LYS B O   1 
ATOM   4703 C CB  . LYS B 1 296 ? 26.229 21.698  23.354  1.00 99.38  ? 292 LYS B CB  1 
ATOM   4704 N N   . PHE B 1 297 ? 27.260 20.037  20.410  1.00 98.91  ? 293 PHE B N   1 
ATOM   4705 C CA  . PHE B 1 297 ? 28.326 19.216  19.862  1.00 98.63  ? 293 PHE B CA  1 
ATOM   4706 C C   . PHE B 1 297 ? 29.530 20.066  19.496  1.00 98.89  ? 293 PHE B C   1 
ATOM   4707 O O   . PHE B 1 297 ? 29.386 21.146  18.921  1.00 98.54  ? 293 PHE B O   1 
ATOM   4708 C CB  . PHE B 1 297 ? 27.846 18.473  18.617  1.00 97.69  ? 293 PHE B CB  1 
ATOM   4709 C CG  . PHE B 1 297 ? 27.041 17.250  18.915  1.00 96.81  ? 293 PHE B CG  1 
ATOM   4710 C CD1 . PHE B 1 297 ? 25.722 17.146  18.479  1.00 96.43  ? 293 PHE B CD1 1 
ATOM   4711 C CD2 . PHE B 1 297 ? 27.605 16.187  19.618  1.00 96.35  ? 293 PHE B CD2 1 
ATOM   4712 C CE1 . PHE B 1 297 ? 24.975 15.998  18.737  1.00 95.88  ? 293 PHE B CE1 1 
ATOM   4713 C CE2 . PHE B 1 297 ? 26.869 15.032  19.883  1.00 95.85  ? 293 PHE B CE2 1 
ATOM   4714 C CZ  . PHE B 1 297 ? 25.551 14.937  19.441  1.00 95.86  ? 293 PHE B CZ  1 
ATOM   4715 N N   . PRO B 1 298 ? 30.736 19.593  19.844  1.00 99.26  ? 294 PRO B N   1 
ATOM   4716 C CA  . PRO B 1 298 ? 31.970 20.319  19.536  1.00 99.63  ? 294 PRO B CA  1 
ATOM   4717 C C   . PRO B 1 298 ? 32.065 20.553  18.027  1.00 99.91  ? 294 PRO B C   1 
ATOM   4718 O O   . PRO B 1 298 ? 32.073 19.600  17.243  1.00 99.68  ? 294 PRO B O   1 
ATOM   4719 C CB  . PRO B 1 298 ? 33.055 19.378  20.052  1.00 99.49  ? 294 PRO B CB  1 
ATOM   4720 C CG  . PRO B 1 298 ? 32.398 18.762  21.247  1.00 99.58  ? 294 PRO B CG  1 
ATOM   4721 C CD  . PRO B 1 298 ? 31.011 18.444  20.725  1.00 99.60  ? 294 PRO B CD  1 
ATOM   4722 N N   . GLN B 1 299 ? 32.125 21.822  17.629  1.00 100.02 ? 295 GLN B N   1 
ATOM   4723 C CA  . GLN B 1 299 ? 32.204 22.179  16.218  1.00 99.80  ? 295 GLN B CA  1 
ATOM   4724 C C   . GLN B 1 299 ? 33.547 21.740  15.635  1.00 99.08  ? 295 GLN B C   1 
ATOM   4725 O O   . GLN B 1 299 ? 34.588 22.337  15.909  1.00 99.20  ? 295 GLN B O   1 
ATOM   4726 C CB  . GLN B 1 299 ? 32.005 23.689  16.045  1.00 100.29 ? 295 GLN B CB  1 
ATOM   4727 C CG  . GLN B 1 299 ? 31.393 24.093  14.705  1.00 101.11 ? 295 GLN B CG  1 
ATOM   4728 C CD  . GLN B 1 299 ? 30.987 25.559  14.674  1.00 102.00 ? 295 GLN B CD  1 
ATOM   4729 O OE1 . GLN B 1 299 ? 30.241 26.025  15.537  1.00 101.95 ? 295 GLN B OE1 1 
ATOM   4730 N NE2 . GLN B 1 299 ? 31.475 26.292  13.677  1.00 102.15 ? 295 GLN B NE2 1 
ATOM   4731 N N   . ILE B 1 300 ? 33.503 20.670  14.848  1.00 98.21  ? 296 ILE B N   1 
ATOM   4732 C CA  . ILE B 1 300 ? 34.683 20.111  14.207  1.00 97.16  ? 296 ILE B CA  1 
ATOM   4733 C C   . ILE B 1 300 ? 34.457 20.167  12.706  1.00 96.57  ? 296 ILE B C   1 
ATOM   4734 O O   . ILE B 1 300 ? 33.340 19.959  12.230  1.00 95.89  ? 296 ILE B O   1 
ATOM   4735 C CB  . ILE B 1 300 ? 34.914 18.641  14.657  1.00 97.14  ? 296 ILE B CB  1 
ATOM   4736 C CG1 . ILE B 1 300 ? 35.275 18.609  16.149  1.00 97.03  ? 296 ILE B CG1 1 
ATOM   4737 C CG2 . ILE B 1 300 ? 36.007 17.999  13.823  1.00 96.93  ? 296 ILE B CG2 1 
ATOM   4738 C CD1 . ILE B 1 300 ? 35.396 17.221  16.741  1.00 96.47  ? 296 ILE B CD1 1 
ATOM   4739 N N   . LYS B 1 301 ? 35.515 20.462  11.960  1.00 96.15  ? 297 LYS B N   1 
ATOM   4740 C CA  . LYS B 1 301 ? 35.403 20.553  10.512  1.00 95.58  ? 297 LYS B CA  1 
ATOM   4741 C C   . LYS B 1 301 ? 35.881 19.288  9.803   1.00 94.63  ? 297 LYS B C   1 
ATOM   4742 O O   . LYS B 1 301 ? 36.886 18.678  10.181  1.00 95.04  ? 297 LYS B O   1 
ATOM   4743 C CB  . LYS B 1 301 ? 36.147 21.799  10.016  1.00 95.96  ? 297 LYS B CB  1 
ATOM   4744 C CG  . LYS B 1 301 ? 35.533 23.078  10.589  1.00 96.85  ? 297 LYS B CG  1 
ATOM   4745 C CD  . LYS B 1 301 ? 36.216 24.356  10.134  1.00 97.37  ? 297 LYS B CD  1 
ATOM   4746 C CE  . LYS B 1 301 ? 35.542 25.569  10.776  1.00 97.34  ? 297 LYS B CE  1 
ATOM   4747 N NZ  . LYS B 1 301 ? 36.200 26.862  10.430  1.00 96.93  ? 297 LYS B NZ  1 
ATOM   4748 N N   . ALA B 1 302 ? 35.116 18.906  8.784   1.00 93.13  ? 298 ALA B N   1 
ATOM   4749 C CA  . ALA B 1 302 ? 35.345 17.715  7.968   1.00 91.75  ? 298 ALA B CA  1 
ATOM   4750 C C   . ALA B 1 302 ? 36.765 17.156  7.899   1.00 90.51  ? 298 ALA B C   1 
ATOM   4751 O O   . ALA B 1 302 ? 37.704 17.860  7.524   1.00 90.14  ? 298 ALA B O   1 
ATOM   4752 C CB  . ALA B 1 302 ? 34.831 17.971  6.547   1.00 91.86  ? 298 ALA B CB  1 
ATOM   4753 N N   . HIS B 1 303 ? 36.908 15.880  8.255   1.00 88.88  ? 299 HIS B N   1 
ATOM   4754 C CA  . HIS B 1 303 ? 38.199 15.199  8.192   1.00 87.56  ? 299 HIS B CA  1 
ATOM   4755 C C   . HIS B 1 303 ? 38.342 14.603  6.785   1.00 85.56  ? 299 HIS B C   1 
ATOM   4756 O O   . HIS B 1 303 ? 37.544 13.753  6.374   1.00 86.08  ? 299 HIS B O   1 
ATOM   4757 C CB  . HIS B 1 303 ? 38.278 14.075  9.228   1.00 88.86  ? 299 HIS B CB  1 
ATOM   4758 C CG  . HIS B 1 303 ? 39.578 13.333  9.212   1.00 90.54  ? 299 HIS B CG  1 
ATOM   4759 N ND1 . HIS B 1 303 ? 40.762 13.895  9.641   1.00 91.52  ? 299 HIS B ND1 1 
ATOM   4760 C CD2 . HIS B 1 303 ? 39.889 12.085  8.785   1.00 91.27  ? 299 HIS B CD2 1 
ATOM   4761 C CE1 . HIS B 1 303 ? 41.746 13.027  9.479   1.00 91.75  ? 299 HIS B CE1 1 
ATOM   4762 N NE2 . HIS B 1 303 ? 41.243 11.921  8.960   1.00 91.87  ? 299 HIS B NE2 1 
ATOM   4763 N N   . PRO B 1 304 ? 39.375 15.025  6.038   1.00 83.04  ? 300 PRO B N   1 
ATOM   4764 C CA  . PRO B 1 304 ? 39.564 14.503  4.683   1.00 80.48  ? 300 PRO B CA  1 
ATOM   4765 C C   . PRO B 1 304 ? 39.304 13.005  4.601   1.00 77.53  ? 300 PRO B C   1 
ATOM   4766 O O   . PRO B 1 304 ? 40.019 12.202  5.201   1.00 76.92  ? 300 PRO B O   1 
ATOM   4767 C CB  . PRO B 1 304 ? 41.013 14.878  4.368   1.00 81.39  ? 300 PRO B CB  1 
ATOM   4768 C CG  . PRO B 1 304 ? 41.659 14.924  5.720   1.00 82.22  ? 300 PRO B CG  1 
ATOM   4769 C CD  . PRO B 1 304 ? 40.617 15.641  6.533   1.00 82.67  ? 300 PRO B CD  1 
ATOM   4770 N N   . TRP B 1 305 ? 38.259 12.638  3.865   1.00 74.07  ? 301 TRP B N   1 
ATOM   4771 C CA  . TRP B 1 305 ? 37.910 11.238  3.715   1.00 70.29  ? 301 TRP B CA  1 
ATOM   4772 C C   . TRP B 1 305 ? 39.133 10.419  3.307   1.00 70.52  ? 301 TRP B C   1 
ATOM   4773 O O   . TRP B 1 305 ? 39.306 9.290   3.765   1.00 70.40  ? 301 TRP B O   1 
ATOM   4774 C CB  . TRP B 1 305 ? 36.796 11.072  2.677   1.00 65.21  ? 301 TRP B CB  1 
ATOM   4775 C CG  . TRP B 1 305 ? 35.410 10.977  3.253   1.00 60.11  ? 301 TRP B CG  1 
ATOM   4776 C CD1 . TRP B 1 305 ? 34.401 11.893  3.127   1.00 58.21  ? 301 TRP B CD1 1 
ATOM   4777 C CD2 . TRP B 1 305 ? 34.854 9.866   3.965   1.00 56.77  ? 301 TRP B CD2 1 
ATOM   4778 N NE1 . TRP B 1 305 ? 33.252 11.416  3.704   1.00 56.56  ? 301 TRP B NE1 1 
ATOM   4779 C CE2 . TRP B 1 305 ? 33.502 10.173  4.228   1.00 56.31  ? 301 TRP B CE2 1 
ATOM   4780 C CE3 . TRP B 1 305 ? 35.365 8.640   4.403   1.00 55.18  ? 301 TRP B CE3 1 
ATOM   4781 C CZ2 . TRP B 1 305 ? 32.652 9.292   4.909   1.00 54.92  ? 301 TRP B CZ2 1 
ATOM   4782 C CZ3 . TRP B 1 305 ? 34.521 7.767   5.080   1.00 55.13  ? 301 TRP B CZ3 1 
ATOM   4783 C CH2 . TRP B 1 305 ? 33.178 8.098   5.325   1.00 54.18  ? 301 TRP B CH2 1 
ATOM   4784 N N   . THR B 1 306 ? 39.992 10.979  2.457   1.00 70.85  ? 302 THR B N   1 
ATOM   4785 C CA  . THR B 1 306 ? 41.178 10.237  2.029   1.00 70.93  ? 302 THR B CA  1 
ATOM   4786 C C   . THR B 1 306 ? 42.099 9.946   3.209   1.00 70.26  ? 302 THR B C   1 
ATOM   4787 O O   . THR B 1 306 ? 42.860 8.981   3.178   1.00 71.08  ? 302 THR B O   1 
ATOM   4788 C CB  . THR B 1 306 ? 41.978 10.986  0.931   1.00 71.42  ? 302 THR B CB  1 
ATOM   4789 O OG1 . THR B 1 306 ? 41.166 11.129  -0.241  1.00 71.12  ? 302 THR B OG1 1 
ATOM   4790 C CG2 . THR B 1 306 ? 43.232 10.192  0.541   1.00 71.42  ? 302 THR B CG2 1 
ATOM   4791 N N   . LYS B 1 307 ? 42.008 10.768  4.252   1.00 69.02  ? 303 LYS B N   1 
ATOM   4792 C CA  . LYS B 1 307 ? 42.822 10.598  5.460   1.00 67.04  ? 303 LYS B CA  1 
ATOM   4793 C C   . LYS B 1 307 ? 42.280 9.483   6.372   1.00 64.17  ? 303 LYS B C   1 
ATOM   4794 O O   . LYS B 1 307 ? 42.935 9.083   7.337   1.00 63.89  ? 303 LYS B O   1 
ATOM   4795 C CB  . LYS B 1 307 ? 42.854 11.908  6.244   1.00 69.47  ? 303 LYS B CB  1 
ATOM   4796 C CG  . LYS B 1 307 ? 44.073 12.082  7.138   1.00 73.23  ? 303 LYS B CG  1 
ATOM   4797 C CD  . LYS B 1 307 ? 45.333 12.324  6.309   1.00 75.48  ? 303 LYS B CD  1 
ATOM   4798 C CE  . LYS B 1 307 ? 46.515 12.687  7.193   1.00 76.63  ? 303 LYS B CE  1 
ATOM   4799 N NZ  . LYS B 1 307 ? 47.731 12.968  6.374   1.00 78.17  ? 303 LYS B NZ  1 
ATOM   4800 N N   . VAL B 1 308 ? 41.084 8.991   6.059   1.00 60.30  ? 304 VAL B N   1 
ATOM   4801 C CA  . VAL B 1 308 ? 40.429 7.939   6.832   1.00 56.09  ? 304 VAL B CA  1 
ATOM   4802 C C   . VAL B 1 308 ? 40.971 6.523   6.592   1.00 55.19  ? 304 VAL B C   1 
ATOM   4803 O O   . VAL B 1 308 ? 41.230 5.771   7.536   1.00 53.06  ? 304 VAL B O   1 
ATOM   4804 C CB  . VAL B 1 308 ? 38.932 7.919   6.523   1.00 55.26  ? 304 VAL B CB  1 
ATOM   4805 C CG1 . VAL B 1 308 ? 38.281 6.717   7.168   1.00 54.14  ? 304 VAL B CG1 1 
ATOM   4806 C CG2 . VAL B 1 308 ? 38.291 9.215   6.987   1.00 55.24  ? 304 VAL B CG2 1 
ATOM   4807 N N   . PHE B 1 309 ? 41.144 6.173   5.322   1.00 54.22  ? 305 PHE B N   1 
ATOM   4808 C CA  . PHE B 1 309 ? 41.599 4.847   4.925   1.00 54.49  ? 305 PHE B CA  1 
ATOM   4809 C C   . PHE B 1 309 ? 43.105 4.727   4.695   1.00 56.06  ? 305 PHE B C   1 
ATOM   4810 O O   . PHE B 1 309 ? 43.787 5.734   4.522   1.00 56.55  ? 305 PHE B O   1 
ATOM   4811 C CB  . PHE B 1 309 ? 40.840 4.449   3.658   1.00 52.37  ? 305 PHE B CB  1 
ATOM   4812 C CG  . PHE B 1 309 ? 39.352 4.469   3.827   1.00 49.98  ? 305 PHE B CG  1 
ATOM   4813 C CD1 . PHE B 1 309 ? 38.700 3.414   4.461   1.00 48.34  ? 305 PHE B CD1 1 
ATOM   4814 C CD2 . PHE B 1 309 ? 38.604 5.559   3.391   1.00 47.37  ? 305 PHE B CD2 1 
ATOM   4815 C CE1 . PHE B 1 309 ? 37.326 3.447   4.661   1.00 46.39  ? 305 PHE B CE1 1 
ATOM   4816 C CE2 . PHE B 1 309 ? 37.239 5.601   3.582   1.00 48.07  ? 305 PHE B CE2 1 
ATOM   4817 C CZ  . PHE B 1 309 ? 36.595 4.541   4.221   1.00 46.85  ? 305 PHE B CZ  1 
ATOM   4818 N N   . ARG B 1 310 ? 43.622 3.497   4.680   1.00 56.91  ? 306 ARG B N   1 
ATOM   4819 C CA  . ARG B 1 310 ? 45.051 3.287   4.465   1.00 59.99  ? 306 ARG B CA  1 
ATOM   4820 C C   . ARG B 1 310 ? 45.448 3.892   3.114   1.00 60.69  ? 306 ARG B C   1 
ATOM   4821 O O   . ARG B 1 310 ? 44.605 4.100   2.247   1.00 60.78  ? 306 ARG B O   1 
ATOM   4822 C CB  . ARG B 1 310 ? 45.388 1.799   4.501   1.00 61.54  ? 306 ARG B CB  1 
ATOM   4823 C CG  . ARG B 1 310 ? 44.890 1.044   3.299   1.00 66.41  ? 306 ARG B CG  1 
ATOM   4824 C CD  . ARG B 1 310 ? 45.176 -0.444  3.399   1.00 69.83  ? 306 ARG B CD  1 
ATOM   4825 N NE  . ARG B 1 310 ? 44.800 -1.124  2.158   1.00 74.37  ? 306 ARG B NE  1 
ATOM   4826 C CZ  . ARG B 1 310 ? 44.877 -2.440  1.962   1.00 76.26  ? 306 ARG B CZ  1 
ATOM   4827 N NH1 . ARG B 1 310 ? 45.320 -3.235  2.935   1.00 77.11  ? 306 ARG B NH1 1 
ATOM   4828 N NH2 . ARG B 1 310 ? 44.518 -2.960  0.789   1.00 76.32  ? 306 ARG B NH2 1 
ATOM   4829 N N   . PRO B 1 311 ? 46.742 4.190   2.920   1.00 61.55  ? 307 PRO B N   1 
ATOM   4830 C CA  . PRO B 1 311 ? 47.229 4.783   1.667   1.00 61.55  ? 307 PRO B CA  1 
ATOM   4831 C C   . PRO B 1 311 ? 46.866 4.066   0.356   1.00 61.64  ? 307 PRO B C   1 
ATOM   4832 O O   . PRO B 1 311 ? 46.460 4.707   -0.612  1.00 60.97  ? 307 PRO B O   1 
ATOM   4833 C CB  . PRO B 1 311 ? 48.740 4.859   1.894   1.00 61.81  ? 307 PRO B CB  1 
ATOM   4834 C CG  . PRO B 1 311 ? 48.832 5.106   3.367   1.00 61.72  ? 307 PRO B CG  1 
ATOM   4835 C CD  . PRO B 1 311 ? 47.832 4.099   3.907   1.00 61.70  ? 307 PRO B CD  1 
ATOM   4836 N N   . ARG B 1 312 ? 47.001 2.747   0.321   1.00 61.97  ? 308 ARG B N   1 
ATOM   4837 C CA  . ARG B 1 312 ? 46.700 1.997   -0.898  1.00 63.82  ? 308 ARG B CA  1 
ATOM   4838 C C   . ARG B 1 312 ? 45.220 1.931   -1.343  1.00 61.92  ? 308 ARG B C   1 
ATOM   4839 O O   . ARG B 1 312 ? 44.929 1.534   -2.475  1.00 63.13  ? 308 ARG B O   1 
ATOM   4840 C CB  . ARG B 1 312 ? 47.266 0.578   -0.765  1.00 67.75  ? 308 ARG B CB  1 
ATOM   4841 C CG  . ARG B 1 312 ? 48.776 0.543   -0.497  1.00 72.28  ? 308 ARG B CG  1 
ATOM   4842 C CD  . ARG B 1 312 ? 49.555 1.356   -1.550  1.00 75.48  ? 308 ARG B CD  1 
ATOM   4843 N NE  . ARG B 1 312 ? 50.979 1.498   -1.224  1.00 79.09  ? 308 ARG B NE  1 
ATOM   4844 C CZ  . ARG B 1 312 ? 51.449 2.011   -0.085  1.00 80.05  ? 308 ARG B CZ  1 
ATOM   4845 N NH1 . ARG B 1 312 ? 50.612 2.434   0.856   1.00 80.99  ? 308 ARG B NH1 1 
ATOM   4846 N NH2 . ARG B 1 312 ? 52.759 2.112   0.113   1.00 80.85  ? 308 ARG B NH2 1 
ATOM   4847 N N   . THR B 1 313 ? 44.301 2.331   -0.468  1.00 58.96  ? 309 THR B N   1 
ATOM   4848 C CA  . THR B 1 313 ? 42.858 2.314   -0.753  1.00 55.72  ? 309 THR B CA  1 
ATOM   4849 C C   . THR B 1 313 ? 42.428 2.958   -2.071  1.00 54.11  ? 309 THR B C   1 
ATOM   4850 O O   . THR B 1 313 ? 42.677 4.135   -2.285  1.00 54.47  ? 309 THR B O   1 
ATOM   4851 C CB  . THR B 1 313 ? 42.072 3.024   0.373   1.00 53.67  ? 309 THR B CB  1 
ATOM   4852 O OG1 . THR B 1 313 ? 42.347 2.386   1.618   1.00 52.08  ? 309 THR B OG1 1 
ATOM   4853 C CG2 . THR B 1 313 ? 40.580 2.961   0.115   1.00 53.37  ? 309 THR B CG2 1 
ATOM   4854 N N   . PRO B 1 314 ? 41.756 2.196   -2.961  1.00 53.74  ? 310 PRO B N   1 
ATOM   4855 C CA  . PRO B 1 314 ? 41.302 2.753   -4.248  1.00 53.41  ? 310 PRO B CA  1 
ATOM   4856 C C   . PRO B 1 314 ? 40.521 4.055   -4.036  1.00 53.57  ? 310 PRO B C   1 
ATOM   4857 O O   . PRO B 1 314 ? 39.643 4.136   -3.179  1.00 53.14  ? 310 PRO B O   1 
ATOM   4858 C CB  . PRO B 1 314 ? 40.414 1.650   -4.814  1.00 53.25  ? 310 PRO B CB  1 
ATOM   4859 C CG  . PRO B 1 314 ? 41.038 0.392   -4.248  1.00 53.95  ? 310 PRO B CG  1 
ATOM   4860 C CD  . PRO B 1 314 ? 41.347 0.783   -2.822  1.00 52.56  ? 310 PRO B CD  1 
ATOM   4861 N N   . PRO B 1 315 ? 40.835 5.093   -4.819  1.00 53.67  ? 311 PRO B N   1 
ATOM   4862 C CA  . PRO B 1 315 ? 40.166 6.392   -4.708  1.00 52.11  ? 311 PRO B CA  1 
ATOM   4863 C C   . PRO B 1 315 ? 38.668 6.295   -4.976  1.00 51.12  ? 311 PRO B C   1 
ATOM   4864 O O   . PRO B 1 315 ? 37.881 7.061   -4.420  1.00 50.57  ? 311 PRO B O   1 
ATOM   4865 C CB  . PRO B 1 315 ? 40.878 7.249   -5.766  1.00 52.77  ? 311 PRO B CB  1 
ATOM   4866 C CG  . PRO B 1 315 ? 42.230 6.581   -5.915  1.00 54.22  ? 311 PRO B CG  1 
ATOM   4867 C CD  . PRO B 1 315 ? 41.873 5.121   -5.870  1.00 53.94  ? 311 PRO B CD  1 
ATOM   4868 N N   . GLU B 1 316 ? 38.274 5.380   -5.856  1.00 49.55  ? 312 GLU B N   1 
ATOM   4869 C CA  . GLU B 1 316 ? 36.861 5.207   -6.168  1.00 48.76  ? 312 GLU B CA  1 
ATOM   4870 C C   . GLU B 1 316 ? 36.111 4.660   -4.944  1.00 46.84  ? 312 GLU B C   1 
ATOM   4871 O O   . GLU B 1 316 ? 34.947 4.991   -4.720  1.00 45.06  ? 312 GLU B O   1 
ATOM   4872 C CB  . GLU B 1 316 ? 36.669 4.250   -7.348  1.00 50.84  ? 312 GLU B CB  1 
ATOM   4873 C CG  . GLU B 1 316 ? 37.307 4.703   -8.662  1.00 56.71  ? 312 GLU B CG  1 
ATOM   4874 C CD  . GLU B 1 316 ? 38.810 4.362   -8.772  1.00 60.43  ? 312 GLU B CD  1 
ATOM   4875 O OE1 . GLU B 1 316 ? 39.382 4.662   -9.853  1.00 63.35  ? 312 GLU B OE1 1 
ATOM   4876 O OE2 . GLU B 1 316 ? 39.410 3.798   -7.809  1.00 59.15  ? 312 GLU B OE2 1 
ATOM   4877 N N   . ALA B 1 317 ? 36.789 3.826   -4.163  1.00 44.35  ? 313 ALA B N   1 
ATOM   4878 C CA  . ALA B 1 317 ? 36.193 3.241   -2.969  1.00 44.04  ? 313 ALA B CA  1 
ATOM   4879 C C   . ALA B 1 317 ? 35.874 4.368   -1.986  1.00 44.68  ? 313 ALA B C   1 
ATOM   4880 O O   . ALA B 1 317 ? 34.784 4.424   -1.398  1.00 41.84  ? 313 ALA B O   1 
ATOM   4881 C CB  . ALA B 1 317 ? 37.152 2.233   -2.336  1.00 41.28  ? 313 ALA B CB  1 
ATOM   4882 N N   . ILE B 1 318 ? 36.827 5.279   -1.829  1.00 44.21  ? 314 ILE B N   1 
ATOM   4883 C CA  . ILE B 1 318 ? 36.656 6.400   -0.927  1.00 44.38  ? 314 ILE B CA  1 
ATOM   4884 C C   . ILE B 1 318 ? 35.537 7.330   -1.396  1.00 43.97  ? 314 ILE B C   1 
ATOM   4885 O O   . ILE B 1 318 ? 34.727 7.786   -0.593  1.00 43.82  ? 314 ILE B O   1 
ATOM   4886 C CB  . ILE B 1 318 ? 37.988 7.183   -0.788  1.00 46.12  ? 314 ILE B CB  1 
ATOM   4887 C CG1 . ILE B 1 318 ? 39.077 6.241   -0.259  1.00 46.13  ? 314 ILE B CG1 1 
ATOM   4888 C CG2 . ILE B 1 318 ? 37.811 8.356   0.173   1.00 44.08  ? 314 ILE B CG2 1 
ATOM   4889 C CD1 . ILE B 1 318 ? 40.476 6.856   -0.217  1.00 48.55  ? 314 ILE B CD1 1 
ATOM   4890 N N   . ALA B 1 319 ? 35.477 7.617   -2.697  1.00 44.46  ? 315 ALA B N   1 
ATOM   4891 C CA  . ALA B 1 319 ? 34.420 8.487   -3.221  1.00 43.30  ? 315 ALA B CA  1 
ATOM   4892 C C   . ALA B 1 319 ? 33.025 7.846   -3.022  1.00 43.49  ? 315 ALA B C   1 
ATOM   4893 O O   . ALA B 1 319 ? 32.050 8.542   -2.678  1.00 43.01  ? 315 ALA B O   1 
ATOM   4894 C CB  . ALA B 1 319 ? 34.646 8.762   -4.704  1.00 44.27  ? 315 ALA B CB  1 
ATOM   4895 N N   . LEU B 1 320 ? 32.916 6.533   -3.255  1.00 40.97  ? 316 LEU B N   1 
ATOM   4896 C CA  . LEU B 1 320 ? 31.625 5.869   -3.043  1.00 37.98  ? 316 LEU B CA  1 
ATOM   4897 C C   . LEU B 1 320 ? 31.222 5.996   -1.552  1.00 37.26  ? 316 LEU B C   1 
ATOM   4898 O O   . LEU B 1 320 ? 30.068 6.313   -1.235  1.00 35.63  ? 316 LEU B O   1 
ATOM   4899 C CB  . LEU B 1 320 ? 31.693 4.390   -3.462  1.00 33.73  ? 316 LEU B CB  1 
ATOM   4900 C CG  . LEU B 1 320 ? 30.456 3.539   -3.128  1.00 32.05  ? 316 LEU B CG  1 
ATOM   4901 C CD1 . LEU B 1 320 ? 29.215 4.190   -3.741  1.00 30.83  ? 316 LEU B CD1 1 
ATOM   4902 C CD2 . LEU B 1 320 ? 30.653 2.096   -3.649  1.00 30.01  ? 316 LEU B CD2 1 
ATOM   4903 N N   . CYS B 1 321 ? 32.159 5.762   -0.644  1.00 37.17  ? 317 CYS B N   1 
ATOM   4904 C CA  . CYS B 1 321 ? 31.848 5.887   0.774   1.00 41.18  ? 317 CYS B CA  1 
ATOM   4905 C C   . CYS B 1 321 ? 31.305 7.266   1.088   1.00 42.31  ? 317 CYS B C   1 
ATOM   4906 O O   . CYS B 1 321 ? 30.313 7.395   1.820   1.00 42.28  ? 317 CYS B O   1 
ATOM   4907 C CB  . CYS B 1 321 ? 33.079 5.675   1.656   1.00 43.03  ? 317 CYS B CB  1 
ATOM   4908 S SG  . CYS B 1 321 ? 33.474 3.991   2.015   1.00 50.28  ? 317 CYS B SG  1 
ATOM   4909 N N   . SER B 1 322 ? 31.938 8.303   0.542   1.00 41.39  ? 318 SER B N   1 
ATOM   4910 C CA  . SER B 1 322 ? 31.482 9.667   0.840   1.00 42.66  ? 318 SER B CA  1 
ATOM   4911 C C   . SER B 1 322 ? 30.109 9.985   0.268   1.00 41.34  ? 318 SER B C   1 
ATOM   4912 O O   . SER B 1 322 ? 29.419 10.901  0.755   1.00 41.33  ? 318 SER B O   1 
ATOM   4913 C CB  . SER B 1 322 ? 32.491 10.714  0.342   1.00 42.69  ? 318 SER B CB  1 
ATOM   4914 O OG  . SER B 1 322 ? 32.536 10.709  -1.076  1.00 48.60  ? 318 SER B OG  1 
ATOM   4915 N N   . ARG B 1 323 ? 29.692 9.248   -0.755  1.00 39.35  ? 319 ARG B N   1 
ATOM   4916 C CA  . ARG B 1 323 ? 28.376 9.510   -1.329  1.00 40.32  ? 319 ARG B CA  1 
ATOM   4917 C C   . ARG B 1 323 ? 27.295 8.682   -0.634  1.00 39.10  ? 319 ARG B C   1 
ATOM   4918 O O   . ARG B 1 323 ? 26.102 8.880   -0.850  1.00 39.25  ? 319 ARG B O   1 
ATOM   4919 C CB  . ARG B 1 323 ? 28.358 9.221   -2.844  1.00 44.86  ? 319 ARG B CB  1 
ATOM   4920 C CG  . ARG B 1 323 ? 29.252 10.126  -3.713  1.00 50.00  ? 319 ARG B CG  1 
ATOM   4921 C CD  . ARG B 1 323 ? 28.963 11.610  -3.512  1.00 56.12  ? 319 ARG B CD  1 
ATOM   4922 N NE  . ARG B 1 323 ? 27.537 11.927  -3.564  1.00 61.85  ? 319 ARG B NE  1 
ATOM   4923 C CZ  . ARG B 1 323 ? 26.771 11.814  -4.647  1.00 63.72  ? 319 ARG B CZ  1 
ATOM   4924 N NH1 . ARG B 1 323 ? 27.284 11.385  -5.799  1.00 66.54  ? 319 ARG B NH1 1 
ATOM   4925 N NH2 . ARG B 1 323 ? 25.488 12.138  -4.578  1.00 63.80  ? 319 ARG B NH2 1 
ATOM   4926 N N   . LEU B 1 324 ? 27.710 7.747   0.204   1.00 37.94  ? 320 LEU B N   1 
ATOM   4927 C CA  . LEU B 1 324 ? 26.747 6.918   0.919   1.00 36.58  ? 320 LEU B CA  1 
ATOM   4928 C C   . LEU B 1 324 ? 26.535 7.477   2.321   1.00 37.55  ? 320 LEU B C   1 
ATOM   4929 O O   . LEU B 1 324 ? 25.407 7.588   2.810   1.00 36.37  ? 320 LEU B O   1 
ATOM   4930 C CB  . LEU B 1 324 ? 27.272 5.478   1.032   1.00 35.05  ? 320 LEU B CB  1 
ATOM   4931 C CG  . LEU B 1 324 ? 27.525 4.724   -0.284  1.00 33.55  ? 320 LEU B CG  1 
ATOM   4932 C CD1 . LEU B 1 324 ? 28.228 3.392   0.007   1.00 33.09  ? 320 LEU B CD1 1 
ATOM   4933 C CD2 . LEU B 1 324 ? 26.205 4.516   -0.995  1.00 31.84  ? 320 LEU B CD2 1 
ATOM   4934 N N   . LEU B 1 325 ? 27.643 7.826   2.963   1.00 37.29  ? 321 LEU B N   1 
ATOM   4935 C CA  . LEU B 1 325 ? 27.613 8.326   4.322   1.00 38.88  ? 321 LEU B CA  1 
ATOM   4936 C C   . LEU B 1 325 ? 27.493 9.858   4.361   1.00 40.10  ? 321 LEU B C   1 
ATOM   4937 O O   . LEU B 1 325 ? 28.459 10.561  4.640   1.00 40.63  ? 321 LEU B O   1 
ATOM   4938 C CB  . LEU B 1 325 ? 28.876 7.836   5.040   1.00 37.56  ? 321 LEU B CB  1 
ATOM   4939 C CG  . LEU B 1 325 ? 29.019 6.305   4.975   1.00 38.21  ? 321 LEU B CG  1 
ATOM   4940 C CD1 . LEU B 1 325 ? 30.382 5.876   5.485   1.00 36.56  ? 321 LEU B CD1 1 
ATOM   4941 C CD2 . LEU B 1 325 ? 27.886 5.647   5.805   1.00 36.18  ? 321 LEU B CD2 1 
ATOM   4942 N N   . GLU B 1 326 ? 26.296 10.347  4.052   1.00 40.40  ? 322 GLU B N   1 
ATOM   4943 C CA  . GLU B 1 326 ? 25.989 11.779  4.022   1.00 41.99  ? 322 GLU B CA  1 
ATOM   4944 C C   . GLU B 1 326 ? 24.919 12.038  5.064   1.00 41.95  ? 322 GLU B C   1 
ATOM   4945 O O   . GLU B 1 326 ? 23.979 11.230  5.218   1.00 41.20  ? 322 GLU B O   1 
ATOM   4946 C CB  . GLU B 1 326 ? 25.381 12.185  2.666   1.00 43.70  ? 322 GLU B CB  1 
ATOM   4947 C CG  . GLU B 1 326 ? 26.240 11.945  1.432   1.00 49.64  ? 322 GLU B CG  1 
ATOM   4948 C CD  . GLU B 1 326 ? 27.019 13.185  0.996   1.00 52.66  ? 322 GLU B CD  1 
ATOM   4949 O OE1 . GLU B 1 326 ? 27.435 13.242  -0.181  1.00 55.87  ? 322 GLU B OE1 1 
ATOM   4950 O OE2 . GLU B 1 326 ? 27.220 14.097  1.825   1.00 54.66  ? 322 GLU B OE2 1 
ATOM   4951 N N   . TYR B 1 327 ? 25.022 13.171  5.753   1.00 41.99  ? 323 TYR B N   1 
ATOM   4952 C CA  . TYR B 1 327 ? 24.016 13.548  6.748   1.00 42.20  ? 323 TYR B CA  1 
ATOM   4953 C C   . TYR B 1 327 ? 22.627 13.667  6.159   1.00 42.32  ? 323 TYR B C   1 
ATOM   4954 O O   . TYR B 1 327 ? 21.669 13.088  6.691   1.00 42.92  ? 323 TYR B O   1 
ATOM   4955 C CB  . TYR B 1 327 ? 24.346 14.901  7.373   1.00 43.48  ? 323 TYR B CB  1 
ATOM   4956 C CG  . TYR B 1 327 ? 25.448 14.869  8.377   1.00 42.44  ? 323 TYR B CG  1 
ATOM   4957 C CD1 . TYR B 1 327 ? 26.575 15.675  8.223   1.00 44.51  ? 323 TYR B CD1 1 
ATOM   4958 C CD2 . TYR B 1 327 ? 25.351 14.069  9.507   1.00 43.12  ? 323 TYR B CD2 1 
ATOM   4959 C CE1 . TYR B 1 327 ? 27.575 15.687  9.175   1.00 44.34  ? 323 TYR B CE1 1 
ATOM   4960 C CE2 . TYR B 1 327 ? 26.351 14.068  10.466  1.00 44.46  ? 323 TYR B CE2 1 
ATOM   4961 C CZ  . TYR B 1 327 ? 27.455 14.874  10.297  1.00 45.99  ? 323 TYR B CZ  1 
ATOM   4962 O OH  . TYR B 1 327 ? 28.440 14.853  11.247  1.00 46.89  ? 323 TYR B OH  1 
ATOM   4963 N N   . THR B 1 328 ? 22.502 14.435  5.076   1.00 41.53  ? 324 THR B N   1 
ATOM   4964 C CA  . THR B 1 328 ? 21.188 14.640  4.452   1.00 41.97  ? 324 THR B CA  1 
ATOM   4965 C C   . THR B 1 328 ? 20.767 13.346  3.789   1.00 41.11  ? 324 THR B C   1 
ATOM   4966 O O   . THR B 1 328 ? 21.410 12.903  2.861   1.00 41.62  ? 324 THR B O   1 
ATOM   4967 C CB  . THR B 1 328 ? 21.261 15.786  3.411   1.00 43.17  ? 324 THR B CB  1 
ATOM   4968 O OG1 . THR B 1 328 ? 21.824 16.946  4.044   1.00 45.97  ? 324 THR B OG1 1 
ATOM   4969 C CG2 . THR B 1 328 ? 19.881 16.112  2.875   1.00 40.57  ? 324 THR B CG2 1 
ATOM   4970 N N   . PRO B 1 329 ? 19.673 12.730  4.255   1.00 42.56  ? 325 PRO B N   1 
ATOM   4971 C CA  . PRO B 1 329 ? 19.212 11.458  3.673   1.00 43.93  ? 325 PRO B CA  1 
ATOM   4972 C C   . PRO B 1 329 ? 18.962 11.432  2.166   1.00 45.38  ? 325 PRO B C   1 
ATOM   4973 O O   . PRO B 1 329 ? 19.368 10.464  1.497   1.00 43.89  ? 325 PRO B O   1 
ATOM   4974 C CB  . PRO B 1 329 ? 17.950 11.131  4.479   1.00 42.99  ? 325 PRO B CB  1 
ATOM   4975 C CG  . PRO B 1 329 ? 18.236 11.737  5.818   1.00 44.08  ? 325 PRO B CG  1 
ATOM   4976 C CD  . PRO B 1 329 ? 18.867 13.090  5.433   1.00 43.04  ? 325 PRO B CD  1 
ATOM   4977 N N   . THR B 1 330 ? 18.299 12.479  1.643   1.00 44.48  ? 326 THR B N   1 
ATOM   4978 C CA  . THR B 1 330 ? 18.005 12.570  0.219   1.00 42.38  ? 326 THR B CA  1 
ATOM   4979 C C   . THR B 1 330 ? 19.262 12.803  -0.596  1.00 41.14  ? 326 THR B C   1 
ATOM   4980 O O   . THR B 1 330 ? 19.239 12.629  -1.812  1.00 43.57  ? 326 THR B O   1 
ATOM   4981 C CB  . THR B 1 330 ? 17.016 13.727  -0.108  1.00 44.75  ? 326 THR B CB  1 
ATOM   4982 O OG1 . THR B 1 330 ? 17.571 14.960  0.369   1.00 45.18  ? 326 THR B OG1 1 
ATOM   4983 C CG2 . THR B 1 330 ? 15.644 13.490  0.536   1.00 42.69  ? 326 THR B CG2 1 
ATOM   4984 N N   . ALA B 1 331 ? 20.354 13.204  0.040   1.00 38.83  ? 327 ALA B N   1 
ATOM   4985 C CA  . ALA B 1 331 ? 21.589 13.413  -0.713  1.00 39.06  ? 327 ALA B CA  1 
ATOM   4986 C C   . ALA B 1 331 ? 22.364 12.105  -0.955  1.00 39.84  ? 327 ALA B C   1 
ATOM   4987 O O   . ALA B 1 331 ? 23.295 12.078  -1.762  1.00 39.87  ? 327 ALA B O   1 
ATOM   4988 C CB  . ALA B 1 331 ? 22.496 14.399  0.018   1.00 38.59  ? 327 ALA B CB  1 
ATOM   4989 N N   . ARG B 1 332 ? 22.014 11.032  -0.244  1.00 38.70  ? 328 ARG B N   1 
ATOM   4990 C CA  . ARG B 1 332 ? 22.731 9.743   -0.427  1.00 38.84  ? 328 ARG B CA  1 
ATOM   4991 C C   . ARG B 1 332 ? 22.369 9.064   -1.756  1.00 37.02  ? 328 ARG B C   1 
ATOM   4992 O O   . ARG B 1 332 ? 21.256 9.180   -2.223  1.00 37.50  ? 328 ARG B O   1 
ATOM   4993 C CB  . ARG B 1 332 ? 22.378 8.765   0.697   1.00 36.32  ? 328 ARG B CB  1 
ATOM   4994 C CG  . ARG B 1 332 ? 22.654 9.308   2.084   1.00 35.71  ? 328 ARG B CG  1 
ATOM   4995 C CD  . ARG B 1 332 ? 22.136 8.397   3.204   1.00 34.75  ? 328 ARG B CD  1 
ATOM   4996 N NE  . ARG B 1 332 ? 22.284 9.109   4.467   1.00 34.66  ? 328 ARG B NE  1 
ATOM   4997 C CZ  . ARG B 1 332 ? 21.489 8.982   5.521   1.00 34.35  ? 328 ARG B CZ  1 
ATOM   4998 N NH1 . ARG B 1 332 ? 20.465 8.139   5.512   1.00 31.54  ? 328 ARG B NH1 1 
ATOM   4999 N NH2 . ARG B 1 332 ? 21.680 9.778   6.571   1.00 34.81  ? 328 ARG B NH2 1 
ATOM   5000 N N   . LEU B 1 333 ? 23.308 8.344   -2.350  1.00 37.64  ? 329 LEU B N   1 
ATOM   5001 C CA  . LEU B 1 333 ? 23.009 7.602   -3.578  1.00 36.65  ? 329 LEU B CA  1 
ATOM   5002 C C   . LEU B 1 333 ? 21.899 6.601   -3.313  1.00 35.31  ? 329 LEU B C   1 
ATOM   5003 O O   . LEU B 1 333 ? 21.745 6.105   -2.192  1.00 34.97  ? 329 LEU B O   1 
ATOM   5004 C CB  . LEU B 1 333 ? 24.208 6.777   -4.014  1.00 36.07  ? 329 LEU B CB  1 
ATOM   5005 C CG  . LEU B 1 333 ? 25.500 7.484   -4.356  1.00 37.63  ? 329 LEU B CG  1 
ATOM   5006 C CD1 . LEU B 1 333 ? 26.531 6.415   -4.721  1.00 38.11  ? 329 LEU B CD1 1 
ATOM   5007 C CD2 . LEU B 1 333 ? 25.277 8.448   -5.509  1.00 38.80  ? 329 LEU B CD2 1 
ATOM   5008 N N   . THR B 1 334 ? 21.110 6.303   -4.337  1.00 35.12  ? 330 THR B N   1 
ATOM   5009 C CA  . THR B 1 334 ? 20.096 5.258   -4.194  1.00 35.32  ? 330 THR B CA  1 
ATOM   5010 C C   . THR B 1 334 ? 20.899 3.939   -4.439  1.00 33.14  ? 330 THR B C   1 
ATOM   5011 O O   . THR B 1 334 ? 22.015 3.980   -4.946  1.00 30.62  ? 330 THR B O   1 
ATOM   5012 C CB  . THR B 1 334 ? 19.049 5.326   -5.305  1.00 35.32  ? 330 THR B CB  1 
ATOM   5013 O OG1 . THR B 1 334 ? 19.727 5.196   -6.547  1.00 37.05  ? 330 THR B OG1 1 
ATOM   5014 C CG2 . THR B 1 334 ? 18.277 6.673   -5.290  1.00 37.06  ? 330 THR B CG2 1 
ATOM   5015 N N   . PRO B 1 335 ? 20.332 2.779   -4.081  1.00 33.10  ? 331 PRO B N   1 
ATOM   5016 C CA  . PRO B 1 335 ? 21.039 1.500   -4.301  1.00 34.82  ? 331 PRO B CA  1 
ATOM   5017 C C   . PRO B 1 335 ? 21.444 1.336   -5.779  1.00 33.25  ? 331 PRO B C   1 
ATOM   5018 O O   . PRO B 1 335 ? 22.582 0.970   -6.092  1.00 34.45  ? 331 PRO B O   1 
ATOM   5019 C CB  . PRO B 1 335 ? 20.007 0.442   -3.865  1.00 31.95  ? 331 PRO B CB  1 
ATOM   5020 C CG  . PRO B 1 335 ? 19.294 1.138   -2.752  1.00 35.35  ? 331 PRO B CG  1 
ATOM   5021 C CD  . PRO B 1 335 ? 19.112 2.583   -3.282  1.00 33.58  ? 331 PRO B CD  1 
ATOM   5022 N N   . LEU B 1 336 ? 20.520 1.630   -6.690  1.00 34.32  ? 332 LEU B N   1 
ATOM   5023 C CA  . LEU B 1 336 ? 20.799 1.466   -8.127  1.00 35.60  ? 332 LEU B CA  1 
ATOM   5024 C C   . LEU B 1 336 ? 21.941 2.389   -8.565  1.00 37.22  ? 332 LEU B C   1 
ATOM   5025 O O   . LEU B 1 336 ? 22.854 1.960   -9.286  1.00 36.57  ? 332 LEU B O   1 
ATOM   5026 C CB  . LEU B 1 336 ? 19.517 1.719   -8.949  1.00 35.82  ? 332 LEU B CB  1 
ATOM   5027 C CG  . LEU B 1 336 ? 19.395 0.979   -10.283 1.00 37.88  ? 332 LEU B CG  1 
ATOM   5028 C CD1 . LEU B 1 336 ? 19.436 -0.558  -10.021 1.00 36.49  ? 332 LEU B CD1 1 
ATOM   5029 C CD2 . LEU B 1 336 ? 18.073 1.394   -10.972 1.00 38.03  ? 332 LEU B CD2 1 
ATOM   5030 N N   . GLU B 1 337 ? 21.913 3.650   -8.125  1.00 34.78  ? 333 GLU B N   1 
ATOM   5031 C CA  . GLU B 1 337 ? 23.009 4.560   -8.469  1.00 36.46  ? 333 GLU B CA  1 
ATOM   5032 C C   . GLU B 1 337 ? 24.330 4.032   -7.902  1.00 36.33  ? 333 GLU B C   1 
ATOM   5033 O O   . GLU B 1 337 ? 25.391 4.215   -8.507  1.00 37.25  ? 333 GLU B O   1 
ATOM   5034 C CB  . GLU B 1 337 ? 22.742 5.968   -7.916  1.00 38.54  ? 333 GLU B CB  1 
ATOM   5035 C CG  . GLU B 1 337 ? 21.563 6.657   -8.588  1.00 42.69  ? 333 GLU B CG  1 
ATOM   5036 C CD  . GLU B 1 337 ? 21.099 7.935   -7.884  1.00 46.87  ? 333 GLU B CD  1 
ATOM   5037 O OE1 . GLU B 1 337 ? 20.275 8.660   -8.492  1.00 48.65  ? 333 GLU B OE1 1 
ATOM   5038 O OE2 . GLU B 1 337 ? 21.534 8.215   -6.734  1.00 45.56  ? 333 GLU B OE2 1 
ATOM   5039 N N   . ALA B 1 338 ? 24.278 3.395   -6.732  1.00 34.53  ? 334 ALA B N   1 
ATOM   5040 C CA  . ALA B 1 338 ? 25.503 2.840   -6.145  1.00 35.34  ? 334 ALA B CA  1 
ATOM   5041 C C   . ALA B 1 338 ? 26.044 1.715   -7.078  1.00 33.15  ? 334 ALA B C   1 
ATOM   5042 O O   . ALA B 1 338 ? 27.221 1.689   -7.404  1.00 31.77  ? 334 ALA B O   1 
ATOM   5043 C CB  . ALA B 1 338 ? 25.213 2.301   -4.721  1.00 30.65  ? 334 ALA B CB  1 
ATOM   5044 N N   . CYS B 1 339 ? 25.171 0.805   -7.509  1.00 34.43  ? 335 CYS B N   1 
ATOM   5045 C CA  . CYS B 1 339 ? 25.586 -0.285  -8.409  1.00 35.46  ? 335 CYS B CA  1 
ATOM   5046 C C   . CYS B 1 339 ? 26.300 0.258   -9.661  1.00 36.12  ? 335 CYS B C   1 
ATOM   5047 O O   . CYS B 1 339 ? 27.241 -0.352  -10.182 1.00 34.73  ? 335 CYS B O   1 
ATOM   5048 C CB  . CYS B 1 339 ? 24.377 -1.097  -8.873  1.00 32.52  ? 335 CYS B CB  1 
ATOM   5049 S SG  . CYS B 1 339 ? 23.618 -2.179  -7.645  1.00 33.57  ? 335 CYS B SG  1 
ATOM   5050 N N   . ALA B 1 340 ? 25.834 1.412   -10.129 1.00 37.66  ? 336 ALA B N   1 
ATOM   5051 C CA  . ALA B 1 340 ? 26.381 2.071   -11.316 1.00 38.13  ? 336 ALA B CA  1 
ATOM   5052 C C   . ALA B 1 340 ? 27.652 2.867   -11.076 1.00 38.62  ? 336 ALA B C   1 
ATOM   5053 O O   . ALA B 1 340 ? 28.266 3.353   -12.032 1.00 38.64  ? 336 ALA B O   1 
ATOM   5054 C CB  . ALA B 1 340 ? 25.324 2.985   -11.935 1.00 37.38  ? 336 ALA B CB  1 
ATOM   5055 N N   . HIS B 1 341 ? 28.049 3.007   -9.813  1.00 38.84  ? 337 HIS B N   1 
ATOM   5056 C CA  . HIS B 1 341 ? 29.253 3.760   -9.459  1.00 37.35  ? 337 HIS B CA  1 
ATOM   5057 C C   . HIS B 1 341 ? 30.536 3.156   -10.064 1.00 38.95  ? 337 HIS B C   1 
ATOM   5058 O O   . HIS B 1 341 ? 30.652 1.924   -10.232 1.00 37.27  ? 337 HIS B O   1 
ATOM   5059 C CB  . HIS B 1 341 ? 29.368 3.839   -7.931  1.00 38.52  ? 337 HIS B CB  1 
ATOM   5060 C CG  . HIS B 1 341 ? 30.358 4.861   -7.449  1.00 38.05  ? 337 HIS B CG  1 
ATOM   5061 N ND1 . HIS B 1 341 ? 31.706 4.594   -7.329  1.00 36.95  ? 337 HIS B ND1 1 
ATOM   5062 C CD2 . HIS B 1 341 ? 30.194 6.153   -7.072  1.00 35.67  ? 337 HIS B CD2 1 
ATOM   5063 C CE1 . HIS B 1 341 ? 32.331 5.676   -6.893  1.00 35.57  ? 337 HIS B CE1 1 
ATOM   5064 N NE2 . HIS B 1 341 ? 31.437 6.635   -6.729  1.00 36.09  ? 337 HIS B NE2 1 
ATOM   5065 N N   . SER B 1 342 ? 31.507 4.024   -10.372 1.00 37.94  ? 338 SER B N   1 
ATOM   5066 C CA  . SER B 1 342 ? 32.769 3.590   -10.976 1.00 38.82  ? 338 SER B CA  1 
ATOM   5067 C C   . SER B 1 342 ? 33.562 2.602   -10.110 1.00 37.61  ? 338 SER B C   1 
ATOM   5068 O O   . SER B 1 342 ? 34.372 1.844   -10.644 1.00 38.15  ? 338 SER B O   1 
ATOM   5069 C CB  . SER B 1 342 ? 33.640 4.805   -11.324 1.00 38.59  ? 338 SER B CB  1 
ATOM   5070 O OG  . SER B 1 342 ? 33.945 5.476   -10.117 1.00 46.66  ? 338 SER B OG  1 
ATOM   5071 N N   . PHE B 1 343 ? 33.343 2.598   -8.791  1.00 35.96  ? 339 PHE B N   1 
ATOM   5072 C CA  . PHE B 1 343 ? 34.043 1.622   -7.942  1.00 36.89  ? 339 PHE B CA  1 
ATOM   5073 C C   . PHE B 1 343 ? 33.731 0.202   -8.459  1.00 35.97  ? 339 PHE B C   1 
ATOM   5074 O O   . PHE B 1 343 ? 34.543 -0.710  -8.325  1.00 38.25  ? 339 PHE B O   1 
ATOM   5075 C CB  . PHE B 1 343 ? 33.603 1.756   -6.467  1.00 34.84  ? 339 PHE B CB  1 
ATOM   5076 C CG  . PHE B 1 343 ? 34.195 0.707   -5.547  1.00 36.33  ? 339 PHE B CG  1 
ATOM   5077 C CD1 . PHE B 1 343 ? 35.589 0.569   -5.405  1.00 33.99  ? 339 PHE B CD1 1 
ATOM   5078 C CD2 . PHE B 1 343 ? 33.354 -0.145  -4.821  1.00 35.48  ? 339 PHE B CD2 1 
ATOM   5079 C CE1 . PHE B 1 343 ? 36.133 -0.402  -4.552  1.00 34.75  ? 339 PHE B CE1 1 
ATOM   5080 C CE2 . PHE B 1 343 ? 33.880 -1.125  -3.959  1.00 35.94  ? 339 PHE B CE2 1 
ATOM   5081 C CZ  . PHE B 1 343 ? 35.273 -1.263  -3.817  1.00 36.92  ? 339 PHE B CZ  1 
ATOM   5082 N N   . PHE B 1 344 ? 32.565 0.020   -9.074  1.00 34.77  ? 340 PHE B N   1 
ATOM   5083 C CA  . PHE B 1 344 ? 32.211 -1.311  -9.581  1.00 35.18  ? 340 PHE B CA  1 
ATOM   5084 C C   . PHE B 1 344 ? 32.546 -1.606  -11.053 1.00 35.54  ? 340 PHE B C   1 
ATOM   5085 O O   . PHE B 1 344 ? 32.193 -2.688  -11.558 1.00 33.70  ? 340 PHE B O   1 
ATOM   5086 C CB  . PHE B 1 344 ? 30.719 -1.597  -9.322  1.00 32.15  ? 340 PHE B CB  1 
ATOM   5087 C CG  . PHE B 1 344 ? 30.336 -1.534  -7.849  1.00 32.68  ? 340 PHE B CG  1 
ATOM   5088 C CD1 . PHE B 1 344 ? 30.898 -2.421  -6.933  1.00 29.14  ? 340 PHE B CD1 1 
ATOM   5089 C CD2 . PHE B 1 344 ? 29.433 -0.554  -7.385  1.00 29.61  ? 340 PHE B CD2 1 
ATOM   5090 C CE1 . PHE B 1 344 ? 30.580 -2.350  -5.567  1.00 32.43  ? 340 PHE B CE1 1 
ATOM   5091 C CE2 . PHE B 1 344 ? 29.109 -0.461  -6.038  1.00 29.27  ? 340 PHE B CE2 1 
ATOM   5092 C CZ  . PHE B 1 344 ? 29.682 -1.361  -5.114  1.00 30.45  ? 340 PHE B CZ  1 
ATOM   5093 N N   . ASP B 1 345 ? 33.255 -0.690  -11.730 1.00 36.27  ? 341 ASP B N   1 
ATOM   5094 C CA  . ASP B 1 345 ? 33.576 -0.898  -13.156 1.00 37.51  ? 341 ASP B CA  1 
ATOM   5095 C C   . ASP B 1 345 ? 34.346 -2.193  -13.435 1.00 37.84  ? 341 ASP B C   1 
ATOM   5096 O O   . ASP B 1 345 ? 34.138 -2.827  -14.464 1.00 37.94  ? 341 ASP B O   1 
ATOM   5097 C CB  . ASP B 1 345 ? 34.355 0.297   -13.746 1.00 37.42  ? 341 ASP B CB  1 
ATOM   5098 C CG  . ASP B 1 345 ? 33.494 1.562   -13.881 1.00 41.96  ? 341 ASP B CG  1 
ATOM   5099 O OD1 . ASP B 1 345 ? 32.240 1.463   -13.881 1.00 40.20  ? 341 ASP B OD1 1 
ATOM   5100 O OD2 . ASP B 1 345 ? 34.070 2.673   -13.997 1.00 42.48  ? 341 ASP B OD2 1 
ATOM   5101 N N   . GLU B 1 346 ? 35.229 -2.591  -12.527 1.00 38.61  ? 342 GLU B N   1 
ATOM   5102 C CA  . GLU B 1 346 ? 35.975 -3.816  -12.730 1.00 39.46  ? 342 GLU B CA  1 
ATOM   5103 C C   . GLU B 1 346 ? 35.018 -5.014  -12.917 1.00 38.81  ? 342 GLU B C   1 
ATOM   5104 O O   . GLU B 1 346 ? 35.304 -5.936  -13.702 1.00 39.88  ? 342 GLU B O   1 
ATOM   5105 C CB  . GLU B 1 346 ? 36.907 -4.083  -11.546 1.00 39.82  ? 342 GLU B CB  1 
ATOM   5106 C CG  . GLU B 1 346 ? 37.874 -5.225  -11.835 1.00 44.03  ? 342 GLU B CG  1 
ATOM   5107 C CD  . GLU B 1 346 ? 38.755 -5.625  -10.656 1.00 45.05  ? 342 GLU B CD  1 
ATOM   5108 O OE1 . GLU B 1 346 ? 38.790 -4.916  -9.623  1.00 45.52  ? 342 GLU B OE1 1 
ATOM   5109 O OE2 . GLU B 1 346 ? 39.428 -6.670  -10.775 1.00 47.76  ? 342 GLU B OE2 1 
ATOM   5110 N N   . LEU B 1 347 ? 33.887 -4.998  -12.215 1.00 36.06  ? 343 LEU B N   1 
ATOM   5111 C CA  . LEU B 1 347 ? 32.922 -6.098  -12.307 1.00 33.55  ? 343 LEU B CA  1 
ATOM   5112 C C   . LEU B 1 347 ? 32.271 -6.147  -13.686 1.00 35.39  ? 343 LEU B C   1 
ATOM   5113 O O   . LEU B 1 347 ? 31.802 -7.195  -14.108 1.00 35.35  ? 343 LEU B O   1 
ATOM   5114 C CB  . LEU B 1 347 ? 31.844 -5.973  -11.215 1.00 32.07  ? 343 LEU B CB  1 
ATOM   5115 C CG  . LEU B 1 347 ? 32.339 -5.991  -9.757  1.00 32.16  ? 343 LEU B CG  1 
ATOM   5116 C CD1 . LEU B 1 347 ? 31.113 -5.958  -8.810  1.00 33.09  ? 343 LEU B CD1 1 
ATOM   5117 C CD2 . LEU B 1 347 ? 33.172 -7.255  -9.489  1.00 29.15  ? 343 LEU B CD2 1 
ATOM   5118 N N   . ARG B 1 348 ? 32.262 -5.021  -14.400 1.00 35.17  ? 344 ARG B N   1 
ATOM   5119 C CA  . ARG B 1 348 ? 31.680 -4.970  -15.726 1.00 38.03  ? 344 ARG B CA  1 
ATOM   5120 C C   . ARG B 1 348 ? 32.696 -5.291  -16.848 1.00 41.04  ? 344 ARG B C   1 
ATOM   5121 O O   . ARG B 1 348 ? 32.341 -5.335  -18.026 1.00 42.31  ? 344 ARG B O   1 
ATOM   5122 C CB  . ARG B 1 348 ? 31.024 -3.595  -15.971 1.00 38.22  ? 344 ARG B CB  1 
ATOM   5123 C CG  . ARG B 1 348 ? 29.719 -3.388  -15.177 1.00 35.20  ? 344 ARG B CG  1 
ATOM   5124 C CD  . ARG B 1 348 ? 29.146 -1.978  -15.393 1.00 35.94  ? 344 ARG B CD  1 
ATOM   5125 N NE  . ARG B 1 348 ? 29.774 -0.947  -14.556 1.00 33.92  ? 344 ARG B NE  1 
ATOM   5126 C CZ  . ARG B 1 348 ? 29.424 -0.675  -13.300 1.00 34.95  ? 344 ARG B CZ  1 
ATOM   5127 N NH1 . ARG B 1 348 ? 28.448 -1.360  -12.705 1.00 32.82  ? 344 ARG B NH1 1 
ATOM   5128 N NH2 . ARG B 1 348 ? 30.030 0.313   -12.647 1.00 35.66  ? 344 ARG B NH2 1 
ATOM   5129 N N   . ASP B 1 349 ? 33.947 -5.537  -16.483 1.00 42.93  ? 345 ASP B N   1 
ATOM   5130 C CA  . ASP B 1 349 ? 34.975 -5.879  -17.460 1.00 45.76  ? 345 ASP B CA  1 
ATOM   5131 C C   . ASP B 1 349 ? 34.731 -7.322  -17.938 1.00 46.88  ? 345 ASP B C   1 
ATOM   5132 O O   . ASP B 1 349 ? 34.615 -8.235  -17.126 1.00 46.19  ? 345 ASP B O   1 
ATOM   5133 C CB  . ASP B 1 349 ? 36.353 -5.776  -16.813 1.00 48.16  ? 345 ASP B CB  1 
ATOM   5134 C CG  . ASP B 1 349 ? 37.498 -6.058  -17.793 1.00 52.48  ? 345 ASP B CG  1 
ATOM   5135 O OD1 . ASP B 1 349 ? 37.495 -7.100  -18.505 1.00 52.54  ? 345 ASP B OD1 1 
ATOM   5136 O OD2 . ASP B 1 349 ? 38.418 -5.224  -17.826 1.00 54.32  ? 345 ASP B OD2 1 
ATOM   5137 N N   . PRO B 1 350 ? 34.665 -7.538  -19.270 1.00 48.24  ? 346 PRO B N   1 
ATOM   5138 C CA  . PRO B 1 350 ? 34.434 -8.845  -19.918 1.00 48.81  ? 346 PRO B CA  1 
ATOM   5139 C C   . PRO B 1 350 ? 35.348 -9.980  -19.429 1.00 49.42  ? 346 PRO B C   1 
ATOM   5140 O O   . PRO B 1 350 ? 34.959 -11.148 -19.387 1.00 50.65  ? 346 PRO B O   1 
ATOM   5141 C CB  . PRO B 1 350 ? 34.700 -8.565  -21.404 1.00 50.16  ? 346 PRO B CB  1 
ATOM   5142 C CG  . PRO B 1 350 ? 34.567 -7.077  -21.547 1.00 50.96  ? 346 PRO B CG  1 
ATOM   5143 C CD  . PRO B 1 350 ? 35.090 -6.523  -20.254 1.00 49.13  ? 346 PRO B CD  1 
ATOM   5144 N N   . ASN B 1 351 ? 36.572 -9.649  -19.053 1.00 49.57  ? 347 ASN B N   1 
ATOM   5145 C CA  . ASN B 1 351 ? 37.502 -10.695 -18.636 1.00 50.26  ? 347 ASN B CA  1 
ATOM   5146 C C   . ASN B 1 351 ? 37.696 -10.918 -17.144 1.00 49.27  ? 347 ASN B C   1 
ATOM   5147 O O   . ASN B 1 351 ? 38.550 -11.724 -16.758 1.00 47.22  ? 347 ASN B O   1 
ATOM   5148 C CB  . ASN B 1 351 ? 38.875 -10.437 -19.260 1.00 52.69  ? 347 ASN B CB  1 
ATOM   5149 C CG  . ASN B 1 351 ? 38.789 -10.154 -20.741 1.00 54.25  ? 347 ASN B CG  1 
ATOM   5150 O OD1 . ASN B 1 351 ? 38.253 -10.957 -21.509 1.00 56.65  ? 347 ASN B OD1 1 
ATOM   5151 N ND2 . ASN B 1 351 ? 39.311 -9.003  -21.154 1.00 55.87  ? 347 ASN B ND2 1 
ATOM   5152 N N   . VAL B 1 352 ? 36.925 -10.226 -16.304 1.00 46.71  ? 348 VAL B N   1 
ATOM   5153 C CA  . VAL B 1 352 ? 37.080 -10.394 -14.863 1.00 44.23  ? 348 VAL B CA  1 
ATOM   5154 C C   . VAL B 1 352 ? 36.829 -11.840 -14.443 1.00 43.60  ? 348 VAL B C   1 
ATOM   5155 O O   . VAL B 1 352 ? 35.954 -12.502 -14.978 1.00 43.23  ? 348 VAL B O   1 
ATOM   5156 C CB  . VAL B 1 352 ? 36.116 -9.464  -14.069 1.00 45.36  ? 348 VAL B CB  1 
ATOM   5157 C CG1 . VAL B 1 352 ? 34.633 -9.862  -14.309 1.00 43.17  ? 348 VAL B CG1 1 
ATOM   5158 C CG2 . VAL B 1 352 ? 36.464 -9.529  -12.593 1.00 43.62  ? 348 VAL B CG2 1 
ATOM   5159 N N   . LYS B 1 353 ? 37.613 -12.327 -13.489 1.00 43.36  ? 349 LYS B N   1 
ATOM   5160 C CA  . LYS B 1 353 ? 37.458 -13.686 -12.973 1.00 43.61  ? 349 LYS B CA  1 
ATOM   5161 C C   . LYS B 1 353 ? 37.628 -13.637 -11.454 1.00 42.20  ? 349 LYS B C   1 
ATOM   5162 O O   . LYS B 1 353 ? 38.171 -12.672 -10.924 1.00 42.61  ? 349 LYS B O   1 
ATOM   5163 C CB  . LYS B 1 353 ? 38.536 -14.611 -13.574 1.00 47.83  ? 349 LYS B CB  1 
ATOM   5164 C CG  . LYS B 1 353 ? 38.338 -14.956 -15.052 1.00 51.27  ? 349 LYS B CG  1 
ATOM   5165 C CD  . LYS B 1 353 ? 37.153 -15.905 -15.215 1.00 55.16  ? 349 LYS B CD  1 
ATOM   5166 C CE  . LYS B 1 353 ? 36.791 -16.133 -16.670 1.00 57.75  ? 349 LYS B CE  1 
ATOM   5167 N NZ  . LYS B 1 353 ? 37.825 -16.905 -17.370 1.00 60.64  ? 349 LYS B NZ  1 
ATOM   5168 N N   . LEU B 1 354 ? 37.152 -14.657 -10.755 1.00 39.70  ? 350 LEU B N   1 
ATOM   5169 C CA  . LEU B 1 354 ? 37.330 -14.715 -9.310  1.00 40.33  ? 350 LEU B CA  1 
ATOM   5170 C C   . LEU B 1 354 ? 38.786 -15.173 -9.091  1.00 42.22  ? 350 LEU B C   1 
ATOM   5171 O O   . LEU B 1 354 ? 39.382 -15.791 -9.969  1.00 40.63  ? 350 LEU B O   1 
ATOM   5172 C CB  . LEU B 1 354 ? 36.392 -15.759 -8.674  1.00 36.31  ? 350 LEU B CB  1 
ATOM   5173 C CG  . LEU B 1 354 ? 34.882 -15.519 -8.820  1.00 36.70  ? 350 LEU B CG  1 
ATOM   5174 C CD1 . LEU B 1 354 ? 34.129 -16.604 -8.073  1.00 32.35  ? 350 LEU B CD1 1 
ATOM   5175 C CD2 . LEU B 1 354 ? 34.519 -14.123 -8.276  1.00 34.80  ? 350 LEU B CD2 1 
ATOM   5176 N N   . PRO B 1 355 ? 39.373 -14.853 -7.931  1.00 43.39  ? 351 PRO B N   1 
ATOM   5177 C CA  . PRO B 1 355 ? 40.752 -15.277 -7.676  1.00 44.48  ? 351 PRO B CA  1 
ATOM   5178 C C   . PRO B 1 355 ? 40.899 -16.789 -7.769  1.00 44.15  ? 351 PRO B C   1 
ATOM   5179 O O   . PRO B 1 355 ? 41.971 -17.274 -8.116  1.00 44.42  ? 351 PRO B O   1 
ATOM   5180 C CB  . PRO B 1 355 ? 41.019 -14.758 -6.266  1.00 44.15  ? 351 PRO B CB  1 
ATOM   5181 C CG  . PRO B 1 355 ? 40.251 -13.447 -6.278  1.00 45.49  ? 351 PRO B CG  1 
ATOM   5182 C CD  . PRO B 1 355 ? 38.929 -13.878 -6.916  1.00 44.06  ? 351 PRO B CD  1 
ATOM   5183 N N   . ASN B 1 356 ? 39.840 -17.539 -7.451  1.00 43.27  ? 352 ASN B N   1 
ATOM   5184 C CA  . ASN B 1 356 ? 39.925 -18.995 -7.544  1.00 41.84  ? 352 ASN B CA  1 
ATOM   5185 C C   . ASN B 1 356 ? 39.812 -19.499 -8.988  1.00 42.68  ? 352 ASN B C   1 
ATOM   5186 O O   . ASN B 1 356 ? 39.727 -20.705 -9.230  1.00 41.15  ? 352 ASN B O   1 
ATOM   5187 C CB  . ASN B 1 356 ? 38.861 -19.679 -6.657  1.00 41.87  ? 352 ASN B CB  1 
ATOM   5188 C CG  . ASN B 1 356 ? 37.406 -19.453 -7.141  1.00 42.93  ? 352 ASN B CG  1 
ATOM   5189 O OD1 . ASN B 1 356 ? 37.157 -18.908 -8.219  1.00 41.96  ? 352 ASN B OD1 1 
ATOM   5190 N ND2 . ASN B 1 356 ? 36.452 -19.901 -6.334  1.00 39.95  ? 352 ASN B ND2 1 
ATOM   5191 N N   . GLY B 1 357 ? 39.799 -18.578 -9.946  1.00 43.06  ? 353 GLY B N   1 
ATOM   5192 C CA  . GLY B 1 357 ? 39.694 -18.973 -11.344 1.00 45.24  ? 353 GLY B CA  1 
ATOM   5193 C C   . GLY B 1 357 ? 38.290 -19.133 -11.926 1.00 46.70  ? 353 GLY B C   1 
ATOM   5194 O O   . GLY B 1 357 ? 38.137 -19.134 -13.138 1.00 46.38  ? 353 GLY B O   1 
ATOM   5195 N N   . ARG B 1 358 ? 37.264 -19.286 -11.093 1.00 47.18  ? 354 ARG B N   1 
ATOM   5196 C CA  . ARG B 1 358 ? 35.896 -19.421 -11.620 1.00 47.74  ? 354 ARG B CA  1 
ATOM   5197 C C   . ARG B 1 358 ? 35.371 -18.090 -12.158 1.00 46.15  ? 354 ARG B C   1 
ATOM   5198 O O   . ARG B 1 358 ? 35.970 -17.044 -11.941 1.00 45.40  ? 354 ARG B O   1 
ATOM   5199 C CB  . ARG B 1 358 ? 34.930 -19.872 -10.525 1.00 48.82  ? 354 ARG B CB  1 
ATOM   5200 C CG  . ARG B 1 358 ? 35.335 -21.110 -9.791  1.00 53.05  ? 354 ARG B CG  1 
ATOM   5201 C CD  . ARG B 1 358 ? 34.167 -21.593 -8.919  1.00 56.03  ? 354 ARG B CD  1 
ATOM   5202 N NE  . ARG B 1 358 ? 34.549 -22.668 -8.005  1.00 56.77  ? 354 ARG B NE  1 
ATOM   5203 C CZ  . ARG B 1 358 ? 33.680 -23.490 -7.427  1.00 58.10  ? 354 ARG B CZ  1 
ATOM   5204 N NH1 . ARG B 1 358 ? 32.380 -23.363 -7.676  1.00 57.53  ? 354 ARG B NH1 1 
ATOM   5205 N NH2 . ARG B 1 358 ? 34.109 -24.425 -6.586  1.00 58.87  ? 354 ARG B NH2 1 
ATOM   5206 N N   . ASP B 1 359 ? 34.246 -18.128 -12.863 1.00 46.22  ? 355 ASP B N   1 
ATOM   5207 C CA  . ASP B 1 359 ? 33.646 -16.875 -13.358 1.00 47.62  ? 355 ASP B CA  1 
ATOM   5208 C C   . ASP B 1 359 ? 32.905 -16.205 -12.213 1.00 43.20  ? 355 ASP B C   1 
ATOM   5209 O O   . ASP B 1 359 ? 32.583 -16.846 -11.216 1.00 41.79  ? 355 ASP B O   1 
ATOM   5210 C CB  . ASP B 1 359 ? 32.625 -17.137 -14.460 1.00 50.72  ? 355 ASP B CB  1 
ATOM   5211 C CG  . ASP B 1 359 ? 33.263 -17.648 -15.723 1.00 56.80  ? 355 ASP B CG  1 
ATOM   5212 O OD1 . ASP B 1 359 ? 34.154 -16.944 -16.263 1.00 58.78  ? 355 ASP B OD1 1 
ATOM   5213 O OD2 . ASP B 1 359 ? 32.874 -18.753 -16.173 1.00 59.11  ? 355 ASP B OD2 1 
ATOM   5214 N N   . THR B 1 360 ? 32.623 -14.921 -12.367 1.00 41.93  ? 356 THR B N   1 
ATOM   5215 C CA  . THR B 1 360 ? 31.866 -14.203 -11.343 1.00 41.05  ? 356 THR B CA  1 
ATOM   5216 C C   . THR B 1 360 ? 30.420 -14.704 -11.398 1.00 39.13  ? 356 THR B C   1 
ATOM   5217 O O   . THR B 1 360 ? 30.007 -15.301 -12.395 1.00 37.02  ? 356 THR B O   1 
ATOM   5218 C CB  . THR B 1 360 ? 31.852 -12.710 -11.646 1.00 41.17  ? 356 THR B CB  1 
ATOM   5219 O OG1 . THR B 1 360 ? 31.464 -12.522 -13.014 1.00 42.48  ? 356 THR B OG1 1 
ATOM   5220 C CG2 . THR B 1 360 ? 33.227 -12.115 -11.437 1.00 41.94  ? 356 THR B CG2 1 
ATOM   5221 N N   . PRO B 1 361 ? 29.645 -14.495 -10.319 1.00 38.42  ? 357 PRO B N   1 
ATOM   5222 C CA  . PRO B 1 361 ? 28.237 -14.927 -10.292 1.00 37.12  ? 357 PRO B CA  1 
ATOM   5223 C C   . PRO B 1 361 ? 27.480 -14.019 -11.282 1.00 36.40  ? 357 PRO B C   1 
ATOM   5224 O O   . PRO B 1 361 ? 28.062 -13.087 -11.849 1.00 31.95  ? 357 PRO B O   1 
ATOM   5225 C CB  . PRO B 1 361 ? 27.797 -14.635 -8.854  1.00 37.34  ? 357 PRO B CB  1 
ATOM   5226 C CG  . PRO B 1 361 ? 29.053 -14.342 -8.109  1.00 36.91  ? 357 PRO B CG  1 
ATOM   5227 C CD  . PRO B 1 361 ? 29.984 -13.735 -9.106  1.00 36.68  ? 357 PRO B CD  1 
ATOM   5228 N N   . ALA B 1 362 ? 26.191 -14.278 -11.472 1.00 38.44  ? 358 ALA B N   1 
ATOM   5229 C CA  . ALA B 1 362 ? 25.388 -13.457 -12.396 1.00 41.26  ? 358 ALA B CA  1 
ATOM   5230 C C   . ALA B 1 362 ? 25.275 -12.037 -11.813 1.00 38.61  ? 358 ALA B C   1 
ATOM   5231 O O   . ALA B 1 362 ? 24.839 -11.872 -10.687 1.00 42.75  ? 358 ALA B O   1 
ATOM   5232 C CB  . ALA B 1 362 ? 23.988 -14.095 -12.565 1.00 43.19  ? 358 ALA B CB  1 
ATOM   5233 N N   . LEU B 1 363 ? 25.690 -11.020 -12.550 1.00 37.08  ? 359 LEU B N   1 
ATOM   5234 C CA  . LEU B 1 363 ? 25.632 -9.659  -12.008 1.00 36.40  ? 359 LEU B CA  1 
ATOM   5235 C C   . LEU B 1 363 ? 24.763 -8.692  -12.805 1.00 33.63  ? 359 LEU B C   1 
ATOM   5236 O O   . LEU B 1 363 ? 24.465 -7.601  -12.335 1.00 34.56  ? 359 LEU B O   1 
ATOM   5237 C CB  . LEU B 1 363 ? 27.060 -9.089  -11.940 1.00 35.35  ? 359 LEU B CB  1 
ATOM   5238 C CG  . LEU B 1 363 ? 28.070 -9.834  -11.035 1.00 36.90  ? 359 LEU B CG  1 
ATOM   5239 C CD1 . LEU B 1 363 ? 29.466 -9.179  -11.134 1.00 37.56  ? 359 LEU B CD1 1 
ATOM   5240 C CD2 . LEU B 1 363 ? 27.586 -9.801  -9.594  1.00 30.91  ? 359 LEU B CD2 1 
ATOM   5241 N N   . PHE B 1 364 ? 24.369 -9.103  -14.006 1.00 33.97  ? 360 PHE B N   1 
ATOM   5242 C CA  . PHE B 1 364 ? 23.645 -8.227  -14.918 1.00 34.63  ? 360 PHE B CA  1 
ATOM   5243 C C   . PHE B 1 364 ? 22.226 -8.614  -15.311 1.00 35.07  ? 360 PHE B C   1 
ATOM   5244 O O   . PHE B 1 364 ? 21.620 -7.950  -16.153 1.00 35.10  ? 360 PHE B O   1 
ATOM   5245 C CB  . PHE B 1 364 ? 24.491 -8.053  -16.183 1.00 36.11  ? 360 PHE B CB  1 
ATOM   5246 C CG  . PHE B 1 364 ? 25.958 -7.881  -15.898 1.00 36.90  ? 360 PHE B CG  1 
ATOM   5247 C CD1 . PHE B 1 364 ? 26.883 -8.828  -16.341 1.00 38.42  ? 360 PHE B CD1 1 
ATOM   5248 C CD2 . PHE B 1 364 ? 26.413 -6.782  -15.178 1.00 35.70  ? 360 PHE B CD2 1 
ATOM   5249 C CE1 . PHE B 1 364 ? 28.254 -8.676  -16.069 1.00 40.00  ? 360 PHE B CE1 1 
ATOM   5250 C CE2 . PHE B 1 364 ? 27.775 -6.615  -14.897 1.00 38.30  ? 360 PHE B CE2 1 
ATOM   5251 C CZ  . PHE B 1 364 ? 28.699 -7.562  -15.343 1.00 39.36  ? 360 PHE B CZ  1 
ATOM   5252 N N   . ASN B 1 365 ? 21.674 -9.646  -14.690 1.00 33.37  ? 361 ASN B N   1 
ATOM   5253 C CA  . ASN B 1 365 ? 20.328 -10.050 -15.054 1.00 35.44  ? 361 ASN B CA  1 
ATOM   5254 C C   . ASN B 1 365 ? 19.257 -9.170  -14.391 1.00 33.56  ? 361 ASN B C   1 
ATOM   5255 O O   . ASN B 1 365 ? 18.381 -9.673  -13.705 1.00 33.71  ? 361 ASN B O   1 
ATOM   5256 C CB  . ASN B 1 365 ? 20.130 -11.528 -14.704 1.00 35.24  ? 361 ASN B CB  1 
ATOM   5257 C CG  . ASN B 1 365 ? 20.500 -11.837 -13.262 1.00 40.69  ? 361 ASN B CG  1 
ATOM   5258 O OD1 . ASN B 1 365 ? 21.209 -11.072 -12.600 1.00 40.53  ? 361 ASN B OD1 1 
ATOM   5259 N ND2 . ASN B 1 365 ? 20.027 -12.973 -12.765 1.00 43.54  ? 361 ASN B ND2 1 
ATOM   5260 N N   . PHE B 1 366 ? 19.334 -7.859  -14.604 1.00 34.26  ? 362 PHE B N   1 
ATOM   5261 C CA  . PHE B 1 366 ? 18.355 -6.935  -14.034 1.00 36.77  ? 362 PHE B CA  1 
ATOM   5262 C C   . PHE B 1 366 ? 16.953 -7.095  -14.640 1.00 37.03  ? 362 PHE B C   1 
ATOM   5263 O O   . PHE B 1 366 ? 16.834 -7.353  -15.830 1.00 37.52  ? 362 PHE B O   1 
ATOM   5264 C CB  . PHE B 1 366 ? 18.798 -5.478  -14.228 1.00 33.89  ? 362 PHE B CB  1 
ATOM   5265 C CG  . PHE B 1 366 ? 19.979 -5.073  -13.376 1.00 37.14  ? 362 PHE B CG  1 
ATOM   5266 C CD1 . PHE B 1 366 ? 21.284 -5.226  -13.845 1.00 36.31  ? 362 PHE B CD1 1 
ATOM   5267 C CD2 . PHE B 1 366 ? 19.789 -4.545  -12.088 1.00 35.52  ? 362 PHE B CD2 1 
ATOM   5268 C CE1 . PHE B 1 366 ? 22.381 -4.857  -13.038 1.00 36.79  ? 362 PHE B CE1 1 
ATOM   5269 C CE2 . PHE B 1 366 ? 20.877 -4.180  -11.288 1.00 34.19  ? 362 PHE B CE2 1 
ATOM   5270 C CZ  . PHE B 1 366 ? 22.175 -4.339  -11.766 1.00 33.82  ? 362 PHE B CZ  1 
ATOM   5271 N N   . THR B 1 367 ? 15.906 -6.959  -13.815 1.00 38.20  ? 363 THR B N   1 
ATOM   5272 C CA  . THR B 1 367 ? 14.505 -7.015  -14.298 1.00 38.97  ? 363 THR B CA  1 
ATOM   5273 C C   . THR B 1 367 ? 14.010 -5.562  -14.372 1.00 40.39  ? 363 THR B C   1 
ATOM   5274 O O   . THR B 1 367 ? 14.667 -4.631  -13.867 1.00 39.53  ? 363 THR B O   1 
ATOM   5275 C CB  . THR B 1 367 ? 13.557 -7.740  -13.317 1.00 39.32  ? 363 THR B CB  1 
ATOM   5276 O OG1 . THR B 1 367 ? 13.567 -7.038  -12.065 1.00 40.36  ? 363 THR B OG1 1 
ATOM   5277 C CG2 . THR B 1 367 ? 13.999 -9.205  -13.089 1.00 37.51  ? 363 THR B CG2 1 
ATOM   5278 N N   . THR B 1 368 ? 12.843 -5.371  -14.975 1.00 41.29  ? 364 THR B N   1 
ATOM   5279 C CA  . THR B 1 368 ? 12.240 -4.048  -15.090 1.00 41.68  ? 364 THR B CA  1 
ATOM   5280 C C   . THR B 1 368 ? 11.949 -3.530  -13.669 1.00 41.31  ? 364 THR B C   1 
ATOM   5281 O O   . THR B 1 368 ? 12.203 -2.369  -13.353 1.00 42.48  ? 364 THR B O   1 
ATOM   5282 C CB  . THR B 1 368 ? 10.890 -4.102  -15.889 1.00 42.36  ? 364 THR B CB  1 
ATOM   5283 O OG1 . THR B 1 368 ? 11.134 -4.566  -17.225 1.00 43.09  ? 364 THR B OG1 1 
ATOM   5284 C CG2 . THR B 1 368 ? 10.259 -2.704  -15.983 1.00 41.17  ? 364 THR B CG2 1 
ATOM   5285 N N   . GLN B 1 369 ? 11.412 -4.399  -12.826 1.00 40.73  ? 365 GLN B N   1 
ATOM   5286 C CA  . GLN B 1 369 ? 11.098 -4.057  -11.442 1.00 40.15  ? 365 GLN B CA  1 
ATOM   5287 C C   . GLN B 1 369 ? 12.358 -3.506  -10.752 1.00 40.84  ? 365 GLN B C   1 
ATOM   5288 O O   . GLN B 1 369 ? 12.342 -2.440  -10.150 1.00 36.89  ? 365 GLN B O   1 
ATOM   5289 C CB  . GLN B 1 369 ? 10.598 -5.314  -10.711 1.00 39.97  ? 365 GLN B CB  1 
ATOM   5290 C CG  . GLN B 1 369 ? 10.323 -5.126  -9.224  1.00 41.08  ? 365 GLN B CG  1 
ATOM   5291 C CD  . GLN B 1 369 ? 9.120  -4.213  -8.918  1.00 41.83  ? 365 GLN B CD  1 
ATOM   5292 O OE1 . GLN B 1 369 ? 8.992  -3.704  -7.816  1.00 40.82  ? 365 GLN B OE1 1 
ATOM   5293 N NE2 . GLN B 1 369 ? 8.232  -4.028  -9.894  1.00 44.63  ? 365 GLN B NE2 1 
ATOM   5294 N N   . GLU B 1 370 ? 13.461 -4.241  -10.886 1.00 42.00  ? 366 GLU B N   1 
ATOM   5295 C CA  . GLU B 1 370 ? 14.736 -3.860  -10.282 1.00 41.65  ? 366 GLU B CA  1 
ATOM   5296 C C   . GLU B 1 370 ? 15.230 -2.511  -10.751 1.00 40.07  ? 366 GLU B C   1 
ATOM   5297 O O   . GLU B 1 370 ? 15.824 -1.766  -9.970  1.00 38.90  ? 366 GLU B O   1 
ATOM   5298 C CB  . GLU B 1 370 ? 15.811 -4.907  -10.598 1.00 42.90  ? 366 GLU B CB  1 
ATOM   5299 C CG  . GLU B 1 370 ? 16.582 -5.382  -9.397  1.00 47.09  ? 366 GLU B CG  1 
ATOM   5300 C CD  . GLU B 1 370 ? 17.683 -6.377  -9.763  1.00 47.67  ? 366 GLU B CD  1 
ATOM   5301 O OE1 . GLU B 1 370 ? 17.428 -7.272  -10.606 1.00 47.71  ? 366 GLU B OE1 1 
ATOM   5302 O OE2 . GLU B 1 370 ? 18.788 -6.246  -9.190  1.00 46.83  ? 366 GLU B OE2 1 
ATOM   5303 N N   . LEU B 1 371 ? 14.993 -2.204  -12.023 1.00 39.65  ? 367 LEU B N   1 
ATOM   5304 C CA  . LEU B 1 371 ? 15.449 -0.942  -12.611 1.00 39.91  ? 367 LEU B CA  1 
ATOM   5305 C C   . LEU B 1 371 ? 14.431 0.197   -12.494 1.00 41.16  ? 367 LEU B C   1 
ATOM   5306 O O   . LEU B 1 371 ? 14.751 1.345   -12.824 1.00 41.16  ? 367 LEU B O   1 
ATOM   5307 C CB  . LEU B 1 371 ? 15.772 -1.148  -14.103 1.00 39.21  ? 367 LEU B CB  1 
ATOM   5308 C CG  . LEU B 1 371 ? 16.941 -2.085  -14.477 1.00 41.25  ? 367 LEU B CG  1 
ATOM   5309 C CD1 . LEU B 1 371 ? 16.781 -2.605  -15.908 1.00 40.09  ? 367 LEU B CD1 1 
ATOM   5310 C CD2 . LEU B 1 371 ? 18.260 -1.330  -14.311 1.00 39.73  ? 367 LEU B CD2 1 
ATOM   5311 N N   . SER B 1 372 ? 13.226 -0.110  -12.028 1.00 41.71  ? 368 SER B N   1 
ATOM   5312 C CA  . SER B 1 372 ? 12.156 0.897   -11.971 1.00 43.77  ? 368 SER B CA  1 
ATOM   5313 C C   . SER B 1 372 ? 12.476 2.272   -11.377 1.00 45.80  ? 368 SER B C   1 
ATOM   5314 O O   . SER B 1 372 ? 11.933 3.287   -11.837 1.00 45.78  ? 368 SER B O   1 
ATOM   5315 C CB  . SER B 1 372 ? 10.909 0.316   -11.293 1.00 43.90  ? 368 SER B CB  1 
ATOM   5316 O OG  . SER B 1 372 ? 11.154 -0.063  -9.950  1.00 44.56  ? 368 SER B OG  1 
ATOM   5317 N N   . SER B 1 373 ? 13.357 2.348   -10.385 1.00 45.87  ? 369 SER B N   1 
ATOM   5318 C CA  . SER B 1 373 ? 13.667 3.666   -9.821  1.00 46.83  ? 369 SER B CA  1 
ATOM   5319 C C   . SER B 1 373 ? 14.481 4.561   -10.785 1.00 48.27  ? 369 SER B C   1 
ATOM   5320 O O   . SER B 1 373 ? 14.676 5.750   -10.514 1.00 46.81  ? 369 SER B O   1 
ATOM   5321 C CB  . SER B 1 373 ? 14.446 3.539   -8.511  1.00 46.21  ? 369 SER B CB  1 
ATOM   5322 O OG  . SER B 1 373 ? 15.836 3.359   -8.772  1.00 45.57  ? 369 SER B OG  1 
ATOM   5323 N N   . ASN B 1 374 ? 14.973 4.009   -11.895 1.00 47.76  ? 370 ASN B N   1 
ATOM   5324 C CA  . ASN B 1 374 ? 15.751 4.820   -12.841 1.00 46.73  ? 370 ASN B CA  1 
ATOM   5325 C C   . ASN B 1 374 ? 16.185 3.983   -14.059 1.00 45.44  ? 370 ASN B C   1 
ATOM   5326 O O   . ASN B 1 374 ? 17.375 3.660   -14.208 1.00 42.88  ? 370 ASN B O   1 
ATOM   5327 C CB  . ASN B 1 374 ? 16.989 5.392   -12.123 1.00 47.35  ? 370 ASN B CB  1 
ATOM   5328 C CG  . ASN B 1 374 ? 17.679 6.508   -12.913 1.00 49.70  ? 370 ASN B CG  1 
ATOM   5329 O OD1 . ASN B 1 374 ? 18.494 7.249   -12.369 1.00 51.54  ? 370 ASN B OD1 1 
ATOM   5330 N ND2 . ASN B 1 374 ? 17.357 6.626   -14.190 1.00 50.66  ? 370 ASN B ND2 1 
ATOM   5331 N N   . PRO B 1 375 ? 15.231 3.647   -14.955 1.00 44.20  ? 371 PRO B N   1 
ATOM   5332 C CA  . PRO B 1 375 ? 15.510 2.837   -16.158 1.00 42.92  ? 371 PRO B CA  1 
ATOM   5333 C C   . PRO B 1 375 ? 16.761 3.191   -16.969 1.00 42.15  ? 371 PRO B C   1 
ATOM   5334 O O   . PRO B 1 375 ? 17.515 2.310   -17.365 1.00 40.43  ? 371 PRO B O   1 
ATOM   5335 C CB  . PRO B 1 375 ? 14.223 2.962   -16.965 1.00 42.81  ? 371 PRO B CB  1 
ATOM   5336 C CG  . PRO B 1 375 ? 13.156 3.036   -15.865 1.00 43.42  ? 371 PRO B CG  1 
ATOM   5337 C CD  . PRO B 1 375 ? 13.801 4.025   -14.899 1.00 44.33  ? 371 PRO B CD  1 
ATOM   5338 N N   . PRO B 1 376 ? 17.019 4.486   -17.204 1.00 42.54  ? 372 PRO B N   1 
ATOM   5339 C CA  . PRO B 1 376 ? 18.207 4.857   -17.977 1.00 43.00  ? 372 PRO B CA  1 
ATOM   5340 C C   . PRO B 1 376 ? 19.544 4.312   -17.445 1.00 43.27  ? 372 PRO B C   1 
ATOM   5341 O O   . PRO B 1 376 ? 20.527 4.274   -18.180 1.00 43.19  ? 372 PRO B O   1 
ATOM   5342 C CB  . PRO B 1 376 ? 18.177 6.389   -17.961 1.00 44.64  ? 372 PRO B CB  1 
ATOM   5343 C CG  . PRO B 1 376 ? 16.694 6.712   -17.808 1.00 44.23  ? 372 PRO B CG  1 
ATOM   5344 C CD  . PRO B 1 376 ? 16.234 5.676   -16.819 1.00 44.88  ? 372 PRO B CD  1 
ATOM   5345 N N   . LEU B 1 377 ? 19.601 3.909   -16.177 1.00 41.83  ? 373 LEU B N   1 
ATOM   5346 C CA  . LEU B 1 377 ? 20.855 3.399   -15.636 1.00 41.49  ? 373 LEU B CA  1 
ATOM   5347 C C   . LEU B 1 377 ? 21.225 2.064   -16.296 1.00 42.51  ? 373 LEU B C   1 
ATOM   5348 O O   . LEU B 1 377 ? 22.364 1.614   -16.224 1.00 40.20  ? 373 LEU B O   1 
ATOM   5349 C CB  . LEU B 1 377 ? 20.777 3.247   -14.098 1.00 41.31  ? 373 LEU B CB  1 
ATOM   5350 C CG  . LEU B 1 377 ? 20.829 4.558   -13.283 1.00 42.66  ? 373 LEU B CG  1 
ATOM   5351 C CD1 . LEU B 1 377 ? 20.891 4.228   -11.797 1.00 40.51  ? 373 LEU B CD1 1 
ATOM   5352 C CD2 . LEU B 1 377 ? 22.064 5.400   -13.697 1.00 38.89  ? 373 LEU B CD2 1 
ATOM   5353 N N   . ALA B 1 378 ? 20.258 1.428   -16.948 1.00 43.13  ? 374 ALA B N   1 
ATOM   5354 C CA  . ALA B 1 378 ? 20.536 0.163   -17.623 1.00 43.74  ? 374 ALA B CA  1 
ATOM   5355 C C   . ALA B 1 378 ? 21.701 0.278   -18.625 1.00 43.75  ? 374 ALA B C   1 
ATOM   5356 O O   . ALA B 1 378 ? 22.438 -0.689  -18.836 1.00 41.16  ? 374 ALA B O   1 
ATOM   5357 C CB  . ALA B 1 378 ? 19.285 -0.344  -18.332 1.00 43.33  ? 374 ALA B CB  1 
ATOM   5358 N N   . THR B 1 379 ? 21.896 1.453   -19.222 1.00 44.02  ? 375 THR B N   1 
ATOM   5359 C CA  . THR B 1 379 ? 22.985 1.614   -20.191 1.00 45.30  ? 375 THR B CA  1 
ATOM   5360 C C   . THR B 1 379 ? 24.363 1.472   -19.539 1.00 45.44  ? 375 THR B C   1 
ATOM   5361 O O   . THR B 1 379 ? 25.361 1.218   -20.221 1.00 44.87  ? 375 THR B O   1 
ATOM   5362 C CB  . THR B 1 379 ? 22.914 2.982   -20.963 1.00 47.23  ? 375 THR B CB  1 
ATOM   5363 O OG1 . THR B 1 379 ? 23.245 4.062   -20.081 1.00 49.60  ? 375 THR B OG1 1 
ATOM   5364 C CG2 . THR B 1 379 ? 21.515 3.198   -21.529 1.00 48.72  ? 375 THR B CG2 1 
ATOM   5365 N N   . ILE B 1 380 ? 24.434 1.657   -18.225 1.00 44.96  ? 376 ILE B N   1 
ATOM   5366 C CA  . ILE B 1 380 ? 25.692 1.474   -17.509 1.00 45.12  ? 376 ILE B CA  1 
ATOM   5367 C C   . ILE B 1 380 ? 25.667 0.090   -16.850 1.00 44.37  ? 376 ILE B C   1 
ATOM   5368 O O   . ILE B 1 380 ? 26.608 -0.686  -16.953 1.00 44.43  ? 376 ILE B O   1 
ATOM   5369 C CB  . ILE B 1 380 ? 25.884 2.517   -16.398 1.00 46.83  ? 376 ILE B CB  1 
ATOM   5370 C CG1 . ILE B 1 380 ? 26.112 3.900   -17.011 1.00 46.50  ? 376 ILE B CG1 1 
ATOM   5371 C CG2 . ILE B 1 380 ? 27.066 2.119   -15.506 1.00 45.38  ? 376 ILE B CG2 1 
ATOM   5372 C CD1 . ILE B 1 380 ? 25.987 5.016   -15.981 1.00 48.54  ? 376 ILE B CD1 1 
ATOM   5373 N N   . LEU B 1 381 ? 24.556 -0.227  -16.207 1.00 43.09  ? 377 LEU B N   1 
ATOM   5374 C CA  . LEU B 1 381 ? 24.411 -1.489  -15.486 1.00 41.80  ? 377 LEU B CA  1 
ATOM   5375 C C   . LEU B 1 381 ? 24.552 -2.791  -16.288 1.00 42.03  ? 377 LEU B C   1 
ATOM   5376 O O   . LEU B 1 381 ? 25.056 -3.791  -15.773 1.00 39.85  ? 377 LEU B O   1 
ATOM   5377 C CB  . LEU B 1 381 ? 23.077 -1.486  -14.745 1.00 38.36  ? 377 LEU B CB  1 
ATOM   5378 C CG  . LEU B 1 381 ? 23.034 -0.382  -13.688 1.00 38.70  ? 377 LEU B CG  1 
ATOM   5379 C CD1 . LEU B 1 381 ? 21.624 -0.297  -13.110 1.00 36.28  ? 377 LEU B CD1 1 
ATOM   5380 C CD2 . LEU B 1 381 ? 24.098 -0.658  -12.595 1.00 36.54  ? 377 LEU B CD2 1 
ATOM   5381 N N   . ILE B 1 382 ? 24.085 -2.793  -17.533 1.00 42.16  ? 378 ILE B N   1 
ATOM   5382 C CA  . ILE B 1 382 ? 24.190 -3.974  -18.365 1.00 43.23  ? 378 ILE B CA  1 
ATOM   5383 C C   . ILE B 1 382 ? 25.264 -3.676  -19.401 1.00 44.24  ? 378 ILE B C   1 
ATOM   5384 O O   . ILE B 1 382 ? 25.007 -3.037  -20.414 1.00 43.69  ? 378 ILE B O   1 
ATOM   5385 C CB  . ILE B 1 382 ? 22.853 -4.280  -19.034 1.00 44.80  ? 378 ILE B CB  1 
ATOM   5386 C CG1 . ILE B 1 382 ? 21.772 -4.416  -17.965 1.00 44.51  ? 378 ILE B CG1 1 
ATOM   5387 C CG2 . ILE B 1 382 ? 22.953 -5.580  -19.814 1.00 44.89  ? 378 ILE B CG2 1 
ATOM   5388 C CD1 . ILE B 1 382 ? 20.406 -4.847  -18.502 1.00 45.73  ? 378 ILE B CD1 1 
ATOM   5389 N N   . PRO B 1 383 ? 26.498 -4.146  -19.156 1.00 45.56  ? 379 PRO B N   1 
ATOM   5390 C CA  . PRO B 1 383 ? 27.606 -3.892  -20.083 1.00 44.74  ? 379 PRO B CA  1 
ATOM   5391 C C   . PRO B 1 383 ? 27.398 -4.465  -21.494 1.00 46.08  ? 379 PRO B C   1 
ATOM   5392 O O   . PRO B 1 383 ? 26.635 -5.425  -21.701 1.00 43.79  ? 379 PRO B O   1 
ATOM   5393 C CB  . PRO B 1 383 ? 28.806 -4.478  -19.340 1.00 43.56  ? 379 PRO B CB  1 
ATOM   5394 C CG  . PRO B 1 383 ? 28.204 -5.668  -18.651 1.00 45.30  ? 379 PRO B CG  1 
ATOM   5395 C CD  . PRO B 1 383 ? 26.882 -5.132  -18.125 1.00 44.31  ? 379 PRO B CD  1 
ATOM   5396 N N   . PRO B 1 384 ? 28.070 -3.870  -22.491 1.00 47.74  ? 380 PRO B N   1 
ATOM   5397 C CA  . PRO B 1 384 ? 27.936 -4.331  -23.877 1.00 49.80  ? 380 PRO B CA  1 
ATOM   5398 C C   . PRO B 1 384 ? 27.970 -5.842  -24.064 1.00 51.47  ? 380 PRO B C   1 
ATOM   5399 O O   . PRO B 1 384 ? 27.121 -6.392  -24.756 1.00 51.49  ? 380 PRO B O   1 
ATOM   5400 C CB  . PRO B 1 384 ? 29.085 -3.624  -24.584 1.00 49.42  ? 380 PRO B CB  1 
ATOM   5401 C CG  . PRO B 1 384 ? 29.115 -2.297  -23.881 1.00 48.90  ? 380 PRO B CG  1 
ATOM   5402 C CD  . PRO B 1 384 ? 28.982 -2.715  -22.412 1.00 47.82  ? 380 PRO B CD  1 
ATOM   5403 N N   . HIS B 1 385 ? 28.918 -6.521  -23.425 1.00 52.33  ? 381 HIS B N   1 
ATOM   5404 C CA  . HIS B 1 385 ? 29.036 -7.963  -23.592 1.00 54.73  ? 381 HIS B CA  1 
ATOM   5405 C C   . HIS B 1 385 ? 27.983 -8.832  -22.926 1.00 57.06  ? 381 HIS B C   1 
ATOM   5406 O O   . HIS B 1 385 ? 27.682 -9.915  -23.404 1.00 58.31  ? 381 HIS B O   1 
ATOM   5407 C CB  . HIS B 1 385 ? 30.394 -8.460  -23.082 1.00 53.00  ? 381 HIS B CB  1 
ATOM   5408 C CG  . HIS B 1 385 ? 30.509 -8.463  -21.587 1.00 52.13  ? 381 HIS B CG  1 
ATOM   5409 N ND1 . HIS B 1 385 ? 30.896 -7.352  -20.866 1.00 51.30  ? 381 HIS B ND1 1 
ATOM   5410 C CD2 . HIS B 1 385 ? 30.276 -9.440  -20.677 1.00 49.35  ? 381 HIS B CD2 1 
ATOM   5411 C CE1 . HIS B 1 385 ? 30.902 -7.647  -19.578 1.00 49.56  ? 381 HIS B CE1 1 
ATOM   5412 N NE2 . HIS B 1 385 ? 30.530 -8.908  -19.437 1.00 49.39  ? 381 HIS B NE2 1 
ATOM   5413 N N   . ALA B 1 386 ? 27.447 -8.400  -21.798 1.00 59.67  ? 382 ALA B N   1 
ATOM   5414 C CA  . ALA B 1 386 ? 26.495 -9.231  -21.069 1.00 63.07  ? 382 ALA B CA  1 
ATOM   5415 C C   . ALA B 1 386 ? 25.205 -9.548  -21.778 1.00 65.46  ? 382 ALA B C   1 
ATOM   5416 O O   . ALA B 1 386 ? 24.817 -8.874  -22.723 1.00 66.64  ? 382 ALA B O   1 
ATOM   5417 C CB  . ALA B 1 386 ? 26.180 -8.593  -19.729 1.00 62.50  ? 382 ALA B CB  1 
ATOM   5418 N N   . ARG B 1 387 ? 24.532 -10.587 -21.313 1.00 68.81  ? 383 ARG B N   1 
ATOM   5419 C CA  . ARG B 1 387 ? 23.247 -10.930 -21.889 1.00 73.79  ? 383 ARG B CA  1 
ATOM   5420 C C   . ARG B 1 387 ? 22.307 -11.230 -20.730 1.00 75.76  ? 383 ARG B C   1 
ATOM   5421 O O   . ARG B 1 387 ? 21.901 -10.269 -20.015 1.00 76.76  ? 383 ARG B O   1 
ATOM   5422 C CB  . ARG B 1 387 ? 23.362 -12.157 -22.798 1.00 75.80  ? 383 ARG B CB  1 
ATOM   5423 C CG  . ARG B 1 387 ? 22.211 -12.310 -23.777 1.00 77.11  ? 383 ARG B CG  1 
ATOM   5424 C CD  . ARG B 1 387 ? 22.771 -12.336 -25.189 1.00 79.23  ? 383 ARG B CD  1 
ATOM   5425 N NE  . ARG B 1 387 ? 23.573 -11.140 -25.458 1.00 80.63  ? 383 ARG B NE  1 
ATOM   5426 C CZ  . ARG B 1 387 ? 24.555 -11.079 -26.356 1.00 80.91  ? 383 ARG B CZ  1 
ATOM   5427 N NH1 . ARG B 1 387 ? 24.866 -12.147 -27.079 1.00 80.76  ? 383 ARG B NH1 1 
ATOM   5428 N NH2 . ARG B 1 387 ? 25.233 -9.950  -26.527 1.00 80.97  ? 383 ARG B NH2 1 
HETATM 5429 C C1  . IXM C 2 .   ? 40.306 3.918   35.381  1.00 47.41  ? 451 IXM A C1  1 
HETATM 5430 C C2  . IXM C 2 .   ? 39.689 5.274   35.224  1.00 48.20  ? 451 IXM A C2  1 
HETATM 5431 C C3  . IXM C 2 .   ? 40.821 3.877   36.699  1.00 46.28  ? 451 IXM A C3  1 
HETATM 5432 N N4  . IXM C 2 .   ? 40.596 5.055   37.347  1.00 47.27  ? 451 IXM A N4  1 
HETATM 5433 C C5  . IXM C 2 .   ? 41.470 2.735   37.209  1.00 47.42  ? 451 IXM A C5  1 
HETATM 5434 C C7  . IXM C 2 .   ? 41.614 1.606   36.362  1.00 46.74  ? 451 IXM A C7  1 
HETATM 5435 C C9  . IXM C 2 .   ? 41.102 1.640   35.027  1.00 47.17  ? 451 IXM A C9  1 
HETATM 5436 C C11 . IXM C 2 .   ? 40.437 2.806   34.523  1.00 47.25  ? 451 IXM A C11 1 
HETATM 5437 C C13 . IXM C 2 .   ? 39.939 5.973   36.556  1.00 46.23  ? 451 IXM A C13 1 
HETATM 5438 C C14 . IXM C 2 .   ? 39.592 7.234   36.934  1.00 46.06  ? 451 IXM A C14 1 
HETATM 5439 C C15 . IXM C 2 .   ? 40.117 7.736   38.276  1.00 44.75  ? 451 IXM A C15 1 
HETATM 5440 N N16 . IXM C 2 .   ? 39.588 9.009   38.435  1.00 44.01  ? 451 IXM A N16 1 
HETATM 5441 C C17 . IXM C 2 .   ? 38.798 9.372   37.355  1.00 43.55  ? 451 IXM A C17 1 
HETATM 5442 C C18 . IXM C 2 .   ? 38.752 8.333   36.387  1.00 44.59  ? 451 IXM A C18 1 
HETATM 5443 C C19 . IXM C 2 .   ? 38.110 10.598  37.215  1.00 43.95  ? 451 IXM A C19 1 
HETATM 5444 C C20 . IXM C 2 .   ? 37.333 10.792  36.048  1.00 43.49  ? 451 IXM A C20 1 
HETATM 5445 C C21 . IXM C 2 .   ? 37.264 9.769   35.052  1.00 45.40  ? 451 IXM A C21 1 
HETATM 5446 C C22 . IXM C 2 .   ? 37.978 8.536   35.221  1.00 44.55  ? 451 IXM A C22 1 
HETATM 5447 O O23 . IXM C 2 .   ? 40.847 7.149   39.076  1.00 44.49  ? 451 IXM A O23 1 
HETATM 5448 N N24 . IXM C 2 .   ? 39.040 5.805   34.233  1.00 52.24  ? 451 IXM A N24 1 
HETATM 5449 O O39 . IXM C 2 .   ? 38.883 5.011   33.096  1.00 58.07  ? 451 IXM A O39 1 
HETATM 5450 C C1  . IXM D 2 .   ? 24.961 -18.530 9.470   1.00 54.84  ? 452 IXM B C1  1 
HETATM 5451 C C2  . IXM D 2 .   ? 23.500 -18.205 9.381   1.00 55.46  ? 452 IXM B C2  1 
HETATM 5452 C C3  . IXM D 2 .   ? 25.280 -19.227 8.273   1.00 54.51  ? 452 IXM B C3  1 
HETATM 5453 N N4  . IXM D 2 .   ? 24.172 -19.363 7.471   1.00 53.90  ? 452 IXM B N4  1 
HETATM 5454 C C5  . IXM D 2 .   ? 26.588 -19.686 8.017   1.00 54.30  ? 452 IXM B C5  1 
HETATM 5455 C C7  . IXM D 2 .   ? 27.605 -19.442 8.996   1.00 54.40  ? 452 IXM B C7  1 
HETATM 5456 C C9  . IXM D 2 .   ? 27.289 -18.744 10.206  1.00 54.75  ? 452 IXM B C9  1 
HETATM 5457 C C11 . IXM D 2 .   ? 25.957 -18.280 10.448  1.00 54.12  ? 452 IXM B C11 1 
HETATM 5458 C C13 . IXM D 2 .   ? 23.041 -18.790 8.031   1.00 52.81  ? 452 IXM B C13 1 
HETATM 5459 C C14 . IXM D 2 .   ? 21.799 -18.731 7.442   1.00 50.78  ? 452 IXM B C14 1 
HETATM 5460 C C15 . IXM D 2 .   ? 21.596 -19.508 6.130   1.00 48.76  ? 452 IXM B C15 1 
HETATM 5461 N N16 . IXM D 2 .   ? 20.310 -19.207 5.704   1.00 47.01  ? 452 IXM B N16 1 
HETATM 5462 C C17 . IXM D 2 .   ? 19.670 -18.343 6.589   1.00 48.21  ? 452 IXM B C17 1 
HETATM 5463 C C18 . IXM D 2 .   ? 20.516 -18.013 7.685   1.00 49.53  ? 452 IXM B C18 1 
HETATM 5464 C C19 . IXM D 2 .   ? 18.353 -17.832 6.438   1.00 47.95  ? 452 IXM B C19 1 
HETATM 5465 C C20 . IXM D 2 .   ? 17.858 -16.950 7.431   1.00 48.68  ? 452 IXM B C20 1 
HETATM 5466 C C21 . IXM D 2 .   ? 18.680 -16.601 8.548   1.00 49.90  ? 452 IXM B C21 1 
HETATM 5467 C C22 . IXM D 2 .   ? 20.011 -17.131 8.678   1.00 49.67  ? 452 IXM B C22 1 
HETATM 5468 O O23 . IXM D 2 .   ? 22.393 -20.230 5.550   1.00 44.12  ? 452 IXM B O23 1 
HETATM 5469 N N24 . IXM D 2 .   ? 22.723 -17.567 10.211  1.00 58.89  ? 452 IXM B N24 1 
HETATM 5470 O O39 . IXM D 2 .   ? 23.314 -17.093 11.392  1.00 63.58  ? 452 IXM B O39 1 
HETATM 5471 O O   . HOH E 3 .   ? 19.759 16.888  26.607  1.00 26.24  ? 502 HOH A O   1 
HETATM 5472 O O   . HOH E 3 .   ? 19.043 4.643   31.690  1.00 28.66  ? 505 HOH A O   1 
HETATM 5473 O O   . HOH E 3 .   ? 22.284 6.368   33.612  1.00 29.99  ? 506 HOH A O   1 
HETATM 5474 O O   . HOH E 3 .   ? 22.635 5.591   23.616  1.00 31.46  ? 509 HOH A O   1 
HETATM 5475 O O   . HOH E 3 .   ? 13.561 6.145   40.739  1.00 33.55  ? 510 HOH A O   1 
HETATM 5476 O O   . HOH E 3 .   ? 28.675 5.785   51.484  1.00 34.18  ? 512 HOH A O   1 
HETATM 5477 O O   . HOH E 3 .   ? 14.302 14.359  37.364  1.00 34.94  ? 513 HOH A O   1 
HETATM 5478 O O   . HOH E 3 .   ? 21.828 2.515   55.788  1.00 34.90  ? 514 HOH A O   1 
HETATM 5479 O O   . HOH E 3 .   ? 37.205 0.018   33.435  1.00 36.75  ? 515 HOH A O   1 
HETATM 5480 O O   . HOH E 3 .   ? 27.568 17.443  31.779  1.00 36.53  ? 517 HOH A O   1 
HETATM 5481 O O   . HOH E 3 .   ? 23.508 -5.570  32.953  1.00 34.91  ? 523 HOH A O   1 
HETATM 5482 O O   . HOH E 3 .   ? 10.263 9.038   36.840  1.00 40.83  ? 524 HOH A O   1 
HETATM 5483 O O   . HOH E 3 .   ? 18.778 -1.793  29.870  1.00 33.91  ? 525 HOH A O   1 
HETATM 5484 O O   . HOH E 3 .   ? 19.309 1.160   22.865  1.00 41.95  ? 526 HOH A O   1 
HETATM 5485 O O   . HOH E 3 .   ? 27.625 11.831  32.841  1.00 35.31  ? 530 HOH A O   1 
HETATM 5486 O O   . HOH E 3 .   ? 25.784 9.088   27.470  1.00 35.85  ? 536 HOH A O   1 
HETATM 5487 O O   . HOH E 3 .   ? 12.394 8.324   33.514  1.00 38.96  ? 537 HOH A O   1 
HETATM 5488 O O   . HOH E 3 .   ? 17.898 12.424  46.383  1.00 43.75  ? 542 HOH A O   1 
HETATM 5489 O O   . HOH E 3 .   ? 13.197 -3.670  51.728  1.00 46.16  ? 543 HOH A O   1 
HETATM 5490 O O   . HOH E 3 .   ? 33.867 18.046  43.151  1.00 40.51  ? 544 HOH A O   1 
HETATM 5491 O O   . HOH E 3 .   ? 29.543 -8.901  33.311  1.00 46.89  ? 545 HOH A O   1 
HETATM 5492 O O   . HOH E 3 .   ? 10.876 6.459   40.489  1.00 40.18  ? 550 HOH A O   1 
HETATM 5493 O O   . HOH E 3 .   ? 16.452 9.648   46.557  1.00 38.76  ? 555 HOH A O   1 
HETATM 5494 O O   . HOH E 3 .   ? 13.194 9.277   48.422  1.00 43.47  ? 557 HOH A O   1 
HETATM 5495 O O   . HOH E 3 .   ? 22.091 -5.147  30.693  1.00 38.79  ? 558 HOH A O   1 
HETATM 5496 O O   . HOH E 3 .   ? 12.918 0.784   50.534  1.00 42.51  ? 560 HOH A O   1 
HETATM 5497 O O   . HOH E 3 .   ? 29.916 -2.942  30.875  1.00 37.37  ? 563 HOH A O   1 
HETATM 5498 O O   . HOH E 3 .   ? 30.776 -4.818  32.687  1.00 50.13  ? 564 HOH A O   1 
HETATM 5499 O O   . HOH E 3 .   ? 16.484 14.573  40.350  1.00 42.22  ? 565 HOH A O   1 
HETATM 5500 O O   . HOH E 3 .   ? 29.133 9.923   29.941  1.00 45.39  ? 571 HOH A O   1 
HETATM 5501 O O   . HOH E 3 .   ? 15.935 10.519  42.196  1.00 37.41  ? 575 HOH A O   1 
HETATM 5502 O O   . HOH E 3 .   ? 7.586  -3.561  35.399  1.00 40.26  ? 576 HOH A O   1 
HETATM 5503 O O   . HOH E 3 .   ? 31.982 5.267   51.501  1.00 42.65  ? 577 HOH A O   1 
HETATM 5504 O O   . HOH E 3 .   ? 19.535 -15.786 33.546  1.00 50.11  ? 579 HOH A O   1 
HETATM 5505 O O   . HOH E 3 .   ? 33.002 14.865  45.478  1.00 42.13  ? 580 HOH A O   1 
HETATM 5506 O O   . HOH E 3 .   ? 35.262 12.050  47.194  1.00 44.15  ? 581 HOH A O   1 
HETATM 5507 O O   . HOH E 3 .   ? 29.323 -9.581  36.049  1.00 48.76  ? 582 HOH A O   1 
HETATM 5508 O O   . HOH E 3 .   ? 21.664 -7.790  53.959  1.00 43.37  ? 584 HOH A O   1 
HETATM 5509 O O   . HOH E 3 .   ? 31.293 -10.776 37.322  1.00 45.83  ? 586 HOH A O   1 
HETATM 5510 O O   . HOH E 3 .   ? 16.034 19.806  31.541  1.00 45.80  ? 587 HOH A O   1 
HETATM 5511 O O   . HOH E 3 .   ? 27.646 -11.838 42.804  1.00 46.26  ? 592 HOH A O   1 
HETATM 5512 O O   . HOH E 3 .   ? 22.713 21.101  33.510  1.00 42.00  ? 593 HOH A O   1 
HETATM 5513 O O   . HOH E 3 .   ? 19.167 -3.240  27.283  1.00 41.72  ? 596 HOH A O   1 
HETATM 5514 O O   . HOH E 3 .   ? 13.349 17.364  31.962  1.00 45.44  ? 598 HOH A O   1 
HETATM 5515 O O   . HOH E 3 .   ? 32.759 15.894  43.184  1.00 45.59  ? 601 HOH A O   1 
HETATM 5516 O O   . HOH E 3 .   ? 17.876 -6.133  15.348  1.00 46.73  ? 603 HOH A O   1 
HETATM 5517 O O   . HOH E 3 .   ? 21.296 6.001   20.944  1.00 35.27  ? 606 HOH A O   1 
HETATM 5518 O O   . HOH E 3 .   ? 8.179  9.360   34.971  1.00 42.92  ? 607 HOH A O   1 
HETATM 5519 O O   . HOH E 3 .   ? 9.902  9.292   32.809  1.00 42.09  ? 608 HOH A O   1 
HETATM 5520 O O   . HOH E 3 .   ? 33.904 7.025   52.062  1.00 46.66  ? 609 HOH A O   1 
HETATM 5521 O O   . HOH E 3 .   ? 14.866 12.910  41.631  1.00 40.98  ? 610 HOH A O   1 
HETATM 5522 O O   . HOH E 3 .   ? 16.248 -11.644 28.971  1.00 47.57  ? 614 HOH A O   1 
HETATM 5523 O O   . HOH E 3 .   ? 30.809 -0.202  31.197  1.00 31.19  ? 617 HOH A O   1 
HETATM 5524 O O   . HOH E 3 .   ? 11.553 -5.402  47.640  1.00 53.69  ? 619 HOH A O   1 
HETATM 5525 O O   . HOH E 3 .   ? 6.027  -1.087  35.945  1.00 47.23  ? 621 HOH A O   1 
HETATM 5526 O O   . HOH E 3 .   ? 29.598 2.602   58.444  1.00 45.72  ? 623 HOH A O   1 
HETATM 5527 O O   . HOH E 3 .   ? 33.032 -6.461  33.306  1.00 45.84  ? 624 HOH A O   1 
HETATM 5528 O O   . HOH E 3 .   ? 9.475  9.177   30.095  1.00 47.40  ? 625 HOH A O   1 
HETATM 5529 O O   . HOH E 3 .   ? 21.828 -8.775  19.458  1.00 49.02  ? 626 HOH A O   1 
HETATM 5530 O O   . HOH E 3 .   ? 18.113 -11.699 30.890  1.00 49.21  ? 627 HOH A O   1 
HETATM 5531 O O   . HOH E 3 .   ? 35.256 25.632  30.090  1.00 54.03  ? 629 HOH A O   1 
HETATM 5532 O O   . HOH E 3 .   ? 36.585 2.803   32.997  1.00 48.83  ? 630 HOH A O   1 
HETATM 5533 O O   . HOH E 3 .   ? 10.945 17.427  29.414  1.00 51.58  ? 632 HOH A O   1 
HETATM 5534 O O   . HOH E 3 .   ? 16.394 12.548  21.256  1.00 50.38  ? 633 HOH A O   1 
HETATM 5535 O O   . HOH E 3 .   ? 13.849 10.853  20.874  1.00 50.92  ? 634 HOH A O   1 
HETATM 5536 O O   . HOH E 3 .   ? 32.465 -2.074  59.745  1.00 51.16  ? 636 HOH A O   1 
HETATM 5537 O O   . HOH E 3 .   ? 30.949 -9.085  58.938  1.00 53.31  ? 637 HOH A O   1 
HETATM 5538 O O   . HOH E 3 .   ? 17.414 12.834  48.955  1.00 47.76  ? 638 HOH A O   1 
HETATM 5539 O O   . HOH E 3 .   ? 22.777 -0.403  65.404  1.00 43.67  ? 639 HOH A O   1 
HETATM 5540 O O   . HOH F 3 .   ? 20.325 2.729   9.505   1.00 29.16  ? 501 HOH B O   1 
HETATM 5541 O O   . HOH F 3 .   ? 24.046 -9.826  -8.527  1.00 32.89  ? 503 HOH B O   1 
HETATM 5542 O O   . HOH F 3 .   ? 14.905 -7.129  8.599   1.00 31.44  ? 504 HOH B O   1 
HETATM 5543 O O   . HOH F 3 .   ? 7.979  0.675   12.813  1.00 30.64  ? 507 HOH B O   1 
HETATM 5544 O O   . HOH F 3 .   ? 26.531 -3.554  -13.494 1.00 29.85  ? 508 HOH B O   1 
HETATM 5545 O O   . HOH F 3 .   ? 19.586 -0.982  7.889   1.00 28.33  ? 511 HOH B O   1 
HETATM 5546 O O   . HOH F 3 .   ? 15.101 0.760   -8.873  1.00 40.42  ? 516 HOH B O   1 
HETATM 5547 O O   . HOH F 3 .   ? 30.247 1.663   12.025  1.00 33.03  ? 518 HOH B O   1 
HETATM 5548 O O   . HOH F 3 .   ? 25.130 -13.176 -7.845  1.00 33.61  ? 519 HOH B O   1 
HETATM 5549 O O   . HOH F 3 .   ? 27.353 4.586   14.696  1.00 36.47  ? 520 HOH B O   1 
HETATM 5550 O O   . HOH F 3 .   ? 14.955 0.422   -6.044  1.00 34.77  ? 521 HOH B O   1 
HETATM 5551 O O   . HOH F 3 .   ? 18.900 0.119   17.658  1.00 36.28  ? 522 HOH B O   1 
HETATM 5552 O O   . HOH F 3 .   ? 14.889 -14.685 -3.200  1.00 31.81  ? 527 HOH B O   1 
HETATM 5553 O O   . HOH F 3 .   ? 16.490 -4.057  14.031  1.00 33.32  ? 528 HOH B O   1 
HETATM 5554 O O   . HOH F 3 .   ? 16.103 8.310   6.073   1.00 36.45  ? 529 HOH B O   1 
HETATM 5555 O O   . HOH F 3 .   ? 31.209 -0.218  10.085  1.00 37.47  ? 531 HOH B O   1 
HETATM 5556 O O   . HOH F 3 .   ? 26.523 4.425   12.021  1.00 32.03  ? 532 HOH B O   1 
HETATM 5557 O O   . HOH F 3 .   ? 37.785 -16.668 -5.011  1.00 38.07  ? 533 HOH B O   1 
HETATM 5558 O O   . HOH F 3 .   ? 16.036 3.504   -2.239  1.00 33.80  ? 534 HOH B O   1 
HETATM 5559 O O   . HOH F 3 .   ? 17.473 2.279   -6.144  1.00 36.85  ? 535 HOH B O   1 
HETATM 5560 O O   . HOH F 3 .   ? 19.618 6.470   -0.516  1.00 38.13  ? 538 HOH B O   1 
HETATM 5561 O O   . HOH F 3 .   ? 29.327 -6.318  12.846  1.00 39.74  ? 539 HOH B O   1 
HETATM 5562 O O   . HOH F 3 .   ? 9.303  -7.980  9.127   1.00 38.38  ? 540 HOH B O   1 
HETATM 5563 O O   . HOH F 3 .   ? 25.359 -16.777 -10.247 1.00 39.07  ? 541 HOH B O   1 
HETATM 5564 O O   . HOH F 3 .   ? 38.349 -7.426  7.898   1.00 35.28  ? 546 HOH B O   1 
HETATM 5565 O O   . HOH F 3 .   ? 15.867 9.832   2.202   1.00 41.62  ? 547 HOH B O   1 
HETATM 5566 O O   . HOH F 3 .   ? 5.403  -4.167  6.235   1.00 41.63  ? 548 HOH B O   1 
HETATM 5567 O O   . HOH F 3 .   ? 2.325  -17.120 10.802  1.00 45.39  ? 549 HOH B O   1 
HETATM 5568 O O   . HOH F 3 .   ? 18.228 -16.573 -3.856  1.00 41.29  ? 551 HOH B O   1 
HETATM 5569 O O   . HOH F 3 .   ? 27.953 -14.435 11.322  1.00 38.30  ? 552 HOH B O   1 
HETATM 5570 O O   . HOH F 3 .   ? 18.859 9.260   -0.754  1.00 37.58  ? 553 HOH B O   1 
HETATM 5571 O O   . HOH F 3 .   ? 26.335 -20.080 -5.033  1.00 42.16  ? 554 HOH B O   1 
HETATM 5572 O O   . HOH F 3 .   ? 36.350 -0.966  -10.454 1.00 36.91  ? 556 HOH B O   1 
HETATM 5573 O O   . HOH F 3 .   ? 11.261 5.090   1.811   1.00 41.04  ? 559 HOH B O   1 
HETATM 5574 O O   . HOH F 3 .   ? 25.152 -14.544 11.118  1.00 47.95  ? 561 HOH B O   1 
HETATM 5575 O O   . HOH F 3 .   ? 40.067 -0.830  -7.464  1.00 45.04  ? 562 HOH B O   1 
HETATM 5576 O O   . HOH F 3 .   ? 41.491 -7.525  -5.534  1.00 42.73  ? 566 HOH B O   1 
HETATM 5577 O O   . HOH F 3 .   ? 13.534 -14.166 -1.064  1.00 38.93  ? 567 HOH B O   1 
HETATM 5578 O O   . HOH F 3 .   ? 11.530 -15.903 -0.988  1.00 42.39  ? 568 HOH B O   1 
HETATM 5579 O O   . HOH F 3 .   ? 43.896 -16.311 -9.436  1.00 44.68  ? 569 HOH B O   1 
HETATM 5580 O O   . HOH F 3 .   ? 36.445 -5.553  8.337   1.00 35.40  ? 570 HOH B O   1 
HETATM 5581 O O   . HOH F 3 .   ? 22.369 4.412   18.455  1.00 46.71  ? 572 HOH B O   1 
HETATM 5582 O O   . HOH F 3 .   ? 12.520 -0.359  -15.058 1.00 44.39  ? 573 HOH B O   1 
HETATM 5583 O O   . HOH F 3 .   ? 10.329 -6.989  -13.641 1.00 41.68  ? 574 HOH B O   1 
HETATM 5584 O O   . HOH F 3 .   ? 33.668 -13.972 -14.974 1.00 46.15  ? 578 HOH B O   1 
HETATM 5585 O O   . HOH F 3 .   ? 17.966 4.980   -8.708  1.00 40.69  ? 583 HOH B O   1 
HETATM 5586 O O   . HOH F 3 .   ? 2.570  -12.258 1.254   1.00 50.16  ? 585 HOH B O   1 
HETATM 5587 O O   . HOH F 3 .   ? 16.523 -8.004  12.036  1.00 45.66  ? 588 HOH B O   1 
HETATM 5588 O O   . HOH F 3 .   ? 11.786 2.296   -0.785  1.00 44.50  ? 589 HOH B O   1 
HETATM 5589 O O   . HOH F 3 .   ? 27.956 8.216   26.615  1.00 45.66  ? 590 HOH B O   1 
HETATM 5590 O O   . HOH F 3 .   ? 9.832  -10.173 -8.183  1.00 47.31  ? 591 HOH B O   1 
HETATM 5591 O O   . HOH F 3 .   ? 35.458 8.807   13.735  1.00 49.04  ? 594 HOH B O   1 
HETATM 5592 O O   . HOH F 3 .   ? 39.401 -4.166  1.982   1.00 41.89  ? 595 HOH B O   1 
HETATM 5593 O O   . HOH F 3 .   ? 27.452 14.812  4.994   1.00 45.27  ? 597 HOH B O   1 
HETATM 5594 O O   . HOH F 3 .   ? 30.628 -17.855 -9.430  1.00 41.57  ? 599 HOH B O   1 
HETATM 5595 O O   . HOH F 3 .   ? 31.946 -9.065  -16.616 1.00 50.58  ? 600 HOH B O   1 
HETATM 5596 O O   . HOH F 3 .   ? 14.289 11.721  8.698   1.00 47.68  ? 602 HOH B O   1 
HETATM 5597 O O   . HOH F 3 .   ? 24.535 -11.899 -15.377 1.00 35.46  ? 604 HOH B O   1 
HETATM 5598 O O   . HOH F 3 .   ? 17.815 1.659   20.033  1.00 32.32  ? 605 HOH B O   1 
HETATM 5599 O O   . HOH F 3 .   ? 9.727  0.966   -15.007 1.00 44.16  ? 611 HOH B O   1 
HETATM 5600 O O   . HOH F 3 .   ? 14.804 10.512  6.269   1.00 39.06  ? 612 HOH B O   1 
HETATM 5601 O O   . HOH F 3 .   ? 13.396 3.893   -2.108  1.00 42.49  ? 613 HOH B O   1 
HETATM 5602 O O   . HOH F 3 .   ? 8.156  -21.928 -3.779  1.00 49.42  ? 615 HOH B O   1 
HETATM 5603 O O   . HOH F 3 .   ? 30.204 3.595   -13.711 1.00 44.68  ? 616 HOH B O   1 
HETATM 5604 O O   . HOH F 3 .   ? 27.027 -7.963  12.395  1.00 28.74  ? 618 HOH B O   1 
HETATM 5605 O O   . HOH F 3 .   ? 23.492 -15.097 -8.195  1.00 46.21  ? 620 HOH B O   1 
HETATM 5606 O O   . HOH F 3 .   ? 9.392  -12.946 12.477  1.00 49.46  ? 622 HOH B O   1 
HETATM 5607 O O   . HOH F 3 .   ? 31.430 0.723   20.891  1.00 49.01  ? 628 HOH B O   1 
HETATM 5608 O O   . HOH F 3 .   ? 17.166 -20.754 -4.223  1.00 55.04  ? 631 HOH B O   1 
HETATM 5609 O O   . HOH F 3 .   ? 12.043 8.350   18.459  1.00 50.40  ? 635 HOH B O   1 
HETATM 5610 O O   . HOH F 3 .   ? 3.172  -30.065 9.312   1.00 52.22  ? 640 HOH B O   1 
HETATM 5611 O O   . HOH F 3 .   ? 3.212  -34.343 -0.940  1.00 49.09  ? 641 HOH B O   1 
HETATM 5612 O O   . HOH F 3 .   ? -3.123 -24.609 3.248   1.00 47.57  ? 642 HOH B O   1 
HETATM 5613 O O   . HOH F 3 .   ? 2.229  -25.715 5.850   1.00 46.95  ? 643 HOH B O   1 
HETATM 5614 O O   . HOH F 3 .   ? 2.673  -27.941 -4.134  1.00 51.26  ? 644 HOH B O   1 
HETATM 5615 O O   . HOH F 3 .   ? 17.496 -11.945 -9.306  1.00 52.92  ? 645 HOH B O   1 
HETATM 5616 O O   . HOH F 3 .   ? 20.071 -24.122 0.412   1.00 49.45  ? 646 HOH B O   1 
HETATM 5617 O O   . HOH F 3 .   ? 24.675 15.938  3.534   1.00 54.01  ? 647 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -3  ?   ?   ?   A . n 
A 1 2   PRO 2   -2  ?   ?   ?   A . n 
A 1 3   LEU 3   -1  ?   ?   ?   A . n 
A 1 4   GLY 4   0   ?   ?   ?   A . n 
A 1 5   SER 5   1   ?   ?   ?   A . n 
A 1 6   SER 6   2   ?   ?   ?   A . n 
A 1 7   GLY 7   3   ?   ?   ?   A . n 
A 1 8   ARG 8   4   ?   ?   ?   A . n 
A 1 9   PRO 9   5   ?   ?   ?   A . n 
A 1 10  ARG 10  6   ?   ?   ?   A . n 
A 1 11  THR 11  7   ?   ?   ?   A . n 
A 1 12  THR 12  8   ?   ?   ?   A . n 
A 1 13  SER 13  9   ?   ?   ?   A . n 
A 1 14  PHE 14  10  ?   ?   ?   A . n 
A 1 15  ALA 15  11  ?   ?   ?   A . n 
A 1 16  GLU 16  12  ?   ?   ?   A . n 
A 1 17  SER 17  13  ?   ?   ?   A . n 
A 1 18  CYS 18  14  ?   ?   ?   A . n 
A 1 19  LYS 19  15  ?   ?   ?   A . n 
A 1 20  PRO 20  16  ?   ?   ?   A . n 
A 1 21  VAL 21  17  ?   ?   ?   A . n 
A 1 22  GLN 22  18  ?   ?   ?   A . n 
A 1 23  GLN 23  19  ?   ?   ?   A . n 
A 1 24  PRO 24  20  ?   ?   ?   A . n 
A 1 25  SER 25  21  ?   ?   ?   A . n 
A 1 26  ALA 26  22  ?   ?   ?   A . n 
A 1 27  PHE 27  23  ?   ?   ?   A . n 
A 1 28  GLY 28  24  ?   ?   ?   A . n 
A 1 29  SER 29  25  ?   ?   ?   A . n 
A 1 30  MET 30  26  ?   ?   ?   A . n 
A 1 31  LYS 31  27  ?   ?   ?   A . n 
A 1 32  VAL 32  28  ?   ?   ?   A . n 
A 1 33  SER 33  29  ?   ?   ?   A . n 
A 1 34  ARG 34  30  ?   ?   ?   A . n 
A 1 35  ASP 35  31  ?   ?   ?   A . n 
A 1 36  LYS 36  32  ?   ?   ?   A . n 
A 1 37  ASP 37  33  ?   ?   ?   A . n 
A 1 38  GLY 38  34  ?   ?   ?   A . n 
A 1 39  SER 39  35  35  SER SER A . n 
A 1 40  LYS 40  36  36  LYS LYS A . n 
A 1 41  VAL 41  37  37  VAL VAL A . n 
A 1 42  THR 42  38  38  THR THR A . n 
A 1 43  THR 43  39  39  THR THR A . n 
A 1 44  VAL 44  40  40  VAL VAL A . n 
A 1 45  VAL 45  41  41  VAL VAL A . n 
A 1 46  ALA 46  42  42  ALA ALA A . n 
A 1 47  THR 47  43  43  THR THR A . n 
A 1 48  PRO 48  44  44  PRO PRO A . n 
A 1 49  GLY 49  45  45  GLY GLY A . n 
A 1 50  GLN 50  46  46  GLN GLN A . n 
A 1 51  GLY 51  47  47  GLY GLY A . n 
A 1 52  PRO 52  48  48  PRO PRO A . n 
A 1 53  ASP 53  49  49  ASP ASP A . n 
A 1 54  ARG 54  50  50  ARG ARG A . n 
A 1 55  PRO 55  51  51  PRO PRO A . n 
A 1 56  GLN 56  52  52  GLN GLN A . n 
A 1 57  GLU 57  53  53  GLU GLU A . n 
A 1 58  VAL 58  54  54  VAL VAL A . n 
A 1 59  SER 59  55  55  SER SER A . n 
A 1 60  TYR 60  56  56  TYR TYR A . n 
A 1 61  THR 61  57  57  THR THR A . n 
A 1 62  ASP 62  58  58  ASP ASP A . n 
A 1 63  THR 63  59  59  THR THR A . n 
A 1 64  LYS 64  60  60  LYS LYS A . n 
A 1 65  VAL 65  61  61  VAL VAL A . n 
A 1 66  ILE 66  62  62  ILE ILE A . n 
A 1 67  GLY 67  63  63  GLY GLY A . n 
A 1 68  ASN 68  64  64  ASN ASN A . n 
A 1 69  GLY 69  65  65  GLY GLY A . n 
A 1 70  SER 70  66  66  SER SER A . n 
A 1 71  PHE 71  67  67  PHE PHE A . n 
A 1 72  GLY 72  68  68  GLY GLY A . n 
A 1 73  VAL 73  69  69  VAL VAL A . n 
A 1 74  VAL 74  70  70  VAL VAL A . n 
A 1 75  TYR 75  71  71  TYR TYR A . n 
A 1 76  GLN 76  72  72  GLN GLN A . n 
A 1 77  ALA 77  73  73  ALA ALA A . n 
A 1 78  LYS 78  74  74  LYS LYS A . n 
A 1 79  LEU 79  75  75  LEU LEU A . n 
A 1 80  CYS 80  76  76  CYS CYS A . n 
A 1 81  ASP 81  77  77  ASP ASP A . n 
A 1 82  SER 82  78  78  SER SER A . n 
A 1 83  GLY 83  79  79  GLY GLY A . n 
A 1 84  GLU 84  80  80  GLU GLU A . n 
A 1 85  LEU 85  81  81  LEU LEU A . n 
A 1 86  VAL 86  82  82  VAL VAL A . n 
A 1 87  ALA 87  83  83  ALA ALA A . n 
A 1 88  ILE 88  84  84  ILE ILE A . n 
A 1 89  LYS 89  85  85  LYS LYS A . n 
A 1 90  LYS 90  86  86  LYS LYS A . n 
A 1 91  VAL 91  87  87  VAL VAL A . n 
A 1 92  LEU 92  88  88  LEU LEU A . n 
A 1 93  GLN 93  89  89  GLN GLN A . n 
A 1 94  ASP 94  90  90  ASP GLY A . n 
A 1 95  LYS 95  91  91  LYS LYS A . n 
A 1 96  ARG 96  92  92  ARG ALA A . n 
A 1 97  PHE 97  93  93  PHE PHE A . n 
A 1 98  LYS 98  94  94  LYS LYS A . n 
A 1 99  ASN 99  95  95  ASN ASN A . n 
A 1 100 ARG 100 96  96  ARG ARG A . n 
A 1 101 GLU 101 97  97  GLU GLU A . n 
A 1 102 LEU 102 98  98  LEU LEU A . n 
A 1 103 GLN 103 99  99  GLN GLN A . n 
A 1 104 ILE 104 100 100 ILE ILE A . n 
A 1 105 MET 105 101 101 MET MET A . n 
A 1 106 ARG 106 102 102 ARG ARG A . n 
A 1 107 LYS 107 103 103 LYS LYS A . n 
A 1 108 LEU 108 104 104 LEU LEU A . n 
A 1 109 ASP 109 105 105 ASP ASP A . n 
A 1 110 HIS 110 106 106 HIS HIS A . n 
A 1 111 CYS 111 107 107 CYS CYS A . n 
A 1 112 ASN 112 108 108 ASN ASN A . n 
A 1 113 ILE 113 109 109 ILE ILE A . n 
A 1 114 VAL 114 110 110 VAL VAL A . n 
A 1 115 ARG 115 111 111 ARG ARG A . n 
A 1 116 LEU 116 112 112 LEU LEU A . n 
A 1 117 ARG 117 113 113 ARG ARG A . n 
A 1 118 TYR 118 114 114 TYR TYR A . n 
A 1 119 PHE 119 115 115 PHE PHE A . n 
A 1 120 PHE 120 116 116 PHE PHE A . n 
A 1 121 TYR 121 117 117 TYR TYR A . n 
A 1 122 SER 122 118 118 SER SER A . n 
A 1 123 SER 123 119 119 SER SER A . n 
A 1 124 GLY 124 120 ?   ?   ?   A . n 
A 1 125 GLU 125 121 ?   ?   ?   A . n 
A 1 126 LYS 126 122 ?   ?   ?   A . n 
A 1 127 LYS 127 123 ?   ?   ?   A . n 
A 1 128 ASP 128 124 ?   ?   ?   A . n 
A 1 129 GLU 129 125 ?   ?   ?   A . n 
A 1 130 VAL 130 126 126 VAL VAL A . n 
A 1 131 TYR 131 127 127 TYR TYR A . n 
A 1 132 LEU 132 128 128 LEU LEU A . n 
A 1 133 ASN 133 129 129 ASN ASN A . n 
A 1 134 LEU 134 130 130 LEU LEU A . n 
A 1 135 VAL 135 131 131 VAL VAL A . n 
A 1 136 LEU 136 132 132 LEU LEU A . n 
A 1 137 ASP 137 133 133 ASP ASP A . n 
A 1 138 TYR 138 134 134 TYR TYR A . n 
A 1 139 VAL 139 135 135 VAL VAL A . n 
A 1 140 PRO 140 136 136 PRO PRO A . n 
A 1 141 GLU 141 137 137 GLU GLU A . n 
A 1 142 THR 142 138 138 THR THR A . n 
A 1 143 VAL 143 139 139 VAL VAL A . n 
A 1 144 TYR 144 140 140 TYR TYR A . n 
A 1 145 ARG 145 141 141 ARG ARG A . n 
A 1 146 VAL 146 142 142 VAL VAL A . n 
A 1 147 ALA 147 143 143 ALA ALA A . n 
A 1 148 ARG 148 144 144 ARG ARG A . n 
A 1 149 HIS 149 145 145 HIS HIS A . n 
A 1 150 TYR 150 146 146 TYR TYR A . n 
A 1 151 SER 151 147 147 SER SER A . n 
A 1 152 ARG 152 148 148 ARG ARG A . n 
A 1 153 ALA 153 149 149 ALA ALA A . n 
A 1 154 LYS 154 150 150 LYS LYS A . n 
A 1 155 GLN 155 151 151 GLN GLN A . n 
A 1 156 THR 156 152 152 THR THR A . n 
A 1 157 LEU 157 153 153 LEU LEU A . n 
A 1 158 PRO 158 154 154 PRO PRO A . n 
A 1 159 VAL 159 155 155 VAL VAL A . n 
A 1 160 ILE 160 156 156 ILE ILE A . n 
A 1 161 TYR 161 157 157 TYR TYR A . n 
A 1 162 VAL 162 158 158 VAL VAL A . n 
A 1 163 LYS 163 159 159 LYS LYS A . n 
A 1 164 LEU 164 160 160 LEU LEU A . n 
A 1 165 TYR 165 161 161 TYR TYR A . n 
A 1 166 MET 166 162 162 MET MET A . n 
A 1 167 TYR 167 163 163 TYR TYR A . n 
A 1 168 GLN 168 164 164 GLN GLN A . n 
A 1 169 LEU 169 165 165 LEU LEU A . n 
A 1 170 PHE 170 166 166 PHE PHE A . n 
A 1 171 ARG 171 167 167 ARG ARG A . n 
A 1 172 SER 172 168 168 SER SER A . n 
A 1 173 LEU 173 169 169 LEU LEU A . n 
A 1 174 ALA 174 170 170 ALA ALA A . n 
A 1 175 TYR 175 171 171 TYR TYR A . n 
A 1 176 ILE 176 172 172 ILE ILE A . n 
A 1 177 HIS 177 173 173 HIS HIS A . n 
A 1 178 SER 178 174 174 SER SER A . n 
A 1 179 PHE 179 175 175 PHE PHE A . n 
A 1 180 GLY 180 176 176 GLY GLY A . n 
A 1 181 ILE 181 177 177 ILE ILE A . n 
A 1 182 CYS 182 178 178 CYS CYS A . n 
A 1 183 HIS 183 179 179 HIS HIS A . n 
A 1 184 ARG 184 180 180 ARG ARG A . n 
A 1 185 ASP 185 181 181 ASP ASP A . n 
A 1 186 ILE 186 182 182 ILE ILE A . n 
A 1 187 LYS 187 183 183 LYS LYS A . n 
A 1 188 PRO 188 184 184 PRO PRO A . n 
A 1 189 GLN 189 185 185 GLN GLN A . n 
A 1 190 ASN 190 186 186 ASN ASN A . n 
A 1 191 LEU 191 187 187 LEU LEU A . n 
A 1 192 LEU 192 188 188 LEU LEU A . n 
A 1 193 LEU 193 189 189 LEU LEU A . n 
A 1 194 ASP 194 190 190 ASP ASP A . n 
A 1 195 PRO 195 191 191 PRO PRO A . n 
A 1 196 ASP 196 192 192 ASP ASP A . n 
A 1 197 THR 197 193 193 THR THR A . n 
A 1 198 ALA 198 194 194 ALA ALA A . n 
A 1 199 VAL 199 195 195 VAL VAL A . n 
A 1 200 LEU 200 196 196 LEU LEU A . n 
A 1 201 LYS 201 197 197 LYS LYS A . n 
A 1 202 LEU 202 198 198 LEU LEU A . n 
A 1 203 CYS 203 199 199 CYS CYS A . n 
A 1 204 ASP 204 200 200 ASP ASP A . n 
A 1 205 PHE 205 201 201 PHE PHE A . n 
A 1 206 GLY 206 202 202 GLY GLY A . n 
A 1 207 SER 207 203 203 SER SER A . n 
A 1 208 ALA 208 204 204 ALA ALA A . n 
A 1 209 LYS 209 205 205 LYS LYS A . n 
A 1 210 GLN 210 206 206 GLN GLN A . n 
A 1 211 LEU 211 207 207 LEU LEU A . n 
A 1 212 VAL 212 208 208 VAL VAL A . n 
A 1 213 ARG 213 209 209 ARG ARG A . n 
A 1 214 GLY 214 210 210 GLY GLY A . n 
A 1 215 GLU 215 211 211 GLU GLU A . n 
A 1 216 PRO 216 212 212 PRO PRO A . n 
A 1 217 ASN 217 213 213 ASN ASN A . n 
A 1 218 VAL 218 214 214 VAL VAL A . n 
A 1 219 SER 219 215 215 SER SER A . n 
A 1 220 TYR 220 216 216 TYR TYR A . n 
A 1 221 ILE 221 217 217 ILE ILE A . n 
A 1 222 CYS 222 218 218 CYS CYS A . n 
A 1 223 SER 223 219 219 SER SER A . n 
A 1 224 ARG 224 220 220 ARG ARG A . n 
A 1 225 TYR 225 221 221 TYR TYR A . n 
A 1 226 TYR 226 222 222 TYR TYR A . n 
A 1 227 ARG 227 223 223 ARG ARG A . n 
A 1 228 ALA 228 224 224 ALA ALA A . n 
A 1 229 PRO 229 225 225 PRO PRO A . n 
A 1 230 GLU 230 226 226 GLU GLU A . n 
A 1 231 LEU 231 227 227 LEU LEU A . n 
A 1 232 ILE 232 228 228 ILE ILE A . n 
A 1 233 PHE 233 229 229 PHE PHE A . n 
A 1 234 GLY 234 230 230 GLY GLY A . n 
A 1 235 ALA 235 231 231 ALA ALA A . n 
A 1 236 THR 236 232 232 THR THR A . n 
A 1 237 ASP 237 233 233 ASP ASP A . n 
A 1 238 TYR 238 234 234 TYR TYR A . n 
A 1 239 THR 239 235 235 THR THR A . n 
A 1 240 SER 240 236 236 SER SER A . n 
A 1 241 SER 241 237 237 SER SER A . n 
A 1 242 ILE 242 238 238 ILE ILE A . n 
A 1 243 ASP 243 239 239 ASP ASP A . n 
A 1 244 VAL 244 240 240 VAL VAL A . n 
A 1 245 TRP 245 241 241 TRP TRP A . n 
A 1 246 SER 246 242 242 SER SER A . n 
A 1 247 ALA 247 243 243 ALA ALA A . n 
A 1 248 GLY 248 244 244 GLY GLY A . n 
A 1 249 CYS 249 245 245 CYS CYS A . n 
A 1 250 VAL 250 246 246 VAL VAL A . n 
A 1 251 LEU 251 247 247 LEU LEU A . n 
A 1 252 ALA 252 248 248 ALA ALA A . n 
A 1 253 GLU 253 249 249 GLU GLU A . n 
A 1 254 LEU 254 250 250 LEU LEU A . n 
A 1 255 LEU 255 251 251 LEU LEU A . n 
A 1 256 LEU 256 252 252 LEU LEU A . n 
A 1 257 GLY 257 253 253 GLY GLY A . n 
A 1 258 GLN 258 254 254 GLN GLN A . n 
A 1 259 PRO 259 255 255 PRO PRO A . n 
A 1 260 ILE 260 256 256 ILE ILE A . n 
A 1 261 PHE 261 257 257 PHE PHE A . n 
A 1 262 PRO 262 258 258 PRO PRO A . n 
A 1 263 GLY 263 259 259 GLY GLY A . n 
A 1 264 ASP 264 260 260 ASP ASP A . n 
A 1 265 SER 265 261 261 SER SER A . n 
A 1 266 GLY 266 262 262 GLY GLY A . n 
A 1 267 VAL 267 263 263 VAL VAL A . n 
A 1 268 ASP 268 264 264 ASP ASP A . n 
A 1 269 GLN 269 265 265 GLN GLN A . n 
A 1 270 LEU 270 266 266 LEU LEU A . n 
A 1 271 VAL 271 267 267 VAL VAL A . n 
A 1 272 GLU 272 268 268 GLU GLU A . n 
A 1 273 ILE 273 269 269 ILE ILE A . n 
A 1 274 ILE 274 270 270 ILE ILE A . n 
A 1 275 LYS 275 271 271 LYS LYS A . n 
A 1 276 VAL 276 272 272 VAL VAL A . n 
A 1 277 LEU 277 273 273 LEU LEU A . n 
A 1 278 GLY 278 274 274 GLY GLY A . n 
A 1 279 THR 279 275 275 THR THR A . n 
A 1 280 PRO 280 276 276 PRO PRO A . n 
A 1 281 THR 281 277 277 THR THR A . n 
A 1 282 ARG 282 278 278 ARG ARG A . n 
A 1 283 GLU 283 279 279 GLU GLU A . n 
A 1 284 GLN 284 280 280 GLN GLN A . n 
A 1 285 ILE 285 281 281 ILE ILE A . n 
A 1 286 ARG 286 282 282 ARG ARG A . n 
A 1 287 GLU 287 283 283 GLU GLU A . n 
A 1 288 MET 288 284 284 MET MET A . n 
A 1 289 ASN 289 285 ?   ?   ?   A . n 
A 1 290 PRO 290 286 ?   ?   ?   A . n 
A 1 291 ASN 291 287 ?   ?   ?   A . n 
A 1 292 TYR 292 288 ?   ?   ?   A . n 
A 1 293 THR 293 289 ?   ?   ?   A . n 
A 1 294 GLU 294 290 ?   ?   ?   A . n 
A 1 295 PHE 295 291 ?   ?   ?   A . n 
A 1 296 LYS 296 292 292 LYS ALA A . n 
A 1 297 PHE 297 293 293 PHE PHE A . n 
A 1 298 PRO 298 294 294 PRO PRO A . n 
A 1 299 GLN 299 295 295 GLN GLN A . n 
A 1 300 ILE 300 296 296 ILE ILE A . n 
A 1 301 LYS 301 297 297 LYS LYS A . n 
A 1 302 ALA 302 298 298 ALA ALA A . n 
A 1 303 HIS 303 299 299 HIS HIS A . n 
A 1 304 PRO 304 300 300 PRO PRO A . n 
A 1 305 TRP 305 301 301 TRP TRP A . n 
A 1 306 THR 306 302 302 THR THR A . n 
A 1 307 LYS 307 303 303 LYS LYS A . n 
A 1 308 VAL 308 304 304 VAL VAL A . n 
A 1 309 PHE 309 305 305 PHE PHE A . n 
A 1 310 ARG 310 306 306 ARG ARG A . n 
A 1 311 PRO 311 307 307 PRO PRO A . n 
A 1 312 ARG 312 308 308 ARG ARG A . n 
A 1 313 THR 313 309 309 THR THR A . n 
A 1 314 PRO 314 310 310 PRO PRO A . n 
A 1 315 PRO 315 311 311 PRO PRO A . n 
A 1 316 GLU 316 312 312 GLU GLU A . n 
A 1 317 ALA 317 313 313 ALA ALA A . n 
A 1 318 ILE 318 314 314 ILE ILE A . n 
A 1 319 ALA 319 315 315 ALA ALA A . n 
A 1 320 LEU 320 316 316 LEU LEU A . n 
A 1 321 CYS 321 317 317 CYS CYS A . n 
A 1 322 SER 322 318 318 SER SER A . n 
A 1 323 ARG 323 319 319 ARG ARG A . n 
A 1 324 LEU 324 320 320 LEU LEU A . n 
A 1 325 LEU 325 321 321 LEU LEU A . n 
A 1 326 GLU 326 322 322 GLU GLU A . n 
A 1 327 TYR 327 323 323 TYR TYR A . n 
A 1 328 THR 328 324 324 THR THR A . n 
A 1 329 PRO 329 325 325 PRO PRO A . n 
A 1 330 THR 330 326 326 THR THR A . n 
A 1 331 ALA 331 327 327 ALA ALA A . n 
A 1 332 ARG 332 328 328 ARG ARG A . n 
A 1 333 LEU 333 329 329 LEU LEU A . n 
A 1 334 THR 334 330 330 THR THR A . n 
A 1 335 PRO 335 331 331 PRO PRO A . n 
A 1 336 LEU 336 332 332 LEU LEU A . n 
A 1 337 GLU 337 333 333 GLU GLU A . n 
A 1 338 ALA 338 334 334 ALA ALA A . n 
A 1 339 CYS 339 335 335 CYS CYS A . n 
A 1 340 ALA 340 336 336 ALA ALA A . n 
A 1 341 HIS 341 337 337 HIS HIS A . n 
A 1 342 SER 342 338 338 SER SER A . n 
A 1 343 PHE 343 339 339 PHE PHE A . n 
A 1 344 PHE 344 340 340 PHE PHE A . n 
A 1 345 ASP 345 341 341 ASP ASP A . n 
A 1 346 GLU 346 342 342 GLU GLU A . n 
A 1 347 LEU 347 343 343 LEU LEU A . n 
A 1 348 ARG 348 344 344 ARG ARG A . n 
A 1 349 ASP 349 345 345 ASP ASP A . n 
A 1 350 PRO 350 346 346 PRO PRO A . n 
A 1 351 ASN 351 347 347 ASN ASN A . n 
A 1 352 VAL 352 348 348 VAL VAL A . n 
A 1 353 LYS 353 349 349 LYS LYS A . n 
A 1 354 LEU 354 350 350 LEU LEU A . n 
A 1 355 PRO 355 351 351 PRO PRO A . n 
A 1 356 ASN 356 352 352 ASN ASN A . n 
A 1 357 GLY 357 353 353 GLY GLY A . n 
A 1 358 ARG 358 354 354 ARG ARG A . n 
A 1 359 ASP 359 355 355 ASP ASP A . n 
A 1 360 THR 360 356 356 THR THR A . n 
A 1 361 PRO 361 357 357 PRO PRO A . n 
A 1 362 ALA 362 358 358 ALA ALA A . n 
A 1 363 LEU 363 359 359 LEU LEU A . n 
A 1 364 PHE 364 360 360 PHE PHE A . n 
A 1 365 ASN 365 361 361 ASN ASN A . n 
A 1 366 PHE 366 362 362 PHE PHE A . n 
A 1 367 THR 367 363 363 THR THR A . n 
A 1 368 THR 368 364 364 THR THR A . n 
A 1 369 GLN 369 365 365 GLN GLN A . n 
A 1 370 GLU 370 366 366 GLU GLU A . n 
A 1 371 LEU 371 367 367 LEU LEU A . n 
A 1 372 SER 372 368 368 SER SER A . n 
A 1 373 SER 373 369 369 SER SER A . n 
A 1 374 ASN 374 370 370 ASN ASN A . n 
A 1 375 PRO 375 371 371 PRO PRO A . n 
A 1 376 PRO 376 372 372 PRO PRO A . n 
A 1 377 LEU 377 373 373 LEU LEU A . n 
A 1 378 ALA 378 374 374 ALA ALA A . n 
A 1 379 THR 379 375 375 THR THR A . n 
A 1 380 ILE 380 376 376 ILE ILE A . n 
A 1 381 LEU 381 377 377 LEU LEU A . n 
A 1 382 ILE 382 378 378 ILE ILE A . n 
A 1 383 PRO 383 379 379 PRO PRO A . n 
A 1 384 PRO 384 380 380 PRO PRO A . n 
A 1 385 HIS 385 381 381 HIS HIS A . n 
A 1 386 ALA 386 382 382 ALA ALA A . n 
A 1 387 ARG 387 383 383 ARG ARG A . n 
A 1 388 ILE 388 384 384 ILE ILE A . n 
A 1 389 GLN 389 385 385 GLN GLN A . n 
A 1 390 ALA 390 386 386 ALA ALA A . n 
A 1 391 ALA 391 387 ?   ?   ?   A . n 
A 1 392 ALA 392 388 ?   ?   ?   A . n 
A 1 393 SER 393 389 ?   ?   ?   A . n 
A 1 394 THR 394 390 ?   ?   ?   A . n 
A 1 395 PRO 395 391 ?   ?   ?   A . n 
A 1 396 THR 396 392 ?   ?   ?   A . n 
A 1 397 ASN 397 393 ?   ?   ?   A . n 
A 1 398 ALA 398 394 ?   ?   ?   A . n 
A 1 399 THR 399 395 ?   ?   ?   A . n 
A 1 400 ALA 400 396 ?   ?   ?   A . n 
A 1 401 ALA 401 397 ?   ?   ?   A . n 
A 1 402 SER 402 398 ?   ?   ?   A . n 
A 1 403 ASP 403 399 ?   ?   ?   A . n 
A 1 404 ALA 404 400 ?   ?   ?   A . n 
A 1 405 ASN 405 401 ?   ?   ?   A . n 
A 1 406 THR 406 402 ?   ?   ?   A . n 
A 1 407 GLY 407 403 ?   ?   ?   A . n 
A 1 408 ASP 408 404 ?   ?   ?   A . n 
A 1 409 ARG 409 405 ?   ?   ?   A . n 
A 1 410 GLY 410 406 ?   ?   ?   A . n 
A 1 411 GLN 411 407 ?   ?   ?   A . n 
A 1 412 THR 412 408 ?   ?   ?   A . n 
A 1 413 ASN 413 409 ?   ?   ?   A . n 
A 1 414 ASN 414 410 ?   ?   ?   A . n 
A 1 415 ALA 415 411 ?   ?   ?   A . n 
A 1 416 ALA 416 412 ?   ?   ?   A . n 
A 1 417 SER 417 413 ?   ?   ?   A . n 
A 1 418 ALA 418 414 ?   ?   ?   A . n 
A 1 419 SER 419 415 ?   ?   ?   A . n 
A 1 420 ALA 420 416 ?   ?   ?   A . n 
A 1 421 SER 421 417 ?   ?   ?   A . n 
A 1 422 ASN 422 418 ?   ?   ?   A . n 
A 1 423 SER 423 419 ?   ?   ?   A . n 
A 1 424 THR 424 420 ?   ?   ?   A . n 
B 1 1   GLY 1   -3  ?   ?   ?   B . n 
B 1 2   PRO 2   -2  ?   ?   ?   B . n 
B 1 3   LEU 3   -1  ?   ?   ?   B . n 
B 1 4   GLY 4   0   ?   ?   ?   B . n 
B 1 5   SER 5   1   ?   ?   ?   B . n 
B 1 6   SER 6   2   ?   ?   ?   B . n 
B 1 7   GLY 7   3   ?   ?   ?   B . n 
B 1 8   ARG 8   4   ?   ?   ?   B . n 
B 1 9   PRO 9   5   ?   ?   ?   B . n 
B 1 10  ARG 10  6   ?   ?   ?   B . n 
B 1 11  THR 11  7   ?   ?   ?   B . n 
B 1 12  THR 12  8   ?   ?   ?   B . n 
B 1 13  SER 13  9   ?   ?   ?   B . n 
B 1 14  PHE 14  10  ?   ?   ?   B . n 
B 1 15  ALA 15  11  ?   ?   ?   B . n 
B 1 16  GLU 16  12  ?   ?   ?   B . n 
B 1 17  SER 17  13  ?   ?   ?   B . n 
B 1 18  CYS 18  14  ?   ?   ?   B . n 
B 1 19  LYS 19  15  ?   ?   ?   B . n 
B 1 20  PRO 20  16  ?   ?   ?   B . n 
B 1 21  VAL 21  17  ?   ?   ?   B . n 
B 1 22  GLN 22  18  ?   ?   ?   B . n 
B 1 23  GLN 23  19  ?   ?   ?   B . n 
B 1 24  PRO 24  20  ?   ?   ?   B . n 
B 1 25  SER 25  21  ?   ?   ?   B . n 
B 1 26  ALA 26  22  ?   ?   ?   B . n 
B 1 27  PHE 27  23  ?   ?   ?   B . n 
B 1 28  GLY 28  24  ?   ?   ?   B . n 
B 1 29  SER 29  25  ?   ?   ?   B . n 
B 1 30  MET 30  26  ?   ?   ?   B . n 
B 1 31  LYS 31  27  ?   ?   ?   B . n 
B 1 32  VAL 32  28  ?   ?   ?   B . n 
B 1 33  SER 33  29  ?   ?   ?   B . n 
B 1 34  ARG 34  30  ?   ?   ?   B . n 
B 1 35  ASP 35  31  ?   ?   ?   B . n 
B 1 36  LYS 36  32  ?   ?   ?   B . n 
B 1 37  ASP 37  33  ?   ?   ?   B . n 
B 1 38  GLY 38  34  ?   ?   ?   B . n 
B 1 39  SER 39  35  35  SER SER B . n 
B 1 40  LYS 40  36  36  LYS LYS B . n 
B 1 41  VAL 41  37  37  VAL VAL B . n 
B 1 42  THR 42  38  38  THR THR B . n 
B 1 43  THR 43  39  39  THR THR B . n 
B 1 44  VAL 44  40  40  VAL VAL B . n 
B 1 45  VAL 45  41  41  VAL VAL B . n 
B 1 46  ALA 46  42  42  ALA ALA B . n 
B 1 47  THR 47  43  43  THR THR B . n 
B 1 48  PRO 48  44  44  PRO PRO B . n 
B 1 49  GLY 49  45  45  GLY GLY B . n 
B 1 50  GLN 50  46  46  GLN GLN B . n 
B 1 51  GLY 51  47  47  GLY GLY B . n 
B 1 52  PRO 52  48  48  PRO PRO B . n 
B 1 53  ASP 53  49  49  ASP ASP B . n 
B 1 54  ARG 54  50  50  ARG ARG B . n 
B 1 55  PRO 55  51  51  PRO PRO B . n 
B 1 56  GLN 56  52  52  GLN GLN B . n 
B 1 57  GLU 57  53  53  GLU GLU B . n 
B 1 58  VAL 58  54  54  VAL VAL B . n 
B 1 59  SER 59  55  55  SER SER B . n 
B 1 60  TYR 60  56  56  TYR TYR B . n 
B 1 61  THR 61  57  57  THR THR B . n 
B 1 62  ASP 62  58  58  ASP ASP B . n 
B 1 63  THR 63  59  59  THR THR B . n 
B 1 64  LYS 64  60  60  LYS LYS B . n 
B 1 65  VAL 65  61  61  VAL VAL B . n 
B 1 66  ILE 66  62  62  ILE ILE B . n 
B 1 67  GLY 67  63  63  GLY GLY B . n 
B 1 68  ASN 68  64  64  ASN ASN B . n 
B 1 69  GLY 69  65  65  GLY GLY B . n 
B 1 70  SER 70  66  66  SER SER B . n 
B 1 71  PHE 71  67  67  PHE PHE B . n 
B 1 72  GLY 72  68  68  GLY GLY B . n 
B 1 73  VAL 73  69  69  VAL VAL B . n 
B 1 74  VAL 74  70  70  VAL VAL B . n 
B 1 75  TYR 75  71  71  TYR TYR B . n 
B 1 76  GLN 76  72  72  GLN GLN B . n 
B 1 77  ALA 77  73  73  ALA ALA B . n 
B 1 78  LYS 78  74  74  LYS LYS B . n 
B 1 79  LEU 79  75  75  LEU LEU B . n 
B 1 80  CYS 80  76  76  CYS CYS B . n 
B 1 81  ASP 81  77  77  ASP ASP B . n 
B 1 82  SER 82  78  78  SER SER B . n 
B 1 83  GLY 83  79  79  GLY GLY B . n 
B 1 84  GLU 84  80  80  GLU GLU B . n 
B 1 85  LEU 85  81  81  LEU LEU B . n 
B 1 86  VAL 86  82  82  VAL VAL B . n 
B 1 87  ALA 87  83  83  ALA ALA B . n 
B 1 88  ILE 88  84  84  ILE ILE B . n 
B 1 89  LYS 89  85  85  LYS LYS B . n 
B 1 90  LYS 90  86  86  LYS LYS B . n 
B 1 91  VAL 91  87  87  VAL VAL B . n 
B 1 92  LEU 92  88  88  LEU LEU B . n 
B 1 93  GLN 93  89  89  GLN GLN B . n 
B 1 94  ASP 94  90  90  ASP GLY B . n 
B 1 95  LYS 95  91  91  LYS LYS B . n 
B 1 96  ARG 96  92  92  ARG ALA B . n 
B 1 97  PHE 97  93  93  PHE PHE B . n 
B 1 98  LYS 98  94  94  LYS LYS B . n 
B 1 99  ASN 99  95  95  ASN ASN B . n 
B 1 100 ARG 100 96  96  ARG ARG B . n 
B 1 101 GLU 101 97  97  GLU GLU B . n 
B 1 102 LEU 102 98  98  LEU LEU B . n 
B 1 103 GLN 103 99  99  GLN GLN B . n 
B 1 104 ILE 104 100 100 ILE ILE B . n 
B 1 105 MET 105 101 101 MET MET B . n 
B 1 106 ARG 106 102 102 ARG ARG B . n 
B 1 107 LYS 107 103 103 LYS LYS B . n 
B 1 108 LEU 108 104 104 LEU LEU B . n 
B 1 109 ASP 109 105 105 ASP ASP B . n 
B 1 110 HIS 110 106 106 HIS HIS B . n 
B 1 111 CYS 111 107 107 CYS CYS B . n 
B 1 112 ASN 112 108 108 ASN ASN B . n 
B 1 113 ILE 113 109 109 ILE ILE B . n 
B 1 114 VAL 114 110 110 VAL VAL B . n 
B 1 115 ARG 115 111 111 ARG ARG B . n 
B 1 116 LEU 116 112 112 LEU LEU B . n 
B 1 117 ARG 117 113 113 ARG ARG B . n 
B 1 118 TYR 118 114 114 TYR TYR B . n 
B 1 119 PHE 119 115 115 PHE PHE B . n 
B 1 120 PHE 120 116 116 PHE PHE B . n 
B 1 121 TYR 121 117 117 TYR TYR B . n 
B 1 122 SER 122 118 118 SER SER B . n 
B 1 123 SER 123 119 119 SER SER B . n 
B 1 124 GLY 124 120 ?   ?   ?   B . n 
B 1 125 GLU 125 121 ?   ?   ?   B . n 
B 1 126 LYS 126 122 ?   ?   ?   B . n 
B 1 127 LYS 127 123 ?   ?   ?   B . n 
B 1 128 ASP 128 124 ?   ?   ?   B . n 
B 1 129 GLU 129 125 ?   ?   ?   B . n 
B 1 130 VAL 130 126 126 VAL VAL B . n 
B 1 131 TYR 131 127 127 TYR TYR B . n 
B 1 132 LEU 132 128 128 LEU LEU B . n 
B 1 133 ASN 133 129 129 ASN ASN B . n 
B 1 134 LEU 134 130 130 LEU LEU B . n 
B 1 135 VAL 135 131 131 VAL VAL B . n 
B 1 136 LEU 136 132 132 LEU LEU B . n 
B 1 137 ASP 137 133 133 ASP ASP B . n 
B 1 138 TYR 138 134 134 TYR TYR B . n 
B 1 139 VAL 139 135 135 VAL VAL B . n 
B 1 140 PRO 140 136 136 PRO PRO B . n 
B 1 141 GLU 141 137 137 GLU GLU B . n 
B 1 142 THR 142 138 138 THR THR B . n 
B 1 143 VAL 143 139 139 VAL VAL B . n 
B 1 144 TYR 144 140 140 TYR TYR B . n 
B 1 145 ARG 145 141 141 ARG ARG B . n 
B 1 146 VAL 146 142 142 VAL VAL B . n 
B 1 147 ALA 147 143 143 ALA ALA B . n 
B 1 148 ARG 148 144 144 ARG ARG B . n 
B 1 149 HIS 149 145 145 HIS HIS B . n 
B 1 150 TYR 150 146 146 TYR TYR B . n 
B 1 151 SER 151 147 147 SER SER B . n 
B 1 152 ARG 152 148 148 ARG ARG B . n 
B 1 153 ALA 153 149 149 ALA ALA B . n 
B 1 154 LYS 154 150 150 LYS LYS B . n 
B 1 155 GLN 155 151 151 GLN GLN B . n 
B 1 156 THR 156 152 152 THR THR B . n 
B 1 157 LEU 157 153 153 LEU LEU B . n 
B 1 158 PRO 158 154 154 PRO PRO B . n 
B 1 159 VAL 159 155 155 VAL VAL B . n 
B 1 160 ILE 160 156 156 ILE ILE B . n 
B 1 161 TYR 161 157 157 TYR TYR B . n 
B 1 162 VAL 162 158 158 VAL VAL B . n 
B 1 163 LYS 163 159 159 LYS LYS B . n 
B 1 164 LEU 164 160 160 LEU LEU B . n 
B 1 165 TYR 165 161 161 TYR TYR B . n 
B 1 166 MET 166 162 162 MET MET B . n 
B 1 167 TYR 167 163 163 TYR TYR B . n 
B 1 168 GLN 168 164 164 GLN GLN B . n 
B 1 169 LEU 169 165 165 LEU LEU B . n 
B 1 170 PHE 170 166 166 PHE PHE B . n 
B 1 171 ARG 171 167 167 ARG ARG B . n 
B 1 172 SER 172 168 168 SER SER B . n 
B 1 173 LEU 173 169 169 LEU LEU B . n 
B 1 174 ALA 174 170 170 ALA ALA B . n 
B 1 175 TYR 175 171 171 TYR TYR B . n 
B 1 176 ILE 176 172 172 ILE ILE B . n 
B 1 177 HIS 177 173 173 HIS HIS B . n 
B 1 178 SER 178 174 174 SER SER B . n 
B 1 179 PHE 179 175 175 PHE PHE B . n 
B 1 180 GLY 180 176 176 GLY GLY B . n 
B 1 181 ILE 181 177 177 ILE ILE B . n 
B 1 182 CYS 182 178 178 CYS CYS B . n 
B 1 183 HIS 183 179 179 HIS HIS B . n 
B 1 184 ARG 184 180 180 ARG ARG B . n 
B 1 185 ASP 185 181 181 ASP ASP B . n 
B 1 186 ILE 186 182 182 ILE ILE B . n 
B 1 187 LYS 187 183 183 LYS LYS B . n 
B 1 188 PRO 188 184 184 PRO PRO B . n 
B 1 189 GLN 189 185 185 GLN GLN B . n 
B 1 190 ASN 190 186 186 ASN ASN B . n 
B 1 191 LEU 191 187 187 LEU LEU B . n 
B 1 192 LEU 192 188 188 LEU LEU B . n 
B 1 193 LEU 193 189 189 LEU LEU B . n 
B 1 194 ASP 194 190 190 ASP ASP B . n 
B 1 195 PRO 195 191 191 PRO PRO B . n 
B 1 196 ASP 196 192 192 ASP ASP B . n 
B 1 197 THR 197 193 193 THR THR B . n 
B 1 198 ALA 198 194 194 ALA ALA B . n 
B 1 199 VAL 199 195 195 VAL VAL B . n 
B 1 200 LEU 200 196 196 LEU LEU B . n 
B 1 201 LYS 201 197 197 LYS LYS B . n 
B 1 202 LEU 202 198 198 LEU LEU B . n 
B 1 203 CYS 203 199 199 CYS CYS B . n 
B 1 204 ASP 204 200 200 ASP ASP B . n 
B 1 205 PHE 205 201 201 PHE PHE B . n 
B 1 206 GLY 206 202 202 GLY GLY B . n 
B 1 207 SER 207 203 203 SER SER B . n 
B 1 208 ALA 208 204 204 ALA ALA B . n 
B 1 209 LYS 209 205 205 LYS LYS B . n 
B 1 210 GLN 210 206 206 GLN GLN B . n 
B 1 211 LEU 211 207 207 LEU LEU B . n 
B 1 212 VAL 212 208 208 VAL VAL B . n 
B 1 213 ARG 213 209 209 ARG ARG B . n 
B 1 214 GLY 214 210 210 GLY GLY B . n 
B 1 215 GLU 215 211 211 GLU GLU B . n 
B 1 216 PRO 216 212 212 PRO PRO B . n 
B 1 217 ASN 217 213 213 ASN ASN B . n 
B 1 218 VAL 218 214 214 VAL VAL B . n 
B 1 219 SER 219 215 215 SER SER B . n 
B 1 220 TYR 220 216 216 TYR TYR B . n 
B 1 221 ILE 221 217 217 ILE ILE B . n 
B 1 222 CYS 222 218 218 CYS CYS B . n 
B 1 223 SER 223 219 219 SER SER B . n 
B 1 224 ARG 224 220 220 ARG ARG B . n 
B 1 225 TYR 225 221 221 TYR TYR B . n 
B 1 226 TYR 226 222 222 TYR TYR B . n 
B 1 227 ARG 227 223 223 ARG ARG B . n 
B 1 228 ALA 228 224 224 ALA ALA B . n 
B 1 229 PRO 229 225 225 PRO PRO B . n 
B 1 230 GLU 230 226 226 GLU GLU B . n 
B 1 231 LEU 231 227 227 LEU LEU B . n 
B 1 232 ILE 232 228 228 ILE ILE B . n 
B 1 233 PHE 233 229 229 PHE PHE B . n 
B 1 234 GLY 234 230 230 GLY GLY B . n 
B 1 235 ALA 235 231 231 ALA ALA B . n 
B 1 236 THR 236 232 232 THR THR B . n 
B 1 237 ASP 237 233 233 ASP ASP B . n 
B 1 238 TYR 238 234 234 TYR TYR B . n 
B 1 239 THR 239 235 235 THR THR B . n 
B 1 240 SER 240 236 236 SER SER B . n 
B 1 241 SER 241 237 237 SER SER B . n 
B 1 242 ILE 242 238 238 ILE ILE B . n 
B 1 243 ASP 243 239 239 ASP ASP B . n 
B 1 244 VAL 244 240 240 VAL VAL B . n 
B 1 245 TRP 245 241 241 TRP TRP B . n 
B 1 246 SER 246 242 242 SER SER B . n 
B 1 247 ALA 247 243 243 ALA ALA B . n 
B 1 248 GLY 248 244 244 GLY GLY B . n 
B 1 249 CYS 249 245 245 CYS CYS B . n 
B 1 250 VAL 250 246 246 VAL VAL B . n 
B 1 251 LEU 251 247 247 LEU LEU B . n 
B 1 252 ALA 252 248 248 ALA ALA B . n 
B 1 253 GLU 253 249 249 GLU GLU B . n 
B 1 254 LEU 254 250 250 LEU LEU B . n 
B 1 255 LEU 255 251 251 LEU LEU B . n 
B 1 256 LEU 256 252 252 LEU LEU B . n 
B 1 257 GLY 257 253 253 GLY GLY B . n 
B 1 258 GLN 258 254 254 GLN GLN B . n 
B 1 259 PRO 259 255 255 PRO PRO B . n 
B 1 260 ILE 260 256 256 ILE ILE B . n 
B 1 261 PHE 261 257 257 PHE PHE B . n 
B 1 262 PRO 262 258 258 PRO PRO B . n 
B 1 263 GLY 263 259 259 GLY GLY B . n 
B 1 264 ASP 264 260 260 ASP ASP B . n 
B 1 265 SER 265 261 261 SER SER B . n 
B 1 266 GLY 266 262 262 GLY GLY B . n 
B 1 267 VAL 267 263 263 VAL VAL B . n 
B 1 268 ASP 268 264 264 ASP ASP B . n 
B 1 269 GLN 269 265 265 GLN GLN B . n 
B 1 270 LEU 270 266 266 LEU LEU B . n 
B 1 271 VAL 271 267 267 VAL VAL B . n 
B 1 272 GLU 272 268 268 GLU GLU B . n 
B 1 273 ILE 273 269 269 ILE ILE B . n 
B 1 274 ILE 274 270 270 ILE ILE B . n 
B 1 275 LYS 275 271 271 LYS LYS B . n 
B 1 276 VAL 276 272 272 VAL VAL B . n 
B 1 277 LEU 277 273 273 LEU LEU B . n 
B 1 278 GLY 278 274 274 GLY GLY B . n 
B 1 279 THR 279 275 275 THR THR B . n 
B 1 280 PRO 280 276 276 PRO PRO B . n 
B 1 281 THR 281 277 277 THR THR B . n 
B 1 282 ARG 282 278 278 ARG ARG B . n 
B 1 283 GLU 283 279 279 GLU GLU B . n 
B 1 284 GLN 284 280 280 GLN GLN B . n 
B 1 285 ILE 285 281 281 ILE ILE B . n 
B 1 286 ARG 286 282 282 ARG ARG B . n 
B 1 287 GLU 287 283 283 GLU GLU B . n 
B 1 288 MET 288 284 284 MET MET B . n 
B 1 289 ASN 289 285 285 ASN ASN B . n 
B 1 290 PRO 290 286 286 PRO PRO B . n 
B 1 291 ASN 291 287 287 ASN ASN B . n 
B 1 292 TYR 292 288 288 TYR TYR B . n 
B 1 293 THR 293 289 289 THR THR B . n 
B 1 294 GLU 294 290 290 GLU GLU B . n 
B 1 295 PHE 295 291 291 PHE PHE B . n 
B 1 296 LYS 296 292 292 LYS ALA B . n 
B 1 297 PHE 297 293 293 PHE PHE B . n 
B 1 298 PRO 298 294 294 PRO PRO B . n 
B 1 299 GLN 299 295 295 GLN GLN B . n 
B 1 300 ILE 300 296 296 ILE ILE B . n 
B 1 301 LYS 301 297 297 LYS LYS B . n 
B 1 302 ALA 302 298 298 ALA ALA B . n 
B 1 303 HIS 303 299 299 HIS HIS B . n 
B 1 304 PRO 304 300 300 PRO PRO B . n 
B 1 305 TRP 305 301 301 TRP TRP B . n 
B 1 306 THR 306 302 302 THR THR B . n 
B 1 307 LYS 307 303 303 LYS LYS B . n 
B 1 308 VAL 308 304 304 VAL VAL B . n 
B 1 309 PHE 309 305 305 PHE PHE B . n 
B 1 310 ARG 310 306 306 ARG ARG B . n 
B 1 311 PRO 311 307 307 PRO PRO B . n 
B 1 312 ARG 312 308 308 ARG ARG B . n 
B 1 313 THR 313 309 309 THR THR B . n 
B 1 314 PRO 314 310 310 PRO PRO B . n 
B 1 315 PRO 315 311 311 PRO PRO B . n 
B 1 316 GLU 316 312 312 GLU GLU B . n 
B 1 317 ALA 317 313 313 ALA ALA B . n 
B 1 318 ILE 318 314 314 ILE ILE B . n 
B 1 319 ALA 319 315 315 ALA ALA B . n 
B 1 320 LEU 320 316 316 LEU LEU B . n 
B 1 321 CYS 321 317 317 CYS CYS B . n 
B 1 322 SER 322 318 318 SER SER B . n 
B 1 323 ARG 323 319 319 ARG ARG B . n 
B 1 324 LEU 324 320 320 LEU LEU B . n 
B 1 325 LEU 325 321 321 LEU LEU B . n 
B 1 326 GLU 326 322 322 GLU GLU B . n 
B 1 327 TYR 327 323 323 TYR TYR B . n 
B 1 328 THR 328 324 324 THR THR B . n 
B 1 329 PRO 329 325 325 PRO PRO B . n 
B 1 330 THR 330 326 326 THR THR B . n 
B 1 331 ALA 331 327 327 ALA ALA B . n 
B 1 332 ARG 332 328 328 ARG ARG B . n 
B 1 333 LEU 333 329 329 LEU LEU B . n 
B 1 334 THR 334 330 330 THR THR B . n 
B 1 335 PRO 335 331 331 PRO PRO B . n 
B 1 336 LEU 336 332 332 LEU LEU B . n 
B 1 337 GLU 337 333 333 GLU GLU B . n 
B 1 338 ALA 338 334 334 ALA ALA B . n 
B 1 339 CYS 339 335 335 CYS CYS B . n 
B 1 340 ALA 340 336 336 ALA ALA B . n 
B 1 341 HIS 341 337 337 HIS HIS B . n 
B 1 342 SER 342 338 338 SER SER B . n 
B 1 343 PHE 343 339 339 PHE PHE B . n 
B 1 344 PHE 344 340 340 PHE PHE B . n 
B 1 345 ASP 345 341 341 ASP ASP B . n 
B 1 346 GLU 346 342 342 GLU GLU B . n 
B 1 347 LEU 347 343 343 LEU LEU B . n 
B 1 348 ARG 348 344 344 ARG ARG B . n 
B 1 349 ASP 349 345 345 ASP ASP B . n 
B 1 350 PRO 350 346 346 PRO PRO B . n 
B 1 351 ASN 351 347 347 ASN ASN B . n 
B 1 352 VAL 352 348 348 VAL VAL B . n 
B 1 353 LYS 353 349 349 LYS LYS B . n 
B 1 354 LEU 354 350 350 LEU LEU B . n 
B 1 355 PRO 355 351 351 PRO PRO B . n 
B 1 356 ASN 356 352 352 ASN ASN B . n 
B 1 357 GLY 357 353 353 GLY GLY B . n 
B 1 358 ARG 358 354 354 ARG ARG B . n 
B 1 359 ASP 359 355 355 ASP ASP B . n 
B 1 360 THR 360 356 356 THR THR B . n 
B 1 361 PRO 361 357 357 PRO PRO B . n 
B 1 362 ALA 362 358 358 ALA ALA B . n 
B 1 363 LEU 363 359 359 LEU LEU B . n 
B 1 364 PHE 364 360 360 PHE PHE B . n 
B 1 365 ASN 365 361 361 ASN ASN B . n 
B 1 366 PHE 366 362 362 PHE PHE B . n 
B 1 367 THR 367 363 363 THR THR B . n 
B 1 368 THR 368 364 364 THR THR B . n 
B 1 369 GLN 369 365 365 GLN GLN B . n 
B 1 370 GLU 370 366 366 GLU GLU B . n 
B 1 371 LEU 371 367 367 LEU LEU B . n 
B 1 372 SER 372 368 368 SER SER B . n 
B 1 373 SER 373 369 369 SER SER B . n 
B 1 374 ASN 374 370 370 ASN ASN B . n 
B 1 375 PRO 375 371 371 PRO PRO B . n 
B 1 376 PRO 376 372 372 PRO PRO B . n 
B 1 377 LEU 377 373 373 LEU LEU B . n 
B 1 378 ALA 378 374 374 ALA ALA B . n 
B 1 379 THR 379 375 375 THR THR B . n 
B 1 380 ILE 380 376 376 ILE ILE B . n 
B 1 381 LEU 381 377 377 LEU LEU B . n 
B 1 382 ILE 382 378 378 ILE ILE B . n 
B 1 383 PRO 383 379 379 PRO PRO B . n 
B 1 384 PRO 384 380 380 PRO PRO B . n 
B 1 385 HIS 385 381 381 HIS HIS B . n 
B 1 386 ALA 386 382 382 ALA ALA B . n 
B 1 387 ARG 387 383 383 ARG ARG B . n 
B 1 388 ILE 388 384 ?   ?   ?   B . n 
B 1 389 GLN 389 385 ?   ?   ?   B . n 
B 1 390 ALA 390 386 ?   ?   ?   B . n 
B 1 391 ALA 391 387 ?   ?   ?   B . n 
B 1 392 ALA 392 388 ?   ?   ?   B . n 
B 1 393 SER 393 389 ?   ?   ?   B . n 
B 1 394 THR 394 390 ?   ?   ?   B . n 
B 1 395 PRO 395 391 ?   ?   ?   B . n 
B 1 396 THR 396 392 ?   ?   ?   B . n 
B 1 397 ASN 397 393 ?   ?   ?   B . n 
B 1 398 ALA 398 394 ?   ?   ?   B . n 
B 1 399 THR 399 395 ?   ?   ?   B . n 
B 1 400 ALA 400 396 ?   ?   ?   B . n 
B 1 401 ALA 401 397 ?   ?   ?   B . n 
B 1 402 SER 402 398 ?   ?   ?   B . n 
B 1 403 ASP 403 399 ?   ?   ?   B . n 
B 1 404 ALA 404 400 ?   ?   ?   B . n 
B 1 405 ASN 405 401 ?   ?   ?   B . n 
B 1 406 THR 406 402 ?   ?   ?   B . n 
B 1 407 GLY 407 403 ?   ?   ?   B . n 
B 1 408 ASP 408 404 ?   ?   ?   B . n 
B 1 409 ARG 409 405 ?   ?   ?   B . n 
B 1 410 GLY 410 406 ?   ?   ?   B . n 
B 1 411 GLN 411 407 ?   ?   ?   B . n 
B 1 412 THR 412 408 ?   ?   ?   B . n 
B 1 413 ASN 413 409 ?   ?   ?   B . n 
B 1 414 ASN 414 410 ?   ?   ?   B . n 
B 1 415 ALA 415 411 ?   ?   ?   B . n 
B 1 416 ALA 416 412 ?   ?   ?   B . n 
B 1 417 SER 417 413 ?   ?   ?   B . n 
B 1 418 ALA 418 414 ?   ?   ?   B . n 
B 1 419 SER 419 415 ?   ?   ?   B . n 
B 1 420 ALA 420 416 ?   ?   ?   B . n 
B 1 421 SER 421 417 ?   ?   ?   B . n 
B 1 422 ASN 422 418 ?   ?   ?   B . n 
B 1 423 SER 423 419 ?   ?   ?   B . n 
B 1 424 THR 424 420 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3430  ? 
1 MORE         -9    ? 
1 'SSA (A^2)'  31120 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-10-21 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SCALEPACK 'data scaling' .    ? 1 
CNX       refinement     2000 ? 2 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 77  ? ? -55.17  -81.04  
2  1 ASP A 181 ? ? -147.15 49.27   
3  1 ASP A 200 ? ? 63.36   85.31   
4  1 CYS A 218 ? ? 80.34   135.13  
5  1 ARG A 220 ? ? -13.64  -78.26  
6  1 PHE A 229 ? ? -69.97  0.85    
7  1 GLN A 295 ? ? -66.41  61.81   
8  1 PRO A 300 ? ? -52.48  99.10   
9  1 TRP A 301 ? ? -37.14  -27.73  
10 1 ARG A 308 ? ? 87.06   4.67    
11 1 ASN A 370 ? ? -176.68 72.49   
12 1 ASN B 64  ? ? -128.12 -120.91 
13 1 ASP B 77  ? ? -56.69  -87.08  
14 1 ASP B 181 ? ? -150.50 47.81   
15 1 ASP B 200 ? ? 62.59   85.88   
16 1 CYS B 218 ? ? 82.35   130.54  
17 1 ARG B 220 ? ? -11.43  -84.50  
18 1 ASN B 287 ? ? -105.19 51.16   
19 1 GLU B 290 ? ? 89.53   119.03  
20 1 ALA B 298 ? ? -23.84  123.87  
21 1 ASN B 370 ? ? -178.62 72.49   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASP 90  ? CB  ? A ASP 94  CB  
2  1 Y 1 A ASP 90  ? CG  ? A ASP 94  CG  
3  1 Y 1 A ASP 90  ? OD1 ? A ASP 94  OD1 
4  1 Y 1 A ASP 90  ? OD2 ? A ASP 94  OD2 
5  1 Y 1 A ARG 92  ? CG  ? A ARG 96  CG  
6  1 Y 1 A ARG 92  ? CD  ? A ARG 96  CD  
7  1 Y 1 A ARG 92  ? NE  ? A ARG 96  NE  
8  1 Y 1 A ARG 92  ? CZ  ? A ARG 96  CZ  
9  1 Y 1 A ARG 92  ? NH1 ? A ARG 96  NH1 
10 1 Y 1 A ARG 92  ? NH2 ? A ARG 96  NH2 
11 1 Y 1 A LYS 292 ? CG  ? A LYS 296 CG  
12 1 Y 1 A LYS 292 ? CD  ? A LYS 296 CD  
13 1 Y 1 A LYS 292 ? CE  ? A LYS 296 CE  
14 1 Y 1 A LYS 292 ? NZ  ? A LYS 296 NZ  
15 1 Y 1 B ASP 90  ? CB  ? B ASP 94  CB  
16 1 Y 1 B ASP 90  ? CG  ? B ASP 94  CG  
17 1 Y 1 B ASP 90  ? OD1 ? B ASP 94  OD1 
18 1 Y 1 B ASP 90  ? OD2 ? B ASP 94  OD2 
19 1 Y 1 B ARG 92  ? CG  ? B ARG 96  CG  
20 1 Y 1 B ARG 92  ? CD  ? B ARG 96  CD  
21 1 Y 1 B ARG 92  ? NE  ? B ARG 96  NE  
22 1 Y 1 B ARG 92  ? CZ  ? B ARG 96  CZ  
23 1 Y 1 B ARG 92  ? NH1 ? B ARG 96  NH1 
24 1 Y 1 B ARG 92  ? NH2 ? B ARG 96  NH2 
25 1 Y 1 B LYS 292 ? CG  ? B LYS 296 CG  
26 1 Y 1 B LYS 292 ? CD  ? B LYS 296 CD  
27 1 Y 1 B LYS 292 ? CE  ? B LYS 296 CE  
28 1 Y 1 B LYS 292 ? NZ  ? B LYS 296 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY -3  ? A GLY 1   
2   1 Y 1 A PRO -2  ? A PRO 2   
3   1 Y 1 A LEU -1  ? A LEU 3   
4   1 Y 1 A GLY 0   ? A GLY 4   
5   1 Y 1 A SER 1   ? A SER 5   
6   1 Y 1 A SER 2   ? A SER 6   
7   1 Y 1 A GLY 3   ? A GLY 7   
8   1 Y 1 A ARG 4   ? A ARG 8   
9   1 Y 1 A PRO 5   ? A PRO 9   
10  1 Y 1 A ARG 6   ? A ARG 10  
11  1 Y 1 A THR 7   ? A THR 11  
12  1 Y 1 A THR 8   ? A THR 12  
13  1 Y 1 A SER 9   ? A SER 13  
14  1 Y 1 A PHE 10  ? A PHE 14  
15  1 Y 1 A ALA 11  ? A ALA 15  
16  1 Y 1 A GLU 12  ? A GLU 16  
17  1 Y 1 A SER 13  ? A SER 17  
18  1 Y 1 A CYS 14  ? A CYS 18  
19  1 Y 1 A LYS 15  ? A LYS 19  
20  1 Y 1 A PRO 16  ? A PRO 20  
21  1 Y 1 A VAL 17  ? A VAL 21  
22  1 Y 1 A GLN 18  ? A GLN 22  
23  1 Y 1 A GLN 19  ? A GLN 23  
24  1 Y 1 A PRO 20  ? A PRO 24  
25  1 Y 1 A SER 21  ? A SER 25  
26  1 Y 1 A ALA 22  ? A ALA 26  
27  1 Y 1 A PHE 23  ? A PHE 27  
28  1 Y 1 A GLY 24  ? A GLY 28  
29  1 Y 1 A SER 25  ? A SER 29  
30  1 Y 1 A MET 26  ? A MET 30  
31  1 Y 1 A LYS 27  ? A LYS 31  
32  1 Y 1 A VAL 28  ? A VAL 32  
33  1 Y 1 A SER 29  ? A SER 33  
34  1 Y 1 A ARG 30  ? A ARG 34  
35  1 Y 1 A ASP 31  ? A ASP 35  
36  1 Y 1 A LYS 32  ? A LYS 36  
37  1 Y 1 A ASP 33  ? A ASP 37  
38  1 Y 1 A GLY 34  ? A GLY 38  
39  1 Y 1 A GLY 120 ? A GLY 124 
40  1 Y 1 A GLU 121 ? A GLU 125 
41  1 Y 1 A LYS 122 ? A LYS 126 
42  1 Y 1 A LYS 123 ? A LYS 127 
43  1 Y 1 A ASP 124 ? A ASP 128 
44  1 Y 1 A GLU 125 ? A GLU 129 
45  1 Y 1 A ASN 285 ? A ASN 289 
46  1 Y 1 A PRO 286 ? A PRO 290 
47  1 Y 1 A ASN 287 ? A ASN 291 
48  1 Y 1 A TYR 288 ? A TYR 292 
49  1 Y 1 A THR 289 ? A THR 293 
50  1 Y 1 A GLU 290 ? A GLU 294 
51  1 Y 1 A PHE 291 ? A PHE 295 
52  1 Y 1 A ALA 387 ? A ALA 391 
53  1 Y 1 A ALA 388 ? A ALA 392 
54  1 Y 1 A SER 389 ? A SER 393 
55  1 Y 1 A THR 390 ? A THR 394 
56  1 Y 1 A PRO 391 ? A PRO 395 
57  1 Y 1 A THR 392 ? A THR 396 
58  1 Y 1 A ASN 393 ? A ASN 397 
59  1 Y 1 A ALA 394 ? A ALA 398 
60  1 Y 1 A THR 395 ? A THR 399 
61  1 Y 1 A ALA 396 ? A ALA 400 
62  1 Y 1 A ALA 397 ? A ALA 401 
63  1 Y 1 A SER 398 ? A SER 402 
64  1 Y 1 A ASP 399 ? A ASP 403 
65  1 Y 1 A ALA 400 ? A ALA 404 
66  1 Y 1 A ASN 401 ? A ASN 405 
67  1 Y 1 A THR 402 ? A THR 406 
68  1 Y 1 A GLY 403 ? A GLY 407 
69  1 Y 1 A ASP 404 ? A ASP 408 
70  1 Y 1 A ARG 405 ? A ARG 409 
71  1 Y 1 A GLY 406 ? A GLY 410 
72  1 Y 1 A GLN 407 ? A GLN 411 
73  1 Y 1 A THR 408 ? A THR 412 
74  1 Y 1 A ASN 409 ? A ASN 413 
75  1 Y 1 A ASN 410 ? A ASN 414 
76  1 Y 1 A ALA 411 ? A ALA 415 
77  1 Y 1 A ALA 412 ? A ALA 416 
78  1 Y 1 A SER 413 ? A SER 417 
79  1 Y 1 A ALA 414 ? A ALA 418 
80  1 Y 1 A SER 415 ? A SER 419 
81  1 Y 1 A ALA 416 ? A ALA 420 
82  1 Y 1 A SER 417 ? A SER 421 
83  1 Y 1 A ASN 418 ? A ASN 422 
84  1 Y 1 A SER 419 ? A SER 423 
85  1 Y 1 A THR 420 ? A THR 424 
86  1 Y 1 B GLY -3  ? B GLY 1   
87  1 Y 1 B PRO -2  ? B PRO 2   
88  1 Y 1 B LEU -1  ? B LEU 3   
89  1 Y 1 B GLY 0   ? B GLY 4   
90  1 Y 1 B SER 1   ? B SER 5   
91  1 Y 1 B SER 2   ? B SER 6   
92  1 Y 1 B GLY 3   ? B GLY 7   
93  1 Y 1 B ARG 4   ? B ARG 8   
94  1 Y 1 B PRO 5   ? B PRO 9   
95  1 Y 1 B ARG 6   ? B ARG 10  
96  1 Y 1 B THR 7   ? B THR 11  
97  1 Y 1 B THR 8   ? B THR 12  
98  1 Y 1 B SER 9   ? B SER 13  
99  1 Y 1 B PHE 10  ? B PHE 14  
100 1 Y 1 B ALA 11  ? B ALA 15  
101 1 Y 1 B GLU 12  ? B GLU 16  
102 1 Y 1 B SER 13  ? B SER 17  
103 1 Y 1 B CYS 14  ? B CYS 18  
104 1 Y 1 B LYS 15  ? B LYS 19  
105 1 Y 1 B PRO 16  ? B PRO 20  
106 1 Y 1 B VAL 17  ? B VAL 21  
107 1 Y 1 B GLN 18  ? B GLN 22  
108 1 Y 1 B GLN 19  ? B GLN 23  
109 1 Y 1 B PRO 20  ? B PRO 24  
110 1 Y 1 B SER 21  ? B SER 25  
111 1 Y 1 B ALA 22  ? B ALA 26  
112 1 Y 1 B PHE 23  ? B PHE 27  
113 1 Y 1 B GLY 24  ? B GLY 28  
114 1 Y 1 B SER 25  ? B SER 29  
115 1 Y 1 B MET 26  ? B MET 30  
116 1 Y 1 B LYS 27  ? B LYS 31  
117 1 Y 1 B VAL 28  ? B VAL 32  
118 1 Y 1 B SER 29  ? B SER 33  
119 1 Y 1 B ARG 30  ? B ARG 34  
120 1 Y 1 B ASP 31  ? B ASP 35  
121 1 Y 1 B LYS 32  ? B LYS 36  
122 1 Y 1 B ASP 33  ? B ASP 37  
123 1 Y 1 B GLY 34  ? B GLY 38  
124 1 Y 1 B GLY 120 ? B GLY 124 
125 1 Y 1 B GLU 121 ? B GLU 125 
126 1 Y 1 B LYS 122 ? B LYS 126 
127 1 Y 1 B LYS 123 ? B LYS 127 
128 1 Y 1 B ASP 124 ? B ASP 128 
129 1 Y 1 B GLU 125 ? B GLU 129 
130 1 Y 1 B ILE 384 ? B ILE 388 
131 1 Y 1 B GLN 385 ? B GLN 389 
132 1 Y 1 B ALA 386 ? B ALA 390 
133 1 Y 1 B ALA 387 ? B ALA 391 
134 1 Y 1 B ALA 388 ? B ALA 392 
135 1 Y 1 B SER 389 ? B SER 393 
136 1 Y 1 B THR 390 ? B THR 394 
137 1 Y 1 B PRO 391 ? B PRO 395 
138 1 Y 1 B THR 392 ? B THR 396 
139 1 Y 1 B ASN 393 ? B ASN 397 
140 1 Y 1 B ALA 394 ? B ALA 398 
141 1 Y 1 B THR 395 ? B THR 399 
142 1 Y 1 B ALA 396 ? B ALA 400 
143 1 Y 1 B ALA 397 ? B ALA 401 
144 1 Y 1 B SER 398 ? B SER 402 
145 1 Y 1 B ASP 399 ? B ASP 403 
146 1 Y 1 B ALA 400 ? B ALA 404 
147 1 Y 1 B ASN 401 ? B ASN 405 
148 1 Y 1 B THR 402 ? B THR 406 
149 1 Y 1 B GLY 403 ? B GLY 407 
150 1 Y 1 B ASP 404 ? B ASP 408 
151 1 Y 1 B ARG 405 ? B ARG 409 
152 1 Y 1 B GLY 406 ? B GLY 410 
153 1 Y 1 B GLN 407 ? B GLN 411 
154 1 Y 1 B THR 408 ? B THR 412 
155 1 Y 1 B ASN 409 ? B ASN 413 
156 1 Y 1 B ASN 410 ? B ASN 414 
157 1 Y 1 B ALA 411 ? B ALA 415 
158 1 Y 1 B ALA 412 ? B ALA 416 
159 1 Y 1 B SER 413 ? B SER 417 
160 1 Y 1 B ALA 414 ? B ALA 418 
161 1 Y 1 B SER 415 ? B SER 419 
162 1 Y 1 B ALA 416 ? B ALA 420 
163 1 Y 1 B SER 417 ? B SER 421 
164 1 Y 1 B ASN 418 ? B ASN 422 
165 1 Y 1 B SER 419 ? B SER 423 
166 1 Y 1 B THR 420 ? B THR 424 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "(Z)-1H,1'H-[2,3']BIINDOLYLIDENE-3,2'-DIONE-3-OXIME" IXM 
3 water                                                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 IXM 1  451 451 IXM IXM A . 
D 2 IXM 1  452 452 IXM IXM B . 
E 3 HOH 1  502 502 HOH WAT A . 
E 3 HOH 2  505 505 HOH WAT A . 
E 3 HOH 3  506 506 HOH WAT A . 
E 3 HOH 4  509 509 HOH WAT A . 
E 3 HOH 5  510 510 HOH WAT A . 
E 3 HOH 6  512 512 HOH WAT A . 
E 3 HOH 7  513 513 HOH WAT A . 
E 3 HOH 8  514 514 HOH WAT A . 
E 3 HOH 9  515 515 HOH WAT A . 
E 3 HOH 10 517 517 HOH WAT A . 
E 3 HOH 11 523 523 HOH WAT A . 
E 3 HOH 12 524 524 HOH WAT A . 
E 3 HOH 13 525 525 HOH WAT A . 
E 3 HOH 14 526 526 HOH WAT A . 
E 3 HOH 15 530 530 HOH WAT A . 
E 3 HOH 16 536 536 HOH WAT A . 
E 3 HOH 17 537 537 HOH WAT A . 
E 3 HOH 18 542 542 HOH WAT A . 
E 3 HOH 19 543 543 HOH WAT A . 
E 3 HOH 20 544 544 HOH WAT A . 
E 3 HOH 21 545 545 HOH WAT A . 
E 3 HOH 22 550 550 HOH WAT A . 
E 3 HOH 23 555 555 HOH WAT A . 
E 3 HOH 24 557 557 HOH WAT A . 
E 3 HOH 25 558 558 HOH WAT A . 
E 3 HOH 26 560 560 HOH WAT A . 
E 3 HOH 27 563 563 HOH WAT A . 
E 3 HOH 28 564 564 HOH WAT A . 
E 3 HOH 29 565 565 HOH WAT A . 
E 3 HOH 30 571 571 HOH WAT A . 
E 3 HOH 31 575 575 HOH WAT A . 
E 3 HOH 32 576 576 HOH WAT A . 
E 3 HOH 33 577 577 HOH WAT A . 
E 3 HOH 34 579 579 HOH WAT A . 
E 3 HOH 35 580 580 HOH WAT A . 
E 3 HOH 36 581 581 HOH WAT A . 
E 3 HOH 37 582 582 HOH WAT A . 
E 3 HOH 38 584 584 HOH WAT A . 
E 3 HOH 39 586 586 HOH WAT A . 
E 3 HOH 40 587 587 HOH WAT A . 
E 3 HOH 41 592 592 HOH WAT A . 
E 3 HOH 42 593 593 HOH WAT A . 
E 3 HOH 43 596 596 HOH WAT A . 
E 3 HOH 44 598 598 HOH WAT A . 
E 3 HOH 45 601 601 HOH WAT A . 
E 3 HOH 46 603 603 HOH WAT A . 
E 3 HOH 47 606 606 HOH WAT A . 
E 3 HOH 48 607 607 HOH WAT A . 
E 3 HOH 49 608 608 HOH WAT A . 
E 3 HOH 50 609 609 HOH WAT A . 
E 3 HOH 51 610 610 HOH WAT A . 
E 3 HOH 52 614 614 HOH WAT A . 
E 3 HOH 53 617 617 HOH WAT A . 
E 3 HOH 54 619 619 HOH WAT A . 
E 3 HOH 55 621 621 HOH WAT A . 
E 3 HOH 56 623 623 HOH WAT A . 
E 3 HOH 57 624 624 HOH WAT A . 
E 3 HOH 58 625 625 HOH WAT A . 
E 3 HOH 59 626 626 HOH WAT A . 
E 3 HOH 60 627 627 HOH WAT A . 
E 3 HOH 61 629 629 HOH WAT A . 
E 3 HOH 62 630 630 HOH WAT A . 
E 3 HOH 63 632 632 HOH WAT A . 
E 3 HOH 64 633 633 HOH WAT A . 
E 3 HOH 65 634 634 HOH WAT A . 
E 3 HOH 66 636 636 HOH WAT A . 
E 3 HOH 67 637 637 HOH WAT A . 
E 3 HOH 68 638 638 HOH WAT A . 
E 3 HOH 69 639 639 HOH WAT A . 
F 3 HOH 1  501 501 HOH WAT B . 
F 3 HOH 2  503 503 HOH WAT B . 
F 3 HOH 3  504 504 HOH WAT B . 
F 3 HOH 4  507 507 HOH WAT B . 
F 3 HOH 5  508 508 HOH WAT B . 
F 3 HOH 6  511 511 HOH WAT B . 
F 3 HOH 7  516 516 HOH WAT B . 
F 3 HOH 8  518 518 HOH WAT B . 
F 3 HOH 9  519 519 HOH WAT B . 
F 3 HOH 10 520 520 HOH WAT B . 
F 3 HOH 11 521 521 HOH WAT B . 
F 3 HOH 12 522 522 HOH WAT B . 
F 3 HOH 13 527 527 HOH WAT B . 
F 3 HOH 14 528 528 HOH WAT B . 
F 3 HOH 15 529 529 HOH WAT B . 
F 3 HOH 16 531 531 HOH WAT B . 
F 3 HOH 17 532 532 HOH WAT B . 
F 3 HOH 18 533 533 HOH WAT B . 
F 3 HOH 19 534 534 HOH WAT B . 
F 3 HOH 20 535 535 HOH WAT B . 
F 3 HOH 21 538 538 HOH WAT B . 
F 3 HOH 22 539 539 HOH WAT B . 
F 3 HOH 23 540 540 HOH WAT B . 
F 3 HOH 24 541 541 HOH WAT B . 
F 3 HOH 25 546 546 HOH WAT B . 
F 3 HOH 26 547 547 HOH WAT B . 
F 3 HOH 27 548 548 HOH WAT B . 
F 3 HOH 28 549 549 HOH WAT B . 
F 3 HOH 29 551 551 HOH WAT B . 
F 3 HOH 30 552 552 HOH WAT B . 
F 3 HOH 31 553 553 HOH WAT B . 
F 3 HOH 32 554 554 HOH WAT B . 
F 3 HOH 33 556 556 HOH WAT B . 
F 3 HOH 34 559 559 HOH WAT B . 
F 3 HOH 35 561 561 HOH WAT B . 
F 3 HOH 36 562 562 HOH WAT B . 
F 3 HOH 37 566 566 HOH WAT B . 
F 3 HOH 38 567 567 HOH WAT B . 
F 3 HOH 39 568 568 HOH WAT B . 
F 3 HOH 40 569 569 HOH WAT B . 
F 3 HOH 41 570 570 HOH WAT B . 
F 3 HOH 42 572 572 HOH WAT B . 
F 3 HOH 43 573 573 HOH WAT B . 
F 3 HOH 44 574 574 HOH WAT B . 
F 3 HOH 45 578 578 HOH WAT B . 
F 3 HOH 46 583 583 HOH WAT B . 
F 3 HOH 47 585 585 HOH WAT B . 
F 3 HOH 48 588 588 HOH WAT B . 
F 3 HOH 49 589 589 HOH WAT B . 
F 3 HOH 50 590 590 HOH WAT B . 
F 3 HOH 51 591 591 HOH WAT B . 
F 3 HOH 52 594 594 HOH WAT B . 
F 3 HOH 53 595 595 HOH WAT B . 
F 3 HOH 54 597 597 HOH WAT B . 
F 3 HOH 55 599 599 HOH WAT B . 
F 3 HOH 56 600 600 HOH WAT B . 
F 3 HOH 57 602 602 HOH WAT B . 
F 3 HOH 58 604 604 HOH WAT B . 
F 3 HOH 59 605 605 HOH WAT B . 
F 3 HOH 60 611 611 HOH WAT B . 
F 3 HOH 61 612 612 HOH WAT B . 
F 3 HOH 62 613 613 HOH WAT B . 
F 3 HOH 63 615 615 HOH WAT B . 
F 3 HOH 64 616 616 HOH WAT B . 
F 3 HOH 65 618 618 HOH WAT B . 
F 3 HOH 66 620 620 HOH WAT B . 
F 3 HOH 67 622 622 HOH WAT B . 
F 3 HOH 68 628 628 HOH WAT B . 
F 3 HOH 69 631 631 HOH WAT B . 
F 3 HOH 70 635 635 HOH WAT B . 
F 3 HOH 71 640 640 HOH WAT B . 
F 3 HOH 72 641 641 HOH WAT B . 
F 3 HOH 73 642 642 HOH WAT B . 
F 3 HOH 74 643 643 HOH WAT B . 
F 3 HOH 75 644 644 HOH WAT B . 
F 3 HOH 76 645 645 HOH WAT B . 
F 3 HOH 77 646 646 HOH WAT B . 
F 3 HOH 78 647 647 HOH WAT B . 
#