data_1Q4L
# 
_entry.id   1Q4L 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1Q4L         
RCSB  RCSB019908   
WWPDB D_1000019908 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1PYX 'GSK-3 BETA COMPLEXED WITH ANP'                   unspecified 
PDB 1Q3D 'GSK-3 BETA COMPLEXED WITH STAUROSPORINE'         unspecified 
PDB 1Q3W 'GSK-3 BETA COMPLEXED WITH ALSTERPAULLONE'        unspecified 
PDB 1Q41 
;GSK-3 BETA COMPLEXED WITH INDIRUBIN-3'-MONOXIME
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1Q4L 
_pdbx_database_status.recvd_initial_deposition_date   2003-08-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bertrand, J.A.' 1 
'Thieffine, S.'  2 
'Vulpetti, A.'   3 
'Cristiani, C.'  4 
'Valsasina, B.'  5 
'Knapp, S.'      6 
'Kalisz, H.M.'   7 
'Flocco, M.'     8 
# 
_citation.id                        primary 
_citation.title                     
'Structural Characterization of the Gsk-3Beta Active Site Using Selective and Non-selective ATP-Mimetic Inhibitors' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            333 
_citation.page_first                393 
_citation.page_last                 407 
_citation.year                      2003 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14529625 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2003.08.031 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bertrand, J.A.' 1 
primary 'Thieffine, S.'  2 
primary 'Vulpetti, A.'   3 
primary 'Cristiani, C.'  4 
primary 'Valsasina, B.'  5 
primary 'Knapp, S.'      6 
primary 'Kalisz, H.M.'   7 
primary 'Flocco, M.'     8 
# 
_cell.entry_id           1Q4L 
_cell.length_a           84.167 
_cell.length_b           86.664 
_cell.length_c           178.650 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1Q4L 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GLYCOGEN SYNTHASE KINASE-3 BETA'                                                         47081.473 2  2.7.1.37 
? ? ? 
2 non-polymer syn '2-CHLORO-5-[4-(3-CHLORO-PHENYL)-2,5-DIOXO-2,5-DIHYDRO-1H-PYRROL-3-YLAMINO]-BENZOIC ACID' 377.178   2  ?        
? ? ? 
3 water       nat water                                                                                     18.015    47 ?        
? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GSK-3 BETA' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLC
DSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVI
YVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTS
SIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIAL
CSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATA
ASDANTGDRGQTNNAASASASNST
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLC
DSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVI
YVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTS
SIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIAL
CSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATA
ASDANTGDRGQTNNAASASASNST
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   ARG n 
1 9   PRO n 
1 10  ARG n 
1 11  THR n 
1 12  THR n 
1 13  SER n 
1 14  PHE n 
1 15  ALA n 
1 16  GLU n 
1 17  SER n 
1 18  CYS n 
1 19  LYS n 
1 20  PRO n 
1 21  VAL n 
1 22  GLN n 
1 23  GLN n 
1 24  PRO n 
1 25  SER n 
1 26  ALA n 
1 27  PHE n 
1 28  GLY n 
1 29  SER n 
1 30  MET n 
1 31  LYS n 
1 32  VAL n 
1 33  SER n 
1 34  ARG n 
1 35  ASP n 
1 36  LYS n 
1 37  ASP n 
1 38  GLY n 
1 39  SER n 
1 40  LYS n 
1 41  VAL n 
1 42  THR n 
1 43  THR n 
1 44  VAL n 
1 45  VAL n 
1 46  ALA n 
1 47  THR n 
1 48  PRO n 
1 49  GLY n 
1 50  GLN n 
1 51  GLY n 
1 52  PRO n 
1 53  ASP n 
1 54  ARG n 
1 55  PRO n 
1 56  GLN n 
1 57  GLU n 
1 58  VAL n 
1 59  SER n 
1 60  TYR n 
1 61  THR n 
1 62  ASP n 
1 63  THR n 
1 64  LYS n 
1 65  VAL n 
1 66  ILE n 
1 67  GLY n 
1 68  ASN n 
1 69  GLY n 
1 70  SER n 
1 71  PHE n 
1 72  GLY n 
1 73  VAL n 
1 74  VAL n 
1 75  TYR n 
1 76  GLN n 
1 77  ALA n 
1 78  LYS n 
1 79  LEU n 
1 80  CYS n 
1 81  ASP n 
1 82  SER n 
1 83  GLY n 
1 84  GLU n 
1 85  LEU n 
1 86  VAL n 
1 87  ALA n 
1 88  ILE n 
1 89  LYS n 
1 90  LYS n 
1 91  VAL n 
1 92  LEU n 
1 93  GLN n 
1 94  ASP n 
1 95  LYS n 
1 96  ARG n 
1 97  PHE n 
1 98  LYS n 
1 99  ASN n 
1 100 ARG n 
1 101 GLU n 
1 102 LEU n 
1 103 GLN n 
1 104 ILE n 
1 105 MET n 
1 106 ARG n 
1 107 LYS n 
1 108 LEU n 
1 109 ASP n 
1 110 HIS n 
1 111 CYS n 
1 112 ASN n 
1 113 ILE n 
1 114 VAL n 
1 115 ARG n 
1 116 LEU n 
1 117 ARG n 
1 118 TYR n 
1 119 PHE n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 SER n 
1 124 GLY n 
1 125 GLU n 
1 126 LYS n 
1 127 LYS n 
1 128 ASP n 
1 129 GLU n 
1 130 VAL n 
1 131 TYR n 
1 132 LEU n 
1 133 ASN n 
1 134 LEU n 
1 135 VAL n 
1 136 LEU n 
1 137 ASP n 
1 138 TYR n 
1 139 VAL n 
1 140 PRO n 
1 141 GLU n 
1 142 THR n 
1 143 VAL n 
1 144 TYR n 
1 145 ARG n 
1 146 VAL n 
1 147 ALA n 
1 148 ARG n 
1 149 HIS n 
1 150 TYR n 
1 151 SER n 
1 152 ARG n 
1 153 ALA n 
1 154 LYS n 
1 155 GLN n 
1 156 THR n 
1 157 LEU n 
1 158 PRO n 
1 159 VAL n 
1 160 ILE n 
1 161 TYR n 
1 162 VAL n 
1 163 LYS n 
1 164 LEU n 
1 165 TYR n 
1 166 MET n 
1 167 TYR n 
1 168 GLN n 
1 169 LEU n 
1 170 PHE n 
1 171 ARG n 
1 172 SER n 
1 173 LEU n 
1 174 ALA n 
1 175 TYR n 
1 176 ILE n 
1 177 HIS n 
1 178 SER n 
1 179 PHE n 
1 180 GLY n 
1 181 ILE n 
1 182 CYS n 
1 183 HIS n 
1 184 ARG n 
1 185 ASP n 
1 186 ILE n 
1 187 LYS n 
1 188 PRO n 
1 189 GLN n 
1 190 ASN n 
1 191 LEU n 
1 192 LEU n 
1 193 LEU n 
1 194 ASP n 
1 195 PRO n 
1 196 ASP n 
1 197 THR n 
1 198 ALA n 
1 199 VAL n 
1 200 LEU n 
1 201 LYS n 
1 202 LEU n 
1 203 CYS n 
1 204 ASP n 
1 205 PHE n 
1 206 GLY n 
1 207 SER n 
1 208 ALA n 
1 209 LYS n 
1 210 GLN n 
1 211 LEU n 
1 212 VAL n 
1 213 ARG n 
1 214 GLY n 
1 215 GLU n 
1 216 PRO n 
1 217 ASN n 
1 218 VAL n 
1 219 SER n 
1 220 TYR n 
1 221 ILE n 
1 222 CYS n 
1 223 SER n 
1 224 ARG n 
1 225 TYR n 
1 226 TYR n 
1 227 ARG n 
1 228 ALA n 
1 229 PRO n 
1 230 GLU n 
1 231 LEU n 
1 232 ILE n 
1 233 PHE n 
1 234 GLY n 
1 235 ALA n 
1 236 THR n 
1 237 ASP n 
1 238 TYR n 
1 239 THR n 
1 240 SER n 
1 241 SER n 
1 242 ILE n 
1 243 ASP n 
1 244 VAL n 
1 245 TRP n 
1 246 SER n 
1 247 ALA n 
1 248 GLY n 
1 249 CYS n 
1 250 VAL n 
1 251 LEU n 
1 252 ALA n 
1 253 GLU n 
1 254 LEU n 
1 255 LEU n 
1 256 LEU n 
1 257 GLY n 
1 258 GLN n 
1 259 PRO n 
1 260 ILE n 
1 261 PHE n 
1 262 PRO n 
1 263 GLY n 
1 264 ASP n 
1 265 SER n 
1 266 GLY n 
1 267 VAL n 
1 268 ASP n 
1 269 GLN n 
1 270 LEU n 
1 271 VAL n 
1 272 GLU n 
1 273 ILE n 
1 274 ILE n 
1 275 LYS n 
1 276 VAL n 
1 277 LEU n 
1 278 GLY n 
1 279 THR n 
1 280 PRO n 
1 281 THR n 
1 282 ARG n 
1 283 GLU n 
1 284 GLN n 
1 285 ILE n 
1 286 ARG n 
1 287 GLU n 
1 288 MET n 
1 289 ASN n 
1 290 PRO n 
1 291 ASN n 
1 292 TYR n 
1 293 THR n 
1 294 GLU n 
1 295 PHE n 
1 296 LYS n 
1 297 PHE n 
1 298 PRO n 
1 299 GLN n 
1 300 ILE n 
1 301 LYS n 
1 302 ALA n 
1 303 HIS n 
1 304 PRO n 
1 305 TRP n 
1 306 THR n 
1 307 LYS n 
1 308 VAL n 
1 309 PHE n 
1 310 ARG n 
1 311 PRO n 
1 312 ARG n 
1 313 THR n 
1 314 PRO n 
1 315 PRO n 
1 316 GLU n 
1 317 ALA n 
1 318 ILE n 
1 319 ALA n 
1 320 LEU n 
1 321 CYS n 
1 322 SER n 
1 323 ARG n 
1 324 LEU n 
1 325 LEU n 
1 326 GLU n 
1 327 TYR n 
1 328 THR n 
1 329 PRO n 
1 330 THR n 
1 331 ALA n 
1 332 ARG n 
1 333 LEU n 
1 334 THR n 
1 335 PRO n 
1 336 LEU n 
1 337 GLU n 
1 338 ALA n 
1 339 CYS n 
1 340 ALA n 
1 341 HIS n 
1 342 SER n 
1 343 PHE n 
1 344 PHE n 
1 345 ASP n 
1 346 GLU n 
1 347 LEU n 
1 348 ARG n 
1 349 ASP n 
1 350 PRO n 
1 351 ASN n 
1 352 VAL n 
1 353 LYS n 
1 354 LEU n 
1 355 PRO n 
1 356 ASN n 
1 357 GLY n 
1 358 ARG n 
1 359 ASP n 
1 360 THR n 
1 361 PRO n 
1 362 ALA n 
1 363 LEU n 
1 364 PHE n 
1 365 ASN n 
1 366 PHE n 
1 367 THR n 
1 368 THR n 
1 369 GLN n 
1 370 GLU n 
1 371 LEU n 
1 372 SER n 
1 373 SER n 
1 374 ASN n 
1 375 PRO n 
1 376 PRO n 
1 377 LEU n 
1 378 ALA n 
1 379 THR n 
1 380 ILE n 
1 381 LEU n 
1 382 ILE n 
1 383 PRO n 
1 384 PRO n 
1 385 HIS n 
1 386 ALA n 
1 387 ARG n 
1 388 ILE n 
1 389 GLN n 
1 390 ALA n 
1 391 ALA n 
1 392 ALA n 
1 393 SER n 
1 394 THR n 
1 395 PRO n 
1 396 THR n 
1 397 ASN n 
1 398 ALA n 
1 399 THR n 
1 400 ALA n 
1 401 ALA n 
1 402 SER n 
1 403 ASP n 
1 404 ALA n 
1 405 ASN n 
1 406 THR n 
1 407 GLY n 
1 408 ASP n 
1 409 ARG n 
1 410 GLY n 
1 411 GLN n 
1 412 THR n 
1 413 ASN n 
1 414 ASN n 
1 415 ALA n 
1 416 ALA n 
1 417 SER n 
1 418 ALA n 
1 419 SER n 
1 420 ALA n 
1 421 SER n 
1 422 ASN n 
1 423 SER n 
1 424 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 GSK3B 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            H5 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               BACULOVIRUS 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PVL-GST-GSK3BETA 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GSK3B_HUMAN 
_struct_ref.pdbx_db_accession          P49841 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGEL
VAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLY
MYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVW
SAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLL
EYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDAN
TGDRGQTNNAASASASNST
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1Q4L A 6 ? 424 ? P49841 2 ? 420 ? 2 420 
2 1 1Q4L B 6 ? 424 ? P49841 2 ? 420 ? 2 420 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1Q4L GLY A 1 ? UNP P49841 ? ? 'CLONING ARTIFACT' -3 1  
1 1Q4L PRO A 2 ? UNP P49841 ? ? 'CLONING ARTIFACT' -2 2  
1 1Q4L LEU A 3 ? UNP P49841 ? ? 'CLONING ARTIFACT' -1 3  
1 1Q4L GLY A 4 ? UNP P49841 ? ? 'CLONING ARTIFACT' 0  4  
1 1Q4L SER A 5 ? UNP P49841 ? ? 'CLONING ARTIFACT' 1  5  
2 1Q4L GLY B 1 ? UNP P49841 ? ? 'CLONING ARTIFACT' -3 6  
2 1Q4L PRO B 2 ? UNP P49841 ? ? 'CLONING ARTIFACT' -2 7  
2 1Q4L LEU B 3 ? UNP P49841 ? ? 'CLONING ARTIFACT' -1 8  
2 1Q4L GLY B 4 ? UNP P49841 ? ? 'CLONING ARTIFACT' 0  9  
2 1Q4L SER B 5 ? UNP P49841 ? ? 'CLONING ARTIFACT' 1  10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
679 non-polymer         . '2-CHLORO-5-[4-(3-CHLORO-PHENYL)-2,5-DIOXO-2,5-DIHYDRO-1H-PYRROL-3-YLAMINO]-BENZOIC ACID' I-5 
'C17 H10 Cl2 N2 O4' 377.178 
ALA 'L-peptide linking' y ALANINE                                                                                   ?   
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                                                  ?   
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                ?   
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                           ?   
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                  ?   
'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                 ?   
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                           ?   
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                                                   ?   
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                 ?   
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                                                     ?   'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                ?   
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                   ?   
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                                                    ?   
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                                                ?   
'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                             ?   
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                                                   ?   
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                                                    ?   
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                                                 ?   
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                ?   
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                  ?   
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                                                    ?   
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1Q4L 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.46 
_exptl_crystal.density_percent_sol   64.42 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.00 
_exptl_crystal_grow.pdbx_details    
'PEG 3350 MONODISPERSE, GLYCEROL, MAGNESIUM CHLORIDE, HEPES, pH 7.00, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2002-03-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9393 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             0.9393 
_diffrn_source.pdbx_wavelength_list        0.9393 
# 
_reflns.entry_id                     1Q4L 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            2.770 
_reflns.number_obs                   33530 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.093 
_reflns.pdbx_netI_over_sigmaI        10.8231 
_reflns.B_iso_Wilson_estimate        37.6 
_reflns.pdbx_redundancy              3.164 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.77 
_reflns_shell.d_res_low              2.87 
_reflns_shell.percent_possible_all   99.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.569 
_reflns_shell.meanI_over_sigI_obs    1.893 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1Q4L 
_refine.ls_number_reflns_obs                     33497 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               1694956.14 
_refine.pdbx_data_cutoff_low_absF                0 
_refine.pdbx_data_cutoff_high_rms_absF           1694956.14 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.77 
_refine.ls_percent_reflns_obs                    98.7 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.212 
_refine.ls_R_factor_R_free                       0.251 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1660 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               53.9 
_refine.aniso_B[1][1]                            3.08 
_refine.aniso_B[2][2]                            15.22 
_refine.aniso_B[3][3]                            -18.30 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.310392 
_refine.solvent_model_param_bsol                 32.3496 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1H8F' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             GROUP 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1Q4L 
_refine_analyze.Luzzati_coordinate_error_obs    0.34 
_refine_analyze.Luzzati_sigma_a_obs             0.48 
_refine_analyze.Luzzati_d_res_low_obs           5 
_refine_analyze.Luzzati_coordinate_error_free   0.40 
_refine_analyze.Luzzati_sigma_a_free            0.50 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5418 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         50 
_refine_hist.number_atoms_solvent             47 
_refine_hist.number_atoms_total               5515 
_refine_hist.d_res_high                       2.77 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.4   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.9  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.01  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.77 
_refine_ls_shell.d_res_low                        2.94 
_refine_ls_shell.number_reflns_R_work             5273 
_refine_ls_shell.R_factor_R_work                  0.327 
_refine_ls_shell.percent_reflns_obs               99.6 
_refine_ls_shell.R_factor_R_free                  0.351 
_refine_ls_shell.R_factor_R_free_error            0.021 
_refine_ls_shell.percent_reflns_R_free            5.0 
_refine_ls_shell.number_reflns_R_free             275 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1Q4L 
_struct.title                     'GSK-3 Beta complexed with Inhibitor I-5' 
_struct.pdbx_descriptor           'Glycogen synthase kinase-3 beta (E.C.2.7.1.37)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1Q4L 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'KINASE, INSULIN PATHWAY, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 99  ? LYS A 107 ? ASN A 95  LYS A 103 1 ? 9  
HELX_P HELX_P2  2  VAL A 143 ? ARG A 152 ? VAL A 139 ARG A 148 1 ? 10 
HELX_P HELX_P3  3  PRO A 158 ? SER A 178 ? PRO A 154 SER A 174 1 ? 21 
HELX_P HELX_P4  4  LYS A 187 ? GLN A 189 ? LYS A 183 GLN A 185 5 ? 3  
HELX_P HELX_P5  5  ALA A 228 ? PHE A 233 ? ALA A 224 PHE A 229 1 ? 6  
HELX_P HELX_P6  6  SER A 240 ? GLY A 257 ? SER A 236 GLY A 253 1 ? 18 
HELX_P HELX_P7  7  SER A 265 ? GLY A 278 ? SER A 261 GLY A 274 1 ? 14 
HELX_P HELX_P8  8  THR A 281 ? ASN A 289 ? THR A 277 ASN A 285 1 ? 9  
HELX_P HELX_P9  9  PRO A 304 ? VAL A 308 ? PRO A 300 VAL A 304 5 ? 5  
HELX_P HELX_P10 10 PRO A 314 ? LEU A 325 ? PRO A 310 LEU A 321 1 ? 12 
HELX_P HELX_P11 11 THR A 328 ? ARG A 332 ? THR A 324 ARG A 328 5 ? 5  
HELX_P HELX_P12 12 THR A 334 ? ALA A 340 ? THR A 330 ALA A 336 1 ? 7  
HELX_P HELX_P13 13 HIS A 341 ? ASP A 349 ? HIS A 337 ASP A 345 5 ? 9  
HELX_P HELX_P14 14 THR A 367 ? SER A 372 ? THR A 363 SER A 368 1 ? 6  
HELX_P HELX_P15 15 ASN A 374 ? PRO A 376 ? ASN A 370 PRO A 372 5 ? 3  
HELX_P HELX_P16 16 LEU A 377 ? ILE A 382 ? LEU A 373 ILE A 378 1 ? 6  
HELX_P HELX_P17 17 PRO A 383 ? ARG A 387 ? PRO A 379 ARG A 383 5 ? 5  
HELX_P HELX_P18 18 ASN B 99  ? ARG B 106 ? ASN B 95  ARG B 102 1 ? 8  
HELX_P HELX_P19 19 VAL B 143 ? ALA B 153 ? VAL B 139 ALA B 149 1 ? 11 
HELX_P HELX_P20 20 PRO B 158 ? PHE B 179 ? PRO B 154 PHE B 175 1 ? 22 
HELX_P HELX_P21 21 LYS B 187 ? GLN B 189 ? LYS B 183 GLN B 185 5 ? 3  
HELX_P HELX_P22 22 ALA B 228 ? PHE B 233 ? ALA B 224 PHE B 229 1 ? 6  
HELX_P HELX_P23 23 SER B 240 ? GLY B 257 ? SER B 236 GLY B 253 1 ? 18 
HELX_P HELX_P24 24 SER B 265 ? GLY B 278 ? SER B 261 GLY B 274 1 ? 14 
HELX_P HELX_P25 25 THR B 281 ? ASN B 289 ? THR B 277 ASN B 285 1 ? 9  
HELX_P HELX_P26 26 PRO B 314 ? LEU B 325 ? PRO B 310 LEU B 321 1 ? 12 
HELX_P HELX_P27 27 THR B 328 ? ARG B 332 ? THR B 324 ARG B 328 5 ? 5  
HELX_P HELX_P28 28 THR B 334 ? ALA B 340 ? THR B 330 ALA B 336 1 ? 7  
HELX_P HELX_P29 29 HIS B 341 ? ASP B 349 ? HIS B 337 ASP B 345 5 ? 9  
HELX_P HELX_P30 30 THR B 367 ? SER B 372 ? THR B 363 SER B 368 1 ? 6  
HELX_P HELX_P31 31 ASN B 374 ? PRO B 376 ? ASN B 370 PRO B 372 5 ? 3  
HELX_P HELX_P32 32 LEU B 377 ? ILE B 382 ? LEU B 373 ILE B 378 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 3 ? 
C ? 2 ? 
D ? 7 ? 
E ? 3 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
D 6 7 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 42  ? PRO A 48  ? THR A 38  PRO A 44  
A 2 GLN A 56  ? GLY A 69  ? GLN A 52  GLY A 65  
A 3 GLY A 72  ? LEU A 79  ? GLY A 68  LEU A 75  
A 4 LEU A 85  ? LEU A 92  ? LEU A 81  LEU A 88  
A 5 TYR A 131 ? ASP A 137 ? TYR A 127 ASP A 133 
A 6 LEU A 116 ? SER A 122 ? LEU A 112 SER A 118 
A 7 THR A 42  ? PRO A 48  ? THR A 38  PRO A 44  
B 1 GLU A 141 ? THR A 142 ? GLU A 137 THR A 138 
B 2 LEU A 191 ? ASP A 194 ? LEU A 187 ASP A 190 
B 3 VAL A 199 ? LEU A 202 ? VAL A 195 LEU A 198 
C 1 ILE A 181 ? CYS A 182 ? ILE A 177 CYS A 178 
C 2 LYS A 209 ? GLN A 210 ? LYS A 205 GLN A 206 
D 1 VAL B 41  ? PRO B 48  ? VAL B 37  PRO B 44  
D 2 GLN B 56  ? VAL B 65  ? GLN B 52  VAL B 61  
D 3 VAL B 73  ? LEU B 79  ? VAL B 69  LEU B 75  
D 4 LEU B 85  ? LEU B 92  ? LEU B 81  LEU B 88  
D 5 VAL B 130 ? ASP B 137 ? VAL B 126 ASP B 133 
D 6 LEU B 116 ? SER B 123 ? LEU B 112 SER B 119 
D 7 VAL B 41  ? PRO B 48  ? VAL B 37  PRO B 44  
E 1 GLU B 141 ? THR B 142 ? GLU B 137 THR B 138 
E 2 LEU B 191 ? ASP B 194 ? LEU B 187 ASP B 190 
E 3 VAL B 199 ? LEU B 202 ? VAL B 195 LEU B 198 
F 1 ILE B 181 ? CYS B 182 ? ILE B 177 CYS B 178 
F 2 LYS B 209 ? GLN B 210 ? LYS B 205 GLN B 206 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 44  ? N VAL A 40  O VAL A 58  ? O VAL A 54  
A 2 3 N LYS A 64  ? N LYS A 60  O GLN A 76  ? O GLN A 72  
A 3 4 N TYR A 75  ? N TYR A 71  O ILE A 88  ? O ILE A 84  
A 4 5 N ALA A 87  ? N ALA A 83  O LEU A 136 ? O LEU A 132 
A 5 6 O VAL A 135 ? O VAL A 131 N TYR A 118 ? N TYR A 114 
A 6 7 O PHE A 119 ? O PHE A 115 N THR A 47  ? N THR A 43  
B 1 2 N GLU A 141 ? N GLU A 137 O LEU A 193 ? O LEU A 189 
B 2 3 N LEU A 192 ? N LEU A 188 O LYS A 201 ? O LYS A 197 
C 1 2 N CYS A 182 ? N CYS A 178 O LYS A 209 ? O LYS A 205 
D 1 2 N VAL B 44  ? N VAL B 40  O VAL B 58  ? O VAL B 54  
D 2 3 N LYS B 64  ? N LYS B 60  O GLN B 76  ? O GLN B 72  
D 3 4 N ALA B 77  ? N ALA B 73  O VAL B 86  ? O VAL B 82  
D 4 5 N VAL B 91  ? N VAL B 87  O LEU B 132 ? O LEU B 128 
D 5 6 O TYR B 131 ? O TYR B 127 N SER B 122 ? N SER B 118 
D 6 7 O PHE B 119 ? O PHE B 115 N THR B 47  ? N THR B 43  
E 1 2 N GLU B 141 ? N GLU B 137 O LEU B 193 ? O LEU B 189 
E 2 3 N LEU B 192 ? N LEU B 188 O LYS B 201 ? O LYS B 197 
F 1 2 N CYS B 182 ? N CYS B 178 O LYS B 209 ? O LYS B 205 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE 679 A 451' 
AC2 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE 679 B 452' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 ILE A 66  ? ILE A 62  . ? 1_555 ? 
2  AC1 17 GLY A 67  ? GLY A 63  . ? 1_555 ? 
3  AC1 17 ASN A 68  ? ASN A 64  . ? 1_555 ? 
4  AC1 17 GLY A 69  ? GLY A 65  . ? 1_555 ? 
5  AC1 17 ALA A 87  ? ALA A 83  . ? 1_555 ? 
6  AC1 17 LYS A 89  ? LYS A 85  . ? 1_555 ? 
7  AC1 17 VAL A 114 ? VAL A 110 . ? 1_555 ? 
8  AC1 17 LEU A 136 ? LEU A 132 . ? 1_555 ? 
9  AC1 17 ASP A 137 ? ASP A 133 . ? 1_555 ? 
10 AC1 17 TYR A 138 ? TYR A 134 . ? 1_555 ? 
11 AC1 17 VAL A 139 ? VAL A 135 . ? 1_555 ? 
12 AC1 17 ARG A 145 ? ARG A 141 . ? 1_555 ? 
13 AC1 17 GLN A 189 ? GLN A 185 . ? 1_555 ? 
14 AC1 17 LEU A 192 ? LEU A 188 . ? 1_555 ? 
15 AC1 17 CYS A 203 ? CYS A 199 . ? 1_555 ? 
16 AC1 17 ASP A 204 ? ASP A 200 . ? 1_555 ? 
17 AC1 17 HOH E .   ? HOH A 508 . ? 1_555 ? 
18 AC2 16 ILE B 66  ? ILE B 62  . ? 1_555 ? 
19 AC2 16 GLY B 67  ? GLY B 63  . ? 1_555 ? 
20 AC2 16 ASN B 68  ? ASN B 64  . ? 1_555 ? 
21 AC2 16 ALA B 87  ? ALA B 83  . ? 1_555 ? 
22 AC2 16 LYS B 89  ? LYS B 85  . ? 1_555 ? 
23 AC2 16 LEU B 136 ? LEU B 132 . ? 1_555 ? 
24 AC2 16 ASP B 137 ? ASP B 133 . ? 1_555 ? 
25 AC2 16 TYR B 138 ? TYR B 134 . ? 1_555 ? 
26 AC2 16 VAL B 139 ? VAL B 135 . ? 1_555 ? 
27 AC2 16 ARG B 145 ? ARG B 141 . ? 1_555 ? 
28 AC2 16 GLN B 189 ? GLN B 185 . ? 1_555 ? 
29 AC2 16 LEU B 192 ? LEU B 188 . ? 1_555 ? 
30 AC2 16 CYS B 203 ? CYS B 199 . ? 1_555 ? 
31 AC2 16 ASP B 204 ? ASP B 200 . ? 1_555 ? 
32 AC2 16 HOH F .   ? HOH B 527 . ? 1_555 ? 
33 AC2 16 HOH F .   ? HOH B 528 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1Q4L 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1Q4L 
_atom_sites.fract_transf_matrix[1][1]   0.011881 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011539 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005598 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 39  ? 64.919 13.689  35.600  1.00 105.72 ? 35  SER A N   1 
ATOM   2    C  CA  . SER A 1 39  ? 63.561 13.357  35.068  1.00 105.77 ? 35  SER A CA  1 
ATOM   3    C  C   . SER A 1 39  ? 62.773 14.635  34.832  1.00 105.05 ? 35  SER A C   1 
ATOM   4    O  O   . SER A 1 39  ? 62.887 15.580  35.612  1.00 105.24 ? 35  SER A O   1 
ATOM   5    C  CB  . SER A 1 39  ? 62.802 12.477  36.062  1.00 114.88 ? 35  SER A CB  1 
ATOM   6    O  OG  . SER A 1 39  ? 62.612 13.158  37.288  1.00 114.92 ? 35  SER A OG  1 
ATOM   7    N  N   . LYS A 1 40  ? 61.968 14.659  33.770  1.00 108.04 ? 36  LYS A N   1 
ATOM   8    C  CA  . LYS A 1 40  ? 61.174 15.842  33.438  1.00 106.16 ? 36  LYS A CA  1 
ATOM   9    C  C   . LYS A 1 40  ? 60.129 16.182  34.487  1.00 104.42 ? 36  LYS A C   1 
ATOM   10   O  O   . LYS A 1 40  ? 59.563 15.298  35.133  1.00 104.61 ? 36  LYS A O   1 
ATOM   11   C  CB  . LYS A 1 40  ? 60.460 15.678  32.096  1.00 75.56  ? 36  LYS A CB  1 
ATOM   12   C  CG  . LYS A 1 40  ? 59.680 16.923  31.694  1.00 76.61  ? 36  LYS A CG  1 
ATOM   13   C  CD  . LYS A 1 40  ? 58.588 16.640  30.680  1.00 77.11  ? 36  LYS A CD  1 
ATOM   14   C  CE  . LYS A 1 40  ? 59.145 16.050  29.402  1.00 78.06  ? 36  LYS A CE  1 
ATOM   15   N  NZ  . LYS A 1 40  ? 58.156 16.124  28.284  1.00 77.79  ? 36  LYS A NZ  1 
ATOM   16   N  N   . VAL A 1 41  ? 59.870 17.480  34.626  1.00 73.36  ? 37  VAL A N   1 
ATOM   17   C  CA  . VAL A 1 41  ? 58.900 18.000  35.581  1.00 69.62  ? 37  VAL A CA  1 
ATOM   18   C  C   . VAL A 1 41  ? 58.074 19.119  34.949  1.00 67.87  ? 37  VAL A C   1 
ATOM   19   O  O   . VAL A 1 41  ? 58.624 20.011  34.311  1.00 66.72  ? 37  VAL A O   1 
ATOM   20   C  CB  . VAL A 1 41  ? 59.610 18.560  36.834  1.00 39.97  ? 37  VAL A CB  1 
ATOM   21   C  CG1 . VAL A 1 41  ? 58.684 19.520  37.574  1.00 39.89  ? 37  VAL A CG1 1 
ATOM   22   C  CG2 . VAL A 1 41  ? 60.011 17.428  37.761  1.00 39.67  ? 37  VAL A CG2 1 
ATOM   23   N  N   . THR A 1 42  ? 56.756 19.066  35.126  1.00 73.83  ? 38  THR A N   1 
ATOM   24   C  CA  . THR A 1 42  ? 55.871 20.097  34.583  1.00 71.39  ? 38  THR A CA  1 
ATOM   25   C  C   . THR A 1 42  ? 55.233 20.896  35.720  1.00 69.98  ? 38  THR A C   1 
ATOM   26   O  O   . THR A 1 42  ? 54.721 20.322  36.683  1.00 69.53  ? 38  THR A O   1 
ATOM   27   C  CB  . THR A 1 42  ? 54.739 19.493  33.725  1.00 49.24  ? 38  THR A CB  1 
ATOM   28   O  OG1 . THR A 1 42  ? 55.302 18.747  32.641  1.00 50.34  ? 38  THR A OG1 1 
ATOM   29   C  CG2 . THR A 1 42  ? 53.862 20.598  33.151  1.00 47.97  ? 38  THR A CG2 1 
ATOM   30   N  N   . THR A 1 43  ? 55.271 22.220  35.610  1.00 48.72  ? 39  THR A N   1 
ATOM   31   C  CA  . THR A 1 43  ? 54.690 23.074  36.635  1.00 45.87  ? 39  THR A CA  1 
ATOM   32   C  C   . THR A 1 43  ? 53.693 24.000  35.971  1.00 44.07  ? 39  THR A C   1 
ATOM   33   O  O   . THR A 1 43  ? 54.023 24.650  34.987  1.00 42.33  ? 39  THR A O   1 
ATOM   34   C  CB  . THR A 1 43  ? 55.759 23.925  37.326  1.00 57.00  ? 39  THR A CB  1 
ATOM   35   O  OG1 . THR A 1 43  ? 56.770 23.071  37.873  1.00 56.51  ? 39  THR A OG1 1 
ATOM   36   C  CG2 . THR A 1 43  ? 55.136 24.751  38.449  1.00 56.27  ? 39  THR A CG2 1 
ATOM   37   N  N   . VAL A 1 44  ? 52.474 24.047  36.503  1.00 64.76  ? 40  VAL A N   1 
ATOM   38   C  CA  . VAL A 1 44  ? 51.424 24.896  35.951  1.00 61.90  ? 40  VAL A CA  1 
ATOM   39   C  C   . VAL A 1 44  ? 50.752 25.673  37.072  1.00 60.46  ? 40  VAL A C   1 
ATOM   40   O  O   . VAL A 1 44  ? 50.871 25.314  38.247  1.00 59.83  ? 40  VAL A O   1 
ATOM   41   C  CB  . VAL A 1 44  ? 50.323 24.061  35.230  1.00 51.86  ? 40  VAL A CB  1 
ATOM   42   C  CG1 . VAL A 1 44  ? 50.908 23.299  34.069  1.00 51.79  ? 40  VAL A CG1 1 
ATOM   43   C  CG2 . VAL A 1 44  ? 49.681 23.090  36.202  1.00 51.31  ? 40  VAL A CG2 1 
ATOM   44   N  N   . VAL A 1 45  ? 50.047 26.739  36.709  1.00 51.02  ? 41  VAL A N   1 
ATOM   45   C  CA  . VAL A 1 45  ? 49.323 27.539  37.692  1.00 51.62  ? 41  VAL A CA  1 
ATOM   46   C  C   . VAL A 1 45  ? 47.857 27.179  37.498  1.00 52.16  ? 41  VAL A C   1 
ATOM   47   O  O   . VAL A 1 45  ? 47.255 27.570  36.497  1.00 52.73  ? 41  VAL A O   1 
ATOM   48   C  CB  . VAL A 1 45  ? 49.517 29.080  37.462  1.00 44.02  ? 41  VAL A CB  1 
ATOM   49   C  CG1 . VAL A 1 45  ? 48.724 29.876  38.505  1.00 42.80  ? 41  VAL A CG1 1 
ATOM   50   C  CG2 . VAL A 1 45  ? 50.991 29.446  37.560  1.00 42.13  ? 41  VAL A CG2 1 
ATOM   51   N  N   . ALA A 1 46  ? 47.284 26.438  38.446  1.00 53.88  ? 42  ALA A N   1 
ATOM   52   C  CA  . ALA A 1 46  ? 45.884 26.020  38.325  1.00 54.34  ? 42  ALA A CA  1 
ATOM   53   C  C   . ALA A 1 46  ? 44.959 26.625  39.364  1.00 54.72  ? 42  ALA A C   1 
ATOM   54   O  O   . ALA A 1 46  ? 45.413 27.180  40.362  1.00 55.15  ? 42  ALA A O   1 
ATOM   55   C  CB  . ALA A 1 46  ? 45.784 24.488  38.387  1.00 49.05  ? 42  ALA A CB  1 
ATOM   56   N  N   . THR A 1 47  ? 43.658 26.502  39.110  1.00 33.97  ? 43  THR A N   1 
ATOM   57   C  CA  . THR A 1 47  ? 42.612 26.994  40.004  1.00 35.73  ? 43  THR A CA  1 
ATOM   58   C  C   . THR A 1 47  ? 42.130 25.846  40.876  1.00 37.86  ? 43  THR A C   1 
ATOM   59   O  O   . THR A 1 47  ? 41.898 24.752  40.380  1.00 36.90  ? 43  THR A O   1 
ATOM   60   C  CB  . THR A 1 47  ? 41.385 27.469  39.216  1.00 34.39  ? 43  THR A CB  1 
ATOM   61   O  OG1 . THR A 1 47  ? 41.763 28.535  38.342  1.00 35.61  ? 43  THR A OG1 1 
ATOM   62   C  CG2 . THR A 1 47  ? 40.275 27.926  40.155  1.00 34.95  ? 43  THR A CG2 1 
ATOM   63   N  N   . PRO A 1 48  ? 41.966 26.075  42.186  1.00 54.19  ? 44  PRO A N   1 
ATOM   64   C  CA  . PRO A 1 48  ? 41.488 24.970  43.031  1.00 54.65  ? 44  PRO A CA  1 
ATOM   65   C  C   . PRO A 1 48  ? 40.168 24.442  42.465  1.00 56.72  ? 44  PRO A C   1 
ATOM   66   O  O   . PRO A 1 48  ? 39.474 25.147  41.739  1.00 53.94  ? 44  PRO A O   1 
ATOM   67   C  CB  . PRO A 1 48  ? 41.298 25.631  44.389  1.00 54.57  ? 44  PRO A CB  1 
ATOM   68   C  CG  . PRO A 1 48  ? 42.370 26.687  44.394  1.00 54.91  ? 44  PRO A CG  1 
ATOM   69   C  CD  . PRO A 1 48  ? 42.283 27.267  42.995  1.00 53.49  ? 44  PRO A CD  1 
ATOM   70   N  N   . GLY A 1 49  ? 39.831 23.202  42.793  1.00 52.51  ? 45  GLY A N   1 
ATOM   71   C  CA  . GLY A 1 49  ? 38.601 22.618  42.299  1.00 55.94  ? 45  GLY A CA  1 
ATOM   72   C  C   . GLY A 1 49  ? 37.369 23.249  42.915  1.00 58.37  ? 45  GLY A C   1 
ATOM   73   O  O   . GLY A 1 49  ? 36.396 23.544  42.204  1.00 58.29  ? 45  GLY A O   1 
ATOM   74   N  N   . GLN A 1 50  ? 37.401 23.465  44.230  1.00 74.11  ? 46  GLN A N   1 
ATOM   75   C  CA  . GLN A 1 50  ? 36.263 24.067  44.913  1.00 77.13  ? 46  GLN A CA  1 
ATOM   76   C  C   . GLN A 1 50  ? 36.601 25.236  45.840  1.00 78.11  ? 46  GLN A C   1 
ATOM   77   O  O   . GLN A 1 50  ? 35.809 26.173  45.972  1.00 79.18  ? 46  GLN A O   1 
ATOM   78   C  CB  . GLN A 1 50  ? 35.488 22.998  45.692  1.00 95.68  ? 46  GLN A CB  1 
ATOM   79   C  CG  . GLN A 1 50  ? 36.360 22.001  46.427  1.00 98.19  ? 46  GLN A CG  1 
ATOM   80   C  CD  . GLN A 1 50  ? 36.467 20.680  45.691  1.00 99.58  ? 46  GLN A CD  1 
ATOM   81   O  OE1 . GLN A 1 50  ? 37.221 19.789  46.093  1.00 99.75  ? 46  GLN A OE1 1 
ATOM   82   N  NE2 . GLN A 1 50  ? 35.704 20.541  44.611  1.00 100.18 ? 46  GLN A NE2 1 
ATOM   83   N  N   . GLY A 1 51  ? 37.760 25.194  46.486  1.00 92.26  ? 47  GLY A N   1 
ATOM   84   C  CA  . GLY A 1 51  ? 38.115 26.286  47.379  1.00 93.13  ? 47  GLY A CA  1 
ATOM   85   C  C   . GLY A 1 51  ? 38.003 27.634  46.685  1.00 93.03  ? 47  GLY A C   1 
ATOM   86   O  O   . GLY A 1 51  ? 37.702 27.675  45.492  1.00 92.71  ? 47  GLY A O   1 
ATOM   87   N  N   . PRO A 1 52  ? 38.205 28.759  47.397  1.00 75.03  ? 48  PRO A N   1 
ATOM   88   C  CA  . PRO A 1 52  ? 38.108 30.066  46.732  1.00 74.10  ? 48  PRO A CA  1 
ATOM   89   C  C   . PRO A 1 52  ? 39.190 30.131  45.653  1.00 72.86  ? 48  PRO A C   1 
ATOM   90   O  O   . PRO A 1 52  ? 40.222 29.465  45.767  1.00 72.26  ? 48  PRO A O   1 
ATOM   91   C  CB  . PRO A 1 52  ? 38.351 31.054  47.871  1.00 71.59  ? 48  PRO A CB  1 
ATOM   92   C  CG  . PRO A 1 52  ? 37.803 30.326  49.071  1.00 71.87  ? 48  PRO A CG  1 
ATOM   93   C  CD  . PRO A 1 52  ? 38.336 28.920  48.859  1.00 71.11  ? 48  PRO A CD  1 
ATOM   94   N  N   . ASP A 1 53  ? 38.956 30.940  44.622  1.00 60.17  ? 49  ASP A N   1 
ATOM   95   C  CA  . ASP A 1 53  ? 39.878 31.063  43.493  1.00 59.03  ? 49  ASP A CA  1 
ATOM   96   C  C   . ASP A 1 53  ? 41.315 31.573  43.726  1.00 56.76  ? 49  ASP A C   1 
ATOM   97   O  O   . ASP A 1 53  ? 41.735 32.536  43.101  1.00 56.85  ? 49  ASP A O   1 
ATOM   98   C  CB  . ASP A 1 53  ? 39.224 31.917  42.409  1.00 96.17  ? 49  ASP A CB  1 
ATOM   99   C  CG  . ASP A 1 53  ? 39.789 31.637  41.033  1.00 98.16  ? 49  ASP A CG  1 
ATOM   100  O  OD1 . ASP A 1 53  ? 41.005 31.844  40.822  1.00 98.78  ? 49  ASP A OD1 1 
ATOM   101  O  OD2 . ASP A 1 53  ? 39.008 31.199  40.160  1.00 100.44 ? 49  ASP A OD2 1 
ATOM   102  N  N   . ARG A 1 54  ? 42.068 30.918  44.602  1.00 49.21  ? 50  ARG A N   1 
ATOM   103  C  CA  . ARG A 1 54  ? 43.454 31.298  44.870  1.00 46.93  ? 50  ARG A CA  1 
ATOM   104  C  C   . ARG A 1 54  ? 44.399 30.434  44.017  1.00 43.30  ? 50  ARG A C   1 
ATOM   105  O  O   . ARG A 1 54  ? 44.723 29.300  44.402  1.00 41.95  ? 50  ARG A O   1 
ATOM   106  C  CB  . ARG A 1 54  ? 43.788 31.073  46.345  1.00 105.30 ? 50  ARG A CB  1 
ATOM   107  C  CG  . ARG A 1 54  ? 42.994 31.915  47.321  1.00 110.03 ? 50  ARG A CG  1 
ATOM   108  C  CD  . ARG A 1 54  ? 43.341 33.384  47.173  1.00 114.01 ? 50  ARG A CD  1 
ATOM   109  N  NE  . ARG A 1 54  ? 42.819 34.192  48.274  1.00 116.94 ? 50  ARG A NE  1 
ATOM   110  C  CZ  . ARG A 1 54  ? 43.051 35.495  48.414  1.00 118.87 ? 50  ARG A CZ  1 
ATOM   111  N  NH1 . ARG A 1 54  ? 43.795 36.133  47.521  1.00 119.60 ? 50  ARG A NH1 1 
ATOM   112  N  NH2 . ARG A 1 54  ? 42.545 36.159  49.447  1.00 118.53 ? 50  ARG A NH2 1 
ATOM   113  N  N   . PRO A 1 55  ? 44.858 30.951  42.861  1.00 39.48  ? 51  PRO A N   1 
ATOM   114  C  CA  . PRO A 1 55  ? 45.764 30.214  41.967  1.00 37.70  ? 51  PRO A CA  1 
ATOM   115  C  C   . PRO A 1 55  ? 46.894 29.546  42.731  1.00 37.35  ? 51  PRO A C   1 
ATOM   116  O  O   . PRO A 1 55  ? 47.508 30.171  43.598  1.00 36.49  ? 51  PRO A O   1 
ATOM   117  C  CB  . PRO A 1 55  ? 46.284 31.294  41.031  1.00 48.14  ? 51  PRO A CB  1 
ATOM   118  C  CG  . PRO A 1 55  ? 45.121 32.205  40.921  1.00 48.94  ? 51  PRO A CG  1 
ATOM   119  C  CD  . PRO A 1 55  ? 44.644 32.315  42.359  1.00 49.15  ? 51  PRO A CD  1 
ATOM   120  N  N   . GLN A 1 56  ? 47.160 28.278  42.421  1.00 42.00  ? 52  GLN A N   1 
ATOM   121  C  CA  . GLN A 1 56  ? 48.223 27.532  43.088  1.00 42.98  ? 52  GLN A CA  1 
ATOM   122  C  C   . GLN A 1 56  ? 49.181 26.979  42.080  1.00 42.18  ? 52  GLN A C   1 
ATOM   123  O  O   . GLN A 1 56  ? 48.785 26.622  40.970  1.00 41.39  ? 52  GLN A O   1 
ATOM   124  C  CB  . GLN A 1 56  ? 47.660 26.376  43.887  1.00 70.57  ? 52  GLN A CB  1 
ATOM   125  C  CG  . GLN A 1 56  ? 47.040 26.756  45.184  1.00 76.76  ? 52  GLN A CG  1 
ATOM   126  C  CD  . GLN A 1 56  ? 46.517 25.542  45.892  1.00 81.21  ? 52  GLN A CD  1 
ATOM   127  O  OE1 . GLN A 1 56  ? 47.254 24.576  46.117  1.00 83.38  ? 52  GLN A OE1 1 
ATOM   128  N  NE2 . GLN A 1 56  ? 45.235 25.569  46.243  1.00 80.98  ? 52  GLN A NE2 1 
ATOM   129  N  N   . GLU A 1 57  ? 50.447 26.901  42.463  1.00 46.78  ? 53  GLU A N   1 
ATOM   130  C  CA  . GLU A 1 57  ? 51.454 26.383  41.560  1.00 48.13  ? 53  GLU A CA  1 
ATOM   131  C  C   . GLU A 1 57  ? 51.492 24.876  41.783  1.00 47.34  ? 53  GLU A C   1 
ATOM   132  O  O   . GLU A 1 57  ? 51.740 24.410  42.894  1.00 46.31  ? 53  GLU A O   1 
ATOM   133  C  CB  . GLU A 1 57  ? 52.804 27.031  41.862  1.00 67.98  ? 53  GLU A CB  1 
ATOM   134  C  CG  . GLU A 1 57  ? 53.760 27.045  40.686  1.00 71.42  ? 53  GLU A CG  1 
ATOM   135  C  CD  . GLU A 1 57  ? 54.982 27.926  40.919  1.00 73.39  ? 53  GLU A CD  1 
ATOM   136  O  OE1 . GLU A 1 57  ? 55.723 27.682  41.892  1.00 75.58  ? 53  GLU A OE1 1 
ATOM   137  O  OE2 . GLU A 1 57  ? 55.206 28.863  40.123  1.00 74.70  ? 53  GLU A OE2 1 
ATOM   138  N  N   . VAL A 1 58  ? 51.219 24.114  40.730  1.00 51.69  ? 54  VAL A N   1 
ATOM   139  C  CA  . VAL A 1 58  ? 51.205 22.657  40.825  1.00 50.50  ? 54  VAL A CA  1 
ATOM   140  C  C   . VAL A 1 58  ? 52.274 22.032  39.923  1.00 50.31  ? 54  VAL A C   1 
ATOM   141  O  O   . VAL A 1 58  ? 52.384 22.374  38.747  1.00 50.57  ? 54  VAL A O   1 
ATOM   142  C  CB  . VAL A 1 58  ? 49.813 22.118  40.442  1.00 59.09  ? 54  VAL A CB  1 
ATOM   143  C  CG1 . VAL A 1 58  ? 49.755 20.628  40.669  1.00 57.51  ? 54  VAL A CG1 1 
ATOM   144  C  CG2 . VAL A 1 58  ? 48.737 22.831  41.259  1.00 57.80  ? 54  VAL A CG2 1 
ATOM   145  N  N   . SER A 1 59  ? 53.066 21.127  40.493  1.00 56.65  ? 55  SER A N   1 
ATOM   146  C  CA  . SER A 1 59  ? 54.151 20.455  39.776  1.00 58.18  ? 55  SER A CA  1 
ATOM   147  C  C   . SER A 1 59  ? 53.939 18.953  39.800  1.00 58.26  ? 55  SER A C   1 
ATOM   148  O  O   . SER A 1 59  ? 53.687 18.365  40.852  1.00 56.65  ? 55  SER A O   1 
ATOM   149  C  CB  . SER A 1 59  ? 55.505 20.756  40.432  1.00 57.89  ? 55  SER A CB  1 
ATOM   150  O  OG  . SER A 1 59  ? 55.878 22.113  40.305  1.00 59.97  ? 55  SER A OG  1 
ATOM   151  N  N   . TYR A 1 60  ? 54.072 18.321  38.647  1.00 57.17  ? 56  TYR A N   1 
ATOM   152  C  CA  . TYR A 1 60  ? 53.870 16.890  38.575  1.00 58.53  ? 56  TYR A CA  1 
ATOM   153  C  C   . TYR A 1 60  ? 54.838 16.254  37.598  1.00 59.58  ? 56  TYR A C   1 
ATOM   154  O  O   . TYR A 1 60  ? 55.405 16.928  36.739  1.00 59.77  ? 56  TYR A O   1 
ATOM   155  C  CB  . TYR A 1 60  ? 52.439 16.615  38.146  1.00 49.63  ? 56  TYR A CB  1 
ATOM   156  C  CG  . TYR A 1 60  ? 52.098 17.185  36.789  1.00 49.07  ? 56  TYR A CG  1 
ATOM   157  C  CD1 . TYR A 1 60  ? 52.572 16.581  35.630  1.00 48.95  ? 56  TYR A CD1 1 
ATOM   158  C  CD2 . TYR A 1 60  ? 51.267 18.298  36.661  1.00 48.92  ? 56  TYR A CD2 1 
ATOM   159  C  CE1 . TYR A 1 60  ? 52.227 17.055  34.371  1.00 47.09  ? 56  TYR A CE1 1 
ATOM   160  C  CE2 . TYR A 1 60  ? 50.910 18.788  35.397  1.00 47.87  ? 56  TYR A CE2 1 
ATOM   161  C  CZ  . TYR A 1 60  ? 51.397 18.152  34.256  1.00 48.63  ? 56  TYR A CZ  1 
ATOM   162  O  OH  . TYR A 1 60  ? 51.060 18.583  32.997  1.00 49.65  ? 56  TYR A OH  1 
ATOM   163  N  N   . THR A 1 61  ? 55.009 14.945  37.723  1.00 61.88  ? 57  THR A N   1 
ATOM   164  C  CA  . THR A 1 61  ? 55.917 14.216  36.856  1.00 63.30  ? 57  THR A CA  1 
ATOM   165  C  C   . THR A 1 61  ? 55.386 12.832  36.521  1.00 64.41  ? 57  THR A C   1 
ATOM   166  O  O   . THR A 1 61  ? 54.554 12.294  37.245  1.00 64.57  ? 57  THR A O   1 
ATOM   167  C  CB  . THR A 1 61  ? 57.278 14.056  37.528  1.00 71.70  ? 57  THR A CB  1 
ATOM   168  O  OG1 . THR A 1 61  ? 58.194 13.463  36.598  1.00 73.74  ? 57  THR A OG1 1 
ATOM   169  C  CG2 . THR A 1 61  ? 57.153 13.179  38.774  1.00 69.80  ? 57  THR A CG2 1 
ATOM   170  N  N   . ASP A 1 62  ? 55.883 12.268  35.421  1.00 59.36  ? 58  ASP A N   1 
ATOM   171  C  CA  . ASP A 1 62  ? 55.505 10.933  34.947  1.00 60.26  ? 58  ASP A CA  1 
ATOM   172  C  C   . ASP A 1 62  ? 54.228 10.883  34.127  1.00 59.78  ? 58  ASP A C   1 
ATOM   173  O  O   . ASP A 1 62  ? 53.498 9.901   34.179  1.00 59.47  ? 58  ASP A O   1 
ATOM   174  C  CB  . ASP A 1 62  ? 55.361 9.942   36.108  1.00 68.66  ? 58  ASP A CB  1 
ATOM   175  C  CG  . ASP A 1 62  ? 56.662 9.717   36.855  1.00 72.65  ? 58  ASP A CG  1 
ATOM   176  O  OD1 . ASP A 1 62  ? 57.743 9.816   36.237  1.00 73.99  ? 58  ASP A OD1 1 
ATOM   177  O  OD2 . ASP A 1 62  ? 56.603 9.417   38.066  1.00 74.01  ? 58  ASP A OD2 1 
ATOM   178  N  N   . THR A 1 63  ? 53.957 11.924  33.358  1.00 64.01  ? 59  THR A N   1 
ATOM   179  C  CA  . THR A 1 63  ? 52.748 11.939  32.553  1.00 64.98  ? 59  THR A CA  1 
ATOM   180  C  C   . THR A 1 63  ? 52.654 10.709  31.651  1.00 65.40  ? 59  THR A C   1 
ATOM   181  O  O   . THR A 1 63  ? 53.363 10.619  30.649  1.00 65.21  ? 59  THR A O   1 
ATOM   182  C  CB  . THR A 1 63  ? 52.694 13.199  31.659  1.00 98.22  ? 59  THR A CB  1 
ATOM   183  O  OG1 . THR A 1 63  ? 52.728 14.369  32.480  1.00 99.84  ? 59  THR A OG1 1 
ATOM   184  C  CG2 . THR A 1 63  ? 51.422 13.219  30.826  1.00 99.65  ? 59  THR A CG2 1 
ATOM   185  N  N   . LYS A 1 64  ? 51.796 9.757   32.000  1.00 69.42  ? 60  LYS A N   1 
ATOM   186  C  CA  . LYS A 1 64  ? 51.619 8.585   31.151  1.00 69.36  ? 60  LYS A CA  1 
ATOM   187  C  C   . LYS A 1 64  ? 50.133 8.393   30.899  1.00 68.70  ? 60  LYS A C   1 
ATOM   188  O  O   . LYS A 1 64  ? 49.305 8.704   31.750  1.00 69.50  ? 60  LYS A O   1 
ATOM   189  C  CB  . LYS A 1 64  ? 52.237 7.337   31.785  1.00 67.18  ? 60  LYS A CB  1 
ATOM   190  C  CG  . LYS A 1 64  ? 51.471 6.734   32.921  1.00 69.65  ? 60  LYS A CG  1 
ATOM   191  C  CD  . LYS A 1 64  ? 52.324 5.692   33.627  1.00 71.21  ? 60  LYS A CD  1 
ATOM   192  C  CE  . LYS A 1 64  ? 51.506 4.877   34.627  1.00 73.44  ? 60  LYS A CE  1 
ATOM   193  N  NZ  . LYS A 1 64  ? 52.346 3.928   35.431  1.00 75.17  ? 60  LYS A NZ  1 
ATOM   194  N  N   . VAL A 1 65  ? 49.797 7.905   29.713  1.00 46.80  ? 61  VAL A N   1 
ATOM   195  C  CA  . VAL A 1 65  ? 48.403 7.681   29.321  1.00 45.30  ? 61  VAL A CA  1 
ATOM   196  C  C   . VAL A 1 65  ? 47.714 6.486   29.995  1.00 44.38  ? 61  VAL A C   1 
ATOM   197  O  O   . VAL A 1 65  ? 48.275 5.387   30.051  1.00 43.28  ? 61  VAL A O   1 
ATOM   198  C  CB  . VAL A 1 65  ? 48.299 7.487   27.793  1.00 39.98  ? 61  VAL A CB  1 
ATOM   199  C  CG1 . VAL A 1 65  ? 47.181 6.505   27.470  1.00 39.07  ? 61  VAL A CG1 1 
ATOM   200  C  CG2 . VAL A 1 65  ? 48.021 8.814   27.124  1.00 39.86  ? 61  VAL A CG2 1 
ATOM   201  N  N   . ILE A 1 66  ? 46.499 6.694   30.501  1.00 49.57  ? 62  ILE A N   1 
ATOM   202  C  CA  . ILE A 1 66  ? 45.799 5.582   31.121  1.00 49.53  ? 62  ILE A CA  1 
ATOM   203  C  C   . ILE A 1 66  ? 44.583 5.131   30.351  1.00 51.19  ? 62  ILE A C   1 
ATOM   204  O  O   . ILE A 1 66  ? 43.993 4.125   30.702  1.00 50.94  ? 62  ILE A O   1 
ATOM   205  C  CB  . ILE A 1 66  ? 45.387 5.839   32.619  1.00 63.04  ? 62  ILE A CB  1 
ATOM   206  C  CG1 . ILE A 1 66  ? 44.598 7.125   32.782  1.00 62.51  ? 62  ILE A CG1 1 
ATOM   207  C  CG2 . ILE A 1 66  ? 46.628 5.903   33.507  1.00 61.97  ? 62  ILE A CG2 1 
ATOM   208  C  CD1 . ILE A 1 66  ? 44.431 7.506   34.249  1.00 61.02  ? 62  ILE A CD1 1 
ATOM   209  N  N   . GLY A 1 67  ? 44.209 5.851   29.298  1.00 46.58  ? 63  GLY A N   1 
ATOM   210  C  CA  . GLY A 1 67  ? 43.052 5.444   28.517  1.00 50.03  ? 63  GLY A CA  1 
ATOM   211  C  C   . GLY A 1 67  ? 42.115 6.558   28.094  1.00 53.36  ? 63  GLY A C   1 
ATOM   212  O  O   . GLY A 1 67  ? 42.361 7.725   28.385  1.00 52.99  ? 63  GLY A O   1 
ATOM   213  N  N   . ASN A 1 68  ? 41.027 6.203   27.416  1.00 68.29  ? 64  ASN A N   1 
ATOM   214  C  CA  . ASN A 1 68  ? 40.052 7.193   26.949  1.00 71.55  ? 64  ASN A CA  1 
ATOM   215  C  C   . ASN A 1 68  ? 38.881 7.479   27.886  1.00 72.99  ? 64  ASN A C   1 
ATOM   216  O  O   . ASN A 1 68  ? 38.212 6.566   28.361  1.00 73.61  ? 64  ASN A O   1 
ATOM   217  C  CB  . ASN A 1 68  ? 39.489 6.772   25.588  1.00 58.80  ? 64  ASN A CB  1 
ATOM   218  C  CG  . ASN A 1 68  ? 40.378 7.181   24.442  1.00 61.29  ? 64  ASN A CG  1 
ATOM   219  O  OD1 . ASN A 1 68  ? 40.290 8.300   23.954  1.00 61.66  ? 64  ASN A OD1 1 
ATOM   220  N  ND2 . ASN A 1 68  ? 41.251 6.281   24.015  1.00 62.27  ? 64  ASN A ND2 1 
ATOM   221  N  N   . GLY A 1 69  ? 38.657 8.764   28.146  1.00 57.86  ? 65  GLY A N   1 
ATOM   222  C  CA  . GLY A 1 69  ? 37.544 9.209   28.970  1.00 59.13  ? 65  GLY A CA  1 
ATOM   223  C  C   . GLY A 1 69  ? 36.620 9.855   27.958  1.00 60.16  ? 65  GLY A C   1 
ATOM   224  O  O   . GLY A 1 69  ? 37.085 10.234  26.885  1.00 60.03  ? 65  GLY A O   1 
ATOM   225  N  N   . SER A 1 70  ? 35.334 10.009  28.247  1.00 58.36  ? 66  SER A N   1 
ATOM   226  C  CA  . SER A 1 70  ? 34.462 10.595  27.225  1.00 59.08  ? 66  SER A CA  1 
ATOM   227  C  C   . SER A 1 70  ? 34.893 12.002  26.813  1.00 59.47  ? 66  SER A C   1 
ATOM   228  O  O   . SER A 1 70  ? 35.055 12.890  27.656  1.00 58.83  ? 66  SER A O   1 
ATOM   229  C  CB  . SER A 1 70  ? 32.994 10.572  27.684  1.00 57.33  ? 66  SER A CB  1 
ATOM   230  O  OG  . SER A 1 70  ? 32.515 11.853  28.033  1.00 57.00  ? 66  SER A OG  1 
ATOM   231  N  N   . PHE A 1 71  ? 35.099 12.181  25.509  1.00 80.59  ? 67  PHE A N   1 
ATOM   232  C  CA  . PHE A 1 71  ? 35.525 13.454  24.916  1.00 80.43  ? 67  PHE A CA  1 
ATOM   233  C  C   . PHE A 1 71  ? 36.975 13.818  25.185  1.00 78.74  ? 67  PHE A C   1 
ATOM   234  O  O   . PHE A 1 71  ? 37.351 14.976  25.014  1.00 78.36  ? 67  PHE A O   1 
ATOM   235  C  CB  . PHE A 1 71  ? 34.650 14.624  25.386  1.00 60.87  ? 67  PHE A CB  1 
ATOM   236  C  CG  . PHE A 1 71  ? 33.236 14.549  24.915  1.00 64.42  ? 67  PHE A CG  1 
ATOM   237  C  CD1 . PHE A 1 71  ? 32.213 14.205  25.794  1.00 65.61  ? 67  PHE A CD1 1 
ATOM   238  C  CD2 . PHE A 1 71  ? 32.927 14.771  23.578  1.00 65.51  ? 67  PHE A CD2 1 
ATOM   239  C  CE1 . PHE A 1 71  ? 30.898 14.073  25.348  1.00 66.61  ? 67  PHE A CE1 1 
ATOM   240  C  CE2 . PHE A 1 71  ? 31.616 14.643  23.118  1.00 66.17  ? 67  PHE A CE2 1 
ATOM   241  C  CZ  . PHE A 1 71  ? 30.598 14.290  24.009  1.00 66.46  ? 67  PHE A CZ  1 
ATOM   242  N  N   . GLY A 1 72  ? 37.790 12.855  25.606  1.00 58.55  ? 68  GLY A N   1 
ATOM   243  C  CA  . GLY A 1 72  ? 39.179 13.176  25.865  1.00 54.59  ? 68  GLY A CA  1 
ATOM   244  C  C   . GLY A 1 72  ? 40.058 12.021  26.284  1.00 52.02  ? 68  GLY A C   1 
ATOM   245  O  O   . GLY A 1 72  ? 39.665 10.867  26.224  1.00 53.08  ? 68  GLY A O   1 
ATOM   246  N  N   . VAL A 1 73  ? 41.273 12.339  26.697  1.00 64.93  ? 69  VAL A N   1 
ATOM   247  C  CA  . VAL A 1 73  ? 42.204 11.323  27.141  1.00 60.11  ? 69  VAL A CA  1 
ATOM   248  C  C   . VAL A 1 73  ? 42.520 11.597  28.593  1.00 56.90  ? 69  VAL A C   1 
ATOM   249  O  O   . VAL A 1 73  ? 42.568 12.744  29.018  1.00 56.15  ? 69  VAL A O   1 
ATOM   250  C  CB  . VAL A 1 73  ? 43.504 11.366  26.341  1.00 56.08  ? 69  VAL A CB  1 
ATOM   251  C  CG1 . VAL A 1 73  ? 44.473 10.315  26.871  1.00 55.68  ? 69  VAL A CG1 1 
ATOM   252  C  CG2 . VAL A 1 73  ? 43.200 11.134  24.875  1.00 55.89  ? 69  VAL A CG2 1 
ATOM   253  N  N   . VAL A 1 74  ? 42.733 10.540  29.354  1.00 42.26  ? 70  VAL A N   1 
ATOM   254  C  CA  . VAL A 1 74  ? 43.029 10.695  30.753  1.00 39.43  ? 70  VAL A CA  1 
ATOM   255  C  C   . VAL A 1 74  ? 44.426 10.175  31.029  1.00 39.03  ? 70  VAL A C   1 
ATOM   256  O  O   . VAL A 1 74  ? 44.756 9.035   30.685  1.00 37.92  ? 70  VAL A O   1 
ATOM   257  C  CB  . VAL A 1 74  ? 42.008 9.928   31.611  1.00 25.65  ? 70  VAL A CB  1 
ATOM   258  C  CG1 . VAL A 1 74  ? 42.280 10.167  33.101  1.00 24.18  ? 70  VAL A CG1 1 
ATOM   259  C  CG2 . VAL A 1 74  ? 40.596 10.362  31.231  1.00 25.64  ? 70  VAL A CG2 1 
ATOM   260  N  N   . TYR A 1 75  ? 45.251 11.014  31.646  1.00 44.74  ? 71  TYR A N   1 
ATOM   261  C  CA  . TYR A 1 75  ? 46.614 10.629  31.958  1.00 43.81  ? 71  TYR A CA  1 
ATOM   262  C  C   . TYR A 1 75  ? 46.751 10.395  33.432  1.00 44.12  ? 71  TYR A C   1 
ATOM   263  O  O   . TYR A 1 75  ? 45.868 10.744  34.216  1.00 42.43  ? 71  TYR A O   1 
ATOM   264  C  CB  . TYR A 1 75  ? 47.594 11.739  31.592  1.00 53.46  ? 71  TYR A CB  1 
ATOM   265  C  CG  . TYR A 1 75  ? 47.532 12.192  30.166  1.00 54.99  ? 71  TYR A CG  1 
ATOM   266  C  CD1 . TYR A 1 75  ? 46.458 12.947  29.702  1.00 54.81  ? 71  TYR A CD1 1 
ATOM   267  C  CD2 . TYR A 1 75  ? 48.533 11.833  29.265  1.00 55.95  ? 71  TYR A CD2 1 
ATOM   268  C  CE1 . TYR A 1 75  ? 46.376 13.332  28.364  1.00 56.78  ? 71  TYR A CE1 1 
ATOM   269  C  CE2 . TYR A 1 75  ? 48.467 12.207  27.929  1.00 54.95  ? 71  TYR A CE2 1 
ATOM   270  C  CZ  . TYR A 1 75  ? 47.388 12.954  27.480  1.00 57.66  ? 71  TYR A CZ  1 
ATOM   271  O  OH  . TYR A 1 75  ? 47.312 13.301  26.148  1.00 60.60  ? 71  TYR A OH  1 
ATOM   272  N  N   . GLN A 1 76  ? 47.866 9.784   33.799  1.00 45.53  ? 72  GLN A N   1 
ATOM   273  C  CA  . GLN A 1 76  ? 48.184 9.571   35.194  1.00 46.79  ? 72  GLN A CA  1 
ATOM   274  C  C   . GLN A 1 76  ? 49.417 10.442  35.404  1.00 47.21  ? 72  GLN A C   1 
ATOM   275  O  O   . GLN A 1 76  ? 50.189 10.671  34.471  1.00 46.82  ? 72  GLN A O   1 
ATOM   276  C  CB  . GLN A 1 76  ? 48.550 8.124   35.487  1.00 65.61  ? 72  GLN A CB  1 
ATOM   277  C  CG  . GLN A 1 76  ? 49.214 8.005   36.843  1.00 66.43  ? 72  GLN A CG  1 
ATOM   278  C  CD  . GLN A 1 76  ? 49.745 6.623   37.155  1.00 69.18  ? 72  GLN A CD  1 
ATOM   279  O  OE1 . GLN A 1 76  ? 48.982 5.713   37.477  1.00 70.19  ? 72  GLN A OE1 1 
ATOM   280  N  NE2 . GLN A 1 76  ? 51.063 6.460   37.068  1.00 65.48  ? 72  GLN A NE2 1 
ATOM   281  N  N   . ALA A 1 77  ? 49.596 10.938  36.621  1.00 48.06  ? 73  ALA A N   1 
ATOM   282  C  CA  . ALA A 1 77  ? 50.749 11.763  36.940  1.00 48.96  ? 73  ALA A CA  1 
ATOM   283  C  C   . ALA A 1 77  ? 50.967 11.740  38.436  1.00 49.44  ? 73  ALA A C   1 
ATOM   284  O  O   . ALA A 1 77  ? 50.032 11.525  39.213  1.00 48.96  ? 73  ALA A O   1 
ATOM   285  C  CB  . ALA A 1 77  ? 50.541 13.189  36.461  1.00 45.50  ? 73  ALA A CB  1 
ATOM   286  N  N   . LYS A 1 78  ? 52.215 11.963  38.827  1.00 55.87  ? 74  LYS A N   1 
ATOM   287  C  CA  . LYS A 1 78  ? 52.615 11.971  40.222  1.00 56.88  ? 74  LYS A CA  1 
ATOM   288  C  C   . LYS A 1 78  ? 52.911 13.404  40.666  1.00 57.68  ? 74  LYS A C   1 
ATOM   289  O  O   . LYS A 1 78  ? 53.696 14.115  40.034  1.00 57.87  ? 74  LYS A O   1 
ATOM   290  C  CB  . LYS A 1 78  ? 53.851 11.086  40.371  1.00 65.03  ? 74  LYS A CB  1 
ATOM   291  C  CG  . LYS A 1 78  ? 54.514 11.080  41.723  1.00 67.43  ? 74  LYS A CG  1 
ATOM   292  C  CD  . LYS A 1 78  ? 55.662 10.081  41.720  1.00 70.27  ? 74  LYS A CD  1 
ATOM   293  C  CE  . LYS A 1 78  ? 56.497 10.172  42.983  1.00 73.23  ? 74  LYS A CE  1 
ATOM   294  N  NZ  . LYS A 1 78  ? 57.216 11.482  43.077  1.00 76.38  ? 74  LYS A NZ  1 
ATOM   295  N  N   . LEU A 1 79  ? 52.252 13.844  41.732  1.00 59.99  ? 75  LEU A N   1 
ATOM   296  C  CA  . LEU A 1 79  ? 52.488 15.187  42.242  1.00 61.44  ? 75  LEU A CA  1 
ATOM   297  C  C   . LEU A 1 79  ? 53.861 15.158  42.901  1.00 63.63  ? 75  LEU A C   1 
ATOM   298  O  O   . LEU A 1 79  ? 54.099 14.359  43.809  1.00 63.94  ? 75  LEU A O   1 
ATOM   299  C  CB  . LEU A 1 79  ? 51.412 15.575  43.264  1.00 49.13  ? 75  LEU A CB  1 
ATOM   300  C  CG  . LEU A 1 79  ? 50.001 15.781  42.700  1.00 47.63  ? 75  LEU A CG  1 
ATOM   301  C  CD1 . LEU A 1 79  ? 49.031 16.075  43.827  1.00 47.17  ? 75  LEU A CD1 1 
ATOM   302  C  CD2 . LEU A 1 79  ? 50.010 16.921  41.681  1.00 45.23  ? 75  LEU A CD2 1 
ATOM   303  N  N   . CYS A 1 80  ? 54.760 16.018  42.427  1.00 80.61  ? 76  CYS A N   1 
ATOM   304  C  CA  . CYS A 1 80  ? 56.126 16.102  42.938  1.00 83.29  ? 76  CYS A CA  1 
ATOM   305  C  C   . CYS A 1 80  ? 56.226 16.017  44.452  1.00 85.80  ? 76  CYS A C   1 
ATOM   306  O  O   . CYS A 1 80  ? 56.757 15.049  44.999  1.00 87.19  ? 76  CYS A O   1 
ATOM   307  C  CB  . CYS A 1 80  ? 56.763 17.400  42.479  1.00 79.73  ? 76  CYS A CB  1 
ATOM   308  S  SG  . CYS A 1 80  ? 56.751 17.576  40.713  1.00 81.46  ? 76  CYS A SG  1 
ATOM   309  N  N   . ASP A 1 81  ? 55.725 17.051  45.116  1.00 60.02  ? 77  ASP A N   1 
ATOM   310  C  CA  . ASP A 1 81  ? 55.734 17.140  46.572  1.00 62.33  ? 77  ASP A CA  1 
ATOM   311  C  C   . ASP A 1 81  ? 55.284 15.871  47.342  1.00 62.47  ? 77  ASP A C   1 
ATOM   312  O  O   . ASP A 1 81  ? 56.114 15.122  47.856  1.00 62.64  ? 77  ASP A O   1 
ATOM   313  C  CB  . ASP A 1 81  ? 54.879 18.343  46.994  1.00 108.23 ? 77  ASP A CB  1 
ATOM   314  C  CG  . ASP A 1 81  ? 53.598 18.467  46.177  1.00 110.59 ? 77  ASP A CG  1 
ATOM   315  O  OD1 . ASP A 1 81  ? 53.686 18.684  44.947  1.00 111.92 ? 77  ASP A OD1 1 
ATOM   316  O  OD2 . ASP A 1 81  ? 52.504 18.343  46.767  1.00 110.41 ? 77  ASP A OD2 1 
ATOM   317  N  N   . SER A 1 82  ? 53.974 15.642  47.420  1.00 70.47  ? 78  SER A N   1 
ATOM   318  C  CA  . SER A 1 82  ? 53.423 14.494  48.135  1.00 69.75  ? 78  SER A CA  1 
ATOM   319  C  C   . SER A 1 82  ? 53.704 13.166  47.457  1.00 69.10  ? 78  SER A C   1 
ATOM   320  O  O   . SER A 1 82  ? 53.510 12.107  48.061  1.00 68.58  ? 78  SER A O   1 
ATOM   321  C  CB  . SER A 1 82  ? 51.908 14.655  48.311  1.00 61.96  ? 78  SER A CB  1 
ATOM   322  O  OG  . SER A 1 82  ? 51.241 14.751  47.059  1.00 62.82  ? 78  SER A OG  1 
ATOM   323  N  N   . GLY A 1 83  ? 54.156 13.215  46.207  1.00 74.91  ? 79  GLY A N   1 
ATOM   324  C  CA  . GLY A 1 83  ? 54.438 11.987  45.483  1.00 73.04  ? 79  GLY A CA  1 
ATOM   325  C  C   . GLY A 1 83  ? 53.171 11.163  45.354  1.00 72.20  ? 79  GLY A C   1 
ATOM   326  O  O   . GLY A 1 83  ? 53.211 9.940   45.225  1.00 73.05  ? 79  GLY A O   1 
ATOM   327  N  N   . GLU A 1 84  ? 52.040 11.857  45.398  1.00 63.54  ? 80  GLU A N   1 
ATOM   328  C  CA  . GLU A 1 84  ? 50.722 11.251  45.294  1.00 61.93  ? 80  GLU A CA  1 
ATOM   329  C  C   . GLU A 1 84  ? 50.266 11.219  43.836  1.00 58.96  ? 80  GLU A C   1 
ATOM   330  O  O   . GLU A 1 84  ? 50.544 12.133  43.065  1.00 57.94  ? 80  GLU A O   1 
ATOM   331  C  CB  . GLU A 1 84  ? 49.741 12.052  46.160  1.00 65.05  ? 80  GLU A CB  1 
ATOM   332  C  CG  . GLU A 1 84  ? 48.269 11.932  45.798  1.00 67.48  ? 80  GLU A CG  1 
ATOM   333  C  CD  . GLU A 1 84  ? 47.379 12.764  46.720  1.00 69.81  ? 80  GLU A CD  1 
ATOM   334  O  OE1 . GLU A 1 84  ? 47.831 13.849  47.163  1.00 71.17  ? 80  GLU A OE1 1 
ATOM   335  O  OE2 . GLU A 1 84  ? 46.229 12.340  46.987  1.00 70.27  ? 80  GLU A OE2 1 
ATOM   336  N  N   . LEU A 1 85  ? 49.569 10.159  43.453  1.00 51.12  ? 81  LEU A N   1 
ATOM   337  C  CA  . LEU A 1 85  ? 49.101 10.043  42.081  1.00 48.73  ? 81  LEU A CA  1 
ATOM   338  C  C   . LEU A 1 85  ? 47.779 10.766  41.846  1.00 46.00  ? 81  LEU A C   1 
ATOM   339  O  O   . LEU A 1 85  ? 46.939 10.860  42.742  1.00 46.34  ? 81  LEU A O   1 
ATOM   340  C  CB  . LEU A 1 85  ? 48.951 8.566   41.711  1.00 51.71  ? 81  LEU A CB  1 
ATOM   341  C  CG  . LEU A 1 85  ? 50.269 7.791   41.630  1.00 52.96  ? 81  LEU A CG  1 
ATOM   342  C  CD1 . LEU A 1 85  ? 49.990 6.316   41.663  1.00 52.70  ? 81  LEU A CD1 1 
ATOM   343  C  CD2 . LEU A 1 85  ? 51.015 8.163   40.356  1.00 51.70  ? 81  LEU A CD2 1 
ATOM   344  N  N   . VAL A 1 86  ? 47.609 11.281  40.632  1.00 29.88  ? 82  VAL A N   1 
ATOM   345  C  CA  . VAL A 1 86  ? 46.381 11.957  40.247  1.00 28.55  ? 82  VAL A CA  1 
ATOM   346  C  C   . VAL A 1 86  ? 46.088 11.614  38.807  1.00 27.49  ? 82  VAL A C   1 
ATOM   347  O  O   . VAL A 1 86  ? 46.942 11.072  38.106  1.00 27.04  ? 82  VAL A O   1 
ATOM   348  C  CB  . VAL A 1 86  ? 46.502 13.492  40.336  1.00 42.43  ? 82  VAL A CB  1 
ATOM   349  C  CG1 . VAL A 1 86  ? 46.717 13.913  41.773  1.00 41.52  ? 82  VAL A CG1 1 
ATOM   350  C  CG2 . VAL A 1 86  ? 47.638 13.978  39.452  1.00 41.60  ? 82  VAL A CG2 1 
ATOM   351  N  N   . ALA A 1 87  ? 44.879 11.932  38.362  1.00 49.85  ? 83  ALA A N   1 
ATOM   352  C  CA  . ALA A 1 87  ? 44.506 11.695  36.978  1.00 49.22  ? 83  ALA A CA  1 
ATOM   353  C  C   . ALA A 1 87  ? 44.316 13.072  36.373  1.00 49.04  ? 83  ALA A C   1 
ATOM   354  O  O   . ALA A 1 87  ? 43.985 14.023  37.070  1.00 49.34  ? 83  ALA A O   1 
ATOM   355  C  CB  . ALA A 1 87  ? 43.212 10.897  36.889  1.00 29.66  ? 83  ALA A CB  1 
ATOM   356  N  N   . ILE A 1 88  ? 44.537 13.177  35.073  1.00 46.62  ? 84  ILE A N   1 
ATOM   357  C  CA  . ILE A 1 88  ? 44.391 14.436  34.374  1.00 47.41  ? 84  ILE A CA  1 
ATOM   358  C  C   . ILE A 1 88  ? 43.627 14.143  33.102  1.00 48.90  ? 84  ILE A C   1 
ATOM   359  O  O   . ILE A 1 88  ? 44.142 13.473  32.209  1.00 49.82  ? 84  ILE A O   1 
ATOM   360  C  CB  . ILE A 1 88  ? 45.767 15.033  33.995  1.00 39.22  ? 84  ILE A CB  1 
ATOM   361  C  CG1 . ILE A 1 88  ? 46.590 15.309  35.260  1.00 39.14  ? 84  ILE A CG1 1 
ATOM   362  C  CG2 . ILE A 1 88  ? 45.570 16.306  33.162  1.00 36.13  ? 84  ILE A CG2 1 
ATOM   363  C  CD1 . ILE A 1 88  ? 47.928 15.985  34.988  1.00 41.40  ? 84  ILE A CD1 1 
ATOM   364  N  N   . LYS A 1 89  ? 42.389 14.621  33.034  1.00 46.84  ? 85  LYS A N   1 
ATOM   365  C  CA  . LYS A 1 89  ? 41.553 14.424  31.862  1.00 47.96  ? 85  LYS A CA  1 
ATOM   366  C  C   . LYS A 1 89  ? 41.753 15.665  31.012  1.00 49.64  ? 85  LYS A C   1 
ATOM   367  O  O   . LYS A 1 89  ? 41.465 16.782  31.441  1.00 49.95  ? 85  LYS A O   1 
ATOM   368  C  CB  . LYS A 1 89  ? 40.088 14.287  32.264  1.00 38.33  ? 85  LYS A CB  1 
ATOM   369  C  CG  . LYS A 1 89  ? 39.159 14.088  31.083  1.00 38.40  ? 85  LYS A CG  1 
ATOM   370  C  CD  . LYS A 1 89  ? 37.694 14.094  31.501  1.00 40.76  ? 85  LYS A CD  1 
ATOM   371  C  CE  . LYS A 1 89  ? 36.791 13.893  30.296  1.00 40.16  ? 85  LYS A CE  1 
ATOM   372  N  NZ  . LYS A 1 89  ? 35.329 13.773  30.654  1.00 42.10  ? 85  LYS A NZ  1 
ATOM   373  N  N   . LYS A 1 90  ? 42.267 15.456  29.807  1.00 37.53  ? 86  LYS A N   1 
ATOM   374  C  CA  . LYS A 1 90  ? 42.554 16.537  28.872  1.00 40.61  ? 86  LYS A CA  1 
ATOM   375  C  C   . LYS A 1 90  ? 41.524 16.518  27.743  1.00 41.96  ? 86  LYS A C   1 
ATOM   376  O  O   . LYS A 1 90  ? 41.358 15.508  27.074  1.00 42.02  ? 86  LYS A O   1 
ATOM   377  C  CB  . LYS A 1 90  ? 43.956 16.322  28.322  1.00 67.84  ? 86  LYS A CB  1 
ATOM   378  C  CG  . LYS A 1 90  ? 44.571 17.517  27.672  1.00 68.54  ? 86  LYS A CG  1 
ATOM   379  C  CD  . LYS A 1 90  ? 46.027 17.229  27.352  1.00 70.08  ? 86  LYS A CD  1 
ATOM   380  C  CE  . LYS A 1 90  ? 46.714 18.437  26.739  1.00 69.99  ? 86  LYS A CE  1 
ATOM   381  N  NZ  . LYS A 1 90  ? 48.126 18.115  26.379  1.00 71.92  ? 86  LYS A NZ  1 
ATOM   382  N  N   . VAL A 1 91  ? 40.822 17.625  27.539  1.00 51.63  ? 87  VAL A N   1 
ATOM   383  C  CA  . VAL A 1 91  ? 39.811 17.694  26.481  1.00 55.09  ? 87  VAL A CA  1 
ATOM   384  C  C   . VAL A 1 91  ? 39.923 18.979  25.683  1.00 57.68  ? 87  VAL A C   1 
ATOM   385  O  O   . VAL A 1 91  ? 40.382 20.001  26.189  1.00 56.33  ? 87  VAL A O   1 
ATOM   386  C  CB  . VAL A 1 91  ? 38.380 17.654  27.045  1.00 59.57  ? 87  VAL A CB  1 
ATOM   387  C  CG1 . VAL A 1 91  ? 38.230 16.503  28.031  1.00 58.78  ? 87  VAL A CG1 1 
ATOM   388  C  CG2 . VAL A 1 91  ? 38.058 18.983  27.700  1.00 59.23  ? 87  VAL A CG2 1 
ATOM   389  N  N   . LEU A 1 92  ? 39.468 18.930  24.439  1.00 93.66  ? 88  LEU A N   1 
ATOM   390  C  CA  . LEU A 1 92  ? 39.515 20.093  23.564  1.00 97.18  ? 88  LEU A CA  1 
ATOM   391  C  C   . LEU A 1 92  ? 38.464 21.127  23.961  1.00 99.01  ? 88  LEU A C   1 
ATOM   392  O  O   . LEU A 1 92  ? 37.267 20.833  23.967  1.00 98.76  ? 88  LEU A O   1 
ATOM   393  C  CB  . LEU A 1 92  ? 39.263 19.660  22.131  1.00 67.55  ? 88  LEU A CB  1 
ATOM   394  C  CG  . LEU A 1 92  ? 39.820 20.607  21.085  1.00 68.61  ? 88  LEU A CG  1 
ATOM   395  C  CD1 . LEU A 1 92  ? 41.351 20.556  21.124  1.00 67.85  ? 88  LEU A CD1 1 
ATOM   396  C  CD2 . LEU A 1 92  ? 39.298 20.197  19.729  1.00 68.75  ? 88  LEU A CD2 1 
ATOM   397  N  N   . GLN A 1 93  ? 38.900 22.341  24.276  1.00 70.78  ? 89  GLN A N   1 
ATOM   398  C  CA  . GLN A 1 93  ? 37.954 23.378  24.673  1.00 73.60  ? 89  GLN A CA  1 
ATOM   399  C  C   . GLN A 1 93  ? 37.729 24.459  23.622  1.00 74.89  ? 89  GLN A C   1 
ATOM   400  O  O   . GLN A 1 93  ? 38.591 25.310  23.388  1.00 75.38  ? 89  GLN A O   1 
ATOM   401  C  CB  . GLN A 1 93  ? 38.393 24.035  25.983  1.00 112.01 ? 89  GLN A CB  1 
ATOM   402  C  CG  . GLN A 1 93  ? 37.330 24.948  26.575  1.00 111.99 ? 89  GLN A CG  1 
ATOM   403  C  CD  . GLN A 1 93  ? 35.952 24.309  26.552  1.00 112.63 ? 89  GLN A CD  1 
ATOM   404  O  OE1 . GLN A 1 93  ? 35.777 23.160  26.964  1.00 112.27 ? 89  GLN A OE1 1 
ATOM   405  N  NE2 . GLN A 1 93  ? 34.965 25.053  26.067  1.00 112.01 ? 89  GLN A NE2 1 
ATOM   406  N  N   . ASP A 1 94  ? 36.556 24.416  23.000  1.00 110.90 ? 90  ASP A N   1 
ATOM   407  C  CA  . ASP A 1 94  ? 36.187 25.391  21.980  1.00 113.21 ? 90  ASP A CA  1 
ATOM   408  C  C   . ASP A 1 94  ? 35.680 26.653  22.696  1.00 114.76 ? 90  ASP A C   1 
ATOM   409  O  O   . ASP A 1 94  ? 34.680 26.614  23.412  1.00 114.54 ? 90  ASP A O   1 
ATOM   410  C  CB  . ASP A 1 94  ? 35.117 24.784  21.025  1.00 146.78 ? 90  ASP A CB  1 
ATOM   411  C  CG  . ASP A 1 94  ? 35.707 23.613  20.081  1.00 146.78 ? 90  ASP A CG  1 
ATOM   412  O  OD1 . ASP A 1 94  ? 36.980 23.302  20.202  1.00 146.78 ? 90  ASP A OD1 1 
ATOM   413  O  OD2 . ASP A 1 94  ? 34.899 23.025  19.230  1.00 146.78 ? 90  ASP A OD2 1 
ATOM   414  N  N   . LYS A 1 95  ? 36.399 27.758  22.500  1.00 132.34 ? 91  LYS A N   1 
ATOM   415  C  CA  . LYS A 1 95  ? 36.096 29.042  23.134  1.00 133.57 ? 91  LYS A CA  1 
ATOM   416  C  C   . LYS A 1 95  ? 34.659 29.530  23.057  1.00 133.21 ? 91  LYS A C   1 
ATOM   417  O  O   . LYS A 1 95  ? 34.243 30.366  23.866  1.00 133.56 ? 91  LYS A O   1 
ATOM   418  C  CB  . LYS A 1 95  ? 36.995 30.141  22.571  1.00 93.33  ? 91  LYS A CB  1 
ATOM   419  C  CG  . LYS A 1 95  ? 38.489 29.907  22.742  1.00 95.12  ? 91  LYS A CG  1 
ATOM   420  C  CD  . LYS A 1 95  ? 38.929 29.918  24.202  1.00 96.14  ? 91  LYS A CD  1 
ATOM   421  C  CE  . LYS A 1 95  ? 38.681 28.578  24.884  1.00 96.49  ? 91  LYS A CE  1 
ATOM   422  N  NZ  . LYS A 1 95  ? 39.190 28.557  26.286  1.00 96.08  ? 91  LYS A NZ  1 
ATOM   423  N  N   . ARG A 1 96  ? 33.904 29.030  22.083  1.00 89.52  ? 92  ARG A N   1 
ATOM   424  C  CA  . ARG A 1 96  ? 32.502 29.430  21.910  1.00 89.31  ? 92  ARG A CA  1 
ATOM   425  C  C   . ARG A 1 96  ? 31.636 29.228  23.161  1.00 88.77  ? 92  ARG A C   1 
ATOM   426  O  O   . ARG A 1 96  ? 30.790 30.068  23.480  1.00 89.15  ? 92  ARG A O   1 
ATOM   427  C  CB  . ARG A 1 96  ? 31.867 28.651  20.748  1.00 181.16 ? 92  ARG A CB  1 
ATOM   428  C  CG  . ARG A 1 96  ? 32.390 29.004  19.348  1.00 108.92 ? 92  ARG A CG  1 
ATOM   429  C  CD  . ARG A 1 96  ? 31.831 27.982  18.288  1.00 108.92 ? 92  ARG A CD  1 
ATOM   430  N  NE  . ARG A 1 96  ? 32.317 28.233  16.918  1.00 108.92 ? 92  ARG A NE  1 
ATOM   431  C  CZ  . ARG A 1 96  ? 32.065 27.402  15.880  1.00 108.92 ? 92  ARG A CZ  1 
ATOM   432  N  NH1 . ARG A 1 96  ? 31.334 26.276  16.097  1.00 108.92 ? 92  ARG A NH1 1 
ATOM   433  N  NH2 . ARG A 1 96  ? 32.526 27.690  14.622  1.00 108.92 ? 92  ARG A NH2 1 
ATOM   434  N  N   . PHE A 1 97  ? 31.835 28.107  23.853  1.00 132.85 ? 93  PHE A N   1 
ATOM   435  C  CA  . PHE A 1 97  ? 31.050 27.798  25.049  1.00 131.56 ? 93  PHE A CA  1 
ATOM   436  C  C   . PHE A 1 97  ? 31.918 27.458  26.256  1.00 128.77 ? 93  PHE A C   1 
ATOM   437  O  O   . PHE A 1 97  ? 33.104 27.156  26.122  1.00 128.73 ? 93  PHE A O   1 
ATOM   438  C  CB  . PHE A 1 97  ? 30.111 26.612  24.782  1.00 163.49 ? 93  PHE A CB  1 
ATOM   439  C  CG  . PHE A 1 97  ? 29.097 26.864  23.701  1.00 167.03 ? 93  PHE A CG  1 
ATOM   440  C  CD1 . PHE A 1 97  ? 29.498 27.054  22.381  1.00 168.25 ? 93  PHE A CD1 1 
ATOM   441  C  CD2 . PHE A 1 97  ? 27.740 26.926  24.004  1.00 168.60 ? 93  PHE A CD2 1 
ATOM   442  C  CE1 . PHE A 1 97  ? 28.564 27.305  21.378  1.00 169.44 ? 93  PHE A CE1 1 
ATOM   443  C  CE2 . PHE A 1 97  ? 26.797 27.176  23.009  1.00 169.73 ? 93  PHE A CE2 1 
ATOM   444  C  CZ  . PHE A 1 97  ? 27.211 27.367  21.692  1.00 169.90 ? 93  PHE A CZ  1 
ATOM   445  N  N   . LYS A 1 98  ? 31.310 27.511  27.438  1.00 86.96  ? 94  LYS A N   1 
ATOM   446  C  CA  . LYS A 1 98  ? 31.999 27.171  28.678  1.00 82.50  ? 94  LYS A CA  1 
ATOM   447  C  C   . LYS A 1 98  ? 31.777 25.666  28.880  1.00 77.54  ? 94  LYS A C   1 
ATOM   448  O  O   . LYS A 1 98  ? 30.737 25.133  28.502  1.00 75.53  ? 94  LYS A O   1 
ATOM   449  C  CB  . LYS A 1 98  ? 31.414 27.971  29.846  1.00 115.35 ? 94  LYS A CB  1 
ATOM   450  C  CG  . LYS A 1 98  ? 32.234 27.906  31.133  1.00 117.99 ? 94  LYS A CG  1 
ATOM   451  C  CD  . LYS A 1 98  ? 33.602 28.563  30.982  1.00 118.77 ? 94  LYS A CD  1 
ATOM   452  C  CE  . LYS A 1 98  ? 34.348 28.579  32.312  1.00 119.58 ? 94  LYS A CE  1 
ATOM   453  N  NZ  . LYS A 1 98  ? 35.693 29.209  32.199  1.00 119.18 ? 94  LYS A NZ  1 
ATOM   454  N  N   . ASN A 1 99  ? 32.751 24.993  29.479  1.00 52.38  ? 95  ASN A N   1 
ATOM   455  C  CA  . ASN A 1 99  ? 32.692 23.548  29.690  1.00 48.17  ? 95  ASN A CA  1 
ATOM   456  C  C   . ASN A 1 99  ? 31.670 23.062  30.736  1.00 45.66  ? 95  ASN A C   1 
ATOM   457  O  O   . ASN A 1 99  ? 31.838 23.282  31.939  1.00 44.18  ? 95  ASN A O   1 
ATOM   458  C  CB  . ASN A 1 99  ? 34.096 23.065  30.053  1.00 49.30  ? 95  ASN A CB  1 
ATOM   459  C  CG  . ASN A 1 99  ? 34.269 21.588  29.868  1.00 48.41  ? 95  ASN A CG  1 
ATOM   460  O  OD1 . ASN A 1 99  ? 33.752 20.792  30.647  1.00 45.64  ? 95  ASN A OD1 1 
ATOM   461  N  ND2 . ASN A 1 99  ? 34.996 21.207  28.824  1.00 47.18  ? 95  ASN A ND2 1 
ATOM   462  N  N   . ARG A 1 100 ? 30.630 22.372  30.274  1.00 46.40  ? 96  ARG A N   1 
ATOM   463  C  CA  . ARG A 1 100 ? 29.580 21.883  31.162  1.00 45.49  ? 96  ARG A CA  1 
ATOM   464  C  C   . ARG A 1 100 ? 30.005 20.822  32.182  1.00 42.74  ? 96  ARG A C   1 
ATOM   465  O  O   . ARG A 1 100 ? 29.386 20.681  33.237  1.00 41.59  ? 96  ARG A O   1 
ATOM   466  C  CB  . ARG A 1 100 ? 28.409 21.341  30.347  1.00 43.83  ? 96  ARG A CB  1 
ATOM   467  C  CG  . ARG A 1 100 ? 27.271 20.853  31.204  1.00 48.00  ? 96  ARG A CG  1 
ATOM   468  C  CD  . ARG A 1 100 ? 26.365 19.947  30.419  1.00 51.18  ? 96  ARG A CD  1 
ATOM   469  N  NE  . ARG A 1 100 ? 25.409 20.656  29.574  1.00 54.55  ? 96  ARG A NE  1 
ATOM   470  C  CZ  . ARG A 1 100 ? 24.764 20.080  28.561  1.00 55.64  ? 96  ARG A CZ  1 
ATOM   471  N  NH1 . ARG A 1 100 ? 25.001 18.798  28.282  1.00 55.16  ? 96  ARG A NH1 1 
ATOM   472  N  NH2 . ARG A 1 100 ? 23.871 20.765  27.844  1.00 56.48  ? 96  ARG A NH2 1 
ATOM   473  N  N   . GLU A 1 101 ? 31.044 20.063  31.877  1.00 47.40  ? 97  GLU A N   1 
ATOM   474  C  CA  . GLU A 1 101 ? 31.478 19.036  32.809  1.00 45.42  ? 97  GLU A CA  1 
ATOM   475  C  C   . GLU A 1 101 ? 32.170 19.782  33.940  1.00 44.66  ? 97  GLU A C   1 
ATOM   476  O  O   . GLU A 1 101 ? 31.975 19.487  35.117  1.00 42.36  ? 97  GLU A O   1 
ATOM   477  C  CB  . GLU A 1 101 ? 32.457 18.082  32.127  1.00 51.53  ? 97  GLU A CB  1 
ATOM   478  C  CG  . GLU A 1 101 ? 32.514 16.711  32.732  1.00 52.76  ? 97  GLU A CG  1 
ATOM   479  C  CD  . GLU A 1 101 ? 33.873 16.055  32.545  1.00 56.30  ? 97  GLU A CD  1 
ATOM   480  O  OE1 . GLU A 1 101 ? 34.632 16.517  31.667  1.00 56.59  ? 97  GLU A OE1 1 
ATOM   481  O  OE2 . GLU A 1 101 ? 34.188 15.075  33.273  1.00 56.72  ? 97  GLU A OE2 1 
ATOM   482  N  N   . LEU A 1 102 ? 32.965 20.774  33.564  1.00 34.87  ? 98  LEU A N   1 
ATOM   483  C  CA  . LEU A 1 102 ? 33.699 21.570  34.526  1.00 36.00  ? 98  LEU A CA  1 
ATOM   484  C  C   . LEU A 1 102 ? 32.768 22.271  35.506  1.00 36.41  ? 98  LEU A C   1 
ATOM   485  O  O   . LEU A 1 102 ? 32.962 22.197  36.710  1.00 35.57  ? 98  LEU A O   1 
ATOM   486  C  CB  . LEU A 1 102 ? 34.539 22.605  33.796  1.00 33.61  ? 98  LEU A CB  1 
ATOM   487  C  CG  . LEU A 1 102 ? 35.263 23.606  34.678  1.00 32.79  ? 98  LEU A CG  1 
ATOM   488  C  CD1 . LEU A 1 102 ? 36.137 22.887  35.682  1.00 31.97  ? 98  LEU A CD1 1 
ATOM   489  C  CD2 . LEU A 1 102 ? 36.071 24.510  33.796  1.00 33.40  ? 98  LEU A CD2 1 
ATOM   490  N  N   . GLN A 1 103 ? 31.745 22.939  34.996  1.00 44.49  ? 99  GLN A N   1 
ATOM   491  C  CA  . GLN A 1 103 ? 30.831 23.645  35.872  1.00 46.98  ? 99  GLN A CA  1 
ATOM   492  C  C   . GLN A 1 103 ? 30.143 22.693  36.824  1.00 47.02  ? 99  GLN A C   1 
ATOM   493  O  O   . GLN A 1 103 ? 29.912 23.032  37.981  1.00 46.40  ? 99  GLN A O   1 
ATOM   494  C  CB  . GLN A 1 103 ? 29.788 24.423  35.062  1.00 76.17  ? 99  GLN A CB  1 
ATOM   495  C  CG  . GLN A 1 103 ? 30.388 25.406  34.058  1.00 82.15  ? 99  GLN A CG  1 
ATOM   496  C  CD  . GLN A 1 103 ? 31.786 25.895  34.453  1.00 86.22  ? 99  GLN A CD  1 
ATOM   497  O  OE1 . GLN A 1 103 ? 31.998 26.391  35.567  1.00 86.75  ? 99  GLN A OE1 1 
ATOM   498  N  NE2 . GLN A 1 103 ? 32.745 25.757  33.533  1.00 89.18  ? 99  GLN A NE2 1 
ATOM   499  N  N   . ILE A 1 104 ? 29.819 21.497  36.348  1.00 48.09  ? 100 ILE A N   1 
ATOM   500  C  CA  . ILE A 1 104 ? 29.147 20.535  37.202  1.00 46.49  ? 100 ILE A CA  1 
ATOM   501  C  C   . ILE A 1 104 ? 30.078 20.013  38.277  1.00 46.64  ? 100 ILE A C   1 
ATOM   502  O  O   . ILE A 1 104 ? 29.702 19.917  39.447  1.00 47.91  ? 100 ILE A O   1 
ATOM   503  C  CB  . ILE A 1 104 ? 28.588 19.331  36.394  1.00 40.77  ? 100 ILE A CB  1 
ATOM   504  C  CG1 . ILE A 1 104 ? 27.321 19.766  35.653  1.00 40.42  ? 100 ILE A CG1 1 
ATOM   505  C  CG2 . ILE A 1 104 ? 28.303 18.128  37.334  1.00 37.95  ? 100 ILE A CG2 1 
ATOM   506  C  CD1 . ILE A 1 104 ? 26.571 18.632  34.991  1.00 42.60  ? 100 ILE A CD1 1 
ATOM   507  N  N   . MET A 1 105 ? 31.304 19.695  37.901  1.00 48.08  ? 101 MET A N   1 
ATOM   508  C  CA  . MET A 1 105 ? 32.211 19.156  38.891  1.00 51.20  ? 101 MET A CA  1 
ATOM   509  C  C   . MET A 1 105 ? 32.698 20.134  39.953  1.00 52.93  ? 101 MET A C   1 
ATOM   510  O  O   . MET A 1 105 ? 32.943 19.741  41.102  1.00 50.83  ? 101 MET A O   1 
ATOM   511  C  CB  . MET A 1 105 ? 33.378 18.465  38.197  1.00 51.58  ? 101 MET A CB  1 
ATOM   512  C  CG  . MET A 1 105 ? 32.947 17.150  37.591  1.00 54.72  ? 101 MET A CG  1 
ATOM   513  S  SD  . MET A 1 105 ? 34.352 16.148  37.270  1.00 60.38  ? 101 MET A SD  1 
ATOM   514  C  CE  . MET A 1 105 ? 34.674 15.504  38.937  1.00 56.88  ? 101 MET A CE  1 
ATOM   515  N  N   . ARG A 1 106 ? 32.822 21.403  39.586  1.00 56.30  ? 102 ARG A N   1 
ATOM   516  C  CA  . ARG A 1 106 ? 33.256 22.414  40.537  1.00 58.48  ? 102 ARG A CA  1 
ATOM   517  C  C   . ARG A 1 106 ? 32.291 22.504  41.712  1.00 58.13  ? 102 ARG A C   1 
ATOM   518  O  O   . ARG A 1 106 ? 32.691 22.836  42.824  1.00 58.79  ? 102 ARG A O   1 
ATOM   519  C  CB  . ARG A 1 106 ? 33.336 23.764  39.859  1.00 59.28  ? 102 ARG A CB  1 
ATOM   520  C  CG  . ARG A 1 106 ? 34.221 23.780  38.650  1.00 62.91  ? 102 ARG A CG  1 
ATOM   521  C  CD  . ARG A 1 106 ? 34.603 25.194  38.360  1.00 65.79  ? 102 ARG A CD  1 
ATOM   522  N  NE  . ARG A 1 106 ? 35.210 25.751  39.555  1.00 68.66  ? 102 ARG A NE  1 
ATOM   523  C  CZ  . ARG A 1 106 ? 35.491 27.031  39.712  1.00 69.38  ? 102 ARG A CZ  1 
ATOM   524  N  NH1 . ARG A 1 106 ? 35.217 27.886  38.729  1.00 69.39  ? 102 ARG A NH1 1 
ATOM   525  N  NH2 . ARG A 1 106 ? 36.031 27.444  40.857  1.00 70.09  ? 102 ARG A NH2 1 
ATOM   526  N  N   . LYS A 1 107 ? 31.020 22.199  41.475  1.00 44.99  ? 103 LYS A N   1 
ATOM   527  C  CA  . LYS A 1 107 ? 30.044 22.264  42.547  1.00 45.54  ? 103 LYS A CA  1 
ATOM   528  C  C   . LYS A 1 107 ? 29.826 20.948  43.287  1.00 43.40  ? 103 LYS A C   1 
ATOM   529  O  O   . LYS A 1 107 ? 28.929 20.850  44.126  1.00 43.86  ? 103 LYS A O   1 
ATOM   530  C  CB  . LYS A 1 107 ? 28.712 22.791  42.012  1.00 55.92  ? 103 LYS A CB  1 
ATOM   531  C  CG  . LYS A 1 107 ? 28.181 22.062  40.816  1.00 60.96  ? 103 LYS A CG  1 
ATOM   532  C  CD  . LYS A 1 107 ? 27.026 22.816  40.197  1.00 63.61  ? 103 LYS A CD  1 
ATOM   533  C  CE  . LYS A 1 107 ? 25.894 23.004  41.188  1.00 66.29  ? 103 LYS A CE  1 
ATOM   534  N  NZ  . LYS A 1 107 ? 24.718 23.713  40.578  1.00 67.68  ? 103 LYS A NZ  1 
ATOM   535  N  N   . LEU A 1 108 ? 30.656 19.946  43.004  1.00 45.80  ? 104 LEU A N   1 
ATOM   536  C  CA  . LEU A 1 108 ? 30.517 18.646  43.659  1.00 43.90  ? 104 LEU A CA  1 
ATOM   537  C  C   . LEU A 1 108 ? 31.634 18.296  44.632  1.00 42.81  ? 104 LEU A C   1 
ATOM   538  O  O   . LEU A 1 108 ? 32.811 18.527  44.362  1.00 41.89  ? 104 LEU A O   1 
ATOM   539  C  CB  . LEU A 1 108 ? 30.429 17.526  42.617  1.00 43.25  ? 104 LEU A CB  1 
ATOM   540  C  CG  . LEU A 1 108 ? 29.256 17.505  41.630  1.00 42.94  ? 104 LEU A CG  1 
ATOM   541  C  CD1 . LEU A 1 108 ? 29.372 16.275  40.739  1.00 42.37  ? 104 LEU A CD1 1 
ATOM   542  C  CD2 . LEU A 1 108 ? 27.941 17.506  42.373  1.00 42.01  ? 104 LEU A CD2 1 
ATOM   543  N  N   . ASP A 1 109 ? 31.251 17.717  45.764  1.00 45.39  ? 105 ASP A N   1 
ATOM   544  C  CA  . ASP A 1 109 ? 32.207 17.285  46.775  1.00 46.84  ? 105 ASP A CA  1 
ATOM   545  C  C   . ASP A 1 109 ? 31.544 16.193  47.628  1.00 45.87  ? 105 ASP A C   1 
ATOM   546  O  O   . ASP A 1 109 ? 30.811 16.494  48.569  1.00 45.55  ? 105 ASP A O   1 
ATOM   547  C  CB  . ASP A 1 109 ? 32.623 18.469  47.638  1.00 63.84  ? 105 ASP A CB  1 
ATOM   548  C  CG  . ASP A 1 109 ? 33.556 18.071  48.754  1.00 67.75  ? 105 ASP A CG  1 
ATOM   549  O  OD1 . ASP A 1 109 ? 33.122 18.118  49.923  1.00 70.19  ? 105 ASP A OD1 1 
ATOM   550  O  OD2 . ASP A 1 109 ? 34.719 17.708  48.460  1.00 69.42  ? 105 ASP A OD2 1 
ATOM   551  N  N   . HIS A 1 110 ? 31.792 14.926  47.278  1.00 34.83  ? 106 HIS A N   1 
ATOM   552  C  CA  . HIS A 1 110 ? 31.204 13.788  47.985  1.00 32.11  ? 106 HIS A CA  1 
ATOM   553  C  C   . HIS A 1 110 ? 32.232 12.662  48.074  1.00 30.25  ? 106 HIS A C   1 
ATOM   554  O  O   . HIS A 1 110 ? 33.013 12.460  47.141  1.00 29.91  ? 106 HIS A O   1 
ATOM   555  C  CB  . HIS A 1 110 ? 29.943 13.328  47.251  1.00 36.72  ? 106 HIS A CB  1 
ATOM   556  C  CG  . HIS A 1 110 ? 29.121 12.342  48.018  1.00 36.33  ? 106 HIS A CG  1 
ATOM   557  N  ND1 . HIS A 1 110 ? 29.451 11.004  48.112  1.00 36.68  ? 106 HIS A ND1 1 
ATOM   558  C  CD2 . HIS A 1 110 ? 27.985 12.501  48.740  1.00 32.99  ? 106 HIS A CD2 1 
ATOM   559  C  CE1 . HIS A 1 110 ? 28.552 10.384  48.860  1.00 36.51  ? 106 HIS A CE1 1 
ATOM   560  N  NE2 . HIS A 1 110 ? 27.653 11.269  49.253  1.00 39.83  ? 106 HIS A NE2 1 
ATOM   561  N  N   . CYS A 1 111 ? 32.242 11.936  49.192  1.00 38.47  ? 107 CYS A N   1 
ATOM   562  C  CA  . CYS A 1 111 ? 33.220 10.864  49.383  1.00 40.20  ? 107 CYS A CA  1 
ATOM   563  C  C   . CYS A 1 111 ? 33.222 9.770   48.318  1.00 38.58  ? 107 CYS A C   1 
ATOM   564  O  O   . CYS A 1 111 ? 34.230 9.088   48.146  1.00 38.87  ? 107 CYS A O   1 
ATOM   565  C  CB  . CYS A 1 111 ? 33.068 10.241  50.770  1.00 46.43  ? 107 CYS A CB  1 
ATOM   566  S  SG  . CYS A 1 111 ? 31.534 9.356   51.060  1.00 56.50  ? 107 CYS A SG  1 
ATOM   567  N  N   . ASN A 1 112 ? 32.113 9.611   47.595  1.00 27.98  ? 108 ASN A N   1 
ATOM   568  C  CA  . ASN A 1 112 ? 32.022 8.595   46.548  1.00 27.48  ? 108 ASN A CA  1 
ATOM   569  C  C   . ASN A 1 112 ? 32.011 9.154   45.125  1.00 28.23  ? 108 ASN A C   1 
ATOM   570  O  O   . ASN A 1 112 ? 31.468 8.550   44.213  1.00 27.90  ? 108 ASN A O   1 
ATOM   571  C  CB  . ASN A 1 112 ? 30.777 7.734   46.762  1.00 36.80  ? 108 ASN A CB  1 
ATOM   572  C  CG  . ASN A 1 112 ? 30.775 7.059   48.102  1.00 37.58  ? 108 ASN A CG  1 
ATOM   573  O  OD1 . ASN A 1 112 ? 31.534 6.132   48.345  1.00 37.96  ? 108 ASN A OD1 1 
ATOM   574  N  ND2 . ASN A 1 112 ? 29.923 7.534   48.994  1.00 38.24  ? 108 ASN A ND2 1 
ATOM   575  N  N   . ILE A 1 113 ? 32.587 10.323  44.926  1.00 40.22  ? 109 ILE A N   1 
ATOM   576  C  CA  . ILE A 1 113 ? 32.634 10.878  43.590  1.00 39.98  ? 109 ILE A CA  1 
ATOM   577  C  C   . ILE A 1 113 ? 34.066 11.333  43.394  1.00 42.54  ? 109 ILE A C   1 
ATOM   578  O  O   . ILE A 1 113 ? 34.746 11.692  44.355  1.00 42.19  ? 109 ILE A O   1 
ATOM   579  C  CB  . ILE A 1 113 ? 31.657 12.052  43.440  1.00 31.23  ? 109 ILE A CB  1 
ATOM   580  C  CG1 . ILE A 1 113 ? 30.230 11.565  43.686  1.00 30.13  ? 109 ILE A CG1 1 
ATOM   581  C  CG2 . ILE A 1 113 ? 31.784 12.676  42.045  1.00 30.97  ? 109 ILE A CG2 1 
ATOM   582  C  CD1 . ILE A 1 113 ? 29.166 12.580  43.342  1.00 32.64  ? 109 ILE A CD1 1 
ATOM   583  N  N   . VAL A 1 114 ? 34.546 11.290  42.165  1.00 35.61  ? 110 VAL A N   1 
ATOM   584  C  CA  . VAL A 1 114 ? 35.917 11.688  41.923  1.00 38.38  ? 110 VAL A CA  1 
ATOM   585  C  C   . VAL A 1 114 ? 35.987 13.182  42.166  1.00 38.74  ? 110 VAL A C   1 
ATOM   586  O  O   . VAL A 1 114 ? 35.147 13.933  41.685  1.00 36.31  ? 110 VAL A O   1 
ATOM   587  C  CB  . VAL A 1 114 ? 36.344 11.326  40.482  1.00 35.52  ? 110 VAL A CB  1 
ATOM   588  C  CG1 . VAL A 1 114 ? 37.794 11.685  40.254  1.00 36.25  ? 110 VAL A CG1 1 
ATOM   589  C  CG2 . VAL A 1 114 ? 36.180 9.838   40.266  1.00 37.99  ? 110 VAL A CG2 1 
ATOM   590  N  N   . ARG A 1 115 ? 36.978 13.615  42.928  1.00 34.24  ? 111 ARG A N   1 
ATOM   591  C  CA  . ARG A 1 115 ? 37.116 15.034  43.237  1.00 36.88  ? 111 ARG A CA  1 
ATOM   592  C  C   . ARG A 1 115 ? 37.976 15.826  42.245  1.00 34.44  ? 111 ARG A C   1 
ATOM   593  O  O   . ARG A 1 115 ? 39.080 15.405  41.857  1.00 34.10  ? 111 ARG A O   1 
ATOM   594  C  CB  . ARG A 1 115 ? 37.698 15.200  44.643  1.00 37.85  ? 111 ARG A CB  1 
ATOM   595  C  CG  . ARG A 1 115 ? 37.579 16.597  45.230  1.00 44.74  ? 111 ARG A CG  1 
ATOM   596  C  CD  . ARG A 1 115 ? 37.953 16.609  46.707  1.00 47.93  ? 111 ARG A CD  1 
ATOM   597  N  NE  . ARG A 1 115 ? 39.387 16.430  46.934  1.00 53.98  ? 111 ARG A NE  1 
ATOM   598  C  CZ  . ARG A 1 115 ? 40.296 17.373  46.701  1.00 57.35  ? 111 ARG A CZ  1 
ATOM   599  N  NH1 . ARG A 1 115 ? 39.917 18.561  46.233  1.00 59.54  ? 111 ARG A NH1 1 
ATOM   600  N  NH2 . ARG A 1 115 ? 41.584 17.131  46.933  1.00 56.69  ? 111 ARG A NH2 1 
ATOM   601  N  N   . LEU A 1 116 ? 37.454 16.975  41.825  1.00 35.69  ? 112 LEU A N   1 
ATOM   602  C  CA  . LEU A 1 116 ? 38.191 17.851  40.924  1.00 36.89  ? 112 LEU A CA  1 
ATOM   603  C  C   . LEU A 1 116 ? 39.167 18.622  41.814  1.00 38.15  ? 112 LEU A C   1 
ATOM   604  O  O   . LEU A 1 116 ? 38.761 19.463  42.598  1.00 38.71  ? 112 LEU A O   1 
ATOM   605  C  CB  . LEU A 1 116 ? 37.236 18.823  40.232  1.00 40.67  ? 112 LEU A CB  1 
ATOM   606  C  CG  . LEU A 1 116 ? 37.903 19.894  39.373  1.00 41.04  ? 112 LEU A CG  1 
ATOM   607  C  CD1 . LEU A 1 116 ? 38.645 19.241  38.213  1.00 39.34  ? 112 LEU A CD1 1 
ATOM   608  C  CD2 . LEU A 1 116 ? 36.851 20.853  38.852  1.00 38.33  ? 112 LEU A CD2 1 
ATOM   609  N  N   . ARG A 1 117 ? 40.451 18.319  41.705  1.00 35.36  ? 113 ARG A N   1 
ATOM   610  C  CA  . ARG A 1 117 ? 41.459 18.981  42.525  1.00 38.57  ? 113 ARG A CA  1 
ATOM   611  C  C   . ARG A 1 117 ? 41.858 20.373  42.025  1.00 38.94  ? 113 ARG A C   1 
ATOM   612  O  O   . ARG A 1 117 ? 41.931 21.328  42.793  1.00 38.61  ? 113 ARG A O   1 
ATOM   613  C  CB  . ARG A 1 117 ? 42.694 18.095  42.615  1.00 41.99  ? 113 ARG A CB  1 
ATOM   614  C  CG  . ARG A 1 117 ? 42.394 16.742  43.206  1.00 45.53  ? 113 ARG A CG  1 
ATOM   615  C  CD  . ARG A 1 117 ? 43.657 16.058  43.622  1.00 48.28  ? 113 ARG A CD  1 
ATOM   616  N  NE  . ARG A 1 117 ? 43.348 14.825  44.323  1.00 51.62  ? 113 ARG A NE  1 
ATOM   617  C  CZ  . ARG A 1 117 ? 44.195 14.190  45.125  1.00 53.26  ? 113 ARG A CZ  1 
ATOM   618  N  NH1 . ARG A 1 117 ? 45.412 14.684  45.331  1.00 51.61  ? 113 ARG A NH1 1 
ATOM   619  N  NH2 . ARG A 1 117 ? 43.822 13.056  45.711  1.00 52.88  ? 113 ARG A NH2 1 
ATOM   620  N  N   . TYR A 1 118 ? 42.133 20.465  40.734  1.00 48.95  ? 114 TYR A N   1 
ATOM   621  C  CA  . TYR A 1 118 ? 42.514 21.711  40.110  1.00 50.10  ? 114 TYR A CA  1 
ATOM   622  C  C   . TYR A 1 118 ? 42.138 21.574  38.657  1.00 49.64  ? 114 TYR A C   1 
ATOM   623  O  O   . TYR A 1 118 ? 41.921 20.470  38.168  1.00 49.95  ? 114 TYR A O   1 
ATOM   624  C  CB  . TYR A 1 118 ? 44.020 21.924  40.167  1.00 61.90  ? 114 TYR A CB  1 
ATOM   625  C  CG  . TYR A 1 118 ? 44.651 21.773  41.521  1.00 63.37  ? 114 TYR A CG  1 
ATOM   626  C  CD1 . TYR A 1 118 ? 45.294 20.589  41.885  1.00 64.68  ? 114 TYR A CD1 1 
ATOM   627  C  CD2 . TYR A 1 118 ? 44.675 22.835  42.417  1.00 64.83  ? 114 TYR A CD2 1 
ATOM   628  C  CE1 . TYR A 1 118 ? 45.957 20.473  43.107  1.00 65.66  ? 114 TYR A CE1 1 
ATOM   629  C  CE2 . TYR A 1 118 ? 45.329 22.732  43.639  1.00 67.32  ? 114 TYR A CE2 1 
ATOM   630  C  CZ  . TYR A 1 118 ? 45.970 21.554  43.976  1.00 68.56  ? 114 TYR A CZ  1 
ATOM   631  O  OH  . TYR A 1 118 ? 46.645 21.480  45.174  1.00 71.88  ? 114 TYR A OH  1 
ATOM   632  N  N   . PHE A 1 119 ? 42.054 22.698  37.968  1.00 42.49  ? 115 PHE A N   1 
ATOM   633  C  CA  . PHE A 1 119 ? 41.776 22.678  36.551  1.00 43.66  ? 115 PHE A CA  1 
ATOM   634  C  C   . PHE A 1 119 ? 42.537 23.855  35.984  1.00 46.02  ? 115 PHE A C   1 
ATOM   635  O  O   . PHE A 1 119 ? 42.609 24.916  36.595  1.00 46.36  ? 115 PHE A O   1 
ATOM   636  C  CB  . PHE A 1 119 ? 40.281 22.771  36.273  1.00 49.10  ? 115 PHE A CB  1 
ATOM   637  C  CG  . PHE A 1 119 ? 39.704 24.107  36.512  1.00 49.79  ? 115 PHE A CG  1 
ATOM   638  C  CD1 . PHE A 1 119 ? 39.786 25.091  35.545  1.00 50.36  ? 115 PHE A CD1 1 
ATOM   639  C  CD2 . PHE A 1 119 ? 39.046 24.386  37.705  1.00 49.96  ? 115 PHE A CD2 1 
ATOM   640  C  CE1 . PHE A 1 119 ? 39.215 26.344  35.759  1.00 51.58  ? 115 PHE A CE1 1 
ATOM   641  C  CE2 . PHE A 1 119 ? 38.469 25.634  37.933  1.00 49.77  ? 115 PHE A CE2 1 
ATOM   642  C  CZ  . PHE A 1 119 ? 38.554 26.613  36.956  1.00 50.45  ? 115 PHE A CZ  1 
ATOM   643  N  N   . PHE A 1 120 ? 43.141 23.656  34.827  1.00 56.98  ? 116 PHE A N   1 
ATOM   644  C  CA  . PHE A 1 120 ? 43.927 24.704  34.217  1.00 57.77  ? 116 PHE A CA  1 
ATOM   645  C  C   . PHE A 1 120 ? 43.889 24.522  32.713  1.00 59.83  ? 116 PHE A C   1 
ATOM   646  O  O   . PHE A 1 120 ? 43.546 23.440  32.238  1.00 59.67  ? 116 PHE A O   1 
ATOM   647  C  CB  . PHE A 1 120 ? 45.366 24.618  34.741  1.00 44.33  ? 116 PHE A CB  1 
ATOM   648  C  CG  . PHE A 1 120 ? 46.111 23.373  34.313  1.00 43.08  ? 116 PHE A CG  1 
ATOM   649  C  CD1 . PHE A 1 120 ? 46.639 23.262  33.029  1.00 43.79  ? 116 PHE A CD1 1 
ATOM   650  C  CD2 . PHE A 1 120 ? 46.289 22.314  35.198  1.00 42.21  ? 116 PHE A CD2 1 
ATOM   651  C  CE1 . PHE A 1 120 ? 47.329 22.120  32.643  1.00 44.42  ? 116 PHE A CE1 1 
ATOM   652  C  CE2 . PHE A 1 120 ? 46.976 21.167  34.817  1.00 43.02  ? 116 PHE A CE2 1 
ATOM   653  C  CZ  . PHE A 1 120 ? 47.496 21.068  33.542  1.00 43.88  ? 116 PHE A CZ  1 
ATOM   654  N  N   . TYR A 1 121 ? 44.227 25.568  31.961  1.00 55.77  ? 117 TYR A N   1 
ATOM   655  C  CA  . TYR A 1 121 ? 44.225 25.440  30.511  1.00 57.63  ? 117 TYR A CA  1 
ATOM   656  C  C   . TYR A 1 121 ? 45.640 25.259  29.956  1.00 59.75  ? 117 TYR A C   1 
ATOM   657  O  O   . TYR A 1 121 ? 46.618 25.650  30.592  1.00 58.84  ? 117 TYR A O   1 
ATOM   658  C  CB  . TYR A 1 121 ? 43.532 26.637  29.880  1.00 48.90  ? 117 TYR A CB  1 
ATOM   659  C  CG  . TYR A 1 121 ? 42.067 26.699  30.229  1.00 48.50  ? 117 TYR A CG  1 
ATOM   660  C  CD1 . TYR A 1 121 ? 41.624 27.309  31.406  1.00 47.55  ? 117 TYR A CD1 1 
ATOM   661  C  CD2 . TYR A 1 121 ? 41.121 26.097  29.409  1.00 47.82  ? 117 TYR A CD2 1 
ATOM   662  C  CE1 . TYR A 1 121 ? 40.274 27.313  31.754  1.00 46.01  ? 117 TYR A CE1 1 
ATOM   663  C  CE2 . TYR A 1 121 ? 39.769 26.089  29.746  1.00 46.92  ? 117 TYR A CE2 1 
ATOM   664  C  CZ  . TYR A 1 121 ? 39.353 26.694  30.915  1.00 46.33  ? 117 TYR A CZ  1 
ATOM   665  O  OH  . TYR A 1 121 ? 38.010 26.648  31.234  1.00 45.60  ? 117 TYR A OH  1 
ATOM   666  N  N   . SER A 1 122 ? 45.755 24.636  28.787  1.00 66.83  ? 118 SER A N   1 
ATOM   667  C  CA  . SER A 1 122 ? 47.069 24.417  28.202  1.00 69.29  ? 118 SER A CA  1 
ATOM   668  C  C   . SER A 1 122 ? 47.060 24.452  26.678  1.00 71.34  ? 118 SER A C   1 
ATOM   669  O  O   . SER A 1 122 ? 46.001 24.559  26.046  1.00 70.90  ? 118 SER A O   1 
ATOM   670  C  CB  . SER A 1 122 ? 47.649 23.083  28.678  1.00 67.28  ? 118 SER A CB  1 
ATOM   671  O  OG  . SER A 1 122 ? 47.111 21.998  27.945  1.00 67.74  ? 118 SER A OG  1 
ATOM   672  N  N   . SER A 1 123 ? 48.259 24.336  26.109  1.00 117.12 ? 119 SER A N   1 
ATOM   673  C  CA  . SER A 1 123 ? 48.492 24.390  24.667  1.00 119.51 ? 119 SER A CA  1 
ATOM   674  C  C   . SER A 1 123 ? 48.295 23.103  23.877  1.00 120.33 ? 119 SER A C   1 
ATOM   675  O  O   . SER A 1 123 ? 48.249 22.005  24.435  1.00 122.05 ? 119 SER A O   1 
ATOM   676  C  CB  . SER A 1 123 ? 49.910 24.891  24.409  1.00 95.59  ? 119 SER A CB  1 
ATOM   677  O  OG  . SER A 1 123 ? 50.860 23.980  24.937  1.00 97.23  ? 119 SER A OG  1 
ATOM   678  N  N   . GLY A 1 124 ? 48.207 23.268  22.558  1.00 133.58 ? 120 GLY A N   1 
ATOM   679  C  CA  . GLY A 1 124 ? 48.030 22.151  21.647  1.00 138.22 ? 120 GLY A CA  1 
ATOM   680  C  C   . GLY A 1 124 ? 48.285 22.576  20.209  1.00 141.04 ? 120 GLY A C   1 
ATOM   681  O  O   . GLY A 1 124 ? 48.493 21.748  19.319  1.00 141.07 ? 120 GLY A O   1 
ATOM   682  N  N   . ASP A 1 128 ? 47.134 24.071  17.225  1.00 149.32 ? 124 ASP A N   1 
ATOM   683  C  CA  . ASP A 1 128 ? 46.686 25.409  17.597  1.00 147.69 ? 124 ASP A CA  1 
ATOM   684  C  C   . ASP A 1 128 ? 45.285 25.429  18.220  1.00 146.22 ? 124 ASP A C   1 
ATOM   685  O  O   . ASP A 1 128 ? 44.352 26.005  17.655  1.00 146.17 ? 124 ASP A O   1 
ATOM   686  C  CB  . ASP A 1 128 ? 46.698 26.323  16.373  1.00 130.56 ? 124 ASP A CB  1 
ATOM   687  C  CG  . ASP A 1 128 ? 46.156 27.705  16.679  1.00 130.87 ? 124 ASP A CG  1 
ATOM   688  O  OD1 . ASP A 1 128 ? 46.786 28.422  17.482  1.00 131.13 ? 124 ASP A OD1 1 
ATOM   689  O  OD2 . ASP A 1 128 ? 45.095 28.069  16.124  1.00 130.71 ? 124 ASP A OD2 1 
ATOM   690  N  N   . GLU A 1 129 ? 45.140 24.806  19.387  1.00 106.07 ? 125 GLU A N   1 
ATOM   691  C  CA  . GLU A 1 129 ? 43.853 24.761  20.074  1.00 102.84 ? 125 GLU A CA  1 
ATOM   692  C  C   . GLU A 1 129 ? 44.062 24.838  21.588  1.00 100.15 ? 125 GLU A C   1 
ATOM   693  O  O   . GLU A 1 129 ? 45.179 24.670  22.079  1.00 99.58  ? 125 GLU A O   1 
ATOM   694  C  CB  . GLU A 1 129 ? 43.106 23.468  19.727  1.00 101.12 ? 125 GLU A CB  1 
ATOM   695  C  CG  . GLU A 1 129 ? 43.499 22.819  18.401  1.00 102.62 ? 125 GLU A CG  1 
ATOM   696  C  CD  . GLU A 1 129 ? 44.758 21.957  18.503  1.00 103.82 ? 125 GLU A CD  1 
ATOM   697  O  OE1 . GLU A 1 129 ? 45.840 22.491  18.825  1.00 103.39 ? 125 GLU A OE1 1 
ATOM   698  O  OE2 . GLU A 1 129 ? 44.664 20.735  18.260  1.00 104.86 ? 125 GLU A OE2 1 
ATOM   699  N  N   . VAL A 1 130 ? 42.977 25.080  22.318  1.00 68.81  ? 126 VAL A N   1 
ATOM   700  C  CA  . VAL A 1 130 ? 43.014 25.197  23.776  1.00 69.65  ? 126 VAL A CA  1 
ATOM   701  C  C   . VAL A 1 130 ? 42.545 23.919  24.482  1.00 68.67  ? 126 VAL A C   1 
ATOM   702  O  O   . VAL A 1 130 ? 41.443 23.426  24.229  1.00 68.87  ? 126 VAL A O   1 
ATOM   703  C  CB  . VAL A 1 130 ? 42.109 26.356  24.254  1.00 77.71  ? 126 VAL A CB  1 
ATOM   704  C  CG1 . VAL A 1 130 ? 42.459 26.736  25.678  1.00 77.47  ? 126 VAL A CG1 1 
ATOM   705  C  CG2 . VAL A 1 130 ? 42.239 27.546  23.322  1.00 78.71  ? 126 VAL A CG2 1 
ATOM   706  N  N   . TYR A 1 131 ? 43.375 23.391  25.375  1.00 73.64  ? 127 TYR A N   1 
ATOM   707  C  CA  . TYR A 1 131 ? 43.013 22.188  26.110  1.00 73.12  ? 127 TYR A CA  1 
ATOM   708  C  C   . TYR A 1 131 ? 42.689 22.470  27.571  1.00 71.92  ? 127 TYR A C   1 
ATOM   709  O  O   . TYR A 1 131 ? 43.482 23.093  28.280  1.00 71.75  ? 127 TYR A O   1 
ATOM   710  C  CB  . TYR A 1 131 ? 44.139 21.154  26.049  1.00 83.79  ? 127 TYR A CB  1 
ATOM   711  C  CG  . TYR A 1 131 ? 44.241 20.435  24.727  1.00 86.92  ? 127 TYR A CG  1 
ATOM   712  C  CD1 . TYR A 1 131 ? 44.593 21.118  23.567  1.00 87.94  ? 127 TYR A CD1 1 
ATOM   713  C  CD2 . TYR A 1 131 ? 43.956 19.075  24.627  1.00 87.55  ? 127 TYR A CD2 1 
ATOM   714  C  CE1 . TYR A 1 131 ? 44.655 20.470  22.338  1.00 88.94  ? 127 TYR A CE1 1 
ATOM   715  C  CE2 . TYR A 1 131 ? 44.015 18.417  23.399  1.00 88.77  ? 127 TYR A CE2 1 
ATOM   716  C  CZ  . TYR A 1 131 ? 44.364 19.123  22.260  1.00 89.07  ? 127 TYR A CZ  1 
ATOM   717  O  OH  . TYR A 1 131 ? 44.414 18.494  21.038  1.00 89.19  ? 127 TYR A OH  1 
ATOM   718  N  N   . LEU A 1 132 ? 41.514 22.018  28.007  1.00 51.80  ? 128 LEU A N   1 
ATOM   719  C  CA  . LEU A 1 132 ? 41.087 22.156  29.394  1.00 48.42  ? 128 LEU A CA  1 
ATOM   720  C  C   . LEU A 1 132 ? 41.629 20.938  30.131  1.00 48.21  ? 128 LEU A C   1 
ATOM   721  O  O   . LEU A 1 132 ? 41.431 19.816  29.687  1.00 46.95  ? 128 LEU A O   1 
ATOM   722  C  CB  . LEU A 1 132 ? 39.563 22.150  29.486  1.00 39.59  ? 128 LEU A CB  1 
ATOM   723  C  CG  . LEU A 1 132 ? 38.997 21.931  30.892  1.00 39.58  ? 128 LEU A CG  1 
ATOM   724  C  CD1 . LEU A 1 132 ? 39.314 23.149  31.736  1.00 39.11  ? 128 LEU A CD1 1 
ATOM   725  C  CD2 . LEU A 1 132 ? 37.484 21.682  30.838  1.00 38.85  ? 128 LEU A CD2 1 
ATOM   726  N  N   . ASN A 1 133 ? 42.316 21.140  31.244  1.00 49.65  ? 129 ASN A N   1 
ATOM   727  C  CA  . ASN A 1 133 ? 42.848 20.007  31.988  1.00 48.22  ? 129 ASN A CA  1 
ATOM   728  C  C   . ASN A 1 133 ? 42.201 19.905  33.362  1.00 48.11  ? 129 ASN A C   1 
ATOM   729  O  O   . ASN A 1 133 ? 42.144 20.881  34.097  1.00 46.48  ? 129 ASN A O   1 
ATOM   730  C  CB  . ASN A 1 133 ? 44.365 20.134  32.146  1.00 54.91  ? 129 ASN A CB  1 
ATOM   731  C  CG  . ASN A 1 133 ? 45.073 20.271  30.818  1.00 57.09  ? 129 ASN A CG  1 
ATOM   732  O  OD1 . ASN A 1 133 ? 44.754 21.165  30.035  1.00 57.88  ? 129 ASN A OD1 1 
ATOM   733  N  ND2 . ASN A 1 133 ? 46.039 19.388  30.552  1.00 56.61  ? 129 ASN A ND2 1 
ATOM   734  N  N   . LEU A 1 134 ? 41.718 18.717  33.710  1.00 45.91  ? 130 LEU A N   1 
ATOM   735  C  CA  . LEU A 1 134 ? 41.096 18.509  35.003  1.00 44.65  ? 130 LEU A CA  1 
ATOM   736  C  C   . LEU A 1 134 ? 41.936 17.551  35.812  1.00 44.91  ? 130 LEU A C   1 
ATOM   737  O  O   . LEU A 1 134 ? 42.158 16.421  35.406  1.00 45.25  ? 130 LEU A O   1 
ATOM   738  C  CB  . LEU A 1 134 ? 39.711 17.923  34.826  1.00 37.47  ? 130 LEU A CB  1 
ATOM   739  C  CG  . LEU A 1 134 ? 38.812 18.624  33.812  1.00 38.54  ? 130 LEU A CG  1 
ATOM   740  C  CD1 . LEU A 1 134 ? 37.443 17.995  33.862  1.00 39.38  ? 130 LEU A CD1 1 
ATOM   741  C  CD2 . LEU A 1 134 ? 38.706 20.097  34.138  1.00 38.07  ? 130 LEU A CD2 1 
ATOM   742  N  N   . VAL A 1 135 ? 42.424 18.014  36.954  1.00 46.70  ? 131 VAL A N   1 
ATOM   743  C  CA  . VAL A 1 135 ? 43.228 17.174  37.823  1.00 46.02  ? 131 VAL A CA  1 
ATOM   744  C  C   . VAL A 1 135 ? 42.249 16.526  38.804  1.00 46.79  ? 131 VAL A C   1 
ATOM   745  O  O   . VAL A 1 135 ? 41.681 17.182  39.671  1.00 46.07  ? 131 VAL A O   1 
ATOM   746  C  CB  . VAL A 1 135 ? 44.293 18.029  38.542  1.00 42.62  ? 131 VAL A CB  1 
ATOM   747  C  CG1 . VAL A 1 135 ? 45.288 17.136  39.281  1.00 40.66  ? 131 VAL A CG1 1 
ATOM   748  C  CG2 . VAL A 1 135 ? 45.012 18.913  37.510  1.00 42.01  ? 131 VAL A CG2 1 
ATOM   749  N  N   . LEU A 1 136 ? 42.051 15.226  38.638  1.00 28.52  ? 132 LEU A N   1 
ATOM   750  C  CA  . LEU A 1 136 ? 41.107 14.448  39.439  1.00 28.68  ? 132 LEU A CA  1 
ATOM   751  C  C   . LEU A 1 136 ? 41.781 13.432  40.346  1.00 29.43  ? 132 LEU A C   1 
ATOM   752  O  O   . LEU A 1 136 ? 42.971 13.159  40.199  1.00 29.67  ? 132 LEU A O   1 
ATOM   753  C  CB  . LEU A 1 136 ? 40.196 13.681  38.491  1.00 24.22  ? 132 LEU A CB  1 
ATOM   754  C  CG  . LEU A 1 136 ? 39.614 14.499  37.338  1.00 25.29  ? 132 LEU A CG  1 
ATOM   755  C  CD1 . LEU A 1 136 ? 39.604 13.690  36.058  1.00 27.02  ? 132 LEU A CD1 1 
ATOM   756  C  CD2 . LEU A 1 136 ? 38.207 14.948  37.724  1.00 23.57  ? 132 LEU A CD2 1 
ATOM   757  N  N   . ASP A 1 137 ? 41.018 12.865  41.281  1.00 29.81  ? 133 ASP A N   1 
ATOM   758  C  CA  . ASP A 1 137 ? 41.559 11.824  42.153  1.00 30.87  ? 133 ASP A CA  1 
ATOM   759  C  C   . ASP A 1 137 ? 41.910 10.656  41.235  1.00 29.94  ? 133 ASP A C   1 
ATOM   760  O  O   . ASP A 1 137 ? 41.250 10.439  40.207  1.00 29.77  ? 133 ASP A O   1 
ATOM   761  C  CB  . ASP A 1 137 ? 40.513 11.303  43.132  1.00 56.65  ? 133 ASP A CB  1 
ATOM   762  C  CG  . ASP A 1 137 ? 40.139 12.299  44.193  1.00 60.90  ? 133 ASP A CG  1 
ATOM   763  O  OD1 . ASP A 1 137 ? 41.050 12.928  44.789  1.00 60.41  ? 133 ASP A OD1 1 
ATOM   764  O  OD2 . ASP A 1 137 ? 38.918 12.419  44.440  1.00 63.62  ? 133 ASP A OD2 1 
ATOM   765  N  N   . TYR A 1 138 ? 42.942 9.902   41.586  1.00 45.01  ? 134 TYR A N   1 
ATOM   766  C  CA  . TYR A 1 138 ? 43.320 8.748   40.786  1.00 46.29  ? 134 TYR A CA  1 
ATOM   767  C  C   . TYR A 1 138 ? 42.877 7.506   41.549  1.00 44.57  ? 134 TYR A C   1 
ATOM   768  O  O   . TYR A 1 138 ? 43.072 7.416   42.753  1.00 44.13  ? 134 TYR A O   1 
ATOM   769  C  CB  . TYR A 1 138 ? 44.829 8.718   40.571  1.00 48.74  ? 134 TYR A CB  1 
ATOM   770  C  CG  . TYR A 1 138 ? 45.326 7.388   40.074  1.00 50.39  ? 134 TYR A CG  1 
ATOM   771  C  CD1 . TYR A 1 138 ? 45.113 6.985   38.760  1.00 50.59  ? 134 TYR A CD1 1 
ATOM   772  C  CD2 . TYR A 1 138 ? 45.919 6.481   40.952  1.00 51.55  ? 134 TYR A CD2 1 
ATOM   773  C  CE1 . TYR A 1 138 ? 45.470 5.696   38.333  1.00 51.72  ? 134 TYR A CE1 1 
ATOM   774  C  CE2 . TYR A 1 138 ? 46.277 5.194   40.539  1.00 52.95  ? 134 TYR A CE2 1 
ATOM   775  C  CZ  . TYR A 1 138 ? 46.045 4.805   39.234  1.00 53.07  ? 134 TYR A CZ  1 
ATOM   776  O  OH  . TYR A 1 138 ? 46.350 3.514   38.855  1.00 55.53  ? 134 TYR A OH  1 
ATOM   777  N  N   . VAL A 1 139 ? 42.238 6.564   40.869  1.00 49.09  ? 135 VAL A N   1 
ATOM   778  C  CA  . VAL A 1 139 ? 41.815 5.334   41.530  1.00 48.08  ? 135 VAL A CA  1 
ATOM   779  C  C   . VAL A 1 139 ? 42.290 4.207   40.608  1.00 48.43  ? 135 VAL A C   1 
ATOM   780  O  O   . VAL A 1 139 ? 42.047 4.229   39.401  1.00 47.82  ? 135 VAL A O   1 
ATOM   781  C  CB  . VAL A 1 139 ? 40.273 5.310   41.758  1.00 39.92  ? 135 VAL A CB  1 
ATOM   782  C  CG1 . VAL A 1 139 ? 39.880 4.116   42.624  1.00 37.20  ? 135 VAL A CG1 1 
ATOM   783  C  CG2 . VAL A 1 139 ? 39.835 6.589   42.451  1.00 38.79  ? 135 VAL A CG2 1 
ATOM   784  N  N   . PRO A 1 140 ? 42.997 3.217   41.170  1.00 45.87  ? 136 PRO A N   1 
ATOM   785  C  CA  . PRO A 1 140 ? 43.580 2.037   40.512  1.00 45.26  ? 136 PRO A CA  1 
ATOM   786  C  C   . PRO A 1 140 ? 42.719 1.051   39.705  1.00 44.81  ? 136 PRO A C   1 
ATOM   787  O  O   . PRO A 1 140 ? 43.163 0.558   38.669  1.00 45.26  ? 136 PRO A O   1 
ATOM   788  C  CB  . PRO A 1 140 ? 44.312 1.352   41.655  1.00 36.74  ? 136 PRO A CB  1 
ATOM   789  C  CG  . PRO A 1 140 ? 43.425 1.654   42.829  1.00 36.72  ? 136 PRO A CG  1 
ATOM   790  C  CD  . PRO A 1 140 ? 43.134 3.113   42.635  1.00 37.13  ? 136 PRO A CD  1 
ATOM   791  N  N   . GLU A 1 141 ? 41.507 0.748   40.154  1.00 39.23  ? 137 GLU A N   1 
ATOM   792  C  CA  . GLU A 1 141 ? 40.673 -0.199  39.418  1.00 38.38  ? 137 GLU A CA  1 
ATOM   793  C  C   . GLU A 1 141 ? 39.293 0.329   39.057  1.00 37.36  ? 137 GLU A C   1 
ATOM   794  O  O   . GLU A 1 141 ? 38.845 1.338   39.596  1.00 36.14  ? 137 GLU A O   1 
ATOM   795  C  CB  . GLU A 1 141 ? 40.504 -1.490  40.227  1.00 73.83  ? 137 GLU A CB  1 
ATOM   796  C  CG  . GLU A 1 141 ? 41.668 -2.468  40.142  1.00 76.23  ? 137 GLU A CG  1 
ATOM   797  C  CD  . GLU A 1 141 ? 41.815 -3.096  38.755  1.00 77.67  ? 137 GLU A CD  1 
ATOM   798  O  OE1 . GLU A 1 141 ? 40.786 -3.527  38.188  1.00 77.03  ? 137 GLU A OE1 1 
ATOM   799  O  OE2 . GLU A 1 141 ? 42.953 -3.173  38.232  1.00 80.62  ? 137 GLU A OE2 1 
ATOM   800  N  N   . THR A 1 142 ? 38.629 -0.354  38.126  1.00 40.00  ? 138 THR A N   1 
ATOM   801  C  CA  . THR A 1 142 ? 37.271 0.006   37.732  1.00 39.62  ? 138 THR A CA  1 
ATOM   802  C  C   . THR A 1 142 ? 36.422 -1.228  37.977  1.00 39.35  ? 138 THR A C   1 
ATOM   803  O  O   . THR A 1 142 ? 36.929 -2.349  37.986  1.00 38.60  ? 138 THR A O   1 
ATOM   804  C  CB  . THR A 1 142 ? 37.142 0.370   36.248  1.00 38.83  ? 138 THR A CB  1 
ATOM   805  O  OG1 . THR A 1 142 ? 37.240 -0.818  35.471  1.00 38.05  ? 138 THR A OG1 1 
ATOM   806  C  CG2 . THR A 1 142 ? 38.216 1.342   35.833  1.00 37.41  ? 138 THR A CG2 1 
ATOM   807  N  N   . VAL A 1 143 ? 35.130 -1.029  38.187  1.00 34.78  ? 139 VAL A N   1 
ATOM   808  C  CA  . VAL A 1 143 ? 34.251 -2.146  38.448  1.00 34.25  ? 139 VAL A CA  1 
ATOM   809  C  C   . VAL A 1 143 ? 34.197 -3.042  37.228  1.00 35.58  ? 139 VAL A C   1 
ATOM   810  O  O   . VAL A 1 143 ? 33.999 -4.240  37.347  1.00 36.56  ? 139 VAL A O   1 
ATOM   811  C  CB  . VAL A 1 143 ? 32.847 -1.655  38.821  1.00 32.26  ? 139 VAL A CB  1 
ATOM   812  C  CG1 . VAL A 1 143 ? 31.866 -2.816  38.849  1.00 29.31  ? 139 VAL A CG1 1 
ATOM   813  C  CG2 . VAL A 1 143 ? 32.901 -0.990  40.192  1.00 30.73  ? 139 VAL A CG2 1 
ATOM   814  N  N   . TYR A 1 144 ? 34.397 -2.458  36.055  1.00 36.35  ? 140 TYR A N   1 
ATOM   815  C  CA  . TYR A 1 144 ? 34.375 -3.216  34.825  1.00 38.05  ? 140 TYR A CA  1 
ATOM   816  C  C   . TYR A 1 144 ? 35.460 -4.295  34.846  1.00 39.06  ? 140 TYR A C   1 
ATOM   817  O  O   . TYR A 1 144 ? 35.195 -5.482  34.632  1.00 36.96  ? 140 TYR A O   1 
ATOM   818  C  CB  . TYR A 1 144 ? 34.637 -2.289  33.634  1.00 29.39  ? 140 TYR A CB  1 
ATOM   819  C  CG  . TYR A 1 144 ? 34.697 -3.010  32.297  1.00 33.56  ? 140 TYR A CG  1 
ATOM   820  C  CD1 . TYR A 1 144 ? 33.532 -3.306  31.591  1.00 34.60  ? 140 TYR A CD1 1 
ATOM   821  C  CD2 . TYR A 1 144 ? 35.912 -3.431  31.763  1.00 35.03  ? 140 TYR A CD2 1 
ATOM   822  C  CE1 . TYR A 1 144 ? 33.570 -3.999  30.395  1.00 38.39  ? 140 TYR A CE1 1 
ATOM   823  C  CE2 . TYR A 1 144 ? 35.967 -4.129  30.567  1.00 38.35  ? 140 TYR A CE2 1 
ATOM   824  C  CZ  . TYR A 1 144 ? 34.790 -4.411  29.886  1.00 40.11  ? 140 TYR A CZ  1 
ATOM   825  O  OH  . TYR A 1 144 ? 34.823 -5.126  28.703  1.00 44.56  ? 140 TYR A OH  1 
ATOM   826  N  N   . ARG A 1 145 ? 36.690 -3.869  35.094  1.00 44.00  ? 141 ARG A N   1 
ATOM   827  C  CA  . ARG A 1 145 ? 37.823 -4.771  35.100  1.00 47.40  ? 141 ARG A CA  1 
ATOM   828  C  C   . ARG A 1 145 ? 37.713 -5.846  36.155  1.00 46.15  ? 141 ARG A C   1 
ATOM   829  O  O   . ARG A 1 145 ? 38.021 -7.008  35.899  1.00 46.36  ? 141 ARG A O   1 
ATOM   830  C  CB  . ARG A 1 145 ? 39.104 -3.976  35.305  1.00 58.96  ? 141 ARG A CB  1 
ATOM   831  C  CG  . ARG A 1 145 ? 40.364 -4.729  34.962  1.00 62.40  ? 141 ARG A CG  1 
ATOM   832  C  CD  . ARG A 1 145 ? 41.329 -3.766  34.323  1.00 65.45  ? 141 ARG A CD  1 
ATOM   833  N  NE  . ARG A 1 145 ? 41.492 -2.575  35.151  1.00 69.20  ? 141 ARG A NE  1 
ATOM   834  C  CZ  . ARG A 1 145 ? 41.733 -1.357  34.674  1.00 72.15  ? 141 ARG A CZ  1 
ATOM   835  N  NH1 . ARG A 1 145 ? 41.836 -1.160  33.361  1.00 72.73  ? 141 ARG A NH1 1 
ATOM   836  N  NH2 . ARG A 1 145 ? 41.883 -0.335  35.514  1.00 73.43  ? 141 ARG A NH2 1 
ATOM   837  N  N   . VAL A 1 146 ? 37.263 -5.462  37.343  1.00 41.38  ? 142 VAL A N   1 
ATOM   838  C  CA  . VAL A 1 146 ? 37.144 -6.421  38.425  1.00 43.03  ? 142 VAL A CA  1 
ATOM   839  C  C   . VAL A 1 146 ? 36.035 -7.420  38.191  1.00 44.03  ? 142 VAL A C   1 
ATOM   840  O  O   . VAL A 1 146 ? 36.243 -8.598  38.368  1.00 44.35  ? 142 VAL A O   1 
ATOM   841  C  CB  . VAL A 1 146 ? 36.927 -5.715  39.766  1.00 32.21  ? 142 VAL A CB  1 
ATOM   842  C  CG1 . VAL A 1 146 ? 36.500 -6.720  40.836  1.00 30.16  ? 142 VAL A CG1 1 
ATOM   843  C  CG2 . VAL A 1 146 ? 38.203 -4.985  40.165  1.00 31.61  ? 142 VAL A CG2 1 
ATOM   844  N  N   . ALA A 1 147 ? 34.855 -6.976  37.801  1.00 36.72  ? 143 ALA A N   1 
ATOM   845  C  CA  . ALA A 1 147 ? 33.789 -7.938  37.565  1.00 38.85  ? 143 ALA A CA  1 
ATOM   846  C  C   . ALA A 1 147 ? 34.204 -8.872  36.441  1.00 41.02  ? 143 ALA A C   1 
ATOM   847  O  O   . ALA A 1 147 ? 33.747 -10.016 36.377  1.00 39.15  ? 143 ALA A O   1 
ATOM   848  C  CB  . ALA A 1 147 ? 32.484 -7.231  37.188  1.00 18.16  ? 143 ALA A CB  1 
ATOM   849  N  N   . ARG A 1 148 ? 35.073 -8.381  35.559  1.00 42.59  ? 144 ARG A N   1 
ATOM   850  C  CA  . ARG A 1 148 ? 35.534 -9.160  34.417  1.00 46.00  ? 144 ARG A CA  1 
ATOM   851  C  C   . ARG A 1 148 ? 36.499 -10.261 34.818  1.00 46.11  ? 144 ARG A C   1 
ATOM   852  O  O   . ARG A 1 148 ? 36.460 -11.342 34.246  1.00 45.26  ? 144 ARG A O   1 
ATOM   853  C  CB  . ARG A 1 148 ? 36.203 -8.249  33.399  1.00 72.58  ? 144 ARG A CB  1 
ATOM   854  C  CG  . ARG A 1 148 ? 36.441 -8.877  32.051  1.00 77.16  ? 144 ARG A CG  1 
ATOM   855  C  CD  . ARG A 1 148 ? 36.923 -7.807  31.098  1.00 81.58  ? 144 ARG A CD  1 
ATOM   856  N  NE  . ARG A 1 148 ? 36.589 -8.084  29.703  1.00 85.83  ? 144 ARG A NE  1 
ATOM   857  C  CZ  . ARG A 1 148 ? 37.240 -8.944  28.926  1.00 87.81  ? 144 ARG A CZ  1 
ATOM   858  N  NH1 . ARG A 1 148 ? 38.277 -9.626  29.403  1.00 88.73  ? 144 ARG A NH1 1 
ATOM   859  N  NH2 . ARG A 1 148 ? 36.855 -9.120  27.667  1.00 87.02  ? 144 ARG A NH2 1 
ATOM   860  N  N   . HIS A 1 149 ? 37.378 -9.993  35.781  1.00 49.56  ? 145 HIS A N   1 
ATOM   861  C  CA  . HIS A 1 149 ? 38.306 -11.021 36.215  1.00 51.47  ? 145 HIS A CA  1 
ATOM   862  C  C   . HIS A 1 149 ? 37.478 -12.167 36.774  1.00 50.82  ? 145 HIS A C   1 
ATOM   863  O  O   . HIS A 1 149 ? 37.685 -13.319 36.414  1.00 50.85  ? 145 HIS A O   1 
ATOM   864  C  CB  . HIS A 1 149 ? 39.285 -10.490 37.263  1.00 60.98  ? 145 HIS A CB  1 
ATOM   865  C  CG  . HIS A 1 149 ? 40.332 -9.569  36.703  1.00 67.16  ? 145 HIS A CG  1 
ATOM   866  N  ND1 . HIS A 1 149 ? 40.741 -9.616  35.386  1.00 69.59  ? 145 HIS A ND1 1 
ATOM   867  C  CD2 . HIS A 1 149 ? 41.075 -8.598  37.288  1.00 68.69  ? 145 HIS A CD2 1 
ATOM   868  C  CE1 . HIS A 1 149 ? 41.688 -8.715  35.184  1.00 70.76  ? 145 HIS A CE1 1 
ATOM   869  N  NE2 . HIS A 1 149 ? 41.910 -8.085  36.323  1.00 71.22  ? 145 HIS A NE2 1 
ATOM   870  N  N   . TYR A 1 150 ? 36.516 -11.868 37.630  1.00 37.98  ? 146 TYR A N   1 
ATOM   871  C  CA  . TYR A 1 150 ? 35.676 -12.928 38.168  1.00 37.74  ? 146 TYR A CA  1 
ATOM   872  C  C   . TYR A 1 150 ? 34.904 -13.621 37.050  1.00 40.65  ? 146 TYR A C   1 
ATOM   873  O  O   . TYR A 1 150 ? 34.785 -14.844 37.033  1.00 42.10  ? 146 TYR A O   1 
ATOM   874  C  CB  . TYR A 1 150 ? 34.679 -12.377 39.182  1.00 46.17  ? 146 TYR A CB  1 
ATOM   875  C  CG  . TYR A 1 150 ? 35.282 -12.038 40.525  1.00 41.91  ? 146 TYR A CG  1 
ATOM   876  C  CD1 . TYR A 1 150 ? 36.074 -10.906 40.693  1.00 41.06  ? 146 TYR A CD1 1 
ATOM   877  C  CD2 . TYR A 1 150 ? 35.033 -12.839 41.645  1.00 41.03  ? 146 TYR A CD2 1 
ATOM   878  C  CE1 . TYR A 1 150 ? 36.598 -10.575 41.946  1.00 39.47  ? 146 TYR A CE1 1 
ATOM   879  C  CE2 . TYR A 1 150 ? 35.552 -12.516 42.895  1.00 39.44  ? 146 TYR A CE2 1 
ATOM   880  C  CZ  . TYR A 1 150 ? 36.330 -11.388 43.030  1.00 39.67  ? 146 TYR A CZ  1 
ATOM   881  O  OH  . TYR A 1 150 ? 36.871 -11.085 44.247  1.00 37.51  ? 146 TYR A OH  1 
ATOM   882  N  N   . SER A 1 151 ? 34.390 -12.832 36.113  1.00 43.14  ? 147 SER A N   1 
ATOM   883  C  CA  . SER A 1 151 ? 33.613 -13.349 34.994  1.00 45.70  ? 147 SER A CA  1 
ATOM   884  C  C   . SER A 1 151 ? 34.354 -14.373 34.123  1.00 47.87  ? 147 SER A C   1 
ATOM   885  O  O   . SER A 1 151 ? 33.861 -15.478 33.912  1.00 45.72  ? 147 SER A O   1 
ATOM   886  C  CB  . SER A 1 151 ? 33.130 -12.183 34.132  1.00 62.05  ? 147 SER A CB  1 
ATOM   887  O  OG  . SER A 1 151 ? 32.270 -12.632 33.101  1.00 65.41  ? 147 SER A OG  1 
ATOM   888  N  N   . ARG A 1 152 ? 35.521 -14.020 33.596  1.00 71.63  ? 148 ARG A N   1 
ATOM   889  C  CA  . ARG A 1 152 ? 36.242 -14.978 32.767  1.00 75.83  ? 148 ARG A CA  1 
ATOM   890  C  C   . ARG A 1 152 ? 37.099 -15.837 33.669  1.00 76.27  ? 148 ARG A C   1 
ATOM   891  O  O   . ARG A 1 152 ? 38.320 -15.766 33.652  1.00 76.79  ? 148 ARG A O   1 
ATOM   892  C  CB  . ARG A 1 152 ? 37.089 -14.273 31.695  1.00 98.82  ? 148 ARG A CB  1 
ATOM   893  C  CG  . ARG A 1 152 ? 38.187 -13.343 32.186  1.00 103.18 ? 148 ARG A CG  1 
ATOM   894  C  CD  . ARG A 1 152 ? 38.849 -12.637 30.997  1.00 106.95 ? 148 ARG A CD  1 
ATOM   895  N  NE  . ARG A 1 152 ? 40.087 -11.949 31.359  1.00 111.61 ? 148 ARG A NE  1 
ATOM   896  C  CZ  . ARG A 1 152 ? 40.870 -11.317 30.488  1.00 113.69 ? 148 ARG A CZ  1 
ATOM   897  N  NH1 . ARG A 1 152 ? 40.540 -11.284 29.203  1.00 114.33 ? 148 ARG A NH1 1 
ATOM   898  N  NH2 . ARG A 1 152 ? 41.989 -10.726 30.897  1.00 113.94 ? 148 ARG A NH2 1 
ATOM   899  N  N   . ALA A 1 153 ? 36.419 -16.644 34.472  1.00 49.32  ? 149 ALA A N   1 
ATOM   900  C  CA  . ALA A 1 153 ? 37.045 -17.547 35.433  1.00 49.39  ? 149 ALA A CA  1 
ATOM   901  C  C   . ALA A 1 153 ? 35.905 -18.223 36.193  1.00 49.24  ? 149 ALA A C   1 
ATOM   902  O  O   . ALA A 1 153 ? 36.116 -18.921 37.184  1.00 49.63  ? 149 ALA A O   1 
ATOM   903  C  CB  . ALA A 1 153 ? 37.942 -16.774 36.393  1.00 22.45  ? 149 ALA A CB  1 
ATOM   904  N  N   . LYS A 1 154 ? 34.693 -17.971 35.704  1.00 60.11  ? 150 LYS A N   1 
ATOM   905  C  CA  . LYS A 1 154 ? 33.456 -18.535 36.231  1.00 61.03  ? 150 LYS A CA  1 
ATOM   906  C  C   . LYS A 1 154 ? 33.044 -18.291 37.685  1.00 60.73  ? 150 LYS A C   1 
ATOM   907  O  O   . LYS A 1 154 ? 32.261 -19.068 38.239  1.00 60.64  ? 150 LYS A O   1 
ATOM   908  C  CB  . LYS A 1 154 ? 33.430 -20.042 35.934  1.00 73.64  ? 150 LYS A CB  1 
ATOM   909  C  CG  . LYS A 1 154 ? 33.416 -20.346 34.443  1.00 75.71  ? 150 LYS A CG  1 
ATOM   910  C  CD  . LYS A 1 154 ? 32.320 -19.532 33.750  1.00 77.72  ? 150 LYS A CD  1 
ATOM   911  C  CE  . LYS A 1 154 ? 32.432 -19.602 32.238  1.00 79.44  ? 150 LYS A CE  1 
ATOM   912  N  NZ  . LYS A 1 154 ? 31.493 -18.666 31.559  1.00 80.27  ? 150 LYS A NZ  1 
ATOM   913  N  N   . GLN A 1 155 ? 33.549 -17.226 38.303  1.00 56.38  ? 151 GLN A N   1 
ATOM   914  C  CA  . GLN A 1 155 ? 33.160 -16.912 39.677  1.00 55.14  ? 151 GLN A CA  1 
ATOM   915  C  C   . GLN A 1 155 ? 32.367 -15.615 39.688  1.00 52.87  ? 151 GLN A C   1 
ATOM   916  O  O   . GLN A 1 155 ? 32.384 -14.857 38.723  1.00 52.71  ? 151 GLN A O   1 
ATOM   917  C  CB  . GLN A 1 155 ? 34.380 -16.727 40.566  1.00 79.10  ? 151 GLN A CB  1 
ATOM   918  C  CG  . GLN A 1 155 ? 35.402 -17.811 40.436  1.00 82.38  ? 151 GLN A CG  1 
ATOM   919  C  CD  . GLN A 1 155 ? 36.769 -17.252 40.132  1.00 85.52  ? 151 GLN A CD  1 
ATOM   920  O  OE1 . GLN A 1 155 ? 37.355 -16.519 40.934  1.00 87.29  ? 151 GLN A OE1 1 
ATOM   921  N  NE2 . GLN A 1 155 ? 37.285 -17.585 38.961  1.00 85.79  ? 151 GLN A NE2 1 
ATOM   922  N  N   . THR A 1 156 ? 31.645 -15.365 40.768  1.00 52.70  ? 152 THR A N   1 
ATOM   923  C  CA  . THR A 1 156 ? 30.913 -14.116 40.874  1.00 48.95  ? 152 THR A CA  1 
ATOM   924  C  C   . THR A 1 156 ? 31.536 -13.364 42.024  1.00 46.10  ? 152 THR A C   1 
ATOM   925  O  O   . THR A 1 156 ? 32.141 -13.960 42.919  1.00 44.19  ? 152 THR A O   1 
ATOM   926  C  CB  . THR A 1 156 ? 29.429 -14.305 41.196  1.00 43.27  ? 152 THR A CB  1 
ATOM   927  O  OG1 . THR A 1 156 ? 29.296 -15.178 42.329  1.00 43.89  ? 152 THR A OG1 1 
ATOM   928  C  CG2 . THR A 1 156 ? 28.674 -14.829 39.975  1.00 42.67  ? 152 THR A CG2 1 
ATOM   929  N  N   . LEU A 1 157 ? 31.388 -12.050 41.997  1.00 55.49  ? 153 LEU A N   1 
ATOM   930  C  CA  . LEU A 1 157 ? 31.935 -11.206 43.044  1.00 53.39  ? 153 LEU A CA  1 
ATOM   931  C  C   . LEU A 1 157 ? 31.224 -11.550 44.360  1.00 50.62  ? 153 LEU A C   1 
ATOM   932  O  O   . LEU A 1 157 ? 30.007 -11.699 44.388  1.00 49.10  ? 153 LEU A O   1 
ATOM   933  C  CB  . LEU A 1 157 ? 31.699 -9.751  42.651  1.00 44.98  ? 153 LEU A CB  1 
ATOM   934  C  CG  . LEU A 1 157 ? 32.318 -8.617  43.444  1.00 45.49  ? 153 LEU A CG  1 
ATOM   935  C  CD1 . LEU A 1 157 ? 33.845 -8.697  43.433  1.00 43.52  ? 153 LEU A CD1 1 
ATOM   936  C  CD2 . LEU A 1 157 ? 31.818 -7.327  42.818  1.00 44.13  ? 153 LEU A CD2 1 
ATOM   937  N  N   . PRO A 1 158 ? 31.979 -11.725 45.457  1.00 42.91  ? 154 PRO A N   1 
ATOM   938  C  CA  . PRO A 1 158 ? 31.341 -12.050 46.736  1.00 42.48  ? 154 PRO A CA  1 
ATOM   939  C  C   . PRO A 1 158 ? 30.280 -11.003 47.059  1.00 44.54  ? 154 PRO A C   1 
ATOM   940  O  O   . PRO A 1 158 ? 30.527 -9.798  46.989  1.00 42.84  ? 154 PRO A O   1 
ATOM   941  C  CB  . PRO A 1 158 ? 32.503 -12.017 47.717  1.00 40.68  ? 154 PRO A CB  1 
ATOM   942  C  CG  . PRO A 1 158 ? 33.640 -12.498 46.875  1.00 40.83  ? 154 PRO A CG  1 
ATOM   943  C  CD  . PRO A 1 158 ? 33.448 -11.752 45.581  1.00 39.51  ? 154 PRO A CD  1 
ATOM   944  N  N   . VAL A 1 159 ? 29.094 -11.465 47.414  1.00 52.62  ? 155 VAL A N   1 
ATOM   945  C  CA  . VAL A 1 159 ? 28.012 -10.561 47.710  1.00 53.72  ? 155 VAL A CA  1 
ATOM   946  C  C   . VAL A 1 159 ? 28.364 -9.423  48.651  1.00 52.39  ? 155 VAL A C   1 
ATOM   947  O  O   . VAL A 1 159 ? 27.861 -8.320  48.476  1.00 53.12  ? 155 VAL A O   1 
ATOM   948  C  CB  . VAL A 1 159 ? 26.796 -11.320 48.252  1.00 28.65  ? 155 VAL A CB  1 
ATOM   949  C  CG1 . VAL A 1 159 ? 25.693 -10.332 48.644  1.00 30.37  ? 155 VAL A CG1 1 
ATOM   950  C  CG2 . VAL A 1 159 ? 26.274 -12.271 47.173  1.00 30.21  ? 155 VAL A CG2 1 
ATOM   951  N  N   . ILE A 1 160 ? 29.220 -9.649  49.639  1.00 39.93  ? 156 ILE A N   1 
ATOM   952  C  CA  . ILE A 1 160 ? 29.531 -8.543  50.540  1.00 40.08  ? 156 ILE A CA  1 
ATOM   953  C  C   . ILE A 1 160 ? 30.025 -7.348  49.723  1.00 39.24  ? 156 ILE A C   1 
ATOM   954  O  O   . ILE A 1 160 ? 29.634 -6.212  49.975  1.00 38.39  ? 156 ILE A O   1 
ATOM   955  C  CB  . ILE A 1 160 ? 30.582 -8.934  51.597  1.00 36.13  ? 156 ILE A CB  1 
ATOM   956  C  CG1 . ILE A 1 160 ? 30.919 -7.724  52.476  1.00 36.36  ? 156 ILE A CG1 1 
ATOM   957  C  CG2 . ILE A 1 160 ? 31.837 -9.419  50.931  1.00 35.87  ? 156 ILE A CG2 1 
ATOM   958  C  CD1 . ILE A 1 160 ? 29.741 -7.138  53.204  1.00 36.87  ? 156 ILE A CD1 1 
ATOM   959  N  N   . TYR A 1 161 ? 30.876 -7.606  48.735  1.00 43.11  ? 157 TYR A N   1 
ATOM   960  C  CA  . TYR A 1 161 ? 31.382 -6.544  47.877  1.00 42.94  ? 157 TYR A CA  1 
ATOM   961  C  C   . TYR A 1 161 ? 30.261 -5.957  47.028  1.00 41.96  ? 157 TYR A C   1 
ATOM   962  O  O   . TYR A 1 161 ? 30.217 -4.750  46.806  1.00 41.50  ? 157 TYR A O   1 
ATOM   963  C  CB  . TYR A 1 161 ? 32.484 -7.071  46.965  1.00 49.14  ? 157 TYR A CB  1 
ATOM   964  C  CG  . TYR A 1 161 ? 33.763 -7.339  47.695  1.00 53.04  ? 157 TYR A CG  1 
ATOM   965  C  CD1 . TYR A 1 161 ? 34.415 -6.313  48.378  1.00 54.59  ? 157 TYR A CD1 1 
ATOM   966  C  CD2 . TYR A 1 161 ? 34.334 -8.609  47.705  1.00 54.60  ? 157 TYR A CD2 1 
ATOM   967  C  CE1 . TYR A 1 161 ? 35.610 -6.541  49.057  1.00 56.99  ? 157 TYR A CE1 1 
ATOM   968  C  CE2 . TYR A 1 161 ? 35.529 -8.851  48.381  1.00 57.72  ? 157 TYR A CE2 1 
ATOM   969  C  CZ  . TYR A 1 161 ? 36.164 -7.810  49.057  1.00 58.26  ? 157 TYR A CZ  1 
ATOM   970  O  OH  . TYR A 1 161 ? 37.348 -8.023  49.738  1.00 62.73  ? 157 TYR A OH  1 
ATOM   971  N  N   . VAL A 1 162 ? 29.360 -6.803  46.544  1.00 39.44  ? 158 VAL A N   1 
ATOM   972  C  CA  . VAL A 1 162 ? 28.261 -6.295  45.750  1.00 40.67  ? 158 VAL A CA  1 
ATOM   973  C  C   . VAL A 1 162 ? 27.492 -5.265  46.591  1.00 40.52  ? 158 VAL A C   1 
ATOM   974  O  O   . VAL A 1 162 ? 27.083 -4.227  46.078  1.00 39.33  ? 158 VAL A O   1 
ATOM   975  C  CB  . VAL A 1 162 ? 27.313 -7.428  45.299  1.00 32.21  ? 158 VAL A CB  1 
ATOM   976  C  CG1 . VAL A 1 162 ? 26.127 -6.853  44.508  1.00 31.00  ? 158 VAL A CG1 1 
ATOM   977  C  CG2 . VAL A 1 162 ? 28.075 -8.400  44.430  1.00 30.88  ? 158 VAL A CG2 1 
ATOM   978  N  N   . LYS A 1 163 ? 27.315 -5.538  47.884  1.00 34.02  ? 159 LYS A N   1 
ATOM   979  C  CA  . LYS A 1 163 ? 26.613 -4.616  48.771  1.00 34.81  ? 159 LYS A CA  1 
ATOM   980  C  C   . LYS A 1 163 ? 27.394 -3.322  48.941  1.00 35.01  ? 159 LYS A C   1 
ATOM   981  O  O   . LYS A 1 163 ? 26.866 -2.238  48.706  1.00 34.86  ? 159 LYS A O   1 
ATOM   982  C  CB  . LYS A 1 163 ? 26.397 -5.252  50.137  1.00 39.01  ? 159 LYS A CB  1 
ATOM   983  C  CG  . LYS A 1 163 ? 25.479 -6.446  50.105  1.00 39.67  ? 159 LYS A CG  1 
ATOM   984  C  CD  . LYS A 1 163 ? 25.241 -6.987  51.494  1.00 41.77  ? 159 LYS A CD  1 
ATOM   985  C  CE  . LYS A 1 163 ? 24.332 -8.196  51.458  1.00 39.72  ? 159 LYS A CE  1 
ATOM   986  N  NZ  . LYS A 1 163 ? 24.081 -8.620  52.848  1.00 41.98  ? 159 LYS A NZ  1 
ATOM   987  N  N   . LEU A 1 164 ? 28.646 -3.431  49.363  1.00 41.17  ? 160 LEU A N   1 
ATOM   988  C  CA  . LEU A 1 164 ? 29.482 -2.254  49.534  1.00 43.82  ? 160 LEU A CA  1 
ATOM   989  C  C   . LEU A 1 164 ? 29.518 -1.386  48.294  1.00 43.63  ? 160 LEU A C   1 
ATOM   990  O  O   . LEU A 1 164 ? 29.377 -0.163  48.395  1.00 43.44  ? 160 LEU A O   1 
ATOM   991  C  CB  . LEU A 1 164 ? 30.915 -2.642  49.870  1.00 42.94  ? 160 LEU A CB  1 
ATOM   992  C  CG  . LEU A 1 164 ? 31.199 -2.978  51.321  1.00 46.95  ? 160 LEU A CG  1 
ATOM   993  C  CD1 . LEU A 1 164 ? 32.575 -3.569  51.414  1.00 46.14  ? 160 LEU A CD1 1 
ATOM   994  C  CD2 . LEU A 1 164 ? 31.079 -1.729  52.169  1.00 46.70  ? 160 LEU A CD2 1 
ATOM   995  N  N   . TYR A 1 165 ? 29.707 -1.999  47.124  1.00 35.39  ? 161 TYR A N   1 
ATOM   996  C  CA  . TYR A 1 165 ? 29.791 -1.204  45.899  1.00 36.18  ? 161 TYR A CA  1 
ATOM   997  C  C   . TYR A 1 165 ? 28.470 -0.548  45.508  1.00 35.48  ? 161 TYR A C   1 
ATOM   998  O  O   . TYR A 1 165 ? 28.421 0.656   45.235  1.00 35.14  ? 161 TYR A O   1 
ATOM   999  C  CB  . TYR A 1 165 ? 30.316 -2.032  44.715  1.00 28.86  ? 161 TYR A CB  1 
ATOM   1000 C  CG  . TYR A 1 165 ? 31.699 -2.622  44.898  1.00 32.10  ? 161 TYR A CG  1 
ATOM   1001 C  CD1 . TYR A 1 165 ? 32.546 -2.175  45.909  1.00 31.36  ? 161 TYR A CD1 1 
ATOM   1002 C  CD2 . TYR A 1 165 ? 32.160 -3.647  44.050  1.00 34.06  ? 161 TYR A CD2 1 
ATOM   1003 C  CE1 . TYR A 1 165 ? 33.822 -2.733  46.085  1.00 35.68  ? 161 TYR A CE1 1 
ATOM   1004 C  CE2 . TYR A 1 165 ? 33.430 -4.210  44.208  1.00 35.10  ? 161 TYR A CE2 1 
ATOM   1005 C  CZ  . TYR A 1 165 ? 34.262 -3.750  45.229  1.00 36.29  ? 161 TYR A CZ  1 
ATOM   1006 O  OH  . TYR A 1 165 ? 35.534 -4.280  45.381  1.00 38.39  ? 161 TYR A OH  1 
ATOM   1007 N  N   . MET A 1 166 ? 27.403 -1.332  45.491  1.00 29.97  ? 162 MET A N   1 
ATOM   1008 C  CA  . MET A 1 166 ? 26.107 -0.803  45.117  1.00 32.48  ? 162 MET A CA  1 
ATOM   1009 C  C   . MET A 1 166 ? 25.618 0.308   46.052  1.00 32.57  ? 162 MET A C   1 
ATOM   1010 O  O   . MET A 1 166 ? 25.060 1.321   45.597  1.00 31.43  ? 162 MET A O   1 
ATOM   1011 C  CB  . MET A 1 166 ? 25.076 -1.933  45.048  1.00 40.32  ? 162 MET A CB  1 
ATOM   1012 C  CG  . MET A 1 166 ? 25.287 -2.869  43.851  1.00 45.54  ? 162 MET A CG  1 
ATOM   1013 S  SD  . MET A 1 166 ? 25.597 -1.965  42.311  1.00 44.77  ? 162 MET A SD  1 
ATOM   1014 C  CE  . MET A 1 166 ? 23.987 -1.172  42.105  1.00 46.07  ? 162 MET A CE  1 
ATOM   1015 N  N   . TYR A 1 167 ? 25.836 0.130   47.351  1.00 31.28  ? 163 TYR A N   1 
ATOM   1016 C  CA  . TYR A 1 167 ? 25.406 1.120   48.314  1.00 31.58  ? 163 TYR A CA  1 
ATOM   1017 C  C   . TYR A 1 167 ? 26.059 2.445   48.017  1.00 32.41  ? 163 TYR A C   1 
ATOM   1018 O  O   . TYR A 1 167 ? 25.388 3.474   47.939  1.00 31.91  ? 163 TYR A O   1 
ATOM   1019 C  CB  . TYR A 1 167 ? 25.793 0.699   49.717  1.00 43.20  ? 163 TYR A CB  1 
ATOM   1020 C  CG  . TYR A 1 167 ? 25.433 1.715   50.783  1.00 45.00  ? 163 TYR A CG  1 
ATOM   1021 C  CD1 . TYR A 1 167 ? 24.179 1.694   51.398  1.00 42.21  ? 163 TYR A CD1 1 
ATOM   1022 C  CD2 . TYR A 1 167 ? 26.374 2.651   51.223  1.00 42.42  ? 163 TYR A CD2 1 
ATOM   1023 C  CE1 . TYR A 1 167 ? 23.884 2.560   52.431  1.00 46.21  ? 163 TYR A CE1 1 
ATOM   1024 C  CE2 . TYR A 1 167 ? 26.087 3.526   52.255  1.00 44.04  ? 163 TYR A CE2 1 
ATOM   1025 C  CZ  . TYR A 1 167 ? 24.844 3.469   52.863  1.00 46.21  ? 163 TYR A CZ  1 
ATOM   1026 O  OH  . TYR A 1 167 ? 24.591 4.261   53.963  1.00 48.63  ? 163 TYR A OH  1 
ATOM   1027 N  N   . GLN A 1 168 ? 27.379 2.423   47.874  1.00 34.60  ? 164 GLN A N   1 
ATOM   1028 C  CA  . GLN A 1 168 ? 28.116 3.643   47.587  1.00 36.14  ? 164 GLN A CA  1 
ATOM   1029 C  C   . GLN A 1 168 ? 27.686 4.291   46.280  1.00 37.04  ? 164 GLN A C   1 
ATOM   1030 O  O   . GLN A 1 168 ? 27.632 5.511   46.174  1.00 33.24  ? 164 GLN A O   1 
ATOM   1031 C  CB  . GLN A 1 168 ? 29.615 3.352   47.573  1.00 22.60  ? 164 GLN A CB  1 
ATOM   1032 C  CG  . GLN A 1 168 ? 30.134 2.950   48.941  1.00 24.39  ? 164 GLN A CG  1 
ATOM   1033 C  CD  . GLN A 1 168 ? 31.591 2.622   48.923  1.00 26.19  ? 164 GLN A CD  1 
ATOM   1034 O  OE1 . GLN A 1 168 ? 32.426 3.500   49.059  1.00 24.73  ? 164 GLN A OE1 1 
ATOM   1035 N  NE2 . GLN A 1 168 ? 31.910 1.346   48.732  1.00 24.36  ? 164 GLN A NE2 1 
ATOM   1036 N  N   . LEU A 1 169 ? 27.384 3.483   45.280  1.00 33.63  ? 165 LEU A N   1 
ATOM   1037 C  CA  . LEU A 1 169 ? 26.955 4.055   44.027  1.00 34.65  ? 165 LEU A CA  1 
ATOM   1038 C  C   . LEU A 1 169 ? 25.665 4.821   44.282  1.00 33.53  ? 165 LEU A C   1 
ATOM   1039 O  O   . LEU A 1 169 ? 25.495 5.934   43.779  1.00 33.26  ? 165 LEU A O   1 
ATOM   1040 C  CB  . LEU A 1 169 ? 26.723 2.959   42.984  1.00 30.80  ? 165 LEU A CB  1 
ATOM   1041 C  CG  . LEU A 1 169 ? 25.958 3.326   41.711  1.00 34.25  ? 165 LEU A CG  1 
ATOM   1042 C  CD1 . LEU A 1 169 ? 26.565 4.552   41.050  1.00 32.07  ? 165 LEU A CD1 1 
ATOM   1043 C  CD2 . LEU A 1 169 ? 25.976 2.140   40.781  1.00 32.42  ? 165 LEU A CD2 1 
ATOM   1044 N  N   . PHE A 1 170 ? 24.756 4.233   45.063  1.00 42.33  ? 166 PHE A N   1 
ATOM   1045 C  CA  . PHE A 1 170 ? 23.491 4.902   45.352  1.00 46.37  ? 166 PHE A CA  1 
ATOM   1046 C  C   . PHE A 1 170 ? 23.657 6.177   46.143  1.00 46.21  ? 166 PHE A C   1 
ATOM   1047 O  O   . PHE A 1 170 ? 22.948 7.153   45.876  1.00 47.10  ? 166 PHE A O   1 
ATOM   1048 C  CB  . PHE A 1 170 ? 22.516 3.974   46.052  1.00 28.15  ? 166 PHE A CB  1 
ATOM   1049 C  CG  . PHE A 1 170 ? 21.901 2.961   45.133  1.00 31.28  ? 166 PHE A CG  1 
ATOM   1050 C  CD1 . PHE A 1 170 ? 21.238 3.367   43.973  1.00 29.46  ? 166 PHE A CD1 1 
ATOM   1051 C  CD2 . PHE A 1 170 ? 21.999 1.597   45.404  1.00 30.42  ? 166 PHE A CD2 1 
ATOM   1052 C  CE1 . PHE A 1 170 ? 20.679 2.432   43.092  1.00 30.37  ? 166 PHE A CE1 1 
ATOM   1053 C  CE2 . PHE A 1 170 ? 21.441 0.642   44.521  1.00 30.03  ? 166 PHE A CE2 1 
ATOM   1054 C  CZ  . PHE A 1 170 ? 20.782 1.065   43.368  1.00 30.13  ? 166 PHE A CZ  1 
ATOM   1055 N  N   . ARG A 1 171 ? 24.571 6.196   47.110  1.00 34.85  ? 167 ARG A N   1 
ATOM   1056 C  CA  . ARG A 1 171 ? 24.782 7.438   47.826  1.00 37.30  ? 167 ARG A CA  1 
ATOM   1057 C  C   . ARG A 1 171 ? 25.212 8.472   46.800  1.00 36.50  ? 167 ARG A C   1 
ATOM   1058 O  O   . ARG A 1 171 ? 24.632 9.550   46.741  1.00 36.40  ? 167 ARG A O   1 
ATOM   1059 C  CB  . ARG A 1 171 ? 25.873 7.327   48.890  1.00 41.31  ? 167 ARG A CB  1 
ATOM   1060 C  CG  . ARG A 1 171 ? 25.360 7.020   50.280  1.00 49.51  ? 167 ARG A CG  1 
ATOM   1061 C  CD  . ARG A 1 171 ? 26.469 7.081   51.309  1.00 49.94  ? 167 ARG A CD  1 
ATOM   1062 N  NE  . ARG A 1 171 ? 26.731 8.443   51.760  1.00 50.16  ? 167 ARG A NE  1 
ATOM   1063 C  CZ  . ARG A 1 171 ? 27.756 8.784   52.535  1.00 52.72  ? 167 ARG A CZ  1 
ATOM   1064 N  NH1 . ARG A 1 171 ? 28.627 7.867   52.941  1.00 46.98  ? 167 ARG A NH1 1 
ATOM   1065 N  NH2 . ARG A 1 171 ? 27.901 10.041  52.925  1.00 52.73  ? 167 ARG A NH2 1 
ATOM   1066 N  N   . SER A 1 172 ? 26.200 8.149   45.967  1.00 30.03  ? 168 SER A N   1 
ATOM   1067 C  CA  . SER A 1 172 ? 26.667 9.131   44.997  1.00 29.92  ? 168 SER A CA  1 
ATOM   1068 C  C   . SER A 1 172 ? 25.533 9.656   44.125  1.00 31.05  ? 168 SER A C   1 
ATOM   1069 O  O   . SER A 1 172 ? 25.519 10.842  43.775  1.00 29.44  ? 168 SER A O   1 
ATOM   1070 C  CB  . SER A 1 172 ? 27.794 8.566   44.128  1.00 37.98  ? 168 SER A CB  1 
ATOM   1071 O  OG  . SER A 1 172 ? 27.296 7.759   43.084  1.00 41.18  ? 168 SER A OG  1 
ATOM   1072 N  N   . LEU A 1 173 ? 24.573 8.793   43.792  1.00 29.24  ? 169 LEU A N   1 
ATOM   1073 C  CA  . LEU A 1 173 ? 23.449 9.216   42.967  1.00 32.09  ? 169 LEU A CA  1 
ATOM   1074 C  C   . LEU A 1 173 ? 22.478 10.097  43.753  1.00 32.26  ? 169 LEU A C   1 
ATOM   1075 O  O   . LEU A 1 173 ? 21.984 11.103  43.227  1.00 31.68  ? 169 LEU A O   1 
ATOM   1076 C  CB  . LEU A 1 173 ? 22.710 8.006   42.387  1.00 30.78  ? 169 LEU A CB  1 
ATOM   1077 C  CG  . LEU A 1 173 ? 23.422 7.208   41.292  1.00 36.15  ? 169 LEU A CG  1 
ATOM   1078 C  CD1 . LEU A 1 173 ? 22.459 6.180   40.727  1.00 31.98  ? 169 LEU A CD1 1 
ATOM   1079 C  CD2 . LEU A 1 173 ? 23.906 8.139   40.190  1.00 31.23  ? 169 LEU A CD2 1 
ATOM   1080 N  N   . ALA A 1 174 ? 22.204 9.733   45.007  1.00 35.84  ? 170 ALA A N   1 
ATOM   1081 C  CA  . ALA A 1 174 ? 21.303 10.538  45.823  1.00 35.41  ? 170 ALA A CA  1 
ATOM   1082 C  C   . ALA A 1 174 ? 21.850 11.961  45.887  1.00 37.34  ? 170 ALA A C   1 
ATOM   1083 O  O   . ALA A 1 174 ? 21.103 12.942  45.821  1.00 37.96  ? 170 ALA A O   1 
ATOM   1084 C  CB  . ALA A 1 174 ? 21.198 9.965   47.219  1.00 9.92   ? 170 ALA A CB  1 
ATOM   1085 N  N   . TYR A 1 175 ? 23.168 12.058  45.983  1.00 38.12  ? 171 TYR A N   1 
ATOM   1086 C  CA  . TYR A 1 175 ? 23.826 13.339  46.080  1.00 40.02  ? 171 TYR A CA  1 
ATOM   1087 C  C   . TYR A 1 175 ? 23.732 14.214  44.842  1.00 41.64  ? 171 TYR A C   1 
ATOM   1088 O  O   . TYR A 1 175 ? 23.228 15.334  44.920  1.00 40.87  ? 171 TYR A O   1 
ATOM   1089 C  CB  . TYR A 1 175 ? 25.277 13.132  46.458  1.00 38.36  ? 171 TYR A CB  1 
ATOM   1090 C  CG  . TYR A 1 175 ? 26.071 14.407  46.518  1.00 40.39  ? 171 TYR A CG  1 
ATOM   1091 C  CD1 . TYR A 1 175 ? 26.947 14.750  45.489  1.00 41.58  ? 171 TYR A CD1 1 
ATOM   1092 C  CD2 . TYR A 1 175 ? 25.981 15.258  47.623  1.00 40.91  ? 171 TYR A CD2 1 
ATOM   1093 C  CE1 . TYR A 1 175 ? 27.724 15.904  45.563  1.00 41.75  ? 171 TYR A CE1 1 
ATOM   1094 C  CE2 . TYR A 1 175 ? 26.753 16.414  47.706  1.00 41.39  ? 171 TYR A CE2 1 
ATOM   1095 C  CZ  . TYR A 1 175 ? 27.626 16.728  46.672  1.00 43.40  ? 171 TYR A CZ  1 
ATOM   1096 O  OH  . TYR A 1 175 ? 28.428 17.839  46.743  1.00 44.24  ? 171 TYR A OH  1 
ATOM   1097 N  N   . ILE A 1 176 ? 24.213 13.734  43.698  1.00 32.55  ? 172 ILE A N   1 
ATOM   1098 C  CA  . ILE A 1 176 ? 24.144 14.562  42.492  1.00 31.91  ? 172 ILE A CA  1 
ATOM   1099 C  C   . ILE A 1 176 ? 22.680 14.825  42.095  1.00 32.08  ? 172 ILE A C   1 
ATOM   1100 O  O   . ILE A 1 176 ? 22.361 15.890  41.592  1.00 34.82  ? 172 ILE A O   1 
ATOM   1101 C  CB  . ILE A 1 176 ? 24.900 13.924  41.282  1.00 29.61  ? 172 ILE A CB  1 
ATOM   1102 C  CG1 . ILE A 1 176 ? 24.281 12.575  40.927  1.00 28.63  ? 172 ILE A CG1 1 
ATOM   1103 C  CG2 . ILE A 1 176 ? 26.375 13.741  41.600  1.00 31.73  ? 172 ILE A CG2 1 
ATOM   1104 C  CD1 . ILE A 1 176 ? 24.789 12.022  39.612  1.00 29.88  ? 172 ILE A CD1 1 
ATOM   1105 N  N   . HIS A 1 177 ? 21.789 13.863  42.317  1.00 33.54  ? 173 HIS A N   1 
ATOM   1106 C  CA  . HIS A 1 177 ? 20.396 14.090  41.968  1.00 34.17  ? 173 HIS A CA  1 
ATOM   1107 C  C   . HIS A 1 177 ? 19.794 15.197  42.829  1.00 38.44  ? 173 HIS A C   1 
ATOM   1108 O  O   . HIS A 1 177 ? 18.943 15.961  42.367  1.00 36.86  ? 173 HIS A O   1 
ATOM   1109 C  CB  . HIS A 1 177 ? 19.571 12.816  42.140  1.00 29.69  ? 173 HIS A CB  1 
ATOM   1110 C  CG  . HIS A 1 177 ? 19.771 11.823  41.045  1.00 31.89  ? 173 HIS A CG  1 
ATOM   1111 N  ND1 . HIS A 1 177 ? 19.093 10.623  40.996  1.00 32.96  ? 173 HIS A ND1 1 
ATOM   1112 C  CD2 . HIS A 1 177 ? 20.592 11.840  39.969  1.00 31.01  ? 173 HIS A CD2 1 
ATOM   1113 C  CE1 . HIS A 1 177 ? 19.491 9.944   39.936  1.00 31.44  ? 173 HIS A CE1 1 
ATOM   1114 N  NE2 . HIS A 1 177 ? 20.400 10.660  39.297  1.00 29.82  ? 173 HIS A NE2 1 
ATOM   1115 N  N   . SER A 1 178 ? 20.226 15.279  44.086  1.00 43.70  ? 174 SER A N   1 
ATOM   1116 C  CA  . SER A 1 178 ? 19.709 16.300  44.979  1.00 45.45  ? 174 SER A CA  1 
ATOM   1117 C  C   . SER A 1 178 ? 19.969 17.701  44.395  1.00 47.54  ? 174 SER A C   1 
ATOM   1118 O  O   . SER A 1 178 ? 19.333 18.671  44.800  1.00 47.01  ? 174 SER A O   1 
ATOM   1119 C  CB  . SER A 1 178 ? 20.346 16.180  46.360  1.00 41.79  ? 174 SER A CB  1 
ATOM   1120 O  OG  . SER A 1 178 ? 21.589 16.857  46.395  1.00 43.25  ? 174 SER A OG  1 
ATOM   1121 N  N   . PHE A 1 179 ? 20.904 17.804  43.454  1.00 44.59  ? 175 PHE A N   1 
ATOM   1122 C  CA  . PHE A 1 179 ? 21.207 19.077  42.796  1.00 45.13  ? 175 PHE A CA  1 
ATOM   1123 C  C   . PHE A 1 179 ? 20.472 19.138  41.457  1.00 43.81  ? 175 PHE A C   1 
ATOM   1124 O  O   . PHE A 1 179 ? 20.637 20.098  40.703  1.00 44.12  ? 175 PHE A O   1 
ATOM   1125 C  CB  . PHE A 1 179 ? 22.696 19.224  42.477  1.00 55.50  ? 175 PHE A CB  1 
ATOM   1126 C  CG  . PHE A 1 179 ? 23.557 19.508  43.657  1.00 61.05  ? 175 PHE A CG  1 
ATOM   1127 C  CD1 . PHE A 1 179 ? 23.885 18.503  44.558  1.00 59.17  ? 175 PHE A CD1 1 
ATOM   1128 C  CD2 . PHE A 1 179 ? 24.096 20.776  43.840  1.00 60.73  ? 175 PHE A CD2 1 
ATOM   1129 C  CE1 . PHE A 1 179 ? 24.749 18.758  45.628  1.00 60.37  ? 175 PHE A CE1 1 
ATOM   1130 C  CE2 . PHE A 1 179 ? 24.958 21.044  44.902  1.00 61.64  ? 175 PHE A CE2 1 
ATOM   1131 C  CZ  . PHE A 1 179 ? 25.287 20.033  45.798  1.00 62.77  ? 175 PHE A CZ  1 
ATOM   1132 N  N   . GLY A 1 180 ? 19.687 18.108  41.150  1.00 45.23  ? 176 GLY A N   1 
ATOM   1133 C  CA  . GLY A 1 180 ? 18.978 18.066  39.882  1.00 43.77  ? 176 GLY A CA  1 
ATOM   1134 C  C   . GLY A 1 180 ? 19.857 17.609  38.719  1.00 43.46  ? 176 GLY A C   1 
ATOM   1135 O  O   . GLY A 1 180 ? 19.485 17.753  37.556  1.00 43.05  ? 176 GLY A O   1 
ATOM   1136 N  N   . ILE A 1 181 ? 21.025 17.055  39.029  1.00 49.66  ? 177 ILE A N   1 
ATOM   1137 C  CA  . ILE A 1 181 ? 21.960 16.588  38.014  1.00 49.26  ? 177 ILE A CA  1 
ATOM   1138 C  C   . ILE A 1 181 ? 21.826 15.097  37.756  1.00 49.07  ? 177 ILE A C   1 
ATOM   1139 O  O   . ILE A 1 181 ? 21.719 14.312  38.685  1.00 47.06  ? 177 ILE A O   1 
ATOM   1140 C  CB  . ILE A 1 181 ? 23.407 16.855  38.435  1.00 37.57  ? 177 ILE A CB  1 
ATOM   1141 C  CG1 . ILE A 1 181 ? 23.595 18.342  38.717  1.00 37.84  ? 177 ILE A CG1 1 
ATOM   1142 C  CG2 . ILE A 1 181 ? 24.365 16.412  37.340  1.00 35.75  ? 177 ILE A CG2 1 
ATOM   1143 C  CD1 . ILE A 1 181 ? 25.008 18.694  39.156  1.00 37.35  ? 177 ILE A CD1 1 
ATOM   1144 N  N   . CYS A 1 182 ? 21.846 14.717  36.483  1.00 35.95  ? 178 CYS A N   1 
ATOM   1145 C  CA  . CYS A 1 182 ? 21.736 13.321  36.082  1.00 34.16  ? 178 CYS A CA  1 
ATOM   1146 C  C   . CYS A 1 182 ? 23.051 12.954  35.383  1.00 33.23  ? 178 CYS A C   1 
ATOM   1147 O  O   . CYS A 1 182 ? 23.518 13.697  34.503  1.00 33.57  ? 178 CYS A O   1 
ATOM   1148 C  CB  . CYS A 1 182 ? 20.556 13.164  35.137  1.00 43.18  ? 178 CYS A CB  1 
ATOM   1149 S  SG  . CYS A 1 182 ? 20.158 11.491  34.682  1.00 45.32  ? 178 CYS A SG  1 
ATOM   1150 N  N   . HIS A 1 183 ? 23.655 11.831  35.797  1.00 29.18  ? 179 HIS A N   1 
ATOM   1151 C  CA  . HIS A 1 183 ? 24.927 11.386  35.227  1.00 27.31  ? 179 HIS A CA  1 
ATOM   1152 C  C   . HIS A 1 183 ? 24.776 10.970  33.759  1.00 27.66  ? 179 HIS A C   1 
ATOM   1153 O  O   . HIS A 1 183 ? 25.590 11.337  32.906  1.00 26.21  ? 179 HIS A O   1 
ATOM   1154 C  CB  . HIS A 1 183 ? 25.499 10.232  36.052  1.00 27.99  ? 179 HIS A CB  1 
ATOM   1155 C  CG  . HIS A 1 183 ? 26.870 9.807   35.625  1.00 28.56  ? 179 HIS A CG  1 
ATOM   1156 N  ND1 . HIS A 1 183 ? 27.101 9.053   34.494  1.00 29.03  ? 179 HIS A ND1 1 
ATOM   1157 C  CD2 . HIS A 1 183 ? 28.088 10.057  36.161  1.00 28.78  ? 179 HIS A CD2 1 
ATOM   1158 C  CE1 . HIS A 1 183 ? 28.398 8.858   34.350  1.00 27.05  ? 179 HIS A CE1 1 
ATOM   1159 N  NE2 . HIS A 1 183 ? 29.021 9.457   35.348  1.00 29.64  ? 179 HIS A NE2 1 
ATOM   1160 N  N   . ARG A 1 184 ? 23.742 10.189  33.475  1.00 35.58  ? 180 ARG A N   1 
ATOM   1161 C  CA  . ARG A 1 184 ? 23.452 9.752   32.123  1.00 38.38  ? 180 ARG A CA  1 
ATOM   1162 C  C   . ARG A 1 184 ? 24.443 8.775   31.473  1.00 38.92  ? 180 ARG A C   1 
ATOM   1163 O  O   . ARG A 1 184 ? 24.435 8.593   30.261  1.00 41.04  ? 180 ARG A O   1 
ATOM   1164 C  CB  . ARG A 1 184 ? 23.240 10.983  31.223  1.00 28.92  ? 180 ARG A CB  1 
ATOM   1165 C  CG  . ARG A 1 184 ? 22.189 11.963  31.771  1.00 30.98  ? 180 ARG A CG  1 
ATOM   1166 C  CD  . ARG A 1 184 ? 21.578 12.854  30.703  1.00 29.70  ? 180 ARG A CD  1 
ATOM   1167 N  NE  . ARG A 1 184 ? 22.569 13.699  30.058  1.00 29.82  ? 180 ARG A NE  1 
ATOM   1168 C  CZ  . ARG A 1 184 ? 22.302 14.517  29.041  1.00 29.49  ? 180 ARG A CZ  1 
ATOM   1169 N  NH1 . ARG A 1 184 ? 21.068 14.607  28.544  1.00 28.81  ? 180 ARG A NH1 1 
ATOM   1170 N  NH2 . ARG A 1 184 ? 23.270 15.251  28.525  1.00 28.31  ? 180 ARG A NH2 1 
ATOM   1171 N  N   . ASP A 1 185 ? 25.294 8.137   32.259  1.00 37.89  ? 181 ASP A N   1 
ATOM   1172 C  CA  . ASP A 1 185 ? 26.211 7.159   31.693  1.00 36.93  ? 181 ASP A CA  1 
ATOM   1173 C  C   . ASP A 1 185 ? 26.722 6.202   32.769  1.00 34.45  ? 181 ASP A C   1 
ATOM   1174 O  O   . ASP A 1 185 ? 27.914 5.891   32.846  1.00 36.33  ? 181 ASP A O   1 
ATOM   1175 C  CB  . ASP A 1 185 ? 27.377 7.843   30.983  1.00 52.46  ? 181 ASP A CB  1 
ATOM   1176 C  CG  . ASP A 1 185 ? 28.126 6.890   30.057  1.00 55.80  ? 181 ASP A CG  1 
ATOM   1177 O  OD1 . ASP A 1 185 ? 27.467 5.979   29.498  1.00 56.40  ? 181 ASP A OD1 1 
ATOM   1178 O  OD2 . ASP A 1 185 ? 29.363 7.065   29.880  1.00 58.19  ? 181 ASP A OD2 1 
ATOM   1179 N  N   . ILE A 1 186 ? 25.793 5.741   33.599  1.00 31.61  ? 182 ILE A N   1 
ATOM   1180 C  CA  . ILE A 1 186 ? 26.111 4.822   34.663  1.00 32.39  ? 182 ILE A CA  1 
ATOM   1181 C  C   . ILE A 1 186 ? 26.306 3.448   34.047  1.00 33.71  ? 182 ILE A C   1 
ATOM   1182 O  O   . ILE A 1 186 ? 25.372 2.865   33.503  1.00 33.55  ? 182 ILE A O   1 
ATOM   1183 C  CB  . ILE A 1 186 ? 24.973 4.758   35.687  1.00 32.26  ? 182 ILE A CB  1 
ATOM   1184 C  CG1 . ILE A 1 186 ? 24.797 6.121   36.355  1.00 30.76  ? 182 ILE A CG1 1 
ATOM   1185 C  CG2 . ILE A 1 186 ? 25.261 3.686   36.715  1.00 30.84  ? 182 ILE A CG2 1 
ATOM   1186 C  CD1 . ILE A 1 186 ? 26.009 6.578   37.124  1.00 30.46  ? 182 ILE A CD1 1 
ATOM   1187 N  N   . LYS A 1 187 ? 27.537 2.959   34.125  1.00 26.63  ? 183 LYS A N   1 
ATOM   1188 C  CA  . LYS A 1 187 ? 27.934 1.654   33.615  1.00 27.89  ? 183 LYS A CA  1 
ATOM   1189 C  C   . LYS A 1 187 ? 29.175 1.278   34.423  1.00 27.22  ? 183 LYS A C   1 
ATOM   1190 O  O   . LYS A 1 187 ? 29.850 2.154   34.950  1.00 27.08  ? 183 LYS A O   1 
ATOM   1191 C  CB  . LYS A 1 187 ? 28.274 1.745   32.133  1.00 18.30  ? 183 LYS A CB  1 
ATOM   1192 C  CG  . LYS A 1 187 ? 29.393 2.730   31.827  1.00 18.77  ? 183 LYS A CG  1 
ATOM   1193 C  CD  . LYS A 1 187 ? 29.510 2.910   30.356  1.00 23.68  ? 183 LYS A CD  1 
ATOM   1194 C  CE  . LYS A 1 187 ? 30.650 3.808   30.000  1.00 25.15  ? 183 LYS A CE  1 
ATOM   1195 N  NZ  . LYS A 1 187 ? 30.673 3.950   28.513  1.00 31.24  ? 183 LYS A NZ  1 
ATOM   1196 N  N   . PRO A 1 188 ? 29.505 -0.025  34.505  1.00 33.46  ? 184 PRO A N   1 
ATOM   1197 C  CA  . PRO A 1 188 ? 30.666 -0.523  35.261  1.00 33.04  ? 184 PRO A CA  1 
ATOM   1198 C  C   . PRO A 1 188 ? 31.980 0.197   35.017  1.00 33.64  ? 184 PRO A C   1 
ATOM   1199 O  O   . PRO A 1 188 ? 32.776 0.351   35.923  1.00 31.31  ? 184 PRO A O   1 
ATOM   1200 C  CB  . PRO A 1 188 ? 30.740 -1.990  34.865  1.00 26.09  ? 184 PRO A CB  1 
ATOM   1201 C  CG  . PRO A 1 188 ? 29.326 -2.316  34.540  1.00 24.72  ? 184 PRO A CG  1 
ATOM   1202 C  CD  . PRO A 1 188 ? 28.887 -1.116  33.737  1.00 22.66  ? 184 PRO A CD  1 
ATOM   1203 N  N   . GLN A 1 189 ? 32.207 0.634   33.792  1.00 28.46  ? 185 GLN A N   1 
ATOM   1204 C  CA  . GLN A 1 189 ? 33.429 1.340   33.452  1.00 30.69  ? 185 GLN A CA  1 
ATOM   1205 C  C   . GLN A 1 189 ? 33.575 2.726   34.120  1.00 29.04  ? 185 GLN A C   1 
ATOM   1206 O  O   . GLN A 1 189 ? 34.677 3.272   34.202  1.00 26.20  ? 185 GLN A O   1 
ATOM   1207 C  CB  . GLN A 1 189 ? 33.507 1.463   31.932  1.00 35.40  ? 185 GLN A CB  1 
ATOM   1208 C  CG  . GLN A 1 189 ? 34.542 2.407   31.391  1.00 42.57  ? 185 GLN A CG  1 
ATOM   1209 C  CD  . GLN A 1 189 ? 35.953 2.089   31.841  1.00 46.92  ? 185 GLN A CD  1 
ATOM   1210 O  OE1 . GLN A 1 189 ? 36.257 0.958   32.247  1.00 52.36  ? 185 GLN A OE1 1 
ATOM   1211 N  NE2 . GLN A 1 189 ? 36.840 3.088   31.750  1.00 47.72  ? 185 GLN A NE2 1 
ATOM   1212 N  N   . ASN A 1 190 ? 32.477 3.307   34.597  1.00 31.33  ? 186 ASN A N   1 
ATOM   1213 C  CA  . ASN A 1 190 ? 32.575 4.612   35.230  1.00 32.69  ? 186 ASN A CA  1 
ATOM   1214 C  C   . ASN A 1 190 ? 32.467 4.499   36.741  1.00 30.71  ? 186 ASN A C   1 
ATOM   1215 O  O   . ASN A 1 190 ? 32.135 5.461   37.434  1.00 29.65  ? 186 ASN A O   1 
ATOM   1216 C  CB  . ASN A 1 190 ? 31.506 5.564   34.689  1.00 35.94  ? 186 ASN A CB  1 
ATOM   1217 C  CG  . ASN A 1 190 ? 31.766 5.984   33.256  1.00 38.03  ? 186 ASN A CG  1 
ATOM   1218 O  OD1 . ASN A 1 190 ? 32.910 6.185   32.852  1.00 40.83  ? 186 ASN A OD1 1 
ATOM   1219 N  ND2 . ASN A 1 190 ? 30.701 6.132   32.481  1.00 38.38  ? 186 ASN A ND2 1 
ATOM   1220 N  N   . LEU A 1 191 ? 32.763 3.314   37.246  1.00 35.12  ? 187 LEU A N   1 
ATOM   1221 C  CA  . LEU A 1 191 ? 32.717 3.059   38.673  1.00 35.69  ? 187 LEU A CA  1 
ATOM   1222 C  C   . LEU A 1 191 ? 34.115 2.656   39.135  1.00 38.31  ? 187 LEU A C   1 
ATOM   1223 O  O   . LEU A 1 191 ? 34.521 1.517   38.934  1.00 37.13  ? 187 LEU A O   1 
ATOM   1224 C  CB  . LEU A 1 191 ? 31.700 1.944   38.968  1.00 22.89  ? 187 LEU A CB  1 
ATOM   1225 C  CG  . LEU A 1 191 ? 30.264 2.261   38.510  1.00 25.48  ? 187 LEU A CG  1 
ATOM   1226 C  CD1 . LEU A 1 191 ? 29.327 1.157   38.961  1.00 22.36  ? 187 LEU A CD1 1 
ATOM   1227 C  CD2 . LEU A 1 191 ? 29.800 3.606   39.105  1.00 25.37  ? 187 LEU A CD2 1 
ATOM   1228 N  N   . LEU A 1 192 ? 34.853 3.592   39.737  1.00 31.74  ? 188 LEU A N   1 
ATOM   1229 C  CA  . LEU A 1 192 ? 36.201 3.305   40.207  1.00 32.93  ? 188 LEU A CA  1 
ATOM   1230 C  C   . LEU A 1 192 ? 36.240 2.666   41.603  1.00 33.62  ? 188 LEU A C   1 
ATOM   1231 O  O   . LEU A 1 192 ? 35.370 2.919   42.445  1.00 32.37  ? 188 LEU A O   1 
ATOM   1232 C  CB  . LEU A 1 192 ? 37.026 4.579   40.182  1.00 34.98  ? 188 LEU A CB  1 
ATOM   1233 C  CG  . LEU A 1 192 ? 36.945 5.322   38.843  1.00 37.90  ? 188 LEU A CG  1 
ATOM   1234 C  CD1 . LEU A 1 192 ? 37.876 6.519   38.877  1.00 37.31  ? 188 LEU A CD1 1 
ATOM   1235 C  CD2 . LEU A 1 192 ? 37.324 4.399   37.688  1.00 36.60  ? 188 LEU A CD2 1 
ATOM   1236 N  N   . LEU A 1 193 ? 37.257 1.836   41.842  1.00 46.88  ? 189 LEU A N   1 
ATOM   1237 C  CA  . LEU A 1 193 ? 37.411 1.129   43.113  1.00 49.18  ? 189 LEU A CA  1 
ATOM   1238 C  C   . LEU A 1 193 ? 38.814 1.090   43.642  1.00 48.54  ? 189 LEU A C   1 
ATOM   1239 O  O   . LEU A 1 193 ? 39.757 0.897   42.892  1.00 46.69  ? 189 LEU A O   1 
ATOM   1240 C  CB  . LEU A 1 193 ? 37.036 -0.335  42.972  1.00 41.70  ? 189 LEU A CB  1 
ATOM   1241 C  CG  . LEU A 1 193 ? 35.656 -0.808  42.587  1.00 45.61  ? 189 LEU A CG  1 
ATOM   1242 C  CD1 . LEU A 1 193 ? 35.740 -2.301  42.356  1.00 43.52  ? 189 LEU A CD1 1 
ATOM   1243 C  CD2 . LEU A 1 193 ? 34.666 -0.479  43.687  1.00 46.96  ? 189 LEU A CD2 1 
ATOM   1244 N  N   . ASP A 1 194 ? 38.953 1.249   44.944  1.00 40.76  ? 190 ASP A N   1 
ATOM   1245 C  CA  . ASP A 1 194 ? 40.256 1.092   45.548  1.00 43.65  ? 190 ASP A CA  1 
ATOM   1246 C  C   . ASP A 1 194 ? 40.122 -0.323  46.118  1.00 45.04  ? 190 ASP A C   1 
ATOM   1247 O  O   . ASP A 1 194 ? 39.264 -0.581  46.970  1.00 44.11  ? 190 ASP A O   1 
ATOM   1248 C  CB  . ASP A 1 194 ? 40.497 2.080   46.671  1.00 74.30  ? 190 ASP A CB  1 
ATOM   1249 C  CG  . ASP A 1 194 ? 41.806 1.824   47.369  1.00 78.44  ? 190 ASP A CG  1 
ATOM   1250 O  OD1 . ASP A 1 194 ? 41.939 0.753   47.992  1.00 78.42  ? 190 ASP A OD1 1 
ATOM   1251 O  OD2 . ASP A 1 194 ? 42.709 2.678   47.283  1.00 81.31  ? 190 ASP A OD2 1 
ATOM   1252 N  N   . PRO A 1 195 ? 40.953 -1.262  45.650  1.00 53.05  ? 191 PRO A N   1 
ATOM   1253 C  CA  . PRO A 1 195 ? 40.913 -2.656  46.106  1.00 54.53  ? 191 PRO A CA  1 
ATOM   1254 C  C   . PRO A 1 195 ? 41.004 -2.862  47.622  1.00 54.73  ? 191 PRO A C   1 
ATOM   1255 O  O   . PRO A 1 195 ? 40.199 -3.597  48.206  1.00 56.14  ? 191 PRO A O   1 
ATOM   1256 C  CB  . PRO A 1 195 ? 42.102 -3.292  45.384  1.00 69.00  ? 191 PRO A CB  1 
ATOM   1257 C  CG  . PRO A 1 195 ? 42.317 -2.404  44.191  1.00 69.69  ? 191 PRO A CG  1 
ATOM   1258 C  CD  . PRO A 1 195 ? 42.108 -1.039  44.769  1.00 67.45  ? 191 PRO A CD  1 
ATOM   1259 N  N   . ASP A 1 196 ? 41.986 -2.211  48.246  1.00 58.94  ? 192 ASP A N   1 
ATOM   1260 C  CA  . ASP A 1 196 ? 42.221 -2.348  49.679  1.00 59.02  ? 192 ASP A CA  1 
ATOM   1261 C  C   . ASP A 1 196 ? 41.167 -1.764  50.609  1.00 59.25  ? 192 ASP A C   1 
ATOM   1262 O  O   . ASP A 1 196 ? 40.840 -2.378  51.622  1.00 59.70  ? 192 ASP A O   1 
ATOM   1263 C  CB  . ASP A 1 196 ? 43.580 -1.756  50.053  1.00 76.20  ? 192 ASP A CB  1 
ATOM   1264 C  CG  . ASP A 1 196 ? 44.722 -2.371  49.270  1.00 78.77  ? 192 ASP A CG  1 
ATOM   1265 O  OD1 . ASP A 1 196 ? 44.722 -3.606  49.075  1.00 76.63  ? 192 ASP A OD1 1 
ATOM   1266 O  OD2 . ASP A 1 196 ? 45.631 -1.617  48.860  1.00 80.10  ? 192 ASP A OD2 1 
ATOM   1267 N  N   . THR A 1 197 ? 40.634 -0.590  50.280  1.00 56.88  ? 193 THR A N   1 
ATOM   1268 C  CA  . THR A 1 197 ? 39.639 0.040   51.140  1.00 54.76  ? 193 THR A CA  1 
ATOM   1269 C  C   . THR A 1 197 ? 38.190 -0.212  50.781  1.00 52.48  ? 193 THR A C   1 
ATOM   1270 O  O   . THR A 1 197 ? 37.315 0.083   51.582  1.00 52.21  ? 193 THR A O   1 
ATOM   1271 C  CB  . THR A 1 197 ? 39.833 1.535   51.188  1.00 46.68  ? 193 THR A CB  1 
ATOM   1272 O  OG1 . THR A 1 197 ? 39.619 2.069   49.879  1.00 47.53  ? 193 THR A OG1 1 
ATOM   1273 C  CG2 . THR A 1 197 ? 41.245 1.865   51.659  1.00 46.26  ? 193 THR A CG2 1 
ATOM   1274 N  N   . ALA A 1 198 ? 37.936 -0.744  49.588  1.00 50.19  ? 194 ALA A N   1 
ATOM   1275 C  CA  . ALA A 1 198 ? 36.575 -1.034  49.139  1.00 48.28  ? 194 ALA A CA  1 
ATOM   1276 C  C   . ALA A 1 198 ? 35.782 0.248   48.891  1.00 46.35  ? 194 ALA A C   1 
ATOM   1277 O  O   . ALA A 1 198 ? 34.548 0.252   48.882  1.00 44.05  ? 194 ALA A O   1 
ATOM   1278 C  CB  . ALA A 1 198 ? 35.858 -1.893  50.164  1.00 19.26  ? 194 ALA A CB  1 
ATOM   1279 N  N   . VAL A 1 199 ? 36.499 1.342   48.691  1.00 39.77  ? 195 VAL A N   1 
ATOM   1280 C  CA  . VAL A 1 199 ? 35.852 2.608   48.432  1.00 38.61  ? 195 VAL A CA  1 
ATOM   1281 C  C   . VAL A 1 199 ? 35.538 2.684   46.962  1.00 37.68  ? 195 VAL A C   1 
ATOM   1282 O  O   . VAL A 1 199 ? 36.361 2.313   46.130  1.00 39.19  ? 195 VAL A O   1 
ATOM   1283 C  CB  . VAL A 1 199 ? 36.768 3.785   48.825  1.00 33.06  ? 195 VAL A CB  1 
ATOM   1284 C  CG1 . VAL A 1 199 ? 36.309 5.083   48.150  1.00 32.02  ? 195 VAL A CG1 1 
ATOM   1285 C  CG2 . VAL A 1 199 ? 36.748 3.936   50.333  1.00 30.08  ? 195 VAL A CG2 1 
ATOM   1286 N  N   . LEU A 1 200 ? 34.338 3.154   46.648  1.00 45.29  ? 196 LEU A N   1 
ATOM   1287 C  CA  . LEU A 1 200 ? 33.931 3.304   45.259  1.00 43.88  ? 196 LEU A CA  1 
ATOM   1288 C  C   . LEU A 1 200 ? 33.672 4.775   44.916  1.00 45.93  ? 196 LEU A C   1 
ATOM   1289 O  O   . LEU A 1 200 ? 33.092 5.512   45.700  1.00 46.58  ? 196 LEU A O   1 
ATOM   1290 C  CB  . LEU A 1 200 ? 32.683 2.480   44.999  1.00 20.06  ? 196 LEU A CB  1 
ATOM   1291 C  CG  . LEU A 1 200 ? 32.099 2.498   43.596  1.00 22.32  ? 196 LEU A CG  1 
ATOM   1292 C  CD1 . LEU A 1 200 ? 31.253 1.258   43.417  1.00 21.47  ? 196 LEU A CD1 1 
ATOM   1293 C  CD2 . LEU A 1 200 ? 31.271 3.748   43.388  1.00 20.23  ? 196 LEU A CD2 1 
ATOM   1294 N  N   . LYS A 1 201 ? 34.116 5.202   43.743  1.00 41.05  ? 197 LYS A N   1 
ATOM   1295 C  CA  . LYS A 1 201 ? 33.910 6.574   43.318  1.00 41.67  ? 197 LYS A CA  1 
ATOM   1296 C  C   . LYS A 1 201 ? 33.324 6.600   41.909  1.00 39.91  ? 197 LYS A C   1 
ATOM   1297 O  O   . LYS A 1 201 ? 33.778 5.888   41.023  1.00 37.34  ? 197 LYS A O   1 
ATOM   1298 C  CB  . LYS A 1 201 ? 35.231 7.354   43.330  1.00 30.33  ? 197 LYS A CB  1 
ATOM   1299 C  CG  . LYS A 1 201 ? 35.780 7.695   44.710  1.00 32.44  ? 197 LYS A CG  1 
ATOM   1300 C  CD  . LYS A 1 201 ? 37.137 8.380   44.564  1.00 37.25  ? 197 LYS A CD  1 
ATOM   1301 C  CE  . LYS A 1 201 ? 37.830 8.637   45.892  1.00 38.74  ? 197 LYS A CE  1 
ATOM   1302 N  NZ  . LYS A 1 201 ? 37.260 9.812   46.595  1.00 43.39  ? 197 LYS A NZ  1 
ATOM   1303 N  N   . LEU A 1 202 ? 32.305 7.424   41.711  1.00 27.68  ? 198 LEU A N   1 
ATOM   1304 C  CA  . LEU A 1 202 ? 31.664 7.574   40.409  1.00 27.46  ? 198 LEU A CA  1 
ATOM   1305 C  C   . LEU A 1 202 ? 32.504 8.548   39.599  1.00 29.48  ? 198 LEU A C   1 
ATOM   1306 O  O   . LEU A 1 202 ? 33.002 9.524   40.138  1.00 29.67  ? 198 LEU A O   1 
ATOM   1307 C  CB  . LEU A 1 202 ? 30.262 8.130   40.610  1.00 29.37  ? 198 LEU A CB  1 
ATOM   1308 C  CG  . LEU A 1 202 ? 29.460 8.497   39.385  1.00 33.04  ? 198 LEU A CG  1 
ATOM   1309 C  CD1 . LEU A 1 202 ? 29.290 7.288   38.485  1.00 29.87  ? 198 LEU A CD1 1 
ATOM   1310 C  CD2 . LEU A 1 202 ? 28.116 9.026   39.857  1.00 31.94  ? 198 LEU A CD2 1 
ATOM   1311 N  N   . CYS A 1 203 ? 32.685 8.293   38.312  1.00 32.15  ? 199 CYS A N   1 
ATOM   1312 C  CA  . CYS A 1 203 ? 33.488 9.208   37.511  1.00 35.40  ? 199 CYS A CA  1 
ATOM   1313 C  C   . CYS A 1 203 ? 32.893 9.470   36.141  1.00 35.84  ? 199 CYS A C   1 
ATOM   1314 O  O   . CYS A 1 203 ? 31.812 8.988   35.827  1.00 34.91  ? 199 CYS A O   1 
ATOM   1315 C  CB  . CYS A 1 203 ? 34.914 8.678   37.354  1.00 34.83  ? 199 CYS A CB  1 
ATOM   1316 S  SG  . CYS A 1 203 ? 34.989 7.143   36.432  1.00 35.75  ? 199 CYS A SG  1 
ATOM   1317 N  N   . ASP A 1 204 ? 33.627 10.241  35.341  1.00 33.87  ? 200 ASP A N   1 
ATOM   1318 C  CA  . ASP A 1 204 ? 33.241 10.633  33.986  1.00 34.52  ? 200 ASP A CA  1 
ATOM   1319 C  C   . ASP A 1 204 ? 31.908 11.371  33.908  1.00 35.54  ? 200 ASP A C   1 
ATOM   1320 O  O   . ASP A 1 204 ? 30.862 10.767  33.664  1.00 35.03  ? 200 ASP A O   1 
ATOM   1321 C  CB  . ASP A 1 204 ? 33.186 9.431   33.056  1.00 55.91  ? 200 ASP A CB  1 
ATOM   1322 C  CG  . ASP A 1 204 ? 33.415 9.820   31.608  1.00 64.28  ? 200 ASP A CG  1 
ATOM   1323 O  OD1 . ASP A 1 204 ? 33.396 11.034  31.307  1.00 65.51  ? 200 ASP A OD1 1 
ATOM   1324 O  OD2 . ASP A 1 204 ? 33.615 8.911   30.775  1.00 65.73  ? 200 ASP A OD2 1 
ATOM   1325 N  N   . PHE A 1 205 ? 31.959 12.686  34.099  1.00 34.44  ? 201 PHE A N   1 
ATOM   1326 C  CA  . PHE A 1 205 ? 30.764 13.485  34.052  1.00 33.82  ? 201 PHE A CA  1 
ATOM   1327 C  C   . PHE A 1 205 ? 30.588 14.183  32.732  1.00 33.45  ? 201 PHE A C   1 
ATOM   1328 O  O   . PHE A 1 205 ? 29.857 15.158  32.630  1.00 35.12  ? 201 PHE A O   1 
ATOM   1329 C  CB  . PHE A 1 205 ? 30.769 14.486  35.194  1.00 32.07  ? 201 PHE A CB  1 
ATOM   1330 C  CG  . PHE A 1 205 ? 30.480 13.859  36.531  1.00 32.08  ? 201 PHE A CG  1 
ATOM   1331 C  CD1 . PHE A 1 205 ? 31.437 13.060  37.163  1.00 33.22  ? 201 PHE A CD1 1 
ATOM   1332 C  CD2 . PHE A 1 205 ? 29.230 14.024  37.130  1.00 31.06  ? 201 PHE A CD2 1 
ATOM   1333 C  CE1 . PHE A 1 205 ? 31.156 12.440  38.356  1.00 33.22  ? 201 PHE A CE1 1 
ATOM   1334 C  CE2 . PHE A 1 205 ? 28.937 13.406  38.327  1.00 31.08  ? 201 PHE A CE2 1 
ATOM   1335 C  CZ  . PHE A 1 205 ? 29.904 12.607  38.946  1.00 32.57  ? 201 PHE A CZ  1 
ATOM   1336 N  N   . GLY A 1 206 ? 31.245 13.656  31.709  1.00 29.53  ? 202 GLY A N   1 
ATOM   1337 C  CA  . GLY A 1 206 ? 31.151 14.236  30.391  1.00 27.56  ? 202 GLY A CA  1 
ATOM   1338 C  C   . GLY A 1 206 ? 29.770 14.161  29.780  1.00 30.07  ? 202 GLY A C   1 
ATOM   1339 O  O   . GLY A 1 206 ? 29.571 14.717  28.719  1.00 29.01  ? 202 GLY A O   1 
ATOM   1340 N  N   . SER A 1 207 ? 28.820 13.498  30.427  1.00 25.22  ? 203 SER A N   1 
ATOM   1341 C  CA  . SER A 1 207 ? 27.468 13.388  29.871  1.00 24.88  ? 203 SER A CA  1 
ATOM   1342 C  C   . SER A 1 207 ? 26.419 13.919  30.861  1.00 23.67  ? 203 SER A C   1 
ATOM   1343 O  O   . SER A 1 207 ? 25.211 13.996  30.547  1.00 22.72  ? 203 SER A O   1 
ATOM   1344 C  CB  . SER A 1 207 ? 27.131 11.923  29.543  1.00 38.00  ? 203 SER A CB  1 
ATOM   1345 O  OG  . SER A 1 207 ? 28.188 11.292  28.845  1.00 41.26  ? 203 SER A OG  1 
ATOM   1346 N  N   . ALA A 1 208 ? 26.885 14.269  32.060  1.00 25.39  ? 204 ALA A N   1 
ATOM   1347 C  CA  . ALA A 1 208 ? 26.027 14.778  33.120  1.00 27.30  ? 204 ALA A CA  1 
ATOM   1348 C  C   . ALA A 1 208 ? 25.351 16.085  32.708  1.00 28.76  ? 204 ALA A C   1 
ATOM   1349 O  O   . ALA A 1 208 ? 25.939 16.916  32.003  1.00 28.16  ? 204 ALA A O   1 
ATOM   1350 C  CB  . ALA A 1 208 ? 26.864 14.990  34.386  1.00 24.48  ? 204 ALA A CB  1 
ATOM   1351 N  N   . LYS A 1 209 ? 24.123 16.272  33.170  1.00 40.21  ? 205 LYS A N   1 
ATOM   1352 C  CA  . LYS A 1 209 ? 23.364 17.474  32.847  1.00 42.63  ? 205 LYS A CA  1 
ATOM   1353 C  C   . LYS A 1 209 ? 22.252 17.810  33.853  1.00 43.25  ? 205 LYS A C   1 
ATOM   1354 O  O   . LYS A 1 209 ? 21.591 16.924  34.407  1.00 41.40  ? 205 LYS A O   1 
ATOM   1355 C  CB  . LYS A 1 209 ? 22.768 17.330  31.439  1.00 40.20  ? 205 LYS A CB  1 
ATOM   1356 C  CG  . LYS A 1 209 ? 21.676 18.339  31.090  1.00 43.77  ? 205 LYS A CG  1 
ATOM   1357 C  CD  . LYS A 1 209 ? 21.897 18.953  29.698  1.00 47.75  ? 205 LYS A CD  1 
ATOM   1358 C  CE  . LYS A 1 209 ? 20.757 19.881  29.282  1.00 47.13  ? 205 LYS A CE  1 
ATOM   1359 N  NZ  . LYS A 1 209 ? 19.558 19.109  28.850  1.00 48.59  ? 205 LYS A NZ  1 
ATOM   1360 N  N   . GLN A 1 210 ? 22.067 19.105  34.087  1.00 53.76  ? 206 GLN A N   1 
ATOM   1361 C  CA  . GLN A 1 210 ? 21.021 19.602  34.970  1.00 56.05  ? 206 GLN A CA  1 
ATOM   1362 C  C   . GLN A 1 210 ? 19.690 19.356  34.240  1.00 54.56  ? 206 GLN A C   1 
ATOM   1363 O  O   . GLN A 1 210 ? 19.436 19.975  33.213  1.00 58.23  ? 206 GLN A O   1 
ATOM   1364 C  CB  . GLN A 1 210 ? 21.234 21.100  35.175  1.00 76.33  ? 206 GLN A CB  1 
ATOM   1365 C  CG  . GLN A 1 210 ? 20.098 21.849  35.849  1.00 83.28  ? 206 GLN A CG  1 
ATOM   1366 C  CD  . GLN A 1 210 ? 20.156 21.758  37.353  1.00 86.18  ? 206 GLN A CD  1 
ATOM   1367 O  OE1 . GLN A 1 210 ? 21.200 22.017  37.962  1.00 86.67  ? 206 GLN A OE1 1 
ATOM   1368 N  NE2 . GLN A 1 210 ? 19.035 21.393  37.968  1.00 87.29  ? 206 GLN A NE2 1 
ATOM   1369 N  N   . LEU A 1 211 ? 18.846 18.454  34.733  1.00 39.08  ? 207 LEU A N   1 
ATOM   1370 C  CA  . LEU A 1 211 ? 17.574 18.195  34.050  1.00 40.01  ? 207 LEU A CA  1 
ATOM   1371 C  C   . LEU A 1 211 ? 16.454 19.044  34.635  1.00 42.84  ? 207 LEU A C   1 
ATOM   1372 O  O   . LEU A 1 211 ? 16.099 18.900  35.806  1.00 43.48  ? 207 LEU A O   1 
ATOM   1373 C  CB  . LEU A 1 211 ? 17.181 16.718  34.142  1.00 37.19  ? 207 LEU A CB  1 
ATOM   1374 C  CG  . LEU A 1 211 ? 18.054 15.586  33.572  1.00 35.43  ? 207 LEU A CG  1 
ATOM   1375 C  CD1 . LEU A 1 211 ? 17.224 14.307  33.585  1.00 34.49  ? 207 LEU A CD1 1 
ATOM   1376 C  CD2 . LEU A 1 211 ? 18.523 15.896  32.151  1.00 33.18  ? 207 LEU A CD2 1 
ATOM   1377 N  N   . VAL A 1 212 ? 15.888 19.918  33.806  1.00 52.99  ? 208 VAL A N   1 
ATOM   1378 C  CA  . VAL A 1 212 ? 14.819 20.828  34.222  1.00 54.87  ? 208 VAL A CA  1 
ATOM   1379 C  C   . VAL A 1 212 ? 13.434 20.451  33.697  1.00 55.31  ? 208 VAL A C   1 
ATOM   1380 O  O   . VAL A 1 212 ? 13.213 20.419  32.489  1.00 54.78  ? 208 VAL A O   1 
ATOM   1381 C  CB  . VAL A 1 212 ? 15.141 22.250  33.752  1.00 50.84  ? 208 VAL A CB  1 
ATOM   1382 C  CG1 . VAL A 1 212 ? 13.967 23.160  34.011  1.00 51.66  ? 208 VAL A CG1 1 
ATOM   1383 C  CG2 . VAL A 1 212 ? 16.396 22.753  34.456  1.00 49.01  ? 208 VAL A CG2 1 
ATOM   1384 N  N   . ARG A 1 213 ? 12.501 20.183  34.607  1.00 60.30  ? 209 ARG A N   1 
ATOM   1385 C  CA  . ARG A 1 213 ? 11.137 19.812  34.231  1.00 64.56  ? 209 ARG A CA  1 
ATOM   1386 C  C   . ARG A 1 213 ? 10.623 20.816  33.197  1.00 64.67  ? 209 ARG A C   1 
ATOM   1387 O  O   . ARG A 1 213 ? 10.511 22.015  33.480  1.00 63.31  ? 209 ARG A O   1 
ATOM   1388 C  CB  . ARG A 1 213 ? 10.243 19.822  35.473  1.00 88.85  ? 209 ARG A CB  1 
ATOM   1389 C  CG  . ARG A 1 213 ? 8.992  18.962  35.398  1.00 95.05  ? 209 ARG A CG  1 
ATOM   1390 C  CD  . ARG A 1 213 ? 8.390  18.834  36.796  1.00 100.42 ? 209 ARG A CD  1 
ATOM   1391 N  NE  . ARG A 1 213 ? 7.256  17.912  36.867  1.00 104.54 ? 209 ARG A NE  1 
ATOM   1392 C  CZ  . ARG A 1 213 ? 6.667  17.533  38.002  1.00 106.91 ? 209 ARG A CZ  1 
ATOM   1393 N  NH1 . ARG A 1 213 ? 7.105  17.997  39.168  1.00 108.21 ? 209 ARG A NH1 1 
ATOM   1394 N  NH2 . ARG A 1 213 ? 5.638  16.690  37.977  1.00 106.93 ? 209 ARG A NH2 1 
ATOM   1395 N  N   . GLY A 1 214 ? 10.330 20.334  31.993  1.00 56.97  ? 210 GLY A N   1 
ATOM   1396 C  CA  . GLY A 1 214 ? 9.852  21.226  30.956  1.00 56.31  ? 210 GLY A CA  1 
ATOM   1397 C  C   . GLY A 1 214 ? 10.807 21.346  29.785  1.00 56.36  ? 210 GLY A C   1 
ATOM   1398 O  O   . GLY A 1 214 ? 10.372 21.556  28.651  1.00 57.44  ? 210 GLY A O   1 
ATOM   1399 N  N   . GLU A 1 215 ? 12.109 21.231  30.035  1.00 76.00  ? 211 GLU A N   1 
ATOM   1400 C  CA  . GLU A 1 215 ? 13.082 21.318  28.946  1.00 74.95  ? 211 GLU A CA  1 
ATOM   1401 C  C   . GLU A 1 215 ? 13.309 19.916  28.371  1.00 72.42  ? 211 GLU A C   1 
ATOM   1402 O  O   . GLU A 1 215 ? 13.165 18.911  29.070  1.00 72.05  ? 211 GLU A O   1 
ATOM   1403 C  CB  . GLU A 1 215 ? 14.404 21.901  29.452  1.00 102.51 ? 211 GLU A CB  1 
ATOM   1404 C  CG  . GLU A 1 215 ? 14.249 23.173  30.280  1.00 108.11 ? 211 GLU A CG  1 
ATOM   1405 C  CD  . GLU A 1 215 ? 15.581 23.735  30.765  1.00 111.73 ? 211 GLU A CD  1 
ATOM   1406 O  OE1 . GLU A 1 215 ? 16.434 22.946  31.234  1.00 113.95 ? 211 GLU A OE1 1 
ATOM   1407 O  OE2 . GLU A 1 215 ? 15.770 24.970  30.690  1.00 113.57 ? 211 GLU A OE2 1 
ATOM   1408 N  N   . PRO A 1 216 ? 13.630 19.828  27.076  1.00 65.26  ? 212 PRO A N   1 
ATOM   1409 C  CA  . PRO A 1 216 ? 13.856 18.504  26.487  1.00 61.96  ? 212 PRO A CA  1 
ATOM   1410 C  C   . PRO A 1 216 ? 15.324 18.116  26.542  1.00 58.77  ? 212 PRO A C   1 
ATOM   1411 O  O   . PRO A 1 216 ? 16.205 18.980  26.624  1.00 56.33  ? 212 PRO A O   1 
ATOM   1412 C  CB  . PRO A 1 216 ? 13.376 18.673  25.042  1.00 53.93  ? 212 PRO A CB  1 
ATOM   1413 C  CG  . PRO A 1 216 ? 12.521 19.908  25.079  1.00 56.35  ? 212 PRO A CG  1 
ATOM   1414 C  CD  . PRO A 1 216 ? 13.279 20.793  26.029  1.00 55.53  ? 212 PRO A CD  1 
ATOM   1415 N  N   . ASN A 1 217 ? 15.583 16.815  26.487  1.00 65.62  ? 213 ASN A N   1 
ATOM   1416 C  CA  . ASN A 1 217 ? 16.949 16.313  26.524  1.00 63.44  ? 213 ASN A CA  1 
ATOM   1417 C  C   . ASN A 1 217 ? 17.125 15.239  25.479  1.00 60.87  ? 213 ASN A C   1 
ATOM   1418 O  O   . ASN A 1 217 ? 16.190 14.476  25.206  1.00 59.80  ? 213 ASN A O   1 
ATOM   1419 C  CB  . ASN A 1 217 ? 17.253 15.743  27.893  1.00 45.72  ? 213 ASN A CB  1 
ATOM   1420 C  CG  . ASN A 1 217 ? 17.005 16.738  28.986  1.00 47.17  ? 213 ASN A CG  1 
ATOM   1421 O  OD1 . ASN A 1 217 ? 17.750 17.708  29.135  1.00 47.04  ? 213 ASN A OD1 1 
ATOM   1422 N  ND2 . ASN A 1 217 ? 15.940 16.517  29.752  1.00 47.48  ? 213 ASN A ND2 1 
ATOM   1423 N  N   . VAL A 1 218 ? 18.319 15.189  24.894  1.00 27.92  ? 214 VAL A N   1 
ATOM   1424 C  CA  . VAL A 1 218 ? 18.615 14.200  23.860  1.00 29.04  ? 214 VAL A CA  1 
ATOM   1425 C  C   . VAL A 1 218 ? 18.416 12.794  24.438  1.00 28.96  ? 214 VAL A C   1 
ATOM   1426 O  O   . VAL A 1 218 ? 18.611 12.565  25.641  1.00 28.14  ? 214 VAL A O   1 
ATOM   1427 C  CB  . VAL A 1 218 ? 20.055 14.378  23.333  1.00 29.95  ? 214 VAL A CB  1 
ATOM   1428 C  CG1 . VAL A 1 218 ? 20.230 15.806  22.821  1.00 29.94  ? 214 VAL A CG1 1 
ATOM   1429 C  CG2 . VAL A 1 218 ? 21.069 14.080  24.441  1.00 28.60  ? 214 VAL A CG2 1 
ATOM   1430 N  N   . SER A 1 219 ? 18.001 11.853  23.601  1.00 36.22  ? 215 SER A N   1 
ATOM   1431 C  CA  . SER A 1 219 ? 17.775 10.509  24.106  1.00 38.22  ? 215 SER A CA  1 
ATOM   1432 C  C   . SER A 1 219 ? 18.823 9.519   23.620  1.00 37.17  ? 215 SER A C   1 
ATOM   1433 O  O   . SER A 1 219 ? 18.684 8.313   23.806  1.00 39.33  ? 215 SER A O   1 
ATOM   1434 C  CB  . SER A 1 219 ? 16.384 10.028  23.714  1.00 42.31  ? 215 SER A CB  1 
ATOM   1435 O  OG  . SER A 1 219 ? 16.271 9.958   22.313  1.00 46.89  ? 215 SER A OG  1 
ATOM   1436 N  N   . TYR A 1 220 ? 19.876 10.024  22.992  1.00 41.67  ? 216 TYR A N   1 
ATOM   1437 C  CA  . TYR A 1 220 ? 20.919 9.142   22.516  1.00 42.15  ? 216 TYR A CA  1 
ATOM   1438 C  C   . TYR A 1 220 ? 22.106 9.076   23.460  1.00 40.53  ? 216 TYR A C   1 
ATOM   1439 O  O   . TYR A 1 220 ? 23.219 8.758   23.044  1.00 38.91  ? 216 TYR A O   1 
ATOM   1440 C  CB  . TYR A 1 220 ? 21.367 9.542   21.104  1.00 37.64  ? 216 TYR A CB  1 
ATOM   1441 C  CG  . TYR A 1 220 ? 21.699 10.994  20.916  1.00 40.37  ? 216 TYR A CG  1 
ATOM   1442 C  CD1 . TYR A 1 220 ? 22.950 11.496  21.265  1.00 40.78  ? 216 TYR A CD1 1 
ATOM   1443 C  CD2 . TYR A 1 220 ? 20.760 11.867  20.408  1.00 40.36  ? 216 TYR A CD2 1 
ATOM   1444 C  CE1 . TYR A 1 220 ? 23.253 12.841  21.113  1.00 41.56  ? 216 TYR A CE1 1 
ATOM   1445 C  CE2 . TYR A 1 220 ? 21.044 13.212  20.253  1.00 40.21  ? 216 TYR A CE2 1 
ATOM   1446 C  CZ  . TYR A 1 220 ? 22.289 13.697  20.607  1.00 42.21  ? 216 TYR A CZ  1 
ATOM   1447 O  OH  . TYR A 1 220 ? 22.554 15.045  20.466  1.00 44.67  ? 216 TYR A OH  1 
ATOM   1448 N  N   . ILE A 1 221 ? 21.869 9.388   24.734  1.00 35.15  ? 217 ILE A N   1 
ATOM   1449 C  CA  . ILE A 1 221 ? 22.926 9.307   25.737  1.00 34.13  ? 217 ILE A CA  1 
ATOM   1450 C  C   . ILE A 1 221 ? 22.796 7.941   26.403  1.00 33.39  ? 217 ILE A C   1 
ATOM   1451 O  O   . ILE A 1 221 ? 21.810 7.239   26.176  1.00 31.38  ? 217 ILE A O   1 
ATOM   1452 C  CB  . ILE A 1 221 ? 22.807 10.436  26.828  1.00 26.42  ? 217 ILE A CB  1 
ATOM   1453 C  CG1 . ILE A 1 221 ? 21.353 10.718  27.164  1.00 25.90  ? 217 ILE A CG1 1 
ATOM   1454 C  CG2 . ILE A 1 221 ? 23.511 11.700  26.376  1.00 28.01  ? 217 ILE A CG2 1 
ATOM   1455 C  CD1 . ILE A 1 221 ? 20.745 9.755   28.119  1.00 22.80  ? 217 ILE A CD1 1 
ATOM   1456 N  N   . CYS A 1 222 ? 23.803 7.567   27.191  1.00 39.74  ? 218 CYS A N   1 
ATOM   1457 C  CA  . CYS A 1 222 ? 23.810 6.300   27.916  1.00 41.04  ? 218 CYS A CA  1 
ATOM   1458 C  C   . CYS A 1 222 ? 24.251 5.084   27.067  1.00 41.19  ? 218 CYS A C   1 
ATOM   1459 O  O   . CYS A 1 222 ? 23.741 4.877   25.974  1.00 41.18  ? 218 CYS A O   1 
ATOM   1460 C  CB  . CYS A 1 222 ? 22.430 6.072   28.503  1.00 50.61  ? 218 CYS A CB  1 
ATOM   1461 S  SG  . CYS A 1 222 ? 22.421 4.922   29.822  1.00 57.20  ? 218 CYS A SG  1 
ATOM   1462 N  N   . SER A 1 223 ? 25.208 4.297   27.570  1.00 36.62  ? 219 SER A N   1 
ATOM   1463 C  CA  . SER A 1 223 ? 25.730 3.113   26.869  1.00 39.39  ? 219 SER A CA  1 
ATOM   1464 C  C   . SER A 1 223 ? 24.783 1.933   26.761  1.00 39.03  ? 219 SER A C   1 
ATOM   1465 O  O   . SER A 1 223 ? 24.013 1.677   27.665  1.00 35.98  ? 219 SER A O   1 
ATOM   1466 C  CB  . SER A 1 223 ? 26.998 2.628   27.546  1.00 39.34  ? 219 SER A CB  1 
ATOM   1467 O  OG  . SER A 1 223 ? 28.043 3.563   27.342  1.00 45.41  ? 219 SER A OG  1 
ATOM   1468 N  N   . ARG A 1 224 ? 24.865 1.189   25.665  1.00 35.68  ? 220 ARG A N   1 
ATOM   1469 C  CA  . ARG A 1 224 ? 23.996 0.023   25.461  1.00 39.08  ? 220 ARG A CA  1 
ATOM   1470 C  C   . ARG A 1 224 ? 24.133 -1.032  26.569  1.00 38.35  ? 220 ARG A C   1 
ATOM   1471 O  O   . ARG A 1 224 ? 25.248 -1.357  26.996  1.00 36.67  ? 220 ARG A O   1 
ATOM   1472 C  CB  . ARG A 1 224 ? 24.303 -0.629  24.117  1.00 85.59  ? 220 ARG A CB  1 
ATOM   1473 C  CG  . ARG A 1 224 ? 25.707 -1.182  24.025  1.00 92.36  ? 220 ARG A CG  1 
ATOM   1474 C  CD  . ARG A 1 224 ? 25.744 -2.377  23.102  1.00 98.18  ? 220 ARG A CD  1 
ATOM   1475 N  NE  . ARG A 1 224 ? 26.990 -3.116  23.248  1.00 101.11 ? 220 ARG A NE  1 
ATOM   1476 C  CZ  . ARG A 1 224 ? 27.210 -4.308  22.709  1.00 101.91 ? 220 ARG A CZ  1 
ATOM   1477 N  NH1 . ARG A 1 224 ? 26.259 -4.889  21.987  1.00 102.18 ? 220 ARG A NH1 1 
ATOM   1478 N  NH2 . ARG A 1 224 ? 28.373 -4.918  22.895  1.00 101.46 ? 220 ARG A NH2 1 
ATOM   1479 N  N   . TYR A 1 225 ? 22.990 -1.567  26.994  1.00 38.78  ? 221 TYR A N   1 
ATOM   1480 C  CA  . TYR A 1 225 ? 22.873 -2.569  28.059  1.00 39.05  ? 221 TYR A CA  1 
ATOM   1481 C  C   . TYR A 1 225 ? 22.343 -1.889  29.298  1.00 37.56  ? 221 TYR A C   1 
ATOM   1482 O  O   . TYR A 1 225 ? 21.668 -2.515  30.122  1.00 34.05  ? 221 TYR A O   1 
ATOM   1483 C  CB  . TYR A 1 225 ? 24.203 -3.190  28.483  1.00 45.41  ? 221 TYR A CB  1 
ATOM   1484 C  CG  . TYR A 1 225 ? 24.841 -4.125  27.512  1.00 49.36  ? 221 TYR A CG  1 
ATOM   1485 C  CD1 . TYR A 1 225 ? 26.050 -4.737  27.822  1.00 51.72  ? 221 TYR A CD1 1 
ATOM   1486 C  CD2 . TYR A 1 225 ? 24.279 -4.357  26.262  1.00 51.56  ? 221 TYR A CD2 1 
ATOM   1487 C  CE1 . TYR A 1 225 ? 26.691 -5.551  26.914  1.00 52.87  ? 221 TYR A CE1 1 
ATOM   1488 C  CE2 . TYR A 1 225 ? 24.914 -5.171  25.335  1.00 56.30  ? 221 TYR A CE2 1 
ATOM   1489 C  CZ  . TYR A 1 225 ? 26.123 -5.765  25.667  1.00 55.55  ? 221 TYR A CZ  1 
ATOM   1490 O  OH  . TYR A 1 225 ? 26.769 -6.563  24.743  1.00 59.29  ? 221 TYR A OH  1 
ATOM   1491 N  N   . TYR A 1 226 ? 22.652 -0.606  29.432  1.00 44.39  ? 222 TYR A N   1 
ATOM   1492 C  CA  . TYR A 1 226 ? 22.246 0.141   30.611  1.00 45.48  ? 222 TYR A CA  1 
ATOM   1493 C  C   . TYR A 1 226 ? 21.175 1.206   30.382  1.00 44.73  ? 222 TYR A C   1 
ATOM   1494 O  O   . TYR A 1 226 ? 20.774 1.889   31.325  1.00 44.98  ? 222 TYR A O   1 
ATOM   1495 C  CB  . TYR A 1 226 ? 23.499 0.770   31.228  1.00 32.14  ? 222 TYR A CB  1 
ATOM   1496 C  CG  . TYR A 1 226 ? 24.599 -0.245  31.401  1.00 34.20  ? 222 TYR A CG  1 
ATOM   1497 C  CD1 . TYR A 1 226 ? 24.517 -1.223  32.392  1.00 32.89  ? 222 TYR A CD1 1 
ATOM   1498 C  CD2 . TYR A 1 226 ? 25.675 -0.292  30.525  1.00 33.12  ? 222 TYR A CD2 1 
ATOM   1499 C  CE1 . TYR A 1 226 ? 25.473 -2.225  32.506  1.00 34.39  ? 222 TYR A CE1 1 
ATOM   1500 C  CE2 . TYR A 1 226 ? 26.648 -1.309  30.626  1.00 34.63  ? 222 TYR A CE2 1 
ATOM   1501 C  CZ  . TYR A 1 226 ? 26.533 -2.272  31.621  1.00 34.84  ? 222 TYR A CZ  1 
ATOM   1502 O  OH  . TYR A 1 226 ? 27.462 -3.293  31.719  1.00 34.71  ? 222 TYR A OH  1 
ATOM   1503 N  N   . ARG A 1 227 ? 20.698 1.338   29.149  1.00 32.98  ? 223 ARG A N   1 
ATOM   1504 C  CA  . ARG A 1 227 ? 19.704 2.354   28.843  1.00 33.46  ? 223 ARG A CA  1 
ATOM   1505 C  C   . ARG A 1 227 ? 18.318 1.981   29.338  1.00 31.67  ? 223 ARG A C   1 
ATOM   1506 O  O   . ARG A 1 227 ? 17.850 0.861   29.109  1.00 28.77  ? 223 ARG A O   1 
ATOM   1507 C  CB  . ARG A 1 227 ? 19.628 2.603   27.340  1.00 33.32  ? 223 ARG A CB  1 
ATOM   1508 C  CG  . ARG A 1 227 ? 20.952 2.513   26.620  1.00 41.39  ? 223 ARG A CG  1 
ATOM   1509 C  CD  . ARG A 1 227 ? 21.115 3.632   25.617  1.00 46.67  ? 223 ARG A CD  1 
ATOM   1510 N  NE  . ARG A 1 227 ? 20.110 3.609   24.558  1.00 47.83  ? 223 ARG A NE  1 
ATOM   1511 C  CZ  . ARG A 1 227 ? 19.590 4.709   24.025  1.00 50.00  ? 223 ARG A CZ  1 
ATOM   1512 N  NH1 . ARG A 1 227 ? 19.987 5.898   24.463  1.00 47.89  ? 223 ARG A NH1 1 
ATOM   1513 N  NH2 . ARG A 1 227 ? 18.680 4.627   23.068  1.00 49.30  ? 223 ARG A NH2 1 
ATOM   1514 N  N   . ALA A 1 228 ? 17.658 2.926   30.010  1.00 39.50  ? 224 ALA A N   1 
ATOM   1515 C  CA  . ALA A 1 228 ? 16.308 2.707   30.514  1.00 39.66  ? 224 ALA A CA  1 
ATOM   1516 C  C   . ALA A 1 228 ? 15.343 2.623   29.328  1.00 38.87  ? 224 ALA A C   1 
ATOM   1517 O  O   . ALA A 1 228 ? 15.563 3.251   28.285  1.00 38.75  ? 224 ALA A O   1 
ATOM   1518 C  CB  . ALA A 1 228 ? 15.908 3.846   31.435  1.00 35.25  ? 224 ALA A CB  1 
ATOM   1519 N  N   . PRO A 1 229 ? 14.254 1.857   29.473  1.00 36.68  ? 225 PRO A N   1 
ATOM   1520 C  CA  . PRO A 1 229 ? 13.254 1.688   28.410  1.00 39.96  ? 225 PRO A CA  1 
ATOM   1521 C  C   . PRO A 1 229 ? 12.825 2.984   27.733  1.00 41.56  ? 225 PRO A C   1 
ATOM   1522 O  O   . PRO A 1 229 ? 12.806 3.053   26.516  1.00 41.04  ? 225 PRO A O   1 
ATOM   1523 C  CB  . PRO A 1 229 ? 12.099 1.009   29.128  1.00 36.55  ? 225 PRO A CB  1 
ATOM   1524 C  CG  . PRO A 1 229 ? 12.793 0.219   30.184  1.00 37.89  ? 225 PRO A CG  1 
ATOM   1525 C  CD  . PRO A 1 229 ? 13.834 1.163   30.701  1.00 35.09  ? 225 PRO A CD  1 
ATOM   1526 N  N   . GLU A 1 230 ? 12.493 4.009   28.516  1.00 38.04  ? 226 GLU A N   1 
ATOM   1527 C  CA  . GLU A 1 230 ? 12.061 5.279   27.944  1.00 37.20  ? 226 GLU A CA  1 
ATOM   1528 C  C   . GLU A 1 230 ? 13.109 5.880   27.022  1.00 38.64  ? 226 GLU A C   1 
ATOM   1529 O  O   . GLU A 1 230 ? 12.773 6.622   26.088  1.00 38.54  ? 226 GLU A O   1 
ATOM   1530 C  CB  . GLU A 1 230 ? 11.670 6.295   29.033  1.00 36.69  ? 226 GLU A CB  1 
ATOM   1531 C  CG  . GLU A 1 230 ? 12.746 6.647   30.045  1.00 40.08  ? 226 GLU A CG  1 
ATOM   1532 C  CD  . GLU A 1 230 ? 12.773 5.698   31.243  1.00 38.89  ? 226 GLU A CD  1 
ATOM   1533 O  OE1 . GLU A 1 230 ? 12.600 4.470   31.049  1.00 39.41  ? 226 GLU A OE1 1 
ATOM   1534 O  OE2 . GLU A 1 230 ? 12.989 6.182   32.380  1.00 39.10  ? 226 GLU A OE2 1 
ATOM   1535 N  N   . LEU A 1 231 ? 14.382 5.572   27.258  1.00 45.57  ? 227 LEU A N   1 
ATOM   1536 C  CA  . LEU A 1 231 ? 15.420 6.094   26.368  1.00 45.57  ? 227 LEU A CA  1 
ATOM   1537 C  C   . LEU A 1 231 ? 15.381 5.325   25.045  1.00 46.41  ? 227 LEU A C   1 
ATOM   1538 O  O   . LEU A 1 231 ? 15.539 5.903   23.971  1.00 45.46  ? 227 LEU A O   1 
ATOM   1539 C  CB  . LEU A 1 231 ? 16.811 5.969   27.000  1.00 29.69  ? 227 LEU A CB  1 
ATOM   1540 C  CG  . LEU A 1 231 ? 17.134 6.941   28.144  1.00 32.30  ? 227 LEU A CG  1 
ATOM   1541 C  CD1 . LEU A 1 231 ? 18.596 6.770   28.559  1.00 26.80  ? 227 LEU A CD1 1 
ATOM   1542 C  CD2 . LEU A 1 231 ? 16.877 8.367   27.697  1.00 27.56  ? 227 LEU A CD2 1 
ATOM   1543 N  N   . ILE A 1 232 ? 15.159 4.017   25.133  1.00 35.77  ? 228 ILE A N   1 
ATOM   1544 C  CA  . ILE A 1 232 ? 15.095 3.182   23.945  1.00 36.71  ? 228 ILE A CA  1 
ATOM   1545 C  C   . ILE A 1 232 ? 13.914 3.653   23.106  1.00 37.20  ? 228 ILE A C   1 
ATOM   1546 O  O   . ILE A 1 232 ? 14.028 3.771   21.897  1.00 37.84  ? 228 ILE A O   1 
ATOM   1547 C  CB  . ILE A 1 232 ? 14.936 1.676   24.312  1.00 26.94  ? 228 ILE A CB  1 
ATOM   1548 C  CG1 . ILE A 1 232 ? 16.158 1.197   25.097  1.00 26.64  ? 228 ILE A CG1 1 
ATOM   1549 C  CG2 . ILE A 1 232 ? 14.792 0.839   23.056  1.00 25.94  ? 228 ILE A CG2 1 
ATOM   1550 C  CD1 . ILE A 1 232 ? 16.041 -0.227  25.616  1.00 28.50  ? 228 ILE A CD1 1 
ATOM   1551 N  N   . PHE A 1 233 ? 12.781 3.929   23.745  1.00 45.24  ? 229 PHE A N   1 
ATOM   1552 C  CA  . PHE A 1 233 ? 11.607 4.404   23.022  1.00 46.95  ? 229 PHE A CA  1 
ATOM   1553 C  C   . PHE A 1 233 ? 11.771 5.847   22.569  1.00 46.21  ? 229 PHE A C   1 
ATOM   1554 O  O   . PHE A 1 233 ? 10.794 6.485   22.217  1.00 48.33  ? 229 PHE A O   1 
ATOM   1555 C  CB  . PHE A 1 233 ? 10.352 4.322   23.885  1.00 41.21  ? 229 PHE A CB  1 
ATOM   1556 C  CG  . PHE A 1 233 ? 9.874  2.928   24.151  1.00 43.49  ? 229 PHE A CG  1 
ATOM   1557 C  CD1 . PHE A 1 233 ? 9.505  2.085   23.110  1.00 44.24  ? 229 PHE A CD1 1 
ATOM   1558 C  CD2 . PHE A 1 233 ? 9.758  2.464   25.444  1.00 43.26  ? 229 PHE A CD2 1 
ATOM   1559 C  CE1 . PHE A 1 233 ? 9.023  0.792   23.358  1.00 44.70  ? 229 PHE A CE1 1 
ATOM   1560 C  CE2 . PHE A 1 233 ? 9.280  1.179   25.701  1.00 44.42  ? 229 PHE A CE2 1 
ATOM   1561 C  CZ  . PHE A 1 233 ? 8.913  0.345   24.653  1.00 43.12  ? 229 PHE A CZ  1 
ATOM   1562 N  N   . GLY A 1 234 ? 12.990 6.376   22.601  1.00 39.43  ? 230 GLY A N   1 
ATOM   1563 C  CA  . GLY A 1 234 ? 13.223 7.747   22.154  1.00 38.88  ? 230 GLY A CA  1 
ATOM   1564 C  C   . GLY A 1 234 ? 12.672 8.934   22.949  1.00 39.31  ? 230 GLY A C   1 
ATOM   1565 O  O   . GLY A 1 234 ? 12.677 10.060  22.449  1.00 37.91  ? 230 GLY A O   1 
ATOM   1566 N  N   . ALA A 1 235 ? 12.217 8.700   24.179  1.00 42.88  ? 231 ALA A N   1 
ATOM   1567 C  CA  . ALA A 1 235 ? 11.659 9.764   25.018  1.00 44.65  ? 231 ALA A CA  1 
ATOM   1568 C  C   . ALA A 1 235 ? 12.631 10.917  25.231  1.00 44.67  ? 231 ALA A C   1 
ATOM   1569 O  O   . ALA A 1 235 ? 13.834 10.701  25.343  1.00 43.97  ? 231 ALA A O   1 
ATOM   1570 C  CB  . ALA A 1 235 ? 11.238 9.187   26.379  1.00 20.01  ? 231 ALA A CB  1 
ATOM   1571 N  N   . THR A 1 236 ? 12.118 12.142  25.286  1.00 48.93  ? 232 THR A N   1 
ATOM   1572 C  CA  . THR A 1 236 ? 12.988 13.296  25.527  1.00 49.81  ? 232 THR A CA  1 
ATOM   1573 C  C   . THR A 1 236 ? 12.605 14.051  26.802  1.00 49.43  ? 232 THR A C   1 
ATOM   1574 O  O   . THR A 1 236 ? 13.217 15.068  27.130  1.00 48.87  ? 232 THR A O   1 
ATOM   1575 C  CB  . THR A 1 236 ? 12.970 14.309  24.360  1.00 56.75  ? 232 THR A CB  1 
ATOM   1576 O  OG1 . THR A 1 236 ? 11.640 14.814  24.171  1.00 56.62  ? 232 THR A OG1 1 
ATOM   1577 C  CG2 . THR A 1 236 ? 13.460 13.656  23.092  1.00 54.63  ? 232 THR A CG2 1 
ATOM   1578 N  N   . ASP A 1 237 ? 11.601 13.538  27.512  1.00 44.44  ? 233 ASP A N   1 
ATOM   1579 C  CA  . ASP A 1 237 ? 11.109 14.140  28.747  1.00 46.12  ? 233 ASP A CA  1 
ATOM   1580 C  C   . ASP A 1 237 ? 11.444 13.265  29.951  1.00 44.60  ? 233 ASP A C   1 
ATOM   1581 O  O   . ASP A 1 237 ? 10.711 13.259  30.947  1.00 43.21  ? 233 ASP A O   1 
ATOM   1582 C  CB  . ASP A 1 237 ? 9.590  14.289  28.690  1.00 54.66  ? 233 ASP A CB  1 
ATOM   1583 C  CG  . ASP A 1 237 ? 8.881  12.952  28.637  1.00 59.56  ? 233 ASP A CG  1 
ATOM   1584 O  OD1 . ASP A 1 237 ? 7.727  12.873  29.101  1.00 63.93  ? 233 ASP A OD1 1 
ATOM   1585 O  OD2 . ASP A 1 237 ? 9.470  11.977  28.121  1.00 61.48  ? 233 ASP A OD2 1 
ATOM   1586 N  N   . TYR A 1 238 ? 12.537 12.521  29.858  1.00 44.73  ? 234 TYR A N   1 
ATOM   1587 C  CA  . TYR A 1 238 ? 12.929 11.620  30.929  1.00 43.00  ? 234 TYR A CA  1 
ATOM   1588 C  C   . TYR A 1 238 ? 13.469 12.354  32.149  1.00 43.86  ? 234 TYR A C   1 
ATOM   1589 O  O   . TYR A 1 238 ? 13.938 13.485  32.039  1.00 42.77  ? 234 TYR A O   1 
ATOM   1590 C  CB  . TYR A 1 238 ? 13.967 10.610  30.397  1.00 29.28  ? 234 TYR A CB  1 
ATOM   1591 C  CG  . TYR A 1 238 ? 15.218 11.238  29.828  1.00 27.24  ? 234 TYR A CG  1 
ATOM   1592 C  CD1 . TYR A 1 238 ? 16.265 11.636  30.659  1.00 25.29  ? 234 TYR A CD1 1 
ATOM   1593 C  CD2 . TYR A 1 238 ? 15.335 11.471  28.459  1.00 27.85  ? 234 TYR A CD2 1 
ATOM   1594 C  CE1 . TYR A 1 238 ? 17.417 12.261  30.133  1.00 27.22  ? 234 TYR A CE1 1 
ATOM   1595 C  CE2 . TYR A 1 238 ? 16.471 12.091  27.907  1.00 23.41  ? 234 TYR A CE2 1 
ATOM   1596 C  CZ  . TYR A 1 238 ? 17.518 12.488  28.746  1.00 25.75  ? 234 TYR A CZ  1 
ATOM   1597 O  OH  . TYR A 1 238 ? 18.653 13.093  28.209  1.00 26.59  ? 234 TYR A OH  1 
ATOM   1598 N  N   . THR A 1 239 ? 13.396 11.699  33.309  1.00 44.57  ? 235 THR A N   1 
ATOM   1599 C  CA  . THR A 1 239 ? 13.890 12.258  34.572  1.00 45.43  ? 235 THR A CA  1 
ATOM   1600 C  C   . THR A 1 239 ? 15.150 11.542  35.024  1.00 45.10  ? 235 THR A C   1 
ATOM   1601 O  O   . THR A 1 239 ? 15.643 10.666  34.346  1.00 43.73  ? 235 THR A O   1 
ATOM   1602 C  CB  . THR A 1 239 ? 12.851 12.124  35.681  1.00 42.76  ? 235 THR A CB  1 
ATOM   1603 O  OG1 . THR A 1 239 ? 12.676 10.744  36.017  1.00 43.92  ? 235 THR A OG1 1 
ATOM   1604 C  CG2 . THR A 1 239 ? 11.525 12.678  35.218  1.00 42.37  ? 235 THR A CG2 1 
ATOM   1605 N  N   . SER A 1 240 ? 15.670 11.916  36.179  1.00 41.98  ? 236 SER A N   1 
ATOM   1606 C  CA  . SER A 1 240 ? 16.880 11.293  36.707  1.00 41.87  ? 236 SER A CA  1 
ATOM   1607 C  C   . SER A 1 240 ? 16.740 9.811   37.018  1.00 39.29  ? 236 SER A C   1 
ATOM   1608 O  O   . SER A 1 240 ? 17.721 9.148   37.328  1.00 39.92  ? 236 SER A O   1 
ATOM   1609 C  CB  . SER A 1 240 ? 17.327 12.009  37.980  1.00 48.19  ? 236 SER A CB  1 
ATOM   1610 O  OG  . SER A 1 240 ? 17.996 13.214  37.668  1.00 52.84  ? 236 SER A OG  1 
ATOM   1611 N  N   . SER A 1 241 ? 15.529 9.279   36.949  1.00 36.45  ? 237 SER A N   1 
ATOM   1612 C  CA  . SER A 1 241 ? 15.370 7.879   37.267  1.00 38.31  ? 237 SER A CA  1 
ATOM   1613 C  C   . SER A 1 241 ? 16.023 6.965   36.240  1.00 38.39  ? 237 SER A C   1 
ATOM   1614 O  O   . SER A 1 241 ? 16.016 5.749   36.419  1.00 40.32  ? 237 SER A O   1 
ATOM   1615 C  CB  . SER A 1 241 ? 13.889 7.523   37.437  1.00 42.38  ? 237 SER A CB  1 
ATOM   1616 O  OG  . SER A 1 241 ? 13.127 7.841   36.290  1.00 45.54  ? 237 SER A OG  1 
ATOM   1617 N  N   . ILE A 1 242 ? 16.575 7.535   35.167  1.00 37.91  ? 238 ILE A N   1 
ATOM   1618 C  CA  . ILE A 1 242 ? 17.236 6.718   34.166  1.00 37.52  ? 238 ILE A CA  1 
ATOM   1619 C  C   . ILE A 1 242 ? 18.538 6.199   34.782  1.00 38.32  ? 238 ILE A C   1 
ATOM   1620 O  O   . ILE A 1 242 ? 18.989 5.099   34.445  1.00 37.22  ? 238 ILE A O   1 
ATOM   1621 C  CB  . ILE A 1 242 ? 17.578 7.492   32.864  1.00 32.63  ? 238 ILE A CB  1 
ATOM   1622 C  CG1 . ILE A 1 242 ? 18.556 8.621   33.157  1.00 33.23  ? 238 ILE A CG1 1 
ATOM   1623 C  CG2 . ILE A 1 242 ? 16.321 7.976   32.197  1.00 31.45  ? 238 ILE A CG2 1 
ATOM   1624 C  CD1 . ILE A 1 242 ? 19.215 9.159   31.910  1.00 35.58  ? 238 ILE A CD1 1 
ATOM   1625 N  N   . ASP A 1 243 ? 19.134 6.991   35.678  1.00 33.78  ? 239 ASP A N   1 
ATOM   1626 C  CA  . ASP A 1 243 ? 20.370 6.608   36.376  1.00 35.52  ? 239 ASP A CA  1 
ATOM   1627 C  C   . ASP A 1 243 ? 20.093 5.414   37.288  1.00 36.58  ? 239 ASP A C   1 
ATOM   1628 O  O   . ASP A 1 243 ? 20.941 4.536   37.471  1.00 32.25  ? 239 ASP A O   1 
ATOM   1629 C  CB  . ASP A 1 243 ? 20.917 7.758   37.237  1.00 33.00  ? 239 ASP A CB  1 
ATOM   1630 C  CG  . ASP A 1 243 ? 21.685 8.795   36.424  1.00 33.52  ? 239 ASP A CG  1 
ATOM   1631 O  OD1 . ASP A 1 243 ? 22.065 8.492   35.266  1.00 31.94  ? 239 ASP A OD1 1 
ATOM   1632 O  OD2 . ASP A 1 243 ? 21.926 9.911   36.949  1.00 34.15  ? 239 ASP A OD2 1 
ATOM   1633 N  N   . VAL A 1 244 ? 18.905 5.390   37.878  1.00 34.65  ? 240 VAL A N   1 
ATOM   1634 C  CA  . VAL A 1 244 ? 18.530 4.291   38.739  1.00 35.27  ? 240 VAL A CA  1 
ATOM   1635 C  C   . VAL A 1 244 ? 18.381 3.021   37.904  1.00 34.28  ? 240 VAL A C   1 
ATOM   1636 O  O   . VAL A 1 244 ? 18.821 1.959   38.325  1.00 33.15  ? 240 VAL A O   1 
ATOM   1637 C  CB  . VAL A 1 244 ? 17.228 4.603   39.473  1.00 33.60  ? 240 VAL A CB  1 
ATOM   1638 C  CG1 . VAL A 1 244 ? 16.714 3.376   40.223  1.00 32.99  ? 240 VAL A CG1 1 
ATOM   1639 C  CG2 . VAL A 1 244 ? 17.475 5.731   40.438  1.00 35.39  ? 240 VAL A CG2 1 
ATOM   1640 N  N   . TRP A 1 245 ? 17.786 3.115   36.720  1.00 28.91  ? 241 TRP A N   1 
ATOM   1641 C  CA  . TRP A 1 245 ? 17.639 1.929   35.888  1.00 28.58  ? 241 TRP A CA  1 
ATOM   1642 C  C   . TRP A 1 245 ? 19.033 1.380   35.553  1.00 27.47  ? 241 TRP A C   1 
ATOM   1643 O  O   . TRP A 1 245 ? 19.276 0.161   35.615  1.00 27.59  ? 241 TRP A O   1 
ATOM   1644 C  CB  . TRP A 1 245 ? 16.859 2.251   34.602  1.00 32.39  ? 241 TRP A CB  1 
ATOM   1645 C  CG  . TRP A 1 245 ? 16.851 1.107   33.616  1.00 33.64  ? 241 TRP A CG  1 
ATOM   1646 C  CD1 . TRP A 1 245 ? 17.859 0.750   32.755  1.00 31.74  ? 241 TRP A CD1 1 
ATOM   1647 C  CD2 . TRP A 1 245 ? 15.807 0.135   33.427  1.00 33.56  ? 241 TRP A CD2 1 
ATOM   1648 N  NE1 . TRP A 1 245 ? 17.506 -0.377  32.049  1.00 33.19  ? 241 TRP A NE1 1 
ATOM   1649 C  CE2 . TRP A 1 245 ? 16.254 -0.775  32.439  1.00 34.03  ? 241 TRP A CE2 1 
ATOM   1650 C  CE3 . TRP A 1 245 ? 14.540 -0.055  33.998  1.00 34.52  ? 241 TRP A CE3 1 
ATOM   1651 C  CZ2 . TRP A 1 245 ? 15.480 -1.853  32.008  1.00 33.28  ? 241 TRP A CZ2 1 
ATOM   1652 C  CZ3 . TRP A 1 245 ? 13.773 -1.130  33.570  1.00 36.90  ? 241 TRP A CZ3 1 
ATOM   1653 C  CH2 . TRP A 1 245 ? 14.248 -2.017  32.582  1.00 35.66  ? 241 TRP A CH2 1 
ATOM   1654 N  N   . SER A 1 246 ? 19.946 2.287   35.210  1.00 27.59  ? 242 SER A N   1 
ATOM   1655 C  CA  . SER A 1 246 ? 21.304 1.899   34.881  1.00 29.13  ? 242 SER A CA  1 
ATOM   1656 C  C   . SER A 1 246 ? 21.930 1.207   36.071  1.00 30.39  ? 242 SER A C   1 
ATOM   1657 O  O   . SER A 1 246 ? 22.561 0.160   35.921  1.00 29.19  ? 242 SER A O   1 
ATOM   1658 C  CB  . SER A 1 246 ? 22.140 3.118   34.501  1.00 35.28  ? 242 SER A CB  1 
ATOM   1659 O  OG  . SER A 1 246 ? 21.597 3.754   33.357  1.00 37.05  ? 242 SER A OG  1 
ATOM   1660 N  N   . ALA A 1 247 ? 21.763 1.784   37.257  1.00 26.13  ? 243 ALA A N   1 
ATOM   1661 C  CA  . ALA A 1 247 ? 22.339 1.180   38.442  1.00 27.71  ? 243 ALA A CA  1 
ATOM   1662 C  C   . ALA A 1 247 ? 21.715 -0.200  38.646  1.00 28.85  ? 243 ALA A C   1 
ATOM   1663 O  O   . ALA A 1 247 ? 22.393 -1.146  39.048  1.00 28.90  ? 243 ALA A O   1 
ATOM   1664 C  CB  . ALA A 1 247 ? 22.110 2.063   39.651  1.00 20.31  ? 243 ALA A CB  1 
ATOM   1665 N  N   . GLY A 1 248 ? 20.426 -0.325  38.361  1.00 26.82  ? 244 GLY A N   1 
ATOM   1666 C  CA  . GLY A 1 248 ? 19.777 -1.619  38.500  1.00 27.63  ? 244 GLY A CA  1 
ATOM   1667 C  C   . GLY A 1 248 ? 20.441 -2.641  37.588  1.00 30.35  ? 244 GLY A C   1 
ATOM   1668 O  O   . GLY A 1 248 ? 20.590 -3.800  37.957  1.00 29.89  ? 244 GLY A O   1 
ATOM   1669 N  N   . CYS A 1 249 ? 20.840 -2.213  36.390  1.00 36.06  ? 245 CYS A N   1 
ATOM   1670 C  CA  . CYS A 1 249 ? 21.511 -3.098  35.450  1.00 37.19  ? 245 CYS A CA  1 
ATOM   1671 C  C   . CYS A 1 249 ? 22.906 -3.479  35.955  1.00 37.84  ? 245 CYS A C   1 
ATOM   1672 O  O   . CYS A 1 249 ? 23.388 -4.571  35.689  1.00 37.79  ? 245 CYS A O   1 
ATOM   1673 C  CB  . CYS A 1 249 ? 21.630 -2.434  34.081  1.00 35.00  ? 245 CYS A CB  1 
ATOM   1674 S  SG  . CYS A 1 249 ? 20.062 -2.188  33.243  1.00 38.70  ? 245 CYS A SG  1 
ATOM   1675 N  N   . VAL A 1 250 ? 23.571 -2.578  36.669  1.00 30.81  ? 246 VAL A N   1 
ATOM   1676 C  CA  . VAL A 1 250 ? 24.888 -2.886  37.200  1.00 31.39  ? 246 VAL A CA  1 
ATOM   1677 C  C   . VAL A 1 250 ? 24.777 -3.915  38.316  1.00 33.13  ? 246 VAL A C   1 
ATOM   1678 O  O   . VAL A 1 250 ? 25.579 -4.838  38.387  1.00 33.03  ? 246 VAL A O   1 
ATOM   1679 C  CB  . VAL A 1 250 ? 25.595 -1.632  37.744  1.00 17.23  ? 246 VAL A CB  1 
ATOM   1680 C  CG1 . VAL A 1 250 ? 26.846 -2.026  38.498  1.00 15.40  ? 246 VAL A CG1 1 
ATOM   1681 C  CG2 . VAL A 1 250 ? 25.984 -0.725  36.587  1.00 15.79  ? 246 VAL A CG2 1 
ATOM   1682 N  N   . LEU A 1 251 ? 23.788 -3.756  39.192  1.00 36.44  ? 247 LEU A N   1 
ATOM   1683 C  CA  . LEU A 1 251 ? 23.579 -4.703  40.280  1.00 38.69  ? 247 LEU A CA  1 
ATOM   1684 C  C   . LEU A 1 251 ? 23.302 -6.092  39.710  1.00 39.51  ? 247 LEU A C   1 
ATOM   1685 O  O   . LEU A 1 251 ? 23.981 -7.056  40.041  1.00 38.66  ? 247 LEU A O   1 
ATOM   1686 C  CB  . LEU A 1 251 ? 22.400 -4.272  41.138  1.00 34.86  ? 247 LEU A CB  1 
ATOM   1687 C  CG  . LEU A 1 251 ? 21.970 -5.267  42.220  1.00 35.12  ? 247 LEU A CG  1 
ATOM   1688 C  CD1 . LEU A 1 251 ? 23.016 -5.357  43.305  1.00 32.67  ? 247 LEU A CD1 1 
ATOM   1689 C  CD2 . LEU A 1 251 ? 20.659 -4.814  42.815  1.00 35.17  ? 247 LEU A CD2 1 
ATOM   1690 N  N   . ALA A 1 252 ? 22.299 -6.190  38.851  1.00 29.87  ? 248 ALA A N   1 
ATOM   1691 C  CA  . ALA A 1 252 ? 21.943 -7.451  38.238  1.00 31.28  ? 248 ALA A CA  1 
ATOM   1692 C  C   . ALA A 1 252 ? 23.161 -8.093  37.579  1.00 33.53  ? 248 ALA A C   1 
ATOM   1693 O  O   . ALA A 1 252 ? 23.364 -9.314  37.672  1.00 33.65  ? 248 ALA A O   1 
ATOM   1694 C  CB  . ALA A 1 252 ? 20.865 -7.224  37.203  1.00 22.52  ? 248 ALA A CB  1 
ATOM   1695 N  N   . GLU A 1 253 ? 23.970 -7.277  36.904  1.00 39.92  ? 249 GLU A N   1 
ATOM   1696 C  CA  . GLU A 1 253 ? 25.148 -7.789  36.227  1.00 39.79  ? 249 GLU A CA  1 
ATOM   1697 C  C   . GLU A 1 253 ? 26.157 -8.375  37.205  1.00 40.39  ? 249 GLU A C   1 
ATOM   1698 O  O   . GLU A 1 253 ? 26.766 -9.418  36.946  1.00 38.88  ? 249 GLU A O   1 
ATOM   1699 C  CB  . GLU A 1 253 ? 25.805 -6.680  35.419  1.00 45.60  ? 249 GLU A CB  1 
ATOM   1700 C  CG  . GLU A 1 253 ? 26.867 -7.168  34.479  1.00 44.03  ? 249 GLU A CG  1 
ATOM   1701 C  CD  . GLU A 1 253 ? 27.313 -6.095  33.517  1.00 47.14  ? 249 GLU A CD  1 
ATOM   1702 O  OE1 . GLU A 1 253 ? 26.443 -5.337  33.040  1.00 47.71  ? 249 GLU A OE1 1 
ATOM   1703 O  OE2 . GLU A 1 253 ? 28.527 -6.014  33.218  1.00 45.89  ? 249 GLU A OE2 1 
ATOM   1704 N  N   . LEU A 1 254 ? 26.348 -7.706  38.331  1.00 39.16  ? 250 LEU A N   1 
ATOM   1705 C  CA  . LEU A 1 254 ? 27.296 -8.196  39.309  1.00 40.60  ? 250 LEU A CA  1 
ATOM   1706 C  C   . LEU A 1 254 ? 26.840 -9.518  39.913  1.00 43.47  ? 250 LEU A C   1 
ATOM   1707 O  O   . LEU A 1 254 ? 27.666 -10.390 40.185  1.00 44.57  ? 250 LEU A O   1 
ATOM   1708 C  CB  . LEU A 1 254 ? 27.523 -7.148  40.397  1.00 28.24  ? 250 LEU A CB  1 
ATOM   1709 C  CG  . LEU A 1 254 ? 28.304 -5.920  39.920  1.00 29.68  ? 250 LEU A CG  1 
ATOM   1710 C  CD1 . LEU A 1 254 ? 28.530 -4.961  41.080  1.00 29.27  ? 250 LEU A CD1 1 
ATOM   1711 C  CD2 . LEU A 1 254 ? 29.631 -6.364  39.333  1.00 30.51  ? 250 LEU A CD2 1 
ATOM   1712 N  N   . LEU A 1 255 ? 25.535 -9.675  40.114  1.00 42.15  ? 251 LEU A N   1 
ATOM   1713 C  CA  . LEU A 1 255 ? 24.994 -10.910 40.672  1.00 43.79  ? 251 LEU A CA  1 
ATOM   1714 C  C   . LEU A 1 255 ? 25.000 -12.015 39.620  1.00 43.64  ? 251 LEU A C   1 
ATOM   1715 O  O   . LEU A 1 255 ? 25.312 -13.157 39.920  1.00 44.49  ? 251 LEU A O   1 
ATOM   1716 C  CB  . LEU A 1 255 ? 23.555 -10.708 41.152  1.00 37.34  ? 251 LEU A CB  1 
ATOM   1717 C  CG  . LEU A 1 255 ? 23.263 -9.696  42.264  1.00 39.38  ? 251 LEU A CG  1 
ATOM   1718 C  CD1 . LEU A 1 255 ? 21.742 -9.539  42.442  1.00 39.75  ? 251 LEU A CD1 1 
ATOM   1719 C  CD2 . LEU A 1 255 ? 23.927 -10.151 43.558  1.00 39.36  ? 251 LEU A CD2 1 
ATOM   1720 N  N   . LEU A 1 256 ? 24.654 -11.671 38.387  1.00 38.13  ? 252 LEU A N   1 
ATOM   1721 C  CA  . LEU A 1 256 ? 24.603 -12.643 37.294  1.00 39.09  ? 252 LEU A CA  1 
ATOM   1722 C  C   . LEU A 1 256 ? 25.934 -13.088 36.710  1.00 38.90  ? 252 LEU A C   1 
ATOM   1723 O  O   . LEU A 1 256 ? 26.099 -14.247 36.380  1.00 39.61  ? 252 LEU A O   1 
ATOM   1724 C  CB  . LEU A 1 256 ? 23.762 -12.106 36.137  1.00 53.92  ? 252 LEU A CB  1 
ATOM   1725 C  CG  . LEU A 1 256 ? 22.252 -12.262 36.179  1.00 59.76  ? 252 LEU A CG  1 
ATOM   1726 C  CD1 . LEU A 1 256 ? 21.662 -11.696 34.891  1.00 60.12  ? 252 LEU A CD1 1 
ATOM   1727 C  CD2 . LEU A 1 256 ? 21.904 -13.725 36.327  1.00 58.81  ? 252 LEU A CD2 1 
ATOM   1728 N  N   . GLY A 1 257 ? 26.874 -12.166 36.557  1.00 41.44  ? 253 GLY A N   1 
ATOM   1729 C  CA  . GLY A 1 257 ? 28.148 -12.524 35.964  1.00 40.89  ? 253 GLY A CA  1 
ATOM   1730 C  C   . GLY A 1 257 ? 28.204 -12.081 34.505  1.00 41.93  ? 253 GLY A C   1 
ATOM   1731 O  O   . GLY A 1 257 ? 29.185 -12.321 33.809  1.00 42.45  ? 253 GLY A O   1 
ATOM   1732 N  N   . GLN A 1 258 ? 27.142 -11.438 34.034  1.00 46.33  ? 254 GLN A N   1 
ATOM   1733 C  CA  . GLN A 1 258 ? 27.066 -10.940 32.666  1.00 45.27  ? 254 GLN A CA  1 
ATOM   1734 C  C   . GLN A 1 258 ? 25.908 -9.943  32.589  1.00 43.77  ? 254 GLN A C   1 
ATOM   1735 O  O   . GLN A 1 258 ? 25.039 -9.918  33.453  1.00 42.02  ? 254 GLN A O   1 
ATOM   1736 C  CB  . GLN A 1 258 ? 26.818 -12.087 31.694  1.00 55.46  ? 254 GLN A CB  1 
ATOM   1737 C  CG  . GLN A 1 258 ? 25.699 -13.000 32.138  1.00 60.91  ? 254 GLN A CG  1 
ATOM   1738 C  CD  . GLN A 1 258 ? 25.199 -13.911 31.030  1.00 67.83  ? 254 GLN A CD  1 
ATOM   1739 O  OE1 . GLN A 1 258 ? 24.594 -13.454 30.066  1.00 68.07  ? 254 GLN A OE1 1 
ATOM   1740 N  NE2 . GLN A 1 258 ? 25.454 -15.205 31.164  1.00 67.49  ? 254 GLN A NE2 1 
ATOM   1741 N  N   . PRO A 1 259 ? 25.884 -9.105  31.550  1.00 43.09  ? 255 PRO A N   1 
ATOM   1742 C  CA  . PRO A 1 259 ? 24.810 -8.123  31.402  1.00 42.95  ? 255 PRO A CA  1 
ATOM   1743 C  C   . PRO A 1 259 ? 23.458 -8.800  31.456  1.00 44.00  ? 255 PRO A C   1 
ATOM   1744 O  O   . PRO A 1 259 ? 23.301 -9.896  30.943  1.00 43.66  ? 255 PRO A O   1 
ATOM   1745 C  CB  . PRO A 1 259 ? 25.082 -7.531  30.026  1.00 46.95  ? 255 PRO A CB  1 
ATOM   1746 C  CG  . PRO A 1 259 ? 26.580 -7.624  29.910  1.00 48.78  ? 255 PRO A CG  1 
ATOM   1747 C  CD  . PRO A 1 259 ? 26.853 -9.003  30.446  1.00 46.06  ? 255 PRO A CD  1 
ATOM   1748 N  N   . ILE A 1 260 ? 22.471 -8.158  32.061  1.00 41.52  ? 256 ILE A N   1 
ATOM   1749 C  CA  . ILE A 1 260 ? 21.155 -8.769  32.124  1.00 42.63  ? 256 ILE A CA  1 
ATOM   1750 C  C   . ILE A 1 260 ? 20.286 -8.472  30.897  1.00 43.19  ? 256 ILE A C   1 
ATOM   1751 O  O   . ILE A 1 260 ? 19.418 -9.259  30.559  1.00 41.44  ? 256 ILE A O   1 
ATOM   1752 C  CB  . ILE A 1 260 ? 20.380 -8.346  33.410  1.00 37.59  ? 256 ILE A CB  1 
ATOM   1753 C  CG1 . ILE A 1 260 ? 19.023 -9.055  33.438  1.00 38.01  ? 256 ILE A CG1 1 
ATOM   1754 C  CG2 . ILE A 1 260 ? 20.190 -6.821  33.461  1.00 37.89  ? 256 ILE A CG2 1 
ATOM   1755 C  CD1 . ILE A 1 260 ? 18.278 -8.907  34.737  1.00 39.75  ? 256 ILE A CD1 1 
ATOM   1756 N  N   . PHE A 1 261 ? 20.513 -7.347  30.230  1.00 37.36  ? 257 PHE A N   1 
ATOM   1757 C  CA  . PHE A 1 261 ? 19.711 -6.986  29.059  1.00 40.38  ? 257 PHE A CA  1 
ATOM   1758 C  C   . PHE A 1 261 ? 20.587 -6.628  27.867  1.00 40.73  ? 257 PHE A C   1 
ATOM   1759 O  O   . PHE A 1 261 ? 20.639 -5.471  27.455  1.00 42.99  ? 257 PHE A O   1 
ATOM   1760 C  CB  . PHE A 1 261 ? 18.810 -5.782  29.368  1.00 39.79  ? 257 PHE A CB  1 
ATOM   1761 C  CG  . PHE A 1 261 ? 17.859 -6.002  30.502  1.00 40.65  ? 257 PHE A CG  1 
ATOM   1762 C  CD1 . PHE A 1 261 ? 17.148 -7.203  30.618  1.00 40.84  ? 257 PHE A CD1 1 
ATOM   1763 C  CD2 . PHE A 1 261 ? 17.645 -5.002  31.443  1.00 39.28  ? 257 PHE A CD2 1 
ATOM   1764 C  CE1 . PHE A 1 261 ? 16.231 -7.406  31.659  1.00 39.82  ? 257 PHE A CE1 1 
ATOM   1765 C  CE2 . PHE A 1 261 ? 16.732 -5.188  32.490  1.00 40.86  ? 257 PHE A CE2 1 
ATOM   1766 C  CZ  . PHE A 1 261 ? 16.024 -6.393  32.597  1.00 40.55  ? 257 PHE A CZ  1 
ATOM   1767 N  N   . PRO A 1 262 ? 21.271 -7.616  27.284  1.00 40.27  ? 258 PRO A N   1 
ATOM   1768 C  CA  . PRO A 1 262 ? 22.150 -7.386  26.133  1.00 39.52  ? 258 PRO A CA  1 
ATOM   1769 C  C   . PRO A 1 262 ? 21.398 -7.304  24.818  1.00 38.71  ? 258 PRO A C   1 
ATOM   1770 O  O   . PRO A 1 262 ? 20.242 -7.684  24.737  1.00 37.59  ? 258 PRO A O   1 
ATOM   1771 C  CB  . PRO A 1 262 ? 23.089 -8.585  26.184  1.00 25.19  ? 258 PRO A CB  1 
ATOM   1772 C  CG  . PRO A 1 262 ? 22.156 -9.680  26.587  1.00 26.21  ? 258 PRO A CG  1 
ATOM   1773 C  CD  . PRO A 1 262 ? 21.274 -9.036  27.673  1.00 26.97  ? 258 PRO A CD  1 
ATOM   1774 N  N   . GLY A 1 263 ? 22.068 -6.815  23.787  1.00 37.01  ? 259 GLY A N   1 
ATOM   1775 C  CA  . GLY A 1 263 ? 21.433 -6.702  22.494  1.00 37.33  ? 259 GLY A CA  1 
ATOM   1776 C  C   . GLY A 1 263 ? 22.153 -5.681  21.645  1.00 39.80  ? 259 GLY A C   1 
ATOM   1777 O  O   . GLY A 1 263 ? 22.516 -4.601  22.135  1.00 39.88  ? 259 GLY A O   1 
ATOM   1778 N  N   . ASP A 1 264 ? 22.370 -6.009  20.375  1.00 44.09  ? 260 ASP A N   1 
ATOM   1779 C  CA  . ASP A 1 264 ? 23.055 -5.094  19.476  1.00 44.50  ? 260 ASP A CA  1 
ATOM   1780 C  C   . ASP A 1 264 ? 22.142 -3.972  19.012  1.00 41.68  ? 260 ASP A C   1 
ATOM   1781 O  O   . ASP A 1 264 ? 22.623 -2.946  18.526  1.00 41.23  ? 260 ASP A O   1 
ATOM   1782 C  CB  . ASP A 1 264 ? 23.597 -5.845  18.262  1.00 94.85  ? 260 ASP A CB  1 
ATOM   1783 C  CG  . ASP A 1 264 ? 24.860 -6.614  18.572  1.00 100.26 ? 260 ASP A CG  1 
ATOM   1784 O  OD1 . ASP A 1 264 ? 25.281 -7.419  17.714  1.00 103.83 ? 260 ASP A OD1 1 
ATOM   1785 O  OD2 . ASP A 1 264 ? 25.433 -6.405  19.663  1.00 102.19 ? 260 ASP A OD2 1 
ATOM   1786 N  N   . SER A 1 265 ? 20.833 -4.159  19.164  1.00 39.57  ? 261 SER A N   1 
ATOM   1787 C  CA  . SER A 1 265 ? 19.884 -3.140  18.736  1.00 38.54  ? 261 SER A CA  1 
ATOM   1788 C  C   . SER A 1 265 ? 18.858 -2.843  19.811  1.00 36.88  ? 261 SER A C   1 
ATOM   1789 O  O   . SER A 1 265 ? 18.743 -3.590  20.782  1.00 36.22  ? 261 SER A O   1 
ATOM   1790 C  CB  . SER A 1 265 ? 19.141 -3.598  17.489  1.00 36.93  ? 261 SER A CB  1 
ATOM   1791 O  OG  . SER A 1 265 ? 18.257 -4.651  17.825  1.00 39.03  ? 261 SER A OG  1 
ATOM   1792 N  N   . GLY A 1 266 ? 18.096 -1.764  19.617  1.00 39.78  ? 262 GLY A N   1 
ATOM   1793 C  CA  . GLY A 1 266 ? 17.077 -1.405  20.584  1.00 37.68  ? 262 GLY A CA  1 
ATOM   1794 C  C   . GLY A 1 266 ? 16.060 -2.523  20.707  1.00 39.87  ? 262 GLY A C   1 
ATOM   1795 O  O   . GLY A 1 266 ? 15.603 -2.849  21.794  1.00 36.68  ? 262 GLY A O   1 
ATOM   1796 N  N   . VAL A 1 267 ? 15.724 -3.126  19.575  1.00 34.35  ? 263 VAL A N   1 
ATOM   1797 C  CA  . VAL A 1 267 ? 14.755 -4.207  19.517  1.00 37.35  ? 263 VAL A CA  1 
ATOM   1798 C  C   . VAL A 1 267 ? 15.190 -5.389  20.375  1.00 37.69  ? 263 VAL A C   1 
ATOM   1799 O  O   . VAL A 1 267 ? 14.417 -5.893  21.192  1.00 38.69  ? 263 VAL A O   1 
ATOM   1800 C  CB  . VAL A 1 267 ? 14.577 -4.724  18.064  1.00 41.70  ? 263 VAL A CB  1 
ATOM   1801 C  CG1 . VAL A 1 267 ? 13.389 -5.640  17.994  1.00 43.24  ? 263 VAL A CG1 1 
ATOM   1802 C  CG2 . VAL A 1 267 ? 14.428 -3.569  17.092  1.00 41.97  ? 263 VAL A CG2 1 
ATOM   1803 N  N   . ASP A 1 268 ? 16.424 -5.841  20.173  1.00 38.69  ? 264 ASP A N   1 
ATOM   1804 C  CA  . ASP A 1 268 ? 16.937 -6.975  20.923  1.00 40.29  ? 264 ASP A CA  1 
ATOM   1805 C  C   . ASP A 1 268 ? 16.914 -6.724  22.418  1.00 40.16  ? 264 ASP A C   1 
ATOM   1806 O  O   . ASP A 1 268 ? 16.484 -7.583  23.196  1.00 39.01  ? 264 ASP A O   1 
ATOM   1807 C  CB  . ASP A 1 268 ? 18.356 -7.316  20.476  1.00 70.75  ? 264 ASP A CB  1 
ATOM   1808 C  CG  . ASP A 1 268 ? 18.410 -7.796  19.045  1.00 75.73  ? 264 ASP A CG  1 
ATOM   1809 O  OD1 . ASP A 1 268 ? 17.508 -8.562  18.644  1.00 76.40  ? 264 ASP A OD1 1 
ATOM   1810 O  OD2 . ASP A 1 268 ? 19.359 -7.416  18.329  1.00 79.34  ? 264 ASP A OD2 1 
ATOM   1811 N  N   . GLN A 1 269 ? 17.374 -5.541  22.813  1.00 44.72  ? 265 GLN A N   1 
ATOM   1812 C  CA  . GLN A 1 269 ? 17.403 -5.165  24.213  1.00 44.94  ? 265 GLN A CA  1 
ATOM   1813 C  C   . GLN A 1 269 ? 15.996 -5.217  24.812  1.00 44.37  ? 265 GLN A C   1 
ATOM   1814 O  O   . GLN A 1 269 ? 15.807 -5.697  25.930  1.00 41.96  ? 265 GLN A O   1 
ATOM   1815 C  CB  . GLN A 1 269 ? 18.000 -3.775  24.346  1.00 39.27  ? 265 GLN A CB  1 
ATOM   1816 C  CG  . GLN A 1 269 ? 19.484 -3.717  24.034  1.00 41.25  ? 265 GLN A CG  1 
ATOM   1817 C  CD  . GLN A 1 269 ? 19.950 -2.297  23.761  1.00 46.08  ? 265 GLN A CD  1 
ATOM   1818 O  OE1 . GLN A 1 269 ? 19.392 -1.333  24.294  1.00 43.65  ? 265 GLN A OE1 1 
ATOM   1819 N  NE2 . GLN A 1 269 ? 20.979 -2.160  22.938  1.00 48.04  ? 265 GLN A NE2 1 
ATOM   1820 N  N   . LEU A 1 270 ? 15.006 -4.736  24.068  1.00 38.41  ? 266 LEU A N   1 
ATOM   1821 C  CA  . LEU A 1 270 ? 13.633 -4.766  24.560  1.00 41.32  ? 266 LEU A CA  1 
ATOM   1822 C  C   . LEU A 1 270 ? 13.146 -6.195  24.713  1.00 42.60  ? 266 LEU A C   1 
ATOM   1823 O  O   . LEU A 1 270 ? 12.450 -6.523  25.665  1.00 41.01  ? 266 LEU A O   1 
ATOM   1824 C  CB  . LEU A 1 270 ? 12.695 -4.011  23.621  1.00 34.64  ? 266 LEU A CB  1 
ATOM   1825 C  CG  . LEU A 1 270 ? 12.836 -2.491  23.649  1.00 37.74  ? 266 LEU A CG  1 
ATOM   1826 C  CD1 . LEU A 1 270 ? 11.848 -1.866  22.700  1.00 36.37  ? 266 LEU A CD1 1 
ATOM   1827 C  CD2 . LEU A 1 270 ? 12.574 -1.996  25.044  1.00 36.14  ? 266 LEU A CD2 1 
ATOM   1828 N  N   . VAL A 1 271 ? 13.506 -7.059  23.780  1.00 46.92  ? 267 VAL A N   1 
ATOM   1829 C  CA  . VAL A 1 271 ? 13.072 -8.438  23.895  1.00 48.43  ? 267 VAL A CA  1 
ATOM   1830 C  C   . VAL A 1 271 ? 13.602 -9.025  25.198  1.00 47.48  ? 267 VAL A C   1 
ATOM   1831 O  O   . VAL A 1 271 ? 12.894 -9.757  25.887  1.00 47.94  ? 267 VAL A O   1 
ATOM   1832 C  CB  . VAL A 1 271 ? 13.572 -9.288  22.721  1.00 37.46  ? 267 VAL A CB  1 
ATOM   1833 C  CG1 . VAL A 1 271 ? 13.323 -10.749 23.008  1.00 37.30  ? 267 VAL A CG1 1 
ATOM   1834 C  CG2 . VAL A 1 271 ? 12.861 -8.873  21.439  1.00 36.89  ? 267 VAL A CG2 1 
ATOM   1835 N  N   . GLU A 1 272 ? 14.843 -8.696  25.542  1.00 44.08  ? 268 GLU A N   1 
ATOM   1836 C  CA  . GLU A 1 272 ? 15.432 -9.203  26.774  1.00 44.49  ? 268 GLU A CA  1 
ATOM   1837 C  C   . GLU A 1 272 ? 14.716 -8.653  27.999  1.00 43.92  ? 268 GLU A C   1 
ATOM   1838 O  O   . GLU A 1 272 ? 14.444 -9.380  28.948  1.00 43.81  ? 268 GLU A O   1 
ATOM   1839 C  CB  . GLU A 1 272 ? 16.916 -8.853  26.827  1.00 64.80  ? 268 GLU A CB  1 
ATOM   1840 C  CG  . GLU A 1 272 ? 17.701 -9.610  25.800  1.00 67.51  ? 268 GLU A CG  1 
ATOM   1841 C  CD  . GLU A 1 272 ? 17.448 -11.099 25.905  1.00 72.40  ? 268 GLU A CD  1 
ATOM   1842 O  OE1 . GLU A 1 272 ? 17.730 -11.830 24.932  1.00 74.68  ? 268 GLU A OE1 1 
ATOM   1843 O  OE2 . GLU A 1 272 ? 16.968 -11.536 26.976  1.00 72.52  ? 268 GLU A OE2 1 
ATOM   1844 N  N   . ILE A 1 273 ? 14.408 -7.360  27.968  1.00 41.63  ? 269 ILE A N   1 
ATOM   1845 C  CA  . ILE A 1 273 ? 13.728 -6.700  29.074  1.00 41.53  ? 269 ILE A CA  1 
ATOM   1846 C  C   . ILE A 1 273 ? 12.348 -7.311  29.253  1.00 43.81  ? 269 ILE A C   1 
ATOM   1847 O  O   . ILE A 1 273 ? 11.929 -7.600  30.368  1.00 44.82  ? 269 ILE A O   1 
ATOM   1848 C  CB  . ILE A 1 273 ? 13.606 -5.189  28.795  1.00 25.76  ? 269 ILE A CB  1 
ATOM   1849 C  CG1 . ILE A 1 273 ? 14.995 -4.542  28.886  1.00 25.01  ? 269 ILE A CG1 1 
ATOM   1850 C  CG2 . ILE A 1 273 ? 12.624 -4.543  29.752  1.00 24.47  ? 269 ILE A CG2 1 
ATOM   1851 C  CD1 . ILE A 1 273 ? 15.057 -3.079  28.360  1.00 22.67  ? 269 ILE A CD1 1 
ATOM   1852 N  N   . ILE A 1 274 ? 11.647 -7.520  28.146  1.00 42.53  ? 270 ILE A N   1 
ATOM   1853 C  CA  . ILE A 1 274 ? 10.320 -8.102  28.201  1.00 44.67  ? 270 ILE A CA  1 
ATOM   1854 C  C   . ILE A 1 274 ? 10.346 -9.533  28.729  1.00 44.18  ? 270 ILE A C   1 
ATOM   1855 O  O   . ILE A 1 274 ? 9.474  -9.921  29.494  1.00 46.42  ? 270 ILE A O   1 
ATOM   1856 C  CB  . ILE A 1 274 ? 9.648  -8.082  26.823  1.00 43.22  ? 270 ILE A CB  1 
ATOM   1857 C  CG1 . ILE A 1 274 ? 9.380  -6.633  26.416  1.00 42.27  ? 270 ILE A CG1 1 
ATOM   1858 C  CG2 . ILE A 1 274 ? 8.341  -8.853  26.870  1.00 43.41  ? 270 ILE A CG2 1 
ATOM   1859 C  CD1 . ILE A 1 274 ? 8.810  -6.483  25.041  1.00 42.49  ? 270 ILE A CD1 1 
ATOM   1860 N  N   . LYS A 1 275 ? 11.341 -10.320 28.337  1.00 52.68  ? 271 LYS A N   1 
ATOM   1861 C  CA  . LYS A 1 275 ? 11.422 -11.691 28.826  1.00 54.09  ? 271 LYS A CA  1 
ATOM   1862 C  C   . LYS A 1 275 ? 11.431 -11.729 30.345  1.00 55.40  ? 271 LYS A C   1 
ATOM   1863 O  O   . LYS A 1 275 ? 11.072 -12.738 30.944  1.00 55.29  ? 271 LYS A O   1 
ATOM   1864 C  CB  . LYS A 1 275 ? 12.695 -12.377 28.358  1.00 40.68  ? 271 LYS A CB  1 
ATOM   1865 C  CG  . LYS A 1 275 ? 12.732 -12.806 26.919  1.00 44.31  ? 271 LYS A CG  1 
ATOM   1866 C  CD  . LYS A 1 275 ? 14.033 -13.572 26.682  1.00 47.72  ? 271 LYS A CD  1 
ATOM   1867 C  CE  . LYS A 1 275 ? 14.184 -14.055 25.244  1.00 50.51  ? 271 LYS A CE  1 
ATOM   1868 N  NZ  . LYS A 1 275 ? 15.454 -14.842 25.104  1.00 52.31  ? 271 LYS A NZ  1 
ATOM   1869 N  N   . VAL A 1 276 ? 11.844 -10.633 30.973  1.00 57.72  ? 272 VAL A N   1 
ATOM   1870 C  CA  . VAL A 1 276 ? 11.924 -10.603 32.421  1.00 56.52  ? 272 VAL A CA  1 
ATOM   1871 C  C   . VAL A 1 276 ? 10.854 -9.771  33.106  1.00 57.71  ? 272 VAL A C   1 
ATOM   1872 O  O   . VAL A 1 276 ? 10.324 -10.195 34.125  1.00 58.04  ? 272 VAL A O   1 
ATOM   1873 C  CB  . VAL A 1 276 ? 13.326 -10.133 32.866  1.00 40.97  ? 272 VAL A CB  1 
ATOM   1874 C  CG1 . VAL A 1 276 ? 13.442 -10.124 34.367  1.00 40.23  ? 272 VAL A CG1 1 
ATOM   1875 C  CG2 . VAL A 1 276 ? 14.365 -11.054 32.296  1.00 40.14  ? 272 VAL A CG2 1 
ATOM   1876 N  N   . LEU A 1 277 ? 10.521 -8.603  32.567  1.00 50.22  ? 273 LEU A N   1 
ATOM   1877 C  CA  . LEU A 1 277 ? 9.496  -7.765  33.202  1.00 52.39  ? 273 LEU A CA  1 
ATOM   1878 C  C   . LEU A 1 277 ? 8.117  -8.005  32.617  1.00 56.36  ? 273 LEU A C   1 
ATOM   1879 O  O   . LEU A 1 277 ? 7.165  -7.324  32.986  1.00 58.71  ? 273 LEU A O   1 
ATOM   1880 C  CB  . LEU A 1 277 ? 9.800  -6.276  33.033  1.00 38.55  ? 273 LEU A CB  1 
ATOM   1881 C  CG  . LEU A 1 277 ? 11.188 -5.701  33.288  1.00 38.61  ? 273 LEU A CG  1 
ATOM   1882 C  CD1 . LEU A 1 277 ? 11.045 -4.199  33.508  1.00 33.70  ? 273 LEU A CD1 1 
ATOM   1883 C  CD2 . LEU A 1 277 ? 11.824 -6.369  34.481  1.00 39.90  ? 273 LEU A CD2 1 
ATOM   1884 N  N   . GLY A 1 278 ? 8.007  -8.963  31.705  1.00 59.13  ? 274 GLY A N   1 
ATOM   1885 C  CA  . GLY A 1 278 ? 6.727  -9.222  31.070  1.00 61.48  ? 274 GLY A CA  1 
ATOM   1886 C  C   . GLY A 1 278 ? 6.476  -8.155  30.017  1.00 62.96  ? 274 GLY A C   1 
ATOM   1887 O  O   . GLY A 1 278 ? 7.326  -7.296  29.776  1.00 60.51  ? 274 GLY A O   1 
ATOM   1888 N  N   . THR A 1 279 ? 5.315  -8.194  29.380  1.00 72.46  ? 275 THR A N   1 
ATOM   1889 C  CA  . THR A 1 279 ? 5.006  -7.201  28.363  1.00 74.27  ? 275 THR A CA  1 
ATOM   1890 C  C   . THR A 1 279 ? 4.487  -5.929  29.028  1.00 74.28  ? 275 THR A C   1 
ATOM   1891 O  O   . THR A 1 279 ? 3.772  -5.984  30.030  1.00 73.43  ? 275 THR A O   1 
ATOM   1892 C  CB  . THR A 1 279 ? 3.951  -7.735  27.366  1.00 81.34  ? 275 THR A CB  1 
ATOM   1893 O  OG1 . THR A 1 279 ? 4.465  -8.897  26.703  1.00 82.76  ? 275 THR A OG1 1 
ATOM   1894 C  CG2 . THR A 1 279 ? 3.623  -6.687  26.319  1.00 81.22  ? 275 THR A CG2 1 
ATOM   1895 N  N   . PRO A 1 280 ? 4.851  -4.759  28.487  1.00 84.30  ? 276 PRO A N   1 
ATOM   1896 C  CA  . PRO A 1 280 ? 4.392  -3.498  29.072  1.00 86.47  ? 276 PRO A CA  1 
ATOM   1897 C  C   . PRO A 1 280 ? 2.908  -3.283  28.817  1.00 87.73  ? 276 PRO A C   1 
ATOM   1898 O  O   . PRO A 1 280 ? 2.430  -3.475  27.699  1.00 87.43  ? 276 PRO A O   1 
ATOM   1899 C  CB  . PRO A 1 280 ? 5.218  -2.440  28.342  1.00 58.92  ? 276 PRO A CB  1 
ATOM   1900 C  CG  . PRO A 1 280 ? 6.334  -3.197  27.708  1.00 59.27  ? 276 PRO A CG  1 
ATOM   1901 C  CD  . PRO A 1 280 ? 5.739  -4.509  27.343  1.00 58.11  ? 276 PRO A CD  1 
ATOM   1902 N  N   . THR A 1 281 ? 2.174  -2.888  29.847  1.00 58.33  ? 277 THR A N   1 
ATOM   1903 C  CA  . THR A 1 281 ? 0.757  -2.608  29.670  1.00 59.52  ? 277 THR A CA  1 
ATOM   1904 C  C   . THR A 1 281 ? 0.724  -1.299  28.870  1.00 61.45  ? 277 THR A C   1 
ATOM   1905 O  O   . THR A 1 281 ? 1.758  -0.654  28.694  1.00 61.20  ? 277 THR A O   1 
ATOM   1906 C  CB  . THR A 1 281 ? 0.051  -2.436  31.036  1.00 64.05  ? 277 THR A CB  1 
ATOM   1907 O  OG1 . THR A 1 281 ? 0.489  -1.225  31.666  1.00 63.04  ? 277 THR A OG1 1 
ATOM   1908 C  CG2 . THR A 1 281 ? 0.382  -3.618  31.948  1.00 62.25  ? 277 THR A CG2 1 
ATOM   1909 N  N   . ARG A 1 282 ? -0.438 -0.899  28.371  1.00 81.05  ? 278 ARG A N   1 
ATOM   1910 C  CA  . ARG A 1 282 ? -0.494 0.338   27.599  1.00 82.73  ? 278 ARG A CA  1 
ATOM   1911 C  C   . ARG A 1 282 ? -0.179 1.534   28.485  1.00 81.73  ? 278 ARG A C   1 
ATOM   1912 O  O   . ARG A 1 282 ? 0.438  2.504   28.038  1.00 81.80  ? 278 ARG A O   1 
ATOM   1913 C  CB  . ARG A 1 282 ? -1.872 0.534   26.966  1.00 160.87 ? 278 ARG A CB  1 
ATOM   1914 C  CG  . ARG A 1 282 ? -1.883 1.639   25.918  1.00 164.61 ? 278 ARG A CG  1 
ATOM   1915 C  CD  . ARG A 1 282 ? -3.288 2.064   25.540  1.00 167.90 ? 278 ARG A CD  1 
ATOM   1916 N  NE  . ARG A 1 282 ? -4.110 0.941   25.103  1.00 170.33 ? 278 ARG A NE  1 
ATOM   1917 C  CZ  . ARG A 1 282 ? -5.349 1.064   24.635  1.00 171.51 ? 278 ARG A CZ  1 
ATOM   1918 N  NH1 . ARG A 1 282 ? -5.909 2.263   24.542  1.00 172.03 ? 278 ARG A NH1 1 
ATOM   1919 N  NH2 . ARG A 1 282 ? -6.031 -0.012  24.266  1.00 171.90 ? 278 ARG A NH2 1 
ATOM   1920 N  N   . GLU A 1 283 ? -0.612 1.455   29.741  1.00 93.76  ? 279 GLU A N   1 
ATOM   1921 C  CA  . GLU A 1 283 ? -0.390 2.521   30.708  1.00 93.57  ? 279 GLU A CA  1 
ATOM   1922 C  C   . GLU A 1 283 ? 1.104  2.691   30.930  1.00 92.07  ? 279 GLU A C   1 
ATOM   1923 O  O   . GLU A 1 283 ? 1.613  3.811   30.978  1.00 91.52  ? 279 GLU A O   1 
ATOM   1924 C  CB  . GLU A 1 283 ? -1.072 2.187   32.039  1.00 142.94 ? 279 GLU A CB  1 
ATOM   1925 C  CG  . GLU A 1 283 ? -1.908 3.323   32.622  1.00 146.13 ? 279 GLU A CG  1 
ATOM   1926 C  CD  . GLU A 1 283 ? -1.119 4.612   32.824  1.00 148.79 ? 279 GLU A CD  1 
ATOM   1927 O  OE1 . GLU A 1 283 ? -0.611 5.172   31.830  1.00 149.38 ? 279 GLU A OE1 1 
ATOM   1928 O  OE2 . GLU A 1 283 ? -1.012 5.072   33.981  1.00 150.33 ? 279 GLU A OE2 1 
ATOM   1929 N  N   . GLN A 1 284 ? 1.802  1.569   31.061  1.00 81.67  ? 280 GLN A N   1 
ATOM   1930 C  CA  . GLN A 1 284 ? 3.238  1.598   31.276  1.00 80.52  ? 280 GLN A CA  1 
ATOM   1931 C  C   . GLN A 1 284 ? 3.970  2.182   30.066  1.00 80.76  ? 280 GLN A C   1 
ATOM   1932 O  O   . GLN A 1 284 ? 4.986  2.861   30.212  1.00 79.42  ? 280 GLN A O   1 
ATOM   1933 C  CB  . GLN A 1 284 ? 3.747  0.190   31.584  1.00 61.21  ? 280 GLN A CB  1 
ATOM   1934 C  CG  . GLN A 1 284 ? 3.272  -0.336  32.911  1.00 59.10  ? 280 GLN A CG  1 
ATOM   1935 C  CD  . GLN A 1 284 ? 3.838  -1.709  33.245  1.00 58.69  ? 280 GLN A CD  1 
ATOM   1936 O  OE1 . GLN A 1 284 ? 3.681  -2.668  32.481  1.00 58.53  ? 280 GLN A OE1 1 
ATOM   1937 N  NE2 . GLN A 1 284 ? 4.495  -1.812  34.399  1.00 57.43  ? 280 GLN A NE2 1 
ATOM   1938 N  N   . ILE A 1 285 ? 3.446  1.929   28.872  1.00 72.10  ? 281 ILE A N   1 
ATOM   1939 C  CA  . ILE A 1 285 ? 4.068  2.443   27.663  1.00 73.56  ? 281 ILE A CA  1 
ATOM   1940 C  C   . ILE A 1 285 ? 3.874  3.947   27.574  1.00 74.40  ? 281 ILE A C   1 
ATOM   1941 O  O   . ILE A 1 285 ? 4.732  4.665   27.049  1.00 73.09  ? 281 ILE A O   1 
ATOM   1942 C  CB  . ILE A 1 285 ? 3.469  1.773   26.418  1.00 74.57  ? 281 ILE A CB  1 
ATOM   1943 C  CG1 . ILE A 1 285 ? 3.783  0.270   26.463  1.00 75.77  ? 281 ILE A CG1 1 
ATOM   1944 C  CG2 . ILE A 1 285 ? 4.020  2.424   25.153  1.00 73.87  ? 281 ILE A CG2 1 
ATOM   1945 C  CD1 . ILE A 1 285 ? 3.029  -0.583  25.455  1.00 76.24  ? 281 ILE A CD1 1 
ATOM   1946 N  N   . ARG A 1 286 ? 2.747  4.417   28.103  1.00 89.76  ? 282 ARG A N   1 
ATOM   1947 C  CA  . ARG A 1 286 ? 2.412  5.836   28.088  1.00 91.35  ? 282 ARG A CA  1 
ATOM   1948 C  C   . ARG A 1 286 ? 3.293  6.658   29.027  1.00 91.23  ? 282 ARG A C   1 
ATOM   1949 O  O   . ARG A 1 286 ? 3.617  7.808   28.732  1.00 89.44  ? 282 ARG A O   1 
ATOM   1950 C  CB  . ARG A 1 286 ? 0.947  6.023   28.472  1.00 105.56 ? 282 ARG A CB  1 
ATOM   1951 C  CG  . ARG A 1 286 ? 0.465  7.469   28.470  1.00 108.97 ? 282 ARG A CG  1 
ATOM   1952 C  CD  . ARG A 1 286 ? -0.899 7.568   29.139  1.00 112.26 ? 282 ARG A CD  1 
ATOM   1953 N  NE  . ARG A 1 286 ? -1.859 6.651   28.527  1.00 115.17 ? 282 ARG A NE  1 
ATOM   1954 C  CZ  . ARG A 1 286 ? -2.992 6.256   29.099  1.00 117.07 ? 282 ARG A CZ  1 
ATOM   1955 N  NH1 . ARG A 1 286 ? -3.319 6.694   30.308  1.00 118.29 ? 282 ARG A NH1 1 
ATOM   1956 N  NH2 . ARG A 1 286 ? -3.799 5.421   28.461  1.00 117.64 ? 282 ARG A NH2 1 
ATOM   1957 N  N   . GLU A 1 287 ? 3.680  6.068   30.156  1.00 91.23  ? 283 GLU A N   1 
ATOM   1958 C  CA  . GLU A 1 287 ? 4.514  6.761   31.135  1.00 92.48  ? 283 GLU A CA  1 
ATOM   1959 C  C   . GLU A 1 287 ? 5.981  6.805   30.720  1.00 92.36  ? 283 GLU A C   1 
ATOM   1960 O  O   . GLU A 1 287 ? 6.754  7.620   31.232  1.00 90.90  ? 283 GLU A O   1 
ATOM   1961 C  CB  . GLU A 1 287 ? 4.356  6.103   32.503  1.00 107.79 ? 283 GLU A CB  1 
ATOM   1962 C  CG  . GLU A 1 287 ? 2.934  6.194   33.027  1.00 110.66 ? 283 GLU A CG  1 
ATOM   1963 C  CD  . GLU A 1 287 ? 2.707  5.366   34.270  1.00 112.70 ? 283 GLU A CD  1 
ATOM   1964 O  OE1 . GLU A 1 287 ? 2.954  4.142   34.215  1.00 113.03 ? 283 GLU A OE1 1 
ATOM   1965 O  OE2 . GLU A 1 287 ? 2.277  5.936   35.299  1.00 113.13 ? 283 GLU A OE2 1 
ATOM   1966 N  N   . MET A 1 288 ? 6.347  5.931   29.782  1.00 66.59  ? 284 MET A N   1 
ATOM   1967 C  CA  . MET A 1 288 ? 7.707  5.872   29.249  1.00 67.91  ? 284 MET A CA  1 
ATOM   1968 C  C   . MET A 1 288 ? 7.798  6.825   28.050  1.00 71.04  ? 284 MET A C   1 
ATOM   1969 O  O   . MET A 1 288 ? 8.779  7.563   27.914  1.00 70.05  ? 284 MET A O   1 
ATOM   1970 C  CB  . MET A 1 288 ? 8.060  4.445   28.807  1.00 78.45  ? 284 MET A CB  1 
ATOM   1971 C  CG  . MET A 1 288 ? 7.971  3.404   29.916  1.00 74.02  ? 284 MET A CG  1 
ATOM   1972 S  SD  . MET A 1 288 ? 8.526  1.736   29.439  1.00 68.84  ? 284 MET A SD  1 
ATOM   1973 C  CE  . MET A 1 288 ? 7.135  1.142   28.418  1.00 69.48  ? 284 MET A CE  1 
ATOM   1974 N  N   . ASN A 1 289 ? 6.772  6.796   27.190  1.00 67.72  ? 285 ASN A N   1 
ATOM   1975 C  CA  . ASN A 1 289 ? 6.680  7.663   26.003  1.00 72.22  ? 285 ASN A CA  1 
ATOM   1976 C  C   . ASN A 1 289 ? 7.317  7.116   24.735  1.00 75.13  ? 285 ASN A C   1 
ATOM   1977 O  O   . ASN A 1 289 ? 7.555  7.866   23.789  1.00 75.32  ? 285 ASN A O   1 
ATOM   1978 C  CB  . ASN A 1 289 ? 7.283  9.035   26.307  1.00 143.78 ? 285 ASN A CB  1 
ATOM   1979 C  CG  . ASN A 1 289 ? 6.276  10.152  26.186  1.00 144.51 ? 285 ASN A CG  1 
ATOM   1980 O  OD1 . ASN A 1 289 ? 5.177  10.078  26.734  1.00 143.17 ? 285 ASN A OD1 1 
ATOM   1981 N  ND2 . ASN A 1 289 ? 6.651  11.205  25.474  1.00 145.20 ? 285 ASN A ND2 1 
ATOM   1982 N  N   . PHE A 1 297 ? 5.308  -6.414  19.525  1.00 121.00 ? 293 PHE A N   1 
ATOM   1983 C  CA  . PHE A 1 297 ? 6.095  -7.390  20.276  1.00 120.14 ? 293 PHE A CA  1 
ATOM   1984 C  C   . PHE A 1 297 ? 5.311  -8.607  20.750  1.00 120.21 ? 293 PHE A C   1 
ATOM   1985 O  O   . PHE A 1 297 ? 4.223  -8.475  21.315  1.00 119.81 ? 293 PHE A O   1 
ATOM   1986 C  CB  . PHE A 1 297 ? 6.740  -6.740  21.498  1.00 119.95 ? 293 PHE A CB  1 
ATOM   1987 C  CG  . PHE A 1 297 ? 8.031  -6.055  21.204  1.00 119.17 ? 293 PHE A CG  1 
ATOM   1988 C  CD1 . PHE A 1 297 ? 8.066  -4.693  20.940  1.00 118.71 ? 293 PHE A CD1 1 
ATOM   1989 C  CD2 . PHE A 1 297 ? 9.216  -6.780  21.167  1.00 118.83 ? 293 PHE A CD2 1 
ATOM   1990 C  CE1 . PHE A 1 297 ? 9.267  -4.059  20.642  1.00 118.77 ? 293 PHE A CE1 1 
ATOM   1991 C  CE2 . PHE A 1 297 ? 10.419 -6.158  20.872  1.00 118.53 ? 293 PHE A CE2 1 
ATOM   1992 C  CZ  . PHE A 1 297 ? 10.447 -4.794  20.608  1.00 118.78 ? 293 PHE A CZ  1 
ATOM   1993 N  N   . PRO A 1 298 ? 5.870  -9.814  20.537  1.00 173.28 ? 294 PRO A N   1 
ATOM   1994 C  CA  . PRO A 1 298 ? 5.249  -11.083 20.936  1.00 173.50 ? 294 PRO A CA  1 
ATOM   1995 C  C   . PRO A 1 298 ? 5.016  -11.128 22.443  1.00 173.59 ? 294 PRO A C   1 
ATOM   1996 O  O   . PRO A 1 298 ? 5.893  -11.530 23.209  1.00 173.40 ? 294 PRO A O   1 
ATOM   1997 C  CB  . PRO A 1 298 ? 6.266  -12.121 20.475  1.00 83.83  ? 294 PRO A CB  1 
ATOM   1998 C  CG  . PRO A 1 298 ? 6.886  -11.465 19.271  1.00 84.10  ? 294 PRO A CG  1 
ATOM   1999 C  CD  . PRO A 1 298 ? 7.105  -10.061 19.771  1.00 83.88  ? 294 PRO A CD  1 
ATOM   2000 N  N   . GLN A 1 299 ? 3.819  -10.716 22.847  1.00 176.81 ? 295 GLN A N   1 
ATOM   2001 C  CA  . GLN A 1 299 ? 3.417  -10.662 24.249  1.00 176.78 ? 295 GLN A CA  1 
ATOM   2002 C  C   . GLN A 1 299 ? 3.825  -11.853 25.117  1.00 176.24 ? 295 GLN A C   1 
ATOM   2003 O  O   . GLN A 1 299 ? 3.459  -12.995 24.839  1.00 176.07 ? 295 GLN A O   1 
ATOM   2004 C  CB  . GLN A 1 299 ? 1.902  -10.483 24.339  1.00 163.64 ? 295 GLN A CB  1 
ATOM   2005 C  CG  . GLN A 1 299 ? 1.406  -10.189 25.739  1.00 165.22 ? 295 GLN A CG  1 
ATOM   2006 C  CD  . GLN A 1 299 ? -0.100 -10.205 25.829  1.00 166.17 ? 295 GLN A CD  1 
ATOM   2007 O  OE1 . GLN A 1 299 ? -0.787 -9.592  25.013  1.00 166.49 ? 295 GLN A OE1 1 
ATOM   2008 N  NE2 . GLN A 1 299 ? -0.627 -10.906 26.829  1.00 166.26 ? 295 GLN A NE2 1 
ATOM   2009 N  N   . ILE A 1 300 ? 4.577  -11.566 26.177  1.00 119.82 ? 296 ILE A N   1 
ATOM   2010 C  CA  . ILE A 1 300 ? 5.035  -12.577 27.129  1.00 119.17 ? 296 ILE A CA  1 
ATOM   2011 C  C   . ILE A 1 300 ? 4.611  -12.100 28.533  1.00 119.00 ? 296 ILE A C   1 
ATOM   2012 O  O   . ILE A 1 300 ? 4.364  -10.910 28.733  1.00 118.77 ? 296 ILE A O   1 
ATOM   2013 C  CB  . ILE A 1 300 ? 6.582  -12.784 27.017  1.00 114.98 ? 296 ILE A CB  1 
ATOM   2014 C  CG1 . ILE A 1 300 ? 6.925  -13.317 25.612  1.00 114.24 ? 296 ILE A CG1 1 
ATOM   2015 C  CG2 . ILE A 1 300 ? 7.074  -13.755 28.090  1.00 115.06 ? 296 ILE A CG2 1 
ATOM   2016 C  CD1 . ILE A 1 300 ? 8.376  -13.756 25.414  1.00 113.15 ? 296 ILE A CD1 1 
ATOM   2017 N  N   . LYS A 1 301 ? 4.512  -13.018 29.494  1.00 146.45 ? 297 LYS A N   1 
ATOM   2018 C  CA  . LYS A 1 301 ? 4.064  -12.667 30.848  1.00 146.19 ? 297 LYS A CA  1 
ATOM   2019 C  C   . LYS A 1 301 ? 5.143  -12.418 31.905  1.00 145.79 ? 297 LYS A C   1 
ATOM   2020 O  O   . LYS A 1 301 ? 6.339  -12.513 31.631  1.00 146.21 ? 297 LYS A O   1 
ATOM   2021 C  CB  . LYS A 1 301 ? 3.091  -13.738 31.357  1.00 109.45 ? 297 LYS A CB  1 
ATOM   2022 C  CG  . LYS A 1 301 ? 1.859  -13.910 30.473  1.00 109.38 ? 297 LYS A CG  1 
ATOM   2023 C  CD  . LYS A 1 301 ? 0.865  -14.915 31.044  1.00 109.29 ? 297 LYS A CD  1 
ATOM   2024 C  CE  . LYS A 1 301 ? -0.416 -14.937 30.217  1.00 109.05 ? 297 LYS A CE  1 
ATOM   2025 N  NZ  . LYS A 1 301 ? -1.513 -15.681 30.895  1.00 108.56 ? 297 LYS A NZ  1 
ATOM   2026 N  N   . ALA A 1 302 ? 4.694  -12.097 33.119  1.00 147.82 ? 298 ALA A N   1 
ATOM   2027 C  CA  . ALA A 1 302 ? 5.582  -11.813 34.246  1.00 146.45 ? 298 ALA A CA  1 
ATOM   2028 C  C   . ALA A 1 302 ? 6.545  -12.957 34.540  1.00 145.29 ? 298 ALA A C   1 
ATOM   2029 O  O   . ALA A 1 302 ? 6.123  -14.086 34.792  1.00 144.93 ? 298 ALA A O   1 
ATOM   2030 C  CB  . ALA A 1 302 ? 4.755  -11.502 35.490  1.00 113.04 ? 298 ALA A CB  1 
ATOM   2031 N  N   . HIS A 1 303 ? 7.840  -12.653 34.522  1.00 138.32 ? 299 HIS A N   1 
ATOM   2032 C  CA  . HIS A 1 303 ? 8.874  -13.653 34.779  1.00 136.62 ? 299 HIS A CA  1 
ATOM   2033 C  C   . HIS A 1 303 ? 9.406  -13.590 36.206  1.00 134.11 ? 299 HIS A C   1 
ATOM   2034 O  O   . HIS A 1 303 ? 10.154 -12.677 36.560  1.00 133.80 ? 299 HIS A O   1 
ATOM   2035 C  CB  . HIS A 1 303 ? 10.044 -13.464 33.814  1.00 125.93 ? 299 HIS A CB  1 
ATOM   2036 C  CG  . HIS A 1 303 ? 11.156 -14.446 34.015  1.00 126.85 ? 299 HIS A CG  1 
ATOM   2037 N  ND1 . HIS A 1 303 ? 11.123 -15.724 33.501  1.00 127.79 ? 299 HIS A ND1 1 
ATOM   2038 C  CD2 . HIS A 1 303 ? 12.326 -14.341 34.688  1.00 127.71 ? 299 HIS A CD2 1 
ATOM   2039 C  CE1 . HIS A 1 303 ? 12.227 -16.363 33.846  1.00 128.45 ? 299 HIS A CE1 1 
ATOM   2040 N  NE2 . HIS A 1 303 ? 12.973 -15.546 34.567  1.00 128.62 ? 299 HIS A NE2 1 
ATOM   2041 N  N   . PRO A 1 304 ? 9.027  -14.565 37.046  1.00 194.69 ? 300 PRO A N   1 
ATOM   2042 C  CA  . PRO A 1 304 ? 9.494  -14.585 38.433  1.00 194.69 ? 300 PRO A CA  1 
ATOM   2043 C  C   . PRO A 1 304 ? 11.010 -14.454 38.477  1.00 191.94 ? 300 PRO A C   1 
ATOM   2044 O  O   . PRO A 1 304 ? 11.739 -15.415 38.227  1.00 192.29 ? 300 PRO A O   1 
ATOM   2045 C  CB  . PRO A 1 304 ? 9.004  -15.937 38.937  1.00 120.41 ? 300 PRO A CB  1 
ATOM   2046 C  CG  . PRO A 1 304 ? 7.716  -16.108 38.189  1.00 121.37 ? 300 PRO A CG  1 
ATOM   2047 C  CD  . PRO A 1 304 ? 8.106  -15.686 36.787  1.00 122.10 ? 300 PRO A CD  1 
ATOM   2048 N  N   . TRP A 1 305 ? 11.470 -13.248 38.785  1.00 91.89  ? 301 TRP A N   1 
ATOM   2049 C  CA  . TRP A 1 305 ? 12.890 -12.948 38.855  1.00 86.74  ? 301 TRP A CA  1 
ATOM   2050 C  C   . TRP A 1 305 ? 13.795 -14.044 39.419  1.00 86.27  ? 301 TRP A C   1 
ATOM   2051 O  O   . TRP A 1 305 ? 14.898 -14.248 38.914  1.00 86.37  ? 301 TRP A O   1 
ATOM   2052 C  CB  . TRP A 1 305 ? 13.113 -11.670 39.658  1.00 60.86  ? 301 TRP A CB  1 
ATOM   2053 C  CG  . TRP A 1 305 ? 12.734 -10.403 38.946  1.00 56.16  ? 301 TRP A CG  1 
ATOM   2054 C  CD1 . TRP A 1 305 ? 11.486 -9.870  38.831  1.00 54.76  ? 301 TRP A CD1 1 
ATOM   2055 C  CD2 . TRP A 1 305 ? 13.627 -9.478  38.302  1.00 52.87  ? 301 TRP A CD2 1 
ATOM   2056 N  NE1 . TRP A 1 305 ? 11.544 -8.667  38.167  1.00 53.15  ? 301 TRP A NE1 1 
ATOM   2057 C  CE2 . TRP A 1 305 ? 12.843 -8.402  37.831  1.00 52.14  ? 301 TRP A CE2 1 
ATOM   2058 C  CE3 . TRP A 1 305 ? 15.015 -9.455  38.083  1.00 51.07  ? 301 TRP A CE3 1 
ATOM   2059 C  CZ2 . TRP A 1 305 ? 13.394 -7.315  37.153  1.00 50.67  ? 301 TRP A CZ2 1 
ATOM   2060 C  CZ3 . TRP A 1 305 ? 15.568 -8.367  37.405  1.00 50.14  ? 301 TRP A CZ3 1 
ATOM   2061 C  CH2 . TRP A 1 305 ? 14.753 -7.311  36.949  1.00 50.25  ? 301 TRP A CH2 1 
ATOM   2062 N  N   . THR A 1 306 ? 13.350 -14.744 40.459  1.00 109.77 ? 302 THR A N   1 
ATOM   2063 C  CA  . THR A 1 306 ? 14.184 -15.789 41.055  1.00 108.95 ? 302 THR A CA  1 
ATOM   2064 C  C   . THR A 1 306 ? 14.726 -16.783 40.027  1.00 107.76 ? 302 THR A C   1 
ATOM   2065 O  O   . THR A 1 306 ? 15.796 -17.363 40.225  1.00 109.06 ? 302 THR A O   1 
ATOM   2066 C  CB  . THR A 1 306 ? 13.432 -16.551 42.171  1.00 100.59 ? 302 THR A CB  1 
ATOM   2067 O  OG1 . THR A 1 306 ? 13.186 -15.658 43.266  1.00 101.12 ? 302 THR A OG1 1 
ATOM   2068 C  CG2 . THR A 1 306 ? 14.262 -17.735 42.672  1.00 100.82 ? 302 THR A CG2 1 
ATOM   2069 N  N   . LYS A 1 307 ? 13.996 -16.967 38.931  1.00 81.27  ? 303 LYS A N   1 
ATOM   2070 C  CA  . LYS A 1 307 ? 14.422 -17.873 37.863  1.00 78.41  ? 303 LYS A CA  1 
ATOM   2071 C  C   . LYS A 1 307 ? 15.679 -17.300 37.185  1.00 74.73  ? 303 LYS A C   1 
ATOM   2072 O  O   . LYS A 1 307 ? 16.546 -18.038 36.701  1.00 74.02  ? 303 LYS A O   1 
ATOM   2073 C  CB  . LYS A 1 307 ? 13.295 -18.026 36.826  1.00 108.42 ? 303 LYS A CB  1 
ATOM   2074 C  CG  . LYS A 1 307 ? 13.490 -19.169 35.823  1.00 111.82 ? 303 LYS A CG  1 
ATOM   2075 C  CD  . LYS A 1 307 ? 13.462 -20.530 36.524  1.00 113.38 ? 303 LYS A CD  1 
ATOM   2076 C  CE  . LYS A 1 307 ? 13.736 -21.687 35.566  1.00 114.21 ? 303 LYS A CE  1 
ATOM   2077 N  NZ  . LYS A 1 307 ? 13.787 -22.995 36.289  1.00 114.30 ? 303 LYS A NZ  1 
ATOM   2078 N  N   . VAL A 1 308 ? 15.758 -15.970 37.184  1.00 71.20  ? 304 VAL A N   1 
ATOM   2079 C  CA  . VAL A 1 308 ? 16.850 -15.209 36.578  1.00 65.29  ? 304 VAL A CA  1 
ATOM   2080 C  C   . VAL A 1 308 ? 18.232 -15.365 37.206  1.00 63.38  ? 304 VAL A C   1 
ATOM   2081 O  O   . VAL A 1 308 ? 19.218 -15.482 36.484  1.00 61.11  ? 304 VAL A O   1 
ATOM   2082 C  CB  . VAL A 1 308 ? 16.499 -13.696 36.555  1.00 51.81  ? 304 VAL A CB  1 
ATOM   2083 C  CG1 . VAL A 1 308 ? 17.723 -12.868 36.172  1.00 48.15  ? 304 VAL A CG1 1 
ATOM   2084 C  CG2 . VAL A 1 308 ? 15.366 -13.447 35.573  1.00 50.48  ? 304 VAL A CG2 1 
ATOM   2085 N  N   . PHE A 1 309 ? 18.308 -15.355 38.536  1.00 54.05  ? 305 PHE A N   1 
ATOM   2086 C  CA  . PHE A 1 309 ? 19.597 -15.469 39.217  1.00 53.54  ? 305 PHE A CA  1 
ATOM   2087 C  C   . PHE A 1 309 ? 19.983 -16.871 39.651  1.00 55.36  ? 305 PHE A C   1 
ATOM   2088 O  O   . PHE A 1 309 ? 19.184 -17.794 39.542  1.00 54.15  ? 305 PHE A O   1 
ATOM   2089 C  CB  . PHE A 1 309 ? 19.616 -14.512 40.402  1.00 52.41  ? 305 PHE A CB  1 
ATOM   2090 C  CG  . PHE A 1 309 ? 19.463 -13.088 39.991  1.00 49.65  ? 305 PHE A CG  1 
ATOM   2091 C  CD1 . PHE A 1 309 ? 20.488 -12.443 39.306  1.00 47.17  ? 305 PHE A CD1 1 
ATOM   2092 C  CD2 . PHE A 1 309 ? 18.251 -12.425 40.169  1.00 47.98  ? 305 PHE A CD2 1 
ATOM   2093 C  CE1 . PHE A 1 309 ? 20.299 -11.162 38.794  1.00 45.67  ? 305 PHE A CE1 1 
ATOM   2094 C  CE2 . PHE A 1 309 ? 18.054 -11.147 39.664  1.00 48.14  ? 305 PHE A CE2 1 
ATOM   2095 C  CZ  . PHE A 1 309 ? 19.074 -10.515 38.975  1.00 45.96  ? 305 PHE A CZ  1 
ATOM   2096 N  N   . ARG A 1 310 ? 21.216 -17.048 40.115  1.00 59.54  ? 306 ARG A N   1 
ATOM   2097 C  CA  . ARG A 1 310 ? 21.634 -18.377 40.553  1.00 63.10  ? 306 ARG A CA  1 
ATOM   2098 C  C   . ARG A 1 310 ? 20.913 -18.694 41.845  1.00 63.78  ? 306 ARG A C   1 
ATOM   2099 O  O   . ARG A 1 310 ? 20.478 -17.790 42.561  1.00 63.42  ? 306 ARG A O   1 
ATOM   2100 C  CB  . ARG A 1 310 ? 23.142 -18.460 40.825  1.00 62.45  ? 306 ARG A CB  1 
ATOM   2101 C  CG  . ARG A 1 310 ? 23.967 -17.255 40.407  1.00 66.38  ? 306 ARG A CG  1 
ATOM   2102 C  CD  . ARG A 1 310 ? 25.329 -17.299 41.099  1.00 69.60  ? 306 ARG A CD  1 
ATOM   2103 N  NE  . ARG A 1 310 ? 25.168 -17.246 42.554  1.00 74.24  ? 306 ARG A NE  1 
ATOM   2104 C  CZ  . ARG A 1 310 ? 26.151 -17.396 43.437  1.00 76.74  ? 306 ARG A CZ  1 
ATOM   2105 N  NH1 . ARG A 1 310 ? 27.391 -17.613 43.021  1.00 78.27  ? 306 ARG A NH1 1 
ATOM   2106 N  NH2 . ARG A 1 310 ? 25.888 -17.330 44.740  1.00 77.03  ? 306 ARG A NH2 1 
ATOM   2107 N  N   . PRO A 1 311 ? 20.742 -19.985 42.148  1.00 101.10 ? 307 PRO A N   1 
ATOM   2108 C  CA  . PRO A 1 311 ? 20.067 -20.333 43.396  1.00 101.05 ? 307 PRO A CA  1 
ATOM   2109 C  C   . PRO A 1 311 ? 21.193 -20.114 44.414  1.00 100.60 ? 307 PRO A C   1 
ATOM   2110 O  O   . PRO A 1 311 ? 22.331 -20.509 44.146  1.00 100.15 ? 307 PRO A O   1 
ATOM   2111 C  CB  . PRO A 1 311 ? 19.710 -21.793 43.174  1.00 71.07  ? 307 PRO A CB  1 
ATOM   2112 C  CG  . PRO A 1 311 ? 20.910 -22.294 42.403  1.00 70.81  ? 307 PRO A CG  1 
ATOM   2113 C  CD  . PRO A 1 311 ? 21.150 -21.191 41.404  1.00 70.34  ? 307 PRO A CD  1 
ATOM   2114 N  N   . ARG A 1 312 ? 20.877 -19.467 45.540  1.00 59.98  ? 308 ARG A N   1 
ATOM   2115 C  CA  . ARG A 1 312 ? 21.838 -19.103 46.602  1.00 61.02  ? 308 ARG A CA  1 
ATOM   2116 C  C   . ARG A 1 312 ? 21.772 -17.575 46.680  1.00 58.71  ? 308 ARG A C   1 
ATOM   2117 O  O   . ARG A 1 312 ? 22.118 -16.964 47.688  1.00 58.48  ? 308 ARG A O   1 
ATOM   2118 C  CB  . ARG A 1 312 ? 23.289 -19.490 46.265  1.00 124.27 ? 308 ARG A CB  1 
ATOM   2119 C  CG  . ARG A 1 312 ? 23.638 -20.963 46.400  1.00 130.79 ? 308 ARG A CG  1 
ATOM   2120 C  CD  . ARG A 1 312 ? 23.754 -21.402 47.839  1.00 136.60 ? 308 ARG A CD  1 
ATOM   2121 N  NE  . ARG A 1 312 ? 23.507 -22.833 47.951  1.00 141.14 ? 308 ARG A NE  1 
ATOM   2122 C  CZ  . ARG A 1 312 ? 22.347 -23.408 47.646  1.00 142.50 ? 308 ARG A CZ  1 
ATOM   2123 N  NH1 . ARG A 1 312 ? 21.332 -22.669 47.215  1.00 142.50 ? 308 ARG A NH1 1 
ATOM   2124 N  NH2 . ARG A 1 312 ? 22.196 -24.719 47.767  1.00 143.06 ? 308 ARG A NH2 1 
ATOM   2125 N  N   . THR A 1 313 ? 21.350 -16.961 45.583  1.00 52.10  ? 309 THR A N   1 
ATOM   2126 C  CA  . THR A 1 313 ? 21.218 -15.519 45.525  1.00 49.70  ? 309 THR A CA  1 
ATOM   2127 C  C   . THR A 1 313 ? 20.218 -15.123 46.599  1.00 48.34  ? 309 THR A C   1 
ATOM   2128 O  O   . THR A 1 313 ? 19.172 -15.751 46.742  1.00 48.47  ? 309 THR A O   1 
ATOM   2129 C  CB  . THR A 1 313 ? 20.672 -15.054 44.163  1.00 68.47  ? 309 THR A CB  1 
ATOM   2130 O  OG1 . THR A 1 313 ? 21.515 -15.548 43.119  1.00 65.03  ? 309 THR A OG1 1 
ATOM   2131 C  CG2 . THR A 1 313 ? 20.632 -13.540 44.096  1.00 68.23  ? 309 THR A CG2 1 
ATOM   2132 N  N   . PRO A 1 314 ? 20.536 -14.080 47.377  1.00 57.24  ? 310 PRO A N   1 
ATOM   2133 C  CA  . PRO A 1 314 ? 19.668 -13.589 48.452  1.00 56.79  ? 310 PRO A CA  1 
ATOM   2134 C  C   . PRO A 1 314 ? 18.351 -13.013 47.949  1.00 55.95  ? 310 PRO A C   1 
ATOM   2135 O  O   . PRO A 1 314 ? 18.304 -12.332 46.928  1.00 55.10  ? 310 PRO A O   1 
ATOM   2136 C  CB  . PRO A 1 314 ? 20.527 -12.523 49.126  1.00 43.49  ? 310 PRO A CB  1 
ATOM   2137 C  CG  . PRO A 1 314 ? 21.941 -12.990 48.839  1.00 44.95  ? 310 PRO A CG  1 
ATOM   2138 C  CD  . PRO A 1 314 ? 21.849 -13.408 47.414  1.00 44.53  ? 310 PRO A CD  1 
ATOM   2139 N  N   . PRO A 1 315 ? 17.257 -13.277 48.668  1.00 62.06  ? 311 PRO A N   1 
ATOM   2140 C  CA  . PRO A 1 315 ? 15.952 -12.756 48.254  1.00 61.91  ? 311 PRO A CA  1 
ATOM   2141 C  C   . PRO A 1 315 ? 15.918 -11.227 48.218  1.00 60.87  ? 311 PRO A C   1 
ATOM   2142 O  O   . PRO A 1 315 ? 15.201 -10.642 47.406  1.00 60.68  ? 311 PRO A O   1 
ATOM   2143 C  CB  . PRO A 1 315 ? 15.010 -13.337 49.302  1.00 53.23  ? 311 PRO A CB  1 
ATOM   2144 C  CG  . PRO A 1 315 ? 15.661 -14.643 49.622  1.00 53.83  ? 311 PRO A CG  1 
ATOM   2145 C  CD  . PRO A 1 315 ? 17.104 -14.251 49.760  1.00 53.95  ? 311 PRO A CD  1 
ATOM   2146 N  N   . GLU A 1 316 ? 16.694 -10.592 49.096  1.00 67.70  ? 312 GLU A N   1 
ATOM   2147 C  CA  . GLU A 1 316 ? 16.746 -9.133  49.173  1.00 67.70  ? 312 GLU A CA  1 
ATOM   2148 C  C   . GLU A 1 316 ? 17.309 -8.511  47.902  1.00 65.68  ? 312 GLU A C   1 
ATOM   2149 O  O   . GLU A 1 316 ? 16.787 -7.501  47.406  1.00 62.66  ? 312 GLU A O   1 
ATOM   2150 C  CB  . GLU A 1 316 ? 17.591 -8.673  50.364  1.00 79.13  ? 312 GLU A CB  1 
ATOM   2151 C  CG  . GLU A 1 316 ? 17.007 -9.027  51.706  1.00 82.23  ? 312 GLU A CG  1 
ATOM   2152 C  CD  . GLU A 1 316 ? 17.147 -10.504 52.031  1.00 86.79  ? 312 GLU A CD  1 
ATOM   2153 O  OE1 . GLU A 1 316 ? 16.474 -10.963 52.980  1.00 90.63  ? 312 GLU A OE1 1 
ATOM   2154 O  OE2 . GLU A 1 316 ? 17.935 -11.205 51.348  1.00 84.58  ? 312 GLU A OE2 1 
ATOM   2155 N  N   . ALA A 1 317 ? 18.383 -9.107  47.385  1.00 46.94  ? 313 ALA A N   1 
ATOM   2156 C  CA  . ALA A 1 317 ? 19.018 -8.620  46.168  1.00 46.38  ? 313 ALA A CA  1 
ATOM   2157 C  C   . ALA A 1 317 ? 18.030 -8.640  45.006  1.00 46.59  ? 313 ALA A C   1 
ATOM   2158 O  O   . ALA A 1 317 ? 17.947 -7.692  44.227  1.00 46.12  ? 313 ALA A O   1 
ATOM   2159 C  CB  . ALA A 1 317 ? 20.216 -9.479  45.844  1.00 34.71  ? 313 ALA A CB  1 
ATOM   2160 N  N   . ILE A 1 318 ? 17.282 -9.730  44.898  1.00 51.79  ? 314 ILE A N   1 
ATOM   2161 C  CA  . ILE A 1 318 ? 16.309 -9.882  43.835  1.00 52.30  ? 314 ILE A CA  1 
ATOM   2162 C  C   . ILE A 1 318 ? 15.153 -8.913  44.033  1.00 51.37  ? 314 ILE A C   1 
ATOM   2163 O  O   . ILE A 1 318 ? 14.603 -8.378  43.064  1.00 50.60  ? 314 ILE A O   1 
ATOM   2164 C  CB  . ILE A 1 318 ? 15.780 -11.318 43.797  1.00 43.24  ? 314 ILE A CB  1 
ATOM   2165 C  CG1 . ILE A 1 318 ? 16.947 -12.281 43.538  1.00 45.10  ? 314 ILE A CG1 1 
ATOM   2166 C  CG2 . ILE A 1 318 ? 14.694 -11.451 42.734  1.00 44.16  ? 314 ILE A CG2 1 
ATOM   2167 C  CD1 . ILE A 1 318 ? 16.572 -13.739 43.658  1.00 44.41  ? 314 ILE A CD1 1 
ATOM   2168 N  N   . ALA A 1 319 ? 14.786 -8.687  45.290  1.00 44.20  ? 315 ALA A N   1 
ATOM   2169 C  CA  . ALA A 1 319 ? 13.696 -7.776  45.614  1.00 44.66  ? 315 ALA A CA  1 
ATOM   2170 C  C   . ALA A 1 319 ? 14.080 -6.378  45.160  1.00 43.22  ? 315 ALA A C   1 
ATOM   2171 O  O   . ALA A 1 319 ? 13.279 -5.661  44.555  1.00 43.03  ? 315 ALA A O   1 
ATOM   2172 C  CB  . ALA A 1 319 ? 13.442 -7.777  47.116  1.00 28.11  ? 315 ALA A CB  1 
ATOM   2173 N  N   . LEU A 1 320 ? 15.318 -5.996  45.468  1.00 48.57  ? 316 LEU A N   1 
ATOM   2174 C  CA  . LEU A 1 320 ? 15.845 -4.686  45.112  1.00 48.52  ? 316 LEU A CA  1 
ATOM   2175 C  C   . LEU A 1 320 ? 15.873 -4.535  43.596  1.00 47.17  ? 316 LEU A C   1 
ATOM   2176 O  O   . LEU A 1 320 ? 15.484 -3.499  43.064  1.00 45.62  ? 316 LEU A O   1 
ATOM   2177 C  CB  . LEU A 1 320 ? 17.263 -4.526  45.655  1.00 35.39  ? 316 LEU A CB  1 
ATOM   2178 C  CG  . LEU A 1 320 ? 17.782 -3.155  46.085  1.00 40.39  ? 316 LEU A CG  1 
ATOM   2179 C  CD1 . LEU A 1 320 ? 19.274 -3.118  45.845  1.00 37.68  ? 316 LEU A CD1 1 
ATOM   2180 C  CD2 . LEU A 1 320 ? 17.120 -2.049  45.321  1.00 35.43  ? 316 LEU A CD2 1 
ATOM   2181 N  N   . CYS A 1 321 ? 16.344 -5.560  42.899  1.00 50.16  ? 317 CYS A N   1 
ATOM   2182 C  CA  . CYS A 1 321 ? 16.400 -5.480  41.454  1.00 51.37  ? 317 CYS A CA  1 
ATOM   2183 C  C   . CYS A 1 321 ? 15.053 -5.160  40.858  1.00 52.33  ? 317 CYS A C   1 
ATOM   2184 O  O   . CYS A 1 321 ? 14.942 -4.264  40.021  1.00 50.71  ? 317 CYS A O   1 
ATOM   2185 C  CB  . CYS A 1 321 ? 16.886 -6.785  40.844  1.00 53.42  ? 317 CYS A CB  1 
ATOM   2186 S  SG  . CYS A 1 321 ? 18.657 -6.950  40.810  1.00 55.43  ? 317 CYS A SG  1 
ATOM   2187 N  N   . SER A 1 322 ? 14.030 -5.893  41.287  1.00 46.26  ? 318 SER A N   1 
ATOM   2188 C  CA  . SER A 1 322 ? 12.695 -5.694  40.757  1.00 47.49  ? 318 SER A CA  1 
ATOM   2189 C  C   . SER A 1 322 ? 12.177 -4.294  41.019  1.00 47.16  ? 318 SER A C   1 
ATOM   2190 O  O   . SER A 1 322 ? 11.425 -3.747  40.219  1.00 47.71  ? 318 SER A O   1 
ATOM   2191 C  CB  . SER A 1 322 ? 11.742 -6.728  41.344  1.00 50.31  ? 318 SER A CB  1 
ATOM   2192 O  OG  . SER A 1 322 ? 11.700 -6.603  42.746  1.00 52.25  ? 318 SER A OG  1 
ATOM   2193 N  N   . ARG A 1 323 ? 12.580 -3.706  42.134  1.00 43.78  ? 319 ARG A N   1 
ATOM   2194 C  CA  . ARG A 1 323 ? 12.123 -2.362  42.455  1.00 44.47  ? 319 ARG A CA  1 
ATOM   2195 C  C   . ARG A 1 323 ? 12.907 -1.280  41.715  1.00 43.54  ? 319 ARG A C   1 
ATOM   2196 O  O   . ARG A 1 323 ? 12.514 -0.123  41.715  1.00 43.15  ? 319 ARG A O   1 
ATOM   2197 C  CB  . ARG A 1 323 ? 12.215 -2.113  43.964  1.00 52.91  ? 319 ARG A CB  1 
ATOM   2198 C  CG  . ARG A 1 323 ? 11.256 -2.940  44.806  1.00 57.11  ? 319 ARG A CG  1 
ATOM   2199 C  CD  . ARG A 1 323 ? 9.817  -2.807  44.306  1.00 61.30  ? 319 ARG A CD  1 
ATOM   2200 N  NE  . ARG A 1 323 ? 9.406  -1.414  44.106  1.00 66.67  ? 319 ARG A NE  1 
ATOM   2201 C  CZ  . ARG A 1 323 ? 9.198  -0.538  45.085  1.00 68.95  ? 319 ARG A CZ  1 
ATOM   2202 N  NH1 . ARG A 1 323 ? 9.355  -0.894  46.359  1.00 71.12  ? 319 ARG A NH1 1 
ATOM   2203 N  NH2 . ARG A 1 323 ? 8.838  0.706   44.787  1.00 70.87  ? 319 ARG A NH2 1 
ATOM   2204 N  N   . LEU A 1 324 ? 14.018 -1.648  41.089  1.00 48.30  ? 320 LEU A N   1 
ATOM   2205 C  CA  . LEU A 1 324 ? 14.823 -0.676  40.368  1.00 47.89  ? 320 LEU A CA  1 
ATOM   2206 C  C   . LEU A 1 324 ? 14.481 -0.734  38.889  1.00 46.71  ? 320 LEU A C   1 
ATOM   2207 O  O   . LEU A 1 324 ? 14.261 0.292   38.233  1.00 48.18  ? 320 LEU A O   1 
ATOM   2208 C  CB  . LEU A 1 324 ? 16.306 -0.986  40.563  1.00 25.95  ? 320 LEU A CB  1 
ATOM   2209 C  CG  . LEU A 1 324 ? 16.896 -0.834  41.977  1.00 27.42  ? 320 LEU A CG  1 
ATOM   2210 C  CD1 . LEU A 1 324 ? 18.253 -1.519  42.071  1.00 22.51  ? 320 LEU A CD1 1 
ATOM   2211 C  CD2 . LEU A 1 324 ? 17.038 0.638   42.313  1.00 22.61  ? 320 LEU A CD2 1 
ATOM   2212 N  N   . LEU A 1 325 ? 14.430 -1.953  38.374  1.00 45.87  ? 321 LEU A N   1 
ATOM   2213 C  CA  . LEU A 1 325 ? 14.144 -2.194  36.966  1.00 45.94  ? 321 LEU A CA  1 
ATOM   2214 C  C   . LEU A 1 325 ? 12.649 -2.255  36.687  1.00 46.81  ? 321 LEU A C   1 
ATOM   2215 O  O   . LEU A 1 325 ? 12.077 -3.332  36.499  1.00 46.57  ? 321 LEU A O   1 
ATOM   2216 C  CB  . LEU A 1 325 ? 14.838 -3.488  36.538  1.00 30.89  ? 321 LEU A CB  1 
ATOM   2217 C  CG  . LEU A 1 325 ? 16.341 -3.417  36.831  1.00 31.51  ? 321 LEU A CG  1 
ATOM   2218 C  CD1 . LEU A 1 325 ? 16.999 -4.760  36.586  1.00 31.21  ? 321 LEU A CD1 1 
ATOM   2219 C  CD2 . LEU A 1 325 ? 16.953 -2.333  35.960  1.00 30.45  ? 321 LEU A CD2 1 
ATOM   2220 N  N   . GLU A 1 326 ? 12.035 -1.077  36.654  1.00 46.38  ? 322 GLU A N   1 
ATOM   2221 C  CA  . GLU A 1 326 ? 10.605 -0.936  36.417  1.00 49.49  ? 322 GLU A CA  1 
ATOM   2222 C  C   . GLU A 1 326 ? 10.305 -0.110  35.167  1.00 48.41  ? 322 GLU A C   1 
ATOM   2223 O  O   . GLU A 1 326 ? 10.943 0.918   34.930  1.00 46.64  ? 322 GLU A O   1 
ATOM   2224 C  CB  . GLU A 1 326 ? 9.953  -0.243  37.616  1.00 76.20  ? 322 GLU A CB  1 
ATOM   2225 C  CG  . GLU A 1 326 ? 10.071 -0.991  38.928  1.00 82.42  ? 322 GLU A CG  1 
ATOM   2226 C  CD  . GLU A 1 326 ? 8.781  -1.682  39.329  1.00 85.56  ? 322 GLU A CD  1 
ATOM   2227 O  OE1 . GLU A 1 326 ? 8.751  -2.311  40.410  1.00 86.96  ? 322 GLU A OE1 1 
ATOM   2228 O  OE2 . GLU A 1 326 ? 7.793  -1.594  38.568  1.00 88.18  ? 322 GLU A OE2 1 
ATOM   2229 N  N   . TYR A 1 327 ? 9.326  -0.548  34.378  1.00 41.63  ? 323 TYR A N   1 
ATOM   2230 C  CA  . TYR A 1 327 ? 8.930  0.192   33.183  1.00 42.90  ? 323 TYR A CA  1 
ATOM   2231 C  C   . TYR A 1 327 ? 8.542  1.626   33.554  1.00 42.38  ? 323 TYR A C   1 
ATOM   2232 O  O   . TYR A 1 327 ? 9.061  2.588   33.002  1.00 42.38  ? 323 TYR A O   1 
ATOM   2233 C  CB  . TYR A 1 327 ? 7.741  -0.486  32.495  1.00 42.95  ? 323 TYR A CB  1 
ATOM   2234 C  CG  . TYR A 1 327 ? 8.085  -1.696  31.656  1.00 43.96  ? 323 TYR A CG  1 
ATOM   2235 C  CD1 . TYR A 1 327 ? 7.449  -2.912  31.873  1.00 43.89  ? 323 TYR A CD1 1 
ATOM   2236 C  CD2 . TYR A 1 327 ? 9.020  -1.615  30.619  1.00 42.38  ? 323 TYR A CD2 1 
ATOM   2237 C  CE1 . TYR A 1 327 ? 7.727  -4.020  31.085  1.00 45.48  ? 323 TYR A CE1 1 
ATOM   2238 C  CE2 . TYR A 1 327 ? 9.303  -2.713  29.824  1.00 44.20  ? 323 TYR A CE2 1 
ATOM   2239 C  CZ  . TYR A 1 327 ? 8.649  -3.916  30.060  1.00 45.31  ? 323 TYR A CZ  1 
ATOM   2240 O  OH  . TYR A 1 327 ? 8.881  -5.015  29.247  1.00 47.57  ? 323 TYR A OH  1 
ATOM   2241 N  N   . THR A 1 328 ? 7.629  1.770   34.500  1.00 43.18  ? 324 THR A N   1 
ATOM   2242 C  CA  . THR A 1 328 ? 7.193  3.093   34.914  1.00 43.70  ? 324 THR A CA  1 
ATOM   2243 C  C   . THR A 1 328 ? 8.308  3.836   35.642  1.00 43.38  ? 324 THR A C   1 
ATOM   2244 O  O   . THR A 1 328 ? 8.697  3.468   36.746  1.00 42.85  ? 324 THR A O   1 
ATOM   2245 C  CB  . THR A 1 328 ? 5.980  2.992   35.846  1.00 45.55  ? 324 THR A CB  1 
ATOM   2246 O  OG1 . THR A 1 328 ? 4.894  2.376   35.142  1.00 47.56  ? 324 THR A OG1 1 
ATOM   2247 C  CG2 . THR A 1 328 ? 5.566  4.374   36.332  1.00 44.54  ? 324 THR A CG2 1 
ATOM   2248 N  N   . PRO A 1 329 ? 8.827  4.904   35.038  1.00 39.42  ? 325 PRO A N   1 
ATOM   2249 C  CA  . PRO A 1 329 ? 9.904  5.675   35.666  1.00 38.06  ? 325 PRO A CA  1 
ATOM   2250 C  C   . PRO A 1 329 ? 9.624  6.133   37.104  1.00 39.91  ? 325 PRO A C   1 
ATOM   2251 O  O   . PRO A 1 329 ? 10.483 6.011   37.987  1.00 39.18  ? 325 PRO A O   1 
ATOM   2252 C  CB  . PRO A 1 329 ? 10.093 6.842   34.702  1.00 36.94  ? 325 PRO A CB  1 
ATOM   2253 C  CG  . PRO A 1 329 ? 9.766  6.226   33.375  1.00 38.13  ? 325 PRO A CG  1 
ATOM   2254 C  CD  . PRO A 1 329 ? 8.530  5.409   33.689  1.00 37.91  ? 325 PRO A CD  1 
ATOM   2255 N  N   . THR A 1 330 ? 8.429  6.656   37.349  1.00 42.83  ? 326 THR A N   1 
ATOM   2256 C  CA  . THR A 1 330 ? 8.067  7.129   38.689  1.00 42.54  ? 326 THR A CA  1 
ATOM   2257 C  C   . THR A 1 330 ? 7.915  6.015   39.724  1.00 41.49  ? 326 THR A C   1 
ATOM   2258 O  O   . THR A 1 330 ? 7.803  6.293   40.915  1.00 41.47  ? 326 THR A O   1 
ATOM   2259 C  CB  . THR A 1 330 ? 6.740  7.917   38.678  1.00 47.98  ? 326 THR A CB  1 
ATOM   2260 O  OG1 . THR A 1 330 ? 5.682  7.080   38.182  1.00 51.30  ? 326 THR A OG1 1 
ATOM   2261 C  CG2 . THR A 1 330 ? 6.864  9.147   37.812  1.00 46.51  ? 326 THR A CG2 1 
ATOM   2262 N  N   . ALA A 1 331 ? 7.898  4.762   39.283  1.00 35.76  ? 327 ALA A N   1 
ATOM   2263 C  CA  . ALA A 1 331 ? 7.750  3.657   40.225  1.00 36.34  ? 327 ALA A CA  1 
ATOM   2264 C  C   . ALA A 1 331 ? 9.082  3.126   40.747  1.00 37.63  ? 327 ALA A C   1 
ATOM   2265 O  O   . ALA A 1 331 ? 9.135  2.417   41.750  1.00 38.15  ? 327 ALA A O   1 
ATOM   2266 C  CB  . ALA A 1 331 ? 6.972  2.525   39.593  1.00 25.66  ? 327 ALA A CB  1 
ATOM   2267 N  N   . ARG A 1 332 ? 10.167 3.450   40.072  1.00 48.95  ? 328 ARG A N   1 
ATOM   2268 C  CA  . ARG A 1 332 ? 11.450 2.959   40.529  1.00 48.60  ? 328 ARG A CA  1 
ATOM   2269 C  C   . ARG A 1 332 ? 11.832 3.665   41.831  1.00 49.47  ? 328 ARG A C   1 
ATOM   2270 O  O   . ARG A 1 332 ? 11.507 4.834   42.021  1.00 49.47  ? 328 ARG A O   1 
ATOM   2271 C  CB  . ARG A 1 332 ? 12.508 3.222   39.453  1.00 35.38  ? 328 ARG A CB  1 
ATOM   2272 C  CG  . ARG A 1 332 ? 12.142 2.673   38.091  1.00 33.37  ? 328 ARG A CG  1 
ATOM   2273 C  CD  . ARG A 1 332 ? 13.051 3.216   37.025  1.00 33.39  ? 328 ARG A CD  1 
ATOM   2274 N  NE  . ARG A 1 332 ? 12.534 2.874   35.715  1.00 32.62  ? 328 ARG A NE  1 
ATOM   2275 C  CZ  . ARG A 1 332 ? 12.859 3.506   34.601  1.00 33.50  ? 328 ARG A CZ  1 
ATOM   2276 N  NH1 . ARG A 1 332 ? 13.718 4.520   34.631  1.00 32.26  ? 328 ARG A NH1 1 
ATOM   2277 N  NH2 . ARG A 1 332 ? 12.288 3.142   33.466  1.00 31.89  ? 328 ARG A NH2 1 
ATOM   2278 N  N   . LEU A 1 333 ? 12.509 2.955   42.727  1.00 38.34  ? 329 LEU A N   1 
ATOM   2279 C  CA  . LEU A 1 333 ? 12.954 3.548   43.980  1.00 38.49  ? 329 LEU A CA  1 
ATOM   2280 C  C   . LEU A 1 333 ? 13.835 4.738   43.673  1.00 38.06  ? 329 LEU A C   1 
ATOM   2281 O  O   . LEU A 1 333 ? 14.363 4.861   42.569  1.00 36.41  ? 329 LEU A O   1 
ATOM   2282 C  CB  . LEU A 1 333 ? 13.797 2.564   44.782  1.00 33.11  ? 329 LEU A CB  1 
ATOM   2283 C  CG  . LEU A 1 333 ? 13.164 1.272   45.295  1.00 35.70  ? 329 LEU A CG  1 
ATOM   2284 C  CD1 . LEU A 1 333 ? 14.244 0.423   45.981  1.00 37.09  ? 329 LEU A CD1 1 
ATOM   2285 C  CD2 . LEU A 1 333 ? 12.035 1.591   46.269  1.00 37.45  ? 329 LEU A CD2 1 
ATOM   2286 N  N   . THR A 1 334 ? 14.001 5.614   44.650  1.00 39.15  ? 330 THR A N   1 
ATOM   2287 C  CA  . THR A 1 334 ? 14.879 6.766   44.482  1.00 38.79  ? 330 THR A CA  1 
ATOM   2288 C  C   . THR A 1 334 ? 16.228 6.276   45.017  1.00 39.70  ? 330 THR A C   1 
ATOM   2289 O  O   . THR A 1 334 ? 16.293 5.251   45.705  1.00 37.97  ? 330 THR A O   1 
ATOM   2290 C  CB  . THR A 1 334 ? 14.426 7.956   45.343  1.00 39.99  ? 330 THR A CB  1 
ATOM   2291 O  OG1 . THR A 1 334 ? 14.522 7.603   46.735  1.00 39.12  ? 330 THR A OG1 1 
ATOM   2292 C  CG2 . THR A 1 334 ? 12.997 8.322   45.031  1.00 38.24  ? 330 THR A CG2 1 
ATOM   2293 N  N   . PRO A 1 335 ? 17.322 6.979   44.702  1.00 43.34  ? 331 PRO A N   1 
ATOM   2294 C  CA  . PRO A 1 335 ? 18.621 6.529   45.211  1.00 43.12  ? 331 PRO A CA  1 
ATOM   2295 C  C   . PRO A 1 335 ? 18.574 6.302   46.728  1.00 45.24  ? 331 PRO A C   1 
ATOM   2296 O  O   . PRO A 1 335 ? 18.963 5.242   47.228  1.00 42.66  ? 331 PRO A O   1 
ATOM   2297 C  CB  . PRO A 1 335 ? 19.547 7.677   44.826  1.00 31.75  ? 331 PRO A CB  1 
ATOM   2298 C  CG  . PRO A 1 335 ? 18.973 8.106   43.500  1.00 31.35  ? 331 PRO A CG  1 
ATOM   2299 C  CD  . PRO A 1 335 ? 17.478 8.089   43.746  1.00 31.84  ? 331 PRO A CD  1 
ATOM   2300 N  N   . LEU A 1 336 ? 18.082 7.311   47.446  1.00 35.77  ? 332 LEU A N   1 
ATOM   2301 C  CA  . LEU A 1 336 ? 17.992 7.267   48.899  1.00 36.22  ? 332 LEU A CA  1 
ATOM   2302 C  C   . LEU A 1 336 ? 17.137 6.112   49.368  1.00 37.11  ? 332 LEU A C   1 
ATOM   2303 O  O   . LEU A 1 336 ? 17.509 5.406   50.295  1.00 38.24  ? 332 LEU A O   1 
ATOM   2304 C  CB  . LEU A 1 336 ? 17.418 8.573   49.420  1.00 49.58  ? 332 LEU A CB  1 
ATOM   2305 C  CG  . LEU A 1 336 ? 18.019 9.090   50.716  1.00 51.35  ? 332 LEU A CG  1 
ATOM   2306 C  CD1 . LEU A 1 336 ? 19.524 9.195   50.580  1.00 48.62  ? 332 LEU A CD1 1 
ATOM   2307 C  CD2 . LEU A 1 336 ? 17.418 10.447  51.024  1.00 52.02  ? 332 LEU A CD2 1 
ATOM   2308 N  N   . GLU A 1 337 ? 15.986 5.913   48.739  1.00 40.89  ? 333 GLU A N   1 
ATOM   2309 C  CA  . GLU A 1 337 ? 15.126 4.801   49.124  1.00 41.39  ? 333 GLU A CA  1 
ATOM   2310 C  C   . GLU A 1 337 ? 15.868 3.475   48.934  1.00 42.61  ? 333 GLU A C   1 
ATOM   2311 O  O   . GLU A 1 337 ? 15.635 2.522   49.665  1.00 43.03  ? 333 GLU A O   1 
ATOM   2312 C  CB  . GLU A 1 337 ? 13.837 4.802   48.298  1.00 56.29  ? 333 GLU A CB  1 
ATOM   2313 C  CG  . GLU A 1 337 ? 12.763 5.734   48.825  1.00 59.82  ? 333 GLU A CG  1 
ATOM   2314 C  CD  . GLU A 1 337 ? 11.637 5.971   47.826  1.00 62.69  ? 333 GLU A CD  1 
ATOM   2315 O  OE1 . GLU A 1 337 ? 10.621 6.586   48.203  1.00 65.47  ? 333 GLU A OE1 1 
ATOM   2316 O  OE2 . GLU A 1 337 ? 11.770 5.551   46.658  1.00 60.72  ? 333 GLU A OE2 1 
ATOM   2317 N  N   . ALA A 1 338 ? 16.772 3.422   47.962  1.00 42.56  ? 334 ALA A N   1 
ATOM   2318 C  CA  . ALA A 1 338 ? 17.524 2.203   47.688  1.00 42.76  ? 334 ALA A CA  1 
ATOM   2319 C  C   . ALA A 1 338 ? 18.545 1.914   48.785  1.00 40.17  ? 334 ALA A C   1 
ATOM   2320 O  O   . ALA A 1 338 ? 18.717 0.764   49.201  1.00 38.45  ? 334 ALA A O   1 
ATOM   2321 C  CB  . ALA A 1 338 ? 18.217 2.304   46.332  1.00 22.30  ? 334 ALA A CB  1 
ATOM   2322 N  N   . CYS A 1 339 ? 19.231 2.948   49.254  1.00 43.01  ? 335 CYS A N   1 
ATOM   2323 C  CA  . CYS A 1 339 ? 20.202 2.752   50.316  1.00 43.64  ? 335 CYS A CA  1 
ATOM   2324 C  C   . CYS A 1 339 ? 19.542 2.132   51.558  1.00 44.85  ? 335 CYS A C   1 
ATOM   2325 O  O   . CYS A 1 339 ? 20.130 1.275   52.227  1.00 45.21  ? 335 CYS A O   1 
ATOM   2326 C  CB  . CYS A 1 339 ? 20.840 4.086   50.697  1.00 39.69  ? 335 CYS A CB  1 
ATOM   2327 S  SG  . CYS A 1 339 ? 21.935 4.795   49.459  1.00 40.90  ? 335 CYS A SG  1 
ATOM   2328 N  N   . ALA A 1 340 ? 18.316 2.559   51.852  1.00 37.52  ? 336 ALA A N   1 
ATOM   2329 C  CA  . ALA A 1 340 ? 17.594 2.080   53.024  1.00 36.00  ? 336 ALA A CA  1 
ATOM   2330 C  C   . ALA A 1 340 ? 16.905 0.714   52.831  1.00 36.56  ? 336 ALA A C   1 
ATOM   2331 O  O   . ALA A 1 340 ? 16.188 0.229   53.713  1.00 35.36  ? 336 ALA A O   1 
ATOM   2332 C  CB  . ALA A 1 340 ? 16.587 3.133   53.440  1.00 21.68  ? 336 ALA A CB  1 
ATOM   2333 N  N   . HIS A 1 341 ? 17.134 0.095   51.676  1.00 39.30  ? 337 HIS A N   1 
ATOM   2334 C  CA  . HIS A 1 341 ? 16.546 -1.208  51.358  1.00 39.42  ? 337 HIS A CA  1 
ATOM   2335 C  C   . HIS A 1 341 ? 17.190 -2.276  52.232  1.00 41.53  ? 337 HIS A C   1 
ATOM   2336 O  O   . HIS A 1 341 ? 18.365 -2.167  52.574  1.00 39.71  ? 337 HIS A O   1 
ATOM   2337 C  CB  . HIS A 1 341 ? 16.760 -1.521  49.877  1.00 41.73  ? 337 HIS A CB  1 
ATOM   2338 C  CG  . HIS A 1 341 ? 16.011 -2.723  49.400  1.00 40.79  ? 337 HIS A CG  1 
ATOM   2339 N  ND1 . HIS A 1 341 ? 16.364 -4.009  49.750  1.00 42.63  ? 337 HIS A ND1 1 
ATOM   2340 C  CD2 . HIS A 1 341 ? 14.928 -2.837  48.595  1.00 40.39  ? 337 HIS A CD2 1 
ATOM   2341 C  CE1 . HIS A 1 341 ? 15.534 -4.863  49.178  1.00 41.66  ? 337 HIS A CE1 1 
ATOM   2342 N  NE2 . HIS A 1 341 ? 14.652 -4.178  48.471  1.00 44.35  ? 337 HIS A NE2 1 
ATOM   2343 N  N   . SER A 1 342 ? 16.430 -3.309  52.585  1.00 45.15  ? 338 SER A N   1 
ATOM   2344 C  CA  . SER A 1 342 ? 16.943 -4.357  53.466  1.00 48.26  ? 338 SER A CA  1 
ATOM   2345 C  C   . SER A 1 342 ? 18.184 -5.080  52.935  1.00 47.17  ? 338 SER A C   1 
ATOM   2346 O  O   . SER A 1 342 ? 18.990 -5.593  53.706  1.00 47.04  ? 338 SER A O   1 
ATOM   2347 C  CB  . SER A 1 342 ? 15.838 -5.361  53.794  1.00 47.15  ? 338 SER A CB  1 
ATOM   2348 O  OG  . SER A 1 342 ? 15.501 -6.120  52.656  1.00 51.13  ? 338 SER A OG  1 
ATOM   2349 N  N   . PHE A 1 343 ? 18.347 -5.121  51.624  1.00 35.80  ? 339 PHE A N   1 
ATOM   2350 C  CA  . PHE A 1 343 ? 19.524 -5.752  51.046  1.00 33.13  ? 339 PHE A CA  1 
ATOM   2351 C  C   . PHE A 1 343 ? 20.803 -5.156  51.649  1.00 32.72  ? 339 PHE A C   1 
ATOM   2352 O  O   . PHE A 1 343 ? 21.826 -5.824  51.733  1.00 30.28  ? 339 PHE A O   1 
ATOM   2353 C  CB  . PHE A 1 343 ? 19.517 -5.555  49.531  1.00 46.26  ? 339 PHE A CB  1 
ATOM   2354 C  CG  . PHE A 1 343 ? 20.731 -6.086  48.839  1.00 47.15  ? 339 PHE A CG  1 
ATOM   2355 C  CD1 . PHE A 1 343 ? 21.113 -7.408  48.993  1.00 46.54  ? 339 PHE A CD1 1 
ATOM   2356 C  CD2 . PHE A 1 343 ? 21.498 -5.259  48.031  1.00 46.30  ? 339 PHE A CD2 1 
ATOM   2357 C  CE1 . PHE A 1 343 ? 22.247 -7.898  48.353  1.00 45.03  ? 339 PHE A CE1 1 
ATOM   2358 C  CE2 . PHE A 1 343 ? 22.628 -5.744  47.391  1.00 45.86  ? 339 PHE A CE2 1 
ATOM   2359 C  CZ  . PHE A 1 343 ? 23.001 -7.062  47.554  1.00 43.71  ? 339 PHE A CZ  1 
ATOM   2360 N  N   . PHE A 1 344 ? 20.757 -3.906  52.088  1.00 30.95  ? 340 PHE A N   1 
ATOM   2361 C  CA  . PHE A 1 344 ? 21.943 -3.294  52.681  1.00 31.55  ? 340 PHE A CA  1 
ATOM   2362 C  C   . PHE A 1 344 ? 21.947 -3.342  54.211  1.00 31.63  ? 340 PHE A C   1 
ATOM   2363 O  O   . PHE A 1 344 ? 22.761 -2.680  54.855  1.00 33.31  ? 340 PHE A O   1 
ATOM   2364 C  CB  . PHE A 1 344 ? 22.082 -1.836  52.223  1.00 37.59  ? 340 PHE A CB  1 
ATOM   2365 C  CG  . PHE A 1 344 ? 22.186 -1.681  50.740  1.00 38.75  ? 340 PHE A CG  1 
ATOM   2366 C  CD1 . PHE A 1 344 ? 23.299 -2.153  50.061  1.00 35.03  ? 340 PHE A CD1 1 
ATOM   2367 C  CD2 . PHE A 1 344 ? 21.146 -1.120  50.011  1.00 36.43  ? 340 PHE A CD2 1 
ATOM   2368 C  CE1 . PHE A 1 344 ? 23.373 -2.075  48.673  1.00 35.20  ? 340 PHE A CE1 1 
ATOM   2369 C  CE2 . PHE A 1 344 ? 21.213 -1.039  48.640  1.00 37.19  ? 340 PHE A CE2 1 
ATOM   2370 C  CZ  . PHE A 1 344 ? 22.327 -1.518  47.966  1.00 35.32  ? 340 PHE A CZ  1 
ATOM   2371 N  N   . ASP A 1 345 ? 21.050 -4.117  54.805  1.00 41.86  ? 341 ASP A N   1 
ATOM   2372 C  CA  . ASP A 1 345 ? 21.024 -4.190  56.262  1.00 44.12  ? 341 ASP A CA  1 
ATOM   2373 C  C   . ASP A 1 345 ? 22.331 -4.700  56.863  1.00 43.44  ? 341 ASP A C   1 
ATOM   2374 O  O   . ASP A 1 345 ? 22.719 -4.265  57.947  1.00 43.40  ? 341 ASP A O   1 
ATOM   2375 C  CB  . ASP A 1 345 ? 19.837 -5.029  56.740  1.00 45.06  ? 341 ASP A CB  1 
ATOM   2376 C  CG  . ASP A 1 345 ? 18.516 -4.283  56.597  1.00 48.73  ? 341 ASP A CG  1 
ATOM   2377 O  OD1 . ASP A 1 345 ? 18.569 -3.049  56.369  1.00 48.73  ? 341 ASP A OD1 1 
ATOM   2378 O  OD2 . ASP A 1 345 ? 17.433 -4.909  56.720  1.00 51.20  ? 341 ASP A OD2 1 
ATOM   2379 N  N   . GLU A 1 346 ? 23.030 -5.595  56.165  1.00 38.76  ? 342 GLU A N   1 
ATOM   2380 C  CA  . GLU A 1 346 ? 24.290 -6.087  56.705  1.00 39.43  ? 342 GLU A CA  1 
ATOM   2381 C  C   . GLU A 1 346 ? 25.334 -4.959  56.878  1.00 39.46  ? 342 GLU A C   1 
ATOM   2382 O  O   . GLU A 1 346 ? 26.166 -4.994  57.790  1.00 37.15  ? 342 GLU A O   1 
ATOM   2383 C  CB  . GLU A 1 346 ? 24.846 -7.210  55.826  1.00 63.63  ? 342 GLU A CB  1 
ATOM   2384 C  CG  . GLU A 1 346 ? 26.315 -7.497  56.070  1.00 68.86  ? 342 GLU A CG  1 
ATOM   2385 C  CD  . GLU A 1 346 ? 26.791 -8.783  55.422  1.00 70.60  ? 342 GLU A CD  1 
ATOM   2386 O  OE1 . GLU A 1 346 ? 26.292 -9.135  54.330  1.00 71.10  ? 342 GLU A OE1 1 
ATOM   2387 O  OE2 . GLU A 1 346 ? 27.684 -9.436  56.005  1.00 72.75  ? 342 GLU A OE2 1 
ATOM   2388 N  N   . LEU A 1 347 ? 25.287 -3.948  56.021  1.00 35.78  ? 343 LEU A N   1 
ATOM   2389 C  CA  . LEU A 1 347 ? 26.245 -2.847  56.121  1.00 35.20  ? 343 LEU A CA  1 
ATOM   2390 C  C   . LEU A 1 347 ? 25.970 -2.002  57.351  1.00 34.11  ? 343 LEU A C   1 
ATOM   2391 O  O   . LEU A 1 347 ? 26.835 -1.263  57.824  1.00 33.13  ? 343 LEU A O   1 
ATOM   2392 C  CB  . LEU A 1 347 ? 26.169 -1.947  54.889  1.00 41.37  ? 343 LEU A CB  1 
ATOM   2393 C  CG  . LEU A 1 347 ? 26.388 -2.613  53.538  1.00 43.53  ? 343 LEU A CG  1 
ATOM   2394 C  CD1 . LEU A 1 347 ? 26.281 -1.569  52.432  1.00 40.06  ? 343 LEU A CD1 1 
ATOM   2395 C  CD2 . LEU A 1 347 ? 27.759 -3.297  53.526  1.00 39.20  ? 343 LEU A CD2 1 
ATOM   2396 N  N   . ARG A 1 348 ? 24.751 -2.093  57.853  1.00 39.80  ? 344 ARG A N   1 
ATOM   2397 C  CA  . ARG A 1 348 ? 24.389 -1.326  59.023  1.00 44.74  ? 344 ARG A CA  1 
ATOM   2398 C  C   . ARG A 1 348 ? 24.701 -2.048  60.331  1.00 46.28  ? 344 ARG A C   1 
ATOM   2399 O  O   . ARG A 1 348 ? 24.515 -1.496  61.410  1.00 46.88  ? 344 ARG A O   1 
ATOM   2400 C  CB  . ARG A 1 348 ? 22.917 -0.942  58.946  1.00 41.78  ? 344 ARG A CB  1 
ATOM   2401 C  CG  . ARG A 1 348 ? 22.700 0.259   58.058  1.00 40.15  ? 344 ARG A CG  1 
ATOM   2402 C  CD  . ARG A 1 348 ? 21.243 0.616   57.968  1.00 37.73  ? 344 ARG A CD  1 
ATOM   2403 N  NE  . ARG A 1 348 ? 20.533 -0.229  57.014  1.00 39.93  ? 344 ARG A NE  1 
ATOM   2404 C  CZ  . ARG A 1 348 ? 20.402 0.057   55.728  1.00 40.03  ? 344 ARG A CZ  1 
ATOM   2405 N  NH1 . ARG A 1 348 ? 20.933 1.169   55.230  1.00 39.21  ? 344 ARG A NH1 1 
ATOM   2406 N  NH2 . ARG A 1 348 ? 19.719 -0.760  54.948  1.00 39.29  ? 344 ARG A NH2 1 
ATOM   2407 N  N   . ASP A 1 349 ? 25.180 -3.285  60.224  1.00 49.18  ? 345 ASP A N   1 
ATOM   2408 C  CA  . ASP A 1 349 ? 25.542 -4.079  61.383  1.00 49.22  ? 345 ASP A CA  1 
ATOM   2409 C  C   . ASP A 1 349 ? 26.824 -3.459  61.936  1.00 49.17  ? 345 ASP A C   1 
ATOM   2410 O  O   . ASP A 1 349 ? 27.725 -3.103  61.176  1.00 49.40  ? 345 ASP A O   1 
ATOM   2411 C  CB  . ASP A 1 349 ? 25.783 -5.526  60.960  1.00 79.15  ? 345 ASP A CB  1 
ATOM   2412 C  CG  . ASP A 1 349 ? 25.787 -6.485  62.132  1.00 81.30  ? 345 ASP A CG  1 
ATOM   2413 O  OD1 . ASP A 1 349 ? 26.711 -6.404  62.972  1.00 81.04  ? 345 ASP A OD1 1 
ATOM   2414 O  OD2 . ASP A 1 349 ? 24.858 -7.319  62.210  1.00 82.22  ? 345 ASP A OD2 1 
ATOM   2415 N  N   . PRO A 1 350 ? 26.918 -3.311  63.268  1.00 47.74  ? 346 PRO A N   1 
ATOM   2416 C  CA  . PRO A 1 350 ? 28.086 -2.721  63.932  1.00 48.65  ? 346 PRO A CA  1 
ATOM   2417 C  C   . PRO A 1 350 ? 29.350 -3.557  63.827  1.00 48.86  ? 346 PRO A C   1 
ATOM   2418 O  O   . PRO A 1 350 ? 30.463 -3.010  63.857  1.00 49.25  ? 346 PRO A O   1 
ATOM   2419 C  CB  . PRO A 1 350 ? 27.637 -2.599  65.385  1.00 41.61  ? 346 PRO A CB  1 
ATOM   2420 C  CG  . PRO A 1 350 ? 26.143 -2.619  65.306  1.00 43.98  ? 346 PRO A CG  1 
ATOM   2421 C  CD  . PRO A 1 350 ? 25.879 -3.643  64.254  1.00 41.87  ? 346 PRO A CD  1 
ATOM   2422 N  N   . ASN A 1 351 ? 29.178 -4.878  63.711  1.00 59.97  ? 347 ASN A N   1 
ATOM   2423 C  CA  . ASN A 1 351 ? 30.311 -5.800  63.647  1.00 63.35  ? 347 ASN A CA  1 
ATOM   2424 C  C   . ASN A 1 351 ? 30.822 -6.085  62.254  1.00 62.75  ? 347 ASN A C   1 
ATOM   2425 O  O   . ASN A 1 351 ? 31.850 -6.739  62.094  1.00 61.20  ? 347 ASN A O   1 
ATOM   2426 C  CB  . ASN A 1 351 ? 29.957 -7.131  64.316  1.00 79.04  ? 347 ASN A CB  1 
ATOM   2427 C  CG  . ASN A 1 351 ? 29.507 -6.963  65.749  1.00 81.63  ? 347 ASN A CG  1 
ATOM   2428 O  OD1 . ASN A 1 351 ? 30.122 -6.218  66.526  1.00 82.19  ? 347 ASN A OD1 1 
ATOM   2429 N  ND2 . ASN A 1 351 ? 28.432 -7.665  66.115  1.00 83.75  ? 347 ASN A ND2 1 
ATOM   2430 N  N   . VAL A 1 352 ? 30.112 -5.597  61.246  1.00 43.85  ? 348 VAL A N   1 
ATOM   2431 C  CA  . VAL A 1 352 ? 30.510 -5.828  59.863  1.00 42.56  ? 348 VAL A CA  1 
ATOM   2432 C  C   . VAL A 1 352 ? 31.956 -5.391  59.611  1.00 43.22  ? 348 VAL A C   1 
ATOM   2433 O  O   . VAL A 1 352 ? 32.388 -4.337  60.080  1.00 42.59  ? 348 VAL A O   1 
ATOM   2434 C  CB  . VAL A 1 352 ? 29.544 -5.090  58.878  1.00 49.05  ? 348 VAL A CB  1 
ATOM   2435 C  CG1 . VAL A 1 352 ? 29.793 -3.584  58.895  1.00 43.08  ? 348 VAL A CG1 1 
ATOM   2436 C  CG2 . VAL A 1 352 ? 29.702 -5.654  57.481  1.00 46.69  ? 348 VAL A CG2 1 
ATOM   2437 N  N   . LYS A 1 353 ? 32.699 -6.223  58.883  1.00 58.54  ? 349 LYS A N   1 
ATOM   2438 C  CA  . LYS A 1 353 ? 34.100 -5.947  58.537  1.00 60.44  ? 349 LYS A CA  1 
ATOM   2439 C  C   . LYS A 1 353 ? 34.365 -6.449  57.119  1.00 59.76  ? 349 LYS A C   1 
ATOM   2440 O  O   . LYS A 1 353 ? 33.587 -7.243  56.584  1.00 57.48  ? 349 LYS A O   1 
ATOM   2441 C  CB  . LYS A 1 353 ? 35.059 -6.664  59.506  1.00 59.66  ? 349 LYS A CB  1 
ATOM   2442 C  CG  . LYS A 1 353 ? 34.891 -6.312  60.990  1.00 63.84  ? 349 LYS A CG  1 
ATOM   2443 C  CD  . LYS A 1 353 ? 35.164 -4.840  61.273  1.00 66.72  ? 349 LYS A CD  1 
ATOM   2444 C  CE  . LYS A 1 353 ? 36.193 -4.676  62.364  1.00 70.12  ? 349 LYS A CE  1 
ATOM   2445 N  NZ  . LYS A 1 353 ? 37.495 -5.307  61.988  1.00 72.90  ? 349 LYS A NZ  1 
ATOM   2446 N  N   . LEU A 1 354 ? 35.456 -5.996  56.508  1.00 56.78  ? 350 LEU A N   1 
ATOM   2447 C  CA  . LEU A 1 354 ? 35.786 -6.445  55.158  1.00 58.68  ? 350 LEU A CA  1 
ATOM   2448 C  C   . LEU A 1 354 ? 36.445 -7.823  55.230  1.00 60.57  ? 350 LEU A C   1 
ATOM   2449 O  O   . LEU A 1 354 ? 37.008 -8.203  56.257  1.00 60.29  ? 350 LEU A O   1 
ATOM   2450 C  CB  . LEU A 1 354 ? 36.735 -5.456  54.473  1.00 44.96  ? 350 LEU A CB  1 
ATOM   2451 C  CG  . LEU A 1 354 ? 36.275 -4.002  54.281  1.00 45.12  ? 350 LEU A CG  1 
ATOM   2452 C  CD1 . LEU A 1 354 ? 37.331 -3.229  53.519  1.00 44.60  ? 350 LEU A CD1 1 
ATOM   2453 C  CD2 . LEU A 1 354 ? 34.981 -3.968  53.516  1.00 44.14  ? 350 LEU A CD2 1 
ATOM   2454 N  N   . PRO A 1 355 ? 36.377 -8.599  54.140  1.00 67.83  ? 351 PRO A N   1 
ATOM   2455 C  CA  . PRO A 1 355 ? 36.985 -9.929  54.135  1.00 69.42  ? 351 PRO A CA  1 
ATOM   2456 C  C   . PRO A 1 355 ? 38.476 -9.884  54.465  1.00 70.88  ? 351 PRO A C   1 
ATOM   2457 O  O   . PRO A 1 355 ? 39.033 -10.866 54.931  1.00 71.55  ? 351 PRO A O   1 
ATOM   2458 C  CB  . PRO A 1 355 ? 36.723 -10.417 52.715  1.00 79.52  ? 351 PRO A CB  1 
ATOM   2459 C  CG  . PRO A 1 355 ? 35.443 -9.742  52.366  1.00 79.18  ? 351 PRO A CG  1 
ATOM   2460 C  CD  . PRO A 1 355 ? 35.681 -8.343  52.869  1.00 78.38  ? 351 PRO A CD  1 
ATOM   2461 N  N   . ASN A 1 356 ? 39.120 -8.746  54.223  1.00 62.04  ? 352 ASN A N   1 
ATOM   2462 C  CA  . ASN A 1 356 ? 40.546 -8.611  54.499  1.00 62.74  ? 352 ASN A CA  1 
ATOM   2463 C  C   . ASN A 1 356 ? 40.825 -8.150  55.936  1.00 63.40  ? 352 ASN A C   1 
ATOM   2464 O  O   . ASN A 1 356 ? 41.953 -7.753  56.270  1.00 64.13  ? 352 ASN A O   1 
ATOM   2465 C  CB  . ASN A 1 356 ? 41.191 -7.640  53.498  1.00 83.80  ? 352 ASN A CB  1 
ATOM   2466 C  CG  . ASN A 1 356 ? 40.675 -6.220  53.640  1.00 84.02  ? 352 ASN A CG  1 
ATOM   2467 O  OD1 . ASN A 1 356 ? 39.786 -5.948  54.446  1.00 84.81  ? 352 ASN A OD1 1 
ATOM   2468 N  ND2 . ASN A 1 356 ? 41.233 -5.303  52.852  1.00 82.67  ? 352 ASN A ND2 1 
ATOM   2469 N  N   . GLY A 1 357 ? 39.796 -8.200  56.781  1.00 67.47  ? 353 GLY A N   1 
ATOM   2470 C  CA  . GLY A 1 357 ? 39.951 -7.796  58.169  1.00 66.01  ? 353 GLY A CA  1 
ATOM   2471 C  C   . GLY A 1 357 ? 39.716 -6.329  58.500  1.00 64.61  ? 353 GLY A C   1 
ATOM   2472 O  O   . GLY A 1 357 ? 39.391 -6.008  59.648  1.00 64.40  ? 353 GLY A O   1 
ATOM   2473 N  N   . ARG A 1 358 ? 39.877 -5.442  57.515  1.00 60.97  ? 354 ARG A N   1 
ATOM   2474 C  CA  . ARG A 1 358 ? 39.690 -4.003  57.729  1.00 60.17  ? 354 ARG A CA  1 
ATOM   2475 C  C   . ARG A 1 358 ? 38.241 -3.591  57.966  1.00 57.30  ? 354 ARG A C   1 
ATOM   2476 O  O   . ARG A 1 358 ? 37.299 -4.362  57.721  1.00 56.60  ? 354 ARG A O   1 
ATOM   2477 C  CB  . ARG A 1 358 ? 40.189 -3.195  56.535  1.00 75.82  ? 354 ARG A CB  1 
ATOM   2478 C  CG  . ARG A 1 358 ? 41.596 -3.468  56.086  1.00 78.28  ? 354 ARG A CG  1 
ATOM   2479 C  CD  . ARG A 1 358 ? 42.072 -2.293  55.264  1.00 81.76  ? 354 ARG A CD  1 
ATOM   2480 N  NE  . ARG A 1 358 ? 43.322 -2.568  54.578  1.00 84.59  ? 354 ARG A NE  1 
ATOM   2481 C  CZ  . ARG A 1 358 ? 44.039 -1.638  53.962  1.00 86.48  ? 354 ARG A CZ  1 
ATOM   2482 N  NH1 . ARG A 1 358 ? 43.618 -0.377  53.959  1.00 85.95  ? 354 ARG A NH1 1 
ATOM   2483 N  NH2 . ARG A 1 358 ? 45.170 -1.967  53.345  1.00 88.26  ? 354 ARG A NH2 1 
ATOM   2484 N  N   . ASP A 1 359 ? 38.078 -2.352  58.421  1.00 65.27  ? 355 ASP A N   1 
ATOM   2485 C  CA  . ASP A 1 359 ? 36.756 -1.809  58.674  1.00 65.20  ? 355 ASP A CA  1 
ATOM   2486 C  C   . ASP A 1 359 ? 36.169 -1.355  57.353  1.00 62.83  ? 355 ASP A C   1 
ATOM   2487 O  O   . ASP A 1 359 ? 36.883 -1.223  56.356  1.00 61.72  ? 355 ASP A O   1 
ATOM   2488 C  CB  . ASP A 1 359 ? 36.831 -0.619  59.629  1.00 97.03  ? 355 ASP A CB  1 
ATOM   2489 C  CG  . ASP A 1 359 ? 37.252 -1.019  61.017  1.00 99.42  ? 355 ASP A CG  1 
ATOM   2490 O  OD1 . ASP A 1 359 ? 36.507 -1.785  61.667  1.00 100.26 ? 355 ASP A OD1 1 
ATOM   2491 O  OD2 . ASP A 1 359 ? 38.331 -0.571  61.455  1.00 102.72 ? 355 ASP A OD2 1 
ATOM   2492 N  N   . THR A 1 360 ? 34.862 -1.132  57.351  1.00 72.34  ? 356 THR A N   1 
ATOM   2493 C  CA  . THR A 1 360 ? 34.176 -0.669  56.159  1.00 70.86  ? 356 THR A CA  1 
ATOM   2494 C  C   . THR A 1 360 ? 34.459 0.824   56.011  1.00 68.07  ? 356 THR A C   1 
ATOM   2495 O  O   . THR A 1 360 ? 34.860 1.493   56.962  1.00 66.22  ? 356 THR A O   1 
ATOM   2496 C  CB  . THR A 1 360 ? 32.641 -0.898  56.263  1.00 66.23  ? 356 THR A CB  1 
ATOM   2497 O  OG1 . THR A 1 360 ? 32.127 -0.241  57.430  1.00 68.06  ? 356 THR A OG1 1 
ATOM   2498 C  CG2 . THR A 1 360 ? 32.328 -2.384  56.353  1.00 67.11  ? 356 THR A CG2 1 
ATOM   2499 N  N   . PRO A 1 361 ? 34.276 1.360   54.802  1.00 48.56  ? 357 PRO A N   1 
ATOM   2500 C  CA  . PRO A 1 361 ? 34.514 2.789   54.552  1.00 48.25  ? 357 PRO A CA  1 
ATOM   2501 C  C   . PRO A 1 361 ? 33.399 3.614   55.200  1.00 46.27  ? 357 PRO A C   1 
ATOM   2502 O  O   . PRO A 1 361 ? 32.464 3.053   55.765  1.00 43.67  ? 357 PRO A O   1 
ATOM   2503 C  CB  . PRO A 1 361 ? 34.459 2.887   53.023  1.00 40.15  ? 357 PRO A CB  1 
ATOM   2504 C  CG  . PRO A 1 361 ? 34.712 1.474   52.547  1.00 39.32  ? 357 PRO A CG  1 
ATOM   2505 C  CD  . PRO A 1 361 ? 33.975 0.644   53.550  1.00 41.25  ? 357 PRO A CD  1 
ATOM   2506 N  N   . ALA A 1 362 ? 33.494 4.938   55.108  1.00 52.57  ? 358 ALA A N   1 
ATOM   2507 C  CA  . ALA A 1 362 ? 32.459 5.822   55.654  1.00 52.63  ? 358 ALA A CA  1 
ATOM   2508 C  C   . ALA A 1 362 ? 31.171 5.494   54.899  1.00 52.45  ? 358 ALA A C   1 
ATOM   2509 O  O   . ALA A 1 362 ? 31.154 5.477   53.667  1.00 54.33  ? 358 ALA A O   1 
ATOM   2510 C  CB  . ALA A 1 362 ? 32.837 7.276   55.424  1.00 101.69 ? 358 ALA A CB  1 
ATOM   2511 N  N   . LEU A 1 363 ? 30.095 5.234   55.628  1.00 36.18  ? 359 LEU A N   1 
ATOM   2512 C  CA  . LEU A 1 363 ? 28.830 4.873   54.989  1.00 35.67  ? 359 LEU A CA  1 
ATOM   2513 C  C   . LEU A 1 363 ? 27.624 5.609   55.545  1.00 34.98  ? 359 LEU A C   1 
ATOM   2514 O  O   . LEU A 1 363 ? 26.543 5.584   54.953  1.00 33.81  ? 359 LEU A O   1 
ATOM   2515 C  CB  . LEU A 1 363 ? 28.563 3.373   55.150  1.00 34.29  ? 359 LEU A CB  1 
ATOM   2516 C  CG  . LEU A 1 363 ? 29.608 2.422   54.582  1.00 36.82  ? 359 LEU A CG  1 
ATOM   2517 C  CD1 . LEU A 1 363 ? 29.150 0.993   54.802  1.00 36.08  ? 359 LEU A CD1 1 
ATOM   2518 C  CD2 . LEU A 1 363 ? 29.793 2.692   53.111  1.00 33.89  ? 359 LEU A CD2 1 
ATOM   2519 N  N   . PHE A 1 364 ? 27.818 6.259   56.688  1.00 49.22  ? 360 PHE A N   1 
ATOM   2520 C  CA  . PHE A 1 364 ? 26.735 6.946   57.358  1.00 50.92  ? 360 PHE A CA  1 
ATOM   2521 C  C   . PHE A 1 364 ? 26.925 8.438   57.548  1.00 51.82  ? 360 PHE A C   1 
ATOM   2522 O  O   . PHE A 1 364 ? 26.067 9.096   58.099  1.00 51.66  ? 360 PHE A O   1 
ATOM   2523 C  CB  . PHE A 1 364 ? 26.516 6.288   58.706  1.00 51.58  ? 360 PHE A CB  1 
ATOM   2524 C  CG  . PHE A 1 364 ? 26.491 4.794   58.643  1.00 51.72  ? 360 PHE A CG  1 
ATOM   2525 C  CD1 . PHE A 1 364 ? 27.458 4.038   59.300  1.00 53.00  ? 360 PHE A CD1 1 
ATOM   2526 C  CD2 . PHE A 1 364 ? 25.494 4.139   57.936  1.00 49.91  ? 360 PHE A CD2 1 
ATOM   2527 C  CE1 . PHE A 1 364 ? 27.427 2.656   59.256  1.00 53.24  ? 360 PHE A CE1 1 
ATOM   2528 C  CE2 . PHE A 1 364 ? 25.455 2.748   57.889  1.00 54.71  ? 360 PHE A CE2 1 
ATOM   2529 C  CZ  . PHE A 1 364 ? 26.425 2.007   58.552  1.00 51.30  ? 360 PHE A CZ  1 
ATOM   2530 N  N   . ASN A 1 365 ? 28.041 8.979   57.093  1.00 46.52  ? 361 ASN A N   1 
ATOM   2531 C  CA  . ASN A 1 365 ? 28.280 10.401  57.249  1.00 46.74  ? 361 ASN A CA  1 
ATOM   2532 C  C   . ASN A 1 365 ? 27.383 11.246  56.335  1.00 45.69  ? 361 ASN A C   1 
ATOM   2533 O  O   . ASN A 1 365 ? 27.857 12.129  55.623  1.00 43.95  ? 361 ASN A O   1 
ATOM   2534 C  CB  . ASN A 1 365 ? 29.766 10.684  57.000  1.00 53.17  ? 361 ASN A CB  1 
ATOM   2535 C  CG  . ASN A 1 365 ? 30.233 10.224  55.634  1.00 56.51  ? 361 ASN A CG  1 
ATOM   2536 O  OD1 . ASN A 1 365 ? 29.703 9.262   55.058  1.00 57.91  ? 361 ASN A OD1 1 
ATOM   2537 N  ND2 . ASN A 1 365 ? 31.248 10.904  55.108  1.00 59.22  ? 361 ASN A ND2 1 
ATOM   2538 N  N   . PHE A 1 366 ? 26.081 10.981  56.362  1.00 52.11  ? 362 PHE A N   1 
ATOM   2539 C  CA  . PHE A 1 366 ? 25.121 11.718  55.532  1.00 55.20  ? 362 PHE A CA  1 
ATOM   2540 C  C   . PHE A 1 366 ? 25.023 13.210  55.865  1.00 56.93  ? 362 PHE A C   1 
ATOM   2541 O  O   . PHE A 1 366 ? 25.149 13.588  57.020  1.00 57.02  ? 362 PHE A O   1 
ATOM   2542 C  CB  . PHE A 1 366 ? 23.725 11.108  55.682  1.00 52.83  ? 362 PHE A CB  1 
ATOM   2543 C  CG  . PHE A 1 366 ? 23.552 9.792   54.979  1.00 52.92  ? 362 PHE A CG  1 
ATOM   2544 C  CD1 . PHE A 1 366 ? 23.761 8.590   55.649  1.00 52.53  ? 362 PHE A CD1 1 
ATOM   2545 C  CD2 . PHE A 1 366 ? 23.183 9.753   53.636  1.00 51.87  ? 362 PHE A CD2 1 
ATOM   2546 C  CE1 . PHE A 1 366 ? 23.603 7.368   54.993  1.00 51.43  ? 362 PHE A CE1 1 
ATOM   2547 C  CE2 . PHE A 1 366 ? 23.025 8.541   52.974  1.00 52.42  ? 362 PHE A CE2 1 
ATOM   2548 C  CZ  . PHE A 1 366 ? 23.236 7.345   53.656  1.00 50.76  ? 362 PHE A CZ  1 
ATOM   2549 N  N   . THR A 1 367 ? 24.801 14.051  54.858  1.00 57.51  ? 363 THR A N   1 
ATOM   2550 C  CA  . THR A 1 367 ? 24.632 15.486  55.093  1.00 58.57  ? 363 THR A CA  1 
ATOM   2551 C  C   . THR A 1 367 ? 23.181 15.871  54.796  1.00 59.69  ? 363 THR A C   1 
ATOM   2552 O  O   . THR A 1 367 ? 22.442 15.099  54.176  1.00 61.25  ? 363 THR A O   1 
ATOM   2553 C  CB  . THR A 1 367 ? 25.547 16.359  54.207  1.00 48.83  ? 363 THR A CB  1 
ATOM   2554 O  OG1 . THR A 1 367 ? 25.318 16.071  52.819  1.00 48.97  ? 363 THR A OG1 1 
ATOM   2555 C  CG2 . THR A 1 367 ? 26.991 16.136  54.559  1.00 47.24  ? 363 THR A CG2 1 
ATOM   2556 N  N   . THR A 1 368 ? 22.767 17.056  55.234  1.00 65.94  ? 364 THR A N   1 
ATOM   2557 C  CA  . THR A 1 368 ? 21.395 17.482  55.004  1.00 64.57  ? 364 THR A CA  1 
ATOM   2558 C  C   . THR A 1 368 ? 21.073 17.519  53.519  1.00 63.00  ? 364 THR A C   1 
ATOM   2559 O  O   . THR A 1 368 ? 19.972 17.130  53.101  1.00 63.59  ? 364 THR A O   1 
ATOM   2560 C  CB  . THR A 1 368 ? 21.140 18.865  55.598  1.00 66.13  ? 364 THR A CB  1 
ATOM   2561 O  OG1 . THR A 1 368 ? 21.381 18.818  57.007  1.00 65.30  ? 364 THR A OG1 1 
ATOM   2562 C  CG2 . THR A 1 368 ? 19.700 19.294  55.345  1.00 64.82  ? 364 THR A CG2 1 
ATOM   2563 N  N   . GLN A 1 369 ? 22.038 17.996  52.735  1.00 54.35  ? 365 GLN A N   1 
ATOM   2564 C  CA  . GLN A 1 369 ? 21.888 18.086  51.293  1.00 56.52  ? 365 GLN A CA  1 
ATOM   2565 C  C   . GLN A 1 369 ? 21.507 16.719  50.744  1.00 56.26  ? 365 GLN A C   1 
ATOM   2566 O  O   . GLN A 1 369 ? 20.562 16.572  49.962  1.00 56.15  ? 365 GLN A O   1 
ATOM   2567 C  CB  . GLN A 1 369 ? 23.212 18.534  50.675  1.00 61.61  ? 365 GLN A CB  1 
ATOM   2568 C  CG  . GLN A 1 369 ? 23.259 18.521  49.152  1.00 65.36  ? 365 GLN A CG  1 
ATOM   2569 C  CD  . GLN A 1 369 ? 22.314 19.527  48.507  1.00 67.13  ? 365 GLN A CD  1 
ATOM   2570 O  OE1 . GLN A 1 369 ? 22.231 19.614  47.281  1.00 67.46  ? 365 GLN A OE1 1 
ATOM   2571 N  NE2 . GLN A 1 369 ? 21.599 20.291  49.331  1.00 67.43  ? 365 GLN A NE2 1 
ATOM   2572 N  N   . GLU A 1 370 ? 22.255 15.720  51.184  1.00 61.40  ? 366 GLU A N   1 
ATOM   2573 C  CA  . GLU A 1 370 ? 22.064 14.357  50.748  1.00 60.50  ? 366 GLU A CA  1 
ATOM   2574 C  C   . GLU A 1 370 ? 20.702 13.780  51.068  1.00 58.37  ? 366 GLU A C   1 
ATOM   2575 O  O   . GLU A 1 370 ? 20.124 13.044  50.260  1.00 56.57  ? 366 GLU A O   1 
ATOM   2576 C  CB  . GLU A 1 370 ? 23.135 13.496  51.379  1.00 58.78  ? 366 GLU A CB  1 
ATOM   2577 C  CG  . GLU A 1 370 ? 23.919 12.685  50.397  1.00 63.74  ? 366 GLU A CG  1 
ATOM   2578 C  CD  . GLU A 1 370 ? 25.080 12.001  51.066  1.00 63.43  ? 366 GLU A CD  1 
ATOM   2579 O  OE1 . GLU A 1 370 ? 25.853 12.702  51.757  1.00 60.26  ? 366 GLU A OE1 1 
ATOM   2580 O  OE2 . GLU A 1 370 ? 25.219 10.770  50.902  1.00 66.93  ? 366 GLU A OE2 1 
ATOM   2581 N  N   . LEU A 1 371 ? 20.189 14.115  52.245  1.00 45.74  ? 367 LEU A N   1 
ATOM   2582 C  CA  . LEU A 1 371 ? 18.893 13.610  52.701  1.00 45.73  ? 367 LEU A CA  1 
ATOM   2583 C  C   . LEU A 1 371 ? 17.680 14.444  52.274  1.00 46.13  ? 367 LEU A C   1 
ATOM   2584 O  O   . LEU A 1 371 ? 16.538 14.002  52.442  1.00 46.21  ? 367 LEU A O   1 
ATOM   2585 C  CB  . LEU A 1 371 ? 18.907 13.498  54.229  1.00 44.42  ? 367 LEU A CB  1 
ATOM   2586 C  CG  . LEU A 1 371 ? 19.933 12.541  54.859  1.00 46.29  ? 367 LEU A CG  1 
ATOM   2587 C  CD1 . LEU A 1 371 ? 20.131 12.863  56.311  1.00 44.48  ? 367 LEU A CD1 1 
ATOM   2588 C  CD2 . LEU A 1 371 ? 19.451 11.107  54.711  1.00 43.96  ? 367 LEU A CD2 1 
ATOM   2589 N  N   . SER A 1 372 ? 17.931 15.639  51.726  1.00 54.37  ? 368 SER A N   1 
ATOM   2590 C  CA  . SER A 1 372 ? 16.862 16.552  51.316  1.00 57.06  ? 368 SER A CA  1 
ATOM   2591 C  C   . SER A 1 372 ? 15.726 15.856  50.574  1.00 58.09  ? 368 SER A C   1 
ATOM   2592 O  O   . SER A 1 372 ? 14.551 16.197  50.740  1.00 58.78  ? 368 SER A O   1 
ATOM   2593 C  CB  . SER A 1 372 ? 17.434 17.686  50.468  1.00 55.64  ? 368 SER A CB  1 
ATOM   2594 O  OG  . SER A 1 372 ? 18.175 17.203  49.364  1.00 56.78  ? 368 SER A OG  1 
ATOM   2595 N  N   . SER A 1 373 ? 16.093 14.872  49.764  1.00 59.36  ? 369 SER A N   1 
ATOM   2596 C  CA  . SER A 1 373 ? 15.135 14.099  48.996  1.00 59.80  ? 369 SER A CA  1 
ATOM   2597 C  C   . SER A 1 373 ? 14.004 13.582  49.892  1.00 59.78  ? 369 SER A C   1 
ATOM   2598 O  O   . SER A 1 373 ? 12.832 13.644  49.516  1.00 60.13  ? 369 SER A O   1 
ATOM   2599 C  CB  . SER A 1 373 ? 15.864 12.925  48.322  1.00 39.61  ? 369 SER A CB  1 
ATOM   2600 O  OG  . SER A 1 373 ? 15.037 11.765  48.211  1.00 37.53  ? 369 SER A OG  1 
ATOM   2601 N  N   . ASN A 1 374 ? 14.361 13.099  51.083  1.00 52.44  ? 370 ASN A N   1 
ATOM   2602 C  CA  . ASN A 1 374 ? 13.385 12.520  52.011  1.00 52.23  ? 370 ASN A CA  1 
ATOM   2603 C  C   . ASN A 1 374 ? 13.999 12.347  53.415  1.00 53.46  ? 370 ASN A C   1 
ATOM   2604 O  O   . ASN A 1 374 ? 14.353 11.241  53.815  1.00 52.44  ? 370 ASN A O   1 
ATOM   2605 C  CB  . ASN A 1 374 ? 12.941 11.165  51.441  1.00 51.52  ? 370 ASN A CB  1 
ATOM   2606 C  CG  . ASN A 1 374 ? 11.956 10.438  52.322  1.00 54.06  ? 370 ASN A CG  1 
ATOM   2607 O  OD1 . ASN A 1 374 ? 11.480 9.360   51.965  1.00 55.47  ? 370 ASN A OD1 1 
ATOM   2608 N  ND2 . ASN A 1 374 ? 11.644 11.013  53.478  1.00 52.95  ? 370 ASN A ND2 1 
ATOM   2609 N  N   . PRO A 1 375 ? 14.098 13.446  54.191  1.00 54.57  ? 371 PRO A N   1 
ATOM   2610 C  CA  . PRO A 1 375 ? 14.666 13.467  55.550  1.00 53.76  ? 371 PRO A CA  1 
ATOM   2611 C  C   . PRO A 1 375 ? 14.263 12.339  56.503  1.00 53.34  ? 371 PRO A C   1 
ATOM   2612 O  O   . PRO A 1 375 ? 15.100 11.776  57.189  1.00 54.40  ? 371 PRO A O   1 
ATOM   2613 C  CB  . PRO A 1 375 ? 14.269 14.852  56.065  1.00 39.45  ? 371 PRO A CB  1 
ATOM   2614 C  CG  . PRO A 1 375 ? 14.280 15.678  54.810  1.00 39.48  ? 371 PRO A CG  1 
ATOM   2615 C  CD  . PRO A 1 375 ? 13.543 14.770  53.846  1.00 39.12  ? 371 PRO A CD  1 
ATOM   2616 N  N   . PRO A 1 376 ? 12.974 12.005  56.572  1.00 54.63  ? 372 PRO A N   1 
ATOM   2617 C  CA  . PRO A 1 376 ? 12.555 10.927  57.473  1.00 54.15  ? 372 PRO A CA  1 
ATOM   2618 C  C   . PRO A 1 376 ? 13.328 9.618   57.316  1.00 53.08  ? 372 PRO A C   1 
ATOM   2619 O  O   . PRO A 1 376 ? 13.241 8.753   58.180  1.00 51.54  ? 372 PRO A O   1 
ATOM   2620 C  CB  . PRO A 1 376 ? 11.081 10.751  57.138  1.00 47.55  ? 372 PRO A CB  1 
ATOM   2621 C  CG  . PRO A 1 376 ? 10.656 12.139  56.833  1.00 47.99  ? 372 PRO A CG  1 
ATOM   2622 C  CD  . PRO A 1 376 ? 11.810 12.714  56.019  1.00 48.04  ? 372 PRO A CD  1 
ATOM   2623 N  N   . LEU A 1 377 ? 14.075 9.461   56.225  1.00 50.13  ? 373 LEU A N   1 
ATOM   2624 C  CA  . LEU A 1 377 ? 14.829 8.221   56.022  1.00 50.38  ? 373 LEU A CA  1 
ATOM   2625 C  C   . LEU A 1 377 ? 16.082 8.109   56.866  1.00 48.48  ? 373 LEU A C   1 
ATOM   2626 O  O   . LEU A 1 377 ? 16.641 7.018   57.001  1.00 46.51  ? 373 LEU A O   1 
ATOM   2627 C  CB  . LEU A 1 377 ? 15.213 8.035   54.560  1.00 34.60  ? 373 LEU A CB  1 
ATOM   2628 C  CG  . LEU A 1 377 ? 14.123 7.610   53.569  1.00 35.81  ? 373 LEU A CG  1 
ATOM   2629 C  CD1 . LEU A 1 377 ? 14.744 7.547   52.176  1.00 36.77  ? 373 LEU A CD1 1 
ATOM   2630 C  CD2 . LEU A 1 377 ? 13.521 6.263   53.960  1.00 35.28  ? 373 LEU A CD2 1 
ATOM   2631 N  N   . ALA A 1 378 ? 16.516 9.228   57.435  1.00 59.20  ? 374 ALA A N   1 
ATOM   2632 C  CA  . ALA A 1 378 ? 17.705 9.235   58.273  1.00 60.29  ? 374 ALA A CA  1 
ATOM   2633 C  C   . ALA A 1 378 ? 17.564 8.211   59.386  1.00 60.11  ? 374 ALA A C   1 
ATOM   2634 O  O   . ALA A 1 378 ? 18.546 7.583   59.781  1.00 60.63  ? 374 ALA A O   1 
ATOM   2635 C  CB  . ALA A 1 378 ? 17.932 10.621  58.866  1.00 70.43  ? 374 ALA A CB  1 
ATOM   2636 N  N   . THR A 1 379 ? 16.343 8.028   59.878  1.00 59.35  ? 375 THR A N   1 
ATOM   2637 C  CA  . THR A 1 379 ? 16.114 7.083   60.960  1.00 61.17  ? 375 THR A CA  1 
ATOM   2638 C  C   . THR A 1 379 ? 16.581 5.669   60.624  1.00 60.45  ? 375 THR A C   1 
ATOM   2639 O  O   . THR A 1 379 ? 16.806 4.863   61.526  1.00 57.84  ? 375 THR A O   1 
ATOM   2640 C  CB  . THR A 1 379 ? 14.625 7.008   61.354  1.00 62.34  ? 375 THR A CB  1 
ATOM   2641 O  OG1 . THR A 1 379 ? 13.970 5.990   60.583  1.00 64.20  ? 375 THR A OG1 1 
ATOM   2642 C  CG2 . THR A 1 379 ? 13.947 8.340   61.110  1.00 62.03  ? 375 THR A CG2 1 
ATOM   2643 N  N   . ILE A 1 380 ? 16.699 5.349   59.339  1.00 58.37  ? 376 ILE A N   1 
ATOM   2644 C  CA  . ILE A 1 380 ? 17.167 4.019   58.951  1.00 57.24  ? 376 ILE A CA  1 
ATOM   2645 C  C   . ILE A 1 380 ? 18.575 4.115   58.398  1.00 56.00  ? 376 ILE A C   1 
ATOM   2646 O  O   . ILE A 1 380 ? 19.435 3.282   58.665  1.00 56.60  ? 376 ILE A O   1 
ATOM   2647 C  CB  . ILE A 1 380 ? 16.345 3.403   57.834  1.00 38.69  ? 376 ILE A CB  1 
ATOM   2648 C  CG1 . ILE A 1 380 ? 14.883 3.255   58.249  1.00 38.71  ? 376 ILE A CG1 1 
ATOM   2649 C  CG2 . ILE A 1 380 ? 16.964 2.076   57.443  1.00 38.56  ? 376 ILE A CG2 1 
ATOM   2650 C  CD1 . ILE A 1 380 ? 13.978 2.747   57.119  1.00 41.03  ? 376 ILE A CD1 1 
ATOM   2651 N  N   . LEU A 1 381 ? 18.796 5.139   57.598  1.00 46.80  ? 377 LEU A N   1 
ATOM   2652 C  CA  . LEU A 1 381 ? 20.087 5.314   56.996  1.00 45.09  ? 377 LEU A CA  1 
ATOM   2653 C  C   . LEU A 1 381 ? 21.173 5.447   58.032  1.00 45.03  ? 377 LEU A C   1 
ATOM   2654 O  O   . LEU A 1 381 ? 22.277 4.964   57.814  1.00 44.92  ? 377 LEU A O   1 
ATOM   2655 C  CB  . LEU A 1 381 ? 20.063 6.521   56.054  1.00 50.58  ? 377 LEU A CB  1 
ATOM   2656 C  CG  . LEU A 1 381 ? 19.170 6.225   54.846  1.00 51.42  ? 377 LEU A CG  1 
ATOM   2657 C  CD1 . LEU A 1 381 ? 18.952 7.468   54.031  1.00 51.44  ? 377 LEU A CD1 1 
ATOM   2658 C  CD2 . LEU A 1 381 ? 19.814 5.118   54.005  1.00 49.79  ? 377 LEU A CD2 1 
ATOM   2659 N  N   . ILE A 1 382 ? 20.874 6.086   59.158  1.00 46.61  ? 378 ILE A N   1 
ATOM   2660 C  CA  . ILE A 1 382 ? 21.886 6.256   60.198  1.00 46.45  ? 378 ILE A CA  1 
ATOM   2661 C  C   . ILE A 1 382 ? 21.611 5.322   61.361  1.00 45.48  ? 378 ILE A C   1 
ATOM   2662 O  O   . ILE A 1 382 ? 20.826 5.641   62.260  1.00 46.87  ? 378 ILE A O   1 
ATOM   2663 C  CB  . ILE A 1 382 ? 21.934 7.698   60.714  1.00 40.84  ? 378 ILE A CB  1 
ATOM   2664 C  CG1 . ILE A 1 382 ? 22.170 8.651   59.549  1.00 40.29  ? 378 ILE A CG1 1 
ATOM   2665 C  CG2 . ILE A 1 382 ? 23.062 7.845   61.703  1.00 39.35  ? 378 ILE A CG2 1 
ATOM   2666 C  CD1 . ILE A 1 382 ? 22.503 10.045  59.971  1.00 42.11  ? 378 ILE A CD1 1 
ATOM   2667 N  N   . PRO A 1 383 ? 22.278 4.157   61.369  1.00 47.46  ? 379 PRO A N   1 
ATOM   2668 C  CA  . PRO A 1 383 ? 22.093 3.164   62.428  1.00 47.85  ? 379 PRO A CA  1 
ATOM   2669 C  C   . PRO A 1 383 ? 22.441 3.694   63.823  1.00 47.07  ? 379 PRO A C   1 
ATOM   2670 O  O   . PRO A 1 383 ? 23.272 4.596   63.977  1.00 50.51  ? 379 PRO A O   1 
ATOM   2671 C  CB  . PRO A 1 383 ? 22.991 2.020   61.972  1.00 41.43  ? 379 PRO A CB  1 
ATOM   2672 C  CG  . PRO A 1 383 ? 24.151 2.760   61.363  1.00 41.02  ? 379 PRO A CG  1 
ATOM   2673 C  CD  . PRO A 1 383 ? 23.458 3.832   60.541  1.00 41.86  ? 379 PRO A CD  1 
ATOM   2674 N  N   . PRO A 1 384 ? 21.798 3.131   64.859  1.00 56.05  ? 380 PRO A N   1 
ATOM   2675 C  CA  . PRO A 1 384 ? 21.966 3.476   66.274  1.00 57.16  ? 380 PRO A CA  1 
ATOM   2676 C  C   . PRO A 1 384 ? 23.399 3.689   66.735  1.00 57.11  ? 380 PRO A C   1 
ATOM   2677 O  O   . PRO A 1 384 ? 23.700 4.715   67.338  1.00 58.58  ? 380 PRO A O   1 
ATOM   2678 C  CB  . PRO A 1 384 ? 21.309 2.311   66.982  1.00 33.63  ? 380 PRO A CB  1 
ATOM   2679 C  CG  . PRO A 1 384 ? 20.166 1.970   66.055  1.00 34.57  ? 380 PRO A CG  1 
ATOM   2680 C  CD  . PRO A 1 384 ? 20.812 2.044   64.697  1.00 31.67  ? 380 PRO A CD  1 
ATOM   2681 N  N   . HIS A 1 385 ? 24.282 2.731   66.454  1.00 44.36  ? 381 HIS A N   1 
ATOM   2682 C  CA  . HIS A 1 385 ? 25.671 2.861   66.876  1.00 46.29  ? 381 HIS A CA  1 
ATOM   2683 C  C   . HIS A 1 385 ? 26.408 4.016   66.198  1.00 47.15  ? 381 HIS A C   1 
ATOM   2684 O  O   . HIS A 1 385 ? 27.495 4.409   66.615  1.00 47.39  ? 381 HIS A O   1 
ATOM   2685 C  CB  . HIS A 1 385 ? 26.425 1.549   66.659  1.00 49.68  ? 381 HIS A CB  1 
ATOM   2686 C  CG  . HIS A 1 385 ? 26.704 1.235   65.225  1.00 49.77  ? 381 HIS A CG  1 
ATOM   2687 N  ND1 . HIS A 1 385 ? 25.768 0.663   64.388  1.00 49.54  ? 381 HIS A ND1 1 
ATOM   2688 C  CD2 . HIS A 1 385 ? 27.808 1.447   64.469  1.00 49.58  ? 381 HIS A CD2 1 
ATOM   2689 C  CE1 . HIS A 1 385 ? 26.283 0.539   63.176  1.00 49.86  ? 381 HIS A CE1 1 
ATOM   2690 N  NE2 . HIS A 1 385 ? 27.519 1.008   63.199  1.00 50.67  ? 381 HIS A NE2 1 
ATOM   2691 N  N   . ALA A 1 386 ? 25.785 4.588   65.178  1.00 51.66  ? 382 ALA A N   1 
ATOM   2692 C  CA  . ALA A 1 386 ? 26.375 5.709   64.465  1.00 53.03  ? 382 ALA A CA  1 
ATOM   2693 C  C   . ALA A 1 386 ? 25.860 6.994   65.104  1.00 54.18  ? 382 ALA A C   1 
ATOM   2694 O  O   . ALA A 1 386 ? 26.243 8.086   64.708  1.00 51.42  ? 382 ALA A O   1 
ATOM   2695 C  CB  . ALA A 1 386 ? 25.988 5.654   63.000  1.00 78.53  ? 382 ALA A CB  1 
ATOM   2696 N  N   . ARG A 1 387 ? 25.000 6.847   66.109  1.00 69.80  ? 383 ARG A N   1 
ATOM   2697 C  CA  . ARG A 1 387 ? 24.427 7.993   66.808  1.00 72.25  ? 383 ARG A CA  1 
ATOM   2698 C  C   . ARG A 1 387 ? 24.933 8.122   68.237  1.00 74.10  ? 383 ARG A C   1 
ATOM   2699 O  O   . ARG A 1 387 ? 24.583 9.070   68.937  1.00 72.97  ? 383 ARG A O   1 
ATOM   2700 C  CB  . ARG A 1 387 ? 22.913 7.869   66.886  1.00 49.38  ? 383 ARG A CB  1 
ATOM   2701 C  CG  . ARG A 1 387 ? 22.230 7.569   65.591  1.00 49.66  ? 383 ARG A CG  1 
ATOM   2702 C  CD  . ARG A 1 387 ? 20.756 7.369   65.837  1.00 51.36  ? 383 ARG A CD  1 
ATOM   2703 N  NE  . ARG A 1 387 ? 20.103 6.913   64.627  1.00 53.88  ? 383 ARG A NE  1 
ATOM   2704 C  CZ  . ARG A 1 387 ? 18.807 6.700   64.519  1.00 57.83  ? 383 ARG A CZ  1 
ATOM   2705 N  NH1 . ARG A 1 387 ? 18.016 6.904   65.562  1.00 57.79  ? 383 ARG A NH1 1 
ATOM   2706 N  NH2 . ARG A 1 387 ? 18.314 6.291   63.363  1.00 58.53  ? 383 ARG A NH2 1 
ATOM   2707 N  N   . ILE A 1 388 ? 25.729 7.156   68.677  1.00 79.09  ? 384 ILE A N   1 
ATOM   2708 C  CA  . ILE A 1 388 ? 26.254 7.160   70.032  1.00 80.33  ? 384 ILE A CA  1 
ATOM   2709 C  C   . ILE A 1 388 ? 27.168 8.357   70.325  1.00 83.89  ? 384 ILE A C   1 
ATOM   2710 O  O   . ILE A 1 388 ? 28.253 8.475   69.757  1.00 85.00  ? 384 ILE A O   1 
ATOM   2711 C  CB  . ILE A 1 388 ? 26.996 5.840   70.301  1.00 53.79  ? 384 ILE A CB  1 
ATOM   2712 C  CG1 . ILE A 1 388 ? 26.022 4.672   70.132  1.00 51.86  ? 384 ILE A CG1 1 
ATOM   2713 C  CG2 . ILE A 1 388 ? 27.579 5.829   71.708  1.00 53.36  ? 384 ILE A CG2 1 
ATOM   2714 C  CD1 . ILE A 1 388 ? 26.655 3.306   70.296  1.00 50.55  ? 384 ILE A CD1 1 
ATOM   2715 N  N   . GLN A 1 389 ? 26.708 9.233   71.223  1.00 114.29 ? 385 GLN A N   1 
ATOM   2716 C  CA  . GLN A 1 389 ? 27.429 10.443  71.642  1.00 117.61 ? 385 GLN A CA  1 
ATOM   2717 C  C   . GLN A 1 389 ? 28.914 10.177  71.926  1.00 119.05 ? 385 GLN A C   1 
ATOM   2718 O  O   . GLN A 1 389 ? 29.285 9.134   72.478  1.00 118.57 ? 385 GLN A O   1 
ATOM   2719 C  CB  . GLN A 1 389 ? 26.744 11.051  72.889  1.00 72.94  ? 385 GLN A CB  1 
ATOM   2720 C  CG  . GLN A 1 389 ? 27.290 12.416  73.374  1.00 75.15  ? 385 GLN A CG  1 
ATOM   2721 C  CD  . GLN A 1 389 ? 26.546 12.985  74.609  1.00 76.39  ? 385 GLN A CD  1 
ATOM   2722 O  OE1 . GLN A 1 389 ? 25.335 13.211  74.573  1.00 77.41  ? 385 GLN A OE1 1 
ATOM   2723 N  NE2 . GLN A 1 389 ? 27.283 13.223  75.695  1.00 76.20  ? 385 GLN A NE2 1 
ATOM   2724 N  N   . ALA A 1 390 ? 29.757 11.132  71.542  1.00 132.88 ? 386 ALA A N   1 
ATOM   2725 C  CA  . ALA A 1 390 ? 31.196 11.013  71.739  1.00 134.33 ? 386 ALA A CA  1 
ATOM   2726 C  C   . ALA A 1 390 ? 31.656 11.790  72.973  1.00 135.09 ? 386 ALA A C   1 
ATOM   2727 O  O   . ALA A 1 390 ? 30.797 12.427  73.618  1.00 135.43 ? 386 ALA A O   1 
ATOM   2728 C  CB  . ALA A 1 390 ? 31.925 11.511  70.491  1.00 51.55  ? 386 ALA A CB  1 
ATOM   2729 N  N   . SER B 1 39  ? 19.877 -41.242 10.273  1.00 101.50 ? 35  SER B N   1 
ATOM   2730 C  CA  . SER B 1 39  ? 19.272 -41.185 11.633  1.00 100.91 ? 35  SER B CA  1 
ATOM   2731 C  C   . SER B 1 39  ? 17.797 -40.802 11.561  1.00 99.84  ? 35  SER B C   1 
ATOM   2732 O  O   . SER B 1 39  ? 17.062 -41.284 10.695  1.00 99.98  ? 35  SER B O   1 
ATOM   2733 C  CB  . SER B 1 39  ? 20.024 -40.173 12.503  1.00 120.95 ? 35  SER B CB  1 
ATOM   2734 O  OG  . SER B 1 39  ? 19.954 -38.870 11.950  1.00 122.45 ? 35  SER B OG  1 
ATOM   2735 N  N   . LYS B 1 40  ? 17.378 -39.928 12.473  1.00 109.04 ? 36  LYS B N   1 
ATOM   2736 C  CA  . LYS B 1 40  ? 15.995 -39.467 12.557  1.00 107.28 ? 36  LYS B CA  1 
ATOM   2737 C  C   . LYS B 1 40  ? 15.507 -38.614 11.384  1.00 105.36 ? 36  LYS B C   1 
ATOM   2738 O  O   . LYS B 1 40  ? 16.190 -37.691 10.942  1.00 105.37 ? 36  LYS B O   1 
ATOM   2739 C  CB  . LYS B 1 40  ? 15.801 -38.687 13.854  1.00 80.75  ? 36  LYS B CB  1 
ATOM   2740 C  CG  . LYS B 1 40  ? 14.559 -37.825 13.868  1.00 82.06  ? 36  LYS B CG  1 
ATOM   2741 C  CD  . LYS B 1 40  ? 14.384 -37.106 15.199  1.00 83.36  ? 36  LYS B CD  1 
ATOM   2742 C  CE  . LYS B 1 40  ? 14.068 -38.087 16.314  1.00 84.80  ? 36  LYS B CE  1 
ATOM   2743 N  NZ  . LYS B 1 40  ? 13.707 -37.399 17.584  1.00 86.19  ? 36  LYS B NZ  1 
ATOM   2744 N  N   . VAL B 1 41  ? 14.309 -38.930 10.900  1.00 74.74  ? 37  VAL B N   1 
ATOM   2745 C  CA  . VAL B 1 41  ? 13.687 -38.206 9.792   1.00 71.78  ? 37  VAL B CA  1 
ATOM   2746 C  C   . VAL B 1 41  ? 12.378 -37.567 10.231  1.00 69.69  ? 37  VAL B C   1 
ATOM   2747 O  O   . VAL B 1 41  ? 11.504 -38.246 10.758  1.00 70.16  ? 37  VAL B O   1 
ATOM   2748 C  CB  . VAL B 1 41  ? 13.354 -39.136 8.587   1.00 50.36  ? 37  VAL B CB  1 
ATOM   2749 C  CG1 . VAL B 1 41  ? 12.336 -38.462 7.682   1.00 49.45  ? 37  VAL B CG1 1 
ATOM   2750 C  CG2 . VAL B 1 41  ? 14.604 -39.430 7.777   1.00 50.44  ? 37  VAL B CG2 1 
ATOM   2751 N  N   . THR B 1 42  ? 12.245 -36.263 10.015  1.00 56.11  ? 38  THR B N   1 
ATOM   2752 C  CA  . THR B 1 42  ? 11.012 -35.569 10.357  1.00 53.06  ? 38  THR B CA  1 
ATOM   2753 C  C   . THR B 1 42  ? 10.231 -35.305 9.076   1.00 50.85  ? 38  THR B C   1 
ATOM   2754 O  O   . THR B 1 42  ? 10.810 -34.911 8.057   1.00 49.48  ? 38  THR B O   1 
ATOM   2755 C  CB  . THR B 1 42  ? 11.284 -34.227 11.050  1.00 34.77  ? 38  THR B CB  1 
ATOM   2756 O  OG1 . THR B 1 42  ? 11.670 -34.459 12.407  1.00 35.00  ? 38  THR B OG1 1 
ATOM   2757 C  CG2 . THR B 1 42  ? 10.043 -33.365 11.048  1.00 33.73  ? 38  THR B CG2 1 
ATOM   2758 N  N   . THR B 1 43  ? 8.922  -35.540 9.115   1.00 52.00  ? 39  THR B N   1 
ATOM   2759 C  CA  . THR B 1 43  ? 8.087  -35.293 7.941   1.00 49.37  ? 39  THR B CA  1 
ATOM   2760 C  C   . THR B 1 43  ? 7.012  -34.270 8.261   1.00 46.83  ? 39  THR B C   1 
ATOM   2761 O  O   . THR B 1 43  ? 6.346  -34.358 9.283   1.00 44.41  ? 39  THR B O   1 
ATOM   2762 C  CB  . THR B 1 43  ? 7.409  -36.569 7.445   1.00 64.69  ? 39  THR B CB  1 
ATOM   2763 O  OG1 . THR B 1 43  ? 8.402  -37.566 7.179   1.00 65.44  ? 39  THR B OG1 1 
ATOM   2764 C  CG2 . THR B 1 43  ? 6.643  -36.286 6.167   1.00 64.17  ? 39  THR B CG2 1 
ATOM   2765 N  N   . VAL B 1 44  ? 6.843  -33.288 7.395   1.00 56.17  ? 40  VAL B N   1 
ATOM   2766 C  CA  . VAL B 1 44  ? 5.842  -32.278 7.665   1.00 52.96  ? 40  VAL B CA  1 
ATOM   2767 C  C   . VAL B 1 44  ? 5.061  -31.927 6.423   1.00 51.70  ? 40  VAL B C   1 
ATOM   2768 O  O   . VAL B 1 44  ? 5.435  -32.301 5.312   1.00 52.00  ? 40  VAL B O   1 
ATOM   2769 C  CB  . VAL B 1 44  ? 6.480  -30.980 8.244   1.00 30.61  ? 40  VAL B CB  1 
ATOM   2770 C  CG1 . VAL B 1 44  ? 7.234  -31.311 9.488   1.00 31.36  ? 40  VAL B CG1 1 
ATOM   2771 C  CG2 . VAL B 1 44  ? 7.422  -30.338 7.242   1.00 28.42  ? 40  VAL B CG2 1 
ATOM   2772 N  N   . VAL B 1 45  ? 3.958  -31.223 6.616   1.00 38.34  ? 41  VAL B N   1 
ATOM   2773 C  CA  . VAL B 1 45  ? 3.152  -30.803 5.497   1.00 38.80  ? 41  VAL B CA  1 
ATOM   2774 C  C   . VAL B 1 45  ? 3.415  -29.304 5.462   1.00 38.57  ? 41  VAL B C   1 
ATOM   2775 O  O   . VAL B 1 45  ? 2.884  -28.549 6.284   1.00 39.47  ? 41  VAL B O   1 
ATOM   2776 C  CB  . VAL B 1 45  ? 1.659  -31.119 5.748   1.00 39.26  ? 41  VAL B CB  1 
ATOM   2777 C  CG1 . VAL B 1 45  ? 0.812  -30.589 4.616   1.00 37.92  ? 41  VAL B CG1 1 
ATOM   2778 C  CG2 . VAL B 1 45  ? 1.461  -32.620 5.875   1.00 37.86  ? 41  VAL B CG2 1 
ATOM   2779 N  N   . ALA B 1 46  ? 4.269  -28.879 4.533   1.00 38.80  ? 42  ALA B N   1 
ATOM   2780 C  CA  . ALA B 1 46  ? 4.618  -27.474 4.440   1.00 37.51  ? 42  ALA B CA  1 
ATOM   2781 C  C   . ALA B 1 46  ? 4.094  -26.838 3.183   1.00 36.33  ? 42  ALA B C   1 
ATOM   2782 O  O   . ALA B 1 46  ? 3.881  -27.507 2.170   1.00 36.39  ? 42  ALA B O   1 
ATOM   2783 C  CB  . ALA B 1 46  ? 6.121  -27.301 4.515   1.00 38.05  ? 42  ALA B CB  1 
ATOM   2784 N  N   . THR B 1 47  ? 3.908  -25.527 3.266   1.00 33.90  ? 43  THR B N   1 
ATOM   2785 C  CA  . THR B 1 47  ? 3.390  -24.724 2.179   1.00 35.83  ? 43  THR B CA  1 
ATOM   2786 C  C   . THR B 1 47  ? 4.521  -24.062 1.420   1.00 37.54  ? 43  THR B C   1 
ATOM   2787 O  O   . THR B 1 47  ? 5.409  -23.473 2.027   1.00 37.44  ? 43  THR B O   1 
ATOM   2788 C  CB  . THR B 1 47  ? 2.545  -23.581 2.719   1.00 34.22  ? 43  THR B CB  1 
ATOM   2789 O  OG1 . THR B 1 47  ? 1.585  -24.084 3.639   1.00 36.36  ? 43  THR B OG1 1 
ATOM   2790 C  CG2 . THR B 1 47  ? 1.859  -22.863 1.608   1.00 31.35  ? 43  THR B CG2 1 
ATOM   2791 N  N   . PRO B 1 48  ? 4.515  -24.148 0.087   1.00 39.66  ? 44  PRO B N   1 
ATOM   2792 C  CA  . PRO B 1 48  ? 5.581  -23.501 -0.681  1.00 41.51  ? 44  PRO B CA  1 
ATOM   2793 C  C   . PRO B 1 48  ? 5.608  -21.991 -0.407  1.00 42.74  ? 44  PRO B C   1 
ATOM   2794 O  O   . PRO B 1 48  ? 4.572  -21.371 -0.150  1.00 39.98  ? 44  PRO B O   1 
ATOM   2795 C  CB  . PRO B 1 48  ? 5.197  -23.815 -2.112  1.00 42.44  ? 44  PRO B CB  1 
ATOM   2796 C  CG  . PRO B 1 48  ? 4.653  -25.203 -1.973  1.00 43.18  ? 44  PRO B CG  1 
ATOM   2797 C  CD  . PRO B 1 48  ? 3.783  -25.118 -0.743  1.00 40.84  ? 44  PRO B CD  1 
ATOM   2798 N  N   . GLY B 1 49  ? 6.800  -21.409 -0.464  1.00 34.82  ? 45  GLY B N   1 
ATOM   2799 C  CA  . GLY B 1 49  ? 6.953  -19.997 -0.210  1.00 37.65  ? 45  GLY B CA  1 
ATOM   2800 C  C   . GLY B 1 49  ? 6.294  -19.138 -1.255  1.00 41.21  ? 45  GLY B C   1 
ATOM   2801 O  O   . GLY B 1 49  ? 5.688  -18.115 -0.931  1.00 40.77  ? 45  GLY B O   1 
ATOM   2802 N  N   . GLN B 1 50  ? 6.419  -19.527 -2.515  1.00 66.79  ? 46  GLN B N   1 
ATOM   2803 C  CA  . GLN B 1 50  ? 5.802  -18.753 -3.577  1.00 71.04  ? 46  GLN B CA  1 
ATOM   2804 C  C   . GLN B 1 50  ? 4.740  -19.567 -4.303  1.00 72.45  ? 46  GLN B C   1 
ATOM   2805 O  O   . GLN B 1 50  ? 4.724  -20.802 -4.243  1.00 74.21  ? 46  GLN B O   1 
ATOM   2806 C  CB  . GLN B 1 50  ? 6.847  -18.277 -4.597  1.00 78.09  ? 46  GLN B CB  1 
ATOM   2807 C  CG  . GLN B 1 50  ? 7.749  -17.128 -4.153  1.00 80.85  ? 46  GLN B CG  1 
ATOM   2808 C  CD  . GLN B 1 50  ? 8.780  -17.551 -3.129  1.00 82.35  ? 46  GLN B CD  1 
ATOM   2809 O  OE1 . GLN B 1 50  ? 9.467  -18.569 -3.295  1.00 83.42  ? 46  GLN B OE1 1 
ATOM   2810 N  NE2 . GLN B 1 50  ? 8.903  -16.767 -2.064  1.00 82.49  ? 46  GLN B NE2 1 
ATOM   2811 N  N   . GLY B 1 51  ? 3.845  -18.857 -4.981  1.00 67.32  ? 47  GLY B N   1 
ATOM   2812 C  CA  . GLY B 1 51  ? 2.810  -19.512 -5.750  1.00 67.91  ? 47  GLY B CA  1 
ATOM   2813 C  C   . GLY B 1 51  ? 1.652  -20.123 -4.999  1.00 68.68  ? 47  GLY B C   1 
ATOM   2814 O  O   . GLY B 1 51  ? 1.452  -19.857 -3.815  1.00 68.51  ? 47  GLY B O   1 
ATOM   2815 N  N   . PRO B 1 52  ? 0.882  -20.983 -5.688  1.00 70.17  ? 48  PRO B N   1 
ATOM   2816 C  CA  . PRO B 1 52  ? -0.290 -21.682 -5.163  1.00 69.49  ? 48  PRO B CA  1 
ATOM   2817 C  C   . PRO B 1 52  ? -0.110 -22.181 -3.746  1.00 67.67  ? 48  PRO B C   1 
ATOM   2818 O  O   . PRO B 1 52  ? 0.880  -22.832 -3.409  1.00 68.87  ? 48  PRO B O   1 
ATOM   2819 C  CB  . PRO B 1 52  ? -0.498 -22.819 -6.170  1.00 69.11  ? 48  PRO B CB  1 
ATOM   2820 C  CG  . PRO B 1 52  ? 0.876  -23.055 -6.712  1.00 69.41  ? 48  PRO B CG  1 
ATOM   2821 C  CD  . PRO B 1 52  ? 1.345  -21.642 -6.925  1.00 68.99  ? 48  PRO B CD  1 
ATOM   2822 N  N   . ASP B 1 53  ? -1.089 -21.850 -2.920  1.00 50.56  ? 49  ASP B N   1 
ATOM   2823 C  CA  . ASP B 1 53  ? -1.102 -22.237 -1.522  1.00 49.37  ? 49  ASP B CA  1 
ATOM   2824 C  C   . ASP B 1 53  ? -1.582 -23.697 -1.453  1.00 47.22  ? 49  ASP B C   1 
ATOM   2825 O  O   . ASP B 1 53  ? -2.675 -23.985 -0.986  1.00 46.79  ? 49  ASP B O   1 
ATOM   2826 C  CB  . ASP B 1 53  ? -2.045 -21.298 -0.765  1.00 63.14  ? 49  ASP B CB  1 
ATOM   2827 C  CG  . ASP B 1 53  ? -1.688 -21.159 0.697   1.00 66.62  ? 49  ASP B CG  1 
ATOM   2828 O  OD1 . ASP B 1 53  ? -1.807 -22.164 1.434   1.00 67.91  ? 49  ASP B OD1 1 
ATOM   2829 O  OD2 . ASP B 1 53  ? -1.289 -20.046 1.112   1.00 68.64  ? 49  ASP B OD2 1 
ATOM   2830 N  N   . ARG B 1 54  ? -0.740 -24.608 -1.933  1.00 52.70  ? 50  ARG B N   1 
ATOM   2831 C  CA  . ARG B 1 54  ? -1.053 -26.030 -1.956  1.00 49.11  ? 50  ARG B CA  1 
ATOM   2832 C  C   . ARG B 1 54  ? 0.022  -26.849 -1.228  1.00 45.44  ? 50  ARG B C   1 
ATOM   2833 O  O   . ARG B 1 54  ? 0.992  -27.304 -1.823  1.00 43.74  ? 50  ARG B O   1 
ATOM   2834 C  CB  . ARG B 1 54  ? -1.181 -26.506 -3.413  1.00 58.49  ? 50  ARG B CB  1 
ATOM   2835 C  CG  . ARG B 1 54  ? -2.310 -25.840 -4.228  1.00 62.17  ? 50  ARG B CG  1 
ATOM   2836 C  CD  . ARG B 1 54  ? -3.704 -26.407 -3.881  1.00 64.24  ? 50  ARG B CD  1 
ATOM   2837 N  NE  . ARG B 1 54  ? -4.789 -25.731 -4.601  1.00 65.20  ? 50  ARG B NE  1 
ATOM   2838 C  CZ  . ARG B 1 54  ? -5.425 -24.630 -4.185  1.00 65.76  ? 50  ARG B CZ  1 
ATOM   2839 N  NH1 . ARG B 1 54  ? -5.106 -24.049 -3.033  1.00 64.73  ? 50  ARG B NH1 1 
ATOM   2840 N  NH2 . ARG B 1 54  ? -6.385 -24.094 -4.933  1.00 64.80  ? 50  ARG B NH2 1 
ATOM   2841 N  N   . PRO B 1 55  ? -0.146 -27.043 0.079   1.00 46.44  ? 51  PRO B N   1 
ATOM   2842 C  CA  . PRO B 1 55  ? 0.788  -27.801 0.920   1.00 45.46  ? 51  PRO B CA  1 
ATOM   2843 C  C   . PRO B 1 55  ? 1.210  -29.150 0.362   1.00 46.51  ? 51  PRO B C   1 
ATOM   2844 O  O   . PRO B 1 55  ? 0.453  -29.797 -0.346  1.00 45.56  ? 51  PRO B O   1 
ATOM   2845 C  CB  . PRO B 1 55  ? 0.018  -27.955 2.232   1.00 39.05  ? 51  PRO B CB  1 
ATOM   2846 C  CG  . PRO B 1 55  ? -0.709 -26.657 2.323   1.00 39.45  ? 51  PRO B CG  1 
ATOM   2847 C  CD  . PRO B 1 55  ? -1.206 -26.428 0.894   1.00 40.03  ? 51  PRO B CD  1 
ATOM   2848 N  N   . GLN B 1 56  ? 2.428  -29.567 0.695   1.00 43.27  ? 52  GLN B N   1 
ATOM   2849 C  CA  . GLN B 1 56  ? 2.949  -30.866 0.271   1.00 45.17  ? 52  GLN B CA  1 
ATOM   2850 C  C   . GLN B 1 56  ? 3.801  -31.450 1.373   1.00 45.92  ? 52  GLN B C   1 
ATOM   2851 O  O   . GLN B 1 56  ? 4.258  -30.726 2.258   1.00 44.92  ? 52  GLN B O   1 
ATOM   2852 C  CB  . GLN B 1 56  ? 3.768  -30.744 -1.009  1.00 50.71  ? 52  GLN B CB  1 
ATOM   2853 C  CG  . GLN B 1 56  ? 4.886  -29.743 -0.964  1.00 55.54  ? 52  GLN B CG  1 
ATOM   2854 C  CD  . GLN B 1 56  ? 5.517  -29.551 -2.334  1.00 57.65  ? 52  GLN B CD  1 
ATOM   2855 O  OE1 . GLN B 1 56  ? 4.892  -28.998 -3.251  1.00 57.85  ? 52  GLN B OE1 1 
ATOM   2856 N  NE2 . GLN B 1 56  ? 6.756  -30.023 -2.486  1.00 58.43  ? 52  GLN B NE2 1 
ATOM   2857 N  N   . GLU B 1 57  ? 3.990  -32.765 1.337   1.00 44.21  ? 53  GLU B N   1 
ATOM   2858 C  CA  . GLU B 1 57  ? 4.789  -33.445 2.349   1.00 45.61  ? 53  GLU B CA  1 
ATOM   2859 C  C   . GLU B 1 57  ? 6.266  -33.171 2.084   1.00 45.00  ? 53  GLU B C   1 
ATOM   2860 O  O   . GLU B 1 57  ? 6.735  -33.245 0.942   1.00 43.48  ? 53  GLU B O   1 
ATOM   2861 C  CB  . GLU B 1 57  ? 4.495  -34.947 2.323   1.00 106.37 ? 53  GLU B CB  1 
ATOM   2862 C  CG  . GLU B 1 57  ? 3.024  -35.254 2.586   1.00 111.45 ? 53  GLU B CG  1 
ATOM   2863 C  CD  . GLU B 1 57  ? 2.631  -36.693 2.287   1.00 114.51 ? 53  GLU B CD  1 
ATOM   2864 O  OE1 . GLU B 1 57  ? 2.929  -37.176 1.173   1.00 116.72 ? 53  GLU B OE1 1 
ATOM   2865 O  OE2 . GLU B 1 57  ? 2.009  -37.335 3.161   1.00 112.75 ? 53  GLU B OE2 1 
ATOM   2866 N  N   . VAL B 1 58  ? 6.988  -32.811 3.142   1.00 41.35  ? 54  VAL B N   1 
ATOM   2867 C  CA  . VAL B 1 58  ? 8.415  -32.520 3.050   1.00 40.37  ? 54  VAL B CA  1 
ATOM   2868 C  C   . VAL B 1 58  ? 9.157  -33.253 4.164   1.00 40.10  ? 54  VAL B C   1 
ATOM   2869 O  O   . VAL B 1 58  ? 8.725  -33.236 5.324   1.00 39.31  ? 54  VAL B O   1 
ATOM   2870 C  CB  . VAL B 1 58  ? 8.691  -31.014 3.201   1.00 40.32  ? 54  VAL B CB  1 
ATOM   2871 C  CG1 . VAL B 1 58  ? 10.201 -30.768 3.222   1.00 40.48  ? 54  VAL B CG1 1 
ATOM   2872 C  CG2 . VAL B 1 58  ? 8.035  -30.244 2.069   1.00 37.99  ? 54  VAL B CG2 1 
ATOM   2873 N  N   . SER B 1 59  ? 10.268 -33.897 3.822   1.00 59.68  ? 55  SER B N   1 
ATOM   2874 C  CA  . SER B 1 59  ? 11.041 -34.620 4.829   1.00 61.73  ? 55  SER B CA  1 
ATOM   2875 C  C   . SER B 1 59  ? 12.501 -34.212 4.898   1.00 60.53  ? 55  SER B C   1 
ATOM   2876 O  O   . SER B 1 59  ? 13.171 -34.068 3.875   1.00 60.45  ? 55  SER B O   1 
ATOM   2877 C  CB  . SER B 1 59  ? 10.952 -36.129 4.604   1.00 57.86  ? 55  SER B CB  1 
ATOM   2878 O  OG  . SER B 1 59  ? 9.770  -36.647 5.180   1.00 60.41  ? 55  SER B OG  1 
ATOM   2879 N  N   . TYR B 1 60  ? 12.987 -34.038 6.120   1.00 47.41  ? 56  TYR B N   1 
ATOM   2880 C  CA  . TYR B 1 60  ? 14.367 -33.648 6.343   1.00 49.12  ? 56  TYR B CA  1 
ATOM   2881 C  C   . TYR B 1 60  ? 15.021 -34.454 7.468   1.00 51.62  ? 56  TYR B C   1 
ATOM   2882 O  O   . TYR B 1 60  ? 14.337 -35.084 8.273   1.00 50.77  ? 56  TYR B O   1 
ATOM   2883 C  CB  . TYR B 1 60  ? 14.434 -32.144 6.639   1.00 49.62  ? 56  TYR B CB  1 
ATOM   2884 C  CG  . TYR B 1 60  ? 13.651 -31.686 7.853   1.00 47.49  ? 56  TYR B CG  1 
ATOM   2885 C  CD1 . TYR B 1 60  ? 14.135 -31.893 9.145   1.00 45.10  ? 56  TYR B CD1 1 
ATOM   2886 C  CD2 . TYR B 1 60  ? 12.440 -31.015 7.709   1.00 46.80  ? 56  TYR B CD2 1 
ATOM   2887 C  CE1 . TYR B 1 60  ? 13.431 -31.436 10.266  1.00 44.62  ? 56  TYR B CE1 1 
ATOM   2888 C  CE2 . TYR B 1 60  ? 11.732 -30.558 8.822   1.00 43.09  ? 56  TYR B CE2 1 
ATOM   2889 C  CZ  . TYR B 1 60  ? 12.231 -30.772 10.092  1.00 44.38  ? 56  TYR B CZ  1 
ATOM   2890 O  OH  . TYR B 1 60  ? 11.522 -30.332 11.182  1.00 44.45  ? 56  TYR B OH  1 
ATOM   2891 N  N   . THR B 1 61  ? 16.348 -34.417 7.525   1.00 69.80  ? 57  THR B N   1 
ATOM   2892 C  CA  . THR B 1 61  ? 17.084 -35.156 8.541   1.00 72.13  ? 57  THR B CA  1 
ATOM   2893 C  C   . THR B 1 61  ? 18.405 -34.468 8.901   1.00 73.90  ? 57  THR B C   1 
ATOM   2894 O  O   . THR B 1 61  ? 18.737 -33.431 8.339   1.00 73.79  ? 57  THR B O   1 
ATOM   2895 C  CB  . THR B 1 61  ? 17.366 -36.582 8.031   1.00 65.95  ? 57  THR B CB  1 
ATOM   2896 O  OG1 . THR B 1 61  ? 18.017 -37.337 9.058   1.00 68.15  ? 57  THR B OG1 1 
ATOM   2897 C  CG2 . THR B 1 61  ? 18.235 -36.539 6.773   1.00 64.80  ? 57  THR B CG2 1 
ATOM   2898 N  N   . ASP B 1 62  ? 19.150 -35.047 9.839   1.00 62.34  ? 58  ASP B N   1 
ATOM   2899 C  CA  . ASP B 1 62  ? 20.445 -34.498 10.264  1.00 63.95  ? 58  ASP B CA  1 
ATOM   2900 C  C   . ASP B 1 62  ? 20.301 -33.083 10.793  1.00 64.50  ? 58  ASP B C   1 
ATOM   2901 O  O   . ASP B 1 62  ? 21.037 -32.179 10.396  1.00 64.12  ? 58  ASP B O   1 
ATOM   2902 C  CB  . ASP B 1 62  ? 21.442 -34.481 9.100   1.00 93.79  ? 58  ASP B CB  1 
ATOM   2903 C  CG  . ASP B 1 62  ? 21.750 -35.865 8.567   1.00 96.93  ? 58  ASP B CG  1 
ATOM   2904 O  OD1 . ASP B 1 62  ? 21.751 -36.826 9.366   1.00 98.36  ? 58  ASP B OD1 1 
ATOM   2905 O  OD2 . ASP B 1 62  ? 22.010 -35.986 7.349   1.00 97.30  ? 58  ASP B OD2 1 
ATOM   2906 N  N   . THR B 1 63  ? 19.362 -32.899 11.707  1.00 63.73  ? 59  THR B N   1 
ATOM   2907 C  CA  . THR B 1 63  ? 19.093 -31.583 12.259  1.00 65.15  ? 59  THR B CA  1 
ATOM   2908 C  C   . THR B 1 63  ? 20.052 -31.108 13.337  1.00 65.71  ? 59  THR B C   1 
ATOM   2909 O  O   . THR B 1 63  ? 20.061 -31.651 14.436  1.00 65.82  ? 59  THR B O   1 
ATOM   2910 C  CB  . THR B 1 63  ? 17.661 -31.523 12.839  1.00 64.54  ? 59  THR B CB  1 
ATOM   2911 O  OG1 . THR B 1 63  ? 16.717 -31.888 11.827  1.00 64.78  ? 59  THR B OG1 1 
ATOM   2912 C  CG2 . THR B 1 63  ? 17.340 -30.125 13.320  1.00 65.64  ? 59  THR B CG2 1 
ATOM   2913 N  N   . LYS B 1 64  ? 20.856 -30.092 13.029  1.00 60.15  ? 60  LYS B N   1 
ATOM   2914 C  CA  . LYS B 1 64  ? 21.763 -29.525 14.027  1.00 60.30  ? 60  LYS B CA  1 
ATOM   2915 C  C   . LYS B 1 64  ? 21.470 -28.034 14.139  1.00 59.04  ? 60  LYS B C   1 
ATOM   2916 O  O   . LYS B 1 64  ? 20.964 -27.428 13.199  1.00 59.38  ? 60  LYS B O   1 
ATOM   2917 C  CB  . LYS B 1 64  ? 23.227 -29.747 13.641  1.00 66.65  ? 60  LYS B CB  1 
ATOM   2918 C  CG  . LYS B 1 64  ? 23.751 -28.878 12.519  1.00 68.99  ? 60  LYS B CG  1 
ATOM   2919 C  CD  . LYS B 1 64  ? 24.988 -29.510 11.899  1.00 71.67  ? 60  LYS B CD  1 
ATOM   2920 C  CE  . LYS B 1 64  ? 24.653 -30.905 11.345  1.00 73.34  ? 60  LYS B CE  1 
ATOM   2921 N  NZ  . LYS B 1 64  ? 25.815 -31.614 10.730  1.00 75.24  ? 60  LYS B NZ  1 
ATOM   2922 N  N   . VAL B 1 65  ? 21.761 -27.457 15.299  1.00 47.67  ? 61  VAL B N   1 
ATOM   2923 C  CA  . VAL B 1 65  ? 21.544 -26.025 15.533  1.00 47.24  ? 61  VAL B CA  1 
ATOM   2924 C  C   . VAL B 1 65  ? 22.657 -25.228 14.865  1.00 47.32  ? 61  VAL B C   1 
ATOM   2925 O  O   . VAL B 1 65  ? 23.817 -25.476 15.138  1.00 47.73  ? 61  VAL B O   1 
ATOM   2926 C  CB  . VAL B 1 65  ? 21.602 -25.692 17.031  1.00 42.65  ? 61  VAL B CB  1 
ATOM   2927 C  CG1 . VAL B 1 65  ? 21.451 -24.194 17.227  1.00 41.63  ? 61  VAL B CG1 1 
ATOM   2928 C  CG2 . VAL B 1 65  ? 20.536 -26.469 17.787  1.00 40.58  ? 61  VAL B CG2 1 
ATOM   2929 N  N   . ILE B 1 66  ? 22.328 -24.264 14.014  1.00 66.67  ? 62  ILE B N   1 
ATOM   2930 C  CA  . ILE B 1 66  ? 23.392 -23.512 13.360  1.00 67.31  ? 62  ILE B CA  1 
ATOM   2931 C  C   . ILE B 1 66  ? 23.492 -22.077 13.760  1.00 69.41  ? 62  ILE B C   1 
ATOM   2932 O  O   . ILE B 1 66  ? 23.872 -21.244 12.943  1.00 70.09  ? 62  ILE B O   1 
ATOM   2933 C  CB  . ILE B 1 66  ? 23.295 -23.540 11.809  1.00 59.95  ? 62  ILE B CB  1 
ATOM   2934 C  CG1 . ILE B 1 66  ? 22.219 -22.593 11.288  1.00 58.60  ? 62  ILE B CG1 1 
ATOM   2935 C  CG2 . ILE B 1 66  ? 22.978 -24.923 11.364  1.00 59.44  ? 62  ILE B CG2 1 
ATOM   2936 C  CD1 . ILE B 1 66  ? 22.038 -22.660 9.783   1.00 57.80  ? 62  ILE B CD1 1 
ATOM   2937 N  N   . GLY B 1 67  ? 23.169 -21.772 15.005  1.00 33.89  ? 63  GLY B N   1 
ATOM   2938 C  CA  . GLY B 1 67  ? 23.255 -20.389 15.410  1.00 36.35  ? 63  GLY B CA  1 
ATOM   2939 C  C   . GLY B 1 67  ? 21.990 -19.775 15.980  1.00 38.18  ? 63  GLY B C   1 
ATOM   2940 O  O   . GLY B 1 67  ? 21.129 -20.470 16.519  1.00 37.67  ? 63  GLY B O   1 
ATOM   2941 N  N   . ASN B 1 68  ? 21.868 -18.457 15.833  1.00 82.21  ? 64  ASN B N   1 
ATOM   2942 C  CA  . ASN B 1 68  ? 20.749 -17.712 16.405  1.00 84.74  ? 64  ASN B CA  1 
ATOM   2943 C  C   . ASN B 1 68  ? 20.286 -16.459 15.611  1.00 85.30  ? 64  ASN B C   1 
ATOM   2944 O  O   . ASN B 1 68  ? 21.092 -15.604 15.241  1.00 85.78  ? 64  ASN B O   1 
ATOM   2945 C  CB  . ASN B 1 68  ? 21.174 -17.322 17.820  1.00 57.40  ? 64  ASN B CB  1 
ATOM   2946 C  CG  . ASN B 1 68  ? 20.030 -17.247 18.763  1.00 59.55  ? 64  ASN B CG  1 
ATOM   2947 O  OD1 . ASN B 1 68  ? 19.359 -16.214 18.863  1.00 59.95  ? 64  ASN B OD1 1 
ATOM   2948 N  ND2 . ASN B 1 68  ? 19.775 -18.350 19.465  1.00 60.23  ? 64  ASN B ND2 1 
ATOM   2949 N  N   . GLY B 1 69  ? 18.983 -16.348 15.361  1.00 55.98  ? 65  GLY B N   1 
ATOM   2950 C  CA  . GLY B 1 69  ? 18.473 -15.204 14.627  1.00 56.35  ? 65  GLY B CA  1 
ATOM   2951 C  C   . GLY B 1 69  ? 17.320 -14.458 15.284  1.00 56.49  ? 65  GLY B C   1 
ATOM   2952 O  O   . GLY B 1 69  ? 16.541 -15.024 16.065  1.00 56.18  ? 65  GLY B O   1 
ATOM   2953 N  N   . SER B 1 70  ? 17.206 -13.176 14.945  1.00 97.07  ? 66  SER B N   1 
ATOM   2954 C  CA  . SER B 1 70  ? 16.171 -12.284 15.466  1.00 96.76  ? 66  SER B CA  1 
ATOM   2955 C  C   . SER B 1 70  ? 15.361 -12.763 16.659  1.00 96.57  ? 66  SER B C   1 
ATOM   2956 O  O   . SER B 1 70  ? 15.816 -12.684 17.806  1.00 95.96  ? 66  SER B O   1 
ATOM   2957 C  CB  . SER B 1 70  ? 15.205 -11.886 14.351  1.00 63.19  ? 66  SER B CB  1 
ATOM   2958 O  OG  . SER B 1 70  ? 15.686 -10.746 13.668  1.00 62.05  ? 66  SER B OG  1 
ATOM   2959 N  N   . PHE B 1 71  ? 14.154 -13.246 16.384  1.00 72.56  ? 67  PHE B N   1 
ATOM   2960 C  CA  . PHE B 1 71  ? 13.267 -13.701 17.443  1.00 71.87  ? 67  PHE B CA  1 
ATOM   2961 C  C   . PHE B 1 71  ? 13.175 -15.214 17.510  1.00 69.73  ? 67  PHE B C   1 
ATOM   2962 O  O   . PHE B 1 71  ? 12.144 -15.755 17.915  1.00 69.13  ? 67  PHE B O   1 
ATOM   2963 C  CB  . PHE B 1 71  ? 11.858 -13.122 17.245  1.00 69.52  ? 67  PHE B CB  1 
ATOM   2964 C  CG  . PHE B 1 71  ? 11.840 -11.657 16.889  1.00 73.10  ? 67  PHE B CG  1 
ATOM   2965 C  CD1 . PHE B 1 71  ? 11.984 -11.247 15.558  1.00 74.20  ? 67  PHE B CD1 1 
ATOM   2966 C  CD2 . PHE B 1 71  ? 11.706 -10.682 17.885  1.00 73.60  ? 67  PHE B CD2 1 
ATOM   2967 C  CE1 . PHE B 1 71  ? 11.998 -9.889  15.223  1.00 74.90  ? 67  PHE B CE1 1 
ATOM   2968 C  CE2 . PHE B 1 71  ? 11.720 -9.320  17.563  1.00 74.41  ? 67  PHE B CE2 1 
ATOM   2969 C  CZ  . PHE B 1 71  ? 11.867 -8.923  16.226  1.00 74.86  ? 67  PHE B CZ  1 
ATOM   2970 N  N   . GLY B 1 72  ? 14.245 -15.906 17.129  1.00 46.33  ? 68  GLY B N   1 
ATOM   2971 C  CA  . GLY B 1 72  ? 14.184 -17.353 17.175  1.00 42.98  ? 68  GLY B CA  1 
ATOM   2972 C  C   . GLY B 1 72  ? 15.498 -18.080 17.058  1.00 40.89  ? 68  GLY B C   1 
ATOM   2973 O  O   . GLY B 1 72  ? 16.541 -17.541 17.387  1.00 41.76  ? 68  GLY B O   1 
ATOM   2974 N  N   . VAL B 1 73  ? 15.444 -19.318 16.589  1.00 61.99  ? 69  VAL B N   1 
ATOM   2975 C  CA  . VAL B 1 73  ? 16.643 -20.117 16.442  1.00 58.08  ? 69  VAL B CA  1 
ATOM   2976 C  C   . VAL B 1 73  ? 16.701 -20.749 15.068  1.00 56.07  ? 69  VAL B C   1 
ATOM   2977 O  O   . VAL B 1 73  ? 15.723 -21.346 14.611  1.00 54.32  ? 69  VAL B O   1 
ATOM   2978 C  CB  . VAL B 1 73  ? 16.695 -21.252 17.485  1.00 61.55  ? 69  VAL B CB  1 
ATOM   2979 C  CG1 . VAL B 1 73  ? 17.995 -22.041 17.331  1.00 61.22  ? 69  VAL B CG1 1 
ATOM   2980 C  CG2 . VAL B 1 73  ? 16.572 -20.673 18.883  1.00 60.65  ? 69  VAL B CG2 1 
ATOM   2981 N  N   . VAL B 1 74  ? 17.855 -20.630 14.419  1.00 44.74  ? 70  VAL B N   1 
ATOM   2982 C  CA  . VAL B 1 74  ? 18.028 -21.205 13.105  1.00 42.33  ? 70  VAL B CA  1 
ATOM   2983 C  C   . VAL B 1 74  ? 18.742 -22.553 13.185  1.00 42.01  ? 70  VAL B C   1 
ATOM   2984 O  O   . VAL B 1 74  ? 19.733 -22.690 13.883  1.00 39.97  ? 70  VAL B O   1 
ATOM   2985 C  CB  . VAL B 1 74  ? 18.819 -20.258 12.237  1.00 32.69  ? 70  VAL B CB  1 
ATOM   2986 C  CG1 . VAL B 1 74  ? 18.799 -20.742 10.787  1.00 31.35  ? 70  VAL B CG1 1 
ATOM   2987 C  CG2 . VAL B 1 74  ? 18.249 -18.859 12.385  1.00 32.87  ? 70  VAL B CG2 1 
ATOM   2988 N  N   . TYR B 1 75  ? 18.221 -23.551 12.479  1.00 38.05  ? 71  TYR B N   1 
ATOM   2989 C  CA  . TYR B 1 75  ? 18.801 -24.896 12.477  1.00 37.79  ? 71  TYR B CA  1 
ATOM   2990 C  C   . TYR B 1 75  ? 19.158 -25.233 11.065  1.00 37.68  ? 71  TYR B C   1 
ATOM   2991 O  O   . TYR B 1 75  ? 18.721 -24.571 10.137  1.00 37.32  ? 71  TYR B O   1 
ATOM   2992 C  CB  . TYR B 1 75  ? 17.801 -25.973 12.914  1.00 51.74  ? 71  TYR B CB  1 
ATOM   2993 C  CG  . TYR B 1 75  ? 17.201 -25.785 14.271  1.00 55.60  ? 71  TYR B CG  1 
ATOM   2994 C  CD1 . TYR B 1 75  ? 16.390 -24.688 14.540  1.00 55.23  ? 71  TYR B CD1 1 
ATOM   2995 C  CD2 . TYR B 1 75  ? 17.455 -26.698 15.297  1.00 57.20  ? 71  TYR B CD2 1 
ATOM   2996 C  CE1 . TYR B 1 75  ? 15.846 -24.495 15.795  1.00 57.46  ? 71  TYR B CE1 1 
ATOM   2997 C  CE2 . TYR B 1 75  ? 16.917 -26.521 16.556  1.00 57.05  ? 71  TYR B CE2 1 
ATOM   2998 C  CZ  . TYR B 1 75  ? 16.110 -25.414 16.801  1.00 58.46  ? 71  TYR B CZ  1 
ATOM   2999 O  OH  . TYR B 1 75  ? 15.545 -25.222 18.040  1.00 58.54  ? 71  TYR B OH  1 
ATOM   3000 N  N   . GLN B 1 76  ? 19.937 -26.286 10.903  1.00 52.48  ? 72  GLN B N   1 
ATOM   3001 C  CA  . GLN B 1 76  ? 20.286 -26.723 9.577   1.00 52.27  ? 72  GLN B CA  1 
ATOM   3002 C  C   . GLN B 1 76  ? 19.836 -28.154 9.487   1.00 51.11  ? 72  GLN B C   1 
ATOM   3003 O  O   . GLN B 1 76  ? 19.925 -28.898 10.463  1.00 49.79  ? 72  GLN B O   1 
ATOM   3004 C  CB  . GLN B 1 76  ? 21.776 -26.666 9.348   1.00 47.63  ? 72  GLN B CB  1 
ATOM   3005 C  CG  . GLN B 1 76  ? 22.175 -27.439 8.144   1.00 50.59  ? 72  GLN B CG  1 
ATOM   3006 C  CD  . GLN B 1 76  ? 23.595 -27.858 8.220   1.00 51.53  ? 72  GLN B CD  1 
ATOM   3007 O  OE1 . GLN B 1 76  ? 24.490 -27.057 7.990   1.00 54.06  ? 72  GLN B OE1 1 
ATOM   3008 N  NE2 . GLN B 1 76  ? 23.825 -29.119 8.566   1.00 49.91  ? 72  GLN B NE2 1 
ATOM   3009 N  N   . ALA B 1 77  ? 19.350 -28.541 8.317   1.00 36.23  ? 73  ALA B N   1 
ATOM   3010 C  CA  . ALA B 1 77  ? 18.885 -29.898 8.123   1.00 36.26  ? 73  ALA B CA  1 
ATOM   3011 C  C   . ALA B 1 77  ? 19.026 -30.214 6.655   1.00 35.57  ? 73  ALA B C   1 
ATOM   3012 O  O   . ALA B 1 77  ? 19.296 -29.315 5.851   1.00 35.71  ? 73  ALA B O   1 
ATOM   3013 C  CB  . ALA B 1 77  ? 17.440 -30.027 8.572   1.00 25.63  ? 73  ALA B CB  1 
ATOM   3014 N  N   . LYS B 1 78  ? 18.853 -31.484 6.303   1.00 49.58  ? 74  LYS B N   1 
ATOM   3015 C  CA  . LYS B 1 78  ? 18.998 -31.928 4.919   1.00 51.08  ? 74  LYS B CA  1 
ATOM   3016 C  C   . LYS B 1 78  ? 17.689 -32.521 4.391   1.00 51.50  ? 74  LYS B C   1 
ATOM   3017 O  O   . LYS B 1 78  ? 17.085 -33.389 5.030   1.00 51.17  ? 74  LYS B O   1 
ATOM   3018 C  CB  . LYS B 1 78  ? 20.124 -32.969 4.843   1.00 64.05  ? 74  LYS B CB  1 
ATOM   3019 C  CG  . LYS B 1 78  ? 20.440 -33.476 3.454   1.00 67.11  ? 74  LYS B CG  1 
ATOM   3020 C  CD  . LYS B 1 78  ? 21.176 -34.811 3.510   1.00 71.91  ? 74  LYS B CD  1 
ATOM   3021 C  CE  . LYS B 1 78  ? 22.628 -34.672 3.965   1.00 76.12  ? 74  LYS B CE  1 
ATOM   3022 N  NZ  . LYS B 1 78  ? 23.513 -34.073 2.906   1.00 79.67  ? 74  LYS B NZ  1 
ATOM   3023 N  N   . LEU B 1 79  ? 17.241 -32.048 3.233   1.00 52.52  ? 75  LEU B N   1 
ATOM   3024 C  CA  . LEU B 1 79  ? 16.012 -32.564 2.647   1.00 54.62  ? 75  LEU B CA  1 
ATOM   3025 C  C   . LEU B 1 79  ? 16.320 -33.971 2.140   1.00 57.17  ? 75  LEU B C   1 
ATOM   3026 O  O   . LEU B 1 79  ? 17.337 -34.176 1.484   1.00 56.20  ? 75  LEU B O   1 
ATOM   3027 C  CB  . LEU B 1 79  ? 15.565 -31.688 1.474   1.00 28.44  ? 75  LEU B CB  1 
ATOM   3028 C  CG  . LEU B 1 79  ? 15.358 -30.186 1.700   1.00 26.85  ? 75  LEU B CG  1 
ATOM   3029 C  CD1 . LEU B 1 79  ? 15.017 -29.556 0.399   1.00 25.48  ? 75  LEU B CD1 1 
ATOM   3030 C  CD2 . LEU B 1 79  ? 14.265 -29.909 2.705   1.00 24.96  ? 75  LEU B CD2 1 
ATOM   3031 N  N   . CYS B 1 80  ? 15.453 -34.936 2.440   1.00 54.13  ? 76  CYS B N   1 
ATOM   3032 C  CA  . CYS B 1 80  ? 15.664 -36.312 1.996   1.00 56.14  ? 76  CYS B CA  1 
ATOM   3033 C  C   . CYS B 1 80  ? 15.508 -36.462 0.481   1.00 57.65  ? 76  CYS B C   1 
ATOM   3034 O  O   . CYS B 1 80  ? 16.359 -37.048 -0.181  1.00 58.10  ? 76  CYS B O   1 
ATOM   3035 C  CB  . CYS B 1 80  ? 14.693 -37.244 2.707   1.00 56.31  ? 76  CYS B CB  1 
ATOM   3036 S  SG  . CYS B 1 80  ? 14.743 -37.104 4.504   1.00 59.62  ? 76  CYS B SG  1 
ATOM   3037 N  N   . ASP B 1 81  ? 14.419 -35.936 -0.065  1.00 60.32  ? 77  ASP B N   1 
ATOM   3038 C  CA  . ASP B 1 81  ? 14.177 -36.005 -1.503  1.00 63.21  ? 77  ASP B CA  1 
ATOM   3039 C  C   . ASP B 1 81  ? 15.411 -35.611 -2.318  1.00 63.62  ? 77  ASP B C   1 
ATOM   3040 O  O   . ASP B 1 81  ? 15.955 -36.425 -3.060  1.00 64.67  ? 77  ASP B O   1 
ATOM   3041 C  CB  . ASP B 1 81  ? 13.004 -35.095 -1.888  1.00 100.33 ? 77  ASP B CB  1 
ATOM   3042 C  CG  . ASP B 1 81  ? 13.135 -33.691 -1.307  1.00 103.63 ? 77  ASP B CG  1 
ATOM   3043 O  OD1 . ASP B 1 81  ? 13.076 -33.546 -0.064  1.00 104.29 ? 77  ASP B OD1 1 
ATOM   3044 O  OD2 . ASP B 1 81  ? 13.299 -32.732 -2.092  1.00 105.42 ? 77  ASP B OD2 1 
ATOM   3045 N  N   . SER B 1 82  ? 15.861 -34.368 -2.159  1.00 74.80  ? 78  SER B N   1 
ATOM   3046 C  CA  . SER B 1 82  ? 17.011 -33.852 -2.904  1.00 73.32  ? 78  SER B CA  1 
ATOM   3047 C  C   . SER B 1 82  ? 18.364 -33.944 -2.211  1.00 72.67  ? 78  SER B C   1 
ATOM   3048 O  O   . SER B 1 82  ? 19.386 -33.691 -2.831  1.00 72.67  ? 78  SER B O   1 
ATOM   3049 C  CB  . SER B 1 82  ? 16.762 -32.392 -3.303  1.00 89.91  ? 78  SER B CB  1 
ATOM   3050 O  OG  . SER B 1 82  ? 16.634 -31.545 -2.170  1.00 89.61  ? 78  SER B OG  1 
ATOM   3051 N  N   . GLY B 1 83  ? 18.381 -34.289 -0.933  1.00 61.72  ? 79  GLY B N   1 
ATOM   3052 C  CA  . GLY B 1 83  ? 19.650 -34.382 -0.229  1.00 59.87  ? 79  GLY B CA  1 
ATOM   3053 C  C   . GLY B 1 83  ? 20.347 -33.038 -0.056  1.00 58.91  ? 79  GLY B C   1 
ATOM   3054 O  O   . GLY B 1 83  ? 21.508 -32.973 0.358   1.00 58.91  ? 79  GLY B O   1 
ATOM   3055 N  N   . GLU B 1 84  ? 19.624 -31.964 -0.362  1.00 56.15  ? 80  GLU B N   1 
ATOM   3056 C  CA  . GLU B 1 84  ? 20.135 -30.600 -0.262  1.00 54.86  ? 80  GLU B CA  1 
ATOM   3057 C  C   . GLU B 1 84  ? 20.013 -30.007 1.149   1.00 52.90  ? 80  GLU B C   1 
ATOM   3058 O  O   . GLU B 1 84  ? 19.080 -30.321 1.890   1.00 50.63  ? 80  GLU B O   1 
ATOM   3059 C  CB  . GLU B 1 84  ? 19.401 -29.718 -1.276  1.00 68.63  ? 80  GLU B CB  1 
ATOM   3060 C  CG  . GLU B 1 84  ? 19.613 -28.237 -1.084  1.00 72.98  ? 80  GLU B CG  1 
ATOM   3061 C  CD  . GLU B 1 84  ? 19.201 -27.417 -2.301  1.00 76.71  ? 80  GLU B CD  1 
ATOM   3062 O  OE1 . GLU B 1 84  ? 18.096 -27.668 -2.847  1.00 78.01  ? 80  GLU B OE1 1 
ATOM   3063 O  OE2 . GLU B 1 84  ? 19.986 -26.517 -2.700  1.00 77.72  ? 80  GLU B OE2 1 
ATOM   3064 N  N   . LEU B 1 85  ? 20.975 -29.154 1.508   1.00 49.77  ? 81  LEU B N   1 
ATOM   3065 C  CA  . LEU B 1 85  ? 21.009 -28.497 2.815   1.00 47.27  ? 81  LEU B CA  1 
ATOM   3066 C  C   . LEU B 1 85  ? 20.162 -27.233 2.856   1.00 43.79  ? 81  LEU B C   1 
ATOM   3067 O  O   . LEU B 1 85  ? 20.203 -26.408 1.935   1.00 42.98  ? 81  LEU B O   1 
ATOM   3068 C  CB  . LEU B 1 85  ? 22.436 -28.109 3.195   1.00 49.22  ? 81  LEU B CB  1 
ATOM   3069 C  CG  . LEU B 1 85  ? 23.482 -29.138 3.599   1.00 50.98  ? 81  LEU B CG  1 
ATOM   3070 C  CD1 . LEU B 1 85  ? 24.426 -28.454 4.565   1.00 52.41  ? 81  LEU B CD1 1 
ATOM   3071 C  CD2 . LEU B 1 85  ? 22.849 -30.321 4.291   1.00 49.71  ? 81  LEU B CD2 1 
ATOM   3072 N  N   . VAL B 1 86  ? 19.417 -27.079 3.945   1.00 36.07  ? 82  VAL B N   1 
ATOM   3073 C  CA  . VAL B 1 86  ? 18.545 -25.926 4.134   1.00 34.31  ? 82  VAL B CA  1 
ATOM   3074 C  C   . VAL B 1 86  ? 18.620 -25.463 5.568   1.00 33.66  ? 82  VAL B C   1 
ATOM   3075 O  O   . VAL B 1 86  ? 19.100 -26.184 6.449   1.00 33.28  ? 82  VAL B O   1 
ATOM   3076 C  CB  . VAL B 1 86  ? 17.068 -26.275 3.861   1.00 30.84  ? 82  VAL B CB  1 
ATOM   3077 C  CG1 . VAL B 1 86  ? 16.837 -26.485 2.372   1.00 27.73  ? 82  VAL B CG1 1 
ATOM   3078 C  CG2 . VAL B 1 86  ? 16.694 -27.534 4.646   1.00 29.96  ? 82  VAL B CG2 1 
ATOM   3079 N  N   . ALA B 1 87  ? 18.136 -24.255 5.805   1.00 35.54  ? 83  ALA B N   1 
ATOM   3080 C  CA  . ALA B 1 87  ? 18.117 -23.724 7.151   1.00 36.53  ? 83  ALA B CA  1 
ATOM   3081 C  C   . ALA B 1 87  ? 16.660 -23.597 7.554   1.00 36.62  ? 83  ALA B C   1 
ATOM   3082 O  O   . ALA B 1 87  ? 15.790 -23.398 6.712   1.00 37.49  ? 83  ALA B O   1 
ATOM   3083 C  CB  . ALA B 1 87  ? 18.788 -22.371 7.196   1.00 25.59  ? 83  ALA B CB  1 
ATOM   3084 N  N   . ILE B 1 88  ? 16.394 -23.711 8.845   1.00 31.82  ? 84  ILE B N   1 
ATOM   3085 C  CA  . ILE B 1 88  ? 15.041 -23.604 9.344   1.00 31.92  ? 84  ILE B CA  1 
ATOM   3086 C  C   . ILE B 1 88  ? 14.989 -22.621 10.491  1.00 32.33  ? 84  ILE B C   1 
ATOM   3087 O  O   . ILE B 1 88  ? 15.484 -22.930 11.566  1.00 33.66  ? 84  ILE B O   1 
ATOM   3088 C  CB  . ILE B 1 88  ? 14.530 -24.978 9.852   1.00 26.37  ? 84  ILE B CB  1 
ATOM   3089 C  CG1 . ILE B 1 88  ? 14.628 -26.007 8.719   1.00 25.53  ? 84  ILE B CG1 1 
ATOM   3090 C  CG2 . ILE B 1 88  ? 13.086 -24.855 10.369  1.00 25.70  ? 84  ILE B CG2 1 
ATOM   3091 C  CD1 . ILE B 1 88  ? 13.968 -27.323 9.052   1.00 27.34  ? 84  ILE B CD1 1 
ATOM   3092 N  N   . LYS B 1 89  ? 14.416 -21.436 10.270  1.00 36.13  ? 85  LYS B N   1 
ATOM   3093 C  CA  . LYS B 1 89  ? 14.275 -20.462 11.354  1.00 36.60  ? 85  LYS B CA  1 
ATOM   3094 C  C   . LYS B 1 89  ? 12.981 -20.848 12.065  1.00 38.76  ? 85  LYS B C   1 
ATOM   3095 O  O   . LYS B 1 89  ? 12.032 -21.264 11.423  1.00 36.62  ? 85  LYS B O   1 
ATOM   3096 C  CB  . LYS B 1 89  ? 14.165 -19.048 10.809  1.00 45.95  ? 85  LYS B CB  1 
ATOM   3097 C  CG  . LYS B 1 89  ? 13.930 -18.014 11.871  1.00 47.24  ? 85  LYS B CG  1 
ATOM   3098 C  CD  . LYS B 1 89  ? 13.826 -16.639 11.247  1.00 48.80  ? 85  LYS B CD  1 
ATOM   3099 C  CE  . LYS B 1 89  ? 13.681 -15.546 12.312  1.00 51.07  ? 85  LYS B CE  1 
ATOM   3100 N  NZ  . LYS B 1 89  ? 13.794 -14.167 11.727  1.00 52.18  ? 85  LYS B NZ  1 
ATOM   3101 N  N   . LYS B 1 90  ? 12.925 -20.720 13.381  1.00 38.97  ? 86  LYS B N   1 
ATOM   3102 C  CA  . LYS B 1 90  ? 11.719 -21.113 14.111  1.00 41.55  ? 86  LYS B CA  1 
ATOM   3103 C  C   . LYS B 1 90  ? 11.337 -20.106 15.184  1.00 42.72  ? 86  LYS B C   1 
ATOM   3104 O  O   . LYS B 1 90  ? 12.123 -19.834 16.066  1.00 43.99  ? 86  LYS B O   1 
ATOM   3105 C  CB  . LYS B 1 90  ? 11.975 -22.481 14.712  1.00 36.06  ? 86  LYS B CB  1 
ATOM   3106 C  CG  . LYS B 1 90  ? 11.077 -22.899 15.814  1.00 38.75  ? 86  LYS B CG  1 
ATOM   3107 C  CD  . LYS B 1 90  ? 11.463 -24.318 16.161  1.00 39.42  ? 86  LYS B CD  1 
ATOM   3108 C  CE  . LYS B 1 90  ? 10.498 -24.952 17.139  1.00 39.92  ? 86  LYS B CE  1 
ATOM   3109 N  NZ  . LYS B 1 90  ? 10.690 -26.432 17.106  1.00 41.77  ? 86  LYS B NZ  1 
ATOM   3110 N  N   . VAL B 1 91  ? 10.134 -19.548 15.108  1.00 40.23  ? 87  VAL B N   1 
ATOM   3111 C  CA  . VAL B 1 91  ? 9.706  -18.544 16.088  1.00 42.30  ? 87  VAL B CA  1 
ATOM   3112 C  C   . VAL B 1 91  ? 8.319  -18.828 16.670  1.00 44.09  ? 87  VAL B C   1 
ATOM   3113 O  O   . VAL B 1 91  ? 7.470  -19.439 16.019  1.00 43.12  ? 87  VAL B O   1 
ATOM   3114 C  CB  . VAL B 1 91  ? 9.675  -17.114 15.467  1.00 40.56  ? 87  VAL B CB  1 
ATOM   3115 C  CG1 . VAL B 1 91  ? 10.981 -16.800 14.746  1.00 40.29  ? 87  VAL B CG1 1 
ATOM   3116 C  CG2 . VAL B 1 91  ? 8.545  -16.999 14.508  1.00 39.92  ? 87  VAL B CG2 1 
ATOM   3117 N  N   . LEU B 1 92  ? 8.088  -18.378 17.898  1.00 47.91  ? 88  LEU B N   1 
ATOM   3118 C  CA  . LEU B 1 92  ? 6.799  -18.576 18.557  1.00 51.70  ? 88  LEU B CA  1 
ATOM   3119 C  C   . LEU B 1 92  ? 5.755  -17.784 17.792  1.00 53.60  ? 88  LEU B C   1 
ATOM   3120 O  O   . LEU B 1 92  ? 6.036  -16.675 17.358  1.00 54.08  ? 88  LEU B O   1 
ATOM   3121 C  CB  . LEU B 1 92  ? 6.874  -18.062 19.976  1.00 49.84  ? 88  LEU B CB  1 
ATOM   3122 C  CG  . LEU B 1 92  ? 6.141  -18.903 21.009  1.00 52.33  ? 88  LEU B CG  1 
ATOM   3123 C  CD1 . LEU B 1 92  ? 6.507  -20.404 20.856  1.00 52.16  ? 88  LEU B CD1 1 
ATOM   3124 C  CD2 . LEU B 1 92  ? 6.511  -18.376 22.388  1.00 52.53  ? 88  LEU B CD2 1 
ATOM   3125 N  N   . GLN B 1 93  ? 4.553  -18.328 17.632  1.00 63.49  ? 89  GLN B N   1 
ATOM   3126 C  CA  . GLN B 1 93  ? 3.533  -17.610 16.876  1.00 66.91  ? 89  GLN B CA  1 
ATOM   3127 C  C   . GLN B 1 93  ? 2.287  -17.142 17.634  1.00 68.90  ? 89  GLN B C   1 
ATOM   3128 O  O   . GLN B 1 93  ? 1.584  -17.935 18.268  1.00 69.67  ? 89  GLN B O   1 
ATOM   3129 C  CB  . GLN B 1 93  ? 3.090  -18.443 15.674  1.00 87.10  ? 89  GLN B CB  1 
ATOM   3130 C  CG  . GLN B 1 93  ? 2.151  -17.692 14.732  1.00 86.33  ? 89  GLN B CG  1 
ATOM   3131 C  CD  . GLN B 1 93  ? 2.839  -16.550 13.998  1.00 87.60  ? 89  GLN B CD  1 
ATOM   3132 O  OE1 . GLN B 1 93  ? 3.500  -15.703 14.614  1.00 85.05  ? 89  GLN B OE1 1 
ATOM   3133 N  NE2 . GLN B 1 93  ? 2.680  -16.519 12.671  1.00 86.33  ? 89  GLN B NE2 1 
ATOM   3134 N  N   . ASP B 1 94  ? 2.028  -15.838 17.524  1.00 87.92  ? 90  ASP B N   1 
ATOM   3135 C  CA  . ASP B 1 94  ? 0.892  -15.140 18.125  1.00 90.65  ? 90  ASP B CA  1 
ATOM   3136 C  C   . ASP B 1 94  ? -0.430 -15.873 17.977  1.00 93.10  ? 90  ASP B C   1 
ATOM   3137 O  O   . ASP B 1 94  ? -1.230 -15.940 18.916  1.00 92.69  ? 90  ASP B O   1 
ATOM   3138 C  CB  . ASP B 1 94  ? 0.726  -13.788 17.448  1.00 111.47 ? 90  ASP B CB  1 
ATOM   3139 C  CG  . ASP B 1 94  ? 1.235  -12.595 18.327  1.00 111.47 ? 90  ASP B CG  1 
ATOM   3140 O  OD1 . ASP B 1 94  ? 0.807  -12.540 19.551  1.00 111.47 ? 90  ASP B OD1 1 
ATOM   3141 O  OD2 . ASP B 1 94  ? 2.033  -11.712 17.780  1.00 111.47 ? 90  ASP B OD2 1 
ATOM   3142 N  N   . LYS B 1 95  ? -0.662 -16.361 16.762  1.00 104.66 ? 91  LYS B N   1 
ATOM   3143 C  CA  . LYS B 1 95  ? -1.863 -17.092 16.378  1.00 106.31 ? 91  LYS B CA  1 
ATOM   3144 C  C   . LYS B 1 95  ? -3.103 -16.271 16.086  1.00 106.13 ? 91  LYS B C   1 
ATOM   3145 O  O   . LYS B 1 95  ? -3.923 -16.685 15.272  1.00 105.86 ? 91  LYS B O   1 
ATOM   3146 C  CB  . LYS B 1 95  ? -2.181 -18.203 17.374  1.00 110.70 ? 91  LYS B CB  1 
ATOM   3147 C  CG  . LYS B 1 95  ? -1.778 -19.555 16.807  1.00 113.26 ? 91  LYS B CG  1 
ATOM   3148 C  CD  . LYS B 1 95  ? -2.425 -19.752 15.426  1.00 114.74 ? 91  LYS B CD  1 
ATOM   3149 C  CE  . LYS B 1 95  ? -1.676 -20.772 14.561  1.00 115.07 ? 91  LYS B CE  1 
ATOM   3150 N  NZ  . LYS B 1 95  ? -0.416 -20.184 13.986  1.00 116.74 ? 91  LYS B NZ  1 
ATOM   3151 N  N   . ARG B 1 96  ? -3.275 -15.134 16.748  1.00 112.01 ? 92  ARG B N   1 
ATOM   3152 C  CA  . ARG B 1 96  ? -4.415 -14.280 16.431  1.00 111.92 ? 92  ARG B CA  1 
ATOM   3153 C  C   . ARG B 1 96  ? -3.792 -13.045 15.793  1.00 111.66 ? 92  ARG B C   1 
ATOM   3154 O  O   . ARG B 1 96  ? -4.304 -11.927 15.910  1.00 112.60 ? 92  ARG B O   1 
ATOM   3155 C  CB  . ARG B 1 96  ? -5.217 -13.893 17.682  1.00 200.42 ? 92  ARG B CB  1 
ATOM   3156 C  CG  . ARG B 1 96  ? -6.288 -14.919 18.138  1.00 121.01 ? 92  ARG B CG  1 
ATOM   3157 C  CD  . ARG B 1 96  ? -7.589 -15.004 17.194  1.00 121.01 ? 92  ARG B CD  1 
ATOM   3158 N  NE  . ARG B 1 96  ? -7.642 -16.306 16.462  1.00 121.01 ? 92  ARG B NE  1 
ATOM   3159 C  CZ  . ARG B 1 96  ? -8.763 -16.874 15.972  1.00 121.01 ? 92  ARG B CZ  1 
ATOM   3160 N  NH1 . ARG B 1 96  ? -9.984 -16.274 16.117  1.00 121.01 ? 92  ARG B NH1 1 
ATOM   3161 N  NH2 . ARG B 1 96  ? -8.674 -18.063 15.336  1.00 121.01 ? 92  ARG B NH2 1 
ATOM   3162 N  N   . PHE B 1 97  ? -2.653 -13.273 15.138  1.00 97.77  ? 93  PHE B N   1 
ATOM   3163 C  CA  . PHE B 1 97  ? -1.898 -12.228 14.440  1.00 96.23  ? 93  PHE B CA  1 
ATOM   3164 C  C   . PHE B 1 97  ? -1.015 -12.843 13.339  1.00 93.48  ? 93  PHE B C   1 
ATOM   3165 O  O   . PHE B 1 97  ? -0.362 -13.876 13.543  1.00 93.09  ? 93  PHE B O   1 
ATOM   3166 C  CB  . PHE B 1 97  ? -1.012 -11.433 15.414  1.00 142.72 ? 93  PHE B CB  1 
ATOM   3167 C  CG  . PHE B 1 97  ? -1.744 -10.896 16.618  1.00 145.17 ? 93  PHE B CG  1 
ATOM   3168 C  CD1 . PHE B 1 97  ? -1.936 -11.693 17.745  1.00 146.09 ? 93  PHE B CD1 1 
ATOM   3169 C  CD2 . PHE B 1 97  ? -2.244 -9.599  16.625  1.00 146.11 ? 93  PHE B CD2 1 
ATOM   3170 C  CE1 . PHE B 1 97  ? -2.612 -11.212 18.859  1.00 146.98 ? 93  PHE B CE1 1 
ATOM   3171 C  CE2 . PHE B 1 97  ? -2.925 -9.104  17.738  1.00 146.35 ? 93  PHE B CE2 1 
ATOM   3172 C  CZ  . PHE B 1 97  ? -3.108 -9.913  18.856  1.00 146.83 ? 93  PHE B CZ  1 
ATOM   3173 N  N   . LYS B 1 98  ? -1.011 -12.202 12.171  1.00 70.74  ? 94  LYS B N   1 
ATOM   3174 C  CA  . LYS B 1 98  ? -0.223 -12.662 11.027  1.00 68.45  ? 94  LYS B CA  1 
ATOM   3175 C  C   . LYS B 1 98  ? 1.240  -12.276 11.212  1.00 63.94  ? 94  LYS B C   1 
ATOM   3176 O  O   . LYS B 1 98  ? 1.538  -11.124 11.540  1.00 62.63  ? 94  LYS B O   1 
ATOM   3177 C  CB  . LYS B 1 98  ? -0.755 -12.041 9.733   1.00 113.74 ? 94  LYS B CB  1 
ATOM   3178 C  CG  . LYS B 1 98  ? -2.061 -12.644 9.233   1.00 119.30 ? 94  LYS B CG  1 
ATOM   3179 C  CD  . LYS B 1 98  ? -1.885 -14.114 8.876   1.00 122.49 ? 94  LYS B CD  1 
ATOM   3180 C  CE  . LYS B 1 98  ? -3.167 -14.708 8.311   1.00 124.44 ? 94  LYS B CE  1 
ATOM   3181 N  NZ  . LYS B 1 98  ? -3.003 -16.150 7.960   1.00 126.60 ? 94  LYS B NZ  1 
ATOM   3182 N  N   . ASN B 1 99  ? 2.142  -13.236 10.994  1.00 50.51  ? 95  ASN B N   1 
ATOM   3183 C  CA  . ASN B 1 99  ? 3.579  -13.006 11.149  1.00 45.52  ? 95  ASN B CA  1 
ATOM   3184 C  C   . ASN B 1 99  ? 4.099  -12.136 10.027  1.00 43.04  ? 95  ASN B C   1 
ATOM   3185 O  O   . ASN B 1 99  ? 4.017  -12.519 8.858   1.00 40.66  ? 95  ASN B O   1 
ATOM   3186 C  CB  . ASN B 1 99  ? 4.337  -14.325 11.151  1.00 36.22  ? 95  ASN B CB  1 
ATOM   3187 C  CG  . ASN B 1 99  ? 5.806  -14.142 11.482  1.00 34.91  ? 95  ASN B CG  1 
ATOM   3188 O  OD1 . ASN B 1 99  ? 6.547  -13.521 10.719  1.00 33.14  ? 95  ASN B OD1 1 
ATOM   3189 N  ND2 . ASN B 1 99  ? 6.232  -14.669 12.633  1.00 31.89  ? 95  ASN B ND2 1 
ATOM   3190 N  N   . ARG B 1 100 ? 4.660  -10.978 10.381  1.00 49.25  ? 96  ARG B N   1 
ATOM   3191 C  CA  . ARG B 1 100 ? 5.141  -10.032 9.378   1.00 48.16  ? 96  ARG B CA  1 
ATOM   3192 C  C   . ARG B 1 100 ? 6.337  -10.478 8.536   1.00 46.25  ? 96  ARG B C   1 
ATOM   3193 O  O   . ARG B 1 100 ? 6.428  -10.117 7.353   1.00 45.78  ? 96  ARG B O   1 
ATOM   3194 C  CB  . ARG B 1 100 ? 5.446  -8.680  10.021  1.00 63.33  ? 96  ARG B CB  1 
ATOM   3195 C  CG  . ARG B 1 100 ? 5.788  -7.624  8.997   1.00 68.01  ? 96  ARG B CG  1 
ATOM   3196 C  CD  . ARG B 1 100 ? 6.415  -6.405  9.638   1.00 71.93  ? 96  ARG B CD  1 
ATOM   3197 N  NE  . ARG B 1 100 ? 5.430  -5.455  10.144  1.00 75.80  ? 96  ARG B NE  1 
ATOM   3198 C  CZ  . ARG B 1 100 ? 5.703  -4.534  11.065  1.00 77.19  ? 96  ARG B CZ  1 
ATOM   3199 N  NH1 . ARG B 1 100 ? 6.928  -4.455  11.575  1.00 77.51  ? 96  ARG B NH1 1 
ATOM   3200 N  NH2 . ARG B 1 100 ? 4.760  -3.689  11.470  1.00 78.27  ? 96  ARG B NH2 1 
ATOM   3201 N  N   . GLU B 1 101 ? 7.260  -11.237 9.128   1.00 45.59  ? 97  GLU B N   1 
ATOM   3202 C  CA  . GLU B 1 101 ? 8.414  -11.697 8.372   1.00 44.09  ? 97  GLU B CA  1 
ATOM   3203 C  C   . GLU B 1 101 ? 7.941  -12.683 7.293   1.00 42.12  ? 97  GLU B C   1 
ATOM   3204 O  O   . GLU B 1 101 ? 8.391  -12.625 6.141   1.00 39.33  ? 97  GLU B O   1 
ATOM   3205 C  CB  . GLU B 1 101 ? 9.439  -12.345 9.303   1.00 56.60  ? 97  GLU B CB  1 
ATOM   3206 C  CG  . GLU B 1 101 ? 10.627 -12.977 8.592   1.00 59.39  ? 97  GLU B CG  1 
ATOM   3207 C  CD  . GLU B 1 101 ? 11.704 -13.456 9.558   1.00 61.01  ? 97  GLU B CD  1 
ATOM   3208 O  OE1 . GLU B 1 101 ? 11.349 -13.873 10.688  1.00 61.44  ? 97  GLU B OE1 1 
ATOM   3209 O  OE2 . GLU B 1 101 ? 12.904 -13.428 9.183   1.00 65.23  ? 97  GLU B OE2 1 
ATOM   3210 N  N   . LEU B 1 102 ? 7.007  -13.560 7.654   1.00 39.61  ? 98  LEU B N   1 
ATOM   3211 C  CA  . LEU B 1 102 ? 6.483  -14.526 6.696   1.00 39.73  ? 98  LEU B CA  1 
ATOM   3212 C  C   . LEU B 1 102 ? 5.789  -13.856 5.517   1.00 40.50  ? 98  LEU B C   1 
ATOM   3213 O  O   . LEU B 1 102 ? 5.939  -14.288 4.375   1.00 39.29  ? 98  LEU B O   1 
ATOM   3214 C  CB  . LEU B 1 102 ? 5.487  -15.466 7.361   1.00 23.36  ? 98  LEU B CB  1 
ATOM   3215 C  CG  . LEU B 1 102 ? 4.738  -16.388 6.390   1.00 26.81  ? 98  LEU B CG  1 
ATOM   3216 C  CD1 . LEU B 1 102 ? 5.749  -17.175 5.582   1.00 26.37  ? 98  LEU B CD1 1 
ATOM   3217 C  CD2 . LEU B 1 102 ? 3.835  -17.336 7.145   1.00 28.18  ? 98  LEU B CD2 1 
ATOM   3218 N  N   . GLN B 1 103 ? 5.018  -12.806 5.789   1.00 37.77  ? 99  GLN B N   1 
ATOM   3219 C  CA  . GLN B 1 103 ? 4.314  -12.126 4.710   1.00 39.67  ? 99  GLN B CA  1 
ATOM   3220 C  C   . GLN B 1 103 ? 5.271  -11.430 3.753   1.00 38.58  ? 99  GLN B C   1 
ATOM   3221 O  O   . GLN B 1 103 ? 5.073  -11.452 2.536   1.00 35.61  ? 99  GLN B O   1 
ATOM   3222 C  CB  . GLN B 1 103 ? 3.272  -11.153 5.274   1.00 72.92  ? 99  GLN B CB  1 
ATOM   3223 C  CG  . GLN B 1 103 ? 2.144  -11.871 6.033   1.00 79.81  ? 99  GLN B CG  1 
ATOM   3224 C  CD  . GLN B 1 103 ? 1.672  -13.173 5.346   1.00 84.28  ? 99  GLN B CD  1 
ATOM   3225 O  OE1 . GLN B 1 103 ? 1.281  -13.177 4.169   1.00 86.32  ? 99  GLN B OE1 1 
ATOM   3226 N  NE2 . GLN B 1 103 ? 1.708  -14.277 6.088   1.00 86.02  ? 99  GLN B NE2 1 
ATOM   3227 N  N   . ILE B 1 104 ? 6.322  -10.832 4.294   1.00 42.32  ? 100 ILE B N   1 
ATOM   3228 C  CA  . ILE B 1 104 ? 7.298  -10.165 3.453   1.00 42.07  ? 100 ILE B CA  1 
ATOM   3229 C  C   . ILE B 1 104 ? 8.098  -11.205 2.664   1.00 41.32  ? 100 ILE B C   1 
ATOM   3230 O  O   . ILE B 1 104 ? 8.398  -11.009 1.495   1.00 39.33  ? 100 ILE B O   1 
ATOM   3231 C  CB  . ILE B 1 104 ? 8.236  -9.273  4.311   1.00 32.85  ? 100 ILE B CB  1 
ATOM   3232 C  CG1 . ILE B 1 104 ? 7.536  -7.939  4.596   1.00 30.80  ? 100 ILE B CG1 1 
ATOM   3233 C  CG2 . ILE B 1 104 ? 9.569  -9.037  3.603   1.00 30.50  ? 100 ILE B CG2 1 
ATOM   3234 C  CD1 . ILE B 1 104 ? 8.129  -7.121  5.723   1.00 31.13  ? 100 ILE B CD1 1 
ATOM   3235 N  N   . MET B 1 105 ? 8.410  -12.336 3.278   1.00 41.15  ? 101 MET B N   1 
ATOM   3236 C  CA  . MET B 1 105 ? 9.191  -13.341 2.570   1.00 41.98  ? 101 MET B CA  1 
ATOM   3237 C  C   . MET B 1 105 ? 8.494  -14.041 1.407   1.00 43.26  ? 101 MET B C   1 
ATOM   3238 O  O   . MET B 1 105 ? 9.106  -14.243 0.360   1.00 41.23  ? 101 MET B O   1 
ATOM   3239 C  CB  . MET B 1 105 ? 9.708  -14.375 3.555   1.00 51.13  ? 101 MET B CB  1 
ATOM   3240 C  CG  . MET B 1 105 ? 10.668 -13.777 4.565   1.00 57.30  ? 101 MET B CG  1 
ATOM   3241 S  SD  . MET B 1 105 ? 12.308 -14.422 4.378   1.00 64.53  ? 101 MET B SD  1 
ATOM   3242 C  CE  . MET B 1 105 ? 12.873 -13.392 3.067   1.00 58.33  ? 101 MET B CE  1 
ATOM   3243 N  N   . ARG B 1 106 ? 7.228  -14.416 1.594   1.00 41.79  ? 102 ARG B N   1 
ATOM   3244 C  CA  . ARG B 1 106 ? 6.449  -15.098 0.562   1.00 43.38  ? 102 ARG B CA  1 
ATOM   3245 C  C   . ARG B 1 106 ? 6.368  -14.273 -0.701  1.00 44.46  ? 102 ARG B C   1 
ATOM   3246 O  O   . ARG B 1 106 ? 6.018  -14.781 -1.752  1.00 44.66  ? 102 ARG B O   1 
ATOM   3247 C  CB  . ARG B 1 106 ? 5.018  -15.327 1.022   1.00 42.93  ? 102 ARG B CB  1 
ATOM   3248 C  CG  . ARG B 1 106 ? 4.850  -16.111 2.282   1.00 46.73  ? 102 ARG B CG  1 
ATOM   3249 C  CD  . ARG B 1 106 ? 3.434  -16.659 2.351   1.00 50.04  ? 102 ARG B CD  1 
ATOM   3250 N  NE  . ARG B 1 106 ? 3.136  -17.496 1.192   1.00 53.80  ? 102 ARG B NE  1 
ATOM   3251 C  CZ  . ARG B 1 106 ? 2.013  -18.193 1.036   1.00 53.13  ? 102 ARG B CZ  1 
ATOM   3252 N  NH1 . ARG B 1 106 ? 1.075  -18.153 1.977   1.00 51.37  ? 102 ARG B NH1 1 
ATOM   3253 N  NH2 . ARG B 1 106 ? 1.833  -18.933 -0.060  1.00 54.93  ? 102 ARG B NH2 1 
ATOM   3254 N  N   . LYS B 1 107 ? 6.696  -12.995 -0.583  1.00 39.26  ? 103 LYS B N   1 
ATOM   3255 C  CA  . LYS B 1 107 ? 6.610  -12.050 -1.683  1.00 41.30  ? 103 LYS B CA  1 
ATOM   3256 C  C   . LYS B 1 107 ? 7.920  -11.712 -2.413  1.00 40.41  ? 103 LYS B C   1 
ATOM   3257 O  O   . LYS B 1 107 ? 7.917  -10.933 -3.371  1.00 41.01  ? 103 LYS B O   1 
ATOM   3258 C  CB  . LYS B 1 107 ? 5.965  -10.781 -1.122  1.00 48.78  ? 103 LYS B CB  1 
ATOM   3259 C  CG  . LYS B 1 107 ? 6.011  -9.561  -1.994  1.00 54.86  ? 103 LYS B CG  1 
ATOM   3260 C  CD  . LYS B 1 107 ? 5.691  -8.295  -1.178  1.00 59.37  ? 103 LYS B CD  1 
ATOM   3261 C  CE  . LYS B 1 107 ? 4.288  -8.331  -0.542  1.00 61.44  ? 103 LYS B CE  1 
ATOM   3262 N  NZ  . LYS B 1 107 ? 3.945  -7.041  0.142   1.00 63.12  ? 103 LYS B NZ  1 
ATOM   3263 N  N   . LEU B 1 108 ? 9.034  -12.308 -1.989  1.00 47.65  ? 104 LEU B N   1 
ATOM   3264 C  CA  . LEU B 1 108 ? 10.347 -12.015 -2.583  1.00 46.01  ? 104 LEU B CA  1 
ATOM   3265 C  C   . LEU B 1 108 ? 10.984 -13.168 -3.344  1.00 44.45  ? 104 LEU B C   1 
ATOM   3266 O  O   . LEU B 1 108 ? 10.910 -14.321 -2.924  1.00 43.68  ? 104 LEU B O   1 
ATOM   3267 C  CB  . LEU B 1 108 ? 11.328 -11.592 -1.483  1.00 33.34  ? 104 LEU B CB  1 
ATOM   3268 C  CG  . LEU B 1 108 ? 10.851 -10.551 -0.469  1.00 35.12  ? 104 LEU B CG  1 
ATOM   3269 C  CD1 . LEU B 1 108 ? 11.907 -10.353 0.609   1.00 34.69  ? 104 LEU B CD1 1 
ATOM   3270 C  CD2 . LEU B 1 108 ? 10.543 -9.237  -1.187  1.00 34.58  ? 104 LEU B CD2 1 
ATOM   3271 N  N   . ASP B 1 109 ? 11.616 -12.850 -4.465  1.00 33.75  ? 105 ASP B N   1 
ATOM   3272 C  CA  . ASP B 1 109 ? 12.323 -13.854 -5.252  1.00 34.75  ? 105 ASP B CA  1 
ATOM   3273 C  C   . ASP B 1 109 ? 13.488 -13.191 -5.973  1.00 32.33  ? 105 ASP B C   1 
ATOM   3274 O  O   . ASP B 1 109 ? 13.338 -12.668 -7.086  1.00 32.48  ? 105 ASP B O   1 
ATOM   3275 C  CB  . ASP B 1 109 ? 11.430 -14.513 -6.292  1.00 60.17  ? 105 ASP B CB  1 
ATOM   3276 C  CG  . ASP B 1 109 ? 12.124 -15.674 -6.989  1.00 64.60  ? 105 ASP B CG  1 
ATOM   3277 O  OD1 . ASP B 1 109 ? 11.836 -15.906 -8.184  1.00 68.22  ? 105 ASP B OD1 1 
ATOM   3278 O  OD2 . ASP B 1 109 ? 12.953 -16.354 -6.336  1.00 68.14  ? 105 ASP B OD2 1 
ATOM   3279 N  N   . HIS B 1 110 ? 14.653 -13.221 -5.337  1.00 46.42  ? 106 HIS B N   1 
ATOM   3280 C  CA  . HIS B 1 110 ? 15.826 -12.594 -5.915  1.00 42.71  ? 106 HIS B CA  1 
ATOM   3281 C  C   . HIS B 1 110 ? 17.061 -13.433 -5.620  1.00 42.00  ? 106 HIS B C   1 
ATOM   3282 O  O   . HIS B 1 110 ? 17.193 -14.008 -4.546  1.00 39.09  ? 106 HIS B O   1 
ATOM   3283 C  CB  . HIS B 1 110 ? 15.957 -11.181 -5.347  1.00 40.47  ? 106 HIS B CB  1 
ATOM   3284 C  CG  . HIS B 1 110 ? 16.938 -10.323 -6.075  1.00 41.96  ? 106 HIS B CG  1 
ATOM   3285 N  ND1 . HIS B 1 110 ? 18.302 -10.451 -5.918  1.00 43.14  ? 106 HIS B ND1 1 
ATOM   3286 C  CD2 . HIS B 1 110 ? 16.754 -9.311  -6.955  1.00 40.52  ? 106 HIS B CD2 1 
ATOM   3287 C  CE1 . HIS B 1 110 ? 18.914 -9.551  -6.668  1.00 41.98  ? 106 HIS B CE1 1 
ATOM   3288 N  NE2 . HIS B 1 110 ? 17.998 -8.847  -7.307  1.00 43.15  ? 106 HIS B NE2 1 
ATOM   3289 N  N   . CYS B 1 111 ? 17.970 -13.502 -6.578  1.00 29.35  ? 107 CYS B N   1 
ATOM   3290 C  CA  . CYS B 1 111 ? 19.157 -14.306 -6.409  1.00 31.07  ? 107 CYS B CA  1 
ATOM   3291 C  C   . CYS B 1 111 ? 20.097 -13.861 -5.280  1.00 31.39  ? 107 CYS B C   1 
ATOM   3292 O  O   . CYS B 1 111 ? 20.944 -14.645 -4.838  1.00 32.16  ? 107 CYS B O   1 
ATOM   3293 C  CB  . CYS B 1 111 ? 19.895 -14.396 -7.740  1.00 39.23  ? 107 CYS B CB  1 
ATOM   3294 S  SG  . CYS B 1 111 ? 20.436 -12.836 -8.413  1.00 46.60  ? 107 CYS B SG  1 
ATOM   3295 N  N   . ASN B 1 112 ? 19.942 -12.625 -4.803  1.00 28.07  ? 108 ASN B N   1 
ATOM   3296 C  CA  . ASN B 1 112 ? 20.777 -12.122 -3.721  1.00 25.54  ? 108 ASN B CA  1 
ATOM   3297 C  C   . ASN B 1 112 ? 20.052 -12.029 -2.377  1.00 26.12  ? 108 ASN B C   1 
ATOM   3298 O  O   . ASN B 1 112 ? 20.464 -11.255 -1.489  1.00 24.92  ? 108 ASN B O   1 
ATOM   3299 C  CB  . ASN B 1 112 ? 21.345 -10.757 -4.079  1.00 33.10  ? 108 ASN B CB  1 
ATOM   3300 C  CG  . ASN B 1 112 ? 22.294 -10.819 -5.255  1.00 31.83  ? 108 ASN B CG  1 
ATOM   3301 O  OD1 . ASN B 1 112 ? 23.109 -11.727 -5.349  1.00 35.49  ? 108 ASN B OD1 1 
ATOM   3302 N  ND2 . ASN B 1 112 ? 22.204 -9.846  -6.154  1.00 29.82  ? 108 ASN B ND2 1 
ATOM   3303 N  N   . ILE B 1 113 ? 18.978 -12.813 -2.226  1.00 20.70  ? 109 ILE B N   1 
ATOM   3304 C  CA  . ILE B 1 113 ? 18.177 -12.838 -0.998  1.00 20.30  ? 109 ILE B CA  1 
ATOM   3305 C  C   . ILE B 1 113 ? 17.888 -14.286 -0.664  1.00 22.43  ? 109 ILE B C   1 
ATOM   3306 O  O   . ILE B 1 113 ? 17.512 -15.058 -1.534  1.00 23.13  ? 109 ILE B O   1 
ATOM   3307 C  CB  . ILE B 1 113 ? 16.817 -12.085 -1.176  1.00 23.85  ? 109 ILE B CB  1 
ATOM   3308 C  CG1 . ILE B 1 113 ? 17.078 -10.614 -1.484  1.00 25.27  ? 109 ILE B CG1 1 
ATOM   3309 C  CG2 . ILE B 1 113 ? 15.973 -12.171 0.099   1.00 23.26  ? 109 ILE B CG2 1 
ATOM   3310 C  CD1 . ILE B 1 113 ? 15.813 -9.791  -1.609  1.00 24.21  ? 109 ILE B CD1 1 
ATOM   3311 N  N   . VAL B 1 114 ? 18.079 -14.674 0.586   1.00 31.51  ? 110 VAL B N   1 
ATOM   3312 C  CA  . VAL B 1 114 ? 17.806 -16.059 0.947   1.00 33.27  ? 110 VAL B CA  1 
ATOM   3313 C  C   . VAL B 1 114 ? 16.336 -16.286 0.599   1.00 34.07  ? 110 VAL B C   1 
ATOM   3314 O  O   . VAL B 1 114 ? 15.512 -15.413 0.777   1.00 30.80  ? 110 VAL B O   1 
ATOM   3315 C  CB  . VAL B 1 114 ? 18.113 -16.321 2.444   1.00 39.69  ? 110 VAL B CB  1 
ATOM   3316 C  CG1 . VAL B 1 114 ? 17.460 -15.258 3.315   1.00 39.24  ? 110 VAL B CG1 1 
ATOM   3317 C  CG2 . VAL B 1 114 ? 17.621 -17.680 2.828   1.00 43.18  ? 110 VAL B CG2 1 
ATOM   3318 N  N   . ARG B 1 115 ? 16.011 -17.450 0.070   1.00 30.20  ? 111 ARG B N   1 
ATOM   3319 C  CA  . ARG B 1 115 ? 14.649 -17.724 -0.350  1.00 32.64  ? 111 ARG B CA  1 
ATOM   3320 C  C   . ARG B 1 115 ? 13.838 -18.516 0.632   1.00 30.98  ? 111 ARG B C   1 
ATOM   3321 O  O   . ARG B 1 115 ? 14.357 -19.412 1.279   1.00 30.59  ? 111 ARG B O   1 
ATOM   3322 C  CB  . ARG B 1 115 ? 14.673 -18.486 -1.671  1.00 40.63  ? 111 ARG B CB  1 
ATOM   3323 C  CG  . ARG B 1 115 ? 13.316 -18.652 -2.333  1.00 46.87  ? 111 ARG B CG  1 
ATOM   3324 C  CD  . ARG B 1 115 ? 13.466 -19.169 -3.756  1.00 50.30  ? 111 ARG B CD  1 
ATOM   3325 N  NE  . ARG B 1 115 ? 13.886 -20.571 -3.794  1.00 54.05  ? 111 ARG B NE  1 
ATOM   3326 C  CZ  . ARG B 1 115 ? 13.062 -21.602 -3.637  1.00 56.94  ? 111 ARG B CZ  1 
ATOM   3327 N  NH1 . ARG B 1 115 ? 11.767 -21.382 -3.433  1.00 55.21  ? 111 ARG B NH1 1 
ATOM   3328 N  NH2 . ARG B 1 115 ? 13.536 -22.845 -3.679  1.00 56.82  ? 111 ARG B NH2 1 
ATOM   3329 N  N   . LEU B 1 116 ? 12.555 -18.192 0.738   1.00 35.88  ? 112 LEU B N   1 
ATOM   3330 C  CA  . LEU B 1 116 ? 11.660 -18.942 1.610   1.00 35.73  ? 112 LEU B CA  1 
ATOM   3331 C  C   . LEU B 1 116 ? 11.182 -20.126 0.761   1.00 36.16  ? 112 LEU B C   1 
ATOM   3332 O  O   . LEU B 1 116 ? 10.503 -19.942 -0.236  1.00 35.55  ? 112 LEU B O   1 
ATOM   3333 C  CB  . LEU B 1 116 ? 10.476 -18.065 2.033   1.00 31.88  ? 112 LEU B CB  1 
ATOM   3334 C  CG  . LEU B 1 116 ? 9.430  -18.702 2.959   1.00 32.61  ? 112 LEU B CG  1 
ATOM   3335 C  CD1 . LEU B 1 116 ? 10.109 -19.281 4.199   1.00 31.24  ? 112 LEU B CD1 1 
ATOM   3336 C  CD2 . LEU B 1 116 ? 8.382  -17.659 3.334   1.00 32.57  ? 112 LEU B CD2 1 
ATOM   3337 N  N   . ARG B 1 117 ? 11.562 -21.340 1.127   1.00 33.67  ? 113 ARG B N   1 
ATOM   3338 C  CA  . ARG B 1 117 ? 11.150 -22.509 0.345   1.00 35.79  ? 113 ARG B CA  1 
ATOM   3339 C  C   . ARG B 1 117 ? 9.829  -23.068 0.824   1.00 34.80  ? 113 ARG B C   1 
ATOM   3340 O  O   . ARG B 1 117 ? 9.003  -23.471 0.021   1.00 34.19  ? 113 ARG B O   1 
ATOM   3341 C  CB  . ARG B 1 117 ? 12.206 -23.592 0.432   1.00 39.40  ? 113 ARG B CB  1 
ATOM   3342 C  CG  . ARG B 1 117 ? 13.542 -23.102 0.002   1.00 42.44  ? 113 ARG B CG  1 
ATOM   3343 C  CD  . ARG B 1 117 ? 14.525 -24.199 0.139   1.00 44.26  ? 113 ARG B CD  1 
ATOM   3344 N  NE  . ARG B 1 117 ? 15.744 -23.872 -0.572  1.00 46.82  ? 113 ARG B NE  1 
ATOM   3345 C  CZ  . ARG B 1 117 ? 16.484 -24.771 -1.206  1.00 49.27  ? 113 ARG B CZ  1 
ATOM   3346 N  NH1 . ARG B 1 117 ? 16.116 -26.050 -1.211  1.00 46.23  ? 113 ARG B NH1 1 
ATOM   3347 N  NH2 . ARG B 1 117 ? 17.587 -24.389 -1.831  1.00 48.93  ? 113 ARG B NH2 1 
ATOM   3348 N  N   . TYR B 1 118 ? 9.653  -23.111 2.141   1.00 40.66  ? 114 TYR B N   1 
ATOM   3349 C  CA  . TYR B 1 118 ? 8.418  -23.582 2.754   1.00 41.73  ? 114 TYR B CA  1 
ATOM   3350 C  C   . TYR B 1 118 ? 8.274  -22.930 4.111   1.00 42.84  ? 114 TYR B C   1 
ATOM   3351 O  O   . TYR B 1 118 ? 9.160  -22.215 4.576   1.00 41.15  ? 114 TYR B O   1 
ATOM   3352 C  CB  . TYR B 1 118 ? 8.432  -25.088 2.986   1.00 44.01  ? 114 TYR B CB  1 
ATOM   3353 C  CG  . TYR B 1 118 ? 8.776  -25.923 1.781   1.00 46.43  ? 114 TYR B CG  1 
ATOM   3354 C  CD1 . TYR B 1 118 ? 10.039 -26.486 1.652   1.00 48.97  ? 114 TYR B CD1 1 
ATOM   3355 C  CD2 . TYR B 1 118 ? 7.828  -26.210 0.799   1.00 48.66  ? 114 TYR B CD2 1 
ATOM   3356 C  CE1 . TYR B 1 118 ? 10.353 -27.320 0.594   1.00 50.59  ? 114 TYR B CE1 1 
ATOM   3357 C  CE2 . TYR B 1 118 ? 8.138  -27.044 -0.267  1.00 50.59  ? 114 TYR B CE2 1 
ATOM   3358 C  CZ  . TYR B 1 118 ? 9.408  -27.597 -0.358  1.00 51.96  ? 114 TYR B CZ  1 
ATOM   3359 O  OH  . TYR B 1 118 ? 9.754  -28.445 -1.390  1.00 54.63  ? 114 TYR B OH  1 
ATOM   3360 N  N   . PHE B 1 119 ? 7.140  -23.183 4.740   1.00 43.11  ? 115 PHE B N   1 
ATOM   3361 C  CA  . PHE B 1 119 ? 6.877  -22.699 6.081   1.00 42.90  ? 115 PHE B CA  1 
ATOM   3362 C  C   . PHE B 1 119 ? 5.752  -23.590 6.556   1.00 44.30  ? 115 PHE B C   1 
ATOM   3363 O  O   . PHE B 1 119 ? 4.864  -23.920 5.775   1.00 43.35  ? 115 PHE B O   1 
ATOM   3364 C  CB  . PHE B 1 119 ? 6.483  -21.222 6.086   1.00 44.57  ? 115 PHE B CB  1 
ATOM   3365 C  CG  . PHE B 1 119 ? 5.138  -20.938 5.494   1.00 45.79  ? 115 PHE B CG  1 
ATOM   3366 C  CD1 . PHE B 1 119 ? 4.001  -20.954 6.282   1.00 47.86  ? 115 PHE B CD1 1 
ATOM   3367 C  CD2 . PHE B 1 119 ? 5.011  -20.625 4.140   1.00 44.86  ? 115 PHE B CD2 1 
ATOM   3368 C  CE1 . PHE B 1 119 ? 2.765  -20.660 5.728   1.00 47.75  ? 115 PHE B CE1 1 
ATOM   3369 C  CE2 . PHE B 1 119 ? 3.771  -20.328 3.581   1.00 47.46  ? 115 PHE B CE2 1 
ATOM   3370 C  CZ  . PHE B 1 119 ? 2.652  -20.345 4.370   1.00 46.14  ? 115 PHE B CZ  1 
ATOM   3371 N  N   . PHE B 1 120 ? 5.822  -24.010 7.815   1.00 37.04  ? 116 PHE B N   1 
ATOM   3372 C  CA  . PHE B 1 120 ? 4.828  -24.895 8.397   1.00 40.82  ? 116 PHE B CA  1 
ATOM   3373 C  C   . PHE B 1 120 ? 4.758  -24.677 9.897   1.00 42.29  ? 116 PHE B C   1 
ATOM   3374 O  O   . PHE B 1 120 ? 5.662  -24.073 10.468  1.00 43.43  ? 116 PHE B O   1 
ATOM   3375 C  CB  . PHE B 1 120 ? 5.214  -26.338 8.104   1.00 45.20  ? 116 PHE B CB  1 
ATOM   3376 C  CG  . PHE B 1 120 ? 6.507  -26.758 8.731   1.00 45.17  ? 116 PHE B CG  1 
ATOM   3377 C  CD1 . PHE B 1 120 ? 6.581  -27.039 10.088  1.00 45.78  ? 116 PHE B CD1 1 
ATOM   3378 C  CD2 . PHE B 1 120 ? 7.656  -26.893 7.958   1.00 45.64  ? 116 PHE B CD2 1 
ATOM   3379 C  CE1 . PHE B 1 120 ? 7.786  -27.455 10.673  1.00 46.87  ? 116 PHE B CE1 1 
ATOM   3380 C  CE2 . PHE B 1 120 ? 8.865  -27.306 8.526   1.00 43.66  ? 116 PHE B CE2 1 
ATOM   3381 C  CZ  . PHE B 1 120 ? 8.931  -27.590 9.891   1.00 45.42  ? 116 PHE B CZ  1 
ATOM   3382 N  N   . TYR B 1 121 ? 3.701  -25.177 10.538  1.00 29.39  ? 117 TYR B N   1 
ATOM   3383 C  CA  . TYR B 1 121 ? 3.548  -25.013 11.984  1.00 30.23  ? 117 TYR B CA  1 
ATOM   3384 C  C   . TYR B 1 121 ? 3.840  -26.263 12.789  1.00 31.64  ? 117 TYR B C   1 
ATOM   3385 O  O   . TYR B 1 121 ? 3.593  -27.385 12.328  1.00 33.16  ? 117 TYR B O   1 
ATOM   3386 C  CB  . TYR B 1 121 ? 2.153  -24.519 12.313  1.00 41.47  ? 117 TYR B CB  1 
ATOM   3387 C  CG  . TYR B 1 121 ? 1.830  -23.242 11.608  1.00 41.72  ? 117 TYR B CG  1 
ATOM   3388 C  CD1 . TYR B 1 121 ? 1.340  -23.249 10.303  1.00 40.85  ? 117 TYR B CD1 1 
ATOM   3389 C  CD2 . TYR B 1 121 ? 2.067  -22.019 12.219  1.00 40.60  ? 117 TYR B CD2 1 
ATOM   3390 C  CE1 . TYR B 1 121 ? 1.096  -22.069 9.625   1.00 41.02  ? 117 TYR B CE1 1 
ATOM   3391 C  CE2 . TYR B 1 121 ? 1.828  -20.817 11.547  1.00 40.35  ? 117 TYR B CE2 1 
ATOM   3392 C  CZ  . TYR B 1 121 ? 1.346  -20.853 10.258  1.00 40.85  ? 117 TYR B CZ  1 
ATOM   3393 O  OH  . TYR B 1 121 ? 1.132  -19.675 9.597   1.00 40.60  ? 117 TYR B OH  1 
ATOM   3394 N  N   . SER B 1 122 ? 4.396  -26.062 13.982  1.00 46.61  ? 118 SER B N   1 
ATOM   3395 C  CA  . SER B 1 122 ? 4.732  -27.159 14.890  1.00 49.59  ? 118 SER B CA  1 
ATOM   3396 C  C   . SER B 1 122 ? 4.476  -26.704 16.331  1.00 52.21  ? 118 SER B C   1 
ATOM   3397 O  O   . SER B 1 122 ? 4.286  -25.512 16.590  1.00 53.20  ? 118 SER B O   1 
ATOM   3398 C  CB  . SER B 1 122 ? 6.194  -27.580 14.717  1.00 48.37  ? 118 SER B CB  1 
ATOM   3399 O  OG  . SER B 1 122 ? 7.080  -26.547 15.111  1.00 47.42  ? 118 SER B OG  1 
ATOM   3400 N  N   . SER B 1 123 ? 4.464  -27.641 17.271  1.00 77.88  ? 119 SER B N   1 
ATOM   3401 C  CA  . SER B 1 123 ? 4.193  -27.270 18.651  1.00 81.74  ? 119 SER B CA  1 
ATOM   3402 C  C   . SER B 1 123 ? 5.193  -27.820 19.659  1.00 82.72  ? 119 SER B C   1 
ATOM   3403 O  O   . SER B 1 123 ? 6.090  -28.586 19.301  1.00 84.34  ? 119 SER B O   1 
ATOM   3404 C  CB  . SER B 1 123 ? 2.766  -27.699 19.029  1.00 60.64  ? 119 SER B CB  1 
ATOM   3405 O  OG  . SER B 1 123 ? 2.527  -29.057 18.703  1.00 63.19  ? 119 SER B OG  1 
ATOM   3406 N  N   . GLY B 1 124 ? 5.026  -27.409 20.917  1.00 133.71 ? 120 GLY B N   1 
ATOM   3407 C  CA  . GLY B 1 124 ? 5.902  -27.852 21.986  1.00 138.36 ? 120 GLY B CA  1 
ATOM   3408 C  C   . GLY B 1 124 ? 5.294  -27.667 23.366  1.00 141.41 ? 120 GLY B C   1 
ATOM   3409 O  O   . GLY B 1 124 ? 4.093  -27.429 23.513  1.00 142.13 ? 120 GLY B O   1 
ATOM   3410 N  N   . ASP B 1 128 ? 1.224  -26.561 24.806  1.00 157.48 ? 124 ASP B N   1 
ATOM   3411 C  CA  . ASP B 1 128 ? 0.421  -25.848 23.815  1.00 155.46 ? 124 ASP B CA  1 
ATOM   3412 C  C   . ASP B 1 128 ? 1.299  -25.145 22.776  1.00 153.30 ? 124 ASP B C   1 
ATOM   3413 O  O   . ASP B 1 128 ? 1.492  -25.656 21.673  1.00 152.75 ? 124 ASP B O   1 
ATOM   3414 C  CB  . ASP B 1 128 ? -0.485 -24.831 24.514  1.00 109.19 ? 124 ASP B CB  1 
ATOM   3415 C  CG  . ASP B 1 128 ? -1.177 -23.895 23.538  1.00 110.15 ? 124 ASP B CG  1 
ATOM   3416 O  OD1 . ASP B 1 128 ? -0.505 -23.012 22.958  1.00 110.38 ? 124 ASP B OD1 1 
ATOM   3417 O  OD2 . ASP B 1 128 ? -2.399 -24.046 23.345  1.00 110.24 ? 124 ASP B OD2 1 
ATOM   3418 N  N   . GLU B 1 129 ? 1.804  -23.967 23.143  1.00 102.67 ? 125 GLU B N   1 
ATOM   3419 C  CA  . GLU B 1 129 ? 2.689  -23.141 22.314  1.00 98.95  ? 125 GLU B CA  1 
ATOM   3420 C  C   . GLU B 1 129 ? 2.817  -23.494 20.828  1.00 96.06  ? 125 GLU B C   1 
ATOM   3421 O  O   . GLU B 1 129 ? 3.236  -24.599 20.468  1.00 95.27  ? 125 GLU B O   1 
ATOM   3422 C  CB  . GLU B 1 129 ? 4.085  -23.120 22.954  1.00 122.54 ? 125 GLU B CB  1 
ATOM   3423 C  CG  . GLU B 1 129 ? 4.528  -24.478 23.508  1.00 123.75 ? 125 GLU B CG  1 
ATOM   3424 C  CD  . GLU B 1 129 ? 5.876  -24.429 24.209  1.00 124.93 ? 125 GLU B CD  1 
ATOM   3425 O  OE1 . GLU B 1 129 ? 6.106  -23.481 24.987  1.00 125.23 ? 125 GLU B OE1 1 
ATOM   3426 O  OE2 . GLU B 1 129 ? 6.699  -25.345 23.994  1.00 125.66 ? 125 GLU B OE2 1 
ATOM   3427 N  N   . VAL B 1 130 ? 2.483  -22.532 19.970  1.00 56.76  ? 126 VAL B N   1 
ATOM   3428 C  CA  . VAL B 1 130 ? 2.565  -22.728 18.520  1.00 57.21  ? 126 VAL B CA  1 
ATOM   3429 C  C   . VAL B 1 130 ? 3.802  -22.091 17.872  1.00 56.32  ? 126 VAL B C   1 
ATOM   3430 O  O   . VAL B 1 130 ? 4.070  -20.894 18.031  1.00 54.56  ? 126 VAL B O   1 
ATOM   3431 C  CB  . VAL B 1 130 ? 1.310  -22.166 17.813  1.00 68.54  ? 126 VAL B CB  1 
ATOM   3432 C  CG1 . VAL B 1 130 ? 1.448  -22.309 16.305  1.00 66.94  ? 126 VAL B CG1 1 
ATOM   3433 C  CG2 . VAL B 1 130 ? 0.080  -22.898 18.298  1.00 69.30  ? 126 VAL B CG2 1 
ATOM   3434 N  N   . TYR B 1 131 ? 4.539  -22.905 17.121  1.00 53.81  ? 127 TYR B N   1 
ATOM   3435 C  CA  . TYR B 1 131 ? 5.744  -22.450 16.429  1.00 53.04  ? 127 TYR B CA  1 
ATOM   3436 C  C   . TYR B 1 131 ? 5.633  -22.345 14.915  1.00 50.91  ? 127 TYR B C   1 
ATOM   3437 O  O   . TYR B 1 131 ? 5.129  -23.247 14.254  1.00 48.16  ? 127 TYR B O   1 
ATOM   3438 C  CB  . TYR B 1 131 ? 6.908  -23.383 16.717  1.00 72.42  ? 127 TYR B CB  1 
ATOM   3439 C  CG  . TYR B 1 131 ? 7.556  -23.181 18.045  1.00 75.46  ? 127 TYR B CG  1 
ATOM   3440 C  CD1 . TYR B 1 131 ? 7.374  -24.100 19.070  1.00 77.16  ? 127 TYR B CD1 1 
ATOM   3441 C  CD2 . TYR B 1 131 ? 8.389  -22.088 18.269  1.00 78.44  ? 127 TYR B CD2 1 
ATOM   3442 C  CE1 . TYR B 1 131 ? 8.009  -23.943 20.286  1.00 79.64  ? 127 TYR B CE1 1 
ATOM   3443 C  CE2 . TYR B 1 131 ? 9.031  -21.922 19.482  1.00 80.83  ? 127 TYR B CE2 1 
ATOM   3444 C  CZ  . TYR B 1 131 ? 8.836  -22.856 20.484  1.00 81.30  ? 127 TYR B CZ  1 
ATOM   3445 O  OH  . TYR B 1 131 ? 9.485  -22.717 21.681  1.00 82.99  ? 127 TYR B OH  1 
ATOM   3446 N  N   . LEU B 1 132 ? 6.133  -21.240 14.378  1.00 38.95  ? 128 LEU B N   1 
ATOM   3447 C  CA  . LEU B 1 132 ? 6.164  -21.016 12.938  1.00 37.10  ? 128 LEU B CA  1 
ATOM   3448 C  C   . LEU B 1 132 ? 7.552  -21.422 12.453  1.00 36.65  ? 128 LEU B C   1 
ATOM   3449 O  O   . LEU B 1 132 ? 8.542  -21.007 13.042  1.00 37.91  ? 128 LEU B O   1 
ATOM   3450 C  CB  . LEU B 1 132 ? 5.932  -19.537 12.627  1.00 25.02  ? 128 LEU B CB  1 
ATOM   3451 C  CG  . LEU B 1 132 ? 6.220  -19.126 11.181  1.00 24.43  ? 128 LEU B CG  1 
ATOM   3452 C  CD1 . LEU B 1 132 ? 5.469  -20.027 10.254  1.00 22.70  ? 128 LEU B CD1 1 
ATOM   3453 C  CD2 . LEU B 1 132 ? 5.825  -17.674 10.947  1.00 22.72  ? 128 LEU B CD2 1 
ATOM   3454 N  N   . ASN B 1 133 ? 7.635  -22.231 11.401  1.00 36.33  ? 129 ASN B N   1 
ATOM   3455 C  CA  . ASN B 1 133 ? 8.937  -22.652 10.877  1.00 35.45  ? 129 ASN B CA  1 
ATOM   3456 C  C   . ASN B 1 133 ? 9.158  -22.194 9.437   1.00 35.91  ? 129 ASN B C   1 
ATOM   3457 O  O   . ASN B 1 133 ? 8.367  -22.521 8.581   1.00 33.31  ? 129 ASN B O   1 
ATOM   3458 C  CB  . ASN B 1 133 ? 9.072  -24.175 10.920  1.00 39.05  ? 129 ASN B CB  1 
ATOM   3459 C  CG  . ASN B 1 133 ? 8.852  -24.745 12.308  1.00 43.38  ? 129 ASN B CG  1 
ATOM   3460 O  OD1 . ASN B 1 133 ? 7.732  -24.743 12.810  1.00 44.62  ? 129 ASN B OD1 1 
ATOM   3461 N  ND2 . ASN B 1 133 ? 9.923  -25.235 12.938  1.00 40.38  ? 129 ASN B ND2 1 
ATOM   3462 N  N   . LEU B 1 134 ? 10.225 -21.442 9.167   1.00 36.02  ? 130 LEU B N   1 
ATOM   3463 C  CA  . LEU B 1 134 ? 10.524 -20.993 7.810   1.00 36.08  ? 130 LEU B CA  1 
ATOM   3464 C  C   . LEU B 1 134 ? 11.672 -21.822 7.273   1.00 37.10  ? 130 LEU B C   1 
ATOM   3465 O  O   . LEU B 1 134 ? 12.718 -21.888 7.905   1.00 37.38  ? 130 LEU B O   1 
ATOM   3466 C  CB  . LEU B 1 134 ? 10.952 -19.535 7.799   1.00 35.76  ? 130 LEU B CB  1 
ATOM   3467 C  CG  . LEU B 1 134 ? 10.101 -18.575 8.628   1.00 39.88  ? 130 LEU B CG  1 
ATOM   3468 C  CD1 . LEU B 1 134 ? 10.553 -17.135 8.352   1.00 41.50  ? 130 LEU B CD1 1 
ATOM   3469 C  CD2 . LEU B 1 134 ? 8.626  -18.757 8.294   1.00 38.87  ? 130 LEU B CD2 1 
ATOM   3470 N  N   . VAL B 1 135 ? 11.487 -22.452 6.115   1.00 32.61  ? 131 VAL B N   1 
ATOM   3471 C  CA  . VAL B 1 135 ? 12.537 -23.266 5.524   1.00 32.70  ? 131 VAL B CA  1 
ATOM   3472 C  C   . VAL B 1 135 ? 13.242 -22.450 4.459   1.00 32.64  ? 131 VAL B C   1 
ATOM   3473 O  O   . VAL B 1 135 ? 12.744 -22.273 3.348   1.00 32.25  ? 131 VAL B O   1 
ATOM   3474 C  CB  . VAL B 1 135 ? 11.966 -24.563 4.925   1.00 21.88  ? 131 VAL B CB  1 
ATOM   3475 C  CG1 . VAL B 1 135 ? 13.066 -25.364 4.247   1.00 20.21  ? 131 VAL B CG1 1 
ATOM   3476 C  CG2 . VAL B 1 135 ? 11.357 -25.392 6.023   1.00 19.99  ? 131 VAL B CG2 1 
ATOM   3477 N  N   . LEU B 1 136 ? 14.424 -21.970 4.811   1.00 32.27  ? 132 LEU B N   1 
ATOM   3478 C  CA  . LEU B 1 136 ? 15.208 -21.112 3.934   1.00 31.35  ? 132 LEU B CA  1 
ATOM   3479 C  C   . LEU B 1 136 ? 16.416 -21.749 3.295   1.00 32.74  ? 132 LEU B C   1 
ATOM   3480 O  O   . LEU B 1 136 ? 16.815 -22.844 3.672   1.00 33.62  ? 132 LEU B O   1 
ATOM   3481 C  CB  . LEU B 1 136 ? 15.697 -19.917 4.743   1.00 25.25  ? 132 LEU B CB  1 
ATOM   3482 C  CG  . LEU B 1 136 ? 14.649 -19.348 5.681   1.00 23.85  ? 132 LEU B CG  1 
ATOM   3483 C  CD1 . LEU B 1 136 ? 15.294 -18.932 6.981   1.00 23.69  ? 132 LEU B CD1 1 
ATOM   3484 C  CD2 . LEU B 1 136 ? 13.960 -18.190 4.989   1.00 24.01  ? 132 LEU B CD2 1 
ATOM   3485 N  N   . ASP B 1 137 ? 17.004 -21.018 2.344   1.00 28.38  ? 133 ASP B N   1 
ATOM   3486 C  CA  . ASP B 1 137 ? 18.221 -21.432 1.649   1.00 29.38  ? 133 ASP B CA  1 
ATOM   3487 C  C   . ASP B 1 137 ? 19.334 -21.523 2.701   1.00 28.82  ? 133 ASP B C   1 
ATOM   3488 O  O   . ASP B 1 137 ? 19.349 -20.742 3.660   1.00 28.30  ? 133 ASP B O   1 
ATOM   3489 C  CB  . ASP B 1 137 ? 18.680 -20.371 0.652   1.00 36.55  ? 133 ASP B CB  1 
ATOM   3490 C  CG  . ASP B 1 137 ? 17.947 -20.414 -0.663  1.00 39.88  ? 133 ASP B CG  1 
ATOM   3491 O  OD1 . ASP B 1 137 ? 17.415 -21.492 -1.034  1.00 39.54  ? 133 ASP B OD1 1 
ATOM   3492 O  OD2 . ASP B 1 137 ? 17.941 -19.356 -1.346  1.00 40.42  ? 133 ASP B OD2 1 
ATOM   3493 N  N   . TYR B 1 138 ? 20.272 -22.455 2.525   1.00 34.65  ? 134 TYR B N   1 
ATOM   3494 C  CA  . TYR B 1 138 ? 21.397 -22.570 3.453   1.00 35.16  ? 134 TYR B CA  1 
ATOM   3495 C  C   . TYR B 1 138 ? 22.638 -21.975 2.811   1.00 33.78  ? 134 TYR B C   1 
ATOM   3496 O  O   . TYR B 1 138 ? 22.949 -22.290 1.669   1.00 32.78  ? 134 TYR B O   1 
ATOM   3497 C  CB  . TYR B 1 138 ? 21.708 -24.018 3.777   1.00 41.40  ? 134 TYR B CB  1 
ATOM   3498 C  CG  . TYR B 1 138 ? 22.960 -24.167 4.614   1.00 42.01  ? 134 TYR B CG  1 
ATOM   3499 C  CD1 . TYR B 1 138 ? 22.923 -23.931 5.987   1.00 42.64  ? 134 TYR B CD1 1 
ATOM   3500 C  CD2 . TYR B 1 138 ? 24.184 -24.506 4.032   1.00 42.58  ? 134 TYR B CD2 1 
ATOM   3501 C  CE1 . TYR B 1 138 ? 24.057 -24.029 6.761   1.00 44.46  ? 134 TYR B CE1 1 
ATOM   3502 C  CE2 . TYR B 1 138 ? 25.337 -24.600 4.807   1.00 45.50  ? 134 TYR B CE2 1 
ATOM   3503 C  CZ  . TYR B 1 138 ? 25.257 -24.358 6.171   1.00 44.99  ? 134 TYR B CZ  1 
ATOM   3504 O  OH  . TYR B 1 138 ? 26.369 -24.414 6.968   1.00 45.57  ? 134 TYR B OH  1 
ATOM   3505 N  N   . VAL B 1 139 ? 23.343 -21.121 3.541   1.00 40.34  ? 135 VAL B N   1 
ATOM   3506 C  CA  . VAL B 1 139 ? 24.570 -20.511 3.035   1.00 38.89  ? 135 VAL B CA  1 
ATOM   3507 C  C   . VAL B 1 139 ? 25.618 -20.641 4.152   1.00 37.92  ? 135 VAL B C   1 
ATOM   3508 O  O   . VAL B 1 139 ? 25.433 -20.129 5.265   1.00 37.48  ? 135 VAL B O   1 
ATOM   3509 C  CB  . VAL B 1 139 ? 24.349 -19.043 2.662   1.00 35.14  ? 135 VAL B CB  1 
ATOM   3510 C  CG1 . VAL B 1 139 ? 25.612 -18.468 2.085   1.00 33.85  ? 135 VAL B CG1 1 
ATOM   3511 C  CG2 . VAL B 1 139 ? 23.224 -18.930 1.647   1.00 34.10  ? 135 VAL B CG2 1 
ATOM   3512 N  N   . PRO B 1 140 ? 26.737 -21.332 3.855   1.00 35.21  ? 136 PRO B N   1 
ATOM   3513 C  CA  . PRO B 1 140 ? 27.893 -21.643 4.704   1.00 35.55  ? 136 PRO B CA  1 
ATOM   3514 C  C   . PRO B 1 140 ? 28.604 -20.541 5.474   1.00 35.61  ? 136 PRO B C   1 
ATOM   3515 O  O   . PRO B 1 140 ? 28.961 -20.758 6.614   1.00 36.18  ? 136 PRO B O   1 
ATOM   3516 C  CB  . PRO B 1 140 ? 28.832 -22.356 3.745   1.00 37.91  ? 136 PRO B CB  1 
ATOM   3517 C  CG  . PRO B 1 140 ? 28.603 -21.617 2.480   1.00 40.22  ? 136 PRO B CG  1 
ATOM   3518 C  CD  . PRO B 1 140 ? 27.085 -21.554 2.437   1.00 39.24  ? 136 PRO B CD  1 
ATOM   3519 N  N   . GLU B 1 141 ? 28.832 -19.373 4.885   1.00 43.24  ? 137 GLU B N   1 
ATOM   3520 C  CA  . GLU B 1 141 ? 29.535 -18.318 5.619   1.00 44.38  ? 137 GLU B CA  1 
ATOM   3521 C  C   . GLU B 1 141 ? 28.764 -17.017 5.740   1.00 43.77  ? 137 GLU B C   1 
ATOM   3522 O  O   . GLU B 1 141 ? 27.698 -16.862 5.159   1.00 42.61  ? 137 GLU B O   1 
ATOM   3523 C  CB  . GLU B 1 141 ? 30.882 -18.015 4.958   1.00 79.75  ? 137 GLU B CB  1 
ATOM   3524 C  CG  . GLU B 1 141 ? 32.031 -18.918 5.368   1.00 84.30  ? 137 GLU B CG  1 
ATOM   3525 C  CD  . GLU B 1 141 ? 32.360 -18.837 6.859   1.00 88.37  ? 137 GLU B CD  1 
ATOM   3526 O  OE1 . GLU B 1 141 ? 32.417 -17.712 7.406   1.00 86.39  ? 137 GLU B OE1 1 
ATOM   3527 O  OE2 . GLU B 1 141 ? 32.576 -19.903 7.484   1.00 91.85  ? 137 GLU B OE2 1 
ATOM   3528 N  N   . THR B 1 142 ? 29.324 -16.079 6.497   1.00 40.34  ? 138 THR B N   1 
ATOM   3529 C  CA  . THR B 1 142 ? 28.728 -14.756 6.670   1.00 40.07  ? 138 THR B CA  1 
ATOM   3530 C  C   . THR B 1 142 ? 29.824 -13.743 6.364   1.00 39.01  ? 138 THR B C   1 
ATOM   3531 O  O   . THR B 1 142 ? 30.998 -14.069 6.470   1.00 38.68  ? 138 THR B O   1 
ATOM   3532 C  CB  . THR B 1 142 ? 28.262 -14.522 8.107   1.00 49.41  ? 138 THR B CB  1 
ATOM   3533 O  OG1 . THR B 1 142 ? 29.408 -14.353 8.940   1.00 51.00  ? 138 THR B OG1 1 
ATOM   3534 C  CG2 . THR B 1 142 ? 27.432 -15.708 8.610   1.00 50.59  ? 138 THR B CG2 1 
ATOM   3535 N  N   . VAL B 1 143 ? 29.462 -12.525 5.978   1.00 33.73  ? 139 VAL B N   1 
ATOM   3536 C  CA  . VAL B 1 143 ? 30.490 -11.540 5.686   1.00 33.02  ? 139 VAL B CA  1 
ATOM   3537 C  C   . VAL B 1 143 ? 31.206 -11.224 6.986   1.00 35.79  ? 139 VAL B C   1 
ATOM   3538 O  O   . VAL B 1 143 ? 32.387 -10.891 6.996   1.00 37.05  ? 139 VAL B O   1 
ATOM   3539 C  CB  . VAL B 1 143 ? 29.915 -10.228 5.125   1.00 28.46  ? 139 VAL B CB  1 
ATOM   3540 C  CG1 . VAL B 1 143 ? 30.979 -9.132  5.176   1.00 25.59  ? 139 VAL B CG1 1 
ATOM   3541 C  CG2 . VAL B 1 143 ? 29.464 -10.424 3.688   1.00 26.03  ? 139 VAL B CG2 1 
ATOM   3542 N  N   . TYR B 1 144 ? 30.478 -11.334 8.083   1.00 39.91  ? 140 TYR B N   1 
ATOM   3543 C  CA  . TYR B 1 144 ? 31.026 -11.068 9.402   1.00 41.62  ? 140 TYR B CA  1 
ATOM   3544 C  C   . TYR B 1 144 ? 32.267 -11.909 9.692   1.00 41.68  ? 140 TYR B C   1 
ATOM   3545 O  O   . TYR B 1 144 ? 33.378 -11.382 9.864   1.00 40.15  ? 140 TYR B O   1 
ATOM   3546 C  CB  . TYR B 1 144 ? 29.987 -11.390 10.460  1.00 32.54  ? 140 TYR B CB  1 
ATOM   3547 C  CG  . TYR B 1 144 ? 30.500 -11.179 11.840  1.00 37.38  ? 140 TYR B CG  1 
ATOM   3548 C  CD1 . TYR B 1 144 ? 30.507 -9.912  12.396  1.00 38.94  ? 140 TYR B CD1 1 
ATOM   3549 C  CD2 . TYR B 1 144 ? 30.997 -12.242 12.588  1.00 39.60  ? 140 TYR B CD2 1 
ATOM   3550 C  CE1 . TYR B 1 144 ? 30.988 -9.697  13.664  1.00 41.54  ? 140 TYR B CE1 1 
ATOM   3551 C  CE2 . TYR B 1 144 ? 31.486 -12.043 13.862  1.00 41.93  ? 140 TYR B CE2 1 
ATOM   3552 C  CZ  . TYR B 1 144 ? 31.475 -10.763 14.391  1.00 43.99  ? 140 TYR B CZ  1 
ATOM   3553 O  OH  . TYR B 1 144 ? 31.959 -10.525 15.645  1.00 46.92  ? 140 TYR B OH  1 
ATOM   3554 N  N   . ARG B 1 145 ? 32.048 -13.220 9.781   1.00 37.10  ? 141 ARG B N   1 
ATOM   3555 C  CA  . ARG B 1 145 ? 33.110 -14.167 10.045  1.00 38.44  ? 141 ARG B CA  1 
ATOM   3556 C  C   . ARG B 1 145 ? 34.258 -14.060 9.025   1.00 38.13  ? 141 ARG B C   1 
ATOM   3557 O  O   . ARG B 1 145 ? 35.420 -14.154 9.399   1.00 38.52  ? 141 ARG B O   1 
ATOM   3558 C  CB  . ARG B 1 145 ? 32.541 -15.579 10.079  1.00 55.00  ? 141 ARG B CB  1 
ATOM   3559 C  CG  . ARG B 1 145 ? 33.558 -16.640 10.412  1.00 59.28  ? 141 ARG B CG  1 
ATOM   3560 C  CD  . ARG B 1 145 ? 32.887 -17.824 11.062  1.00 62.29  ? 141 ARG B CD  1 
ATOM   3561 N  NE  . ARG B 1 145 ? 31.677 -18.184 10.335  1.00 66.79  ? 141 ARG B NE  1 
ATOM   3562 C  CZ  . ARG B 1 145 ? 30.447 -18.075 10.827  1.00 71.11  ? 141 ARG B CZ  1 
ATOM   3563 N  NH1 . ARG B 1 145 ? 30.260 -17.618 12.060  1.00 70.36  ? 141 ARG B NH1 1 
ATOM   3564 N  NH2 . ARG B 1 145 ? 29.404 -18.415 10.080  1.00 71.93  ? 141 ARG B NH2 1 
ATOM   3565 N  N   . VAL B 1 146 ? 33.958 -13.847 7.750   1.00 32.56  ? 142 VAL B N   1 
ATOM   3566 C  CA  . VAL B 1 146 ? 35.030 -13.718 6.768   1.00 33.53  ? 142 VAL B CA  1 
ATOM   3567 C  C   . VAL B 1 146 ? 35.900 -12.495 7.021   1.00 35.93  ? 142 VAL B C   1 
ATOM   3568 O  O   . VAL B 1 146 ? 37.115 -12.592 7.007   1.00 35.03  ? 142 VAL B O   1 
ATOM   3569 C  CB  . VAL B 1 146 ? 34.488 -13.631 5.319   1.00 24.68  ? 142 VAL B CB  1 
ATOM   3570 C  CG1 . VAL B 1 146 ? 35.456 -12.854 4.429   1.00 24.92  ? 142 VAL B CG1 1 
ATOM   3571 C  CG2 . VAL B 1 146 ? 34.294 -15.031 4.765   1.00 24.41  ? 142 VAL B CG2 1 
ATOM   3572 N  N   . ALA B 1 147 ? 35.286 -11.341 7.240   1.00 33.81  ? 143 ALA B N   1 
ATOM   3573 C  CA  . ALA B 1 147 ? 36.053 -10.121 7.486   1.00 34.60  ? 143 ALA B CA  1 
ATOM   3574 C  C   . ALA B 1 147 ? 36.937 -10.268 8.718   1.00 35.27  ? 143 ALA B C   1 
ATOM   3575 O  O   . ALA B 1 147 ? 38.049 -9.752  8.748   1.00 34.12  ? 143 ALA B O   1 
ATOM   3576 C  CB  . ALA B 1 147 ? 35.110 -8.928  7.661   1.00 20.51  ? 143 ALA B CB  1 
ATOM   3577 N  N   . ARG B 1 148 ? 36.440 -10.985 9.722   1.00 34.90  ? 144 ARG B N   1 
ATOM   3578 C  CA  . ARG B 1 148 ? 37.167 -11.187 10.979  1.00 39.22  ? 144 ARG B CA  1 
ATOM   3579 C  C   . ARG B 1 148 ? 38.430 -11.996 10.719  1.00 40.11  ? 144 ARG B C   1 
ATOM   3580 O  O   . ARG B 1 148 ? 39.473 -11.744 11.315  1.00 38.29  ? 144 ARG B O   1 
ATOM   3581 C  CB  . ARG B 1 148 ? 36.260 -11.900 11.999  1.00 52.40  ? 144 ARG B CB  1 
ATOM   3582 C  CG  . ARG B 1 148 ? 36.713 -11.814 13.450  1.00 58.95  ? 144 ARG B CG  1 
ATOM   3583 C  CD  . ARG B 1 148 ? 35.795 -12.625 14.380  1.00 63.86  ? 144 ARG B CD  1 
ATOM   3584 N  NE  . ARG B 1 148 ? 35.605 -14.006 13.910  1.00 69.22  ? 144 ARG B NE  1 
ATOM   3585 C  CZ  . ARG B 1 148 ? 34.743 -14.884 14.433  1.00 71.65  ? 144 ARG B CZ  1 
ATOM   3586 N  NH1 . ARG B 1 148 ? 33.973 -14.537 15.461  1.00 73.36  ? 144 ARG B NH1 1 
ATOM   3587 N  NH2 . ARG B 1 148 ? 34.641 -16.112 13.919  1.00 71.90  ? 144 ARG B NH2 1 
ATOM   3588 N  N   . HIS B 1 149 ? 38.334 -12.972 9.826   1.00 39.26  ? 145 HIS B N   1 
ATOM   3589 C  CA  . HIS B 1 149 ? 39.485 -13.780 9.478   1.00 40.55  ? 145 HIS B CA  1 
ATOM   3590 C  C   . HIS B 1 149 ? 40.582 -12.842 8.978   1.00 40.42  ? 145 HIS B C   1 
ATOM   3591 O  O   . HIS B 1 149 ? 41.688 -12.826 9.511   1.00 38.97  ? 145 HIS B O   1 
ATOM   3592 C  CB  . HIS B 1 149 ? 39.128 -14.777 8.379   1.00 72.58  ? 145 HIS B CB  1 
ATOM   3593 C  CG  . HIS B 1 149 ? 40.318 -15.391 7.704   1.00 77.21  ? 145 HIS B CG  1 
ATOM   3594 N  ND1 . HIS B 1 149 ? 40.779 -16.654 8.006   1.00 79.02  ? 145 HIS B ND1 1 
ATOM   3595 C  CD2 . HIS B 1 149 ? 41.132 -14.918 6.728   1.00 79.38  ? 145 HIS B CD2 1 
ATOM   3596 C  CE1 . HIS B 1 149 ? 41.822 -16.933 7.244   1.00 79.06  ? 145 HIS B CE1 1 
ATOM   3597 N  NE2 . HIS B 1 149 ? 42.057 -15.896 6.460   1.00 80.47  ? 145 HIS B NE2 1 
ATOM   3598 N  N   . TYR B 1 150 ? 40.290 -12.053 7.956   1.00 36.72  ? 146 TYR B N   1 
ATOM   3599 C  CA  . TYR B 1 150 ? 41.315 -11.168 7.452   1.00 37.45  ? 146 TYR B CA  1 
ATOM   3600 C  C   . TYR B 1 150 ? 41.793 -10.250 8.550   1.00 40.94  ? 146 TYR B C   1 
ATOM   3601 O  O   . TYR B 1 150 ? 42.993 -10.037 8.710   1.00 40.80  ? 146 TYR B O   1 
ATOM   3602 C  CB  . TYR B 1 150 ? 40.809 -10.367 6.250   1.00 43.49  ? 146 TYR B CB  1 
ATOM   3603 C  CG  . TYR B 1 150 ? 40.677 -11.240 5.031   1.00 42.36  ? 146 TYR B CG  1 
ATOM   3604 C  CD1 . TYR B 1 150 ? 39.640 -12.169 4.933   1.00 40.61  ? 146 TYR B CD1 1 
ATOM   3605 C  CD2 . TYR B 1 150 ? 41.645 -11.225 4.029   1.00 39.87  ? 146 TYR B CD2 1 
ATOM   3606 C  CE1 . TYR B 1 150 ? 39.578 -13.057 3.889   1.00 38.43  ? 146 TYR B CE1 1 
ATOM   3607 C  CE2 . TYR B 1 150 ? 41.588 -12.115 2.981   1.00 39.40  ? 146 TYR B CE2 1 
ATOM   3608 C  CZ  . TYR B 1 150 ? 40.553 -13.029 2.925   1.00 41.17  ? 146 TYR B CZ  1 
ATOM   3609 O  OH  . TYR B 1 150 ? 40.508 -13.954 1.922   1.00 40.58  ? 146 TYR B OH  1 
ATOM   3610 N  N   . SER B 1 151 ? 40.851 -9.731  9.326   1.00 43.36  ? 147 SER B N   1 
ATOM   3611 C  CA  . SER B 1 151 ? 41.173 -8.833  10.420  1.00 46.33  ? 147 SER B CA  1 
ATOM   3612 C  C   . SER B 1 151 ? 42.231 -9.381  11.377  1.00 49.06  ? 147 SER B C   1 
ATOM   3613 O  O   . SER B 1 151 ? 43.312 -8.824  11.470  1.00 48.03  ? 147 SER B O   1 
ATOM   3614 C  CB  . SER B 1 151 ? 39.908 -8.484  11.197  1.00 53.81  ? 147 SER B CB  1 
ATOM   3615 O  OG  . SER B 1 151 ? 39.891 -7.105  11.502  1.00 56.23  ? 147 SER B OG  1 
ATOM   3616 N  N   . ARG B 1 152 ? 41.967 -10.466 12.089  1.00 57.18  ? 148 ARG B N   1 
ATOM   3617 C  CA  . ARG B 1 152 ? 43.007 -10.909 12.996  1.00 60.79  ? 148 ARG B CA  1 
ATOM   3618 C  C   . ARG B 1 152 ? 44.264 -11.480 12.375  1.00 61.94  ? 148 ARG B C   1 
ATOM   3619 O  O   . ARG B 1 152 ? 45.232 -11.746 13.080  1.00 63.60  ? 148 ARG B O   1 
ATOM   3620 C  CB  . ARG B 1 152 ? 42.472 -11.859 14.060  1.00 82.55  ? 148 ARG B CB  1 
ATOM   3621 C  CG  . ARG B 1 152 ? 41.499 -12.907 13.642  1.00 85.29  ? 148 ARG B CG  1 
ATOM   3622 C  CD  . ARG B 1 152 ? 40.867 -13.370 14.937  1.00 87.79  ? 148 ARG B CD  1 
ATOM   3623 N  NE  . ARG B 1 152 ? 39.694 -14.217 14.775  1.00 91.15  ? 148 ARG B NE  1 
ATOM   3624 C  CZ  . ARG B 1 152 ? 38.761 -14.359 15.713  1.00 92.85  ? 148 ARG B CZ  1 
ATOM   3625 N  NH1 . ARG B 1 152 ? 38.874 -13.705 16.864  1.00 93.42  ? 148 ARG B NH1 1 
ATOM   3626 N  NH2 . ARG B 1 152 ? 37.720 -15.153 15.507  1.00 93.03  ? 148 ARG B NH2 1 
ATOM   3627 N  N   . ALA B 1 153 ? 44.280 -11.670 11.066  1.00 51.58  ? 149 ALA B N   1 
ATOM   3628 C  CA  . ALA B 1 153 ? 45.494 -12.171 10.446  1.00 51.13  ? 149 ALA B CA  1 
ATOM   3629 C  C   . ALA B 1 153 ? 46.233 -10.962 9.875   1.00 51.17  ? 149 ALA B C   1 
ATOM   3630 O  O   . ALA B 1 153 ? 47.144 -11.092 9.064   1.00 52.70  ? 149 ALA B O   1 
ATOM   3631 C  CB  . ALA B 1 153 ? 45.170 -13.161 9.355   1.00 32.97  ? 149 ALA B CB  1 
ATOM   3632 N  N   . LYS B 1 154 ? 45.824 -9.778  10.309  1.00 58.42  ? 150 LYS B N   1 
ATOM   3633 C  CA  . LYS B 1 154 ? 46.451 -8.549  9.859   1.00 58.70  ? 150 LYS B CA  1 
ATOM   3634 C  C   . LYS B 1 154 ? 46.522 -8.477  8.334   1.00 58.28  ? 150 LYS B C   1 
ATOM   3635 O  O   . LYS B 1 154 ? 47.534 -8.074  7.767   1.00 58.34  ? 150 LYS B O   1 
ATOM   3636 C  CB  . LYS B 1 154 ? 47.845 -8.459  10.465  1.00 97.87  ? 150 LYS B CB  1 
ATOM   3637 C  CG  . LYS B 1 154 ? 47.849 -8.682  11.968  1.00 99.73  ? 150 LYS B CG  1 
ATOM   3638 C  CD  . LYS B 1 154 ? 49.259 -8.677  12.514  1.00 102.14 ? 150 LYS B CD  1 
ATOM   3639 C  CE  . LYS B 1 154 ? 49.273 -8.855  14.018  1.00 102.47 ? 150 LYS B CE  1 
ATOM   3640 N  NZ  . LYS B 1 154 ? 50.666 -8.754  14.537  1.00 102.54 ? 150 LYS B NZ  1 
ATOM   3641 N  N   . GLN B 1 155 ? 45.434 -8.876  7.680   1.00 56.65  ? 151 GLN B N   1 
ATOM   3642 C  CA  . GLN B 1 155 ? 45.315 -8.869  6.217   1.00 54.74  ? 151 GLN B CA  1 
ATOM   3643 C  C   . GLN B 1 155 ? 44.059 -8.082  5.845   1.00 53.79  ? 151 GLN B C   1 
ATOM   3644 O  O   . GLN B 1 155 ? 43.169 -7.887  6.677   1.00 53.56  ? 151 GLN B O   1 
ATOM   3645 C  CB  . GLN B 1 155 ? 45.165 -10.303 5.680   1.00 77.68  ? 151 GLN B CB  1 
ATOM   3646 C  CG  . GLN B 1 155 ? 46.434 -11.127 5.621   1.00 79.74  ? 151 GLN B CG  1 
ATOM   3647 C  CD  . GLN B 1 155 ? 47.446 -10.519 4.676   1.00 82.39  ? 151 GLN B CD  1 
ATOM   3648 O  OE1 . GLN B 1 155 ? 47.130 -10.219 3.525   1.00 83.21  ? 151 GLN B OE1 1 
ATOM   3649 N  NE2 . GLN B 1 155 ? 48.670 -10.328 5.155   1.00 83.19  ? 151 GLN B NE2 1 
ATOM   3650 N  N   . THR B 1 156 ? 43.976 -7.633  4.601   1.00 61.95  ? 152 THR B N   1 
ATOM   3651 C  CA  . THR B 1 156 ? 42.795 -6.904  4.160   1.00 60.49  ? 152 THR B CA  1 
ATOM   3652 C  C   . THR B 1 156 ? 42.141 -7.583  2.961   1.00 56.69  ? 152 THR B C   1 
ATOM   3653 O  O   . THR B 1 156 ? 42.750 -7.718  1.912   1.00 54.41  ? 152 THR B O   1 
ATOM   3654 C  CB  . THR B 1 156 ? 43.121 -5.437  3.773   1.00 79.82  ? 152 THR B CB  1 
ATOM   3655 O  OG1 . THR B 1 156 ? 44.250 -5.413  2.892   1.00 81.23  ? 152 THR B OG1 1 
ATOM   3656 C  CG2 . THR B 1 156 ? 43.405 -4.600  5.014   1.00 81.53  ? 152 THR B CG2 1 
ATOM   3657 N  N   . LEU B 1 157 ? 40.897 -8.011  3.134   1.00 40.76  ? 153 LEU B N   1 
ATOM   3658 C  CA  . LEU B 1 157 ? 40.122 -8.660  2.080   1.00 37.42  ? 153 LEU B CA  1 
ATOM   3659 C  C   . LEU B 1 157 ? 40.426 -8.064  0.706   1.00 35.27  ? 153 LEU B C   1 
ATOM   3660 O  O   . LEU B 1 157 ? 40.242 -6.873  0.500   1.00 36.14  ? 153 LEU B O   1 
ATOM   3661 C  CB  . LEU B 1 157 ? 38.645 -8.489  2.404   1.00 37.30  ? 153 LEU B CB  1 
ATOM   3662 C  CG  . LEU B 1 157 ? 37.590 -9.188  1.565   1.00 36.88  ? 153 LEU B CG  1 
ATOM   3663 C  CD1 . LEU B 1 157 ? 37.771 -10.687 1.658   1.00 35.86  ? 153 LEU B CD1 1 
ATOM   3664 C  CD2 . LEU B 1 157 ? 36.209 -8.772  2.087   1.00 37.28  ? 153 LEU B CD2 1 
ATOM   3665 N  N   . PRO B 1 158 ? 40.905 -8.884  -0.249  1.00 37.73  ? 154 PRO B N   1 
ATOM   3666 C  CA  . PRO B 1 158 ? 41.206 -8.347  -1.577  1.00 36.66  ? 154 PRO B CA  1 
ATOM   3667 C  C   . PRO B 1 158 ? 40.019 -7.542  -2.101  1.00 37.74  ? 154 PRO B C   1 
ATOM   3668 O  O   . PRO B 1 158 ? 38.872 -7.979  -2.019  1.00 35.65  ? 154 PRO B O   1 
ATOM   3669 C  CB  . PRO B 1 158 ? 41.480 -9.598  -2.408  1.00 28.43  ? 154 PRO B CB  1 
ATOM   3670 C  CG  . PRO B 1 158 ? 42.062 -10.546 -1.406  1.00 31.69  ? 154 PRO B CG  1 
ATOM   3671 C  CD  . PRO B 1 158 ? 41.181 -10.331 -0.195  1.00 29.64  ? 154 PRO B CD  1 
ATOM   3672 N  N   . VAL B 1 159 ? 40.306 -6.358  -2.621  1.00 48.02  ? 155 VAL B N   1 
ATOM   3673 C  CA  . VAL B 1 159 ? 39.288 -5.471  -3.150  1.00 49.17  ? 155 VAL B CA  1 
ATOM   3674 C  C   . VAL B 1 159 ? 38.336 -6.130  -4.148  1.00 48.09  ? 155 VAL B C   1 
ATOM   3675 O  O   . VAL B 1 159 ? 37.198 -5.689  -4.309  1.00 47.21  ? 155 VAL B O   1 
ATOM   3676 C  CB  . VAL B 1 159 ? 39.950 -4.229  -3.820  1.00 36.11  ? 155 VAL B CB  1 
ATOM   3677 C  CG1 . VAL B 1 159 ? 39.298 -3.926  -5.173  1.00 36.90  ? 155 VAL B CG1 1 
ATOM   3678 C  CG2 . VAL B 1 159 ? 39.824 -3.021  -2.903  1.00 39.26  ? 155 VAL B CG2 1 
ATOM   3679 N  N   . ILE B 1 160 ? 38.772 -7.181  -4.822  1.00 32.47  ? 156 ILE B N   1 
ATOM   3680 C  CA  . ILE B 1 160 ? 37.874 -7.769  -5.785  1.00 31.44  ? 156 ILE B CA  1 
ATOM   3681 C  C   . ILE B 1 160 ? 36.657 -8.297  -5.046  1.00 30.10  ? 156 ILE B C   1 
ATOM   3682 O  O   . ILE B 1 160 ? 35.521 -8.066  -5.480  1.00 29.21  ? 156 ILE B O   1 
ATOM   3683 C  CB  . ILE B 1 160 ? 38.556 -8.886  -6.605  1.00 34.53  ? 156 ILE B CB  1 
ATOM   3684 C  CG1 . ILE B 1 160 ? 37.554 -9.525  -7.575  1.00 34.56  ? 156 ILE B CG1 1 
ATOM   3685 C  CG2 . ILE B 1 160 ? 39.071 -9.960  -5.691  1.00 33.15  ? 156 ILE B CG2 1 
ATOM   3686 C  CD1 . ILE B 1 160 ? 36.910 -8.576  -8.560  1.00 37.41  ? 156 ILE B CD1 1 
ATOM   3687 N  N   . TYR B 1 161 ? 36.879 -8.983  -3.926  1.00 33.56  ? 157 TYR B N   1 
ATOM   3688 C  CA  . TYR B 1 161 ? 35.766 -9.512  -3.139  1.00 33.19  ? 157 TYR B CA  1 
ATOM   3689 C  C   . TYR B 1 161 ? 34.914 -8.381  -2.574  1.00 33.10  ? 157 TYR B C   1 
ATOM   3690 O  O   . TYR B 1 161 ? 33.694 -8.476  -2.525  1.00 30.66  ? 157 TYR B O   1 
ATOM   3691 C  CB  . TYR B 1 161 ? 36.274 -10.389 -1.997  1.00 34.72  ? 157 TYR B CB  1 
ATOM   3692 C  CG  . TYR B 1 161 ? 36.833 -11.695 -2.468  1.00 38.30  ? 157 TYR B CG  1 
ATOM   3693 C  CD1 . TYR B 1 161 ? 36.034 -12.596 -3.167  1.00 39.71  ? 157 TYR B CD1 1 
ATOM   3694 C  CD2 . TYR B 1 161 ? 38.161 -12.047 -2.215  1.00 40.45  ? 157 TYR B CD2 1 
ATOM   3695 C  CE1 . TYR B 1 161 ? 36.532 -13.823 -3.605  1.00 43.44  ? 157 TYR B CE1 1 
ATOM   3696 C  CE2 . TYR B 1 161 ? 38.677 -13.284 -2.656  1.00 42.20  ? 157 TYR B CE2 1 
ATOM   3697 C  CZ  . TYR B 1 161 ? 37.848 -14.161 -3.344  1.00 44.07  ? 157 TYR B CZ  1 
ATOM   3698 O  OH  . TYR B 1 161 ? 38.323 -15.383 -3.750  1.00 45.56  ? 157 TYR B OH  1 
ATOM   3699 N  N   . VAL B 1 162 ? 35.548 -7.308  -2.137  1.00 33.89  ? 158 VAL B N   1 
ATOM   3700 C  CA  . VAL B 1 162 ? 34.779 -6.205  -1.608  1.00 35.80  ? 158 VAL B CA  1 
ATOM   3701 C  C   . VAL B 1 162 ? 33.790 -5.731  -2.669  1.00 35.90  ? 158 VAL B C   1 
ATOM   3702 O  O   . VAL B 1 162 ? 32.646 -5.411  -2.341  1.00 34.98  ? 158 VAL B O   1 
ATOM   3703 C  CB  . VAL B 1 162 ? 35.682 -5.042  -1.176  1.00 31.86  ? 158 VAL B CB  1 
ATOM   3704 C  CG1 . VAL B 1 162 ? 34.837 -3.876  -0.671  1.00 31.13  ? 158 VAL B CG1 1 
ATOM   3705 C  CG2 . VAL B 1 162 ? 36.607 -5.512  -0.094  1.00 31.66  ? 158 VAL B CG2 1 
ATOM   3706 N  N   . LYS B 1 163 ? 34.225 -5.692  -3.932  1.00 31.37  ? 159 LYS B N   1 
ATOM   3707 C  CA  . LYS B 1 163 ? 33.358 -5.285  -5.045  1.00 30.45  ? 159 LYS B CA  1 
ATOM   3708 C  C   . LYS B 1 163 ? 32.221 -6.289  -5.254  1.00 30.97  ? 159 LYS B C   1 
ATOM   3709 O  O   . LYS B 1 163 ? 31.051 -5.925  -5.234  1.00 30.24  ? 159 LYS B O   1 
ATOM   3710 C  CB  . LYS B 1 163 ? 34.159 -5.179  -6.329  1.00 41.96  ? 159 LYS B CB  1 
ATOM   3711 C  CG  . LYS B 1 163 ? 35.204 -4.107  -6.273  1.00 43.39  ? 159 LYS B CG  1 
ATOM   3712 C  CD  . LYS B 1 163 ? 35.928 -3.969  -7.602  1.00 42.18  ? 159 LYS B CD  1 
ATOM   3713 C  CE  . LYS B 1 163 ? 36.970 -2.860  -7.558  1.00 43.36  ? 159 LYS B CE  1 
ATOM   3714 N  NZ  . LYS B 1 163 ? 37.579 -2.717  -8.891  1.00 42.56  ? 159 LYS B NZ  1 
ATOM   3715 N  N   . LEU B 1 164 ? 32.570 -7.553  -5.456  1.00 34.15  ? 160 LEU B N   1 
ATOM   3716 C  CA  . LEU B 1 164 ? 31.565 -8.583  -5.643  1.00 34.90  ? 160 LEU B CA  1 
ATOM   3717 C  C   . LEU B 1 164 ? 30.519 -8.595  -4.550  1.00 34.74  ? 160 LEU B C   1 
ATOM   3718 O  O   . LEU B 1 164 ? 29.331 -8.690  -4.845  1.00 34.06  ? 160 LEU B O   1 
ATOM   3719 C  CB  . LEU B 1 164 ? 32.209 -9.961  -5.683  1.00 40.42  ? 160 LEU B CB  1 
ATOM   3720 C  CG  . LEU B 1 164 ? 32.803 -10.392 -7.019  1.00 43.59  ? 160 LEU B CG  1 
ATOM   3721 C  CD1 . LEU B 1 164 ? 33.583 -11.663 -6.814  1.00 43.20  ? 160 LEU B CD1 1 
ATOM   3722 C  CD2 . LEU B 1 164 ? 31.679 -10.570 -8.057  1.00 42.88  ? 160 LEU B CD2 1 
ATOM   3723 N  N   . TYR B 1 165 ? 30.949 -8.515  -3.289  1.00 32.95  ? 161 TYR B N   1 
ATOM   3724 C  CA  . TYR B 1 165 ? 30.007 -8.551  -2.171  1.00 33.60  ? 161 TYR B CA  1 
ATOM   3725 C  C   . TYR B 1 165 ? 29.126 -7.309  -2.082  1.00 33.75  ? 161 TYR B C   1 
ATOM   3726 O  O   . TYR B 1 165 ? 27.906 -7.422  -1.958  1.00 31.28  ? 161 TYR B O   1 
ATOM   3727 C  CB  . TYR B 1 165 ? 30.740 -8.741  -0.836  1.00 30.29  ? 161 TYR B CB  1 
ATOM   3728 C  CG  . TYR B 1 165 ? 31.526 -10.027 -0.705  1.00 34.99  ? 161 TYR B CG  1 
ATOM   3729 C  CD1 . TYR B 1 165 ? 31.351 -11.070 -1.606  1.00 33.28  ? 161 TYR B CD1 1 
ATOM   3730 C  CD2 . TYR B 1 165 ? 32.447 -10.200 0.335   1.00 35.74  ? 161 TYR B CD2 1 
ATOM   3731 C  CE1 . TYR B 1 165 ? 32.073 -12.256 -1.481  1.00 39.07  ? 161 TYR B CE1 1 
ATOM   3732 C  CE2 . TYR B 1 165 ? 33.177 -11.387 0.474   1.00 38.10  ? 161 TYR B CE2 1 
ATOM   3733 C  CZ  . TYR B 1 165 ? 32.985 -12.411 -0.440  1.00 40.86  ? 161 TYR B CZ  1 
ATOM   3734 O  OH  . TYR B 1 165 ? 33.688 -13.593 -0.326  1.00 44.22  ? 161 TYR B OH  1 
ATOM   3735 N  N   . MET B 1 166 ? 29.744 -6.131  -2.150  1.00 24.34  ? 162 MET B N   1 
ATOM   3736 C  CA  . MET B 1 166 ? 29.000 -4.880  -2.061  1.00 25.66  ? 162 MET B CA  1 
ATOM   3737 C  C   . MET B 1 166 ? 28.004 -4.687  -3.189  1.00 25.89  ? 162 MET B C   1 
ATOM   3738 O  O   . MET B 1 166 ? 26.901 -4.191  -2.968  1.00 25.99  ? 162 MET B O   1 
ATOM   3739 C  CB  . MET B 1 166 ? 29.959 -3.690  -2.005  1.00 37.50  ? 162 MET B CB  1 
ATOM   3740 C  CG  . MET B 1 166 ? 30.718 -3.581  -0.683  1.00 39.92  ? 162 MET B CG  1 
ATOM   3741 S  SD  . MET B 1 166 ? 29.635 -3.774  0.775   1.00 43.22  ? 162 MET B SD  1 
ATOM   3742 C  CE  . MET B 1 166 ? 28.599 -2.315  0.588   1.00 39.54  ? 162 MET B CE  1 
ATOM   3743 N  N   . TYR B 1 167 ? 28.390 -5.081  -4.398  1.00 28.29  ? 163 TYR B N   1 
ATOM   3744 C  CA  . TYR B 1 167 ? 27.506 -4.966  -5.545  1.00 27.70  ? 163 TYR B CA  1 
ATOM   3745 C  C   . TYR B 1 167 ? 26.257 -5.778  -5.318  1.00 28.38  ? 163 TYR B C   1 
ATOM   3746 O  O   . TYR B 1 167 ? 25.146 -5.278  -5.488  1.00 28.56  ? 163 TYR B O   1 
ATOM   3747 C  CB  . TYR B 1 167 ? 28.182 -5.491  -6.796  1.00 31.50  ? 163 TYR B CB  1 
ATOM   3748 C  CG  . TYR B 1 167 ? 27.311 -5.445  -8.033  1.00 30.25  ? 163 TYR B CG  1 
ATOM   3749 C  CD1 . TYR B 1 167 ? 27.230 -4.295  -8.816  1.00 32.17  ? 163 TYR B CD1 1 
ATOM   3750 C  CD2 . TYR B 1 167 ? 26.623 -6.587  -8.458  1.00 32.18  ? 163 TYR B CD2 1 
ATOM   3751 C  CE1 . TYR B 1 167 ? 26.508 -4.294  -9.991  1.00 30.71  ? 163 TYR B CE1 1 
ATOM   3752 C  CE2 . TYR B 1 167 ? 25.888 -6.594  -9.638  1.00 32.06  ? 163 TYR B CE2 1 
ATOM   3753 C  CZ  . TYR B 1 167 ? 25.847 -5.452  -10.397 1.00 32.03  ? 163 TYR B CZ  1 
ATOM   3754 O  OH  . TYR B 1 167 ? 25.207 -5.507  -11.603 1.00 31.34  ? 163 TYR B OH  1 
ATOM   3755 N  N   . GLN B 1 168 ? 26.442 -7.041  -4.944  1.00 28.80  ? 164 GLN B N   1 
ATOM   3756 C  CA  . GLN B 1 168 ? 25.307 -7.917  -4.710  1.00 28.67  ? 164 GLN B CA  1 
ATOM   3757 C  C   . GLN B 1 168 ? 24.407 -7.420  -3.583  1.00 28.02  ? 164 GLN B C   1 
ATOM   3758 O  O   . GLN B 1 168 ? 23.182 -7.550  -3.638  1.00 27.82  ? 164 GLN B O   1 
ATOM   3759 C  CB  . GLN B 1 168 ? 25.791 -9.338  -4.439  1.00 22.99  ? 164 GLN B CB  1 
ATOM   3760 C  CG  . GLN B 1 168 ? 26.442 -9.956  -5.644  1.00 22.20  ? 164 GLN B CG  1 
ATOM   3761 C  CD  . GLN B 1 168 ? 26.976 -11.336 -5.373  1.00 26.58  ? 164 GLN B CD  1 
ATOM   3762 O  OE1 . GLN B 1 168 ? 26.272 -12.343 -5.507  1.00 24.77  ? 164 GLN B OE1 1 
ATOM   3763 N  NE2 . GLN B 1 168 ? 28.238 -11.395 -4.968  1.00 24.34  ? 164 GLN B NE2 1 
ATOM   3764 N  N   . LEU B 1 169 ? 24.994 -6.849  -2.550  1.00 41.40  ? 165 LEU B N   1 
ATOM   3765 C  CA  . LEU B 1 169 ? 24.166 -6.348  -1.477  1.00 41.32  ? 165 LEU B CA  1 
ATOM   3766 C  C   . LEU B 1 169 ? 23.284 -5.236  -2.032  1.00 42.58  ? 165 LEU B C   1 
ATOM   3767 O  O   . LEU B 1 169 ? 22.105 -5.155  -1.697  1.00 42.59  ? 165 LEU B O   1 
ATOM   3768 C  CB  . LEU B 1 169 ? 25.027 -5.806  -0.348  1.00 22.17  ? 165 LEU B CB  1 
ATOM   3769 C  CG  . LEU B 1 169 ? 24.378 -4.915  0.714   1.00 25.04  ? 165 LEU B CG  1 
ATOM   3770 C  CD1 . LEU B 1 169 ? 23.168 -5.612  1.303   1.00 23.25  ? 165 LEU B CD1 1 
ATOM   3771 C  CD2 . LEU B 1 169 ? 25.398 -4.593  1.790   1.00 20.62  ? 165 LEU B CD2 1 
ATOM   3772 N  N   . PHE B 1 170 ? 23.848 -4.384  -2.888  1.00 27.82  ? 166 PHE B N   1 
ATOM   3773 C  CA  . PHE B 1 170 ? 23.076 -3.290  -3.455  1.00 31.18  ? 166 PHE B CA  1 
ATOM   3774 C  C   . PHE B 1 170 ? 21.978 -3.775  -4.371  1.00 31.35  ? 166 PHE B C   1 
ATOM   3775 O  O   . PHE B 1 170 ? 20.891 -3.218  -4.367  1.00 30.49  ? 166 PHE B O   1 
ATOM   3776 C  CB  . PHE B 1 170 ? 23.977 -2.296  -4.169  1.00 28.01  ? 166 PHE B CB  1 
ATOM   3777 C  CG  . PHE B 1 170 ? 24.743 -1.412  -3.236  1.00 29.01  ? 166 PHE B CG  1 
ATOM   3778 C  CD1 . PHE B 1 170 ? 24.073 -0.659  -2.271  1.00 29.44  ? 166 PHE B CD1 1 
ATOM   3779 C  CD2 . PHE B 1 170 ? 26.133 -1.339  -3.301  1.00 30.03  ? 166 PHE B CD2 1 
ATOM   3780 C  CE1 . PHE B 1 170 ? 24.776 0.161   -1.371  1.00 30.15  ? 166 PHE B CE1 1 
ATOM   3781 C  CE2 . PHE B 1 170 ? 26.853 -0.525  -2.409  1.00 30.13  ? 166 PHE B CE2 1 
ATOM   3782 C  CZ  . PHE B 1 170 ? 26.176 0.225   -1.441  1.00 28.57  ? 166 PHE B CZ  1 
ATOM   3783 N  N   . ARG B 1 171 ? 22.232 -4.803  -5.164  1.00 34.74  ? 167 ARG B N   1 
ATOM   3784 C  CA  . ARG B 1 171 ? 21.159 -5.299  -5.998  1.00 35.05  ? 167 ARG B CA  1 
ATOM   3785 C  C   . ARG B 1 171 ? 20.054 -5.749  -5.061  1.00 34.61  ? 167 ARG B C   1 
ATOM   3786 O  O   . ARG B 1 171 ? 18.910 -5.363  -5.228  1.00 34.59  ? 167 ARG B O   1 
ATOM   3787 C  CB  . ARG B 1 171 ? 21.592 -6.489  -6.854  1.00 35.04  ? 167 ARG B CB  1 
ATOM   3788 C  CG  . ARG B 1 171 ? 22.047 -6.126  -8.252  1.00 38.04  ? 167 ARG B CG  1 
ATOM   3789 C  CD  . ARG B 1 171 ? 22.292 -7.371  -9.083  1.00 38.72  ? 167 ARG B CD  1 
ATOM   3790 N  NE  . ARG B 1 171 ? 21.066 -7.909  -9.653  1.00 36.22  ? 167 ARG B NE  1 
ATOM   3791 C  CZ  . ARG B 1 171 ? 20.986 -9.085  -10.263 1.00 40.29  ? 167 ARG B CZ  1 
ATOM   3792 N  NH1 . ARG B 1 171 ? 22.055 -9.853  -10.372 1.00 37.39  ? 167 ARG B NH1 1 
ATOM   3793 N  NH2 . ARG B 1 171 ? 19.846 -9.484  -10.800 1.00 36.58  ? 167 ARG B NH2 1 
ATOM   3794 N  N   . SER B 1 172 ? 20.380 -6.543  -4.050  1.00 35.41  ? 168 SER B N   1 
ATOM   3795 C  CA  . SER B 1 172 ? 19.326 -7.014  -3.156  1.00 35.91  ? 168 SER B CA  1 
ATOM   3796 C  C   . SER B 1 172 ? 18.519 -5.858  -2.557  1.00 37.79  ? 168 SER B C   1 
ATOM   3797 O  O   . SER B 1 172 ? 17.307 -5.976  -2.376  1.00 35.46  ? 168 SER B O   1 
ATOM   3798 C  CB  . SER B 1 172 ? 19.897 -7.890  -2.040  1.00 32.72  ? 168 SER B CB  1 
ATOM   3799 O  OG  . SER B 1 172 ? 20.445 -7.100  -0.999  1.00 32.87  ? 168 SER B OG  1 
ATOM   3800 N  N   . LEU B 1 173 ? 19.181 -4.746  -2.255  1.00 27.28  ? 169 LEU B N   1 
ATOM   3801 C  CA  . LEU B 1 173 ? 18.487 -3.597  -1.695  1.00 28.87  ? 169 LEU B CA  1 
ATOM   3802 C  C   . LEU B 1 173 ? 17.623 -2.897  -2.752  1.00 28.84  ? 169 LEU B C   1 
ATOM   3803 O  O   . LEU B 1 173 ? 16.497 -2.484  -2.462  1.00 31.10  ? 169 LEU B O   1 
ATOM   3804 C  CB  . LEU B 1 173 ? 19.474 -2.597  -1.073  1.00 16.66  ? 169 LEU B CB  1 
ATOM   3805 C  CG  . LEU B 1 173 ? 20.182 -3.007  0.228   1.00 20.72  ? 169 LEU B CG  1 
ATOM   3806 C  CD1 . LEU B 1 173 ? 20.974 -1.831  0.778   1.00 19.33  ? 169 LEU B CD1 1 
ATOM   3807 C  CD2 . LEU B 1 173 ? 19.155 -3.479  1.256   1.00 18.59  ? 169 LEU B CD2 1 
ATOM   3808 N  N   . ALA B 1 174 ? 18.129 -2.758  -3.972  1.00 33.83  ? 170 ALA B N   1 
ATOM   3809 C  CA  . ALA B 1 174 ? 17.340 -2.115  -5.023  1.00 35.84  ? 170 ALA B CA  1 
ATOM   3810 C  C   . ALA B 1 174 ? 16.027 -2.882  -5.195  1.00 35.91  ? 170 ALA B C   1 
ATOM   3811 O  O   . ALA B 1 174 ? 14.952 -2.306  -5.392  1.00 33.66  ? 170 ALA B O   1 
ATOM   3812 C  CB  . ALA B 1 174 ? 18.112 -2.110  -6.337  1.00 22.78  ? 170 ALA B CB  1 
ATOM   3813 N  N   . TYR B 1 175 ? 16.128 -4.195  -5.097  1.00 31.51  ? 171 TYR B N   1 
ATOM   3814 C  CA  . TYR B 1 175 ? 14.978 -5.061  -5.241  1.00 32.00  ? 171 TYR B CA  1 
ATOM   3815 C  C   . TYR B 1 175 ? 13.916 -4.926  -4.147  1.00 33.34  ? 171 TYR B C   1 
ATOM   3816 O  O   . TYR B 1 175 ? 12.778 -4.612  -4.447  1.00 31.87  ? 171 TYR B O   1 
ATOM   3817 C  CB  . TYR B 1 175 ? 15.447 -6.513  -5.338  1.00 22.88  ? 171 TYR B CB  1 
ATOM   3818 C  CG  . TYR B 1 175 ? 14.314 -7.493  -5.438  1.00 26.25  ? 171 TYR B CG  1 
ATOM   3819 C  CD1 . TYR B 1 175 ? 13.946 -8.268  -4.353  1.00 26.41  ? 171 TYR B CD1 1 
ATOM   3820 C  CD2 . TYR B 1 175 ? 13.629 -7.666  -6.630  1.00 26.42  ? 171 TYR B CD2 1 
ATOM   3821 C  CE1 . TYR B 1 175 ? 12.935 -9.200  -4.455  1.00 27.36  ? 171 TYR B CE1 1 
ATOM   3822 C  CE2 . TYR B 1 175 ? 12.604 -8.603  -6.742  1.00 28.69  ? 171 TYR B CE2 1 
ATOM   3823 C  CZ  . TYR B 1 175 ? 12.270 -9.364  -5.656  1.00 29.46  ? 171 TYR B CZ  1 
ATOM   3824 O  OH  . TYR B 1 175 ? 11.282 -10.305 -5.784  1.00 29.58  ? 171 TYR B OH  1 
ATOM   3825 N  N   . ILE B 1 176 ? 14.260 -5.177  -2.890  1.00 26.66  ? 172 ILE B N   1 
ATOM   3826 C  CA  . ILE B 1 176 ? 13.259 -5.061  -1.830  1.00 27.56  ? 172 ILE B CA  1 
ATOM   3827 C  C   . ILE B 1 176 ? 12.755 -3.611  -1.721  1.00 28.77  ? 172 ILE B C   1 
ATOM   3828 O  O   . ILE B 1 176 ? 11.582 -3.384  -1.464  1.00 28.66  ? 172 ILE B O   1 
ATOM   3829 C  CB  . ILE B 1 176 ? 13.792 -5.520  -0.434  1.00 31.75  ? 172 ILE B CB  1 
ATOM   3830 C  CG1 . ILE B 1 176 ? 14.961 -4.637  -0.006  1.00 31.43  ? 172 ILE B CG1 1 
ATOM   3831 C  CG2 . ILE B 1 176 ? 14.224 -6.973  -0.470  1.00 32.99  ? 172 ILE B CG2 1 
ATOM   3832 C  CD1 . ILE B 1 176 ? 15.379 -4.862  1.440   1.00 30.39  ? 172 ILE B CD1 1 
ATOM   3833 N  N   . HIS B 1 177 ? 13.617 -2.623  -1.922  1.00 31.47  ? 173 HIS B N   1 
ATOM   3834 C  CA  . HIS B 1 177 ? 13.142 -1.249  -1.844  1.00 32.99  ? 173 HIS B CA  1 
ATOM   3835 C  C   . HIS B 1 177 ? 12.125 -0.961  -2.941  1.00 35.37  ? 173 HIS B C   1 
ATOM   3836 O  O   . HIS B 1 177 ? 11.194 -0.183  -2.739  1.00 33.26  ? 173 HIS B O   1 
ATOM   3837 C  CB  . HIS B 1 177 ? 14.291 -0.249  -1.955  1.00 25.72  ? 173 HIS B CB  1 
ATOM   3838 C  CG  . HIS B 1 177 ? 15.124 -0.156  -0.720  1.00 28.22  ? 173 HIS B CG  1 
ATOM   3839 N  ND1 . HIS B 1 177 ? 16.222 0.671   -0.626  1.00 25.28  ? 173 HIS B ND1 1 
ATOM   3840 C  CD2 . HIS B 1 177 ? 15.054 -0.825  0.459   1.00 26.29  ? 173 HIS B CD2 1 
ATOM   3841 C  CE1 . HIS B 1 177 ? 16.796 0.505   0.556   1.00 27.74  ? 173 HIS B CE1 1 
ATOM   3842 N  NE2 . HIS B 1 177 ? 16.108 -0.399  1.231   1.00 28.66  ? 173 HIS B NE2 1 
ATOM   3843 N  N   . SER B 1 178 ? 12.297 -1.575  -4.107  1.00 35.08  ? 174 SER B N   1 
ATOM   3844 C  CA  . SER B 1 178 ? 11.361 -1.339  -5.190  1.00 36.29  ? 174 SER B CA  1 
ATOM   3845 C  C   . SER B 1 178 ? 9.941  -1.730  -4.754  1.00 39.14  ? 174 SER B C   1 
ATOM   3846 O  O   . SER B 1 178 ? 8.976  -1.304  -5.365  1.00 40.99  ? 174 SER B O   1 
ATOM   3847 C  CB  . SER B 1 178 ? 11.764 -2.129  -6.429  1.00 31.74  ? 174 SER B CB  1 
ATOM   3848 O  OG  . SER B 1 178 ? 11.246 -3.448  -6.370  1.00 29.69  ? 174 SER B OG  1 
ATOM   3849 N  N   . PHE B 1 179 ? 9.817  -2.535  -3.702  1.00 37.77  ? 175 PHE B N   1 
ATOM   3850 C  CA  . PHE B 1 179 ? 8.511  -2.941  -3.200  1.00 37.51  ? 175 PHE B CA  1 
ATOM   3851 C  C   . PHE B 1 179 ? 8.146  -2.051  -2.019  1.00 38.79  ? 175 PHE B C   1 
ATOM   3852 O  O   . PHE B 1 179 ? 7.110  -2.258  -1.380  1.00 39.30  ? 175 PHE B O   1 
ATOM   3853 C  CB  . PHE B 1 179 ? 8.519  -4.378  -2.670  1.00 53.96  ? 175 PHE B CB  1 
ATOM   3854 C  CG  . PHE B 1 179 ? 8.541  -5.434  -3.724  1.00 58.05  ? 175 PHE B CG  1 
ATOM   3855 C  CD1 . PHE B 1 179 ? 9.708  -5.718  -4.426  1.00 58.69  ? 175 PHE B CD1 1 
ATOM   3856 C  CD2 . PHE B 1 179 ? 7.409  -6.192  -3.974  1.00 58.65  ? 175 PHE B CD2 1 
ATOM   3857 C  CE1 . PHE B 1 179 ? 9.749  -6.751  -5.363  1.00 60.38  ? 175 PHE B CE1 1 
ATOM   3858 C  CE2 . PHE B 1 179 ? 7.432  -7.221  -4.904  1.00 61.73  ? 175 PHE B CE2 1 
ATOM   3859 C  CZ  . PHE B 1 179 ? 8.605  -7.504  -5.602  1.00 61.93  ? 175 PHE B CZ  1 
ATOM   3860 N  N   . GLY B 1 180 ? 9.009  -1.092  -1.698  1.00 42.15  ? 176 GLY B N   1 
ATOM   3861 C  CA  . GLY B 1 180 ? 8.754  -0.214  -0.564  1.00 42.35  ? 176 GLY B CA  1 
ATOM   3862 C  C   . GLY B 1 180 ? 9.114  -0.831  0.784   1.00 42.46  ? 176 GLY B C   1 
ATOM   3863 O  O   . GLY B 1 180 ? 8.713  -0.326  1.839   1.00 42.16  ? 176 GLY B O   1 
ATOM   3864 N  N   . ILE B 1 181 ? 9.866  -1.930  0.747   1.00 52.61  ? 177 ILE B N   1 
ATOM   3865 C  CA  . ILE B 1 181 ? 10.295 -2.635  1.948   1.00 52.10  ? 177 ILE B CA  1 
ATOM   3866 C  C   . ILE B 1 181 ? 11.703 -2.233  2.383   1.00 52.33  ? 177 ILE B C   1 
ATOM   3867 O  O   . ILE B 1 181 ? 12.619 -2.136  1.561   1.00 49.68  ? 177 ILE B O   1 
ATOM   3868 C  CB  . ILE B 1 181 ? 10.303 -4.127  1.720   1.00 28.35  ? 177 ILE B CB  1 
ATOM   3869 C  CG1 . ILE B 1 181 ? 8.931  -4.587  1.263   1.00 30.98  ? 177 ILE B CG1 1 
ATOM   3870 C  CG2 . ILE B 1 181 ? 10.674 -4.844  2.998   1.00 27.86  ? 177 ILE B CG2 1 
ATOM   3871 C  CD1 . ILE B 1 181 ? 8.845  -6.087  1.060   1.00 33.84  ? 177 ILE B CD1 1 
ATOM   3872 N  N   . CYS B 1 182 ? 11.872 -2.008  3.681   1.00 39.76  ? 178 CYS B N   1 
ATOM   3873 C  CA  . CYS B 1 182 ? 13.160 -1.620  4.225   1.00 38.97  ? 178 CYS B CA  1 
ATOM   3874 C  C   . CYS B 1 182 ? 13.606 -2.737  5.167   1.00 35.89  ? 178 CYS B C   1 
ATOM   3875 O  O   . CYS B 1 182 ? 12.825 -3.167  6.008   1.00 34.23  ? 178 CYS B O   1 
ATOM   3876 C  CB  . CYS B 1 182 ? 13.014 -0.298  4.974   1.00 43.36  ? 178 CYS B CB  1 
ATOM   3877 S  SG  . CYS B 1 182 ? 14.558 0.365   5.609   1.00 46.64  ? 178 CYS B SG  1 
ATOM   3878 N  N   . HIS B 1 183 ? 14.850 -3.205  5.022   1.00 30.80  ? 179 HIS B N   1 
ATOM   3879 C  CA  . HIS B 1 183 ? 15.373 -4.302  5.839   1.00 27.49  ? 179 HIS B CA  1 
ATOM   3880 C  C   . HIS B 1 183 ? 15.544 -3.906  7.306   1.00 29.95  ? 179 HIS B C   1 
ATOM   3881 O  O   . HIS B 1 183 ? 15.184 -4.656  8.224   1.00 26.96  ? 179 HIS B O   1 
ATOM   3882 C  CB  . HIS B 1 183 ? 16.699 -4.802  5.263   1.00 27.52  ? 179 HIS B CB  1 
ATOM   3883 C  CG  . HIS B 1 183 ? 17.237 -6.014  5.959   1.00 26.18  ? 179 HIS B CG  1 
ATOM   3884 N  ND1 . HIS B 1 183 ? 17.840 -5.955  7.197   1.00 26.60  ? 179 HIS B ND1 1 
ATOM   3885 C  CD2 . HIS B 1 183 ? 17.217 -7.323  5.614   1.00 25.95  ? 179 HIS B CD2 1 
ATOM   3886 C  CE1 . HIS B 1 183 ? 18.168 -7.175  7.584   1.00 27.64  ? 179 HIS B CE1 1 
ATOM   3887 N  NE2 . HIS B 1 183 ? 17.800 -8.023  6.642   1.00 26.25  ? 179 HIS B NE2 1 
ATOM   3888 N  N   . ARG B 1 184 ? 16.113 -2.725  7.516   1.00 37.55  ? 180 ARG B N   1 
ATOM   3889 C  CA  . ARG B 1 184 ? 16.291 -2.184  8.850   1.00 40.83  ? 180 ARG B CA  1 
ATOM   3890 C  C   . ARG B 1 184 ? 17.273 -2.900  9.784   1.00 42.08  ? 180 ARG B C   1 
ATOM   3891 O  O   . ARG B 1 184 ? 17.248 -2.695  10.992  1.00 43.55  ? 180 ARG B O   1 
ATOM   3892 C  CB  . ARG B 1 184 ? 14.916 -2.048  9.521   1.00 34.21  ? 180 ARG B CB  1 
ATOM   3893 C  CG  . ARG B 1 184 ? 13.908 -1.239  8.696   1.00 33.12  ? 180 ARG B CG  1 
ATOM   3894 C  CD  . ARG B 1 184 ? 12.795 -0.633  9.547   1.00 33.25  ? 180 ARG B CD  1 
ATOM   3895 N  NE  . ARG B 1 184 ? 11.998 -1.645  10.234  1.00 33.30  ? 180 ARG B NE  1 
ATOM   3896 C  CZ  . ARG B 1 184 ? 10.992 -1.368  11.061  1.00 35.89  ? 180 ARG B CZ  1 
ATOM   3897 N  NH1 . ARG B 1 184 ? 10.666 -0.104  11.299  1.00 33.98  ? 180 ARG B NH1 1 
ATOM   3898 N  NH2 . ARG B 1 184 ? 10.309 -2.351  11.639  1.00 33.17  ? 180 ARG B NH2 1 
ATOM   3899 N  N   . ASP B 1 185 ? 18.144 -3.734  9.235   1.00 38.17  ? 181 ASP B N   1 
ATOM   3900 C  CA  . ASP B 1 185 ? 19.140 -4.411  10.058  1.00 40.34  ? 181 ASP B CA  1 
ATOM   3901 C  C   . ASP B 1 185 ? 20.314 -4.897  9.212   1.00 39.18  ? 181 ASP B C   1 
ATOM   3902 O  O   . ASP B 1 185 ? 20.797 -6.022  9.368   1.00 38.23  ? 181 ASP B O   1 
ATOM   3903 C  CB  . ASP B 1 185 ? 18.516 -5.571  10.834  1.00 53.22  ? 181 ASP B CB  1 
ATOM   3904 C  CG  . ASP B 1 185 ? 19.389 -6.027  12.005  1.00 56.85  ? 181 ASP B CG  1 
ATOM   3905 O  OD1 . ASP B 1 185 ? 20.114 -5.173  12.580  1.00 59.24  ? 181 ASP B OD1 1 
ATOM   3906 O  OD2 . ASP B 1 185 ? 19.338 -7.232  12.357  1.00 58.48  ? 181 ASP B OD2 1 
ATOM   3907 N  N   . ILE B 1 186 ? 20.767 -4.022  8.317   1.00 30.91  ? 182 ILE B N   1 
ATOM   3908 C  CA  . ILE B 1 186 ? 21.878 -4.331  7.440   1.00 32.03  ? 182 ILE B CA  1 
ATOM   3909 C  C   . ILE B 1 186 ? 23.163 -4.220  8.241   1.00 33.18  ? 182 ILE B C   1 
ATOM   3910 O  O   . ILE B 1 186 ? 23.548 -3.127  8.667   1.00 31.02  ? 182 ILE B O   1 
ATOM   3911 C  CB  . ILE B 1 186 ? 21.940 -3.352  6.238   1.00 32.03  ? 182 ILE B CB  1 
ATOM   3912 C  CG1 . ILE B 1 186 ? 20.691 -3.497  5.378   1.00 29.84  ? 182 ILE B CG1 1 
ATOM   3913 C  CG2 . ILE B 1 186 ? 23.171 -3.623  5.392   1.00 31.52  ? 182 ILE B CG2 1 
ATOM   3914 C  CD1 . ILE B 1 186 ? 20.519 -4.873  4.790   1.00 29.18  ? 182 ILE B CD1 1 
ATOM   3915 N  N   . LYS B 1 187 ? 23.806 -5.368  8.443   1.00 32.92  ? 183 LYS B N   1 
ATOM   3916 C  CA  . LYS B 1 187 ? 25.055 -5.480  9.167   1.00 33.64  ? 183 LYS B CA  1 
ATOM   3917 C  C   . LYS B 1 187 ? 25.726 -6.740  8.623   1.00 33.73  ? 183 LYS B C   1 
ATOM   3918 O  O   . LYS B 1 187 ? 25.047 -7.612  8.074   1.00 32.78  ? 183 LYS B O   1 
ATOM   3919 C  CB  . LYS B 1 187 ? 24.773 -5.616  10.654  1.00 24.84  ? 183 LYS B CB  1 
ATOM   3920 C  CG  . LYS B 1 187 ? 23.923 -6.812  11.005  1.00 27.97  ? 183 LYS B CG  1 
ATOM   3921 C  CD  . LYS B 1 187 ? 23.579 -6.771  12.471  1.00 29.21  ? 183 LYS B CD  1 
ATOM   3922 C  CE  . LYS B 1 187 ? 22.783 -7.970  12.875  1.00 35.81  ? 183 LYS B CE  1 
ATOM   3923 N  NZ  . LYS B 1 187 ? 22.434 -7.840  14.306  1.00 37.96  ? 183 LYS B NZ  1 
ATOM   3924 N  N   . PRO B 1 188 ? 27.061 -6.867  8.780   1.00 35.27  ? 184 PRO B N   1 
ATOM   3925 C  CA  . PRO B 1 188 ? 27.815 -8.033  8.282   1.00 34.30  ? 184 PRO B CA  1 
ATOM   3926 C  C   . PRO B 1 188 ? 27.253 -9.398  8.627   1.00 33.32  ? 184 PRO B C   1 
ATOM   3927 O  O   . PRO B 1 188 ? 27.348 -10.327 7.848   1.00 31.73  ? 184 PRO B O   1 
ATOM   3928 C  CB  . PRO B 1 188 ? 29.205 -7.831  8.872   1.00 26.56  ? 184 PRO B CB  1 
ATOM   3929 C  CG  . PRO B 1 188 ? 29.292 -6.316  9.018   1.00 26.51  ? 184 PRO B CG  1 
ATOM   3930 C  CD  . PRO B 1 188 ? 27.938 -5.972  9.559   1.00 25.94  ? 184 PRO B CD  1 
ATOM   3931 N  N   . GLN B 1 189 ? 26.661 -9.515  9.800   1.00 23.92  ? 185 GLN B N   1 
ATOM   3932 C  CA  . GLN B 1 189 ? 26.095 -10.775 10.249  1.00 26.46  ? 185 GLN B CA  1 
ATOM   3933 C  C   . GLN B 1 189 ? 24.881 -11.236 9.431   1.00 26.19  ? 185 GLN B C   1 
ATOM   3934 O  O   . GLN B 1 189 ? 24.556 -12.421 9.416   1.00 26.29  ? 185 GLN B O   1 
ATOM   3935 C  CB  . GLN B 1 189 ? 25.757 -10.646 11.739  1.00 48.37  ? 185 GLN B CB  1 
ATOM   3936 C  CG  . GLN B 1 189 ? 24.900 -11.744 12.330  1.00 57.89  ? 185 GLN B CG  1 
ATOM   3937 C  CD  . GLN B 1 189 ? 25.469 -13.139 12.145  1.00 65.82  ? 185 GLN B CD  1 
ATOM   3938 O  OE1 . GLN B 1 189 ? 26.674 -13.314 11.955  1.00 69.59  ? 185 GLN B OE1 1 
ATOM   3939 N  NE2 . GLN B 1 189 ? 24.597 -14.147 12.224  1.00 65.61  ? 185 GLN B NE2 1 
ATOM   3940 N  N   . ASN B 1 190 ? 24.210 -10.315 8.743   1.00 43.16  ? 186 ASN B N   1 
ATOM   3941 C  CA  . ASN B 1 190 ? 23.053 -10.701 7.947   1.00 44.26  ? 186 ASN B CA  1 
ATOM   3942 C  C   . ASN B 1 190 ? 23.376 -10.775 6.451   1.00 42.62  ? 186 ASN B C   1 
ATOM   3943 O  O   . ASN B 1 190 ? 22.492 -10.679 5.600   1.00 42.29  ? 186 ASN B O   1 
ATOM   3944 C  CB  . ASN B 1 190 ? 21.894 -9.742  8.193   1.00 32.94  ? 186 ASN B CB  1 
ATOM   3945 C  CG  . ASN B 1 190 ? 21.331 -9.845  9.609   1.00 35.95  ? 186 ASN B CG  1 
ATOM   3946 O  OD1 . ASN B 1 190 ? 21.193 -10.937 10.173  1.00 32.77  ? 186 ASN B OD1 1 
ATOM   3947 N  ND2 . ASN B 1 190 ? 20.986 -8.705  10.181  1.00 31.38  ? 186 ASN B ND2 1 
ATOM   3948 N  N   . LEU B 1 191 ? 24.652 -10.960 6.139   1.00 28.00  ? 187 LEU B N   1 
ATOM   3949 C  CA  . LEU B 1 191 ? 25.109 -11.073 4.765   1.00 27.67  ? 187 LEU B CA  1 
ATOM   3950 C  C   . LEU B 1 191 ? 25.773 -12.436 4.602   1.00 28.87  ? 187 LEU B C   1 
ATOM   3951 O  O   . LEU B 1 191 ? 26.909 -12.617 5.008   1.00 27.65  ? 187 LEU B O   1 
ATOM   3952 C  CB  . LEU B 1 191 ? 26.109 -9.948  4.461   1.00 19.82  ? 187 LEU B CB  1 
ATOM   3953 C  CG  . LEU B 1 191 ? 25.532 -8.533  4.644   1.00 25.38  ? 187 LEU B CG  1 
ATOM   3954 C  CD1 . LEU B 1 191 ? 26.552 -7.503  4.214   1.00 21.77  ? 187 LEU B CD1 1 
ATOM   3955 C  CD2 . LEU B 1 191 ? 24.254 -8.365  3.802   1.00 22.29  ? 187 LEU B CD2 1 
ATOM   3956 N  N   . LEU B 1 192 ? 25.065 -13.397 4.022   1.00 31.47  ? 188 LEU B N   1 
ATOM   3957 C  CA  . LEU B 1 192 ? 25.605 -14.742 3.834   1.00 31.48  ? 188 LEU B CA  1 
ATOM   3958 C  C   . LEU B 1 192 ? 26.447 -14.880 2.562   1.00 31.40  ? 188 LEU B C   1 
ATOM   3959 O  O   . LEU B 1 192 ? 26.203 -14.195 1.562   1.00 29.20  ? 188 LEU B O   1 
ATOM   3960 C  CB  . LEU B 1 192 ? 24.464 -15.744 3.813   1.00 26.97  ? 188 LEU B CB  1 
ATOM   3961 C  CG  . LEU B 1 192 ? 23.524 -15.591 5.016   1.00 28.64  ? 188 LEU B CG  1 
ATOM   3962 C  CD1 . LEU B 1 192 ? 22.506 -16.711 4.990   1.00 26.66  ? 188 LEU B CD1 1 
ATOM   3963 C  CD2 . LEU B 1 192 ? 24.317 -15.619 6.329   1.00 29.14  ? 188 LEU B CD2 1 
ATOM   3964 N  N   . LEU B 1 193 ? 27.436 -15.772 2.609   1.00 29.65  ? 189 LEU B N   1 
ATOM   3965 C  CA  . LEU B 1 193 ? 28.344 -15.983 1.489   1.00 32.37  ? 189 LEU B CA  1 
ATOM   3966 C  C   . LEU B 1 193 ? 28.651 -17.428 1.199   1.00 30.68  ? 189 LEU B C   1 
ATOM   3967 O  O   . LEU B 1 193 ? 28.832 -18.225 2.110   1.00 29.68  ? 189 LEU B O   1 
ATOM   3968 C  CB  . LEU B 1 193 ? 29.699 -15.363 1.773   1.00 39.26  ? 189 LEU B CB  1 
ATOM   3969 C  CG  . LEU B 1 193 ? 29.923 -13.887 1.978   1.00 43.65  ? 189 LEU B CG  1 
ATOM   3970 C  CD1 . LEU B 1 193 ? 31.365 -13.714 2.403   1.00 43.91  ? 189 LEU B CD1 1 
ATOM   3971 C  CD2 . LEU B 1 193 ? 29.640 -13.124 0.693   1.00 45.87  ? 189 LEU B CD2 1 
ATOM   3972 N  N   . ASP B 1 194 ? 28.730 -17.771 -0.075  1.00 29.63  ? 190 ASP B N   1 
ATOM   3973 C  CA  . ASP B 1 194 ? 29.144 -19.110 -0.432  1.00 33.71  ? 190 ASP B CA  1 
ATOM   3974 C  C   . ASP B 1 194 ? 30.581 -18.814 -0.847  1.00 35.18  ? 190 ASP B C   1 
ATOM   3975 O  O   . ASP B 1 194 ? 30.803 -18.056 -1.795  1.00 34.21  ? 190 ASP B O   1 
ATOM   3976 C  CB  . ASP B 1 194 ? 28.377 -19.655 -1.621  1.00 45.39  ? 190 ASP B CB  1 
ATOM   3977 C  CG  . ASP B 1 194 ? 28.913 -20.985 -2.073  1.00 49.58  ? 190 ASP B CG  1 
ATOM   3978 O  OD1 . ASP B 1 194 ? 30.071 -21.026 -2.542  1.00 50.85  ? 190 ASP B OD1 1 
ATOM   3979 O  OD2 . ASP B 1 194 ? 28.190 -21.992 -1.945  1.00 52.58  ? 190 ASP B OD2 1 
ATOM   3980 N  N   . PRO B 1 195 ? 31.573 -19.399 -0.139  1.00 52.64  ? 191 PRO B N   1 
ATOM   3981 C  CA  . PRO B 1 195 ? 33.006 -19.210 -0.401  1.00 55.20  ? 191 PRO B CA  1 
ATOM   3982 C  C   . PRO B 1 195 ? 33.443 -19.491 -1.836  1.00 54.86  ? 191 PRO B C   1 
ATOM   3983 O  O   . PRO B 1 195 ? 34.145 -18.683 -2.443  1.00 57.76  ? 191 PRO B O   1 
ATOM   3984 C  CB  . PRO B 1 195 ? 33.672 -20.177 0.577   1.00 63.99  ? 191 PRO B CB  1 
ATOM   3985 C  CG  . PRO B 1 195 ? 32.659 -20.356 1.651   1.00 66.81  ? 191 PRO B CG  1 
ATOM   3986 C  CD  . PRO B 1 195 ? 31.379 -20.443 0.883   1.00 62.95  ? 191 PRO B CD  1 
ATOM   3987 N  N   . ASP B 1 196 ? 33.012 -20.628 -2.376  1.00 50.85  ? 192 ASP B N   1 
ATOM   3988 C  CA  . ASP B 1 196 ? 33.401 -21.032 -3.719  1.00 50.03  ? 192 ASP B CA  1 
ATOM   3989 C  C   . ASP B 1 196 ? 32.823 -20.239 -4.872  1.00 47.95  ? 192 ASP B C   1 
ATOM   3990 O  O   . ASP B 1 196 ? 33.510 -20.000 -5.861  1.00 47.70  ? 192 ASP B O   1 
ATOM   3991 C  CB  . ASP B 1 196 ? 33.079 -22.507 -3.949  1.00 62.71  ? 192 ASP B CB  1 
ATOM   3992 C  CG  . ASP B 1 196 ? 33.719 -23.411 -2.920  1.00 66.86  ? 192 ASP B CG  1 
ATOM   3993 O  OD1 . ASP B 1 196 ? 34.896 -23.190 -2.567  1.00 69.43  ? 192 ASP B OD1 1 
ATOM   3994 O  OD2 . ASP B 1 196 ? 33.043 -24.358 -2.468  1.00 69.51  ? 192 ASP B OD2 1 
ATOM   3995 N  N   . THR B 1 197 ? 31.569 -19.825 -4.767  1.00 39.00  ? 193 THR B N   1 
ATOM   3996 C  CA  . THR B 1 197 ? 30.959 -19.095 -5.869  1.00 37.47  ? 193 THR B CA  1 
ATOM   3997 C  C   . THR B 1 197 ? 30.946 -17.596 -5.722  1.00 35.12  ? 193 THR B C   1 
ATOM   3998 O  O   . THR B 1 197 ? 30.651 -16.895 -6.675  1.00 34.95  ? 193 THR B O   1 
ATOM   3999 C  CB  . THR B 1 197 ? 29.520 -19.546 -6.102  1.00 32.67  ? 193 THR B CB  1 
ATOM   4000 O  OG1 . THR B 1 197 ? 28.746 -19.262 -4.931  1.00 31.32  ? 193 THR B OG1 1 
ATOM   4001 C  CG2 . THR B 1 197 ? 29.470 -21.033 -6.401  1.00 31.06  ? 193 THR B CG2 1 
ATOM   4002 N  N   . ALA B 1 198 ? 31.254 -17.101 -4.536  1.00 36.04  ? 194 ALA B N   1 
ATOM   4003 C  CA  . ALA B 1 198 ? 31.273 -15.654 -4.296  1.00 37.44  ? 194 ALA B CA  1 
ATOM   4004 C  C   . ALA B 1 198 ? 29.865 -15.041 -4.360  1.00 38.28  ? 194 ALA B C   1 
ATOM   4005 O  O   . ALA B 1 198 ? 29.691 -13.834 -4.552  1.00 36.97  ? 194 ALA B O   1 
ATOM   4006 C  CB  . ALA B 1 198 ? 32.217 -14.948 -5.298  1.00 17.97  ? 194 ALA B CB  1 
ATOM   4007 N  N   . VAL B 1 199 ? 28.863 -15.893 -4.188  1.00 43.10  ? 195 VAL B N   1 
ATOM   4008 C  CA  . VAL B 1 199 ? 27.490 -15.445 -4.187  1.00 43.15  ? 195 VAL B CA  1 
ATOM   4009 C  C   . VAL B 1 199 ? 27.156 -14.937 -2.799  1.00 42.89  ? 195 VAL B C   1 
ATOM   4010 O  O   . VAL B 1 199 ? 27.531 -15.551 -1.798  1.00 43.43  ? 195 VAL B O   1 
ATOM   4011 C  CB  . VAL B 1 199 ? 26.544 -16.595 -4.559  1.00 21.81  ? 195 VAL B CB  1 
ATOM   4012 C  CG1 . VAL B 1 199 ? 25.123 -16.269 -4.146  1.00 21.12  ? 195 VAL B CG1 1 
ATOM   4013 C  CG2 . VAL B 1 199 ? 26.604 -16.819 -6.059  1.00 18.61  ? 195 VAL B CG2 1 
ATOM   4014 N  N   . LEU B 1 200 ? 26.466 -13.805 -2.743  1.00 39.33  ? 196 LEU B N   1 
ATOM   4015 C  CA  . LEU B 1 200 ? 26.074 -13.232 -1.470  1.00 37.35  ? 196 LEU B CA  1 
ATOM   4016 C  C   . LEU B 1 200 ? 24.557 -13.161 -1.375  1.00 35.87  ? 196 LEU B C   1 
ATOM   4017 O  O   . LEU B 1 200 ? 23.891 -12.803 -2.333  1.00 37.41  ? 196 LEU B O   1 
ATOM   4018 C  CB  . LEU B 1 200 ? 26.676 -11.832 -1.331  1.00 21.76  ? 196 LEU B CB  1 
ATOM   4019 C  CG  . LEU B 1 200 ? 26.355 -11.039 -0.066  1.00 24.23  ? 196 LEU B CG  1 
ATOM   4020 C  CD1 . LEU B 1 200 ? 27.419 -9.997  0.158   1.00 21.47  ? 196 LEU B CD1 1 
ATOM   4021 C  CD2 . LEU B 1 200 ? 24.979 -10.393 -0.200  1.00 21.02  ? 196 LEU B CD2 1 
ATOM   4022 N  N   . LYS B 1 201 ? 24.007 -13.509 -0.224  1.00 26.21  ? 197 LYS B N   1 
ATOM   4023 C  CA  . LYS B 1 201 ? 22.566 -13.456 -0.024  1.00 26.38  ? 197 LYS B CA  1 
ATOM   4024 C  C   . LYS B 1 201 ? 22.231 -12.682 1.257   1.00 27.33  ? 197 LYS B C   1 
ATOM   4025 O  O   . LYS B 1 201 ? 22.849 -12.888 2.302   1.00 24.40  ? 197 LYS B O   1 
ATOM   4026 C  CB  . LYS B 1 201 ? 21.994 -14.870 0.084   1.00 23.74  ? 197 LYS B CB  1 
ATOM   4027 C  CG  . LYS B 1 201 ? 21.911 -15.642 -1.232  1.00 28.27  ? 197 LYS B CG  1 
ATOM   4028 C  CD  . LYS B 1 201 ? 21.422 -17.058 -0.962  1.00 29.83  ? 197 LYS B CD  1 
ATOM   4029 C  CE  . LYS B 1 201 ? 21.486 -17.958 -2.196  1.00 30.20  ? 197 LYS B CE  1 
ATOM   4030 N  NZ  . LYS B 1 201 ? 20.366 -17.699 -3.133  1.00 35.83  ? 197 LYS B NZ  1 
ATOM   4031 N  N   . LEU B 1 202 ? 21.260 -11.784 1.173   1.00 27.76  ? 198 LEU B N   1 
ATOM   4032 C  CA  . LEU B 1 202 ? 20.827 -11.012 2.333   1.00 27.41  ? 198 LEU B CA  1 
ATOM   4033 C  C   . LEU B 1 202 ? 19.851 -11.881 3.132   1.00 28.37  ? 198 LEU B C   1 
ATOM   4034 O  O   . LEU B 1 202 ? 19.049 -12.623 2.558   1.00 28.12  ? 198 LEU B O   1 
ATOM   4035 C  CB  . LEU B 1 202 ? 20.137 -9.743  1.861   1.00 23.77  ? 198 LEU B CB  1 
ATOM   4036 C  CG  . LEU B 1 202 ? 19.454 -8.859  2.893   1.00 23.87  ? 198 LEU B CG  1 
ATOM   4037 C  CD1 . LEU B 1 202 ? 20.461 -8.379  3.899   1.00 21.12  ? 198 LEU B CD1 1 
ATOM   4038 C  CD2 . LEU B 1 202 ? 18.817 -7.675  2.179   1.00 25.56  ? 198 LEU B CD2 1 
ATOM   4039 N  N   . CYS B 1 203 ? 19.918 -11.822 4.453   1.00 23.20  ? 199 CYS B N   1 
ATOM   4040 C  CA  . CYS B 1 203 ? 19.007 -12.643 5.247   1.00 26.94  ? 199 CYS B CA  1 
ATOM   4041 C  C   . CYS B 1 203 ? 18.476 -11.908 6.471   1.00 26.85  ? 199 CYS B C   1 
ATOM   4042 O  O   . CYS B 1 203 ? 18.786 -10.731 6.697   1.00 25.32  ? 199 CYS B O   1 
ATOM   4043 C  CB  . CYS B 1 203 ? 19.697 -13.938 5.693   1.00 40.40  ? 199 CYS B CB  1 
ATOM   4044 S  SG  . CYS B 1 203 ? 21.077 -13.680 6.827   1.00 44.23  ? 199 CYS B SG  1 
ATOM   4045 N  N   . ASP B 1 204 ? 17.689 -12.638 7.256   1.00 30.64  ? 200 ASP B N   1 
ATOM   4046 C  CA  . ASP B 1 204 ? 17.055 -12.148 8.475   1.00 33.28  ? 200 ASP B CA  1 
ATOM   4047 C  C   . ASP B 1 204 ? 16.152 -10.953 8.220   1.00 33.57  ? 200 ASP B C   1 
ATOM   4048 O  O   . ASP B 1 204 ? 16.572 -9.798  8.335   1.00 34.94  ? 200 ASP B O   1 
ATOM   4049 C  CB  . ASP B 1 204 ? 18.086 -11.770 9.525   1.00 38.91  ? 200 ASP B CB  1 
ATOM   4050 C  CG  . ASP B 1 204 ? 17.518 -11.819 10.925  1.00 43.45  ? 200 ASP B CG  1 
ATOM   4051 O  OD1 . ASP B 1 204 ? 16.279 -11.964 11.060  1.00 44.22  ? 200 ASP B OD1 1 
ATOM   4052 O  OD2 . ASP B 1 204 ? 18.312 -11.713 11.890  1.00 45.86  ? 200 ASP B OD2 1 
ATOM   4053 N  N   . PHE B 1 205 ? 14.901 -11.239 7.881   1.00 35.31  ? 201 PHE B N   1 
ATOM   4054 C  CA  . PHE B 1 205 ? 13.934 -10.189 7.623   1.00 34.95  ? 201 PHE B CA  1 
ATOM   4055 C  C   . PHE B 1 205 ? 13.019 -9.937  8.811   1.00 33.55  ? 201 PHE B C   1 
ATOM   4056 O  O   . PHE B 1 205 ? 11.955 -9.358  8.669   1.00 34.60  ? 201 PHE B O   1 
ATOM   4057 C  CB  . PHE B 1 205 ? 13.128 -10.537 6.373   1.00 26.03  ? 201 PHE B CB  1 
ATOM   4058 C  CG  . PHE B 1 205 ? 13.896 -10.339 5.113   1.00 26.44  ? 201 PHE B CG  1 
ATOM   4059 C  CD1 . PHE B 1 205 ? 14.926 -11.201 4.781   1.00 27.36  ? 201 PHE B CD1 1 
ATOM   4060 C  CD2 . PHE B 1 205 ? 13.646 -9.236  4.300   1.00 25.75  ? 201 PHE B CD2 1 
ATOM   4061 C  CE1 . PHE B 1 205 ? 15.703 -10.975 3.660   1.00 25.65  ? 201 PHE B CE1 1 
ATOM   4062 C  CE2 . PHE B 1 205 ? 14.414 -8.984  3.170   1.00 27.27  ? 201 PHE B CE2 1 
ATOM   4063 C  CZ  . PHE B 1 205 ? 15.449 -9.855  2.844   1.00 27.36  ? 201 PHE B CZ  1 
ATOM   4064 N  N   . GLY B 1 206 ? 13.456 -10.362 9.989   1.00 30.71  ? 202 GLY B N   1 
ATOM   4065 C  CA  . GLY B 1 206 ? 12.664 -10.172 11.181  1.00 31.55  ? 202 GLY B CA  1 
ATOM   4066 C  C   . GLY B 1 206 ? 12.445 -8.719  11.578  1.00 31.80  ? 202 GLY B C   1 
ATOM   4067 O  O   . GLY B 1 206 ? 11.700 -8.456  12.510  1.00 32.29  ? 202 GLY B O   1 
ATOM   4068 N  N   . SER B 1 207 ? 13.070 -7.774  10.887  1.00 37.96  ? 203 SER B N   1 
ATOM   4069 C  CA  . SER B 1 207 ? 12.908 -6.361  11.225  1.00 38.97  ? 203 SER B CA  1 
ATOM   4070 C  C   . SER B 1 207 ? 12.420 -5.581  10.017  1.00 37.98  ? 203 SER B C   1 
ATOM   4071 O  O   . SER B 1 207 ? 12.195 -4.369  10.110  1.00 39.23  ? 203 SER B O   1 
ATOM   4072 C  CB  . SER B 1 207 ? 14.243 -5.739  11.677  1.00 45.03  ? 203 SER B CB  1 
ATOM   4073 O  OG  . SER B 1 207 ? 14.916 -6.533  12.639  1.00 49.83  ? 203 SER B OG  1 
ATOM   4074 N  N   . ALA B 1 208 ? 12.289 -6.271  8.883   1.00 32.20  ? 204 ALA B N   1 
ATOM   4075 C  CA  . ALA B 1 208 ? 11.855 -5.652  7.636   1.00 33.60  ? 204 ALA B CA  1 
ATOM   4076 C  C   . ALA B 1 208 ? 10.431 -5.127  7.743   1.00 34.66  ? 204 ALA B C   1 
ATOM   4077 O  O   . ALA B 1 208 ? 9.593  -5.716  8.416   1.00 34.30  ? 204 ALA B O   1 
ATOM   4078 C  CB  . ALA B 1 208 ? 11.956 -6.657  6.499   1.00 42.05  ? 204 ALA B CB  1 
ATOM   4079 N  N   . LYS B 1 209 ? 10.157 -4.018  7.073   1.00 36.24  ? 205 LYS B N   1 
ATOM   4080 C  CA  . LYS B 1 209 ? 8.828  -3.430  7.108   1.00 37.65  ? 205 LYS B CA  1 
ATOM   4081 C  C   . LYS B 1 209 ? 8.509  -2.524  5.901   1.00 37.64  ? 205 LYS B C   1 
ATOM   4082 O  O   . LYS B 1 209 ? 9.373  -1.813  5.369   1.00 36.18  ? 205 LYS B O   1 
ATOM   4083 C  CB  . LYS B 1 209 ? 8.657  -2.655  8.420   1.00 31.31  ? 205 LYS B CB  1 
ATOM   4084 C  CG  . LYS B 1 209 ? 7.459  -1.705  8.441   1.00 35.46  ? 205 LYS B CG  1 
ATOM   4085 C  CD  . LYS B 1 209 ? 6.700  -1.769  9.774   1.00 38.42  ? 205 LYS B CD  1 
ATOM   4086 C  CE  . LYS B 1 209 ? 5.558  -0.757  9.859   1.00 38.38  ? 205 LYS B CE  1 
ATOM   4087 N  NZ  . LYS B 1 209 ? 6.076  0.601   10.174  1.00 40.62  ? 205 LYS B NZ  1 
ATOM   4088 N  N   . GLN B 1 210 ? 7.258  -2.585  5.463   1.00 33.83  ? 206 GLN B N   1 
ATOM   4089 C  CA  . GLN B 1 210 ? 6.768  -1.770  4.358   1.00 35.91  ? 206 GLN B CA  1 
ATOM   4090 C  C   . GLN B 1 210 ? 6.713  -0.342  4.899   1.00 36.30  ? 206 GLN B C   1 
ATOM   4091 O  O   . GLN B 1 210 ? 5.927  -0.070  5.797   1.00 36.81  ? 206 GLN B O   1 
ATOM   4092 C  CB  . GLN B 1 210 ? 5.366  -2.255  3.988   1.00 69.50  ? 206 GLN B CB  1 
ATOM   4093 C  CG  . GLN B 1 210 ? 4.581  -1.351  3.065   1.00 74.49  ? 206 GLN B CG  1 
ATOM   4094 C  CD  . GLN B 1 210 ? 4.892  -1.601  1.621   1.00 78.15  ? 206 GLN B CD  1 
ATOM   4095 O  OE1 . GLN B 1 210 ? 4.861  -2.747  1.158   1.00 82.13  ? 206 GLN B OE1 1 
ATOM   4096 N  NE2 . GLN B 1 210 ? 5.191  -0.530  0.887   1.00 79.21  ? 206 GLN B NE2 1 
ATOM   4097 N  N   . LEU B 1 211 ? 7.553  0.560   4.400   1.00 36.36  ? 207 LEU B N   1 
ATOM   4098 C  CA  . LEU B 1 211 ? 7.527  1.949   4.891   1.00 39.25  ? 207 LEU B CA  1 
ATOM   4099 C  C   . LEU B 1 211 ? 6.627  2.839   4.025   1.00 42.62  ? 207 LEU B C   1 
ATOM   4100 O  O   . LEU B 1 211 ? 6.901  3.059   2.842   1.00 44.10  ? 207 LEU B O   1 
ATOM   4101 C  CB  . LEU B 1 211 ? 8.931  2.560   4.928   1.00 32.22  ? 207 LEU B CB  1 
ATOM   4102 C  CG  . LEU B 1 211 ? 10.058 1.978   5.799   1.00 30.64  ? 207 LEU B CG  1 
ATOM   4103 C  CD1 . LEU B 1 211 ? 11.218 2.986   5.817   1.00 27.26  ? 207 LEU B CD1 1 
ATOM   4104 C  CD2 . LEU B 1 211 ? 9.567  1.678   7.224   1.00 27.95  ? 207 LEU B CD2 1 
ATOM   4105 N  N   . VAL B 1 212 ? 5.567  3.362   4.638   1.00 66.32  ? 208 VAL B N   1 
ATOM   4106 C  CA  . VAL B 1 212 ? 4.588  4.203   3.952   1.00 67.77  ? 208 VAL B CA  1 
ATOM   4107 C  C   . VAL B 1 212 ? 4.673  5.690   4.290   1.00 68.60  ? 208 VAL B C   1 
ATOM   4108 O  O   . VAL B 1 212 ? 4.463  6.080   5.434   1.00 67.07  ? 208 VAL B O   1 
ATOM   4109 C  CB  . VAL B 1 212 ? 3.168  3.714   4.273   1.00 41.82  ? 208 VAL B CB  1 
ATOM   4110 C  CG1 . VAL B 1 212 ? 2.142  4.678   3.699   1.00 43.05  ? 208 VAL B CG1 1 
ATOM   4111 C  CG2 . VAL B 1 212 ? 2.975  2.296   3.727   1.00 40.01  ? 208 VAL B CG2 1 
ATOM   4112 N  N   . ARG B 1 213 ? 4.958  6.516   3.285   1.00 72.50  ? 209 ARG B N   1 
ATOM   4113 C  CA  . ARG B 1 213 ? 5.073  7.963   3.474   1.00 75.15  ? 209 ARG B CA  1 
ATOM   4114 C  C   . ARG B 1 213 ? 3.866  8.436   4.273   1.00 74.31  ? 209 ARG B C   1 
ATOM   4115 O  O   . ARG B 1 213 ? 2.726  8.298   3.831   1.00 72.25  ? 209 ARG B O   1 
ATOM   4116 C  CB  . ARG B 1 213 ? 5.120  8.658   2.111   1.00 102.27 ? 209 ARG B CB  1 
ATOM   4117 C  CG  . ARG B 1 213 ? 5.780  10.029  2.097   1.00 107.88 ? 209 ARG B CG  1 
ATOM   4118 C  CD  . ARG B 1 213 ? 6.041  10.449  0.649   1.00 113.59 ? 209 ARG B CD  1 
ATOM   4119 N  NE  . ARG B 1 213 ? 6.796  11.698  0.521   1.00 117.46 ? 209 ARG B NE  1 
ATOM   4120 C  CZ  . ARG B 1 213 ? 7.264  12.174  -0.634  1.00 119.99 ? 209 ARG B CZ  1 
ATOM   4121 N  NH1 . ARG B 1 213 ? 7.058  11.510  -1.766  1.00 120.53 ? 209 ARG B NH1 1 
ATOM   4122 N  NH2 . ARG B 1 213 ? 7.945  13.313  -0.662  1.00 120.59 ? 209 ARG B NH2 1 
ATOM   4123 N  N   . GLY B 1 214 ? 4.116  8.971   5.463   1.00 50.26  ? 210 GLY B N   1 
ATOM   4124 C  CA  . GLY B 1 214 ? 3.022  9.431   6.290   1.00 50.34  ? 210 GLY B CA  1 
ATOM   4125 C  C   . GLY B 1 214 ? 2.849  8.644   7.573   1.00 50.19  ? 210 GLY B C   1 
ATOM   4126 O  O   . GLY B 1 214 ? 2.405  9.192   8.581   1.00 51.19  ? 210 GLY B O   1 
ATOM   4127 N  N   . GLU B 1 215 ? 3.179  7.358   7.551   1.00 62.93  ? 211 GLU B N   1 
ATOM   4128 C  CA  . GLU B 1 215 ? 3.053  6.548   8.757   1.00 62.66  ? 211 GLU B CA  1 
ATOM   4129 C  C   . GLU B 1 215 ? 4.365  6.634   9.540   1.00 61.10  ? 211 GLU B C   1 
ATOM   4130 O  O   . GLU B 1 215 ? 5.427  6.857   8.968   1.00 59.82  ? 211 GLU B O   1 
ATOM   4131 C  CB  . GLU B 1 215 ? 2.746  5.097   8.401   1.00 69.75  ? 211 GLU B CB  1 
ATOM   4132 C  CG  . GLU B 1 215 ? 1.600  4.934   7.418   1.00 74.71  ? 211 GLU B CG  1 
ATOM   4133 C  CD  . GLU B 1 215 ? 1.316  3.479   7.079   1.00 77.63  ? 211 GLU B CD  1 
ATOM   4134 O  OE1 . GLU B 1 215 ? 2.280  2.709   6.854   1.00 79.56  ? 211 GLU B OE1 1 
ATOM   4135 O  OE2 . GLU B 1 215 ? 0.124  3.107   7.027   1.00 79.21  ? 211 GLU B OE2 1 
ATOM   4136 N  N   . PRO B 1 216 ? 4.303  6.508   10.869  1.00 67.96  ? 212 PRO B N   1 
ATOM   4137 C  CA  . PRO B 1 216 ? 5.540  6.585   11.652  1.00 64.82  ? 212 PRO B CA  1 
ATOM   4138 C  C   . PRO B 1 216 ? 6.136  5.208   11.887  1.00 61.52  ? 212 PRO B C   1 
ATOM   4139 O  O   . PRO B 1 216 ? 5.436  4.205   11.832  1.00 58.33  ? 212 PRO B O   1 
ATOM   4140 C  CB  . PRO B 1 216 ? 5.086  7.231   12.965  1.00 49.61  ? 212 PRO B CB  1 
ATOM   4141 C  CG  . PRO B 1 216 ? 3.768  7.873   12.615  1.00 52.31  ? 212 PRO B CG  1 
ATOM   4142 C  CD  . PRO B 1 216 ? 3.151  6.860   11.709  1.00 51.94  ? 212 PRO B CD  1 
ATOM   4143 N  N   . ASN B 1 217 ? 7.430  5.165   12.163  1.00 45.05  ? 213 ASN B N   1 
ATOM   4144 C  CA  . ASN B 1 217 ? 8.099  3.898   12.418  1.00 43.21  ? 213 ASN B CA  1 
ATOM   4145 C  C   . ASN B 1 217 ? 9.023  4.047   13.611  1.00 41.92  ? 213 ASN B C   1 
ATOM   4146 O  O   . ASN B 1 217 ? 9.620  5.120   13.816  1.00 41.60  ? 213 ASN B O   1 
ATOM   4147 C  CB  . ASN B 1 217 ? 8.906  3.484   11.199  1.00 33.86  ? 213 ASN B CB  1 
ATOM   4148 C  CG  . ASN B 1 217 ? 8.065  3.431   9.954   1.00 35.68  ? 213 ASN B CG  1 
ATOM   4149 O  OD1 . ASN B 1 217 ? 7.235  2.526   9.798   1.00 34.83  ? 213 ASN B OD1 1 
ATOM   4150 N  ND2 . ASN B 1 217 ? 8.257  4.417   9.057   1.00 33.73  ? 213 ASN B ND2 1 
ATOM   4151 N  N   . VAL B 1 218 ? 9.135  2.974   14.396  1.00 31.97  ? 214 VAL B N   1 
ATOM   4152 C  CA  . VAL B 1 218 ? 9.985  2.986   15.572  1.00 31.16  ? 214 VAL B CA  1 
ATOM   4153 C  C   . VAL B 1 218 ? 11.412 3.321   15.151  1.00 31.50  ? 214 VAL B C   1 
ATOM   4154 O  O   . VAL B 1 218 ? 11.835 2.985   14.034  1.00 30.71  ? 214 VAL B O   1 
ATOM   4155 C  CB  . VAL B 1 218 ? 9.945  1.623   16.283  1.00 28.88  ? 214 VAL B CB  1 
ATOM   4156 C  CG1 . VAL B 1 218 ? 8.510  1.284   16.641  1.00 31.17  ? 214 VAL B CG1 1 
ATOM   4157 C  CG2 . VAL B 1 218 ? 10.552 0.548   15.399  1.00 28.19  ? 214 VAL B CG2 1 
ATOM   4158 N  N   . SER B 1 219 ? 12.157 3.991   16.024  1.00 46.47  ? 215 SER B N   1 
ATOM   4159 C  CA  . SER B 1 219 ? 13.516 4.356   15.671  1.00 48.89  ? 215 SER B CA  1 
ATOM   4160 C  C   . SER B 1 219 ? 14.564 3.555   16.428  1.00 47.93  ? 215 SER B C   1 
ATOM   4161 O  O   . SER B 1 219 ? 15.763 3.844   16.349  1.00 48.30  ? 215 SER B O   1 
ATOM   4162 C  CB  . SER B 1 219 ? 13.723 5.844   15.909  1.00 36.59  ? 215 SER B CB  1 
ATOM   4163 O  OG  . SER B 1 219 ? 13.550 6.134   17.276  1.00 39.95  ? 215 SER B OG  1 
ATOM   4164 N  N   . TYR B 1 220 ? 14.119 2.550   17.170  1.00 43.98  ? 216 TYR B N   1 
ATOM   4165 C  CA  . TYR B 1 220 ? 15.060 1.732   17.908  1.00 43.84  ? 216 TYR B CA  1 
ATOM   4166 C  C   . TYR B 1 220 ? 15.456 0.458   17.161  1.00 43.98  ? 216 TYR B C   1 
ATOM   4167 O  O   . TYR B 1 220 ? 15.916 -0.510  17.767  1.00 43.49  ? 216 TYR B O   1 
ATOM   4168 C  CB  . TYR B 1 220 ? 14.517 1.409   19.302  1.00 43.45  ? 216 TYR B CB  1 
ATOM   4169 C  CG  . TYR B 1 220 ? 13.117 0.882   19.323  1.00 44.22  ? 216 TYR B CG  1 
ATOM   4170 C  CD1 . TYR B 1 220 ? 12.855 -0.466  19.113  1.00 46.31  ? 216 TYR B CD1 1 
ATOM   4171 C  CD2 . TYR B 1 220 ? 12.044 1.739   19.558  1.00 43.90  ? 216 TYR B CD2 1 
ATOM   4172 C  CE1 . TYR B 1 220 ? 11.551 -0.954  19.140  1.00 46.07  ? 216 TYR B CE1 1 
ATOM   4173 C  CE2 . TYR B 1 220 ? 10.734 1.271   19.586  1.00 44.12  ? 216 TYR B CE2 1 
ATOM   4174 C  CZ  . TYR B 1 220 ? 10.489 -0.075  19.376  1.00 46.77  ? 216 TYR B CZ  1 
ATOM   4175 O  OH  . TYR B 1 220 ? 9.185  -0.539  19.390  1.00 50.80  ? 216 TYR B OH  1 
ATOM   4176 N  N   . ILE B 1 221 ? 15.284 0.459   15.841  1.00 38.70  ? 217 ILE B N   1 
ATOM   4177 C  CA  . ILE B 1 221 ? 15.681 -0.703  15.048  1.00 36.66  ? 217 ILE B CA  1 
ATOM   4178 C  C   . ILE B 1 221 ? 17.102 -0.451  14.553  1.00 35.49  ? 217 ILE B C   1 
ATOM   4179 O  O   . ILE B 1 221 ? 17.616 0.665   14.683  1.00 35.91  ? 217 ILE B O   1 
ATOM   4180 C  CB  . ILE B 1 221 ? 14.743 -0.965  13.796  1.00 34.93  ? 217 ILE B CB  1 
ATOM   4181 C  CG1 . ILE B 1 221 ? 14.296 0.347   13.166  1.00 32.35  ? 217 ILE B CG1 1 
ATOM   4182 C  CG2 . ILE B 1 221 ? 13.551 -1.817  14.194  1.00 32.76  ? 217 ILE B CG2 1 
ATOM   4183 C  CD1 . ILE B 1 221 ? 15.322 1.001   12.314  1.00 30.46  ? 217 ILE B CD1 1 
ATOM   4184 N  N   . CYS B 1 222 ? 17.737 -1.496  14.022  1.00 36.71  ? 218 CYS B N   1 
ATOM   4185 C  CA  . CYS B 1 222 ? 19.085 -1.397  13.473  1.00 36.24  ? 218 CYS B CA  1 
ATOM   4186 C  C   . CYS B 1 222 ? 20.182 -1.502  14.532  1.00 36.95  ? 218 CYS B C   1 
ATOM   4187 O  O   . CYS B 1 222 ? 20.119 -0.842  15.554  1.00 35.05  ? 218 CYS B O   1 
ATOM   4188 C  CB  . CYS B 1 222 ? 19.200 -0.093  12.697  1.00 56.76  ? 218 CYS B CB  1 
ATOM   4189 S  SG  . CYS B 1 222 ? 20.484 -0.084  11.503  1.00 59.97  ? 218 CYS B SG  1 
ATOM   4190 N  N   . SER B 1 223 ? 21.193 -2.328  14.271  1.00 40.40  ? 219 SER B N   1 
ATOM   4191 C  CA  . SER B 1 223 ? 22.298 -2.574  15.203  1.00 43.73  ? 219 SER B CA  1 
ATOM   4192 C  C   . SER B 1 223 ? 23.316 -1.454  15.314  1.00 41.51  ? 219 SER B C   1 
ATOM   4193 O  O   . SER B 1 223 ? 23.476 -0.669  14.386  1.00 40.83  ? 219 SER B O   1 
ATOM   4194 C  CB  . SER B 1 223 ? 23.030 -3.852  14.802  1.00 47.96  ? 219 SER B CB  1 
ATOM   4195 O  OG  . SER B 1 223 ? 22.114 -4.907  14.580  1.00 52.22  ? 219 SER B OG  1 
ATOM   4196 N  N   . ARG B 1 224 ? 24.033 -1.414  16.443  1.00 50.85  ? 220 ARG B N   1 
ATOM   4197 C  CA  . ARG B 1 224 ? 25.048 -0.385  16.698  1.00 52.46  ? 220 ARG B CA  1 
ATOM   4198 C  C   . ARG B 1 224 ? 26.192 -0.397  15.678  1.00 52.35  ? 220 ARG B C   1 
ATOM   4199 O  O   . ARG B 1 224 ? 26.634 -1.463  15.248  1.00 52.58  ? 220 ARG B O   1 
ATOM   4200 C  CB  . ARG B 1 224 ? 25.607 -0.530  18.127  1.00 67.71  ? 220 ARG B CB  1 
ATOM   4201 C  CG  . ARG B 1 224 ? 26.707 -1.577  18.333  1.00 74.61  ? 220 ARG B CG  1 
ATOM   4202 C  CD  . ARG B 1 224 ? 27.129 -1.648  19.813  1.00 81.85  ? 220 ARG B CD  1 
ATOM   4203 N  NE  . ARG B 1 224 ? 28.476 -2.191  20.047  1.00 86.70  ? 220 ARG B NE  1 
ATOM   4204 C  CZ  . ARG B 1 224 ? 28.913 -3.384  19.635  1.00 88.52  ? 220 ARG B CZ  1 
ATOM   4205 N  NH1 . ARG B 1 224 ? 28.124 -4.202  18.942  1.00 89.24  ? 220 ARG B NH1 1 
ATOM   4206 N  NH2 . ARG B 1 224 ? 30.146 -3.774  19.937  1.00 88.11  ? 220 ARG B NH2 1 
ATOM   4207 N  N   . TYR B 1 225 ? 26.655 0.800   15.309  1.00 51.34  ? 221 TYR B N   1 
ATOM   4208 C  CA  . TYR B 1 225 ? 27.736 1.015   14.323  1.00 51.91  ? 221 TYR B CA  1 
ATOM   4209 C  C   . TYR B 1 225 ? 27.178 1.229   12.922  1.00 51.25  ? 221 TYR B C   1 
ATOM   4210 O  O   . TYR B 1 225 ? 27.798 1.898   12.106  1.00 50.64  ? 221 TYR B O   1 
ATOM   4211 C  CB  . TYR B 1 225 ? 28.684 -0.175  14.176  1.00 37.24  ? 221 TYR B CB  1 
ATOM   4212 C  CG  . TYR B 1 225 ? 29.505 -0.582  15.352  1.00 41.69  ? 221 TYR B CG  1 
ATOM   4213 C  CD1 . TYR B 1 225 ? 30.283 -1.735  15.281  1.00 43.33  ? 221 TYR B CD1 1 
ATOM   4214 C  CD2 . TYR B 1 225 ? 29.490 0.144   16.542  1.00 44.81  ? 221 TYR B CD2 1 
ATOM   4215 C  CE1 . TYR B 1 225 ? 31.023 -2.169  16.357  1.00 46.28  ? 221 TYR B CE1 1 
ATOM   4216 C  CE2 . TYR B 1 225 ? 30.238 -0.279  17.646  1.00 47.83  ? 221 TYR B CE2 1 
ATOM   4217 C  CZ  . TYR B 1 225 ? 31.001 -1.439  17.540  1.00 47.32  ? 221 TYR B CZ  1 
ATOM   4218 O  OH  . TYR B 1 225 ? 31.753 -1.877  18.600  1.00 51.31  ? 221 TYR B OH  1 
ATOM   4219 N  N   . TYR B 1 226 ? 26.022 0.626   12.646  1.00 38.10  ? 222 TYR B N   1 
ATOM   4220 C  CA  . TYR B 1 226 ? 25.405 0.711   11.328  1.00 39.52  ? 222 TYR B CA  1 
ATOM   4221 C  C   . TYR B 1 226 ? 24.175 1.598   11.240  1.00 39.55  ? 222 TYR B C   1 
ATOM   4222 O  O   . TYR B 1 226 ? 23.600 1.736   10.167  1.00 39.47  ? 222 TYR B O   1 
ATOM   4223 C  CB  . TYR B 1 226 ? 25.057 -0.707  10.861  1.00 33.66  ? 222 TYR B CB  1 
ATOM   4224 C  CG  . TYR B 1 226 ? 26.237 -1.640  10.979  1.00 34.44  ? 222 TYR B CG  1 
ATOM   4225 C  CD1 . TYR B 1 226 ? 27.324 -1.533  10.107  1.00 34.85  ? 222 TYR B CD1 1 
ATOM   4226 C  CD2 . TYR B 1 226 ? 26.310 -2.564  12.010  1.00 34.87  ? 222 TYR B CD2 1 
ATOM   4227 C  CE1 . TYR B 1 226 ? 28.460 -2.318  10.268  1.00 35.86  ? 222 TYR B CE1 1 
ATOM   4228 C  CE2 . TYR B 1 226 ? 27.447 -3.359  12.186  1.00 36.10  ? 222 TYR B CE2 1 
ATOM   4229 C  CZ  . TYR B 1 226 ? 28.520 -3.229  11.313  1.00 37.52  ? 222 TYR B CZ  1 
ATOM   4230 O  OH  . TYR B 1 226 ? 29.656 -3.989  11.503  1.00 37.55  ? 222 TYR B OH  1 
ATOM   4231 N  N   . ARG B 1 227 ? 23.780 2.204   12.354  1.00 29.99  ? 223 ARG B N   1 
ATOM   4232 C  CA  . ARG B 1 227 ? 22.585 3.035   12.367  1.00 31.52  ? 223 ARG B CA  1 
ATOM   4233 C  C   . ARG B 1 227 ? 22.827 4.395   11.731  1.00 30.73  ? 223 ARG B C   1 
ATOM   4234 O  O   . ARG B 1 227 ? 23.820 5.060   12.033  1.00 29.38  ? 223 ARG B O   1 
ATOM   4235 C  CB  . ARG B 1 227 ? 22.074 3.245   13.796  1.00 28.60  ? 223 ARG B CB  1 
ATOM   4236 C  CG  . ARG B 1 227 ? 22.247 2.065   14.721  1.00 36.54  ? 223 ARG B CG  1 
ATOM   4237 C  CD  . ARG B 1 227 ? 21.038 1.870   15.592  1.00 39.63  ? 223 ARG B CD  1 
ATOM   4238 N  NE  . ARG B 1 227 ? 20.780 2.998   16.471  1.00 42.94  ? 223 ARG B NE  1 
ATOM   4239 C  CZ  . ARG B 1 227 ? 19.555 3.400   16.791  1.00 42.37  ? 223 ARG B CZ  1 
ATOM   4240 N  NH1 . ARG B 1 227 ? 18.502 2.762   16.288  1.00 39.81  ? 223 ARG B NH1 1 
ATOM   4241 N  NH2 . ARG B 1 227 ? 19.383 4.423   17.617  1.00 41.74  ? 223 ARG B NH2 1 
ATOM   4242 N  N   . ALA B 1 228 ? 21.914 4.796   10.850  1.00 31.40  ? 224 ALA B N   1 
ATOM   4243 C  CA  . ALA B 1 228 ? 22.009 6.080   10.179  1.00 32.97  ? 224 ALA B CA  1 
ATOM   4244 C  C   . ALA B 1 228 ? 21.766 7.179   11.204  1.00 32.01  ? 224 ALA B C   1 
ATOM   4245 O  O   . ALA B 1 228 ? 21.027 6.975   12.170  1.00 32.00  ? 224 ALA B O   1 
ATOM   4246 C  CB  . ALA B 1 228 ? 20.980 6.162   9.067   1.00 41.93  ? 224 ALA B CB  1 
ATOM   4247 N  N   . PRO B 1 229 ? 22.381 8.359   11.006  1.00 34.14  ? 225 PRO B N   1 
ATOM   4248 C  CA  . PRO B 1 229 ? 22.244 9.511   11.910  1.00 35.14  ? 225 PRO B CA  1 
ATOM   4249 C  C   . PRO B 1 229 ? 20.802 9.813   12.345  1.00 34.53  ? 225 PRO B C   1 
ATOM   4250 O  O   . PRO B 1 229 ? 20.525 9.963   13.535  1.00 35.96  ? 225 PRO B O   1 
ATOM   4251 C  CB  . PRO B 1 229 ? 22.847 10.651  11.102  1.00 39.41  ? 225 PRO B CB  1 
ATOM   4252 C  CG  . PRO B 1 229 ? 23.896 9.963   10.296  1.00 40.41  ? 225 PRO B CG  1 
ATOM   4253 C  CD  . PRO B 1 229 ? 23.195 8.710   9.828   1.00 38.51  ? 225 PRO B CD  1 
ATOM   4254 N  N   . GLU B 1 230 ? 19.883 9.898   11.386  1.00 38.50  ? 226 GLU B N   1 
ATOM   4255 C  CA  . GLU B 1 230 ? 18.490 10.184  11.715  1.00 39.35  ? 226 GLU B CA  1 
ATOM   4256 C  C   . GLU B 1 230 ? 17.915 9.171   12.712  1.00 39.34  ? 226 GLU B C   1 
ATOM   4257 O  O   . GLU B 1 230 ? 16.996 9.496   13.473  1.00 39.27  ? 226 GLU B O   1 
ATOM   4258 C  CB  . GLU B 1 230 ? 17.607 10.244  10.447  1.00 36.93  ? 226 GLU B CB  1 
ATOM   4259 C  CG  . GLU B 1 230 ? 17.561 8.982   9.593   1.00 36.91  ? 226 GLU B CG  1 
ATOM   4260 C  CD  . GLU B 1 230 ? 18.654 8.937   8.538   1.00 37.63  ? 226 GLU B CD  1 
ATOM   4261 O  OE1 . GLU B 1 230 ? 19.800 9.379   8.826   1.00 37.28  ? 226 GLU B OE1 1 
ATOM   4262 O  OE2 . GLU B 1 230 ? 18.374 8.451   7.418   1.00 36.36  ? 226 GLU B OE2 1 
ATOM   4263 N  N   . LEU B 1 231 ? 18.433 7.945   12.710  1.00 41.10  ? 227 LEU B N   1 
ATOM   4264 C  CA  . LEU B 1 231 ? 17.950 6.951   13.664  1.00 40.87  ? 227 LEU B CA  1 
ATOM   4265 C  C   . LEU B 1 231 ? 18.503 7.287   15.061  1.00 40.41  ? 227 LEU B C   1 
ATOM   4266 O  O   . LEU B 1 231 ? 17.795 7.173   16.068  1.00 37.95  ? 227 LEU B O   1 
ATOM   4267 C  CB  . LEU B 1 231 ? 18.376 5.531   13.262  1.00 31.96  ? 227 LEU B CB  1 
ATOM   4268 C  CG  . LEU B 1 231 ? 17.640 4.908   12.081  1.00 33.92  ? 227 LEU B CG  1 
ATOM   4269 C  CD1 . LEU B 1 231 ? 18.060 3.441   11.918  1.00 27.94  ? 227 LEU B CD1 1 
ATOM   4270 C  CD2 . LEU B 1 231 ? 16.143 5.014   12.318  1.00 29.56  ? 227 LEU B CD2 1 
ATOM   4271 N  N   . ILE B 1 232 ? 19.767 7.702   15.109  1.00 34.74  ? 228 ILE B N   1 
ATOM   4272 C  CA  . ILE B 1 232 ? 20.384 8.063   16.366  1.00 35.71  ? 228 ILE B CA  1 
ATOM   4273 C  C   . ILE B 1 232 ? 19.639 9.261   16.964  1.00 36.92  ? 228 ILE B C   1 
ATOM   4274 O  O   . ILE B 1 232 ? 19.388 9.292   18.159  1.00 34.37  ? 228 ILE B O   1 
ATOM   4275 C  CB  . ILE B 1 232 ? 21.868 8.414   16.184  1.00 30.60  ? 228 ILE B CB  1 
ATOM   4276 C  CG1 . ILE B 1 232 ? 22.647 7.194   15.671  1.00 31.67  ? 228 ILE B CG1 1 
ATOM   4277 C  CG2 . ILE B 1 232 ? 22.452 8.840   17.514  1.00 29.34  ? 228 ILE B CG2 1 
ATOM   4278 C  CD1 . ILE B 1 232 ? 24.115 7.478   15.332  1.00 27.89  ? 228 ILE B CD1 1 
ATOM   4279 N  N   . PHE B 1 233 ? 19.292 10.245  16.136  1.00 32.79  ? 229 PHE B N   1 
ATOM   4280 C  CA  . PHE B 1 233 ? 18.548 11.414  16.606  1.00 35.80  ? 229 PHE B CA  1 
ATOM   4281 C  C   . PHE B 1 233 ? 17.080 11.064  16.867  1.00 37.45  ? 229 PHE B C   1 
ATOM   4282 O  O   . PHE B 1 233 ? 16.244 11.955  16.970  1.00 38.95  ? 229 PHE B O   1 
ATOM   4283 C  CB  . PHE B 1 233 ? 18.574 12.553  15.580  1.00 34.09  ? 229 PHE B CB  1 
ATOM   4284 C  CG  . PHE B 1 233 ? 19.904 13.203  15.413  1.00 36.80  ? 229 PHE B CG  1 
ATOM   4285 C  CD1 . PHE B 1 233 ? 20.529 13.815  16.479  1.00 38.27  ? 229 PHE B CD1 1 
ATOM   4286 C  CD2 . PHE B 1 233 ? 20.526 13.231  14.175  1.00 38.65  ? 229 PHE B CD2 1 
ATOM   4287 C  CE1 . PHE B 1 233 ? 21.762 14.453  16.324  1.00 40.12  ? 229 PHE B CE1 1 
ATOM   4288 C  CE2 . PHE B 1 233 ? 21.761 13.865  14.003  1.00 39.75  ? 229 PHE B CE2 1 
ATOM   4289 C  CZ  . PHE B 1 233 ? 22.377 14.477  15.083  1.00 39.33  ? 229 PHE B CZ  1 
ATOM   4290 N  N   . GLY B 1 234 ? 16.750 9.781   16.933  1.00 57.44  ? 230 GLY B N   1 
ATOM   4291 C  CA  . GLY B 1 234 ? 15.374 9.389   17.216  1.00 55.46  ? 230 GLY B CA  1 
ATOM   4292 C  C   . GLY B 1 234 ? 14.262 9.639   16.202  1.00 56.18  ? 230 GLY B C   1 
ATOM   4293 O  O   . GLY B 1 234 ? 13.082 9.507   16.537  1.00 55.41  ? 230 GLY B O   1 
ATOM   4294 N  N   . ALA B 1 235 ? 14.612 9.983   14.968  1.00 40.97  ? 231 ALA B N   1 
ATOM   4295 C  CA  . ALA B 1 235 ? 13.610 10.230  13.929  1.00 38.59  ? 231 ALA B CA  1 
ATOM   4296 C  C   . ALA B 1 235 ? 12.645 9.062   13.723  1.00 39.11  ? 231 ALA B C   1 
ATOM   4297 O  O   . ALA B 1 235 ? 13.037 7.909   13.829  1.00 39.01  ? 231 ALA B O   1 
ATOM   4298 C  CB  . ALA B 1 235 ? 14.312 10.541  12.615  1.00 23.63  ? 231 ALA B CB  1 
ATOM   4299 N  N   . THR B 1 236 ? 11.384 9.346   13.421  1.00 60.53  ? 232 THR B N   1 
ATOM   4300 C  CA  . THR B 1 236 ? 10.427 8.263   13.178  1.00 60.62  ? 232 THR B CA  1 
ATOM   4301 C  C   . THR B 1 236 ? 9.831  8.344   11.780  1.00 60.40  ? 232 THR B C   1 
ATOM   4302 O  O   . THR B 1 236 ? 8.990  7.516   11.410  1.00 58.24  ? 232 THR B O   1 
ATOM   4303 C  CB  . THR B 1 236 ? 9.263  8.270   14.178  1.00 54.78  ? 232 THR B CB  1 
ATOM   4304 O  OG1 . THR B 1 236 ? 8.557  9.510   14.074  1.00 57.92  ? 232 THR B OG1 1 
ATOM   4305 C  CG2 . THR B 1 236 ? 9.772  8.071   15.591  1.00 55.23  ? 232 THR B CG2 1 
ATOM   4306 N  N   . ASP B 1 237 ? 10.272 9.342   11.012  1.00 42.22  ? 233 ASP B N   1 
ATOM   4307 C  CA  . ASP B 1 237 ? 9.809  9.555   9.636   1.00 45.66  ? 233 ASP B CA  1 
ATOM   4308 C  C   . ASP B 1 237 ? 10.903 9.206   8.611   1.00 45.16  ? 233 ASP B C   1 
ATOM   4309 O  O   . ASP B 1 237 ? 10.943 9.785   7.515   1.00 44.64  ? 233 ASP B O   1 
ATOM   4310 C  CB  . ASP B 1 237 ? 9.438  11.014  9.434   1.00 49.40  ? 233 ASP B CB  1 
ATOM   4311 C  CG  . ASP B 1 237 ? 10.641 11.925  9.554   1.00 54.21  ? 233 ASP B CG  1 
ATOM   4312 O  OD1 . ASP B 1 237 ? 10.628 13.019  8.950   1.00 58.04  ? 233 ASP B OD1 1 
ATOM   4313 O  OD2 . ASP B 1 237 ? 11.605 11.548  10.264  1.00 56.95  ? 233 ASP B OD2 1 
ATOM   4314 N  N   . TYR B 1 238 ? 11.786 8.273   8.968   1.00 47.97  ? 234 TYR B N   1 
ATOM   4315 C  CA  . TYR B 1 238 ? 12.884 7.877   8.094   1.00 46.72  ? 234 TYR B CA  1 
ATOM   4316 C  C   . TYR B 1 238 ? 12.436 7.047   6.887   1.00 45.26  ? 234 TYR B C   1 
ATOM   4317 O  O   . TYR B 1 238 ? 11.396 6.387   6.916   1.00 43.62  ? 234 TYR B O   1 
ATOM   4318 C  CB  . TYR B 1 238 ? 13.925 7.109   8.909   1.00 33.75  ? 234 TYR B CB  1 
ATOM   4319 C  CG  . TYR B 1 238 ? 13.388 5.862   9.574   1.00 32.31  ? 234 TYR B CG  1 
ATOM   4320 C  CD1 . TYR B 1 238 ? 13.260 4.665   8.872   1.00 31.09  ? 234 TYR B CD1 1 
ATOM   4321 C  CD2 . TYR B 1 238 ? 12.982 5.886   10.906  1.00 31.87  ? 234 TYR B CD2 1 
ATOM   4322 C  CE1 . TYR B 1 238 ? 12.735 3.515   9.496   1.00 30.23  ? 234 TYR B CE1 1 
ATOM   4323 C  CE2 . TYR B 1 238 ? 12.454 4.742   11.539  1.00 30.37  ? 234 TYR B CE2 1 
ATOM   4324 C  CZ  . TYR B 1 238 ? 12.334 3.566   10.838  1.00 29.92  ? 234 TYR B CZ  1 
ATOM   4325 O  OH  . TYR B 1 238 ? 11.833 2.457   11.482  1.00 29.42  ? 234 TYR B OH  1 
ATOM   4326 N  N   . THR B 1 239 ? 13.232 7.091   5.824   1.00 44.53  ? 235 THR B N   1 
ATOM   4327 C  CA  . THR B 1 239 ? 12.943 6.349   4.598   1.00 44.50  ? 235 THR B CA  1 
ATOM   4328 C  C   . THR B 1 239 ? 13.887 5.169   4.433   1.00 43.83  ? 235 THR B C   1 
ATOM   4329 O  O   . THR B 1 239 ? 14.717 4.900   5.291   1.00 41.69  ? 235 THR B O   1 
ATOM   4330 C  CB  . THR B 1 239 ? 13.093 7.242   3.359   1.00 27.88  ? 235 THR B CB  1 
ATOM   4331 O  OG1 . THR B 1 239 ? 14.468 7.619   3.190   1.00 27.01  ? 235 THR B OG1 1 
ATOM   4332 C  CG2 . THR B 1 239 ? 12.260 8.501   3.523   1.00 30.44  ? 235 THR B CG2 1 
ATOM   4333 N  N   . SER B 1 240 ? 13.775 4.470   3.319   1.00 42.85  ? 236 SER B N   1 
ATOM   4334 C  CA  . SER B 1 240 ? 14.634 3.322   3.073   1.00 43.12  ? 236 SER B CA  1 
ATOM   4335 C  C   . SER B 1 240 ? 16.104 3.651   2.953   1.00 41.98  ? 236 SER B C   1 
ATOM   4336 O  O   . SER B 1 240 ? 16.933 2.739   2.897   1.00 39.06  ? 236 SER B O   1 
ATOM   4337 C  CB  . SER B 1 240 ? 14.202 2.593   1.809   1.00 49.51  ? 236 SER B CB  1 
ATOM   4338 O  OG  . SER B 1 240 ? 13.070 1.794   2.086   1.00 54.89  ? 236 SER B OG  1 
ATOM   4339 N  N   . SER B 1 241 ? 16.444 4.936   2.912   1.00 35.54  ? 237 SER B N   1 
ATOM   4340 C  CA  . SER B 1 241 ? 17.840 5.286   2.765   1.00 35.35  ? 237 SER B CA  1 
ATOM   4341 C  C   . SER B 1 241 ? 18.661 4.939   4.002   1.00 33.73  ? 237 SER B C   1 
ATOM   4342 O  O   . SER B 1 241 ? 19.883 5.111   3.996   1.00 32.91  ? 237 SER B O   1 
ATOM   4343 C  CB  . SER B 1 241 ? 18.012 6.768   2.382   1.00 35.23  ? 237 SER B CB  1 
ATOM   4344 O  OG  . SER B 1 241 ? 17.471 7.651   3.339   1.00 38.85  ? 237 SER B OG  1 
ATOM   4345 N  N   . ILE B 1 242 ? 18.009 4.456   5.060   1.00 34.36  ? 238 ILE B N   1 
ATOM   4346 C  CA  . ILE B 1 242 ? 18.758 4.060   6.242   1.00 34.03  ? 238 ILE B CA  1 
ATOM   4347 C  C   . ILE B 1 242 ? 19.553 2.785   5.902   1.00 35.85  ? 238 ILE B C   1 
ATOM   4348 O  O   . ILE B 1 242 ? 20.634 2.569   6.458   1.00 34.38  ? 238 ILE B O   1 
ATOM   4349 C  CB  . ILE B 1 242 ? 17.857 3.757   7.468   1.00 27.35  ? 238 ILE B CB  1 
ATOM   4350 C  CG1 . ILE B 1 242 ? 16.934 2.573   7.178   1.00 24.41  ? 238 ILE B CG1 1 
ATOM   4351 C  CG2 . ILE B 1 242 ? 17.083 4.980   7.863   1.00 26.54  ? 238 ILE B CG2 1 
ATOM   4352 C  CD1 . ILE B 1 242 ? 16.303 1.985   8.430   1.00 23.37  ? 238 ILE B CD1 1 
ATOM   4353 N  N   . ASP B 1 243 ? 19.011 1.957   4.996   1.00 35.77  ? 239 ASP B N   1 
ATOM   4354 C  CA  . ASP B 1 243 ? 19.671 0.721   4.562   1.00 35.48  ? 239 ASP B CA  1 
ATOM   4355 C  C   . ASP B 1 243 ? 20.941 1.080   3.795   1.00 34.86  ? 239 ASP B C   1 
ATOM   4356 O  O   . ASP B 1 243 ? 21.964 0.394   3.881   1.00 34.04  ? 239 ASP B O   1 
ATOM   4357 C  CB  . ASP B 1 243 ? 18.760 -0.127  3.644   1.00 37.25  ? 239 ASP B CB  1 
ATOM   4358 C  CG  . ASP B 1 243 ? 17.714 -0.944  4.417   1.00 37.26  ? 239 ASP B CG  1 
ATOM   4359 O  OD1 . ASP B 1 243 ? 17.862 -1.123  5.648   1.00 39.30  ? 239 ASP B OD1 1 
ATOM   4360 O  OD2 . ASP B 1 243 ? 16.744 -1.422  3.791   1.00 38.90  ? 239 ASP B OD2 1 
ATOM   4361 N  N   . VAL B 1 244 ? 20.878 2.161   3.034   1.00 34.60  ? 240 VAL B N   1 
ATOM   4362 C  CA  . VAL B 1 244 ? 22.034 2.583   2.274   1.00 36.53  ? 240 VAL B CA  1 
ATOM   4363 C  C   . VAL B 1 244 ? 23.130 3.046   3.237   1.00 36.75  ? 240 VAL B C   1 
ATOM   4364 O  O   . VAL B 1 244 ? 24.299 2.729   3.050   1.00 35.96  ? 240 VAL B O   1 
ATOM   4365 C  CB  . VAL B 1 244 ? 21.647 3.698   1.298   1.00 27.79  ? 240 VAL B CB  1 
ATOM   4366 C  CG1 . VAL B 1 244 ? 22.879 4.337   0.683   1.00 26.80  ? 240 VAL B CG1 1 
ATOM   4367 C  CG2 . VAL B 1 244 ? 20.773 3.126   0.220   1.00 27.65  ? 240 VAL B CG2 1 
ATOM   4368 N  N   . TRP B 1 245 ? 22.767 3.776   4.287   1.00 27.62  ? 241 TRP B N   1 
ATOM   4369 C  CA  . TRP B 1 245 ? 23.792 4.214   5.236   1.00 26.77  ? 241 TRP B CA  1 
ATOM   4370 C  C   . TRP B 1 245 ? 24.476 2.979   5.854   1.00 26.44  ? 241 TRP B C   1 
ATOM   4371 O  O   . TRP B 1 245 ? 25.704 2.916   5.970   1.00 23.86  ? 241 TRP B O   1 
ATOM   4372 C  CB  . TRP B 1 245 ? 23.178 5.106   6.323   1.00 30.13  ? 241 TRP B CB  1 
ATOM   4373 C  CG  . TRP B 1 245 ? 24.144 5.425   7.428   1.00 30.60  ? 241 TRP B CG  1 
ATOM   4374 C  CD1 . TRP B 1 245 ? 24.512 4.605   8.455   1.00 31.65  ? 241 TRP B CD1 1 
ATOM   4375 C  CD2 . TRP B 1 245 ? 24.909 6.623   7.581   1.00 32.19  ? 241 TRP B CD2 1 
ATOM   4376 N  NE1 . TRP B 1 245 ? 25.456 5.214   9.231   1.00 30.88  ? 241 TRP B NE1 1 
ATOM   4377 C  CE2 . TRP B 1 245 ? 25.719 6.457   8.719   1.00 31.62  ? 241 TRP B CE2 1 
ATOM   4378 C  CE3 . TRP B 1 245 ? 24.992 7.825   6.864   1.00 32.72  ? 241 TRP B CE3 1 
ATOM   4379 C  CZ2 . TRP B 1 245 ? 26.607 7.453   9.164   1.00 31.67  ? 241 TRP B CZ2 1 
ATOM   4380 C  CZ3 . TRP B 1 245 ? 25.869 8.811   7.304   1.00 33.26  ? 241 TRP B CZ3 1 
ATOM   4381 C  CH2 . TRP B 1 245 ? 26.664 8.619   8.444   1.00 32.72  ? 241 TRP B CH2 1 
ATOM   4382 N  N   . SER B 1 246 ? 23.666 1.998   6.235   1.00 21.85  ? 242 SER B N   1 
ATOM   4383 C  CA  . SER B 1 246 ? 24.184 0.764   6.794   1.00 23.13  ? 242 SER B CA  1 
ATOM   4384 C  C   . SER B 1 246 ? 25.131 0.110   5.795   1.00 22.94  ? 242 SER B C   1 
ATOM   4385 O  O   . SER B 1 246 ? 26.221 -0.319  6.158   1.00 25.93  ? 242 SER B O   1 
ATOM   4386 C  CB  . SER B 1 246 ? 23.048 -0.214  7.114   1.00 28.08  ? 242 SER B CB  1 
ATOM   4387 O  OG  . SER B 1 246 ? 22.165 0.329   8.076   1.00 27.90  ? 242 SER B OG  1 
ATOM   4388 N  N   . ALA B 1 247 ? 24.722 0.032   4.535   1.00 31.61  ? 243 ALA B N   1 
ATOM   4389 C  CA  . ALA B 1 247 ? 25.579 -0.594  3.549   1.00 32.74  ? 243 ALA B CA  1 
ATOM   4390 C  C   . ALA B 1 247 ? 26.876 0.210   3.447   1.00 33.12  ? 243 ALA B C   1 
ATOM   4391 O  O   . ALA B 1 247 ? 27.972 -0.354  3.315   1.00 32.21  ? 243 ALA B O   1 
ATOM   4392 C  CB  . ALA B 1 247 ? 24.870 -0.672  2.206   1.00 26.71  ? 243 ALA B CB  1 
ATOM   4393 N  N   . GLY B 1 248 ? 26.757 1.527   3.529   1.00 28.11  ? 244 GLY B N   1 
ATOM   4394 C  CA  . GLY B 1 248 ? 27.948 2.357   3.460   1.00 28.51  ? 244 GLY B CA  1 
ATOM   4395 C  C   . GLY B 1 248 ? 28.916 2.001   4.583   1.00 29.92  ? 244 GLY B C   1 
ATOM   4396 O  O   . GLY B 1 248 ? 30.135 2.015   4.392   1.00 30.95  ? 244 GLY B O   1 
ATOM   4397 N  N   . CYS B 1 249 ? 28.370 1.684   5.756   1.00 38.47  ? 245 CYS B N   1 
ATOM   4398 C  CA  . CYS B 1 249 ? 29.187 1.312   6.902   1.00 36.52  ? 245 CYS B CA  1 
ATOM   4399 C  C   . CYS B 1 249 ? 29.846 -0.036  6.686   1.00 37.45  ? 245 CYS B C   1 
ATOM   4400 O  O   . CYS B 1 249 ? 30.948 -0.265  7.185   1.00 35.83  ? 245 CYS B O   1 
ATOM   4401 C  CB  . CYS B 1 249 ? 28.351 1.254   8.186   1.00 31.18  ? 245 CYS B CB  1 
ATOM   4402 S  SG  . CYS B 1 249 ? 27.761 2.845   8.748   1.00 31.80  ? 245 CYS B SG  1 
ATOM   4403 N  N   . VAL B 1 250 ? 29.177 -0.934  5.963   1.00 33.30  ? 246 VAL B N   1 
ATOM   4404 C  CA  . VAL B 1 250 ? 29.745 -2.258  5.706   1.00 33.89  ? 246 VAL B CA  1 
ATOM   4405 C  C   . VAL B 1 250 ? 30.902 -2.128  4.719   1.00 33.79  ? 246 VAL B C   1 
ATOM   4406 O  O   . VAL B 1 250 ? 31.925 -2.783  4.887   1.00 34.08  ? 246 VAL B O   1 
ATOM   4407 C  CB  . VAL B 1 250 ? 28.694 -3.242  5.130   1.00 22.12  ? 246 VAL B CB  1 
ATOM   4408 C  CG1 . VAL B 1 250 ? 29.369 -4.502  4.623   1.00 22.88  ? 246 VAL B CG1 1 
ATOM   4409 C  CG2 . VAL B 1 250 ? 27.691 -3.608  6.189   1.00 20.39  ? 246 VAL B CG2 1 
ATOM   4410 N  N   . LEU B 1 251 ? 30.745 -1.278  3.702   1.00 36.62  ? 247 LEU B N   1 
ATOM   4411 C  CA  . LEU B 1 251 ? 31.800 -1.075  2.713   1.00 40.34  ? 247 LEU B CA  1 
ATOM   4412 C  C   . LEU B 1 251 ? 33.017 -0.511  3.408   1.00 42.85  ? 247 LEU B C   1 
ATOM   4413 O  O   . LEU B 1 251 ? 34.103 -1.066  3.325   1.00 42.68  ? 247 LEU B O   1 
ATOM   4414 C  CB  . LEU B 1 251 ? 31.352 -0.097  1.620   1.00 37.60  ? 247 LEU B CB  1 
ATOM   4415 C  CG  . LEU B 1 251 ? 32.424 0.362   0.621   1.00 39.12  ? 247 LEU B CG  1 
ATOM   4416 C  CD1 . LEU B 1 251 ? 32.865 -0.798  -0.255  1.00 38.86  ? 247 LEU B CD1 1 
ATOM   4417 C  CD2 . LEU B 1 251 ? 31.873 1.476   -0.238  1.00 39.39  ? 247 LEU B CD2 1 
ATOM   4418 N  N   . ALA B 1 252 ? 32.829 0.602   4.096   1.00 34.71  ? 248 ALA B N   1 
ATOM   4419 C  CA  . ALA B 1 252 ? 33.922 1.230   4.811   1.00 35.70  ? 248 ALA B CA  1 
ATOM   4420 C  C   . ALA B 1 252 ? 34.625 0.230   5.729   1.00 33.84  ? 248 ALA B C   1 
ATOM   4421 O  O   . ALA B 1 252 ? 35.849 0.210   5.834   1.00 33.37  ? 248 ALA B O   1 
ATOM   4422 C  CB  . ALA B 1 252 ? 33.398 2.389   5.626   1.00 24.83  ? 248 ALA B CB  1 
ATOM   4423 N  N   . GLU B 1 253 ? 33.848 -0.610  6.392   1.00 37.11  ? 249 GLU B N   1 
ATOM   4424 C  CA  . GLU B 1 253 ? 34.419 -1.578  7.310   1.00 34.96  ? 249 GLU B CA  1 
ATOM   4425 C  C   . GLU B 1 253 ? 35.287 -2.579  6.576   1.00 35.18  ? 249 GLU B C   1 
ATOM   4426 O  O   . GLU B 1 253 ? 36.375 -2.938  7.046   1.00 34.68  ? 249 GLU B O   1 
ATOM   4427 C  CB  . GLU B 1 253 ? 33.303 -2.297  8.059   1.00 43.12  ? 249 GLU B CB  1 
ATOM   4428 C  CG  . GLU B 1 253 ? 33.787 -3.140  9.195   1.00 43.58  ? 249 GLU B CG  1 
ATOM   4429 C  CD  . GLU B 1 253 ? 32.662 -3.621  10.078  1.00 46.90  ? 249 GLU B CD  1 
ATOM   4430 O  OE1 . GLU B 1 253 ? 31.692 -2.858  10.296  1.00 46.42  ? 249 GLU B OE1 1 
ATOM   4431 O  OE2 . GLU B 1 253 ? 32.756 -4.760  10.573  1.00 44.52  ? 249 GLU B OE2 1 
ATOM   4432 N  N   . LEU B 1 254 ? 34.819 -3.028  5.414   1.00 33.77  ? 250 LEU B N   1 
ATOM   4433 C  CA  . LEU B 1 254 ? 35.579 -4.001  4.646   1.00 37.55  ? 250 LEU B CA  1 
ATOM   4434 C  C   . LEU B 1 254 ? 36.901 -3.432  4.147   1.00 38.60  ? 250 LEU B C   1 
ATOM   4435 O  O   . LEU B 1 254 ? 37.901 -4.151  4.107   1.00 38.56  ? 250 LEU B O   1 
ATOM   4436 C  CB  . LEU B 1 254 ? 34.745 -4.533  3.488   1.00 27.03  ? 250 LEU B CB  1 
ATOM   4437 C  CG  . LEU B 1 254 ? 33.591 -5.452  3.935   1.00 30.42  ? 250 LEU B CG  1 
ATOM   4438 C  CD1 . LEU B 1 254 ? 32.872 -6.007  2.708   1.00 24.14  ? 250 LEU B CD1 1 
ATOM   4439 C  CD2 . LEU B 1 254 ? 34.119 -6.586  4.790   1.00 28.30  ? 250 LEU B CD2 1 
ATOM   4440 N  N   . LEU B 1 255 ? 36.914 -2.146  3.776   1.00 34.15  ? 251 LEU B N   1 
ATOM   4441 C  CA  . LEU B 1 255 ? 38.144 -1.490  3.317   1.00 37.43  ? 251 LEU B CA  1 
ATOM   4442 C  C   . LEU B 1 255 ? 39.059 -1.181  4.499   1.00 39.44  ? 251 LEU B C   1 
ATOM   4443 O  O   . LEU B 1 255 ? 40.263 -1.354  4.410   1.00 40.36  ? 251 LEU B O   1 
ATOM   4444 C  CB  . LEU B 1 255 ? 37.841 -0.180  2.603   1.00 24.64  ? 251 LEU B CB  1 
ATOM   4445 C  CG  . LEU B 1 255 ? 36.961 -0.205  1.346   1.00 24.81  ? 251 LEU B CG  1 
ATOM   4446 C  CD1 . LEU B 1 255 ? 36.607 1.229   0.916   1.00 23.86  ? 251 LEU B CD1 1 
ATOM   4447 C  CD2 . LEU B 1 255 ? 37.675 -0.942  0.243   1.00 24.50  ? 251 LEU B CD2 1 
ATOM   4448 N  N   . LEU B 1 256 ? 38.481 -0.732  5.610   1.00 42.22  ? 252 LEU B N   1 
ATOM   4449 C  CA  . LEU B 1 256 ? 39.253 -0.382  6.799   1.00 42.35  ? 252 LEU B CA  1 
ATOM   4450 C  C   . LEU B 1 256 ? 39.779 -1.537  7.616   1.00 42.15  ? 252 LEU B C   1 
ATOM   4451 O  O   . LEU B 1 256 ? 40.896 -1.468  8.092   1.00 41.59  ? 252 LEU B O   1 
ATOM   4452 C  CB  . LEU B 1 256 ? 38.434 0.498   7.739   1.00 49.60  ? 252 LEU B CB  1 
ATOM   4453 C  CG  . LEU B 1 256 ? 38.358 2.002   7.493   1.00 55.27  ? 252 LEU B CG  1 
ATOM   4454 C  CD1 . LEU B 1 256 ? 37.504 2.673   8.580   1.00 55.32  ? 252 LEU B CD1 1 
ATOM   4455 C  CD2 . LEU B 1 256 ? 39.771 2.568   7.503   1.00 55.32  ? 252 LEU B CD2 1 
ATOM   4456 N  N   . GLY B 1 257 ? 38.975 -2.581  7.803   1.00 35.06  ? 253 GLY B N   1 
ATOM   4457 C  CA  . GLY B 1 257 ? 39.413 -3.697  8.619   1.00 33.63  ? 253 GLY B CA  1 
ATOM   4458 C  C   . GLY B 1 257 ? 38.808 -3.637  10.014  1.00 33.55  ? 253 GLY B C   1 
ATOM   4459 O  O   . GLY B 1 257 ? 39.137 -4.451  10.878  1.00 33.13  ? 253 GLY B O   1 
ATOM   4460 N  N   . GLN B 1 258 ? 37.929 -2.660  10.235  1.00 48.50  ? 254 GLN B N   1 
ATOM   4461 C  CA  . GLN B 1 258 ? 37.240 -2.476  11.511  1.00 50.38  ? 254 GLN B CA  1 
ATOM   4462 C  C   . GLN B 1 258 ? 36.091 -1.510  11.281  1.00 48.40  ? 254 GLN B C   1 
ATOM   4463 O  O   . GLN B 1 258 ? 36.082 -0.791  10.288  1.00 47.07  ? 254 GLN B O   1 
ATOM   4464 C  CB  . GLN B 1 258 ? 38.181 -1.897  12.556  1.00 59.52  ? 254 GLN B CB  1 
ATOM   4465 C  CG  . GLN B 1 258 ? 38.966 -0.714  12.053  1.00 61.97  ? 254 GLN B CG  1 
ATOM   4466 C  CD  . GLN B 1 258 ? 39.613 0.070   13.168  1.00 67.51  ? 254 GLN B CD  1 
ATOM   4467 O  OE1 . GLN B 1 258 ? 38.928 0.720   13.959  1.00 69.07  ? 254 GLN B OE1 1 
ATOM   4468 N  NE2 . GLN B 1 258 ? 40.939 0.012   13.244  1.00 67.97  ? 254 GLN B NE2 1 
ATOM   4469 N  N   . PRO B 1 259 ? 35.105 -1.472  12.194  1.00 40.50  ? 255 PRO B N   1 
ATOM   4470 C  CA  . PRO B 1 259 ? 33.962 -0.562  12.030  1.00 41.00  ? 255 PRO B CA  1 
ATOM   4471 C  C   . PRO B 1 259 ? 34.435 0.865   11.848  1.00 41.57  ? 255 PRO B C   1 
ATOM   4472 O  O   . PRO B 1 259 ? 35.411 1.275   12.462  1.00 41.10  ? 255 PRO B O   1 
ATOM   4473 C  CB  . PRO B 1 259 ? 33.205 -0.734  13.332  1.00 25.72  ? 255 PRO B CB  1 
ATOM   4474 C  CG  . PRO B 1 259 ? 33.520 -2.179  13.716  1.00 27.51  ? 255 PRO B CG  1 
ATOM   4475 C  CD  . PRO B 1 259 ? 34.985 -2.258  13.438  1.00 23.96  ? 255 PRO B CD  1 
ATOM   4476 N  N   . ILE B 1 260 ? 33.755 1.637   11.015  1.00 35.94  ? 256 ILE B N   1 
ATOM   4477 C  CA  . ILE B 1 260 ? 34.175 3.016   10.835  1.00 37.43  ? 256 ILE B CA  1 
ATOM   4478 C  C   . ILE B 1 260 ? 33.583 3.976   11.860  1.00 38.08  ? 256 ILE B C   1 
ATOM   4479 O  O   . ILE B 1 260 ? 34.201 4.990   12.154  1.00 39.85  ? 256 ILE B O   1 
ATOM   4480 C  CB  . ILE B 1 260 ? 33.849 3.544   9.418   1.00 33.52  ? 256 ILE B CB  1 
ATOM   4481 C  CG1 . ILE B 1 260 ? 34.353 4.989   9.285   1.00 32.96  ? 256 ILE B CG1 1 
ATOM   4482 C  CG2 . ILE B 1 260 ? 32.358 3.454   9.154   1.00 31.95  ? 256 ILE B CG2 1 
ATOM   4483 C  CD1 . ILE B 1 260 ? 34.296 5.544   7.893   1.00 36.28  ? 256 ILE B CD1 1 
ATOM   4484 N  N   . PHE B 1 261 ? 32.406 3.665   12.405  1.00 41.47  ? 257 PHE B N   1 
ATOM   4485 C  CA  . PHE B 1 261 ? 31.760 4.541   13.390  1.00 40.76  ? 257 PHE B CA  1 
ATOM   4486 C  C   . PHE B 1 261 ? 31.354 3.799   14.651  1.00 41.62  ? 257 PHE B C   1 
ATOM   4487 O  O   . PHE B 1 261 ? 30.168 3.645   14.933  1.00 41.84  ? 257 PHE B O   1 
ATOM   4488 C  CB  . PHE B 1 261 ? 30.502 5.195   12.801  1.00 48.74  ? 257 PHE B CB  1 
ATOM   4489 C  CG  . PHE B 1 261 ? 30.757 6.014   11.568  1.00 48.80  ? 257 PHE B CG  1 
ATOM   4490 C  CD1 . PHE B 1 261 ? 31.838 6.894   11.506  1.00 50.44  ? 257 PHE B CD1 1 
ATOM   4491 C  CD2 . PHE B 1 261 ? 29.898 5.930   10.479  1.00 48.39  ? 257 PHE B CD2 1 
ATOM   4492 C  CE1 . PHE B 1 261 ? 32.058 7.672   10.383  1.00 47.34  ? 257 PHE B CE1 1 
ATOM   4493 C  CE2 . PHE B 1 261 ? 30.111 6.709   9.347   1.00 48.78  ? 257 PHE B CE2 1 
ATOM   4494 C  CZ  . PHE B 1 261 ? 31.191 7.578   9.300   1.00 47.39  ? 257 PHE B CZ  1 
ATOM   4495 N  N   . PRO B 1 262 ? 32.328 3.361   15.445  1.00 46.55  ? 258 PRO B N   1 
ATOM   4496 C  CA  . PRO B 1 262 ? 32.051 2.625   16.685  1.00 45.32  ? 258 PRO B CA  1 
ATOM   4497 C  C   . PRO B 1 262 ? 31.678 3.517   17.852  1.00 44.50  ? 258 PRO B C   1 
ATOM   4498 O  O   . PRO B 1 262 ? 31.900 4.724   17.822  1.00 44.26  ? 258 PRO B O   1 
ATOM   4499 C  CB  . PRO B 1 262 ? 33.355 1.889   16.936  1.00 26.43  ? 258 PRO B CB  1 
ATOM   4500 C  CG  . PRO B 1 262 ? 34.377 2.941   16.529  1.00 25.54  ? 258 PRO B CG  1 
ATOM   4501 C  CD  . PRO B 1 262 ? 33.778 3.556   15.250  1.00 26.54  ? 258 PRO B CD  1 
ATOM   4502 N  N   . GLY B 1 263 ? 31.133 2.911   18.895  1.00 37.22  ? 259 GLY B N   1 
ATOM   4503 C  CA  . GLY B 1 263 ? 30.745 3.672   20.061  1.00 36.49  ? 259 GLY B CA  1 
ATOM   4504 C  C   . GLY B 1 263 ? 29.701 2.919   20.851  1.00 38.81  ? 259 GLY B C   1 
ATOM   4505 O  O   . GLY B 1 263 ? 28.767 2.344   20.277  1.00 39.71  ? 259 GLY B O   1 
ATOM   4506 N  N   . ASP B 1 264 ? 29.850 2.921   22.172  1.00 39.14  ? 260 ASP B N   1 
ATOM   4507 C  CA  . ASP B 1 264 ? 28.916 2.221   23.042  1.00 42.16  ? 260 ASP B CA  1 
ATOM   4508 C  C   . ASP B 1 264 ? 27.615 2.987   23.202  1.00 40.84  ? 260 ASP B C   1 
ATOM   4509 O  O   . ASP B 1 264 ? 26.598 2.410   23.581  1.00 40.86  ? 260 ASP B O   1 
ATOM   4510 C  CB  . ASP B 1 264 ? 29.549 1.974   24.408  1.00 93.27  ? 260 ASP B CB  1 
ATOM   4511 C  CG  . ASP B 1 264 ? 30.540 0.831   24.388  1.00 99.60  ? 260 ASP B CG  1 
ATOM   4512 O  OD1 . ASP B 1 264 ? 31.274 0.676   25.386  1.00 104.80 ? 260 ASP B OD1 1 
ATOM   4513 O  OD2 . ASP B 1 264 ? 30.578 0.086   23.382  1.00 102.76 ? 260 ASP B OD2 1 
ATOM   4514 N  N   . SER B 1 265 ? 27.636 4.281   22.900  1.00 33.26  ? 261 SER B N   1 
ATOM   4515 C  CA  . SER B 1 265 ? 26.435 5.103   23.033  1.00 31.18  ? 261 SER B CA  1 
ATOM   4516 C  C   . SER B 1 265 ? 26.185 5.934   21.781  1.00 30.23  ? 261 SER B C   1 
ATOM   4517 O  O   . SER B 1 265 ? 27.071 6.080   20.935  1.00 28.50  ? 261 SER B O   1 
ATOM   4518 C  CB  . SER B 1 265 ? 26.589 6.058   24.195  1.00 23.88  ? 261 SER B CB  1 
ATOM   4519 O  OG  . SER B 1 265 ? 27.556 7.030   23.835  1.00 23.58  ? 261 SER B OG  1 
ATOM   4520 N  N   . GLY B 1 266 ? 24.978 6.493   21.690  1.00 43.01  ? 262 GLY B N   1 
ATOM   4521 C  CA  . GLY B 1 266 ? 24.622 7.318   20.554  1.00 44.07  ? 262 GLY B CA  1 
ATOM   4522 C  C   . GLY B 1 266 ? 25.582 8.476   20.438  1.00 44.91  ? 262 GLY B C   1 
ATOM   4523 O  O   . GLY B 1 266 ? 25.984 8.857   19.344  1.00 42.87  ? 262 GLY B O   1 
ATOM   4524 N  N   . VAL B 1 267 ? 25.965 9.023   21.582  1.00 43.83  ? 263 VAL B N   1 
ATOM   4525 C  CA  . VAL B 1 267 ? 26.880 10.155  21.628  1.00 45.24  ? 263 VAL B CA  1 
ATOM   4526 C  C   . VAL B 1 267 ? 28.234 9.831   20.998  1.00 44.96  ? 263 VAL B C   1 
ATOM   4527 O  O   . VAL B 1 267 ? 28.734 10.571  20.146  1.00 47.43  ? 263 VAL B O   1 
ATOM   4528 C  CB  . VAL B 1 267 ? 27.128 10.604  23.089  1.00 48.95  ? 263 VAL B CB  1 
ATOM   4529 C  CG1 . VAL B 1 267 ? 27.861 11.936  23.101  1.00 48.30  ? 263 VAL B CG1 1 
ATOM   4530 C  CG2 . VAL B 1 267 ? 25.812 10.699  23.840  1.00 47.75  ? 263 VAL B CG2 1 
ATOM   4531 N  N   . ASP B 1 268 ? 28.834 8.729   21.436  1.00 39.75  ? 264 ASP B N   1 
ATOM   4532 C  CA  . ASP B 1 268 ? 30.135 8.335   20.919  1.00 40.92  ? 264 ASP B CA  1 
ATOM   4533 C  C   . ASP B 1 268 ? 30.098 8.118   19.411  1.00 40.72  ? 264 ASP B C   1 
ATOM   4534 O  O   . ASP B 1 268 ? 30.968 8.585   18.683  1.00 41.93  ? 264 ASP B O   1 
ATOM   4535 C  CB  . ASP B 1 268 ? 30.616 7.068   21.623  1.00 76.79  ? 264 ASP B CB  1 
ATOM   4536 C  CG  . ASP B 1 268 ? 30.859 7.283   23.105  1.00 82.83  ? 264 ASP B CG  1 
ATOM   4537 O  OD1 . ASP B 1 268 ? 31.423 8.337   23.464  1.00 82.52  ? 264 ASP B OD1 1 
ATOM   4538 O  OD2 . ASP B 1 268 ? 30.501 6.393   23.907  1.00 86.53  ? 264 ASP B OD2 1 
ATOM   4539 N  N   . GLN B 1 269 ? 29.080 7.407   18.948  1.00 35.66  ? 265 GLN B N   1 
ATOM   4540 C  CA  . GLN B 1 269 ? 28.913 7.131   17.538  1.00 36.42  ? 265 GLN B CA  1 
ATOM   4541 C  C   . GLN B 1 269 ? 28.845 8.429   16.742  1.00 35.98  ? 265 GLN B C   1 
ATOM   4542 O  O   . GLN B 1 269 ? 29.458 8.533   15.679  1.00 36.63  ? 265 GLN B O   1 
ATOM   4543 C  CB  . GLN B 1 269 ? 27.648 6.307   17.328  1.00 42.58  ? 265 GLN B CB  1 
ATOM   4544 C  CG  . GLN B 1 269 ? 27.749 4.894   17.876  1.00 46.77  ? 265 GLN B CG  1 
ATOM   4545 C  CD  . GLN B 1 269 ? 26.391 4.233   18.001  1.00 48.41  ? 265 GLN B CD  1 
ATOM   4546 O  OE1 . GLN B 1 269 ? 25.474 4.543   17.248  1.00 47.49  ? 265 GLN B OE1 1 
ATOM   4547 N  NE2 . GLN B 1 269 ? 26.259 3.311   18.944  1.00 48.16  ? 265 GLN B NE2 1 
ATOM   4548 N  N   . LEU B 1 270 ? 28.103 9.417   17.242  1.00 37.35  ? 266 LEU B N   1 
ATOM   4549 C  CA  . LEU B 1 270 ? 28.012 10.707  16.556  1.00 39.47  ? 266 LEU B CA  1 
ATOM   4550 C  C   . LEU B 1 270 ? 29.372 11.401  16.516  1.00 39.86  ? 266 LEU B C   1 
ATOM   4551 O  O   . LEU B 1 270 ? 29.738 12.022  15.510  1.00 39.21  ? 266 LEU B O   1 
ATOM   4552 C  CB  . LEU B 1 270 ? 27.006 11.621  17.243  1.00 36.12  ? 266 LEU B CB  1 
ATOM   4553 C  CG  . LEU B 1 270 ? 25.547 11.232  17.053  1.00 41.19  ? 266 LEU B CG  1 
ATOM   4554 C  CD1 . LEU B 1 270 ? 24.661 12.227  17.765  1.00 41.94  ? 266 LEU B CD1 1 
ATOM   4555 C  CD2 . LEU B 1 270 ? 25.213 11.223  15.578  1.00 39.98  ? 266 LEU B CD2 1 
ATOM   4556 N  N   . VAL B 1 271 ? 30.133 11.301  17.602  1.00 43.24  ? 267 VAL B N   1 
ATOM   4557 C  CA  . VAL B 1 271 ? 31.443 11.933  17.616  1.00 43.67  ? 267 VAL B CA  1 
ATOM   4558 C  C   . VAL B 1 271 ? 32.287 11.341  16.495  1.00 45.00  ? 267 VAL B C   1 
ATOM   4559 O  O   . VAL B 1 271 ? 32.991 12.061  15.791  1.00 43.07  ? 267 VAL B O   1 
ATOM   4560 C  CB  . VAL B 1 271 ? 32.157 11.735  18.963  1.00 48.24  ? 267 VAL B CB  1 
ATOM   4561 C  CG1 . VAL B 1 271 ? 33.612 12.178  18.854  1.00 47.90  ? 267 VAL B CG1 1 
ATOM   4562 C  CG2 . VAL B 1 271 ? 31.436 12.535  20.040  1.00 47.00  ? 267 VAL B CG2 1 
ATOM   4563 N  N   . GLU B 1 272 ? 32.205 10.029  16.319  1.00 39.79  ? 268 GLU B N   1 
ATOM   4564 C  CA  . GLU B 1 272 ? 32.962 9.380   15.265  1.00 38.82  ? 268 GLU B CA  1 
ATOM   4565 C  C   . GLU B 1 272 ? 32.509 9.834   13.882  1.00 37.10  ? 268 GLU B C   1 
ATOM   4566 O  O   . GLU B 1 272 ? 33.329 10.121  13.008  1.00 37.49  ? 268 GLU B O   1 
ATOM   4567 C  CB  . GLU B 1 272 ? 32.833 7.869   15.401  1.00 67.70  ? 268 GLU B CB  1 
ATOM   4568 C  CG  . GLU B 1 272 ? 33.526 7.364   16.630  1.00 70.95  ? 268 GLU B CG  1 
ATOM   4569 C  CD  . GLU B 1 272 ? 34.969 7.821   16.674  1.00 73.28  ? 268 GLU B CD  1 
ATOM   4570 O  OE1 . GLU B 1 272 ? 35.581 7.779   17.759  1.00 76.28  ? 268 GLU B OE1 1 
ATOM   4571 O  OE2 . GLU B 1 272 ? 35.497 8.223   15.613  1.00 74.45  ? 268 GLU B OE2 1 
ATOM   4572 N  N   . ILE B 1 273 ? 31.197 9.908   13.694  1.00 39.36  ? 269 ILE B N   1 
ATOM   4573 C  CA  . ILE B 1 273 ? 30.631 10.325  12.429  1.00 39.39  ? 269 ILE B CA  1 
ATOM   4574 C  C   . ILE B 1 273 ? 31.049 11.757  12.127  1.00 41.65  ? 269 ILE B C   1 
ATOM   4575 O  O   . ILE B 1 273 ? 31.426 12.079  11.002  1.00 42.02  ? 269 ILE B O   1 
ATOM   4576 C  CB  . ILE B 1 273 ? 29.102 10.229  12.477  1.00 35.19  ? 269 ILE B CB  1 
ATOM   4577 C  CG1 . ILE B 1 273 ? 28.688 8.755   12.526  1.00 35.41  ? 269 ILE B CG1 1 
ATOM   4578 C  CG2 . ILE B 1 273 ? 28.481 10.965  11.285  1.00 34.89  ? 269 ILE B CG2 1 
ATOM   4579 C  CD1 . ILE B 1 273 ? 27.211 8.539   12.822  1.00 30.16  ? 269 ILE B CD1 1 
ATOM   4580 N  N   . ILE B 1 274 ? 30.992 12.617  13.137  1.00 35.18  ? 270 ILE B N   1 
ATOM   4581 C  CA  . ILE B 1 274 ? 31.370 14.003  12.934  1.00 37.56  ? 270 ILE B CA  1 
ATOM   4582 C  C   . ILE B 1 274 ? 32.845 14.143  12.585  1.00 37.59  ? 270 ILE B C   1 
ATOM   4583 O  O   . ILE B 1 274 ? 33.201 14.943  11.723  1.00 38.85  ? 270 ILE B O   1 
ATOM   4584 C  CB  . ILE B 1 274 ? 31.038 14.857  14.171  1.00 39.59  ? 270 ILE B CB  1 
ATOM   4585 C  CG1 . ILE B 1 274 ? 29.518 14.916  14.345  1.00 39.36  ? 270 ILE B CG1 1 
ATOM   4586 C  CG2 . ILE B 1 274 ? 31.583 16.275  13.996  1.00 39.70  ? 270 ILE B CG2 1 
ATOM   4587 C  CD1 . ILE B 1 274 ? 29.054 15.654  15.570  1.00 41.04  ? 270 ILE B CD1 1 
ATOM   4588 N  N   . LYS B 1 275 ? 33.701 13.362  13.236  1.00 45.00  ? 271 LYS B N   1 
ATOM   4589 C  CA  . LYS B 1 275 ? 35.129 13.433  12.959  1.00 46.80  ? 271 LYS B CA  1 
ATOM   4590 C  C   . LYS B 1 275 ? 35.398 13.240  11.477  1.00 48.79  ? 271 LYS B C   1 
ATOM   4591 O  O   . LYS B 1 275 ? 36.424 13.692  10.966  1.00 49.88  ? 271 LYS B O   1 
ATOM   4592 C  CB  . LYS B 1 275 ? 35.900 12.353  13.709  1.00 63.10  ? 271 LYS B CB  1 
ATOM   4593 C  CG  . LYS B 1 275 ? 36.101 12.577  15.184  1.00 64.44  ? 271 LYS B CG  1 
ATOM   4594 C  CD  . LYS B 1 275 ? 37.011 11.480  15.709  1.00 66.01  ? 271 LYS B CD  1 
ATOM   4595 C  CE  . LYS B 1 275 ? 37.295 11.614  17.189  1.00 69.07  ? 271 LYS B CE  1 
ATOM   4596 N  NZ  . LYS B 1 275 ? 38.223 10.532  17.624  1.00 70.62  ? 271 LYS B NZ  1 
ATOM   4597 N  N   . VAL B 1 276 ? 34.486 12.565  10.785  1.00 51.12  ? 272 VAL B N   1 
ATOM   4598 C  CA  . VAL B 1 276 ? 34.688 12.308  9.370   1.00 49.82  ? 272 VAL B CA  1 
ATOM   4599 C  C   . VAL B 1 276 ? 33.823 13.131  8.426   1.00 50.91  ? 272 VAL B C   1 
ATOM   4600 O  O   . VAL B 1 276 ? 34.308 13.572  7.399   1.00 51.29  ? 272 VAL B O   1 
ATOM   4601 C  CB  . VAL B 1 276 ? 34.499 10.814  9.067   1.00 39.83  ? 272 VAL B CB  1 
ATOM   4602 C  CG1 . VAL B 1 276 ? 34.742 10.536  7.608   1.00 39.16  ? 272 VAL B CG1 1 
ATOM   4603 C  CG2 . VAL B 1 276 ? 35.452 10.005  9.910   1.00 38.47  ? 272 VAL B CG2 1 
ATOM   4604 N  N   . LEU B 1 277 ? 32.551 13.340  8.747   1.00 66.11  ? 273 LEU B N   1 
ATOM   4605 C  CA  . LEU B 1 277 ? 31.689 14.122  7.859   1.00 67.96  ? 273 LEU B CA  1 
ATOM   4606 C  C   . LEU B 1 277 ? 31.642 15.587  8.263   1.00 69.19  ? 273 LEU B C   1 
ATOM   4607 O  O   . LEU B 1 277 ? 30.895 16.367  7.672   1.00 68.91  ? 273 LEU B O   1 
ATOM   4608 C  CB  . LEU B 1 277 ? 30.247 13.602  7.867   1.00 42.92  ? 273 LEU B CB  1 
ATOM   4609 C  CG  . LEU B 1 277 ? 29.914 12.115  7.757   1.00 43.97  ? 273 LEU B CG  1 
ATOM   4610 C  CD1 . LEU B 1 277 ? 28.465 11.985  7.324   1.00 41.65  ? 273 LEU B CD1 1 
ATOM   4611 C  CD2 . LEU B 1 277 ? 30.829 11.422  6.769   1.00 43.53  ? 273 LEU B CD2 1 
ATOM   4612 N  N   . GLY B 1 278 ? 32.427 15.966  9.266   1.00 52.71  ? 274 GLY B N   1 
ATOM   4613 C  CA  . GLY B 1 278 ? 32.397 17.341  9.721   1.00 53.92  ? 274 GLY B CA  1 
ATOM   4614 C  C   . GLY B 1 278 ? 31.160 17.551  10.573  1.00 55.45  ? 274 GLY B C   1 
ATOM   4615 O  O   . GLY B 1 278 ? 30.418 16.609  10.828  1.00 55.98  ? 274 GLY B O   1 
ATOM   4616 N  N   . THR B 1 279 ? 30.927 18.774  11.024  1.00 60.53  ? 275 THR B N   1 
ATOM   4617 C  CA  . THR B 1 279 ? 29.755 19.040  11.843  1.00 61.11  ? 275 THR B CA  1 
ATOM   4618 C  C   . THR B 1 279 ? 28.541 19.244  10.943  1.00 61.95  ? 275 THR B C   1 
ATOM   4619 O  O   . THR B 1 279 ? 28.645 19.801  9.849   1.00 62.35  ? 275 THR B O   1 
ATOM   4620 C  CB  . THR B 1 279 ? 29.971 20.286  12.727  1.00 62.73  ? 275 THR B CB  1 
ATOM   4621 O  OG1 . THR B 1 279 ? 31.092 20.062  13.597  1.00 61.89  ? 275 THR B OG1 1 
ATOM   4622 C  CG2 . THR B 1 279 ? 28.730 20.571  13.569  1.00 61.10  ? 275 THR B CG2 1 
ATOM   4623 N  N   . PRO B 1 280 ? 27.370 18.780  11.385  1.00 57.20  ? 276 PRO B N   1 
ATOM   4624 C  CA  . PRO B 1 280 ? 26.167 18.940  10.571  1.00 58.75  ? 276 PRO B CA  1 
ATOM   4625 C  C   . PRO B 1 280 ? 25.709 20.389  10.556  1.00 61.48  ? 276 PRO B C   1 
ATOM   4626 O  O   . PRO B 1 280 ? 25.670 21.026  11.601  1.00 62.04  ? 276 PRO B O   1 
ATOM   4627 C  CB  . PRO B 1 280 ? 25.134 18.062  11.282  1.00 50.46  ? 276 PRO B CB  1 
ATOM   4628 C  CG  . PRO B 1 280 ? 25.927 17.191  12.176  1.00 50.73  ? 276 PRO B CG  1 
ATOM   4629 C  CD  . PRO B 1 280 ? 27.073 18.035  12.613  1.00 50.21  ? 276 PRO B CD  1 
ATOM   4630 N  N   . THR B 1 281 ? 25.362 20.907  9.382   1.00 68.40  ? 277 THR B N   1 
ATOM   4631 C  CA  . THR B 1 281 ? 24.853 22.267  9.298   1.00 70.23  ? 277 THR B CA  1 
ATOM   4632 C  C   . THR B 1 281 ? 23.441 22.190  9.897   1.00 72.95  ? 277 THR B C   1 
ATOM   4633 O  O   . THR B 1 281 ? 22.931 21.091  10.131  1.00 73.09  ? 277 THR B O   1 
ATOM   4634 C  CB  . THR B 1 281 ? 24.792 22.747  7.840   1.00 55.46  ? 277 THR B CB  1 
ATOM   4635 O  OG1 . THR B 1 281 ? 23.763 22.044  7.132   1.00 54.37  ? 277 THR B OG1 1 
ATOM   4636 C  CG2 . THR B 1 281 ? 26.130 22.497  7.160   1.00 55.03  ? 277 THR B CG2 1 
ATOM   4637 N  N   . ARG B 1 282 ? 22.806 23.329  10.163  1.00 78.00  ? 278 ARG B N   1 
ATOM   4638 C  CA  . ARG B 1 282 ? 21.469 23.289  10.752  1.00 80.48  ? 278 ARG B CA  1 
ATOM   4639 C  C   . ARG B 1 282 ? 20.481 22.672  9.775   1.00 79.76  ? 278 ARG B C   1 
ATOM   4640 O  O   . ARG B 1 282 ? 19.550 21.968  10.171  1.00 79.62  ? 278 ARG B O   1 
ATOM   4641 C  CB  . ARG B 1 282 ? 20.988 24.688  11.141  1.00 138.25 ? 278 ARG B CB  1 
ATOM   4642 C  CG  . ARG B 1 282 ? 19.751 24.658  12.032  1.00 143.31 ? 278 ARG B CG  1 
ATOM   4643 C  CD  . ARG B 1 282 ? 19.077 26.014  12.136  1.00 147.45 ? 278 ARG B CD  1 
ATOM   4644 N  NE  . ARG B 1 282 ? 19.991 27.061  12.584  1.00 150.61 ? 278 ARG B NE  1 
ATOM   4645 C  CZ  . ARG B 1 282 ? 19.624 28.314  12.834  1.00 151.98 ? 278 ARG B CZ  1 
ATOM   4646 N  NH1 . ARG B 1 282 ? 18.358 28.678  12.682  1.00 152.26 ? 278 ARG B NH1 1 
ATOM   4647 N  NH2 . ARG B 1 282 ? 20.521 29.207  13.230  1.00 152.72 ? 278 ARG B NH2 1 
ATOM   4648 N  N   . GLU B 1 283 ? 20.697 22.944  8.493   1.00 118.81 ? 279 GLU B N   1 
ATOM   4649 C  CA  . GLU B 1 283 ? 19.835 22.422  7.447   1.00 118.62 ? 279 GLU B CA  1 
ATOM   4650 C  C   . GLU B 1 283 ? 19.917 20.904  7.452   1.00 116.91 ? 279 GLU B C   1 
ATOM   4651 O  O   . GLU B 1 283 ? 18.900 20.217  7.354   1.00 117.18 ? 279 GLU B O   1 
ATOM   4652 C  CB  . GLU B 1 283 ? 20.269 22.960  6.080   1.00 121.46 ? 279 GLU B CB  1 
ATOM   4653 C  CG  . GLU B 1 283 ? 19.127 23.522  5.240   1.00 124.24 ? 279 GLU B CG  1 
ATOM   4654 C  CD  . GLU B 1 283 ? 18.008 22.519  4.997   1.00 125.99 ? 279 GLU B CD  1 
ATOM   4655 O  OE1 . GLU B 1 283 ? 17.385 22.062  5.979   1.00 126.68 ? 279 GLU B OE1 1 
ATOM   4656 O  OE2 . GLU B 1 283 ? 17.746 22.188  3.821   1.00 127.65 ? 279 GLU B OE2 1 
ATOM   4657 N  N   . GLN B 1 284 ? 21.137 20.386  7.574   1.00 67.75  ? 280 GLN B N   1 
ATOM   4658 C  CA  . GLN B 1 284 ? 21.351 18.942  7.594   1.00 65.70  ? 280 GLN B CA  1 
ATOM   4659 C  C   . GLN B 1 284 ? 20.705 18.281  8.813   1.00 65.30  ? 280 GLN B C   1 
ATOM   4660 O  O   . GLN B 1 284 ? 20.225 17.148  8.743   1.00 65.34  ? 280 GLN B O   1 
ATOM   4661 C  CB  . GLN B 1 284 ? 22.850 18.631  7.549   1.00 51.20  ? 280 GLN B CB  1 
ATOM   4662 C  CG  . GLN B 1 284 ? 23.483 18.989  6.221   1.00 49.34  ? 280 GLN B CG  1 
ATOM   4663 C  CD  . GLN B 1 284 ? 24.960 18.648  6.161   1.00 49.32  ? 280 GLN B CD  1 
ATOM   4664 O  OE1 . GLN B 1 284 ? 25.753 19.064  7.013   1.00 49.45  ? 280 GLN B OE1 1 
ATOM   4665 N  NE2 . GLN B 1 284 ? 25.341 17.892  5.147   1.00 47.88  ? 280 GLN B NE2 1 
ATOM   4666 N  N   . ILE B 1 285 ? 20.686 18.992  9.930   1.00 75.31  ? 281 ILE B N   1 
ATOM   4667 C  CA  . ILE B 1 285 ? 20.084 18.453  11.136  1.00 75.11  ? 281 ILE B CA  1 
ATOM   4668 C  C   . ILE B 1 285 ? 18.565 18.420  10.994  1.00 75.61  ? 281 ILE B C   1 
ATOM   4669 O  O   . ILE B 1 285 ? 17.898 17.540  11.539  1.00 74.54  ? 281 ILE B O   1 
ATOM   4670 C  CB  . ILE B 1 285 ? 20.470 19.304  12.352  1.00 65.73  ? 281 ILE B CB  1 
ATOM   4671 C  CG1 . ILE B 1 285 ? 21.993 19.237  12.542  1.00 65.66  ? 281 ILE B CG1 1 
ATOM   4672 C  CG2 . ILE B 1 285 ? 19.717 18.827  13.584  1.00 65.48  ? 281 ILE B CG2 1 
ATOM   4673 C  CD1 . ILE B 1 285 ? 22.566 20.246  13.519  1.00 66.66  ? 281 ILE B CD1 1 
ATOM   4674 N  N   . ARG B 1 286 ? 18.026 19.379  10.246  1.00 76.77  ? 282 ARG B N   1 
ATOM   4675 C  CA  . ARG B 1 286 ? 16.587 19.476  10.028  1.00 77.68  ? 282 ARG B CA  1 
ATOM   4676 C  C   . ARG B 1 286 ? 16.049 18.357  9.137   1.00 76.84  ? 282 ARG B C   1 
ATOM   4677 O  O   . ARG B 1 286 ? 14.927 17.899  9.325   1.00 74.87  ? 282 ARG B O   1 
ATOM   4678 C  CB  . ARG B 1 286 ? 16.252 20.828  9.396   1.00 149.41 ? 282 ARG B CB  1 
ATOM   4679 C  CG  . ARG B 1 286 ? 14.769 21.067  9.138   1.00 152.95 ? 282 ARG B CG  1 
ATOM   4680 C  CD  . ARG B 1 286 ? 14.583 22.296  8.262   1.00 157.69 ? 282 ARG B CD  1 
ATOM   4681 N  NE  . ARG B 1 286 ? 15.251 23.464  8.832   1.00 161.58 ? 282 ARG B NE  1 
ATOM   4682 C  CZ  . ARG B 1 286 ? 15.556 24.564  8.151   1.00 163.91 ? 282 ARG B CZ  1 
ATOM   4683 N  NH1 . ARG B 1 286 ? 15.256 24.656  6.862   1.00 165.14 ? 282 ARG B NH1 1 
ATOM   4684 N  NH2 . ARG B 1 286 ? 16.165 25.574  8.761   1.00 163.85 ? 282 ARG B NH2 1 
ATOM   4685 N  N   . GLU B 1 287 ? 16.848 17.924  8.167   1.00 75.67  ? 283 GLU B N   1 
ATOM   4686 C  CA  . GLU B 1 287 ? 16.439 16.868  7.243   1.00 76.11  ? 283 GLU B CA  1 
ATOM   4687 C  C   . GLU B 1 287 ? 16.533 15.460  7.830   1.00 74.73  ? 283 GLU B C   1 
ATOM   4688 O  O   . GLU B 1 287 ? 15.874 14.544  7.342   1.00 73.60  ? 283 GLU B O   1 
ATOM   4689 C  CB  . GLU B 1 287 ? 17.265 16.958  5.960   1.00 117.26 ? 283 GLU B CB  1 
ATOM   4690 C  CG  . GLU B 1 287 ? 17.066 18.269  5.222   1.00 120.10 ? 283 GLU B CG  1 
ATOM   4691 C  CD  . GLU B 1 287 ? 18.037 18.453  4.076   1.00 122.66 ? 283 GLU B CD  1 
ATOM   4692 O  OE1 . GLU B 1 287 ? 19.260 18.396  4.325   1.00 123.75 ? 283 GLU B OE1 1 
ATOM   4693 O  OE2 . GLU B 1 287 ? 17.581 18.659  2.930   1.00 124.45 ? 283 GLU B OE2 1 
ATOM   4694 N  N   . MET B 1 288 ? 17.357 15.274  8.861   1.00 83.91  ? 284 MET B N   1 
ATOM   4695 C  CA  . MET B 1 288 ? 17.481 13.962  9.499   1.00 83.78  ? 284 MET B CA  1 
ATOM   4696 C  C   . MET B 1 288 ? 16.317 13.817  10.465  1.00 86.02  ? 284 MET B C   1 
ATOM   4697 O  O   . MET B 1 288 ? 15.454 12.955  10.306  1.00 85.05  ? 284 MET B O   1 
ATOM   4698 C  CB  . MET B 1 288 ? 18.806 13.850  10.253  1.00 77.79  ? 284 MET B CB  1 
ATOM   4699 C  CG  . MET B 1 288 ? 20.008 13.838  9.332   1.00 74.76  ? 284 MET B CG  1 
ATOM   4700 S  SD  . MET B 1 288 ? 21.580 13.637  10.176  1.00 70.25  ? 284 MET B SD  1 
ATOM   4701 C  CE  . MET B 1 288 ? 21.814 15.282  10.852  1.00 70.23  ? 284 MET B CE  1 
ATOM   4702 N  N   . ASN B 1 289 ? 16.304 14.683  11.466  1.00 81.07  ? 285 ASN B N   1 
ATOM   4703 C  CA  . ASN B 1 289 ? 15.242 14.697  12.454  1.00 84.38  ? 285 ASN B CA  1 
ATOM   4704 C  C   . ASN B 1 289 ? 14.822 16.142  12.691  1.00 87.47  ? 285 ASN B C   1 
ATOM   4705 O  O   . ASN B 1 289 ? 15.609 16.956  13.185  1.00 86.42  ? 285 ASN B O   1 
ATOM   4706 C  CB  . ASN B 1 289 ? 15.712 14.093  13.764  1.00 79.52  ? 285 ASN B CB  1 
ATOM   4707 C  CG  . ASN B 1 289 ? 14.657 14.162  14.825  1.00 79.82  ? 285 ASN B CG  1 
ATOM   4708 O  OD1 . ASN B 1 289 ? 13.616 13.521  14.723  1.00 79.68  ? 285 ASN B OD1 1 
ATOM   4709 N  ND2 . ASN B 1 289 ? 14.909 14.957  15.849  1.00 79.10  ? 285 ASN B ND2 1 
ATOM   4710 N  N   . PRO B 1 290 ? 13.575 16.480  12.326  1.00 199.29 ? 286 PRO B N   1 
ATOM   4711 C  CA  . PRO B 1 290 ? 13.014 17.826  12.480  1.00 200.42 ? 286 PRO B CA  1 
ATOM   4712 C  C   . PRO B 1 290 ? 12.771 18.263  13.928  1.00 200.42 ? 286 PRO B C   1 
ATOM   4713 O  O   . PRO B 1 290 ? 12.411 19.414  14.175  1.00 200.42 ? 286 PRO B O   1 
ATOM   4714 C  CB  . PRO B 1 290 ? 11.708 17.747  11.688  1.00 101.48 ? 286 PRO B CB  1 
ATOM   4715 C  CG  . PRO B 1 290 ? 11.963 16.644  10.686  1.00 100.46 ? 286 PRO B CG  1 
ATOM   4716 C  CD  . PRO B 1 290 ? 12.670 15.630  11.532  1.00 99.51  ? 286 PRO B CD  1 
ATOM   4717 N  N   . ASN B 1 291 ? 12.969 17.351  14.877  1.00 100.81 ? 287 ASN B N   1 
ATOM   4718 C  CA  . ASN B 1 291 ? 12.745 17.658  16.288  1.00 104.16 ? 287 ASN B CA  1 
ATOM   4719 C  C   . ASN B 1 291 ? 14.004 17.546  17.143  1.00 105.93 ? 287 ASN B C   1 
ATOM   4720 O  O   . ASN B 1 291 ? 13.950 17.039  18.263  1.00 106.54 ? 287 ASN B O   1 
ATOM   4721 C  CB  . ASN B 1 291 ? 11.676 16.721  16.857  1.00 149.64 ? 287 ASN B CB  1 
ATOM   4722 C  CG  . ASN B 1 291 ? 10.388 16.749  16.057  1.00 150.68 ? 287 ASN B CG  1 
ATOM   4723 O  OD1 . ASN B 1 291 ? 10.383 16.472  14.857  1.00 151.54 ? 287 ASN B OD1 1 
ATOM   4724 N  ND2 . ASN B 1 291 ? 9.286  17.081  16.723  1.00 151.13 ? 287 ASN B ND2 1 
ATOM   4725 N  N   . TYR B 1 292 ? 15.131 18.023  16.625  1.00 170.86 ? 288 TYR B N   1 
ATOM   4726 C  CA  . TYR B 1 292 ? 16.393 17.952  17.358  1.00 173.28 ? 288 TYR B CA  1 
ATOM   4727 C  C   . TYR B 1 292 ? 16.315 18.655  18.713  1.00 174.01 ? 288 TYR B C   1 
ATOM   4728 O  O   . TYR B 1 292 ? 15.353 19.374  18.992  1.00 174.12 ? 288 TYR B O   1 
ATOM   4729 C  CB  . TYR B 1 292 ? 17.517 18.558  16.519  1.00 132.38 ? 288 TYR B CB  1 
ATOM   4730 C  CG  . TYR B 1 292 ? 17.322 20.020  16.196  1.00 134.06 ? 288 TYR B CG  1 
ATOM   4731 C  CD1 . TYR B 1 292 ? 17.371 20.987  17.201  1.00 134.36 ? 288 TYR B CD1 1 
ATOM   4732 C  CD2 . TYR B 1 292 ? 17.102 20.440  14.884  1.00 134.67 ? 288 TYR B CD2 1 
ATOM   4733 C  CE1 . TYR B 1 292 ? 17.209 22.335  16.910  1.00 135.13 ? 288 TYR B CE1 1 
ATOM   4734 C  CE2 . TYR B 1 292 ? 16.939 21.789  14.580  1.00 135.30 ? 288 TYR B CE2 1 
ATOM   4735 C  CZ  . TYR B 1 292 ? 16.995 22.731  15.599  1.00 135.63 ? 288 TYR B CZ  1 
ATOM   4736 O  OH  . TYR B 1 292 ? 16.849 24.068  15.311  1.00 136.18 ? 288 TYR B OH  1 
ATOM   4737 N  N   . THR B 1 293 ? 17.336 18.453  19.544  1.00 110.14 ? 289 THR B N   1 
ATOM   4738 C  CA  . THR B 1 293 ? 17.380 19.060  20.873  1.00 110.69 ? 289 THR B CA  1 
ATOM   4739 C  C   . THR B 1 293 ? 18.682 19.834  21.136  1.00 111.20 ? 289 THR B C   1 
ATOM   4740 O  O   . THR B 1 293 ? 18.683 20.825  21.866  1.00 111.47 ? 289 THR B O   1 
ATOM   4741 C  CB  . THR B 1 293 ? 17.191 17.982  21.962  1.00 92.97  ? 289 THR B CB  1 
ATOM   4742 O  OG1 . THR B 1 293 ? 15.950 17.288  21.745  1.00 92.82  ? 289 THR B OG1 1 
ATOM   4743 C  CG2 . THR B 1 293 ? 17.187 18.621  23.343  1.00 92.71  ? 289 THR B CG2 1 
ATOM   4744 N  N   . GLU B 1 294 ? 19.783 19.367  20.549  1.00 82.58  ? 290 GLU B N   1 
ATOM   4745 C  CA  . GLU B 1 294 ? 21.098 20.008  20.672  1.00 82.77  ? 290 GLU B CA  1 
ATOM   4746 C  C   . GLU B 1 294 ? 21.734 19.982  22.065  1.00 81.96  ? 290 GLU B C   1 
ATOM   4747 O  O   . GLU B 1 294 ? 21.219 19.367  22.999  1.00 81.18  ? 290 GLU B O   1 
ATOM   4748 C  CB  . GLU B 1 294 ? 20.998 21.450  20.175  1.00 112.14 ? 290 GLU B CB  1 
ATOM   4749 C  CG  . GLU B 1 294 ? 20.359 21.551  18.799  1.00 113.89 ? 290 GLU B CG  1 
ATOM   4750 C  CD  . GLU B 1 294 ? 19.918 22.959  18.451  1.00 115.27 ? 290 GLU B CD  1 
ATOM   4751 O  OE1 . GLU B 1 294 ? 19.169 23.563  19.249  1.00 116.15 ? 290 GLU B OE1 1 
ATOM   4752 O  OE2 . GLU B 1 294 ? 20.312 23.458  17.376  1.00 115.80 ? 290 GLU B OE2 1 
ATOM   4753 N  N   . PRO B 1 304 ? 38.736 15.104  6.246   1.00 106.15 ? 300 PRO B N   1 
ATOM   4754 C  CA  . PRO B 1 304 ? 38.997 14.600  4.893   1.00 103.91 ? 300 PRO B CA  1 
ATOM   4755 C  C   . PRO B 1 304 ? 38.315 13.259  4.785   1.00 101.28 ? 300 PRO B C   1 
ATOM   4756 O  O   . PRO B 1 304 ? 37.675 12.824  5.736   1.00 101.24 ? 300 PRO B O   1 
ATOM   4757 C  CB  . PRO B 1 304 ? 40.514 14.441  4.858   1.00 126.79 ? 300 PRO B CB  1 
ATOM   4758 C  CG  . PRO B 1 304 ? 41.002 15.312  5.985   1.00 127.31 ? 300 PRO B CG  1 
ATOM   4759 C  CD  . PRO B 1 304 ? 39.969 15.094  7.044   1.00 127.50 ? 300 PRO B CD  1 
ATOM   4760 N  N   . TRP B 1 305 ? 38.448 12.602  3.638   1.00 118.17 ? 301 TRP B N   1 
ATOM   4761 C  CA  . TRP B 1 305 ? 37.850 11.283  3.452   1.00 114.11 ? 301 TRP B CA  1 
ATOM   4762 C  C   . TRP B 1 305 ? 38.933 10.339  2.969   1.00 114.04 ? 301 TRP B C   1 
ATOM   4763 O  O   . TRP B 1 305 ? 38.751 9.126   2.973   1.00 113.76 ? 301 TRP B O   1 
ATOM   4764 C  CB  . TRP B 1 305 ? 36.719 11.316  2.421   1.00 56.21  ? 301 TRP B CB  1 
ATOM   4765 C  CG  . TRP B 1 305 ? 35.314 11.026  2.958   1.00 50.99  ? 301 TRP B CG  1 
ATOM   4766 C  CD1 . TRP B 1 305 ? 34.209 11.831  2.832   1.00 48.87  ? 301 TRP B CD1 1 
ATOM   4767 C  CD2 . TRP B 1 305 ? 34.858 9.837   3.631   1.00 47.29  ? 301 TRP B CD2 1 
ATOM   4768 N  NE1 . TRP B 1 305 ? 33.100 11.216  3.378   1.00 46.42  ? 301 TRP B NE1 1 
ATOM   4769 C  CE2 . TRP B 1 305 ? 33.471 9.995   3.875   1.00 46.43  ? 301 TRP B CE2 1 
ATOM   4770 C  CE3 . TRP B 1 305 ? 35.481 8.657   4.048   1.00 45.72  ? 301 TRP B CE3 1 
ATOM   4771 C  CZ2 . TRP B 1 305 ? 32.707 9.019   4.519   1.00 44.61  ? 301 TRP B CZ2 1 
ATOM   4772 C  CZ3 . TRP B 1 305 ? 34.714 7.684   4.689   1.00 45.19  ? 301 TRP B CZ3 1 
ATOM   4773 C  CH2 . TRP B 1 305 ? 33.347 7.874   4.917   1.00 44.11  ? 301 TRP B CH2 1 
ATOM   4774 N  N   . THR B 1 306 ? 40.063 10.893  2.546   1.00 103.77 ? 302 THR B N   1 
ATOM   4775 C  CA  . THR B 1 306 ? 41.157 10.055  2.073   1.00 103.70 ? 302 THR B CA  1 
ATOM   4776 C  C   . THR B 1 306 ? 42.140 9.814   3.202   1.00 102.96 ? 302 THR B C   1 
ATOM   4777 O  O   . THR B 1 306 ? 42.952 8.890   3.144   1.00 103.76 ? 302 THR B O   1 
ATOM   4778 C  CB  . THR B 1 306 ? 41.910 10.699  0.898   1.00 84.84  ? 302 THR B CB  1 
ATOM   4779 O  OG1 . THR B 1 306 ? 40.981 11.016  -0.147  1.00 84.60  ? 302 THR B OG1 1 
ATOM   4780 C  CG2 . THR B 1 306 ? 42.974 9.736   0.355   1.00 84.68  ? 302 THR B CG2 1 
ATOM   4781 N  N   . LYS B 1 307 ? 42.059 10.653  4.229   1.00 89.05  ? 303 LYS B N   1 
ATOM   4782 C  CA  . LYS B 1 307 ? 42.932 10.529  5.388   1.00 86.88  ? 303 LYS B CA  1 
ATOM   4783 C  C   . LYS B 1 307 ? 42.429 9.363   6.239   1.00 83.90  ? 303 LYS B C   1 
ATOM   4784 O  O   . LYS B 1 307 ? 43.088 8.929   7.182   1.00 83.35  ? 303 LYS B O   1 
ATOM   4785 C  CB  . LYS B 1 307 ? 42.881 11.823  6.204   1.00 133.63 ? 303 LYS B CB  1 
ATOM   4786 C  CG  . LYS B 1 307 ? 43.967 11.952  7.264   1.00 137.36 ? 303 LYS B CG  1 
ATOM   4787 C  CD  . LYS B 1 307 ? 45.346 12.143  6.638   1.00 139.65 ? 303 LYS B CD  1 
ATOM   4788 C  CE  . LYS B 1 307 ? 46.413 12.355  7.704   1.00 140.71 ? 303 LYS B CE  1 
ATOM   4789 N  NZ  . LYS B 1 307 ? 47.764 12.560  7.114   1.00 142.09 ? 303 LYS B NZ  1 
ATOM   4790 N  N   . VAL B 1 308 ? 41.258 8.858   5.864   1.00 52.77  ? 304 VAL B N   1 
ATOM   4791 C  CA  . VAL B 1 308 ? 40.566 7.779   6.552   1.00 48.74  ? 304 VAL B CA  1 
ATOM   4792 C  C   . VAL B 1 308 ? 41.044 6.373   6.237   1.00 47.76  ? 304 VAL B C   1 
ATOM   4793 O  O   . VAL B 1 308 ? 41.188 5.545   7.137   1.00 45.72  ? 304 VAL B O   1 
ATOM   4794 C  CB  . VAL B 1 308 ? 39.051 7.842   6.238   1.00 39.54  ? 304 VAL B CB  1 
ATOM   4795 C  CG1 . VAL B 1 308 ? 38.317 6.688   6.912   1.00 38.43  ? 304 VAL B CG1 1 
ATOM   4796 C  CG2 . VAL B 1 308 ? 38.483 9.196   6.677   1.00 39.26  ? 304 VAL B CG2 1 
ATOM   4797 N  N   . PHE B 1 309 ? 41.272 6.090   4.964   1.00 66.56  ? 305 PHE B N   1 
ATOM   4798 C  CA  . PHE B 1 309 ? 41.703 4.753   4.566   1.00 66.84  ? 305 PHE B CA  1 
ATOM   4799 C  C   . PHE B 1 309 ? 43.188 4.691   4.237   1.00 68.12  ? 305 PHE B C   1 
ATOM   4800 O  O   . PHE B 1 309 ? 43.802 5.710   3.910   1.00 68.73  ? 305 PHE B O   1 
ATOM   4801 C  CB  . PHE B 1 309 ? 40.893 4.295   3.349   1.00 52.17  ? 305 PHE B CB  1 
ATOM   4802 C  CG  . PHE B 1 309 ? 39.405 4.347   3.556   1.00 50.21  ? 305 PHE B CG  1 
ATOM   4803 C  CD1 . PHE B 1 309 ? 38.739 3.306   4.208   1.00 48.57  ? 305 PHE B CD1 1 
ATOM   4804 C  CD2 . PHE B 1 309 ? 38.676 5.460   3.144   1.00 47.82  ? 305 PHE B CD2 1 
ATOM   4805 C  CE1 . PHE B 1 309 ? 37.377 3.379   4.447   1.00 46.84  ? 305 PHE B CE1 1 
ATOM   4806 C  CE2 . PHE B 1 309 ? 37.316 5.545   3.378   1.00 48.67  ? 305 PHE B CE2 1 
ATOM   4807 C  CZ  . PHE B 1 309 ? 36.663 4.509   4.029   1.00 47.01  ? 305 PHE B CZ  1 
ATOM   4808 N  N   . ARG B 1 310 ? 43.762 3.494   4.314   1.00 44.27  ? 306 ARG B N   1 
ATOM   4809 C  CA  . ARG B 1 310 ? 45.172 3.315   4.006   1.00 47.39  ? 306 ARG B CA  1 
ATOM   4810 C  C   . ARG B 1 310 ? 45.443 3.909   2.614   1.00 48.09  ? 306 ARG B C   1 
ATOM   4811 O  O   . ARG B 1 310 ? 44.513 4.257   1.876   1.00 48.19  ? 306 ARG B O   1 
ATOM   4812 C  CB  . ARG B 1 310 ? 45.543 1.836   4.049   1.00 93.89  ? 306 ARG B CB  1 
ATOM   4813 C  CG  . ARG B 1 310 ? 44.839 0.995   3.027   1.00 98.57  ? 306 ARG B CG  1 
ATOM   4814 C  CD  . ARG B 1 310 ? 45.046 -0.461  3.324   1.00 101.71 ? 306 ARG B CD  1 
ATOM   4815 N  NE  . ARG B 1 310 ? 44.719 -1.297  2.179   1.00 106.05 ? 306 ARG B NE  1 
ATOM   4816 C  CZ  . ARG B 1 310 ? 44.922 -2.609  2.142   1.00 108.09 ? 306 ARG B CZ  1 
ATOM   4817 N  NH1 . ARG B 1 310 ? 45.447 -3.228  3.194   1.00 108.88 ? 306 ARG B NH1 1 
ATOM   4818 N  NH2 . ARG B 1 310 ? 44.620 -3.303  1.051   1.00 108.29 ? 306 ARG B NH2 1 
ATOM   4819 N  N   . PRO B 1 311 ? 46.724 4.060   2.247   1.00 85.61  ? 307 PRO B N   1 
ATOM   4820 C  CA  . PRO B 1 311 ? 47.073 4.629   0.943   1.00 85.47  ? 307 PRO B CA  1 
ATOM   4821 C  C   . PRO B 1 311 ? 46.727 3.804   -0.290  1.00 85.46  ? 307 PRO B C   1 
ATOM   4822 O  O   . PRO B 1 311 ? 46.376 4.360   -1.330  1.00 84.70  ? 307 PRO B O   1 
ATOM   4823 C  CB  . PRO B 1 311 ? 48.566 4.879   1.077   1.00 66.40  ? 307 PRO B CB  1 
ATOM   4824 C  CG  . PRO B 1 311 ? 48.714 5.170   2.541   1.00 66.51  ? 307 PRO B CG  1 
ATOM   4825 C  CD  . PRO B 1 311 ? 47.897 4.063   3.136   1.00 66.34  ? 307 PRO B CD  1 
ATOM   4826 N  N   . ARG B 1 312 ? 46.827 2.485   -0.184  1.00 87.09  ? 308 ARG B N   1 
ATOM   4827 C  CA  . ARG B 1 312 ? 46.512 1.621   -1.318  1.00 88.92  ? 308 ARG B CA  1 
ATOM   4828 C  C   . ARG B 1 312 ? 45.074 1.788   -1.820  1.00 87.12  ? 308 ARG B C   1 
ATOM   4829 O  O   . ARG B 1 312 ? 44.850 2.018   -3.009  1.00 88.20  ? 308 ARG B O   1 
ATOM   4830 C  CB  . ARG B 1 312 ? 46.755 0.155   -0.948  1.00 140.20 ? 308 ARG B CB  1 
ATOM   4831 C  CG  . ARG B 1 312 ? 48.195 -0.151  -0.589  1.00 144.45 ? 308 ARG B CG  1 
ATOM   4832 C  CD  . ARG B 1 312 ? 49.132 0.270   -1.711  1.00 147.51 ? 308 ARG B CD  1 
ATOM   4833 N  NE  . ARG B 1 312 ? 50.534 0.087   -1.355  1.00 151.13 ? 308 ARG B NE  1 
ATOM   4834 C  CZ  . ARG B 1 312 ? 51.101 0.602   -0.269  1.00 152.10 ? 308 ARG B CZ  1 
ATOM   4835 N  NH1 . ARG B 1 312 ? 50.383 1.332   0.575   1.00 152.86 ? 308 ARG B NH1 1 
ATOM   4836 N  NH2 . ARG B 1 312 ? 52.389 0.393   -0.031  1.00 152.87 ? 308 ARG B NH2 1 
ATOM   4837 N  N   . THR B 1 313 ? 44.110 1.681   -0.906  1.00 69.25  ? 309 THR B N   1 
ATOM   4838 C  CA  . THR B 1 313 ? 42.691 1.796   -1.238  1.00 66.04  ? 309 THR B CA  1 
ATOM   4839 C  C   . THR B 1 313 ? 42.379 2.669   -2.458  1.00 64.35  ? 309 THR B C   1 
ATOM   4840 O  O   . THR B 1 313 ? 42.783 3.833   -2.540  1.00 64.64  ? 309 THR B O   1 
ATOM   4841 C  CB  . THR B 1 313 ? 41.866 2.291   -0.019  1.00 60.03  ? 309 THR B CB  1 
ATOM   4842 O  OG1 . THR B 1 313 ? 42.232 3.629   0.311   1.00 58.65  ? 309 THR B OG1 1 
ATOM   4843 C  CG2 . THR B 1 313 ? 42.122 1.406   1.183   1.00 59.30  ? 309 THR B CG2 1 
ATOM   4844 N  N   . PRO B 1 314 ? 41.641 2.099   -3.422  1.00 65.45  ? 310 PRO B N   1 
ATOM   4845 C  CA  . PRO B 1 314 ? 41.215 2.714   -4.683  1.00 65.18  ? 310 PRO B CA  1 
ATOM   4846 C  C   . PRO B 1 314 ? 40.386 3.975   -4.502  1.00 65.50  ? 310 PRO B C   1 
ATOM   4847 O  O   . PRO B 1 314 ? 39.536 4.051   -3.627  1.00 65.22  ? 310 PRO B O   1 
ATOM   4848 C  CB  . PRO B 1 314 ? 40.400 1.608   -5.350  1.00 42.53  ? 310 PRO B CB  1 
ATOM   4849 C  CG  . PRO B 1 314 ? 40.961 0.342   -4.759  1.00 43.30  ? 310 PRO B CG  1 
ATOM   4850 C  CD  . PRO B 1 314 ? 41.123 0.724   -3.313  1.00 41.80  ? 310 PRO B CD  1 
ATOM   4851 N  N   . PRO B 1 315 ? 40.617 4.985   -5.342  1.00 59.22  ? 311 PRO B N   1 
ATOM   4852 C  CA  . PRO B 1 315 ? 39.863 6.237   -5.252  1.00 57.69  ? 311 PRO B CA  1 
ATOM   4853 C  C   . PRO B 1 315 ? 38.356 6.031   -5.430  1.00 56.57  ? 311 PRO B C   1 
ATOM   4854 O  O   . PRO B 1 315 ? 37.556 6.764   -4.856  1.00 55.79  ? 311 PRO B O   1 
ATOM   4855 C  CB  . PRO B 1 315 ? 40.461 7.068   -6.379  1.00 65.40  ? 311 PRO B CB  1 
ATOM   4856 C  CG  . PRO B 1 315 ? 41.877 6.602   -6.403  1.00 66.97  ? 311 PRO B CG  1 
ATOM   4857 C  CD  . PRO B 1 315 ? 41.713 5.110   -6.314  1.00 66.51  ? 311 PRO B CD  1 
ATOM   4858 N  N   . GLU B 1 316 ? 37.976 5.029   -6.220  1.00 71.93  ? 312 GLU B N   1 
ATOM   4859 C  CA  . GLU B 1 316 ? 36.565 4.744   -6.477  1.00 71.02  ? 312 GLU B CA  1 
ATOM   4860 C  C   . GLU B 1 316 ? 35.837 4.301   -5.222  1.00 69.05  ? 312 GLU B C   1 
ATOM   4861 O  O   . GLU B 1 316 ? 34.709 4.731   -4.959  1.00 66.98  ? 312 GLU B O   1 
ATOM   4862 C  CB  . GLU B 1 316 ? 36.411 3.660   -7.553  1.00 91.00  ? 312 GLU B CB  1 
ATOM   4863 C  CG  . GLU B 1 316 ? 36.887 4.073   -8.927  1.00 96.63  ? 312 GLU B CG  1 
ATOM   4864 C  CD  . GLU B 1 316 ? 38.397 4.107   -9.029  1.00 100.23 ? 312 GLU B CD  1 
ATOM   4865 O  OE1 . GLU B 1 316 ? 38.909 4.686   -10.015 1.00 103.38 ? 312 GLU B OE1 1 
ATOM   4866 O  OE2 . GLU B 1 316 ? 39.071 3.548   -8.133  1.00 98.70  ? 312 GLU B OE2 1 
ATOM   4867 N  N   . ALA B 1 317 ? 36.484 3.429   -4.457  1.00 46.27  ? 313 ALA B N   1 
ATOM   4868 C  CA  . ALA B 1 317 ? 35.907 2.921   -3.229  1.00 46.02  ? 313 ALA B CA  1 
ATOM   4869 C  C   . ALA B 1 317 ? 35.614 4.072   -2.275  1.00 46.88  ? 313 ALA B C   1 
ATOM   4870 O  O   . ALA B 1 317 ? 34.545 4.138   -1.667  1.00 44.57  ? 313 ALA B O   1 
ATOM   4871 C  CB  . ALA B 1 317 ? 36.863 1.942   -2.585  1.00 35.96  ? 313 ALA B CB  1 
ATOM   4872 N  N   . ILE B 1 318 ? 36.571 4.981   -2.153  1.00 42.97  ? 314 ILE B N   1 
ATOM   4873 C  CA  . ILE B 1 318 ? 36.427 6.125   -1.261  1.00 43.43  ? 314 ILE B CA  1 
ATOM   4874 C  C   . ILE B 1 318 ? 35.362 7.071   -1.769  1.00 42.90  ? 314 ILE B C   1 
ATOM   4875 O  O   . ILE B 1 318 ? 34.617 7.672   -0.982  1.00 42.67  ? 314 ILE B O   1 
ATOM   4876 C  CB  . ILE B 1 318 ? 37.753 6.877   -1.132  1.00 47.56  ? 314 ILE B CB  1 
ATOM   4877 C  CG1 . ILE B 1 318 ? 38.808 5.942   -0.531  1.00 47.88  ? 314 ILE B CG1 1 
ATOM   4878 C  CG2 . ILE B 1 318 ? 37.570 8.103   -0.279  1.00 45.84  ? 314 ILE B CG2 1 
ATOM   4879 C  CD1 . ILE B 1 318 ? 40.208 6.497   -0.552  1.00 49.87  ? 314 ILE B CD1 1 
ATOM   4880 N  N   . ALA B 1 319 ? 35.289 7.199   -3.091  1.00 49.32  ? 315 ALA B N   1 
ATOM   4881 C  CA  . ALA B 1 319 ? 34.295 8.060   -3.726  1.00 48.33  ? 315 ALA B CA  1 
ATOM   4882 C  C   . ALA B 1 319 ? 32.896 7.539   -3.414  1.00 48.74  ? 315 ALA B C   1 
ATOM   4883 O  O   . ALA B 1 319 ? 31.996 8.314   -3.082  1.00 48.58  ? 315 ALA B O   1 
ATOM   4884 C  CB  . ALA B 1 319 ? 34.510 8.084   -5.226  1.00 84.37  ? 315 ALA B CB  1 
ATOM   4885 N  N   . LEU B 1 320 ? 32.731 6.222   -3.526  1.00 61.94  ? 316 LEU B N   1 
ATOM   4886 C  CA  . LEU B 1 320 ? 31.458 5.563   -3.268  1.00 59.25  ? 316 LEU B CA  1 
ATOM   4887 C  C   . LEU B 1 320 ? 31.068 5.741   -1.798  1.00 57.84  ? 316 LEU B C   1 
ATOM   4888 O  O   . LEU B 1 320 ? 29.914 6.039   -1.479  1.00 55.35  ? 316 LEU B O   1 
ATOM   4889 C  CB  . LEU B 1 320 ? 31.575 4.073   -3.590  1.00 30.87  ? 316 LEU B CB  1 
ATOM   4890 C  CG  . LEU B 1 320 ? 30.371 3.289   -4.114  1.00 32.96  ? 316 LEU B CG  1 
ATOM   4891 C  CD1 . LEU B 1 320 ? 30.511 1.857   -3.675  1.00 27.42  ? 316 LEU B CD1 1 
ATOM   4892 C  CD2 . LEU B 1 320 ? 29.073 3.861   -3.603  1.00 28.87  ? 316 LEU B CD2 1 
ATOM   4893 N  N   . CYS B 1 321 ? 32.027 5.558   -0.900  1.00 45.42  ? 317 CYS B N   1 
ATOM   4894 C  CA  . CYS B 1 321 ? 31.736 5.710   0.510   1.00 49.70  ? 317 CYS B CA  1 
ATOM   4895 C  C   . CYS B 1 321 ? 31.149 7.065   0.807   1.00 50.71  ? 317 CYS B C   1 
ATOM   4896 O  O   . CYS B 1 321 ? 30.115 7.169   1.470   1.00 50.76  ? 317 CYS B O   1 
ATOM   4897 C  CB  . CYS B 1 321 ? 32.989 5.543   1.349   1.00 55.30  ? 317 CYS B CB  1 
ATOM   4898 S  SG  . CYS B 1 321 ? 33.339 3.869   1.742   1.00 62.19  ? 317 CYS B SG  1 
ATOM   4899 N  N   . SER B 1 322 ? 31.815 8.106   0.322   1.00 47.74  ? 318 SER B N   1 
ATOM   4900 C  CA  . SER B 1 322 ? 31.365 9.467   0.570   1.00 48.84  ? 318 SER B CA  1 
ATOM   4901 C  C   . SER B 1 322 ? 29.965 9.723   0.031   1.00 47.46  ? 318 SER B C   1 
ATOM   4902 O  O   . SER B 1 322 ? 29.209 10.515  0.589   1.00 46.85  ? 318 SER B O   1 
ATOM   4903 C  CB  . SER B 1 322 ? 32.349 10.454  -0.040  1.00 65.82  ? 318 SER B CB  1 
ATOM   4904 O  OG  . SER B 1 322 ? 32.447 10.255  -1.435  1.00 72.17  ? 318 SER B OG  1 
ATOM   4905 N  N   . ARG B 1 323 ? 29.603 9.044   -1.048  1.00 39.89  ? 319 ARG B N   1 
ATOM   4906 C  CA  . ARG B 1 323 ? 28.277 9.236   -1.612  1.00 41.12  ? 319 ARG B CA  1 
ATOM   4907 C  C   . ARG B 1 323 ? 27.210 8.425   -0.885  1.00 40.03  ? 319 ARG B C   1 
ATOM   4908 O  O   . ARG B 1 323 ? 26.021 8.658   -1.074  1.00 39.87  ? 319 ARG B O   1 
ATOM   4909 C  CB  . ARG B 1 323 ? 28.268 8.878   -3.103  1.00 55.04  ? 319 ARG B CB  1 
ATOM   4910 C  CG  . ARG B 1 323 ? 29.079 9.817   -3.987  1.00 60.41  ? 319 ARG B CG  1 
ATOM   4911 C  CD  . ARG B 1 323 ? 28.686 11.274  -3.764  1.00 66.38  ? 319 ARG B CD  1 
ATOM   4912 N  NE  . ARG B 1 323 ? 27.241 11.476  -3.827  1.00 72.01  ? 319 ARG B NE  1 
ATOM   4913 C  CZ  . ARG B 1 323 ? 26.511 11.389  -4.936  1.00 73.82  ? 319 ARG B CZ  1 
ATOM   4914 N  NH1 . ARG B 1 323 ? 27.080 11.105  -6.102  1.00 77.06  ? 319 ARG B NH1 1 
ATOM   4915 N  NH2 . ARG B 1 323 ? 25.201 11.580  -4.876  1.00 74.18  ? 319 ARG B NH2 1 
ATOM   4916 N  N   . LEU B 1 324 ? 27.621 7.467   -0.062  1.00 41.14  ? 320 LEU B N   1 
ATOM   4917 C  CA  . LEU B 1 324 ? 26.659 6.651   0.666   1.00 40.22  ? 320 LEU B CA  1 
ATOM   4918 C  C   . LEU B 1 324 ? 26.462 7.229   2.061   1.00 40.83  ? 320 LEU B C   1 
ATOM   4919 O  O   . LEU B 1 324 ? 25.336 7.406   2.534   1.00 39.00  ? 320 LEU B O   1 
ATOM   4920 C  CB  . LEU B 1 324 ? 27.161 5.211   0.776   1.00 31.81  ? 320 LEU B CB  1 
ATOM   4921 C  CG  . LEU B 1 324 ? 27.328 4.420   -0.523  1.00 33.62  ? 320 LEU B CG  1 
ATOM   4922 C  CD1 . LEU B 1 324 ? 28.196 3.179   -0.296  1.00 29.64  ? 320 LEU B CD1 1 
ATOM   4923 C  CD2 . LEU B 1 324 ? 25.957 4.033   -1.044  1.00 30.96  ? 320 LEU B CD2 1 
ATOM   4924 N  N   . LEU B 1 325 ? 27.576 7.539   2.707   1.00 43.41  ? 321 LEU B N   1 
ATOM   4925 C  CA  . LEU B 1 325 ? 27.552 8.071   4.058   1.00 44.89  ? 321 LEU B CA  1 
ATOM   4926 C  C   . LEU B 1 325 ? 27.359 9.581   4.084   1.00 45.86  ? 321 LEU B C   1 
ATOM   4927 O  O   . LEU B 1 325 ? 28.307 10.339  4.305   1.00 46.46  ? 321 LEU B O   1 
ATOM   4928 C  CB  . LEU B 1 325 ? 28.856 7.664   4.763   1.00 29.78  ? 321 LEU B CB  1 
ATOM   4929 C  CG  . LEU B 1 325 ? 29.036 6.143   4.750   1.00 31.26  ? 321 LEU B CG  1 
ATOM   4930 C  CD1 . LEU B 1 325 ? 30.389 5.786   5.266   1.00 28.97  ? 321 LEU B CD1 1 
ATOM   4931 C  CD2 . LEU B 1 325 ? 27.944 5.498   5.591   1.00 29.67  ? 321 LEU B CD2 1 
ATOM   4932 N  N   . GLU B 1 326 ? 26.115 10.002  3.866   1.00 46.99  ? 322 GLU B N   1 
ATOM   4933 C  CA  . GLU B 1 326 ? 25.749 11.417  3.832   1.00 48.67  ? 322 GLU B CA  1 
ATOM   4934 C  C   . GLU B 1 326 ? 24.702 11.764  4.890   1.00 48.45  ? 322 GLU B C   1 
ATOM   4935 O  O   . GLU B 1 326 ? 23.738 11.017  5.096   1.00 47.46  ? 322 GLU B O   1 
ATOM   4936 C  CB  . GLU B 1 326 ? 25.175 11.770  2.457   1.00 58.40  ? 322 GLU B CB  1 
ATOM   4937 C  CG  . GLU B 1 326 ? 26.123 11.562  1.295   1.00 64.15  ? 322 GLU B CG  1 
ATOM   4938 C  CD  . GLU B 1 326 ? 26.678 12.861  0.760   1.00 67.15  ? 322 GLU B CD  1 
ATOM   4939 O  OE1 . GLU B 1 326 ? 27.454 12.824  -0.222  1.00 70.63  ? 322 GLU B OE1 1 
ATOM   4940 O  OE2 . GLU B 1 326 ? 26.337 13.922  1.321   1.00 68.92  ? 322 GLU B OE2 1 
ATOM   4941 N  N   . TYR B 1 327 ? 24.882 12.906  5.550   1.00 51.29  ? 323 TYR B N   1 
ATOM   4942 C  CA  . TYR B 1 327 ? 23.922 13.355  6.554   1.00 51.88  ? 323 TYR B CA  1 
ATOM   4943 C  C   . TYR B 1 327 ? 22.525 13.470  5.938   1.00 51.92  ? 323 TYR B C   1 
ATOM   4944 O  O   . TYR B 1 327 ? 21.551 12.932  6.464   1.00 51.97  ? 323 TYR B O   1 
ATOM   4945 C  CB  . TYR B 1 327 ? 24.322 14.722  7.113   1.00 42.72  ? 323 TYR B CB  1 
ATOM   4946 C  CG  . TYR B 1 327 ? 25.427 14.693  8.142   1.00 41.49  ? 323 TYR B CG  1 
ATOM   4947 C  CD1 . TYR B 1 327 ? 26.566 15.478  7.984   1.00 43.42  ? 323 TYR B CD1 1 
ATOM   4948 C  CD2 . TYR B 1 327 ? 25.311 13.924  9.302   1.00 42.35  ? 323 TYR B CD2 1 
ATOM   4949 C  CE1 . TYR B 1 327 ? 27.567 15.505  8.954   1.00 43.52  ? 323 TYR B CE1 1 
ATOM   4950 C  CE2 . TYR B 1 327 ? 26.303 13.950  10.278  1.00 43.91  ? 323 TYR B CE2 1 
ATOM   4951 C  CZ  . TYR B 1 327 ? 27.426 14.745  10.093  1.00 45.12  ? 323 TYR B CZ  1 
ATOM   4952 O  OH  . TYR B 1 327 ? 28.397 14.798  11.058  1.00 46.15  ? 323 TYR B OH  1 
ATOM   4953 N  N   . THR B 1 328 ? 22.419 14.182  4.822   1.00 42.16  ? 324 THR B N   1 
ATOM   4954 C  CA  . THR B 1 328 ? 21.121 14.341  4.186   1.00 43.08  ? 324 THR B CA  1 
ATOM   4955 C  C   . THR B 1 328 ? 20.656 13.023  3.578   1.00 42.42  ? 324 THR B C   1 
ATOM   4956 O  O   . THR B 1 328 ? 21.263 12.517  2.640   1.00 43.06  ? 324 THR B O   1 
ATOM   4957 C  CB  . THR B 1 328 ? 21.190 15.398  3.093   1.00 56.40  ? 324 THR B CB  1 
ATOM   4958 O  OG1 . THR B 1 328 ? 21.537 16.655  3.680   1.00 59.51  ? 324 THR B OG1 1 
ATOM   4959 C  CG2 . THR B 1 328 ? 19.859 15.508  2.386   1.00 53.63  ? 324 THR B CG2 1 
ATOM   4960 N  N   . PRO B 1 329 ? 19.570 12.449  4.103   1.00 46.13  ? 325 PRO B N   1 
ATOM   4961 C  CA  . PRO B 1 329 ? 19.045 11.178  3.587   1.00 47.27  ? 325 PRO B CA  1 
ATOM   4962 C  C   . PRO B 1 329 ? 18.780 11.149  2.079   1.00 48.49  ? 325 PRO B C   1 
ATOM   4963 O  O   . PRO B 1 329 ? 19.133 10.182  1.395   1.00 47.30  ? 325 PRO B O   1 
ATOM   4964 C  CB  . PRO B 1 329 ? 17.775 10.972  4.400   1.00 33.28  ? 325 PRO B CB  1 
ATOM   4965 C  CG  . PRO B 1 329 ? 18.130 11.583  5.718   1.00 34.28  ? 325 PRO B CG  1 
ATOM   4966 C  CD  . PRO B 1 329 ? 18.849 12.870  5.313   1.00 33.60  ? 325 PRO B CD  1 
ATOM   4967 N  N   . THR B 1 330 ? 18.176 12.211  1.556   1.00 52.98  ? 326 THR B N   1 
ATOM   4968 C  CA  . THR B 1 330 ? 17.872 12.285  0.130   1.00 50.57  ? 326 THR B CA  1 
ATOM   4969 C  C   . THR B 1 330 ? 19.095 12.452  -0.748  1.00 49.46  ? 326 THR B C   1 
ATOM   4970 O  O   . THR B 1 330 ? 18.995 12.324  -1.960  1.00 51.59  ? 326 THR B O   1 
ATOM   4971 C  CB  . THR B 1 330 ? 16.937 13.448  -0.189  1.00 53.87  ? 326 THR B CB  1 
ATOM   4972 O  OG1 . THR B 1 330 ? 17.562 14.673  0.215   1.00 53.67  ? 326 THR B OG1 1 
ATOM   4973 C  CG2 . THR B 1 330 ? 15.603 13.274  0.522   1.00 51.43  ? 326 THR B CG2 1 
ATOM   4974 N  N   . ALA B 1 331 ? 20.243 12.746  -0.155  1.00 42.23  ? 327 ALA B N   1 
ATOM   4975 C  CA  . ALA B 1 331 ? 21.455 12.914  -0.950  1.00 42.50  ? 327 ALA B CA  1 
ATOM   4976 C  C   . ALA B 1 331 ? 22.212 11.621  -1.182  1.00 43.46  ? 327 ALA B C   1 
ATOM   4977 O  O   . ALA B 1 331 ? 23.045 11.542  -2.079  1.00 43.24  ? 327 ALA B O   1 
ATOM   4978 C  CB  . ALA B 1 331 ? 22.372 13.899  -0.300  1.00 16.90  ? 327 ALA B CB  1 
ATOM   4979 N  N   . ARG B 1 332 ? 21.942 10.602  -0.376  1.00 41.05  ? 328 ARG B N   1 
ATOM   4980 C  CA  . ARG B 1 332 ? 22.661 9.345   -0.544  1.00 40.90  ? 328 ARG B CA  1 
ATOM   4981 C  C   . ARG B 1 332 ? 22.230 8.665   -1.834  1.00 38.97  ? 328 ARG B C   1 
ATOM   4982 O  O   . ARG B 1 332 ? 21.068 8.765   -2.227  1.00 39.10  ? 328 ARG B O   1 
ATOM   4983 C  CB  . ARG B 1 332 ? 22.382 8.429   0.644   1.00 42.38  ? 328 ARG B CB  1 
ATOM   4984 C  CG  . ARG B 1 332 ? 22.633 9.090   1.973   1.00 41.50  ? 328 ARG B CG  1 
ATOM   4985 C  CD  . ARG B 1 332 ? 22.080 8.260   3.137   1.00 41.05  ? 328 ARG B CD  1 
ATOM   4986 N  NE  . ARG B 1 332 ? 22.128 9.037   4.371   1.00 40.29  ? 328 ARG B NE  1 
ATOM   4987 C  CZ  . ARG B 1 332 ? 21.390 8.784   5.440   1.00 39.72  ? 328 ARG B CZ  1 
ATOM   4988 N  NH1 . ARG B 1 332 ? 20.551 7.764   5.432   1.00 36.22  ? 328 ARG B NH1 1 
ATOM   4989 N  NH2 . ARG B 1 332 ? 21.457 9.583   6.493   1.00 39.97  ? 328 ARG B NH2 1 
ATOM   4990 N  N   . LEU B 1 333 ? 23.167 7.990   -2.499  1.00 33.06  ? 329 LEU B N   1 
ATOM   4991 C  CA  . LEU B 1 333 ? 22.843 7.267   -3.722  1.00 32.05  ? 329 LEU B CA  1 
ATOM   4992 C  C   . LEU B 1 333 ? 21.736 6.256   -3.429  1.00 30.97  ? 329 LEU B C   1 
ATOM   4993 O  O   . LEU B 1 333 ? 21.506 5.883   -2.277  1.00 31.04  ? 329 LEU B O   1 
ATOM   4994 C  CB  . LEU B 1 333 ? 24.042 6.489   -4.223  1.00 36.97  ? 329 LEU B CB  1 
ATOM   4995 C  CG  . LEU B 1 333 ? 25.293 7.221   -4.673  1.00 38.44  ? 329 LEU B CG  1 
ATOM   4996 C  CD1 . LEU B 1 333 ? 26.375 6.183   -5.021  1.00 38.33  ? 329 LEU B CD1 1 
ATOM   4997 C  CD2 . LEU B 1 333 ? 24.970 8.094   -5.866  1.00 39.62  ? 329 LEU B CD2 1 
ATOM   4998 N  N   . THR B 1 334 ? 21.047 5.816   -4.474  1.00 39.47  ? 330 THR B N   1 
ATOM   4999 C  CA  . THR B 1 334 ? 20.013 4.810   -4.313  1.00 39.68  ? 330 THR B CA  1 
ATOM   5000 C  C   . THR B 1 334 ? 20.747 3.495   -4.533  1.00 37.23  ? 330 THR B C   1 
ATOM   5001 O  O   . THR B 1 334 ? 21.867 3.485   -5.052  1.00 35.30  ? 330 THR B O   1 
ATOM   5002 C  CB  . THR B 1 334 ? 18.912 4.932   -5.388  1.00 46.25  ? 330 THR B CB  1 
ATOM   5003 O  OG1 . THR B 1 334 ? 19.466 4.673   -6.687  1.00 48.27  ? 330 THR B OG1 1 
ATOM   5004 C  CG2 . THR B 1 334 ? 18.315 6.307   -5.376  1.00 47.81  ? 330 THR B CG2 1 
ATOM   5005 N  N   . PRO B 1 335 ? 20.150 2.371   -4.124  1.00 32.56  ? 331 PRO B N   1 
ATOM   5006 C  CA  . PRO B 1 335 ? 20.840 1.094   -4.338  1.00 33.87  ? 331 PRO B CA  1 
ATOM   5007 C  C   . PRO B 1 335 ? 21.284 0.936   -5.800  1.00 32.35  ? 331 PRO B C   1 
ATOM   5008 O  O   . PRO B 1 335 ? 22.454 0.636   -6.087  1.00 33.79  ? 331 PRO B O   1 
ATOM   5009 C  CB  . PRO B 1 335 ? 19.784 0.068   -3.944  1.00 30.50  ? 331 PRO B CB  1 
ATOM   5010 C  CG  . PRO B 1 335 ? 19.091 0.771   -2.798  1.00 33.97  ? 331 PRO B CG  1 
ATOM   5011 C  CD  . PRO B 1 335 ? 18.946 2.194   -3.290  1.00 32.03  ? 331 PRO B CD  1 
ATOM   5012 N  N   . LEU B 1 336 ? 20.341 1.163   -6.711  1.00 40.16  ? 332 LEU B N   1 
ATOM   5013 C  CA  . LEU B 1 336 ? 20.599 1.038   -8.138  1.00 41.82  ? 332 LEU B CA  1 
ATOM   5014 C  C   . LEU B 1 336 ? 21.709 1.974   -8.598  1.00 43.44  ? 332 LEU B C   1 
ATOM   5015 O  O   . LEU B 1 336 ? 22.594 1.573   -9.354  1.00 43.10  ? 332 LEU B O   1 
ATOM   5016 C  CB  . LEU B 1 336 ? 19.322 1.322   -8.917  1.00 30.34  ? 332 LEU B CB  1 
ATOM   5017 C  CG  . LEU B 1 336 ? 19.118 0.479   -10.162 1.00 32.08  ? 332 LEU B CG  1 
ATOM   5018 C  CD1 . LEU B 1 336 ? 19.232 -1.006  -9.795  1.00 30.11  ? 332 LEU B CD1 1 
ATOM   5019 C  CD2 . LEU B 1 336 ? 17.754 0.778   -10.738 1.00 31.72  ? 332 LEU B CD2 1 
ATOM   5020 N  N   . GLU B 1 337 ? 21.665 3.223   -8.147  1.00 34.72  ? 333 GLU B N   1 
ATOM   5021 C  CA  . GLU B 1 337 ? 22.694 4.175   -8.530  1.00 36.54  ? 333 GLU B CA  1 
ATOM   5022 C  C   . GLU B 1 337 ? 24.049 3.691   -8.057  1.00 36.47  ? 333 GLU B C   1 
ATOM   5023 O  O   . GLU B 1 337 ? 25.056 3.954   -8.706  1.00 37.00  ? 333 GLU B O   1 
ATOM   5024 C  CB  . GLU B 1 337 ? 22.407 5.554   -7.948  1.00 54.77  ? 333 GLU B CB  1 
ATOM   5025 C  CG  . GLU B 1 337 ? 21.461 6.394   -8.786  1.00 58.73  ? 333 GLU B CG  1 
ATOM   5026 C  CD  . GLU B 1 337 ? 20.901 7.597   -8.031  1.00 63.19  ? 333 GLU B CD  1 
ATOM   5027 O  OE1 . GLU B 1 337 ? 20.210 8.428   -8.656  1.00 64.63  ? 333 GLU B OE1 1 
ATOM   5028 O  OE2 . GLU B 1 337 ? 21.143 7.707   -6.810  1.00 61.81  ? 333 GLU B OE2 1 
ATOM   5029 N  N   . ALA B 1 338 ? 24.073 2.973   -6.936  1.00 45.02  ? 334 ALA B N   1 
ATOM   5030 C  CA  . ALA B 1 338 ? 25.325 2.462   -6.384  1.00 46.18  ? 334 ALA B CA  1 
ATOM   5031 C  C   . ALA B 1 338 ? 25.913 1.348   -7.252  1.00 43.93  ? 334 ALA B C   1 
ATOM   5032 O  O   . ALA B 1 338 ? 27.127 1.309   -7.492  1.00 42.35  ? 334 ALA B O   1 
ATOM   5033 C  CB  . ALA B 1 338 ? 25.106 1.969   -4.957  1.00 55.87  ? 334 ALA B CB  1 
ATOM   5034 N  N   . CYS B 1 339 ? 25.063 0.448   -7.732  1.00 43.09  ? 335 CYS B N   1 
ATOM   5035 C  CA  . CYS B 1 339 ? 25.538 -0.637  -8.581  1.00 43.58  ? 335 CYS B CA  1 
ATOM   5036 C  C   . CYS B 1 339 ? 26.245 -0.096  -9.835  1.00 44.64  ? 335 CYS B C   1 
ATOM   5037 O  O   . CYS B 1 339 ? 27.252 -0.652  -10.298 1.00 43.75  ? 335 CYS B O   1 
ATOM   5038 C  CB  . CYS B 1 339 ? 24.370 -1.528  -8.998  1.00 36.95  ? 335 CYS B CB  1 
ATOM   5039 S  SG  . CYS B 1 339 ? 23.588 -2.441  -7.630  1.00 38.53  ? 335 CYS B SG  1 
ATOM   5040 N  N   . ALA B 1 340 ? 25.725 1.003   -10.368 1.00 37.49  ? 336 ALA B N   1 
ATOM   5041 C  CA  . ALA B 1 340 ? 26.282 1.608   -11.570 1.00 38.01  ? 336 ALA B CA  1 
ATOM   5042 C  C   . ALA B 1 340 ? 27.495 2.507   -11.313 1.00 38.52  ? 336 ALA B C   1 
ATOM   5043 O  O   . ALA B 1 340 ? 28.011 3.152   -12.237 1.00 38.89  ? 336 ALA B O   1 
ATOM   5044 C  CB  . ALA B 1 340 ? 25.191 2.392   -12.291 1.00 41.79  ? 336 ALA B CB  1 
ATOM   5045 N  N   . HIS B 1 341 ? 27.952 2.542   -10.064 1.00 36.87  ? 337 HIS B N   1 
ATOM   5046 C  CA  . HIS B 1 341 ? 29.099 3.367   -9.694  1.00 35.82  ? 337 HIS B CA  1 
ATOM   5047 C  C   . HIS B 1 341 ? 30.380 2.776   -10.288 1.00 37.50  ? 337 HIS B C   1 
ATOM   5048 O  O   . HIS B 1 341 ? 30.501 1.557   -10.419 1.00 36.04  ? 337 HIS B O   1 
ATOM   5049 C  CB  . HIS B 1 341 ? 29.188 3.454   -8.176  1.00 49.12  ? 337 HIS B CB  1 
ATOM   5050 C  CG  . HIS B 1 341 ? 30.195 4.439   -7.690  1.00 48.79  ? 337 HIS B CG  1 
ATOM   5051 N  ND1 . HIS B 1 341 ? 31.554 4.225   -7.792  1.00 48.29  ? 337 HIS B ND1 1 
ATOM   5052 C  CD2 . HIS B 1 341 ? 30.042 5.642   -7.088  1.00 46.23  ? 337 HIS B CD2 1 
ATOM   5053 C  CE1 . HIS B 1 341 ? 32.195 5.258   -7.269  1.00 46.16  ? 337 HIS B CE1 1 
ATOM   5054 N  NE2 . HIS B 1 341 ? 31.300 6.131   -6.835  1.00 46.46  ? 337 HIS B NE2 1 
ATOM   5055 N  N   . SER B 1 342 ? 31.341 3.629   -10.638 1.00 36.41  ? 338 SER B N   1 
ATOM   5056 C  CA  . SER B 1 342 ? 32.575 3.150   -11.274 1.00 37.35  ? 338 SER B CA  1 
ATOM   5057 C  C   . SER B 1 342 ? 33.358 2.128   -10.448 1.00 35.93  ? 338 SER B C   1 
ATOM   5058 O  O   . SER B 1 342 ? 34.079 1.293   -10.996 1.00 36.50  ? 338 SER B O   1 
ATOM   5059 C  CB  . SER B 1 342 ? 33.474 4.327   -11.649 1.00 51.10  ? 338 SER B CB  1 
ATOM   5060 O  OG  . SER B 1 342 ? 33.967 4.948   -10.483 1.00 58.75  ? 338 SER B OG  1 
ATOM   5061 N  N   . PHE B 1 343 ? 33.217 2.186   -9.129  1.00 36.07  ? 339 PHE B N   1 
ATOM   5062 C  CA  . PHE B 1 343 ? 33.912 1.229   -8.277  1.00 36.80  ? 339 PHE B CA  1 
ATOM   5063 C  C   . PHE B 1 343 ? 33.609 -0.216  -8.719  1.00 35.97  ? 339 PHE B C   1 
ATOM   5064 O  O   . PHE B 1 343 ? 34.424 -1.122  -8.524  1.00 38.39  ? 339 PHE B O   1 
ATOM   5065 C  CB  . PHE B 1 343 ? 33.490 1.441   -6.829  1.00 40.77  ? 339 PHE B CB  1 
ATOM   5066 C  CG  . PHE B 1 343 ? 34.062 0.445   -5.885  1.00 42.04  ? 339 PHE B CG  1 
ATOM   5067 C  CD1 . PHE B 1 343 ? 35.434 0.268   -5.788  1.00 40.00  ? 339 PHE B CD1 1 
ATOM   5068 C  CD2 . PHE B 1 343 ? 33.227 -0.323  -5.083  1.00 41.40  ? 339 PHE B CD2 1 
ATOM   5069 C  CE1 . PHE B 1 343 ? 35.966 -0.661  -4.902  1.00 40.68  ? 339 PHE B CE1 1 
ATOM   5070 C  CE2 . PHE B 1 343 ? 33.755 -1.252  -4.197  1.00 41.70  ? 339 PHE B CE2 1 
ATOM   5071 C  CZ  . PHE B 1 343 ? 35.128 -1.420  -4.106  1.00 42.50  ? 339 PHE B CZ  1 
ATOM   5072 N  N   . PHE B 1 344 ? 32.445 -0.430  -9.331  1.00 46.48  ? 340 PHE B N   1 
ATOM   5073 C  CA  . PHE B 1 344 ? 32.074 -1.772  -9.784  1.00 46.49  ? 340 PHE B CA  1 
ATOM   5074 C  C   . PHE B 1 344 ? 32.358 -2.018  -11.260 1.00 47.21  ? 340 PHE B C   1 
ATOM   5075 O  O   . PHE B 1 344 ? 31.926 -3.027  -11.805 1.00 45.67  ? 340 PHE B O   1 
ATOM   5076 C  CB  . PHE B 1 344 ? 30.590 -2.054  -9.504  1.00 27.47  ? 340 PHE B CB  1 
ATOM   5077 C  CG  . PHE B 1 344 ? 30.222 -1.958  -8.043  1.00 27.84  ? 340 PHE B CG  1 
ATOM   5078 C  CD1 . PHE B 1 344 ? 30.742 -2.862  -7.120  1.00 24.62  ? 340 PHE B CD1 1 
ATOM   5079 C  CD2 . PHE B 1 344 ? 29.409 -0.919  -7.584  1.00 24.55  ? 340 PHE B CD2 1 
ATOM   5080 C  CE1 . PHE B 1 344 ? 30.470 -2.735  -5.776  1.00 27.32  ? 340 PHE B CE1 1 
ATOM   5081 C  CE2 . PHE B 1 344 ? 29.134 -0.786  -6.239  1.00 24.28  ? 340 PHE B CE2 1 
ATOM   5082 C  CZ  . PHE B 1 344 ? 29.666 -1.695  -5.331  1.00 25.57  ? 340 PHE B CZ  1 
ATOM   5083 N  N   . ASP B 1 345 ? 33.086 -1.114  -11.905 1.00 40.06  ? 341 ASP B N   1 
ATOM   5084 C  CA  . ASP B 1 345 ? 33.391 -1.299  -13.320 1.00 41.42  ? 341 ASP B CA  1 
ATOM   5085 C  C   . ASP B 1 345 ? 34.175 -2.578  -13.617 1.00 41.78  ? 341 ASP B C   1 
ATOM   5086 O  O   . ASP B 1 345 ? 34.006 -3.188  -14.667 1.00 42.08  ? 341 ASP B O   1 
ATOM   5087 C  CB  . ASP B 1 345 ? 34.124 -0.080  -13.881 1.00 38.42  ? 341 ASP B CB  1 
ATOM   5088 C  CG  . ASP B 1 345 ? 33.197 1.128   -14.036 1.00 42.84  ? 341 ASP B CG  1 
ATOM   5089 O  OD1 . ASP B 1 345 ? 31.954 0.933   -13.956 1.00 41.37  ? 341 ASP B OD1 1 
ATOM   5090 O  OD2 . ASP B 1 345 ? 33.696 2.261   -14.245 1.00 43.04  ? 341 ASP B OD2 1 
ATOM   5091 N  N   . GLU B 1 346 ? 35.023 -3.010  -12.699 1.00 41.33  ? 342 GLU B N   1 
ATOM   5092 C  CA  . GLU B 1 346 ? 35.756 -4.234  -12.948 1.00 41.88  ? 342 GLU B CA  1 
ATOM   5093 C  C   . GLU B 1 346 ? 34.820 -5.446  -13.084 1.00 40.96  ? 342 GLU B C   1 
ATOM   5094 O  O   . GLU B 1 346 ? 35.111 -6.375  -13.835 1.00 41.87  ? 342 GLU B O   1 
ATOM   5095 C  CB  . GLU B 1 346 ? 36.780 -4.470  -11.840 1.00 52.20  ? 342 GLU B CB  1 
ATOM   5096 C  CG  . GLU B 1 346 ? 37.290 -5.898  -11.784 1.00 56.15  ? 342 GLU B CG  1 
ATOM   5097 C  CD  . GLU B 1 346 ? 38.514 -6.066  -10.897 1.00 57.15  ? 342 GLU B CD  1 
ATOM   5098 O  OE1 . GLU B 1 346 ? 38.604 -5.384  -9.851  1.00 58.26  ? 342 GLU B OE1 1 
ATOM   5099 O  OE2 . GLU B 1 346 ? 39.383 -6.898  -11.241 1.00 60.04  ? 342 GLU B OE2 1 
ATOM   5100 N  N   . LEU B 1 347 ? 33.695 -5.442  -12.370 1.00 47.08  ? 343 LEU B N   1 
ATOM   5101 C  CA  . LEU B 1 347 ? 32.764 -6.564  -12.436 1.00 44.74  ? 343 LEU B CA  1 
ATOM   5102 C  C   . LEU B 1 347 ? 32.097 -6.622  -13.798 1.00 46.44  ? 343 LEU B C   1 
ATOM   5103 O  O   . LEU B 1 347 ? 31.591 -7.672  -14.214 1.00 46.36  ? 343 LEU B O   1 
ATOM   5104 C  CB  . LEU B 1 347 ? 31.680 -6.431  -11.369 1.00 32.80  ? 343 LEU B CB  1 
ATOM   5105 C  CG  . LEU B 1 347 ? 32.129 -6.347  -9.925  1.00 32.37  ? 343 LEU B CG  1 
ATOM   5106 C  CD1 . LEU B 1 347 ? 30.899 -6.214  -9.015  1.00 33.51  ? 343 LEU B CD1 1 
ATOM   5107 C  CD2 . LEU B 1 347 ? 32.946 -7.582  -9.580  1.00 29.89  ? 343 LEU B CD2 1 
ATOM   5108 N  N   . ARG B 1 348 ? 32.080 -5.486  -14.488 1.00 52.94  ? 344 ARG B N   1 
ATOM   5109 C  CA  . ARG B 1 348 ? 31.455 -5.425  -15.793 1.00 55.79  ? 344 ARG B CA  1 
ATOM   5110 C  C   . ARG B 1 348 ? 32.407 -5.800  -16.927 1.00 58.80  ? 344 ARG B C   1 
ATOM   5111 O  O   . ARG B 1 348 ? 32.014 -5.846  -18.100 1.00 59.91  ? 344 ARG B O   1 
ATOM   5112 C  CB  . ARG B 1 348 ? 30.853 -4.038  -16.007 1.00 40.30  ? 344 ARG B CB  1 
ATOM   5113 C  CG  . ARG B 1 348 ? 29.508 -3.888  -15.333 1.00 37.20  ? 344 ARG B CG  1 
ATOM   5114 C  CD  . ARG B 1 348 ? 28.935 -2.525  -15.564 1.00 37.76  ? 344 ARG B CD  1 
ATOM   5115 N  NE  . ARG B 1 348 ? 29.518 -1.535  -14.668 1.00 36.12  ? 344 ARG B NE  1 
ATOM   5116 C  CZ  . ARG B 1 348 ? 29.022 -1.228  -13.477 1.00 37.51  ? 344 ARG B CZ  1 
ATOM   5117 N  NH1 . ARG B 1 348 ? 27.929 -1.834  -13.037 1.00 35.36  ? 344 ARG B NH1 1 
ATOM   5118 N  NH2 . ARG B 1 348 ? 29.624 -0.313  -12.734 1.00 37.52  ? 344 ARG B NH2 1 
ATOM   5119 N  N   . ASP B 1 349 ? 33.661 -6.072  -16.569 1.00 49.76  ? 345 ASP B N   1 
ATOM   5120 C  CA  . ASP B 1 349 ? 34.667 -6.482  -17.536 1.00 52.48  ? 345 ASP B CA  1 
ATOM   5121 C  C   . ASP B 1 349 ? 34.321 -7.924  -17.944 1.00 53.21  ? 345 ASP B C   1 
ATOM   5122 O  O   . ASP B 1 349 ? 33.960 -8.752  -17.101 1.00 52.43  ? 345 ASP B O   1 
ATOM   5123 C  CB  . ASP B 1 349 ? 36.042 -6.421  -16.887 1.00 69.94  ? 345 ASP B CB  1 
ATOM   5124 C  CG  . ASP B 1 349 ? 37.160 -6.465  -17.892 1.00 74.13  ? 345 ASP B CG  1 
ATOM   5125 O  OD1 . ASP B 1 349 ? 37.345 -7.512  -18.552 1.00 74.32  ? 345 ASP B OD1 1 
ATOM   5126 O  OD2 . ASP B 1 349 ? 37.858 -5.442  -18.021 1.00 75.68  ? 345 ASP B OD2 1 
ATOM   5127 N  N   . PRO B 1 350 ? 34.414 -8.239  -19.245 1.00 65.86  ? 346 PRO B N   1 
ATOM   5128 C  CA  . PRO B 1 350 ? 34.110 -9.570  -19.781 1.00 66.40  ? 346 PRO B CA  1 
ATOM   5129 C  C   . PRO B 1 350 ? 35.085 -10.652 -19.353 1.00 66.99  ? 346 PRO B C   1 
ATOM   5130 O  O   . PRO B 1 350 ? 34.729 -11.835 -19.272 1.00 68.19  ? 346 PRO B O   1 
ATOM   5131 C  CB  . PRO B 1 350 ? 34.172 -9.363  -21.284 1.00 52.22  ? 346 PRO B CB  1 
ATOM   5132 C  CG  . PRO B 1 350 ? 33.948 -7.894  -21.453 1.00 53.24  ? 346 PRO B CG  1 
ATOM   5133 C  CD  . PRO B 1 350 ? 34.725 -7.306  -20.335 1.00 51.34  ? 346 PRO B CD  1 
ATOM   5134 N  N   . ASN B 1 351 ? 36.319 -10.248 -19.085 1.00 63.81  ? 347 ASN B N   1 
ATOM   5135 C  CA  . ASN B 1 351 ? 37.345 -11.202 -18.699 1.00 64.55  ? 347 ASN B CA  1 
ATOM   5136 C  C   . ASN B 1 351 ? 37.473 -11.436 -17.204 1.00 63.62  ? 347 ASN B C   1 
ATOM   5137 O  O   . ASN B 1 351 ? 38.239 -12.300 -16.779 1.00 61.35  ? 347 ASN B O   1 
ATOM   5138 C  CB  . ASN B 1 351 ? 38.705 -10.767 -19.243 1.00 68.99  ? 347 ASN B CB  1 
ATOM   5139 C  CG  . ASN B 1 351 ? 38.699 -10.567 -20.748 1.00 70.68  ? 347 ASN B CG  1 
ATOM   5140 O  OD1 . ASN B 1 351 ? 38.181 -11.396 -21.502 1.00 72.95  ? 347 ASN B OD1 1 
ATOM   5141 N  ND2 . ASN B 1 351 ? 39.289 -9.465  -21.194 1.00 72.16  ? 347 ASN B ND2 1 
ATOM   5142 N  N   . VAL B 1 352 ? 36.734 -10.678 -16.404 1.00 51.46  ? 348 VAL B N   1 
ATOM   5143 C  CA  . VAL B 1 352 ? 36.807 -10.834 -14.959 1.00 49.08  ? 348 VAL B CA  1 
ATOM   5144 C  C   . VAL B 1 352 ? 36.537 -12.278 -14.523 1.00 48.42  ? 348 VAL B C   1 
ATOM   5145 O  O   . VAL B 1 352 ? 35.642 -12.949 -15.053 1.00 47.88  ? 348 VAL B O   1 
ATOM   5146 C  CB  . VAL B 1 352 ? 35.815 -9.869  -14.251 1.00 49.49  ? 348 VAL B CB  1 
ATOM   5147 C  CG1 . VAL B 1 352 ? 34.365 -10.332 -14.437 1.00 47.32  ? 348 VAL B CG1 1 
ATOM   5148 C  CG2 . VAL B 1 352 ? 36.182 -9.751  -12.787 1.00 47.62  ? 348 VAL B CG2 1 
ATOM   5149 N  N   . LYS B 1 353 ? 37.335 -12.755 -13.570 1.00 33.89  ? 349 LYS B N   1 
ATOM   5150 C  CA  . LYS B 1 353 ? 37.199 -14.111 -13.034 1.00 34.09  ? 349 LYS B CA  1 
ATOM   5151 C  C   . LYS B 1 353 ? 37.499 -14.068 -11.534 1.00 32.96  ? 349 LYS B C   1 
ATOM   5152 O  O   . LYS B 1 353 ? 38.074 -13.096 -11.048 1.00 33.64  ? 349 LYS B O   1 
ATOM   5153 C  CB  . LYS B 1 353 ? 38.182 -15.077 -13.711 1.00 57.02  ? 349 LYS B CB  1 
ATOM   5154 C  CG  . LYS B 1 353 ? 38.047 -15.198 -15.215 1.00 60.38  ? 349 LYS B CG  1 
ATOM   5155 C  CD  . LYS B 1 353 ? 36.682 -15.744 -15.632 1.00 64.21  ? 349 LYS B CD  1 
ATOM   5156 C  CE  . LYS B 1 353 ? 36.830 -16.932 -16.580 1.00 66.94  ? 349 LYS B CE  1 
ATOM   5157 N  NZ  . LYS B 1 353 ? 37.562 -18.056 -15.912 1.00 69.37  ? 349 LYS B NZ  1 
ATOM   5158 N  N   . LEU B 1 354 ? 37.105 -15.107 -10.802 1.00 44.50  ? 350 LEU B N   1 
ATOM   5159 C  CA  . LEU B 1 354 ? 37.368 -15.155 -9.371  1.00 45.24  ? 350 LEU B CA  1 
ATOM   5160 C  C   . LEU B 1 354 ? 38.815 -15.606 -9.143  1.00 47.10  ? 350 LEU B C   1 
ATOM   5161 O  O   . LEU B 1 354 ? 39.419 -16.258 -9.999  1.00 46.07  ? 350 LEU B O   1 
ATOM   5162 C  CB  . LEU B 1 354 ? 36.407 -16.132 -8.681  1.00 31.90  ? 350 LEU B CB  1 
ATOM   5163 C  CG  . LEU B 1 354 ? 34.898 -15.887 -8.793  1.00 32.02  ? 350 LEU B CG  1 
ATOM   5164 C  CD1 . LEU B 1 354 ? 34.139 -16.901 -7.956  1.00 28.04  ? 350 LEU B CD1 1 
ATOM   5165 C  CD2 . LEU B 1 354 ? 34.586 -14.501 -8.306  1.00 29.48  ? 350 LEU B CD2 1 
ATOM   5166 N  N   . PRO B 1 355 ? 39.393 -15.265 -7.984  1.00 51.39  ? 351 PRO B N   1 
ATOM   5167 C  CA  . PRO B 1 355 ? 40.771 -15.654 -7.679  1.00 52.39  ? 351 PRO B CA  1 
ATOM   5168 C  C   . PRO B 1 355 ? 40.991 -17.157 -7.735  1.00 51.96  ? 351 PRO B C   1 
ATOM   5169 O  O   . PRO B 1 355 ? 42.113 -17.610 -7.913  1.00 51.57  ? 351 PRO B O   1 
ATOM   5170 C  CB  . PRO B 1 355 ? 40.979 -15.110 -6.277  1.00 48.33  ? 351 PRO B CB  1 
ATOM   5171 C  CG  . PRO B 1 355 ? 40.106 -13.899 -6.263  1.00 49.44  ? 351 PRO B CG  1 
ATOM   5172 C  CD  . PRO B 1 355 ? 38.849 -14.416 -6.914  1.00 48.09  ? 351 PRO B CD  1 
ATOM   5173 N  N   . ASN B 1 356 ? 39.923 -17.929 -7.572  1.00 30.22  ? 352 ASN B N   1 
ATOM   5174 C  CA  . ASN B 1 356 ? 40.016 -19.385 -7.609  1.00 28.68  ? 352 ASN B CA  1 
ATOM   5175 C  C   . ASN B 1 356 ? 39.828 -19.957 -9.023  1.00 29.19  ? 352 ASN B C   1 
ATOM   5176 O  O   . ASN B 1 356 ? 39.669 -21.177 -9.205  1.00 27.61  ? 352 ASN B O   1 
ATOM   5177 C  CB  . ASN B 1 356 ? 38.993 -20.003 -6.650  1.00 43.37  ? 352 ASN B CB  1 
ATOM   5178 C  CG  . ASN B 1 356 ? 37.554 -19.740 -7.067  1.00 44.75  ? 352 ASN B CG  1 
ATOM   5179 O  OD1 . ASN B 1 356 ? 37.294 -19.033 -8.045  1.00 42.62  ? 352 ASN B OD1 1 
ATOM   5180 N  ND2 . ASN B 1 356 ? 36.605 -20.310 -6.317  1.00 42.21  ? 352 ASN B ND2 1 
ATOM   5181 N  N   . GLY B 1 357 ? 39.835 -19.071 -10.017 1.00 43.56  ? 353 GLY B N   1 
ATOM   5182 C  CA  . GLY B 1 357 ? 39.689 -19.505 -11.396 1.00 45.64  ? 353 GLY B CA  1 
ATOM   5183 C  C   . GLY B 1 357 ? 38.285 -19.568 -11.963 1.00 46.81  ? 353 GLY B C   1 
ATOM   5184 O  O   . GLY B 1 357 ? 38.117 -19.510 -13.183 1.00 46.03  ? 353 GLY B O   1 
ATOM   5185 N  N   . ARG B 1 358 ? 37.282 -19.694 -11.091 1.00 46.99  ? 354 ARG B N   1 
ATOM   5186 C  CA  . ARG B 1 358 ? 35.885 -19.761 -11.513 1.00 47.60  ? 354 ARG B CA  1 
ATOM   5187 C  C   . ARG B 1 358 ? 35.328 -18.439 -12.050 1.00 46.11  ? 354 ARG B C   1 
ATOM   5188 O  O   . ARG B 1 358 ? 35.904 -17.361 -11.852 1.00 45.79  ? 354 ARG B O   1 
ATOM   5189 C  CB  . ARG B 1 358 ? 34.988 -20.171 -10.356 1.00 50.64  ? 354 ARG B CB  1 
ATOM   5190 C  CG  . ARG B 1 358 ? 35.367 -21.425 -9.647  1.00 55.29  ? 354 ARG B CG  1 
ATOM   5191 C  CD  . ARG B 1 358 ? 34.144 -21.966 -8.938  1.00 58.39  ? 354 ARG B CD  1 
ATOM   5192 N  NE  . ARG B 1 358 ? 34.470 -23.051 -8.022  1.00 59.63  ? 354 ARG B NE  1 
ATOM   5193 C  CZ  . ARG B 1 358 ? 33.559 -23.792 -7.403  1.00 61.38  ? 354 ARG B CZ  1 
ATOM   5194 N  NH1 . ARG B 1 358 ? 32.266 -23.565 -7.612  1.00 61.29  ? 354 ARG B NH1 1 
ATOM   5195 N  NH2 . ARG B 1 358 ? 33.947 -24.742 -6.560  1.00 61.95  ? 354 ARG B NH2 1 
ATOM   5196 N  N   . ASP B 1 359 ? 34.178 -18.536 -12.711 1.00 59.43  ? 355 ASP B N   1 
ATOM   5197 C  CA  . ASP B 1 359 ? 33.510 -17.364 -13.253 1.00 60.79  ? 355 ASP B CA  1 
ATOM   5198 C  C   . ASP B 1 359 ? 32.778 -16.661 -12.127 1.00 56.58  ? 355 ASP B C   1 
ATOM   5199 O  O   . ASP B 1 359 ? 32.585 -17.226 -11.047 1.00 55.17  ? 355 ASP B O   1 
ATOM   5200 C  CB  . ASP B 1 359 ? 32.502 -17.769 -14.322 1.00 94.07  ? 355 ASP B CB  1 
ATOM   5201 C  CG  . ASP B 1 359 ? 33.163 -18.341 -15.543 1.00 99.92  ? 355 ASP B CG  1 
ATOM   5202 O  OD1 . ASP B 1 359 ? 33.916 -17.596 -16.204 1.00 101.65 ? 355 ASP B OD1 1 
ATOM   5203 O  OD2 . ASP B 1 359 ? 32.936 -19.533 -15.836 1.00 102.00 ? 355 ASP B OD2 1 
ATOM   5204 N  N   . THR B 1 360 ? 32.378 -15.423 -12.386 1.00 55.30  ? 356 THR B N   1 
ATOM   5205 C  CA  . THR B 1 360 ? 31.654 -14.648 -11.398 1.00 54.51  ? 356 THR B CA  1 
ATOM   5206 C  C   . THR B 1 360 ? 30.199 -15.132 -11.391 1.00 52.71  ? 356 THR B C   1 
ATOM   5207 O  O   . THR B 1 360 ? 29.739 -15.768 -12.342 1.00 50.95  ? 356 THR B O   1 
ATOM   5208 C  CB  . THR B 1 360 ? 31.704 -13.151 -11.748 1.00 42.20  ? 356 THR B CB  1 
ATOM   5209 O  OG1 . THR B 1 360 ? 31.209 -12.962 -13.080 1.00 43.08  ? 356 THR B OG1 1 
ATOM   5210 C  CG2 . THR B 1 360 ? 33.135 -12.627 -11.678 1.00 42.18  ? 356 THR B CG2 1 
ATOM   5211 N  N   . PRO B 1 361 ? 29.462 -14.858 -10.309 1.00 32.26  ? 357 PRO B N   1 
ATOM   5212 C  CA  . PRO B 1 361 ? 28.063 -15.270 -10.206 1.00 31.25  ? 357 PRO B CA  1 
ATOM   5213 C  C   . PRO B 1 361 ? 27.199 -14.407 -11.133 1.00 31.00  ? 357 PRO B C   1 
ATOM   5214 O  O   . PRO B 1 361 ? 27.701 -13.470 -11.771 1.00 26.76  ? 357 PRO B O   1 
ATOM   5215 C  CB  . PRO B 1 361 ? 27.731 -15.001 -8.743  1.00 48.20  ? 357 PRO B CB  1 
ATOM   5216 C  CG  . PRO B 1 361 ? 29.057 -14.953 -8.063  1.00 47.31  ? 357 PRO B CG  1 
ATOM   5217 C  CD  . PRO B 1 361 ? 29.911 -14.245 -9.055  1.00 47.52  ? 357 PRO B CD  1 
ATOM   5218 N  N   . ALA B 1 362 ? 25.905 -14.713 -11.202 1.00 30.48  ? 358 ALA B N   1 
ATOM   5219 C  CA  . ALA B 1 362 ? 24.987 -13.925 -12.021 1.00 33.69  ? 358 ALA B CA  1 
ATOM   5220 C  C   . ALA B 1 362 ? 25.030 -12.492 -11.475 1.00 31.20  ? 358 ALA B C   1 
ATOM   5221 O  O   . ALA B 1 362 ? 24.865 -12.282 -10.265 1.00 35.46  ? 358 ALA B O   1 
ATOM   5222 C  CB  . ALA B 1 362 ? 23.584 -14.486 -11.907 1.00 25.74  ? 358 ALA B CB  1 
ATOM   5223 N  N   . LEU B 1 363 ? 25.247 -11.515 -12.350 1.00 34.04  ? 359 LEU B N   1 
ATOM   5224 C  CA  . LEU B 1 363 ? 25.341 -10.132 -11.901 1.00 33.27  ? 359 LEU B CA  1 
ATOM   5225 C  C   . LEU B 1 363 ? 24.540 -9.157  -12.729 1.00 30.43  ? 359 LEU B C   1 
ATOM   5226 O  O   . LEU B 1 363 ? 24.300 -8.021  -12.307 1.00 31.17  ? 359 LEU B O   1 
ATOM   5227 C  CB  . LEU B 1 363 ? 26.801 -9.675  -11.916 1.00 32.93  ? 359 LEU B CB  1 
ATOM   5228 C  CG  . LEU B 1 363 ? 27.793 -10.427 -11.043 1.00 34.38  ? 359 LEU B CG  1 
ATOM   5229 C  CD1 . LEU B 1 363 ? 29.142 -9.786  -11.195 1.00 34.90  ? 359 LEU B CD1 1 
ATOM   5230 C  CD2 . LEU B 1 363 ? 27.356 -10.366 -9.604  1.00 29.08  ? 359 LEU B CD2 1 
ATOM   5231 N  N   . PHE B 1 364 ? 24.121 -9.614  -13.903 1.00 31.61  ? 360 PHE B N   1 
ATOM   5232 C  CA  . PHE B 1 364 ? 23.402 -8.773  -14.834 1.00 32.10  ? 360 PHE B CA  1 
ATOM   5233 C  C   . PHE B 1 364 ? 21.983 -9.205  -15.178 1.00 32.39  ? 360 PHE B C   1 
ATOM   5234 O  O   . PHE B 1 364 ? 21.307 -8.554  -15.963 1.00 32.52  ? 360 PHE B O   1 
ATOM   5235 C  CB  . PHE B 1 364 ? 24.229 -8.688  -16.099 1.00 30.58  ? 360 PHE B CB  1 
ATOM   5236 C  CG  . PHE B 1 364 ? 25.676 -8.403  -15.843 1.00 30.67  ? 360 PHE B CG  1 
ATOM   5237 C  CD1 . PHE B 1 364 ? 26.649 -9.330  -16.194 1.00 32.85  ? 360 PHE B CD1 1 
ATOM   5238 C  CD2 . PHE B 1 364 ? 26.070 -7.207  -15.252 1.00 29.68  ? 360 PHE B CD2 1 
ATOM   5239 C  CE1 . PHE B 1 364 ? 27.978 -9.081  -15.967 1.00 34.50  ? 360 PHE B CE1 1 
ATOM   5240 C  CE2 . PHE B 1 364 ? 27.417 -6.944  -15.018 1.00 32.84  ? 360 PHE B CE2 1 
ATOM   5241 C  CZ  . PHE B 1 364 ? 28.367 -7.881  -15.375 1.00 33.59  ? 360 PHE B CZ  1 
ATOM   5242 N  N   . ASN B 1 365 ? 21.519 -10.293 -14.588 1.00 33.12  ? 361 ASN B N   1 
ATOM   5243 C  CA  . ASN B 1 365 ? 20.189 -10.776 -14.895 1.00 35.21  ? 361 ASN B CA  1 
ATOM   5244 C  C   . ASN B 1 365 ? 19.109 -9.897  -14.271 1.00 33.46  ? 361 ASN B C   1 
ATOM   5245 O  O   . ASN B 1 365 ? 18.196 -10.385 -13.617 1.00 33.42  ? 361 ASN B O   1 
ATOM   5246 C  CB  . ASN B 1 365 ? 20.064 -12.229 -14.426 1.00 30.24  ? 361 ASN B CB  1 
ATOM   5247 C  CG  . ASN B 1 365 ? 20.344 -12.391 -12.937 1.00 35.46  ? 361 ASN B CG  1 
ATOM   5248 O  OD1 . ASN B 1 365 ? 21.109 -11.616 -12.340 1.00 35.19  ? 361 ASN B OD1 1 
ATOM   5249 N  ND2 . ASN B 1 365 ? 19.739 -13.402 -12.333 1.00 38.53  ? 361 ASN B ND2 1 
ATOM   5250 N  N   . PHE B 1 366 ? 19.204 -8.594  -14.493 1.00 39.38  ? 362 PHE B N   1 
ATOM   5251 C  CA  . PHE B 1 366 ? 18.234 -7.649  -13.950 1.00 41.64  ? 362 PHE B CA  1 
ATOM   5252 C  C   . PHE B 1 366 ? 16.818 -7.837  -14.489 1.00 42.03  ? 362 PHE B C   1 
ATOM   5253 O  O   . PHE B 1 366 ? 16.653 -8.195  -15.644 1.00 42.47  ? 362 PHE B O   1 
ATOM   5254 C  CB  . PHE B 1 366 ? 18.674 -6.221  -14.273 1.00 38.22  ? 362 PHE B CB  1 
ATOM   5255 C  CG  . PHE B 1 366 ? 19.818 -5.736  -13.446 1.00 41.57  ? 362 PHE B CG  1 
ATOM   5256 C  CD1 . PHE B 1 366 ? 21.126 -5.855  -13.905 1.00 40.91  ? 362 PHE B CD1 1 
ATOM   5257 C  CD2 . PHE B 1 366 ? 19.592 -5.169  -12.194 1.00 39.80  ? 362 PHE B CD2 1 
ATOM   5258 C  CE1 . PHE B 1 366 ? 22.200 -5.416  -13.126 1.00 41.38  ? 362 PHE B CE1 1 
ATOM   5259 C  CE2 . PHE B 1 366 ? 20.663 -4.725  -11.406 1.00 38.15  ? 362 PHE B CE2 1 
ATOM   5260 C  CZ  . PHE B 1 366 ? 21.968 -4.849  -11.872 1.00 38.16  ? 362 PHE B CZ  1 
ATOM   5261 N  N   . THR B 1 367 ? 15.799 -7.599  -13.660 1.00 48.59  ? 363 THR B N   1 
ATOM   5262 C  CA  . THR B 1 367 ? 14.401 -7.676  -14.119 1.00 49.21  ? 363 THR B CA  1 
ATOM   5263 C  C   . THR B 1 367 ? 13.796 -6.268  -14.132 1.00 50.49  ? 363 THR B C   1 
ATOM   5264 O  O   . THR B 1 367 ? 14.365 -5.329  -13.564 1.00 49.35  ? 363 THR B O   1 
ATOM   5265 C  CB  . THR B 1 367 ? 13.503 -8.555  -13.226 1.00 42.22  ? 363 THR B CB  1 
ATOM   5266 O  OG1 . THR B 1 367 ? 13.523 -8.067  -11.879 1.00 43.23  ? 363 THR B OG1 1 
ATOM   5267 C  CG2 . THR B 1 367 ? 13.949 -9.985  -13.276 1.00 40.81  ? 363 THR B CG2 1 
ATOM   5268 N  N   . THR B 1 368 ? 12.642 -6.115  -14.775 1.00 53.95  ? 364 THR B N   1 
ATOM   5269 C  CA  . THR B 1 368 ? 12.004 -4.803  -14.845 1.00 54.10  ? 364 THR B CA  1 
ATOM   5270 C  C   . THR B 1 368 ? 11.702 -4.271  -13.455 1.00 54.07  ? 364 THR B C   1 
ATOM   5271 O  O   . THR B 1 368 ? 11.889 -3.089  -13.177 1.00 54.92  ? 364 THR B O   1 
ATOM   5272 C  CB  . THR B 1 368 ? 10.698 -4.852  -15.641 1.00 50.87  ? 364 THR B CB  1 
ATOM   5273 O  OG1 . THR B 1 368 ? 10.971 -5.288  -16.976 1.00 52.00  ? 364 THR B OG1 1 
ATOM   5274 C  CG2 . THR B 1 368 ? 10.074 -3.484  -15.705 1.00 49.89  ? 364 THR B CG2 1 
ATOM   5275 N  N   . GLN B 1 369 ? 11.221 -5.157  -12.590 1.00 47.09  ? 365 GLN B N   1 
ATOM   5276 C  CA  . GLN B 1 369 ? 10.898 -4.807  -11.215 1.00 46.45  ? 365 GLN B CA  1 
ATOM   5277 C  C   . GLN B 1 369 ? 12.115 -4.155  -10.572 1.00 47.04  ? 365 GLN B C   1 
ATOM   5278 O  O   . GLN B 1 369 ? 12.030 -3.087  -9.964  1.00 43.33  ? 365 GLN B O   1 
ATOM   5279 C  CB  . GLN B 1 369 ? 10.524 -6.074  -10.444 1.00 56.08  ? 365 GLN B CB  1 
ATOM   5280 C  CG  . GLN B 1 369 ? 10.331 -5.889  -8.950  1.00 56.93  ? 365 GLN B CG  1 
ATOM   5281 C  CD  . GLN B 1 369 ? 9.139  -5.032  -8.610  1.00 57.54  ? 365 GLN B CD  1 
ATOM   5282 O  OE1 . GLN B 1 369 ? 8.876  -4.754  -7.444  1.00 56.62  ? 365 GLN B OE1 1 
ATOM   5283 N  NE2 . GLN B 1 369 ? 8.405  -4.609  -9.626  1.00 59.72  ? 365 GLN B NE2 1 
ATOM   5284 N  N   . GLU B 1 370 ? 13.254 -4.814  -10.730 1.00 41.06  ? 366 GLU B N   1 
ATOM   5285 C  CA  . GLU B 1 370 ? 14.496 -4.341  -10.161 1.00 40.80  ? 366 GLU B CA  1 
ATOM   5286 C  C   . GLU B 1 370 ? 14.939 -2.956  -10.641 1.00 39.43  ? 366 GLU B C   1 
ATOM   5287 O  O   . GLU B 1 370 ? 15.497 -2.163  -9.868  1.00 38.65  ? 366 GLU B O   1 
ATOM   5288 C  CB  . GLU B 1 370 ? 15.583 -5.354  -10.470 1.00 47.86  ? 366 GLU B CB  1 
ATOM   5289 C  CG  . GLU B 1 370 ? 16.363 -5.795  -9.285  1.00 51.53  ? 366 GLU B CG  1 
ATOM   5290 C  CD  . GLU B 1 370 ? 17.278 -6.927  -9.640  1.00 52.54  ? 366 GLU B CD  1 
ATOM   5291 O  OE1 . GLU B 1 370 ? 16.781 -7.908  -10.261 1.00 51.92  ? 366 GLU B OE1 1 
ATOM   5292 O  OE2 . GLU B 1 370 ? 18.482 -6.834  -9.297  1.00 51.86  ? 366 GLU B OE2 1 
ATOM   5293 N  N   . LEU B 1 371 ? 14.699 -2.676  -11.920 1.00 47.21  ? 367 LEU B N   1 
ATOM   5294 C  CA  . LEU B 1 371 ? 15.112 -1.406  -12.521 1.00 47.27  ? 367 LEU B CA  1 
ATOM   5295 C  C   . LEU B 1 371 ? 14.069 -0.303  -12.434 1.00 48.49  ? 367 LEU B C   1 
ATOM   5296 O  O   . LEU B 1 371 ? 14.368 0.841   -12.759 1.00 48.43  ? 367 LEU B O   1 
ATOM   5297 C  CB  . LEU B 1 371 ? 15.484 -1.621  -13.994 1.00 38.75  ? 367 LEU B CB  1 
ATOM   5298 C  CG  . LEU B 1 371 ? 16.647 -2.573  -14.304 1.00 41.35  ? 367 LEU B CG  1 
ATOM   5299 C  CD1 . LEU B 1 371 ? 16.580 -3.049  -15.743 1.00 40.50  ? 367 LEU B CD1 1 
ATOM   5300 C  CD2 . LEU B 1 371 ? 17.955 -1.875  -14.037 1.00 39.43  ? 367 LEU B CD2 1 
ATOM   5301 N  N   . SER B 1 372 ? 12.857 -0.648  -11.994 1.00 48.84  ? 368 SER B N   1 
ATOM   5302 C  CA  . SER B 1 372 ? 11.755 0.315   -11.901 1.00 50.74  ? 368 SER B CA  1 
ATOM   5303 C  C   . SER B 1 372 ? 12.171 1.638   -11.275 1.00 52.64  ? 368 SER B C   1 
ATOM   5304 O  O   . SER B 1 372 ? 11.713 2.708   -11.679 1.00 52.45  ? 368 SER B O   1 
ATOM   5305 C  CB  . SER B 1 372 ? 10.574 -0.288  -11.134 1.00 77.79  ? 368 SER B CB  1 
ATOM   5306 O  OG  . SER B 1 372 ? 10.962 -0.768  -9.866  1.00 77.70  ? 368 SER B OG  1 
ATOM   5307 N  N   . SER B 1 373 ? 13.057 1.554   -10.295 1.00 66.93  ? 369 SER B N   1 
ATOM   5308 C  CA  . SER B 1 373 ? 13.579 2.729   -9.619  1.00 68.23  ? 369 SER B CA  1 
ATOM   5309 C  C   . SER B 1 373 ? 14.076 3.783   -10.620 1.00 69.59  ? 369 SER B C   1 
ATOM   5310 O  O   . SER B 1 373 ? 13.812 4.970   -10.453 1.00 68.08  ? 369 SER B O   1 
ATOM   5311 C  CB  . SER B 1 373 ? 14.730 2.307   -8.695  1.00 46.59  ? 369 SER B CB  1 
ATOM   5312 O  OG  . SER B 1 373 ? 15.701 3.343   -8.588  1.00 45.61  ? 369 SER B OG  1 
ATOM   5313 N  N   . ASN B 1 374 ? 14.778 3.334   -11.664 1.00 56.36  ? 370 ASN B N   1 
ATOM   5314 C  CA  . ASN B 1 374 ? 15.359 4.225   -12.672 1.00 55.50  ? 370 ASN B CA  1 
ATOM   5315 C  C   . ASN B 1 374 ? 15.830 3.433   -13.913 1.00 54.44  ? 370 ASN B C   1 
ATOM   5316 O  O   . ASN B 1 374 ? 17.020 3.175   -14.087 1.00 52.24  ? 370 ASN B O   1 
ATOM   5317 C  CB  . ASN B 1 374 ? 16.529 4.963   -12.019 1.00 53.47  ? 370 ASN B CB  1 
ATOM   5318 C  CG  . ASN B 1 374 ? 17.267 5.872   -12.973 1.00 55.70  ? 370 ASN B CG  1 
ATOM   5319 O  OD1 . ASN B 1 374 ? 18.227 6.534   -12.579 1.00 57.61  ? 370 ASN B OD1 1 
ATOM   5320 N  ND2 . ASN B 1 374 ? 16.833 5.915   -14.227 1.00 56.31  ? 370 ASN B ND2 1 
ATOM   5321 N  N   . PRO B 1 375 ? 14.895 3.069   -14.805 1.00 49.55  ? 371 PRO B N   1 
ATOM   5322 C  CA  . PRO B 1 375 ? 15.152 2.301   -16.038 1.00 48.37  ? 371 PRO B CA  1 
ATOM   5323 C  C   . PRO B 1 375 ? 16.348 2.715   -16.902 1.00 47.40  ? 371 PRO B C   1 
ATOM   5324 O  O   . PRO B 1 375 ? 17.109 1.880   -17.381 1.00 45.61  ? 371 PRO B O   1 
ATOM   5325 C  CB  . PRO B 1 375 ? 13.832 2.408   -16.784 1.00 34.02  ? 371 PRO B CB  1 
ATOM   5326 C  CG  . PRO B 1 375 ? 12.820 2.470   -15.655 1.00 34.95  ? 371 PRO B CG  1 
ATOM   5327 C  CD  . PRO B 1 375 ? 13.475 3.460   -14.721 1.00 35.53  ? 371 PRO B CD  1 
ATOM   5328 N  N   . PRO B 1 376 ? 16.514 4.011   -17.137 1.00 43.41  ? 372 PRO B N   1 
ATOM   5329 C  CA  . PRO B 1 376 ? 17.653 4.442   -17.955 1.00 43.61  ? 372 PRO B CA  1 
ATOM   5330 C  C   . PRO B 1 376 ? 19.004 3.907   -17.498 1.00 43.78  ? 372 PRO B C   1 
ATOM   5331 O  O   . PRO B 1 376 ? 19.971 4.005   -18.231 1.00 43.65  ? 372 PRO B O   1 
ATOM   5332 C  CB  . PRO B 1 376 ? 17.603 5.961   -17.848 1.00 24.80  ? 372 PRO B CB  1 
ATOM   5333 C  CG  . PRO B 1 376 ? 16.113 6.238   -17.755 1.00 24.89  ? 372 PRO B CG  1 
ATOM   5334 C  CD  . PRO B 1 376 ? 15.576 5.121   -16.866 1.00 25.13  ? 372 PRO B CD  1 
ATOM   5335 N  N   . LEU B 1 377 ? 19.089 3.362   -16.289 1.00 54.77  ? 373 LEU B N   1 
ATOM   5336 C  CA  . LEU B 1 377 ? 20.369 2.858   -15.789 1.00 54.22  ? 373 LEU B CA  1 
ATOM   5337 C  C   . LEU B 1 377 ? 20.778 1.523   -16.386 1.00 55.32  ? 373 LEU B C   1 
ATOM   5338 O  O   . LEU B 1 377 ? 21.942 1.122   -16.284 1.00 52.86  ? 373 LEU B O   1 
ATOM   5339 C  CB  . LEU B 1 377 ? 20.346 2.741   -14.266 1.00 37.28  ? 373 LEU B CB  1 
ATOM   5340 C  CG  . LEU B 1 377 ? 20.485 4.025   -13.440 1.00 38.52  ? 373 LEU B CG  1 
ATOM   5341 C  CD1 . LEU B 1 377 ? 20.408 3.637   -11.967 1.00 36.50  ? 373 LEU B CD1 1 
ATOM   5342 C  CD2 . LEU B 1 377 ? 21.808 4.751   -13.750 1.00 34.84  ? 373 LEU B CD2 1 
ATOM   5343 N  N   . ALA B 1 378 ? 19.823 0.836   -17.006 1.00 43.85  ? 374 ALA B N   1 
ATOM   5344 C  CA  . ALA B 1 378 ? 20.097 -0.452  -17.631 1.00 44.28  ? 374 ALA B CA  1 
ATOM   5345 C  C   . ALA B 1 378 ? 21.253 -0.338  -18.610 1.00 44.43  ? 374 ALA B C   1 
ATOM   5346 O  O   . ALA B 1 378 ? 22.048 -1.257  -18.736 1.00 42.01  ? 374 ALA B O   1 
ATOM   5347 C  CB  . ALA B 1 378 ? 18.863 -0.968  -18.357 1.00 29.13  ? 374 ALA B CB  1 
ATOM   5348 N  N   . THR B 1 379 ? 21.357 0.798   -19.289 1.00 51.09  ? 375 THR B N   1 
ATOM   5349 C  CA  . THR B 1 379 ? 22.429 0.995   -20.260 1.00 51.91  ? 375 THR B CA  1 
ATOM   5350 C  C   . THR B 1 379 ? 23.817 0.822   -19.646 1.00 52.29  ? 375 THR B C   1 
ATOM   5351 O  O   . THR B 1 379 ? 24.775 0.582   -20.369 1.00 51.24  ? 375 THR B O   1 
ATOM   5352 C  CB  . THR B 1 379 ? 22.377 2.387   -20.914 1.00 60.50  ? 375 THR B CB  1 
ATOM   5353 O  OG1 . THR B 1 379 ? 23.197 3.293   -20.167 1.00 62.71  ? 375 THR B OG1 1 
ATOM   5354 C  CG2 . THR B 1 379 ? 20.946 2.911   -20.948 1.00 62.01  ? 375 THR B CG2 1 
ATOM   5355 N  N   . ILE B 1 380 ? 23.946 0.967   -18.329 1.00 45.54  ? 376 ILE B N   1 
ATOM   5356 C  CA  . ILE B 1 380 ? 25.253 0.784   -17.688 1.00 45.98  ? 376 ILE B CA  1 
ATOM   5357 C  C   . ILE B 1 380 ? 25.266 -0.525  -16.929 1.00 45.38  ? 376 ILE B C   1 
ATOM   5358 O  O   . ILE B 1 380 ? 26.242 -1.275  -16.961 1.00 45.16  ? 376 ILE B O   1 
ATOM   5359 C  CB  . ILE B 1 380 ? 25.567 1.850   -16.645 1.00 37.02  ? 376 ILE B CB  1 
ATOM   5360 C  CG1 . ILE B 1 380 ? 25.621 3.235   -17.284 1.00 36.92  ? 376 ILE B CG1 1 
ATOM   5361 C  CG2 . ILE B 1 380 ? 26.866 1.504   -15.969 1.00 35.67  ? 376 ILE B CG2 1 
ATOM   5362 C  CD1 . ILE B 1 380 ? 25.815 4.363   -16.264 1.00 38.45  ? 376 ILE B CD1 1 
ATOM   5363 N  N   . LEU B 1 381 ? 24.169 -0.777  -16.225 1.00 38.86  ? 377 LEU B N   1 
ATOM   5364 C  CA  . LEU B 1 381 ? 24.063 -1.979  -15.431 1.00 37.68  ? 377 LEU B CA  1 
ATOM   5365 C  C   . LEU B 1 381 ? 24.225 -3.238  -16.259 1.00 37.97  ? 377 LEU B C   1 
ATOM   5366 O  O   . LEU B 1 381 ? 24.768 -4.228  -15.777 1.00 35.45  ? 377 LEU B O   1 
ATOM   5367 C  CB  . LEU B 1 381 ? 22.737 -1.982  -14.672 1.00 36.25  ? 377 LEU B CB  1 
ATOM   5368 C  CG  . LEU B 1 381 ? 22.741 -0.884  -13.605 1.00 36.18  ? 377 LEU B CG  1 
ATOM   5369 C  CD1 . LEU B 1 381 ? 21.373 -0.742  -12.971 1.00 33.81  ? 377 LEU B CD1 1 
ATOM   5370 C  CD2 . LEU B 1 381 ? 23.788 -1.226  -12.562 1.00 34.20  ? 377 LEU B CD2 1 
ATOM   5371 N  N   . ILE B 1 382 ? 23.759 -3.210  -17.503 1.00 39.70  ? 378 ILE B N   1 
ATOM   5372 C  CA  . ILE B 1 382 ? 23.888 -4.386  -18.360 1.00 40.66  ? 378 ILE B CA  1 
ATOM   5373 C  C   . ILE B 1 382 ? 24.936 -4.142  -19.430 1.00 41.84  ? 378 ILE B C   1 
ATOM   5374 O  O   . ILE B 1 382 ? 24.648 -3.573  -20.483 1.00 41.45  ? 378 ILE B O   1 
ATOM   5375 C  CB  . ILE B 1 382 ? 22.563 -4.758  -19.037 1.00 33.27  ? 378 ILE B CB  1 
ATOM   5376 C  CG1 . ILE B 1 382 ? 21.477 -4.977  -17.988 1.00 32.84  ? 378 ILE B CG1 1 
ATOM   5377 C  CG2 . ILE B 1 382 ? 22.736 -6.051  -19.798 1.00 33.36  ? 378 ILE B CG2 1 
ATOM   5378 C  CD1 . ILE B 1 382 ? 20.220 -5.586  -18.530 1.00 34.27  ? 378 ILE B CD1 1 
ATOM   5379 N  N   . PRO B 1 383 ? 26.173 -4.590  -19.174 1.00 50.58  ? 379 PRO B N   1 
ATOM   5380 C  CA  . PRO B 1 383 ? 27.288 -4.424  -20.098 1.00 49.89  ? 379 PRO B CA  1 
ATOM   5381 C  C   . PRO B 1 383 ? 27.023 -5.064  -21.454 1.00 50.95  ? 379 PRO B C   1 
ATOM   5382 O  O   . PRO B 1 383 ? 26.260 -6.041  -21.566 1.00 48.86  ? 379 PRO B O   1 
ATOM   5383 C  CB  . PRO B 1 383 ? 28.448 -5.068  -19.347 1.00 46.90  ? 379 PRO B CB  1 
ATOM   5384 C  CG  . PRO B 1 383 ? 27.798 -6.180  -18.651 1.00 48.72  ? 379 PRO B CG  1 
ATOM   5385 C  CD  . PRO B 1 383 ? 26.536 -5.538  -18.106 1.00 47.59  ? 379 PRO B CD  1 
ATOM   5386 N  N   . PRO B 1 384 ? 27.661 -4.515  -22.506 1.00 50.42  ? 380 PRO B N   1 
ATOM   5387 C  CA  . PRO B 1 384 ? 27.566 -4.941  -23.902 1.00 52.48  ? 380 PRO B CA  1 
ATOM   5388 C  C   . PRO B 1 384 ? 27.594 -6.436  -24.129 1.00 54.41  ? 380 PRO B C   1 
ATOM   5389 O  O   . PRO B 1 384 ? 26.739 -6.972  -24.827 1.00 54.81  ? 380 PRO B O   1 
ATOM   5390 C  CB  . PRO B 1 384 ? 28.746 -4.239  -24.544 1.00 44.56  ? 380 PRO B CB  1 
ATOM   5391 C  CG  . PRO B 1 384 ? 28.779 -2.935  -23.815 1.00 43.60  ? 380 PRO B CG  1 
ATOM   5392 C  CD  . PRO B 1 384 ? 28.607 -3.390  -22.378 1.00 42.75  ? 380 PRO B CD  1 
ATOM   5393 N  N   . HIS B 1 385 ? 28.568 -7.113  -23.534 1.00 43.45  ? 381 HIS B N   1 
ATOM   5394 C  CA  . HIS B 1 385 ? 28.692 -8.553  -23.717 1.00 45.93  ? 381 HIS B CA  1 
ATOM   5395 C  C   . HIS B 1 385 ? 27.654 -9.414  -22.979 1.00 48.24  ? 381 HIS B C   1 
ATOM   5396 O  O   . HIS B 1 385 ? 27.396 -10.546 -23.376 1.00 49.64  ? 381 HIS B O   1 
ATOM   5397 C  CB  . HIS B 1 385 ? 30.070 -9.013  -23.268 1.00 53.11  ? 381 HIS B CB  1 
ATOM   5398 C  CG  . HIS B 1 385 ? 30.230 -9.037  -21.782 1.00 52.06  ? 381 HIS B CG  1 
ATOM   5399 N  ND1 . HIS B 1 385 ? 30.529 -7.911  -21.050 1.00 51.51  ? 381 HIS B ND1 1 
ATOM   5400 C  CD2 . HIS B 1 385 ? 30.059 -10.037 -20.883 1.00 49.55  ? 381 HIS B CD2 1 
ATOM   5401 C  CE1 . HIS B 1 385 ? 30.536 -8.214  -19.763 1.00 49.99  ? 381 HIS B CE1 1 
ATOM   5402 N  NE2 . HIS B 1 385 ? 30.252 -9.498  -19.635 1.00 49.47  ? 381 HIS B NE2 1 
ATOM   5403 N  N   . ALA B 1 386 ? 27.099 -8.912  -21.878 1.00 44.73  ? 382 ALA B N   1 
ATOM   5404 C  CA  . ALA B 1 386 ? 26.144 -9.676  -21.069 1.00 48.02  ? 382 ALA B CA  1 
ATOM   5405 C  C   . ALA B 1 386 ? 24.903 -10.139 -21.811 1.00 50.32  ? 382 ALA B C   1 
ATOM   5406 O  O   . ALA B 1 386 ? 24.152 -9.314  -22.339 1.00 51.45  ? 382 ALA B O   1 
ATOM   5407 C  CB  . ALA B 1 386 ? 25.739 -8.861  -19.870 1.00 56.42  ? 382 ALA B CB  1 
ATOM   5408 N  N   . ARG B 1 387 ? 24.670 -11.450 -21.831 1.00 87.24  ? 383 ARG B N   1 
ATOM   5409 C  CA  . ARG B 1 387 ? 23.514 -12.009 -22.535 1.00 92.26  ? 383 ARG B CA  1 
ATOM   5410 C  C   . ARG B 1 387 ? 22.194 -11.345 -22.151 1.00 94.14  ? 383 ARG B C   1 
ATOM   5411 O  O   . ARG B 1 387 ? 21.417 -11.009 -23.076 1.00 95.15  ? 383 ARG B O   1 
ATOM   5412 C  CB  . ARG B 1 387 ? 23.417 -13.532 -22.320 1.00 94.69  ? 383 ARG B CB  1 
ATOM   5413 C  CG  . ARG B 1 387 ? 22.378 -14.231 -23.221 1.00 96.26  ? 383 ARG B CG  1 
ATOM   5414 C  CD  . ARG B 1 387 ? 22.717 -14.091 -24.718 1.00 98.45  ? 383 ARG B CD  1 
ATOM   5415 N  NE  . ARG B 1 387 ? 23.139 -12.730 -25.048 1.00 99.95  ? 383 ARG B NE  1 
ATOM   5416 C  CZ  . ARG B 1 387 ? 23.404 -12.282 -26.270 1.00 100.39 ? 383 ARG B CZ  1 
ATOM   5417 N  NH1 . ARG B 1 387 ? 23.287 -13.084 -27.318 1.00 100.25 ? 383 ARG B NH1 1 
ATOM   5418 N  NH2 . ARG B 1 387 ? 23.808 -11.029 -26.435 1.00 100.36 ? 383 ARG B NH2 1 
HETATM 5419 C  C1  . 679 C 2 .   ? 37.664 7.074   34.367  1.00 47.25  ? 451 679 A C1  1 
HETATM 5420 C  C2  . 679 C 2 .   ? 36.756 7.046   33.277  1.00 47.25  ? 451 679 A C2  1 
HETATM 5421 C  C3  . 679 C 2 .   ? 36.467 8.230   32.563  1.00 47.25  ? 451 679 A C3  1 
HETATM 5422 C  C4  . 679 C 2 .   ? 37.096 9.446   32.944  1.00 47.25  ? 451 679 A C4  1 
HETATM 5423 C  C5  . 679 C 2 .   ? 38.011 9.479   34.028  1.00 47.25  ? 451 679 A C5  1 
HETATM 5424 C  C6  . 679 C 2 .   ? 38.310 8.289   34.760  1.00 47.25  ? 451 679 A C6  1 
HETATM 5425 CL CL7 . 679 C 2 .   ? 36.744 10.886  32.102  1.00 47.25  ? 451 679 A CL7 1 
HETATM 5426 C  C8  . 679 C 2 .   ? 39.225 8.315   35.856  1.00 47.25  ? 451 679 A C8  1 
HETATM 5427 C  C9  . 679 C 2 .   ? 40.252 7.386   36.238  1.00 47.25  ? 451 679 A C9  1 
HETATM 5428 C  C10 . 679 C 2 .   ? 40.790 7.861   37.430  1.00 47.25  ? 451 679 A C10 1 
HETATM 5429 C  C11 . 679 C 2 .   ? 39.274 9.323   36.862  1.00 47.25  ? 451 679 A C11 1 
HETATM 5430 O  O12 . 679 C 2 .   ? 38.534 10.317  36.920  1.00 47.25  ? 451 679 A O12 1 
HETATM 5431 O  O13 . 679 C 2 .   ? 41.659 7.273   38.083  1.00 47.25  ? 451 679 A O13 1 
HETATM 5432 N  N14 . 679 C 2 .   ? 40.226 9.038   37.750  1.00 47.25  ? 451 679 A N14 1 
HETATM 5433 N  N15 . 679 C 2 .   ? 40.736 6.213   35.617  1.00 47.25  ? 451 679 A N15 1 
HETATM 5434 C  C16 . 679 C 2 .   ? 40.668 5.689   34.322  1.00 47.25  ? 451 679 A C16 1 
HETATM 5435 C  C17 . 679 C 2 .   ? 40.784 6.532   33.164  1.00 47.25  ? 451 679 A C17 1 
HETATM 5436 C  C18 . 679 C 2 .   ? 40.686 5.983   31.878  1.00 47.25  ? 451 679 A C18 1 
HETATM 5437 C  C19 . 679 C 2 .   ? 40.478 4.591   31.721  1.00 47.25  ? 451 679 A C19 1 
HETATM 5438 C  C20 . 679 C 2 .   ? 40.363 3.690   32.848  1.00 47.25  ? 451 679 A C20 1 
HETATM 5439 C  C21 . 679 C 2 .   ? 40.462 4.285   34.157  1.00 47.25  ? 451 679 A C21 1 
HETATM 5440 CL CL2 . 679 C 2 .   ? 40.378 4.146   30.103  1.00 47.25  ? 451 679 A CL2 1 
HETATM 5441 C  C23 . 679 C 2 .   ? 40.170 2.338   32.742  1.00 47.25  ? 451 679 A C23 1 
HETATM 5442 O  O24 . 679 C 2 .   ? 41.117 1.609   33.131  1.00 47.25  ? 451 679 A O24 1 
HETATM 5443 O  O25 . 679 C 2 .   ? 39.129 1.828   32.241  1.00 47.25  ? 451 679 A O25 1 
HETATM 5444 C  C1  . 679 D 2 .   ? 21.131 -15.926 9.304   1.00 43.33  ? 452 679 B C1  1 
HETATM 5445 C  C2  . 679 D 2 .   ? 20.831 -14.896 10.249  1.00 43.33  ? 452 679 B C2  1 
HETATM 5446 C  C3  . 679 D 2 .   ? 19.508 -14.713 10.745  1.00 43.33  ? 452 679 B C3  1 
HETATM 5447 C  C4  . 679 D 2 .   ? 18.470 -15.568 10.291  1.00 43.33  ? 452 679 B C4  1 
HETATM 5448 C  C5  . 679 D 2 .   ? 18.764 -16.608 9.351   1.00 43.33  ? 452 679 B C5  1 
HETATM 5449 C  C6  . 679 D 2 .   ? 20.104 -16.809 8.836   1.00 43.33  ? 452 679 B C6  1 
HETATM 5450 CL CL7 . 679 D 2 .   ? 16.839 -15.359 10.849  1.00 43.33  ? 452 679 B CL7 1 
HETATM 5451 C  C8  . 679 D 2 .   ? 20.375 -17.867 7.883   1.00 43.33  ? 452 679 B C8  1 
HETATM 5452 C  C9  . 679 D 2 .   ? 21.481 -18.787 7.760   1.00 43.33  ? 452 679 B C9  1 
HETATM 5453 C  C10 . 679 D 2 .   ? 21.225 -19.555 6.627   1.00 43.33  ? 452 679 B C10 1 
HETATM 5454 C  C11 . 679 D 2 .   ? 19.507 -18.251 6.832   1.00 43.33  ? 452 679 B C11 1 
HETATM 5455 O  O12 . 679 D 2 .   ? 18.389 -17.772 6.622   1.00 43.33  ? 452 679 B O12 1 
HETATM 5456 O  O13 . 679 D 2 .   ? 21.970 -20.437 6.199   1.00 43.33  ? 452 679 B O13 1 
HETATM 5457 N  N14 . 679 D 2 .   ? 20.064 -19.204 6.092   1.00 43.33  ? 452 679 B N14 1 
HETATM 5458 N  N15 . 679 D 2 .   ? 22.602 -19.040 8.587   1.00 43.33  ? 452 679 B N15 1 
HETATM 5459 C  C16 . 679 D 2 .   ? 22.949 -18.708 9.886   1.00 43.33  ? 452 679 B C16 1 
HETATM 5460 C  C17 . 679 D 2 .   ? 22.007 -18.777 10.964  1.00 43.33  ? 452 679 B C17 1 
HETATM 5461 C  C18 . 679 D 2 .   ? 22.388 -18.402 12.260  1.00 43.33  ? 452 679 B C18 1 
HETATM 5462 C  C19 . 679 D 2 .   ? 23.719 -17.961 12.498  1.00 43.33  ? 452 679 B C19 1 
HETATM 5463 C  C20 . 679 D 2 .   ? 24.704 -17.887 11.452  1.00 43.33  ? 452 679 B C20 1 
HETATM 5464 C  C21 . 679 D 2 .   ? 24.277 -18.272 10.133  1.00 43.33  ? 452 679 B C21 1 
HETATM 5465 CL CL2 . 679 D 2 .   ? 24.019 -17.532 14.104  1.00 43.33  ? 452 679 B CL2 1 
HETATM 5466 C  C23 . 679 D 2 .   ? 25.986 -17.472 11.660  1.00 43.33  ? 452 679 B C23 1 
HETATM 5467 O  O24 . 679 D 2 .   ? 26.895 -18.326 11.451  1.00 43.33  ? 452 679 B O24 1 
HETATM 5468 O  O25 . 679 D 2 .   ? 26.255 -16.327 12.119  1.00 43.33  ? 452 679 B O25 1 
HETATM 5469 O  O   . HOH E 3 .   ? 20.232 16.885  26.407  1.00 29.39  ? 502 HOH A O   1 
HETATM 5470 O  O   . HOH E 3 .   ? 19.376 4.862   31.490  1.00 24.99  ? 505 HOH A O   1 
HETATM 5471 O  O   . HOH E 3 .   ? 38.221 -0.653  33.090  1.00 37.60  ? 508 HOH A O   1 
HETATM 5472 O  O   . HOH E 3 .   ? 18.812 -1.605  29.873  1.00 32.83  ? 510 HOH A O   1 
HETATM 5473 O  O   . HOH E 3 .   ? 21.974 -5.163  30.439  1.00 31.53  ? 519 HOH A O   1 
HETATM 5474 O  O   . HOH E 3 .   ? 30.142 -3.099  30.732  1.00 32.20  ? 520 HOH A O   1 
HETATM 5475 O  O   . HOH E 3 .   ? 16.450 10.535  41.848  1.00 40.70  ? 522 HOH A O   1 
HETATM 5476 O  O   . HOH E 3 .   ? 31.533 -0.230  30.938  1.00 38.12  ? 524 HOH A O   1 
HETATM 5477 O  O   . HOH E 3 .   ? 30.663 12.832  51.866  1.00 26.90  ? 526 HOH A O   1 
HETATM 5478 O  O   . HOH E 3 .   ? 28.631 11.607  32.513  1.00 27.07  ? 529 HOH A O   1 
HETATM 5479 O  O   . HOH E 3 .   ? 18.607 12.781  46.143  1.00 37.59  ? 530 HOH A O   1 
HETATM 5480 O  O   . HOH E 3 .   ? 12.423 9.081   33.107  1.00 35.86  ? 531 HOH A O   1 
HETATM 5481 O  O   . HOH E 3 .   ? 22.803 6.319   33.305  1.00 35.10  ? 534 HOH A O   1 
HETATM 5482 O  O   . HOH E 3 .   ? 13.635 9.789   48.410  1.00 32.77  ? 536 HOH A O   1 
HETATM 5483 O  O   . HOH E 3 .   ? 14.640 14.806  37.026  1.00 45.15  ? 541 HOH A O   1 
HETATM 5484 O  O   . HOH E 3 .   ? 32.864 5.292   51.354  1.00 35.37  ? 542 HOH A O   1 
HETATM 5485 O  O   . HOH E 3 .   ? 30.381 6.803   58.690  1.00 34.55  ? 546 HOH A O   1 
HETATM 5486 O  O   . HOH F 3 .   ? 20.644 2.679   9.380   1.00 23.77  ? 501 HOH B O   1 
HETATM 5487 O  O   . HOH F 3 .   ? 23.805 -10.237 -8.206  1.00 24.10  ? 503 HOH B O   1 
HETATM 5488 O  O   . HOH F 3 .   ? 15.115 -7.452  8.799   1.00 24.15  ? 504 HOH B O   1 
HETATM 5489 O  O   . HOH F 3 .   ? 8.010  0.608   12.871  1.00 29.87  ? 506 HOH B O   1 
HETATM 5490 O  O   . HOH F 3 .   ? 26.142 -4.128  -13.654 1.00 32.19  ? 507 HOH B O   1 
HETATM 5491 O  O   . HOH F 3 .   ? 24.981 -13.236 -7.629  1.00 36.55  ? 509 HOH B O   1 
HETATM 5492 O  O   . HOH F 3 .   ? 31.457 -0.208  9.834   1.00 38.66  ? 511 HOH B O   1 
HETATM 5493 O  O   . HOH F 3 .   ? 37.721 -16.998 -5.326  1.00 35.29  ? 512 HOH B O   1 
HETATM 5494 O  O   . HOH F 3 .   ? 17.342 1.946   -5.991  1.00 37.46  ? 513 HOH B O   1 
HETATM 5495 O  O   . HOH F 3 .   ? 29.481 -6.272  12.720  1.00 36.17  ? 514 HOH B O   1 
HETATM 5496 O  O   . HOH F 3 .   ? 9.586  -8.024  9.175   1.00 34.65  ? 515 HOH B O   1 
HETATM 5497 O  O   . HOH F 3 .   ? 16.009 9.873   1.956   1.00 39.09  ? 516 HOH B O   1 
HETATM 5498 O  O   . HOH F 3 .   ? 5.502  -4.362  6.318   1.00 49.09  ? 517 HOH B O   1 
HETATM 5499 O  O   . HOH F 3 .   ? 36.272 -1.588  -10.950 1.00 55.58  ? 518 HOH B O   1 
HETATM 5500 O  O   . HOH F 3 .   ? 22.768 4.093   18.449  1.00 32.84  ? 521 HOH B O   1 
HETATM 5501 O  O   . HOH F 3 .   ? 24.372 -12.265 -15.466 1.00 22.91  ? 523 HOH B O   1 
HETATM 5502 O  O   . HOH F 3 .   ? 27.476 -8.041  12.047  1.00 42.57  ? 525 HOH B O   1 
HETATM 5503 O  O   . HOH F 3 .   ? 28.780 -14.920 11.827  1.00 44.56  ? 527 HOH B O   1 
HETATM 5504 O  O   . HOH F 3 .   ? 16.964 -15.188 6.581   1.00 36.36  ? 528 HOH B O   1 
HETATM 5505 O  O   . HOH F 3 .   ? 27.128 -4.582  16.041  1.00 38.58  ? 532 HOH B O   1 
HETATM 5506 O  O   . HOH F 3 .   ? 26.399 4.686   11.825  1.00 18.73  ? 533 HOH B O   1 
HETATM 5507 O  O   . HOH F 3 .   ? 14.710 0.606   -5.999  1.00 40.12  ? 535 HOH B O   1 
HETATM 5508 O  O   . HOH F 3 .   ? 16.760 -4.341  14.153  1.00 38.02  ? 537 HOH B O   1 
HETATM 5509 O  O   . HOH F 3 .   ? 11.262 5.164   1.917   1.00 34.69  ? 538 HOH B O   1 
HETATM 5510 O  O   . HOH F 3 .   ? 7.903  -11.526 12.120  1.00 47.50  ? 539 HOH B O   1 
HETATM 5511 O  O   . HOH F 3 .   ? 15.967 3.428   -1.990  1.00 32.67  ? 540 HOH B O   1 
HETATM 5512 O  O   . HOH F 3 .   ? 19.668 -1.105  8.173   1.00 31.27  ? 543 HOH B O   1 
HETATM 5513 O  O   . HOH F 3 .   ? 30.659 1.687   11.577  1.00 35.51  ? 544 HOH B O   1 
HETATM 5514 O  O   . HOH F 3 .   ? 43.747 -16.284 -9.744  1.00 38.34  ? 545 HOH B O   1 
HETATM 5515 O  O   . HOH F 3 .   ? 17.190 -15.017 19.053  1.00 38.23  ? 547 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -3  ?   ?   ?   A . n 
A 1 2   PRO 2   -2  ?   ?   ?   A . n 
A 1 3   LEU 3   -1  ?   ?   ?   A . n 
A 1 4   GLY 4   0   ?   ?   ?   A . n 
A 1 5   SER 5   1   ?   ?   ?   A . n 
A 1 6   SER 6   2   ?   ?   ?   A . n 
A 1 7   GLY 7   3   ?   ?   ?   A . n 
A 1 8   ARG 8   4   ?   ?   ?   A . n 
A 1 9   PRO 9   5   ?   ?   ?   A . n 
A 1 10  ARG 10  6   ?   ?   ?   A . n 
A 1 11  THR 11  7   ?   ?   ?   A . n 
A 1 12  THR 12  8   ?   ?   ?   A . n 
A 1 13  SER 13  9   ?   ?   ?   A . n 
A 1 14  PHE 14  10  ?   ?   ?   A . n 
A 1 15  ALA 15  11  ?   ?   ?   A . n 
A 1 16  GLU 16  12  ?   ?   ?   A . n 
A 1 17  SER 17  13  ?   ?   ?   A . n 
A 1 18  CYS 18  14  ?   ?   ?   A . n 
A 1 19  LYS 19  15  ?   ?   ?   A . n 
A 1 20  PRO 20  16  ?   ?   ?   A . n 
A 1 21  VAL 21  17  ?   ?   ?   A . n 
A 1 22  GLN 22  18  ?   ?   ?   A . n 
A 1 23  GLN 23  19  ?   ?   ?   A . n 
A 1 24  PRO 24  20  ?   ?   ?   A . n 
A 1 25  SER 25  21  ?   ?   ?   A . n 
A 1 26  ALA 26  22  ?   ?   ?   A . n 
A 1 27  PHE 27  23  ?   ?   ?   A . n 
A 1 28  GLY 28  24  ?   ?   ?   A . n 
A 1 29  SER 29  25  ?   ?   ?   A . n 
A 1 30  MET 30  26  ?   ?   ?   A . n 
A 1 31  LYS 31  27  ?   ?   ?   A . n 
A 1 32  VAL 32  28  ?   ?   ?   A . n 
A 1 33  SER 33  29  ?   ?   ?   A . n 
A 1 34  ARG 34  30  ?   ?   ?   A . n 
A 1 35  ASP 35  31  ?   ?   ?   A . n 
A 1 36  LYS 36  32  ?   ?   ?   A . n 
A 1 37  ASP 37  33  ?   ?   ?   A . n 
A 1 38  GLY 38  34  ?   ?   ?   A . n 
A 1 39  SER 39  35  35  SER SER A . n 
A 1 40  LYS 40  36  36  LYS LYS A . n 
A 1 41  VAL 41  37  37  VAL VAL A . n 
A 1 42  THR 42  38  38  THR THR A . n 
A 1 43  THR 43  39  39  THR THR A . n 
A 1 44  VAL 44  40  40  VAL VAL A . n 
A 1 45  VAL 45  41  41  VAL VAL A . n 
A 1 46  ALA 46  42  42  ALA ALA A . n 
A 1 47  THR 47  43  43  THR THR A . n 
A 1 48  PRO 48  44  44  PRO PRO A . n 
A 1 49  GLY 49  45  45  GLY GLY A . n 
A 1 50  GLN 50  46  46  GLN GLN A . n 
A 1 51  GLY 51  47  47  GLY GLY A . n 
A 1 52  PRO 52  48  48  PRO PRO A . n 
A 1 53  ASP 53  49  49  ASP ASP A . n 
A 1 54  ARG 54  50  50  ARG ARG A . n 
A 1 55  PRO 55  51  51  PRO PRO A . n 
A 1 56  GLN 56  52  52  GLN GLN A . n 
A 1 57  GLU 57  53  53  GLU GLU A . n 
A 1 58  VAL 58  54  54  VAL VAL A . n 
A 1 59  SER 59  55  55  SER SER A . n 
A 1 60  TYR 60  56  56  TYR TYR A . n 
A 1 61  THR 61  57  57  THR THR A . n 
A 1 62  ASP 62  58  58  ASP ASP A . n 
A 1 63  THR 63  59  59  THR THR A . n 
A 1 64  LYS 64  60  60  LYS LYS A . n 
A 1 65  VAL 65  61  61  VAL VAL A . n 
A 1 66  ILE 66  62  62  ILE ILE A . n 
A 1 67  GLY 67  63  63  GLY GLY A . n 
A 1 68  ASN 68  64  64  ASN ASN A . n 
A 1 69  GLY 69  65  65  GLY GLY A . n 
A 1 70  SER 70  66  66  SER SER A . n 
A 1 71  PHE 71  67  67  PHE PHE A . n 
A 1 72  GLY 72  68  68  GLY GLY A . n 
A 1 73  VAL 73  69  69  VAL VAL A . n 
A 1 74  VAL 74  70  70  VAL VAL A . n 
A 1 75  TYR 75  71  71  TYR TYR A . n 
A 1 76  GLN 76  72  72  GLN GLN A . n 
A 1 77  ALA 77  73  73  ALA ALA A . n 
A 1 78  LYS 78  74  74  LYS LYS A . n 
A 1 79  LEU 79  75  75  LEU LEU A . n 
A 1 80  CYS 80  76  76  CYS CYS A . n 
A 1 81  ASP 81  77  77  ASP ASP A . n 
A 1 82  SER 82  78  78  SER SER A . n 
A 1 83  GLY 83  79  79  GLY GLY A . n 
A 1 84  GLU 84  80  80  GLU GLU A . n 
A 1 85  LEU 85  81  81  LEU LEU A . n 
A 1 86  VAL 86  82  82  VAL VAL A . n 
A 1 87  ALA 87  83  83  ALA ALA A . n 
A 1 88  ILE 88  84  84  ILE ILE A . n 
A 1 89  LYS 89  85  85  LYS LYS A . n 
A 1 90  LYS 90  86  86  LYS LYS A . n 
A 1 91  VAL 91  87  87  VAL VAL A . n 
A 1 92  LEU 92  88  88  LEU LEU A . n 
A 1 93  GLN 93  89  89  GLN GLN A . n 
A 1 94  ASP 94  90  90  ASP ASP A . n 
A 1 95  LYS 95  91  91  LYS LYS A . n 
A 1 96  ARG 96  92  92  ARG ARG A . n 
A 1 97  PHE 97  93  93  PHE PHE A . n 
A 1 98  LYS 98  94  94  LYS LYS A . n 
A 1 99  ASN 99  95  95  ASN ASN A . n 
A 1 100 ARG 100 96  96  ARG ARG A . n 
A 1 101 GLU 101 97  97  GLU GLU A . n 
A 1 102 LEU 102 98  98  LEU LEU A . n 
A 1 103 GLN 103 99  99  GLN GLN A . n 
A 1 104 ILE 104 100 100 ILE ILE A . n 
A 1 105 MET 105 101 101 MET MET A . n 
A 1 106 ARG 106 102 102 ARG ARG A . n 
A 1 107 LYS 107 103 103 LYS LYS A . n 
A 1 108 LEU 108 104 104 LEU LEU A . n 
A 1 109 ASP 109 105 105 ASP ASP A . n 
A 1 110 HIS 110 106 106 HIS HIS A . n 
A 1 111 CYS 111 107 107 CYS CYS A . n 
A 1 112 ASN 112 108 108 ASN ASN A . n 
A 1 113 ILE 113 109 109 ILE ILE A . n 
A 1 114 VAL 114 110 110 VAL VAL A . n 
A 1 115 ARG 115 111 111 ARG ARG A . n 
A 1 116 LEU 116 112 112 LEU LEU A . n 
A 1 117 ARG 117 113 113 ARG ARG A . n 
A 1 118 TYR 118 114 114 TYR TYR A . n 
A 1 119 PHE 119 115 115 PHE PHE A . n 
A 1 120 PHE 120 116 116 PHE PHE A . n 
A 1 121 TYR 121 117 117 TYR TYR A . n 
A 1 122 SER 122 118 118 SER SER A . n 
A 1 123 SER 123 119 119 SER SER A . n 
A 1 124 GLY 124 120 120 GLY GLY A . n 
A 1 125 GLU 125 121 ?   ?   ?   A . n 
A 1 126 LYS 126 122 ?   ?   ?   A . n 
A 1 127 LYS 127 123 ?   ?   ?   A . n 
A 1 128 ASP 128 124 124 ASP ASP A . n 
A 1 129 GLU 129 125 125 GLU GLU A . n 
A 1 130 VAL 130 126 126 VAL VAL A . n 
A 1 131 TYR 131 127 127 TYR TYR A . n 
A 1 132 LEU 132 128 128 LEU LEU A . n 
A 1 133 ASN 133 129 129 ASN ASN A . n 
A 1 134 LEU 134 130 130 LEU LEU A . n 
A 1 135 VAL 135 131 131 VAL VAL A . n 
A 1 136 LEU 136 132 132 LEU LEU A . n 
A 1 137 ASP 137 133 133 ASP ASP A . n 
A 1 138 TYR 138 134 134 TYR TYR A . n 
A 1 139 VAL 139 135 135 VAL VAL A . n 
A 1 140 PRO 140 136 136 PRO PRO A . n 
A 1 141 GLU 141 137 137 GLU GLU A . n 
A 1 142 THR 142 138 138 THR THR A . n 
A 1 143 VAL 143 139 139 VAL VAL A . n 
A 1 144 TYR 144 140 140 TYR TYR A . n 
A 1 145 ARG 145 141 141 ARG ARG A . n 
A 1 146 VAL 146 142 142 VAL VAL A . n 
A 1 147 ALA 147 143 143 ALA ALA A . n 
A 1 148 ARG 148 144 144 ARG ARG A . n 
A 1 149 HIS 149 145 145 HIS HIS A . n 
A 1 150 TYR 150 146 146 TYR TYR A . n 
A 1 151 SER 151 147 147 SER SER A . n 
A 1 152 ARG 152 148 148 ARG ARG A . n 
A 1 153 ALA 153 149 149 ALA ALA A . n 
A 1 154 LYS 154 150 150 LYS LYS A . n 
A 1 155 GLN 155 151 151 GLN GLN A . n 
A 1 156 THR 156 152 152 THR THR A . n 
A 1 157 LEU 157 153 153 LEU LEU A . n 
A 1 158 PRO 158 154 154 PRO PRO A . n 
A 1 159 VAL 159 155 155 VAL VAL A . n 
A 1 160 ILE 160 156 156 ILE ILE A . n 
A 1 161 TYR 161 157 157 TYR TYR A . n 
A 1 162 VAL 162 158 158 VAL VAL A . n 
A 1 163 LYS 163 159 159 LYS LYS A . n 
A 1 164 LEU 164 160 160 LEU LEU A . n 
A 1 165 TYR 165 161 161 TYR TYR A . n 
A 1 166 MET 166 162 162 MET MET A . n 
A 1 167 TYR 167 163 163 TYR TYR A . n 
A 1 168 GLN 168 164 164 GLN GLN A . n 
A 1 169 LEU 169 165 165 LEU LEU A . n 
A 1 170 PHE 170 166 166 PHE PHE A . n 
A 1 171 ARG 171 167 167 ARG ARG A . n 
A 1 172 SER 172 168 168 SER SER A . n 
A 1 173 LEU 173 169 169 LEU LEU A . n 
A 1 174 ALA 174 170 170 ALA ALA A . n 
A 1 175 TYR 175 171 171 TYR TYR A . n 
A 1 176 ILE 176 172 172 ILE ILE A . n 
A 1 177 HIS 177 173 173 HIS HIS A . n 
A 1 178 SER 178 174 174 SER SER A . n 
A 1 179 PHE 179 175 175 PHE PHE A . n 
A 1 180 GLY 180 176 176 GLY GLY A . n 
A 1 181 ILE 181 177 177 ILE ILE A . n 
A 1 182 CYS 182 178 178 CYS CYS A . n 
A 1 183 HIS 183 179 179 HIS HIS A . n 
A 1 184 ARG 184 180 180 ARG ARG A . n 
A 1 185 ASP 185 181 181 ASP ASP A . n 
A 1 186 ILE 186 182 182 ILE ILE A . n 
A 1 187 LYS 187 183 183 LYS LYS A . n 
A 1 188 PRO 188 184 184 PRO PRO A . n 
A 1 189 GLN 189 185 185 GLN GLN A . n 
A 1 190 ASN 190 186 186 ASN ASN A . n 
A 1 191 LEU 191 187 187 LEU LEU A . n 
A 1 192 LEU 192 188 188 LEU LEU A . n 
A 1 193 LEU 193 189 189 LEU LEU A . n 
A 1 194 ASP 194 190 190 ASP ASP A . n 
A 1 195 PRO 195 191 191 PRO PRO A . n 
A 1 196 ASP 196 192 192 ASP ASP A . n 
A 1 197 THR 197 193 193 THR THR A . n 
A 1 198 ALA 198 194 194 ALA ALA A . n 
A 1 199 VAL 199 195 195 VAL VAL A . n 
A 1 200 LEU 200 196 196 LEU LEU A . n 
A 1 201 LYS 201 197 197 LYS LYS A . n 
A 1 202 LEU 202 198 198 LEU LEU A . n 
A 1 203 CYS 203 199 199 CYS CYS A . n 
A 1 204 ASP 204 200 200 ASP ASP A . n 
A 1 205 PHE 205 201 201 PHE PHE A . n 
A 1 206 GLY 206 202 202 GLY GLY A . n 
A 1 207 SER 207 203 203 SER SER A . n 
A 1 208 ALA 208 204 204 ALA ALA A . n 
A 1 209 LYS 209 205 205 LYS LYS A . n 
A 1 210 GLN 210 206 206 GLN GLN A . n 
A 1 211 LEU 211 207 207 LEU LEU A . n 
A 1 212 VAL 212 208 208 VAL VAL A . n 
A 1 213 ARG 213 209 209 ARG ARG A . n 
A 1 214 GLY 214 210 210 GLY GLY A . n 
A 1 215 GLU 215 211 211 GLU GLU A . n 
A 1 216 PRO 216 212 212 PRO PRO A . n 
A 1 217 ASN 217 213 213 ASN ASN A . n 
A 1 218 VAL 218 214 214 VAL VAL A . n 
A 1 219 SER 219 215 215 SER SER A . n 
A 1 220 TYR 220 216 216 TYR TYR A . n 
A 1 221 ILE 221 217 217 ILE ILE A . n 
A 1 222 CYS 222 218 218 CYS CYS A . n 
A 1 223 SER 223 219 219 SER SER A . n 
A 1 224 ARG 224 220 220 ARG ARG A . n 
A 1 225 TYR 225 221 221 TYR TYR A . n 
A 1 226 TYR 226 222 222 TYR TYR A . n 
A 1 227 ARG 227 223 223 ARG ARG A . n 
A 1 228 ALA 228 224 224 ALA ALA A . n 
A 1 229 PRO 229 225 225 PRO PRO A . n 
A 1 230 GLU 230 226 226 GLU GLU A . n 
A 1 231 LEU 231 227 227 LEU LEU A . n 
A 1 232 ILE 232 228 228 ILE ILE A . n 
A 1 233 PHE 233 229 229 PHE PHE A . n 
A 1 234 GLY 234 230 230 GLY GLY A . n 
A 1 235 ALA 235 231 231 ALA ALA A . n 
A 1 236 THR 236 232 232 THR THR A . n 
A 1 237 ASP 237 233 233 ASP ASP A . n 
A 1 238 TYR 238 234 234 TYR TYR A . n 
A 1 239 THR 239 235 235 THR THR A . n 
A 1 240 SER 240 236 236 SER SER A . n 
A 1 241 SER 241 237 237 SER SER A . n 
A 1 242 ILE 242 238 238 ILE ILE A . n 
A 1 243 ASP 243 239 239 ASP ASP A . n 
A 1 244 VAL 244 240 240 VAL VAL A . n 
A 1 245 TRP 245 241 241 TRP TRP A . n 
A 1 246 SER 246 242 242 SER SER A . n 
A 1 247 ALA 247 243 243 ALA ALA A . n 
A 1 248 GLY 248 244 244 GLY GLY A . n 
A 1 249 CYS 249 245 245 CYS CYS A . n 
A 1 250 VAL 250 246 246 VAL VAL A . n 
A 1 251 LEU 251 247 247 LEU LEU A . n 
A 1 252 ALA 252 248 248 ALA ALA A . n 
A 1 253 GLU 253 249 249 GLU GLU A . n 
A 1 254 LEU 254 250 250 LEU LEU A . n 
A 1 255 LEU 255 251 251 LEU LEU A . n 
A 1 256 LEU 256 252 252 LEU LEU A . n 
A 1 257 GLY 257 253 253 GLY GLY A . n 
A 1 258 GLN 258 254 254 GLN GLN A . n 
A 1 259 PRO 259 255 255 PRO PRO A . n 
A 1 260 ILE 260 256 256 ILE ILE A . n 
A 1 261 PHE 261 257 257 PHE PHE A . n 
A 1 262 PRO 262 258 258 PRO PRO A . n 
A 1 263 GLY 263 259 259 GLY GLY A . n 
A 1 264 ASP 264 260 260 ASP ASP A . n 
A 1 265 SER 265 261 261 SER SER A . n 
A 1 266 GLY 266 262 262 GLY GLY A . n 
A 1 267 VAL 267 263 263 VAL VAL A . n 
A 1 268 ASP 268 264 264 ASP ASP A . n 
A 1 269 GLN 269 265 265 GLN GLN A . n 
A 1 270 LEU 270 266 266 LEU LEU A . n 
A 1 271 VAL 271 267 267 VAL VAL A . n 
A 1 272 GLU 272 268 268 GLU GLU A . n 
A 1 273 ILE 273 269 269 ILE ILE A . n 
A 1 274 ILE 274 270 270 ILE ILE A . n 
A 1 275 LYS 275 271 271 LYS LYS A . n 
A 1 276 VAL 276 272 272 VAL VAL A . n 
A 1 277 LEU 277 273 273 LEU LEU A . n 
A 1 278 GLY 278 274 274 GLY GLY A . n 
A 1 279 THR 279 275 275 THR THR A . n 
A 1 280 PRO 280 276 276 PRO PRO A . n 
A 1 281 THR 281 277 277 THR THR A . n 
A 1 282 ARG 282 278 278 ARG ARG A . n 
A 1 283 GLU 283 279 279 GLU GLU A . n 
A 1 284 GLN 284 280 280 GLN GLN A . n 
A 1 285 ILE 285 281 281 ILE ILE A . n 
A 1 286 ARG 286 282 282 ARG ARG A . n 
A 1 287 GLU 287 283 283 GLU GLU A . n 
A 1 288 MET 288 284 284 MET MET A . n 
A 1 289 ASN 289 285 285 ASN ASN A . n 
A 1 290 PRO 290 286 ?   ?   ?   A . n 
A 1 291 ASN 291 287 ?   ?   ?   A . n 
A 1 292 TYR 292 288 ?   ?   ?   A . n 
A 1 293 THR 293 289 ?   ?   ?   A . n 
A 1 294 GLU 294 290 ?   ?   ?   A . n 
A 1 295 PHE 295 291 ?   ?   ?   A . n 
A 1 296 LYS 296 292 ?   ?   ?   A . n 
A 1 297 PHE 297 293 293 PHE PHE A . n 
A 1 298 PRO 298 294 294 PRO PRO A . n 
A 1 299 GLN 299 295 295 GLN GLN A . n 
A 1 300 ILE 300 296 296 ILE ILE A . n 
A 1 301 LYS 301 297 297 LYS LYS A . n 
A 1 302 ALA 302 298 298 ALA ALA A . n 
A 1 303 HIS 303 299 299 HIS HIS A . n 
A 1 304 PRO 304 300 300 PRO PRO A . n 
A 1 305 TRP 305 301 301 TRP TRP A . n 
A 1 306 THR 306 302 302 THR THR A . n 
A 1 307 LYS 307 303 303 LYS LYS A . n 
A 1 308 VAL 308 304 304 VAL VAL A . n 
A 1 309 PHE 309 305 305 PHE PHE A . n 
A 1 310 ARG 310 306 306 ARG ARG A . n 
A 1 311 PRO 311 307 307 PRO PRO A . n 
A 1 312 ARG 312 308 308 ARG ARG A . n 
A 1 313 THR 313 309 309 THR THR A . n 
A 1 314 PRO 314 310 310 PRO PRO A . n 
A 1 315 PRO 315 311 311 PRO PRO A . n 
A 1 316 GLU 316 312 312 GLU GLU A . n 
A 1 317 ALA 317 313 313 ALA ALA A . n 
A 1 318 ILE 318 314 314 ILE ILE A . n 
A 1 319 ALA 319 315 315 ALA ALA A . n 
A 1 320 LEU 320 316 316 LEU LEU A . n 
A 1 321 CYS 321 317 317 CYS CYS A . n 
A 1 322 SER 322 318 318 SER SER A . n 
A 1 323 ARG 323 319 319 ARG ARG A . n 
A 1 324 LEU 324 320 320 LEU LEU A . n 
A 1 325 LEU 325 321 321 LEU LEU A . n 
A 1 326 GLU 326 322 322 GLU GLU A . n 
A 1 327 TYR 327 323 323 TYR TYR A . n 
A 1 328 THR 328 324 324 THR THR A . n 
A 1 329 PRO 329 325 325 PRO PRO A . n 
A 1 330 THR 330 326 326 THR THR A . n 
A 1 331 ALA 331 327 327 ALA ALA A . n 
A 1 332 ARG 332 328 328 ARG ARG A . n 
A 1 333 LEU 333 329 329 LEU LEU A . n 
A 1 334 THR 334 330 330 THR THR A . n 
A 1 335 PRO 335 331 331 PRO PRO A . n 
A 1 336 LEU 336 332 332 LEU LEU A . n 
A 1 337 GLU 337 333 333 GLU GLU A . n 
A 1 338 ALA 338 334 334 ALA ALA A . n 
A 1 339 CYS 339 335 335 CYS CYS A . n 
A 1 340 ALA 340 336 336 ALA ALA A . n 
A 1 341 HIS 341 337 337 HIS HIS A . n 
A 1 342 SER 342 338 338 SER SER A . n 
A 1 343 PHE 343 339 339 PHE PHE A . n 
A 1 344 PHE 344 340 340 PHE PHE A . n 
A 1 345 ASP 345 341 341 ASP ASP A . n 
A 1 346 GLU 346 342 342 GLU GLU A . n 
A 1 347 LEU 347 343 343 LEU LEU A . n 
A 1 348 ARG 348 344 344 ARG ARG A . n 
A 1 349 ASP 349 345 345 ASP ASP A . n 
A 1 350 PRO 350 346 346 PRO PRO A . n 
A 1 351 ASN 351 347 347 ASN ASN A . n 
A 1 352 VAL 352 348 348 VAL VAL A . n 
A 1 353 LYS 353 349 349 LYS LYS A . n 
A 1 354 LEU 354 350 350 LEU LEU A . n 
A 1 355 PRO 355 351 351 PRO PRO A . n 
A 1 356 ASN 356 352 352 ASN ASN A . n 
A 1 357 GLY 357 353 353 GLY GLY A . n 
A 1 358 ARG 358 354 354 ARG ARG A . n 
A 1 359 ASP 359 355 355 ASP ASP A . n 
A 1 360 THR 360 356 356 THR THR A . n 
A 1 361 PRO 361 357 357 PRO PRO A . n 
A 1 362 ALA 362 358 358 ALA ALA A . n 
A 1 363 LEU 363 359 359 LEU LEU A . n 
A 1 364 PHE 364 360 360 PHE PHE A . n 
A 1 365 ASN 365 361 361 ASN ASN A . n 
A 1 366 PHE 366 362 362 PHE PHE A . n 
A 1 367 THR 367 363 363 THR THR A . n 
A 1 368 THR 368 364 364 THR THR A . n 
A 1 369 GLN 369 365 365 GLN GLN A . n 
A 1 370 GLU 370 366 366 GLU GLU A . n 
A 1 371 LEU 371 367 367 LEU LEU A . n 
A 1 372 SER 372 368 368 SER SER A . n 
A 1 373 SER 373 369 369 SER SER A . n 
A 1 374 ASN 374 370 370 ASN ASN A . n 
A 1 375 PRO 375 371 371 PRO PRO A . n 
A 1 376 PRO 376 372 372 PRO PRO A . n 
A 1 377 LEU 377 373 373 LEU LEU A . n 
A 1 378 ALA 378 374 374 ALA ALA A . n 
A 1 379 THR 379 375 375 THR THR A . n 
A 1 380 ILE 380 376 376 ILE ILE A . n 
A 1 381 LEU 381 377 377 LEU LEU A . n 
A 1 382 ILE 382 378 378 ILE ILE A . n 
A 1 383 PRO 383 379 379 PRO PRO A . n 
A 1 384 PRO 384 380 380 PRO PRO A . n 
A 1 385 HIS 385 381 381 HIS HIS A . n 
A 1 386 ALA 386 382 382 ALA ALA A . n 
A 1 387 ARG 387 383 383 ARG ARG A . n 
A 1 388 ILE 388 384 384 ILE ILE A . n 
A 1 389 GLN 389 385 385 GLN GLN A . n 
A 1 390 ALA 390 386 386 ALA ALA A . n 
A 1 391 ALA 391 387 ?   ?   ?   A . n 
A 1 392 ALA 392 388 ?   ?   ?   A . n 
A 1 393 SER 393 389 ?   ?   ?   A . n 
A 1 394 THR 394 390 ?   ?   ?   A . n 
A 1 395 PRO 395 391 ?   ?   ?   A . n 
A 1 396 THR 396 392 ?   ?   ?   A . n 
A 1 397 ASN 397 393 ?   ?   ?   A . n 
A 1 398 ALA 398 394 ?   ?   ?   A . n 
A 1 399 THR 399 395 ?   ?   ?   A . n 
A 1 400 ALA 400 396 ?   ?   ?   A . n 
A 1 401 ALA 401 397 ?   ?   ?   A . n 
A 1 402 SER 402 398 ?   ?   ?   A . n 
A 1 403 ASP 403 399 ?   ?   ?   A . n 
A 1 404 ALA 404 400 ?   ?   ?   A . n 
A 1 405 ASN 405 401 ?   ?   ?   A . n 
A 1 406 THR 406 402 ?   ?   ?   A . n 
A 1 407 GLY 407 403 ?   ?   ?   A . n 
A 1 408 ASP 408 404 ?   ?   ?   A . n 
A 1 409 ARG 409 405 ?   ?   ?   A . n 
A 1 410 GLY 410 406 ?   ?   ?   A . n 
A 1 411 GLN 411 407 ?   ?   ?   A . n 
A 1 412 THR 412 408 ?   ?   ?   A . n 
A 1 413 ASN 413 409 ?   ?   ?   A . n 
A 1 414 ASN 414 410 ?   ?   ?   A . n 
A 1 415 ALA 415 411 ?   ?   ?   A . n 
A 1 416 ALA 416 412 ?   ?   ?   A . n 
A 1 417 SER 417 413 ?   ?   ?   A . n 
A 1 418 ALA 418 414 ?   ?   ?   A . n 
A 1 419 SER 419 415 ?   ?   ?   A . n 
A 1 420 ALA 420 416 ?   ?   ?   A . n 
A 1 421 SER 421 417 ?   ?   ?   A . n 
A 1 422 ASN 422 418 ?   ?   ?   A . n 
A 1 423 SER 423 419 ?   ?   ?   A . n 
A 1 424 THR 424 420 ?   ?   ?   A . n 
B 1 1   GLY 1   -3  ?   ?   ?   B . n 
B 1 2   PRO 2   -2  ?   ?   ?   B . n 
B 1 3   LEU 3   -1  ?   ?   ?   B . n 
B 1 4   GLY 4   0   ?   ?   ?   B . n 
B 1 5   SER 5   1   ?   ?   ?   B . n 
B 1 6   SER 6   2   ?   ?   ?   B . n 
B 1 7   GLY 7   3   ?   ?   ?   B . n 
B 1 8   ARG 8   4   ?   ?   ?   B . n 
B 1 9   PRO 9   5   ?   ?   ?   B . n 
B 1 10  ARG 10  6   ?   ?   ?   B . n 
B 1 11  THR 11  7   ?   ?   ?   B . n 
B 1 12  THR 12  8   ?   ?   ?   B . n 
B 1 13  SER 13  9   ?   ?   ?   B . n 
B 1 14  PHE 14  10  ?   ?   ?   B . n 
B 1 15  ALA 15  11  ?   ?   ?   B . n 
B 1 16  GLU 16  12  ?   ?   ?   B . n 
B 1 17  SER 17  13  ?   ?   ?   B . n 
B 1 18  CYS 18  14  ?   ?   ?   B . n 
B 1 19  LYS 19  15  ?   ?   ?   B . n 
B 1 20  PRO 20  16  ?   ?   ?   B . n 
B 1 21  VAL 21  17  ?   ?   ?   B . n 
B 1 22  GLN 22  18  ?   ?   ?   B . n 
B 1 23  GLN 23  19  ?   ?   ?   B . n 
B 1 24  PRO 24  20  ?   ?   ?   B . n 
B 1 25  SER 25  21  ?   ?   ?   B . n 
B 1 26  ALA 26  22  ?   ?   ?   B . n 
B 1 27  PHE 27  23  ?   ?   ?   B . n 
B 1 28  GLY 28  24  ?   ?   ?   B . n 
B 1 29  SER 29  25  ?   ?   ?   B . n 
B 1 30  MET 30  26  ?   ?   ?   B . n 
B 1 31  LYS 31  27  ?   ?   ?   B . n 
B 1 32  VAL 32  28  ?   ?   ?   B . n 
B 1 33  SER 33  29  ?   ?   ?   B . n 
B 1 34  ARG 34  30  ?   ?   ?   B . n 
B 1 35  ASP 35  31  ?   ?   ?   B . n 
B 1 36  LYS 36  32  ?   ?   ?   B . n 
B 1 37  ASP 37  33  ?   ?   ?   B . n 
B 1 38  GLY 38  34  ?   ?   ?   B . n 
B 1 39  SER 39  35  35  SER SER B . n 
B 1 40  LYS 40  36  36  LYS LYS B . n 
B 1 41  VAL 41  37  37  VAL VAL B . n 
B 1 42  THR 42  38  38  THR THR B . n 
B 1 43  THR 43  39  39  THR THR B . n 
B 1 44  VAL 44  40  40  VAL VAL B . n 
B 1 45  VAL 45  41  41  VAL VAL B . n 
B 1 46  ALA 46  42  42  ALA ALA B . n 
B 1 47  THR 47  43  43  THR THR B . n 
B 1 48  PRO 48  44  44  PRO PRO B . n 
B 1 49  GLY 49  45  45  GLY GLY B . n 
B 1 50  GLN 50  46  46  GLN GLN B . n 
B 1 51  GLY 51  47  47  GLY GLY B . n 
B 1 52  PRO 52  48  48  PRO PRO B . n 
B 1 53  ASP 53  49  49  ASP ASP B . n 
B 1 54  ARG 54  50  50  ARG ARG B . n 
B 1 55  PRO 55  51  51  PRO PRO B . n 
B 1 56  GLN 56  52  52  GLN GLN B . n 
B 1 57  GLU 57  53  53  GLU GLU B . n 
B 1 58  VAL 58  54  54  VAL VAL B . n 
B 1 59  SER 59  55  55  SER SER B . n 
B 1 60  TYR 60  56  56  TYR TYR B . n 
B 1 61  THR 61  57  57  THR THR B . n 
B 1 62  ASP 62  58  58  ASP ASP B . n 
B 1 63  THR 63  59  59  THR THR B . n 
B 1 64  LYS 64  60  60  LYS LYS B . n 
B 1 65  VAL 65  61  61  VAL VAL B . n 
B 1 66  ILE 66  62  62  ILE ILE B . n 
B 1 67  GLY 67  63  63  GLY GLY B . n 
B 1 68  ASN 68  64  64  ASN ASN B . n 
B 1 69  GLY 69  65  65  GLY GLY B . n 
B 1 70  SER 70  66  66  SER SER B . n 
B 1 71  PHE 71  67  67  PHE PHE B . n 
B 1 72  GLY 72  68  68  GLY GLY B . n 
B 1 73  VAL 73  69  69  VAL VAL B . n 
B 1 74  VAL 74  70  70  VAL VAL B . n 
B 1 75  TYR 75  71  71  TYR TYR B . n 
B 1 76  GLN 76  72  72  GLN GLN B . n 
B 1 77  ALA 77  73  73  ALA ALA B . n 
B 1 78  LYS 78  74  74  LYS LYS B . n 
B 1 79  LEU 79  75  75  LEU LEU B . n 
B 1 80  CYS 80  76  76  CYS CYS B . n 
B 1 81  ASP 81  77  77  ASP ASP B . n 
B 1 82  SER 82  78  78  SER SER B . n 
B 1 83  GLY 83  79  79  GLY GLY B . n 
B 1 84  GLU 84  80  80  GLU GLU B . n 
B 1 85  LEU 85  81  81  LEU LEU B . n 
B 1 86  VAL 86  82  82  VAL VAL B . n 
B 1 87  ALA 87  83  83  ALA ALA B . n 
B 1 88  ILE 88  84  84  ILE ILE B . n 
B 1 89  LYS 89  85  85  LYS LYS B . n 
B 1 90  LYS 90  86  86  LYS LYS B . n 
B 1 91  VAL 91  87  87  VAL VAL B . n 
B 1 92  LEU 92  88  88  LEU LEU B . n 
B 1 93  GLN 93  89  89  GLN GLN B . n 
B 1 94  ASP 94  90  90  ASP ASP B . n 
B 1 95  LYS 95  91  91  LYS LYS B . n 
B 1 96  ARG 96  92  92  ARG ARG B . n 
B 1 97  PHE 97  93  93  PHE PHE B . n 
B 1 98  LYS 98  94  94  LYS LYS B . n 
B 1 99  ASN 99  95  95  ASN ASN B . n 
B 1 100 ARG 100 96  96  ARG ARG B . n 
B 1 101 GLU 101 97  97  GLU GLU B . n 
B 1 102 LEU 102 98  98  LEU LEU B . n 
B 1 103 GLN 103 99  99  GLN GLN B . n 
B 1 104 ILE 104 100 100 ILE ILE B . n 
B 1 105 MET 105 101 101 MET MET B . n 
B 1 106 ARG 106 102 102 ARG ARG B . n 
B 1 107 LYS 107 103 103 LYS LYS B . n 
B 1 108 LEU 108 104 104 LEU LEU B . n 
B 1 109 ASP 109 105 105 ASP ASP B . n 
B 1 110 HIS 110 106 106 HIS HIS B . n 
B 1 111 CYS 111 107 107 CYS CYS B . n 
B 1 112 ASN 112 108 108 ASN ASN B . n 
B 1 113 ILE 113 109 109 ILE ILE B . n 
B 1 114 VAL 114 110 110 VAL VAL B . n 
B 1 115 ARG 115 111 111 ARG ARG B . n 
B 1 116 LEU 116 112 112 LEU LEU B . n 
B 1 117 ARG 117 113 113 ARG ARG B . n 
B 1 118 TYR 118 114 114 TYR TYR B . n 
B 1 119 PHE 119 115 115 PHE PHE B . n 
B 1 120 PHE 120 116 116 PHE PHE B . n 
B 1 121 TYR 121 117 117 TYR TYR B . n 
B 1 122 SER 122 118 118 SER SER B . n 
B 1 123 SER 123 119 119 SER SER B . n 
B 1 124 GLY 124 120 120 GLY GLY B . n 
B 1 125 GLU 125 121 ?   ?   ?   B . n 
B 1 126 LYS 126 122 ?   ?   ?   B . n 
B 1 127 LYS 127 123 ?   ?   ?   B . n 
B 1 128 ASP 128 124 124 ASP ASP B . n 
B 1 129 GLU 129 125 125 GLU GLU B . n 
B 1 130 VAL 130 126 126 VAL VAL B . n 
B 1 131 TYR 131 127 127 TYR TYR B . n 
B 1 132 LEU 132 128 128 LEU LEU B . n 
B 1 133 ASN 133 129 129 ASN ASN B . n 
B 1 134 LEU 134 130 130 LEU LEU B . n 
B 1 135 VAL 135 131 131 VAL VAL B . n 
B 1 136 LEU 136 132 132 LEU LEU B . n 
B 1 137 ASP 137 133 133 ASP ASP B . n 
B 1 138 TYR 138 134 134 TYR TYR B . n 
B 1 139 VAL 139 135 135 VAL VAL B . n 
B 1 140 PRO 140 136 136 PRO PRO B . n 
B 1 141 GLU 141 137 137 GLU GLU B . n 
B 1 142 THR 142 138 138 THR THR B . n 
B 1 143 VAL 143 139 139 VAL VAL B . n 
B 1 144 TYR 144 140 140 TYR TYR B . n 
B 1 145 ARG 145 141 141 ARG ARG B . n 
B 1 146 VAL 146 142 142 VAL VAL B . n 
B 1 147 ALA 147 143 143 ALA ALA B . n 
B 1 148 ARG 148 144 144 ARG ARG B . n 
B 1 149 HIS 149 145 145 HIS HIS B . n 
B 1 150 TYR 150 146 146 TYR TYR B . n 
B 1 151 SER 151 147 147 SER SER B . n 
B 1 152 ARG 152 148 148 ARG ARG B . n 
B 1 153 ALA 153 149 149 ALA ALA B . n 
B 1 154 LYS 154 150 150 LYS LYS B . n 
B 1 155 GLN 155 151 151 GLN GLN B . n 
B 1 156 THR 156 152 152 THR THR B . n 
B 1 157 LEU 157 153 153 LEU LEU B . n 
B 1 158 PRO 158 154 154 PRO PRO B . n 
B 1 159 VAL 159 155 155 VAL VAL B . n 
B 1 160 ILE 160 156 156 ILE ILE B . n 
B 1 161 TYR 161 157 157 TYR TYR B . n 
B 1 162 VAL 162 158 158 VAL VAL B . n 
B 1 163 LYS 163 159 159 LYS LYS B . n 
B 1 164 LEU 164 160 160 LEU LEU B . n 
B 1 165 TYR 165 161 161 TYR TYR B . n 
B 1 166 MET 166 162 162 MET MET B . n 
B 1 167 TYR 167 163 163 TYR TYR B . n 
B 1 168 GLN 168 164 164 GLN GLN B . n 
B 1 169 LEU 169 165 165 LEU LEU B . n 
B 1 170 PHE 170 166 166 PHE PHE B . n 
B 1 171 ARG 171 167 167 ARG ARG B . n 
B 1 172 SER 172 168 168 SER SER B . n 
B 1 173 LEU 173 169 169 LEU LEU B . n 
B 1 174 ALA 174 170 170 ALA ALA B . n 
B 1 175 TYR 175 171 171 TYR TYR B . n 
B 1 176 ILE 176 172 172 ILE ILE B . n 
B 1 177 HIS 177 173 173 HIS HIS B . n 
B 1 178 SER 178 174 174 SER SER B . n 
B 1 179 PHE 179 175 175 PHE PHE B . n 
B 1 180 GLY 180 176 176 GLY GLY B . n 
B 1 181 ILE 181 177 177 ILE ILE B . n 
B 1 182 CYS 182 178 178 CYS CYS B . n 
B 1 183 HIS 183 179 179 HIS HIS B . n 
B 1 184 ARG 184 180 180 ARG ARG B . n 
B 1 185 ASP 185 181 181 ASP ASP B . n 
B 1 186 ILE 186 182 182 ILE ILE B . n 
B 1 187 LYS 187 183 183 LYS LYS B . n 
B 1 188 PRO 188 184 184 PRO PRO B . n 
B 1 189 GLN 189 185 185 GLN GLN B . n 
B 1 190 ASN 190 186 186 ASN ASN B . n 
B 1 191 LEU 191 187 187 LEU LEU B . n 
B 1 192 LEU 192 188 188 LEU LEU B . n 
B 1 193 LEU 193 189 189 LEU LEU B . n 
B 1 194 ASP 194 190 190 ASP ASP B . n 
B 1 195 PRO 195 191 191 PRO PRO B . n 
B 1 196 ASP 196 192 192 ASP ASP B . n 
B 1 197 THR 197 193 193 THR THR B . n 
B 1 198 ALA 198 194 194 ALA ALA B . n 
B 1 199 VAL 199 195 195 VAL VAL B . n 
B 1 200 LEU 200 196 196 LEU LEU B . n 
B 1 201 LYS 201 197 197 LYS LYS B . n 
B 1 202 LEU 202 198 198 LEU LEU B . n 
B 1 203 CYS 203 199 199 CYS CYS B . n 
B 1 204 ASP 204 200 200 ASP ASP B . n 
B 1 205 PHE 205 201 201 PHE PHE B . n 
B 1 206 GLY 206 202 202 GLY GLY B . n 
B 1 207 SER 207 203 203 SER SER B . n 
B 1 208 ALA 208 204 204 ALA ALA B . n 
B 1 209 LYS 209 205 205 LYS LYS B . n 
B 1 210 GLN 210 206 206 GLN GLN B . n 
B 1 211 LEU 211 207 207 LEU LEU B . n 
B 1 212 VAL 212 208 208 VAL VAL B . n 
B 1 213 ARG 213 209 209 ARG ARG B . n 
B 1 214 GLY 214 210 210 GLY GLY B . n 
B 1 215 GLU 215 211 211 GLU GLU B . n 
B 1 216 PRO 216 212 212 PRO PRO B . n 
B 1 217 ASN 217 213 213 ASN ASN B . n 
B 1 218 VAL 218 214 214 VAL VAL B . n 
B 1 219 SER 219 215 215 SER SER B . n 
B 1 220 TYR 220 216 216 TYR TYR B . n 
B 1 221 ILE 221 217 217 ILE ILE B . n 
B 1 222 CYS 222 218 218 CYS CYS B . n 
B 1 223 SER 223 219 219 SER SER B . n 
B 1 224 ARG 224 220 220 ARG ARG B . n 
B 1 225 TYR 225 221 221 TYR TYR B . n 
B 1 226 TYR 226 222 222 TYR TYR B . n 
B 1 227 ARG 227 223 223 ARG ARG B . n 
B 1 228 ALA 228 224 224 ALA ALA B . n 
B 1 229 PRO 229 225 225 PRO PRO B . n 
B 1 230 GLU 230 226 226 GLU GLU B . n 
B 1 231 LEU 231 227 227 LEU LEU B . n 
B 1 232 ILE 232 228 228 ILE ILE B . n 
B 1 233 PHE 233 229 229 PHE PHE B . n 
B 1 234 GLY 234 230 230 GLY GLY B . n 
B 1 235 ALA 235 231 231 ALA ALA B . n 
B 1 236 THR 236 232 232 THR THR B . n 
B 1 237 ASP 237 233 233 ASP ASP B . n 
B 1 238 TYR 238 234 234 TYR TYR B . n 
B 1 239 THR 239 235 235 THR THR B . n 
B 1 240 SER 240 236 236 SER SER B . n 
B 1 241 SER 241 237 237 SER SER B . n 
B 1 242 ILE 242 238 238 ILE ILE B . n 
B 1 243 ASP 243 239 239 ASP ASP B . n 
B 1 244 VAL 244 240 240 VAL VAL B . n 
B 1 245 TRP 245 241 241 TRP TRP B . n 
B 1 246 SER 246 242 242 SER SER B . n 
B 1 247 ALA 247 243 243 ALA ALA B . n 
B 1 248 GLY 248 244 244 GLY GLY B . n 
B 1 249 CYS 249 245 245 CYS CYS B . n 
B 1 250 VAL 250 246 246 VAL VAL B . n 
B 1 251 LEU 251 247 247 LEU LEU B . n 
B 1 252 ALA 252 248 248 ALA ALA B . n 
B 1 253 GLU 253 249 249 GLU GLU B . n 
B 1 254 LEU 254 250 250 LEU LEU B . n 
B 1 255 LEU 255 251 251 LEU LEU B . n 
B 1 256 LEU 256 252 252 LEU LEU B . n 
B 1 257 GLY 257 253 253 GLY GLY B . n 
B 1 258 GLN 258 254 254 GLN GLN B . n 
B 1 259 PRO 259 255 255 PRO PRO B . n 
B 1 260 ILE 260 256 256 ILE ILE B . n 
B 1 261 PHE 261 257 257 PHE PHE B . n 
B 1 262 PRO 262 258 258 PRO PRO B . n 
B 1 263 GLY 263 259 259 GLY GLY B . n 
B 1 264 ASP 264 260 260 ASP ASP B . n 
B 1 265 SER 265 261 261 SER SER B . n 
B 1 266 GLY 266 262 262 GLY GLY B . n 
B 1 267 VAL 267 263 263 VAL VAL B . n 
B 1 268 ASP 268 264 264 ASP ASP B . n 
B 1 269 GLN 269 265 265 GLN GLN B . n 
B 1 270 LEU 270 266 266 LEU LEU B . n 
B 1 271 VAL 271 267 267 VAL VAL B . n 
B 1 272 GLU 272 268 268 GLU GLU B . n 
B 1 273 ILE 273 269 269 ILE ILE B . n 
B 1 274 ILE 274 270 270 ILE ILE B . n 
B 1 275 LYS 275 271 271 LYS LYS B . n 
B 1 276 VAL 276 272 272 VAL VAL B . n 
B 1 277 LEU 277 273 273 LEU LEU B . n 
B 1 278 GLY 278 274 274 GLY GLY B . n 
B 1 279 THR 279 275 275 THR THR B . n 
B 1 280 PRO 280 276 276 PRO PRO B . n 
B 1 281 THR 281 277 277 THR THR B . n 
B 1 282 ARG 282 278 278 ARG ARG B . n 
B 1 283 GLU 283 279 279 GLU GLU B . n 
B 1 284 GLN 284 280 280 GLN GLN B . n 
B 1 285 ILE 285 281 281 ILE ILE B . n 
B 1 286 ARG 286 282 282 ARG ARG B . n 
B 1 287 GLU 287 283 283 GLU GLU B . n 
B 1 288 MET 288 284 284 MET MET B . n 
B 1 289 ASN 289 285 285 ASN ASN B . n 
B 1 290 PRO 290 286 286 PRO PRO B . n 
B 1 291 ASN 291 287 287 ASN ASN B . n 
B 1 292 TYR 292 288 288 TYR TYR B . n 
B 1 293 THR 293 289 289 THR THR B . n 
B 1 294 GLU 294 290 290 GLU GLU B . n 
B 1 295 PHE 295 291 ?   ?   ?   B . n 
B 1 296 LYS 296 292 ?   ?   ?   B . n 
B 1 297 PHE 297 293 ?   ?   ?   B . n 
B 1 298 PRO 298 294 ?   ?   ?   B . n 
B 1 299 GLN 299 295 ?   ?   ?   B . n 
B 1 300 ILE 300 296 ?   ?   ?   B . n 
B 1 301 LYS 301 297 ?   ?   ?   B . n 
B 1 302 ALA 302 298 ?   ?   ?   B . n 
B 1 303 HIS 303 299 ?   ?   ?   B . n 
B 1 304 PRO 304 300 300 PRO PRO B . n 
B 1 305 TRP 305 301 301 TRP TRP B . n 
B 1 306 THR 306 302 302 THR THR B . n 
B 1 307 LYS 307 303 303 LYS LYS B . n 
B 1 308 VAL 308 304 304 VAL VAL B . n 
B 1 309 PHE 309 305 305 PHE PHE B . n 
B 1 310 ARG 310 306 306 ARG ARG B . n 
B 1 311 PRO 311 307 307 PRO PRO B . n 
B 1 312 ARG 312 308 308 ARG ARG B . n 
B 1 313 THR 313 309 309 THR THR B . n 
B 1 314 PRO 314 310 310 PRO PRO B . n 
B 1 315 PRO 315 311 311 PRO PRO B . n 
B 1 316 GLU 316 312 312 GLU GLU B . n 
B 1 317 ALA 317 313 313 ALA ALA B . n 
B 1 318 ILE 318 314 314 ILE ILE B . n 
B 1 319 ALA 319 315 315 ALA ALA B . n 
B 1 320 LEU 320 316 316 LEU LEU B . n 
B 1 321 CYS 321 317 317 CYS CYS B . n 
B 1 322 SER 322 318 318 SER SER B . n 
B 1 323 ARG 323 319 319 ARG ARG B . n 
B 1 324 LEU 324 320 320 LEU LEU B . n 
B 1 325 LEU 325 321 321 LEU LEU B . n 
B 1 326 GLU 326 322 322 GLU GLU B . n 
B 1 327 TYR 327 323 323 TYR TYR B . n 
B 1 328 THR 328 324 324 THR THR B . n 
B 1 329 PRO 329 325 325 PRO PRO B . n 
B 1 330 THR 330 326 326 THR THR B . n 
B 1 331 ALA 331 327 327 ALA ALA B . n 
B 1 332 ARG 332 328 328 ARG ARG B . n 
B 1 333 LEU 333 329 329 LEU LEU B . n 
B 1 334 THR 334 330 330 THR THR B . n 
B 1 335 PRO 335 331 331 PRO PRO B . n 
B 1 336 LEU 336 332 332 LEU LEU B . n 
B 1 337 GLU 337 333 333 GLU GLU B . n 
B 1 338 ALA 338 334 334 ALA ALA B . n 
B 1 339 CYS 339 335 335 CYS CYS B . n 
B 1 340 ALA 340 336 336 ALA ALA B . n 
B 1 341 HIS 341 337 337 HIS HIS B . n 
B 1 342 SER 342 338 338 SER SER B . n 
B 1 343 PHE 343 339 339 PHE PHE B . n 
B 1 344 PHE 344 340 340 PHE PHE B . n 
B 1 345 ASP 345 341 341 ASP ASP B . n 
B 1 346 GLU 346 342 342 GLU GLU B . n 
B 1 347 LEU 347 343 343 LEU LEU B . n 
B 1 348 ARG 348 344 344 ARG ARG B . n 
B 1 349 ASP 349 345 345 ASP ASP B . n 
B 1 350 PRO 350 346 346 PRO PRO B . n 
B 1 351 ASN 351 347 347 ASN ASN B . n 
B 1 352 VAL 352 348 348 VAL VAL B . n 
B 1 353 LYS 353 349 349 LYS LYS B . n 
B 1 354 LEU 354 350 350 LEU LEU B . n 
B 1 355 PRO 355 351 351 PRO PRO B . n 
B 1 356 ASN 356 352 352 ASN ASN B . n 
B 1 357 GLY 357 353 353 GLY GLY B . n 
B 1 358 ARG 358 354 354 ARG ARG B . n 
B 1 359 ASP 359 355 355 ASP ASP B . n 
B 1 360 THR 360 356 356 THR THR B . n 
B 1 361 PRO 361 357 357 PRO PRO B . n 
B 1 362 ALA 362 358 358 ALA ALA B . n 
B 1 363 LEU 363 359 359 LEU LEU B . n 
B 1 364 PHE 364 360 360 PHE PHE B . n 
B 1 365 ASN 365 361 361 ASN ASN B . n 
B 1 366 PHE 366 362 362 PHE PHE B . n 
B 1 367 THR 367 363 363 THR THR B . n 
B 1 368 THR 368 364 364 THR THR B . n 
B 1 369 GLN 369 365 365 GLN GLN B . n 
B 1 370 GLU 370 366 366 GLU GLU B . n 
B 1 371 LEU 371 367 367 LEU LEU B . n 
B 1 372 SER 372 368 368 SER SER B . n 
B 1 373 SER 373 369 369 SER SER B . n 
B 1 374 ASN 374 370 370 ASN ASN B . n 
B 1 375 PRO 375 371 371 PRO PRO B . n 
B 1 376 PRO 376 372 372 PRO PRO B . n 
B 1 377 LEU 377 373 373 LEU LEU B . n 
B 1 378 ALA 378 374 374 ALA ALA B . n 
B 1 379 THR 379 375 375 THR THR B . n 
B 1 380 ILE 380 376 376 ILE ILE B . n 
B 1 381 LEU 381 377 377 LEU LEU B . n 
B 1 382 ILE 382 378 378 ILE ILE B . n 
B 1 383 PRO 383 379 379 PRO PRO B . n 
B 1 384 PRO 384 380 380 PRO PRO B . n 
B 1 385 HIS 385 381 381 HIS HIS B . n 
B 1 386 ALA 386 382 382 ALA ALA B . n 
B 1 387 ARG 387 383 383 ARG ARG B . n 
B 1 388 ILE 388 384 ?   ?   ?   B . n 
B 1 389 GLN 389 385 ?   ?   ?   B . n 
B 1 390 ALA 390 386 ?   ?   ?   B . n 
B 1 391 ALA 391 387 ?   ?   ?   B . n 
B 1 392 ALA 392 388 ?   ?   ?   B . n 
B 1 393 SER 393 389 ?   ?   ?   B . n 
B 1 394 THR 394 390 ?   ?   ?   B . n 
B 1 395 PRO 395 391 ?   ?   ?   B . n 
B 1 396 THR 396 392 ?   ?   ?   B . n 
B 1 397 ASN 397 393 ?   ?   ?   B . n 
B 1 398 ALA 398 394 ?   ?   ?   B . n 
B 1 399 THR 399 395 ?   ?   ?   B . n 
B 1 400 ALA 400 396 ?   ?   ?   B . n 
B 1 401 ALA 401 397 ?   ?   ?   B . n 
B 1 402 SER 402 398 ?   ?   ?   B . n 
B 1 403 ASP 403 399 ?   ?   ?   B . n 
B 1 404 ALA 404 400 ?   ?   ?   B . n 
B 1 405 ASN 405 401 ?   ?   ?   B . n 
B 1 406 THR 406 402 ?   ?   ?   B . n 
B 1 407 GLY 407 403 ?   ?   ?   B . n 
B 1 408 ASP 408 404 ?   ?   ?   B . n 
B 1 409 ARG 409 405 ?   ?   ?   B . n 
B 1 410 GLY 410 406 ?   ?   ?   B . n 
B 1 411 GLN 411 407 ?   ?   ?   B . n 
B 1 412 THR 412 408 ?   ?   ?   B . n 
B 1 413 ASN 413 409 ?   ?   ?   B . n 
B 1 414 ASN 414 410 ?   ?   ?   B . n 
B 1 415 ALA 415 411 ?   ?   ?   B . n 
B 1 416 ALA 416 412 ?   ?   ?   B . n 
B 1 417 SER 417 413 ?   ?   ?   B . n 
B 1 418 ALA 418 414 ?   ?   ?   B . n 
B 1 419 SER 419 415 ?   ?   ?   B . n 
B 1 420 ALA 420 416 ?   ?   ?   B . n 
B 1 421 SER 421 417 ?   ?   ?   B . n 
B 1 422 ASN 422 418 ?   ?   ?   B . n 
B 1 423 SER 423 419 ?   ?   ?   B . n 
B 1 424 THR 424 420 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-10-14 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SCALEPACK 'data scaling' .    ? 1 
CNX       refinement     2000 ? 2 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             VAL 
_pdbx_validate_rmsd_angle.auth_seq_id_1              135 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              136 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              136 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                129.41 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            10.11 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 46  ? ? -130.88 -33.93  
2  1 ASP A 49  ? ? -61.56  56.39   
3  1 ASP A 58  ? ? 83.27   33.66   
4  1 THR A 59  ? ? -54.83  105.04  
5  1 ASP A 77  ? ? -46.09  -78.43  
6  1 ALA A 149 ? ? 176.93  7.95    
7  1 ASP A 181 ? ? -159.35 44.63   
8  1 ASP A 200 ? ? 57.74   86.06   
9  1 CYS A 218 ? ? 81.69   129.23  
10 1 TYR A 221 ? ? 104.98  -29.32  
11 1 PRO A 294 ? ? -59.61  92.85   
12 1 PRO A 300 ? ? -51.45  101.58  
13 1 TRP A 301 ? ? -37.06  -39.77  
14 1 ARG A 308 ? ? 119.49  -23.75  
15 1 ASN A 370 ? ? -166.81 78.13   
16 1 SER B 66  ? ? 12.73   -100.46 
17 1 LYS B 91  ? ? 79.17   -31.48  
18 1 GLU B 125 ? ? 13.37   121.45  
19 1 LEU B 153 ? ? -35.68  120.78  
20 1 ASP B 181 ? ? -159.47 44.21   
21 1 ASP B 200 ? ? 58.72   87.12   
22 1 CYS B 218 ? ? 83.04   132.56  
23 1 TYR B 221 ? ? 93.39   -29.64  
24 1 THR B 309 ? ? -28.02  125.92  
25 1 ASN B 370 ? ? -167.12 79.54   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY -3  ? A GLY 1   
2   1 Y 1 A PRO -2  ? A PRO 2   
3   1 Y 1 A LEU -1  ? A LEU 3   
4   1 Y 1 A GLY 0   ? A GLY 4   
5   1 Y 1 A SER 1   ? A SER 5   
6   1 Y 1 A SER 2   ? A SER 6   
7   1 Y 1 A GLY 3   ? A GLY 7   
8   1 Y 1 A ARG 4   ? A ARG 8   
9   1 Y 1 A PRO 5   ? A PRO 9   
10  1 Y 1 A ARG 6   ? A ARG 10  
11  1 Y 1 A THR 7   ? A THR 11  
12  1 Y 1 A THR 8   ? A THR 12  
13  1 Y 1 A SER 9   ? A SER 13  
14  1 Y 1 A PHE 10  ? A PHE 14  
15  1 Y 1 A ALA 11  ? A ALA 15  
16  1 Y 1 A GLU 12  ? A GLU 16  
17  1 Y 1 A SER 13  ? A SER 17  
18  1 Y 1 A CYS 14  ? A CYS 18  
19  1 Y 1 A LYS 15  ? A LYS 19  
20  1 Y 1 A PRO 16  ? A PRO 20  
21  1 Y 1 A VAL 17  ? A VAL 21  
22  1 Y 1 A GLN 18  ? A GLN 22  
23  1 Y 1 A GLN 19  ? A GLN 23  
24  1 Y 1 A PRO 20  ? A PRO 24  
25  1 Y 1 A SER 21  ? A SER 25  
26  1 Y 1 A ALA 22  ? A ALA 26  
27  1 Y 1 A PHE 23  ? A PHE 27  
28  1 Y 1 A GLY 24  ? A GLY 28  
29  1 Y 1 A SER 25  ? A SER 29  
30  1 Y 1 A MET 26  ? A MET 30  
31  1 Y 1 A LYS 27  ? A LYS 31  
32  1 Y 1 A VAL 28  ? A VAL 32  
33  1 Y 1 A SER 29  ? A SER 33  
34  1 Y 1 A ARG 30  ? A ARG 34  
35  1 Y 1 A ASP 31  ? A ASP 35  
36  1 Y 1 A LYS 32  ? A LYS 36  
37  1 Y 1 A ASP 33  ? A ASP 37  
38  1 Y 1 A GLY 34  ? A GLY 38  
39  1 Y 1 A GLU 121 ? A GLU 125 
40  1 Y 1 A LYS 122 ? A LYS 126 
41  1 Y 1 A LYS 123 ? A LYS 127 
42  1 Y 1 A PRO 286 ? A PRO 290 
43  1 Y 1 A ASN 287 ? A ASN 291 
44  1 Y 1 A TYR 288 ? A TYR 292 
45  1 Y 1 A THR 289 ? A THR 293 
46  1 Y 1 A GLU 290 ? A GLU 294 
47  1 Y 1 A PHE 291 ? A PHE 295 
48  1 Y 1 A LYS 292 ? A LYS 296 
49  1 Y 1 A ALA 387 ? A ALA 391 
50  1 Y 1 A ALA 388 ? A ALA 392 
51  1 Y 1 A SER 389 ? A SER 393 
52  1 Y 1 A THR 390 ? A THR 394 
53  1 Y 1 A PRO 391 ? A PRO 395 
54  1 Y 1 A THR 392 ? A THR 396 
55  1 Y 1 A ASN 393 ? A ASN 397 
56  1 Y 1 A ALA 394 ? A ALA 398 
57  1 Y 1 A THR 395 ? A THR 399 
58  1 Y 1 A ALA 396 ? A ALA 400 
59  1 Y 1 A ALA 397 ? A ALA 401 
60  1 Y 1 A SER 398 ? A SER 402 
61  1 Y 1 A ASP 399 ? A ASP 403 
62  1 Y 1 A ALA 400 ? A ALA 404 
63  1 Y 1 A ASN 401 ? A ASN 405 
64  1 Y 1 A THR 402 ? A THR 406 
65  1 Y 1 A GLY 403 ? A GLY 407 
66  1 Y 1 A ASP 404 ? A ASP 408 
67  1 Y 1 A ARG 405 ? A ARG 409 
68  1 Y 1 A GLY 406 ? A GLY 410 
69  1 Y 1 A GLN 407 ? A GLN 411 
70  1 Y 1 A THR 408 ? A THR 412 
71  1 Y 1 A ASN 409 ? A ASN 413 
72  1 Y 1 A ASN 410 ? A ASN 414 
73  1 Y 1 A ALA 411 ? A ALA 415 
74  1 Y 1 A ALA 412 ? A ALA 416 
75  1 Y 1 A SER 413 ? A SER 417 
76  1 Y 1 A ALA 414 ? A ALA 418 
77  1 Y 1 A SER 415 ? A SER 419 
78  1 Y 1 A ALA 416 ? A ALA 420 
79  1 Y 1 A SER 417 ? A SER 421 
80  1 Y 1 A ASN 418 ? A ASN 422 
81  1 Y 1 A SER 419 ? A SER 423 
82  1 Y 1 A THR 420 ? A THR 424 
83  1 Y 1 B GLY -3  ? B GLY 1   
84  1 Y 1 B PRO -2  ? B PRO 2   
85  1 Y 1 B LEU -1  ? B LEU 3   
86  1 Y 1 B GLY 0   ? B GLY 4   
87  1 Y 1 B SER 1   ? B SER 5   
88  1 Y 1 B SER 2   ? B SER 6   
89  1 Y 1 B GLY 3   ? B GLY 7   
90  1 Y 1 B ARG 4   ? B ARG 8   
91  1 Y 1 B PRO 5   ? B PRO 9   
92  1 Y 1 B ARG 6   ? B ARG 10  
93  1 Y 1 B THR 7   ? B THR 11  
94  1 Y 1 B THR 8   ? B THR 12  
95  1 Y 1 B SER 9   ? B SER 13  
96  1 Y 1 B PHE 10  ? B PHE 14  
97  1 Y 1 B ALA 11  ? B ALA 15  
98  1 Y 1 B GLU 12  ? B GLU 16  
99  1 Y 1 B SER 13  ? B SER 17  
100 1 Y 1 B CYS 14  ? B CYS 18  
101 1 Y 1 B LYS 15  ? B LYS 19  
102 1 Y 1 B PRO 16  ? B PRO 20  
103 1 Y 1 B VAL 17  ? B VAL 21  
104 1 Y 1 B GLN 18  ? B GLN 22  
105 1 Y 1 B GLN 19  ? B GLN 23  
106 1 Y 1 B PRO 20  ? B PRO 24  
107 1 Y 1 B SER 21  ? B SER 25  
108 1 Y 1 B ALA 22  ? B ALA 26  
109 1 Y 1 B PHE 23  ? B PHE 27  
110 1 Y 1 B GLY 24  ? B GLY 28  
111 1 Y 1 B SER 25  ? B SER 29  
112 1 Y 1 B MET 26  ? B MET 30  
113 1 Y 1 B LYS 27  ? B LYS 31  
114 1 Y 1 B VAL 28  ? B VAL 32  
115 1 Y 1 B SER 29  ? B SER 33  
116 1 Y 1 B ARG 30  ? B ARG 34  
117 1 Y 1 B ASP 31  ? B ASP 35  
118 1 Y 1 B LYS 32  ? B LYS 36  
119 1 Y 1 B ASP 33  ? B ASP 37  
120 1 Y 1 B GLY 34  ? B GLY 38  
121 1 Y 1 B GLU 121 ? B GLU 125 
122 1 Y 1 B LYS 122 ? B LYS 126 
123 1 Y 1 B LYS 123 ? B LYS 127 
124 1 Y 1 B PHE 291 ? B PHE 295 
125 1 Y 1 B LYS 292 ? B LYS 296 
126 1 Y 1 B PHE 293 ? B PHE 297 
127 1 Y 1 B PRO 294 ? B PRO 298 
128 1 Y 1 B GLN 295 ? B GLN 299 
129 1 Y 1 B ILE 296 ? B ILE 300 
130 1 Y 1 B LYS 297 ? B LYS 301 
131 1 Y 1 B ALA 298 ? B ALA 302 
132 1 Y 1 B HIS 299 ? B HIS 303 
133 1 Y 1 B ILE 384 ? B ILE 388 
134 1 Y 1 B GLN 385 ? B GLN 389 
135 1 Y 1 B ALA 386 ? B ALA 390 
136 1 Y 1 B ALA 387 ? B ALA 391 
137 1 Y 1 B ALA 388 ? B ALA 392 
138 1 Y 1 B SER 389 ? B SER 393 
139 1 Y 1 B THR 390 ? B THR 394 
140 1 Y 1 B PRO 391 ? B PRO 395 
141 1 Y 1 B THR 392 ? B THR 396 
142 1 Y 1 B ASN 393 ? B ASN 397 
143 1 Y 1 B ALA 394 ? B ALA 398 
144 1 Y 1 B THR 395 ? B THR 399 
145 1 Y 1 B ALA 396 ? B ALA 400 
146 1 Y 1 B ALA 397 ? B ALA 401 
147 1 Y 1 B SER 398 ? B SER 402 
148 1 Y 1 B ASP 399 ? B ASP 403 
149 1 Y 1 B ALA 400 ? B ALA 404 
150 1 Y 1 B ASN 401 ? B ASN 405 
151 1 Y 1 B THR 402 ? B THR 406 
152 1 Y 1 B GLY 403 ? B GLY 407 
153 1 Y 1 B ASP 404 ? B ASP 408 
154 1 Y 1 B ARG 405 ? B ARG 409 
155 1 Y 1 B GLY 406 ? B GLY 410 
156 1 Y 1 B GLN 407 ? B GLN 411 
157 1 Y 1 B THR 408 ? B THR 412 
158 1 Y 1 B ASN 409 ? B ASN 413 
159 1 Y 1 B ASN 410 ? B ASN 414 
160 1 Y 1 B ALA 411 ? B ALA 415 
161 1 Y 1 B ALA 412 ? B ALA 416 
162 1 Y 1 B SER 413 ? B SER 417 
163 1 Y 1 B ALA 414 ? B ALA 418 
164 1 Y 1 B SER 415 ? B SER 419 
165 1 Y 1 B ALA 416 ? B ALA 420 
166 1 Y 1 B SER 417 ? B SER 421 
167 1 Y 1 B ASN 418 ? B ASN 422 
168 1 Y 1 B SER 419 ? B SER 423 
169 1 Y 1 B THR 420 ? B THR 424 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '2-CHLORO-5-[4-(3-CHLORO-PHENYL)-2,5-DIOXO-2,5-DIHYDRO-1H-PYRROL-3-YLAMINO]-BENZOIC ACID' 679 
3 water                                                                                     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 679 1  451 451 679 679 A . 
D 2 679 1  452 452 679 679 B . 
E 3 HOH 1  502 502 HOH WAT A . 
E 3 HOH 2  505 505 HOH WAT A . 
E 3 HOH 3  508 508 HOH WAT A . 
E 3 HOH 4  510 510 HOH WAT A . 
E 3 HOH 5  519 519 HOH WAT A . 
E 3 HOH 6  520 520 HOH WAT A . 
E 3 HOH 7  522 522 HOH WAT A . 
E 3 HOH 8  524 524 HOH WAT A . 
E 3 HOH 9  526 526 HOH WAT A . 
E 3 HOH 10 529 529 HOH WAT A . 
E 3 HOH 11 530 530 HOH WAT A . 
E 3 HOH 12 531 531 HOH WAT A . 
E 3 HOH 13 534 534 HOH WAT A . 
E 3 HOH 14 536 536 HOH WAT A . 
E 3 HOH 15 541 541 HOH WAT A . 
E 3 HOH 16 542 542 HOH WAT A . 
E 3 HOH 17 546 546 HOH WAT A . 
F 3 HOH 1  501 501 HOH WAT B . 
F 3 HOH 2  503 503 HOH WAT B . 
F 3 HOH 3  504 504 HOH WAT B . 
F 3 HOH 4  506 506 HOH WAT B . 
F 3 HOH 5  507 507 HOH WAT B . 
F 3 HOH 6  509 509 HOH WAT B . 
F 3 HOH 7  511 511 HOH WAT B . 
F 3 HOH 8  512 512 HOH WAT B . 
F 3 HOH 9  513 513 HOH WAT B . 
F 3 HOH 10 514 514 HOH WAT B . 
F 3 HOH 11 515 515 HOH WAT B . 
F 3 HOH 12 516 516 HOH WAT B . 
F 3 HOH 13 517 517 HOH WAT B . 
F 3 HOH 14 518 518 HOH WAT B . 
F 3 HOH 15 521 521 HOH WAT B . 
F 3 HOH 16 523 523 HOH WAT B . 
F 3 HOH 17 525 525 HOH WAT B . 
F 3 HOH 18 527 527 HOH WAT B . 
F 3 HOH 19 528 528 HOH WAT B . 
F 3 HOH 20 532 532 HOH WAT B . 
F 3 HOH 21 533 533 HOH WAT B . 
F 3 HOH 22 535 535 HOH WAT B . 
F 3 HOH 23 537 537 HOH WAT B . 
F 3 HOH 24 538 538 HOH WAT B . 
F 3 HOH 25 539 539 HOH WAT B . 
F 3 HOH 26 540 540 HOH WAT B . 
F 3 HOH 27 543 543 HOH WAT B . 
F 3 HOH 28 544 544 HOH WAT B . 
F 3 HOH 29 545 545 HOH WAT B . 
F 3 HOH 30 547 547 HOH WAT B . 
#