data_1Q5K
# 
_entry.id   1Q5K 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1Q5K         
RCSB  RCSB019943   
WWPDB D_1000019943 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1Q5K 
_pdbx_database_status.recvd_initial_deposition_date   2003-08-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bhat, R.'            1  
'Xue, Y.'             2  
'Berg, S.'            3  
'Hellberg, S.'        4  
'Ormo, M.'            5  
'Nilsson, Y.'         6  
'Radesater, A.C.'     7  
'Jerning, E.'         8  
'Markgren, P.O.'      9  
'Borgegard, T.'       10 
'Nylof, M.'           11 
'Gimenez-Cassina, A.' 12 
'Hernandez, F.'       13 
'Lucas, J.J.'         14 
'Diaz-Mido, J.'       15 
'Avila, J.'           16 
# 
_citation.id                        primary 
_citation.title                     
'Structural insights and biological effects of glycogen synthase kinase 3-specific inhibitor AR-A014418.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            278 
_citation.page_first                45937 
_citation.page_last                 45945 
_citation.year                      2003 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12928438 
_citation.pdbx_database_id_DOI      10.1074/jbc.M306268200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bhat, R.'            1  
primary 'Xue, Y.'             2  
primary 'Berg, S.'            3  
primary 'Hellberg, S.'        4  
primary 'Ormo, M.'            5  
primary 'Nilsson, Y.'         6  
primary 'Radesater, A.C.'     7  
primary 'Jerning, E.'         8  
primary 'Markgren, P.O.'      9  
primary 'Borgegard, T.'       10 
primary 'Nylof, M.'           11 
primary 'Gimenez-Cassina, A.' 12 
primary 'Hernandez, F.'       13 
primary 'Lucas, J.J.'         14 
primary 'Diaz-Nido, J.'       15 
primary 'Avila, J.'           16 
# 
_cell.entry_id           1Q5K 
_cell.length_a           82.584 
_cell.length_b           84.913 
_cell.length_c           178.424 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1Q5K 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glycogen synthase kinase-3 beta'                       46114.391 2   2.7.1.37 ? ? ? 
2 non-polymer syn "N-(4-METHOXYBENZYL)-N'-(5-NITRO-1,3-THIAZOL-2-YL)UREA" 308.313   2   ?        ? ? ? 
3 water       nat water                                                   18.015    373 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GSK-3 beta' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;TTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKK
VLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLF
RSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCV
LAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPT
ARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRG
QTNNAASASASNST
;
_entity_poly.pdbx_seq_one_letter_code_can   
;TTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKK
VLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLF
RSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCV
LAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPT
ARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRG
QTNNAASASASNST
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   THR n 
1 3   SER n 
1 4   PHE n 
1 5   ALA n 
1 6   GLU n 
1 7   SER n 
1 8   CYS n 
1 9   LYS n 
1 10  PRO n 
1 11  VAL n 
1 12  GLN n 
1 13  GLN n 
1 14  PRO n 
1 15  SER n 
1 16  ALA n 
1 17  PHE n 
1 18  GLY n 
1 19  SER n 
1 20  MET n 
1 21  LYS n 
1 22  VAL n 
1 23  SER n 
1 24  ARG n 
1 25  ASP n 
1 26  LYS n 
1 27  ASP n 
1 28  GLY n 
1 29  SER n 
1 30  LYS n 
1 31  VAL n 
1 32  THR n 
1 33  THR n 
1 34  VAL n 
1 35  VAL n 
1 36  ALA n 
1 37  THR n 
1 38  PRO n 
1 39  GLY n 
1 40  GLN n 
1 41  GLY n 
1 42  PRO n 
1 43  ASP n 
1 44  ARG n 
1 45  PRO n 
1 46  GLN n 
1 47  GLU n 
1 48  VAL n 
1 49  SER n 
1 50  TYR n 
1 51  THR n 
1 52  ASP n 
1 53  THR n 
1 54  LYS n 
1 55  VAL n 
1 56  ILE n 
1 57  GLY n 
1 58  ASN n 
1 59  GLY n 
1 60  SER n 
1 61  PHE n 
1 62  GLY n 
1 63  VAL n 
1 64  VAL n 
1 65  TYR n 
1 66  GLN n 
1 67  ALA n 
1 68  LYS n 
1 69  LEU n 
1 70  CYS n 
1 71  ASP n 
1 72  SER n 
1 73  GLY n 
1 74  GLU n 
1 75  LEU n 
1 76  VAL n 
1 77  ALA n 
1 78  ILE n 
1 79  LYS n 
1 80  LYS n 
1 81  VAL n 
1 82  LEU n 
1 83  GLN n 
1 84  ASP n 
1 85  LYS n 
1 86  ARG n 
1 87  PHE n 
1 88  LYS n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  GLN n 
1 94  ILE n 
1 95  MET n 
1 96  ARG n 
1 97  LYS n 
1 98  LEU n 
1 99  ASP n 
1 100 HIS n 
1 101 CYS n 
1 102 ASN n 
1 103 ILE n 
1 104 VAL n 
1 105 ARG n 
1 106 LEU n 
1 107 ARG n 
1 108 TYR n 
1 109 PHE n 
1 110 PHE n 
1 111 TYR n 
1 112 SER n 
1 113 SER n 
1 114 GLY n 
1 115 GLU n 
1 116 LYS n 
1 117 LYS n 
1 118 ASP n 
1 119 GLU n 
1 120 VAL n 
1 121 TYR n 
1 122 LEU n 
1 123 ASN n 
1 124 LEU n 
1 125 VAL n 
1 126 LEU n 
1 127 ASP n 
1 128 TYR n 
1 129 VAL n 
1 130 PRO n 
1 131 GLU n 
1 132 THR n 
1 133 VAL n 
1 134 TYR n 
1 135 ARG n 
1 136 VAL n 
1 137 ALA n 
1 138 ARG n 
1 139 HIS n 
1 140 TYR n 
1 141 SER n 
1 142 ARG n 
1 143 ALA n 
1 144 LYS n 
1 145 GLN n 
1 146 THR n 
1 147 LEU n 
1 148 PRO n 
1 149 VAL n 
1 150 ILE n 
1 151 TYR n 
1 152 VAL n 
1 153 LYS n 
1 154 LEU n 
1 155 TYR n 
1 156 MET n 
1 157 TYR n 
1 158 GLN n 
1 159 LEU n 
1 160 PHE n 
1 161 ARG n 
1 162 SER n 
1 163 LEU n 
1 164 ALA n 
1 165 TYR n 
1 166 ILE n 
1 167 HIS n 
1 168 SER n 
1 169 PHE n 
1 170 GLY n 
1 171 ILE n 
1 172 CYS n 
1 173 HIS n 
1 174 ARG n 
1 175 ASP n 
1 176 ILE n 
1 177 LYS n 
1 178 PRO n 
1 179 GLN n 
1 180 ASN n 
1 181 LEU n 
1 182 LEU n 
1 183 LEU n 
1 184 ASP n 
1 185 PRO n 
1 186 ASP n 
1 187 THR n 
1 188 ALA n 
1 189 VAL n 
1 190 LEU n 
1 191 LYS n 
1 192 LEU n 
1 193 CYS n 
1 194 ASP n 
1 195 PHE n 
1 196 GLY n 
1 197 SER n 
1 198 ALA n 
1 199 LYS n 
1 200 GLN n 
1 201 LEU n 
1 202 VAL n 
1 203 ARG n 
1 204 GLY n 
1 205 GLU n 
1 206 PRO n 
1 207 ASN n 
1 208 VAL n 
1 209 SER n 
1 210 TYR n 
1 211 ILE n 
1 212 CYS n 
1 213 SER n 
1 214 ARG n 
1 215 TYR n 
1 216 TYR n 
1 217 ARG n 
1 218 ALA n 
1 219 PRO n 
1 220 GLU n 
1 221 LEU n 
1 222 ILE n 
1 223 PHE n 
1 224 GLY n 
1 225 ALA n 
1 226 THR n 
1 227 ASP n 
1 228 TYR n 
1 229 THR n 
1 230 SER n 
1 231 SER n 
1 232 ILE n 
1 233 ASP n 
1 234 VAL n 
1 235 TRP n 
1 236 SER n 
1 237 ALA n 
1 238 GLY n 
1 239 CYS n 
1 240 VAL n 
1 241 LEU n 
1 242 ALA n 
1 243 GLU n 
1 244 LEU n 
1 245 LEU n 
1 246 LEU n 
1 247 GLY n 
1 248 GLN n 
1 249 PRO n 
1 250 ILE n 
1 251 PHE n 
1 252 PRO n 
1 253 GLY n 
1 254 ASP n 
1 255 SER n 
1 256 GLY n 
1 257 VAL n 
1 258 ASP n 
1 259 GLN n 
1 260 LEU n 
1 261 VAL n 
1 262 GLU n 
1 263 ILE n 
1 264 ILE n 
1 265 LYS n 
1 266 VAL n 
1 267 LEU n 
1 268 GLY n 
1 269 THR n 
1 270 PRO n 
1 271 THR n 
1 272 ARG n 
1 273 GLU n 
1 274 GLN n 
1 275 ILE n 
1 276 ARG n 
1 277 GLU n 
1 278 MET n 
1 279 ASN n 
1 280 PRO n 
1 281 ASN n 
1 282 TYR n 
1 283 THR n 
1 284 GLU n 
1 285 PHE n 
1 286 LYS n 
1 287 PHE n 
1 288 PRO n 
1 289 GLN n 
1 290 ILE n 
1 291 LYS n 
1 292 ALA n 
1 293 HIS n 
1 294 PRO n 
1 295 TRP n 
1 296 THR n 
1 297 LYS n 
1 298 VAL n 
1 299 PHE n 
1 300 ARG n 
1 301 PRO n 
1 302 ARG n 
1 303 THR n 
1 304 PRO n 
1 305 PRO n 
1 306 GLU n 
1 307 ALA n 
1 308 ILE n 
1 309 ALA n 
1 310 LEU n 
1 311 CYS n 
1 312 SER n 
1 313 ARG n 
1 314 LEU n 
1 315 LEU n 
1 316 GLU n 
1 317 TYR n 
1 318 THR n 
1 319 PRO n 
1 320 THR n 
1 321 ALA n 
1 322 ARG n 
1 323 LEU n 
1 324 THR n 
1 325 PRO n 
1 326 LEU n 
1 327 GLU n 
1 328 ALA n 
1 329 CYS n 
1 330 ALA n 
1 331 HIS n 
1 332 SER n 
1 333 PHE n 
1 334 PHE n 
1 335 ASP n 
1 336 GLU n 
1 337 LEU n 
1 338 ARG n 
1 339 ASP n 
1 340 PRO n 
1 341 ASN n 
1 342 VAL n 
1 343 LYS n 
1 344 LEU n 
1 345 PRO n 
1 346 ASN n 
1 347 GLY n 
1 348 ARG n 
1 349 ASP n 
1 350 THR n 
1 351 PRO n 
1 352 ALA n 
1 353 LEU n 
1 354 PHE n 
1 355 ASN n 
1 356 PHE n 
1 357 THR n 
1 358 THR n 
1 359 GLN n 
1 360 GLU n 
1 361 LEU n 
1 362 SER n 
1 363 SER n 
1 364 ASN n 
1 365 PRO n 
1 366 PRO n 
1 367 LEU n 
1 368 ALA n 
1 369 THR n 
1 370 ILE n 
1 371 LEU n 
1 372 ILE n 
1 373 PRO n 
1 374 PRO n 
1 375 HIS n 
1 376 ALA n 
1 377 ARG n 
1 378 ILE n 
1 379 GLN n 
1 380 ALA n 
1 381 ALA n 
1 382 ALA n 
1 383 SER n 
1 384 THR n 
1 385 PRO n 
1 386 THR n 
1 387 ASN n 
1 388 ALA n 
1 389 THR n 
1 390 ALA n 
1 391 ALA n 
1 392 SER n 
1 393 ASP n 
1 394 ALA n 
1 395 ASN n 
1 396 THR n 
1 397 GLY n 
1 398 ASP n 
1 399 ARG n 
1 400 GLY n 
1 401 GLN n 
1 402 THR n 
1 403 ASN n 
1 404 ASN n 
1 405 ALA n 
1 406 ALA n 
1 407 SER n 
1 408 ALA n 
1 409 SER n 
1 410 ALA n 
1 411 SER n 
1 412 ASN n 
1 413 SER n 
1 414 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 GSK3B 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'cabbage looper' 
_entity_src_gen.pdbx_host_org_scientific_name      'Trichoplusia ni' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7111 
_entity_src_gen.host_org_genus                     Trichoplusia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 'High five cells' 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GSK3B_HUMAN 
_struct_ref.pdbx_db_accession          P49841 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKK
VLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLF
RSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCV
LAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPT
ARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRG
QTNNAASASASNST
;
_struct_ref.pdbx_align_begin           7 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1Q5K A 1 ? 414 ? P49841 7 ? 420 ? 7 420 
2 1 1Q5K B 1 ? 414 ? P49841 7 ? 420 ? 7 420 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                 ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                              ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                         ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                                ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                               ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                         ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                 ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                               ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                   ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                              ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                 ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                  ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                              ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                           ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                 ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                  ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                               ? 'C4 H9 N O3'      119.119 
TMU non-polymer         . "N-(4-METHOXYBENZYL)-N'-(5-NITRO-1,3-THIAZOL-2-YL)UREA" ? 'C12 H12 N4 O4 S' 308.313 
TRP 'L-peptide linking' y TRYPTOPHAN                                              ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                  ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1Q5K 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.39 
_exptl_crystal.density_percent_sol   63.71 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2001-10-07 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0064 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0064 
# 
_reflns.entry_id                     1Q5K 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             20 
_reflns.d_resolution_high            1.94 
_reflns.number_obs                   78815 
_reflns.number_all                   78815 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        41.3 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.94 
_reflns_shell.d_res_low              2.04 
_reflns_shell.percent_possible_all   58.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1Q5K 
_refine.ls_number_reflns_obs                     78753 
_refine.ls_number_reflns_all                     78815 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               2437760.63 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.99 
_refine.ls_d_res_high                            1.94 
_refine.ls_percent_reflns_obs                    84.2 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.222 
_refine.ls_R_factor_R_free                       0.242 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 3.4 
_refine.ls_number_reflns_R_free                  2670 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               40.4 
_refine.aniso_B[1][1]                            1.75 
_refine.aniso_B[2][2]                            9.97 
_refine.aniso_B[3][3]                            -11.72 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.372922 
_refine.solvent_model_param_bsol                 43.3918 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1Q5K 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.21 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.29 
_refine_analyze.Luzzati_sigma_a_free            0.21 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5515 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         42 
_refine_hist.number_atoms_solvent             373 
_refine_hist.number_atoms_total               5930 
_refine_hist.d_res_high                       1.94 
_refine_hist.d_res_low                        19.99 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.5  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.82  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.23  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.03  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.71  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.61  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.94 
_refine_ls_shell.d_res_low                        2.06 
_refine_ls_shell.number_reflns_R_work             8824 
_refine_ls_shell.R_factor_R_work                  0.274 
_refine_ls_shell.percent_reflns_obs               59.3 
_refine_ls_shell.R_factor_R_free                  0.289 
_refine_ls_shell.R_factor_R_free_error            0.016 
_refine_ls_shell.percent_reflns_R_free            3.4 
_refine_ls_shell.number_reflns_R_free             310 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
3 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
4 INH.PAR           INH.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1Q5K 
_struct.title                     'crystal structure of Glycogen synthase kinase 3 in complexed with inhibitor' 
_struct.pdbx_descriptor           'Glycogen synthase kinase-3 beta (E.C.2.7.1.37)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1Q5K 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'kinase-inhibitor complex, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 89  ? LEU A 98  ? ASN A 95  LEU A 104 1 ? 10 
HELX_P HELX_P2  2  VAL A 133 ? ALA A 143 ? VAL A 139 ALA A 149 1 ? 11 
HELX_P HELX_P3  3  PRO A 148 ? SER A 168 ? PRO A 154 SER A 174 1 ? 21 
HELX_P HELX_P4  4  LYS A 177 ? GLN A 179 ? LYS A 183 GLN A 185 5 ? 3  
HELX_P HELX_P5  5  ALA A 218 ? PHE A 223 ? ALA A 224 PHE A 229 1 ? 6  
HELX_P HELX_P6  6  SER A 230 ? GLY A 247 ? SER A 236 GLY A 253 1 ? 18 
HELX_P HELX_P7  7  SER A 255 ? GLY A 268 ? SER A 261 GLY A 274 1 ? 14 
HELX_P HELX_P8  8  THR A 271 ? ASN A 279 ? THR A 277 ASN A 285 1 ? 9  
HELX_P HELX_P9  9  PRO A 294 ? VAL A 298 ? PRO A 300 VAL A 304 5 ? 5  
HELX_P HELX_P10 10 PRO A 304 ? LEU A 315 ? PRO A 310 LEU A 321 1 ? 12 
HELX_P HELX_P11 11 THR A 318 ? ARG A 322 ? THR A 324 ARG A 328 5 ? 5  
HELX_P HELX_P12 12 THR A 324 ? ALA A 330 ? THR A 330 ALA A 336 1 ? 7  
HELX_P HELX_P13 13 HIS A 331 ? ASP A 339 ? HIS A 337 ASP A 345 5 ? 9  
HELX_P HELX_P14 14 THR A 357 ? SER A 362 ? THR A 363 SER A 368 1 ? 6  
HELX_P HELX_P15 15 ASN A 364 ? PRO A 366 ? ASN A 370 PRO A 372 5 ? 3  
HELX_P HELX_P16 16 LEU A 367 ? ILE A 372 ? LEU A 373 ILE A 378 1 ? 6  
HELX_P HELX_P17 17 ASN B 89  ? ARG B 96  ? ASN B 95  ARG B 102 1 ? 8  
HELX_P HELX_P18 18 VAL B 133 ? ALA B 143 ? VAL B 139 ALA B 149 1 ? 11 
HELX_P HELX_P19 19 PRO B 148 ? PHE B 169 ? PRO B 154 PHE B 175 1 ? 22 
HELX_P HELX_P20 20 LYS B 177 ? GLN B 179 ? LYS B 183 GLN B 185 5 ? 3  
HELX_P HELX_P21 21 ALA B 218 ? PHE B 223 ? ALA B 224 PHE B 229 1 ? 6  
HELX_P HELX_P22 22 SER B 230 ? GLY B 247 ? SER B 236 GLY B 253 1 ? 18 
HELX_P HELX_P23 23 SER B 255 ? GLY B 268 ? SER B 261 GLY B 274 1 ? 14 
HELX_P HELX_P24 24 THR B 271 ? ASN B 279 ? THR B 277 ASN B 285 1 ? 9  
HELX_P HELX_P25 25 PRO B 304 ? LEU B 315 ? PRO B 310 LEU B 321 1 ? 12 
HELX_P HELX_P26 26 THR B 318 ? ARG B 322 ? THR B 324 ARG B 328 5 ? 5  
HELX_P HELX_P27 27 THR B 324 ? ALA B 330 ? THR B 330 ALA B 336 1 ? 7  
HELX_P HELX_P28 28 HIS B 331 ? ASP B 339 ? HIS B 337 ASP B 345 5 ? 9  
HELX_P HELX_P29 29 THR B 357 ? SER B 362 ? THR B 363 SER B 368 1 ? 6  
HELX_P HELX_P30 30 ASN B 364 ? PRO B 366 ? ASN B 370 PRO B 372 5 ? 3  
HELX_P HELX_P31 31 LEU B 367 ? ILE B 372 ? LEU B 373 ILE B 378 1 ? 6  
HELX_P HELX_P32 32 PRO B 373 ? ILE B 378 ? PRO B 379 ILE B 384 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 3 ? 
C ? 2 ? 
D ? 7 ? 
E ? 3 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
D 6 7 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 32  ? PRO A 38  ? THR A 38  PRO A 44  
A 2 GLN A 46  ? GLY A 59  ? GLN A 52  GLY A 65  
A 3 GLY A 62  ? LEU A 69  ? GLY A 68  LEU A 75  
A 4 LEU A 75  ? LEU A 82  ? LEU A 81  LEU A 88  
A 5 TYR A 121 ? ASP A 127 ? TYR A 127 ASP A 133 
A 6 LEU A 106 ? SER A 112 ? LEU A 112 SER A 118 
A 7 THR A 32  ? PRO A 38  ? THR A 38  PRO A 44  
B 1 GLU A 131 ? THR A 132 ? GLU A 137 THR A 138 
B 2 LEU A 181 ? LEU A 183 ? LEU A 187 LEU A 189 
B 3 LEU A 190 ? LEU A 192 ? LEU A 196 LEU A 198 
C 1 ILE A 171 ? CYS A 172 ? ILE A 177 CYS A 178 
C 2 LYS A 199 ? GLN A 200 ? LYS A 205 GLN A 206 
D 1 THR B 32  ? PRO B 38  ? THR B 38  PRO B 44  
D 2 GLN B 46  ? GLY B 57  ? GLN B 52  GLY B 63  
D 3 VAL B 63  ? LEU B 69  ? VAL B 69  LEU B 75  
D 4 LEU B 75  ? LEU B 82  ? LEU B 81  LEU B 88  
D 5 TYR B 121 ? ASP B 127 ? TYR B 127 ASP B 133 
D 6 LEU B 106 ? SER B 112 ? LEU B 112 SER B 118 
D 7 THR B 32  ? PRO B 38  ? THR B 38  PRO B 44  
E 1 GLU B 131 ? THR B 132 ? GLU B 137 THR B 138 
E 2 LEU B 181 ? LEU B 183 ? LEU B 187 LEU B 189 
E 3 LEU B 190 ? LEU B 192 ? LEU B 196 LEU B 198 
F 1 ILE B 171 ? CYS B 172 ? ILE B 177 CYS B 178 
F 2 LYS B 199 ? GLN B 200 ? LYS B 205 GLN B 206 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 34  ? N VAL A 40  O VAL A 48  ? O VAL A 54  
A 2 3 N LYS A 54  ? N LYS A 60  O GLN A 66  ? O GLN A 72  
A 3 4 N VAL A 63  ? N VAL A 69  O LYS A 80  ? O LYS A 86  
A 4 5 N ALA A 77  ? N ALA A 83  O LEU A 126 ? O LEU A 132 
A 5 6 O TYR A 121 ? O TYR A 127 N SER A 112 ? N SER A 118 
A 6 7 O PHE A 109 ? O PHE A 115 N THR A 37  ? N THR A 43  
B 1 2 N GLU A 131 ? N GLU A 137 O LEU A 183 ? O LEU A 189 
B 2 3 N LEU A 182 ? N LEU A 188 O LYS A 191 ? O LYS A 197 
C 1 2 N CYS A 172 ? N CYS A 178 O LYS A 199 ? O LYS A 205 
D 1 2 N VAL B 34  ? N VAL B 40  O VAL B 48  ? O VAL B 54  
D 2 3 N LYS B 54  ? N LYS B 60  O GLN B 66  ? O GLN B 72  
D 3 4 N ALA B 67  ? N ALA B 73  O VAL B 76  ? O VAL B 82  
D 4 5 N VAL B 81  ? N VAL B 87  O LEU B 122 ? O LEU B 128 
D 5 6 O TYR B 121 ? O TYR B 127 N SER B 112 ? N SER B 118 
D 6 7 O PHE B 109 ? O PHE B 115 N THR B 37  ? N THR B 43  
E 1 2 N GLU B 131 ? N GLU B 137 O LEU B 183 ? O LEU B 189 
E 2 3 N LEU B 182 ? N LEU B 188 O LYS B 191 ? O LYS B 197 
F 1 2 N CYS B 172 ? N CYS B 178 O LYS B 199 ? O LYS B 205 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE TMU A 901' 
AC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE TMU B 902' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 ILE A 56  ? ILE A 62  . ? 1_555 ? 
2  AC1 12 VAL A 64  ? VAL A 70  . ? 1_555 ? 
3  AC1 12 ALA A 77  ? ALA A 83  . ? 1_555 ? 
4  AC1 12 LEU A 126 ? LEU A 132 . ? 1_555 ? 
5  AC1 12 ASP A 127 ? ASP A 133 . ? 1_555 ? 
6  AC1 12 TYR A 128 ? TYR A 134 . ? 1_555 ? 
7  AC1 12 VAL A 129 ? VAL A 135 . ? 1_555 ? 
8  AC1 12 PRO A 130 ? PRO A 136 . ? 1_555 ? 
9  AC1 12 ARG A 135 ? ARG A 141 . ? 1_555 ? 
10 AC1 12 LEU A 182 ? LEU A 188 . ? 1_555 ? 
11 AC1 12 HOH E .   ? HOH A 626 . ? 1_555 ? 
12 AC1 12 HOH E .   ? HOH A 817 . ? 1_555 ? 
13 AC2 12 ILE B 56  ? ILE B 62  . ? 1_555 ? 
14 AC2 12 VAL B 64  ? VAL B 70  . ? 1_555 ? 
15 AC2 12 ALA B 77  ? ALA B 83  . ? 1_555 ? 
16 AC2 12 LEU B 126 ? LEU B 132 . ? 1_555 ? 
17 AC2 12 ASP B 127 ? ASP B 133 . ? 1_555 ? 
18 AC2 12 TYR B 128 ? TYR B 134 . ? 1_555 ? 
19 AC2 12 VAL B 129 ? VAL B 135 . ? 1_555 ? 
20 AC2 12 PRO B 130 ? PRO B 136 . ? 1_555 ? 
21 AC2 12 ARG B 135 ? ARG B 141 . ? 1_555 ? 
22 AC2 12 LEU B 182 ? LEU B 188 . ? 1_555 ? 
23 AC2 12 HOH F .   ? HOH B 749 . ? 1_555 ? 
24 AC2 12 HOH F .   ? HOH B 762 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1Q5K 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1Q5K 
_atom_sites.fract_transf_matrix[1][1]   0.012109 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011777 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005605 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 29  ? 20.222 2.981  11.403  1.00 64.42 ? 35  SER A N   1 
ATOM   2    C CA  . SER A 1 29  ? 19.594 3.181  12.742  1.00 64.12 ? 35  SER A CA  1 
ATOM   3    C C   . SER A 1 29  ? 18.083 3.372  12.616  1.00 63.31 ? 35  SER A C   1 
ATOM   4    O O   . SER A 1 29  ? 17.449 2.796  11.728  1.00 63.18 ? 35  SER A O   1 
ATOM   5    C CB  . SER A 1 29  ? 20.218 4.397  13.441  1.00 64.88 ? 35  SER A CB  1 
ATOM   6    O OG  . SER A 1 29  ? 20.052 5.576  12.670  1.00 65.95 ? 35  SER A OG  1 
ATOM   7    N N   . LYS A 1 30  ? 17.510 4.180  13.504  1.00 61.75 ? 36  LYS A N   1 
ATOM   8    C CA  . LYS A 1 30  ? 16.074 4.431  13.489  1.00 61.05 ? 36  LYS A CA  1 
ATOM   9    C C   . LYS A 1 30  ? 15.604 5.011  12.159  1.00 59.55 ? 36  LYS A C   1 
ATOM   10   O O   . LYS A 1 30  ? 16.242 5.901  11.593  1.00 59.64 ? 36  LYS A O   1 
ATOM   11   C CB  . LYS A 1 30  ? 15.686 5.392  14.619  1.00 61.92 ? 36  LYS A CB  1 
ATOM   12   C CG  . LYS A 1 30  ? 14.193 5.713  14.667  1.00 63.18 ? 36  LYS A CG  1 
ATOM   13   C CD  . LYS A 1 30  ? 13.870 6.813  15.674  1.00 64.07 ? 36  LYS A CD  1 
ATOM   14   C CE  . LYS A 1 30  ? 14.235 6.413  17.097  1.00 65.20 ? 36  LYS A CE  1 
ATOM   15   N NZ  . LYS A 1 30  ? 13.894 7.483  18.084  1.00 65.33 ? 36  LYS A NZ  1 
ATOM   16   N N   . VAL A 1 31  ? 14.487 4.492  11.660  1.00 57.29 ? 37  VAL A N   1 
ATOM   17   C CA  . VAL A 1 31  ? 13.916 4.975  10.411  1.00 55.22 ? 37  VAL A CA  1 
ATOM   18   C C   . VAL A 1 31  ? 12.599 5.660  10.740  1.00 53.46 ? 37  VAL A C   1 
ATOM   19   O O   . VAL A 1 31  ? 11.700 5.045  11.314  1.00 53.92 ? 37  VAL A O   1 
ATOM   20   C CB  . VAL A 1 31  ? 13.646 3.826  9.421   1.00 55.31 ? 37  VAL A CB  1 
ATOM   21   C CG1 . VAL A 1 31  ? 13.013 4.375  8.148   1.00 54.98 ? 37  VAL A CG1 1 
ATOM   22   C CG2 . VAL A 1 31  ? 14.945 3.105  9.097   1.00 55.47 ? 37  VAL A CG2 1 
ATOM   23   N N   . THR A 1 32  ? 12.496 6.938  10.394  1.00 51.11 ? 38  THR A N   1 
ATOM   24   C CA  . THR A 1 32  ? 11.282 7.698  10.655  1.00 48.36 ? 38  THR A CA  1 
ATOM   25   C C   . THR A 1 32  ? 10.496 7.879  9.364   1.00 46.58 ? 38  THR A C   1 
ATOM   26   O O   . THR A 1 32  ? 11.038 8.307  8.346   1.00 45.40 ? 38  THR A O   1 
ATOM   27   C CB  . THR A 1 32  ? 11.603 9.092  11.238  1.00 49.19 ? 38  THR A CB  1 
ATOM   28   O OG1 . THR A 1 32  ? 12.339 8.944  12.460  1.00 49.35 ? 38  THR A OG1 1 
ATOM   29   C CG2 . THR A 1 32  ? 10.318 9.866  11.517  1.00 47.87 ? 38  THR A CG2 1 
ATOM   30   N N   . THR A 1 33  ? 9.214  7.539  9.409   1.00 45.36 ? 39  THR A N   1 
ATOM   31   C CA  . THR A 1 33  ? 8.356  7.679  8.243   1.00 43.54 ? 39  THR A CA  1 
ATOM   32   C C   . THR A 1 33  ? 7.215  8.629  8.582   1.00 41.48 ? 39  THR A C   1 
ATOM   33   O O   . THR A 1 33  ? 6.540  8.476  9.602   1.00 41.07 ? 39  THR A O   1 
ATOM   34   C CB  . THR A 1 33  ? 7.795  6.318  7.802   1.00 44.76 ? 39  THR A CB  1 
ATOM   35   O OG1 . THR A 1 33  ? 8.885  5.436  7.498   1.00 45.78 ? 39  THR A OG1 1 
ATOM   36   C CG2 . THR A 1 33  ? 6.918  6.475  6.564   1.00 43.65 ? 39  THR A CG2 1 
ATOM   37   N N   . VAL A 1 34  ? 7.016  9.623  7.725   1.00 38.75 ? 40  VAL A N   1 
ATOM   38   C CA  . VAL A 1 34  ? 5.974  10.615 7.939   1.00 36.54 ? 40  VAL A CA  1 
ATOM   39   C C   . VAL A 1 34  ? 5.244  10.905 6.639   1.00 35.10 ? 40  VAL A C   1 
ATOM   40   O O   . VAL A 1 34  ? 5.701  10.526 5.569   1.00 34.77 ? 40  VAL A O   1 
ATOM   41   C CB  . VAL A 1 34  ? 6.573  11.954 8.448   1.00 37.15 ? 40  VAL A CB  1 
ATOM   42   C CG1 . VAL A 1 34  ? 7.337  11.737 9.754   1.00 36.69 ? 40  VAL A CG1 1 
ATOM   43   C CG2 . VAL A 1 34  ? 7.495  12.542 7.388   1.00 35.26 ? 40  VAL A CG2 1 
ATOM   44   N N   . VAL A 1 35  ? 4.098  11.571 6.745   1.00 34.50 ? 41  VAL A N   1 
ATOM   45   C CA  . VAL A 1 35  ? 3.333  11.959 5.570   1.00 33.84 ? 41  VAL A CA  1 
ATOM   46   C C   . VAL A 1 35  ? 3.575  13.455 5.490   1.00 33.98 ? 41  VAL A C   1 
ATOM   47   O O   . VAL A 1 35  ? 3.008  14.228 6.261   1.00 34.50 ? 41  VAL A O   1 
ATOM   48   C CB  . VAL A 1 35  ? 1.822  11.684 5.733   1.00 33.70 ? 41  VAL A CB  1 
ATOM   49   C CG1 . VAL A 1 35  ? 1.086  12.069 4.456   1.00 32.13 ? 41  VAL A CG1 1 
ATOM   50   C CG2 . VAL A 1 35  ? 1.595  10.217 6.052   1.00 32.12 ? 41  VAL A CG2 1 
ATOM   51   N N   . ALA A 1 36  ? 4.435  13.853 4.560   1.00 33.16 ? 42  ALA A N   1 
ATOM   52   C CA  . ALA A 1 36  ? 4.800  15.250 4.400   1.00 32.72 ? 42  ALA A CA  1 
ATOM   53   C C   . ALA A 1 36  ? 4.231  15.899 3.154   1.00 31.91 ? 42  ALA A C   1 
ATOM   54   O O   . ALA A 1 36  ? 4.010  15.252 2.131   1.00 31.99 ? 42  ALA A O   1 
ATOM   55   C CB  . ALA A 1 36  ? 6.329  15.384 4.404   1.00 31.55 ? 42  ALA A CB  1 
ATOM   56   N N   . THR A 1 37  ? 4.012  17.201 3.251   1.00 32.04 ? 43  THR A N   1 
ATOM   57   C CA  . THR A 1 37  ? 3.473  17.974 2.149   1.00 32.66 ? 43  THR A CA  1 
ATOM   58   C C   . THR A 1 37  ? 4.608  18.669 1.398   1.00 34.31 ? 43  THR A C   1 
ATOM   59   O O   . THR A 1 37  ? 5.427  19.356 2.010   1.00 32.53 ? 43  THR A O   1 
ATOM   60   C CB  . THR A 1 37  ? 2.528  19.041 2.679   1.00 32.99 ? 43  THR A CB  1 
ATOM   61   O OG1 . THR A 1 37  ? 1.601  18.436 3.589   1.00 33.30 ? 43  THR A OG1 1 
ATOM   62   C CG2 . THR A 1 37  ? 1.788  19.701 1.548   1.00 33.19 ? 43  THR A CG2 1 
ATOM   63   N N   . PRO A 1 38  ? 4.675  18.492 0.064   1.00 34.73 ? 44  PRO A N   1 
ATOM   64   C CA  . PRO A 1 38  ? 5.723  19.122 -0.742  1.00 36.23 ? 44  PRO A CA  1 
ATOM   65   C C   . PRO A 1 38  ? 5.720  20.626 -0.511  1.00 38.04 ? 44  PRO A C   1 
ATOM   66   O O   . PRO A 1 38  ? 4.657  21.238 -0.356  1.00 36.01 ? 44  PRO A O   1 
ATOM   67   C CB  . PRO A 1 38  ? 5.325  18.759 -2.175  1.00 36.55 ? 44  PRO A CB  1 
ATOM   68   C CG  . PRO A 1 38  ? 4.671  17.425 -2.007  1.00 37.07 ? 44  PRO A CG  1 
ATOM   69   C CD  . PRO A 1 38  ? 3.806  17.652 -0.780  1.00 35.76 ? 44  PRO A CD  1 
ATOM   70   N N   . GLY A 1 39  ? 6.914  21.214 -0.482  1.00 39.72 ? 45  GLY A N   1 
ATOM   71   C CA  . GLY A 1 39  ? 7.034  22.642 -0.265  1.00 43.56 ? 45  GLY A CA  1 
ATOM   72   C C   . GLY A 1 39  ? 6.329  23.453 -1.329  1.00 46.15 ? 45  GLY A C   1 
ATOM   73   O O   . GLY A 1 39  ? 5.632  24.416 -1.016  1.00 47.53 ? 45  GLY A O   1 
ATOM   74   N N   . GLN A 1 40  ? 6.511  23.066 -2.589  1.00 48.72 ? 46  GLN A N   1 
ATOM   75   C CA  . GLN A 1 40  ? 5.876  23.764 -3.702  1.00 51.96 ? 46  GLN A CA  1 
ATOM   76   C C   . GLN A 1 40  ? 4.803  22.904 -4.364  1.00 52.79 ? 46  GLN A C   1 
ATOM   77   O O   . GLN A 1 40  ? 4.648  21.726 -4.042  1.00 53.86 ? 46  GLN A O   1 
ATOM   78   C CB  . GLN A 1 40  ? 6.919  24.175 -4.748  1.00 54.21 ? 46  GLN A CB  1 
ATOM   79   C CG  . GLN A 1 40  ? 7.967  25.158 -4.239  1.00 57.59 ? 46  GLN A CG  1 
ATOM   80   C CD  . GLN A 1 40  ? 9.304  24.498 -3.960  1.00 59.46 ? 46  GLN A CD  1 
ATOM   81   O OE1 . GLN A 1 40  ? 9.393  23.546 -3.182  1.00 60.32 ? 46  GLN A OE1 1 
ATOM   82   N NE2 . GLN A 1 40  ? 10.355 25.003 -4.597  1.00 60.88 ? 46  GLN A NE2 1 
ATOM   83   N N   . GLY A 1 41  ? 4.062  23.501 -5.292  1.00 53.52 ? 47  GLY A N   1 
ATOM   84   C CA  . GLY A 1 41  ? 3.011  22.773 -5.979  1.00 53.54 ? 47  GLY A CA  1 
ATOM   85   C C   . GLY A 1 41  ? 1.780  22.577 -5.112  1.00 53.51 ? 47  GLY A C   1 
ATOM   86   O O   . GLY A 1 41  ? 1.698  23.131 -4.014  1.00 54.47 ? 47  GLY A O   1 
ATOM   87   N N   . PRO A 1 42  ? 0.799  21.791 -5.582  1.00 53.11 ? 48  PRO A N   1 
ATOM   88   C CA  . PRO A 1 42  ? -0.445 21.516 -4.850  1.00 52.32 ? 48  PRO A CA  1 
ATOM   89   C C   . PRO A 1 42  ? -0.222 20.743 -3.550  1.00 50.29 ? 48  PRO A C   1 
ATOM   90   O O   . PRO A 1 42  ? 0.717  19.958 -3.442  1.00 49.97 ? 48  PRO A O   1 
ATOM   91   C CB  . PRO A 1 42  ? -1.264 20.708 -5.856  1.00 52.60 ? 48  PRO A CB  1 
ATOM   92   C CG  . PRO A 1 42  ? -0.767 21.209 -7.179  1.00 53.45 ? 48  PRO A CG  1 
ATOM   93   C CD  . PRO A 1 42  ? 0.721  21.256 -6.952  1.00 53.42 ? 48  PRO A CD  1 
ATOM   94   N N   . ASP A 1 43  ? -1.095 20.966 -2.573  1.00 49.56 ? 49  ASP A N   1 
ATOM   95   C CA  . ASP A 1 43  ? -0.996 20.281 -1.287  1.00 48.79 ? 49  ASP A CA  1 
ATOM   96   C C   . ASP A 1 43  ? -1.357 18.808 -1.410  1.00 47.38 ? 49  ASP A C   1 
ATOM   97   O O   . ASP A 1 43  ? -2.478 18.406 -1.092  1.00 47.91 ? 49  ASP A O   1 
ATOM   98   C CB  . ASP A 1 43  ? -1.913 20.940 -0.259  1.00 51.09 ? 49  ASP A CB  1 
ATOM   99   C CG  . ASP A 1 43  ? -1.225 22.052 0.505   1.00 53.57 ? 49  ASP A CG  1 
ATOM   100  O OD1 . ASP A 1 43  ? -0.704 22.989 -0.139  1.00 54.52 ? 49  ASP A OD1 1 
ATOM   101  O OD2 . ASP A 1 43  ? -1.206 21.986 1.753   1.00 54.81 ? 49  ASP A OD2 1 
ATOM   102  N N   . ARG A 1 44  ? -0.398 18.008 -1.862  1.00 44.63 ? 50  ARG A N   1 
ATOM   103  C CA  . ARG A 1 44  ? -0.605 16.579 -2.034  1.00 42.76 ? 50  ARG A CA  1 
ATOM   104  C C   . ARG A 1 44  ? 0.451  15.795 -1.264  1.00 40.13 ? 50  ARG A C   1 
ATOM   105  O O   . ARG A 1 44  ? 1.466  15.369 -1.822  1.00 39.05 ? 50  ARG A O   1 
ATOM   106  C CB  . ARG A 1 44  ? -0.561 16.236 -3.522  1.00 43.66 ? 50  ARG A CB  1 
ATOM   107  C CG  . ARG A 1 44  ? -1.714 16.863 -4.309  1.00 47.33 ? 50  ARG A CG  1 
ATOM   108  C CD  . ARG A 1 44  ? -3.046 16.169 -4.006  1.00 50.07 ? 50  ARG A CD  1 
ATOM   109  N NE  . ARG A 1 44  ? -4.181 16.839 -4.639  1.00 52.28 ? 50  ARG A NE  1 
ATOM   110  C CZ  . ARG A 1 44  ? -4.818 17.889 -4.124  1.00 54.19 ? 50  ARG A CZ  1 
ATOM   111  N NH1 . ARG A 1 44  ? -4.443 18.395 -2.957  1.00 54.92 ? 50  ARG A NH1 1 
ATOM   112  N NH2 . ARG A 1 44  ? -5.826 18.445 -4.784  1.00 54.76 ? 50  ARG A NH2 1 
ATOM   113  N N   . PRO A 1 45  ? 0.217  15.593 0.042   1.00 37.47 ? 51  PRO A N   1 
ATOM   114  C CA  . PRO A 1 45  ? 1.131  14.866 0.926   1.00 36.21 ? 51  PRO A CA  1 
ATOM   115  C C   . PRO A 1 45  ? 1.563  13.509 0.386   1.00 35.99 ? 51  PRO A C   1 
ATOM   116  O O   . PRO A 1 45  ? 0.824  12.846 -0.337  1.00 34.52 ? 51  PRO A O   1 
ATOM   117  C CB  . PRO A 1 45  ? 0.330  14.740 2.222   1.00 35.58 ? 51  PRO A CB  1 
ATOM   118  C CG  . PRO A 1 45  ? -0.504 15.988 2.223   1.00 35.06 ? 51  PRO A CG  1 
ATOM   119  C CD  . PRO A 1 45  ? -0.976 16.043 0.783   1.00 36.90 ? 51  PRO A CD  1 
ATOM   120  N N   . GLN A 1 46  ? 2.776  13.104 0.733   1.00 35.30 ? 52  GLN A N   1 
ATOM   121  C CA  . GLN A 1 46  ? 3.282  11.815 0.302   1.00 36.26 ? 52  GLN A CA  1 
ATOM   122  C C   . GLN A 1 46  ? 4.070  11.242 1.462   1.00 36.97 ? 52  GLN A C   1 
ATOM   123  O O   . GLN A 1 46  ? 4.526  11.981 2.335   1.00 36.23 ? 52  GLN A O   1 
ATOM   124  C CB  . GLN A 1 46  ? 4.163  11.964 -0.947  1.00 38.56 ? 52  GLN A CB  1 
ATOM   125  C CG  . GLN A 1 46  ? 5.412  12.811 -0.764  1.00 42.74 ? 52  GLN A CG  1 
ATOM   126  C CD  . GLN A 1 46  ? 6.181  13.006 -2.066  1.00 44.42 ? 52  GLN A CD  1 
ATOM   127  O OE1 . GLN A 1 46  ? 5.708  13.679 -2.985  1.00 45.95 ? 52  GLN A OE1 1 
ATOM   128  N NE2 . GLN A 1 46  ? 7.369  12.411 -2.150  1.00 44.91 ? 52  GLN A NE2 1 
ATOM   129  N N   . GLU A 1 47  ? 4.207  9.925  1.493   1.00 38.41 ? 53  GLU A N   1 
ATOM   130  C CA  . GLU A 1 47  ? 4.943  9.285  2.567   1.00 40.53 ? 53  GLU A CA  1 
ATOM   131  C C   . GLU A 1 47  ? 6.432  9.503  2.326   1.00 39.97 ? 53  GLU A C   1 
ATOM   132  O O   . GLU A 1 47  ? 6.932  9.294  1.222   1.00 38.94 ? 53  GLU A O   1 
ATOM   133  C CB  . GLU A 1 47  ? 4.584  7.797  2.621   1.00 43.87 ? 53  GLU A CB  1 
ATOM   134  C CG  . GLU A 1 47  ? 3.079  7.584  2.848   1.00 50.46 ? 53  GLU A CG  1 
ATOM   135  C CD  . GLU A 1 47  ? 2.618  6.145  2.656   1.00 53.89 ? 53  GLU A CD  1 
ATOM   136  O OE1 . GLU A 1 47  ? 2.910  5.560  1.588   1.00 54.98 ? 53  GLU A OE1 1 
ATOM   137  O OE2 . GLU A 1 47  ? 1.947  5.608  3.569   1.00 55.51 ? 53  GLU A OE2 1 
ATOM   138  N N   . VAL A 1 48  ? 7.126  9.962  3.359   1.00 38.71 ? 54  VAL A N   1 
ATOM   139  C CA  . VAL A 1 48  ? 8.556  10.221 3.260   1.00 38.32 ? 54  VAL A CA  1 
ATOM   140  C C   . VAL A 1 48  ? 9.272  9.585  4.435   1.00 37.78 ? 54  VAL A C   1 
ATOM   141  O O   . VAL A 1 48  ? 8.881  9.777  5.585   1.00 38.16 ? 54  VAL A O   1 
ATOM   142  C CB  . VAL A 1 48  ? 8.853  11.736 3.267   1.00 38.02 ? 54  VAL A CB  1 
ATOM   143  C CG1 . VAL A 1 48  ? 10.359 11.972 3.326   1.00 40.05 ? 54  VAL A CG1 1 
ATOM   144  C CG2 . VAL A 1 48  ? 8.266  12.387 2.027   1.00 36.92 ? 54  VAL A CG2 1 
ATOM   145  N N   . SER A 1 49  ? 10.313 8.817  4.138   1.00 38.49 ? 55  SER A N   1 
ATOM   146  C CA  . SER A 1 49  ? 11.097 8.161  5.174   1.00 39.60 ? 55  SER A CA  1 
ATOM   147  C C   . SER A 1 49  ? 12.521 8.707  5.198   1.00 38.44 ? 55  SER A C   1 
ATOM   148  O O   . SER A 1 49  ? 13.087 9.029  4.157   1.00 37.12 ? 55  SER A O   1 
ATOM   149  C CB  . SER A 1 49  ? 11.139 6.651  4.938   1.00 40.96 ? 55  SER A CB  1 
ATOM   150  O OG  . SER A 1 49  ? 9.873  6.064  5.171   1.00 44.37 ? 55  SER A OG  1 
ATOM   151  N N   . TYR A 1 50  ? 13.085 8.822  6.394   1.00 39.12 ? 56  TYR A N   1 
ATOM   152  C CA  . TYR A 1 50  ? 14.448 9.308  6.541   1.00 40.24 ? 56  TYR A CA  1 
ATOM   153  C C   . TYR A 1 50  ? 15.110 8.679  7.756   1.00 41.88 ? 56  TYR A C   1 
ATOM   154  O O   . TYR A 1 50  ? 14.445 8.070  8.600   1.00 41.50 ? 56  TYR A O   1 
ATOM   155  C CB  . TYR A 1 50  ? 14.482 10.834 6.662   1.00 39.45 ? 56  TYR A CB  1 
ATOM   156  C CG  . TYR A 1 50  ? 13.736 11.395 7.847   1.00 38.85 ? 56  TYR A CG  1 
ATOM   157  C CD1 . TYR A 1 50  ? 12.419 11.839 7.722   1.00 39.03 ? 56  TYR A CD1 1 
ATOM   158  C CD2 . TYR A 1 50  ? 14.348 11.495 9.094   1.00 38.01 ? 56  TYR A CD2 1 
ATOM   159  C CE1 . TYR A 1 50  ? 11.735 12.370 8.807   1.00 38.45 ? 56  TYR A CE1 1 
ATOM   160  C CE2 . TYR A 1 50  ? 13.672 12.022 10.186  1.00 39.33 ? 56  TYR A CE2 1 
ATOM   161  C CZ  . TYR A 1 50  ? 12.366 12.459 10.035  1.00 39.29 ? 56  TYR A CZ  1 
ATOM   162  O OH  . TYR A 1 50  ? 11.693 12.990 11.112  1.00 40.64 ? 56  TYR A OH  1 
ATOM   163  N N   . THR A 1 51  ? 16.424 8.840  7.848   1.00 44.22 ? 57  THR A N   1 
ATOM   164  C CA  . THR A 1 51  ? 17.178 8.264  8.950   1.00 46.07 ? 57  THR A CA  1 
ATOM   165  C C   . THR A 1 51  ? 18.482 9.024  9.204   1.00 47.22 ? 57  THR A C   1 
ATOM   166  O O   . THR A 1 51  ? 18.684 10.122 8.682   1.00 45.95 ? 57  THR A O   1 
ATOM   167  C CB  . THR A 1 51  ? 17.497 6.786  8.652   1.00 46.56 ? 57  THR A CB  1 
ATOM   168  O OG1 . THR A 1 51  ? 18.222 6.219  9.748   1.00 48.07 ? 57  THR A OG1 1 
ATOM   169  C CG2 . THR A 1 51  ? 18.318 6.666  7.372   1.00 45.50 ? 57  THR A CG2 1 
ATOM   170  N N   . ASP A 1 52  ? 19.362 8.424  10.004  1.00 48.90 ? 58  ASP A N   1 
ATOM   171  C CA  . ASP A 1 52  ? 20.654 9.017  10.352  1.00 50.14 ? 58  ASP A CA  1 
ATOM   172  C C   . ASP A 1 52  ? 20.505 10.450 10.845  1.00 50.02 ? 58  ASP A C   1 
ATOM   173  O O   . ASP A 1 52  ? 21.231 11.345 10.415  1.00 50.66 ? 58  ASP A O   1 
ATOM   174  C CB  . ASP A 1 52  ? 21.605 8.988  9.152   1.00 51.24 ? 58  ASP A CB  1 
ATOM   175  C CG  . ASP A 1 52  ? 21.896 7.578  8.671   1.00 53.82 ? 58  ASP A CG  1 
ATOM   176  O OD1 . ASP A 1 52  ? 21.989 6.662  9.519   1.00 55.10 ? 58  ASP A OD1 1 
ATOM   177  O OD2 . ASP A 1 52  ? 22.046 7.387  7.445   1.00 54.77 ? 58  ASP A OD2 1 
ATOM   178  N N   . THR A 1 53  ? 19.569 10.656 11.761  1.00 50.49 ? 59  THR A N   1 
ATOM   179  C CA  . THR A 1 53  ? 19.310 11.980 12.306  1.00 51.33 ? 59  THR A CA  1 
ATOM   180  C C   . THR A 1 53  ? 20.397 12.447 13.263  1.00 51.29 ? 59  THR A C   1 
ATOM   181  O O   . THR A 1 53  ? 20.824 11.704 14.142  1.00 52.07 ? 59  THR A O   1 
ATOM   182  C CB  . THR A 1 53  ? 17.951 12.013 13.030  1.00 51.48 ? 59  THR A CB  1 
ATOM   183  O OG1 . THR A 1 53  ? 16.903 11.828 12.073  1.00 51.58 ? 59  THR A OG1 1 
ATOM   184  C CG2 . THR A 1 53  ? 17.749 13.340 13.739  1.00 52.38 ? 59  THR A CG2 1 
ATOM   185  N N   . LYS A 1 54  ? 20.834 13.690 13.079  1.00 51.32 ? 60  LYS A N   1 
ATOM   186  C CA  . LYS A 1 54  ? 21.872 14.293 13.912  1.00 51.14 ? 60  LYS A CA  1 
ATOM   187  C C   . LYS A 1 54  ? 21.523 15.762 14.096  1.00 50.10 ? 60  LYS A C   1 
ATOM   188  O O   . LYS A 1 54  ? 20.896 16.366 13.229  1.00 49.83 ? 60  LYS A O   1 
ATOM   189  C CB  . LYS A 1 54  ? 23.236 14.202 13.222  1.00 51.74 ? 60  LYS A CB  1 
ATOM   190  C CG  . LYS A 1 54  ? 23.552 12.847 12.614  1.00 53.83 ? 60  LYS A CG  1 
ATOM   191  C CD  . LYS A 1 54  ? 24.810 12.914 11.759  1.00 54.81 ? 60  LYS A CD  1 
ATOM   192  C CE  . LYS A 1 54  ? 25.103 11.567 11.111  1.00 55.91 ? 60  LYS A CE  1 
ATOM   193  N NZ  . LYS A 1 54  ? 26.302 11.616 10.227  1.00 57.73 ? 60  LYS A NZ  1 
ATOM   194  N N   . VAL A 1 55  ? 21.936 16.339 15.217  1.00 48.60 ? 61  VAL A N   1 
ATOM   195  C CA  . VAL A 1 55  ? 21.674 17.746 15.476  1.00 48.03 ? 61  VAL A CA  1 
ATOM   196  C C   . VAL A 1 55  ? 22.699 18.596 14.727  1.00 47.85 ? 61  VAL A C   1 
ATOM   197  O O   . VAL A 1 55  ? 23.895 18.312 14.773  1.00 47.33 ? 61  VAL A O   1 
ATOM   198  C CB  . VAL A 1 55  ? 21.763 18.058 16.982  1.00 48.06 ? 61  VAL A CB  1 
ATOM   199  C CG1 . VAL A 1 55  ? 21.609 19.553 17.216  1.00 48.00 ? 61  VAL A CG1 1 
ATOM   200  C CG2 . VAL A 1 55  ? 20.679 17.294 17.729  1.00 47.71 ? 61  VAL A CG2 1 
ATOM   201  N N   . ILE A 1 56  ? 22.224 19.625 14.028  1.00 47.22 ? 62  ILE A N   1 
ATOM   202  C CA  . ILE A 1 56  ? 23.097 20.523 13.271  1.00 47.88 ? 62  ILE A CA  1 
ATOM   203  C C   . ILE A 1 56  ? 23.320 21.804 14.055  1.00 48.64 ? 62  ILE A C   1 
ATOM   204  O O   . ILE A 1 56  ? 24.404 22.380 14.029  1.00 49.25 ? 62  ILE A O   1 
ATOM   205  C CB  . ILE A 1 56  ? 22.482 20.914 11.897  1.00 47.77 ? 62  ILE A CB  1 
ATOM   206  C CG1 . ILE A 1 56  ? 22.604 19.756 10.913  1.00 47.31 ? 62  ILE A CG1 1 
ATOM   207  C CG2 . ILE A 1 56  ? 23.179 22.154 11.338  1.00 47.73 ? 62  ILE A CG2 1 
ATOM   208  C CD1 . ILE A 1 56  ? 22.011 20.060 9.548   1.00 45.81 ? 62  ILE A CD1 1 
ATOM   209  N N   . GLY A 1 57  ? 22.280 22.256 14.741  1.00 49.67 ? 63  GLY A N   1 
ATOM   210  C CA  . GLY A 1 57  ? 22.395 23.473 15.515  1.00 51.68 ? 63  GLY A CA  1 
ATOM   211  C C   . GLY A 1 57  ? 21.136 23.760 16.300  1.00 53.91 ? 63  GLY A C   1 
ATOM   212  O O   . GLY A 1 57  ? 20.029 23.512 15.825  1.00 52.98 ? 63  GLY A O   1 
ATOM   213  N N   . ASN A 1 58  ? 21.309 24.269 17.515  1.00 56.14 ? 64  ASN A N   1 
ATOM   214  C CA  . ASN A 1 58  ? 20.179 24.600 18.367  1.00 58.18 ? 64  ASN A CA  1 
ATOM   215  C C   . ASN A 1 58  ? 19.960 26.101 18.329  1.00 58.81 ? 64  ASN A C   1 
ATOM   216  O O   . ASN A 1 58  ? 20.814 26.872 18.765  1.00 59.20 ? 64  ASN A O   1 
ATOM   217  C CB  . ASN A 1 58  ? 20.439 24.153 19.808  1.00 59.60 ? 64  ASN A CB  1 
ATOM   218  C CG  . ASN A 1 58  ? 20.702 22.666 19.917  1.00 60.75 ? 64  ASN A CG  1 
ATOM   219  O OD1 . ASN A 1 58  ? 21.751 22.177 19.496  1.00 61.97 ? 64  ASN A OD1 1 
ATOM   220  N ND2 . ASN A 1 58  ? 19.745 21.936 20.476  1.00 61.13 ? 64  ASN A ND2 1 
ATOM   221  N N   . GLY A 1 59  ? 18.818 26.508 17.789  1.00 59.35 ? 65  GLY A N   1 
ATOM   222  C CA  . GLY A 1 59  ? 18.499 27.919 17.710  1.00 60.01 ? 65  GLY A CA  1 
ATOM   223  C C   . GLY A 1 59  ? 17.433 28.284 18.722  1.00 60.35 ? 65  GLY A C   1 
ATOM   224  O O   . GLY A 1 59  ? 16.794 27.403 19.303  1.00 60.40 ? 65  GLY A O   1 
ATOM   225  N N   . SER A 1 60  ? 17.238 29.580 18.938  1.00 60.38 ? 66  SER A N   1 
ATOM   226  C CA  . SER A 1 60  ? 16.238 30.041 19.889  1.00 61.06 ? 66  SER A CA  1 
ATOM   227  C C   . SER A 1 60  ? 14.846 29.537 19.511  1.00 60.99 ? 66  SER A C   1 
ATOM   228  O O   . SER A 1 60  ? 14.113 29.036 20.363  1.00 61.59 ? 66  SER A O   1 
ATOM   229  C CB  . SER A 1 60  ? 16.234 31.571 19.957  1.00 60.78 ? 66  SER A CB  1 
ATOM   230  O OG  . SER A 1 60  ? 15.897 32.138 18.703  1.00 62.04 ? 66  SER A OG  1 
ATOM   231  N N   . PHE A 1 61  ? 14.488 29.655 18.234  1.00 60.71 ? 67  PHE A N   1 
ATOM   232  C CA  . PHE A 1 61  ? 13.170 29.215 17.785  1.00 59.98 ? 67  PHE A CA  1 
ATOM   233  C C   . PHE A 1 61  ? 13.047 27.741 17.428  1.00 58.52 ? 67  PHE A C   1 
ATOM   234  O O   . PHE A 1 61  ? 12.045 27.327 16.850  1.00 59.06 ? 67  PHE A O   1 
ATOM   235  C CB  . PHE A 1 61  ? 12.695 30.059 16.602  1.00 61.39 ? 67  PHE A CB  1 
ATOM   236  C CG  . PHE A 1 61  ? 12.186 31.414 16.997  1.00 63.13 ? 67  PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 61  ? 12.992 32.540 16.877  1.00 63.95 ? 67  PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 61  ? 10.903 31.559 17.520  1.00 63.24 ? 67  PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 61  ? 12.527 33.795 17.274  1.00 64.92 ? 67  PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 61  ? 10.429 32.805 17.919  1.00 63.71 ? 67  PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 61  ? 11.241 33.926 17.796  1.00 64.08 ? 67  PHE A CZ  1 
ATOM   242  N N   . GLY A 1 62  ? 14.052 26.946 17.777  1.00 56.46 ? 68  GLY A N   1 
ATOM   243  C CA  . GLY A 1 62  ? 13.983 25.530 17.473  1.00 53.21 ? 68  GLY A CA  1 
ATOM   244  C C   . GLY A 1 62  ? 15.318 24.894 17.153  1.00 50.52 ? 68  GLY A C   1 
ATOM   245  O O   . GLY A 1 62  ? 16.359 25.549 17.180  1.00 51.86 ? 68  GLY A O   1 
ATOM   246  N N   . VAL A 1 63  ? 15.283 23.604 16.847  1.00 46.72 ? 69  VAL A N   1 
ATOM   247  C CA  . VAL A 1 63  ? 16.488 22.863 16.523  1.00 42.62 ? 69  VAL A CA  1 
ATOM   248  C C   . VAL A 1 63  ? 16.507 22.481 15.045  1.00 40.69 ? 69  VAL A C   1 
ATOM   249  O O   . VAL A 1 63  ? 15.461 22.265 14.432  1.00 37.34 ? 69  VAL A O   1 
ATOM   250  C CB  . VAL A 1 63  ? 16.583 21.571 17.370  1.00 43.60 ? 69  VAL A CB  1 
ATOM   251  C CG1 . VAL A 1 63  ? 17.869 20.817 17.045  1.00 42.69 ? 69  VAL A CG1 1 
ATOM   252  C CG2 . VAL A 1 63  ? 16.524 21.919 18.857  1.00 44.21 ? 69  VAL A CG2 1 
ATOM   253  N N   . VAL A 1 64  ? 17.705 22.414 14.478  1.00 37.28 ? 70  VAL A N   1 
ATOM   254  C CA  . VAL A 1 64  ? 17.869 22.025 13.089  1.00 36.57 ? 70  VAL A CA  1 
ATOM   255  C C   . VAL A 1 64  ? 18.623 20.701 13.093  1.00 37.00 ? 70  VAL A C   1 
ATOM   256  O O   . VAL A 1 64  ? 19.668 20.565 13.736  1.00 36.22 ? 70  VAL A O   1 
ATOM   257  C CB  . VAL A 1 64  ? 18.670 23.078 12.289  1.00 35.39 ? 70  VAL A CB  1 
ATOM   258  C CG1 . VAL A 1 64  ? 18.782 22.653 10.836  1.00 36.24 ? 70  VAL A CG1 1 
ATOM   259  C CG2 . VAL A 1 64  ? 17.987 24.428 12.385  1.00 35.13 ? 70  VAL A CG2 1 
ATOM   260  N N   . TYR A 1 65  ? 18.083 19.724 12.379  1.00 36.70 ? 71  TYR A N   1 
ATOM   261  C CA  . TYR A 1 65  ? 18.684 18.403 12.309  1.00 36.38 ? 71  TYR A CA  1 
ATOM   262  C C   . TYR A 1 65  ? 19.141 18.093 10.903  1.00 36.87 ? 71  TYR A C   1 
ATOM   263  O O   . TYR A 1 65  ? 18.707 18.724 9.938   1.00 36.41 ? 71  TYR A O   1 
ATOM   264  C CB  . TYR A 1 65  ? 17.665 17.334 12.711  1.00 38.44 ? 71  TYR A CB  1 
ATOM   265  C CG  . TYR A 1 65  ? 17.072 17.504 14.089  1.00 40.71 ? 71  TYR A CG  1 
ATOM   266  C CD1 . TYR A 1 65  ? 17.667 16.914 15.204  1.00 42.62 ? 71  TYR A CD1 1 
ATOM   267  C CD2 . TYR A 1 65  ? 15.916 18.260 14.281  1.00 41.90 ? 71  TYR A CD2 1 
ATOM   268  C CE1 . TYR A 1 65  ? 17.125 17.070 16.475  1.00 43.20 ? 71  TYR A CE1 1 
ATOM   269  C CE2 . TYR A 1 65  ? 15.366 18.425 15.549  1.00 43.03 ? 71  TYR A CE2 1 
ATOM   270  C CZ  . TYR A 1 65  ? 15.975 17.826 16.640  1.00 43.66 ? 71  TYR A CZ  1 
ATOM   271  O OH  . TYR A 1 65  ? 15.431 17.981 17.893  1.00 43.46 ? 71  TYR A OH  1 
ATOM   272  N N   . GLN A 1 66  ? 20.035 17.122 10.795  1.00 36.02 ? 72  GLN A N   1 
ATOM   273  C CA  . GLN A 1 66  ? 20.490 16.669 9.499   1.00 36.70 ? 72  GLN A CA  1 
ATOM   274  C C   . GLN A 1 66  ? 19.903 15.272 9.422   1.00 36.75 ? 72  GLN A C   1 
ATOM   275  O O   . GLN A 1 66  ? 19.843 14.570 10.434  1.00 37.04 ? 72  GLN A O   1 
ATOM   276  C CB  . GLN A 1 66  ? 22.012 16.570 9.423   1.00 36.80 ? 72  GLN A CB  1 
ATOM   277  C CG  . GLN A 1 66  ? 22.488 16.113 8.052   1.00 38.43 ? 72  GLN A CG  1 
ATOM   278  C CD  . GLN A 1 66  ? 23.875 15.504 8.080   1.00 40.86 ? 72  GLN A CD  1 
ATOM   279  O OE1 . GLN A 1 66  ? 24.069 14.403 8.584   1.00 41.25 ? 72  GLN A OE1 1 
ATOM   280  N NE2 . GLN A 1 66  ? 24.847 16.224 7.542   1.00 42.10 ? 72  GLN A NE2 1 
ATOM   281  N N   . ALA A 1 67  ? 19.448 14.875 8.242   1.00 36.43 ? 73  ALA A N   1 
ATOM   282  C CA  . ALA A 1 67  ? 18.879 13.547 8.073   1.00 37.41 ? 73  ALA A CA  1 
ATOM   283  C C   . ALA A 1 67  ? 19.147 13.070 6.662   1.00 37.23 ? 73  ALA A C   1 
ATOM   284  O O   . ALA A 1 67  ? 19.530 13.852 5.796   1.00 38.19 ? 73  ALA A O   1 
ATOM   285  C CB  . ALA A 1 67  ? 17.373 13.572 8.350   1.00 37.22 ? 73  ALA A CB  1 
ATOM   286  N N   . LYS A 1 68  ? 18.951 11.779 6.435   1.00 38.94 ? 74  LYS A N   1 
ATOM   287  C CA  . LYS A 1 68  ? 19.175 11.199 5.121   1.00 40.98 ? 74  LYS A CA  1 
ATOM   288  C C   . LYS A 1 68  ? 17.888 10.563 4.615   1.00 41.07 ? 74  LYS A C   1 
ATOM   289  O O   . LYS A 1 68  ? 17.303 9.710  5.284   1.00 39.97 ? 74  LYS A O   1 
ATOM   290  C CB  . LYS A 1 68  ? 20.286 10.148 5.195   1.00 42.86 ? 74  LYS A CB  1 
ATOM   291  C CG  . LYS A 1 68  ? 20.652 9.531  3.858   1.00 46.26 ? 74  LYS A CG  1 
ATOM   292  C CD  . LYS A 1 68  ? 21.825 8.567  3.999   1.00 48.81 ? 74  LYS A CD  1 
ATOM   293  C CE  . LYS A 1 68  ? 22.196 7.967  2.654   1.00 52.11 ? 74  LYS A CE  1 
ATOM   294  N NZ  . LYS A 1 68  ? 23.423 7.118  2.726   1.00 54.69 ? 74  LYS A NZ  1 
ATOM   295  N N   . LEU A 1 69  ? 17.448 10.992 3.438   1.00 42.17 ? 75  LEU A N   1 
ATOM   296  C CA  . LEU A 1 69  ? 16.228 10.466 2.839   1.00 44.91 ? 75  LEU A CA  1 
ATOM   297  C C   . LEU A 1 69  ? 16.458 9.034  2.370   1.00 47.47 ? 75  LEU A C   1 
ATOM   298  O O   . LEU A 1 69  ? 17.315 8.784  1.522   1.00 48.09 ? 75  LEU A O   1 
ATOM   299  C CB  . LEU A 1 69  ? 15.805 11.344 1.662   1.00 42.52 ? 75  LEU A CB  1 
ATOM   300  C CG  . LEU A 1 69  ? 15.420 12.781 2.020   1.00 41.48 ? 75  LEU A CG  1 
ATOM   301  C CD1 . LEU A 1 69  ? 15.124 13.559 0.752   1.00 39.96 ? 75  LEU A CD1 1 
ATOM   302  C CD2 . LEU A 1 69  ? 14.205 12.776 2.945   1.00 41.37 ? 75  LEU A CD2 1 
ATOM   303  N N   . CYS A 1 70  ? 15.694 8.101  2.932   1.00 49.91 ? 76  CYS A N   1 
ATOM   304  C CA  . CYS A 1 70  ? 15.816 6.687  2.586   1.00 52.58 ? 76  CYS A CA  1 
ATOM   305  C C   . CYS A 1 70  ? 15.647 6.462  1.094   1.00 54.28 ? 76  CYS A C   1 
ATOM   306  O O   . CYS A 1 70  ? 16.289 5.593  0.506   1.00 55.52 ? 76  CYS A O   1 
ATOM   307  C CB  . CYS A 1 70  ? 14.761 5.862  3.326   1.00 51.24 ? 76  CYS A CB  1 
ATOM   308  S SG  . CYS A 1 70  ? 14.861 5.929  5.112   1.00 54.24 ? 76  CYS A SG  1 
ATOM   309  N N   . ASP A 1 71  ? 14.774 7.257  0.491   1.00 56.41 ? 77  ASP A N   1 
ATOM   310  C CA  . ASP A 1 71  ? 14.476 7.153  -0.928  1.00 58.77 ? 77  ASP A CA  1 
ATOM   311  C C   . ASP A 1 71  ? 15.670 7.407  -1.848  1.00 59.07 ? 77  ASP A C   1 
ATOM   312  O O   . ASP A 1 71  ? 16.063 6.535  -2.623  1.00 59.62 ? 77  ASP A O   1 
ATOM   313  C CB  . ASP A 1 71  ? 13.342 8.124  -1.276  1.00 61.14 ? 77  ASP A CB  1 
ATOM   314  C CG  . ASP A 1 71  ? 12.873 7.991  -2.715  1.00 63.76 ? 77  ASP A CG  1 
ATOM   315  O OD1 . ASP A 1 71  ? 13.675 8.256  -3.637  1.00 65.49 ? 77  ASP A OD1 1 
ATOM   316  O OD2 . ASP A 1 71  ? 11.695 7.623  -2.924  1.00 65.20 ? 77  ASP A OD2 1 
ATOM   317  N N   . SER A 1 72  ? 16.245 8.602  -1.754  1.00 58.74 ? 78  SER A N   1 
ATOM   318  C CA  . SER A 1 72  ? 17.361 8.995  -2.611  1.00 57.01 ? 78  SER A CA  1 
ATOM   319  C C   . SER A 1 72  ? 18.741 8.987  -1.967  1.00 56.14 ? 78  SER A C   1 
ATOM   320  O O   . SER A 1 72  ? 19.753 8.946  -2.666  1.00 56.43 ? 78  SER A O   1 
ATOM   321  C CB  . SER A 1 72  ? 17.092 10.390 -3.171  1.00 57.51 ? 78  SER A CB  1 
ATOM   322  O OG  . SER A 1 72  ? 16.850 11.308 -2.116  1.00 57.53 ? 78  SER A OG  1 
ATOM   323  N N   . GLY A 1 73  ? 18.791 9.039  -0.643  1.00 54.56 ? 79  GLY A N   1 
ATOM   324  C CA  . GLY A 1 73  ? 20.078 9.059  0.026   1.00 52.13 ? 79  GLY A CA  1 
ATOM   325  C C   . GLY A 1 73  ? 20.555 10.489 0.203   1.00 50.57 ? 79  GLY A C   1 
ATOM   326  O O   . GLY A 1 73  ? 21.578 10.737 0.838   1.00 50.67 ? 79  GLY A O   1 
ATOM   327  N N   . GLU A 1 74  ? 19.808 11.434 -0.364  1.00 49.08 ? 80  GLU A N   1 
ATOM   328  C CA  . GLU A 1 74  ? 20.145 12.848 -0.255  1.00 47.56 ? 80  GLU A CA  1 
ATOM   329  C C   . GLU A 1 74  ? 20.052 13.281 1.201   1.00 45.07 ? 80  GLU A C   1 
ATOM   330  O O   . GLU A 1 74  ? 19.194 12.806 1.949   1.00 44.37 ? 80  GLU A O   1 
ATOM   331  C CB  . GLU A 1 74  ? 19.171 13.715 -1.054  1.00 49.50 ? 80  GLU A CB  1 
ATOM   332  C CG  . GLU A 1 74  ? 18.962 13.324 -2.496  1.00 53.87 ? 80  GLU A CG  1 
ATOM   333  C CD  . GLU A 1 74  ? 17.850 14.137 -3.138  1.00 56.54 ? 80  GLU A CD  1 
ATOM   334  O OE1 . GLU A 1 74  ? 18.026 15.364 -3.305  1.00 57.94 ? 80  GLU A OE1 1 
ATOM   335  O OE2 . GLU A 1 74  ? 16.792 13.553 -3.462  1.00 58.39 ? 80  GLU A OE2 1 
ATOM   336  N N   . LEU A 1 75  ? 20.937 14.187 1.600   1.00 41.99 ? 81  LEU A N   1 
ATOM   337  C CA  . LEU A 1 75  ? 20.915 14.695 2.957   1.00 39.43 ? 81  LEU A CA  1 
ATOM   338  C C   . LEU A 1 75  ? 19.990 15.905 2.967   1.00 35.98 ? 81  LEU A C   1 
ATOM   339  O O   . LEU A 1 75  ? 19.916 16.652 1.994   1.00 36.41 ? 81  LEU A O   1 
ATOM   340  C CB  . LEU A 1 75  ? 22.321 15.110 3.412   1.00 39.96 ? 81  LEU A CB  1 
ATOM   341  C CG  . LEU A 1 75  ? 23.382 14.008 3.532   1.00 42.12 ? 81  LEU A CG  1 
ATOM   342  C CD1 . LEU A 1 75  ? 24.684 14.607 4.057   1.00 41.58 ? 81  LEU A CD1 1 
ATOM   343  C CD2 . LEU A 1 75  ? 22.894 12.913 4.473   1.00 41.79 ? 81  LEU A CD2 1 
ATOM   344  N N   . VAL A 1 76  ? 19.275 16.085 4.067   1.00 34.23 ? 82  VAL A N   1 
ATOM   345  C CA  . VAL A 1 76  ? 18.376 17.216 4.192   1.00 32.08 ? 82  VAL A CA  1 
ATOM   346  C C   . VAL A 1 76  ? 18.482 17.769 5.597   1.00 30.75 ? 82  VAL A C   1 
ATOM   347  O O   . VAL A 1 76  ? 18.999 17.118 6.502   1.00 32.56 ? 82  VAL A O   1 
ATOM   348  C CB  . VAL A 1 76  ? 16.896 16.810 3.940   1.00 31.44 ? 82  VAL A CB  1 
ATOM   349  C CG1 . VAL A 1 76  ? 16.714 16.334 2.505   1.00 30.19 ? 82  VAL A CG1 1 
ATOM   350  C CG2 . VAL A 1 76  ? 16.482 15.728 4.923   1.00 30.05 ? 82  VAL A CG2 1 
ATOM   351  N N   . ALA A 1 77  ? 18.000 18.988 5.770   1.00 29.43 ? 83  ALA A N   1 
ATOM   352  C CA  . ALA A 1 77  ? 17.998 19.616 7.069   1.00 28.80 ? 83  ALA A CA  1 
ATOM   353  C C   . ALA A 1 77  ? 16.535 19.667 7.494   1.00 28.59 ? 83  ALA A C   1 
ATOM   354  O O   . ALA A 1 77  ? 15.652 19.916 6.675   1.00 28.47 ? 83  ALA A O   1 
ATOM   355  C CB  . ALA A 1 77  ? 18.574 21.019 6.976   1.00 29.42 ? 83  ALA A CB  1 
ATOM   356  N N   . ILE A 1 78  ? 16.276 19.397 8.763   1.00 28.14 ? 84  ILE A N   1 
ATOM   357  C CA  . ILE A 1 78  ? 14.914 19.443 9.263   1.00 28.47 ? 84  ILE A CA  1 
ATOM   358  C C   . ILE A 1 78  ? 14.869 20.437 10.404  1.00 27.88 ? 84  ILE A C   1 
ATOM   359  O O   . ILE A 1 78  ? 15.425 20.188 11.475  1.00 29.52 ? 84  ILE A O   1 
ATOM   360  C CB  . ILE A 1 78  ? 14.442 18.073 9.793   1.00 28.61 ? 84  ILE A CB  1 
ATOM   361  C CG1 . ILE A 1 78  ? 14.515 17.019 8.688   1.00 29.30 ? 84  ILE A CG1 1 
ATOM   362  C CG2 . ILE A 1 78  ? 13.011 18.191 10.318  1.00 30.43 ? 84  ILE A CG2 1 
ATOM   363  C CD1 . ILE A 1 78  ? 14.078 15.627 9.150   1.00 32.10 ? 84  ILE A CD1 1 
ATOM   364  N N   . LYS A 1 79  ? 14.224 21.571 10.160  1.00 28.52 ? 85  LYS A N   1 
ATOM   365  C CA  . LYS A 1 79  ? 14.080 22.618 11.163  1.00 28.95 ? 85  LYS A CA  1 
ATOM   366  C C   . LYS A 1 79  ? 12.783 22.334 11.909  1.00 31.57 ? 85  LYS A C   1 
ATOM   367  O O   . LYS A 1 79  ? 11.702 22.317 11.316  1.00 28.77 ? 85  LYS A O   1 
ATOM   368  C CB  . LYS A 1 79  ? 14.023 23.987 10.482  1.00 28.88 ? 85  LYS A CB  1 
ATOM   369  C CG  . LYS A 1 79  ? 13.946 25.166 11.436  1.00 29.43 ? 85  LYS A CG  1 
ATOM   370  C CD  . LYS A 1 79  ? 14.153 26.481 10.686  1.00 30.61 ? 85  LYS A CD  1 
ATOM   371  C CE  . LYS A 1 79  ? 14.132 27.668 11.639  1.00 32.24 ? 85  LYS A CE  1 
ATOM   372  N NZ  . LYS A 1 79  ? 14.297 28.966 10.920  1.00 33.06 ? 85  LYS A NZ  1 
ATOM   373  N N   . LYS A 1 80  ? 12.895 22.118 13.215  1.00 32.58 ? 86  LYS A N   1 
ATOM   374  C CA  . LYS A 1 80  ? 11.739 21.790 14.040  1.00 34.98 ? 86  LYS A CA  1 
ATOM   375  C C   . LYS A 1 80  ? 11.386 22.911 15.011  1.00 35.91 ? 86  LYS A C   1 
ATOM   376  O O   . LYS A 1 80  ? 12.177 23.248 15.895  1.00 35.83 ? 86  LYS A O   1 
ATOM   377  C CB  . LYS A 1 80  ? 12.041 20.499 14.800  1.00 35.94 ? 86  LYS A CB  1 
ATOM   378  C CG  . LYS A 1 80  ? 10.872 19.864 15.514  1.00 39.47 ? 86  LYS A CG  1 
ATOM   379  C CD  . LYS A 1 80  ? 11.308 18.537 16.108  1.00 40.30 ? 86  LYS A CD  1 
ATOM   380  C CE  . LYS A 1 80  ? 10.169 17.820 16.794  1.00 41.74 ? 86  LYS A CE  1 
ATOM   381  N NZ  . LYS A 1 80  ? 10.625 16.520 17.355  1.00 43.44 ? 86  LYS A NZ  1 
ATOM   382  N N   . VAL A 1 81  ? 10.201 23.491 14.840  1.00 35.61 ? 87  VAL A N   1 
ATOM   383  C CA  . VAL A 1 81  ? 9.755  24.567 15.717  1.00 37.18 ? 87  VAL A CA  1 
ATOM   384  C C   . VAL A 1 81  ? 8.383  24.275 16.329  1.00 38.92 ? 87  VAL A C   1 
ATOM   385  O O   . VAL A 1 81  ? 7.518  23.660 15.697  1.00 36.47 ? 87  VAL A O   1 
ATOM   386  C CB  . VAL A 1 81  ? 9.668  25.919 14.965  1.00 38.16 ? 87  VAL A CB  1 
ATOM   387  C CG1 . VAL A 1 81  ? 10.989 26.216 14.261  1.00 38.51 ? 87  VAL A CG1 1 
ATOM   388  C CG2 . VAL A 1 81  ? 8.522  25.893 13.974  1.00 37.81 ? 87  VAL A CG2 1 
ATOM   389  N N   . LEU A 1 82  ? 8.197  24.719 17.567  1.00 41.15 ? 88  LEU A N   1 
ATOM   390  C CA  . LEU A 1 82  ? 6.937  24.532 18.270  1.00 45.11 ? 88  LEU A CA  1 
ATOM   391  C C   . LEU A 1 82  ? 5.895  25.371 17.535  1.00 47.34 ? 88  LEU A C   1 
ATOM   392  O O   . LEU A 1 82  ? 6.108  26.560 17.288  1.00 47.96 ? 88  LEU A O   1 
ATOM   393  C CB  . LEU A 1 82  ? 7.076  25.007 19.718  1.00 45.97 ? 88  LEU A CB  1 
ATOM   394  C CG  . LEU A 1 82  ? 5.951  24.647 20.684  1.00 47.37 ? 88  LEU A CG  1 
ATOM   395  C CD1 . LEU A 1 82  ? 5.884  23.132 20.829  1.00 48.22 ? 88  LEU A CD1 1 
ATOM   396  C CD2 . LEU A 1 82  ? 6.203  25.305 22.037  1.00 48.63 ? 88  LEU A CD2 1 
ATOM   397  N N   . GLN A 1 83  ? 4.776  24.756 17.174  1.00 49.14 ? 89  GLN A N   1 
ATOM   398  C CA  . GLN A 1 83  ? 3.734  25.471 16.448  1.00 53.40 ? 89  GLN A CA  1 
ATOM   399  C C   . GLN A 1 83  ? 2.387  25.430 17.154  1.00 55.41 ? 89  GLN A C   1 
ATOM   400  O O   . GLN A 1 83  ? 1.893  24.356 17.497  1.00 56.07 ? 89  GLN A O   1 
ATOM   401  C CB  . GLN A 1 83  ? 3.590  24.880 15.043  1.00 53.93 ? 89  GLN A CB  1 
ATOM   402  C CG  . GLN A 1 83  ? 2.530  25.537 14.171  1.00 55.13 ? 89  GLN A CG  1 
ATOM   403  C CD  . GLN A 1 83  ? 2.701  27.040 14.074  1.00 56.84 ? 89  GLN A CD  1 
ATOM   404  O OE1 . GLN A 1 83  ? 3.825  27.551 13.997  1.00 57.53 ? 89  GLN A OE1 1 
ATOM   405  N NE2 . GLN A 1 83  ? 1.586  27.760 14.065  1.00 56.60 ? 89  GLN A NE2 1 
ATOM   406  N N   . ASP A 1 84  ? 1.800  26.601 17.378  1.00 57.88 ? 90  ASP A N   1 
ATOM   407  C CA  . ASP A 1 84  ? 0.490  26.673 18.014  1.00 60.66 ? 90  ASP A CA  1 
ATOM   408  C C   . ASP A 1 84  ? -0.548 26.575 16.902  1.00 61.58 ? 90  ASP A C   1 
ATOM   409  O O   . ASP A 1 84  ? -0.411 27.225 15.864  1.00 60.85 ? 90  ASP A O   1 
ATOM   410  C CB  . ASP A 1 84  ? 0.327  27.989 18.772  1.00 62.10 ? 90  ASP A CB  1 
ATOM   411  C CG  . ASP A 1 84  ? -1.022 28.097 19.465  1.00 64.22 ? 90  ASP A CG  1 
ATOM   412  O OD1 . ASP A 1 84  ? -1.378 27.176 20.235  1.00 64.40 ? 90  ASP A OD1 1 
ATOM   413  O OD2 . ASP A 1 84  ? -1.722 29.107 19.239  1.00 65.14 ? 90  ASP A OD2 1 
ATOM   414  N N   . LYS A 1 85  ? -1.582 25.766 17.120  1.00 63.39 ? 91  LYS A N   1 
ATOM   415  C CA  . LYS A 1 85  ? -2.620 25.565 16.111  1.00 64.97 ? 91  LYS A CA  1 
ATOM   416  C C   . LYS A 1 85  ? -3.422 26.806 15.725  1.00 65.19 ? 91  LYS A C   1 
ATOM   417  O O   . LYS A 1 85  ? -4.027 26.834 14.652  1.00 65.84 ? 91  LYS A O   1 
ATOM   418  C CB  . LYS A 1 85  ? -3.589 24.459 16.544  1.00 66.01 ? 91  LYS A CB  1 
ATOM   419  C CG  . LYS A 1 85  ? -4.580 24.858 17.632  1.00 67.62 ? 91  LYS A CG  1 
ATOM   420  C CD  . LYS A 1 85  ? -5.717 23.841 17.716  1.00 68.71 ? 91  LYS A CD  1 
ATOM   421  C CE  . LYS A 1 85  ? -6.830 24.294 18.653  1.00 68.26 ? 91  LYS A CE  1 
ATOM   422  N NZ  . LYS A 1 85  ? -7.990 23.360 18.586  1.00 68.54 ? 91  LYS A NZ  1 
ATOM   423  N N   . ARG A 1 86  ? -3.444 27.826 16.578  1.00 65.36 ? 92  ARG A N   1 
ATOM   424  C CA  . ARG A 1 86  ? -4.195 29.027 16.234  1.00 65.58 ? 92  ARG A CA  1 
ATOM   425  C C   . ARG A 1 86  ? -3.367 30.186 15.675  1.00 64.83 ? 92  ARG A C   1 
ATOM   426  O O   . ARG A 1 86  ? -3.105 31.183 16.353  1.00 64.80 ? 92  ARG A O   1 
ATOM   427  C CB  . ARG A 1 86  ? -5.058 29.494 17.416  1.00 67.36 ? 92  ARG A CB  1 
ATOM   428  C CG  . ARG A 1 86  ? -4.589 29.097 18.804  1.00 68.60 ? 92  ARG A CG  1 
ATOM   429  C CD  . ARG A 1 86  ? -5.813 28.900 19.685  1.00 70.62 ? 92  ARG A CD  1 
ATOM   430  N NE  . ARG A 1 86  ? -5.644 29.398 21.047  1.00 72.56 ? 92  ARG A NE  1 
ATOM   431  C CZ  . ARG A 1 86  ? -6.629 29.444 21.942  1.00 73.49 ? 92  ARG A CZ  1 
ATOM   432  N NH1 . ARG A 1 86  ? -7.845 29.020 21.613  1.00 73.15 ? 92  ARG A NH1 1 
ATOM   433  N NH2 . ARG A 1 86  ? -6.405 29.919 23.162  1.00 73.71 ? 92  ARG A NH2 1 
ATOM   434  N N   . PHE A 1 87  ? -2.974 30.007 14.414  1.00 63.34 ? 93  PHE A N   1 
ATOM   435  C CA  . PHE A 1 87  ? -2.202 30.943 13.595  1.00 61.36 ? 93  PHE A CA  1 
ATOM   436  C C   . PHE A 1 87  ? -1.189 30.165 12.762  1.00 58.79 ? 93  PHE A C   1 
ATOM   437  O O   . PHE A 1 87  ? -0.522 29.257 13.255  1.00 58.19 ? 93  PHE A O   1 
ATOM   438  C CB  . PHE A 1 87  ? -1.471 32.015 14.412  1.00 63.65 ? 93  PHE A CB  1 
ATOM   439  C CG  . PHE A 1 87  ? -1.379 33.339 13.695  1.00 66.37 ? 93  PHE A CG  1 
ATOM   440  C CD1 . PHE A 1 87  ? -2.501 34.162 13.598  1.00 67.56 ? 93  PHE A CD1 1 
ATOM   441  C CD2 . PHE A 1 87  ? -0.213 33.720 13.032  1.00 67.41 ? 93  PHE A CD2 1 
ATOM   442  C CE1 . PHE A 1 87  ? -2.469 35.343 12.848  1.00 68.06 ? 93  PHE A CE1 1 
ATOM   443  C CE2 . PHE A 1 87  ? -0.169 34.901 12.276  1.00 68.24 ? 93  PHE A CE2 1 
ATOM   444  C CZ  . PHE A 1 87  ? -1.301 35.712 12.184  1.00 67.99 ? 93  PHE A CZ  1 
ATOM   445  N N   . LYS A 1 88  ? -1.087 30.529 11.491  1.00 55.22 ? 94  LYS A N   1 
ATOM   446  C CA  . LYS A 1 88  ? -0.181 29.864 10.572  1.00 51.76 ? 94  LYS A CA  1 
ATOM   447  C C   . LYS A 1 88  ? 1.255  30.350 10.753  1.00 47.73 ? 94  LYS A C   1 
ATOM   448  O O   . LYS A 1 88  ? 1.491  31.518 11.063  1.00 47.66 ? 94  LYS A O   1 
ATOM   449  C CB  . LYS A 1 88  ? -0.675 30.106 9.150   1.00 53.83 ? 94  LYS A CB  1 
ATOM   450  C CG  . LYS A 1 88  ? -2.150 29.751 9.009   1.00 56.89 ? 94  LYS A CG  1 
ATOM   451  C CD  . LYS A 1 88  ? -2.784 30.341 7.767   1.00 58.90 ? 94  LYS A CD  1 
ATOM   452  C CE  . LYS A 1 88  ? -4.283 30.069 7.756   1.00 60.48 ? 94  LYS A CE  1 
ATOM   453  N NZ  . LYS A 1 88  ? -4.957 30.734 6.607   1.00 61.92 ? 94  LYS A NZ  1 
ATOM   454  N N   . ASN A 1 89  ? 2.208  29.441 10.576  1.00 42.68 ? 95  ASN A N   1 
ATOM   455  C CA  . ASN A 1 89  ? 3.621  29.774 10.731  1.00 38.10 ? 95  ASN A CA  1 
ATOM   456  C C   . ASN A 1 89  ? 4.096  30.653 9.575   1.00 35.55 ? 95  ASN A C   1 
ATOM   457  O O   . ASN A 1 89  ? 4.057  30.245 8.413   1.00 33.31 ? 95  ASN A O   1 
ATOM   458  C CB  . ASN A 1 89  ? 4.449  28.490 10.815  1.00 36.80 ? 95  ASN A CB  1 
ATOM   459  C CG  . ASN A 1 89  ? 5.927  28.768 10.987  1.00 36.98 ? 95  ASN A CG  1 
ATOM   460  O OD1 . ASN A 1 89  ? 6.582  29.258 10.070  1.00 35.20 ? 95  ASN A OD1 1 
ATOM   461  N ND2 . ASN A 1 89  ? 6.456  28.473 12.171  1.00 35.84 ? 95  ASN A ND2 1 
ATOM   462  N N   . ARG A 1 90  ? 4.546  31.862 9.898   1.00 33.00 ? 96  ARG A N   1 
ATOM   463  C CA  . ARG A 1 90  ? 4.987  32.803 8.874   1.00 32.90 ? 96  ARG A CA  1 
ATOM   464  C C   . ARG A 1 90  ? 6.192  32.360 8.051   1.00 31.35 ? 96  ARG A C   1 
ATOM   465  O O   . ARG A 1 90  ? 6.256  32.625 6.846   1.00 29.29 ? 96  ARG A O   1 
ATOM   466  C CB  . ARG A 1 90  ? 5.276  34.172 9.489   1.00 35.04 ? 96  ARG A CB  1 
ATOM   467  C CG  . ARG A 1 90  ? 5.710  35.196 8.447   1.00 39.65 ? 96  ARG A CG  1 
ATOM   468  C CD  . ARG A 1 90  ? 5.255  36.596 8.810   1.00 44.34 ? 96  ARG A CD  1 
ATOM   469  N NE  . ARG A 1 90  ? 5.967  37.131 9.961   1.00 47.73 ? 96  ARG A NE  1 
ATOM   470  C CZ  . ARG A 1 90  ? 5.571  38.197 10.648  1.00 49.01 ? 96  ARG A CZ  1 
ATOM   471  N NH1 . ARG A 1 90  ? 4.463  38.839 10.300  1.00 49.58 ? 96  ARG A NH1 1 
ATOM   472  N NH2 . ARG A 1 90  ? 6.287  38.624 11.679  1.00 48.41 ? 96  ARG A NH2 1 
ATOM   473  N N   . GLU A 1 91  ? 7.150  31.702 8.699   1.00 29.54 ? 97  GLU A N   1 
ATOM   474  C CA  . GLU A 1 91  ? 8.339  31.234 7.995   1.00 29.30 ? 97  GLU A CA  1 
ATOM   475  C C   . GLU A 1 91  ? 7.897  30.243 6.932   1.00 28.20 ? 97  GLU A C   1 
ATOM   476  O O   . GLU A 1 91  ? 8.317  30.326 5.784   1.00 27.08 ? 97  GLU A O   1 
ATOM   477  C CB  . GLU A 1 91  ? 9.313  30.560 8.968   1.00 29.28 ? 97  GLU A CB  1 
ATOM   478  C CG  . GLU A 1 91  ? 10.595 30.043 8.305   1.00 30.36 ? 97  GLU A CG  1 
ATOM   479  C CD  . GLU A 1 91  ? 11.644 29.579 9.310   1.00 32.67 ? 97  GLU A CD  1 
ATOM   480  O OE1 . GLU A 1 91  ? 11.324 29.470 10.513  1.00 32.65 ? 97  GLU A OE1 1 
ATOM   481  O OE2 . GLU A 1 91  ? 12.793 29.314 8.892   1.00 34.00 ? 97  GLU A OE2 1 
ATOM   482  N N   . LEU A 1 92  ? 7.032  29.313 7.322   1.00 28.39 ? 98  LEU A N   1 
ATOM   483  C CA  . LEU A 1 92  ? 6.528  28.305 6.394   1.00 29.02 ? 98  LEU A CA  1 
ATOM   484  C C   . LEU A 1 92  ? 5.823  28.924 5.192   1.00 28.75 ? 98  LEU A C   1 
ATOM   485  O O   . LEU A 1 92  ? 6.044  28.526 4.046   1.00 27.52 ? 98  LEU A O   1 
ATOM   486  C CB  . LEU A 1 92  ? 5.549  27.363 7.106   1.00 28.91 ? 98  LEU A CB  1 
ATOM   487  C CG  . LEU A 1 92  ? 4.761  26.422 6.177   1.00 30.22 ? 98  LEU A CG  1 
ATOM   488  C CD1 . LEU A 1 92  ? 5.722  25.524 5.414   1.00 30.30 ? 98  LEU A CD1 1 
ATOM   489  C CD2 . LEU A 1 92  ? 3.786  25.585 6.989   1.00 30.91 ? 98  LEU A CD2 1 
ATOM   490  N N   . GLN A 1 93  ? 4.957  29.893 5.456   1.00 30.89 ? 99  GLN A N   1 
ATOM   491  C CA  . GLN A 1 93  ? 4.217  30.527 4.377   1.00 31.75 ? 99  GLN A CA  1 
ATOM   492  C C   . GLN A 1 93  ? 5.139  31.267 3.428   1.00 30.49 ? 99  GLN A C   1 
ATOM   493  O O   . GLN A 1 93  ? 4.939  31.243 2.217   1.00 27.72 ? 99  GLN A O   1 
ATOM   494  C CB  . GLN A 1 93  ? 3.144  31.453 4.951   1.00 35.33 ? 99  GLN A CB  1 
ATOM   495  C CG  . GLN A 1 93  ? 2.051  30.677 5.685   1.00 40.54 ? 99  GLN A CG  1 
ATOM   496  C CD  . GLN A 1 93  ? 1.513  29.500 4.862   1.00 44.28 ? 99  GLN A CD  1 
ATOM   497  O OE1 . GLN A 1 93  ? 0.921  29.687 3.794   1.00 47.44 ? 99  GLN A OE1 1 
ATOM   498  N NE2 . GLN A 1 93  ? 1.730  28.283 5.354   1.00 44.51 ? 99  GLN A NE2 1 
ATOM   499  N N   . ILE A 1 94  ? 6.167  31.910 3.969   1.00 29.36 ? 100 ILE A N   1 
ATOM   500  C CA  . ILE A 1 94  ? 7.109  32.618 3.115   1.00 28.39 ? 100 ILE A CA  1 
ATOM   501  C C   . ILE A 1 94  ? 7.926  31.627 2.283   1.00 27.11 ? 100 ILE A C   1 
ATOM   502  O O   . ILE A 1 94  ? 8.081  31.801 1.080   1.00 26.86 ? 100 ILE A O   1 
ATOM   503  C CB  . ILE A 1 94  ? 8.053  33.514 3.948   1.00 28.19 ? 100 ILE A CB  1 
ATOM   504  C CG1 . ILE A 1 94  ? 7.282  34.753 4.417   1.00 30.13 ? 100 ILE A CG1 1 
ATOM   505  C CG2 . ILE A 1 94  ? 9.272  33.915 3.123   1.00 27.45 ? 100 ILE A CG2 1 
ATOM   506  C CD1 . ILE A 1 94  ? 8.018  35.620 5.411   1.00 29.06 ? 100 ILE A CD1 1 
ATOM   507  N N   . MET A 1 95  ? 8.430  30.572 2.914   1.00 28.53 ? 101 MET A N   1 
ATOM   508  C CA  . MET A 1 95  ? 9.242  29.592 2.191   1.00 28.31 ? 101 MET A CA  1 
ATOM   509  C C   . MET A 1 95  ? 8.507  28.840 1.086   1.00 29.33 ? 101 MET A C   1 
ATOM   510  O O   . MET A 1 95  ? 9.102  28.484 0.071   1.00 25.78 ? 101 MET A O   1 
ATOM   511  C CB  . MET A 1 95  ? 9.849  28.593 3.163   1.00 29.11 ? 101 MET A CB  1 
ATOM   512  C CG  . MET A 1 95  ? 10.780 29.250 4.157   1.00 32.43 ? 101 MET A CG  1 
ATOM   513  S SD  . MET A 1 95  ? 12.244 28.267 4.398   1.00 41.00 ? 101 MET A SD  1 
ATOM   514  C CE  . MET A 1 95  ? 13.048 28.499 2.830   1.00 32.82 ? 101 MET A CE  1 
ATOM   515  N N   . ARG A 1 96  ? 7.220  28.583 1.282   1.00 30.23 ? 102 ARG A N   1 
ATOM   516  C CA  . ARG A 1 96  ? 6.458  27.874 0.260   1.00 31.22 ? 102 ARG A CA  1 
ATOM   517  C C   . ARG A 1 96  ? 6.362  28.690 -1.033  1.00 31.38 ? 102 ARG A C   1 
ATOM   518  O O   . ARG A 1 96  ? 6.090  28.140 -2.099  1.00 32.20 ? 102 ARG A O   1 
ATOM   519  C CB  . ARG A 1 96  ? 5.054  27.549 0.768   1.00 31.92 ? 102 ARG A CB  1 
ATOM   520  C CG  . ARG A 1 96  ? 5.016  26.610 1.954   1.00 32.71 ? 102 ARG A CG  1 
ATOM   521  C CD  . ARG A 1 96  ? 3.601  26.099 2.173   1.00 37.00 ? 102 ARG A CD  1 
ATOM   522  N NE  . ARG A 1 96  ? 3.210  25.191 1.099   1.00 40.32 ? 102 ARG A NE  1 
ATOM   523  C CZ  . ARG A 1 96  ? 2.013  24.623 0.988   1.00 42.16 ? 102 ARG A CZ  1 
ATOM   524  N NH1 . ARG A 1 96  ? 1.070  24.873 1.886   1.00 41.97 ? 102 ARG A NH1 1 
ATOM   525  N NH2 . ARG A 1 96  ? 1.770  23.785 -0.012  1.00 44.30 ? 102 ARG A NH2 1 
ATOM   526  N N   . LYS A 1 97  ? 6.597  29.997 -0.945  1.00 31.46 ? 103 LYS A N   1 
ATOM   527  C CA  . LYS A 1 97  ? 6.538  30.866 -2.124  1.00 31.81 ? 103 LYS A CA  1 
ATOM   528  C C   . LYS A 1 97  ? 7.880  31.064 -2.834  1.00 30.63 ? 103 LYS A C   1 
ATOM   529  O O   . LYS A 1 97  ? 7.914  31.390 -4.015  1.00 30.12 ? 103 LYS A O   1 
ATOM   530  C CB  . LYS A 1 97  ? 6.018  32.255 -1.745  1.00 35.19 ? 103 LYS A CB  1 
ATOM   531  C CG  . LYS A 1 97  ? 4.566  32.332 -1.303  1.00 40.84 ? 103 LYS A CG  1 
ATOM   532  C CD  . LYS A 1 97  ? 4.279  33.747 -0.802  1.00 44.48 ? 103 LYS A CD  1 
ATOM   533  C CE  . LYS A 1 97  ? 2.831  33.948 -0.386  1.00 47.60 ? 103 LYS A CE  1 
ATOM   534  N NZ  . LYS A 1 97  ? 2.635  35.320 0.171   1.00 47.65 ? 103 LYS A NZ  1 
ATOM   535  N N   . LEU A 1 98  ? 8.983  30.875 -2.119  1.00 29.05 ? 104 LEU A N   1 
ATOM   536  C CA  . LEU A 1 98  ? 10.306 31.098 -2.701  1.00 27.56 ? 104 LEU A CA  1 
ATOM   537  C C   . LEU A 1 98  ? 10.836 29.956 -3.549  1.00 26.39 ? 104 LEU A C   1 
ATOM   538  O O   . LEU A 1 98  ? 10.687 28.790 -3.202  1.00 28.50 ? 104 LEU A O   1 
ATOM   539  C CB  . LEU A 1 98  ? 11.317 31.401 -1.586  1.00 26.06 ? 104 LEU A CB  1 
ATOM   540  C CG  . LEU A 1 98  ? 10.858 32.450 -0.573  1.00 26.13 ? 104 LEU A CG  1 
ATOM   541  C CD1 . LEU A 1 98  ? 11.929 32.642 0.488   1.00 24.27 ? 104 LEU A CD1 1 
ATOM   542  C CD2 . LEU A 1 98  ? 10.557 33.759 -1.289  1.00 28.56 ? 104 LEU A CD2 1 
ATOM   543  N N   . ASP A 1 99  ? 11.464 30.315 -4.662  1.00 27.50 ? 105 ASP A N   1 
ATOM   544  C CA  . ASP A 1 99  ? 12.058 29.354 -5.583  1.00 27.94 ? 105 ASP A CA  1 
ATOM   545  C C   . ASP A 1 99  ? 13.204 30.066 -6.285  1.00 26.05 ? 105 ASP A C   1 
ATOM   546  O O   . ASP A 1 99  ? 13.010 30.691 -7.321  1.00 24.52 ? 105 ASP A O   1 
ATOM   547  C CB  . ASP A 1 99  ? 11.034 28.893 -6.625  1.00 30.17 ? 105 ASP A CB  1 
ATOM   548  C CG  . ASP A 1 99  ? 11.638 27.956 -7.656  1.00 35.23 ? 105 ASP A CG  1 
ATOM   549  O OD1 . ASP A 1 99  ? 11.018 27.761 -8.723  1.00 38.46 ? 105 ASP A OD1 1 
ATOM   550  O OD2 . ASP A 1 99  ? 12.735 27.410 -7.400  1.00 37.28 ? 105 ASP A OD2 1 
ATOM   551  N N   . HIS A 1 100 ? 14.403 29.976 -5.717  1.00 26.43 ? 106 HIS A N   1 
ATOM   552  C CA  . HIS A 1 100 ? 15.562 30.642 -6.302  1.00 24.65 ? 106 HIS A CA  1 
ATOM   553  C C   . HIS A 1 100 ? 16.820 29.819 -6.017  1.00 25.26 ? 106 HIS A C   1 
ATOM   554  O O   . HIS A 1 100 ? 16.932 29.230 -4.948  1.00 24.08 ? 106 HIS A O   1 
ATOM   555  C CB  . HIS A 1 100 ? 15.674 32.049 -5.709  1.00 24.89 ? 106 HIS A CB  1 
ATOM   556  C CG  . HIS A 1 100 ? 16.767 32.875 -6.308  1.00 26.64 ? 106 HIS A CG  1 
ATOM   557  N ND1 . HIS A 1 100 ? 18.092 32.727 -5.956  1.00 24.25 ? 106 HIS A ND1 1 
ATOM   558  C CD2 . HIS A 1 100 ? 16.734 33.851 -7.247  1.00 25.57 ? 106 HIS A CD2 1 
ATOM   559  C CE1 . HIS A 1 100 ? 18.826 33.577 -6.651  1.00 25.40 ? 106 HIS A CE1 1 
ATOM   560  N NE2 . HIS A 1 100 ? 18.026 34.270 -7.441  1.00 25.42 ? 106 HIS A NE2 1 
ATOM   561  N N   . CYS A 1 101 ? 17.753 29.776 -6.971  1.00 25.13 ? 107 CYS A N   1 
ATOM   562  C CA  . CYS A 1 101 ? 18.978 28.985 -6.817  1.00 25.65 ? 107 CYS A CA  1 
ATOM   563  C C   . CYS A 1 101 ? 19.847 29.362 -5.617  1.00 25.45 ? 107 CYS A C   1 
ATOM   564  O O   . CYS A 1 101 ? 20.626 28.531 -5.130  1.00 24.33 ? 107 CYS A O   1 
ATOM   565  C CB  . CYS A 1 101 ? 19.818 29.038 -8.106  1.00 27.14 ? 107 CYS A CB  1 
ATOM   566  S SG  . CYS A 1 101 ? 20.337 30.691 -8.656  1.00 33.34 ? 107 CYS A SG  1 
ATOM   567  N N   . ASN A 1 102 ? 19.705 30.592 -5.127  1.00 24.00 ? 108 ASN A N   1 
ATOM   568  C CA  . ASN A 1 102 ? 20.496 31.045 -3.975  1.00 23.06 ? 108 ASN A CA  1 
ATOM   569  C C   . ASN A 1 102 ? 19.728 31.157 -2.660  1.00 23.99 ? 108 ASN A C   1 
ATOM   570  O O   . ASN A 1 102 ? 20.082 31.954 -1.782  1.00 22.21 ? 108 ASN A O   1 
ATOM   571  C CB  . ASN A 1 102 ? 21.178 32.368 -4.318  1.00 22.76 ? 108 ASN A CB  1 
ATOM   572  C CG  . ASN A 1 102 ? 22.168 32.206 -5.458  1.00 22.52 ? 108 ASN A CG  1 
ATOM   573  O OD1 . ASN A 1 102 ? 22.069 32.862 -6.490  1.00 22.91 ? 108 ASN A OD1 1 
ATOM   574  N ND2 . ASN A 1 102 ? 23.119 31.297 -5.275  1.00 19.96 ? 108 ASN A ND2 1 
ATOM   575  N N   . ILE A 1 103 ? 18.677 30.344 -2.530  1.00 20.65 ? 109 ILE A N   1 
ATOM   576  C CA  . ILE A 1 103 ? 17.869 30.302 -1.312  1.00 22.59 ? 109 ILE A CA  1 
ATOM   577  C C   . ILE A 1 103 ? 17.599 28.841 -1.032  1.00 23.56 ? 109 ILE A C   1 
ATOM   578  O O   . ILE A 1 103 ? 17.214 28.103 -1.937  1.00 22.79 ? 109 ILE A O   1 
ATOM   579  C CB  . ILE A 1 103 ? 16.513 31.022 -1.483  1.00 23.18 ? 109 ILE A CB  1 
ATOM   580  C CG1 . ILE A 1 103 ? 16.753 32.510 -1.751  1.00 24.73 ? 109 ILE A CG1 1 
ATOM   581  C CG2 . ILE A 1 103 ? 15.641 30.807 -0.228  1.00 22.30 ? 109 ILE A CG2 1 
ATOM   582  C CD1 . ILE A 1 103 ? 15.476 33.319 -1.939  1.00 26.70 ? 109 ILE A CD1 1 
ATOM   583  N N   . VAL A 1 104 ? 17.800 28.421 0.214   1.00 23.80 ? 110 VAL A N   1 
ATOM   584  C CA  . VAL A 1 104 ? 17.577 27.032 0.577   1.00 25.21 ? 110 VAL A CA  1 
ATOM   585  C C   . VAL A 1 104 ? 16.139 26.624 0.235   1.00 26.28 ? 110 VAL A C   1 
ATOM   586  O O   . VAL A 1 104 ? 15.177 27.320 0.572   1.00 24.21 ? 110 VAL A O   1 
ATOM   587  C CB  . VAL A 1 104 ? 17.864 26.796 2.081   1.00 27.73 ? 110 VAL A CB  1 
ATOM   588  C CG1 . VAL A 1 104 ? 16.857 27.536 2.936   1.00 26.52 ? 110 VAL A CG1 1 
ATOM   589  C CG2 . VAL A 1 104 ? 17.838 25.312 2.385   1.00 30.17 ? 110 VAL A CG2 1 
ATOM   590  N N   . ARG A 1 105 ? 16.005 25.493 -0.444  1.00 25.69 ? 111 ARG A N   1 
ATOM   591  C CA  . ARG A 1 105 ? 14.699 25.009 -0.857  1.00 29.41 ? 111 ARG A CA  1 
ATOM   592  C C   . ARG A 1 105 ? 13.932 24.229 0.207   1.00 27.95 ? 111 ARG A C   1 
ATOM   593  O O   . ARG A 1 105 ? 14.489 23.383 0.912   1.00 25.40 ? 111 ARG A O   1 
ATOM   594  C CB  . ARG A 1 105 ? 14.843 24.148 -2.115  1.00 32.70 ? 111 ARG A CB  1 
ATOM   595  C CG  . ARG A 1 105 ? 13.519 23.762 -2.762  1.00 39.04 ? 111 ARG A CG  1 
ATOM   596  C CD  . ARG A 1 105 ? 13.734 23.221 -4.168  1.00 43.60 ? 111 ARG A CD  1 
ATOM   597  N NE  . ARG A 1 105 ? 14.443 21.944 -4.170  1.00 49.70 ? 111 ARG A NE  1 
ATOM   598  C CZ  . ARG A 1 105 ? 13.869 20.770 -3.925  1.00 52.32 ? 111 ARG A CZ  1 
ATOM   599  N NH1 . ARG A 1 105 ? 12.569 20.705 -3.658  1.00 52.24 ? 111 ARG A NH1 1 
ATOM   600  N NH2 . ARG A 1 105 ? 14.596 19.659 -3.947  1.00 53.89 ? 111 ARG A NH2 1 
ATOM   601  N N   . LEU A 1 106 ? 12.646 24.545 0.326   1.00 28.14 ? 112 LEU A N   1 
ATOM   602  C CA  . LEU A 1 106 ? 11.770 23.841 1.253   1.00 28.64 ? 112 LEU A CA  1 
ATOM   603  C C   . LEU A 1 106 ? 11.272 22.629 0.465   1.00 29.35 ? 112 LEU A C   1 
ATOM   604  O O   . LEU A 1 106 ? 10.473 22.770 -0.463  1.00 28.16 ? 112 LEU A O   1 
ATOM   605  C CB  . LEU A 1 106 ? 10.576 24.715 1.646   1.00 27.97 ? 112 LEU A CB  1 
ATOM   606  C CG  . LEU A 1 106 ? 9.554  24.003 2.542   1.00 28.31 ? 112 LEU A CG  1 
ATOM   607  C CD1 . LEU A 1 106 ? 10.184 23.710 3.901   1.00 27.61 ? 112 LEU A CD1 1 
ATOM   608  C CD2 . LEU A 1 106 ? 8.309  24.864 2.696   1.00 28.95 ? 112 LEU A CD2 1 
ATOM   609  N N   . ARG A 1 107 ? 11.759 21.446 0.819   1.00 29.51 ? 113 ARG A N   1 
ATOM   610  C CA  . ARG A 1 107 ? 11.358 20.223 0.130   1.00 29.82 ? 113 ARG A CA  1 
ATOM   611  C C   . ARG A 1 107 ? 9.986  19.729 0.590   1.00 30.28 ? 113 ARG A C   1 
ATOM   612  O O   . ARG A 1 107 ? 9.135  19.384 -0.232  1.00 29.01 ? 113 ARG A O   1 
ATOM   613  C CB  . ARG A 1 107 ? 12.403 19.133 0.361   1.00 31.87 ? 113 ARG A CB  1 
ATOM   614  C CG  . ARG A 1 107 ? 13.704 19.372 -0.382  1.00 35.47 ? 113 ARG A CG  1 
ATOM   615  C CD  . ARG A 1 107 ? 14.800 18.479 0.155   1.00 39.44 ? 113 ARG A CD  1 
ATOM   616  N NE  . ARG A 1 107 ? 16.036 18.636 -0.604  1.00 43.74 ? 113 ARG A NE  1 
ATOM   617  C CZ  . ARG A 1 107 ? 16.514 17.726 -1.446  1.00 45.19 ? 113 ARG A CZ  1 
ATOM   618  N NH1 . ARG A 1 107 ? 15.858 16.588 -1.635  1.00 45.21 ? 113 ARG A NH1 1 
ATOM   619  N NH2 . ARG A 1 107 ? 17.650 17.953 -2.092  1.00 46.47 ? 113 ARG A NH2 1 
ATOM   620  N N   . TYR A 1 108 ? 9.791  19.688 1.904   1.00 29.45 ? 114 TYR A N   1 
ATOM   621  C CA  . TYR A 1 108 ? 8.531  19.247 2.499   1.00 30.72 ? 114 TYR A CA  1 
ATOM   622  C C   . TYR A 1 108 ? 8.389  19.868 3.875   1.00 30.96 ? 114 TYR A C   1 
ATOM   623  O O   . TYR A 1 108 ? 9.312  20.506 4.388   1.00 29.83 ? 114 TYR A O   1 
ATOM   624  C CB  . TYR A 1 108 ? 8.498  17.731 2.728   1.00 31.58 ? 114 TYR A CB  1 
ATOM   625  C CG  . TYR A 1 108 ? 8.832  16.851 1.552   1.00 34.34 ? 114 TYR A CG  1 
ATOM   626  C CD1 . TYR A 1 108 ? 10.131 16.392 1.349   1.00 37.19 ? 114 TYR A CD1 1 
ATOM   627  C CD2 . TYR A 1 108 ? 7.841  16.439 0.663   1.00 36.52 ? 114 TYR A CD2 1 
ATOM   628  C CE1 . TYR A 1 108 ? 10.438 15.538 0.290   1.00 37.93 ? 114 TYR A CE1 1 
ATOM   629  C CE2 . TYR A 1 108 ? 8.136  15.588 -0.399  1.00 38.13 ? 114 TYR A CE2 1 
ATOM   630  C CZ  . TYR A 1 108 ? 9.436  15.141 -0.578  1.00 39.38 ? 114 TYR A CZ  1 
ATOM   631  O OH  . TYR A 1 108 ? 9.729  14.294 -1.627  1.00 42.51 ? 114 TYR A OH  1 
ATOM   632  N N   . PHE A 1 109 ? 7.217  19.665 4.469   1.00 30.64 ? 115 PHE A N   1 
ATOM   633  C CA  . PHE A 1 109 ? 6.953  20.105 5.828   1.00 30.17 ? 115 PHE A CA  1 
ATOM   634  C C   . PHE A 1 109 ? 5.927  19.128 6.377   1.00 30.73 ? 115 PHE A C   1 
ATOM   635  O O   . PHE A 1 109 ? 5.170  18.517 5.617   1.00 29.23 ? 115 PHE A O   1 
ATOM   636  C CB  . PHE A 1 109 ? 6.457  21.560 5.883   1.00 30.10 ? 115 PHE A CB  1 
ATOM   637  C CG  . PHE A 1 109 ? 5.102  21.785 5.278   1.00 30.50 ? 115 PHE A CG  1 
ATOM   638  C CD1 . PHE A 1 109 ? 3.952  21.690 6.056   1.00 32.92 ? 115 PHE A CD1 1 
ATOM   639  C CD2 . PHE A 1 109 ? 4.977  22.144 3.940   1.00 30.64 ? 115 PHE A CD2 1 
ATOM   640  C CE1 . PHE A 1 109 ? 2.690  21.955 5.508   1.00 32.50 ? 115 PHE A CE1 1 
ATOM   641  C CE2 . PHE A 1 109 ? 3.721  22.409 3.384   1.00 32.67 ? 115 PHE A CE2 1 
ATOM   642  C CZ  . PHE A 1 109 ? 2.579  22.313 4.175   1.00 30.29 ? 115 PHE A CZ  1 
ATOM   643  N N   . PHE A 1 110 ? 5.937  18.939 7.688   1.00 30.74 ? 116 PHE A N   1 
ATOM   644  C CA  . PHE A 1 110 ? 5.006  18.017 8.319   1.00 32.44 ? 116 PHE A CA  1 
ATOM   645  C C   . PHE A 1 110 ? 4.912  18.334 9.799   1.00 33.11 ? 116 PHE A C   1 
ATOM   646  O O   . PHE A 1 110 ? 5.731  19.092 10.329  1.00 33.41 ? 116 PHE A O   1 
ATOM   647  C CB  . PHE A 1 110 ? 5.467  16.566 8.098   1.00 32.28 ? 116 PHE A CB  1 
ATOM   648  C CG  . PHE A 1 110 ? 6.785  16.225 8.755   1.00 34.97 ? 116 PHE A CG  1 
ATOM   649  C CD1 . PHE A 1 110 ? 6.838  15.849 10.094  1.00 34.63 ? 116 PHE A CD1 1 
ATOM   650  C CD2 . PHE A 1 110 ? 7.970  16.258 8.025   1.00 34.67 ? 116 PHE A CD2 1 
ATOM   651  C CE1 . PHE A 1 110 ? 8.057  15.505 10.697  1.00 35.42 ? 116 PHE A CE1 1 
ATOM   652  C CE2 . PHE A 1 110 ? 9.195  15.917 8.618   1.00 34.94 ? 116 PHE A CE2 1 
ATOM   653  C CZ  . PHE A 1 110 ? 9.236  15.540 9.953   1.00 34.62 ? 116 PHE A CZ  1 
ATOM   654  N N   . TYR A 1 111 ? 3.908  17.769 10.465  1.00 34.21 ? 117 TYR A N   1 
ATOM   655  C CA  . TYR A 1 111 ? 3.725  18.007 11.889  1.00 35.81 ? 117 TYR A CA  1 
ATOM   656  C C   . TYR A 1 111 ? 3.972  16.752 12.702  1.00 37.34 ? 117 TYR A C   1 
ATOM   657  O O   . TYR A 1 111 ? 3.708  15.641 12.242  1.00 38.06 ? 117 TYR A O   1 
ATOM   658  C CB  . TYR A 1 111 ? 2.318  18.536 12.161  1.00 34.92 ? 117 TYR A CB  1 
ATOM   659  C CG  . TYR A 1 111 ? 2.023  19.805 11.407  1.00 34.32 ? 117 TYR A CG  1 
ATOM   660  C CD1 . TYR A 1 111 ? 1.459  19.769 10.130  1.00 34.24 ? 117 TYR A CD1 1 
ATOM   661  C CD2 . TYR A 1 111 ? 2.349  21.045 11.950  1.00 33.99 ? 117 TYR A CD2 1 
ATOM   662  C CE1 . TYR A 1 111 ? 1.231  20.942 9.417   1.00 33.56 ? 117 TYR A CE1 1 
ATOM   663  C CE2 . TYR A 1 111 ? 2.125  22.221 11.248  1.00 32.02 ? 117 TYR A CE2 1 
ATOM   664  C CZ  . TYR A 1 111 ? 1.569  22.163 9.987   1.00 32.82 ? 117 TYR A CZ  1 
ATOM   665  O OH  . TYR A 1 111 ? 1.353  23.330 9.298   1.00 33.89 ? 117 TYR A OH  1 
ATOM   666  N N   . SER A 1 112 ? 4.492  16.942 13.910  1.00 39.66 ? 118 SER A N   1 
ATOM   667  C CA  . SER A 1 112 ? 4.790  15.838 14.811  1.00 43.00 ? 118 SER A CA  1 
ATOM   668  C C   . SER A 1 112 ? 4.623  16.298 16.253  1.00 45.24 ? 118 SER A C   1 
ATOM   669  O O   . SER A 1 112 ? 4.450  17.489 16.516  1.00 45.41 ? 118 SER A O   1 
ATOM   670  C CB  . SER A 1 112 ? 6.224  15.345 14.592  1.00 43.47 ? 118 SER A CB  1 
ATOM   671  O OG  . SER A 1 112 ? 7.174  16.322 14.994  1.00 43.85 ? 118 SER A OG  1 
ATOM   672  N N   . SER A 1 113 ? 4.673  15.350 17.183  1.00 48.71 ? 119 SER A N   1 
ATOM   673  C CA  . SER A 1 113 ? 4.535  15.662 18.603  1.00 52.02 ? 119 SER A CA  1 
ATOM   674  C C   . SER A 1 113 ? 5.830  15.347 19.341  1.00 53.43 ? 119 SER A C   1 
ATOM   675  O O   . SER A 1 113 ? 6.305  14.211 19.315  1.00 55.45 ? 119 SER A O   1 
ATOM   676  C CB  . SER A 1 113 ? 3.388  14.856 19.218  1.00 53.48 ? 119 SER A CB  1 
ATOM   677  O OG  . SER A 1 113 ? 2.150  15.176 18.605  1.00 55.50 ? 119 SER A OG  1 
ATOM   678  N N   . LYS A 1 116 ? 5.755  18.328 25.488  1.00 72.07 ? 122 LYS A N   1 
ATOM   679  C CA  . LYS A 1 116 ? 5.526  16.909 25.257  1.00 72.09 ? 122 LYS A CA  1 
ATOM   680  C C   . LYS A 1 116 ? 4.065  16.578 24.963  1.00 71.92 ? 122 LYS A C   1 
ATOM   681  O O   . LYS A 1 116 ? 3.166  16.974 25.708  1.00 71.52 ? 122 LYS A O   1 
ATOM   682  C CB  . LYS A 1 116 ? 5.977  16.087 26.467  1.00 72.51 ? 122 LYS A CB  1 
ATOM   683  C CG  . LYS A 1 116 ? 7.481  16.018 26.681  1.00 73.20 ? 122 LYS A CG  1 
ATOM   684  C CD  . LYS A 1 116 ? 7.846  14.748 27.442  1.00 72.91 ? 122 LYS A CD  1 
ATOM   685  C CE  . LYS A 1 116 ? 7.327  13.519 26.700  1.00 72.78 ? 122 LYS A CE  1 
ATOM   686  N NZ  . LYS A 1 116 ? 7.646  12.245 27.402  1.00 72.84 ? 122 LYS A NZ  1 
ATOM   687  N N   . LYS A 1 117 ? 3.846  15.852 23.869  1.00 71.89 ? 123 LYS A N   1 
ATOM   688  C CA  . LYS A 1 117 ? 2.518  15.406 23.450  1.00 71.46 ? 123 LYS A CA  1 
ATOM   689  C C   . LYS A 1 117 ? 1.489  16.487 23.091  1.00 70.95 ? 123 LYS A C   1 
ATOM   690  O O   . LYS A 1 117 ? 1.167  16.659 21.911  1.00 71.23 ? 123 LYS A O   1 
ATOM   691  C CB  . LYS A 1 117 ? 1.964  14.445 24.509  1.00 71.76 ? 123 LYS A CB  1 
ATOM   692  C CG  . LYS A 1 117 ? 2.928  13.282 24.749  1.00 72.02 ? 123 LYS A CG  1 
ATOM   693  C CD  . LYS A 1 117 ? 2.429  12.237 25.735  1.00 72.34 ? 123 LYS A CD  1 
ATOM   694  C CE  . LYS A 1 117 ? 3.466  11.118 25.858  1.00 72.93 ? 123 LYS A CE  1 
ATOM   695  N NZ  . LYS A 1 117 ? 3.058  10.016 26.778  1.00 72.88 ? 123 LYS A NZ  1 
ATOM   696  N N   . ASP A 1 118 ? 0.963  17.210 24.079  1.00 69.78 ? 124 ASP A N   1 
ATOM   697  C CA  . ASP A 1 118 ? -0.018 18.253 23.778  1.00 68.28 ? 124 ASP A CA  1 
ATOM   698  C C   . ASP A 1 118 ? 0.635  19.330 22.910  1.00 66.82 ? 124 ASP A C   1 
ATOM   699  O O   . ASP A 1 118 ? -0.045 20.190 22.342  1.00 67.06 ? 124 ASP A O   1 
ATOM   700  C CB  . ASP A 1 118 ? -0.577 18.880 25.067  1.00 68.77 ? 124 ASP A CB  1 
ATOM   701  C CG  . ASP A 1 118 ? -0.094 20.309 25.289  1.00 69.66 ? 124 ASP A CG  1 
ATOM   702  O OD1 . ASP A 1 118 ? 1.085  20.496 25.664  1.00 70.05 ? 124 ASP A OD1 1 
ATOM   703  O OD2 . ASP A 1 118 ? -0.897 21.247 25.083  1.00 70.00 ? 124 ASP A OD2 1 
ATOM   704  N N   . GLU A 1 119 ? 1.961  19.267 22.810  1.00 64.32 ? 125 GLU A N   1 
ATOM   705  C CA  . GLU A 1 119 ? 2.732  20.219 22.020  1.00 61.50 ? 125 GLU A CA  1 
ATOM   706  C C   . GLU A 1 119 ? 2.929  19.713 20.594  1.00 58.27 ? 125 GLU A C   1 
ATOM   707  O O   . GLU A 1 119 ? 3.360  18.579 20.377  1.00 58.17 ? 125 GLU A O   1 
ATOM   708  C CB  . GLU A 1 119 ? 4.088  20.465 22.691  1.00 63.07 ? 125 GLU A CB  1 
ATOM   709  C CG  . GLU A 1 119 ? 3.988  21.270 23.984  1.00 65.16 ? 125 GLU A CG  1 
ATOM   710  C CD  . GLU A 1 119 ? 5.212  21.124 24.876  1.00 67.12 ? 125 GLU A CD  1 
ATOM   711  O OE1 . GLU A 1 119 ? 6.346  21.298 24.378  1.00 68.00 ? 125 GLU A OE1 1 
ATOM   712  O OE2 . GLU A 1 119 ? 5.039  20.841 26.083  1.00 68.32 ? 125 GLU A OE2 1 
ATOM   713  N N   . VAL A 1 120 ? 2.600  20.560 19.625  1.00 54.16 ? 126 VAL A N   1 
ATOM   714  C CA  . VAL A 1 120 ? 2.734  20.196 18.221  1.00 49.99 ? 126 VAL A CA  1 
ATOM   715  C C   . VAL A 1 120 ? 3.908  20.922 17.582  1.00 47.05 ? 126 VAL A C   1 
ATOM   716  O O   . VAL A 1 120 ? 4.101  22.119 17.790  1.00 45.07 ? 126 VAL A O   1 
ATOM   717  C CB  . VAL A 1 120 ? 1.457  20.535 17.427  1.00 50.43 ? 126 VAL A CB  1 
ATOM   718  C CG1 . VAL A 1 120 ? 1.644  20.170 15.959  1.00 49.23 ? 126 VAL A CG1 1 
ATOM   719  C CG2 . VAL A 1 120 ? 0.267  19.786 18.013  1.00 50.01 ? 126 VAL A CG2 1 
ATOM   720  N N   . TYR A 1 121 ? 4.678  20.184 16.792  1.00 44.39 ? 127 TYR A N   1 
ATOM   721  C CA  . TYR A 1 121 ? 5.844  20.733 16.118  1.00 41.75 ? 127 TYR A CA  1 
ATOM   722  C C   . TYR A 1 121 ? 5.703  20.791 14.601  1.00 39.39 ? 127 TYR A C   1 
ATOM   723  O O   . TYR A 1 121 ? 5.207  19.853 13.978  1.00 38.25 ? 127 TYR A O   1 
ATOM   724  C CB  . TYR A 1 121 ? 7.075  19.891 16.454  1.00 43.80 ? 127 TYR A CB  1 
ATOM   725  C CG  . TYR A 1 121 ? 7.602  20.086 17.852  1.00 46.13 ? 127 TYR A CG  1 
ATOM   726  C CD1 . TYR A 1 121 ? 8.405  21.181 18.165  1.00 46.76 ? 127 TYR A CD1 1 
ATOM   727  C CD2 . TYR A 1 121 ? 7.291  19.180 18.867  1.00 47.47 ? 127 TYR A CD2 1 
ATOM   728  C CE1 . TYR A 1 121 ? 8.890  21.371 19.458  1.00 48.97 ? 127 TYR A CE1 1 
ATOM   729  C CE2 . TYR A 1 121 ? 7.768  19.362 20.165  1.00 48.87 ? 127 TYR A CE2 1 
ATOM   730  C CZ  . TYR A 1 121 ? 8.566  20.460 20.451  1.00 49.23 ? 127 TYR A CZ  1 
ATOM   731  O OH  . TYR A 1 121 ? 9.033  20.654 21.730  1.00 50.81 ? 127 TYR A OH  1 
ATOM   732  N N   . LEU A 1 122 ? 6.137  21.904 14.018  1.00 36.01 ? 128 LEU A N   1 
ATOM   733  C CA  . LEU A 1 122 ? 6.135  22.056 12.571  1.00 33.10 ? 128 LEU A CA  1 
ATOM   734  C C   . LEU A 1 122 ? 7.546  21.644 12.175  1.00 32.94 ? 128 LEU A C   1 
ATOM   735  O O   . LEU A 1 122 ? 8.522  22.075 12.795  1.00 31.96 ? 128 LEU A O   1 
ATOM   736  C CB  . LEU A 1 122 ? 5.893  23.508 12.160  1.00 32.24 ? 128 LEU A CB  1 
ATOM   737  C CG  . LEU A 1 122 ? 6.294  23.880 10.722  1.00 30.62 ? 128 LEU A CG  1 
ATOM   738  C CD1 . LEU A 1 122 ? 5.446  23.131 9.703   1.00 30.53 ? 128 LEU A CD1 1 
ATOM   739  C CD2 . LEU A 1 122 ? 6.132  25.375 10.541  1.00 31.26 ? 128 LEU A CD2 1 
ATOM   740  N N   . ASN A 1 123 ? 7.654  20.792 11.165  1.00 31.15 ? 129 ASN A N   1 
ATOM   741  C CA  . ASN A 1 123 ? 8.954  20.323 10.707  1.00 30.88 ? 129 ASN A CA  1 
ATOM   742  C C   . ASN A 1 123 ? 9.184  20.781 9.277   1.00 30.09 ? 129 ASN A C   1 
ATOM   743  O O   . ASN A 1 123 ? 8.423  20.433 8.374   1.00 29.25 ? 129 ASN A O   1 
ATOM   744  C CB  . ASN A 1 123 ? 9.016  18.792 10.781  1.00 30.96 ? 129 ASN A CB  1 
ATOM   745  C CG  . ASN A 1 123 ? 9.006  18.271 12.209  1.00 33.09 ? 129 ASN A CG  1 
ATOM   746  O OD1 . ASN A 1 123 ? 10.062 18.071 12.815  1.00 34.49 ? 129 ASN A OD1 1 
ATOM   747  N ND2 . ASN A 1 123 ? 7.812  18.057 12.759  1.00 30.84 ? 129 ASN A ND2 1 
ATOM   748  N N   . LEU A 1 124 ? 10.229 21.576 9.068   1.00 29.24 ? 130 LEU A N   1 
ATOM   749  C CA  . LEU A 1 124 ? 10.539 22.060 7.728   1.00 28.77 ? 130 LEU A CA  1 
ATOM   750  C C   . LEU A 1 124 ? 11.678 21.228 7.163   1.00 28.37 ? 130 LEU A C   1 
ATOM   751  O O   . LEU A 1 124 ? 12.760 21.176 7.750   1.00 27.43 ? 130 LEU A O   1 
ATOM   752  C CB  . LEU A 1 124 ? 10.941 23.538 7.774   1.00 30.12 ? 130 LEU A CB  1 
ATOM   753  C CG  . LEU A 1 124 ? 9.897  24.484 8.377   1.00 32.05 ? 130 LEU A CG  1 
ATOM   754  C CD1 . LEU A 1 124 ? 10.467 25.883 8.466   1.00 33.82 ? 130 LEU A CD1 1 
ATOM   755  C CD2 . LEU A 1 124 ? 8.631  24.470 7.521   1.00 31.46 ? 130 LEU A CD2 1 
ATOM   756  N N   . VAL A 1 125 ? 11.429 20.554 6.043   1.00 27.20 ? 131 VAL A N   1 
ATOM   757  C CA  . VAL A 1 125 ? 12.462 19.739 5.423   1.00 27.64 ? 131 VAL A CA  1 
ATOM   758  C C   . VAL A 1 125 ? 13.083 20.584 4.327   1.00 27.96 ? 131 VAL A C   1 
ATOM   759  O O   . VAL A 1 125 ? 12.452 20.891 3.315   1.00 25.26 ? 131 VAL A O   1 
ATOM   760  C CB  . VAL A 1 125 ? 11.900 18.435 4.838   1.00 29.54 ? 131 VAL A CB  1 
ATOM   761  C CG1 . VAL A 1 125 ? 13.035 17.589 4.279   1.00 28.92 ? 131 VAL A CG1 1 
ATOM   762  C CG2 . VAL A 1 125 ? 11.167 17.657 5.930   1.00 28.81 ? 131 VAL A CG2 1 
ATOM   763  N N   . LEU A 1 126 ? 14.337 20.957 4.556   1.00 27.78 ? 132 LEU A N   1 
ATOM   764  C CA  . LEU A 1 126 ? 15.086 21.815 3.651   1.00 25.78 ? 132 LEU A CA  1 
ATOM   765  C C   . LEU A 1 126 ? 16.280 21.119 3.017   1.00 27.00 ? 132 LEU A C   1 
ATOM   766  O O   . LEU A 1 126 ? 16.688 20.048 3.460   1.00 26.10 ? 132 LEU A O   1 
ATOM   767  C CB  . LEU A 1 126 ? 15.590 23.016 4.447   1.00 27.65 ? 132 LEU A CB  1 
ATOM   768  C CG  . LEU A 1 126 ? 14.508 23.753 5.235   1.00 29.48 ? 132 LEU A CG  1 
ATOM   769  C CD1 . LEU A 1 126 ? 15.098 24.399 6.478   1.00 31.80 ? 132 LEU A CD1 1 
ATOM   770  C CD2 . LEU A 1 126 ? 13.854 24.776 4.330   1.00 29.32 ? 132 LEU A CD2 1 
ATOM   771  N N   . ASP A 1 127 ? 16.836 21.732 1.973   1.00 26.98 ? 133 ASP A N   1 
ATOM   772  C CA  . ASP A 1 127 ? 18.034 21.173 1.356   1.00 29.46 ? 133 ASP A CA  1 
ATOM   773  C C   . ASP A 1 127 ? 19.106 21.311 2.428   1.00 28.57 ? 133 ASP A C   1 
ATOM   774  O O   . ASP A 1 127 ? 19.104 22.277 3.192   1.00 27.53 ? 133 ASP A O   1 
ATOM   775  C CB  . ASP A 1 127 ? 18.512 21.994 0.159   1.00 30.25 ? 133 ASP A CB  1 
ATOM   776  C CG  . ASP A 1 127 ? 17.698 21.763 -1.094  1.00 35.23 ? 133 ASP A CG  1 
ATOM   777  O OD1 . ASP A 1 127 ? 17.257 20.615 -1.337  1.00 33.22 ? 133 ASP A OD1 1 
ATOM   778  O OD2 . ASP A 1 127 ? 17.530 22.748 -1.847  1.00 37.79 ? 133 ASP A OD2 1 
ATOM   779  N N   . TYR A 1 128 ? 20.012 20.348 2.491   1.00 29.14 ? 134 TYR A N   1 
ATOM   780  C CA  . TYR A 1 128 ? 21.106 20.421 3.443   1.00 28.58 ? 134 TYR A CA  1 
ATOM   781  C C   . TYR A 1 128 ? 22.329 20.946 2.679   1.00 27.86 ? 134 TYR A C   1 
ATOM   782  O O   . TYR A 1 128 ? 22.627 20.469 1.582   1.00 26.18 ? 134 TYR A O   1 
ATOM   783  C CB  . TYR A 1 128 ? 21.409 19.035 4.015   1.00 30.25 ? 134 TYR A CB  1 
ATOM   784  C CG  . TYR A 1 128 ? 22.724 18.975 4.763   1.00 31.92 ? 134 TYR A CG  1 
ATOM   785  C CD1 . TYR A 1 128 ? 22.845 19.494 6.052   1.00 31.79 ? 134 TYR A CD1 1 
ATOM   786  C CD2 . TYR A 1 128 ? 23.858 18.435 4.158   1.00 31.34 ? 134 TYR A CD2 1 
ATOM   787  C CE1 . TYR A 1 128 ? 24.070 19.478 6.722   1.00 32.82 ? 134 TYR A CE1 1 
ATOM   788  C CE2 . TYR A 1 128 ? 25.085 18.416 4.816   1.00 32.93 ? 134 TYR A CE2 1 
ATOM   789  C CZ  . TYR A 1 128 ? 25.183 18.937 6.092   1.00 32.42 ? 134 TYR A CZ  1 
ATOM   790  O OH  . TYR A 1 128 ? 26.398 18.922 6.734   1.00 34.37 ? 134 TYR A OH  1 
ATOM   791  N N   . VAL A 1 129 ? 23.008 21.946 3.238   1.00 26.24 ? 135 VAL A N   1 
ATOM   792  C CA  . VAL A 1 129 ? 24.212 22.494 2.614   1.00 25.20 ? 135 VAL A CA  1 
ATOM   793  C C   . VAL A 1 129 ? 25.322 22.253 3.646   1.00 25.79 ? 135 VAL A C   1 
ATOM   794  O O   . VAL A 1 129 ? 25.165 22.573 4.822   1.00 24.50 ? 135 VAL A O   1 
ATOM   795  C CB  . VAL A 1 129 ? 24.063 23.998 2.311   1.00 25.84 ? 135 VAL A CB  1 
ATOM   796  C CG1 . VAL A 1 129 ? 25.266 24.494 1.509   1.00 24.32 ? 135 VAL A CG1 1 
ATOM   797  C CG2 . VAL A 1 129 ? 22.793 24.237 1.500   1.00 26.63 ? 135 VAL A CG2 1 
ATOM   798  N N   . PRO A 1 130 ? 26.456 21.680 3.213   1.00 26.06 ? 136 PRO A N   1 
ATOM   799  C CA  . PRO A 1 130 ? 27.592 21.372 4.093   1.00 26.16 ? 136 PRO A CA  1 
ATOM   800  C C   . PRO A 1 130 ? 28.168 22.448 5.007   1.00 25.03 ? 136 PRO A C   1 
ATOM   801  O O   . PRO A 1 130 ? 28.371 22.206 6.189   1.00 27.23 ? 136 PRO A O   1 
ATOM   802  C CB  . PRO A 1 130 ? 28.645 20.834 3.123   1.00 26.69 ? 136 PRO A CB  1 
ATOM   803  C CG  . PRO A 1 130 ? 27.821 20.249 2.014   1.00 28.58 ? 136 PRO A CG  1 
ATOM   804  C CD  . PRO A 1 130 ? 26.773 21.319 1.820   1.00 26.85 ? 136 PRO A CD  1 
ATOM   805  N N   . GLU A 1 131 ? 28.432 23.631 4.474   1.00 24.64 ? 137 GLU A N   1 
ATOM   806  C CA  . GLU A 1 131 ? 29.049 24.691 5.270   1.00 25.99 ? 137 GLU A CA  1 
ATOM   807  C C   . GLU A 1 131 ? 28.266 25.993 5.380   1.00 27.40 ? 137 GLU A C   1 
ATOM   808  O O   . GLU A 1 131 ? 27.175 26.129 4.833   1.00 26.94 ? 137 GLU A O   1 
ATOM   809  C CB  . GLU A 1 131 ? 30.427 25.012 4.675   1.00 28.32 ? 137 GLU A CB  1 
ATOM   810  C CG  . GLU A 1 131 ? 31.490 23.949 4.919   1.00 30.67 ? 137 GLU A CG  1 
ATOM   811  C CD  . GLU A 1 131 ? 31.859 23.842 6.382   1.00 34.36 ? 137 GLU A CD  1 
ATOM   812  O OE1 . GLU A 1 131 ? 31.556 24.794 7.136   1.00 33.95 ? 137 GLU A OE1 1 
ATOM   813  O OE2 . GLU A 1 131 ? 32.460 22.817 6.777   1.00 36.45 ? 137 GLU A OE2 1 
ATOM   814  N N   . THR A 1 132 ? 28.847 26.950 6.102   1.00 27.02 ? 138 THR A N   1 
ATOM   815  C CA  . THR A 1 132 ? 28.262 28.278 6.251   1.00 27.47 ? 138 THR A CA  1 
ATOM   816  C C   . THR A 1 132 ? 29.408 29.272 6.114   1.00 28.01 ? 138 THR A C   1 
ATOM   817  O O   . THR A 1 132 ? 30.569 28.924 6.341   1.00 27.96 ? 138 THR A O   1 
ATOM   818  C CB  . THR A 1 132 ? 27.595 28.498 7.630   1.00 27.19 ? 138 THR A CB  1 
ATOM   819  O OG1 . THR A 1 132 ? 28.597 28.563 8.653   1.00 28.87 ? 138 THR A OG1 1 
ATOM   820  C CG2 . THR A 1 132 ? 26.622 27.369 7.943   1.00 26.35 ? 138 THR A CG2 1 
ATOM   821  N N   . VAL A 1 133 ? 29.088 30.505 5.746   1.00 27.52 ? 139 VAL A N   1 
ATOM   822  C CA  . VAL A 1 133 ? 30.112 31.529 5.602   1.00 28.32 ? 139 VAL A CA  1 
ATOM   823  C C   . VAL A 1 133 ? 30.772 31.761 6.957   1.00 29.59 ? 139 VAL A C   1 
ATOM   824  O O   . VAL A 1 133 ? 31.960 32.064 7.036   1.00 29.98 ? 139 VAL A O   1 
ATOM   825  C CB  . VAL A 1 133 ? 29.508 32.851 5.092   1.00 28.01 ? 139 VAL A CB  1 
ATOM   826  C CG1 . VAL A 1 133 ? 30.508 33.990 5.256   1.00 27.16 ? 139 VAL A CG1 1 
ATOM   827  C CG2 . VAL A 1 133 ? 29.113 32.695 3.639   1.00 25.77 ? 139 VAL A CG2 1 
ATOM   828  N N   . TYR A 1 134 ? 29.994 31.614 8.021   1.00 29.68 ? 140 TYR A N   1 
ATOM   829  C CA  . TYR A 1 134 ? 30.512 31.796 9.374   1.00 30.50 ? 140 TYR A CA  1 
ATOM   830  C C   . TYR A 1 134 ? 31.658 30.820 9.650   1.00 30.68 ? 140 TYR A C   1 
ATOM   831  O O   . TYR A 1 134 ? 32.753 31.230 10.045  1.00 31.04 ? 140 TYR A O   1 
ATOM   832  C CB  . TYR A 1 134 ? 29.402 31.555 10.398  1.00 30.91 ? 140 TYR A CB  1 
ATOM   833  C CG  . TYR A 1 134 ? 29.864 31.654 11.831  1.00 33.42 ? 140 TYR A CG  1 
ATOM   834  C CD1 . TYR A 1 134 ? 30.074 32.891 12.431  1.00 34.87 ? 140 TYR A CD1 1 
ATOM   835  C CD2 . TYR A 1 134 ? 30.099 30.506 12.587  1.00 35.52 ? 140 TYR A CD2 1 
ATOM   836  C CE1 . TYR A 1 134 ? 30.505 32.989 13.753  1.00 38.27 ? 140 TYR A CE1 1 
ATOM   837  C CE2 . TYR A 1 134 ? 30.535 30.589 13.911  1.00 37.63 ? 140 TYR A CE2 1 
ATOM   838  C CZ  . TYR A 1 134 ? 30.734 31.835 14.487  1.00 39.04 ? 140 TYR A CZ  1 
ATOM   839  O OH  . TYR A 1 134 ? 31.160 31.933 15.792  1.00 39.99 ? 140 TYR A OH  1 
ATOM   840  N N   . ARG A 1 135 ? 31.390 29.532 9.451   1.00 29.19 ? 141 ARG A N   1 
ATOM   841  C CA  . ARG A 1 135 ? 32.381 28.486 9.684   1.00 30.66 ? 141 ARG A CA  1 
ATOM   842  C C   . ARG A 1 135 ? 33.613 28.636 8.795   1.00 30.37 ? 141 ARG A C   1 
ATOM   843  O O   . ARG A 1 135 ? 34.732 28.516 9.275   1.00 29.88 ? 141 ARG A O   1 
ATOM   844  C CB  . ARG A 1 135 ? 31.752 27.105 9.474   1.00 30.42 ? 141 ARG A CB  1 
ATOM   845  C CG  . ARG A 1 135 ? 30.749 26.713 10.560  1.00 32.46 ? 141 ARG A CG  1 
ATOM   846  C CD  . ARG A 1 135 ? 29.846 25.591 10.091  1.00 32.49 ? 141 ARG A CD  1 
ATOM   847  N NE  . ARG A 1 135 ? 30.595 24.415 9.654   1.00 36.18 ? 141 ARG A NE  1 
ATOM   848  C CZ  . ARG A 1 135 ? 30.925 23.396 10.443  1.00 39.04 ? 141 ARG A CZ  1 
ATOM   849  N NH1 . ARG A 1 135 ? 30.572 23.397 11.725  1.00 37.14 ? 141 ARG A NH1 1 
ATOM   850  N NH2 . ARG A 1 135 ? 31.607 22.370 9.948   1.00 41.32 ? 141 ARG A NH2 1 
ATOM   851  N N   . VAL A 1 136 ? 33.408 28.898 7.509   1.00 31.08 ? 142 VAL A N   1 
ATOM   852  C CA  . VAL A 1 136 ? 34.529 29.064 6.580   1.00 32.03 ? 142 VAL A CA  1 
ATOM   853  C C   . VAL A 1 136 ? 35.399 30.270 6.933   1.00 33.17 ? 142 VAL A C   1 
ATOM   854  O O   . VAL A 1 136 ? 36.628 30.178 6.921   1.00 33.08 ? 142 VAL A O   1 
ATOM   855  C CB  . VAL A 1 136 ? 34.039 29.211 5.119   1.00 31.91 ? 142 VAL A CB  1 
ATOM   856  C CG1 . VAL A 1 136 ? 35.190 29.643 4.213   1.00 31.46 ? 142 VAL A CG1 1 
ATOM   857  C CG2 . VAL A 1 136 ? 33.474 27.883 4.631   1.00 33.24 ? 142 VAL A CG2 1 
ATOM   858  N N   . ALA A 1 137 ? 34.762 31.395 7.246   1.00 32.60 ? 143 ALA A N   1 
ATOM   859  C CA  . ALA A 1 137 ? 35.487 32.609 7.605   1.00 33.70 ? 143 ALA A CA  1 
ATOM   860  C C   . ALA A 1 137 ? 36.278 32.377 8.890   1.00 35.21 ? 143 ALA A C   1 
ATOM   861  O O   . ALA A 1 137 ? 37.389 32.884 9.049   1.00 34.24 ? 143 ALA A O   1 
ATOM   862  C CB  . ALA A 1 137 ? 34.511 33.771 7.793   1.00 33.56 ? 143 ALA A CB  1 
ATOM   863  N N   . ARG A 1 138 ? 35.696 31.609 9.802   1.00 35.94 ? 144 ARG A N   1 
ATOM   864  C CA  . ARG A 1 138 ? 36.343 31.300 11.071  1.00 38.66 ? 144 ARG A CA  1 
ATOM   865  C C   . ARG A 1 138 ? 37.624 30.500 10.788  1.00 38.68 ? 144 ARG A C   1 
ATOM   866  O O   . ARG A 1 138 ? 38.649 30.708 11.434  1.00 37.59 ? 144 ARG A O   1 
ATOM   867  C CB  . ARG A 1 138 ? 35.380 30.498 11.949  1.00 40.35 ? 144 ARG A CB  1 
ATOM   868  C CG  . ARG A 1 138 ? 35.800 30.308 13.401  1.00 44.58 ? 144 ARG A CG  1 
ATOM   869  C CD  . ARG A 1 138 ? 34.696 29.569 14.169  1.00 47.20 ? 144 ARG A CD  1 
ATOM   870  N NE  . ARG A 1 138 ? 34.429 28.247 13.597  1.00 49.79 ? 144 ARG A NE  1 
ATOM   871  C CZ  . ARG A 1 138 ? 33.327 27.534 13.820  1.00 51.08 ? 144 ARG A CZ  1 
ATOM   872  N NH1 . ARG A 1 138 ? 32.370 28.010 14.606  1.00 52.56 ? 144 ARG A NH1 1 
ATOM   873  N NH2 . ARG A 1 138 ? 33.181 26.339 13.260  1.00 51.01 ? 144 ARG A NH2 1 
ATOM   874  N N   . HIS A 1 139 ? 37.562 29.590 9.820   1.00 39.22 ? 145 HIS A N   1 
ATOM   875  C CA  . HIS A 1 139 ? 38.736 28.799 9.462   1.00 39.85 ? 145 HIS A CA  1 
ATOM   876  C C   . HIS A 1 139 ? 39.876 29.725 9.056   1.00 39.18 ? 145 HIS A C   1 
ATOM   877  O O   . HIS A 1 139 ? 40.985 29.630 9.586   1.00 39.86 ? 145 HIS A O   1 
ATOM   878  C CB  . HIS A 1 139 ? 38.441 27.854 8.296   1.00 42.10 ? 145 HIS A CB  1 
ATOM   879  C CG  . HIS A 1 139 ? 39.677 27.360 7.603   1.00 45.80 ? 145 HIS A CG  1 
ATOM   880  N ND1 . HIS A 1 139 ? 40.434 26.310 8.079   1.00 46.65 ? 145 HIS A ND1 1 
ATOM   881  C CD2 . HIS A 1 139 ? 40.331 27.827 6.511   1.00 46.73 ? 145 HIS A CD2 1 
ATOM   882  C CE1 . HIS A 1 139 ? 41.499 26.152 7.313   1.00 46.73 ? 145 HIS A CE1 1 
ATOM   883  N NE2 . HIS A 1 139 ? 41.461 27.061 6.354   1.00 47.60 ? 145 HIS A NE2 1 
ATOM   884  N N   . TYR A 1 140 ? 39.612 30.615 8.106   1.00 36.81 ? 146 TYR A N   1 
ATOM   885  C CA  . TYR A 1 140 ? 40.648 31.531 7.657   1.00 36.43 ? 146 TYR A CA  1 
ATOM   886  C C   . TYR A 1 140 ? 41.131 32.434 8.780   1.00 39.08 ? 146 TYR A C   1 
ATOM   887  O O   . TYR A 1 140 ? 42.336 32.612 8.970   1.00 39.22 ? 146 TYR A O   1 
ATOM   888  C CB  . TYR A 1 140 ? 40.155 32.370 6.479   1.00 33.06 ? 146 TYR A CB  1 
ATOM   889  C CG  . TYR A 1 140 ? 40.090 31.585 5.192   1.00 31.79 ? 146 TYR A CG  1 
ATOM   890  C CD1 . TYR A 1 140 ? 38.952 30.848 4.852   1.00 30.43 ? 146 TYR A CD1 1 
ATOM   891  C CD2 . TYR A 1 140 ? 41.190 31.538 4.333   1.00 29.45 ? 146 TYR A CD2 1 
ATOM   892  C CE1 . TYR A 1 140 ? 38.912 30.080 3.682   1.00 29.09 ? 146 TYR A CE1 1 
ATOM   893  C CE2 . TYR A 1 140 ? 41.165 30.778 3.169   1.00 29.64 ? 146 TYR A CE2 1 
ATOM   894  C CZ  . TYR A 1 140 ? 40.030 30.053 2.848   1.00 30.54 ? 146 TYR A CZ  1 
ATOM   895  O OH  . TYR A 1 140 ? 40.019 29.304 1.699   1.00 29.64 ? 146 TYR A OH  1 
ATOM   896  N N   . SER A 1 141 ? 40.187 32.997 9.526   1.00 40.22 ? 147 SER A N   1 
ATOM   897  C CA  . SER A 1 141 ? 40.506 33.883 10.637  1.00 43.22 ? 147 SER A CA  1 
ATOM   898  C C   . SER A 1 141 ? 41.503 33.223 11.590  1.00 44.82 ? 147 SER A C   1 
ATOM   899  O O   . SER A 1 141 ? 42.481 33.843 12.014  1.00 45.50 ? 147 SER A O   1 
ATOM   900  C CB  . SER A 1 141 ? 39.226 34.245 11.394  1.00 42.99 ? 147 SER A CB  1 
ATOM   901  O OG  . SER A 1 141 ? 39.519 35.030 12.533  1.00 47.35 ? 147 SER A OG  1 
ATOM   902  N N   . ARG A 1 142 ? 41.250 31.961 11.918  1.00 46.35 ? 148 ARG A N   1 
ATOM   903  C CA  . ARG A 1 142 ? 42.120 31.215 12.814  1.00 48.20 ? 148 ARG A CA  1 
ATOM   904  C C   . ARG A 1 142 ? 43.482 30.938 12.183  1.00 48.54 ? 148 ARG A C   1 
ATOM   905  O O   . ARG A 1 142 ? 44.504 30.961 12.869  1.00 49.08 ? 148 ARG A O   1 
ATOM   906  C CB  . ARG A 1 142 ? 41.448 29.902 13.217  1.00 49.36 ? 148 ARG A CB  1 
ATOM   907  C CG  . ARG A 1 142 ? 40.245 30.110 14.117  1.00 53.16 ? 148 ARG A CG  1 
ATOM   908  C CD  . ARG A 1 142 ? 39.494 28.820 14.396  1.00 56.22 ? 148 ARG A CD  1 
ATOM   909  N NE  . ARG A 1 142 ? 38.365 29.054 15.295  1.00 59.16 ? 148 ARG A NE  1 
ATOM   910  C CZ  . ARG A 1 142 ? 37.460 28.134 15.618  1.00 61.60 ? 148 ARG A CZ  1 
ATOM   911  N NH1 . ARG A 1 142 ? 37.547 26.909 15.113  1.00 62.74 ? 148 ARG A NH1 1 
ATOM   912  N NH2 . ARG A 1 142 ? 36.467 28.439 16.446  1.00 61.51 ? 148 ARG A NH2 1 
ATOM   913  N N   . ALA A 1 143 ? 43.493 30.685 10.877  1.00 48.63 ? 149 ALA A N   1 
ATOM   914  C CA  . ALA A 1 143 ? 44.731 30.405 10.154  1.00 48.43 ? 149 ALA A CA  1 
ATOM   915  C C   . ALA A 1 143 ? 45.509 31.684 9.868   1.00 48.79 ? 149 ALA A C   1 
ATOM   916  O O   . ALA A 1 143 ? 46.479 31.677 9.108   1.00 49.51 ? 149 ALA A O   1 
ATOM   917  C CB  . ALA A 1 143 ? 44.421 29.688 8.849   1.00 48.12 ? 149 ALA A CB  1 
ATOM   918  N N   . LYS A 1 144 ? 45.080 32.783 10.479  1.00 48.88 ? 150 LYS A N   1 
ATOM   919  C CA  . LYS A 1 144 ? 45.734 34.070 10.289  1.00 49.94 ? 150 LYS A CA  1 
ATOM   920  C C   . LYS A 1 144 ? 45.737 34.436 8.803   1.00 50.57 ? 150 LYS A C   1 
ATOM   921  O O   . LYS A 1 144 ? 46.665 35.077 8.307   1.00 50.57 ? 150 LYS A O   1 
ATOM   922  C CB  . LYS A 1 144 ? 47.174 34.008 10.812  1.00 51.76 ? 150 LYS A CB  1 
ATOM   923  C CG  . LYS A 1 144 ? 47.330 33.262 12.135  1.00 53.62 ? 150 LYS A CG  1 
ATOM   924  C CD  . LYS A 1 144 ? 47.788 34.170 13.277  1.00 56.07 ? 150 LYS A CD  1 
ATOM   925  C CE  . LYS A 1 144 ? 46.690 35.127 13.724  1.00 57.19 ? 150 LYS A CE  1 
ATOM   926  N NZ  . LYS A 1 144 ? 47.124 35.972 14.875  1.00 57.28 ? 150 LYS A NZ  1 
ATOM   927  N N   . GLN A 1 145 ? 44.694 34.020 8.092   1.00 50.09 ? 151 GLN A N   1 
ATOM   928  C CA  . GLN A 1 145 ? 44.588 34.312 6.669   1.00 49.85 ? 151 GLN A CA  1 
ATOM   929  C C   . GLN A 1 145 ? 43.201 34.818 6.334   1.00 48.73 ? 151 GLN A C   1 
ATOM   930  O O   . GLN A 1 145 ? 42.280 34.728 7.146   1.00 48.54 ? 151 GLN A O   1 
ATOM   931  C CB  . GLN A 1 145 ? 44.865 33.061 5.841   1.00 51.32 ? 151 GLN A CB  1 
ATOM   932  C CG  . GLN A 1 145 ? 46.182 32.397 6.150   1.00 55.57 ? 151 GLN A CG  1 
ATOM   933  C CD  . GLN A 1 145 ? 46.527 31.322 5.151   1.00 57.20 ? 151 GLN A CD  1 
ATOM   934  O OE1 . GLN A 1 145 ? 45.733 30.412 4.899   1.00 58.49 ? 151 GLN A OE1 1 
ATOM   935  N NE2 . GLN A 1 145 ? 47.720 31.416 4.572   1.00 58.63 ? 151 GLN A NE2 1 
ATOM   936  N N   . THR A 1 146 ? 43.058 35.351 5.129   1.00 47.10 ? 152 THR A N   1 
ATOM   937  C CA  . THR A 1 146 ? 41.771 35.854 4.679   1.00 45.52 ? 152 THR A CA  1 
ATOM   938  C C   . THR A 1 146 ? 41.293 35.050 3.480   1.00 41.46 ? 152 THR A C   1 
ATOM   939  O O   . THR A 1 146 ? 42.089 34.507 2.715   1.00 40.21 ? 152 THR A O   1 
ATOM   940  C CB  . THR A 1 146 ? 41.844 37.349 4.291   1.00 47.36 ? 152 THR A CB  1 
ATOM   941  O OG1 . THR A 1 146 ? 42.969 37.569 3.431   1.00 48.65 ? 152 THR A OG1 1 
ATOM   942  C CG2 . THR A 1 146 ? 41.967 38.215 5.535   1.00 48.07 ? 152 THR A CG2 1 
ATOM   943  N N   . LEU A 1 147 ? 39.978 34.969 3.340   1.00 39.21 ? 153 LEU A N   1 
ATOM   944  C CA  . LEU A 1 147 ? 39.362 34.244 2.244   1.00 34.88 ? 153 LEU A CA  1 
ATOM   945  C C   . LEU A 1 147 ? 39.783 34.868 0.916   1.00 32.83 ? 153 LEU A C   1 
ATOM   946  O O   . LEU A 1 147 ? 39.734 36.086 0.759   1.00 32.17 ? 153 LEU A O   1 
ATOM   947  C CB  . LEU A 1 147 ? 37.839 34.317 2.387   1.00 34.83 ? 153 LEU A CB  1 
ATOM   948  C CG  . LEU A 1 147 ? 36.975 33.589 1.359   1.00 34.54 ? 153 LEU A CG  1 
ATOM   949  C CD1 . LEU A 1 147 ? 37.158 32.087 1.507   1.00 33.57 ? 153 LEU A CD1 1 
ATOM   950  C CD2 . LEU A 1 147 ? 35.507 33.970 1.566   1.00 35.30 ? 153 LEU A CD2 1 
ATOM   951  N N   . PRO A 1 148 ? 40.224 34.043 -0.052  1.00 31.84 ? 154 PRO A N   1 
ATOM   952  C CA  . PRO A 1 148 ? 40.629 34.591 -1.352  1.00 31.57 ? 154 PRO A CA  1 
ATOM   953  C C   . PRO A 1 148 ? 39.488 35.452 -1.903  1.00 32.14 ? 154 PRO A C   1 
ATOM   954  O O   . PRO A 1 148 ? 38.314 35.096 -1.778  1.00 29.39 ? 154 PRO A O   1 
ATOM   955  C CB  . PRO A 1 148 ? 40.875 33.338 -2.188  1.00 30.66 ? 154 PRO A CB  1 
ATOM   956  C CG  . PRO A 1 148 ? 41.435 32.388 -1.166  1.00 32.24 ? 154 PRO A CG  1 
ATOM   957  C CD  . PRO A 1 148 ? 40.508 32.599 0.022   1.00 31.20 ? 154 PRO A CD  1 
ATOM   958  N N   . VAL A 1 149 ? 39.839 36.579 -2.508  1.00 32.06 ? 155 VAL A N   1 
ATOM   959  C CA  . VAL A 1 149 ? 38.850 37.505 -3.043  1.00 32.90 ? 155 VAL A CA  1 
ATOM   960  C C   . VAL A 1 149 ? 37.875 36.900 -4.052  1.00 32.29 ? 155 VAL A C   1 
ATOM   961  O O   . VAL A 1 149 ? 36.733 37.352 -4.160  1.00 31.60 ? 155 VAL A O   1 
ATOM   962  C CB  . VAL A 1 149 ? 39.540 38.727 -3.680  1.00 34.79 ? 155 VAL A CB  1 
ATOM   963  C CG1 . VAL A 1 149 ? 40.332 38.302 -4.901  1.00 36.58 ? 155 VAL A CG1 1 
ATOM   964  C CG2 . VAL A 1 149 ? 38.504 39.775 -4.045  1.00 35.75 ? 155 VAL A CG2 1 
ATOM   965  N N   . ILE A 1 150 ? 38.311 35.886 -4.793  1.00 29.29 ? 156 ILE A N   1 
ATOM   966  C CA  . ILE A 1 150 ? 37.420 35.268 -5.760  1.00 28.96 ? 156 ILE A CA  1 
ATOM   967  C C   . ILE A 1 150 ? 36.201 34.691 -5.033  1.00 27.98 ? 156 ILE A C   1 
ATOM   968  O O   . ILE A 1 150 ? 35.091 34.736 -5.553  1.00 27.44 ? 156 ILE A O   1 
ATOM   969  C CB  . ILE A 1 150 ? 38.126 34.148 -6.566  1.00 29.54 ? 156 ILE A CB  1 
ATOM   970  C CG1 . ILE A 1 150 ? 37.142 33.525 -7.562  1.00 30.21 ? 156 ILE A CG1 1 
ATOM   971  C CG2 . ILE A 1 150 ? 38.669 33.087 -5.627  1.00 29.21 ? 156 ILE A CG2 1 
ATOM   972  C CD1 . ILE A 1 150 ? 36.506 34.523 -8.522  1.00 30.79 ? 156 ILE A CD1 1 
ATOM   973  N N   . TYR A 1 151 ? 36.411 34.152 -3.836  1.00 28.12 ? 157 TYR A N   1 
ATOM   974  C CA  . TYR A 1 151 ? 35.308 33.588 -3.060  1.00 27.94 ? 157 TYR A CA  1 
ATOM   975  C C   . TYR A 1 151 ? 34.441 34.703 -2.505  1.00 27.93 ? 157 TYR A C   1 
ATOM   976  O O   . TYR A 1 151 ? 33.225 34.570 -2.447  1.00 27.38 ? 157 TYR A O   1 
ATOM   977  C CB  . TYR A 1 151 ? 35.827 32.717 -1.915  1.00 29.46 ? 157 TYR A CB  1 
ATOM   978  C CG  . TYR A 1 151 ? 36.443 31.423 -2.383  1.00 32.44 ? 157 TYR A CG  1 
ATOM   979  C CD1 . TYR A 1 151 ? 37.773 31.120 -2.092  1.00 33.86 ? 157 TYR A CD1 1 
ATOM   980  C CD2 . TYR A 1 151 ? 35.703 30.505 -3.130  1.00 32.35 ? 157 TYR A CD2 1 
ATOM   981  C CE1 . TYR A 1 151 ? 38.355 29.938 -2.535  1.00 35.99 ? 157 TYR A CE1 1 
ATOM   982  C CE2 . TYR A 1 151 ? 36.276 29.316 -3.579  1.00 35.53 ? 157 TYR A CE2 1 
ATOM   983  C CZ  . TYR A 1 151 ? 37.608 29.042 -3.272  1.00 36.26 ? 157 TYR A CZ  1 
ATOM   984  O OH  . TYR A 1 151 ? 38.191 27.866 -3.681  1.00 38.05 ? 157 TYR A OH  1 
ATOM   985  N N   . VAL A 1 152 ? 35.065 35.801 -2.092  1.00 26.37 ? 158 VAL A N   1 
ATOM   986  C CA  . VAL A 1 152 ? 34.303 36.929 -1.578  1.00 26.70 ? 158 VAL A CA  1 
ATOM   987  C C   . VAL A 1 152 ? 33.355 37.396 -2.681  1.00 26.51 ? 158 VAL A C   1 
ATOM   988  O O   . VAL A 1 152 ? 32.183 37.685 -2.427  1.00 25.06 ? 158 VAL A O   1 
ATOM   989  C CB  . VAL A 1 152 ? 35.224 38.100 -1.172  1.00 28.03 ? 158 VAL A CB  1 
ATOM   990  C CG1 . VAL A 1 152 ? 34.378 39.288 -0.701  1.00 26.27 ? 158 VAL A CG1 1 
ATOM   991  C CG2 . VAL A 1 152 ? 36.171 37.649 -0.054  1.00 27.15 ? 158 VAL A CG2 1 
ATOM   992  N N   . LYS A 1 153 ? 33.870 37.462 -3.910  1.00 25.70 ? 159 LYS A N   1 
ATOM   993  C CA  . LYS A 1 153 ? 33.065 37.880 -5.052  1.00 24.52 ? 159 LYS A CA  1 
ATOM   994  C C   . LYS A 1 153 ? 31.926 36.891 -5.275  1.00 24.30 ? 159 LYS A C   1 
ATOM   995  O O   . LYS A 1 153 ? 30.773 37.283 -5.388  1.00 24.19 ? 159 LYS A O   1 
ATOM   996  C CB  . LYS A 1 153 ? 33.915 37.949 -6.325  1.00 27.30 ? 159 LYS A CB  1 
ATOM   997  C CG  . LYS A 1 153 ? 34.956 39.059 -6.331  1.00 28.20 ? 159 LYS A CG  1 
ATOM   998  C CD  . LYS A 1 153 ? 35.789 39.037 -7.609  1.00 28.73 ? 159 LYS A CD  1 
ATOM   999  C CE  . LYS A 1 153 ? 36.830 40.153 -7.607  1.00 30.34 ? 159 LYS A CE  1 
ATOM   1000 N NZ  . LYS A 1 153 ? 37.693 40.102 -8.827  1.00 32.57 ? 159 LYS A NZ  1 
ATOM   1001 N N   . LEU A 1 154 ? 32.261 35.607 -5.342  1.00 23.47 ? 160 LEU A N   1 
ATOM   1002 C CA  . LEU A 1 154 ? 31.255 34.575 -5.567  1.00 25.53 ? 160 LEU A CA  1 
ATOM   1003 C C   . LEU A 1 154 ? 30.150 34.563 -4.516  1.00 25.40 ? 160 LEU A C   1 
ATOM   1004 O O   . LEU A 1 154 ? 28.958 34.536 -4.848  1.00 25.23 ? 160 LEU A O   1 
ATOM   1005 C CB  . LEU A 1 154 ? 31.919 33.198 -5.610  1.00 24.64 ? 160 LEU A CB  1 
ATOM   1006 C CG  . LEU A 1 154 ? 32.679 32.852 -6.893  1.00 25.68 ? 160 LEU A CG  1 
ATOM   1007 C CD1 . LEU A 1 154 ? 33.538 31.619 -6.653  1.00 26.16 ? 160 LEU A CD1 1 
ATOM   1008 C CD2 . LEU A 1 154 ? 31.686 32.612 -8.025  1.00 27.38 ? 160 LEU A CD2 1 
ATOM   1009 N N   . TYR A 1 155 ? 30.548 34.570 -3.247  1.00 23.71 ? 161 TYR A N   1 
ATOM   1010 C CA  . TYR A 1 155 ? 29.585 34.525 -2.152  1.00 23.85 ? 161 TYR A CA  1 
ATOM   1011 C C   . TYR A 1 155 ? 28.688 35.749 -2.067  1.00 23.70 ? 161 TYR A C   1 
ATOM   1012 O O   . TYR A 1 155 ? 27.467 35.624 -1.933  1.00 23.48 ? 161 TYR A O   1 
ATOM   1013 C CB  . TYR A 1 155 ? 30.327 34.328 -0.825  1.00 24.72 ? 161 TYR A CB  1 
ATOM   1014 C CG  . TYR A 1 155 ? 31.097 33.026 -0.758  1.00 26.78 ? 161 TYR A CG  1 
ATOM   1015 C CD1 . TYR A 1 155 ? 32.073 32.815 0.219   1.00 27.76 ? 161 TYR A CD1 1 
ATOM   1016 C CD2 . TYR A 1 155 ? 30.855 32.006 -1.679  1.00 28.54 ? 161 TYR A CD2 1 
ATOM   1017 C CE1 . TYR A 1 155 ? 32.788 31.620 0.271   1.00 29.93 ? 161 TYR A CE1 1 
ATOM   1018 C CE2 . TYR A 1 155 ? 31.561 30.814 -1.634  1.00 31.01 ? 161 TYR A CE2 1 
ATOM   1019 C CZ  . TYR A 1 155 ? 32.524 30.626 -0.658  1.00 31.22 ? 161 TYR A CZ  1 
ATOM   1020 O OH  . TYR A 1 155 ? 33.210 29.434 -0.618  1.00 35.26 ? 161 TYR A OH  1 
ATOM   1021 N N   . MET A 1 156 ? 29.287 36.930 -2.152  1.00 22.62 ? 162 MET A N   1 
ATOM   1022 C CA  . MET A 1 156 ? 28.524 38.165 -2.055  1.00 22.86 ? 162 MET A CA  1 
ATOM   1023 C C   . MET A 1 156 ? 27.589 38.376 -3.246  1.00 23.00 ? 162 MET A C   1 
ATOM   1024 O O   . MET A 1 156 ? 26.461 38.832 -3.082  1.00 24.47 ? 162 MET A O   1 
ATOM   1025 C CB  . MET A 1 156 ? 29.470 39.354 -1.906  1.00 22.28 ? 162 MET A CB  1 
ATOM   1026 C CG  . MET A 1 156 ? 30.239 39.363 -0.580  1.00 24.43 ? 162 MET A CG  1 
ATOM   1027 S SD  . MET A 1 156 ? 29.167 39.325 0.875   1.00 28.06 ? 162 MET A SD  1 
ATOM   1028 C CE  . MET A 1 156 ? 28.109 40.779 0.548   1.00 26.84 ? 162 MET A CE  1 
ATOM   1029 N N   . TYR A 1 157 ? 28.060 38.049 -4.442  1.00 21.84 ? 163 TYR A N   1 
ATOM   1030 C CA  . TYR A 1 157 ? 27.235 38.195 -5.637  1.00 21.90 ? 163 TYR A CA  1 
ATOM   1031 C C   . TYR A 1 157 ? 25.971 37.353 -5.488  1.00 22.70 ? 163 TYR A C   1 
ATOM   1032 O O   . TYR A 1 157 ? 24.854 37.816 -5.755  1.00 22.39 ? 163 TYR A O   1 
ATOM   1033 C CB  . TYR A 1 157 ? 28.006 37.723 -6.873  1.00 20.96 ? 163 TYR A CB  1 
ATOM   1034 C CG  . TYR A 1 157 ? 27.166 37.704 -8.131  1.00 23.83 ? 163 TYR A CG  1 
ATOM   1035 C CD1 . TYR A 1 157 ? 27.077 38.826 -8.950  1.00 22.87 ? 163 TYR A CD1 1 
ATOM   1036 C CD2 . TYR A 1 157 ? 26.474 36.552 -8.512  1.00 25.15 ? 163 TYR A CD2 1 
ATOM   1037 C CE1 . TYR A 1 157 ? 26.326 38.804 -10.131 1.00 24.55 ? 163 TYR A CE1 1 
ATOM   1038 C CE2 . TYR A 1 157 ? 25.714 36.519 -9.694  1.00 24.29 ? 163 TYR A CE2 1 
ATOM   1039 C CZ  . TYR A 1 157 ? 25.653 37.648 -10.498 1.00 26.14 ? 163 TYR A CZ  1 
ATOM   1040 O OH  . TYR A 1 157 ? 24.951 37.610 -11.688 1.00 24.31 ? 163 TYR A OH  1 
ATOM   1041 N N   . GLN A 1 158 ? 26.149 36.109 -5.062  1.00 20.94 ? 164 GLN A N   1 
ATOM   1042 C CA  . GLN A 1 158 ? 25.015 35.218 -4.889  1.00 22.36 ? 164 GLN A CA  1 
ATOM   1043 C C   . GLN A 1 158 ? 24.095 35.681 -3.758  1.00 23.29 ? 164 GLN A C   1 
ATOM   1044 O O   . GLN A 1 158 ? 22.883 35.498 -3.822  1.00 20.96 ? 164 GLN A O   1 
ATOM   1045 C CB  . GLN A 1 158 ? 25.509 33.800 -4.634  1.00 22.93 ? 164 GLN A CB  1 
ATOM   1046 C CG  . GLN A 1 158 ? 26.249 33.209 -5.832  1.00 22.39 ? 164 GLN A CG  1 
ATOM   1047 C CD  . GLN A 1 158 ? 26.740 31.823 -5.546  1.00 23.00 ? 164 GLN A CD  1 
ATOM   1048 O OE1 . GLN A 1 158 ? 25.976 30.859 -5.606  1.00 25.17 ? 164 GLN A OE1 1 
ATOM   1049 N NE2 . GLN A 1 158 ? 28.015 31.710 -5.194  1.00 25.10 ? 164 GLN A NE2 1 
ATOM   1050 N N   . LEU A 1 159 ? 24.669 36.280 -2.720  1.00 21.69 ? 165 LEU A N   1 
ATOM   1051 C CA  . LEU A 1 159 ? 23.847 36.775 -1.620  1.00 21.67 ? 165 LEU A CA  1 
ATOM   1052 C C   . LEU A 1 159 ? 22.971 37.898 -2.178  1.00 21.33 ? 165 LEU A C   1 
ATOM   1053 O O   . LEU A 1 159 ? 21.776 37.975 -1.901  1.00 20.88 ? 165 LEU A O   1 
ATOM   1054 C CB  . LEU A 1 159 ? 24.733 37.312 -0.495  1.00 20.42 ? 165 LEU A CB  1 
ATOM   1055 C CG  . LEU A 1 159 ? 24.044 38.066 0.651   1.00 21.41 ? 165 LEU A CG  1 
ATOM   1056 C CD1 . LEU A 1 159 ? 22.889 37.245 1.209   1.00 20.49 ? 165 LEU A CD1 1 
ATOM   1057 C CD2 . LEU A 1 159 ? 25.081 38.357 1.749   1.00 19.77 ? 165 LEU A CD2 1 
ATOM   1058 N N   . PHE A 1 160 ? 23.570 38.769 -2.977  1.00 21.28 ? 166 PHE A N   1 
ATOM   1059 C CA  . PHE A 1 160 ? 22.810 39.862 -3.553  1.00 23.74 ? 166 PHE A CA  1 
ATOM   1060 C C   . PHE A 1 160 ? 21.715 39.369 -4.504  1.00 24.52 ? 166 PHE A C   1 
ATOM   1061 O O   . PHE A 1 160 ? 20.647 39.982 -4.589  1.00 24.24 ? 166 PHE A O   1 
ATOM   1062 C CB  . PHE A 1 160 ? 23.751 40.854 -4.233  1.00 23.66 ? 166 PHE A CB  1 
ATOM   1063 C CG  . PHE A 1 160 ? 24.497 41.732 -3.257  1.00 24.46 ? 166 PHE A CG  1 
ATOM   1064 C CD1 . PHE A 1 160 ? 23.798 42.488 -2.319  1.00 24.96 ? 166 PHE A CD1 1 
ATOM   1065 C CD2 . PHE A 1 160 ? 25.885 41.809 -3.277  1.00 26.09 ? 166 PHE A CD2 1 
ATOM   1066 C CE1 . PHE A 1 160 ? 24.472 43.313 -1.410  1.00 26.65 ? 166 PHE A CE1 1 
ATOM   1067 C CE2 . PHE A 1 160 ? 26.573 42.632 -2.372  1.00 26.80 ? 166 PHE A CE2 1 
ATOM   1068 C CZ  . PHE A 1 160 ? 25.863 43.383 -1.439  1.00 26.04 ? 166 PHE A CZ  1 
ATOM   1069 N N   . ARG A 1 161 ? 21.962 38.267 -5.210  1.00 24.42 ? 167 ARG A N   1 
ATOM   1070 C CA  . ARG A 1 161 ? 20.926 37.733 -6.092  1.00 24.39 ? 167 ARG A CA  1 
ATOM   1071 C C   . ARG A 1 161 ? 19.757 37.255 -5.217  1.00 23.78 ? 167 ARG A C   1 
ATOM   1072 O O   . ARG A 1 161 ? 18.597 37.525 -5.525  1.00 21.60 ? 167 ARG A O   1 
ATOM   1073 C CB  . ARG A 1 161 ? 21.441 36.551 -6.926  1.00 24.72 ? 167 ARG A CB  1 
ATOM   1074 C CG  . ARG A 1 161 ? 22.217 36.936 -8.176  1.00 28.25 ? 167 ARG A CG  1 
ATOM   1075 C CD  . ARG A 1 161 ? 22.338 35.742 -9.127  1.00 26.24 ? 167 ARG A CD  1 
ATOM   1076 N NE  . ARG A 1 161 ? 21.060 35.392 -9.740  1.00 25.39 ? 167 ARG A NE  1 
ATOM   1077 C CZ  . ARG A 1 161 ? 20.826 34.266 -10.409 1.00 28.54 ? 167 ARG A CZ  1 
ATOM   1078 N NH1 . ARG A 1 161 ? 21.786 33.356 -10.548 1.00 25.76 ? 167 ARG A NH1 1 
ATOM   1079 N NH2 . ARG A 1 161 ? 19.640 34.062 -10.972 1.00 27.31 ? 167 ARG A NH2 1 
ATOM   1080 N N   . SER A 1 162 ? 20.058 36.556 -4.121  1.00 22.05 ? 168 SER A N   1 
ATOM   1081 C CA  . SER A 1 162 ? 18.987 36.068 -3.253  1.00 22.96 ? 168 SER A CA  1 
ATOM   1082 C C   . SER A 1 162 ? 18.158 37.227 -2.694  1.00 23.14 ? 168 SER A C   1 
ATOM   1083 O O   . SER A 1 162 ? 16.940 37.115 -2.582  1.00 22.18 ? 168 SER A O   1 
ATOM   1084 C CB  . SER A 1 162 ? 19.540 35.203 -2.104  1.00 23.28 ? 168 SER A CB  1 
ATOM   1085 O OG  . SER A 1 162 ? 20.236 35.968 -1.138  1.00 20.22 ? 168 SER A OG  1 
ATOM   1086 N N   . LEU A 1 163 ? 18.806 38.346 -2.373  1.00 22.31 ? 169 LEU A N   1 
ATOM   1087 C CA  . LEU A 1 163 ? 18.087 39.499 -1.837  1.00 22.89 ? 169 LEU A CA  1 
ATOM   1088 C C   . LEU A 1 163 ? 17.259 40.189 -2.928  1.00 23.41 ? 169 LEU A C   1 
ATOM   1089 O O   . LEU A 1 163 ? 16.145 40.650 -2.673  1.00 24.01 ? 169 LEU A O   1 
ATOM   1090 C CB  . LEU A 1 163 ? 19.069 40.492 -1.198  1.00 21.40 ? 169 LEU A CB  1 
ATOM   1091 C CG  . LEU A 1 163 ? 19.830 39.969 0.040   1.00 21.20 ? 169 LEU A CG  1 
ATOM   1092 C CD1 . LEU A 1 163 ? 20.806 41.031 0.550   1.00 21.62 ? 169 LEU A CD1 1 
ATOM   1093 C CD2 . LEU A 1 163 ? 18.852 39.582 1.133   1.00 20.32 ? 169 LEU A CD2 1 
ATOM   1094 N N   . ALA A 1 164 ? 17.808 40.264 -4.136  1.00 24.32 ? 170 ALA A N   1 
ATOM   1095 C CA  . ALA A 1 164 ? 17.095 40.871 -5.259  1.00 24.44 ? 170 ALA A CA  1 
ATOM   1096 C C   . ALA A 1 164 ? 15.792 40.116 -5.436  1.00 24.88 ? 170 ALA A C   1 
ATOM   1097 O O   . ALA A 1 164 ? 14.729 40.706 -5.641  1.00 26.71 ? 170 ALA A O   1 
ATOM   1098 C CB  . ALA A 1 164 ? 17.932 40.764 -6.530  1.00 25.16 ? 170 ALA A CB  1 
ATOM   1099 N N   . TYR A 1 165 ? 15.882 38.796 -5.347  1.00 23.71 ? 171 TYR A N   1 
ATOM   1100 C CA  . TYR A 1 165 ? 14.718 37.946 -5.497  1.00 24.09 ? 171 TYR A CA  1 
ATOM   1101 C C   . TYR A 1 165 ? 13.685 38.161 -4.382  1.00 24.47 ? 171 TYR A C   1 
ATOM   1102 O O   . TYR A 1 165 ? 12.539 38.527 -4.661  1.00 24.81 ? 171 TYR A O   1 
ATOM   1103 C CB  . TYR A 1 165 ? 15.148 36.477 -5.541  1.00 23.05 ? 171 TYR A CB  1 
ATOM   1104 C CG  . TYR A 1 165 ? 13.998 35.505 -5.673  1.00 24.15 ? 171 TYR A CG  1 
ATOM   1105 C CD1 . TYR A 1 165 ? 13.366 35.291 -6.903  1.00 24.54 ? 171 TYR A CD1 1 
ATOM   1106 C CD2 . TYR A 1 165 ? 13.521 34.822 -4.560  1.00 25.19 ? 171 TYR A CD2 1 
ATOM   1107 C CE1 . TYR A 1 165 ? 12.279 34.413 -7.013  1.00 25.43 ? 171 TYR A CE1 1 
ATOM   1108 C CE2 . TYR A 1 165 ? 12.448 33.952 -4.653  1.00 25.50 ? 171 TYR A CE2 1 
ATOM   1109 C CZ  . TYR A 1 165 ? 11.831 33.748 -5.880  1.00 26.56 ? 171 TYR A CZ  1 
ATOM   1110 O OH  . TYR A 1 165 ? 10.790 32.859 -5.954  1.00 27.48 ? 171 TYR A OH  1 
ATOM   1111 N N   . ILE A 1 166 ? 14.059 37.955 -3.119  1.00 22.25 ? 172 ILE A N   1 
ATOM   1112 C CA  . ILE A 1 166 ? 13.052 38.148 -2.074  1.00 23.07 ? 172 ILE A CA  1 
ATOM   1113 C C   . ILE A 1 166 ? 12.530 39.577 -1.996  1.00 23.30 ? 172 ILE A C   1 
ATOM   1114 O O   . ILE A 1 166 ? 11.341 39.790 -1.737  1.00 25.63 ? 172 ILE A O   1 
ATOM   1115 C CB  . ILE A 1 166 ? 13.546 37.715 -0.660  1.00 21.86 ? 172 ILE A CB  1 
ATOM   1116 C CG1 . ILE A 1 166 ? 14.728 38.569 -0.206  1.00 20.24 ? 172 ILE A CG1 1 
ATOM   1117 C CG2 . ILE A 1 166 ? 13.925 36.244 -0.676  1.00 20.25 ? 172 ILE A CG2 1 
ATOM   1118 C CD1 . ILE A 1 166 ? 15.105 38.309 1.273   1.00 24.59 ? 172 ILE A CD1 1 
ATOM   1119 N N   . HIS A 1 167 ? 13.393 40.559 -2.237  1.00 22.74 ? 173 HIS A N   1 
ATOM   1120 C CA  . HIS A 1 167 ? 12.952 41.945 -2.162  1.00 23.98 ? 173 HIS A CA  1 
ATOM   1121 C C   . HIS A 1 167 ? 11.954 42.285 -3.272  1.00 26.71 ? 173 HIS A C   1 
ATOM   1122 O O   . HIS A 1 167 ? 11.117 43.177 -3.107  1.00 24.55 ? 173 HIS A O   1 
ATOM   1123 C CB  . HIS A 1 167 ? 14.142 42.900 -2.223  1.00 23.29 ? 173 HIS A CB  1 
ATOM   1124 C CG  . HIS A 1 167 ? 14.982 42.905 -0.981  1.00 22.76 ? 173 HIS A CG  1 
ATOM   1125 N ND1 . HIS A 1 167 ? 16.057 43.751 -0.814  1.00 22.80 ? 173 HIS A ND1 1 
ATOM   1126 C CD2 . HIS A 1 167 ? 14.911 42.161 0.151   1.00 22.62 ? 173 HIS A CD2 1 
ATOM   1127 C CE1 . HIS A 1 167 ? 16.614 43.528 0.365   1.00 23.52 ? 173 HIS A CE1 1 
ATOM   1128 N NE2 . HIS A 1 167 ? 15.937 42.568 0.969   1.00 25.46 ? 173 HIS A NE2 1 
ATOM   1129 N N   . SER A 1 168 ? 12.036 41.567 -4.393  1.00 26.10 ? 174 SER A N   1 
ATOM   1130 C CA  . SER A 1 168 ? 11.130 41.811 -5.509  1.00 26.84 ? 174 SER A CA  1 
ATOM   1131 C C   . SER A 1 168 ? 9.696  41.460 -5.116  1.00 28.28 ? 174 SER A C   1 
ATOM   1132 O O   . SER A 1 168 ? 8.741  41.871 -5.783  1.00 31.38 ? 174 SER A O   1 
ATOM   1133 C CB  . SER A 1 168 ? 11.564 41.007 -6.748  1.00 24.88 ? 174 SER A CB  1 
ATOM   1134 O OG  . SER A 1 168 ? 11.207 39.639 -6.639  1.00 23.82 ? 174 SER A OG  1 
ATOM   1135 N N   . PHE A 1 169 ? 9.542  40.691 -4.041  1.00 27.62 ? 175 PHE A N   1 
ATOM   1136 C CA  . PHE A 1 169 ? 8.220  40.313 -3.544  1.00 28.65 ? 175 PHE A CA  1 
ATOM   1137 C C   . PHE A 1 169 ? 7.886  41.136 -2.305  1.00 28.55 ? 175 PHE A C   1 
ATOM   1138 O O   . PHE A 1 169 ? 6.883  40.883 -1.633  1.00 28.93 ? 175 PHE A O   1 
ATOM   1139 C CB  . PHE A 1 169 ? 8.163  38.832 -3.163  1.00 29.01 ? 175 PHE A CB  1 
ATOM   1140 C CG  . PHE A 1 169 ? 8.250  37.898 -4.330  1.00 34.28 ? 175 PHE A CG  1 
ATOM   1141 C CD1 . PHE A 1 169 ? 9.472  37.349 -4.709  1.00 34.56 ? 175 PHE A CD1 1 
ATOM   1142 C CD2 . PHE A 1 169 ? 7.109  37.572 -5.061  1.00 33.85 ? 175 PHE A CD2 1 
ATOM   1143 C CE1 . PHE A 1 169 ? 9.556  36.488 -5.802  1.00 36.43 ? 175 PHE A CE1 1 
ATOM   1144 C CE2 . PHE A 1 169 ? 7.184  36.711 -6.156  1.00 36.63 ? 175 PHE A CE2 1 
ATOM   1145 C CZ  . PHE A 1 169 ? 8.413  36.168 -6.526  1.00 36.86 ? 175 PHE A CZ  1 
ATOM   1146 N N   . GLY A 1 170 ? 8.737  42.112 -2.001  1.00 28.23 ? 176 GLY A N   1 
ATOM   1147 C CA  . GLY A 1 170 ? 8.521  42.942 -0.830  1.00 29.22 ? 176 GLY A CA  1 
ATOM   1148 C C   . GLY A 1 170 ? 8.930  42.258 0.467   1.00 29.85 ? 176 GLY A C   1 
ATOM   1149 O O   . GLY A 1 170 ? 8.621  42.744 1.557   1.00 31.70 ? 176 GLY A O   1 
ATOM   1150 N N   . ILE A 1 171 ? 9.639  41.137 0.362   1.00 27.63 ? 177 ILE A N   1 
ATOM   1151 C CA  . ILE A 1 171 ? 10.053 40.401 1.553   1.00 26.67 ? 177 ILE A CA  1 
ATOM   1152 C C   . ILE A 1 171 ? 11.462 40.779 1.985   1.00 25.51 ? 177 ILE A C   1 
ATOM   1153 O O   . ILE A 1 171 ? 12.404 40.741 1.190   1.00 24.92 ? 177 ILE A O   1 
ATOM   1154 C CB  . ILE A 1 171 ? 9.999  38.873 1.317   1.00 28.56 ? 177 ILE A CB  1 
ATOM   1155 C CG1 . ILE A 1 171 ? 8.582  38.466 0.898   1.00 29.24 ? 177 ILE A CG1 1 
ATOM   1156 C CG2 . ILE A 1 171 ? 10.429 38.121 2.579   1.00 28.21 ? 177 ILE A CG2 1 
ATOM   1157 C CD1 . ILE A 1 171 ? 8.417  36.983 0.620   1.00 32.97 ? 177 ILE A CD1 1 
ATOM   1158 N N   . CYS A 1 172 ? 11.588 41.142 3.257   1.00 25.29 ? 178 CYS A N   1 
ATOM   1159 C CA  . CYS A 1 172 ? 12.870 41.518 3.843   1.00 25.04 ? 178 CYS A CA  1 
ATOM   1160 C C   . CYS A 1 172 ? 13.258 40.383 4.793   1.00 23.71 ? 178 CYS A C   1 
ATOM   1161 O O   . CYS A 1 172 ? 12.454 39.952 5.615   1.00 23.84 ? 178 CYS A O   1 
ATOM   1162 C CB  . CYS A 1 172 ? 12.719 42.834 4.612   1.00 25.50 ? 178 CYS A CB  1 
ATOM   1163 S SG  . CYS A 1 172 ? 14.242 43.464 5.361   1.00 27.00 ? 178 CYS A SG  1 
ATOM   1164 N N   . HIS A 1 173 ? 14.490 39.896 4.673   1.00 23.47 ? 179 HIS A N   1 
ATOM   1165 C CA  . HIS A 1 173 ? 14.967 38.792 5.503   1.00 22.10 ? 179 HIS A CA  1 
ATOM   1166 C C   . HIS A 1 173 ? 15.093 39.190 6.977   1.00 21.14 ? 179 HIS A C   1 
ATOM   1167 O O   . HIS A 1 173 ? 14.650 38.462 7.860   1.00 20.35 ? 179 HIS A O   1 
ATOM   1168 C CB  . HIS A 1 173 ? 16.310 38.295 4.950   1.00 22.12 ? 179 HIS A CB  1 
ATOM   1169 C CG  . HIS A 1 173 ? 16.843 37.083 5.641   1.00 20.60 ? 179 HIS A CG  1 
ATOM   1170 N ND1 . HIS A 1 173 ? 17.460 37.138 6.872   1.00 20.81 ? 179 HIS A ND1 1 
ATOM   1171 C CD2 . HIS A 1 173 ? 16.864 35.779 5.267   1.00 22.61 ? 179 HIS A CD2 1 
ATOM   1172 C CE1 . HIS A 1 173 ? 17.840 35.923 7.227   1.00 21.27 ? 179 HIS A CE1 1 
ATOM   1173 N NE2 . HIS A 1 173 ? 17.491 35.081 6.271   1.00 22.35 ? 179 HIS A NE2 1 
ATOM   1174 N N   . ARG A 1 174 ? 15.718 40.336 7.226   1.00 21.10 ? 180 ARG A N   1 
ATOM   1175 C CA  . ARG A 1 174 ? 15.881 40.884 8.575   1.00 21.48 ? 180 ARG A CA  1 
ATOM   1176 C C   . ARG A 1 174 ? 16.856 40.204 9.533   1.00 22.82 ? 180 ARG A C   1 
ATOM   1177 O O   . ARG A 1 174 ? 16.896 40.539 10.720  1.00 22.49 ? 180 ARG A O   1 
ATOM   1178 C CB  . ARG A 1 174 ? 14.515 41.018 9.263   1.00 24.16 ? 180 ARG A CB  1 
ATOM   1179 C CG  . ARG A 1 174 ? 13.498 41.817 8.435   1.00 24.86 ? 180 ARG A CG  1 
ATOM   1180 C CD  . ARG A 1 174 ? 12.412 42.425 9.320   1.00 26.15 ? 180 ARG A CD  1 
ATOM   1181 N NE  . ARG A 1 174 ? 11.599 41.416 9.992   1.00 25.20 ? 180 ARG A NE  1 
ATOM   1182 C CZ  . ARG A 1 174 ? 10.603 41.696 10.829  1.00 26.79 ? 180 ARG A CZ  1 
ATOM   1183 N NH1 . ARG A 1 174 ? 10.297 42.959 11.105  1.00 26.74 ? 180 ARG A NH1 1 
ATOM   1184 N NH2 . ARG A 1 174 ? 9.898  40.715 11.372  1.00 24.82 ? 180 ARG A NH2 1 
ATOM   1185 N N   . ASP A 1 175 ? 17.629 39.244 9.043   1.00 21.99 ? 181 ASP A N   1 
ATOM   1186 C CA  . ASP A 1 175 ? 18.617 38.591 9.904   1.00 23.56 ? 181 ASP A CA  1 
ATOM   1187 C C   . ASP A 1 175 ? 19.768 38.057 9.051   1.00 24.16 ? 181 ASP A C   1 
ATOM   1188 O O   . ASP A 1 175 ? 20.181 36.910 9.197   1.00 25.35 ? 181 ASP A O   1 
ATOM   1189 C CB  . ASP A 1 175 ? 17.979 37.462 10.719  1.00 24.65 ? 181 ASP A CB  1 
ATOM   1190 C CG  . ASP A 1 175 ? 18.790 37.105 11.966  1.00 28.33 ? 181 ASP A CG  1 
ATOM   1191 O OD1 . ASP A 1 175 ? 19.649 37.910 12.387  1.00 28.32 ? 181 ASP A OD1 1 
ATOM   1192 O OD2 . ASP A 1 175 ? 18.554 36.022 12.536  1.00 32.69 ? 181 ASP A OD2 1 
ATOM   1193 N N   . ILE A 1 176 ? 20.262 38.905 8.151   1.00 22.32 ? 182 ILE A N   1 
ATOM   1194 C CA  . ILE A 1 176 ? 21.372 38.542 7.287   1.00 22.88 ? 182 ILE A CA  1 
ATOM   1195 C C   . ILE A 1 176 ? 22.635 38.560 8.144   1.00 23.77 ? 182 ILE A C   1 
ATOM   1196 O O   . ILE A 1 176 ? 22.979 39.583 8.745   1.00 23.25 ? 182 ILE A O   1 
ATOM   1197 C CB  . ILE A 1 176 ? 21.545 39.546 6.122   1.00 23.01 ? 182 ILE A CB  1 
ATOM   1198 C CG1 . ILE A 1 176 ? 20.319 39.495 5.187   1.00 23.95 ? 182 ILE A CG1 1 
ATOM   1199 C CG2 . ILE A 1 176 ? 22.841 39.243 5.343   1.00 23.33 ? 182 ILE A CG2 1 
ATOM   1200 C CD1 . ILE A 1 176 ? 20.085 38.144 4.525   1.00 23.68 ? 182 ILE A CD1 1 
ATOM   1201 N N   . LYS A 1 177 ? 23.303 37.412 8.206   1.00 23.73 ? 183 LYS A N   1 
ATOM   1202 C CA  . LYS A 1 177 ? 24.536 37.264 8.964   1.00 24.49 ? 183 LYS A CA  1 
ATOM   1203 C C   . LYS A 1 177 ? 25.252 36.015 8.457   1.00 25.33 ? 183 LYS A C   1 
ATOM   1204 O O   . LYS A 1 177 ? 24.623 35.128 7.870   1.00 25.37 ? 183 LYS A O   1 
ATOM   1205 C CB  . LYS A 1 177 ? 24.229 37.156 10.465  1.00 24.49 ? 183 LYS A CB  1 
ATOM   1206 C CG  . LYS A 1 177 ? 23.408 35.955 10.869  1.00 24.76 ? 183 LYS A CG  1 
ATOM   1207 C CD  . LYS A 1 177 ? 23.146 36.004 12.368  1.00 27.73 ? 183 LYS A CD  1 
ATOM   1208 C CE  . LYS A 1 177 ? 22.353 34.825 12.871  1.00 28.34 ? 183 LYS A CE  1 
ATOM   1209 N NZ  . LYS A 1 177 ? 22.218 34.940 14.361  1.00 30.20 ? 183 LYS A NZ  1 
ATOM   1210 N N   . PRO A 1 178 ? 26.575 35.918 8.689   1.00 26.72 ? 184 PRO A N   1 
ATOM   1211 C CA  . PRO A 1 178 ? 27.381 34.772 8.240   1.00 25.27 ? 184 PRO A CA  1 
ATOM   1212 C C   . PRO A 1 178 ? 26.799 33.395 8.534   1.00 24.39 ? 184 PRO A C   1 
ATOM   1213 O O   . PRO A 1 178 ? 26.915 32.484 7.718   1.00 24.12 ? 184 PRO A O   1 
ATOM   1214 C CB  . PRO A 1 178 ? 28.726 35.001 8.936   1.00 26.47 ? 184 PRO A CB  1 
ATOM   1215 C CG  . PRO A 1 178 ? 28.805 36.495 9.016   1.00 25.17 ? 184 PRO A CG  1 
ATOM   1216 C CD  . PRO A 1 178 ? 27.403 36.858 9.469   1.00 26.42 ? 184 PRO A CD  1 
ATOM   1217 N N   . GLN A 1 179 ? 26.169 33.248 9.694   1.00 24.42 ? 185 GLN A N   1 
ATOM   1218 C CA  . GLN A 1 179 ? 25.579 31.978 10.081  1.00 24.28 ? 185 GLN A CA  1 
ATOM   1219 C C   . GLN A 1 179 ? 24.386 31.572 9.215   1.00 24.94 ? 185 GLN A C   1 
ATOM   1220 O O   . GLN A 1 179 ? 24.038 30.394 9.151   1.00 23.95 ? 185 GLN A O   1 
ATOM   1221 C CB  . GLN A 1 179 ? 25.147 32.026 11.552  1.00 28.93 ? 185 GLN A CB  1 
ATOM   1222 C CG  . GLN A 1 179 ? 26.305 32.243 12.522  1.00 32.33 ? 185 GLN A CG  1 
ATOM   1223 C CD  . GLN A 1 179 ? 26.478 33.698 12.955  1.00 36.25 ? 185 GLN A CD  1 
ATOM   1224 O OE1 . GLN A 1 179 ? 26.654 34.610 12.132  1.00 31.19 ? 185 GLN A OE1 1 
ATOM   1225 N NE2 . GLN A 1 179 ? 26.437 33.917 14.268  1.00 38.07 ? 185 GLN A NE2 1 
ATOM   1226 N N   . ASN A 1 180 ? 23.766 32.542 8.546   1.00 24.03 ? 186 ASN A N   1 
ATOM   1227 C CA  . ASN A 1 180 ? 22.614 32.248 7.703   1.00 25.03 ? 186 ASN A CA  1 
ATOM   1228 C C   . ASN A 1 180 ? 22.928 32.185 6.226   1.00 24.82 ? 186 ASN A C   1 
ATOM   1229 O O   . ASN A 1 180 ? 22.017 32.212 5.388   1.00 22.08 ? 186 ASN A O   1 
ATOM   1230 C CB  . ASN A 1 180 ? 21.501 33.272 7.948   1.00 25.63 ? 186 ASN A CB  1 
ATOM   1231 C CG  . ASN A 1 180 ? 20.892 33.128 9.314   1.00 27.80 ? 186 ASN A CG  1 
ATOM   1232 O OD1 . ASN A 1 180 ? 20.900 32.036 9.884   1.00 28.86 ? 186 ASN A OD1 1 
ATOM   1233 N ND2 . ASN A 1 180 ? 20.346 34.215 9.847   1.00 27.48 ? 186 ASN A ND2 1 
ATOM   1234 N N   . LEU A 1 181 ? 24.219 32.106 5.909   1.00 23.21 ? 187 LEU A N   1 
ATOM   1235 C CA  . LEU A 1 181 ? 24.679 32.025 4.531   1.00 23.72 ? 187 LEU A CA  1 
ATOM   1236 C C   . LEU A 1 181 ? 25.333 30.655 4.360   1.00 24.82 ? 187 LEU A C   1 
ATOM   1237 O O   . LEU A 1 181 ? 26.462 30.435 4.806   1.00 24.17 ? 187 LEU A O   1 
ATOM   1238 C CB  . LEU A 1 181 ? 25.682 33.150 4.254   1.00 24.49 ? 187 LEU A CB  1 
ATOM   1239 C CG  . LEU A 1 181 ? 25.177 34.559 4.608   1.00 24.78 ? 187 LEU A CG  1 
ATOM   1240 C CD1 . LEU A 1 181 ? 26.246 35.587 4.273   1.00 25.67 ? 187 LEU A CD1 1 
ATOM   1241 C CD2 . LEU A 1 181 ? 23.885 34.869 3.828   1.00 27.16 ? 187 LEU A CD2 1 
ATOM   1242 N N   . LEU A 1 182 ? 24.606 29.730 3.739   1.00 24.67 ? 188 LEU A N   1 
ATOM   1243 C CA  . LEU A 1 182 ? 25.095 28.374 3.535   1.00 24.99 ? 188 LEU A CA  1 
ATOM   1244 C C   . LEU A 1 182 ? 26.007 28.322 2.319   1.00 27.09 ? 188 LEU A C   1 
ATOM   1245 O O   . LEU A 1 182 ? 25.810 29.043 1.341   1.00 25.61 ? 188 LEU A O   1 
ATOM   1246 C CB  . LEU A 1 182 ? 23.918 27.411 3.354   1.00 25.79 ? 188 LEU A CB  1 
ATOM   1247 C CG  . LEU A 1 182 ? 22.832 27.503 4.439   1.00 26.80 ? 188 LEU A CG  1 
ATOM   1248 C CD1 . LEU A 1 182 ? 21.709 26.524 4.109   1.00 27.58 ? 188 LEU A CD1 1 
ATOM   1249 C CD2 . LEU A 1 182 ? 23.423 27.209 5.815   1.00 28.44 ? 188 LEU A CD2 1 
ATOM   1250 N N   . LEU A 1 183 ? 26.991 27.437 2.383   1.00 26.95 ? 189 LEU A N   1 
ATOM   1251 C CA  . LEU A 1 183 ? 27.980 27.305 1.322   1.00 29.90 ? 189 LEU A CA  1 
ATOM   1252 C C   . LEU A 1 183 ? 28.277 25.862 0.993   1.00 30.15 ? 189 LEU A C   1 
ATOM   1253 O O   . LEU A 1 183 ? 28.383 25.027 1.890   1.00 27.16 ? 189 LEU A O   1 
ATOM   1254 C CB  . LEU A 1 183 ? 29.293 27.944 1.778   1.00 31.91 ? 189 LEU A CB  1 
ATOM   1255 C CG  . LEU A 1 183 ? 29.772 29.321 1.335   1.00 36.02 ? 189 LEU A CG  1 
ATOM   1256 C CD1 . LEU A 1 183 ? 28.619 30.286 1.118   1.00 37.61 ? 189 LEU A CD1 1 
ATOM   1257 C CD2 . LEU A 1 183 ? 30.739 29.822 2.408   1.00 35.49 ? 189 LEU A CD2 1 
ATOM   1258 N N   . ASP A 1 184 ? 28.406 25.570 -0.294  1.00 31.16 ? 190 ASP A N   1 
ATOM   1259 C CA  . ASP A 1 184 ? 28.787 24.230 -0.708  1.00 35.50 ? 190 ASP A CA  1 
ATOM   1260 C C   . ASP A 1 184 ? 30.234 24.436 -1.137  1.00 35.21 ? 190 ASP A C   1 
ATOM   1261 O O   . ASP A 1 184 ? 30.498 25.056 -2.161  1.00 34.73 ? 190 ASP A O   1 
ATOM   1262 C CB  . ASP A 1 184 ? 27.967 23.729 -1.893  1.00 37.00 ? 190 ASP A CB  1 
ATOM   1263 C CG  . ASP A 1 184 ? 28.405 22.342 -2.342  1.00 40.53 ? 190 ASP A CG  1 
ATOM   1264 O OD1 . ASP A 1 184 ? 29.561 22.200 -2.796  1.00 42.28 ? 190 ASP A OD1 1 
ATOM   1265 O OD2 . ASP A 1 184 ? 27.608 21.387 -2.226  1.00 42.26 ? 190 ASP A OD2 1 
ATOM   1266 N N   . PRO A 1 185 ? 31.190 23.940 -0.338  1.00 37.76 ? 191 PRO A N   1 
ATOM   1267 C CA  . PRO A 1 185 ? 32.617 24.085 -0.642  1.00 38.49 ? 191 PRO A CA  1 
ATOM   1268 C C   . PRO A 1 185 ? 33.052 23.655 -2.039  1.00 38.54 ? 191 PRO A C   1 
ATOM   1269 O O   . PRO A 1 185 ? 33.918 24.291 -2.638  1.00 40.78 ? 191 PRO A O   1 
ATOM   1270 C CB  . PRO A 1 185 ? 33.296 23.273 0.470   1.00 39.09 ? 191 PRO A CB  1 
ATOM   1271 C CG  . PRO A 1 185 ? 32.258 22.256 0.849   1.00 40.41 ? 191 PRO A CG  1 
ATOM   1272 C CD  . PRO A 1 185 ? 30.991 23.082 0.844   1.00 38.02 ? 191 PRO A CD  1 
ATOM   1273 N N   . ASP A 1 186 ? 32.439 22.602 -2.569  1.00 37.16 ? 192 ASP A N   1 
ATOM   1274 C CA  . ASP A 1 186 ? 32.803 22.093 -3.889  1.00 36.92 ? 192 ASP A CA  1 
ATOM   1275 C C   . ASP A 1 186 ? 32.302 22.893 -5.091  1.00 35.14 ? 192 ASP A C   1 
ATOM   1276 O O   . ASP A 1 186 ? 33.045 23.107 -6.050  1.00 35.16 ? 192 ASP A O   1 
ATOM   1277 C CB  . ASP A 1 186 ? 32.330 20.644 -4.036  1.00 40.16 ? 192 ASP A CB  1 
ATOM   1278 C CG  . ASP A 1 186 ? 33.048 19.694 -3.090  1.00 43.84 ? 192 ASP A CG  1 
ATOM   1279 O OD1 . ASP A 1 186 ? 32.654 18.508 -3.034  1.00 47.20 ? 192 ASP A OD1 1 
ATOM   1280 O OD2 . ASP A 1 186 ? 34.004 20.128 -2.410  1.00 43.01 ? 192 ASP A OD2 1 
ATOM   1281 N N   . THR A 1 187 ? 31.050 23.332 -5.046  1.00 32.38 ? 193 THR A N   1 
ATOM   1282 C CA  . THR A 1 187 ? 30.467 24.072 -6.162  1.00 29.84 ? 193 THR A CA  1 
ATOM   1283 C C   . THR A 1 187 ? 30.491 25.589 -6.011  1.00 27.65 ? 193 THR A C   1 
ATOM   1284 O O   . THR A 1 187 ? 30.200 26.314 -6.961  1.00 25.62 ? 193 THR A O   1 
ATOM   1285 C CB  . THR A 1 187 ? 29.012 23.643 -6.385  1.00 31.84 ? 193 THR A CB  1 
ATOM   1286 O OG1 . THR A 1 187 ? 28.238 23.980 -5.226  1.00 31.71 ? 193 THR A OG1 1 
ATOM   1287 C CG2 . THR A 1 187 ? 28.933 22.140 -6.623  1.00 31.26 ? 193 THR A CG2 1 
ATOM   1288 N N   . ALA A 1 188 ? 30.838 26.057 -4.818  1.00 26.44 ? 194 ALA A N   1 
ATOM   1289 C CA  . ALA A 1 188 ? 30.898 27.482 -4.515  1.00 26.86 ? 194 ALA A CA  1 
ATOM   1290 C C   . ALA A 1 188 ? 29.498 28.130 -4.524  1.00 27.05 ? 194 ALA A C   1 
ATOM   1291 O O   . ALA A 1 188 ? 29.361 29.351 -4.618  1.00 26.68 ? 194 ALA A O   1 
ATOM   1292 C CB  . ALA A 1 188 ? 31.827 28.191 -5.499  1.00 28.09 ? 194 ALA A CB  1 
ATOM   1293 N N   . VAL A 1 189 ? 28.466 27.300 -4.418  1.00 25.11 ? 195 VAL A N   1 
ATOM   1294 C CA  . VAL A 1 189 ? 27.097 27.798 -4.391  1.00 25.83 ? 195 VAL A CA  1 
ATOM   1295 C C   . VAL A 1 189 ? 26.769 28.305 -2.990  1.00 25.41 ? 195 VAL A C   1 
ATOM   1296 O O   . VAL A 1 189 ? 27.136 27.681 -1.987  1.00 25.01 ? 195 VAL A O   1 
ATOM   1297 C CB  . VAL A 1 189 ? 26.077 26.688 -4.783  1.00 26.09 ? 195 VAL A CB  1 
ATOM   1298 C CG1 . VAL A 1 189 ? 24.652 27.120 -4.432  1.00 27.46 ? 195 VAL A CG1 1 
ATOM   1299 C CG2 . VAL A 1 189 ? 26.176 26.402 -6.277  1.00 24.91 ? 195 VAL A CG2 1 
ATOM   1300 N N   . LEU A 1 190 ? 26.110 29.459 -2.930  1.00 24.12 ? 196 LEU A N   1 
ATOM   1301 C CA  . LEU A 1 190 ? 25.702 30.032 -1.657  1.00 24.23 ? 196 LEU A CA  1 
ATOM   1302 C C   . LEU A 1 190 ? 24.182 30.031 -1.611  1.00 24.45 ? 196 LEU A C   1 
ATOM   1303 O O   . LEU A 1 190 ? 23.521 30.315 -2.616  1.00 24.21 ? 196 LEU A O   1 
ATOM   1304 C CB  . LEU A 1 190 ? 26.224 31.468 -1.497  1.00 24.51 ? 196 LEU A CB  1 
ATOM   1305 C CG  . LEU A 1 190 ? 25.721 32.225 -0.253  1.00 26.17 ? 196 LEU A CG  1 
ATOM   1306 C CD1 . LEU A 1 190 ? 26.784 33.200 0.225   1.00 25.75 ? 196 LEU A CD1 1 
ATOM   1307 C CD2 . LEU A 1 190 ? 24.417 32.958 -0.566  1.00 25.55 ? 196 LEU A CD2 1 
ATOM   1308 N N   . LYS A 1 191 ? 23.630 29.703 -0.451  1.00 23.02 ? 197 LYS A N   1 
ATOM   1309 C CA  . LYS A 1 191 ? 22.186 29.693 -0.279  1.00 23.28 ? 197 LYS A CA  1 
ATOM   1310 C C   . LYS A 1 191 ? 21.820 30.393 1.022   1.00 23.85 ? 197 LYS A C   1 
ATOM   1311 O O   . LYS A 1 191 ? 22.381 30.112 2.084   1.00 23.70 ? 197 LYS A O   1 
ATOM   1312 C CB  . LYS A 1 191 ? 21.634 28.261 -0.268  1.00 24.75 ? 197 LYS A CB  1 
ATOM   1313 C CG  . LYS A 1 191 ? 21.709 27.523 -1.617  1.00 27.17 ? 197 LYS A CG  1 
ATOM   1314 C CD  . LYS A 1 191 ? 20.974 26.184 -1.546  1.00 29.66 ? 197 LYS A CD  1 
ATOM   1315 C CE  . LYS A 1 191 ? 21.190 25.332 -2.800  1.00 30.57 ? 197 LYS A CE  1 
ATOM   1316 N NZ  . LYS A 1 191 ? 20.700 26.000 -4.030  1.00 35.44 ? 197 LYS A NZ  1 
ATOM   1317 N N   . LEU A 1 192 ? 20.881 31.323 0.916   1.00 21.81 ? 198 LEU A N   1 
ATOM   1318 C CA  . LEU A 1 192 ? 20.402 32.076 2.058   1.00 22.68 ? 198 LEU A CA  1 
ATOM   1319 C C   . LEU A 1 192 ? 19.436 31.178 2.828   1.00 23.39 ? 198 LEU A C   1 
ATOM   1320 O O   . LEU A 1 192 ? 18.636 30.467 2.213   1.00 22.63 ? 198 LEU A O   1 
ATOM   1321 C CB  . LEU A 1 192 ? 19.682 33.332 1.561   1.00 21.78 ? 198 LEU A CB  1 
ATOM   1322 C CG  . LEU A 1 192 ? 19.036 34.253 2.601   1.00 23.52 ? 198 LEU A CG  1 
ATOM   1323 C CD1 . LEU A 1 192 ? 20.086 34.772 3.594   1.00 23.63 ? 198 LEU A CD1 1 
ATOM   1324 C CD2 . LEU A 1 192 ? 18.371 35.412 1.863   1.00 23.15 ? 198 LEU A CD2 1 
ATOM   1325 N N   . CYS A 1 193 ? 19.527 31.178 4.160   1.00 22.82 ? 199 CYS A N   1 
ATOM   1326 C CA  . CYS A 1 193 ? 18.616 30.361 4.960   1.00 25.31 ? 199 CYS A CA  1 
ATOM   1327 C C   . CYS A 1 193 ? 18.072 31.108 6.171   1.00 25.09 ? 199 CYS A C   1 
ATOM   1328 O O   . CYS A 1 193 ? 18.342 32.293 6.355   1.00 24.90 ? 199 CYS A O   1 
ATOM   1329 C CB  . CYS A 1 193 ? 19.283 29.051 5.417   1.00 26.43 ? 199 CYS A CB  1 
ATOM   1330 S SG  . CYS A 1 193 ? 20.522 29.189 6.736   1.00 31.31 ? 199 CYS A SG  1 
ATOM   1331 N N   . ASP A 1 194 ? 17.307 30.382 6.983   1.00 24.53 ? 200 ASP A N   1 
ATOM   1332 C CA  . ASP A 1 194 ? 16.658 30.890 8.190   1.00 25.68 ? 200 ASP A CA  1 
ATOM   1333 C C   . ASP A 1 194 ? 15.756 32.090 7.939   1.00 25.23 ? 200 ASP A C   1 
ATOM   1334 O O   . ASP A 1 194 ? 16.148 33.235 8.153   1.00 25.84 ? 200 ASP A O   1 
ATOM   1335 C CB  . ASP A 1 194 ? 17.678 31.241 9.280   1.00 26.82 ? 200 ASP A CB  1 
ATOM   1336 C CG  . ASP A 1 194 ? 17.004 31.601 10.603  1.00 32.78 ? 200 ASP A CG  1 
ATOM   1337 O OD1 . ASP A 1 194 ? 15.774 31.393 10.726  1.00 32.44 ? 200 ASP A OD1 1 
ATOM   1338 O OD2 . ASP A 1 194 ? 17.697 32.083 11.522  1.00 34.58 ? 200 ASP A OD2 1 
ATOM   1339 N N   . PHE A 1 195 ? 14.534 31.818 7.493   1.00 25.75 ? 201 PHE A N   1 
ATOM   1340 C CA  . PHE A 1 195 ? 13.577 32.889 7.230   1.00 26.69 ? 201 PHE A CA  1 
ATOM   1341 C C   . PHE A 1 195 ? 12.658 33.138 8.431   1.00 26.37 ? 201 PHE A C   1 
ATOM   1342 O O   . PHE A 1 195 ? 11.560 33.672 8.293   1.00 27.03 ? 201 PHE A O   1 
ATOM   1343 C CB  . PHE A 1 195 ? 12.769 32.566 5.968   1.00 24.94 ? 201 PHE A CB  1 
ATOM   1344 C CG  . PHE A 1 195 ? 13.541 32.801 4.698   1.00 25.46 ? 201 PHE A CG  1 
ATOM   1345 C CD1 . PHE A 1 195 ? 14.553 31.925 4.305   1.00 24.58 ? 201 PHE A CD1 1 
ATOM   1346 C CD2 . PHE A 1 195 ? 13.327 33.951 3.952   1.00 24.25 ? 201 PHE A CD2 1 
ATOM   1347 C CE1 . PHE A 1 195 ? 15.342 32.199 3.192   1.00 24.25 ? 201 PHE A CE1 1 
ATOM   1348 C CE2 . PHE A 1 195 ? 14.110 34.237 2.837   1.00 25.06 ? 201 PHE A CE2 1 
ATOM   1349 C CZ  . PHE A 1 195 ? 15.124 33.356 2.457   1.00 25.72 ? 201 PHE A CZ  1 
ATOM   1350 N N   . GLY A 1 196 ? 13.142 32.767 9.613   1.00 25.76 ? 202 GLY A N   1 
ATOM   1351 C CA  . GLY A 1 196 ? 12.375 32.946 10.835  1.00 26.88 ? 202 GLY A CA  1 
ATOM   1352 C C   . GLY A 1 196 ? 12.074 34.385 11.234  1.00 27.16 ? 202 GLY A C   1 
ATOM   1353 O O   . GLY A 1 196 ? 11.184 34.618 12.050  1.00 28.80 ? 202 GLY A O   1 
ATOM   1354 N N   . SER A 1 197 ? 12.810 35.348 10.684  1.00 25.49 ? 203 SER A N   1 
ATOM   1355 C CA  . SER A 1 197 ? 12.581 36.759 10.989  1.00 26.16 ? 203 SER A CA  1 
ATOM   1356 C C   . SER A 1 197 ? 12.032 37.483 9.757   1.00 25.97 ? 203 SER A C   1 
ATOM   1357 O O   . SER A 1 197 ? 11.678 38.659 9.822   1.00 26.57 ? 203 SER A O   1 
ATOM   1358 C CB  . SER A 1 197 ? 13.892 37.447 11.401  1.00 25.84 ? 203 SER A CB  1 
ATOM   1359 O OG  . SER A 1 197 ? 14.518 36.780 12.477  1.00 27.98 ? 203 SER A OG  1 
ATOM   1360 N N   . ALA A 1 198 ? 11.965 36.777 8.635   1.00 25.53 ? 204 ALA A N   1 
ATOM   1361 C CA  . ALA A 1 198 ? 11.505 37.381 7.389   1.00 26.57 ? 204 ALA A CA  1 
ATOM   1362 C C   . ALA A 1 198 ? 10.071 37.884 7.475   1.00 26.18 ? 204 ALA A C   1 
ATOM   1363 O O   . ALA A 1 198 ? 9.246  37.319 8.190   1.00 26.70 ? 204 ALA A O   1 
ATOM   1364 C CB  . ALA A 1 198 ? 11.647 36.383 6.238   1.00 26.16 ? 204 ALA A CB  1 
ATOM   1365 N N   . LYS A 1 199 ? 9.788  38.947 6.734   1.00 28.57 ? 205 LYS A N   1 
ATOM   1366 C CA  . LYS A 1 199 ? 8.452  39.533 6.715   1.00 29.36 ? 205 LYS A CA  1 
ATOM   1367 C C   . LYS A 1 199 ? 8.258  40.437 5.504   1.00 29.71 ? 205 LYS A C   1 
ATOM   1368 O O   . LYS A 1 199 ? 9.194  41.082 5.033   1.00 27.64 ? 205 LYS A O   1 
ATOM   1369 C CB  . LYS A 1 199 ? 8.225  40.344 7.993   1.00 31.72 ? 205 LYS A CB  1 
ATOM   1370 C CG  . LYS A 1 199 ? 6.831  40.944 8.113   1.00 34.43 ? 205 LYS A CG  1 
ATOM   1371 C CD  . LYS A 1 199 ? 6.761  41.908 9.286   1.00 36.02 ? 205 LYS A CD  1 
ATOM   1372 C CE  . LYS A 1 199 ? 5.446  42.677 9.284   1.00 38.31 ? 205 LYS A CE  1 
ATOM   1373 N NZ  . LYS A 1 199 ? 5.503  43.775 10.280  1.00 42.56 ? 205 LYS A NZ  1 
ATOM   1374 N N   . GLN A 1 200 ? 7.040  40.466 4.981   1.00 30.23 ? 206 GLN A N   1 
ATOM   1375 C CA  . GLN A 1 200 ? 6.756  41.333 3.856   1.00 32.22 ? 206 GLN A CA  1 
ATOM   1376 C C   . GLN A 1 200 ? 6.607  42.729 4.441   1.00 32.42 ? 206 GLN A C   1 
ATOM   1377 O O   . GLN A 1 200 ? 5.788  42.949 5.332   1.00 33.38 ? 206 GLN A O   1 
ATOM   1378 C CB  . GLN A 1 200 ? 5.459  40.922 3.167   1.00 35.19 ? 206 GLN A CB  1 
ATOM   1379 C CG  . GLN A 1 200 ? 5.224  41.661 1.863   1.00 40.71 ? 206 GLN A CG  1 
ATOM   1380 C CD  . GLN A 1 200 ? 4.074  41.086 1.074   1.00 45.69 ? 206 GLN A CD  1 
ATOM   1381 O OE1 . GLN A 1 200 ? 4.002  39.873 0.860   1.00 48.72 ? 206 GLN A OE1 1 
ATOM   1382 N NE2 . GLN A 1 200 ? 3.168  41.951 0.627   1.00 46.41 ? 206 GLN A NE2 1 
ATOM   1383 N N   . LEU A 1 201 ? 7.412  43.669 3.970   1.00 32.80 ? 207 LEU A N   1 
ATOM   1384 C CA  . LEU A 1 201 ? 7.326  45.015 4.492   1.00 34.15 ? 207 LEU A CA  1 
ATOM   1385 C C   . LEU A 1 201 ? 6.333  45.826 3.672   1.00 37.65 ? 207 LEU A C   1 
ATOM   1386 O O   . LEU A 1 201 ? 6.457  45.933 2.451   1.00 38.88 ? 207 LEU A O   1 
ATOM   1387 C CB  . LEU A 1 201 ? 8.702  45.676 4.485   1.00 33.03 ? 207 LEU A CB  1 
ATOM   1388 C CG  . LEU A 1 201 ? 9.761  44.966 5.342   1.00 32.19 ? 207 LEU A CG  1 
ATOM   1389 C CD1 . LEU A 1 201 ? 11.018 45.811 5.388   1.00 31.91 ? 207 LEU A CD1 1 
ATOM   1390 C CD2 . LEU A 1 201 ? 9.231  44.746 6.755   1.00 30.94 ? 207 LEU A CD2 1 
ATOM   1391 N N   . VAL A 1 202 ? 5.336  46.379 4.353   1.00 39.29 ? 208 VAL A N   1 
ATOM   1392 C CA  . VAL A 1 202 ? 4.310  47.179 3.701   1.00 42.02 ? 208 VAL A CA  1 
ATOM   1393 C C   . VAL A 1 202 ? 4.427  48.625 4.157   1.00 43.80 ? 208 VAL A C   1 
ATOM   1394 O O   . VAL A 1 202 ? 4.301  48.926 5.345   1.00 44.00 ? 208 VAL A O   1 
ATOM   1395 C CB  . VAL A 1 202 ? 2.902  46.659 4.042   1.00 42.04 ? 208 VAL A CB  1 
ATOM   1396 C CG1 . VAL A 1 202 ? 1.849  47.490 3.319   1.00 42.86 ? 208 VAL A CG1 1 
ATOM   1397 C CG2 . VAL A 1 202 ? 2.785  45.197 3.648   1.00 42.62 ? 208 VAL A CG2 1 
ATOM   1398 N N   . ARG A 1 203 ? 4.680  49.516 3.206   1.00 45.83 ? 209 ARG A N   1 
ATOM   1399 C CA  . ARG A 1 203 ? 4.817  50.932 3.508   1.00 48.13 ? 209 ARG A CA  1 
ATOM   1400 C C   . ARG A 1 203 ? 3.661  51.363 4.415   1.00 47.61 ? 209 ARG A C   1 
ATOM   1401 O O   . ARG A 1 203 ? 2.521  50.934 4.228   1.00 46.72 ? 209 ARG A O   1 
ATOM   1402 C CB  . ARG A 1 203 ? 4.808  51.735 2.206   1.00 51.44 ? 209 ARG A CB  1 
ATOM   1403 C CG  . ARG A 1 203 ? 5.329  53.155 2.332   1.00 56.13 ? 209 ARG A CG  1 
ATOM   1404 C CD  . ARG A 1 203 ? 5.404  53.815 0.965   1.00 60.66 ? 209 ARG A CD  1 
ATOM   1405 N NE  . ARG A 1 203 ? 6.123  55.086 0.998   1.00 64.73 ? 209 ARG A NE  1 
ATOM   1406 C CZ  . ARG A 1 203 ? 6.368  55.833 -0.077  1.00 66.72 ? 209 ARG A CZ  1 
ATOM   1407 N NH1 . ARG A 1 203 ? 5.949  55.436 -1.272  1.00 66.95 ? 209 ARG A NH1 1 
ATOM   1408 N NH2 . ARG A 1 203 ? 7.034  56.977 0.043   1.00 67.61 ? 209 ARG A NH2 1 
ATOM   1409 N N   . GLY A 1 204 ? 3.969  52.185 5.415   1.00 47.06 ? 210 GLY A N   1 
ATOM   1410 C CA  . GLY A 1 204 ? 2.944  52.652 6.329   1.00 47.18 ? 210 GLY A CA  1 
ATOM   1411 C C   . GLY A 1 204 ? 2.678  51.752 7.525   1.00 47.30 ? 210 GLY A C   1 
ATOM   1412 O O   . GLY A 1 204 ? 2.086  52.195 8.508   1.00 47.23 ? 210 GLY A O   1 
ATOM   1413 N N   . GLU A 1 205 ? 3.096  50.492 7.453   1.00 46.35 ? 211 GLU A N   1 
ATOM   1414 C CA  . GLU A 1 205 ? 2.883  49.572 8.565   1.00 46.12 ? 211 GLU A CA  1 
ATOM   1415 C C   . GLU A 1 205 ? 4.171  49.419 9.374   1.00 44.55 ? 211 GLU A C   1 
ATOM   1416 O O   . GLU A 1 205 ? 5.235  49.134 8.818   1.00 43.56 ? 211 GLU A O   1 
ATOM   1417 C CB  . GLU A 1 205 ? 2.445  48.196 8.062   1.00 48.61 ? 211 GLU A CB  1 
ATOM   1418 C CG  . GLU A 1 205 ? 1.331  48.219 7.035   1.00 53.37 ? 211 GLU A CG  1 
ATOM   1419 C CD  . GLU A 1 205 ? 0.825  46.828 6.705   1.00 55.43 ? 211 GLU A CD  1 
ATOM   1420 O OE1 . GLU A 1 205 ? 1.655  45.897 6.624   1.00 57.65 ? 211 GLU A OE1 1 
ATOM   1421 O OE2 . GLU A 1 205 ? -0.399 46.668 6.516   1.00 57.72 ? 211 GLU A OE2 1 
ATOM   1422 N N   . PRO A 1 206 ? 4.087  49.620 10.699  1.00 42.20 ? 212 PRO A N   1 
ATOM   1423 C CA  . PRO A 1 206 ? 5.223  49.513 11.624  1.00 40.52 ? 212 PRO A CA  1 
ATOM   1424 C C   . PRO A 1 206 ? 5.784  48.096 11.748  1.00 38.61 ? 212 PRO A C   1 
ATOM   1425 O O   . PRO A 1 206 ? 5.047  47.115 11.680  1.00 38.41 ? 212 PRO A O   1 
ATOM   1426 C CB  . PRO A 1 206 ? 4.638  50.004 12.950  1.00 40.66 ? 212 PRO A CB  1 
ATOM   1427 C CG  . PRO A 1 206 ? 3.547  50.932 12.524  1.00 42.91 ? 212 PRO A CG  1 
ATOM   1428 C CD  . PRO A 1 206 ? 2.910  50.179 11.388  1.00 41.98 ? 212 PRO A CD  1 
ATOM   1429 N N   . ASN A 1 207 ? 7.095  48.004 11.944  1.00 36.93 ? 213 ASN A N   1 
ATOM   1430 C CA  . ASN A 1 207 ? 7.778  46.724 12.100  1.00 34.82 ? 213 ASN A CA  1 
ATOM   1431 C C   . ASN A 1 207 ? 8.720  46.832 13.300  1.00 33.83 ? 213 ASN A C   1 
ATOM   1432 O O   . ASN A 1 207 ? 9.322  47.884 13.516  1.00 32.42 ? 213 ASN A O   1 
ATOM   1433 C CB  . ASN A 1 207 ? 8.572  46.417 10.835  1.00 33.40 ? 213 ASN A CB  1 
ATOM   1434 C CG  . ASN A 1 207 ? 7.698  46.399 9.604   1.00 34.05 ? 213 ASN A CG  1 
ATOM   1435 O OD1 . ASN A 1 207 ? 6.823  45.547 9.472   1.00 32.94 ? 213 ASN A OD1 1 
ATOM   1436 N ND2 . ASN A 1 207 ? 7.918  47.350 8.703   1.00 34.88 ? 213 ASN A ND2 1 
ATOM   1437 N N   . VAL A 1 208 ? 8.853  45.750 14.067  1.00 33.48 ? 214 VAL A N   1 
ATOM   1438 C CA  . VAL A 1 208 ? 9.714  45.761 15.255  1.00 33.62 ? 214 VAL A CA  1 
ATOM   1439 C C   . VAL A 1 208 ? 11.164 46.058 14.904  1.00 34.35 ? 214 VAL A C   1 
ATOM   1440 O O   . VAL A 1 208 ? 11.695 45.559 13.912  1.00 33.91 ? 214 VAL A O   1 
ATOM   1441 C CB  . VAL A 1 208 ? 9.660  44.420 16.013  1.00 33.93 ? 214 VAL A CB  1 
ATOM   1442 C CG1 . VAL A 1 208 ? 8.224  44.103 16.404  1.00 34.31 ? 214 VAL A CG1 1 
ATOM   1443 C CG2 . VAL A 1 208 ? 10.252 43.313 15.160  1.00 33.55 ? 214 VAL A CG2 1 
ATOM   1444 N N   . SER A 1 209 ? 11.812 46.873 15.724  1.00 33.93 ? 215 SER A N   1 
ATOM   1445 C CA  . SER A 1 209 ? 13.193 47.222 15.453  1.00 33.37 ? 215 SER A CA  1 
ATOM   1446 C C   . SER A 1 209 ? 14.180 46.292 16.146  1.00 32.08 ? 215 SER A C   1 
ATOM   1447 O O   . SER A 1 209 ? 15.382 46.447 15.975  1.00 34.39 ? 215 SER A O   1 
ATOM   1448 C CB  . SER A 1 209 ? 13.463 48.670 15.877  1.00 34.69 ? 215 SER A CB  1 
ATOM   1449 O OG  . SER A 1 209 ? 13.380 48.817 17.281  1.00 37.99 ? 215 SER A OG  1 
ATOM   1450 N N   . TYR A 1 210 ? 13.687 45.320 16.907  1.00 29.95 ? 216 TYR A N   1 
ATOM   1451 C CA  . TYR A 1 210 ? 14.592 44.420 17.616  1.00 29.29 ? 216 TYR A CA  1 
ATOM   1452 C C   . TYR A 1 210 ? 14.977 43.126 16.896  1.00 28.65 ? 216 TYR A C   1 
ATOM   1453 O O   . TYR A 1 210 ? 15.391 42.143 17.526  1.00 26.99 ? 216 TYR A O   1 
ATOM   1454 C CB  . TYR A 1 210 ? 14.054 44.126 19.026  1.00 28.07 ? 216 TYR A CB  1 
ATOM   1455 C CG  . TYR A 1 210 ? 12.622 43.645 19.084  1.00 30.55 ? 216 TYR A CG  1 
ATOM   1456 C CD1 . TYR A 1 210 ? 12.304 42.301 18.884  1.00 30.14 ? 216 TYR A CD1 1 
ATOM   1457 C CD2 . TYR A 1 210 ? 11.583 44.533 19.353  1.00 29.09 ? 216 TYR A CD2 1 
ATOM   1458 C CE1 . TYR A 1 210 ? 10.986 41.855 18.955  1.00 32.76 ? 216 TYR A CE1 1 
ATOM   1459 C CE2 . TYR A 1 210 ? 10.258 44.095 19.421  1.00 32.23 ? 216 TYR A CE2 1 
ATOM   1460 C CZ  . TYR A 1 210 ? 9.971  42.758 19.223  1.00 31.34 ? 216 TYR A CZ  1 
ATOM   1461 O OH  . TYR A 1 210 ? 8.671  42.322 19.296  1.00 36.71 ? 216 TYR A OH  1 
ATOM   1462 N N   . ILE A 1 211 ? 14.845 43.121 15.571  1.00 27.55 ? 217 ILE A N   1 
ATOM   1463 C CA  . ILE A 1 211 ? 15.259 41.957 14.804  1.00 26.47 ? 217 ILE A CA  1 
ATOM   1464 C C   . ILE A 1 211 ? 16.682 42.238 14.347  1.00 27.22 ? 217 ILE A C   1 
ATOM   1465 O O   . ILE A 1 211 ? 17.205 43.334 14.560  1.00 26.40 ? 217 ILE A O   1 
ATOM   1466 C CB  . ILE A 1 211 ? 14.370 41.690 13.538  1.00 26.69 ? 217 ILE A CB  1 
ATOM   1467 C CG1 . ILE A 1 211 ? 13.908 43.000 12.894  1.00 23.41 ? 217 ILE A CG1 1 
ATOM   1468 C CG2 . ILE A 1 211 ? 13.194 40.816 13.915  1.00 24.56 ? 217 ILE A CG2 1 
ATOM   1469 C CD1 . ILE A 1 211 ? 14.999 43.817 12.258  1.00 24.35 ? 217 ILE A CD1 1 
ATOM   1470 N N   . CYS A 1 212 ? 17.297 41.247 13.716  1.00 27.92 ? 218 CYS A N   1 
ATOM   1471 C CA  . CYS A 1 212 ? 18.651 41.362 13.195  1.00 26.13 ? 218 CYS A CA  1 
ATOM   1472 C C   . CYS A 1 212 ? 19.701 41.209 14.290  1.00 28.06 ? 218 CYS A C   1 
ATOM   1473 O O   . CYS A 1 212 ? 19.607 41.804 15.367  1.00 28.09 ? 218 CYS A O   1 
ATOM   1474 C CB  . CYS A 1 212 ? 18.848 42.687 12.471  1.00 27.51 ? 218 CYS A CB  1 
ATOM   1475 S SG  . CYS A 1 212 ? 20.249 42.635 11.324  1.00 29.24 ? 218 CYS A SG  1 
ATOM   1476 N N   . SER A 1 213 ? 20.715 40.409 13.995  1.00 28.85 ? 219 SER A N   1 
ATOM   1477 C CA  . SER A 1 213 ? 21.767 40.134 14.959  1.00 29.30 ? 219 SER A CA  1 
ATOM   1478 C C   . SER A 1 213 ? 22.798 41.239 15.144  1.00 29.40 ? 219 SER A C   1 
ATOM   1479 O O   . SER A 1 213 ? 23.166 41.939 14.200  1.00 26.05 ? 219 SER A O   1 
ATOM   1480 C CB  . SER A 1 213 ? 22.451 38.827 14.576  1.00 30.37 ? 219 SER A CB  1 
ATOM   1481 O OG  . SER A 1 213 ? 21.479 37.792 14.536  1.00 33.66 ? 219 SER A OG  1 
ATOM   1482 N N   . ARG A 1 214 ? 23.266 41.387 16.381  1.00 30.65 ? 220 ARG A N   1 
ATOM   1483 C CA  . ARG A 1 214 ? 24.259 42.405 16.692  1.00 33.90 ? 220 ARG A CA  1 
ATOM   1484 C C   . ARG A 1 214 ? 25.475 42.279 15.776  1.00 32.37 ? 220 ARG A C   1 
ATOM   1485 O O   . ARG A 1 214 ? 25.940 41.172 15.480  1.00 33.65 ? 220 ARG A O   1 
ATOM   1486 C CB  . ARG A 1 214 ? 24.693 42.304 18.159  1.00 38.60 ? 220 ARG A CB  1 
ATOM   1487 C CG  . ARG A 1 214 ? 25.531 41.087 18.496  1.00 46.22 ? 220 ARG A CG  1 
ATOM   1488 C CD  . ARG A 1 214 ? 26.308 41.343 19.786  1.00 52.41 ? 220 ARG A CD  1 
ATOM   1489 N NE  . ARG A 1 214 ? 27.409 40.401 19.970  1.00 57.93 ? 220 ARG A NE  1 
ATOM   1490 C CZ  . ARG A 1 214 ? 28.371 40.546 20.877  1.00 60.40 ? 220 ARG A CZ  1 
ATOM   1491 N NH1 . ARG A 1 214 ? 28.373 41.598 21.688  1.00 61.69 ? 220 ARG A NH1 1 
ATOM   1492 N NH2 . ARG A 1 214 ? 29.336 39.640 20.972  1.00 62.15 ? 220 ARG A NH2 1 
ATOM   1493 N N   . TYR A 1 215 ? 25.981 43.433 15.357  1.00 30.46 ? 221 TYR A N   1 
ATOM   1494 C CA  . TYR A 1 215 ? 27.117 43.576 14.452  1.00 30.52 ? 221 TYR A CA  1 
ATOM   1495 C C   . TYR A 1 215 ? 26.599 43.850 13.040  1.00 28.26 ? 221 TYR A C   1 
ATOM   1496 O O   . TYR A 1 215 ? 27.217 44.598 12.288  1.00 28.22 ? 221 TYR A O   1 
ATOM   1497 C CB  . TYR A 1 215 ? 27.992 42.317 14.398  1.00 34.40 ? 221 TYR A CB  1 
ATOM   1498 C CG  . TYR A 1 215 ? 28.783 41.994 15.652  1.00 37.85 ? 221 TYR A CG  1 
ATOM   1499 C CD1 . TYR A 1 215 ? 29.706 40.947 15.653  1.00 39.13 ? 221 TYR A CD1 1 
ATOM   1500 C CD2 . TYR A 1 215 ? 28.604 42.717 16.835  1.00 39.25 ? 221 TYR A CD2 1 
ATOM   1501 C CE1 . TYR A 1 215 ? 30.435 40.623 16.798  1.00 41.47 ? 221 TYR A CE1 1 
ATOM   1502 C CE2 . TYR A 1 215 ? 29.330 42.400 17.991  1.00 41.83 ? 221 TYR A CE2 1 
ATOM   1503 C CZ  . TYR A 1 215 ? 30.244 41.350 17.960  1.00 42.47 ? 221 TYR A CZ  1 
ATOM   1504 O OH  . TYR A 1 215 ? 30.969 41.031 19.085  1.00 45.24 ? 221 TYR A OH  1 
ATOM   1505 N N   . TYR A 1 216 ? 25.456 43.254 12.695  1.00 27.37 ? 222 TYR A N   1 
ATOM   1506 C CA  . TYR A 1 216 ? 24.885 43.399 11.352  1.00 27.38 ? 222 TYR A CA  1 
ATOM   1507 C C   . TYR A 1 216 ? 23.657 44.306 11.237  1.00 27.69 ? 222 TYR A C   1 
ATOM   1508 O O   . TYR A 1 216 ? 23.091 44.466 10.149  1.00 26.58 ? 222 TYR A O   1 
ATOM   1509 C CB  . TYR A 1 216 ? 24.544 42.005 10.798  1.00 26.24 ? 222 TYR A CB  1 
ATOM   1510 C CG  . TYR A 1 216 ? 25.692 41.037 10.957  1.00 26.44 ? 222 TYR A CG  1 
ATOM   1511 C CD1 . TYR A 1 216 ? 25.784 40.209 12.083  1.00 28.70 ? 222 TYR A CD1 1 
ATOM   1512 C CD2 . TYR A 1 216 ? 26.752 41.039 10.054  1.00 26.22 ? 222 TYR A CD2 1 
ATOM   1513 C CE1 . TYR A 1 216 ? 26.918 39.417 12.309  1.00 28.44 ? 222 TYR A CE1 1 
ATOM   1514 C CE2 . TYR A 1 216 ? 27.883 40.257 10.266  1.00 28.64 ? 222 TYR A CE2 1 
ATOM   1515 C CZ  . TYR A 1 216 ? 27.964 39.454 11.393  1.00 28.27 ? 222 TYR A CZ  1 
ATOM   1516 O OH  . TYR A 1 216 ? 29.100 38.709 11.611  1.00 28.79 ? 222 TYR A OH  1 
ATOM   1517 N N   . ARG A 1 217 ? 23.249 44.903 12.351  1.00 27.86 ? 223 ARG A N   1 
ATOM   1518 C CA  . ARG A 1 217 ? 22.071 45.765 12.358  1.00 28.64 ? 223 ARG A CA  1 
ATOM   1519 C C   . ARG A 1 217 ? 22.339 47.114 11.703  1.00 28.22 ? 223 ARG A C   1 
ATOM   1520 O O   . ARG A 1 217 ? 23.335 47.773 12.008  1.00 28.84 ? 223 ARG A O   1 
ATOM   1521 C CB  . ARG A 1 217 ? 21.597 46.003 13.800  1.00 29.91 ? 223 ARG A CB  1 
ATOM   1522 C CG  . ARG A 1 217 ? 21.413 44.750 14.637  1.00 32.54 ? 223 ARG A CG  1 
ATOM   1523 C CD  . ARG A 1 217 ? 20.929 45.112 16.040  1.00 34.65 ? 223 ARG A CD  1 
ATOM   1524 N NE  . ARG A 1 217 ? 19.531 45.537 16.034  1.00 38.81 ? 223 ARG A NE  1 
ATOM   1525 C CZ  . ARG A 1 217 ? 19.008 46.405 16.894  1.00 41.09 ? 223 ARG A CZ  1 
ATOM   1526 N NH1 . ARG A 1 217 ? 19.763 46.955 17.835  1.00 42.77 ? 223 ARG A NH1 1 
ATOM   1527 N NH2 . ARG A 1 217 ? 17.725 46.722 16.822  1.00 42.36 ? 223 ARG A NH2 1 
ATOM   1528 N N   . ALA A 1 218 ? 21.451 47.524 10.802  1.00 26.87 ? 224 ALA A N   1 
ATOM   1529 C CA  . ALA A 1 218 ? 21.588 48.822 10.147  1.00 27.94 ? 224 ALA A CA  1 
ATOM   1530 C C   . ALA A 1 218 ? 21.428 49.881 11.235  1.00 28.10 ? 224 ALA A C   1 
ATOM   1531 O O   . ALA A 1 218 ? 20.805 49.625 12.256  1.00 26.77 ? 224 ALA A O   1 
ATOM   1532 C CB  . ALA A 1 218 ? 20.497 49.000 9.076   1.00 25.86 ? 224 ALA A CB  1 
ATOM   1533 N N   . PRO A 1 219 ? 21.987 51.081 11.025  1.00 29.96 ? 225 PRO A N   1 
ATOM   1534 C CA  . PRO A 1 219 ? 21.893 52.167 12.007  1.00 30.56 ? 225 PRO A CA  1 
ATOM   1535 C C   . PRO A 1 219 ? 20.445 52.487 12.391  1.00 30.87 ? 225 PRO A C   1 
ATOM   1536 O O   . PRO A 1 219 ? 20.132 52.647 13.571  1.00 30.38 ? 225 PRO A O   1 
ATOM   1537 C CB  . PRO A 1 219 ? 22.548 53.351 11.296  1.00 31.59 ? 225 PRO A CB  1 
ATOM   1538 C CG  . PRO A 1 219 ? 23.426 52.723 10.267  1.00 31.60 ? 225 PRO A CG  1 
ATOM   1539 C CD  . PRO A 1 219 ? 22.650 51.537 9.792   1.00 30.00 ? 225 PRO A CD  1 
ATOM   1540 N N   . GLU A 1 220 ? 19.565 52.584 11.397  1.00 29.62 ? 226 GLU A N   1 
ATOM   1541 C CA  . GLU A 1 220 ? 18.175 52.908 11.684  1.00 29.80 ? 226 GLU A CA  1 
ATOM   1542 C C   . GLU A 1 220 ? 17.547 51.938 12.679  1.00 29.50 ? 226 GLU A C   1 
ATOM   1543 O O   . GLU A 1 220 ? 16.667 52.326 13.451  1.00 29.42 ? 226 GLU A O   1 
ATOM   1544 C CB  . GLU A 1 220 ? 17.329 52.991 10.395  1.00 30.59 ? 226 GLU A CB  1 
ATOM   1545 C CG  . GLU A 1 220 ? 17.223 51.728 9.543   1.00 31.45 ? 226 GLU A CG  1 
ATOM   1546 C CD  . GLU A 1 220 ? 18.296 51.654 8.474   1.00 32.08 ? 226 GLU A CD  1 
ATOM   1547 O OE1 . GLU A 1 220 ? 18.085 50.944 7.465   1.00 29.01 ? 226 GLU A OE1 1 
ATOM   1548 O OE2 . GLU A 1 220 ? 19.351 52.302 8.642   1.00 33.56 ? 226 GLU A OE2 1 
ATOM   1549 N N   . LEU A 1 221 ? 17.996 50.684 12.677  1.00 27.28 ? 227 LEU A N   1 
ATOM   1550 C CA  . LEU A 1 221 ? 17.463 49.710 13.627  1.00 27.15 ? 227 LEU A CA  1 
ATOM   1551 C C   . LEU A 1 221 ? 18.009 50.022 15.027  1.00 28.80 ? 227 LEU A C   1 
ATOM   1552 O O   . LEU A 1 221 ? 17.271 49.984 16.014  1.00 28.11 ? 227 LEU A O   1 
ATOM   1553 C CB  . LEU A 1 221 ? 17.862 48.283 13.233  1.00 27.90 ? 227 LEU A CB  1 
ATOM   1554 C CG  . LEU A 1 221 ? 17.309 47.678 11.934  1.00 26.26 ? 227 LEU A CG  1 
ATOM   1555 C CD1 . LEU A 1 221 ? 17.771 46.228 11.848  1.00 26.05 ? 227 LEU A CD1 1 
ATOM   1556 C CD2 . LEU A 1 221 ? 15.783 47.744 11.910  1.00 25.29 ? 227 LEU A CD2 1 
ATOM   1557 N N   . ILE A 1 222 ? 19.302 50.329 15.112  1.00 28.27 ? 228 ILE A N   1 
ATOM   1558 C CA  . ILE A 1 222 ? 19.895 50.653 16.409  1.00 30.09 ? 228 ILE A CA  1 
ATOM   1559 C C   . ILE A 1 222 ? 19.176 51.867 16.988  1.00 31.62 ? 228 ILE A C   1 
ATOM   1560 O O   . ILE A 1 222 ? 18.917 51.932 18.194  1.00 31.25 ? 228 ILE A O   1 
ATOM   1561 C CB  . ILE A 1 222 ? 21.390 50.970 16.288  1.00 29.97 ? 228 ILE A CB  1 
ATOM   1562 C CG1 . ILE A 1 222 ? 22.124 49.753 15.709  1.00 29.80 ? 228 ILE A CG1 1 
ATOM   1563 C CG2 . ILE A 1 222 ? 21.957 51.345 17.666  1.00 30.98 ? 228 ILE A CG2 1 
ATOM   1564 C CD1 . ILE A 1 222 ? 23.574 50.001 15.382  1.00 28.55 ? 228 ILE A CD1 1 
ATOM   1565 N N   . PHE A 1 223 ? 18.848 52.824 16.123  1.00 32.62 ? 229 PHE A N   1 
ATOM   1566 C CA  . PHE A 1 223 ? 18.147 54.034 16.546  1.00 32.95 ? 229 PHE A CA  1 
ATOM   1567 C C   . PHE A 1 223 ? 16.668 53.797 16.862  1.00 33.64 ? 229 PHE A C   1 
ATOM   1568 O O   . PHE A 1 223 ? 15.963 54.725 17.256  1.00 34.67 ? 229 PHE A O   1 
ATOM   1569 C CB  . PHE A 1 223 ? 18.280 55.126 15.479  1.00 33.61 ? 229 PHE A CB  1 
ATOM   1570 C CG  . PHE A 1 223 ? 19.603 55.846 15.498  1.00 36.35 ? 229 PHE A CG  1 
ATOM   1571 C CD1 . PHE A 1 223 ? 20.429 55.842 14.380  1.00 37.41 ? 229 PHE A CD1 1 
ATOM   1572 C CD2 . PHE A 1 223 ? 20.004 56.565 16.624  1.00 36.41 ? 229 PHE A CD2 1 
ATOM   1573 C CE1 . PHE A 1 223 ? 21.633 56.544 14.375  1.00 37.22 ? 229 PHE A CE1 1 
ATOM   1574 C CE2 . PHE A 1 223 ? 21.204 57.269 16.628  1.00 37.64 ? 229 PHE A CE2 1 
ATOM   1575 C CZ  . PHE A 1 223 ? 22.020 57.260 15.500  1.00 37.77 ? 229 PHE A CZ  1 
ATOM   1576 N N   . GLY A 1 224 ? 16.197 52.565 16.677  1.00 32.38 ? 230 GLY A N   1 
ATOM   1577 C CA  . GLY A 1 224 ? 14.811 52.244 16.982  1.00 30.99 ? 230 GLY A CA  1 
ATOM   1578 C C   . GLY A 1 224 ? 13.746 52.548 15.934  1.00 31.30 ? 230 GLY A C   1 
ATOM   1579 O O   . GLY A 1 224 ? 12.569 52.700 16.260  1.00 29.86 ? 230 GLY A O   1 
ATOM   1580 N N   . ALA A 1 225 ? 14.139 52.638 14.672  1.00 31.70 ? 231 ALA A N   1 
ATOM   1581 C CA  . ALA A 1 225 ? 13.163 52.916 13.629  1.00 31.50 ? 231 ALA A CA  1 
ATOM   1582 C C   . ALA A 1 225 ? 12.218 51.731 13.474  1.00 31.41 ? 231 ALA A C   1 
ATOM   1583 O O   . ALA A 1 225 ? 12.625 50.575 13.613  1.00 31.34 ? 231 ALA A O   1 
ATOM   1584 C CB  . ALA A 1 225 ? 13.874 53.200 12.309  1.00 31.77 ? 231 ALA A CB  1 
ATOM   1585 N N   . THR A 1 226 ? 10.948 52.025 13.213  1.00 32.38 ? 232 THR A N   1 
ATOM   1586 C CA  . THR A 1 226 ? 9.942  50.990 13.002  1.00 31.65 ? 232 THR A CA  1 
ATOM   1587 C C   . THR A 1 226 ? 9.385  51.155 11.583  1.00 31.07 ? 232 THR A C   1 
ATOM   1588 O O   . THR A 1 226 ? 8.505  50.409 11.160  1.00 29.95 ? 232 THR A O   1 
ATOM   1589 C CB  . THR A 1 226 ? 8.776  51.108 14.009  1.00 33.94 ? 232 THR A CB  1 
ATOM   1590 O OG1 . THR A 1 226 ? 8.172  52.402 13.890  1.00 35.04 ? 232 THR A OG1 1 
ATOM   1591 C CG2 . THR A 1 226 ? 9.276  50.901 15.442  1.00 33.28 ? 232 THR A CG2 1 
ATOM   1592 N N   . ASP A 1 227 ? 9.912  52.134 10.853  1.00 31.19 ? 233 ASP A N   1 
ATOM   1593 C CA  . ASP A 1 227 ? 9.467  52.403 9.487   1.00 32.45 ? 233 ASP A CA  1 
ATOM   1594 C C   . ASP A 1 227 ? 10.574 52.082 8.485   1.00 32.02 ? 233 ASP A C   1 
ATOM   1595 O O   . ASP A 1 227 ? 10.646 52.682 7.408   1.00 30.75 ? 233 ASP A O   1 
ATOM   1596 C CB  . ASP A 1 227 ? 9.064  53.874 9.345   1.00 34.73 ? 233 ASP A CB  1 
ATOM   1597 C CG  . ASP A 1 227 ? 10.249 54.815 9.470   1.00 38.71 ? 233 ASP A CG  1 
ATOM   1598 O OD1 . ASP A 1 227 ? 11.244 54.418 10.111  1.00 40.22 ? 233 ASP A OD1 1 
ATOM   1599 O OD2 . ASP A 1 227 ? 10.187 55.950 8.939   1.00 39.45 ? 233 ASP A OD2 1 
ATOM   1600 N N   . TYR A 1 228 ? 11.434 51.131 8.838   1.00 29.72 ? 234 TYR A N   1 
ATOM   1601 C CA  . TYR A 1 228 ? 12.533 50.762 7.958   1.00 28.37 ? 234 TYR A CA  1 
ATOM   1602 C C   . TYR A 1 228 ? 12.058 49.944 6.760   1.00 28.47 ? 234 TYR A C   1 
ATOM   1603 O O   . TYR A 1 228 ? 10.943 49.408 6.748   1.00 28.70 ? 234 TYR A O   1 
ATOM   1604 C CB  . TYR A 1 228 ? 13.609 49.997 8.744   1.00 25.78 ? 234 TYR A CB  1 
ATOM   1605 C CG  . TYR A 1 228 ? 13.101 48.741 9.409   1.00 24.96 ? 234 TYR A CG  1 
ATOM   1606 C CD1 . TYR A 1 228 ? 12.974 47.550 8.694   1.00 23.97 ? 234 TYR A CD1 1 
ATOM   1607 C CD2 . TYR A 1 228 ? 12.722 48.749 10.752  1.00 24.76 ? 234 TYR A CD2 1 
ATOM   1608 C CE1 . TYR A 1 228 ? 12.479 46.396 9.303   1.00 24.71 ? 234 TYR A CE1 1 
ATOM   1609 C CE2 . TYR A 1 228 ? 12.229 47.603 11.369  1.00 24.40 ? 234 TYR A CE2 1 
ATOM   1610 C CZ  . TYR A 1 228 ? 12.110 46.429 10.641  1.00 24.40 ? 234 TYR A CZ  1 
ATOM   1611 O OH  . TYR A 1 228 ? 11.625 45.293 11.260  1.00 24.58 ? 234 TYR A OH  1 
ATOM   1612 N N   . THR A 1 229 ? 12.922 49.851 5.756   1.00 30.06 ? 235 THR A N   1 
ATOM   1613 C CA  . THR A 1 229 ? 12.622 49.118 4.533   1.00 29.62 ? 235 THR A CA  1 
ATOM   1614 C C   . THR A 1 229 ? 13.577 47.942 4.345   1.00 29.27 ? 235 THR A C   1 
ATOM   1615 O O   . THR A 1 229 ? 14.407 47.650 5.211   1.00 25.61 ? 235 THR A O   1 
ATOM   1616 C CB  . THR A 1 229 ? 12.764 50.026 3.311   1.00 30.58 ? 235 THR A CB  1 
ATOM   1617 O OG1 . THR A 1 229 ? 14.146 50.377 3.145   1.00 31.45 ? 235 THR A OG1 1 
ATOM   1618 C CG2 . THR A 1 229 ? 11.941 51.292 3.497   1.00 31.77 ? 235 THR A CG2 1 
ATOM   1619 N N   . SER A 1 230 ? 13.460 47.279 3.199   1.00 27.79 ? 236 SER A N   1 
ATOM   1620 C CA  . SER A 1 230 ? 14.303 46.133 2.892   1.00 27.96 ? 236 SER A CA  1 
ATOM   1621 C C   . SER A 1 230 ? 15.771 46.500 2.804   1.00 27.00 ? 236 SER A C   1 
ATOM   1622 O O   . SER A 1 230 ? 16.643 45.621 2.773   1.00 27.32 ? 236 SER A O   1 
ATOM   1623 C CB  . SER A 1 230 ? 13.845 45.482 1.583   1.00 30.22 ? 236 SER A CB  1 
ATOM   1624 O OG  . SER A 1 230 ? 12.587 44.857 1.776   1.00 34.30 ? 236 SER A OG  1 
ATOM   1625 N N   . SER A 1 231 ? 16.059 47.795 2.751   1.00 26.02 ? 237 SER A N   1 
ATOM   1626 C CA  . SER A 1 231 ? 17.442 48.214 2.677   1.00 26.53 ? 237 SER A CA  1 
ATOM   1627 C C   . SER A 1 231 ? 18.232 47.833 3.943   1.00 26.00 ? 237 SER A C   1 
ATOM   1628 O O   . SER A 1 231 ? 19.454 47.967 3.955   1.00 24.40 ? 237 SER A O   1 
ATOM   1629 C CB  . SER A 1 231 ? 17.546 49.726 2.405   1.00 27.56 ? 237 SER A CB  1 
ATOM   1630 O OG  . SER A 1 231 ? 17.096 50.498 3.501   1.00 31.50 ? 237 SER A OG  1 
ATOM   1631 N N   . ILE A 1 232 ? 17.562 47.369 5.006   1.00 24.93 ? 238 ILE A N   1 
ATOM   1632 C CA  . ILE A 1 232 ? 18.331 46.964 6.194   1.00 25.18 ? 238 ILE A CA  1 
ATOM   1633 C C   . ILE A 1 232 ? 19.114 45.684 5.840   1.00 25.75 ? 238 ILE A C   1 
ATOM   1634 O O   . ILE A 1 232 ? 20.151 45.389 6.438   1.00 24.00 ? 238 ILE A O   1 
ATOM   1635 C CB  . ILE A 1 232 ? 17.448 46.683 7.448   1.00 24.30 ? 238 ILE A CB  1 
ATOM   1636 C CG1 . ILE A 1 232 ? 16.492 45.519 7.186   1.00 22.02 ? 238 ILE A CG1 1 
ATOM   1637 C CG2 . ILE A 1 232 ? 16.679 47.945 7.851   1.00 23.65 ? 238 ILE A CG2 1 
ATOM   1638 C CD1 . ILE A 1 232 ? 15.833 44.990 8.443   1.00 22.06 ? 238 ILE A CD1 1 
ATOM   1639 N N   . ASP A 1 233 ? 18.610 44.931 4.862   1.00 24.78 ? 239 ASP A N   1 
ATOM   1640 C CA  . ASP A 1 233 ? 19.276 43.707 4.410   1.00 23.90 ? 239 ASP A CA  1 
ATOM   1641 C C   . ASP A 1 233 ? 20.556 44.074 3.664   1.00 23.66 ? 239 ASP A C   1 
ATOM   1642 O O   . ASP A 1 233 ? 21.544 43.346 3.712   1.00 22.02 ? 239 ASP A O   1 
ATOM   1643 C CB  . ASP A 1 233 ? 18.380 42.907 3.455   1.00 23.84 ? 239 ASP A CB  1 
ATOM   1644 C CG  . ASP A 1 233 ? 17.349 42.053 4.179   1.00 24.92 ? 239 ASP A CG  1 
ATOM   1645 O OD1 . ASP A 1 233 ? 16.435 41.530 3.492   1.00 23.14 ? 239 ASP A OD1 1 
ATOM   1646 O OD2 . ASP A 1 233 ? 17.453 41.888 5.416   1.00 22.69 ? 239 ASP A OD2 1 
ATOM   1647 N N   . VAL A 1 234 ? 20.529 45.195 2.952   1.00 22.90 ? 240 VAL A N   1 
ATOM   1648 C CA  . VAL A 1 234 ? 21.705 45.630 2.203   1.00 23.79 ? 240 VAL A CA  1 
ATOM   1649 C C   . VAL A 1 234 ? 22.826 46.054 3.147   1.00 24.55 ? 240 VAL A C   1 
ATOM   1650 O O   . VAL A 1 234 ? 24.002 45.786 2.890   1.00 24.04 ? 240 VAL A O   1 
ATOM   1651 C CB  . VAL A 1 234 ? 21.359 46.788 1.242   1.00 24.57 ? 240 VAL A CB  1 
ATOM   1652 C CG1 . VAL A 1 234 ? 22.621 47.341 0.619   1.00 23.04 ? 240 VAL A CG1 1 
ATOM   1653 C CG2 . VAL A 1 234 ? 20.419 46.282 0.145   1.00 26.15 ? 240 VAL A CG2 1 
ATOM   1654 N N   . TRP A 1 235 ? 22.466 46.728 4.232   1.00 24.60 ? 241 TRP A N   1 
ATOM   1655 C CA  . TRP A 1 235 ? 23.474 47.126 5.206   1.00 25.41 ? 241 TRP A CA  1 
ATOM   1656 C C   . TRP A 1 235 ? 24.092 45.839 5.774   1.00 24.99 ? 241 TRP A C   1 
ATOM   1657 O O   . TRP A 1 235 ? 25.306 45.681 5.788   1.00 25.75 ? 241 TRP A O   1 
ATOM   1658 C CB  . TRP A 1 235 ? 22.838 47.955 6.332   1.00 26.28 ? 241 TRP A CB  1 
ATOM   1659 C CG  . TRP A 1 235 ? 23.785 48.251 7.462   1.00 24.44 ? 241 TRP A CG  1 
ATOM   1660 C CD1 . TRP A 1 235 ? 24.159 47.399 8.461   1.00 25.79 ? 241 TRP A CD1 1 
ATOM   1661 C CD2 . TRP A 1 235 ? 24.536 49.456 7.661   1.00 26.12 ? 241 TRP A CD2 1 
ATOM   1662 N NE1 . TRP A 1 235 ? 25.102 47.994 9.265   1.00 26.88 ? 241 TRP A NE1 1 
ATOM   1663 C CE2 . TRP A 1 235 ? 25.355 49.256 8.796   1.00 26.52 ? 241 TRP A CE2 1 
ATOM   1664 C CE3 . TRP A 1 235 ? 24.604 50.685 6.984   1.00 25.00 ? 241 TRP A CE3 1 
ATOM   1665 C CZ2 . TRP A 1 235 ? 26.231 50.242 9.275   1.00 26.04 ? 241 TRP A CZ2 1 
ATOM   1666 C CZ3 . TRP A 1 235 ? 25.472 51.663 7.460   1.00 26.03 ? 241 TRP A CZ3 1 
ATOM   1667 C CH2 . TRP A 1 235 ? 26.278 51.432 8.594   1.00 25.29 ? 241 TRP A CH2 1 
ATOM   1668 N N   . SER A 1 236 ? 23.247 44.913 6.222   1.00 24.39 ? 242 SER A N   1 
ATOM   1669 C CA  . SER A 1 236 ? 23.741 43.658 6.777   1.00 23.27 ? 242 SER A CA  1 
ATOM   1670 C C   . SER A 1 236 ? 24.676 42.969 5.789   1.00 22.92 ? 242 SER A C   1 
ATOM   1671 O O   . SER A 1 236 ? 25.695 42.411 6.186   1.00 24.62 ? 242 SER A O   1 
ATOM   1672 C CB  . SER A 1 236 ? 22.579 42.720 7.128   1.00 23.29 ? 242 SER A CB  1 
ATOM   1673 O OG  . SER A 1 236 ? 21.748 43.280 8.126   1.00 23.67 ? 242 SER A OG  1 
ATOM   1674 N N   . ALA A 1 237 ? 24.322 43.011 4.505   1.00 22.14 ? 243 ALA A N   1 
ATOM   1675 C CA  . ALA A 1 237 ? 25.140 42.404 3.459   1.00 22.33 ? 243 ALA A CA  1 
ATOM   1676 C C   . ALA A 1 237 ? 26.496 43.106 3.403   1.00 22.40 ? 243 ALA A C   1 
ATOM   1677 O O   . ALA A 1 237 ? 27.543 42.464 3.261   1.00 22.42 ? 243 ALA A O   1 
ATOM   1678 C CB  . ALA A 1 237 ? 24.429 42.516 2.094   1.00 20.84 ? 243 ALA A CB  1 
ATOM   1679 N N   . GLY A 1 238 ? 26.468 44.431 3.499   1.00 22.65 ? 244 GLY A N   1 
ATOM   1680 C CA  . GLY A 1 238 ? 27.704 45.197 3.473   1.00 22.87 ? 244 GLY A CA  1 
ATOM   1681 C C   . GLY A 1 238 ? 28.597 44.844 4.651   1.00 24.50 ? 244 GLY A C   1 
ATOM   1682 O O   . GLY A 1 238 ? 29.823 44.828 4.520   1.00 25.36 ? 244 GLY A O   1 
ATOM   1683 N N   . CYS A 1 239 ? 27.992 44.564 5.806   1.00 24.53 ? 245 CYS A N   1 
ATOM   1684 C CA  . CYS A 1 239 ? 28.769 44.199 6.990   1.00 25.42 ? 245 CYS A CA  1 
ATOM   1685 C C   . CYS A 1 239 ? 29.450 42.856 6.772   1.00 25.46 ? 245 CYS A C   1 
ATOM   1686 O O   . CYS A 1 239 ? 30.567 42.638 7.238   1.00 23.51 ? 245 CYS A O   1 
ATOM   1687 C CB  . CYS A 1 239 ? 27.877 44.124 8.233   1.00 25.98 ? 245 CYS A CB  1 
ATOM   1688 S SG  . CYS A 1 239 ? 27.224 45.718 8.790   1.00 27.34 ? 245 CYS A SG  1 
ATOM   1689 N N   . VAL A 1 240 ? 28.770 41.956 6.062   1.00 25.40 ? 246 VAL A N   1 
ATOM   1690 C CA  . VAL A 1 240 ? 29.332 40.642 5.775   1.00 24.90 ? 246 VAL A CA  1 
ATOM   1691 C C   . VAL A 1 240 ? 30.516 40.788 4.808   1.00 25.39 ? 246 VAL A C   1 
ATOM   1692 O O   . VAL A 1 240 ? 31.561 40.164 4.997   1.00 24.55 ? 246 VAL A O   1 
ATOM   1693 C CB  . VAL A 1 240 ? 28.245 39.696 5.184   1.00 24.87 ? 246 VAL A CB  1 
ATOM   1694 C CG1 . VAL A 1 240 ? 28.886 38.413 4.636   1.00 25.36 ? 246 VAL A CG1 1 
ATOM   1695 C CG2 . VAL A 1 240 ? 27.233 39.341 6.281   1.00 24.15 ? 246 VAL A CG2 1 
ATOM   1696 N N   . LEU A 1 241 ? 30.355 41.619 3.781   1.00 25.19 ? 247 LEU A N   1 
ATOM   1697 C CA  . LEU A 1 241 ? 31.432 41.843 2.813   1.00 27.20 ? 247 LEU A CA  1 
ATOM   1698 C C   . LEU A 1 241 ? 32.655 42.409 3.531   1.00 28.11 ? 247 LEU A C   1 
ATOM   1699 O O   . LEU A 1 241 ? 33.778 41.932 3.345   1.00 29.29 ? 247 LEU A O   1 
ATOM   1700 C CB  . LEU A 1 241 ? 30.993 42.833 1.723   1.00 24.75 ? 247 LEU A CB  1 
ATOM   1701 C CG  . LEU A 1 241 ? 32.089 43.358 0.783   1.00 25.29 ? 247 LEU A CG  1 
ATOM   1702 C CD1 . LEU A 1 241 ? 32.738 42.195 0.028   1.00 23.62 ? 247 LEU A CD1 1 
ATOM   1703 C CD2 . LEU A 1 241 ? 31.488 44.362 -0.201  1.00 23.55 ? 247 LEU A CD2 1 
ATOM   1704 N N   . ALA A 1 242 ? 32.431 43.437 4.343   1.00 27.47 ? 248 ALA A N   1 
ATOM   1705 C CA  . ALA A 1 242 ? 33.517 44.072 5.083   1.00 28.22 ? 248 ALA A CA  1 
ATOM   1706 C C   . ALA A 1 242 ? 34.225 43.048 5.955   1.00 27.56 ? 248 ALA A C   1 
ATOM   1707 O O   . ALA A 1 242 ? 35.458 42.988 5.988   1.00 28.34 ? 248 ALA A O   1 
ATOM   1708 C CB  . ALA A 1 242 ? 32.973 45.205 5.944   1.00 26.68 ? 248 ALA A CB  1 
ATOM   1709 N N   . GLU A 1 243 ? 33.439 42.229 6.647   1.00 27.92 ? 249 GLU A N   1 
ATOM   1710 C CA  . GLU A 1 243 ? 33.984 41.208 7.535   1.00 26.68 ? 249 GLU A CA  1 
ATOM   1711 C C   . GLU A 1 243 ? 34.860 40.203 6.790   1.00 27.18 ? 249 GLU A C   1 
ATOM   1712 O O   . GLU A 1 243 ? 35.919 39.822 7.279   1.00 26.84 ? 249 GLU A O   1 
ATOM   1713 C CB  . GLU A 1 243 ? 32.845 40.486 8.263   1.00 25.93 ? 249 GLU A CB  1 
ATOM   1714 C CG  . GLU A 1 243 ? 33.303 39.384 9.203   1.00 27.25 ? 249 GLU A CG  1 
ATOM   1715 C CD  . GLU A 1 243 ? 32.252 39.010 10.246  1.00 30.20 ? 249 GLU A CD  1 
ATOM   1716 O OE1 . GLU A 1 243 ? 32.476 38.021 10.981  1.00 29.82 ? 249 GLU A OE1 1 
ATOM   1717 O OE2 . GLU A 1 243 ? 31.215 39.709 10.342  1.00 28.21 ? 249 GLU A OE2 1 
ATOM   1718 N N   . LEU A 1 244 ? 34.420 39.775 5.609   1.00 26.56 ? 250 LEU A N   1 
ATOM   1719 C CA  . LEU A 1 244 ? 35.190 38.817 4.819   1.00 27.81 ? 250 LEU A CA  1 
ATOM   1720 C C   . LEU A 1 244 ? 36.512 39.421 4.340   1.00 27.80 ? 250 LEU A C   1 
ATOM   1721 O O   . LEU A 1 244 ? 37.512 38.724 4.212   1.00 29.88 ? 250 LEU A O   1 
ATOM   1722 C CB  . LEU A 1 244 ? 34.367 38.337 3.618   1.00 26.60 ? 250 LEU A CB  1 
ATOM   1723 C CG  . LEU A 1 244 ? 33.145 37.486 3.985   1.00 26.88 ? 250 LEU A CG  1 
ATOM   1724 C CD1 . LEU A 1 244 ? 32.426 37.032 2.714   1.00 26.51 ? 250 LEU A CD1 1 
ATOM   1725 C CD2 . LEU A 1 244 ? 33.596 36.283 4.798   1.00 25.80 ? 250 LEU A CD2 1 
ATOM   1726 N N   . LEU A 1 245 ? 36.505 40.720 4.074   1.00 28.49 ? 251 LEU A N   1 
ATOM   1727 C CA  . LEU A 1 245 ? 37.707 41.414 3.626   1.00 29.95 ? 251 LEU A CA  1 
ATOM   1728 C C   . LEU A 1 245 ? 38.661 41.640 4.798   1.00 31.71 ? 251 LEU A C   1 
ATOM   1729 O O   . LEU A 1 245 ? 39.869 41.441 4.675   1.00 32.10 ? 251 LEU A O   1 
ATOM   1730 C CB  . LEU A 1 245 ? 37.330 42.758 3.003   1.00 29.16 ? 251 LEU A CB  1 
ATOM   1731 C CG  . LEU A 1 245 ? 36.514 42.698 1.708   1.00 29.57 ? 251 LEU A CG  1 
ATOM   1732 C CD1 . LEU A 1 245 ? 36.086 44.101 1.302   1.00 29.65 ? 251 LEU A CD1 1 
ATOM   1733 C CD2 . LEU A 1 245 ? 37.343 42.050 0.611   1.00 29.15 ? 251 LEU A CD2 1 
ATOM   1734 N N   . LEU A 1 246 ? 38.096 42.038 5.934   1.00 32.90 ? 252 LEU A N   1 
ATOM   1735 C CA  . LEU A 1 246 ? 38.854 42.327 7.148   1.00 33.36 ? 252 LEU A CA  1 
ATOM   1736 C C   . LEU A 1 246 ? 39.308 41.125 7.970   1.00 33.63 ? 252 LEU A C   1 
ATOM   1737 O O   . LEU A 1 246 ? 40.388 41.149 8.566   1.00 33.80 ? 252 LEU A O   1 
ATOM   1738 C CB  . LEU A 1 246 ? 38.032 43.244 8.052   1.00 33.82 ? 252 LEU A CB  1 
ATOM   1739 C CG  . LEU A 1 246 ? 37.822 44.689 7.600   1.00 35.86 ? 252 LEU A CG  1 
ATOM   1740 C CD1 . LEU A 1 246 ? 36.812 45.371 8.514   1.00 37.58 ? 252 LEU A CD1 1 
ATOM   1741 C CD2 . LEU A 1 246 ? 39.157 45.430 7.627   1.00 36.87 ? 252 LEU A CD2 1 
ATOM   1742 N N   . GLY A 1 247 ? 38.485 40.083 8.019   1.00 31.05 ? 253 GLY A N   1 
ATOM   1743 C CA  . GLY A 1 247 ? 38.832 38.915 8.805   1.00 30.31 ? 253 GLY A CA  1 
ATOM   1744 C C   . GLY A 1 247 ? 38.207 38.986 10.190  1.00 29.88 ? 253 GLY A C   1 
ATOM   1745 O O   . GLY A 1 247 ? 38.495 38.159 11.056  1.00 29.92 ? 253 GLY A O   1 
ATOM   1746 N N   . GLN A 1 248 ? 37.355 39.987 10.397  1.00 30.23 ? 254 GLN A N   1 
ATOM   1747 C CA  . GLN A 1 248 ? 36.648 40.183 11.667  1.00 31.52 ? 254 GLN A CA  1 
ATOM   1748 C C   . GLN A 1 248 ? 35.499 41.177 11.457  1.00 30.91 ? 254 GLN A C   1 
ATOM   1749 O O   . GLN A 1 248 ? 35.524 41.960 10.514  1.00 29.70 ? 254 GLN A O   1 
ATOM   1750 C CB  . GLN A 1 248 ? 37.606 40.712 12.746  1.00 33.02 ? 254 GLN A CB  1 
ATOM   1751 C CG  . GLN A 1 248 ? 38.324 42.001 12.390  1.00 36.32 ? 254 GLN A CG  1 
ATOM   1752 C CD  . GLN A 1 248 ? 39.291 42.449 13.480  1.00 40.43 ? 254 GLN A CD  1 
ATOM   1753 O OE1 . GLN A 1 248 ? 38.881 42.955 14.522  1.00 42.67 ? 254 GLN A OE1 1 
ATOM   1754 N NE2 . GLN A 1 248 ? 40.579 42.247 13.245  1.00 41.52 ? 254 GLN A NE2 1 
ATOM   1755 N N   . PRO A 1 249 ? 34.482 41.162 12.337  1.00 31.22 ? 255 PRO A N   1 
ATOM   1756 C CA  . PRO A 1 249 ? 33.347 42.088 12.194  1.00 31.61 ? 255 PRO A CA  1 
ATOM   1757 C C   . PRO A 1 249 ? 33.833 43.529 12.077  1.00 32.75 ? 255 PRO A C   1 
ATOM   1758 O O   . PRO A 1 249 ? 34.794 43.914 12.742  1.00 32.38 ? 255 PRO A O   1 
ATOM   1759 C CB  . PRO A 1 249 ? 32.545 41.859 13.476  1.00 31.41 ? 255 PRO A CB  1 
ATOM   1760 C CG  . PRO A 1 249 ? 32.846 40.418 13.815  1.00 32.74 ? 255 PRO A CG  1 
ATOM   1761 C CD  . PRO A 1 249 ? 34.335 40.324 13.541  1.00 30.70 ? 255 PRO A CD  1 
ATOM   1762 N N   . ILE A 1 250 ? 33.181 44.330 11.239  1.00 32.75 ? 256 ILE A N   1 
ATOM   1763 C CA  . ILE A 1 250 ? 33.609 45.718 11.084  1.00 33.60 ? 256 ILE A CA  1 
ATOM   1764 C C   . ILE A 1 250 ? 32.986 46.681 12.100  1.00 32.94 ? 256 ILE A C   1 
ATOM   1765 O O   . ILE A 1 250 ? 33.565 47.726 12.398  1.00 32.78 ? 256 ILE A O   1 
ATOM   1766 C CB  . ILE A 1 250 ? 33.335 46.248 9.650   1.00 34.57 ? 256 ILE A CB  1 
ATOM   1767 C CG1 . ILE A 1 250 ? 33.834 47.692 9.537   1.00 34.54 ? 256 ILE A CG1 1 
ATOM   1768 C CG2 . ILE A 1 250 ? 31.848 46.155 9.318   1.00 33.74 ? 256 ILE A CG2 1 
ATOM   1769 C CD1 . ILE A 1 250 ? 33.835 48.243 8.124   1.00 36.44 ? 256 ILE A CD1 1 
ATOM   1770 N N   . PHE A 1 251 ? 31.823 46.333 12.642  1.00 31.51 ? 257 PHE A N   1 
ATOM   1771 C CA  . PHE A 1 251 ? 31.161 47.198 13.622  1.00 31.92 ? 257 PHE A CA  1 
ATOM   1772 C C   . PHE A 1 251 ? 30.765 46.441 14.898  1.00 31.85 ? 257 PHE A C   1 
ATOM   1773 O O   . PHE A 1 251 ? 29.588 46.323 15.218  1.00 31.99 ? 257 PHE A O   1 
ATOM   1774 C CB  . PHE A 1 251 ? 29.911 47.854 13.005  1.00 30.79 ? 257 PHE A CB  1 
ATOM   1775 C CG  . PHE A 1 251 ? 30.188 48.679 11.764  1.00 32.42 ? 257 PHE A CG  1 
ATOM   1776 C CD1 . PHE A 1 251 ? 31.181 49.657 11.759  1.00 33.52 ? 257 PHE A CD1 1 
ATOM   1777 C CD2 . PHE A 1 251 ? 29.437 48.490 10.606  1.00 31.85 ? 257 PHE A CD2 1 
ATOM   1778 C CE1 . PHE A 1 251 ? 31.420 50.433 10.622  1.00 32.69 ? 257 PHE A CE1 1 
ATOM   1779 C CE2 . PHE A 1 251 ? 29.666 49.261 9.463   1.00 32.47 ? 257 PHE A CE2 1 
ATOM   1780 C CZ  . PHE A 1 251 ? 30.660 50.234 9.471   1.00 32.62 ? 257 PHE A CZ  1 
ATOM   1781 N N   . PRO A 1 252 ? 31.749 45.916 15.645  1.00 32.78 ? 258 PRO A N   1 
ATOM   1782 C CA  . PRO A 1 252 ? 31.434 45.184 16.874  1.00 32.70 ? 258 PRO A CA  1 
ATOM   1783 C C   . PRO A 1 252 ? 30.972 46.125 17.988  1.00 33.06 ? 258 PRO A C   1 
ATOM   1784 O O   . PRO A 1 252 ? 31.070 47.341 17.855  1.00 33.33 ? 258 PRO A O   1 
ATOM   1785 C CB  . PRO A 1 252 ? 32.753 44.493 17.203  1.00 33.84 ? 258 PRO A CB  1 
ATOM   1786 C CG  . PRO A 1 252 ? 33.765 45.495 16.742  1.00 34.17 ? 258 PRO A CG  1 
ATOM   1787 C CD  . PRO A 1 252 ? 33.202 45.921 15.396  1.00 33.69 ? 258 PRO A CD  1 
ATOM   1788 N N   . GLY A 1 253 ? 30.475 45.554 19.080  1.00 33.39 ? 259 GLY A N   1 
ATOM   1789 C CA  . GLY A 1 253 ? 30.011 46.356 20.201  1.00 34.01 ? 259 GLY A CA  1 
ATOM   1790 C C   . GLY A 1 253 ? 28.966 45.607 21.002  1.00 34.81 ? 259 GLY A C   1 
ATOM   1791 O O   . GLY A 1 253 ? 28.047 45.024 20.424  1.00 35.56 ? 259 GLY A O   1 
ATOM   1792 N N   . ASP A 1 254 ? 29.105 45.614 22.327  1.00 35.54 ? 260 ASP A N   1 
ATOM   1793 C CA  . ASP A 1 254 ? 28.171 44.919 23.216  1.00 36.48 ? 260 ASP A CA  1 
ATOM   1794 C C   . ASP A 1 254 ? 26.834 45.654 23.325  1.00 35.26 ? 260 ASP A C   1 
ATOM   1795 O O   . ASP A 1 254 ? 25.803 45.046 23.621  1.00 35.35 ? 260 ASP A O   1 
ATOM   1796 C CB  . ASP A 1 254 ? 28.777 44.774 24.618  1.00 40.23 ? 260 ASP A CB  1 
ATOM   1797 C CG  . ASP A 1 254 ? 30.014 43.888 24.639  1.00 44.19 ? 260 ASP A CG  1 
ATOM   1798 O OD1 . ASP A 1 254 ? 30.726 43.893 25.672  1.00 48.53 ? 260 ASP A OD1 1 
ATOM   1799 O OD2 . ASP A 1 254 ? 30.272 43.185 23.637  1.00 45.66 ? 260 ASP A OD2 1 
ATOM   1800 N N   . SER A 1 255 ? 26.860 46.961 23.088  1.00 34.47 ? 261 SER A N   1 
ATOM   1801 C CA  . SER A 1 255 ? 25.651 47.774 23.162  1.00 33.11 ? 261 SER A CA  1 
ATOM   1802 C C   . SER A 1 255 ? 25.465 48.586 21.886  1.00 32.04 ? 261 SER A C   1 
ATOM   1803 O O   . SER A 1 255 ? 26.392 48.726 21.088  1.00 33.67 ? 261 SER A O   1 
ATOM   1804 C CB  . SER A 1 255 ? 25.744 48.741 24.332  1.00 31.72 ? 261 SER A CB  1 
ATOM   1805 O OG  . SER A 1 255 ? 26.675 49.762 24.032  1.00 31.01 ? 261 SER A OG  1 
ATOM   1806 N N   . GLY A 1 256 ? 24.262 49.129 21.717  1.00 31.99 ? 262 GLY A N   1 
ATOM   1807 C CA  . GLY A 1 256 ? 23.962 49.940 20.554  1.00 30.70 ? 262 GLY A CA  1 
ATOM   1808 C C   . GLY A 1 256 ? 24.901 51.125 20.486  1.00 31.26 ? 262 GLY A C   1 
ATOM   1809 O O   . GLY A 1 256 ? 25.417 51.453 19.422  1.00 29.45 ? 262 GLY A O   1 
ATOM   1810 N N   . VAL A 1 257 ? 25.127 51.770 21.631  1.00 31.67 ? 263 VAL A N   1 
ATOM   1811 C CA  . VAL A 1 257 ? 26.025 52.920 21.697  1.00 31.03 ? 263 VAL A CA  1 
ATOM   1812 C C   . VAL A 1 257 ? 27.406 52.554 21.168  1.00 30.79 ? 263 VAL A C   1 
ATOM   1813 O O   . VAL A 1 257 ? 27.957 53.251 20.320  1.00 32.73 ? 263 VAL A O   1 
ATOM   1814 C CB  . VAL A 1 257 ? 26.170 53.445 23.158  1.00 31.71 ? 263 VAL A CB  1 
ATOM   1815 C CG1 . VAL A 1 257 ? 27.240 54.523 23.225  1.00 32.57 ? 263 VAL A CG1 1 
ATOM   1816 C CG2 . VAL A 1 257 ? 24.844 53.996 23.641  1.00 30.15 ? 263 VAL A CG2 1 
ATOM   1817 N N   . ASP A 1 258 ? 27.967 51.458 21.666  1.00 29.81 ? 264 ASP A N   1 
ATOM   1818 C CA  . ASP A 1 258 ? 29.287 51.025 21.224  1.00 31.52 ? 264 ASP A CA  1 
ATOM   1819 C C   . ASP A 1 258 ? 29.323 50.759 19.718  1.00 31.34 ? 264 ASP A C   1 
ATOM   1820 O O   . ASP A 1 258 ? 30.237 51.203 19.020  1.00 32.50 ? 264 ASP A O   1 
ATOM   1821 C CB  . ASP A 1 258 ? 29.709 49.778 22.005  1.00 32.32 ? 264 ASP A CB  1 
ATOM   1822 C CG  . ASP A 1 258 ? 30.022 50.089 23.469  1.00 37.53 ? 264 ASP A CG  1 
ATOM   1823 O OD1 . ASP A 1 258 ? 30.175 49.145 24.273  1.00 38.35 ? 264 ASP A OD1 1 
ATOM   1824 O OD2 . ASP A 1 258 ? 30.116 51.289 23.811  1.00 37.86 ? 264 ASP A OD2 1 
ATOM   1825 N N   . GLN A 1 259 ? 28.319 50.040 19.224  1.00 31.19 ? 265 GLN A N   1 
ATOM   1826 C CA  . GLN A 1 259 ? 28.219 49.724 17.804  1.00 31.17 ? 265 GLN A CA  1 
ATOM   1827 C C   . GLN A 1 259 ? 28.155 51.007 16.977  1.00 31.73 ? 265 GLN A C   1 
ATOM   1828 O O   . GLN A 1 259 ? 28.782 51.103 15.921  1.00 31.11 ? 265 GLN A O   1 
ATOM   1829 C CB  . GLN A 1 259 ? 26.973 48.870 17.543  1.00 31.36 ? 265 GLN A CB  1 
ATOM   1830 C CG  . GLN A 1 259 ? 27.064 47.454 18.096  1.00 31.55 ? 265 GLN A CG  1 
ATOM   1831 C CD  . GLN A 1 259 ? 25.704 46.772 18.211  1.00 33.37 ? 265 GLN A CD  1 
ATOM   1832 O OE1 . GLN A 1 259 ? 24.718 47.219 17.626  1.00 33.10 ? 265 GLN A OE1 1 
ATOM   1833 N NE2 . GLN A 1 259 ? 25.653 45.681 18.967  1.00 34.34 ? 265 GLN A NE2 1 
ATOM   1834 N N   . LEU A 1 260 ? 27.393 51.991 17.455  1.00 32.51 ? 266 LEU A N   1 
ATOM   1835 C CA  . LEU A 1 260 ? 27.278 53.263 16.746  1.00 33.90 ? 266 LEU A CA  1 
ATOM   1836 C C   . LEU A 1 260 ? 28.608 54.016 16.720  1.00 35.30 ? 266 LEU A C   1 
ATOM   1837 O O   . LEU A 1 260 ? 28.917 54.711 15.755  1.00 35.80 ? 266 LEU A O   1 
ATOM   1838 C CB  . LEU A 1 260 ? 26.189 54.140 17.377  1.00 34.56 ? 266 LEU A CB  1 
ATOM   1839 C CG  . LEU A 1 260 ? 24.742 53.771 17.037  1.00 35.75 ? 266 LEU A CG  1 
ATOM   1840 C CD1 . LEU A 1 260 ? 23.774 54.682 17.784  1.00 36.59 ? 266 LEU A CD1 1 
ATOM   1841 C CD2 . LEU A 1 260 ? 24.532 53.897 15.535  1.00 36.30 ? 266 LEU A CD2 1 
ATOM   1842 N N   . VAL A 1 261 ? 29.400 53.880 17.780  1.00 36.45 ? 267 VAL A N   1 
ATOM   1843 C CA  . VAL A 1 261 ? 30.697 54.546 17.824  1.00 36.62 ? 267 VAL A CA  1 
ATOM   1844 C C   . VAL A 1 261 ? 31.597 53.956 16.738  1.00 37.51 ? 267 VAL A C   1 
ATOM   1845 O O   . VAL A 1 261 ? 32.299 54.688 16.037  1.00 36.27 ? 267 VAL A O   1 
ATOM   1846 C CB  . VAL A 1 261 ? 31.377 54.374 19.207  1.00 36.75 ? 267 VAL A CB  1 
ATOM   1847 C CG1 . VAL A 1 261 ? 32.823 54.854 19.154  1.00 37.17 ? 267 VAL A CG1 1 
ATOM   1848 C CG2 . VAL A 1 261 ? 30.609 55.157 20.254  1.00 35.82 ? 267 VAL A CG2 1 
ATOM   1849 N N   . GLU A 1 262 ? 31.569 52.633 16.596  1.00 37.73 ? 268 GLU A N   1 
ATOM   1850 C CA  . GLU A 1 262 ? 32.380 51.968 15.581  1.00 37.79 ? 268 GLU A CA  1 
ATOM   1851 C C   . GLU A 1 262 ? 31.953 52.405 14.183  1.00 37.44 ? 268 GLU A C   1 
ATOM   1852 O O   . GLU A 1 262 ? 32.788 52.576 13.295  1.00 37.53 ? 268 GLU A O   1 
ATOM   1853 C CB  . GLU A 1 262 ? 32.263 50.447 15.713  1.00 38.66 ? 268 GLU A CB  1 
ATOM   1854 C CG  . GLU A 1 262 ? 32.823 49.897 17.011  1.00 40.40 ? 268 GLU A CG  1 
ATOM   1855 C CD  . GLU A 1 262 ? 34.251 50.353 17.269  1.00 42.41 ? 268 GLU A CD  1 
ATOM   1856 O OE1 . GLU A 1 262 ? 35.116 50.141 16.393  1.00 43.47 ? 268 GLU A OE1 1 
ATOM   1857 O OE2 . GLU A 1 262 ? 34.508 50.925 18.350  1.00 45.03 ? 268 GLU A OE2 1 
ATOM   1858 N N   . ILE A 1 263 ? 30.652 52.588 13.986  1.00 37.20 ? 269 ILE A N   1 
ATOM   1859 C CA  . ILE A 1 263 ? 30.146 53.024 12.689  1.00 37.34 ? 269 ILE A CA  1 
ATOM   1860 C C   . ILE A 1 263 ? 30.604 54.454 12.423  1.00 39.31 ? 269 ILE A C   1 
ATOM   1861 O O   . ILE A 1 263 ? 31.124 54.763 11.350  1.00 38.77 ? 269 ILE A O   1 
ATOM   1862 C CB  . ILE A 1 263 ? 28.609 52.962 12.637  1.00 36.38 ? 269 ILE A CB  1 
ATOM   1863 C CG1 . ILE A 1 263 ? 28.154 51.505 12.706  1.00 35.19 ? 269 ILE A CG1 1 
ATOM   1864 C CG2 . ILE A 1 263 ? 28.092 53.616 11.356  1.00 35.86 ? 269 ILE A CG2 1 
ATOM   1865 C CD1 . ILE A 1 263 ? 26.654 51.343 12.851  1.00 34.66 ? 269 ILE A CD1 1 
ATOM   1866 N N   . ILE A 1 264 ? 30.415 55.321 13.412  1.00 41.03 ? 270 ILE A N   1 
ATOM   1867 C CA  . ILE A 1 264 ? 30.812 56.718 13.291  1.00 42.10 ? 270 ILE A CA  1 
ATOM   1868 C C   . ILE A 1 264 ? 32.298 56.841 12.959  1.00 42.28 ? 270 ILE A C   1 
ATOM   1869 O O   . ILE A 1 264 ? 32.688 57.674 12.148  1.00 42.67 ? 270 ILE A O   1 
ATOM   1870 C CB  . ILE A 1 264 ? 30.505 57.495 14.596  1.00 42.11 ? 270 ILE A CB  1 
ATOM   1871 C CG1 . ILE A 1 264 ? 28.994 57.681 14.735  1.00 42.37 ? 270 ILE A CG1 1 
ATOM   1872 C CG2 . ILE A 1 264 ? 31.207 58.842 14.591  1.00 42.37 ? 270 ILE A CG2 1 
ATOM   1873 C CD1 . ILE A 1 264 ? 28.566 58.346 16.028  1.00 41.14 ? 270 ILE A CD1 1 
ATOM   1874 N N   . LYS A 1 265 ? 33.125 56.004 13.572  1.00 43.08 ? 271 LYS A N   1 
ATOM   1875 C CA  . LYS A 1 265 ? 34.555 56.056 13.310  1.00 44.69 ? 271 LYS A CA  1 
ATOM   1876 C C   . LYS A 1 265 ? 34.888 55.801 11.844  1.00 45.19 ? 271 LYS A C   1 
ATOM   1877 O O   . LYS A 1 265 ? 35.932 56.237 11.360  1.00 45.26 ? 271 LYS A O   1 
ATOM   1878 C CB  . LYS A 1 265 ? 35.306 55.060 14.202  1.00 46.32 ? 271 LYS A CB  1 
ATOM   1879 C CG  . LYS A 1 265 ? 35.270 55.448 15.678  1.00 48.42 ? 271 LYS A CG  1 
ATOM   1880 C CD  . LYS A 1 265 ? 36.304 54.711 16.509  1.00 50.51 ? 271 LYS A CD  1 
ATOM   1881 C CE  . LYS A 1 265 ? 35.983 53.238 16.653  1.00 52.46 ? 271 LYS A CE  1 
ATOM   1882 N NZ  . LYS A 1 265 ? 36.841 52.617 17.703  1.00 53.75 ? 271 LYS A NZ  1 
ATOM   1883 N N   . VAL A 1 266 ? 34.006 55.105 11.133  1.00 44.66 ? 272 VAL A N   1 
ATOM   1884 C CA  . VAL A 1 266 ? 34.253 54.828 9.722   1.00 45.13 ? 272 VAL A CA  1 
ATOM   1885 C C   . VAL A 1 266 ? 33.460 55.762 8.811   1.00 45.58 ? 272 VAL A C   1 
ATOM   1886 O O   . VAL A 1 266 ? 34.028 56.402 7.929   1.00 46.10 ? 272 VAL A O   1 
ATOM   1887 C CB  . VAL A 1 266 ? 33.905 53.366 9.351   1.00 44.41 ? 272 VAL A CB  1 
ATOM   1888 C CG1 . VAL A 1 266 ? 34.076 53.157 7.852   1.00 44.14 ? 272 VAL A CG1 1 
ATOM   1889 C CG2 . VAL A 1 266 ? 34.799 52.404 10.114  1.00 42.90 ? 272 VAL A CG2 1 
ATOM   1890 N N   . LEU A 1 267 ? 32.151 55.843 9.028   1.00 45.70 ? 273 LEU A N   1 
ATOM   1891 C CA  . LEU A 1 267 ? 31.291 56.693 8.208   1.00 45.92 ? 273 LEU A CA  1 
ATOM   1892 C C   . LEU A 1 267 ? 31.292 58.162 8.609   1.00 46.81 ? 273 LEU A C   1 
ATOM   1893 O O   . LEU A 1 267 ? 30.759 59.004 7.889   1.00 46.34 ? 273 LEU A O   1 
ATOM   1894 C CB  . LEU A 1 267 ? 29.849 56.174 8.233   1.00 44.30 ? 273 LEU A CB  1 
ATOM   1895 C CG  . LEU A 1 267 ? 29.493 54.984 7.334   1.00 44.44 ? 273 LEU A CG  1 
ATOM   1896 C CD1 . LEU A 1 267 ? 30.333 53.769 7.689   1.00 43.72 ? 273 LEU A CD1 1 
ATOM   1897 C CD2 . LEU A 1 267 ? 28.012 54.674 7.490   1.00 41.83 ? 273 LEU A CD2 1 
ATOM   1898 N N   . GLY A 1 268 ? 31.890 58.473 9.753   1.00 48.04 ? 274 GLY A N   1 
ATOM   1899 C CA  . GLY A 1 268 ? 31.910 59.850 10.207  1.00 48.82 ? 274 GLY A CA  1 
ATOM   1900 C C   . GLY A 1 268 ? 30.601 60.154 10.905  1.00 49.77 ? 274 GLY A C   1 
ATOM   1901 O O   . GLY A 1 268 ? 29.647 59.389 10.783  1.00 49.64 ? 274 GLY A O   1 
ATOM   1902 N N   . THR A 1 269 ? 30.545 61.259 11.641  1.00 51.15 ? 275 THR A N   1 
ATOM   1903 C CA  . THR A 1 269 ? 29.326 61.627 12.354  1.00 51.96 ? 275 THR A CA  1 
ATOM   1904 C C   . THR A 1 269 ? 28.186 61.919 11.385  1.00 52.44 ? 275 THR A C   1 
ATOM   1905 O O   . THR A 1 269 ? 28.368 62.609 10.386  1.00 52.86 ? 275 THR A O   1 
ATOM   1906 C CB  . THR A 1 269 ? 29.549 62.864 13.253  1.00 52.32 ? 275 THR A CB  1 
ATOM   1907 O OG1 . THR A 1 269 ? 30.531 62.556 14.251  1.00 53.12 ? 275 THR A OG1 1 
ATOM   1908 C CG2 . THR A 1 269 ? 28.250 63.267 13.940  1.00 52.08 ? 275 THR A CG2 1 
ATOM   1909 N N   . PRO A 1 270 ? 26.993 61.381 11.668  1.00 53.00 ? 276 PRO A N   1 
ATOM   1910 C CA  . PRO A 1 270 ? 25.805 61.574 10.829  1.00 54.14 ? 276 PRO A CA  1 
ATOM   1911 C C   . PRO A 1 270 ? 25.261 62.998 10.901  1.00 55.59 ? 276 PRO A C   1 
ATOM   1912 O O   . PRO A 1 270 ? 25.125 63.555 11.989  1.00 55.91 ? 276 PRO A O   1 
ATOM   1913 C CB  . PRO A 1 270 ? 24.799 60.578 11.411  1.00 53.49 ? 276 PRO A CB  1 
ATOM   1914 C CG  . PRO A 1 270 ? 25.648 59.570 12.120  1.00 53.63 ? 276 PRO A CG  1 
ATOM   1915 C CD  . PRO A 1 270 ? 26.726 60.402 12.733  1.00 52.96 ? 276 PRO A CD  1 
ATOM   1916 N N   . THR A 1 271 ? 24.949 63.583 9.748   1.00 57.07 ? 277 THR A N   1 
ATOM   1917 C CA  . THR A 1 271 ? 24.377 64.926 9.717   1.00 57.90 ? 277 THR A CA  1 
ATOM   1918 C C   . THR A 1 271 ? 22.990 64.744 10.318  1.00 59.61 ? 277 THR A C   1 
ATOM   1919 O O   . THR A 1 271 ? 22.425 63.653 10.227  1.00 60.22 ? 277 THR A O   1 
ATOM   1920 C CB  . THR A 1 271 ? 24.219 65.450 8.277   1.00 56.86 ? 277 THR A CB  1 
ATOM   1921 O OG1 . THR A 1 271 ? 23.258 64.647 7.579   1.00 56.28 ? 277 THR A OG1 1 
ATOM   1922 C CG2 . THR A 1 271 ? 25.549 65.394 7.538   1.00 57.23 ? 277 THR A CG2 1 
ATOM   1923 N N   . ARG A 1 272 ? 22.433 65.784 10.935  1.00 61.32 ? 278 ARG A N   1 
ATOM   1924 C CA  . ARG A 1 272 ? 21.106 65.637 11.529  1.00 62.78 ? 278 ARG A CA  1 
ATOM   1925 C C   . ARG A 1 272 ? 20.108 65.222 10.452  1.00 62.34 ? 278 ARG A C   1 
ATOM   1926 O O   . ARG A 1 272 ? 19.055 64.650 10.743  1.00 62.32 ? 278 ARG A O   1 
ATOM   1927 C CB  . ARG A 1 272 ? 20.657 66.933 12.218  1.00 64.08 ? 278 ARG A CB  1 
ATOM   1928 C CG  . ARG A 1 272 ? 20.411 68.128 11.309  1.00 66.41 ? 278 ARG A CG  1 
ATOM   1929 C CD  . ARG A 1 272 ? 19.834 69.281 12.134  1.00 68.15 ? 278 ARG A CD  1 
ATOM   1930 N NE  . ARG A 1 272 ? 19.511 70.462 11.335  1.00 69.17 ? 278 ARG A NE  1 
ATOM   1931 C CZ  . ARG A 1 272 ? 18.910 71.546 11.820  1.00 69.83 ? 278 ARG A CZ  1 
ATOM   1932 N NH1 . ARG A 1 272 ? 18.565 71.601 13.101  1.00 69.88 ? 278 ARG A NH1 1 
ATOM   1933 N NH2 . ARG A 1 272 ? 18.652 72.577 11.024  1.00 69.64 ? 278 ARG A NH2 1 
ATOM   1934 N N   . GLU A 1 273 ? 20.459 65.505 9.203   1.00 62.35 ? 279 GLU A N   1 
ATOM   1935 C CA  . GLU A 1 273 ? 19.622 65.143 8.070   1.00 61.79 ? 279 GLU A CA  1 
ATOM   1936 C C   . GLU A 1 273 ? 19.605 63.620 7.972   1.00 60.43 ? 279 GLU A C   1 
ATOM   1937 O O   . GLU A 1 273 ? 18.543 63.001 7.925   1.00 60.64 ? 279 GLU A O   1 
ATOM   1938 C CB  . GLU A 1 273 ? 20.197 65.737 6.782   1.00 63.58 ? 279 GLU A CB  1 
ATOM   1939 C CG  . GLU A 1 273 ? 19.417 65.382 5.524   1.00 66.12 ? 279 GLU A CG  1 
ATOM   1940 C CD  . GLU A 1 273 ? 18.004 65.932 5.539   1.00 68.20 ? 279 GLU A CD  1 
ATOM   1941 O OE1 . GLU A 1 273 ? 17.850 67.169 5.647   1.00 69.84 ? 279 GLU A OE1 1 
ATOM   1942 O OE2 . GLU A 1 273 ? 17.048 65.131 5.444   1.00 68.95 ? 279 GLU A OE2 1 
ATOM   1943 N N   . GLN A 1 274 ? 20.794 63.024 7.951   1.00 58.56 ? 280 GLN A N   1 
ATOM   1944 C CA  . GLN A 1 274 ? 20.924 61.574 7.857   1.00 56.23 ? 280 GLN A CA  1 
ATOM   1945 C C   . GLN A 1 274 ? 20.232 60.876 9.021   1.00 55.75 ? 280 GLN A C   1 
ATOM   1946 O O   . GLN A 1 274 ? 19.620 59.823 8.846   1.00 54.87 ? 280 GLN A O   1 
ATOM   1947 C CB  . GLN A 1 274 ? 22.404 61.182 7.806   1.00 55.22 ? 280 GLN A CB  1 
ATOM   1948 C CG  . GLN A 1 274 ? 23.132 61.728 6.585   1.00 53.39 ? 280 GLN A CG  1 
ATOM   1949 C CD  . GLN A 1 274 ? 24.607 61.392 6.577   1.00 53.27 ? 280 GLN A CD  1 
ATOM   1950 O OE1 . GLN A 1 274 ? 25.325 61.672 7.539   1.00 53.38 ? 280 GLN A OE1 1 
ATOM   1951 N NE2 . GLN A 1 274 ? 25.074 60.795 5.484   1.00 51.51 ? 280 GLN A NE2 1 
ATOM   1952 N N   . ILE A 1 275 ? 20.323 61.463 10.210  1.00 55.43 ? 281 ILE A N   1 
ATOM   1953 C CA  . ILE A 1 275 ? 19.685 60.876 11.381  1.00 55.50 ? 281 ILE A CA  1 
ATOM   1954 C C   . ILE A 1 275 ? 18.179 60.874 11.164  1.00 55.31 ? 281 ILE A C   1 
ATOM   1955 O O   . ILE A 1 275 ? 17.484 59.942 11.565  1.00 54.56 ? 281 ILE A O   1 
ATOM   1956 C CB  . ILE A 1 275 ? 20.017 61.671 12.657  1.00 55.87 ? 281 ILE A CB  1 
ATOM   1957 C CG1 . ILE A 1 275 ? 21.530 61.647 12.897  1.00 56.18 ? 281 ILE A CG1 1 
ATOM   1958 C CG2 . ILE A 1 275 ? 19.274 61.075 13.847  1.00 55.36 ? 281 ILE A CG2 1 
ATOM   1959 C CD1 . ILE A 1 275 ? 21.988 62.474 14.084  1.00 57.22 ? 281 ILE A CD1 1 
ATOM   1960 N N   . ARG A 1 276 ? 17.685 61.928 10.521  1.00 56.27 ? 282 ARG A N   1 
ATOM   1961 C CA  . ARG A 1 276 ? 16.266 62.056 10.218  1.00 56.74 ? 282 ARG A CA  1 
ATOM   1962 C C   . ARG A 1 276 ? 15.887 60.952 9.229   1.00 56.30 ? 282 ARG A C   1 
ATOM   1963 O O   . ARG A 1 276 ? 14.812 60.355 9.323   1.00 55.31 ? 282 ARG A O   1 
ATOM   1964 C CB  . ARG A 1 276 ? 15.993 63.434 9.607   1.00 58.58 ? 282 ARG A CB  1 
ATOM   1965 C CG  . ARG A 1 276 ? 14.584 63.627 9.063   1.00 61.05 ? 282 ARG A CG  1 
ATOM   1966 C CD  . ARG A 1 276 ? 14.488 64.924 8.266   1.00 62.90 ? 282 ARG A CD  1 
ATOM   1967 N NE  . ARG A 1 276 ? 13.276 64.982 7.451   1.00 64.86 ? 282 ARG A NE  1 
ATOM   1968 C CZ  . ARG A 1 276 ? 12.969 65.984 6.629   1.00 65.67 ? 282 ARG A CZ  1 
ATOM   1969 N NH1 . ARG A 1 276 ? 13.784 67.023 6.506   1.00 65.61 ? 282 ARG A NH1 1 
ATOM   1970 N NH2 . ARG A 1 276 ? 11.845 65.946 5.924   1.00 66.03 ? 282 ARG A NH2 1 
ATOM   1971 N N   . GLU A 1 277 ? 16.789 60.685 8.287   1.00 56.08 ? 283 GLU A N   1 
ATOM   1972 C CA  . GLU A 1 277 ? 16.583 59.654 7.270   1.00 56.38 ? 283 GLU A CA  1 
ATOM   1973 C C   . GLU A 1 277 ? 16.420 58.282 7.928   1.00 55.84 ? 283 GLU A C   1 
ATOM   1974 O O   . GLU A 1 277 ? 15.583 57.476 7.519   1.00 55.11 ? 283 GLU A O   1 
ATOM   1975 C CB  . GLU A 1 277 ? 17.787 59.594 6.323   1.00 58.17 ? 283 GLU A CB  1 
ATOM   1976 C CG  . GLU A 1 277 ? 18.304 60.939 5.840   1.00 61.24 ? 283 GLU A CG  1 
ATOM   1977 C CD  . GLU A 1 277 ? 17.436 61.553 4.767   1.00 63.78 ? 283 GLU A CD  1 
ATOM   1978 O OE1 . GLU A 1 277 ? 17.373 60.986 3.655   1.00 65.10 ? 283 GLU A OE1 1 
ATOM   1979 O OE2 . GLU A 1 277 ? 16.816 62.604 5.033   1.00 66.47 ? 283 GLU A OE2 1 
ATOM   1980 N N   . MET A 1 278 ? 17.235 58.022 8.946   1.00 55.56 ? 284 MET A N   1 
ATOM   1981 C CA  . MET A 1 278 ? 17.200 56.745 9.647   1.00 55.54 ? 284 MET A CA  1 
ATOM   1982 C C   . MET A 1 278 ? 16.014 56.589 10.594  1.00 56.92 ? 284 MET A C   1 
ATOM   1983 O O   . MET A 1 278 ? 15.318 55.573 10.557  1.00 56.39 ? 284 MET A O   1 
ATOM   1984 C CB  . MET A 1 278 ? 18.512 56.540 10.409  1.00 53.75 ? 284 MET A CB  1 
ATOM   1985 C CG  . MET A 1 278 ? 19.732 56.495 9.496   1.00 52.11 ? 284 MET A CG  1 
ATOM   1986 S SD  . MET A 1 278 ? 21.294 56.208 10.351  1.00 49.39 ? 284 MET A SD  1 
ATOM   1987 C CE  . MET A 1 278 ? 21.714 57.879 10.890  1.00 49.81 ? 284 MET A CE  1 
ATOM   1988 N N   . ASN A 1 279 ? 15.780 57.586 11.441  1.00 58.95 ? 285 ASN A N   1 
ATOM   1989 C CA  . ASN A 1 279 ? 14.670 57.517 12.388  1.00 61.22 ? 285 ASN A CA  1 
ATOM   1990 C C   . ASN A 1 279 ? 14.120 58.893 12.742  1.00 62.91 ? 285 ASN A C   1 
ATOM   1991 O O   . ASN A 1 279 ? 14.774 59.677 13.434  1.00 63.31 ? 285 ASN A O   1 
ATOM   1992 C CB  . ASN A 1 279 ? 15.111 56.792 13.665  1.00 61.17 ? 285 ASN A CB  1 
ATOM   1993 C CG  . ASN A 1 279 ? 13.990 56.663 14.680  1.00 61.81 ? 285 ASN A CG  1 
ATOM   1994 O OD1 . ASN A 1 279 ? 12.858 56.327 14.329  1.00 61.54 ? 285 ASN A OD1 1 
ATOM   1995 N ND2 . ASN A 1 279 ? 14.301 56.917 15.946  1.00 61.39 ? 285 ASN A ND2 1 
ATOM   1996 N N   . PRO A 1 280 ? 12.899 59.199 12.267  1.00 64.14 ? 286 PRO A N   1 
ATOM   1997 C CA  . PRO A 1 280 ? 12.201 60.469 12.498  1.00 64.98 ? 286 PRO A CA  1 
ATOM   1998 C C   . PRO A 1 280 ? 12.133 60.852 13.977  1.00 65.56 ? 286 PRO A C   1 
ATOM   1999 O O   . PRO A 1 280 ? 11.722 60.050 14.819  1.00 66.35 ? 286 PRO A O   1 
ATOM   2000 C CB  . PRO A 1 280 ? 10.816 60.209 11.910  1.00 65.60 ? 286 PRO A CB  1 
ATOM   2001 C CG  . PRO A 1 280 ? 11.103 59.257 10.791  1.00 65.25 ? 286 PRO A CG  1 
ATOM   2002 C CD  . PRO A 1 280 ? 12.082 58.301 11.429  1.00 64.60 ? 286 PRO A CD  1 
ATOM   2003 N N   . GLU A 1 284 ? 18.385 61.644 19.239  1.00 64.90 ? 290 GLU A N   1 
ATOM   2004 C CA  . GLU A 1 284 ? 18.259 62.492 20.419  1.00 64.15 ? 290 GLU A CA  1 
ATOM   2005 C C   . GLU A 1 284 ? 19.493 62.401 21.325  1.00 64.00 ? 290 GLU A C   1 
ATOM   2006 O O   . GLU A 1 284 ? 19.548 63.027 22.381  1.00 64.32 ? 290 GLU A O   1 
ATOM   2007 C CB  . GLU A 1 284 ? 17.000 62.094 21.197  1.00 64.18 ? 290 GLU A CB  1 
ATOM   2008 C CG  . GLU A 1 284 ? 16.532 60.665 20.915  1.00 63.79 ? 290 GLU A CG  1 
ATOM   2009 C CD  . GLU A 1 284 ? 15.510 60.158 21.919  1.00 63.89 ? 290 GLU A CD  1 
ATOM   2010 O OE1 . GLU A 1 284 ? 15.854 60.040 23.115  1.00 63.61 ? 290 GLU A OE1 1 
ATOM   2011 O OE2 . GLU A 1 284 ? 14.363 59.873 21.514  1.00 64.69 ? 290 GLU A OE2 1 
ATOM   2012 N N   . PHE A 1 285 ? 20.486 61.632 20.891  1.00 63.56 ? 291 PHE A N   1 
ATOM   2013 C CA  . PHE A 1 285 ? 21.720 61.431 21.648  1.00 63.08 ? 291 PHE A CA  1 
ATOM   2014 C C   . PHE A 1 285 ? 22.815 62.430 21.258  1.00 63.59 ? 291 PHE A C   1 
ATOM   2015 O O   . PHE A 1 285 ? 22.646 63.239 20.341  1.00 63.34 ? 291 PHE A O   1 
ATOM   2016 C CB  . PHE A 1 285 ? 22.238 60.009 21.410  1.00 61.79 ? 291 PHE A CB  1 
ATOM   2017 C CG  . PHE A 1 285 ? 22.959 59.408 22.587  1.00 60.89 ? 291 PHE A CG  1 
ATOM   2018 C CD1 . PHE A 1 285 ? 22.298 59.197 23.793  1.00 60.25 ? 291 PHE A CD1 1 
ATOM   2019 C CD2 . PHE A 1 285 ? 24.286 59.006 22.474  1.00 60.31 ? 291 PHE A CD2 1 
ATOM   2020 C CE1 . PHE A 1 285 ? 22.945 58.590 24.869  1.00 59.67 ? 291 PHE A CE1 1 
ATOM   2021 C CE2 . PHE A 1 285 ? 24.941 58.398 23.547  1.00 60.06 ? 291 PHE A CE2 1 
ATOM   2022 C CZ  . PHE A 1 285 ? 24.269 58.190 24.743  1.00 59.22 ? 291 PHE A CZ  1 
ATOM   2023 N N   . LYS A 1 286 ? 23.937 62.350 21.971  1.00 63.67 ? 292 LYS A N   1 
ATOM   2024 C CA  . LYS A 1 286 ? 25.105 63.198 21.741  1.00 63.73 ? 292 LYS A CA  1 
ATOM   2025 C C   . LYS A 1 286 ? 26.269 62.292 21.364  1.00 63.71 ? 292 LYS A C   1 
ATOM   2026 O O   . LYS A 1 286 ? 26.693 61.463 22.172  1.00 63.41 ? 292 LYS A O   1 
ATOM   2027 C CB  . LYS A 1 286 ? 25.498 63.952 23.016  1.00 64.83 ? 292 LYS A CB  1 
ATOM   2028 C CG  . LYS A 1 286 ? 24.663 65.169 23.377  1.00 66.03 ? 292 LYS A CG  1 
ATOM   2029 C CD  . LYS A 1 286 ? 25.212 65.792 24.662  1.00 66.57 ? 292 LYS A CD  1 
ATOM   2030 C CE  . LYS A 1 286 ? 24.513 67.097 25.018  1.00 66.41 ? 292 LYS A CE  1 
ATOM   2031 N NZ  . LYS A 1 286 ? 25.004 67.658 26.312  1.00 65.87 ? 292 LYS A NZ  1 
ATOM   2032 N N   . PHE A 1 287 ? 26.790 62.439 20.152  1.00 63.61 ? 293 PHE A N   1 
ATOM   2033 C CA  . PHE A 1 287 ? 27.915 61.612 19.734  1.00 63.65 ? 293 PHE A CA  1 
ATOM   2034 C C   . PHE A 1 287 ? 29.166 62.431 19.464  1.00 64.15 ? 293 PHE A C   1 
ATOM   2035 O O   . PHE A 1 287 ? 29.087 63.608 19.111  1.00 64.29 ? 293 PHE A O   1 
ATOM   2036 C CB  . PHE A 1 287 ? 27.558 60.793 18.491  1.00 62.74 ? 293 PHE A CB  1 
ATOM   2037 C CG  . PHE A 1 287 ? 26.756 59.563 18.792  1.00 61.51 ? 293 PHE A CG  1 
ATOM   2038 C CD1 . PHE A 1 287 ? 25.371 59.564 18.658  1.00 61.68 ? 293 PHE A CD1 1 
ATOM   2039 C CD2 . PHE A 1 287 ? 27.388 58.404 19.240  1.00 61.36 ? 293 PHE A CD2 1 
ATOM   2040 C CE1 . PHE A 1 287 ? 24.622 58.426 18.966  1.00 60.91 ? 293 PHE A CE1 1 
ATOM   2041 C CE2 . PHE A 1 287 ? 26.653 57.263 19.551  1.00 60.73 ? 293 PHE A CE2 1 
ATOM   2042 C CZ  . PHE A 1 287 ? 25.266 57.274 19.414  1.00 60.34 ? 293 PHE A CZ  1 
ATOM   2043 N N   . PRO A 1 288 ? 30.347 61.818 19.646  1.00 64.59 ? 294 PRO A N   1 
ATOM   2044 C CA  . PRO A 1 288 ? 31.615 62.513 19.412  1.00 64.86 ? 294 PRO A CA  1 
ATOM   2045 C C   . PRO A 1 288 ? 31.723 62.924 17.947  1.00 65.19 ? 294 PRO A C   1 
ATOM   2046 O O   . PRO A 1 288 ? 31.564 62.096 17.049  1.00 65.20 ? 294 PRO A O   1 
ATOM   2047 C CB  . PRO A 1 288 ? 32.658 61.466 19.801  1.00 64.79 ? 294 PRO A CB  1 
ATOM   2048 C CG  . PRO A 1 288 ? 31.953 60.669 20.858  1.00 64.60 ? 294 PRO A CG  1 
ATOM   2049 C CD  . PRO A 1 288 ? 30.584 60.493 20.245  1.00 64.97 ? 294 PRO A CD  1 
ATOM   2050 N N   . GLN A 1 289 ? 31.980 64.206 17.712  1.00 65.42 ? 295 GLN A N   1 
ATOM   2051 C CA  . GLN A 1 289 ? 32.107 64.718 16.354  1.00 65.62 ? 295 GLN A CA  1 
ATOM   2052 C C   . GLN A 1 289 ? 33.382 64.164 15.722  1.00 65.72 ? 295 GLN A C   1 
ATOM   2053 O O   . GLN A 1 289 ? 34.474 64.692 15.938  1.00 65.65 ? 295 GLN A O   1 
ATOM   2054 C CB  . GLN A 1 289 ? 32.152 66.248 16.370  1.00 65.54 ? 295 GLN A CB  1 
ATOM   2055 C CG  . GLN A 1 289 ? 32.009 66.889 14.999  1.00 65.93 ? 295 GLN A CG  1 
ATOM   2056 C CD  . GLN A 1 289 ? 30.666 66.588 14.354  1.00 66.43 ? 295 GLN A CD  1 
ATOM   2057 O OE1 . GLN A 1 289 ? 29.612 66.863 14.931  1.00 66.70 ? 295 GLN A OE1 1 
ATOM   2058 N NE2 . GLN A 1 289 ? 30.699 66.021 13.152  1.00 65.45 ? 295 GLN A NE2 1 
ATOM   2059 N N   . ILE A 1 290 ? 33.236 63.093 14.948  1.00 65.75 ? 296 ILE A N   1 
ATOM   2060 C CA  . ILE A 1 290 ? 34.376 62.465 14.293  1.00 65.83 ? 296 ILE A CA  1 
ATOM   2061 C C   . ILE A 1 290 ? 34.252 62.555 12.778  1.00 65.92 ? 296 ILE A C   1 
ATOM   2062 O O   . ILE A 1 290 ? 33.179 62.331 12.217  1.00 66.27 ? 296 ILE A O   1 
ATOM   2063 C CB  . ILE A 1 290 ? 34.502 60.978 14.699  1.00 65.71 ? 296 ILE A CB  1 
ATOM   2064 C CG1 . ILE A 1 290 ? 34.673 60.869 16.218  1.00 65.77 ? 296 ILE A CG1 1 
ATOM   2065 C CG2 . ILE A 1 290 ? 35.688 60.344 13.992  1.00 65.56 ? 296 ILE A CG2 1 
ATOM   2066 C CD1 . ILE A 1 290 ? 34.703 59.444 16.740  1.00 66.05 ? 296 ILE A CD1 1 
ATOM   2067 N N   . LYS A 1 291 ? 35.360 62.895 12.125  1.00 66.14 ? 297 LYS A N   1 
ATOM   2068 C CA  . LYS A 1 291 ? 35.395 63.015 10.673  1.00 65.86 ? 297 LYS A CA  1 
ATOM   2069 C C   . LYS A 1 291 ? 35.539 61.637 10.032  1.00 65.51 ? 297 LYS A C   1 
ATOM   2070 O O   . LYS A 1 291 ? 36.256 60.773 10.542  1.00 65.21 ? 297 LYS A O   1 
ATOM   2071 C CB  . LYS A 1 291 ? 36.555 63.926 10.254  1.00 66.31 ? 297 LYS A CB  1 
ATOM   2072 C CG  . LYS A 1 291 ? 37.877 63.597 10.935  1.00 67.61 ? 297 LYS A CG  1 
ATOM   2073 C CD  . LYS A 1 291 ? 38.926 64.669 10.675  1.00 68.46 ? 297 LYS A CD  1 
ATOM   2074 C CE  . LYS A 1 291 ? 40.206 64.393 11.459  1.00 68.75 ? 297 LYS A CE  1 
ATOM   2075 N NZ  . LYS A 1 291 ? 41.230 65.463 11.258  1.00 69.51 ? 297 LYS A NZ  1 
ATOM   2076 N N   . ALA A 1 292 ? 34.845 61.441 8.915   1.00 65.31 ? 298 ALA A N   1 
ATOM   2077 C CA  . ALA A 1 292 ? 34.867 60.171 8.195   1.00 65.04 ? 298 ALA A CA  1 
ATOM   2078 C C   . ALA A 1 292 ? 36.273 59.611 8.007   1.00 65.19 ? 298 ALA A C   1 
ATOM   2079 O O   . ALA A 1 292 ? 37.225 60.352 7.756   1.00 65.26 ? 298 ALA A O   1 
ATOM   2080 C CB  . ALA A 1 292 ? 34.191 60.335 6.836   1.00 65.03 ? 298 ALA A CB  1 
ATOM   2081 N N   . HIS A 1 293 ? 36.394 58.293 8.131   1.00 64.99 ? 299 HIS A N   1 
ATOM   2082 C CA  . HIS A 1 293 ? 37.677 57.627 7.956   1.00 64.86 ? 299 HIS A CA  1 
ATOM   2083 C C   . HIS A 1 293 ? 37.756 57.091 6.528   1.00 64.32 ? 299 HIS A C   1 
ATOM   2084 O O   . HIS A 1 293 ? 36.916 56.288 6.109   1.00 64.47 ? 299 HIS A O   1 
ATOM   2085 C CB  . HIS A 1 293 ? 37.818 56.477 8.956   1.00 65.78 ? 299 HIS A CB  1 
ATOM   2086 C CG  . HIS A 1 293 ? 39.144 55.785 8.893   1.00 67.55 ? 299 HIS A CG  1 
ATOM   2087 N ND1 . HIS A 1 293 ? 40.341 56.466 8.964   1.00 68.31 ? 299 HIS A ND1 1 
ATOM   2088 C CD2 . HIS A 1 293 ? 39.462 54.475 8.771   1.00 68.45 ? 299 HIS A CD2 1 
ATOM   2089 C CE1 . HIS A 1 293 ? 41.340 55.604 8.886   1.00 68.98 ? 299 HIS A CE1 1 
ATOM   2090 N NE2 . HIS A 1 293 ? 40.834 54.389 8.769   1.00 69.28 ? 299 HIS A NE2 1 
ATOM   2091 N N   . PRO A 1 294 ? 38.768 57.527 5.759   1.00 63.51 ? 300 PRO A N   1 
ATOM   2092 C CA  . PRO A 1 294 ? 38.913 57.062 4.375   1.00 62.48 ? 300 PRO A CA  1 
ATOM   2093 C C   . PRO A 1 294 ? 38.829 55.542 4.280   1.00 61.17 ? 300 PRO A C   1 
ATOM   2094 O O   . PRO A 1 294 ? 39.716 54.828 4.752   1.00 61.76 ? 300 PRO A O   1 
ATOM   2095 C CB  . PRO A 1 294 ? 40.284 57.609 3.968   1.00 62.99 ? 300 PRO A CB  1 
ATOM   2096 C CG  . PRO A 1 294 ? 41.028 57.665 5.274   1.00 63.35 ? 300 PRO A CG  1 
ATOM   2097 C CD  . PRO A 1 294 ? 39.983 58.232 6.203   1.00 63.46 ? 300 PRO A CD  1 
ATOM   2098 N N   . TRP A 1 295 ? 37.747 55.056 3.677   1.00 59.27 ? 301 TRP A N   1 
ATOM   2099 C CA  . TRP A 1 295 ? 37.530 53.623 3.529   1.00 56.65 ? 301 TRP A CA  1 
ATOM   2100 C C   . TRP A 1 295 ? 38.777 52.852 3.100   1.00 56.65 ? 301 TRP A C   1 
ATOM   2101 O O   . TRP A 1 295 ? 38.945 51.688 3.465   1.00 56.64 ? 301 TRP A O   1 
ATOM   2102 C CB  . TRP A 1 295 ? 36.405 53.356 2.526   1.00 53.50 ? 301 TRP A CB  1 
ATOM   2103 C CG  . TRP A 1 295 ? 35.024 53.393 3.111   1.00 50.19 ? 301 TRP A CG  1 
ATOM   2104 C CD1 . TRP A 1 295 ? 34.088 54.377 2.953   1.00 49.12 ? 301 TRP A CD1 1 
ATOM   2105 C CD2 . TRP A 1 295 ? 34.401 52.369 3.894   1.00 48.13 ? 301 TRP A CD2 1 
ATOM   2106 N NE1 . TRP A 1 295 ? 32.917 54.023 3.581   1.00 48.02 ? 301 TRP A NE1 1 
ATOM   2107 C CE2 . TRP A 1 295 ? 33.082 52.795 4.167   1.00 47.72 ? 301 TRP A CE2 1 
ATOM   2108 C CE3 . TRP A 1 295 ? 34.829 51.129 4.391   1.00 47.14 ? 301 TRP A CE3 1 
ATOM   2109 C CZ2 . TRP A 1 295 ? 32.186 52.023 4.914   1.00 45.76 ? 301 TRP A CZ2 1 
ATOM   2110 C CZ3 . TRP A 1 295 ? 33.937 50.362 5.134   1.00 45.79 ? 301 TRP A CZ3 1 
ATOM   2111 C CH2 . TRP A 1 295 ? 32.630 50.814 5.387   1.00 45.62 ? 301 TRP A CH2 1 
ATOM   2112 N N   . THR A 1 296 ? 39.650 53.491 2.327   1.00 57.00 ? 302 THR A N   1 
ATOM   2113 C CA  . THR A 1 296 ? 40.860 52.821 1.864   1.00 56.92 ? 302 THR A CA  1 
ATOM   2114 C C   . THR A 1 296 ? 41.764 52.398 3.019   1.00 56.44 ? 302 THR A C   1 
ATOM   2115 O O   . THR A 1 296 ? 42.441 51.373 2.934   1.00 57.46 ? 302 THR A O   1 
ATOM   2116 C CB  . THR A 1 296 ? 41.658 53.711 0.884   1.00 57.17 ? 302 THR A CB  1 
ATOM   2117 O OG1 . THR A 1 296 ? 40.839 54.012 -0.254  1.00 57.32 ? 302 THR A OG1 1 
ATOM   2118 C CG2 . THR A 1 296 ? 42.916 52.989 0.406   1.00 57.40 ? 302 THR A CG2 1 
ATOM   2119 N N   . LYS A 1 297 ? 41.764 53.177 4.098   1.00 55.94 ? 303 LYS A N   1 
ATOM   2120 C CA  . LYS A 1 297 ? 42.586 52.870 5.268   1.00 54.93 ? 303 LYS A CA  1 
ATOM   2121 C C   . LYS A 1 297 ? 41.934 51.856 6.210   1.00 53.26 ? 303 LYS A C   1 
ATOM   2122 O O   . LYS A 1 297 ? 42.525 51.464 7.218   1.00 52.70 ? 303 LYS A O   1 
ATOM   2123 C CB  . LYS A 1 297 ? 42.891 54.147 6.055   1.00 57.21 ? 303 LYS A CB  1 
ATOM   2124 C CG  . LYS A 1 297 ? 43.798 55.140 5.340   1.00 59.72 ? 303 LYS A CG  1 
ATOM   2125 C CD  . LYS A 1 297 ? 44.088 56.328 6.246   1.00 61.02 ? 303 LYS A CD  1 
ATOM   2126 C CE  . LYS A 1 297 ? 44.982 57.357 5.571   1.00 62.06 ? 303 LYS A CE  1 
ATOM   2127 N NZ  . LYS A 1 297 ? 45.233 58.518 6.475   1.00 62.54 ? 303 LYS A NZ  1 
ATOM   2128 N N   . VAL A 1 298 ? 40.714 51.436 5.891   1.00 51.05 ? 304 VAL A N   1 
ATOM   2129 C CA  . VAL A 1 298 ? 40.012 50.469 6.726   1.00 48.04 ? 304 VAL A CA  1 
ATOM   2130 C C   . VAL A 1 298 ? 40.503 49.048 6.471   1.00 46.83 ? 304 VAL A C   1 
ATOM   2131 O O   . VAL A 1 298 ? 40.631 48.253 7.402   1.00 45.29 ? 304 VAL A O   1 
ATOM   2132 C CB  . VAL A 1 298 ? 38.487 50.520 6.480   1.00 48.41 ? 304 VAL A CB  1 
ATOM   2133 C CG1 . VAL A 1 298 ? 37.800 49.398 7.240   1.00 48.42 ? 304 VAL A CG1 1 
ATOM   2134 C CG2 . VAL A 1 298 ? 37.934 51.869 6.917   1.00 47.37 ? 304 VAL A CG2 1 
ATOM   2135 N N   . PHE A 1 299 ? 40.784 48.731 5.211   1.00 45.89 ? 305 PHE A N   1 
ATOM   2136 C CA  . PHE A 1 299 ? 41.243 47.392 4.860   1.00 45.58 ? 305 PHE A CA  1 
ATOM   2137 C C   . PHE A 1 299 ? 42.737 47.351 4.551   1.00 46.61 ? 305 PHE A C   1 
ATOM   2138 O O   . PHE A 1 299 ? 43.356 48.383 4.301   1.00 46.36 ? 305 PHE A O   1 
ATOM   2139 C CB  . PHE A 1 299 ? 40.455 46.864 3.655   1.00 43.19 ? 305 PHE A CB  1 
ATOM   2140 C CG  . PHE A 1 299 ? 38.964 47.024 3.787   1.00 40.53 ? 305 PHE A CG  1 
ATOM   2141 C CD1 . PHE A 1 299 ? 38.327 48.159 3.296   1.00 38.08 ? 305 PHE A CD1 1 
ATOM   2142 C CD2 . PHE A 1 299 ? 38.202 46.055 4.436   1.00 38.85 ? 305 PHE A CD2 1 
ATOM   2143 C CE1 . PHE A 1 299 ? 36.955 48.331 3.449   1.00 38.94 ? 305 PHE A CE1 1 
ATOM   2144 C CE2 . PHE A 1 299 ? 36.827 46.216 4.597   1.00 36.92 ? 305 PHE A CE2 1 
ATOM   2145 C CZ  . PHE A 1 299 ? 36.201 47.356 4.102   1.00 36.96 ? 305 PHE A CZ  1 
ATOM   2146 N N   . ARG A 1 300 ? 43.308 46.150 4.567   1.00 48.28 ? 306 ARG A N   1 
ATOM   2147 C CA  . ARG A 1 300 ? 44.728 45.978 4.285   1.00 50.41 ? 306 ARG A CA  1 
ATOM   2148 C C   . ARG A 1 300 ? 45.063 46.593 2.926   1.00 50.91 ? 306 ARG A C   1 
ATOM   2149 O O   . ARG A 1 300 ? 44.177 46.816 2.100   1.00 50.20 ? 306 ARG A O   1 
ATOM   2150 C CB  . ARG A 1 300 ? 45.088 44.492 4.289   1.00 51.75 ? 306 ARG A CB  1 
ATOM   2151 C CG  . ARG A 1 300 ? 44.410 43.701 3.192   1.00 55.22 ? 306 ARG A CG  1 
ATOM   2152 C CD  . ARG A 1 300 ? 44.812 42.238 3.228   1.00 57.46 ? 306 ARG A CD  1 
ATOM   2153 N NE  . ARG A 1 300 ? 44.254 41.509 2.095   1.00 59.99 ? 306 ARG A NE  1 
ATOM   2154 C CZ  . ARG A 1 300 ? 44.421 40.207 1.885   1.00 61.65 ? 306 ARG A CZ  1 
ATOM   2155 N NH1 . ARG A 1 300 ? 45.135 39.479 2.737   1.00 62.57 ? 306 ARG A NH1 1 
ATOM   2156 N NH2 . ARG A 1 300 ? 43.876 39.633 0.818   1.00 61.61 ? 306 ARG A NH2 1 
ATOM   2157 N N   . PRO A 1 301 ? 46.354 46.877 2.677   1.00 51.60 ? 307 PRO A N   1 
ATOM   2158 C CA  . PRO A 1 301 ? 46.815 47.473 1.419   1.00 52.01 ? 307 PRO A CA  1 
ATOM   2159 C C   . PRO A 1 301 ? 46.400 46.757 0.132   1.00 52.29 ? 307 PRO A C   1 
ATOM   2160 O O   . PRO A 1 301 ? 45.977 47.400 -0.829  1.00 52.38 ? 307 PRO A O   1 
ATOM   2161 C CB  . PRO A 1 301 ? 48.332 47.504 1.595   1.00 51.85 ? 307 PRO A CB  1 
ATOM   2162 C CG  . PRO A 1 301 ? 48.478 47.740 3.061   1.00 51.86 ? 307 PRO A CG  1 
ATOM   2163 C CD  . PRO A 1 301 ? 47.470 46.767 3.635   1.00 51.80 ? 307 PRO A CD  1 
ATOM   2164 N N   . ARG A 1 302 ? 46.520 45.434 0.111   1.00 53.05 ? 308 ARG A N   1 
ATOM   2165 C CA  . ARG A 1 302 ? 46.176 44.658 -1.082  1.00 54.20 ? 308 ARG A CA  1 
ATOM   2166 C C   . ARG A 1 302 ? 44.691 44.617 -1.459  1.00 52.70 ? 308 ARG A C   1 
ATOM   2167 O O   . ARG A 1 302 ? 44.336 44.123 -2.530  1.00 52.82 ? 308 ARG A O   1 
ATOM   2168 C CB  . ARG A 1 302 ? 46.687 43.222 -0.938  1.00 57.51 ? 308 ARG A CB  1 
ATOM   2169 C CG  . ARG A 1 302 ? 48.205 43.087 -0.923  1.00 61.90 ? 308 ARG A CG  1 
ATOM   2170 C CD  . ARG A 1 302 ? 48.611 41.620 -1.016  1.00 65.34 ? 308 ARG A CD  1 
ATOM   2171 N NE  . ARG A 1 302 ? 50.060 41.439 -1.061  1.00 67.39 ? 308 ARG A NE  1 
ATOM   2172 C CZ  . ARG A 1 302 ? 50.658 40.275 -1.302  1.00 68.99 ? 308 ARG A CZ  1 
ATOM   2173 N NH1 . ARG A 1 302 ? 49.931 39.186 -1.521  1.00 69.42 ? 308 ARG A NH1 1 
ATOM   2174 N NH2 . ARG A 1 302 ? 51.984 40.198 -1.325  1.00 69.36 ? 308 ARG A NH2 1 
ATOM   2175 N N   . THR A 1 303 ? 43.828 45.134 -0.591  1.00 50.25 ? 309 THR A N   1 
ATOM   2176 C CA  . THR A 1 303 ? 42.388 45.127 -0.847  1.00 47.90 ? 309 THR A CA  1 
ATOM   2177 C C   . THR A 1 303 ? 41.985 45.777 -2.166  1.00 46.52 ? 309 THR A C   1 
ATOM   2178 O O   . THR A 1 303 ? 42.232 46.958 -2.388  1.00 46.81 ? 309 THR A O   1 
ATOM   2179 C CB  . THR A 1 303 ? 41.624 45.839 0.283   1.00 46.43 ? 309 THR A CB  1 
ATOM   2180 O OG1 . THR A 1 303 ? 41.928 45.203 1.527   1.00 46.43 ? 309 THR A OG1 1 
ATOM   2181 C CG2 . THR A 1 303 ? 40.117 45.773 0.041   1.00 45.45 ? 309 THR A CG2 1 
ATOM   2182 N N   . PRO A 1 304 ? 41.340 45.009 -3.058  1.00 46.18 ? 310 PRO A N   1 
ATOM   2183 C CA  . PRO A 1 304 ? 40.907 45.542 -4.353  1.00 45.13 ? 310 PRO A CA  1 
ATOM   2184 C C   . PRO A 1 304 ? 40.087 46.824 -4.202  1.00 45.03 ? 310 PRO A C   1 
ATOM   2185 O O   . PRO A 1 304 ? 39.187 46.903 -3.364  1.00 44.38 ? 310 PRO A O   1 
ATOM   2186 C CB  . PRO A 1 304 ? 40.085 44.399 -4.935  1.00 45.59 ? 310 PRO A CB  1 
ATOM   2187 C CG  . PRO A 1 304 ? 40.787 43.193 -4.403  1.00 46.99 ? 310 PRO A CG  1 
ATOM   2188 C CD  . PRO A 1 304 ? 41.038 43.571 -2.954  1.00 45.70 ? 310 PRO A CD  1 
ATOM   2189 N N   . PRO A 1 305 ? 40.395 47.848 -5.013  1.00 44.13 ? 311 PRO A N   1 
ATOM   2190 C CA  . PRO A 1 305 ? 39.701 49.139 -4.990  1.00 43.35 ? 311 PRO A CA  1 
ATOM   2191 C C   . PRO A 1 305 ? 38.189 49.008 -5.164  1.00 41.74 ? 311 PRO A C   1 
ATOM   2192 O O   . PRO A 1 305 ? 37.420 49.738 -4.541  1.00 42.04 ? 311 PRO A O   1 
ATOM   2193 C CB  . PRO A 1 305 ? 40.341 49.892 -6.154  1.00 43.33 ? 311 PRO A CB  1 
ATOM   2194 C CG  . PRO A 1 305 ? 41.728 49.347 -6.176  1.00 44.42 ? 311 PRO A CG  1 
ATOM   2195 C CD  . PRO A 1 305 ? 41.494 47.870 -5.995  1.00 44.56 ? 311 PRO A CD  1 
ATOM   2196 N N   . GLU A 1 306 ? 37.774 48.078 -6.017  1.00 40.23 ? 312 GLU A N   1 
ATOM   2197 C CA  . GLU A 1 306 ? 36.359 47.856 -6.290  1.00 39.17 ? 312 GLU A CA  1 
ATOM   2198 C C   . GLU A 1 306 ? 35.608 47.313 -5.076  1.00 37.08 ? 312 GLU A C   1 
ATOM   2199 O O   . GLU A 1 306 ? 34.428 47.603 -4.892  1.00 35.90 ? 312 GLU A O   1 
ATOM   2200 C CB  . GLU A 1 306 ? 36.186 46.892 -7.467  1.00 40.73 ? 312 GLU A CB  1 
ATOM   2201 C CG  . GLU A 1 306 ? 36.750 47.395 -8.792  1.00 44.29 ? 312 GLU A CG  1 
ATOM   2202 C CD  . GLU A 1 306 ? 38.263 47.220 -8.915  1.00 47.68 ? 312 GLU A CD  1 
ATOM   2203 O OE1 . GLU A 1 306 ? 38.804 47.576 -9.986  1.00 49.86 ? 312 GLU A OE1 1 
ATOM   2204 O OE2 . GLU A 1 306 ? 38.912 46.728 -7.959  1.00 46.60 ? 312 GLU A OE2 1 
ATOM   2205 N N   . ALA A 1 307 ? 36.293 46.516 -4.261  1.00 34.85 ? 313 ALA A N   1 
ATOM   2206 C CA  . ALA A 1 307 ? 35.683 45.951 -3.066  1.00 34.80 ? 313 ALA A CA  1 
ATOM   2207 C C   . ALA A 1 307 ? 35.384 47.087 -2.090  1.00 35.38 ? 313 ALA A C   1 
ATOM   2208 O O   . ALA A 1 307 ? 34.281 47.186 -1.547  1.00 35.08 ? 313 ALA A O   1 
ATOM   2209 C CB  . ALA A 1 307 ? 36.624 44.937 -2.424  1.00 33.94 ? 313 ALA A CB  1 
ATOM   2210 N N   . ILE A 1 308 ? 36.374 47.951 -1.884  1.00 36.01 ? 314 ILE A N   1 
ATOM   2211 C CA  . ILE A 1 308 ? 36.228 49.088 -0.983  1.00 36.16 ? 314 ILE A CA  1 
ATOM   2212 C C   . ILE A 1 308 ? 35.108 50.011 -1.459  1.00 36.11 ? 314 ILE A C   1 
ATOM   2213 O O   . ILE A 1 308 ? 34.298 50.483 -0.657  1.00 37.08 ? 314 ILE A O   1 
ATOM   2214 C CB  . ILE A 1 308 ? 37.546 49.892 -0.893  1.00 36.43 ? 314 ILE A CB  1 
ATOM   2215 C CG1 . ILE A 1 308 ? 38.678 48.974 -0.431  1.00 37.34 ? 314 ILE A CG1 1 
ATOM   2216 C CG2 . ILE A 1 308 ? 37.390 51.046 0.084   1.00 36.25 ? 314 ILE A CG2 1 
ATOM   2217 C CD1 . ILE A 1 308 ? 40.034 49.645 -0.353  1.00 37.61 ? 314 ILE A CD1 1 
ATOM   2218 N N   . ALA A 1 309 ? 35.066 50.267 -2.764  1.00 34.85 ? 315 ALA A N   1 
ATOM   2219 C CA  . ALA A 1 309 ? 34.036 51.125 -3.340  1.00 34.76 ? 315 ALA A CA  1 
ATOM   2220 C C   . ALA A 1 309 ? 32.638 50.541 -3.098  1.00 34.64 ? 315 ALA A C   1 
ATOM   2221 O O   . ALA A 1 309 ? 31.720 51.259 -2.696  1.00 34.65 ? 315 ALA A O   1 
ATOM   2222 C CB  . ALA A 1 309 ? 34.280 51.299 -4.836  1.00 34.01 ? 315 ALA A CB  1 
ATOM   2223 N N   . LEU A 1 310 ? 32.477 49.242 -3.345  1.00 33.35 ? 316 LEU A N   1 
ATOM   2224 C CA  . LEU A 1 310 ? 31.185 48.590 -3.135  1.00 31.94 ? 316 LEU A CA  1 
ATOM   2225 C C   . LEU A 1 310 ? 30.768 48.730 -1.668  1.00 32.29 ? 316 LEU A C   1 
ATOM   2226 O O   . LEU A 1 310 ? 29.625 49.073 -1.371  1.00 31.69 ? 316 LEU A O   1 
ATOM   2227 C CB  . LEU A 1 310 ? 31.253 47.106 -3.526  1.00 29.63 ? 316 LEU A CB  1 
ATOM   2228 C CG  . LEU A 1 310 ? 30.023 46.242 -3.185  1.00 29.77 ? 316 LEU A CG  1 
ATOM   2229 C CD1 . LEU A 1 310 ? 28.784 46.802 -3.877  1.00 28.69 ? 316 LEU A CD1 1 
ATOM   2230 C CD2 . LEU A 1 310 ? 30.273 44.793 -3.621  1.00 27.49 ? 316 LEU A CD2 1 
ATOM   2231 N N   . CYS A 1 311 ? 31.700 48.468 -0.757  1.00 33.73 ? 317 CYS A N   1 
ATOM   2232 C CA  . CYS A 1 311 ? 31.422 48.591 0.672   1.00 35.40 ? 317 CYS A CA  1 
ATOM   2233 C C   . CYS A 1 311 ? 30.838 49.950 1.009   1.00 35.68 ? 317 CYS A C   1 
ATOM   2234 O O   . CYS A 1 311 ? 29.820 50.046 1.693   1.00 35.12 ? 317 CYS A O   1 
ATOM   2235 C CB  . CYS A 1 311 ? 32.698 48.414 1.494   1.00 36.98 ? 317 CYS A CB  1 
ATOM   2236 S SG  . CYS A 1 311 ? 33.068 46.734 1.974   1.00 42.75 ? 317 CYS A SG  1 
ATOM   2237 N N   . SER A 1 312 ? 31.501 50.999 0.531   1.00 36.33 ? 318 SER A N   1 
ATOM   2238 C CA  . SER A 1 312 ? 31.080 52.368 0.801   1.00 36.92 ? 318 SER A CA  1 
ATOM   2239 C C   . SER A 1 312 ? 29.703 52.702 0.247   1.00 35.83 ? 318 SER A C   1 
ATOM   2240 O O   . SER A 1 312 ? 29.042 53.621 0.736   1.00 35.50 ? 318 SER A O   1 
ATOM   2241 C CB  . SER A 1 312 ? 32.112 53.355 0.248   1.00 37.82 ? 318 SER A CB  1 
ATOM   2242 O OG  . SER A 1 312 ? 32.207 53.254 -1.162  1.00 41.47 ? 318 SER A OG  1 
ATOM   2243 N N   . ARG A 1 313 ? 29.267 51.958 -0.767  1.00 35.02 ? 319 ARG A N   1 
ATOM   2244 C CA  . ARG A 1 313 ? 27.960 52.191 -1.371  1.00 34.15 ? 319 ARG A CA  1 
ATOM   2245 C C   . ARG A 1 313 ? 26.876 51.330 -0.729  1.00 32.64 ? 319 ARG A C   1 
ATOM   2246 O O   . ARG A 1 313 ? 25.691 51.484 -1.019  1.00 33.04 ? 319 ARG A O   1 
ATOM   2247 C CB  . ARG A 1 313 ? 28.014 51.924 -2.881  1.00 37.48 ? 319 ARG A CB  1 
ATOM   2248 C CG  . ARG A 1 313 ? 28.950 52.850 -3.642  1.00 40.87 ? 319 ARG A CG  1 
ATOM   2249 C CD  . ARG A 1 313 ? 28.480 54.304 -3.629  1.00 44.15 ? 319 ARG A CD  1 
ATOM   2250 N NE  . ARG A 1 313 ? 27.277 54.515 -4.433  1.00 48.59 ? 319 ARG A NE  1 
ATOM   2251 C CZ  . ARG A 1 313 ? 26.032 54.420 -3.974  1.00 49.56 ? 319 ARG A CZ  1 
ATOM   2252 N NH1 . ARG A 1 313 ? 25.807 54.122 -2.700  1.00 50.81 ? 319 ARG A NH1 1 
ATOM   2253 N NH2 . ARG A 1 313 ? 25.007 54.616 -4.794  1.00 50.55 ? 319 ARG A NH2 1 
ATOM   2254 N N   . LEU A 1 314 ? 27.288 50.416 0.139   1.00 31.63 ? 320 LEU A N   1 
ATOM   2255 C CA  . LEU A 1 314 ? 26.349 49.553 0.843   1.00 29.91 ? 320 LEU A CA  1 
ATOM   2256 C C   . LEU A 1 314 ? 26.156 50.093 2.252   1.00 30.39 ? 320 LEU A C   1 
ATOM   2257 O O   . LEU A 1 314 ? 25.033 50.206 2.742   1.00 29.03 ? 320 LEU A O   1 
ATOM   2258 C CB  . LEU A 1 314 ? 26.894 48.128 0.928   1.00 28.98 ? 320 LEU A CB  1 
ATOM   2259 C CG  . LEU A 1 314 ? 27.130 47.412 -0.403  1.00 28.86 ? 320 LEU A CG  1 
ATOM   2260 C CD1 . LEU A 1 314 ? 27.795 46.069 -0.133  1.00 28.61 ? 320 LEU A CD1 1 
ATOM   2261 C CD2 . LEU A 1 314 ? 25.807 47.242 -1.141  1.00 27.54 ? 320 LEU A CD2 1 
ATOM   2262 N N   . LEU A 1 315 ? 27.270 50.419 2.896   1.00 30.82 ? 321 LEU A N   1 
ATOM   2263 C CA  . LEU A 1 315 ? 27.252 50.933 4.254   1.00 32.50 ? 321 LEU A CA  1 
ATOM   2264 C C   . LEU A 1 315 ? 27.086 52.450 4.279   1.00 33.67 ? 321 LEU A C   1 
ATOM   2265 O O   . LEU A 1 315 ? 28.029 53.187 4.551   1.00 36.55 ? 321 LEU A O   1 
ATOM   2266 C CB  . LEU A 1 315 ? 28.538 50.512 4.970   1.00 31.56 ? 321 LEU A CB  1 
ATOM   2267 C CG  . LEU A 1 315 ? 28.720 48.989 5.009   1.00 31.38 ? 321 LEU A CG  1 
ATOM   2268 C CD1 . LEU A 1 315 ? 30.055 48.627 5.627   1.00 31.71 ? 321 LEU A CD1 1 
ATOM   2269 C CD2 . LEU A 1 315 ? 27.581 48.370 5.805   1.00 31.81 ? 321 LEU A CD2 1 
ATOM   2270 N N   . GLU A 1 316 ? 25.877 52.907 3.982   1.00 35.04 ? 322 GLU A N   1 
ATOM   2271 C CA  . GLU A 1 316 ? 25.571 54.332 3.974   1.00 37.10 ? 322 GLU A CA  1 
ATOM   2272 C C   . GLU A 1 316 ? 24.504 54.616 5.020   1.00 37.09 ? 322 GLU A C   1 
ATOM   2273 O O   . GLU A 1 316 ? 23.580 53.817 5.204   1.00 36.75 ? 322 GLU A O   1 
ATOM   2274 C CB  . GLU A 1 316 ? 25.039 54.757 2.600   1.00 39.07 ? 322 GLU A CB  1 
ATOM   2275 C CG  . GLU A 1 316 ? 25.988 54.518 1.435   1.00 42.89 ? 322 GLU A CG  1 
ATOM   2276 C CD  . GLU A 1 316 ? 26.613 55.801 0.906   1.00 45.95 ? 322 GLU A CD  1 
ATOM   2277 O OE1 . GLU A 1 316 ? 27.246 55.756 -0.172  1.00 47.00 ? 322 GLU A OE1 1 
ATOM   2278 O OE2 . GLU A 1 316 ? 26.475 56.854 1.566   1.00 49.03 ? 322 GLU A OE2 1 
ATOM   2279 N N   . TYR A 1 317 ? 24.629 55.752 5.701   1.00 37.66 ? 323 TYR A N   1 
ATOM   2280 C CA  . TYR A 1 317 ? 23.654 56.152 6.715   1.00 37.38 ? 323 TYR A CA  1 
ATOM   2281 C C   . TYR A 1 317 ? 22.246 56.241 6.140   1.00 37.50 ? 323 TYR A C   1 
ATOM   2282 O O   . TYR A 1 317 ? 21.320 55.605 6.640   1.00 37.41 ? 323 TYR A O   1 
ATOM   2283 C CB  . TYR A 1 317 ? 24.027 57.511 7.305   1.00 37.67 ? 323 TYR A CB  1 
ATOM   2284 C CG  . TYR A 1 317 ? 25.104 57.453 8.351   1.00 37.52 ? 323 TYR A CG  1 
ATOM   2285 C CD1 . TYR A 1 317 ? 26.171 58.347 8.325   1.00 39.04 ? 323 TYR A CD1 1 
ATOM   2286 C CD2 . TYR A 1 317 ? 25.053 56.514 9.379   1.00 38.47 ? 323 TYR A CD2 1 
ATOM   2287 C CE1 . TYR A 1 317 ? 27.161 58.309 9.294   1.00 38.24 ? 323 TYR A CE1 1 
ATOM   2288 C CE2 . TYR A 1 317 ? 26.041 56.468 10.354  1.00 38.44 ? 323 TYR A CE2 1 
ATOM   2289 C CZ  . TYR A 1 317 ? 27.092 57.368 10.304  1.00 39.15 ? 323 TYR A CZ  1 
ATOM   2290 O OH  . TYR A 1 317 ? 28.077 57.331 11.258  1.00 37.97 ? 323 TYR A OH  1 
ATOM   2291 N N   . THR A 1 318 ? 22.084 57.047 5.096   1.00 37.93 ? 324 THR A N   1 
ATOM   2292 C CA  . THR A 1 318 ? 20.775 57.216 4.477   1.00 38.03 ? 324 THR A CA  1 
ATOM   2293 C C   . THR A 1 318 ? 20.346 55.915 3.805   1.00 37.40 ? 324 THR A C   1 
ATOM   2294 O O   . THR A 1 318 ? 20.959 55.473 2.840   1.00 38.41 ? 324 THR A O   1 
ATOM   2295 C CB  . THR A 1 318 ? 20.797 58.350 3.434   1.00 38.96 ? 324 THR A CB  1 
ATOM   2296 O OG1 . THR A 1 318 ? 21.335 59.533 4.035   1.00 40.51 ? 324 THR A OG1 1 
ATOM   2297 C CG2 . THR A 1 318 ? 19.390 58.645 2.935   1.00 37.46 ? 324 THR A CG2 1 
ATOM   2298 N N   . PRO A 1 319 ? 19.282 55.283 4.317   1.00 37.73 ? 325 PRO A N   1 
ATOM   2299 C CA  . PRO A 1 319 ? 18.791 54.026 3.751   1.00 37.56 ? 325 PRO A CA  1 
ATOM   2300 C C   . PRO A 1 319 ? 18.608 54.057 2.239   1.00 37.69 ? 325 PRO A C   1 
ATOM   2301 O O   . PRO A 1 319 ? 19.115 53.187 1.528   1.00 37.23 ? 325 PRO A O   1 
ATOM   2302 C CB  . PRO A 1 319 ? 17.480 53.811 4.494   1.00 37.84 ? 325 PRO A CB  1 
ATOM   2303 C CG  . PRO A 1 319 ? 17.797 54.368 5.857   1.00 38.86 ? 325 PRO A CG  1 
ATOM   2304 C CD  . PRO A 1 319 ? 18.499 55.664 5.506   1.00 37.75 ? 325 PRO A CD  1 
ATOM   2305 N N   . THR A 1 320 ? 17.888 55.065 1.753   1.00 37.11 ? 326 THR A N   1 
ATOM   2306 C CA  . THR A 1 320 ? 17.621 55.207 0.325   1.00 36.31 ? 326 THR A CA  1 
ATOM   2307 C C   . THR A 1 320 ? 18.857 55.455 -0.536  1.00 36.04 ? 326 THR A C   1 
ATOM   2308 O O   . THR A 1 320 ? 18.771 55.415 -1.761  1.00 36.81 ? 326 THR A O   1 
ATOM   2309 C CB  . THR A 1 320 ? 16.642 56.361 0.053   1.00 36.57 ? 326 THR A CB  1 
ATOM   2310 O OG1 . THR A 1 320 ? 17.200 57.581 0.554   1.00 36.29 ? 326 THR A OG1 1 
ATOM   2311 C CG2 . THR A 1 320 ? 15.304 56.099 0.714   1.00 36.01 ? 326 THR A CG2 1 
ATOM   2312 N N   . ALA A 1 321 ? 19.998 55.719 0.090   1.00 35.36 ? 327 ALA A N   1 
ATOM   2313 C CA  . ALA A 1 321 ? 21.217 55.981 -0.667  1.00 34.52 ? 327 ALA A CA  1 
ATOM   2314 C C   . ALA A 1 321 ? 22.018 54.717 -0.940  1.00 34.05 ? 327 ALA A C   1 
ATOM   2315 O O   . ALA A 1 321 ? 22.941 54.732 -1.752  1.00 34.05 ? 327 ALA A O   1 
ATOM   2316 C CB  . ALA A 1 321 ? 22.089 56.989 0.073   1.00 33.96 ? 327 ALA A CB  1 
ATOM   2317 N N   . ARG A 1 322 ? 21.671 53.630 -0.257  1.00 32.52 ? 328 ARG A N   1 
ATOM   2318 C CA  . ARG A 1 322 ? 22.379 52.364 -0.430  1.00 31.51 ? 328 ARG A CA  1 
ATOM   2319 C C   . ARG A 1 322 ? 21.994 51.723 -1.757  1.00 30.58 ? 328 ARG A C   1 
ATOM   2320 O O   . ARG A 1 322 ? 20.895 51.928 -2.248  1.00 28.47 ? 328 ARG A O   1 
ATOM   2321 C CB  . ARG A 1 322 ? 22.032 51.402 0.714   1.00 30.90 ? 328 ARG A CB  1 
ATOM   2322 C CG  . ARG A 1 322 ? 22.326 51.966 2.099   1.00 29.33 ? 328 ARG A CG  1 
ATOM   2323 C CD  . ARG A 1 322 ? 21.782 51.099 3.229   1.00 30.12 ? 328 ARG A CD  1 
ATOM   2324 N NE  . ARG A 1 322 ? 21.932 51.802 4.504   1.00 28.26 ? 328 ARG A NE  1 
ATOM   2325 C CZ  . ARG A 1 322 ? 21.120 51.663 5.546   1.00 27.38 ? 328 ARG A CZ  1 
ATOM   2326 N NH1 . ARG A 1 322 ? 20.091 50.831 5.491   1.00 27.53 ? 328 ARG A NH1 1 
ATOM   2327 N NH2 . ARG A 1 322 ? 21.314 52.399 6.631   1.00 27.06 ? 328 ARG A NH2 1 
ATOM   2328 N N   . LEU A 1 323 ? 22.910 50.951 -2.333  1.00 30.71 ? 329 LEU A N   1 
ATOM   2329 C CA  . LEU A 1 323 ? 22.635 50.260 -3.584  1.00 30.41 ? 329 LEU A CA  1 
ATOM   2330 C C   . LEU A 1 323 ? 21.543 49.239 -3.318  1.00 30.07 ? 329 LEU A C   1 
ATOM   2331 O O   . LEU A 1 323 ? 21.383 48.770 -2.188  1.00 29.16 ? 329 LEU A O   1 
ATOM   2332 C CB  . LEU A 1 323 ? 23.871 49.501 -4.064  1.00 30.97 ? 329 LEU A CB  1 
ATOM   2333 C CG  . LEU A 1 323 ? 25.142 50.274 -4.388  1.00 32.54 ? 329 LEU A CG  1 
ATOM   2334 C CD1 . LEU A 1 323 ? 26.271 49.288 -4.635  1.00 33.30 ? 329 LEU A CD1 1 
ATOM   2335 C CD2 . LEU A 1 323 ? 24.912 51.157 -5.598  1.00 32.68 ? 329 LEU A CD2 1 
ATOM   2336 N N   . THR A 1 324 ? 20.789 48.900 -4.355  1.00 28.93 ? 330 THR A N   1 
ATOM   2337 C CA  . THR A 1 324 ? 19.760 47.884 -4.223  1.00 28.17 ? 330 THR A CA  1 
ATOM   2338 C C   . THR A 1 324 ? 20.515 46.585 -4.475  1.00 27.49 ? 330 THR A C   1 
ATOM   2339 O O   . THR A 1 324 ? 21.642 46.603 -4.973  1.00 26.80 ? 330 THR A O   1 
ATOM   2340 C CB  . THR A 1 324 ? 18.695 48.004 -5.309  1.00 28.78 ? 330 THR A CB  1 
ATOM   2341 O OG1 . THR A 1 324 ? 19.328 47.883 -6.582  1.00 29.08 ? 330 THR A OG1 1 
ATOM   2342 C CG2 . THR A 1 324 ? 17.969 49.341 -5.224  1.00 30.17 ? 330 THR A CG2 1 
ATOM   2343 N N   . PRO A 1 325 ? 19.913 45.442 -4.136  1.00 26.67 ? 331 PRO A N   1 
ATOM   2344 C CA  . PRO A 1 325 ? 20.628 44.188 -4.377  1.00 26.21 ? 331 PRO A CA  1 
ATOM   2345 C C   . PRO A 1 325 ? 21.028 44.020 -5.852  1.00 25.55 ? 331 PRO A C   1 
ATOM   2346 O O   . PRO A 1 325 ? 22.172 43.707 -6.156  1.00 24.20 ? 331 PRO A O   1 
ATOM   2347 C CB  . PRO A 1 325 ? 19.628 43.133 -3.911  1.00 26.41 ? 331 PRO A CB  1 
ATOM   2348 C CG  . PRO A 1 325 ? 18.918 43.843 -2.773  1.00 28.18 ? 331 PRO A CG  1 
ATOM   2349 C CD  . PRO A 1 325 ? 18.679 45.214 -3.360  1.00 26.70 ? 331 PRO A CD  1 
ATOM   2350 N N   . LEU A 1 326 ? 20.085 44.252 -6.764  1.00 26.95 ? 332 LEU A N   1 
ATOM   2351 C CA  . LEU A 1 326 ? 20.357 44.108 -8.193  1.00 27.55 ? 332 LEU A CA  1 
ATOM   2352 C C   . LEU A 1 326 ? 21.500 45.019 -8.638  1.00 28.56 ? 332 LEU A C   1 
ATOM   2353 O O   . LEU A 1 326 ? 22.372 44.605 -9.409  1.00 29.08 ? 332 LEU A O   1 
ATOM   2354 C CB  . LEU A 1 326 ? 19.088 44.412 -9.010  1.00 28.01 ? 332 LEU A CB  1 
ATOM   2355 C CG  . LEU A 1 326 ? 19.088 43.831 -10.426 1.00 28.94 ? 332 LEU A CG  1 
ATOM   2356 C CD1 . LEU A 1 326 ? 19.166 42.310 -10.340 1.00 28.21 ? 332 LEU A CD1 1 
ATOM   2357 C CD2 . LEU A 1 326 ? 17.823 44.262 -11.175 1.00 29.14 ? 332 LEU A CD2 1 
ATOM   2358 N N   . GLU A 1 327 ? 21.507 46.256 -8.149  1.00 29.24 ? 333 GLU A N   1 
ATOM   2359 C CA  . GLU A 1 327 ? 22.569 47.190 -8.506  1.00 28.92 ? 333 GLU A CA  1 
ATOM   2360 C C   . GLU A 1 327 ? 23.913 46.686 -7.989  1.00 29.62 ? 333 GLU A C   1 
ATOM   2361 O O   . GLU A 1 327 ? 24.943 46.858 -8.644  1.00 28.21 ? 333 GLU A O   1 
ATOM   2362 C CB  . GLU A 1 327 ? 22.279 48.582 -7.937  1.00 32.29 ? 333 GLU A CB  1 
ATOM   2363 C CG  . GLU A 1 327 ? 20.990 49.207 -8.451  1.00 35.28 ? 333 GLU A CG  1 
ATOM   2364 C CD  . GLU A 1 327 ? 20.709 50.572 -7.841  1.00 37.58 ? 333 GLU A CD  1 
ATOM   2365 O OE1 . GLU A 1 327 ? 21.169 50.833 -6.708  1.00 36.30 ? 333 GLU A OE1 1 
ATOM   2366 O OE2 . GLU A 1 327 ? 20.016 51.381 -8.492  1.00 38.71 ? 333 GLU A OE2 1 
ATOM   2367 N N   . ALA A 1 328 ? 23.908 46.061 -6.813  1.00 27.41 ? 334 ALA A N   1 
ATOM   2368 C CA  . ALA A 1 328 ? 25.147 45.536 -6.247  1.00 27.29 ? 334 ALA A CA  1 
ATOM   2369 C C   . ALA A 1 328 ? 25.680 44.426 -7.158  1.00 25.28 ? 334 ALA A C   1 
ATOM   2370 O O   . ALA A 1 328 ? 26.865 44.393 -7.479  1.00 26.92 ? 334 ALA A O   1 
ATOM   2371 C CB  . ALA A 1 328 ? 24.899 45.000 -4.821  1.00 25.01 ? 334 ALA A CB  1 
ATOM   2372 N N   . CYS A 1 329 ? 24.801 43.521 -7.576  1.00 26.28 ? 335 CYS A N   1 
ATOM   2373 C CA  . CYS A 1 329 ? 25.197 42.432 -8.472  1.00 26.73 ? 335 CYS A CA  1 
ATOM   2374 C C   . CYS A 1 329 ? 25.911 42.974 -9.720  1.00 26.69 ? 335 CYS A C   1 
ATOM   2375 O O   . CYS A 1 329 ? 26.867 42.373 -10.218 1.00 26.58 ? 335 CYS A O   1 
ATOM   2376 C CB  . CYS A 1 329 ? 23.967 41.627 -8.919  1.00 24.98 ? 335 CYS A CB  1 
ATOM   2377 S SG  . CYS A 1 329 ? 23.228 40.549 -7.665  1.00 27.41 ? 335 CYS A SG  1 
ATOM   2378 N N   . ALA A 1 330 ? 25.443 44.118 -10.211 1.00 27.56 ? 336 ALA A N   1 
ATOM   2379 C CA  . ALA A 1 330 ? 25.997 44.738 -11.412 1.00 28.24 ? 336 ALA A CA  1 
ATOM   2380 C C   . ALA A 1 330 ? 27.276 45.540 -11.194 1.00 29.90 ? 336 ALA A C   1 
ATOM   2381 O O   . ALA A 1 330 ? 27.881 46.022 -12.151 1.00 31.63 ? 336 ALA A O   1 
ATOM   2382 C CB  . ALA A 1 330 ? 24.929 45.631 -12.060 1.00 28.50 ? 336 ALA A CB  1 
ATOM   2383 N N   . HIS A 1 331 ? 27.689 45.669 -9.937  1.00 30.74 ? 337 HIS A N   1 
ATOM   2384 C CA  . HIS A 1 331 ? 28.884 46.427 -9.571  1.00 30.39 ? 337 HIS A CA  1 
ATOM   2385 C C   . HIS A 1 331 ? 30.178 45.858 -10.164 1.00 31.27 ? 337 HIS A C   1 
ATOM   2386 O O   . HIS A 1 331 ? 30.303 44.650 -10.376 1.00 30.37 ? 337 HIS A O   1 
ATOM   2387 C CB  . HIS A 1 331 ? 28.983 46.491 -8.040  1.00 30.52 ? 337 HIS A CB  1 
ATOM   2388 C CG  . HIS A 1 331 ? 29.986 47.481 -7.534  1.00 28.93 ? 337 HIS A CG  1 
ATOM   2389 N ND1 . HIS A 1 331 ? 31.341 47.237 -7.534  1.00 31.02 ? 337 HIS A ND1 1 
ATOM   2390 C CD2 . HIS A 1 331 ? 29.826 48.720 -7.014  1.00 29.11 ? 337 HIS A CD2 1 
ATOM   2391 C CE1 . HIS A 1 331 ? 31.976 48.283 -7.031  1.00 30.23 ? 337 HIS A CE1 1 
ATOM   2392 N NE2 . HIS A 1 331 ? 31.079 49.197 -6.708  1.00 30.53 ? 337 HIS A NE2 1 
ATOM   2393 N N   . SER A 1 332 ? 31.139 46.746 -10.417 1.00 32.11 ? 338 SER A N   1 
ATOM   2394 C CA  . SER A 1 332 ? 32.436 46.378 -10.989 1.00 32.92 ? 338 SER A CA  1 
ATOM   2395 C C   . SER A 1 332 ? 33.183 45.306 -10.205 1.00 31.91 ? 338 SER A C   1 
ATOM   2396 O O   . SER A 1 332 ? 33.960 44.537 -10.779 1.00 30.52 ? 338 SER A O   1 
ATOM   2397 C CB  . SER A 1 332 ? 33.338 47.612 -11.097 1.00 34.47 ? 338 SER A CB  1 
ATOM   2398 O OG  . SER A 1 332 ? 32.823 48.539 -12.032 1.00 39.81 ? 338 SER A OG  1 
ATOM   2399 N N   . PHE A 1 333 ? 32.962 45.263 -8.895  1.00 30.78 ? 339 PHE A N   1 
ATOM   2400 C CA  . PHE A 1 333 ? 33.640 44.273 -8.067  1.00 30.12 ? 339 PHE A CA  1 
ATOM   2401 C C   . PHE A 1 333 ? 33.372 42.854 -8.558  1.00 28.20 ? 339 PHE A C   1 
ATOM   2402 O O   . PHE A 1 333 ? 34.215 41.977 -8.410  1.00 28.95 ? 339 PHE A O   1 
ATOM   2403 C CB  . PHE A 1 333 ? 33.201 44.411 -6.603  1.00 29.34 ? 339 PHE A CB  1 
ATOM   2404 C CG  . PHE A 1 333 ? 33.845 43.416 -5.679  1.00 29.99 ? 339 PHE A CG  1 
ATOM   2405 C CD1 . PHE A 1 333 ? 35.232 43.358 -5.549  1.00 30.13 ? 339 PHE A CD1 1 
ATOM   2406 C CD2 . PHE A 1 333 ? 33.064 42.546 -4.921  1.00 29.35 ? 339 PHE A CD2 1 
ATOM   2407 C CE1 . PHE A 1 333 ? 35.834 42.450 -4.676  1.00 29.52 ? 339 PHE A CE1 1 
ATOM   2408 C CE2 . PHE A 1 333 ? 33.655 41.635 -4.043  1.00 29.64 ? 339 PHE A CE2 1 
ATOM   2409 C CZ  . PHE A 1 333 ? 35.043 41.587 -3.920  1.00 30.38 ? 339 PHE A CZ  1 
ATOM   2410 N N   . PHE A 1 334 ? 32.207 42.634 -9.160  1.00 27.33 ? 340 PHE A N   1 
ATOM   2411 C CA  . PHE A 1 334 ? 31.854 41.303 -9.646  1.00 27.16 ? 340 PHE A CA  1 
ATOM   2412 C C   . PHE A 1 334 ? 32.166 41.054 -11.121 1.00 28.40 ? 340 PHE A C   1 
ATOM   2413 O O   . PHE A 1 334 ? 31.801 40.011 -11.663 1.00 28.49 ? 340 PHE A O   1 
ATOM   2414 C CB  . PHE A 1 334 ? 30.367 41.030 -9.381  1.00 26.10 ? 340 PHE A CB  1 
ATOM   2415 C CG  . PHE A 1 334 ? 29.978 41.160 -7.925  1.00 25.48 ? 340 PHE A CG  1 
ATOM   2416 C CD1 . PHE A 1 334 ? 29.096 42.157 -7.510  1.00 24.64 ? 340 PHE A CD1 1 
ATOM   2417 C CD2 . PHE A 1 334 ? 30.522 40.308 -6.973  1.00 22.39 ? 340 PHE A CD2 1 
ATOM   2418 C CE1 . PHE A 1 334 ? 28.764 42.306 -6.156  1.00 23.34 ? 340 PHE A CE1 1 
ATOM   2419 C CE2 . PHE A 1 334 ? 30.199 40.444 -5.620  1.00 26.45 ? 340 PHE A CE2 1 
ATOM   2420 C CZ  . PHE A 1 334 ? 29.315 41.450 -5.210  1.00 23.09 ? 340 PHE A CZ  1 
ATOM   2421 N N   . ASP A 1 335 ? 32.849 41.997 -11.765 1.00 28.65 ? 341 ASP A N   1 
ATOM   2422 C CA  . ASP A 1 335 ? 33.180 41.851 -13.184 1.00 30.27 ? 341 ASP A CA  1 
ATOM   2423 C C   . ASP A 1 335 ? 33.924 40.556 -13.501 1.00 30.05 ? 341 ASP A C   1 
ATOM   2424 O O   . ASP A 1 335 ? 33.680 39.931 -14.536 1.00 30.65 ? 341 ASP A O   1 
ATOM   2425 C CB  . ASP A 1 335 ? 34.001 43.048 -13.663 1.00 30.31 ? 341 ASP A CB  1 
ATOM   2426 C CG  . ASP A 1 335 ? 33.156 44.293 -13.857 1.00 32.76 ? 341 ASP A CG  1 
ATOM   2427 O OD1 . ASP A 1 335 ? 33.736 45.366 -14.113 1.00 34.73 ? 341 ASP A OD1 1 
ATOM   2428 O OD2 . ASP A 1 335 ? 31.913 44.202 -13.764 1.00 32.89 ? 341 ASP A OD2 1 
ATOM   2429 N N   . GLU A 1 336 ? 34.827 40.150 -12.616 1.00 29.54 ? 342 GLU A N   1 
ATOM   2430 C CA  . GLU A 1 336 ? 35.578 38.922 -12.837 1.00 29.63 ? 342 GLU A CA  1 
ATOM   2431 C C   . GLU A 1 336 ? 34.651 37.720 -12.969 1.00 28.90 ? 342 GLU A C   1 
ATOM   2432 O O   . GLU A 1 336 ? 34.964 36.763 -13.683 1.00 29.09 ? 342 GLU A O   1 
ATOM   2433 C CB  . GLU A 1 336 ? 36.578 38.678 -11.700 1.00 30.62 ? 342 GLU A CB  1 
ATOM   2434 C CG  . GLU A 1 336 ? 37.178 37.277 -11.724 1.00 32.83 ? 342 GLU A CG  1 
ATOM   2435 C CD  . GLU A 1 336 ? 38.369 37.107 -10.793 1.00 34.02 ? 342 GLU A CD  1 
ATOM   2436 O OE1 . GLU A 1 336 ? 38.373 37.699 -9.695  1.00 34.45 ? 342 GLU A OE1 1 
ATOM   2437 O OE2 . GLU A 1 336 ? 39.298 36.361 -11.157 1.00 35.90 ? 342 GLU A OE2 1 
ATOM   2438 N N   . LEU A 1 337 ? 33.510 37.759 -12.284 1.00 27.84 ? 343 LEU A N   1 
ATOM   2439 C CA  . LEU A 1 337 ? 32.571 36.649 -12.363 1.00 26.33 ? 343 LEU A CA  1 
ATOM   2440 C C   . LEU A 1 337 ? 31.936 36.569 -13.757 1.00 26.80 ? 343 LEU A C   1 
ATOM   2441 O O   . LEU A 1 337 ? 31.486 35.503 -14.174 1.00 27.16 ? 343 LEU A O   1 
ATOM   2442 C CB  . LEU A 1 337 ? 31.475 36.789 -11.293 1.00 27.07 ? 343 LEU A CB  1 
ATOM   2443 C CG  . LEU A 1 337 ? 31.924 36.746 -9.826  1.00 26.73 ? 343 LEU A CG  1 
ATOM   2444 C CD1 . LEU A 1 337 ? 30.692 36.780 -8.910  1.00 27.99 ? 343 LEU A CD1 1 
ATOM   2445 C CD2 . LEU A 1 337 ? 32.734 35.477 -9.569  1.00 26.30 ? 343 LEU A CD2 1 
ATOM   2446 N N   . ARG A 1 338 ? 31.906 37.693 -14.470 1.00 26.44 ? 344 ARG A N   1 
ATOM   2447 C CA  . ARG A 1 338 ? 31.319 37.743 -15.811 1.00 28.41 ? 344 ARG A CA  1 
ATOM   2448 C C   . ARG A 1 338 ? 32.356 37.511 -16.916 1.00 30.90 ? 344 ARG A C   1 
ATOM   2449 O O   . ARG A 1 338 ? 32.064 37.669 -18.104 1.00 32.69 ? 344 ARG A O   1 
ATOM   2450 C CB  . ARG A 1 338 ? 30.618 39.090 -16.038 1.00 28.36 ? 344 ARG A CB  1 
ATOM   2451 C CG  . ARG A 1 338 ? 29.300 39.259 -15.262 1.00 27.66 ? 344 ARG A CG  1 
ATOM   2452 C CD  . ARG A 1 338 ? 28.728 40.665 -15.417 1.00 28.03 ? 344 ARG A CD  1 
ATOM   2453 N NE  . ARG A 1 338 ? 29.439 41.659 -14.610 1.00 29.04 ? 344 ARG A NE  1 
ATOM   2454 C CZ  . ARG A 1 338 ? 29.096 42.005 -13.370 1.00 29.58 ? 344 ARG A CZ  1 
ATOM   2455 N NH1 . ARG A 1 338 ? 28.050 41.442 -12.782 1.00 28.08 ? 344 ARG A NH1 1 
ATOM   2456 N NH2 . ARG A 1 338 ? 29.792 42.928 -12.718 1.00 31.23 ? 344 ARG A NH2 1 
ATOM   2457 N N   . ASP A 1 339 ? 33.563 37.136 -16.518 1.00 32.49 ? 345 ASP A N   1 
ATOM   2458 C CA  . ASP A 1 339 ? 34.632 36.863 -17.475 1.00 34.74 ? 345 ASP A CA  1 
ATOM   2459 C C   . ASP A 1 339 ? 34.424 35.436 -17.981 1.00 35.48 ? 345 ASP A C   1 
ATOM   2460 O O   . ASP A 1 339 ? 34.330 34.501 -17.192 1.00 35.07 ? 345 ASP A O   1 
ATOM   2461 C CB  . ASP A 1 339 ? 35.990 37.010 -16.777 1.00 34.78 ? 345 ASP A CB  1 
ATOM   2462 C CG  . ASP A 1 339 ? 37.172 36.786 -17.712 1.00 37.29 ? 345 ASP A CG  1 
ATOM   2463 O OD1 . ASP A 1 339 ? 38.246 37.358 -17.435 1.00 38.17 ? 345 ASP A OD1 1 
ATOM   2464 O OD2 . ASP A 1 339 ? 37.042 36.033 -18.700 1.00 38.00 ? 345 ASP A OD2 1 
ATOM   2465 N N   . PRO A 1 340 ? 34.333 35.255 -19.309 1.00 37.22 ? 346 PRO A N   1 
ATOM   2466 C CA  . PRO A 1 340 ? 34.131 33.922 -19.888 1.00 37.38 ? 346 PRO A CA  1 
ATOM   2467 C C   . PRO A 1 340 ? 35.153 32.858 -19.476 1.00 38.06 ? 346 PRO A C   1 
ATOM   2468 O O   . PRO A 1 340 ? 34.863 31.663 -19.534 1.00 39.08 ? 346 PRO A O   1 
ATOM   2469 C CB  . PRO A 1 340 ? 34.152 34.191 -21.397 1.00 38.34 ? 346 PRO A CB  1 
ATOM   2470 C CG  . PRO A 1 340 ? 35.026 35.405 -21.520 1.00 38.39 ? 346 PRO A CG  1 
ATOM   2471 C CD  . PRO A 1 340 ? 34.528 36.259 -20.369 1.00 38.25 ? 346 PRO A CD  1 
ATOM   2472 N N   . ASN A 1 341 ? 36.339 33.280 -19.050 1.00 37.72 ? 347 ASN A N   1 
ATOM   2473 C CA  . ASN A 1 341 ? 37.370 32.321 -18.655 1.00 38.96 ? 347 ASN A CA  1 
ATOM   2474 C C   . ASN A 1 341 ? 37.496 32.056 -17.153 1.00 37.65 ? 347 ASN A C   1 
ATOM   2475 O O   . ASN A 1 341 ? 38.375 31.308 -16.731 1.00 38.25 ? 347 ASN A O   1 
ATOM   2476 C CB  . ASN A 1 341 ? 38.732 32.769 -19.195 1.00 41.88 ? 347 ASN A CB  1 
ATOM   2477 C CG  . ASN A 1 341 ? 38.752 32.875 -20.704 1.00 43.55 ? 347 ASN A CG  1 
ATOM   2478 O OD1 . ASN A 1 341 ? 38.352 31.945 -21.407 1.00 45.62 ? 347 ASN A OD1 1 
ATOM   2479 N ND2 . ASN A 1 341 ? 39.227 34.009 -21.213 1.00 45.49 ? 347 ASN A ND2 1 
ATOM   2480 N N   . VAL A 1 342 ? 36.625 32.649 -16.341 1.00 36.27 ? 348 VAL A N   1 
ATOM   2481 C CA  . VAL A 1 342 ? 36.709 32.441 -14.898 1.00 33.71 ? 348 VAL A CA  1 
ATOM   2482 C C   . VAL A 1 342 ? 36.456 30.984 -14.528 1.00 33.16 ? 348 VAL A C   1 
ATOM   2483 O O   . VAL A 1 342 ? 35.633 30.307 -15.135 1.00 32.86 ? 348 VAL A O   1 
ATOM   2484 C CB  . VAL A 1 342 ? 35.704 33.349 -14.140 1.00 34.14 ? 348 VAL A CB  1 
ATOM   2485 C CG1 . VAL A 1 342 ? 34.276 32.915 -14.437 1.00 33.03 ? 348 VAL A CG1 1 
ATOM   2486 C CG2 . VAL A 1 342 ? 35.992 33.307 -12.649 1.00 33.58 ? 348 VAL A CG2 1 
ATOM   2487 N N   . LYS A 1 343 ? 37.186 30.505 -13.531 1.00 32.38 ? 349 LYS A N   1 
ATOM   2488 C CA  . LYS A 1 343 ? 37.050 29.134 -13.055 1.00 33.00 ? 349 LYS A CA  1 
ATOM   2489 C C   . LYS A 1 343 ? 37.210 29.167 -11.538 1.00 32.26 ? 349 LYS A C   1 
ATOM   2490 O O   . LYS A 1 343 ? 37.734 30.138 -11.003 1.00 31.88 ? 349 LYS A O   1 
ATOM   2491 C CB  . LYS A 1 343 ? 38.159 28.257 -13.642 1.00 35.27 ? 349 LYS A CB  1 
ATOM   2492 C CG  . LYS A 1 343 ? 38.138 28.077 -15.147 1.00 37.64 ? 349 LYS A CG  1 
ATOM   2493 C CD  . LYS A 1 343 ? 37.094 27.059 -15.564 1.00 40.40 ? 349 LYS A CD  1 
ATOM   2494 C CE  . LYS A 1 343 ? 37.227 26.720 -17.043 1.00 44.48 ? 349 LYS A CE  1 
ATOM   2495 N NZ  . LYS A 1 343 ? 36.161 25.782 -17.500 1.00 48.55 ? 349 LYS A NZ  1 
ATOM   2496 N N   . LEU A 1 344 ? 36.757 28.126 -10.849 1.00 31.67 ? 350 LEU A N   1 
ATOM   2497 C CA  . LEU A 1 344 ? 36.917 28.066 -9.411  1.00 30.50 ? 350 LEU A CA  1 
ATOM   2498 C C   . LEU A 1 344 ? 38.332 27.539 -9.138  1.00 32.70 ? 350 LEU A C   1 
ATOM   2499 O O   . LEU A 1 344 ? 38.944 26.886 -9.988  1.00 30.78 ? 350 LEU A O   1 
ATOM   2500 C CB  . LEU A 1 344 ? 35.896 27.102 -8.788  1.00 30.05 ? 350 LEU A CB  1 
ATOM   2501 C CG  . LEU A 1 344 ? 34.403 27.411 -8.966  1.00 28.63 ? 350 LEU A CG  1 
ATOM   2502 C CD1 . LEU A 1 344 ? 33.582 26.344 -8.256  1.00 26.85 ? 350 LEU A CD1 1 
ATOM   2503 C CD2 . LEU A 1 344 ? 34.058 28.760 -8.375  1.00 27.18 ? 350 LEU A CD2 1 
ATOM   2504 N N   . PRO A 1 345 ? 38.865 27.813 -7.940  1.00 33.82 ? 351 PRO A N   1 
ATOM   2505 C CA  . PRO A 1 345 ? 40.207 27.334 -7.601  1.00 34.45 ? 351 PRO A CA  1 
ATOM   2506 C C   . PRO A 1 345 ? 40.352 25.815 -7.701  1.00 34.25 ? 351 PRO A C   1 
ATOM   2507 O O   . PRO A 1 345 ? 41.435 25.317 -8.010  1.00 36.08 ? 351 PRO A O   1 
ATOM   2508 C CB  . PRO A 1 345 ? 40.399 27.849 -6.181  1.00 33.54 ? 351 PRO A CB  1 
ATOM   2509 C CG  . PRO A 1 345 ? 39.705 29.177 -6.236  1.00 35.02 ? 351 PRO A CG  1 
ATOM   2510 C CD  . PRO A 1 345 ? 38.419 28.839 -6.976  1.00 34.25 ? 351 PRO A CD  1 
ATOM   2511 N N   . ASN A 1 346 ? 39.272 25.084 -7.432  1.00 33.27 ? 352 ASN A N   1 
ATOM   2512 C CA  . ASN A 1 346 ? 39.321 23.631 -7.514  1.00 33.00 ? 352 ASN A CA  1 
ATOM   2513 C C   . ASN A 1 346 ? 39.261 23.130 -8.958  1.00 32.88 ? 352 ASN A C   1 
ATOM   2514 O O   . ASN A 1 346 ? 39.170 21.931 -9.202  1.00 33.88 ? 352 ASN A O   1 
ATOM   2515 C CB  . ASN A 1 346 ? 38.198 22.974 -6.686  1.00 32.45 ? 352 ASN A CB  1 
ATOM   2516 C CG  . ASN A 1 346 ? 36.797 23.316 -7.190  1.00 33.09 ? 352 ASN A CG  1 
ATOM   2517 O OD1 . ASN A 1 346 ? 36.609 23.746 -8.329  1.00 32.34 ? 352 ASN A OD1 1 
ATOM   2518 N ND2 . ASN A 1 346 ? 35.803 23.102 -6.334  1.00 34.19 ? 352 ASN A ND2 1 
ATOM   2519 N N   . GLY A 1 347 ? 39.314 24.052 -9.914  1.00 33.27 ? 353 GLY A N   1 
ATOM   2520 C CA  . GLY A 1 347 ? 39.282 23.676 -11.317 1.00 34.92 ? 353 GLY A CA  1 
ATOM   2521 C C   . GLY A 1 347 ? 37.907 23.523 -11.952 1.00 36.57 ? 353 GLY A C   1 
ATOM   2522 O O   . GLY A 1 347 ? 37.806 23.387 -13.169 1.00 35.95 ? 353 GLY A O   1 
ATOM   2523 N N   . ARG A 1 348 ? 36.849 23.543 -11.146 1.00 37.20 ? 354 ARG A N   1 
ATOM   2524 C CA  . ARG A 1 348 ? 35.491 23.399 -11.676 1.00 38.46 ? 354 ARG A CA  1 
ATOM   2525 C C   . ARG A 1 348 ? 34.956 24.728 -12.201 1.00 37.94 ? 354 ARG A C   1 
ATOM   2526 O O   . ARG A 1 348 ? 35.493 25.791 -11.884 1.00 37.69 ? 354 ARG A O   1 
ATOM   2527 C CB  . ARG A 1 348 ? 34.566 22.855 -10.581 1.00 40.46 ? 354 ARG A CB  1 
ATOM   2528 C CG  . ARG A 1 348 ? 35.029 21.514 -10.044 1.00 44.65 ? 354 ARG A CG  1 
ATOM   2529 C CD  . ARG A 1 348 ? 34.392 21.141 -8.714  1.00 47.71 ? 354 ARG A CD  1 
ATOM   2530 N NE  . ARG A 1 348 ? 32.993 20.744 -8.842  1.00 50.24 ? 354 ARG A NE  1 
ATOM   2531 C CZ  . ARG A 1 348 ? 32.417 19.817 -8.083  1.00 51.65 ? 354 ARG A CZ  1 
ATOM   2532 N NH1 . ARG A 1 348 ? 33.123 19.192 -7.149  1.00 52.93 ? 354 ARG A NH1 1 
ATOM   2533 N NH2 . ARG A 1 348 ? 31.136 19.516 -8.253  1.00 52.90 ? 354 ARG A NH2 1 
ATOM   2534 N N   . ASP A 1 349 ? 33.917 24.671 -13.028 1.00 37.53 ? 355 ASP A N   1 
ATOM   2535 C CA  . ASP A 1 349 ? 33.333 25.899 -13.549 1.00 37.50 ? 355 ASP A CA  1 
ATOM   2536 C C   . ASP A 1 349 ? 32.537 26.556 -12.436 1.00 35.23 ? 355 ASP A C   1 
ATOM   2537 O O   . ASP A 1 349 ? 32.119 25.891 -11.488 1.00 33.35 ? 355 ASP A O   1 
ATOM   2538 C CB  . ASP A 1 349 ? 32.401 25.621 -14.729 1.00 41.48 ? 355 ASP A CB  1 
ATOM   2539 C CG  . ASP A 1 349 ? 33.154 25.240 -15.980 1.00 44.41 ? 355 ASP A CG  1 
ATOM   2540 O OD1 . ASP A 1 349 ? 33.514 24.053 -16.121 1.00 48.22 ? 355 ASP A OD1 1 
ATOM   2541 O OD2 . ASP A 1 349 ? 33.402 26.134 -16.813 1.00 47.90 ? 355 ASP A OD2 1 
ATOM   2542 N N   . THR A 1 350 ? 32.349 27.864 -12.547 1.00 35.01 ? 356 THR A N   1 
ATOM   2543 C CA  . THR A 1 350 ? 31.586 28.611 -11.556 1.00 34.25 ? 356 THR A CA  1 
ATOM   2544 C C   . THR A 1 350 ? 30.148 28.112 -11.572 1.00 32.65 ? 356 THR A C   1 
ATOM   2545 O O   . THR A 1 350 ? 29.718 27.480 -12.532 1.00 31.11 ? 356 THR A O   1 
ATOM   2546 C CB  . THR A 1 350 ? 31.572 30.113 -11.886 1.00 34.98 ? 356 THR A CB  1 
ATOM   2547 O OG1 . THR A 1 350 ? 31.191 30.292 -13.256 1.00 37.59 ? 356 THR A OG1 1 
ATOM   2548 C CG2 . THR A 1 350 ? 32.940 30.721 -11.653 1.00 34.26 ? 356 THR A CG2 1 
ATOM   2549 N N   . PRO A 1 351 ? 29.387 28.384 -10.501 1.00 32.47 ? 357 PRO A N   1 
ATOM   2550 C CA  . PRO A 1 351 ? 27.985 27.950 -10.423 1.00 32.08 ? 357 PRO A CA  1 
ATOM   2551 C C   . PRO A 1 351 ? 27.161 28.794 -11.391 1.00 30.84 ? 357 PRO A C   1 
ATOM   2552 O O   . PRO A 1 351 ? 27.697 29.680 -12.050 1.00 31.21 ? 357 PRO A O   1 
ATOM   2553 C CB  . PRO A 1 351 ? 27.595 28.256 -8.973  1.00 32.42 ? 357 PRO A CB  1 
ATOM   2554 C CG  . PRO A 1 351 ? 28.889 28.372 -8.255  1.00 33.33 ? 357 PRO A CG  1 
ATOM   2555 C CD  . PRO A 1 351 ? 29.807 29.024 -9.246  1.00 31.46 ? 357 PRO A CD  1 
ATOM   2556 N N   . ALA A 1 352 ? 25.862 28.526 -11.469 1.00 32.62 ? 358 ALA A N   1 
ATOM   2557 C CA  . ALA A 1 352 ? 24.985 29.315 -12.332 1.00 34.24 ? 358 ALA A CA  1 
ATOM   2558 C C   . ALA A 1 352 ? 24.961 30.709 -11.709 1.00 33.15 ? 358 ALA A C   1 
ATOM   2559 O O   . ALA A 1 352 ? 24.747 30.852 -10.501 1.00 35.87 ? 358 ALA A O   1 
ATOM   2560 C CB  . ALA A 1 352 ? 23.576 28.715 -12.352 1.00 35.53 ? 358 ALA A CB  1 
ATOM   2561 N N   . LEU A 1 353 ? 25.190 31.735 -12.517 1.00 31.64 ? 359 LEU A N   1 
ATOM   2562 C CA  . LEU A 1 353 ? 25.222 33.097 -12.000 1.00 29.22 ? 359 LEU A CA  1 
ATOM   2563 C C   . LEU A 1 353 ? 24.405 34.075 -12.820 1.00 28.65 ? 359 LEU A C   1 
ATOM   2564 O O   . LEU A 1 353 ? 24.165 35.201 -12.384 1.00 26.85 ? 359 LEU A O   1 
ATOM   2565 C CB  . LEU A 1 353 ? 26.673 33.596 -11.973 1.00 30.32 ? 359 LEU A CB  1 
ATOM   2566 C CG  . LEU A 1 353 ? 27.648 32.860 -11.052 1.00 27.75 ? 359 LEU A CG  1 
ATOM   2567 C CD1 . LEU A 1 353 ? 29.069 33.352 -11.289 1.00 30.55 ? 359 LEU A CD1 1 
ATOM   2568 C CD2 . LEU A 1 353 ? 27.227 33.085 -9.609  1.00 26.32 ? 359 LEU A CD2 1 
ATOM   2569 N N   . PHE A 1 354 ? 23.979 33.642 -14.002 1.00 27.77 ? 360 PHE A N   1 
ATOM   2570 C CA  . PHE A 1 354 ? 23.263 34.524 -14.916 1.00 28.05 ? 360 PHE A CA  1 
ATOM   2571 C C   . PHE A 1 354 ? 21.864 34.099 -15.329 1.00 28.02 ? 360 PHE A C   1 
ATOM   2572 O O   . PHE A 1 354 ? 21.286 34.690 -16.245 1.00 28.51 ? 360 PHE A O   1 
ATOM   2573 C CB  . PHE A 1 354 ? 24.106 34.712 -16.179 1.00 28.59 ? 360 PHE A CB  1 
ATOM   2574 C CG  . PHE A 1 354 ? 25.575 34.886 -15.906 1.00 30.40 ? 360 PHE A CG  1 
ATOM   2575 C CD1 . PHE A 1 354 ? 26.497 33.954 -16.374 1.00 30.61 ? 360 PHE A CD1 1 
ATOM   2576 C CD2 . PHE A 1 354 ? 26.036 35.981 -15.181 1.00 28.81 ? 360 PHE A CD2 1 
ATOM   2577 C CE1 . PHE A 1 354 ? 27.863 34.111 -16.122 1.00 32.85 ? 360 PHE A CE1 1 
ATOM   2578 C CE2 . PHE A 1 354 ? 27.400 36.150 -14.923 1.00 30.46 ? 360 PHE A CE2 1 
ATOM   2579 C CZ  . PHE A 1 354 ? 28.314 35.214 -15.394 1.00 31.16 ? 360 PHE A CZ  1 
ATOM   2580 N N   . ASN A 1 355 ? 21.314 33.085 -14.675 1.00 28.48 ? 361 ASN A N   1 
ATOM   2581 C CA  . ASN A 1 355 ? 19.978 32.632 -15.037 1.00 29.05 ? 361 ASN A CA  1 
ATOM   2582 C C   . ASN A 1 355 ? 18.910 33.514 -14.394 1.00 27.85 ? 361 ASN A C   1 
ATOM   2583 O O   . ASN A 1 355 ? 18.033 33.027 -13.681 1.00 28.08 ? 361 ASN A O   1 
ATOM   2584 C CB  . ASN A 1 355 ? 19.789 31.159 -14.642 1.00 29.09 ? 361 ASN A CB  1 
ATOM   2585 C CG  . ASN A 1 355 ? 20.023 30.907 -13.162 1.00 32.55 ? 361 ASN A CG  1 
ATOM   2586 O OD1 . ASN A 1 355 ? 20.863 31.549 -12.536 1.00 32.01 ? 361 ASN A OD1 1 
ATOM   2587 N ND2 . ASN A 1 355 ? 19.290 29.951 -12.602 1.00 33.72 ? 361 ASN A ND2 1 
ATOM   2588 N N   . PHE A 1 356 ? 18.998 34.817 -14.651 1.00 28.31 ? 362 PHE A N   1 
ATOM   2589 C CA  . PHE A 1 356 ? 18.034 35.776 -14.105 1.00 28.03 ? 362 PHE A CA  1 
ATOM   2590 C C   . PHE A 1 356 ? 16.650 35.620 -14.725 1.00 28.28 ? 362 PHE A C   1 
ATOM   2591 O O   . PHE A 1 356 ? 16.527 35.341 -15.918 1.00 26.80 ? 362 PHE A O   1 
ATOM   2592 C CB  . PHE A 1 356 ? 18.495 37.220 -14.344 1.00 27.99 ? 362 PHE A CB  1 
ATOM   2593 C CG  . PHE A 1 356 ? 19.660 37.641 -13.491 1.00 30.89 ? 362 PHE A CG  1 
ATOM   2594 C CD1 . PHE A 1 356 ? 20.969 37.463 -13.938 1.00 31.81 ? 362 PHE A CD1 1 
ATOM   2595 C CD2 . PHE A 1 356 ? 19.449 38.193 -12.228 1.00 29.79 ? 362 PHE A CD2 1 
ATOM   2596 C CE1 . PHE A 1 356 ? 22.058 37.828 -13.133 1.00 32.85 ? 362 PHE A CE1 1 
ATOM   2597 C CE2 . PHE A 1 356 ? 20.529 38.560 -11.414 1.00 30.03 ? 362 PHE A CE2 1 
ATOM   2598 C CZ  . PHE A 1 356 ? 21.834 38.376 -11.870 1.00 30.86 ? 362 PHE A CZ  1 
ATOM   2599 N N   . THR A 1 357 ? 15.617 35.815 -13.905 1.00 29.25 ? 363 THR A N   1 
ATOM   2600 C CA  . THR A 1 357 ? 14.220 35.748 -14.357 1.00 29.52 ? 363 THR A CA  1 
ATOM   2601 C C   . THR A 1 357 ? 13.706 37.187 -14.427 1.00 29.81 ? 363 THR A C   1 
ATOM   2602 O O   . THR A 1 357 ? 14.337 38.106 -13.895 1.00 27.59 ? 363 THR A O   1 
ATOM   2603 C CB  . THR A 1 357 ? 13.321 35.015 -13.341 1.00 30.65 ? 363 THR A CB  1 
ATOM   2604 O OG1 . THR A 1 357 ? 13.390 35.702 -12.082 1.00 30.33 ? 363 THR A OG1 1 
ATOM   2605 C CG2 . THR A 1 357 ? 13.761 33.568 -13.157 1.00 30.03 ? 363 THR A CG2 1 
ATOM   2606 N N   . THR A 1 358 ? 12.555 37.380 -15.069 1.00 30.19 ? 364 THR A N   1 
ATOM   2607 C CA  . THR A 1 358 ? 11.957 38.707 -15.172 1.00 30.13 ? 364 THR A CA  1 
ATOM   2608 C C   . THR A 1 358 ? 11.676 39.249 -13.763 1.00 29.24 ? 364 THR A C   1 
ATOM   2609 O O   . THR A 1 358 ? 11.915 40.420 -13.470 1.00 28.06 ? 364 THR A O   1 
ATOM   2610 C CB  . THR A 1 358 ? 10.620 38.659 -15.951 1.00 31.29 ? 364 THR A CB  1 
ATOM   2611 O OG1 . THR A 1 358 ? 10.834 38.083 -17.249 1.00 33.60 ? 364 THR A OG1 1 
ATOM   2612 C CG2 . THR A 1 358 ? 10.057 40.059 -16.112 1.00 31.91 ? 364 THR A CG2 1 
ATOM   2613 N N   . GLN A 1 359 ? 11.161 38.381 -12.901 1.00 30.14 ? 365 GLN A N   1 
ATOM   2614 C CA  . GLN A 1 359 ? 10.840 38.734 -11.518 1.00 30.20 ? 365 GLN A CA  1 
ATOM   2615 C C   . GLN A 1 359 ? 12.072 39.275 -10.790 1.00 31.01 ? 365 GLN A C   1 
ATOM   2616 O O   . GLN A 1 359 ? 12.027 40.318 -10.136 1.00 29.19 ? 365 GLN A O   1 
ATOM   2617 C CB  . GLN A 1 359 ? 10.329 37.491 -10.786 1.00 31.68 ? 365 GLN A CB  1 
ATOM   2618 C CG  . GLN A 1 359 ? 10.033 37.680 -9.298  1.00 33.26 ? 365 GLN A CG  1 
ATOM   2619 C CD  . GLN A 1 359 ? 8.827  38.563 -9.047  1.00 35.81 ? 365 GLN A CD  1 
ATOM   2620 O OE1 . GLN A 1 359 ? 7.806  38.450 -9.732  1.00 36.48 ? 365 GLN A OE1 1 
ATOM   2621 N NE2 . GLN A 1 359 ? 8.930  39.435 -8.053  1.00 36.14 ? 365 GLN A NE2 1 
ATOM   2622 N N   . GLU A 1 360 ? 13.178 38.552 -10.917 1.00 30.60 ? 366 GLU A N   1 
ATOM   2623 C CA  . GLU A 1 360 ? 14.423 38.932 -10.257 1.00 29.18 ? 366 GLU A CA  1 
ATOM   2624 C C   . GLU A 1 360 ? 14.965 40.265 -10.767 1.00 28.76 ? 366 GLU A C   1 
ATOM   2625 O O   . GLU A 1 360 ? 15.567 41.019 -10.008 1.00 25.92 ? 366 GLU A O   1 
ATOM   2626 C CB  . GLU A 1 360 ? 15.453 37.817 -10.457 1.00 29.19 ? 366 GLU A CB  1 
ATOM   2627 C CG  . GLU A 1 360 ? 16.763 37.981 -9.695  1.00 30.50 ? 366 GLU A CG  1 
ATOM   2628 C CD  . GLU A 1 360 ? 17.594 36.706 -9.736  1.00 31.53 ? 366 GLU A CD  1 
ATOM   2629 O OE1 . GLU A 1 360 ? 17.264 35.817 -10.556 1.00 32.24 ? 366 GLU A OE1 1 
ATOM   2630 O OE2 . GLU A 1 360 ? 18.571 36.593 -8.962  1.00 31.58 ? 366 GLU A OE2 1 
ATOM   2631 N N   . LEU A 1 361 ? 14.731 40.561 -12.045 1.00 28.71 ? 367 LEU A N   1 
ATOM   2632 C CA  . LEU A 1 361 ? 15.217 41.805 -12.651 1.00 29.85 ? 367 LEU A CA  1 
ATOM   2633 C C   . LEU A 1 361 ? 14.201 42.950 -12.602 1.00 30.52 ? 367 LEU A C   1 
ATOM   2634 O O   . LEU A 1 361 ? 14.499 44.063 -13.032 1.00 31.75 ? 367 LEU A O   1 
ATOM   2635 C CB  . LEU A 1 361 ? 15.589 41.568 -14.122 1.00 28.42 ? 367 LEU A CB  1 
ATOM   2636 C CG  . LEU A 1 361 ? 16.730 40.617 -14.490 1.00 29.41 ? 367 LEU A CG  1 
ATOM   2637 C CD1 . LEU A 1 361 ? 16.548 40.151 -15.933 1.00 29.41 ? 367 LEU A CD1 1 
ATOM   2638 C CD2 . LEU A 1 361 ? 18.072 41.316 -14.322 1.00 28.63 ? 367 LEU A CD2 1 
ATOM   2639 N N   . SER A 1 362 ? 13.014 42.677 -12.075 1.00 31.63 ? 368 SER A N   1 
ATOM   2640 C CA  . SER A 1 362 ? 11.945 43.677 -12.025 1.00 34.06 ? 368 SER A CA  1 
ATOM   2641 C C   . SER A 1 362 ? 12.282 45.061 -11.475 1.00 34.66 ? 368 SER A C   1 
ATOM   2642 O O   . SER A 1 362 ? 11.722 46.055 -11.936 1.00 34.52 ? 368 SER A O   1 
ATOM   2643 C CB  . SER A 1 362 ? 10.728 43.113 -11.278 1.00 33.62 ? 368 SER A CB  1 
ATOM   2644 O OG  . SER A 1 362 ? 11.040 42.757 -9.945  1.00 34.49 ? 368 SER A OG  1 
ATOM   2645 N N   . SER A 1 363 ? 13.189 45.149 -10.507 1.00 35.16 ? 369 SER A N   1 
ATOM   2646 C CA  . SER A 1 363 ? 13.529 46.457 -9.941  1.00 36.13 ? 369 SER A CA  1 
ATOM   2647 C C   . SER A 1 363 ? 14.301 47.358 -10.909 1.00 36.61 ? 369 SER A C   1 
ATOM   2648 O O   . SER A 1 363 ? 14.382 48.572 -10.702 1.00 37.67 ? 369 SER A O   1 
ATOM   2649 C CB  . SER A 1 363 ? 14.345 46.295 -8.658  1.00 34.38 ? 369 SER A CB  1 
ATOM   2650 O OG  . SER A 1 363 ? 15.668 45.886 -8.958  1.00 36.22 ? 369 SER A OG  1 
ATOM   2651 N N   . ASN A 1 364 ? 14.878 46.771 -11.956 1.00 36.30 ? 370 ASN A N   1 
ATOM   2652 C CA  . ASN A 1 364 ? 15.639 47.546 -12.937 1.00 35.43 ? 370 ASN A CA  1 
ATOM   2653 C C   . ASN A 1 364 ? 16.040 46.647 -14.113 1.00 34.69 ? 370 ASN A C   1 
ATOM   2654 O O   . ASN A 1 364 ? 17.208 46.270 -14.252 1.00 31.93 ? 370 ASN A O   1 
ATOM   2655 C CB  . ASN A 1 364 ? 16.898 48.130 -12.285 1.00 37.68 ? 370 ASN A CB  1 
ATOM   2656 C CG  . ASN A 1 364 ? 17.536 49.228 -13.118 1.00 39.70 ? 370 ASN A CG  1 
ATOM   2657 O OD1 . ASN A 1 364 ? 17.477 49.208 -14.347 1.00 42.47 ? 370 ASN A OD1 1 
ATOM   2658 N ND2 . ASN A 1 364 ? 18.164 50.187 -12.449 1.00 40.52 ? 370 ASN A ND2 1 
ATOM   2659 N N   . PRO A 1 365 ? 15.072 46.307 -14.983 1.00 34.02 ? 371 PRO A N   1 
ATOM   2660 C CA  . PRO A 1 365 ? 15.288 45.451 -16.155 1.00 34.32 ? 371 PRO A CA  1 
ATOM   2661 C C   . PRO A 1 365 ? 16.514 45.773 -17.011 1.00 33.85 ? 371 PRO A C   1 
ATOM   2662 O O   . PRO A 1 365 ? 17.208 44.868 -17.460 1.00 34.37 ? 371 PRO A O   1 
ATOM   2663 C CB  . PRO A 1 365 ? 13.977 45.592 -16.927 1.00 35.29 ? 371 PRO A CB  1 
ATOM   2664 C CG  . PRO A 1 365 ? 12.973 45.760 -15.821 1.00 34.68 ? 371 PRO A CG  1 
ATOM   2665 C CD  . PRO A 1 365 ? 13.667 46.751 -14.916 1.00 33.96 ? 371 PRO A CD  1 
ATOM   2666 N N   . PRO A 1 366 ? 16.796 47.065 -17.250 1.00 34.18 ? 372 PRO A N   1 
ATOM   2667 C CA  . PRO A 1 366 ? 17.958 47.434 -18.065 1.00 34.24 ? 372 PRO A CA  1 
ATOM   2668 C C   . PRO A 1 366 ? 19.296 46.883 -17.576 1.00 34.25 ? 372 PRO A C   1 
ATOM   2669 O O   . PRO A 1 366 ? 20.256 46.798 -18.347 1.00 34.50 ? 372 PRO A O   1 
ATOM   2670 C CB  . PRO A 1 366 ? 17.919 48.959 -18.044 1.00 35.45 ? 372 PRO A CB  1 
ATOM   2671 C CG  . PRO A 1 366 ? 16.444 49.239 -18.015 1.00 35.61 ? 372 PRO A CG  1 
ATOM   2672 C CD  . PRO A 1 366 ? 15.952 48.247 -16.984 1.00 35.62 ? 372 PRO A CD  1 
ATOM   2673 N N   . LEU A 1 367 ? 19.377 46.518 -16.300 1.00 32.29 ? 373 LEU A N   1 
ATOM   2674 C CA  . LEU A 1 367 ? 20.625 45.985 -15.773 1.00 31.88 ? 373 LEU A CA  1 
ATOM   2675 C C   . LEU A 1 367 ? 20.974 44.637 -16.407 1.00 30.56 ? 373 LEU A C   1 
ATOM   2676 O O   . LEU A 1 367 ? 22.108 44.180 -16.318 1.00 29.27 ? 373 LEU A O   1 
ATOM   2677 C CB  . LEU A 1 367 ? 20.553 45.855 -14.240 1.00 31.62 ? 373 LEU A CB  1 
ATOM   2678 C CG  . LEU A 1 367 ? 20.536 47.168 -13.439 1.00 32.01 ? 373 LEU A CG  1 
ATOM   2679 C CD1 . LEU A 1 367 ? 20.526 46.856 -11.946 1.00 33.83 ? 373 LEU A CD1 1 
ATOM   2680 C CD2 . LEU A 1 367 ? 21.762 48.015 -13.780 1.00 31.53 ? 373 LEU A CD2 1 
ATOM   2681 N N   . ALA A 1 368 ? 19.998 44.016 -17.066 1.00 32.43 ? 374 ALA A N   1 
ATOM   2682 C CA  . ALA A 1 368 ? 20.213 42.726 -17.722 1.00 32.45 ? 374 ALA A CA  1 
ATOM   2683 C C   . ALA A 1 368 ? 21.379 42.749 -18.712 1.00 33.91 ? 374 ALA A C   1 
ATOM   2684 O O   . ALA A 1 368 ? 22.106 41.760 -18.852 1.00 33.14 ? 374 ALA A O   1 
ATOM   2685 C CB  . ALA A 1 368 ? 18.939 42.285 -18.436 1.00 33.13 ? 374 ALA A CB  1 
ATOM   2686 N N   . THR A 1 369 ? 21.570 43.873 -19.395 1.00 35.05 ? 375 THR A N   1 
ATOM   2687 C CA  . THR A 1 369 ? 22.652 43.966 -20.369 1.00 36.39 ? 375 THR A CA  1 
ATOM   2688 C C   . THR A 1 369 ? 24.018 43.873 -19.701 1.00 36.37 ? 375 THR A C   1 
ATOM   2689 O O   . THR A 1 369 ? 25.025 43.626 -20.363 1.00 35.89 ? 375 THR A O   1 
ATOM   2690 C CB  . THR A 1 369 ? 22.585 45.271 -21.183 1.00 37.48 ? 375 THR A CB  1 
ATOM   2691 O OG1 . THR A 1 369 ? 22.870 46.384 -20.332 1.00 38.87 ? 375 THR A OG1 1 
ATOM   2692 C CG2 . THR A 1 369 ? 21.208 45.441 -21.798 1.00 37.08 ? 375 THR A CG2 1 
ATOM   2693 N N   . ILE A 1 370 ? 24.054 44.086 -18.389 1.00 36.06 ? 376 ILE A N   1 
ATOM   2694 C CA  . ILE A 1 370 ? 25.304 43.985 -17.640 1.00 35.86 ? 376 ILE A CA  1 
ATOM   2695 C C   . ILE A 1 370 ? 25.359 42.621 -16.965 1.00 35.50 ? 376 ILE A C   1 
ATOM   2696 O O   . ILE A 1 370 ? 26.346 41.889 -17.077 1.00 34.62 ? 376 ILE A O   1 
ATOM   2697 C CB  . ILE A 1 370 ? 25.400 45.045 -16.525 1.00 37.86 ? 376 ILE A CB  1 
ATOM   2698 C CG1 . ILE A 1 370 ? 25.553 46.442 -17.129 1.00 39.15 ? 376 ILE A CG1 1 
ATOM   2699 C CG2 . ILE A 1 370 ? 26.578 44.721 -15.609 1.00 37.60 ? 376 ILE A CG2 1 
ATOM   2700 C CD1 . ILE A 1 370 ? 25.516 47.553 -16.099 1.00 40.04 ? 376 ILE A CD1 1 
ATOM   2701 N N   . LEU A 1 371 ? 24.273 42.292 -16.273 1.00 32.78 ? 377 LEU A N   1 
ATOM   2702 C CA  . LEU A 1 371 ? 24.152 41.047 -15.530 1.00 32.13 ? 377 LEU A CA  1 
ATOM   2703 C C   . LEU A 1 371 ? 24.259 39.762 -16.336 1.00 31.68 ? 377 LEU A C   1 
ATOM   2704 O O   . LEU A 1 371 ? 24.748 38.757 -15.830 1.00 30.48 ? 377 LEU A O   1 
ATOM   2705 C CB  . LEU A 1 371 ? 22.841 41.058 -14.741 1.00 28.93 ? 377 LEU A CB  1 
ATOM   2706 C CG  . LEU A 1 371 ? 22.793 42.164 -13.683 1.00 28.24 ? 377 LEU A CG  1 
ATOM   2707 C CD1 . LEU A 1 371 ? 21.427 42.179 -13.021 1.00 28.01 ? 377 LEU A CD1 1 
ATOM   2708 C CD2 . LEU A 1 371 ? 23.896 41.927 -12.641 1.00 28.87 ? 377 LEU A CD2 1 
ATOM   2709 N N   . ILE A 1 372 ? 23.790 39.775 -17.579 1.00 32.17 ? 378 ILE A N   1 
ATOM   2710 C CA  . ILE A 1 372 ? 23.882 38.581 -18.402 1.00 32.69 ? 378 ILE A CA  1 
ATOM   2711 C C   . ILE A 1 372 ? 24.911 38.864 -19.490 1.00 34.15 ? 378 ILE A C   1 
ATOM   2712 O O   . ILE A 1 372 ? 24.610 39.502 -20.502 1.00 33.09 ? 378 ILE A O   1 
ATOM   2713 C CB  . ILE A 1 372 ? 22.524 38.222 -19.031 1.00 34.31 ? 378 ILE A CB  1 
ATOM   2714 C CG1 . ILE A 1 372 ? 21.472 38.042 -17.934 1.00 35.67 ? 378 ILE A CG1 1 
ATOM   2715 C CG2 . ILE A 1 372 ? 22.652 36.940 -19.838 1.00 35.38 ? 378 ILE A CG2 1 
ATOM   2716 C CD1 . ILE A 1 372 ? 20.080 37.686 -18.456 1.00 37.76 ? 378 ILE A CD1 1 
ATOM   2717 N N   . PRO A 1 373 ? 26.155 38.404 -19.285 1.00 35.01 ? 379 PRO A N   1 
ATOM   2718 C CA  . PRO A 1 373 ? 27.223 38.627 -20.265 1.00 35.45 ? 379 PRO A CA  1 
ATOM   2719 C C   . PRO A 1 373 ? 26.983 37.937 -21.611 1.00 36.12 ? 379 PRO A C   1 
ATOM   2720 O O   . PRO A 1 373 ? 26.235 36.963 -21.704 1.00 34.20 ? 379 PRO A O   1 
ATOM   2721 C CB  . PRO A 1 373 ? 28.470 38.122 -19.534 1.00 35.37 ? 379 PRO A CB  1 
ATOM   2722 C CG  . PRO A 1 373 ? 27.925 37.026 -18.660 1.00 35.69 ? 379 PRO A CG  1 
ATOM   2723 C CD  . PRO A 1 373 ? 26.644 37.626 -18.130 1.00 34.73 ? 379 PRO A CD  1 
ATOM   2724 N N   . PRO A 1 374 ? 27.620 38.446 -22.676 1.00 37.59 ? 380 PRO A N   1 
ATOM   2725 C CA  . PRO A 1 374 ? 27.493 37.907 -24.034 1.00 39.45 ? 380 PRO A CA  1 
ATOM   2726 C C   . PRO A 1 374 ? 27.576 36.387 -24.150 1.00 41.00 ? 380 PRO A C   1 
ATOM   2727 O O   . PRO A 1 374 ? 26.784 35.771 -24.861 1.00 40.80 ? 380 PRO A O   1 
ATOM   2728 C CB  . PRO A 1 374 ? 28.622 38.607 -24.782 1.00 39.41 ? 380 PRO A CB  1 
ATOM   2729 C CG  . PRO A 1 374 ? 28.640 39.957 -24.129 1.00 39.90 ? 380 PRO A CG  1 
ATOM   2730 C CD  . PRO A 1 374 ? 28.532 39.603 -22.657 1.00 37.21 ? 380 PRO A CD  1 
ATOM   2731 N N   . HIS A 1 375 ? 28.520 35.782 -23.437 1.00 42.19 ? 381 HIS A N   1 
ATOM   2732 C CA  . HIS A 1 375 ? 28.710 34.337 -23.501 1.00 43.67 ? 381 HIS A CA  1 
ATOM   2733 C C   . HIS A 1 375 ? 27.705 33.511 -22.710 1.00 45.46 ? 381 HIS A C   1 
ATOM   2734 O O   . HIS A 1 375 ? 27.556 32.317 -22.951 1.00 46.32 ? 381 HIS A O   1 
ATOM   2735 C CB  . HIS A 1 375 ? 30.111 33.975 -23.010 1.00 42.74 ? 381 HIS A CB  1 
ATOM   2736 C CG  . HIS A 1 375 ? 30.300 34.172 -21.537 1.00 41.80 ? 381 HIS A CG  1 
ATOM   2737 N ND1 . HIS A 1 375 ? 30.580 35.400 -20.978 1.00 40.51 ? 381 HIS A ND1 1 
ATOM   2738 C CD2 . HIS A 1 375 ? 30.226 33.296 -20.506 1.00 40.36 ? 381 HIS A CD2 1 
ATOM   2739 C CE1 . HIS A 1 375 ? 30.672 35.272 -19.666 1.00 40.30 ? 381 HIS A CE1 1 
ATOM   2740 N NE2 . HIS A 1 375 ? 30.461 34.006 -19.354 1.00 39.71 ? 381 HIS A NE2 1 
ATOM   2741 N N   . ALA A 1 376 ? 27.014 34.140 -21.769 1.00 48.06 ? 382 ALA A N   1 
ATOM   2742 C CA  . ALA A 1 376 ? 26.066 33.420 -20.928 1.00 50.85 ? 382 ALA A CA  1 
ATOM   2743 C C   . ALA A 1 376 ? 24.801 32.945 -21.619 1.00 52.56 ? 382 ALA A C   1 
ATOM   2744 O O   . ALA A 1 376 ? 24.275 33.608 -22.509 1.00 52.90 ? 382 ALA A O   1 
ATOM   2745 C CB  . ALA A 1 376 ? 25.695 34.273 -19.718 1.00 50.97 ? 382 ALA A CB  1 
ATOM   2746 N N   . ARG A 1 377 ? 24.327 31.782 -21.186 1.00 55.21 ? 383 ARG A N   1 
ATOM   2747 C CA  . ARG A 1 377 ? 23.102 31.178 -21.694 1.00 58.94 ? 383 ARG A CA  1 
ATOM   2748 C C   . ARG A 1 377 ? 22.877 31.361 -23.194 1.00 61.19 ? 383 ARG A C   1 
ATOM   2749 O O   . ARG A 1 377 ? 21.809 31.805 -23.616 1.00 61.67 ? 383 ARG A O   1 
ATOM   2750 C CB  . ARG A 1 377 ? 21.913 31.750 -20.919 1.00 58.24 ? 383 ARG A CB  1 
ATOM   2751 C CG  . ARG A 1 377 ? 22.081 31.663 -19.404 1.00 59.44 ? 383 ARG A CG  1 
ATOM   2752 C CD  . ARG A 1 377 ? 21.103 32.573 -18.666 1.00 58.84 ? 383 ARG A CD  1 
ATOM   2753 N NE  . ARG A 1 377 ? 19.704 32.220 -18.897 1.00 59.11 ? 383 ARG A NE  1 
ATOM   2754 C CZ  . ARG A 1 377 ? 19.166 31.039 -18.598 1.00 59.05 ? 383 ARG A CZ  1 
ATOM   2755 N NH1 . ARG A 1 377 ? 19.909 30.084 -18.055 1.00 58.20 ? 383 ARG A NH1 1 
ATOM   2756 N NH2 . ARG A 1 377 ? 17.879 30.817 -18.833 1.00 58.83 ? 383 ARG A NH2 1 
ATOM   2757 N N   . ILE A 1 378 ? 23.881 31.013 -23.995 1.00 63.92 ? 384 ILE A N   1 
ATOM   2758 C CA  . ILE A 1 378 ? 23.786 31.131 -25.450 1.00 66.73 ? 384 ILE A CA  1 
ATOM   2759 C C   . ILE A 1 378 ? 22.669 30.236 -25.990 1.00 68.01 ? 384 ILE A C   1 
ATOM   2760 O O   . ILE A 1 378 ? 22.107 30.568 -27.058 1.00 71.82 ? 384 ILE A O   1 
ATOM   2761 C CB  . ILE A 1 378 ? 25.122 30.741 -26.135 1.00 66.38 ? 384 ILE A CB  1 
ATOM   2762 C CG1 . ILE A 1 378 ? 26.232 31.699 -25.692 1.00 64.73 ? 384 ILE A CG1 1 
ATOM   2763 C CG2 . ILE A 1 378 ? 24.970 30.786 -27.653 1.00 64.83 ? 384 ILE A CG2 1 
ATOM   2764 C CD1 . ILE A 1 378 ? 27.598 31.349 -26.242 1.00 64.72 ? 384 ILE A CD1 1 
ATOM   2765 N N   . SER B 1 29  ? 61.236 54.392 36.103  1.00 68.35 ? 35  SER B N   1 
ATOM   2766 C CA  . SER B 1 29  ? 61.342 54.706 34.649  1.00 68.27 ? 35  SER B CA  1 
ATOM   2767 C C   . SER B 1 29  ? 60.783 56.100 34.362  1.00 67.79 ? 35  SER B C   1 
ATOM   2768 O O   . SER B 1 29  ? 61.140 57.071 35.034  1.00 68.08 ? 35  SER B O   1 
ATOM   2769 C CB  . SER B 1 29  ? 60.580 53.657 33.829  1.00 69.00 ? 35  SER B CB  1 
ATOM   2770 O OG  . SER B 1 29  ? 60.740 53.869 32.435  1.00 69.95 ? 35  SER B OG  1 
ATOM   2771 N N   . LYS B 1 30  ? 59.905 56.192 33.367  1.00 66.45 ? 36  LYS B N   1 
ATOM   2772 C CA  . LYS B 1 30  ? 59.298 57.460 32.983  1.00 64.96 ? 36  LYS B CA  1 
ATOM   2773 C C   . LYS B 1 30  ? 58.320 57.959 34.041  1.00 64.26 ? 36  LYS B C   1 
ATOM   2774 O O   . LYS B 1 30  ? 57.443 57.217 34.487  1.00 64.83 ? 36  LYS B O   1 
ATOM   2775 C CB  . LYS B 1 30  ? 58.565 57.307 31.648  1.00 65.11 ? 36  LYS B CB  1 
ATOM   2776 C CG  . LYS B 1 30  ? 57.865 58.570 31.172  1.00 65.01 ? 36  LYS B CG  1 
ATOM   2777 C CD  . LYS B 1 30  ? 57.166 58.340 29.841  1.00 65.17 ? 36  LYS B CD  1 
ATOM   2778 C CE  . LYS B 1 30  ? 56.544 59.623 29.316  1.00 65.42 ? 36  LYS B CE  1 
ATOM   2779 N NZ  . LYS B 1 30  ? 55.916 59.424 27.981  1.00 65.37 ? 36  LYS B NZ  1 
ATOM   2780 N N   . VAL B 1 31  ? 58.474 59.219 34.438  1.00 62.15 ? 37  VAL B N   1 
ATOM   2781 C CA  . VAL B 1 31  ? 57.593 59.816 35.434  1.00 59.57 ? 37  VAL B CA  1 
ATOM   2782 C C   . VAL B 1 31  ? 56.802 60.970 34.837  1.00 58.27 ? 37  VAL B C   1 
ATOM   2783 O O   . VAL B 1 31  ? 57.369 61.886 34.242  1.00 58.08 ? 37  VAL B O   1 
ATOM   2784 C CB  . VAL B 1 31  ? 58.383 60.339 36.645  1.00 59.45 ? 37  VAL B CB  1 
ATOM   2785 C CG1 . VAL B 1 31  ? 57.450 61.084 37.587  1.00 59.47 ? 37  VAL B CG1 1 
ATOM   2786 C CG2 . VAL B 1 31  ? 59.045 59.180 37.369  1.00 59.18 ? 37  VAL B CG2 1 
ATOM   2787 N N   . THR B 1 32  ? 55.485 60.915 34.997  1.00 56.45 ? 38  THR B N   1 
ATOM   2788 C CA  . THR B 1 32  ? 54.610 61.955 34.479  1.00 54.58 ? 38  THR B CA  1 
ATOM   2789 C C   . THR B 1 32  ? 54.046 62.780 35.628  1.00 53.60 ? 38  THR B C   1 
ATOM   2790 O O   . THR B 1 32  ? 53.550 62.238 36.617  1.00 53.52 ? 38  THR B O   1 
ATOM   2791 C CB  . THR B 1 32  ? 53.440 61.353 33.683  1.00 54.90 ? 38  THR B CB  1 
ATOM   2792 O OG1 . THR B 1 32  ? 53.954 60.568 32.600  1.00 56.04 ? 38  THR B OG1 1 
ATOM   2793 C CG2 . THR B 1 32  ? 52.553 62.454 33.124  1.00 54.50 ? 38  THR B CG2 1 
ATOM   2794 N N   . THR B 1 33  ? 54.133 64.096 35.495  1.00 51.44 ? 39  THR B N   1 
ATOM   2795 C CA  . THR B 1 33  ? 53.621 64.991 36.516  1.00 49.32 ? 39  THR B CA  1 
ATOM   2796 C C   . THR B 1 33  ? 52.640 65.953 35.870  1.00 47.60 ? 39  THR B C   1 
ATOM   2797 O O   . THR B 1 33  ? 52.934 66.562 34.841  1.00 46.89 ? 39  THR B O   1 
ATOM   2798 C CB  . THR B 1 33  ? 54.763 65.791 37.188  1.00 49.74 ? 39  THR B CB  1 
ATOM   2799 O OG1 . THR B 1 33  ? 55.657 64.886 37.848  1.00 49.14 ? 39  THR B OG1 1 
ATOM   2800 C CG2 . THR B 1 33  ? 54.198 66.770 38.214  1.00 49.22 ? 39  THR B CG2 1 
ATOM   2801 N N   . VAL B 1 34  ? 51.466 66.072 36.474  1.00 46.01 ? 40  VAL B N   1 
ATOM   2802 C CA  . VAL B 1 34  ? 50.434 66.956 35.962  1.00 44.95 ? 40  VAL B CA  1 
ATOM   2803 C C   . VAL B 1 34  ? 49.803 67.710 37.122  1.00 44.13 ? 40  VAL B C   1 
ATOM   2804 O O   . VAL B 1 34  ? 50.008 67.365 38.282  1.00 44.06 ? 40  VAL B O   1 
ATOM   2805 C CB  . VAL B 1 34  ? 49.322 66.151 35.238  1.00 45.02 ? 40  VAL B CB  1 
ATOM   2806 C CG1 . VAL B 1 34  ? 49.916 65.352 34.091  1.00 45.47 ? 40  VAL B CG1 1 
ATOM   2807 C CG2 . VAL B 1 34  ? 48.626 65.219 36.225  1.00 43.48 ? 40  VAL B CG2 1 
ATOM   2808 N N   . VAL B 1 35  ? 49.043 68.748 36.805  1.00 44.29 ? 41  VAL B N   1 
ATOM   2809 C CA  . VAL B 1 35  ? 48.352 69.513 37.830  1.00 45.03 ? 41  VAL B CA  1 
ATOM   2810 C C   . VAL B 1 35  ? 46.882 69.176 37.626  1.00 45.45 ? 41  VAL B C   1 
ATOM   2811 O O   . VAL B 1 35  ? 46.292 69.515 36.596  1.00 46.52 ? 41  VAL B O   1 
ATOM   2812 C CB  . VAL B 1 35  ? 48.579 71.029 37.665  1.00 44.81 ? 41  VAL B CB  1 
ATOM   2813 C CG1 . VAL B 1 35  ? 47.843 71.784 38.759  1.00 44.44 ? 41  VAL B CG1 1 
ATOM   2814 C CG2 . VAL B 1 35  ? 50.067 71.337 37.726  1.00 44.51 ? 41  VAL B CG2 1 
ATOM   2815 N N   . ALA B 1 36  ? 46.300 68.492 38.605  1.00 45.39 ? 42  ALA B N   1 
ATOM   2816 C CA  . ALA B 1 36  ? 44.911 68.069 38.512  1.00 45.74 ? 42  ALA B CA  1 
ATOM   2817 C C   . ALA B 1 36  ? 43.978 68.696 39.536  1.00 46.31 ? 42  ALA B C   1 
ATOM   2818 O O   . ALA B 1 36  ? 44.409 69.182 40.586  1.00 45.49 ? 42  ALA B O   1 
ATOM   2819 C CB  . ALA B 1 36  ? 44.839 66.552 38.617  1.00 46.44 ? 42  ALA B CB  1 
ATOM   2820 N N   . THR B 1 37  ? 42.689 68.665 39.210  1.00 45.59 ? 43  THR B N   1 
ATOM   2821 C CA  . THR B 1 37  ? 41.640 69.194 40.067  1.00 46.54 ? 43  THR B CA  1 
ATOM   2822 C C   . THR B 1 37  ? 41.096 68.053 40.920  1.00 47.11 ? 43  THR B C   1 
ATOM   2823 O O   . THR B 1 37  ? 40.812 66.970 40.407  1.00 47.10 ? 43  THR B O   1 
ATOM   2824 C CB  . THR B 1 37  ? 40.480 69.756 39.229  1.00 46.36 ? 43  THR B CB  1 
ATOM   2825 O OG1 . THR B 1 37  ? 40.976 70.769 38.347  1.00 47.66 ? 43  THR B OG1 1 
ATOM   2826 C CG2 . THR B 1 37  ? 39.403 70.345 40.127  1.00 46.56 ? 43  THR B CG2 1 
ATOM   2827 N N   . PRO B 1 38  ? 40.957 68.274 42.237  1.00 47.61 ? 44  PRO B N   1 
ATOM   2828 C CA  . PRO B 1 38  ? 40.436 67.224 43.119  1.00 47.58 ? 44  PRO B CA  1 
ATOM   2829 C C   . PRO B 1 38  ? 39.053 66.763 42.669  1.00 47.78 ? 44  PRO B C   1 
ATOM   2830 O O   . PRO B 1 38  ? 38.257 67.561 42.176  1.00 47.85 ? 44  PRO B O   1 
ATOM   2831 C CB  . PRO B 1 38  ? 40.395 67.911 44.482  1.00 47.50 ? 44  PRO B CB  1 
ATOM   2832 C CG  . PRO B 1 38  ? 41.556 68.856 44.406  1.00 47.82 ? 44  PRO B CG  1 
ATOM   2833 C CD  . PRO B 1 38  ? 41.406 69.441 43.017  1.00 47.26 ? 44  PRO B CD  1 
ATOM   2834 N N   . GLY B 1 39  ? 38.771 65.475 42.836  1.00 49.02 ? 45  GLY B N   1 
ATOM   2835 C CA  . GLY B 1 39  ? 37.476 64.949 42.443  1.00 50.82 ? 45  GLY B CA  1 
ATOM   2836 C C   . GLY B 1 39  ? 36.347 65.595 43.224  1.00 52.88 ? 45  GLY B C   1 
ATOM   2837 O O   . GLY B 1 39  ? 35.266 65.828 42.682  1.00 52.67 ? 45  GLY B O   1 
ATOM   2838 N N   . GLN B 1 40  ? 36.599 65.887 44.499  1.00 54.59 ? 46  GLN B N   1 
ATOM   2839 C CA  . GLN B 1 40  ? 35.600 66.516 45.360  1.00 56.66 ? 46  GLN B CA  1 
ATOM   2840 C C   . GLN B 1 40  ? 36.195 67.667 46.170  1.00 56.89 ? 46  GLN B C   1 
ATOM   2841 O O   . GLN B 1 40  ? 37.413 67.839 46.230  1.00 56.99 ? 46  GLN B O   1 
ATOM   2842 C CB  . GLN B 1 40  ? 35.003 65.490 46.329  1.00 58.75 ? 46  GLN B CB  1 
ATOM   2843 C CG  . GLN B 1 40  ? 34.291 64.322 45.666  1.00 61.74 ? 46  GLN B CG  1 
ATOM   2844 C CD  . GLN B 1 40  ? 34.997 63.002 45.909  1.00 63.31 ? 46  GLN B CD  1 
ATOM   2845 O OE1 . GLN B 1 40  ? 36.144 62.812 45.500  1.00 64.42 ? 46  GLN B OE1 1 
ATOM   2846 N NE2 . GLN B 1 40  ? 34.315 62.080 46.584  1.00 64.45 ? 46  GLN B NE2 1 
ATOM   2847 N N   . GLY B 1 41  ? 35.322 68.450 46.796  1.00 57.13 ? 47  GLY B N   1 
ATOM   2848 C CA  . GLY B 1 41  ? 35.773 69.567 47.606  1.00 57.43 ? 47  GLY B CA  1 
ATOM   2849 C C   . GLY B 1 41  ? 36.212 70.777 46.801  1.00 57.38 ? 47  GLY B C   1 
ATOM   2850 O O   . GLY B 1 41  ? 35.973 70.842 45.596  1.00 57.52 ? 47  GLY B O   1 
ATOM   2851 N N   . PRO B 1 42  ? 36.860 71.759 47.450  1.00 57.21 ? 48  PRO B N   1 
ATOM   2852 C CA  . PRO B 1 42  ? 37.343 72.987 46.807  1.00 56.82 ? 48  PRO B CA  1 
ATOM   2853 C C   . PRO B 1 42  ? 38.281 72.699 45.637  1.00 55.76 ? 48  PRO B C   1 
ATOM   2854 O O   . PRO B 1 42  ? 38.940 71.660 45.603  1.00 55.64 ? 48  PRO B O   1 
ATOM   2855 C CB  . PRO B 1 42  ? 38.061 73.711 47.946  1.00 57.72 ? 48  PRO B CB  1 
ATOM   2856 C CG  . PRO B 1 42  ? 37.318 73.248 49.165  1.00 57.88 ? 48  PRO B CG  1 
ATOM   2857 C CD  . PRO B 1 42  ? 37.161 71.775 48.893  1.00 57.33 ? 48  PRO B CD  1 
ATOM   2858 N N   . ASP B 1 43  ? 38.343 73.627 44.685  1.00 55.06 ? 49  ASP B N   1 
ATOM   2859 C CA  . ASP B 1 43  ? 39.207 73.464 43.522  1.00 54.29 ? 49  ASP B CA  1 
ATOM   2860 C C   . ASP B 1 43  ? 40.630 73.916 43.822  1.00 53.50 ? 49  ASP B C   1 
ATOM   2861 O O   . ASP B 1 43  ? 41.065 74.974 43.371  1.00 53.90 ? 49  ASP B O   1 
ATOM   2862 C CB  . ASP B 1 43  ? 38.668 74.258 42.326  1.00 54.29 ? 49  ASP B CB  1 
ATOM   2863 C CG  . ASP B 1 43  ? 39.541 74.107 41.083  1.00 55.39 ? 49  ASP B CG  1 
ATOM   2864 O OD1 . ASP B 1 43  ? 39.290 74.816 40.084  1.00 56.05 ? 49  ASP B OD1 1 
ATOM   2865 O OD2 . ASP B 1 43  ? 40.477 73.279 41.099  1.00 54.96 ? 49  ASP B OD2 1 
ATOM   2866 N N   . ARG B 1 44  ? 41.346 73.117 44.602  1.00 52.53 ? 50  ARG B N   1 
ATOM   2867 C CA  . ARG B 1 44  ? 42.729 73.419 44.934  1.00 51.21 ? 50  ARG B CA  1 
ATOM   2868 C C   . ARG B 1 44  ? 43.602 72.459 44.144  1.00 48.73 ? 50  ARG B C   1 
ATOM   2869 O O   . ARG B 1 44  ? 43.821 71.321 44.558  1.00 47.81 ? 50  ARG B O   1 
ATOM   2870 C CB  . ARG B 1 44  ? 42.976 73.255 46.437  1.00 53.24 ? 50  ARG B CB  1 
ATOM   2871 C CG  . ARG B 1 44  ? 42.845 74.557 47.217  1.00 57.29 ? 50  ARG B CG  1 
ATOM   2872 C CD  . ARG B 1 44  ? 41.420 75.103 47.187  1.00 60.18 ? 50  ARG B CD  1 
ATOM   2873 N NE  . ARG B 1 44  ? 41.376 76.567 47.173  1.00 63.29 ? 50  ARG B NE  1 
ATOM   2874 C CZ  . ARG B 1 44  ? 41.981 77.359 48.057  1.00 64.02 ? 50  ARG B CZ  1 
ATOM   2875 N NH1 . ARG B 1 44  ? 42.695 76.842 49.050  1.00 63.87 ? 50  ARG B NH1 1 
ATOM   2876 N NH2 . ARG B 1 44  ? 41.867 78.678 47.948  1.00 63.73 ? 50  ARG B NH2 1 
ATOM   2877 N N   . PRO B 1 45  ? 44.111 72.910 42.986  1.00 47.10 ? 51  PRO B N   1 
ATOM   2878 C CA  . PRO B 1 45  ? 44.961 72.083 42.129  1.00 46.17 ? 51  PRO B CA  1 
ATOM   2879 C C   . PRO B 1 45  ? 46.063 71.387 42.901  1.00 46.49 ? 51  PRO B C   1 
ATOM   2880 O O   . PRO B 1 45  ? 46.648 71.956 43.823  1.00 45.90 ? 51  PRO B O   1 
ATOM   2881 C CB  . PRO B 1 45  ? 45.517 73.084 41.120  1.00 46.05 ? 51  PRO B CB  1 
ATOM   2882 C CG  . PRO B 1 45  ? 44.427 74.088 41.011  1.00 46.20 ? 51  PRO B CG  1 
ATOM   2883 C CD  . PRO B 1 45  ? 44.014 74.280 42.452  1.00 46.54 ? 51  PRO B CD  1 
ATOM   2884 N N   . GLN B 1 46  ? 46.337 70.146 42.528  1.00 47.36 ? 52  GLN B N   1 
ATOM   2885 C CA  . GLN B 1 46  ? 47.389 69.389 43.179  1.00 48.45 ? 52  GLN B CA  1 
ATOM   2886 C C   . GLN B 1 46  ? 48.311 68.768 42.152  1.00 47.87 ? 52  GLN B C   1 
ATOM   2887 O O   . GLN B 1 46  ? 47.881 68.339 41.083  1.00 46.93 ? 52  GLN B O   1 
ATOM   2888 C CB  . GLN B 1 46  ? 46.804 68.300 44.081  1.00 50.46 ? 52  GLN B CB  1 
ATOM   2889 C CG  . GLN B 1 46  ? 46.142 68.839 45.340  1.00 53.94 ? 52  GLN B CG  1 
ATOM   2890 C CD  . GLN B 1 46  ? 45.966 67.778 46.410  1.00 56.14 ? 52  GLN B CD  1 
ATOM   2891 O OE1 . GLN B 1 46  ? 45.443 68.055 47.493  1.00 58.22 ? 52  GLN B OE1 1 
ATOM   2892 N NE2 . GLN B 1 46  ? 46.407 66.555 46.116  1.00 56.31 ? 52  GLN B NE2 1 
ATOM   2893 N N   . GLU B 1 47  ? 49.589 68.737 42.489  1.00 48.63 ? 53  GLU B N   1 
ATOM   2894 C CA  . GLU B 1 47  ? 50.603 68.177 41.618  1.00 49.81 ? 53  GLU B CA  1 
ATOM   2895 C C   . GLU B 1 47  ? 50.598 66.663 41.803  1.00 50.20 ? 53  GLU B C   1 
ATOM   2896 O O   . GLU B 1 47  ? 50.861 66.163 42.896  1.00 50.46 ? 53  GLU B O   1 
ATOM   2897 C CB  . GLU B 1 47  ? 51.960 68.767 41.997  1.00 49.90 ? 53  GLU B CB  1 
ATOM   2898 C CG  . GLU B 1 47  ? 53.042 68.598 40.960  1.00 50.85 ? 53  GLU B CG  1 
ATOM   2899 C CD  . GLU B 1 47  ? 54.202 69.544 41.198  1.00 51.20 ? 53  GLU B CD  1 
ATOM   2900 O OE1 . GLU B 1 47  ? 53.999 70.772 41.081  1.00 51.05 ? 53  GLU B OE1 1 
ATOM   2901 O OE2 . GLU B 1 47  ? 55.310 69.062 41.510  1.00 51.94 ? 53  GLU B OE2 1 
ATOM   2902 N N   . VAL B 1 48  ? 50.285 65.938 40.733  1.00 50.49 ? 54  VAL B N   1 
ATOM   2903 C CA  . VAL B 1 48  ? 50.232 64.480 40.786  1.00 50.00 ? 54  VAL B CA  1 
ATOM   2904 C C   . VAL B 1 48  ? 51.260 63.841 39.859  1.00 49.70 ? 54  VAL B C   1 
ATOM   2905 O O   . VAL B 1 48  ? 51.336 64.174 38.677  1.00 49.18 ? 54  VAL B O   1 
ATOM   2906 C CB  . VAL B 1 48  ? 48.822 63.964 40.402  1.00 50.46 ? 54  VAL B CB  1 
ATOM   2907 C CG1 . VAL B 1 48  ? 48.792 62.443 40.435  1.00 49.79 ? 54  VAL B CG1 1 
ATOM   2908 C CG2 . VAL B 1 48  ? 47.785 64.535 41.352  1.00 49.05 ? 54  VAL B CG2 1 
ATOM   2909 N N   . SER B 1 49  ? 52.048 62.920 40.407  1.00 49.82 ? 55  SER B N   1 
ATOM   2910 C CA  . SER B 1 49  ? 53.076 62.224 39.641  1.00 50.43 ? 55  SER B CA  1 
ATOM   2911 C C   . SER B 1 49  ? 52.838 60.721 39.675  1.00 50.70 ? 55  SER B C   1 
ATOM   2912 O O   . SER B 1 49  ? 52.617 60.142 40.739  1.00 50.03 ? 55  SER B O   1 
ATOM   2913 C CB  . SER B 1 49  ? 54.467 62.528 40.208  1.00 50.89 ? 55  SER B CB  1 
ATOM   2914 O OG  . SER B 1 49  ? 54.777 63.903 40.085  1.00 51.85 ? 55  SER B OG  1 
ATOM   2915 N N   . TYR B 1 50  ? 52.889 60.094 38.504  1.00 51.23 ? 56  TYR B N   1 
ATOM   2916 C CA  . TYR B 1 50  ? 52.674 58.659 38.397  1.00 51.88 ? 56  TYR B CA  1 
ATOM   2917 C C   . TYR B 1 50  ? 53.573 58.036 37.340  1.00 52.60 ? 56  TYR B C   1 
ATOM   2918 O O   . TYR B 1 50  ? 54.017 58.708 36.412  1.00 52.95 ? 56  TYR B O   1 
ATOM   2919 C CB  . TYR B 1 50  ? 51.211 58.364 38.053  1.00 50.24 ? 56  TYR B CB  1 
ATOM   2920 C CG  . TYR B 1 50  ? 50.723 59.037 36.789  1.00 49.62 ? 56  TYR B CG  1 
ATOM   2921 C CD1 . TYR B 1 50  ? 50.219 60.337 36.818  1.00 48.97 ? 56  TYR B CD1 1 
ATOM   2922 C CD2 . TYR B 1 50  ? 50.762 58.374 35.563  1.00 48.53 ? 56  TYR B CD2 1 
ATOM   2923 C CE1 . TYR B 1 50  ? 49.762 60.957 35.660  1.00 48.81 ? 56  TYR B CE1 1 
ATOM   2924 C CE2 . TYR B 1 50  ? 50.309 58.986 34.398  1.00 48.12 ? 56  TYR B CE2 1 
ATOM   2925 C CZ  . TYR B 1 50  ? 49.808 60.277 34.456  1.00 48.78 ? 56  TYR B CZ  1 
ATOM   2926 O OH  . TYR B 1 50  ? 49.343 60.888 33.315  1.00 50.04 ? 56  TYR B OH  1 
ATOM   2927 N N   . THR B 1 51  ? 53.827 56.741 37.486  1.00 54.25 ? 57  THR B N   1 
ATOM   2928 C CA  . THR B 1 51  ? 54.670 56.010 36.551  1.00 55.42 ? 57  THR B CA  1 
ATOM   2929 C C   . THR B 1 51  ? 54.105 54.611 36.301  1.00 55.95 ? 57  THR B C   1 
ATOM   2930 O O   . THR B 1 51  ? 53.013 54.282 36.766  1.00 56.17 ? 57  THR B O   1 
ATOM   2931 C CB  . THR B 1 51  ? 56.104 55.880 37.100  1.00 55.66 ? 57  THR B CB  1 
ATOM   2932 O OG1 . THR B 1 51  ? 56.923 55.189 36.149  1.00 58.06 ? 57  THR B OG1 1 
ATOM   2933 C CG2 . THR B 1 51  ? 56.100 55.115 38.415  1.00 54.81 ? 57  THR B CG2 1 
ATOM   2934 N N   . ASP B 1 52  ? 54.854 53.796 35.562  1.00 56.45 ? 58  ASP B N   1 
ATOM   2935 C CA  . ASP B 1 52  ? 54.453 52.426 35.247  1.00 56.24 ? 58  ASP B CA  1 
ATOM   2936 C C   . ASP B 1 52  ? 53.049 52.340 34.658  1.00 55.30 ? 58  ASP B C   1 
ATOM   2937 O O   . ASP B 1 52  ? 52.253 51.490 35.052  1.00 54.74 ? 58  ASP B O   1 
ATOM   2938 C CB  . ASP B 1 52  ? 54.530 51.553 36.502  1.00 58.01 ? 58  ASP B CB  1 
ATOM   2939 C CG  . ASP B 1 52  ? 55.884 51.630 37.184  1.00 60.57 ? 58  ASP B CG  1 
ATOM   2940 O OD1 . ASP B 1 52  ? 56.909 51.389 36.508  1.00 62.23 ? 58  ASP B OD1 1 
ATOM   2941 O OD2 . ASP B 1 52  ? 55.923 51.929 38.397  1.00 61.95 ? 58  ASP B OD2 1 
ATOM   2942 N N   . THR B 1 53  ? 52.753 53.221 33.710  1.00 54.65 ? 59  THR B N   1 
ATOM   2943 C CA  . THR B 1 53  ? 51.447 53.244 33.071  1.00 54.53 ? 59  THR B CA  1 
ATOM   2944 C C   . THR B 1 53  ? 51.276 52.086 32.098  1.00 54.63 ? 59  THR B C   1 
ATOM   2945 O O   . THR B 1 53  ? 52.205 51.728 31.375  1.00 54.89 ? 59  THR B O   1 
ATOM   2946 C CB  . THR B 1 53  ? 51.229 54.566 32.312  1.00 54.83 ? 59  THR B CB  1 
ATOM   2947 O OG1 . THR B 1 53  ? 51.123 55.640 33.254  1.00 55.80 ? 59  THR B OG1 1 
ATOM   2948 C CG2 . THR B 1 53  ? 49.963 54.505 31.475  1.00 54.88 ? 59  THR B CG2 1 
ATOM   2949 N N   . LYS B 1 54  ? 50.083 51.499 32.096  1.00 53.73 ? 60  LYS B N   1 
ATOM   2950 C CA  . LYS B 1 54  ? 49.775 50.391 31.203  1.00 52.89 ? 60  LYS B CA  1 
ATOM   2951 C C   . LYS B 1 54  ? 48.268 50.307 30.979  1.00 52.01 ? 60  LYS B C   1 
ATOM   2952 O O   . LYS B 1 54  ? 47.476 50.631 31.866  1.00 51.88 ? 60  LYS B O   1 
ATOM   2953 C CB  . LYS B 1 54  ? 50.293 49.073 31.781  1.00 53.41 ? 60  LYS B CB  1 
ATOM   2954 C CG  . LYS B 1 54  ? 49.489 48.526 32.942  1.00 54.90 ? 60  LYS B CG  1 
ATOM   2955 C CD  . LYS B 1 54  ? 49.981 47.139 33.328  1.00 56.28 ? 60  LYS B CD  1 
ATOM   2956 C CE  . LYS B 1 54  ? 49.063 46.485 34.348  1.00 57.82 ? 60  LYS B CE  1 
ATOM   2957 N NZ  . LYS B 1 54  ? 49.471 45.083 34.647  1.00 59.60 ? 60  LYS B NZ  1 
ATOM   2958 N N   . VAL B 1 55  ? 47.878 49.876 29.787  1.00 50.65 ? 61  VAL B N   1 
ATOM   2959 C CA  . VAL B 1 55  ? 46.470 49.763 29.440  1.00 49.81 ? 61  VAL B CA  1 
ATOM   2960 C C   . VAL B 1 55  ? 45.746 48.689 30.244  1.00 49.95 ? 61  VAL B C   1 
ATOM   2961 O O   . VAL B 1 55  ? 46.246 47.576 30.402  1.00 49.79 ? 61  VAL B O   1 
ATOM   2962 C CB  . VAL B 1 55  ? 46.303 49.454 27.939  1.00 49.42 ? 61  VAL B CB  1 
ATOM   2963 C CG1 . VAL B 1 55  ? 44.829 49.312 27.592  1.00 48.64 ? 61  VAL B CG1 1 
ATOM   2964 C CG2 . VAL B 1 55  ? 46.934 50.563 27.117  1.00 49.63 ? 61  VAL B CG2 1 
ATOM   2965 N N   . ILE B 1 56  ? 44.575 49.041 30.767  1.00 49.47 ? 62  ILE B N   1 
ATOM   2966 C CA  . ILE B 1 56  ? 43.759 48.106 31.531  1.00 50.25 ? 62  ILE B CA  1 
ATOM   2967 C C   . ILE B 1 56  ? 42.737 47.542 30.560  1.00 51.53 ? 62  ILE B C   1 
ATOM   2968 O O   . ILE B 1 56  ? 42.389 46.363 30.614  1.00 52.09 ? 62  ILE B O   1 
ATOM   2969 C CB  . ILE B 1 56  ? 43.008 48.805 32.695  1.00 49.38 ? 62  ILE B CB  1 
ATOM   2970 C CG1 . ILE B 1 56  ? 43.961 49.048 33.866  1.00 48.74 ? 62  ILE B CG1 1 
ATOM   2971 C CG2 . ILE B 1 56  ? 41.821 47.954 33.141  1.00 49.79 ? 62  ILE B CG2 1 
ATOM   2972 C CD1 . ILE B 1 56  ? 43.300 49.704 35.073  1.00 46.19 ? 62  ILE B CD1 1 
ATOM   2973 N N   . GLY B 1 57  ? 42.265 48.399 29.664  1.00 52.79 ? 63  GLY B N   1 
ATOM   2974 C CA  . GLY B 1 57  ? 41.291 47.972 28.684  1.00 55.97 ? 63  GLY B CA  1 
ATOM   2975 C C   . GLY B 1 57  ? 40.784 49.123 27.846  1.00 58.33 ? 63  GLY B C   1 
ATOM   2976 O O   . GLY B 1 57  ? 40.392 50.160 28.378  1.00 59.09 ? 63  GLY B O   1 
ATOM   2977 N N   . ASN B 1 58  ? 40.803 48.950 26.530  1.00 60.51 ? 64  ASN B N   1 
ATOM   2978 C CA  . ASN B 1 58  ? 40.313 49.982 25.630  1.00 62.91 ? 64  ASN B CA  1 
ATOM   2979 C C   . ASN B 1 58  ? 38.793 50.025 25.770  1.00 64.10 ? 64  ASN B C   1 
ATOM   2980 O O   . ASN B 1 58  ? 38.233 49.392 26.667  1.00 64.83 ? 64  ASN B O   1 
ATOM   2981 C CB  . ASN B 1 58  ? 40.714 49.665 24.185  1.00 63.81 ? 64  ASN B CB  1 
ATOM   2982 C CG  . ASN B 1 58  ? 42.210 49.843 23.940  1.00 65.66 ? 64  ASN B CG  1 
ATOM   2983 O OD1 . ASN B 1 58  ? 42.711 50.968 23.863  1.00 65.87 ? 64  ASN B OD1 1 
ATOM   2984 N ND2 . ASN B 1 58  ? 42.931 48.730 23.828  1.00 66.01 ? 64  ASN B ND2 1 
ATOM   2985 N N   . GLY B 1 59  ? 38.132 50.774 24.896  1.00 64.82 ? 65  GLY B N   1 
ATOM   2986 C CA  . GLY B 1 59  ? 36.685 50.877 24.962  1.00 65.46 ? 65  GLY B CA  1 
ATOM   2987 C C   . GLY B 1 59  ? 36.180 52.056 24.153  1.00 66.17 ? 65  GLY B C   1 
ATOM   2988 O O   . GLY B 1 59  ? 36.687 53.171 24.298  1.00 66.43 ? 65  GLY B O   1 
ATOM   2989 N N   . SER B 1 60  ? 35.182 51.805 23.307  1.00 66.31 ? 66  SER B N   1 
ATOM   2990 C CA  . SER B 1 60  ? 34.597 52.835 22.448  1.00 66.55 ? 66  SER B CA  1 
ATOM   2991 C C   . SER B 1 60  ? 34.712 54.251 23.022  1.00 66.22 ? 66  SER B C   1 
ATOM   2992 O O   . SER B 1 60  ? 35.206 55.156 22.344  1.00 65.82 ? 66  SER B O   1 
ATOM   2993 C CB  . SER B 1 60  ? 33.124 52.506 22.154  1.00 66.46 ? 66  SER B CB  1 
ATOM   2994 O OG  . SER B 1 60  ? 32.345 52.485 23.339  1.00 67.10 ? 66  SER B OG  1 
ATOM   2995 N N   . PHE B 1 61  ? 34.265 54.440 24.264  1.00 65.83 ? 67  PHE B N   1 
ATOM   2996 C CA  . PHE B 1 61  ? 34.333 55.752 24.909  1.00 65.44 ? 67  PHE B CA  1 
ATOM   2997 C C   . PHE B 1 61  ? 35.776 56.229 25.059  1.00 64.54 ? 67  PHE B C   1 
ATOM   2998 O O   . PHE B 1 61  ? 36.223 57.146 24.365  1.00 64.15 ? 67  PHE B O   1 
ATOM   2999 C CB  . PHE B 1 61  ? 33.677 55.714 26.295  1.00 66.56 ? 67  PHE B CB  1 
ATOM   3000 C CG  . PHE B 1 61  ? 32.279 56.268 26.324  1.00 67.82 ? 67  PHE B CG  1 
ATOM   3001 C CD1 . PHE B 1 61  ? 31.174 55.418 26.357  1.00 68.81 ? 67  PHE B CD1 1 
ATOM   3002 C CD2 . PHE B 1 61  ? 32.065 57.645 26.312  1.00 68.03 ? 67  PHE B CD2 1 
ATOM   3003 C CE1 . PHE B 1 61  ? 29.873 55.934 26.380  1.00 68.50 ? 67  PHE B CE1 1 
ATOM   3004 C CE2 . PHE B 1 61  ? 30.770 58.172 26.334  1.00 68.14 ? 67  PHE B CE2 1 
ATOM   3005 C CZ  . PHE B 1 61  ? 29.672 57.314 26.367  1.00 68.44 ? 67  PHE B CZ  1 
ATOM   3006 N N   . GLY B 1 62  ? 36.499 55.604 25.979  1.00 63.13 ? 68  GLY B N   1 
ATOM   3007 C CA  . GLY B 1 62  ? 37.877 55.984 26.202  1.00 60.60 ? 68  GLY B CA  1 
ATOM   3008 C C   . GLY B 1 62  ? 38.672 54.859 26.824  1.00 58.75 ? 68  GLY B C   1 
ATOM   3009 O O   . GLY B 1 62  ? 38.112 53.965 27.468  1.00 58.93 ? 68  GLY B O   1 
ATOM   3010 N N   . VAL B 1 63  ? 39.985 54.912 26.628  1.00 55.56 ? 69  VAL B N   1 
ATOM   3011 C CA  . VAL B 1 63  ? 40.896 53.910 27.155  1.00 52.32 ? 69  VAL B CA  1 
ATOM   3012 C C   . VAL B 1 63  ? 41.112 54.098 28.654  1.00 50.18 ? 69  VAL B C   1 
ATOM   3013 O O   . VAL B 1 63  ? 41.132 55.221 29.151  1.00 49.47 ? 69  VAL B O   1 
ATOM   3014 C CB  . VAL B 1 63  ? 42.259 53.999 26.441  1.00 52.14 ? 69  VAL B CB  1 
ATOM   3015 C CG1 . VAL B 1 63  ? 43.219 52.958 26.997  1.00 51.99 ? 69  VAL B CG1 1 
ATOM   3016 C CG2 . VAL B 1 63  ? 42.064 53.806 24.949  1.00 52.42 ? 69  VAL B CG2 1 
ATOM   3017 N N   . VAL B 1 64  ? 41.261 52.991 29.370  1.00 47.94 ? 70  VAL B N   1 
ATOM   3018 C CA  . VAL B 1 64  ? 41.499 53.045 30.802  1.00 46.57 ? 70  VAL B CA  1 
ATOM   3019 C C   . VAL B 1 64  ? 42.895 52.503 31.067  1.00 45.70 ? 70  VAL B C   1 
ATOM   3020 O O   . VAL B 1 64  ? 43.245 51.416 30.607  1.00 45.25 ? 70  VAL B O   1 
ATOM   3021 C CB  . VAL B 1 64  ? 40.460 52.212 31.579  1.00 46.24 ? 70  VAL B CB  1 
ATOM   3022 C CG1 . VAL B 1 64  ? 40.744 52.285 33.071  1.00 45.11 ? 70  VAL B CG1 1 
ATOM   3023 C CG2 . VAL B 1 64  ? 39.067 52.731 31.287  1.00 45.88 ? 70  VAL B CG2 1 
ATOM   3024 N N   . TYR B 1 65  ? 43.691 53.279 31.798  1.00 44.34 ? 71  TYR B N   1 
ATOM   3025 C CA  . TYR B 1 65  ? 45.062 52.904 32.123  1.00 43.47 ? 71  TYR B CA  1 
ATOM   3026 C C   . TYR B 1 65  ? 45.243 52.637 33.606  1.00 42.76 ? 71  TYR B C   1 
ATOM   3027 O O   . TYR B 1 65  ? 44.463 53.098 34.440  1.00 41.21 ? 71  TYR B O   1 
ATOM   3028 C CB  . TYR B 1 65  ? 46.031 54.031 31.751  1.00 44.61 ? 71  TYR B CB  1 
ATOM   3029 C CG  . TYR B 1 65  ? 46.041 54.428 30.298  1.00 45.59 ? 71  TYR B CG  1 
ATOM   3030 C CD1 . TYR B 1 65  ? 46.813 53.730 29.369  1.00 46.30 ? 71  TYR B CD1 1 
ATOM   3031 C CD2 . TYR B 1 65  ? 45.286 55.508 29.850  1.00 46.37 ? 71  TYR B CD2 1 
ATOM   3032 C CE1 . TYR B 1 65  ? 46.832 54.101 28.029  1.00 47.12 ? 71  TYR B CE1 1 
ATOM   3033 C CE2 . TYR B 1 65  ? 45.296 55.887 28.513  1.00 47.99 ? 71  TYR B CE2 1 
ATOM   3034 C CZ  . TYR B 1 65  ? 46.071 55.180 27.609  1.00 47.97 ? 71  TYR B CZ  1 
ATOM   3035 O OH  . TYR B 1 65  ? 46.080 55.556 26.284  1.00 49.65 ? 71  TYR B OH  1 
ATOM   3036 N N   . GLN B 1 66  ? 46.289 51.886 33.920  1.00 42.88 ? 72  GLN B N   1 
ATOM   3037 C CA  . GLN B 1 66  ? 46.646 51.604 35.296  1.00 43.61 ? 72  GLN B CA  1 
ATOM   3038 C C   . GLN B 1 66  ? 47.938 52.392 35.463  1.00 44.19 ? 72  GLN B C   1 
ATOM   3039 O O   . GLN B 1 66  ? 48.754 52.442 34.543  1.00 43.66 ? 72  GLN B O   1 
ATOM   3040 C CB  . GLN B 1 66  ? 46.938 50.123 35.516  1.00 43.61 ? 72  GLN B CB  1 
ATOM   3041 C CG  . GLN B 1 66  ? 47.203 49.793 36.977  1.00 44.46 ? 72  GLN B CG  1 
ATOM   3042 C CD  . GLN B 1 66  ? 47.910 48.468 37.172  1.00 46.10 ? 72  GLN B CD  1 
ATOM   3043 O OE1 . GLN B 1 66  ? 49.095 48.332 36.866  1.00 46.30 ? 72  GLN B OE1 1 
ATOM   3044 N NE2 . GLN B 1 66  ? 47.186 47.480 37.684  1.00 46.61 ? 72  GLN B NE2 1 
ATOM   3045 N N   . ALA B 1 67  ? 48.119 53.018 36.619  1.00 44.89 ? 73  ALA B N   1 
ATOM   3046 C CA  . ALA B 1 67  ? 49.326 53.793 36.867  1.00 45.57 ? 73  ALA B CA  1 
ATOM   3047 C C   . ALA B 1 67  ? 49.635 53.769 38.351  1.00 46.31 ? 73  ALA B C   1 
ATOM   3048 O O   . ALA B 1 67  ? 48.750 53.523 39.169  1.00 45.81 ? 73  ALA B O   1 
ATOM   3049 C CB  . ALA B 1 67  ? 49.138 55.226 36.389  1.00 44.57 ? 73  ALA B CB  1 
ATOM   3050 N N   . LYS B 1 68  ? 50.895 54.019 38.697  1.00 47.88 ? 74  LYS B N   1 
ATOM   3051 C CA  . LYS B 1 68  ? 51.304 54.020 40.094  1.00 49.09 ? 74  LYS B CA  1 
ATOM   3052 C C   . LYS B 1 68  ? 51.751 55.408 40.553  1.00 49.14 ? 74  LYS B C   1 
ATOM   3053 O O   . LYS B 1 68  ? 52.631 56.026 39.948  1.00 49.06 ? 74  LYS B O   1 
ATOM   3054 C CB  . LYS B 1 68  ? 52.430 53.004 40.311  1.00 50.67 ? 74  LYS B CB  1 
ATOM   3055 C CG  . LYS B 1 68  ? 52.852 52.853 41.764  1.00 52.89 ? 74  LYS B CG  1 
ATOM   3056 C CD  . LYS B 1 68  ? 53.635 51.566 41.998  1.00 56.04 ? 74  LYS B CD  1 
ATOM   3057 C CE  . LYS B 1 68  ? 54.955 51.549 41.244  1.00 57.38 ? 74  LYS B CE  1 
ATOM   3058 N NZ  . LYS B 1 68  ? 55.909 52.575 41.754  1.00 59.93 ? 74  LYS B NZ  1 
ATOM   3059 N N   . LEU B 1 69  ? 51.125 55.896 41.619  1.00 49.21 ? 75  LEU B N   1 
ATOM   3060 C CA  . LEU B 1 69  ? 51.454 57.201 42.170  1.00 49.74 ? 75  LEU B CA  1 
ATOM   3061 C C   . LEU B 1 69  ? 52.855 57.132 42.766  1.00 51.57 ? 75  LEU B C   1 
ATOM   3062 O O   . LEU B 1 69  ? 53.114 56.346 43.674  1.00 51.34 ? 75  LEU B O   1 
ATOM   3063 C CB  . LEU B 1 69  ? 50.433 57.593 43.243  1.00 48.01 ? 75  LEU B CB  1 
ATOM   3064 C CG  . LEU B 1 69  ? 48.973 57.662 42.779  1.00 46.03 ? 75  LEU B CG  1 
ATOM   3065 C CD1 . LEU B 1 69  ? 48.081 58.112 43.930  1.00 46.03 ? 75  LEU B CD1 1 
ATOM   3066 C CD2 . LEU B 1 69  ? 48.852 58.619 41.607  1.00 45.72 ? 75  LEU B CD2 1 
ATOM   3067 N N   . CYS B 1 70  ? 53.752 57.959 42.239  1.00 54.08 ? 76  CYS B N   1 
ATOM   3068 C CA  . CYS B 1 70  ? 55.145 58.002 42.675  1.00 57.04 ? 76  CYS B CA  1 
ATOM   3069 C C   . CYS B 1 70  ? 55.414 57.881 44.170  1.00 58.18 ? 76  CYS B C   1 
ATOM   3070 O O   . CYS B 1 70  ? 56.074 56.940 44.614  1.00 58.90 ? 76  CYS B O   1 
ATOM   3071 C CB  . CYS B 1 70  ? 55.807 59.276 42.154  1.00 57.47 ? 76  CYS B CB  1 
ATOM   3072 S SG  . CYS B 1 70  ? 56.044 59.276 40.372  1.00 61.94 ? 76  CYS B SG  1 
ATOM   3073 N N   . ASP B 1 71  ? 54.912 58.832 44.948  1.00 59.15 ? 77  ASP B N   1 
ATOM   3074 C CA  . ASP B 1 71  ? 55.147 58.823 46.385  1.00 60.15 ? 77  ASP B CA  1 
ATOM   3075 C C   . ASP B 1 71  ? 54.562 57.627 47.127  1.00 59.89 ? 77  ASP B C   1 
ATOM   3076 O O   . ASP B 1 71  ? 55.300 56.778 47.625  1.00 60.86 ? 77  ASP B O   1 
ATOM   3077 C CB  . ASP B 1 71  ? 54.624 60.122 47.004  1.00 61.75 ? 77  ASP B CB  1 
ATOM   3078 C CG  . ASP B 1 71  ? 55.353 61.345 46.483  1.00 63.29 ? 77  ASP B CG  1 
ATOM   3079 O OD1 . ASP B 1 71  ? 56.598 61.383 46.596  1.00 63.59 ? 77  ASP B OD1 1 
ATOM   3080 O OD2 . ASP B 1 71  ? 54.684 62.264 45.963  1.00 64.44 ? 77  ASP B OD2 1 
ATOM   3081 N N   . SER B 1 72  ? 53.239 57.565 47.201  1.00 58.92 ? 78  SER B N   1 
ATOM   3082 C CA  . SER B 1 72  ? 52.561 56.483 47.902  1.00 57.91 ? 78  SER B CA  1 
ATOM   3083 C C   . SER B 1 72  ? 52.726 55.118 47.240  1.00 56.97 ? 78  SER B C   1 
ATOM   3084 O O   . SER B 1 72  ? 52.539 54.086 47.884  1.00 56.77 ? 78  SER B O   1 
ATOM   3085 C CB  . SER B 1 72  ? 51.073 56.813 48.034  1.00 58.12 ? 78  SER B CB  1 
ATOM   3086 O OG  . SER B 1 72  ? 50.502 57.083 46.764  1.00 58.12 ? 78  SER B OG  1 
ATOM   3087 N N   . GLY B 1 73  ? 53.079 55.111 45.958  1.00 55.87 ? 79  GLY B N   1 
ATOM   3088 C CA  . GLY B 1 73  ? 53.240 53.853 45.248  1.00 54.67 ? 79  GLY B CA  1 
ATOM   3089 C C   . GLY B 1 73  ? 51.880 53.216 45.015  1.00 53.80 ? 79  GLY B C   1 
ATOM   3090 O O   . GLY B 1 73  ? 51.768 52.108 44.489  1.00 53.88 ? 79  GLY B O   1 
ATOM   3091 N N   . GLU B 1 74  ? 50.840 53.936 45.413  1.00 52.06 ? 80  GLU B N   1 
ATOM   3092 C CA  . GLU B 1 74  ? 49.468 53.477 45.272  1.00 50.66 ? 80  GLU B CA  1 
ATOM   3093 C C   . GLU B 1 74  ? 49.077 53.388 43.801  1.00 48.63 ? 80  GLU B C   1 
ATOM   3094 O O   . GLU B 1 74  ? 49.466 54.229 42.992  1.00 47.77 ? 80  GLU B O   1 
ATOM   3095 C CB  . GLU B 1 74  ? 48.539 54.443 46.005  1.00 51.88 ? 80  GLU B CB  1 
ATOM   3096 C CG  . GLU B 1 74  ? 47.105 53.986 46.126  1.00 54.64 ? 80  GLU B CG  1 
ATOM   3097 C CD  . GLU B 1 74  ? 46.269 54.959 46.933  1.00 55.55 ? 80  GLU B CD  1 
ATOM   3098 O OE1 . GLU B 1 74  ? 45.078 54.669 47.171  1.00 55.59 ? 80  GLU B OE1 1 
ATOM   3099 O OE2 . GLU B 1 74  ? 46.810 56.015 47.328  1.00 56.74 ? 80  GLU B OE2 1 
ATOM   3100 N N   . LEU B 1 75  ? 48.308 52.361 43.457  1.00 46.56 ? 81  LEU B N   1 
ATOM   3101 C CA  . LEU B 1 75  ? 47.870 52.177 42.080  1.00 44.64 ? 81  LEU B CA  1 
ATOM   3102 C C   . LEU B 1 75  ? 46.540 52.883 41.843  1.00 42.60 ? 81  LEU B C   1 
ATOM   3103 O O   . LEU B 1 75  ? 45.662 52.885 42.704  1.00 42.35 ? 81  LEU B O   1 
ATOM   3104 C CB  . LEU B 1 75  ? 47.727 50.686 41.759  1.00 45.00 ? 81  LEU B CB  1 
ATOM   3105 C CG  . LEU B 1 75  ? 49.001 49.834 41.757  1.00 46.31 ? 81  LEU B CG  1 
ATOM   3106 C CD1 . LEU B 1 75  ? 48.633 48.367 41.581  1.00 46.20 ? 81  LEU B CD1 1 
ATOM   3107 C CD2 . LEU B 1 75  ? 49.930 50.288 40.639  1.00 45.22 ? 81  LEU B CD2 1 
ATOM   3108 N N   . VAL B 1 76  ? 46.406 53.500 40.677  1.00 40.80 ? 82  VAL B N   1 
ATOM   3109 C CA  . VAL B 1 76  ? 45.179 54.193 40.320  1.00 39.52 ? 82  VAL B CA  1 
ATOM   3110 C C   . VAL B 1 76  ? 44.827 53.865 38.879  1.00 39.11 ? 82  VAL B C   1 
ATOM   3111 O O   . VAL B 1 76  ? 45.642 53.316 38.134  1.00 37.63 ? 82  VAL B O   1 
ATOM   3112 C CB  . VAL B 1 76  ? 45.320 55.730 40.440  1.00 39.56 ? 82  VAL B CB  1 
ATOM   3113 C CG1 . VAL B 1 76  ? 45.565 56.129 41.885  1.00 39.57 ? 82  VAL B CG1 1 
ATOM   3114 C CG2 . VAL B 1 76  ? 46.449 56.216 39.552  1.00 39.03 ? 82  VAL B CG2 1 
ATOM   3115 N N   . ALA B 1 77  ? 43.605 54.204 38.495  1.00 38.14 ? 83  ALA B N   1 
ATOM   3116 C CA  . ALA B 1 77  ? 43.144 53.970 37.142  1.00 37.73 ? 83  ALA B CA  1 
ATOM   3117 C C   . ALA B 1 77  ? 42.955 55.338 36.525  1.00 38.16 ? 83  ALA B C   1 
ATOM   3118 O O   . ALA B 1 77  ? 42.515 56.266 37.196  1.00 38.77 ? 83  ALA B O   1 
ATOM   3119 C CB  . ALA B 1 77  ? 41.823 53.218 37.157  1.00 38.19 ? 83  ALA B CB  1 
ATOM   3120 N N   . ILE B 1 78  ? 43.307 55.469 35.253  1.00 37.89 ? 84  ILE B N   1 
ATOM   3121 C CA  . ILE B 1 78  ? 43.149 56.736 34.562  1.00 37.70 ? 84  ILE B CA  1 
ATOM   3122 C C   . ILE B 1 78  ? 42.324 56.505 33.308  1.00 38.40 ? 84  ILE B C   1 
ATOM   3123 O O   . ILE B 1 78  ? 42.753 55.790 32.401  1.00 38.42 ? 84  ILE B O   1 
ATOM   3124 C CB  . ILE B 1 78  ? 44.511 57.336 34.153  1.00 37.19 ? 84  ILE B CB  1 
ATOM   3125 C CG1 . ILE B 1 78  ? 45.383 57.559 35.395  1.00 37.80 ? 84  ILE B CG1 1 
ATOM   3126 C CG2 . ILE B 1 78  ? 44.290 58.653 33.414  1.00 37.39 ? 84  ILE B CG2 1 
ATOM   3127 C CD1 . ILE B 1 78  ? 46.763 58.139 35.086  1.00 37.00 ? 84  ILE B CD1 1 
ATOM   3128 N N   . LYS B 1 79  ? 41.135 57.099 33.263  1.00 38.48 ? 85  LYS B N   1 
ATOM   3129 C CA  . LYS B 1 79  ? 40.267 56.956 32.105  1.00 39.29 ? 85  LYS B CA  1 
ATOM   3130 C C   . LYS B 1 79  ? 40.456 58.195 31.240  1.00 41.25 ? 85  LYS B C   1 
ATOM   3131 O O   . LYS B 1 79  ? 40.216 59.321 31.683  1.00 41.76 ? 85  LYS B O   1 
ATOM   3132 C CB  . LYS B 1 79  ? 38.807 56.817 32.539  1.00 38.28 ? 85  LYS B CB  1 
ATOM   3133 C CG  . LYS B 1 79  ? 37.851 56.571 31.384  1.00 38.56 ? 85  LYS B CG  1 
ATOM   3134 C CD  . LYS B 1 79  ? 36.454 56.226 31.871  1.00 39.09 ? 85  LYS B CD  1 
ATOM   3135 C CE  . LYS B 1 79  ? 35.526 55.957 30.698  1.00 40.10 ? 85  LYS B CE  1 
ATOM   3136 N NZ  . LYS B 1 79  ? 34.168 55.562 31.153  1.00 42.00 ? 85  LYS B NZ  1 
ATOM   3137 N N   . LYS B 1 80  ? 40.893 57.975 30.006  1.00 41.31 ? 86  LYS B N   1 
ATOM   3138 C CA  . LYS B 1 80  ? 41.164 59.056 29.070  1.00 43.41 ? 86  LYS B CA  1 
ATOM   3139 C C   . LYS B 1 80  ? 40.200 59.036 27.889  1.00 44.78 ? 86  LYS B C   1 
ATOM   3140 O O   . LYS B 1 80  ? 40.156 58.066 27.136  1.00 44.52 ? 86  LYS B O   1 
ATOM   3141 C CB  . LYS B 1 80  ? 42.607 58.918 28.577  1.00 42.95 ? 86  LYS B CB  1 
ATOM   3142 C CG  . LYS B 1 80  ? 43.133 60.047 27.715  1.00 43.91 ? 86  LYS B CG  1 
ATOM   3143 C CD  . LYS B 1 80  ? 44.625 59.836 27.490  1.00 45.24 ? 86  LYS B CD  1 
ATOM   3144 C CE  . LYS B 1 80  ? 45.273 60.991 26.750  1.00 45.26 ? 86  LYS B CE  1 
ATOM   3145 N NZ  . LYS B 1 80  ? 46.752 60.797 26.697  1.00 47.14 ? 86  LYS B NZ  1 
ATOM   3146 N N   . VAL B 1 81  ? 39.431 60.111 27.740  1.00 46.42 ? 87  VAL B N   1 
ATOM   3147 C CA  . VAL B 1 81  ? 38.466 60.238 26.651  1.00 48.84 ? 87  VAL B CA  1 
ATOM   3148 C C   . VAL B 1 81  ? 38.619 61.599 25.975  1.00 50.79 ? 87  VAL B C   1 
ATOM   3149 O O   . VAL B 1 81  ? 39.022 62.573 26.613  1.00 49.34 ? 87  VAL B O   1 
ATOM   3150 C CB  . VAL B 1 81  ? 37.011 60.121 27.163  1.00 49.06 ? 87  VAL B CB  1 
ATOM   3151 C CG1 . VAL B 1 81  ? 36.801 58.782 27.867  1.00 49.07 ? 87  VAL B CG1 1 
ATOM   3152 C CG2 . VAL B 1 81  ? 36.697 61.274 28.103  1.00 48.70 ? 87  VAL B CG2 1 
ATOM   3153 N N   . LEU B 1 82  ? 38.295 61.661 24.684  1.00 52.94 ? 88  LEU B N   1 
ATOM   3154 C CA  . LEU B 1 82  ? 38.385 62.909 23.929  1.00 55.56 ? 88  LEU B CA  1 
ATOM   3155 C C   . LEU B 1 82  ? 37.457 63.967 24.513  1.00 57.26 ? 88  LEU B C   1 
ATOM   3156 O O   . LEU B 1 82  ? 36.266 63.727 24.704  1.00 57.11 ? 88  LEU B O   1 
ATOM   3157 C CB  . LEU B 1 82  ? 38.016 62.685 22.456  1.00 55.83 ? 88  LEU B CB  1 
ATOM   3158 C CG  . LEU B 1 82  ? 39.080 62.145 21.497  1.00 56.15 ? 88  LEU B CG  1 
ATOM   3159 C CD1 . LEU B 1 82  ? 38.442 61.882 20.144  1.00 56.02 ? 88  LEU B CD1 1 
ATOM   3160 C CD2 . LEU B 1 82  ? 40.218 63.148 21.358  1.00 55.51 ? 88  LEU B CD2 1 
ATOM   3161 N N   . GLN B 1 83  ? 38.011 65.142 24.787  1.00 59.89 ? 89  GLN B N   1 
ATOM   3162 C CA  . GLN B 1 83  ? 37.238 66.244 25.344  1.00 62.69 ? 89  GLN B CA  1 
ATOM   3163 C C   . GLN B 1 83  ? 36.423 66.918 24.246  1.00 63.34 ? 89  GLN B C   1 
ATOM   3164 O O   . GLN B 1 83  ? 36.982 67.508 23.321  1.00 63.76 ? 89  GLN B O   1 
ATOM   3165 C CB  . GLN B 1 83  ? 38.185 67.252 26.006  1.00 64.01 ? 89  GLN B CB  1 
ATOM   3166 C CG  . GLN B 1 83  ? 37.516 68.462 26.646  1.00 66.29 ? 89  GLN B CG  1 
ATOM   3167 C CD  . GLN B 1 83  ? 37.341 69.621 25.680  1.00 68.08 ? 89  GLN B CD  1 
ATOM   3168 O OE1 . GLN B 1 83  ? 36.482 69.591 24.797  1.00 68.64 ? 89  GLN B OE1 1 
ATOM   3169 N NE2 . GLN B 1 83  ? 38.169 70.651 25.840  1.00 68.66 ? 89  GLN B NE2 1 
ATOM   3170 N N   . ASP B 1 84  ? 35.100 66.816 24.348  1.00 64.59 ? 90  ASP B N   1 
ATOM   3171 C CA  . ASP B 1 84  ? 34.202 67.419 23.367  1.00 65.62 ? 90  ASP B CA  1 
ATOM   3172 C C   . ASP B 1 84  ? 34.165 68.925 23.619  1.00 66.22 ? 90  ASP B C   1 
ATOM   3173 O O   . ASP B 1 84  ? 33.640 69.386 24.633  1.00 65.91 ? 90  ASP B O   1 
ATOM   3174 C CB  . ASP B 1 84  ? 32.798 66.824 23.501  1.00 66.22 ? 90  ASP B CB  1 
ATOM   3175 C CG  . ASP B 1 84  ? 32.011 66.896 22.208  1.00 67.06 ? 90  ASP B CG  1 
ATOM   3176 O OD1 . ASP B 1 84  ? 31.929 67.997 21.626  1.00 67.76 ? 90  ASP B OD1 1 
ATOM   3177 O OD2 . ASP B 1 84  ? 31.473 65.853 21.775  1.00 67.79 ? 90  ASP B OD2 1 
ATOM   3178 N N   . LYS B 1 85  ? 34.726 69.682 22.683  1.00 67.12 ? 91  LYS B N   1 
ATOM   3179 C CA  . LYS B 1 85  ? 34.816 71.135 22.791  1.00 67.82 ? 91  LYS B CA  1 
ATOM   3180 C C   . LYS B 1 85  ? 33.508 71.902 23.002  1.00 67.71 ? 91  LYS B C   1 
ATOM   3181 O O   . LYS B 1 85  ? 33.509 72.971 23.617  1.00 67.85 ? 91  LYS B O   1 
ATOM   3182 C CB  . LYS B 1 85  ? 35.543 71.692 21.560  1.00 68.24 ? 91  LYS B CB  1 
ATOM   3183 C CG  . LYS B 1 85  ? 35.940 73.154 21.687  1.00 69.10 ? 91  LYS B CG  1 
ATOM   3184 C CD  . LYS B 1 85  ? 36.823 73.383 22.908  1.00 69.14 ? 91  LYS B CD  1 
ATOM   3185 C CE  . LYS B 1 85  ? 37.130 74.863 23.098  1.00 69.85 ? 91  LYS B CE  1 
ATOM   3186 N NZ  . LYS B 1 85  ? 37.861 75.130 24.371  1.00 70.23 ? 91  LYS B NZ  1 
ATOM   3187 N N   . ARG B 1 86  ? 32.397 71.369 22.505  1.00 67.50 ? 92  ARG B N   1 
ATOM   3188 C CA  . ARG B 1 86  ? 31.113 72.051 22.653  1.00 67.17 ? 92  ARG B CA  1 
ATOM   3189 C C   . ARG B 1 86  ? 30.502 71.950 24.050  1.00 66.75 ? 92  ARG B C   1 
ATOM   3190 O O   . ARG B 1 86  ? 30.053 72.957 24.605  1.00 67.26 ? 92  ARG B O   1 
ATOM   3191 C CB  . ARG B 1 86  ? 30.121 71.532 21.607  1.00 67.70 ? 92  ARG B CB  1 
ATOM   3192 C CG  . ARG B 1 86  ? 29.988 70.029 21.583  1.00 68.61 ? 92  ARG B CG  1 
ATOM   3193 C CD  . ARG B 1 86  ? 29.399 69.546 20.271  1.00 68.96 ? 92  ARG B CD  1 
ATOM   3194 N NE  . ARG B 1 86  ? 29.637 68.118 20.080  1.00 69.82 ? 92  ARG B NE  1 
ATOM   3195 C CZ  . ARG B 1 86  ? 29.316 67.447 18.980  1.00 69.83 ? 92  ARG B CZ  1 
ATOM   3196 N NH1 . ARG B 1 86  ? 28.738 68.075 17.965  1.00 70.36 ? 92  ARG B NH1 1 
ATOM   3197 N NH2 . ARG B 1 86  ? 29.583 66.151 18.892  1.00 70.28 ? 92  ARG B NH2 1 
ATOM   3198 N N   . PHE B 1 87  ? 30.480 70.749 24.623  1.00 65.54 ? 93  PHE B N   1 
ATOM   3199 C CA  . PHE B 1 87  ? 29.912 70.573 25.958  1.00 64.29 ? 93  PHE B CA  1 
ATOM   3200 C C   . PHE B 1 87  ? 30.847 69.869 26.937  1.00 62.86 ? 93  PHE B C   1 
ATOM   3201 O O   . PHE B 1 87  ? 31.804 69.203 26.538  1.00 63.16 ? 93  PHE B O   1 
ATOM   3202 C CB  . PHE B 1 87  ? 28.575 69.818 25.877  1.00 65.21 ? 93  PHE B CB  1 
ATOM   3203 C CG  . PHE B 1 87  ? 28.631 68.543 25.073  1.00 66.15 ? 93  PHE B CG  1 
ATOM   3204 C CD1 . PHE B 1 87  ? 29.414 67.467 25.487  1.00 66.83 ? 93  PHE B CD1 1 
ATOM   3205 C CD2 . PHE B 1 87  ? 27.885 68.416 23.902  1.00 66.59 ? 93  PHE B CD2 1 
ATOM   3206 C CE1 . PHE B 1 87  ? 29.453 66.280 24.744  1.00 66.54 ? 93  PHE B CE1 1 
ATOM   3207 C CE2 . PHE B 1 87  ? 27.916 67.238 23.153  1.00 66.42 ? 93  PHE B CE2 1 
ATOM   3208 C CZ  . PHE B 1 87  ? 28.701 66.168 23.575  1.00 66.57 ? 93  PHE B CZ  1 
ATOM   3209 N N   . LYS B 1 88  ? 30.568 70.032 28.226  1.00 60.72 ? 94  LYS B N   1 
ATOM   3210 C CA  . LYS B 1 88  ? 31.376 69.407 29.262  1.00 58.21 ? 94  LYS B CA  1 
ATOM   3211 C C   . LYS B 1 88  ? 30.994 67.938 29.395  1.00 55.04 ? 94  LYS B C   1 
ATOM   3212 O O   . LYS B 1 88  ? 29.856 67.555 29.131  1.00 54.42 ? 94  LYS B O   1 
ATOM   3213 C CB  . LYS B 1 88  ? 31.187 70.139 30.592  1.00 59.88 ? 94  LYS B CB  1 
ATOM   3214 C CG  . LYS B 1 88  ? 31.712 71.569 30.555  1.00 62.61 ? 94  LYS B CG  1 
ATOM   3215 C CD  . LYS B 1 88  ? 31.412 72.335 31.833  1.00 63.77 ? 94  LYS B CD  1 
ATOM   3216 C CE  . LYS B 1 88  ? 31.823 73.795 31.686  1.00 64.47 ? 94  LYS B CE  1 
ATOM   3217 N NZ  . LYS B 1 88  ? 31.448 74.613 32.873  1.00 65.19 ? 94  LYS B NZ  1 
ATOM   3218 N N   . ASN B 1 89  ? 31.960 67.122 29.799  1.00 51.44 ? 95  ASN B N   1 
ATOM   3219 C CA  . ASN B 1 89  ? 31.759 65.687 29.948  1.00 47.79 ? 95  ASN B CA  1 
ATOM   3220 C C   . ASN B 1 89  ? 30.697 65.318 30.996  1.00 45.81 ? 95  ASN B C   1 
ATOM   3221 O O   . ASN B 1 89  ? 30.803 65.687 32.166  1.00 44.02 ? 95  ASN B O   1 
ATOM   3222 C CB  . ASN B 1 89  ? 33.104 65.043 30.281  1.00 47.44 ? 95  ASN B CB  1 
ATOM   3223 C CG  . ASN B 1 89  ? 33.047 63.539 30.280  1.00 47.41 ? 95  ASN B CG  1 
ATOM   3224 O OD1 . ASN B 1 89  ? 32.528 62.925 31.211  1.00 46.10 ? 95  ASN B OD1 1 
ATOM   3225 N ND2 . ASN B 1 89  ? 33.581 62.929 29.226  1.00 47.28 ? 95  ASN B ND2 1 
ATOM   3226 N N   . ARG B 1 90  ? 29.673 64.582 30.567  1.00 42.60 ? 96  ARG B N   1 
ATOM   3227 C CA  . ARG B 1 90  ? 28.595 64.173 31.464  1.00 41.55 ? 96  ARG B CA  1 
ATOM   3228 C C   . ARG B 1 90  ? 29.059 63.187 32.538  1.00 39.53 ? 96  ARG B C   1 
ATOM   3229 O O   . ARG B 1 90  ? 28.569 63.221 33.666  1.00 39.44 ? 96  ARG B O   1 
ATOM   3230 C CB  . ARG B 1 90  ? 27.442 63.554 30.667  1.00 42.16 ? 96  ARG B CB  1 
ATOM   3231 C CG  . ARG B 1 90  ? 26.262 63.109 31.526  1.00 45.22 ? 96  ARG B CG  1 
ATOM   3232 C CD  . ARG B 1 90  ? 25.158 62.483 30.676  1.00 48.41 ? 96  ARG B CD  1 
ATOM   3233 N NE  . ARG B 1 90  ? 24.452 63.474 29.866  1.00 51.45 ? 96  ARG B NE  1 
ATOM   3234 C CZ  . ARG B 1 90  ? 23.613 63.180 28.875  1.00 53.11 ? 96  ARG B CZ  1 
ATOM   3235 N NH1 . ARG B 1 90  ? 23.368 61.914 28.556  1.00 52.45 ? 96  ARG B NH1 1 
ATOM   3236 N NH2 . ARG B 1 90  ? 23.010 64.155 28.204  1.00 52.59 ? 96  ARG B NH2 1 
ATOM   3237 N N   . GLU B 1 91  ? 29.994 62.309 32.185  1.00 36.70 ? 97  GLU B N   1 
ATOM   3238 C CA  . GLU B 1 91  ? 30.505 61.332 33.137  1.00 36.28 ? 97  GLU B CA  1 
ATOM   3239 C C   . GLU B 1 91  ? 31.210 62.086 34.261  1.00 36.03 ? 97  GLU B C   1 
ATOM   3240 O O   . GLU B 1 91  ? 30.999 61.803 35.440  1.00 34.87 ? 97  GLU B O   1 
ATOM   3241 C CB  . GLU B 1 91  ? 31.496 60.377 32.457  1.00 35.13 ? 97  GLU B CB  1 
ATOM   3242 C CG  . GLU B 1 91  ? 31.848 59.143 33.288  1.00 35.85 ? 97  GLU B CG  1 
ATOM   3243 C CD  . GLU B 1 91  ? 32.833 58.206 32.584  1.00 38.11 ? 97  GLU B CD  1 
ATOM   3244 O OE1 . GLU B 1 91  ? 33.071 58.378 31.368  1.00 38.33 ? 97  GLU B OE1 1 
ATOM   3245 O OE2 . GLU B 1 91  ? 33.364 57.290 33.247  1.00 37.69 ? 97  GLU B OE2 1 
ATOM   3246 N N   . LEU B 1 92  ? 32.049 63.044 33.879  1.00 36.34 ? 98  LEU B N   1 
ATOM   3247 C CA  . LEU B 1 92  ? 32.789 63.850 34.842  1.00 37.97 ? 98  LEU B CA  1 
ATOM   3248 C C   . LEU B 1 92  ? 31.846 64.556 35.808  1.00 38.76 ? 98  LEU B C   1 
ATOM   3249 O O   . LEU B 1 92  ? 32.009 64.467 37.024  1.00 37.68 ? 98  LEU B O   1 
ATOM   3250 C CB  . LEU B 1 92  ? 33.649 64.891 34.118  1.00 38.11 ? 98  LEU B CB  1 
ATOM   3251 C CG  . LEU B 1 92  ? 34.437 65.847 35.024  1.00 38.21 ? 98  LEU B CG  1 
ATOM   3252 C CD1 . LEU B 1 92  ? 35.313 65.056 35.983  1.00 36.40 ? 98  LEU B CD1 1 
ATOM   3253 C CD2 . LEU B 1 92  ? 35.284 66.776 34.170  1.00 38.55 ? 98  LEU B CD2 1 
ATOM   3254 N N   . GLN B 1 93  ? 30.856 65.255 35.264  1.00 39.81 ? 99  GLN B N   1 
ATOM   3255 C CA  . GLN B 1 93  ? 29.910 65.977 36.098  1.00 41.26 ? 99  GLN B CA  1 
ATOM   3256 C C   . GLN B 1 93  ? 29.196 65.062 37.075  1.00 41.25 ? 99  GLN B C   1 
ATOM   3257 O O   . GLN B 1 93  ? 28.953 65.441 38.218  1.00 41.58 ? 99  GLN B O   1 
ATOM   3258 C CB  . GLN B 1 93  ? 28.896 66.724 35.226  1.00 43.66 ? 99  GLN B CB  1 
ATOM   3259 C CG  . GLN B 1 93  ? 29.533 67.843 34.409  1.00 47.74 ? 99  GLN B CG  1 
ATOM   3260 C CD  . GLN B 1 93  ? 30.377 68.780 35.271  1.00 50.67 ? 99  GLN B CD  1 
ATOM   3261 O OE1 . GLN B 1 93  ? 29.854 69.502 36.125  1.00 52.77 ? 99  GLN B OE1 1 
ATOM   3262 N NE2 . GLN B 1 93  ? 31.689 68.761 35.057  1.00 50.70 ? 99  GLN B NE2 1 
ATOM   3263 N N   . ILE B 1 94  ? 28.871 63.853 36.630  1.00 40.33 ? 100 ILE B N   1 
ATOM   3264 C CA  . ILE B 1 94  ? 28.191 62.890 37.484  1.00 40.04 ? 100 ILE B CA  1 
ATOM   3265 C C   . ILE B 1 94  ? 29.136 62.334 38.544  1.00 39.92 ? 100 ILE B C   1 
ATOM   3266 O O   . ILE B 1 94  ? 28.774 62.236 39.715  1.00 40.28 ? 100 ILE B O   1 
ATOM   3267 C CB  . ILE B 1 94  ? 27.603 61.725 36.653  1.00 39.64 ? 100 ILE B CB  1 
ATOM   3268 C CG1 . ILE B 1 94  ? 26.329 62.200 35.943  1.00 40.68 ? 100 ILE B CG1 1 
ATOM   3269 C CG2 . ILE B 1 94  ? 27.325 60.520 37.546  1.00 39.33 ? 100 ILE B CG2 1 
ATOM   3270 C CD1 . ILE B 1 94  ? 25.636 61.142 35.108  1.00 39.47 ? 100 ILE B CD1 1 
ATOM   3271 N N   . MET B 1 95  ? 30.348 61.986 38.126  1.00 39.20 ? 101 MET B N   1 
ATOM   3272 C CA  . MET B 1 95  ? 31.358 61.440 39.025  1.00 41.16 ? 101 MET B CA  1 
ATOM   3273 C C   . MET B 1 95  ? 31.723 62.406 40.149  1.00 41.33 ? 101 MET B C   1 
ATOM   3274 O O   . MET B 1 95  ? 32.035 61.989 41.264  1.00 39.67 ? 101 MET B O   1 
ATOM   3275 C CB  . MET B 1 95  ? 32.623 61.101 38.241  1.00 42.78 ? 101 MET B CB  1 
ATOM   3276 C CG  . MET B 1 95  ? 32.426 60.046 37.170  1.00 46.09 ? 101 MET B CG  1 
ATOM   3277 S SD  . MET B 1 95  ? 33.182 58.496 37.611  1.00 50.47 ? 101 MET B SD  1 
ATOM   3278 C CE  . MET B 1 95  ? 31.953 57.862 38.699  1.00 46.95 ? 101 MET B CE  1 
ATOM   3279 N N   . ARG B 1 96  ? 31.694 63.698 39.843  1.00 41.47 ? 102 ARG B N   1 
ATOM   3280 C CA  . ARG B 1 96  ? 32.033 64.721 40.822  1.00 43.53 ? 102 ARG B CA  1 
ATOM   3281 C C   . ARG B 1 96  ? 31.000 64.836 41.933  1.00 43.09 ? 102 ARG B C   1 
ATOM   3282 O O   . ARG B 1 96  ? 31.282 65.398 42.987  1.00 44.48 ? 102 ARG B O   1 
ATOM   3283 C CB  . ARG B 1 96  ? 32.196 66.075 40.131  1.00 44.26 ? 102 ARG B CB  1 
ATOM   3284 C CG  . ARG B 1 96  ? 33.299 66.095 39.093  1.00 47.20 ? 102 ARG B CG  1 
ATOM   3285 C CD  . ARG B 1 96  ? 33.497 67.487 38.546  1.00 49.77 ? 102 ARG B CD  1 
ATOM   3286 N NE  . ARG B 1 96  ? 33.974 68.388 39.588  1.00 52.99 ? 102 ARG B NE  1 
ATOM   3287 C CZ  . ARG B 1 96  ? 34.148 69.694 39.428  1.00 54.09 ? 102 ARG B CZ  1 
ATOM   3288 N NH1 . ARG B 1 96  ? 33.879 70.264 38.260  1.00 54.72 ? 102 ARG B NH1 1 
ATOM   3289 N NH2 . ARG B 1 96  ? 34.599 70.428 40.435  1.00 55.28 ? 102 ARG B NH2 1 
ATOM   3290 N N   . LYS B 1 97  ? 29.810 64.297 41.697  1.00 42.59 ? 103 LYS B N   1 
ATOM   3291 C CA  . LYS B 1 97  ? 28.736 64.352 42.681  1.00 43.19 ? 103 LYS B CA  1 
ATOM   3292 C C   . LYS B 1 97  ? 28.654 63.110 43.568  1.00 42.07 ? 103 LYS B C   1 
ATOM   3293 O O   . LYS B 1 97  ? 27.994 63.129 44.602  1.00 42.37 ? 103 LYS B O   1 
ATOM   3294 C CB  . LYS B 1 97  ? 27.388 64.537 41.973  1.00 44.51 ? 103 LYS B CB  1 
ATOM   3295 C CG  . LYS B 1 97  ? 27.303 65.781 41.103  1.00 48.06 ? 103 LYS B CG  1 
ATOM   3296 C CD  . LYS B 1 97  ? 25.903 65.973 40.517  1.00 50.51 ? 103 LYS B CD  1 
ATOM   3297 C CE  . LYS B 1 97  ? 25.817 67.287 39.738  1.00 51.71 ? 103 LYS B CE  1 
ATOM   3298 N NZ  . LYS B 1 97  ? 24.449 67.567 39.223  1.00 52.05 ? 103 LYS B NZ  1 
ATOM   3299 N N   . LEU B 1 98  ? 29.328 62.037 43.174  1.00 40.70 ? 104 LEU B N   1 
ATOM   3300 C CA  . LEU B 1 98  ? 29.266 60.791 43.928  1.00 39.10 ? 104 LEU B CA  1 
ATOM   3301 C C   . LEU B 1 98  ? 30.352 60.590 44.981  1.00 38.57 ? 104 LEU B C   1 
ATOM   3302 O O   . LEU B 1 98  ? 31.512 60.960 44.792  1.00 38.03 ? 104 LEU B O   1 
ATOM   3303 C CB  . LEU B 1 98  ? 29.274 59.606 42.960  1.00 38.88 ? 104 LEU B CB  1 
ATOM   3304 C CG  . LEU B 1 98  ? 28.287 59.677 41.787  1.00 38.87 ? 104 LEU B CG  1 
ATOM   3305 C CD1 . LEU B 1 98  ? 28.466 58.453 40.901  1.00 37.70 ? 104 LEU B CD1 1 
ATOM   3306 C CD2 . LEU B 1 98  ? 26.857 59.767 42.301  1.00 38.18 ? 104 LEU B CD2 1 
ATOM   3307 N N   . ASP B 1 99  ? 29.947 59.983 46.090  1.00 37.63 ? 105 ASP B N   1 
ATOM   3308 C CA  . ASP B 1 99  ? 30.830 59.685 47.210  1.00 37.25 ? 105 ASP B CA  1 
ATOM   3309 C C   . ASP B 1 99  ? 30.175 58.502 47.916  1.00 35.77 ? 105 ASP B C   1 
ATOM   3310 O O   . ASP B 1 99  ? 29.255 58.681 48.709  1.00 35.74 ? 105 ASP B O   1 
ATOM   3311 C CB  . ASP B 1 99  ? 30.909 60.885 48.163  1.00 38.63 ? 105 ASP B CB  1 
ATOM   3312 C CG  . ASP B 1 99  ? 31.889 60.667 49.304  1.00 41.59 ? 105 ASP B CG  1 
ATOM   3313 O OD1 . ASP B 1 99  ? 31.778 61.383 50.325  1.00 43.64 ? 105 ASP B OD1 1 
ATOM   3314 O OD2 . ASP B 1 99  ? 32.774 59.792 49.184  1.00 41.21 ? 105 ASP B OD2 1 
ATOM   3315 N N   . HIS B 1 100 ? 30.638 57.293 47.618  1.00 34.11 ? 106 HIS B N   1 
ATOM   3316 C CA  . HIS B 1 100 ? 30.053 56.100 48.216  1.00 31.50 ? 106 HIS B CA  1 
ATOM   3317 C C   . HIS B 1 100 ? 31.063 54.957 48.203  1.00 32.31 ? 106 HIS B C   1 
ATOM   3318 O O   . HIS B 1 100 ? 31.815 54.795 47.239  1.00 31.91 ? 106 HIS B O   1 
ATOM   3319 C CB  . HIS B 1 100 ? 28.792 55.720 47.437  1.00 30.98 ? 106 HIS B CB  1 
ATOM   3320 C CG  . HIS B 1 100 ? 27.982 54.638 48.075  1.00 28.09 ? 106 HIS B CG  1 
ATOM   3321 N ND1 . HIS B 1 100 ? 28.326 53.306 47.999  1.00 28.11 ? 106 HIS B ND1 1 
ATOM   3322 C CD2 . HIS B 1 100 ? 26.837 54.690 48.795  1.00 28.27 ? 106 HIS B CD2 1 
ATOM   3323 C CE1 . HIS B 1 100 ? 27.425 52.585 48.641  1.00 28.51 ? 106 HIS B CE1 1 
ATOM   3324 N NE2 . HIS B 1 100 ? 26.510 53.401 49.134  1.00 28.50 ? 106 HIS B NE2 1 
ATOM   3325 N N   . CYS B 1 101 ? 31.065 54.167 49.275  1.00 31.27 ? 107 CYS B N   1 
ATOM   3326 C CA  . CYS B 1 101 ? 31.994 53.053 49.431  1.00 31.20 ? 107 CYS B CA  1 
ATOM   3327 C C   . CYS B 1 101 ? 31.920 51.998 48.329  1.00 29.79 ? 107 CYS B C   1 
ATOM   3328 O O   . CYS B 1 101 ? 32.881 51.265 48.115  1.00 29.32 ? 107 CYS B O   1 
ATOM   3329 C CB  . CYS B 1 101 ? 31.778 52.385 50.796  1.00 33.03 ? 107 CYS B CB  1 
ATOM   3330 S SG  . CYS B 1 101 ? 30.065 51.829 51.133  1.00 42.68 ? 107 CYS B SG  1 
ATOM   3331 N N   . ASN B 1 102 ? 30.787 51.917 47.634  1.00 27.78 ? 108 ASN B N   1 
ATOM   3332 C CA  . ASN B 1 102 ? 30.628 50.925 46.575  1.00 26.54 ? 108 ASN B CA  1 
ATOM   3333 C C   . ASN B 1 102 ? 30.593 51.513 45.170  1.00 27.03 ? 108 ASN B C   1 
ATOM   3334 O O   . ASN B 1 102 ? 30.009 50.939 44.246  1.00 26.84 ? 108 ASN B O   1 
ATOM   3335 C CB  . ASN B 1 102 ? 29.382 50.079 46.840  1.00 25.64 ? 108 ASN B CB  1 
ATOM   3336 C CG  . ASN B 1 102 ? 29.474 49.318 48.155  1.00 26.63 ? 108 ASN B CG  1 
ATOM   3337 O OD1 . ASN B 1 102 ? 28.629 49.472 49.039  1.00 26.78 ? 108 ASN B OD1 1 
ATOM   3338 N ND2 . ASN B 1 102 ? 30.514 48.497 48.290  1.00 23.45 ? 108 ASN B ND2 1 
ATOM   3339 N N   . ILE B 1 103 ? 31.237 52.661 45.019  1.00 26.79 ? 109 ILE B N   1 
ATOM   3340 C CA  . ILE B 1 103 ? 31.345 53.329 43.735  1.00 28.58 ? 109 ILE B CA  1 
ATOM   3341 C C   . ILE B 1 103 ? 32.786 53.813 43.650  1.00 30.05 ? 109 ILE B C   1 
ATOM   3342 O O   . ILE B 1 103 ? 33.304 54.408 44.599  1.00 29.87 ? 109 ILE B O   1 
ATOM   3343 C CB  . ILE B 1 103 ? 30.384 54.535 43.628  1.00 27.97 ? 109 ILE B CB  1 
ATOM   3344 C CG1 . ILE B 1 103 ? 28.933 54.047 43.696  1.00 27.87 ? 109 ILE B CG1 1 
ATOM   3345 C CG2 . ILE B 1 103 ? 30.644 55.299 42.326  1.00 28.91 ? 109 ILE B CG2 1 
ATOM   3346 C CD1 . ILE B 1 103 ? 27.906 55.130 43.469  1.00 29.85 ? 109 ILE B CD1 1 
ATOM   3347 N N   . VAL B 1 104 ? 33.438 53.541 42.525  1.00 28.93 ? 110 VAL B N   1 
ATOM   3348 C CA  . VAL B 1 104 ? 34.818 53.950 42.340  1.00 31.26 ? 110 VAL B CA  1 
ATOM   3349 C C   . VAL B 1 104 ? 34.911 55.468 42.505  1.00 30.96 ? 110 VAL B C   1 
ATOM   3350 O O   . VAL B 1 104 ? 34.100 56.212 41.953  1.00 29.84 ? 110 VAL B O   1 
ATOM   3351 C CB  . VAL B 1 104 ? 35.337 53.507 40.944  1.00 31.26 ? 110 VAL B CB  1 
ATOM   3352 C CG1 . VAL B 1 104 ? 34.702 54.346 39.843  1.00 32.59 ? 110 VAL B CG1 1 
ATOM   3353 C CG2 . VAL B 1 104 ? 36.840 53.596 40.910  1.00 34.42 ? 110 VAL B CG2 1 
ATOM   3354 N N   . ARG B 1 105 ? 35.893 55.931 43.270  1.00 31.42 ? 111 ARG B N   1 
ATOM   3355 C CA  . ARG B 1 105 ? 36.022 57.363 43.504  1.00 32.99 ? 111 ARG B CA  1 
ATOM   3356 C C   . ARG B 1 105 ? 36.871 58.099 42.485  1.00 32.29 ? 111 ARG B C   1 
ATOM   3357 O O   . ARG B 1 105 ? 37.890 57.595 42.024  1.00 32.16 ? 111 ARG B O   1 
ATOM   3358 C CB  . ARG B 1 105 ? 36.586 57.645 44.906  1.00 36.23 ? 111 ARG B CB  1 
ATOM   3359 C CG  . ARG B 1 105 ? 36.481 59.117 45.295  1.00 41.18 ? 111 ARG B CG  1 
ATOM   3360 C CD  . ARG B 1 105 ? 36.814 59.393 46.757  1.00 44.55 ? 111 ARG B CD  1 
ATOM   3361 N NE  . ARG B 1 105 ? 38.214 59.754 46.961  1.00 48.61 ? 111 ARG B NE  1 
ATOM   3362 C CZ  . ARG B 1 105 ? 39.219 58.887 46.970  1.00 51.25 ? 111 ARG B CZ  1 
ATOM   3363 N NH1 . ARG B 1 105 ? 38.985 57.593 46.788  1.00 52.15 ? 111 ARG B NH1 1 
ATOM   3364 N NH2 . ARG B 1 105 ? 40.461 59.314 47.165  1.00 51.62 ? 111 ARG B NH2 1 
ATOM   3365 N N   . LEU B 1 106 ? 36.420 59.296 42.131  1.00 32.72 ? 112 LEU B N   1 
ATOM   3366 C CA  . LEU B 1 106 ? 37.148 60.150 41.205  1.00 34.27 ? 112 LEU B CA  1 
ATOM   3367 C C   . LEU B 1 106 ? 38.086 60.959 42.095  1.00 35.22 ? 112 LEU B C   1 
ATOM   3368 O O   . LEU B 1 106 ? 37.645 61.846 42.827  1.00 35.65 ? 112 LEU B O   1 
ATOM   3369 C CB  . LEU B 1 106 ? 36.189 61.093 40.475  1.00 33.80 ? 112 LEU B CB  1 
ATOM   3370 C CG  . LEU B 1 106 ? 36.820 62.204 39.632  1.00 33.82 ? 112 LEU B CG  1 
ATOM   3371 C CD1 . LEU B 1 106 ? 37.513 61.627 38.415  1.00 34.88 ? 112 LEU B CD1 1 
ATOM   3372 C CD2 . LEU B 1 106 ? 35.736 63.179 39.214  1.00 35.10 ? 112 LEU B CD2 1 
ATOM   3373 N N   . ARG B 1 107 ? 39.369 60.631 42.057  1.00 35.94 ? 113 ARG B N   1 
ATOM   3374 C CA  . ARG B 1 107 ? 40.347 61.336 42.874  1.00 38.94 ? 113 ARG B CA  1 
ATOM   3375 C C   . ARG B 1 107 ? 40.641 62.708 42.293  1.00 39.49 ? 113 ARG B C   1 
ATOM   3376 O O   . ARG B 1 107 ? 40.533 63.722 42.985  1.00 39.15 ? 113 ARG B O   1 
ATOM   3377 C CB  . ARG B 1 107 ? 41.624 60.517 42.970  1.00 39.49 ? 113 ARG B CB  1 
ATOM   3378 C CG  . ARG B 1 107 ? 41.371 59.138 43.515  1.00 41.92 ? 113 ARG B CG  1 
ATOM   3379 C CD  . ARG B 1 107 ? 42.655 58.425 43.803  1.00 44.74 ? 113 ARG B CD  1 
ATOM   3380 N NE  . ARG B 1 107 ? 42.402 57.229 44.593  1.00 47.32 ? 113 ARG B NE  1 
ATOM   3381 C CZ  . ARG B 1 107 ? 43.323 56.622 45.330  1.00 48.68 ? 113 ARG B CZ  1 
ATOM   3382 N NH1 . ARG B 1 107 ? 44.559 57.105 45.373  1.00 48.46 ? 113 ARG B NH1 1 
ATOM   3383 N NH2 . ARG B 1 107 ? 43.005 55.538 46.023  1.00 48.65 ? 113 ARG B NH2 1 
ATOM   3384 N N   . TYR B 1 108 ? 41.016 62.732 41.020  1.00 39.35 ? 114 TYR B N   1 
ATOM   3385 C CA  . TYR B 1 108 ? 41.300 63.977 40.327  1.00 40.14 ? 114 TYR B CA  1 
ATOM   3386 C C   . TYR B 1 108 ? 40.894 63.820 38.872  1.00 40.42 ? 114 TYR B C   1 
ATOM   3387 O O   . TYR B 1 108 ? 40.519 62.736 38.433  1.00 39.23 ? 114 TYR B O   1 
ATOM   3388 C CB  . TYR B 1 108 ? 42.792 64.321 40.343  1.00 41.11 ? 114 TYR B CB  1 
ATOM   3389 C CG  . TYR B 1 108 ? 43.546 64.034 41.615  1.00 43.55 ? 114 TYR B CG  1 
ATOM   3390 C CD1 . TYR B 1 108 ? 44.125 62.786 41.838  1.00 44.04 ? 114 TYR B CD1 1 
ATOM   3391 C CD2 . TYR B 1 108 ? 43.746 65.030 42.566  1.00 44.52 ? 114 TYR B CD2 1 
ATOM   3392 C CE1 . TYR B 1 108 ? 44.892 62.540 42.970  1.00 44.94 ? 114 TYR B CE1 1 
ATOM   3393 C CE2 . TYR B 1 108 ? 44.510 64.794 43.705  1.00 45.51 ? 114 TYR B CE2 1 
ATOM   3394 C CZ  . TYR B 1 108 ? 45.081 63.549 43.898  1.00 45.74 ? 114 TYR B CZ  1 
ATOM   3395 O OH  . TYR B 1 108 ? 45.844 63.315 45.018  1.00 48.11 ? 114 TYR B OH  1 
ATOM   3396 N N   . PHE B 1 109 ? 40.982 64.919 38.135  1.00 40.98 ? 115 PHE B N   1 
ATOM   3397 C CA  . PHE B 1 109 ? 40.681 64.936 36.712  1.00 41.86 ? 115 PHE B CA  1 
ATOM   3398 C C   . PHE B 1 109 ? 41.467 66.097 36.129  1.00 43.09 ? 115 PHE B C   1 
ATOM   3399 O O   . PHE B 1 109 ? 41.607 67.144 36.763  1.00 43.70 ? 115 PHE B O   1 
ATOM   3400 C CB  . PHE B 1 109 ? 39.178 65.101 36.461  1.00 41.03 ? 115 PHE B CB  1 
ATOM   3401 C CG  . PHE B 1 109 ? 38.641 66.469 36.775  1.00 42.24 ? 115 PHE B CG  1 
ATOM   3402 C CD1 . PHE B 1 109 ? 38.761 67.509 35.856  1.00 43.16 ? 115 PHE B CD1 1 
ATOM   3403 C CD2 . PHE B 1 109 ? 37.983 66.710 37.977  1.00 42.19 ? 115 PHE B CD2 1 
ATOM   3404 C CE1 . PHE B 1 109 ? 38.229 68.769 36.127  1.00 43.32 ? 115 PHE B CE1 1 
ATOM   3405 C CE2 . PHE B 1 109 ? 37.448 67.965 38.259  1.00 42.98 ? 115 PHE B CE2 1 
ATOM   3406 C CZ  . PHE B 1 109 ? 37.569 68.997 37.333  1.00 42.91 ? 115 PHE B CZ  1 
ATOM   3407 N N   . PHE B 1 110 ? 42.002 65.901 34.934  1.00 43.52 ? 116 PHE B N   1 
ATOM   3408 C CA  . PHE B 1 110 ? 42.788 66.937 34.292  1.00 45.07 ? 116 PHE B CA  1 
ATOM   3409 C C   . PHE B 1 110 ? 42.722 66.781 32.785  1.00 46.43 ? 116 PHE B C   1 
ATOM   3410 O O   . PHE B 1 110 ? 42.268 65.754 32.277  1.00 45.55 ? 116 PHE B O   1 
ATOM   3411 C CB  . PHE B 1 110 ? 44.241 66.854 34.767  1.00 44.24 ? 116 PHE B CB  1 
ATOM   3412 C CG  . PHE B 1 110 ? 44.928 65.566 34.406  1.00 44.70 ? 116 PHE B CG  1 
ATOM   3413 C CD1 . PHE B 1 110 ? 45.581 65.428 33.187  1.00 45.05 ? 116 PHE B CD1 1 
ATOM   3414 C CD2 . PHE B 1 110 ? 44.910 64.484 35.279  1.00 44.54 ? 116 PHE B CD2 1 
ATOM   3415 C CE1 . PHE B 1 110 ? 46.207 64.230 32.841  1.00 44.73 ? 116 PHE B CE1 1 
ATOM   3416 C CE2 . PHE B 1 110 ? 45.531 63.283 34.944  1.00 45.43 ? 116 PHE B CE2 1 
ATOM   3417 C CZ  . PHE B 1 110 ? 46.181 63.157 33.721  1.00 44.82 ? 116 PHE B CZ  1 
ATOM   3418 N N   . TYR B 1 111 ? 43.175 67.802 32.070  1.00 48.06 ? 117 TYR B N   1 
ATOM   3419 C CA  . TYR B 1 111 ? 43.158 67.755 30.621  1.00 49.64 ? 117 TYR B CA  1 
ATOM   3420 C C   . TYR B 1 111 ? 44.559 67.682 30.051  1.00 51.10 ? 117 TYR B C   1 
ATOM   3421 O O   . TYR B 1 111 ? 45.537 68.019 30.720  1.00 51.50 ? 117 TYR B O   1 
ATOM   3422 C CB  . TYR B 1 111 ? 42.421 68.967 30.059  1.00 48.58 ? 117 TYR B CB  1 
ATOM   3423 C CG  . TYR B 1 111 ? 40.974 69.024 30.476  1.00 49.11 ? 117 TYR B CG  1 
ATOM   3424 C CD1 . TYR B 1 111 ? 40.605 69.526 31.723  1.00 49.22 ? 117 TYR B CD1 1 
ATOM   3425 C CD2 . TYR B 1 111 ? 39.969 68.557 29.630  1.00 49.23 ? 117 TYR B CD2 1 
ATOM   3426 C CE1 . TYR B 1 111 ? 39.270 69.565 32.116  1.00 48.90 ? 117 TYR B CE1 1 
ATOM   3427 C CE2 . TYR B 1 111 ? 38.633 68.590 30.014  1.00 48.62 ? 117 TYR B CE2 1 
ATOM   3428 C CZ  . TYR B 1 111 ? 38.292 69.097 31.257  1.00 48.84 ? 117 TYR B CZ  1 
ATOM   3429 O OH  . TYR B 1 111 ? 36.969 69.148 31.632  1.00 48.62 ? 117 TYR B OH  1 
ATOM   3430 N N   . SER B 1 112 ? 44.647 67.221 28.810  1.00 52.99 ? 118 SER B N   1 
ATOM   3431 C CA  . SER B 1 112 ? 45.923 67.089 28.126  1.00 55.03 ? 118 SER B CA  1 
ATOM   3432 C C   . SER B 1 112 ? 45.667 66.630 26.696  1.00 56.76 ? 118 SER B C   1 
ATOM   3433 O O   . SER B 1 112 ? 44.609 66.894 26.126  1.00 56.67 ? 118 SER B O   1 
ATOM   3434 C CB  . SER B 1 112 ? 46.799 66.060 28.841  1.00 54.65 ? 118 SER B CB  1 
ATOM   3435 O OG  . SER B 1 112 ? 46.278 64.754 28.664  1.00 54.47 ? 118 SER B OG  1 
ATOM   3436 N N   . SER B 1 113 ? 46.652 65.939 26.135  1.00 59.01 ? 119 SER B N   1 
ATOM   3437 C CA  . SER B 1 113 ? 46.583 65.404 24.781  1.00 61.02 ? 119 SER B CA  1 
ATOM   3438 C C   . SER B 1 113 ? 47.076 63.963 24.820  1.00 62.19 ? 119 SER B C   1 
ATOM   3439 O O   . SER B 1 113 ? 47.421 63.457 25.891  1.00 61.61 ? 119 SER B O   1 
ATOM   3440 C CB  . SER B 1 113 ? 47.465 66.234 23.841  1.00 60.94 ? 119 SER B CB  1 
ATOM   3441 O OG  . SER B 1 113 ? 48.791 66.295 24.330  1.00 61.19 ? 119 SER B OG  1 
ATOM   3442 N N   . GLY B 1 114 ? 47.118 63.306 23.663  1.00 63.78 ? 120 GLY B N   1 
ATOM   3443 C CA  . GLY B 1 114 ? 47.585 61.932 23.634  1.00 65.99 ? 120 GLY B CA  1 
ATOM   3444 C C   . GLY B 1 114 ? 47.655 61.272 22.267  1.00 67.47 ? 120 GLY B C   1 
ATOM   3445 O O   . GLY B 1 114 ? 48.332 60.252 22.111  1.00 67.71 ? 120 GLY B O   1 
ATOM   3446 N N   . GLU B 1 115 ? 46.972 61.833 21.273  1.00 68.46 ? 121 GLU B N   1 
ATOM   3447 C CA  . GLU B 1 115 ? 46.997 61.238 19.943  1.00 70.09 ? 121 GLU B CA  1 
ATOM   3448 C C   . GLU B 1 115 ? 47.361 62.152 18.777  1.00 70.68 ? 121 GLU B C   1 
ATOM   3449 O O   . GLU B 1 115 ? 48.209 61.780 17.962  1.00 71.33 ? 121 GLU B O   1 
ATOM   3450 C CB  . GLU B 1 115 ? 45.666 60.544 19.639  1.00 70.48 ? 121 GLU B CB  1 
ATOM   3451 C CG  . GLU B 1 115 ? 45.511 59.165 20.278  1.00 71.95 ? 121 GLU B CG  1 
ATOM   3452 C CD  . GLU B 1 115 ? 46.694 58.253 19.996  1.00 72.69 ? 121 GLU B CD  1 
ATOM   3453 O OE1 . GLU B 1 115 ? 47.286 58.370 18.901  1.00 73.23 ? 121 GLU B OE1 1 
ATOM   3454 O OE2 . GLU B 1 115 ? 47.025 57.412 20.862  1.00 73.23 ? 121 GLU B OE2 1 
ATOM   3455 N N   . LYS B 1 116 ? 46.745 63.331 18.668  1.00 70.85 ? 122 LYS B N   1 
ATOM   3456 C CA  . LYS B 1 116 ? 47.088 64.189 17.536  1.00 70.83 ? 122 LYS B CA  1 
ATOM   3457 C C   . LYS B 1 116 ? 46.847 65.701 17.594  1.00 70.61 ? 122 LYS B C   1 
ATOM   3458 O O   . LYS B 1 116 ? 45.709 66.172 17.628  1.00 70.23 ? 122 LYS B O   1 
ATOM   3459 C CB  . LYS B 1 116 ? 46.435 63.634 16.265  1.00 70.93 ? 122 LYS B CB  1 
ATOM   3460 C CG  . LYS B 1 116 ? 46.879 64.346 14.995  1.00 72.04 ? 122 LYS B CG  1 
ATOM   3461 C CD  . LYS B 1 116 ? 48.406 64.396 14.900  1.00 71.69 ? 122 LYS B CD  1 
ATOM   3462 C CE  . LYS B 1 116 ? 48.877 65.240 13.720  1.00 71.30 ? 122 LYS B CE  1 
ATOM   3463 N NZ  . LYS B 1 116 ? 50.350 65.475 13.763  1.00 71.65 ? 122 LYS B NZ  1 
ATOM   3464 N N   . LYS B 1 117 ? 47.957 66.437 17.564  1.00 70.66 ? 123 LYS B N   1 
ATOM   3465 C CA  . LYS B 1 117 ? 48.004 67.902 17.568  1.00 70.40 ? 123 LYS B CA  1 
ATOM   3466 C C   . LYS B 1 117 ? 46.692 68.677 17.456  1.00 70.26 ? 123 LYS B C   1 
ATOM   3467 O O   . LYS B 1 117 ? 46.378 69.197 16.384  1.00 70.63 ? 123 LYS B O   1 
ATOM   3468 C CB  . LYS B 1 117 ? 48.929 68.375 16.438  1.00 70.51 ? 123 LYS B CB  1 
ATOM   3469 C CG  . LYS B 1 117 ? 50.409 68.433 16.780  1.00 70.63 ? 123 LYS B CG  1 
ATOM   3470 C CD  . LYS B 1 117 ? 50.697 69.592 17.725  1.00 70.26 ? 123 LYS B CD  1 
ATOM   3471 C CE  . LYS B 1 117 ? 52.191 69.773 17.949  1.00 70.63 ? 123 LYS B CE  1 
ATOM   3472 N NZ  . LYS B 1 117 ? 52.478 70.886 18.899  1.00 70.94 ? 123 LYS B NZ  1 
ATOM   3473 N N   . ASP B 1 118 ? 45.949 68.770 18.559  1.00 69.82 ? 124 ASP B N   1 
ATOM   3474 C CA  . ASP B 1 118 ? 44.674 69.501 18.613  1.00 68.97 ? 124 ASP B CA  1 
ATOM   3475 C C   . ASP B 1 118 ? 43.763 68.871 19.661  1.00 68.08 ? 124 ASP B C   1 
ATOM   3476 O O   . ASP B 1 118 ? 43.696 69.338 20.799  1.00 68.79 ? 124 ASP B O   1 
ATOM   3477 C CB  . ASP B 1 118 ? 43.963 69.492 17.247  1.00 69.15 ? 124 ASP B CB  1 
ATOM   3478 C CG  . ASP B 1 118 ? 42.815 70.495 17.172  1.00 70.24 ? 124 ASP B CG  1 
ATOM   3479 O OD1 . ASP B 1 118 ? 43.052 71.697 17.429  1.00 70.16 ? 124 ASP B OD1 1 
ATOM   3480 O OD2 . ASP B 1 118 ? 41.678 70.084 16.849  1.00 70.23 ? 124 ASP B OD2 1 
ATOM   3481 N N   . GLU B 1 119 ? 43.069 67.808 19.266  1.00 66.53 ? 125 GLU B N   1 
ATOM   3482 C CA  . GLU B 1 119 ? 42.157 67.088 20.149  1.00 64.75 ? 125 GLU B CA  1 
ATOM   3483 C C   . GLU B 1 119 ? 42.612 67.099 21.611  1.00 62.66 ? 125 GLU B C   1 
ATOM   3484 O O   . GLU B 1 119 ? 43.746 66.732 21.928  1.00 62.08 ? 125 GLU B O   1 
ATOM   3485 C CB  . GLU B 1 119 ? 42.014 65.646 19.662  1.00 66.05 ? 125 GLU B CB  1 
ATOM   3486 C CG  . GLU B 1 119 ? 43.347 64.941 19.457  1.00 67.86 ? 125 GLU B CG  1 
ATOM   3487 C CD  . GLU B 1 119 ? 43.191 63.562 18.849  1.00 69.62 ? 125 GLU B CD  1 
ATOM   3488 O OE1 . GLU B 1 119 ? 42.650 63.459 17.727  1.00 70.28 ? 125 GLU B OE1 1 
ATOM   3489 O OE2 . GLU B 1 119 ? 43.610 62.579 19.493  1.00 71.16 ? 125 GLU B OE2 1 
ATOM   3490 N N   . VAL B 1 120 ? 41.717 67.531 22.493  1.00 60.09 ? 126 VAL B N   1 
ATOM   3491 C CA  . VAL B 1 120 ? 42.009 67.589 23.921  1.00 57.68 ? 126 VAL B CA  1 
ATOM   3492 C C   . VAL B 1 120 ? 41.447 66.344 24.601  1.00 55.97 ? 126 VAL B C   1 
ATOM   3493 O O   . VAL B 1 120 ? 40.391 65.845 24.218  1.00 55.47 ? 126 VAL B O   1 
ATOM   3494 C CB  . VAL B 1 120 ? 41.375 68.840 24.567  1.00 57.77 ? 126 VAL B CB  1 
ATOM   3495 C CG1 . VAL B 1 120 ? 41.735 68.906 26.045  1.00 57.38 ? 126 VAL B CG1 1 
ATOM   3496 C CG2 . VAL B 1 120 ? 41.848 70.088 23.842  1.00 57.23 ? 126 VAL B CG2 1 
ATOM   3497 N N   . TYR B 1 121 ? 42.156 65.844 25.607  1.00 54.02 ? 127 TYR B N   1 
ATOM   3498 C CA  . TYR B 1 121 ? 41.721 64.652 26.326  1.00 52.33 ? 127 TYR B CA  1 
ATOM   3499 C C   . TYR B 1 121 ? 41.365 64.915 27.783  1.00 50.41 ? 127 TYR B C   1 
ATOM   3500 O O   . TYR B 1 121 ? 42.071 65.640 28.483  1.00 50.39 ? 127 TYR B O   1 
ATOM   3501 C CB  . TYR B 1 121 ? 42.817 63.585 26.279  1.00 53.64 ? 127 TYR B CB  1 
ATOM   3502 C CG  . TYR B 1 121 ? 42.922 62.848 24.963  1.00 55.46 ? 127 TYR B CG  1 
ATOM   3503 C CD1 . TYR B 1 121 ? 41.990 61.873 24.614  1.00 55.67 ? 127 TYR B CD1 1 
ATOM   3504 C CD2 . TYR B 1 121 ? 43.956 63.125 24.065  1.00 56.13 ? 127 TYR B CD2 1 
ATOM   3505 C CE1 . TYR B 1 121 ? 42.084 61.188 23.404  1.00 56.96 ? 127 TYR B CE1 1 
ATOM   3506 C CE2 . TYR B 1 121 ? 44.058 62.447 22.850  1.00 56.93 ? 127 TYR B CE2 1 
ATOM   3507 C CZ  . TYR B 1 121 ? 43.119 61.480 22.528  1.00 57.47 ? 127 TYR B CZ  1 
ATOM   3508 O OH  . TYR B 1 121 ? 43.208 60.807 21.331  1.00 58.94 ? 127 TYR B OH  1 
ATOM   3509 N N   . LEU B 1 122 ? 40.261 64.323 28.231  1.00 48.20 ? 128 LEU B N   1 
ATOM   3510 C CA  . LEU B 1 122 ? 39.839 64.439 29.622  1.00 45.44 ? 128 LEU B CA  1 
ATOM   3511 C C   . LEU B 1 122 ? 40.384 63.193 30.308  1.00 44.35 ? 128 LEU B C   1 
ATOM   3512 O O   . LEU B 1 122 ? 40.196 62.077 29.820  1.00 43.72 ? 128 LEU B O   1 
ATOM   3513 C CB  . LEU B 1 122 ? 38.312 64.464 29.739  1.00 44.63 ? 128 LEU B CB  1 
ATOM   3514 C CG  . LEU B 1 122 ? 37.750 64.249 31.155  1.00 44.01 ? 128 LEU B CG  1 
ATOM   3515 C CD1 . LEU B 1 122 ? 38.171 65.384 32.078  1.00 43.64 ? 128 LEU B CD1 1 
ATOM   3516 C CD2 . LEU B 1 122 ? 36.238 64.157 31.090  1.00 43.10 ? 128 LEU B CD2 1 
ATOM   3517 N N   . ASN B 1 123 ? 41.075 63.385 31.427  1.00 42.45 ? 129 ASN B N   1 
ATOM   3518 C CA  . ASN B 1 123 ? 41.658 62.279 32.176  1.00 40.33 ? 129 ASN B CA  1 
ATOM   3519 C C   . ASN B 1 123 ? 41.014 62.180 33.551  1.00 40.03 ? 129 ASN B C   1 
ATOM   3520 O O   . ASN B 1 123 ? 41.098 63.110 34.354  1.00 39.28 ? 129 ASN B O   1 
ATOM   3521 C CB  . ASN B 1 123 ? 43.162 62.491 32.346  1.00 41.02 ? 129 ASN B CB  1 
ATOM   3522 C CG  . ASN B 1 123 ? 43.913 62.429 31.034  1.00 42.60 ? 129 ASN B CG  1 
ATOM   3523 O OD1 . ASN B 1 123 ? 44.425 61.377 30.651  1.00 43.17 ? 129 ASN B OD1 1 
ATOM   3524 N ND2 . ASN B 1 123 ? 43.975 63.556 30.330  1.00 41.76 ? 129 ASN B ND2 1 
ATOM   3525 N N   . LEU B 1 124 ? 40.366 61.055 33.819  1.00 38.04 ? 130 LEU B N   1 
ATOM   3526 C CA  . LEU B 1 124 ? 39.732 60.850 35.110  1.00 36.77 ? 130 LEU B CA  1 
ATOM   3527 C C   . LEU B 1 124 ? 40.612 59.910 35.913  1.00 35.99 ? 130 LEU B C   1 
ATOM   3528 O O   . LEU B 1 124 ? 40.830 58.772 35.510  1.00 35.35 ? 130 LEU B O   1 
ATOM   3529 C CB  . LEU B 1 124 ? 38.344 60.229 34.935  1.00 36.76 ? 130 LEU B CB  1 
ATOM   3530 C CG  . LEU B 1 124 ? 37.347 60.940 34.016  1.00 37.16 ? 130 LEU B CG  1 
ATOM   3531 C CD1 . LEU B 1 124 ? 36.060 60.135 33.984  1.00 38.81 ? 130 LEU B CD1 1 
ATOM   3532 C CD2 . LEU B 1 124 ? 37.076 62.352 34.501  1.00 36.82 ? 130 LEU B CD2 1 
ATOM   3533 N N   . VAL B 1 125 ? 41.145 60.394 37.032  1.00 35.19 ? 131 VAL B N   1 
ATOM   3534 C CA  . VAL B 1 125 ? 41.981 59.564 37.889  1.00 34.67 ? 131 VAL B CA  1 
ATOM   3535 C C   . VAL B 1 125 ? 41.040 58.939 38.910  1.00 35.28 ? 131 VAL B C   1 
ATOM   3536 O O   . VAL B 1 125 ? 40.459 59.634 39.750  1.00 35.10 ? 131 VAL B O   1 
ATOM   3537 C CB  . VAL B 1 125 ? 43.065 60.392 38.612  1.00 35.04 ? 131 VAL B CB  1 
ATOM   3538 C CG1 . VAL B 1 125 ? 43.910 59.483 39.495  1.00 34.48 ? 131 VAL B CG1 1 
ATOM   3539 C CG2 . VAL B 1 125 ? 43.940 61.101 37.588  1.00 34.74 ? 131 VAL B CG2 1 
ATOM   3540 N N   . LEU B 1 126 ? 40.902 57.622 38.828  1.00 34.49 ? 132 LEU B N   1 
ATOM   3541 C CA  . LEU B 1 126 ? 39.996 56.877 39.686  1.00 34.52 ? 132 LEU B CA  1 
ATOM   3542 C C   . LEU B 1 126 ? 40.712 55.873 40.571  1.00 35.53 ? 132 LEU B C   1 
ATOM   3543 O O   . LEU B 1 126 ? 41.868 55.529 40.327  1.00 35.34 ? 132 LEU B O   1 
ATOM   3544 C CB  . LEU B 1 126 ? 38.993 56.130 38.804  1.00 33.19 ? 132 LEU B CB  1 
ATOM   3545 C CG  . LEU B 1 126 ? 38.222 56.996 37.803  1.00 33.41 ? 132 LEU B CG  1 
ATOM   3546 C CD1 . LEU B 1 126 ? 37.944 56.211 36.517  1.00 35.46 ? 132 LEU B CD1 1 
ATOM   3547 C CD2 . LEU B 1 126 ? 36.932 57.474 38.444  1.00 33.18 ? 132 LEU B CD2 1 
ATOM   3548 N N   . ASP B 1 127 ? 40.018 55.408 41.606  1.00 36.89 ? 133 ASP B N   1 
ATOM   3549 C CA  . ASP B 1 127 ? 40.584 54.395 42.481  1.00 38.07 ? 133 ASP B CA  1 
ATOM   3550 C C   . ASP B 1 127 ? 40.773 53.171 41.594  1.00 38.25 ? 133 ASP B C   1 
ATOM   3551 O O   . ASP B 1 127 ? 39.981 52.927 40.681  1.00 37.20 ? 133 ASP B O   1 
ATOM   3552 C CB  . ASP B 1 127 ? 39.618 54.020 43.613  1.00 41.39 ? 133 ASP B CB  1 
ATOM   3553 C CG  . ASP B 1 127 ? 39.518 55.086 44.687  1.00 43.56 ? 133 ASP B CG  1 
ATOM   3554 O OD1 . ASP B 1 127 ? 40.567 55.567 45.155  1.00 45.62 ? 133 ASP B OD1 1 
ATOM   3555 O OD2 . ASP B 1 127 ? 38.382 55.428 45.074  1.00 47.84 ? 133 ASP B OD2 1 
ATOM   3556 N N   . TYR B 1 128 ? 41.821 52.407 41.857  1.00 37.88 ? 134 TYR B N   1 
ATOM   3557 C CA  . TYR B 1 128 ? 42.069 51.205 41.085  1.00 37.87 ? 134 TYR B CA  1 
ATOM   3558 C C   . TYR B 1 128 ? 41.628 50.011 41.916  1.00 37.18 ? 134 TYR B C   1 
ATOM   3559 O O   . TYR B 1 128 ? 41.925 49.930 43.107  1.00 36.47 ? 134 TYR B O   1 
ATOM   3560 C CB  . TYR B 1 128 ? 43.554 51.068 40.751  1.00 38.71 ? 134 TYR B CB  1 
ATOM   3561 C CG  . TYR B 1 128 ? 43.909 49.717 40.176  1.00 38.61 ? 134 TYR B CG  1 
ATOM   3562 C CD1 . TYR B 1 128 ? 43.599 49.393 38.854  1.00 39.02 ? 134 TYR B CD1 1 
ATOM   3563 C CD2 . TYR B 1 128 ? 44.517 48.742 40.968  1.00 39.15 ? 134 TYR B CD2 1 
ATOM   3564 C CE1 . TYR B 1 128 ? 43.885 48.132 38.338  1.00 37.86 ? 134 TYR B CE1 1 
ATOM   3565 C CE2 . TYR B 1 128 ? 44.804 47.481 40.462  1.00 38.22 ? 134 TYR B CE2 1 
ATOM   3566 C CZ  . TYR B 1 128 ? 44.486 47.183 39.150  1.00 37.61 ? 134 TYR B CZ  1 
ATOM   3567 O OH  . TYR B 1 128 ? 44.762 45.932 38.653  1.00 39.16 ? 134 TYR B OH  1 
ATOM   3568 N N   . VAL B 1 129 ? 40.898 49.096 41.291  1.00 36.13 ? 135 VAL B N   1 
ATOM   3569 C CA  . VAL B 1 129 ? 40.445 47.899 41.981  1.00 34.30 ? 135 VAL B CA  1 
ATOM   3570 C C   . VAL B 1 129 ? 41.035 46.735 41.190  1.00 34.75 ? 135 VAL B C   1 
ATOM   3571 O O   . VAL B 1 129 ? 40.987 46.725 39.967  1.00 33.50 ? 135 VAL B O   1 
ATOM   3572 C CB  . VAL B 1 129 ? 38.899 47.816 42.014  1.00 35.49 ? 135 VAL B CB  1 
ATOM   3573 C CG1 . VAL B 1 129 ? 38.455 46.592 42.802  1.00 33.38 ? 135 VAL B CG1 1 
ATOM   3574 C CG2 . VAL B 1 129 ? 38.327 49.083 42.645  1.00 34.21 ? 135 VAL B CG2 1 
ATOM   3575 N N   . PRO B 1 130 ? 41.621 45.749 41.887  1.00 35.79 ? 136 PRO B N   1 
ATOM   3576 C CA  . PRO B 1 130 ? 42.245 44.566 41.290  1.00 36.05 ? 136 PRO B CA  1 
ATOM   3577 C C   . PRO B 1 130 ? 41.460 43.769 40.251  1.00 34.56 ? 136 PRO B C   1 
ATOM   3578 O O   . PRO B 1 130 ? 41.940 43.545 39.140  1.00 36.26 ? 136 PRO B O   1 
ATOM   3579 C CB  . PRO B 1 130 ? 42.585 43.713 42.511  1.00 36.17 ? 136 PRO B CB  1 
ATOM   3580 C CG  . PRO B 1 130 ? 42.922 44.735 43.526  1.00 37.15 ? 136 PRO B CG  1 
ATOM   3581 C CD  . PRO B 1 130 ? 41.794 45.732 43.350  1.00 36.36 ? 136 PRO B CD  1 
ATOM   3582 N N   . GLU B 1 131 ? 40.260 43.337 40.612  1.00 33.04 ? 137 GLU B N   1 
ATOM   3583 C CA  . GLU B 1 131 ? 39.463 42.509 39.721  1.00 32.28 ? 137 GLU B CA  1 
ATOM   3584 C C   . GLU B 1 131 ? 38.099 43.051 39.318  1.00 31.47 ? 137 GLU B C   1 
ATOM   3585 O O   . GLU B 1 131 ? 37.669 44.112 39.765  1.00 31.15 ? 137 GLU B O   1 
ATOM   3586 C CB  . GLU B 1 131 ? 39.264 41.135 40.367  1.00 33.91 ? 137 GLU B CB  1 
ATOM   3587 C CG  . GLU B 1 131 ? 40.503 40.246 40.387  1.00 36.91 ? 137 GLU B CG  1 
ATOM   3588 C CD  . GLU B 1 131 ? 40.902 39.792 39.000  1.00 38.84 ? 137 GLU B CD  1 
ATOM   3589 O OE1 . GLU B 1 131 ? 40.011 39.727 38.123  1.00 40.53 ? 137 GLU B OE1 1 
ATOM   3590 O OE2 . GLU B 1 131 ? 42.096 39.492 38.785  1.00 40.98 ? 137 GLU B OE2 1 
ATOM   3591 N N   . THR B 1 132 ? 37.431 42.290 38.458  1.00 30.95 ? 138 THR B N   1 
ATOM   3592 C CA  . THR B 1 132 ? 36.092 42.616 37.990  1.00 30.22 ? 138 THR B CA  1 
ATOM   3593 C C   . THR B 1 132 ? 35.282 41.332 38.135  1.00 30.33 ? 138 THR B C   1 
ATOM   3594 O O   . THR B 1 132 ? 35.843 40.235 38.149  1.00 30.32 ? 138 THR B O   1 
ATOM   3595 C CB  . THR B 1 132 ? 36.080 43.056 36.504  1.00 30.62 ? 138 THR B CB  1 
ATOM   3596 O OG1 . THR B 1 132 ? 36.332 41.929 35.653  1.00 30.77 ? 138 THR B OG1 1 
ATOM   3597 C CG2 . THR B 1 132 ? 37.138 44.119 36.258  1.00 29.46 ? 138 THR B CG2 1 
ATOM   3598 N N   . VAL B 1 133 ? 33.970 41.462 38.267  1.00 28.96 ? 139 VAL B N   1 
ATOM   3599 C CA  . VAL B 1 133 ? 33.127 40.287 38.394  1.00 28.28 ? 139 VAL B CA  1 
ATOM   3600 C C   . VAL B 1 133 ? 33.228 39.485 37.097  1.00 28.78 ? 139 VAL B C   1 
ATOM   3601 O O   . VAL B 1 133 ? 33.125 38.262 37.103  1.00 29.18 ? 139 VAL B O   1 
ATOM   3602 C CB  . VAL B 1 133 ? 31.656 40.682 38.643  1.00 27.54 ? 139 VAL B CB  1 
ATOM   3603 C CG1 . VAL B 1 133 ? 30.759 39.457 38.548  1.00 25.08 ? 139 VAL B CG1 1 
ATOM   3604 C CG2 . VAL B 1 133 ? 31.525 41.325 40.031  1.00 27.12 ? 139 VAL B CG2 1 
ATOM   3605 N N   . TYR B 1 134 ? 33.434 40.184 35.988  1.00 27.76 ? 140 TYR B N   1 
ATOM   3606 C CA  . TYR B 1 134 ? 33.542 39.522 34.697  1.00 28.84 ? 140 TYR B CA  1 
ATOM   3607 C C   . TYR B 1 134 ? 34.709 38.537 34.699  1.00 29.39 ? 140 TYR B C   1 
ATOM   3608 O O   . TYR B 1 134 ? 34.550 37.365 34.369  1.00 28.79 ? 140 TYR B O   1 
ATOM   3609 C CB  . TYR B 1 134 ? 33.764 40.546 33.593  1.00 29.94 ? 140 TYR B CB  1 
ATOM   3610 C CG  . TYR B 1 134 ? 33.927 39.912 32.232  1.00 33.13 ? 140 TYR B CG  1 
ATOM   3611 C CD1 . TYR B 1 134 ? 32.826 39.407 31.542  1.00 32.99 ? 140 TYR B CD1 1 
ATOM   3612 C CD2 . TYR B 1 134 ? 35.185 39.796 31.645  1.00 34.37 ? 140 TYR B CD2 1 
ATOM   3613 C CE1 . TYR B 1 134 ? 32.970 38.802 30.299  1.00 35.79 ? 140 TYR B CE1 1 
ATOM   3614 C CE2 . TYR B 1 134 ? 35.344 39.191 30.399  1.00 36.77 ? 140 TYR B CE2 1 
ATOM   3615 C CZ  . TYR B 1 134 ? 34.231 38.698 29.733  1.00 37.08 ? 140 TYR B CZ  1 
ATOM   3616 O OH  . TYR B 1 134 ? 34.381 38.102 28.504  1.00 39.80 ? 140 TYR B OH  1 
ATOM   3617 N N   . ARG B 1 135 ? 35.879 39.037 35.077  1.00 29.73 ? 141 ARG B N   1 
ATOM   3618 C CA  . ARG B 1 135 ? 37.096 38.233 35.122  1.00 32.21 ? 141 ARG B CA  1 
ATOM   3619 C C   . ARG B 1 135 ? 36.997 37.098 36.138  1.00 32.71 ? 141 ARG B C   1 
ATOM   3620 O O   . ARG B 1 135 ? 37.343 35.956 35.836  1.00 33.53 ? 141 ARG B O   1 
ATOM   3621 C CB  . ARG B 1 135 ? 38.294 39.136 35.436  1.00 32.19 ? 141 ARG B CB  1 
ATOM   3622 C CG  . ARG B 1 135 ? 38.730 40.003 34.255  1.00 33.76 ? 141 ARG B CG  1 
ATOM   3623 C CD  . ARG B 1 135 ? 39.557 41.200 34.713  1.00 35.15 ? 141 ARG B CD  1 
ATOM   3624 N NE  . ARG B 1 135 ? 40.701 40.822 35.541  1.00 37.87 ? 141 ARG B NE  1 
ATOM   3625 C CZ  . ARG B 1 135 ? 41.912 40.540 35.071  1.00 39.22 ? 141 ARG B CZ  1 
ATOM   3626 N NH1 . ARG B 1 135 ? 42.151 40.592 33.768  1.00 39.10 ? 141 ARG B NH1 1 
ATOM   3627 N NH2 . ARG B 1 135 ? 42.885 40.208 35.909  1.00 39.94 ? 141 ARG B NH2 1 
ATOM   3628 N N   . VAL B 1 136 ? 36.514 37.404 37.337  1.00 31.81 ? 142 VAL B N   1 
ATOM   3629 C CA  . VAL B 1 136 ? 36.379 36.379 38.368  1.00 32.36 ? 142 VAL B CA  1 
ATOM   3630 C C   . VAL B 1 136 ? 35.370 35.308 37.964  1.00 32.34 ? 142 VAL B C   1 
ATOM   3631 O O   . VAL B 1 136 ? 35.640 34.118 38.100  1.00 32.26 ? 142 VAL B O   1 
ATOM   3632 C CB  . VAL B 1 136 ? 35.965 36.999 39.726  1.00 31.85 ? 142 VAL B CB  1 
ATOM   3633 C CG1 . VAL B 1 136 ? 35.571 35.906 40.717  1.00 32.61 ? 142 VAL B CG1 1 
ATOM   3634 C CG2 . VAL B 1 136 ? 37.122 37.801 40.286  1.00 31.32 ? 142 VAL B CG2 1 
ATOM   3635 N N   . ALA B 1 137 ? 34.214 35.727 37.457  1.00 31.84 ? 143 ALA B N   1 
ATOM   3636 C CA  . ALA B 1 137 ? 33.187 34.775 37.043  1.00 33.81 ? 143 ALA B CA  1 
ATOM   3637 C C   . ALA B 1 137 ? 33.677 33.843 35.927  1.00 34.92 ? 143 ALA B C   1 
ATOM   3638 O O   . ALA B 1 137 ? 33.313 32.668 35.886  1.00 34.47 ? 143 ALA B O   1 
ATOM   3639 C CB  . ALA B 1 137 ? 31.933 35.523 36.576  1.00 33.20 ? 143 ALA B CB  1 
ATOM   3640 N N   . ARG B 1 138 ? 34.491 34.374 35.020  1.00 36.22 ? 144 ARG B N   1 
ATOM   3641 C CA  . ARG B 1 138 ? 35.004 33.585 33.904  1.00 39.81 ? 144 ARG B CA  1 
ATOM   3642 C C   . ARG B 1 138 ? 35.950 32.487 34.385  1.00 40.45 ? 144 ARG B C   1 
ATOM   3643 O O   . ARG B 1 138 ? 35.941 31.372 33.861  1.00 40.96 ? 144 ARG B O   1 
ATOM   3644 C CB  . ARG B 1 138 ? 35.712 34.499 32.904  1.00 42.30 ? 144 ARG B CB  1 
ATOM   3645 C CG  . ARG B 1 138 ? 36.185 33.794 31.650  1.00 47.39 ? 144 ARG B CG  1 
ATOM   3646 C CD  . ARG B 1 138 ? 36.610 34.798 30.591  1.00 51.46 ? 144 ARG B CD  1 
ATOM   3647 N NE  . ARG B 1 138 ? 37.606 35.739 31.097  1.00 54.33 ? 144 ARG B NE  1 
ATOM   3648 C CZ  . ARG B 1 138 ? 38.063 36.784 30.413  1.00 55.93 ? 144 ARG B CZ  1 
ATOM   3649 N NH1 . ARG B 1 138 ? 37.614 37.024 29.186  1.00 56.93 ? 144 ARG B NH1 1 
ATOM   3650 N NH2 . ARG B 1 138 ? 38.962 37.597 30.959  1.00 55.71 ? 144 ARG B NH2 1 
ATOM   3651 N N   . HIS B 1 139 ? 36.770 32.806 35.379  1.00 40.65 ? 145 HIS B N   1 
ATOM   3652 C CA  . HIS B 1 139 ? 37.691 31.827 35.937  1.00 41.70 ? 145 HIS B CA  1 
ATOM   3653 C C   . HIS B 1 139 ? 36.894 30.644 36.461  1.00 41.39 ? 145 HIS B C   1 
ATOM   3654 O O   . HIS B 1 139 ? 37.208 29.497 36.152  1.00 41.33 ? 145 HIS B O   1 
ATOM   3655 C CB  . HIS B 1 139 ? 38.514 32.451 37.062  1.00 43.19 ? 145 HIS B CB  1 
ATOM   3656 C CG  . HIS B 1 139 ? 39.651 33.297 36.577  1.00 46.24 ? 145 HIS B CG  1 
ATOM   3657 N ND1 . HIS B 1 139 ? 39.997 34.494 37.168  1.00 48.26 ? 145 HIS B ND1 1 
ATOM   3658 C CD2 . HIS B 1 139 ? 40.533 33.108 35.566  1.00 47.33 ? 145 HIS B CD2 1 
ATOM   3659 C CE1 . HIS B 1 139 ? 41.042 35.007 36.541  1.00 48.86 ? 145 HIS B CE1 1 
ATOM   3660 N NE2 . HIS B 1 139 ? 41.387 34.185 35.565  1.00 48.14 ? 145 HIS B NE2 1 
ATOM   3661 N N   . TYR B 1 140 ? 35.848 30.915 37.237  1.00 40.24 ? 146 TYR B N   1 
ATOM   3662 C CA  . TYR B 1 140 ? 35.030 29.833 37.772  1.00 40.15 ? 146 TYR B CA  1 
ATOM   3663 C C   . TYR B 1 140 ? 34.328 29.059 36.666  1.00 42.11 ? 146 TYR B C   1 
ATOM   3664 O O   . TYR B 1 140 ? 34.300 27.831 36.685  1.00 42.75 ? 146 TYR B O   1 
ATOM   3665 C CB  . TYR B 1 140 ? 33.988 30.365 38.762  1.00 38.28 ? 146 TYR B CB  1 
ATOM   3666 C CG  . TYR B 1 140 ? 34.554 30.700 40.121  1.00 37.01 ? 146 TYR B CG  1 
ATOM   3667 C CD1 . TYR B 1 140 ? 35.240 31.895 40.341  1.00 37.13 ? 146 TYR B CD1 1 
ATOM   3668 C CD2 . TYR B 1 140 ? 34.436 29.803 41.183  1.00 36.48 ? 146 TYR B CD2 1 
ATOM   3669 C CE1 . TYR B 1 140 ? 35.796 32.186 41.592  1.00 37.13 ? 146 TYR B CE1 1 
ATOM   3670 C CE2 . TYR B 1 140 ? 34.985 30.082 42.431  1.00 35.45 ? 146 TYR B CE2 1 
ATOM   3671 C CZ  . TYR B 1 140 ? 35.663 31.272 42.631  1.00 36.25 ? 146 TYR B CZ  1 
ATOM   3672 O OH  . TYR B 1 140 ? 36.207 31.546 43.864  1.00 34.41 ? 146 TYR B OH  1 
ATOM   3673 N N   . SER B 1 141 ? 33.761 29.783 35.707  1.00 42.95 ? 147 SER B N   1 
ATOM   3674 C CA  . SER B 1 141 ? 33.048 29.169 34.593  1.00 46.25 ? 147 SER B CA  1 
ATOM   3675 C C   . SER B 1 141 ? 33.944 28.205 33.817  1.00 47.28 ? 147 SER B C   1 
ATOM   3676 O O   . SER B 1 141 ? 33.522 27.110 33.444  1.00 46.63 ? 147 SER B O   1 
ATOM   3677 C CB  . SER B 1 141 ? 32.519 30.256 33.655  1.00 45.49 ? 147 SER B CB  1 
ATOM   3678 O OG  . SER B 1 141 ? 31.891 29.687 32.525  1.00 50.46 ? 147 SER B OG  1 
ATOM   3679 N N   . ARG B 1 142 ? 35.181 28.622 33.577  1.00 49.92 ? 148 ARG B N   1 
ATOM   3680 C CA  . ARG B 1 142 ? 36.142 27.797 32.858  1.00 52.80 ? 148 ARG B CA  1 
ATOM   3681 C C   . ARG B 1 142 ? 36.459 26.525 33.635  1.00 53.74 ? 148 ARG B C   1 
ATOM   3682 O O   . ARG B 1 142 ? 36.633 25.459 33.045  1.00 54.27 ? 148 ARG B O   1 
ATOM   3683 C CB  . ARG B 1 142 ? 37.430 28.583 32.615  1.00 53.87 ? 148 ARG B CB  1 
ATOM   3684 C CG  . ARG B 1 142 ? 37.290 29.666 31.571  1.00 57.25 ? 148 ARG B CG  1 
ATOM   3685 C CD  . ARG B 1 142 ? 38.509 30.566 31.553  1.00 60.30 ? 148 ARG B CD  1 
ATOM   3686 N NE  . ARG B 1 142 ? 38.435 31.552 30.480  1.00 63.13 ? 148 ARG B NE  1 
ATOM   3687 C CZ  . ARG B 1 142 ? 39.210 32.629 30.403  1.00 64.52 ? 148 ARG B CZ  1 
ATOM   3688 N NH1 . ARG B 1 142 ? 40.119 32.862 31.342  1.00 64.79 ? 148 ARG B NH1 1 
ATOM   3689 N NH2 . ARG B 1 142 ? 39.075 33.474 29.387  1.00 65.00 ? 148 ARG B NH2 1 
ATOM   3690 N N   . ALA B 1 143 ? 36.535 26.640 34.957  1.00 53.68 ? 149 ALA B N   1 
ATOM   3691 C CA  . ALA B 1 143 ? 36.834 25.491 35.803  1.00 53.83 ? 149 ALA B CA  1 
ATOM   3692 C C   . ALA B 1 143 ? 35.560 24.730 36.146  1.00 54.03 ? 149 ALA B C   1 
ATOM   3693 O O   . ALA B 1 143 ? 35.564 23.847 37.001  1.00 54.42 ? 149 ALA B O   1 
ATOM   3694 C CB  . ALA B 1 143 ? 37.535 25.945 37.076  1.00 53.83 ? 149 ALA B CB  1 
ATOM   3695 N N   . LYS B 1 144 ? 34.473 25.078 35.468  1.00 54.87 ? 150 LYS B N   1 
ATOM   3696 C CA  . LYS B 1 144 ? 33.182 24.437 35.693  1.00 55.67 ? 150 LYS B CA  1 
ATOM   3697 C C   . LYS B 1 144 ? 32.689 24.543 37.135  1.00 55.33 ? 150 LYS B C   1 
ATOM   3698 O O   . LYS B 1 144 ? 31.974 23.666 37.629  1.00 54.94 ? 150 LYS B O   1 
ATOM   3699 C CB  . LYS B 1 144 ? 33.243 22.966 35.268  1.00 57.28 ? 150 LYS B CB  1 
ATOM   3700 C CG  . LYS B 1 144 ? 32.720 22.727 33.862  1.00 59.32 ? 150 LYS B CG  1 
ATOM   3701 C CD  . LYS B 1 144 ? 31.256 23.152 33.777  1.00 61.38 ? 150 LYS B CD  1 
ATOM   3702 C CE  . LYS B 1 144 ? 30.679 22.960 32.385  1.00 61.97 ? 150 LYS B CE  1 
ATOM   3703 N NZ  . LYS B 1 144 ? 29.247 23.372 32.348  1.00 62.74 ? 150 LYS B NZ  1 
ATOM   3704 N N   . GLN B 1 145 ? 33.072 25.626 37.804  1.00 54.02 ? 151 GLN B N   1 
ATOM   3705 C CA  . GLN B 1 145 ? 32.656 25.863 39.181  1.00 53.02 ? 151 GLN B CA  1 
ATOM   3706 C C   . GLN B 1 145 ? 31.866 27.166 39.219  1.00 51.13 ? 151 GLN B C   1 
ATOM   3707 O O   . GLN B 1 145 ? 31.889 27.942 38.264  1.00 50.55 ? 151 GLN B O   1 
ATOM   3708 C CB  . GLN B 1 145 ? 33.878 26.002 40.093  1.00 55.48 ? 151 GLN B CB  1 
ATOM   3709 C CG  . GLN B 1 145 ? 34.879 24.861 40.012  1.00 58.83 ? 151 GLN B CG  1 
ATOM   3710 C CD  . GLN B 1 145 ? 34.279 23.524 40.393  1.00 61.16 ? 151 GLN B CD  1 
ATOM   3711 O OE1 . GLN B 1 145 ? 33.628 23.394 41.432  1.00 63.03 ? 151 GLN B OE1 1 
ATOM   3712 N NE2 . GLN B 1 145 ? 34.504 22.514 39.556  1.00 63.15 ? 151 GLN B NE2 1 
ATOM   3713 N N   . THR B 1 146 ? 31.155 27.403 40.315  1.00 48.62 ? 152 THR B N   1 
ATOM   3714 C CA  . THR B 1 146 ? 30.409 28.641 40.459  1.00 45.57 ? 152 THR B CA  1 
ATOM   3715 C C   . THR B 1 146 ? 30.891 29.335 41.720  1.00 43.84 ? 152 THR B C   1 
ATOM   3716 O O   . THR B 1 146 ? 31.273 28.685 42.695  1.00 42.97 ? 152 THR B O   1 
ATOM   3717 C CB  . THR B 1 146 ? 28.887 28.408 40.556  1.00 46.38 ? 152 THR B CB  1 
ATOM   3718 O OG1 . THR B 1 146 ? 28.614 27.403 41.540  1.00 46.61 ? 152 THR B OG1 1 
ATOM   3719 C CG2 . THR B 1 146 ? 28.325 27.988 39.201  1.00 45.65 ? 152 THR B CG2 1 
ATOM   3720 N N   . LEU B 1 147 ? 30.898 30.661 41.677  1.00 41.45 ? 153 LEU B N   1 
ATOM   3721 C CA  . LEU B 1 147 ? 31.331 31.475 42.801  1.00 39.73 ? 153 LEU B CA  1 
ATOM   3722 C C   . LEU B 1 147 ? 30.571 31.071 44.066  1.00 38.21 ? 153 LEU B C   1 
ATOM   3723 O O   . LEU B 1 147 ? 29.354 30.897 44.036  1.00 35.84 ? 153 LEU B O   1 
ATOM   3724 C CB  . LEU B 1 147 ? 31.062 32.948 42.487  1.00 40.70 ? 153 LEU B CB  1 
ATOM   3725 C CG  . LEU B 1 147 ? 31.569 34.004 43.467  1.00 41.29 ? 153 LEU B CG  1 
ATOM   3726 C CD1 . LEU B 1 147 ? 33.097 34.042 43.456  1.00 41.17 ? 153 LEU B CD1 1 
ATOM   3727 C CD2 . LEU B 1 147 ? 31.003 35.354 43.063  1.00 41.61 ? 153 LEU B CD2 1 
ATOM   3728 N N   . PRO B 1 148 ? 31.286 30.893 45.191  1.00 36.62 ? 154 PRO B N   1 
ATOM   3729 C CA  . PRO B 1 148 ? 30.613 30.514 46.434  1.00 36.14 ? 154 PRO B CA  1 
ATOM   3730 C C   . PRO B 1 148 ? 29.495 31.516 46.715  1.00 36.04 ? 154 PRO B C   1 
ATOM   3731 O O   . PRO B 1 148 ? 29.691 32.724 46.584  1.00 33.88 ? 154 PRO B O   1 
ATOM   3732 C CB  . PRO B 1 148 ? 31.734 30.589 47.465  1.00 37.42 ? 154 PRO B CB  1 
ATOM   3733 C CG  . PRO B 1 148 ? 32.940 30.173 46.666  1.00 36.66 ? 154 PRO B CG  1 
ATOM   3734 C CD  . PRO B 1 148 ? 32.747 30.952 45.378  1.00 37.75 ? 154 PRO B CD  1 
ATOM   3735 N N   . VAL B 1 149 ? 28.331 31.007 47.100  1.00 35.89 ? 155 VAL B N   1 
ATOM   3736 C CA  . VAL B 1 149 ? 27.177 31.851 47.377  1.00 36.72 ? 155 VAL B CA  1 
ATOM   3737 C C   . VAL B 1 149 ? 27.459 33.016 48.330  1.00 35.39 ? 155 VAL B C   1 
ATOM   3738 O O   . VAL B 1 149 ? 26.917 34.104 48.145  1.00 36.18 ? 155 VAL B O   1 
ATOM   3739 C CB  . VAL B 1 149 ? 26.002 31.007 47.919  1.00 36.91 ? 155 VAL B CB  1 
ATOM   3740 C CG1 . VAL B 1 149 ? 24.811 31.900 48.228  1.00 39.36 ? 155 VAL B CG1 1 
ATOM   3741 C CG2 . VAL B 1 149 ? 25.613 29.951 46.888  1.00 38.87 ? 155 VAL B CG2 1 
ATOM   3742 N N   . ILE B 1 150 ? 28.302 32.805 49.337  1.00 33.50 ? 156 ILE B N   1 
ATOM   3743 C CA  . ILE B 1 150 ? 28.619 33.878 50.273  1.00 32.04 ? 156 ILE B CA  1 
ATOM   3744 C C   . ILE B 1 150 ? 29.164 35.105 49.539  1.00 31.09 ? 156 ILE B C   1 
ATOM   3745 O O   . ILE B 1 150 ? 28.864 36.236 49.916  1.00 28.78 ? 156 ILE B O   1 
ATOM   3746 C CB  . ILE B 1 150 ? 29.651 33.429 51.354  1.00 33.51 ? 156 ILE B CB  1 
ATOM   3747 C CG1 . ILE B 1 150 ? 29.903 34.572 52.344  1.00 34.54 ? 156 ILE B CG1 1 
ATOM   3748 C CG2 . ILE B 1 150 ? 30.966 33.036 50.706  1.00 32.93 ? 156 ILE B CG2 1 
ATOM   3749 C CD1 . ILE B 1 150 ? 28.682 34.992 53.148  1.00 33.97 ? 156 ILE B CD1 1 
ATOM   3750 N N   . TYR B 1 151 ? 29.965 34.885 48.495  1.00 29.68 ? 157 TYR B N   1 
ATOM   3751 C CA  . TYR B 1 151 ? 30.508 36.003 47.724  1.00 28.41 ? 157 TYR B CA  1 
ATOM   3752 C C   . TYR B 1 151 ? 29.418 36.598 46.832  1.00 27.55 ? 157 TYR B C   1 
ATOM   3753 O O   . TYR B 1 151 ? 29.405 37.801 46.574  1.00 26.65 ? 157 TYR B O   1 
ATOM   3754 C CB  . TYR B 1 151 ? 31.689 35.554 46.857  1.00 28.48 ? 157 TYR B CB  1 
ATOM   3755 C CG  . TYR B 1 151 ? 32.928 35.232 47.653  1.00 31.84 ? 157 TYR B CG  1 
ATOM   3756 C CD1 . TYR B 1 151 ? 33.405 33.926 47.742  1.00 33.70 ? 157 TYR B CD1 1 
ATOM   3757 C CD2 . TYR B 1 151 ? 33.607 36.233 48.352  1.00 31.80 ? 157 TYR B CD2 1 
ATOM   3758 C CE1 . TYR B 1 151 ? 34.529 33.622 48.512  1.00 36.28 ? 157 TYR B CE1 1 
ATOM   3759 C CE2 . TYR B 1 151 ? 34.728 35.940 49.122  1.00 35.74 ? 157 TYR B CE2 1 
ATOM   3760 C CZ  . TYR B 1 151 ? 35.182 34.634 49.197  1.00 35.92 ? 157 TYR B CZ  1 
ATOM   3761 O OH  . TYR B 1 151 ? 36.287 34.343 49.954  1.00 40.90 ? 157 TYR B OH  1 
ATOM   3762 N N   . VAL B 1 152 ? 28.518 35.752 46.346  1.00 26.43 ? 158 VAL B N   1 
ATOM   3763 C CA  . VAL B 1 152 ? 27.432 36.238 45.506  1.00 27.88 ? 158 VAL B CA  1 
ATOM   3764 C C   . VAL B 1 152 ? 26.592 37.190 46.353  1.00 27.69 ? 158 VAL B C   1 
ATOM   3765 O O   . VAL B 1 152 ? 26.139 38.232 45.872  1.00 28.16 ? 158 VAL B O   1 
ATOM   3766 C CB  . VAL B 1 152 ? 26.533 35.077 44.998  1.00 28.50 ? 158 VAL B CB  1 
ATOM   3767 C CG1 . VAL B 1 152 ? 25.297 35.641 44.289  1.00 28.55 ? 158 VAL B CG1 1 
ATOM   3768 C CG2 . VAL B 1 152 ? 27.326 34.188 44.041  1.00 28.39 ? 158 VAL B CG2 1 
ATOM   3769 N N   . LYS B 1 153 ? 26.393 36.826 47.619  1.00 26.81 ? 159 LYS B N   1 
ATOM   3770 C CA  . LYS B 1 153 ? 25.611 37.647 48.536  1.00 26.41 ? 159 LYS B CA  1 
ATOM   3771 C C   . LYS B 1 153 ? 26.290 38.980 48.764  1.00 26.21 ? 159 LYS B C   1 
ATOM   3772 O O   . LYS B 1 153 ? 25.673 40.029 48.607  1.00 25.72 ? 159 LYS B O   1 
ATOM   3773 C CB  . LYS B 1 153 ? 25.425 36.942 49.886  1.00 28.74 ? 159 LYS B CB  1 
ATOM   3774 C CG  . LYS B 1 153 ? 24.352 35.874 49.891  1.00 29.30 ? 159 LYS B CG  1 
ATOM   3775 C CD  . LYS B 1 153 ? 24.219 35.219 51.264  1.00 32.35 ? 159 LYS B CD  1 
ATOM   3776 C CE  . LYS B 1 153 ? 23.271 34.022 51.204  1.00 32.57 ? 159 LYS B CE  1 
ATOM   3777 N NZ  . LYS B 1 153 ? 23.124 33.348 52.524  1.00 33.87 ? 159 LYS B NZ  1 
ATOM   3778 N N   . LEU B 1 154 ? 27.569 38.934 49.123  1.00 25.23 ? 160 LEU B N   1 
ATOM   3779 C CA  . LEU B 1 154 ? 28.330 40.149 49.387  1.00 26.52 ? 160 LEU B CA  1 
ATOM   3780 C C   . LEU B 1 154 ? 28.396 41.083 48.186  1.00 25.31 ? 160 LEU B C   1 
ATOM   3781 O O   . LEU B 1 154 ? 28.197 42.289 48.319  1.00 24.41 ? 160 LEU B O   1 
ATOM   3782 C CB  . LEU B 1 154 ? 29.755 39.797 49.829  1.00 27.99 ? 160 LEU B CB  1 
ATOM   3783 C CG  . LEU B 1 154 ? 29.921 39.317 51.270  1.00 31.35 ? 160 LEU B CG  1 
ATOM   3784 C CD1 . LEU B 1 154 ? 31.261 38.605 51.428  1.00 31.63 ? 160 LEU B CD1 1 
ATOM   3785 C CD2 . LEU B 1 154 ? 29.808 40.514 52.219  1.00 30.74 ? 160 LEU B CD2 1 
ATOM   3786 N N   . TYR B 1 155 ? 28.697 40.528 47.015  1.00 25.10 ? 161 TYR B N   1 
ATOM   3787 C CA  . TYR B 1 155 ? 28.814 41.336 45.806  1.00 24.52 ? 161 TYR B CA  1 
ATOM   3788 C C   . TYR B 1 155 ? 27.493 41.962 45.393  1.00 24.09 ? 161 TYR B C   1 
ATOM   3789 O O   . TYR B 1 155 ? 27.418 43.169 45.148  1.00 24.62 ? 161 TYR B O   1 
ATOM   3790 C CB  . TYR B 1 155 ? 29.348 40.484 44.644  1.00 26.36 ? 161 TYR B CB  1 
ATOM   3791 C CG  . TYR B 1 155 ? 30.745 39.936 44.862  1.00 28.84 ? 161 TYR B CG  1 
ATOM   3792 C CD1 . TYR B 1 155 ? 31.261 38.941 44.023  1.00 31.06 ? 161 TYR B CD1 1 
ATOM   3793 C CD2 . TYR B 1 155 ? 31.554 40.414 45.888  1.00 29.19 ? 161 TYR B CD2 1 
ATOM   3794 C CE1 . TYR B 1 155 ? 32.542 38.443 44.207  1.00 31.63 ? 161 TYR B CE1 1 
ATOM   3795 C CE2 . TYR B 1 155 ? 32.839 39.923 46.082  1.00 32.13 ? 161 TYR B CE2 1 
ATOM   3796 C CZ  . TYR B 1 155 ? 33.326 38.937 45.234  1.00 32.47 ? 161 TYR B CZ  1 
ATOM   3797 O OH  . TYR B 1 155 ? 34.600 38.456 45.408  1.00 35.61 ? 161 TYR B OH  1 
ATOM   3798 N N   . MET B 1 156 ? 26.456 41.138 45.297  1.00 22.88 ? 162 MET B N   1 
ATOM   3799 C CA  . MET B 1 156 ? 25.152 41.630 44.879  1.00 24.89 ? 162 MET B CA  1 
ATOM   3800 C C   . MET B 1 156 ? 24.606 42.641 45.874  1.00 24.73 ? 162 MET B C   1 
ATOM   3801 O O   . MET B 1 156 ? 24.005 43.636 45.480  1.00 23.83 ? 162 MET B O   1 
ATOM   3802 C CB  . MET B 1 156 ? 24.166 40.471 44.702  1.00 25.29 ? 162 MET B CB  1 
ATOM   3803 C CG  . MET B 1 156 ? 24.493 39.562 43.508  1.00 28.50 ? 162 MET B CG  1 
ATOM   3804 S SD  . MET B 1 156 ? 24.687 40.480 41.962  1.00 28.70 ? 162 MET B SD  1 
ATOM   3805 C CE  . MET B 1 156 ? 23.108 41.390 41.910  1.00 29.73 ? 162 MET B CE  1 
ATOM   3806 N N   . TYR B 1 157 ? 24.818 42.389 47.163  1.00 23.58 ? 163 TYR B N   1 
ATOM   3807 C CA  . TYR B 1 157 ? 24.335 43.315 48.181  1.00 23.89 ? 163 TYR B CA  1 
ATOM   3808 C C   . TYR B 1 157 ? 24.980 44.683 47.990  1.00 23.43 ? 163 TYR B C   1 
ATOM   3809 O O   . TYR B 1 157 ? 24.302 45.705 48.031  1.00 24.57 ? 163 TYR B O   1 
ATOM   3810 C CB  . TYR B 1 157 ? 24.662 42.800 49.583  1.00 24.62 ? 163 TYR B CB  1 
ATOM   3811 C CG  . TYR B 1 157 ? 24.267 43.756 50.686  1.00 25.95 ? 163 TYR B CG  1 
ATOM   3812 C CD1 . TYR B 1 157 ? 23.012 43.674 51.292  1.00 25.27 ? 163 TYR B CD1 1 
ATOM   3813 C CD2 . TYR B 1 157 ? 25.159 44.726 51.143  1.00 24.45 ? 163 TYR B CD2 1 
ATOM   3814 C CE1 . TYR B 1 157 ? 22.656 44.530 52.341  1.00 27.32 ? 163 TYR B CE1 1 
ATOM   3815 C CE2 . TYR B 1 157 ? 24.814 45.592 52.189  1.00 26.16 ? 163 TYR B CE2 1 
ATOM   3816 C CZ  . TYR B 1 157 ? 23.563 45.482 52.785  1.00 27.21 ? 163 TYR B CZ  1 
ATOM   3817 O OH  . TYR B 1 157 ? 23.234 46.296 53.849  1.00 29.48 ? 163 TYR B OH  1 
ATOM   3818 N N   . GLN B 1 158 ? 26.294 44.706 47.797  1.00 21.85 ? 164 GLN B N   1 
ATOM   3819 C CA  . GLN B 1 158 ? 26.996 45.973 47.606  1.00 23.02 ? 164 GLN B CA  1 
ATOM   3820 C C   . GLN B 1 158 ? 26.580 46.637 46.296  1.00 23.39 ? 164 GLN B C   1 
ATOM   3821 O O   . GLN B 1 158 ? 26.537 47.863 46.200  1.00 23.88 ? 164 GLN B O   1 
ATOM   3822 C CB  . GLN B 1 158 ? 28.511 45.755 47.630  1.00 22.81 ? 164 GLN B CB  1 
ATOM   3823 C CG  . GLN B 1 158 ? 29.017 45.250 48.993  1.00 24.85 ? 164 GLN B CG  1 
ATOM   3824 C CD  . GLN B 1 158 ? 30.469 44.819 48.951  1.00 25.40 ? 164 GLN B CD  1 
ATOM   3825 O OE1 . GLN B 1 158 ? 31.378 45.645 49.006  1.00 26.82 ? 164 GLN B OE1 1 
ATOM   3826 N NE2 . GLN B 1 158 ? 30.691 43.519 48.835  1.00 26.99 ? 164 GLN B NE2 1 
ATOM   3827 N N   . LEU B 1 159 ? 26.266 45.832 45.288  1.00 22.51 ? 165 LEU B N   1 
ATOM   3828 C CA  . LEU B 1 159 ? 25.843 46.395 44.010  1.00 23.67 ? 165 LEU B CA  1 
ATOM   3829 C C   . LEU B 1 159 ? 24.514 47.117 44.237  1.00 23.92 ? 165 LEU B C   1 
ATOM   3830 O O   . LEU B 1 159 ? 24.323 48.245 43.790  1.00 24.36 ? 165 LEU B O   1 
ATOM   3831 C CB  . LEU B 1 159 ? 25.672 45.296 42.952  1.00 24.05 ? 165 LEU B CB  1 
ATOM   3832 C CG  . LEU B 1 159 ? 24.878 45.738 41.716  1.00 24.98 ? 165 LEU B CG  1 
ATOM   3833 C CD1 . LEU B 1 159 ? 25.570 46.919 41.060  1.00 23.91 ? 165 LEU B CD1 1 
ATOM   3834 C CD2 . LEU B 1 159 ? 24.728 44.571 40.735  1.00 25.54 ? 165 LEU B CD2 1 
ATOM   3835 N N   . PHE B 1 160 ? 23.600 46.466 44.944  1.00 23.67 ? 166 PHE B N   1 
ATOM   3836 C CA  . PHE B 1 160 ? 22.317 47.086 45.221  1.00 26.68 ? 166 PHE B CA  1 
ATOM   3837 C C   . PHE B 1 160 ? 22.455 48.352 46.075  1.00 26.65 ? 166 PHE B C   1 
ATOM   3838 O O   . PHE B 1 160 ? 21.663 49.278 45.924  1.00 27.94 ? 166 PHE B O   1 
ATOM   3839 C CB  . PHE B 1 160 ? 21.366 46.078 45.867  1.00 27.20 ? 166 PHE B CB  1 
ATOM   3840 C CG  . PHE B 1 160 ? 20.793 45.089 44.888  1.00 27.82 ? 166 PHE B CG  1 
ATOM   3841 C CD1 . PHE B 1 160 ? 20.164 45.533 43.726  1.00 27.68 ? 166 PHE B CD1 1 
ATOM   3842 C CD2 . PHE B 1 160 ? 20.888 43.722 45.116  1.00 28.33 ? 166 PHE B CD2 1 
ATOM   3843 C CE1 . PHE B 1 160 ? 19.641 44.631 42.804  1.00 27.07 ? 166 PHE B CE1 1 
ATOM   3844 C CE2 . PHE B 1 160 ? 20.367 42.811 44.199  1.00 28.58 ? 166 PHE B CE2 1 
ATOM   3845 C CZ  . PHE B 1 160 ? 19.744 43.266 43.043  1.00 27.85 ? 166 PHE B CZ  1 
ATOM   3846 N N   . ARG B 1 161 ? 23.451 48.409 46.960  1.00 26.78 ? 167 ARG B N   1 
ATOM   3847 C CA  . ARG B 1 161 ? 23.645 49.618 47.766  1.00 27.52 ? 167 ARG B CA  1 
ATOM   3848 C C   . ARG B 1 161 ? 24.076 50.753 46.844  1.00 26.97 ? 167 ARG B C   1 
ATOM   3849 O O   . ARG B 1 161 ? 23.582 51.874 46.949  1.00 28.37 ? 167 ARG B O   1 
ATOM   3850 C CB  . ARG B 1 161 ? 24.734 49.440 48.838  1.00 27.00 ? 167 ARG B CB  1 
ATOM   3851 C CG  . ARG B 1 161 ? 24.246 48.989 50.195  1.00 31.94 ? 167 ARG B CG  1 
ATOM   3852 C CD  . ARG B 1 161 ? 25.328 49.172 51.270  1.00 33.23 ? 167 ARG B CD  1 
ATOM   3853 N NE  . ARG B 1 161 ? 25.472 50.564 51.698  1.00 33.64 ? 167 ARG B NE  1 
ATOM   3854 C CZ  . ARG B 1 161 ? 26.348 50.982 52.608  1.00 35.99 ? 167 ARG B CZ  1 
ATOM   3855 N NH1 . ARG B 1 161 ? 27.175 50.119 53.192  1.00 34.04 ? 167 ARG B NH1 1 
ATOM   3856 N NH2 . ARG B 1 161 ? 26.389 52.262 52.952  1.00 37.36 ? 167 ARG B NH2 1 
ATOM   3857 N N   . SER B 1 162 ? 25.005 50.459 45.940  1.00 26.03 ? 168 SER B N   1 
ATOM   3858 C CA  . SER B 1 162 ? 25.489 51.474 45.018  1.00 25.19 ? 168 SER B CA  1 
ATOM   3859 C C   . SER B 1 162 ? 24.334 52.004 44.167  1.00 24.91 ? 168 SER B C   1 
ATOM   3860 O O   . SER B 1 162 ? 24.269 53.196 43.887  1.00 24.63 ? 168 SER B O   1 
ATOM   3861 C CB  . SER B 1 162 ? 26.601 50.908 44.120  1.00 26.95 ? 168 SER B CB  1 
ATOM   3862 O OG  . SER B 1 162 ? 26.083 50.026 43.141  1.00 26.59 ? 168 SER B OG  1 
ATOM   3863 N N   . LEU B 1 163 ? 23.416 51.124 43.777  1.00 23.41 ? 169 LEU B N   1 
ATOM   3864 C CA  . LEU B 1 163 ? 22.274 51.545 42.963  1.00 24.12 ? 169 LEU B CA  1 
ATOM   3865 C C   . LEU B 1 163 ? 21.283 52.368 43.784  1.00 24.05 ? 169 LEU B C   1 
ATOM   3866 O O   . LEU B 1 163 ? 20.731 53.352 43.297  1.00 24.16 ? 169 LEU B O   1 
ATOM   3867 C CB  . LEU B 1 163 ? 21.563 50.333 42.357  1.00 23.81 ? 169 LEU B CB  1 
ATOM   3868 C CG  . LEU B 1 163 ? 22.376 49.552 41.312  1.00 25.14 ? 169 LEU B CG  1 
ATOM   3869 C CD1 . LEU B 1 163 ? 21.508 48.452 40.736  1.00 23.96 ? 169 LEU B CD1 1 
ATOM   3870 C CD2 . LEU B 1 163 ? 22.863 50.484 40.210  1.00 22.78 ? 169 LEU B CD2 1 
ATOM   3871 N N   . ALA B 1 164 ? 21.037 51.951 45.019  1.00 23.76 ? 170 ALA B N   1 
ATOM   3872 C CA  . ALA B 1 164 ? 20.133 52.697 45.884  1.00 25.28 ? 170 ALA B CA  1 
ATOM   3873 C C   . ALA B 1 164 ? 20.694 54.117 45.967  1.00 26.47 ? 170 ALA B C   1 
ATOM   3874 O O   . ALA B 1 164 ? 19.962 55.100 45.870  1.00 30.33 ? 170 ALA B O   1 
ATOM   3875 C CB  . ALA B 1 164 ? 20.080 52.059 47.280  1.00 24.31 ? 170 ALA B CB  1 
ATOM   3876 N N   . TYR B 1 165 ? 22.007 54.217 46.113  1.00 26.43 ? 171 TYR B N   1 
ATOM   3877 C CA  . TYR B 1 165 ? 22.664 55.511 46.213  1.00 28.32 ? 171 TYR B CA  1 
ATOM   3878 C C   . TYR B 1 165 ? 22.553 56.399 44.968  1.00 29.52 ? 171 TYR B C   1 
ATOM   3879 O O   . TYR B 1 165 ? 22.097 57.537 45.068  1.00 29.64 ? 171 TYR B O   1 
ATOM   3880 C CB  . TYR B 1 165 ? 24.137 55.323 46.577  1.00 29.37 ? 171 TYR B CB  1 
ATOM   3881 C CG  . TYR B 1 165 ? 24.906 56.619 46.683  1.00 29.74 ? 171 TYR B CG  1 
ATOM   3882 C CD1 . TYR B 1 165 ? 24.718 57.492 47.764  1.00 31.62 ? 171 TYR B CD1 1 
ATOM   3883 C CD2 . TYR B 1 165 ? 25.806 56.987 45.690  1.00 31.22 ? 171 TYR B CD2 1 
ATOM   3884 C CE1 . TYR B 1 165 ? 25.418 58.704 47.842  1.00 31.18 ? 171 TYR B CE1 1 
ATOM   3885 C CE2 . TYR B 1 165 ? 26.502 58.185 45.753  1.00 32.69 ? 171 TYR B CE2 1 
ATOM   3886 C CZ  . TYR B 1 165 ? 26.307 59.040 46.827  1.00 32.86 ? 171 TYR B CZ  1 
ATOM   3887 O OH  . TYR B 1 165 ? 27.008 60.224 46.850  1.00 34.48 ? 171 TYR B OH  1 
ATOM   3888 N N   . ILE B 1 166 ? 22.967 55.914 43.798  1.00 28.89 ? 172 ILE B N   1 
ATOM   3889 C CA  . ILE B 1 166 ? 22.870 56.768 42.614  1.00 28.73 ? 172 ILE B CA  1 
ATOM   3890 C C   . ILE B 1 166 ? 21.423 57.036 42.229  1.00 27.20 ? 172 ILE B C   1 
ATOM   3891 O O   . ILE B 1 166 ? 21.098 58.116 41.750  1.00 29.22 ? 172 ILE B O   1 
ATOM   3892 C CB  . ILE B 1 166 ? 23.615 56.191 41.373  1.00 29.45 ? 172 ILE B CB  1 
ATOM   3893 C CG1 . ILE B 1 166 ? 23.005 54.860 40.944  1.00 29.36 ? 172 ILE B CG1 1 
ATOM   3894 C CG2 . ILE B 1 166 ? 25.099 56.064 41.675  1.00 30.60 ? 172 ILE B CG2 1 
ATOM   3895 C CD1 . ILE B 1 166 ? 23.510 54.384 39.585  1.00 32.60 ? 172 ILE B CD1 1 
ATOM   3896 N N   . HIS B 1 167 ? 20.550 56.062 42.443  1.00 27.02 ? 173 HIS B N   1 
ATOM   3897 C CA  . HIS B 1 167 ? 19.150 56.238 42.107  1.00 27.86 ? 173 HIS B CA  1 
ATOM   3898 C C   . HIS B 1 167 ? 18.498 57.287 43.004  1.00 30.44 ? 173 HIS B C   1 
ATOM   3899 O O   . HIS B 1 167 ? 17.537 57.943 42.591  1.00 30.30 ? 173 HIS B O   1 
ATOM   3900 C CB  . HIS B 1 167 ? 18.395 54.907 42.220  1.00 27.33 ? 173 HIS B CB  1 
ATOM   3901 C CG  . HIS B 1 167 ? 18.717 53.937 41.123  1.00 27.50 ? 173 HIS B CG  1 
ATOM   3902 N ND1 . HIS B 1 167 ? 18.040 52.746 40.958  1.00 28.07 ? 173 HIS B ND1 1 
ATOM   3903 C CD2 . HIS B 1 167 ? 19.637 53.988 40.131  1.00 26.73 ? 173 HIS B CD2 1 
ATOM   3904 C CE1 . HIS B 1 167 ? 18.532 52.107 39.911  1.00 26.72 ? 173 HIS B CE1 1 
ATOM   3905 N NE2 . HIS B 1 167 ? 19.502 52.837 39.391  1.00 26.38 ? 173 HIS B NE2 1 
ATOM   3906 N N   . SER B 1 168 ? 19.023 57.452 44.217  1.00 30.45 ? 174 SER B N   1 
ATOM   3907 C CA  . SER B 1 168 ? 18.470 58.437 45.151  1.00 33.03 ? 174 SER B CA  1 
ATOM   3908 C C   . SER B 1 168 ? 18.633 59.839 44.568  1.00 34.54 ? 174 SER B C   1 
ATOM   3909 O O   . SER B 1 168 ? 17.917 60.762 44.950  1.00 37.01 ? 174 SER B O   1 
ATOM   3910 C CB  . SER B 1 168 ? 19.164 58.355 46.522  1.00 28.49 ? 174 SER B CB  1 
ATOM   3911 O OG  . SER B 1 168 ? 20.447 58.959 46.494  1.00 29.13 ? 174 SER B OG  1 
ATOM   3912 N N   . PHE B 1 169 ? 19.583 59.991 43.646  1.00 36.02 ? 175 PHE B N   1 
ATOM   3913 C CA  . PHE B 1 169 ? 19.823 61.274 42.993  1.00 36.14 ? 175 PHE B CA  1 
ATOM   3914 C C   . PHE B 1 169 ? 19.139 61.309 41.629  1.00 35.11 ? 175 PHE B C   1 
ATOM   3915 O O   . PHE B 1 169 ? 19.280 62.273 40.889  1.00 36.17 ? 175 PHE B O   1 
ATOM   3916 C CB  . PHE B 1 169 ? 21.321 61.520 42.797  1.00 38.53 ? 175 PHE B CB  1 
ATOM   3917 C CG  . PHE B 1 169 ? 22.079 61.720 44.076  1.00 41.38 ? 175 PHE B CG  1 
ATOM   3918 C CD1 . PHE B 1 169 ? 23.031 60.792 44.488  1.00 42.34 ? 175 PHE B CD1 1 
ATOM   3919 C CD2 . PHE B 1 169 ? 21.842 62.838 44.873  1.00 43.17 ? 175 PHE B CD2 1 
ATOM   3920 C CE1 . PHE B 1 169 ? 23.738 60.972 45.675  1.00 43.33 ? 175 PHE B CE1 1 
ATOM   3921 C CE2 . PHE B 1 169 ? 22.542 63.030 46.064  1.00 44.30 ? 175 PHE B CE2 1 
ATOM   3922 C CZ  . PHE B 1 169 ? 23.493 62.094 46.466  1.00 44.59 ? 175 PHE B CZ  1 
ATOM   3923 N N   . GLY B 1 170 ? 18.404 60.253 41.301  1.00 34.85 ? 176 GLY B N   1 
ATOM   3924 C CA  . GLY B 1 170 ? 17.727 60.196 40.017  1.00 34.32 ? 176 GLY B CA  1 
ATOM   3925 C C   . GLY B 1 170 ? 18.661 59.781 38.888  1.00 34.09 ? 176 GLY B C   1 
ATOM   3926 O O   . GLY B 1 170 ? 18.302 59.870 37.714  1.00 34.49 ? 176 GLY B O   1 
ATOM   3927 N N   . ILE B 1 171 ? 19.858 59.324 39.241  1.00 32.47 ? 177 ILE B N   1 
ATOM   3928 C CA  . ILE B 1 171 ? 20.845 58.901 38.251  1.00 31.98 ? 177 ILE B CA  1 
ATOM   3929 C C   . ILE B 1 171 ? 20.750 57.403 37.985  1.00 31.77 ? 177 ILE B C   1 
ATOM   3930 O O   . ILE B 1 171 ? 20.754 56.594 38.915  1.00 30.86 ? 177 ILE B O   1 
ATOM   3931 C CB  . ILE B 1 171 ? 22.279 59.210 38.714  1.00 33.39 ? 177 ILE B CB  1 
ATOM   3932 C CG1 . ILE B 1 171 ? 22.458 60.716 38.903  1.00 33.87 ? 177 ILE B CG1 1 
ATOM   3933 C CG2 . ILE B 1 171 ? 23.279 58.676 37.698  1.00 32.24 ? 177 ILE B CG2 1 
ATOM   3934 C CD1 . ILE B 1 171 ? 23.798 61.102 39.488  1.00 35.26 ? 177 ILE B CD1 1 
ATOM   3935 N N   . CYS B 1 172 ? 20.665 57.051 36.706  1.00 30.15 ? 178 CYS B N   1 
ATOM   3936 C CA  . CYS B 1 172 ? 20.574 55.663 36.275  1.00 27.63 ? 178 CYS B CA  1 
ATOM   3937 C C   . CYS B 1 172 ? 21.901 55.342 35.592  1.00 25.91 ? 178 CYS B C   1 
ATOM   3938 O O   . CYS B 1 172 ? 22.373 56.117 34.759  1.00 26.03 ? 178 CYS B O   1 
ATOM   3939 C CB  . CYS B 1 172 ? 19.412 55.503 35.287  1.00 29.21 ? 178 CYS B CB  1 
ATOM   3940 S SG  . CYS B 1 172 ? 19.108 53.807 34.716  1.00 27.47 ? 178 CYS B SG  1 
ATOM   3941 N N   . HIS B 1 173 ? 22.508 54.214 35.949  1.00 22.94 ? 179 HIS B N   1 
ATOM   3942 C CA  . HIS B 1 173 ? 23.791 53.835 35.364  1.00 22.26 ? 179 HIS B CA  1 
ATOM   3943 C C   . HIS B 1 173 ? 23.628 53.468 33.886  1.00 22.96 ? 179 HIS B C   1 
ATOM   3944 O O   . HIS B 1 173 ? 24.428 53.872 33.040  1.00 24.04 ? 179 HIS B O   1 
ATOM   3945 C CB  . HIS B 1 173 ? 24.388 52.665 36.158  1.00 23.54 ? 179 HIS B CB  1 
ATOM   3946 C CG  . HIS B 1 173 ? 25.765 52.268 35.718  1.00 24.69 ? 179 HIS B CG  1 
ATOM   3947 N ND1 . HIS B 1 173 ? 26.002 51.535 34.575  1.00 26.10 ? 179 HIS B ND1 1 
ATOM   3948 C CD2 . HIS B 1 173 ? 26.978 52.491 36.278  1.00 24.80 ? 179 HIS B CD2 1 
ATOM   3949 C CE1 . HIS B 1 173 ? 27.300 51.320 34.453  1.00 25.19 ? 179 HIS B CE1 1 
ATOM   3950 N NE2 . HIS B 1 173 ? 27.914 51.890 35.475  1.00 25.07 ? 179 HIS B NE2 1 
ATOM   3951 N N   . ARG B 1 174 ? 22.585 52.698 33.594  1.00 21.82 ? 180 ARG B N   1 
ATOM   3952 C CA  . ARG B 1 174 ? 22.255 52.275 32.231  1.00 24.67 ? 180 ARG B CA  1 
ATOM   3953 C C   . ARG B 1 174 ? 23.214 51.296 31.546  1.00 26.23 ? 180 ARG B C   1 
ATOM   3954 O O   . ARG B 1 174 ? 23.030 50.984 30.369  1.00 27.44 ? 180 ARG B O   1 
ATOM   3955 C CB  . ARG B 1 174 ? 22.052 53.502 31.324  1.00 24.57 ? 180 ARG B CB  1 
ATOM   3956 C CG  . ARG B 1 174 ? 20.971 54.479 31.813  1.00 23.79 ? 180 ARG B CG  1 
ATOM   3957 C CD  . ARG B 1 174 ? 20.419 55.349 30.664  1.00 23.20 ? 180 ARG B CD  1 
ATOM   3958 N NE  . ARG B 1 174 ? 21.440 56.220 30.082  1.00 24.49 ? 180 ARG B NE  1 
ATOM   3959 C CZ  . ARG B 1 174 ? 21.218 57.075 29.088  1.00 24.88 ? 180 ARG B CZ  1 
ATOM   3960 N NH1 . ARG B 1 174 ? 20.007 57.179 28.555  1.00 27.08 ? 180 ARG B NH1 1 
ATOM   3961 N NH2 . ARG B 1 174 ? 22.203 57.832 28.634  1.00 24.50 ? 180 ARG B NH2 1 
ATOM   3962 N N   . ASP B 1 175 ? 24.226 50.806 32.257  1.00 25.49 ? 181 ASP B N   1 
ATOM   3963 C CA  . ASP B 1 175 ? 25.150 49.850 31.653  1.00 27.45 ? 181 ASP B CA  1 
ATOM   3964 C C   . ASP B 1 175 ? 25.689 48.880 32.693  1.00 26.26 ? 181 ASP B C   1 
ATOM   3965 O O   . ASP B 1 175 ? 26.878 48.573 32.715  1.00 28.22 ? 181 ASP B O   1 
ATOM   3966 C CB  . ASP B 1 175 ? 26.306 50.579 30.953  1.00 28.64 ? 181 ASP B CB  1 
ATOM   3967 C CG  . ASP B 1 175 ? 27.053 49.684 29.962  1.00 32.11 ? 181 ASP B CG  1 
ATOM   3968 O OD1 . ASP B 1 175 ? 26.437 48.737 29.425  1.00 29.64 ? 181 ASP B OD1 1 
ATOM   3969 O OD2 . ASP B 1 175 ? 28.254 49.941 29.712  1.00 34.82 ? 181 ASP B OD2 1 
ATOM   3970 N N   . ILE B 1 176 ? 24.801 48.400 33.557  1.00 26.59 ? 182 ILE B N   1 
ATOM   3971 C CA  . ILE B 1 176 ? 25.194 47.455 34.592  1.00 26.66 ? 182 ILE B CA  1 
ATOM   3972 C C   . ILE B 1 176 ? 25.514 46.127 33.920  1.00 26.56 ? 182 ILE B C   1 
ATOM   3973 O O   . ILE B 1 176 ? 24.683 45.572 33.199  1.00 26.19 ? 182 ILE B O   1 
ATOM   3974 C CB  . ILE B 1 176 ? 24.063 47.230 35.618  1.00 26.43 ? 182 ILE B CB  1 
ATOM   3975 C CG1 . ILE B 1 176 ? 23.755 48.533 36.363  1.00 27.28 ? 182 ILE B CG1 1 
ATOM   3976 C CG2 . ILE B 1 176 ? 24.457 46.125 36.593  1.00 25.44 ? 182 ILE B CG2 1 
ATOM   3977 C CD1 . ILE B 1 176 ? 24.945 49.120 37.108  1.00 26.61 ? 182 ILE B CD1 1 
ATOM   3978 N N   . LYS B 1 177 ? 26.725 45.632 34.159  1.00 26.37 ? 183 LYS B N   1 
ATOM   3979 C CA  . LYS B 1 177 ? 27.188 44.372 33.591  1.00 26.25 ? 183 LYS B CA  1 
ATOM   3980 C C   . LYS B 1 177 ? 28.427 43.923 34.368  1.00 26.51 ? 183 LYS B C   1 
ATOM   3981 O O   . LYS B 1 177 ? 29.101 44.739 34.993  1.00 25.46 ? 183 LYS B O   1 
ATOM   3982 C CB  . LYS B 1 177 ? 27.526 44.552 32.110  1.00 27.21 ? 183 LYS B CB  1 
ATOM   3983 C CG  . LYS B 1 177 ? 28.662 45.518 31.841  1.00 25.87 ? 183 LYS B CG  1 
ATOM   3984 C CD  . LYS B 1 177 ? 28.846 45.721 30.356  1.00 30.05 ? 183 LYS B CD  1 
ATOM   3985 C CE  . LYS B 1 177 ? 29.963 46.700 30.064  1.00 29.58 ? 183 LYS B CE  1 
ATOM   3986 N NZ  . LYS B 1 177 ? 30.018 46.973 28.602  1.00 34.84 ? 183 LYS B NZ  1 
ATOM   3987 N N   . PRO B 1 178 ? 28.746 42.620 34.331  1.00 27.01 ? 184 PRO B N   1 
ATOM   3988 C CA  . PRO B 1 178 ? 29.911 42.089 35.054  1.00 26.66 ? 184 PRO B CA  1 
ATOM   3989 C C   . PRO B 1 178 ? 31.208 42.875 34.871  1.00 26.84 ? 184 PRO B C   1 
ATOM   3990 O O   . PRO B 1 178 ? 31.972 43.046 35.820  1.00 26.39 ? 184 PRO B O   1 
ATOM   3991 C CB  . PRO B 1 178 ? 30.012 40.658 34.532  1.00 27.07 ? 184 PRO B CB  1 
ATOM   3992 C CG  . PRO B 1 178 ? 28.574 40.301 34.313  1.00 26.21 ? 184 PRO B CG  1 
ATOM   3993 C CD  . PRO B 1 178 ? 28.050 41.541 33.607  1.00 24.88 ? 184 PRO B CD  1 
ATOM   3994 N N   . GLN B 1 179 ? 31.448 43.361 33.658  1.00 26.77 ? 185 GLN B N   1 
ATOM   3995 C CA  . GLN B 1 179 ? 32.663 44.120 33.370  1.00 28.19 ? 185 GLN B CA  1 
ATOM   3996 C C   . GLN B 1 179 ? 32.759 45.468 34.080  1.00 27.46 ? 185 GLN B C   1 
ATOM   3997 O O   . GLN B 1 179 ? 33.843 46.031 34.194  1.00 25.98 ? 185 GLN B O   1 
ATOM   3998 C CB  . GLN B 1 179 ? 32.799 44.321 31.858  1.00 31.55 ? 185 GLN B CB  1 
ATOM   3999 C CG  . GLN B 1 179 ? 33.108 43.025 31.124  1.00 37.21 ? 185 GLN B CG  1 
ATOM   4000 C CD  . GLN B 1 179 ? 32.825 43.100 29.646  1.00 41.77 ? 185 GLN B CD  1 
ATOM   4001 O OE1 . GLN B 1 179 ? 31.684 43.300 29.232  1.00 45.73 ? 185 GLN B OE1 1 
ATOM   4002 N NE2 . GLN B 1 179 ? 33.865 42.933 28.834  1.00 45.89 ? 185 GLN B NE2 1 
ATOM   4003 N N   . ASN B 1 180 ? 31.627 45.982 34.552  1.00 28.15 ? 186 ASN B N   1 
ATOM   4004 C CA  . ASN B 1 180 ? 31.605 47.267 35.246  1.00 27.50 ? 186 ASN B CA  1 
ATOM   4005 C C   . ASN B 1 180 ? 31.483 47.137 36.760  1.00 26.13 ? 186 ASN B C   1 
ATOM   4006 O O   . ASN B 1 180 ? 31.196 48.114 37.445  1.00 25.83 ? 186 ASN B O   1 
ATOM   4007 C CB  . ASN B 1 180 ? 30.461 48.142 34.715  1.00 27.86 ? 186 ASN B CB  1 
ATOM   4008 C CG  . ASN B 1 180 ? 30.728 48.640 33.317  1.00 29.46 ? 186 ASN B CG  1 
ATOM   4009 O OD1 . ASN B 1 180 ? 31.882 48.783 32.921  1.00 31.98 ? 186 ASN B OD1 1 
ATOM   4010 N ND2 . ASN B 1 180 ? 29.670 48.924 32.566  1.00 29.13 ? 186 ASN B ND2 1 
ATOM   4011 N N   . LEU B 1 181 ? 31.706 45.930 37.272  1.00 25.38 ? 187 LEU B N   1 
ATOM   4012 C CA  . LEU B 1 181 ? 31.636 45.668 38.705  1.00 25.94 ? 187 LEU B CA  1 
ATOM   4013 C C   . LEU B 1 181 ? 33.030 45.260 39.169  1.00 27.08 ? 187 LEU B C   1 
ATOM   4014 O O   . LEU B 1 181 ? 33.481 44.149 38.900  1.00 27.60 ? 187 LEU B O   1 
ATOM   4015 C CB  . LEU B 1 181 ? 30.629 44.547 38.990  1.00 24.82 ? 187 LEU B CB  1 
ATOM   4016 C CG  . LEU B 1 181 ? 29.239 44.803 38.399  1.00 26.35 ? 187 LEU B CG  1 
ATOM   4017 C CD1 . LEU B 1 181 ? 28.321 43.606 38.645  1.00 24.19 ? 187 LEU B CD1 1 
ATOM   4018 C CD2 . LEU B 1 181 ? 28.664 46.072 39.014  1.00 25.48 ? 187 LEU B CD2 1 
ATOM   4019 N N   . LEU B 1 182 ? 33.713 46.176 39.848  1.00 27.80 ? 188 LEU B N   1 
ATOM   4020 C CA  . LEU B 1 182 ? 35.067 45.933 40.335  1.00 28.90 ? 188 LEU B CA  1 
ATOM   4021 C C   . LEU B 1 182 ? 35.044 45.195 41.671  1.00 29.35 ? 188 LEU B C   1 
ATOM   4022 O O   . LEU B 1 182 ? 34.148 45.404 42.488  1.00 28.81 ? 188 LEU B O   1 
ATOM   4023 C CB  . LEU B 1 182 ? 35.804 47.258 40.489  1.00 29.32 ? 188 LEU B CB  1 
ATOM   4024 C CG  . LEU B 1 182 ? 35.782 48.150 39.245  1.00 31.50 ? 188 LEU B CG  1 
ATOM   4025 C CD1 . LEU B 1 182 ? 36.547 49.427 39.543  1.00 30.67 ? 188 LEU B CD1 1 
ATOM   4026 C CD2 . LEU B 1 182 ? 36.400 47.415 38.058  1.00 31.72 ? 188 LEU B CD2 1 
ATOM   4027 N N   . LEU B 1 183 ? 36.042 44.343 41.884  1.00 30.73 ? 189 LEU B N   1 
ATOM   4028 C CA  . LEU B 1 183 ? 36.133 43.544 43.105  1.00 32.43 ? 189 LEU B CA  1 
ATOM   4029 C C   . LEU B 1 183 ? 37.533 43.502 43.694  1.00 32.82 ? 189 LEU B C   1 
ATOM   4030 O O   . LEU B 1 183 ? 38.520 43.432 42.965  1.00 29.33 ? 189 LEU B O   1 
ATOM   4031 C CB  . LEU B 1 183 ? 35.743 42.091 42.820  1.00 33.30 ? 189 LEU B CB  1 
ATOM   4032 C CG  . LEU B 1 183 ? 34.411 41.745 42.166  1.00 36.03 ? 189 LEU B CG  1 
ATOM   4033 C CD1 . LEU B 1 183 ? 34.468 40.308 41.674  1.00 32.31 ? 189 LEU B CD1 1 
ATOM   4034 C CD2 . LEU B 1 183 ? 33.271 41.955 43.163  1.00 36.13 ? 189 LEU B CD2 1 
ATOM   4035 N N   . ASP B 1 184 ? 37.605 43.530 45.020  1.00 34.04 ? 190 ASP B N   1 
ATOM   4036 C CA  . ASP B 1 184 ? 38.881 43.406 45.700  1.00 36.93 ? 190 ASP B CA  1 
ATOM   4037 C C   . ASP B 1 184 ? 38.835 41.990 46.262  1.00 37.33 ? 190 ASP B C   1 
ATOM   4038 O O   . ASP B 1 184 ? 38.046 41.690 47.157  1.00 35.80 ? 190 ASP B O   1 
ATOM   4039 C CB  . ASP B 1 184 ? 39.026 44.419 46.832  1.00 38.39 ? 190 ASP B CB  1 
ATOM   4040 C CG  . ASP B 1 184 ? 40.366 44.309 47.537  1.00 40.91 ? 190 ASP B CG  1 
ATOM   4041 O OD1 . ASP B 1 184 ? 40.603 43.292 48.219  1.00 43.40 ? 190 ASP B OD1 1 
ATOM   4042 O OD2 . ASP B 1 184 ? 41.190 45.234 47.401  1.00 42.76 ? 190 ASP B OD2 1 
ATOM   4043 N N   . PRO B 1 185 ? 39.670 41.097 45.718  1.00 39.82 ? 191 PRO B N   1 
ATOM   4044 C CA  . PRO B 1 185 ? 39.777 39.688 46.110  1.00 41.61 ? 191 PRO B CA  1 
ATOM   4045 C C   . PRO B 1 185 ? 39.916 39.437 47.610  1.00 41.96 ? 191 PRO B C   1 
ATOM   4046 O O   . PRO B 1 185 ? 39.328 38.499 48.147  1.00 42.96 ? 191 PRO B O   1 
ATOM   4047 C CB  . PRO B 1 185 ? 41.009 39.212 45.340  1.00 42.09 ? 191 PRO B CB  1 
ATOM   4048 C CG  . PRO B 1 185 ? 40.976 40.065 44.106  1.00 42.04 ? 191 PRO B CG  1 
ATOM   4049 C CD  . PRO B 1 185 ? 40.664 41.422 44.678  1.00 40.66 ? 191 PRO B CD  1 
ATOM   4050 N N   . ASP B 1 186 ? 40.685 40.284 48.282  1.00 42.32 ? 192 ASP B N   1 
ATOM   4051 C CA  . ASP B 1 186 ? 40.932 40.127 49.709  1.00 42.77 ? 192 ASP B CA  1 
ATOM   4052 C C   . ASP B 1 186 ? 39.826 40.642 50.632  1.00 42.61 ? 192 ASP B C   1 
ATOM   4053 O O   . ASP B 1 186 ? 39.371 39.916 51.520  1.00 43.41 ? 192 ASP B O   1 
ATOM   4054 C CB  . ASP B 1 186 ? 42.260 40.802 50.072  1.00 45.04 ? 192 ASP B CB  1 
ATOM   4055 C CG  . ASP B 1 186 ? 43.462 40.143 49.395  1.00 48.06 ? 192 ASP B CG  1 
ATOM   4056 O OD1 . ASP B 1 186 ? 44.562 40.739 49.421  1.00 49.57 ? 192 ASP B OD1 1 
ATOM   4057 O OD2 . ASP B 1 186 ? 43.314 39.029 48.842  1.00 48.33 ? 192 ASP B OD2 1 
ATOM   4058 N N   . THR B 1 187 ? 39.394 41.884 50.416  1.00 40.77 ? 193 THR B N   1 
ATOM   4059 C CA  . THR B 1 187 ? 38.369 42.504 51.256  1.00 37.34 ? 193 THR B CA  1 
ATOM   4060 C C   . THR B 1 187 ? 36.923 42.234 50.848  1.00 35.49 ? 193 THR B C   1 
ATOM   4061 O O   . THR B 1 187 ? 35.996 42.549 51.594  1.00 34.46 ? 193 THR B O   1 
ATOM   4062 C CB  . THR B 1 187 ? 38.575 44.034 51.327  1.00 38.52 ? 193 THR B CB  1 
ATOM   4063 O OG1 . THR B 1 187 ? 38.425 44.602 50.019  1.00 39.35 ? 193 THR B OG1 1 
ATOM   4064 C CG2 . THR B 1 187 ? 39.967 44.358 51.854  1.00 37.98 ? 193 THR B CG2 1 
ATOM   4065 N N   . ALA B 1 188 ? 36.729 41.663 49.666  1.00 33.12 ? 194 ALA B N   1 
ATOM   4066 C CA  . ALA B 1 188 ? 35.392 41.347 49.175  1.00 32.09 ? 194 ALA B CA  1 
ATOM   4067 C C   . ALA B 1 188 ? 34.569 42.605 48.897  1.00 30.92 ? 194 ALA B C   1 
ATOM   4068 O O   . ALA B 1 188 ? 33.342 42.557 48.813  1.00 29.50 ? 194 ALA B O   1 
ATOM   4069 C CB  . ALA B 1 188 ? 34.662 40.449 50.171  1.00 32.20 ? 194 ALA B CB  1 
ATOM   4070 N N   . VAL B 1 189 ? 35.254 43.734 48.762  1.00 30.10 ? 195 VAL B N   1 
ATOM   4071 C CA  . VAL B 1 189 ? 34.582 44.989 48.467  1.00 30.38 ? 195 VAL B CA  1 
ATOM   4072 C C   . VAL B 1 189 ? 34.276 45.074 46.977  1.00 30.03 ? 195 VAL B C   1 
ATOM   4073 O O   . VAL B 1 189 ? 35.121 44.755 46.143  1.00 30.17 ? 195 VAL B O   1 
ATOM   4074 C CB  . VAL B 1 189 ? 35.455 46.202 48.854  1.00 31.81 ? 195 VAL B CB  1 
ATOM   4075 C CG1 . VAL B 1 189 ? 34.872 47.479 48.261  1.00 31.88 ? 195 VAL B CG1 1 
ATOM   4076 C CG2 . VAL B 1 189 ? 35.533 46.317 50.372  1.00 31.66 ? 195 VAL B CG2 1 
ATOM   4077 N N   . LEU B 1 190 ? 33.057 45.486 46.647  1.00 29.40 ? 196 LEU B N   1 
ATOM   4078 C CA  . LEU B 1 190 ? 32.666 45.649 45.257  1.00 28.13 ? 196 LEU B CA  1 
ATOM   4079 C C   . LEU B 1 190 ? 32.430 47.126 45.007  1.00 28.69 ? 196 LEU B C   1 
ATOM   4080 O O   . LEU B 1 190 ? 31.870 47.831 45.851  1.00 28.22 ? 196 LEU B O   1 
ATOM   4081 C CB  . LEU B 1 190 ? 31.388 44.862 44.938  1.00 27.27 ? 196 LEU B CB  1 
ATOM   4082 C CG  . LEU B 1 190 ? 30.812 45.088 43.529  1.00 27.66 ? 196 LEU B CG  1 
ATOM   4083 C CD1 . LEU B 1 190 ? 30.102 43.832 43.031  1.00 27.14 ? 196 LEU B CD1 1 
ATOM   4084 C CD2 . LEU B 1 190 ? 29.854 46.284 43.549  1.00 26.79 ? 196 LEU B CD2 1 
ATOM   4085 N N   . LYS B 1 191 ? 32.868 47.594 43.846  1.00 28.86 ? 197 LYS B N   1 
ATOM   4086 C CA  . LYS B 1 191 ? 32.681 48.986 43.473  1.00 28.18 ? 197 LYS B CA  1 
ATOM   4087 C C   . LYS B 1 191 ? 32.174 49.069 42.039  1.00 28.17 ? 197 LYS B C   1 
ATOM   4088 O O   . LYS B 1 191 ? 32.677 48.379 41.145  1.00 26.17 ? 197 LYS B O   1 
ATOM   4089 C CB  . LYS B 1 191 ? 33.992 49.768 43.609  1.00 28.38 ? 197 LYS B CB  1 
ATOM   4090 C CG  . LYS B 1 191 ? 34.463 49.951 45.044  1.00 28.46 ? 197 LYS B CG  1 
ATOM   4091 C CD  . LYS B 1 191 ? 35.715 50.817 45.108  1.00 30.95 ? 197 LYS B CD  1 
ATOM   4092 C CE  . LYS B 1 191 ? 36.149 51.056 46.552  1.00 31.61 ? 197 LYS B CE  1 
ATOM   4093 N NZ  . LYS B 1 191 ? 37.297 51.996 46.599  1.00 36.79 ? 197 LYS B NZ  1 
ATOM   4094 N N   . LEU B 1 192 ? 31.157 49.901 41.839  1.00 27.70 ? 198 LEU B N   1 
ATOM   4095 C CA  . LEU B 1 192 ? 30.569 50.120 40.523  1.00 27.83 ? 198 LEU B CA  1 
ATOM   4096 C C   . LEU B 1 192 ? 31.430 51.142 39.780  1.00 28.97 ? 198 LEU B C   1 
ATOM   4097 O O   . LEU B 1 192 ? 31.904 52.107 40.383  1.00 28.83 ? 198 LEU B O   1 
ATOM   4098 C CB  . LEU B 1 192 ? 29.136 50.646 40.696  1.00 27.45 ? 198 LEU B CB  1 
ATOM   4099 C CG  . LEU B 1 192 ? 28.281 50.955 39.468  1.00 28.43 ? 198 LEU B CG  1 
ATOM   4100 C CD1 . LEU B 1 192 ? 28.134 49.708 38.600  1.00 27.85 ? 198 LEU B CD1 1 
ATOM   4101 C CD2 . LEU B 1 192 ? 26.911 51.457 39.930  1.00 25.92 ? 198 LEU B CD2 1 
ATOM   4102 N N   . CYS B 1 193 ? 31.655 50.923 38.484  1.00 27.38 ? 199 CYS B N   1 
ATOM   4103 C CA  . CYS B 1 193 ? 32.447 51.854 37.689  1.00 28.86 ? 199 CYS B CA  1 
ATOM   4104 C C   . CYS B 1 193 ? 31.828 52.070 36.307  1.00 28.65 ? 199 CYS B C   1 
ATOM   4105 O O   . CYS B 1 193 ? 30.768 51.533 36.003  1.00 28.09 ? 199 CYS B O   1 
ATOM   4106 C CB  . CYS B 1 193 ? 33.884 51.355 37.530  1.00 29.90 ? 199 CYS B CB  1 
ATOM   4107 S SG  . CYS B 1 193 ? 34.093 49.896 36.475  1.00 36.68 ? 199 CYS B SG  1 
ATOM   4108 N N   . ASP B 1 194 ? 32.516 52.859 35.491  1.00 29.51 ? 200 ASP B N   1 
ATOM   4109 C CA  . ASP B 1 194 ? 32.105 53.215 34.129  1.00 30.98 ? 200 ASP B CA  1 
ATOM   4110 C C   . ASP B 1 194 ? 30.755 53.912 34.060  1.00 30.60 ? 200 ASP B C   1 
ATOM   4111 O O   . ASP B 1 194 ? 29.739 53.297 33.724  1.00 30.65 ? 200 ASP B O   1 
ATOM   4112 C CB  . ASP B 1 194 ? 32.075 51.992 33.202  1.00 32.20 ? 200 ASP B CB  1 
ATOM   4113 C CG  . ASP B 1 194 ? 32.053 52.386 31.719  1.00 37.20 ? 200 ASP B CG  1 
ATOM   4114 O OD1 . ASP B 1 194 ? 31.606 53.511 31.405  1.00 36.29 ? 200 ASP B OD1 1 
ATOM   4115 O OD2 . ASP B 1 194 ? 32.476 51.572 30.868  1.00 39.04 ? 200 ASP B OD2 1 
ATOM   4116 N N   . PHE B 1 195 ? 30.753 55.207 34.363  1.00 29.70 ? 201 PHE B N   1 
ATOM   4117 C CA  . PHE B 1 195 ? 29.531 55.996 34.316  1.00 29.17 ? 201 PHE B CA  1 
ATOM   4118 C C   . PHE B 1 195 ? 29.365 56.711 32.972  1.00 29.57 ? 201 PHE B C   1 
ATOM   4119 O O   . PHE B 1 195 ? 28.719 57.755 32.881  1.00 30.03 ? 201 PHE B O   1 
ATOM   4120 C CB  . PHE B 1 195 ? 29.518 56.993 35.477  1.00 29.36 ? 201 PHE B CB  1 
ATOM   4121 C CG  . PHE B 1 195 ? 29.226 56.351 36.805  1.00 29.56 ? 201 PHE B CG  1 
ATOM   4122 C CD1 . PHE B 1 195 ? 30.166 55.525 37.416  1.00 29.14 ? 201 PHE B CD1 1 
ATOM   4123 C CD2 . PHE B 1 195 ? 27.983 56.507 37.405  1.00 28.40 ? 201 PHE B CD2 1 
ATOM   4124 C CE1 . PHE B 1 195 ? 29.868 54.857 38.607  1.00 29.05 ? 201 PHE B CE1 1 
ATOM   4125 C CE2 . PHE B 1 195 ? 27.674 55.844 38.594  1.00 30.05 ? 201 PHE B CE2 1 
ATOM   4126 C CZ  . PHE B 1 195 ? 28.620 55.016 39.195  1.00 28.24 ? 201 PHE B CZ  1 
ATOM   4127 N N   . GLY B 1 196 ? 29.931 56.115 31.928  1.00 29.33 ? 202 GLY B N   1 
ATOM   4128 C CA  . GLY B 1 196 ? 29.861 56.687 30.594  1.00 30.20 ? 202 GLY B CA  1 
ATOM   4129 C C   . GLY B 1 196 ? 28.488 56.669 29.946  1.00 31.48 ? 202 GLY B C   1 
ATOM   4130 O O   . GLY B 1 196 ? 28.274 57.346 28.944  1.00 32.19 ? 202 GLY B O   1 
ATOM   4131 N N   . SER B 1 197 ? 27.566 55.885 30.496  1.00 30.60 ? 203 SER B N   1 
ATOM   4132 C CA  . SER B 1 197 ? 26.209 55.810 29.967  1.00 30.81 ? 203 SER B CA  1 
ATOM   4133 C C   . SER B 1 197 ? 25.219 56.387 30.977  1.00 30.46 ? 203 SER B C   1 
ATOM   4134 O O   . SER B 1 197 ? 24.042 56.593 30.663  1.00 30.37 ? 203 SER B O   1 
ATOM   4135 C CB  . SER B 1 197 ? 25.828 54.357 29.676  1.00 31.02 ? 203 SER B CB  1 
ATOM   4136 O OG  . SER B 1 197 ? 26.673 53.787 28.696  1.00 33.72 ? 203 SER B OG  1 
ATOM   4137 N N   . ALA B 1 198 ? 25.706 56.650 32.187  1.00 30.40 ? 204 ALA B N   1 
ATOM   4138 C CA  . ALA B 1 198 ? 24.868 57.169 33.266  1.00 30.57 ? 204 ALA B CA  1 
ATOM   4139 C C   . ALA B 1 198 ? 24.175 58.471 32.908  1.00 32.34 ? 204 ALA B C   1 
ATOM   4140 O O   . ALA B 1 198 ? 24.743 59.321 32.222  1.00 31.55 ? 204 ALA B O   1 
ATOM   4141 C CB  . ALA B 1 198 ? 25.699 57.356 34.528  1.00 28.61 ? 204 ALA B CB  1 
ATOM   4142 N N   . LYS B 1 199 ? 22.947 58.627 33.390  1.00 33.39 ? 205 LYS B N   1 
ATOM   4143 C CA  . LYS B 1 199 ? 22.186 59.833 33.118  1.00 36.13 ? 205 LYS B CA  1 
ATOM   4144 C C   . LYS B 1 199 ? 21.069 60.091 34.120  1.00 36.39 ? 205 LYS B C   1 
ATOM   4145 O O   . LYS B 1 199 ? 20.456 59.163 34.655  1.00 36.03 ? 205 LYS B O   1 
ATOM   4146 C CB  . LYS B 1 199 ? 21.589 59.770 31.708  1.00 37.53 ? 205 LYS B CB  1 
ATOM   4147 C CG  . LYS B 1 199 ? 20.901 61.052 31.286  1.00 40.23 ? 205 LYS B CG  1 
ATOM   4148 C CD  . LYS B 1 199 ? 20.196 60.896 29.953  1.00 43.21 ? 205 LYS B CD  1 
ATOM   4149 C CE  . LYS B 1 199 ? 19.443 62.171 29.588  1.00 44.28 ? 205 LYS B CE  1 
ATOM   4150 N NZ  . LYS B 1 199 ? 18.741 62.018 28.290  1.00 47.98 ? 205 LYS B NZ  1 
ATOM   4151 N N   . GLN B 1 200 ? 20.817 61.370 34.364  1.00 38.35 ? 206 GLN B N   1 
ATOM   4152 C CA  . GLN B 1 200 ? 19.761 61.806 35.263  1.00 40.26 ? 206 GLN B CA  1 
ATOM   4153 C C   . GLN B 1 200 ? 18.452 61.622 34.504  1.00 40.17 ? 206 GLN B C   1 
ATOM   4154 O O   . GLN B 1 200 ? 18.192 62.325 33.532  1.00 40.75 ? 206 GLN B O   1 
ATOM   4155 C CB  . GLN B 1 200 ? 19.976 63.281 35.610  1.00 43.49 ? 206 GLN B CB  1 
ATOM   4156 C CG  . GLN B 1 200 ? 18.759 64.021 36.156  1.00 48.53 ? 206 GLN B CG  1 
ATOM   4157 C CD  . GLN B 1 200 ? 18.693 64.015 37.665  1.00 50.75 ? 206 GLN B CD  1 
ATOM   4158 O OE1 . GLN B 1 200 ? 19.685 64.294 38.338  1.00 52.60 ? 206 GLN B OE1 1 
ATOM   4159 N NE2 . GLN B 1 200 ? 17.517 63.711 38.210  1.00 52.12 ? 206 GLN B NE2 1 
ATOM   4160 N N   . LEU B 1 201 ? 17.636 60.667 34.932  1.00 40.18 ? 207 LEU B N   1 
ATOM   4161 C CA  . LEU B 1 201 ? 16.369 60.422 34.261  1.00 40.94 ? 207 LEU B CA  1 
ATOM   4162 C C   . LEU B 1 201 ? 15.284 61.307 34.844  1.00 43.22 ? 207 LEU B C   1 
ATOM   4163 O O   . LEU B 1 201 ? 15.023 61.270 36.045  1.00 43.65 ? 207 LEU B O   1 
ATOM   4164 C CB  . LEU B 1 201 ? 15.959 58.953 34.393  1.00 38.21 ? 207 LEU B CB  1 
ATOM   4165 C CG  . LEU B 1 201 ? 16.943 57.934 33.807  1.00 37.74 ? 207 LEU B CG  1 
ATOM   4166 C CD1 . LEU B 1 201 ? 16.286 56.572 33.768  1.00 35.27 ? 207 LEU B CD1 1 
ATOM   4167 C CD2 . LEU B 1 201 ? 17.367 58.357 32.405  1.00 34.88 ? 207 LEU B CD2 1 
ATOM   4168 N N   . VAL B 1 202 ? 14.662 62.106 33.984  1.00 44.62 ? 208 VAL B N   1 
ATOM   4169 C CA  . VAL B 1 202 ? 13.595 63.008 34.399  1.00 46.62 ? 208 VAL B CA  1 
ATOM   4170 C C   . VAL B 1 202 ? 12.288 62.579 33.754  1.00 47.39 ? 208 VAL B C   1 
ATOM   4171 O O   . VAL B 1 202 ? 12.203 62.453 32.533  1.00 47.58 ? 208 VAL B O   1 
ATOM   4172 C CB  . VAL B 1 202 ? 13.892 64.462 33.984  1.00 46.59 ? 208 VAL B CB  1 
ATOM   4173 C CG1 . VAL B 1 202 ? 12.765 65.377 34.450  1.00 46.81 ? 208 VAL B CG1 1 
ATOM   4174 C CG2 . VAL B 1 202 ? 15.217 64.906 34.573  1.00 46.68 ? 208 VAL B CG2 1 
ATOM   4175 N N   . ARG B 1 203 ? 11.275 62.351 34.581  1.00 49.41 ? 209 ARG B N   1 
ATOM   4176 C CA  . ARG B 1 203 ? 9.965  61.933 34.100  1.00 51.53 ? 209 ARG B CA  1 
ATOM   4177 C C   . ARG B 1 203 ? 9.483  62.873 32.999  1.00 51.55 ? 209 ARG B C   1 
ATOM   4178 O O   . ARG B 1 203 ? 9.608  64.093 33.111  1.00 51.59 ? 209 ARG B O   1 
ATOM   4179 C CB  . ARG B 1 203 ? 8.969  61.922 35.260  1.00 53.93 ? 209 ARG B CB  1 
ATOM   4180 C CG  . ARG B 1 203 ? 7.668  61.209 34.959  1.00 57.75 ? 209 ARG B CG  1 
ATOM   4181 C CD  . ARG B 1 203 ? 6.917  60.922 36.250  1.00 61.49 ? 209 ARG B CD  1 
ATOM   4182 N NE  . ARG B 1 203 ? 5.786  60.020 36.040  1.00 64.34 ? 209 ARG B NE  1 
ATOM   4183 C CZ  . ARG B 1 203 ? 5.098  59.445 37.024  1.00 65.59 ? 209 ARG B CZ  1 
ATOM   4184 N NH1 . ARG B 1 203 ? 5.423  59.676 38.290  1.00 66.22 ? 209 ARG B NH1 1 
ATOM   4185 N NH2 . ARG B 1 203 ? 4.088  58.632 36.743  1.00 66.21 ? 209 ARG B NH2 1 
ATOM   4186 N N   . GLY B 1 204 ? 8.947  62.298 31.928  1.00 50.96 ? 210 GLY B N   1 
ATOM   4187 C CA  . GLY B 1 204 ? 8.465  63.107 30.826  1.00 50.79 ? 210 GLY B CA  1 
ATOM   4188 C C   . GLY B 1 204 ? 9.503  63.333 29.742  1.00 50.76 ? 210 GLY B C   1 
ATOM   4189 O O   . GLY B 1 204 ? 9.156  63.681 28.614  1.00 51.83 ? 210 GLY B O   1 
ATOM   4190 N N   . GLU B 1 205 ? 10.777 63.139 30.070  1.00 49.95 ? 211 GLU B N   1 
ATOM   4191 C CA  . GLU B 1 205 ? 11.840 63.338 29.089  1.00 49.18 ? 211 GLU B CA  1 
ATOM   4192 C C   . GLU B 1 205 ? 12.257 62.009 28.460  1.00 47.37 ? 211 GLU B C   1 
ATOM   4193 O O   . GLU B 1 205 ? 12.465 61.015 29.160  1.00 47.31 ? 211 GLU B O   1 
ATOM   4194 C CB  . GLU B 1 205 ? 13.051 63.997 29.746  1.00 51.16 ? 211 GLU B CB  1 
ATOM   4195 C CG  . GLU B 1 205 ? 12.693 65.100 30.720  1.00 54.42 ? 211 GLU B CG  1 
ATOM   4196 C CD  . GLU B 1 205 ? 13.885 65.961 31.081  1.00 55.88 ? 211 GLU B CD  1 
ATOM   4197 O OE1 . GLU B 1 205 ? 14.996 65.409 31.238  1.00 56.81 ? 211 GLU B OE1 1 
ATOM   4198 O OE2 . GLU B 1 205 ? 13.707 67.190 31.216  1.00 57.26 ? 211 GLU B OE2 1 
ATOM   4199 N N   . PRO B 1 206 ? 12.374 61.973 27.124  1.00 45.15 ? 212 PRO B N   1 
ATOM   4200 C CA  . PRO B 1 206 ? 12.765 60.758 26.402  1.00 42.75 ? 212 PRO B CA  1 
ATOM   4201 C C   . PRO B 1 206 ? 14.247 60.431 26.549  1.00 39.76 ? 212 PRO B C   1 
ATOM   4202 O O   . PRO B 1 206 ? 15.083 61.325 26.674  1.00 38.95 ? 212 PRO B O   1 
ATOM   4203 C CB  . PRO B 1 206 ? 12.412 61.086 24.946  1.00 43.78 ? 212 PRO B CB  1 
ATOM   4204 C CG  . PRO B 1 206 ? 11.368 62.157 25.064  1.00 45.85 ? 212 PRO B CG  1 
ATOM   4205 C CD  . PRO B 1 206 ? 11.913 63.002 26.180  1.00 45.27 ? 212 PRO B CD  1 
ATOM   4206 N N   . ASN B 1 207 ? 14.564 59.144 26.526  1.00 37.55 ? 213 ASN B N   1 
ATOM   4207 C CA  . ASN B 1 207 ? 15.947 58.702 26.617  1.00 34.91 ? 213 ASN B CA  1 
ATOM   4208 C C   . ASN B 1 207 ? 16.185 57.597 25.589  1.00 33.53 ? 213 ASN B C   1 
ATOM   4209 O O   . ASN B 1 207 ? 15.300 56.785 25.339  1.00 32.82 ? 213 ASN B O   1 
ATOM   4210 C CB  . ASN B 1 207 ? 16.241 58.214 28.034  1.00 34.06 ? 213 ASN B CB  1 
ATOM   4211 C CG  . ASN B 1 207 ? 16.266 59.352 29.034  1.00 34.74 ? 213 ASN B CG  1 
ATOM   4212 O OD1 . ASN B 1 207 ? 17.135 60.225 28.979  1.00 36.86 ? 213 ASN B OD1 1 
ATOM   4213 N ND2 . ASN B 1 207 ? 15.306 59.359 29.940  1.00 35.61 ? 213 ASN B ND2 1 
ATOM   4214 N N   . VAL B 1 208 ? 17.374 57.572 24.991  1.00 33.55 ? 214 VAL B N   1 
ATOM   4215 C CA  . VAL B 1 208 ? 17.687 56.562 23.979  1.00 33.79 ? 214 VAL B CA  1 
ATOM   4216 C C   . VAL B 1 208 ? 17.539 55.150 24.525  1.00 33.76 ? 214 VAL B C   1 
ATOM   4217 O O   . VAL B 1 208 ? 17.871 54.874 25.673  1.00 33.82 ? 214 VAL B O   1 
ATOM   4218 C CB  . VAL B 1 208 ? 19.113 56.736 23.409  1.00 34.19 ? 214 VAL B CB  1 
ATOM   4219 C CG1 . VAL B 1 208 ? 19.273 58.142 22.850  1.00 32.99 ? 214 VAL B CG1 1 
ATOM   4220 C CG2 . VAL B 1 208 ? 20.154 56.437 24.474  1.00 33.37 ? 214 VAL B CG2 1 
ATOM   4221 N N   . SER B 1 209 ? 17.030 54.249 23.698  1.00 33.64 ? 215 SER B N   1 
ATOM   4222 C CA  . SER B 1 209 ? 16.830 52.881 24.144  1.00 33.41 ? 215 SER B CA  1 
ATOM   4223 C C   . SER B 1 209 ? 17.965 51.957 23.731  1.00 31.83 ? 215 SER B C   1 
ATOM   4224 O O   . SER B 1 209 ? 17.918 50.763 23.999  1.00 33.22 ? 215 SER B O   1 
ATOM   4225 C CB  . SER B 1 209 ? 15.498 52.350 23.603  1.00 33.58 ? 215 SER B CB  1 
ATOM   4226 O OG  . SER B 1 209 ? 15.464 52.445 22.192  1.00 38.76 ? 215 SER B OG  1 
ATOM   4227 N N   . TYR B 1 210 ? 18.998 52.506 23.101  1.00 30.83 ? 216 TYR B N   1 
ATOM   4228 C CA  . TYR B 1 210 ? 20.101 51.672 22.657  1.00 30.81 ? 216 TYR B CA  1 
ATOM   4229 C C   . TYR B 1 210 ? 21.307 51.630 23.587  1.00 29.97 ? 216 TYR B C   1 
ATOM   4230 O O   . TYR B 1 210 ? 22.410 51.282 23.172  1.00 30.32 ? 216 TYR B O   1 
ATOM   4231 C CB  . TYR B 1 210 ? 20.521 52.063 21.238  1.00 30.65 ? 216 TYR B CB  1 
ATOM   4232 C CG  . TYR B 1 210 ? 20.769 53.533 21.028  1.00 31.72 ? 216 TYR B CG  1 
ATOM   4233 C CD1 . TYR B 1 210 ? 21.981 54.115 21.388  1.00 31.80 ? 216 TYR B CD1 1 
ATOM   4234 C CD2 . TYR B 1 210 ? 19.797 54.338 20.439  1.00 33.22 ? 216 TYR B CD2 1 
ATOM   4235 C CE1 . TYR B 1 210 ? 22.224 55.460 21.160  1.00 32.96 ? 216 TYR B CE1 1 
ATOM   4236 C CE2 . TYR B 1 210 ? 20.028 55.683 20.209  1.00 34.52 ? 216 TYR B CE2 1 
ATOM   4237 C CZ  . TYR B 1 210 ? 21.243 56.235 20.566  1.00 34.35 ? 216 TYR B CZ  1 
ATOM   4238 O OH  . TYR B 1 210 ? 21.478 57.560 20.300  1.00 38.39 ? 216 TYR B OH  1 
ATOM   4239 N N   . ILE B 1 211 ? 21.094 51.988 24.849  1.00 29.43 ? 217 ILE B N   1 
ATOM   4240 C CA  . ILE B 1 211 ? 22.167 51.899 25.825  1.00 28.30 ? 217 ILE B CA  1 
ATOM   4241 C C   . ILE B 1 211 ? 22.040 50.519 26.466  1.00 27.44 ? 217 ILE B C   1 
ATOM   4242 O O   . ILE B 1 211 ? 21.119 49.767 26.148  1.00 27.18 ? 217 ILE B O   1 
ATOM   4243 C CB  . ILE B 1 211 ? 22.075 53.015 26.922  1.00 28.45 ? 217 ILE B CB  1 
ATOM   4244 C CG1 . ILE B 1 211 ? 20.620 53.319 27.296  1.00 26.72 ? 217 ILE B CG1 1 
ATOM   4245 C CG2 . ILE B 1 211 ? 22.774 54.268 26.425  1.00 28.10 ? 217 ILE B CG2 1 
ATOM   4246 C CD1 . ILE B 1 211 ? 19.880 52.202 28.001  1.00 26.78 ? 217 ILE B CD1 1 
ATOM   4247 N N   . CYS B 1 212 ? 22.970 50.190 27.356  1.00 28.84 ? 218 CYS B N   1 
ATOM   4248 C CA  . CYS B 1 212 ? 22.989 48.912 28.059  1.00 28.78 ? 218 CYS B CA  1 
ATOM   4249 C C   . CYS B 1 212 ? 23.464 47.787 27.136  1.00 30.28 ? 218 CYS B C   1 
ATOM   4250 O O   . CYS B 1 212 ? 23.043 47.693 25.987  1.00 29.77 ? 218 CYS B O   1 
ATOM   4251 C CB  . CYS B 1 212 ? 21.614 48.584 28.635  1.00 28.67 ? 218 CYS B CB  1 
ATOM   4252 S SG  . CYS B 1 212 ? 21.700 47.319 29.926  1.00 33.28 ? 218 CYS B SG  1 
ATOM   4253 N N   . SER B 1 213 ? 24.343 46.938 27.658  1.00 29.68 ? 219 SER B N   1 
ATOM   4254 C CA  . SER B 1 213 ? 24.926 45.843 26.893  1.00 30.54 ? 219 SER B CA  1 
ATOM   4255 C C   . SER B 1 213 ? 24.052 44.604 26.731  1.00 29.86 ? 219 SER B C   1 
ATOM   4256 O O   . SER B 1 213 ? 23.311 44.222 27.640  1.00 26.63 ? 219 SER B O   1 
ATOM   4257 C CB  . SER B 1 213 ? 26.257 45.454 27.529  1.00 31.85 ? 219 SER B CB  1 
ATOM   4258 O OG  . SER B 1 213 ? 27.105 46.592 27.586  1.00 36.46 ? 219 SER B OG  1 
ATOM   4259 N N   . ARG B 1 214 ? 24.167 43.966 25.569  1.00 32.23 ? 220 ARG B N   1 
ATOM   4260 C CA  . ARG B 1 214 ? 23.390 42.768 25.278  1.00 34.98 ? 220 ARG B CA  1 
ATOM   4261 C C   . ARG B 1 214 ? 23.525 41.763 26.416  1.00 33.17 ? 220 ARG B C   1 
ATOM   4262 O O   . ARG B 1 214 ? 24.587 41.640 27.032  1.00 35.76 ? 220 ARG B O   1 
ATOM   4263 C CB  . ARG B 1 214 ? 23.849 42.125 23.963  1.00 40.00 ? 220 ARG B CB  1 
ATOM   4264 C CG  . ARG B 1 214 ? 25.185 41.421 24.048  1.00 46.92 ? 220 ARG B CG  1 
ATOM   4265 C CD  . ARG B 1 214 ? 25.361 40.469 22.877  1.00 53.71 ? 220 ARG B CD  1 
ATOM   4266 N NE  . ARG B 1 214 ? 26.432 39.505 23.123  1.00 58.54 ? 220 ARG B NE  1 
ATOM   4267 C CZ  . ARG B 1 214 ? 26.712 38.481 22.324  1.00 60.48 ? 220 ARG B CZ  1 
ATOM   4268 N NH1 . ARG B 1 214 ? 26.000 38.281 21.220  1.00 62.03 ? 220 ARG B NH1 1 
ATOM   4269 N NH2 . ARG B 1 214 ? 27.704 37.655 22.627  1.00 61.37 ? 220 ARG B NH2 1 
ATOM   4270 N N   . TYR B 1 215 ? 22.437 41.048 26.665  1.00 31.63 ? 221 TYR B N   1 
ATOM   4271 C CA  . TYR B 1 215 ? 22.321 40.055 27.731  1.00 31.05 ? 221 TYR B CA  1 
ATOM   4272 C C   . TYR B 1 215 ? 21.732 40.695 28.985  1.00 29.08 ? 221 TYR B C   1 
ATOM   4273 O O   . TYR B 1 215 ? 20.947 40.065 29.693  1.00 29.92 ? 221 TYR B O   1 
ATOM   4274 C CB  . TYR B 1 215 ? 23.672 39.436 28.114  1.00 34.13 ? 221 TYR B CB  1 
ATOM   4275 C CG  . TYR B 1 215 ? 24.333 38.562 27.065  1.00 37.24 ? 221 TYR B CG  1 
ATOM   4276 C CD1 . TYR B 1 215 ? 25.483 37.835 27.377  1.00 40.26 ? 221 TYR B CD1 1 
ATOM   4277 C CD2 . TYR B 1 215 ? 23.831 38.475 25.768  1.00 39.00 ? 221 TYR B CD2 1 
ATOM   4278 C CE1 . TYR B 1 215 ? 26.120 37.043 26.425  1.00 41.76 ? 221 TYR B CE1 1 
ATOM   4279 C CE2 . TYR B 1 215 ? 24.461 37.685 24.803  1.00 42.17 ? 221 TYR B CE2 1 
ATOM   4280 C CZ  . TYR B 1 215 ? 25.605 36.973 25.142  1.00 43.14 ? 221 TYR B CZ  1 
ATOM   4281 O OH  . TYR B 1 215 ? 26.231 36.183 24.204  1.00 46.71 ? 221 TYR B OH  1 
ATOM   4282 N N   . TYR B 1 216 ? 22.106 41.944 29.250  1.00 25.91 ? 222 TYR B N   1 
ATOM   4283 C CA  . TYR B 1 216 ? 21.647 42.641 30.460  1.00 26.14 ? 222 TYR B CA  1 
ATOM   4284 C C   . TYR B 1 216 ? 20.554 43.682 30.263  1.00 26.10 ? 222 TYR B C   1 
ATOM   4285 O O   . TYR B 1 216 ? 20.164 44.359 31.214  1.00 25.03 ? 222 TYR B O   1 
ATOM   4286 C CB  . TYR B 1 216 ? 22.846 43.291 31.159  1.00 25.99 ? 222 TYR B CB  1 
ATOM   4287 C CG  . TYR B 1 216 ? 23.977 42.311 31.320  1.00 26.29 ? 222 TYR B CG  1 
ATOM   4288 C CD1 . TYR B 1 216 ? 24.946 42.168 30.325  1.00 25.95 ? 222 TYR B CD1 1 
ATOM   4289 C CD2 . TYR B 1 216 ? 23.992 41.419 32.391  1.00 25.78 ? 222 TYR B CD2 1 
ATOM   4290 C CE1 . TYR B 1 216 ? 25.897 41.146 30.390  1.00 28.97 ? 222 TYR B CE1 1 
ATOM   4291 C CE2 . TYR B 1 216 ? 24.928 40.401 32.467  1.00 27.41 ? 222 TYR B CE2 1 
ATOM   4292 C CZ  . TYR B 1 216 ? 25.876 40.265 31.464  1.00 28.02 ? 222 TYR B CZ  1 
ATOM   4293 O OH  . TYR B 1 216 ? 26.780 39.234 31.528  1.00 28.67 ? 222 TYR B OH  1 
ATOM   4294 N N   . ARG B 1 217 ? 20.042 43.796 29.045  1.00 25.38 ? 223 ARG B N   1 
ATOM   4295 C CA  . ARG B 1 217 ? 19.008 44.789 28.751  1.00 26.65 ? 223 ARG B CA  1 
ATOM   4296 C C   . ARG B 1 217 ? 17.607 44.414 29.227  1.00 27.29 ? 223 ARG B C   1 
ATOM   4297 O O   . ARG B 1 217 ? 17.125 43.313 28.964  1.00 26.95 ? 223 ARG B O   1 
ATOM   4298 C CB  . ARG B 1 217 ? 18.945 45.063 27.243  1.00 28.15 ? 223 ARG B CB  1 
ATOM   4299 C CG  . ARG B 1 217 ? 20.245 45.516 26.614  1.00 29.53 ? 223 ARG B CG  1 
ATOM   4300 C CD  . ARG B 1 217 ? 20.069 45.689 25.101  1.00 34.43 ? 223 ARG B CD  1 
ATOM   4301 N NE  . ARG B 1 217 ? 19.331 46.911 24.785  1.00 39.23 ? 223 ARG B NE  1 
ATOM   4302 C CZ  . ARG B 1 217 ? 18.592 47.082 23.693  1.00 39.70 ? 223 ARG B CZ  1 
ATOM   4303 N NH1 . ARG B 1 217 ? 18.477 46.111 22.799  1.00 41.06 ? 223 ARG B NH1 1 
ATOM   4304 N NH2 . ARG B 1 217 ? 17.969 48.231 23.492  1.00 42.34 ? 223 ARG B NH2 1 
ATOM   4305 N N   . ALA B 1 218 ? 16.953 45.343 29.917  1.00 27.13 ? 224 ALA B N   1 
ATOM   4306 C CA  . ALA B 1 218 ? 15.588 45.121 30.385  1.00 27.85 ? 224 ALA B CA  1 
ATOM   4307 C C   . ALA B 1 218 ? 14.699 44.983 29.149  1.00 27.99 ? 224 ALA B C   1 
ATOM   4308 O O   . ALA B 1 218 ? 14.983 45.572 28.110  1.00 27.69 ? 224 ALA B O   1 
ATOM   4309 C CB  . ALA B 1 218 ? 15.120 46.299 31.239  1.00 27.14 ? 224 ALA B CB  1 
ATOM   4310 N N   . PRO B 1 219 ? 13.612 44.203 29.252  1.00 29.27 ? 225 PRO B N   1 
ATOM   4311 C CA  . PRO B 1 219 ? 12.687 43.991 28.133  1.00 30.31 ? 225 PRO B CA  1 
ATOM   4312 C C   . PRO B 1 219 ? 12.205 45.286 27.491  1.00 30.83 ? 225 PRO B C   1 
ATOM   4313 O O   . PRO B 1 219 ? 12.087 45.370 26.266  1.00 29.66 ? 225 PRO B O   1 
ATOM   4314 C CB  . PRO B 1 219 ? 11.531 43.226 28.773  1.00 32.16 ? 225 PRO B CB  1 
ATOM   4315 C CG  . PRO B 1 219 ? 12.167 42.513 29.906  1.00 34.04 ? 225 PRO B CG  1 
ATOM   4316 C CD  . PRO B 1 219 ? 13.128 43.528 30.467  1.00 30.75 ? 225 PRO B CD  1 
ATOM   4317 N N   . GLU B 1 220 ? 11.917 46.292 28.316  1.00 29.79 ? 226 GLU B N   1 
ATOM   4318 C CA  . GLU B 1 220 ? 11.430 47.564 27.787  1.00 30.16 ? 226 GLU B CA  1 
ATOM   4319 C C   . GLU B 1 220 ? 12.439 48.238 26.860  1.00 30.47 ? 226 GLU B C   1 
ATOM   4320 O O   . GLU B 1 220 ? 12.055 48.952 25.927  1.00 31.13 ? 226 GLU B O   1 
ATOM   4321 C CB  . GLU B 1 220 ? 11.011 48.520 28.921  1.00 28.69 ? 226 GLU B CB  1 
ATOM   4322 C CG  . GLU B 1 220 ? 12.098 48.899 29.923  1.00 31.25 ? 226 GLU B CG  1 
ATOM   4323 C CD  . GLU B 1 220 ? 12.115 48.003 31.149  1.00 30.95 ? 226 GLU B CD  1 
ATOM   4324 O OE1 . GLU B 1 220 ? 12.570 48.471 32.218  1.00 30.76 ? 226 GLU B OE1 1 
ATOM   4325 O OE2 . GLU B 1 220 ? 11.681 46.834 31.050  1.00 31.23 ? 226 GLU B OE2 1 
ATOM   4326 N N   . LEU B 1 221 ? 13.727 48.021 27.106  1.00 28.38 ? 227 LEU B N   1 
ATOM   4327 C CA  . LEU B 1 221 ? 14.747 48.595 26.235  1.00 29.25 ? 227 LEU B CA  1 
ATOM   4328 C C   . LEU B 1 221 ? 14.720 47.834 24.910  1.00 29.70 ? 227 LEU B C   1 
ATOM   4329 O O   . LEU B 1 221 ? 14.780 48.436 23.840  1.00 29.79 ? 227 LEU B O   1 
ATOM   4330 C CB  . LEU B 1 221 ? 16.141 48.484 26.865  1.00 27.93 ? 227 LEU B CB  1 
ATOM   4331 C CG  . LEU B 1 221 ? 16.376 49.336 28.121  1.00 27.82 ? 227 LEU B CG  1 
ATOM   4332 C CD1 . LEU B 1 221 ? 17.822 49.194 28.575  1.00 26.16 ? 227 LEU B CD1 1 
ATOM   4333 C CD2 . LEU B 1 221 ? 16.051 50.795 27.817  1.00 23.86 ? 227 LEU B CD2 1 
ATOM   4334 N N   . ILE B 1 222 ? 14.619 46.508 24.990  1.00 30.11 ? 228 ILE B N   1 
ATOM   4335 C CA  . ILE B 1 222 ? 14.581 45.673 23.790  1.00 30.37 ? 228 ILE B CA  1 
ATOM   4336 C C   . ILE B 1 222 ? 13.377 46.077 22.948  1.00 31.24 ? 228 ILE B C   1 
ATOM   4337 O O   . ILE B 1 222 ? 13.457 46.144 21.726  1.00 31.38 ? 228 ILE B O   1 
ATOM   4338 C CB  . ILE B 1 222 ? 14.466 44.170 24.145  1.00 28.96 ? 228 ILE B CB  1 
ATOM   4339 C CG1 . ILE B 1 222 ? 15.663 43.747 25.008  1.00 29.07 ? 228 ILE B CG1 1 
ATOM   4340 C CG2 . ILE B 1 222 ? 14.435 43.331 22.862  1.00 28.76 ? 228 ILE B CG2 1 
ATOM   4341 C CD1 . ILE B 1 222 ? 15.624 42.300 25.472  1.00 28.17 ? 228 ILE B CD1 1 
ATOM   4342 N N   . PHE B 1 223 ? 12.264 46.356 23.618  1.00 32.76 ? 229 PHE B N   1 
ATOM   4343 C CA  . PHE B 1 223 ? 11.042 46.765 22.937  1.00 32.78 ? 229 PHE B CA  1 
ATOM   4344 C C   . PHE B 1 223 ? 11.110 48.202 22.431  1.00 33.42 ? 229 PHE B C   1 
ATOM   4345 O O   . PHE B 1 223 ? 10.157 48.697 21.827  1.00 33.91 ? 229 PHE B O   1 
ATOM   4346 C CB  . PHE B 1 223 ? 9.836  46.593 23.860  1.00 33.83 ? 229 PHE B CB  1 
ATOM   4347 C CG  . PHE B 1 223 ? 9.343  45.180 23.951  1.00 35.24 ? 229 PHE B CG  1 
ATOM   4348 C CD1 . PHE B 1 223 ? 9.254  44.537 25.179  1.00 35.74 ? 229 PHE B CD1 1 
ATOM   4349 C CD2 . PHE B 1 223 ? 8.960  44.489 22.802  1.00 37.14 ? 229 PHE B CD2 1 
ATOM   4350 C CE1 . PHE B 1 223 ? 8.794  43.223 25.267  1.00 36.18 ? 229 PHE B CE1 1 
ATOM   4351 C CE2 . PHE B 1 223 ? 8.498  43.175 22.878  1.00 37.71 ? 229 PHE B CE2 1 
ATOM   4352 C CZ  . PHE B 1 223 ? 8.416  42.541 24.115  1.00 36.36 ? 229 PHE B CZ  1 
ATOM   4353 N N   . GLY B 1 224 ? 12.232 48.868 22.686  1.00 31.72 ? 230 GLY B N   1 
ATOM   4354 C CA  . GLY B 1 224 ? 12.415 50.231 22.215  1.00 32.38 ? 230 GLY B CA  1 
ATOM   4355 C C   . GLY B 1 224 ? 11.809 51.362 23.026  1.00 32.36 ? 230 GLY B C   1 
ATOM   4356 O O   . GLY B 1 224 ? 11.627 52.460 22.503  1.00 32.11 ? 230 GLY B O   1 
ATOM   4357 N N   . ALA B 1 225 ? 11.510 51.125 24.300  1.00 31.45 ? 231 ALA B N   1 
ATOM   4358 C CA  . ALA B 1 225 ? 10.924 52.179 25.121  1.00 30.26 ? 231 ALA B CA  1 
ATOM   4359 C C   . ALA B 1 225 ? 11.907 53.326 25.306  1.00 30.53 ? 231 ALA B C   1 
ATOM   4360 O O   . ALA B 1 225 ? 13.121 53.115 25.392  1.00 27.74 ? 231 ALA B O   1 
ATOM   4361 C CB  . ALA B 1 225 ? 10.514 51.625 26.480  1.00 32.30 ? 231 ALA B CB  1 
ATOM   4362 N N   . THR B 1 226 ? 11.380 54.546 25.359  1.00 30.13 ? 232 THR B N   1 
ATOM   4363 C CA  . THR B 1 226 ? 12.217 55.723 25.567  1.00 31.50 ? 232 THR B CA  1 
ATOM   4364 C C   . THR B 1 226 ? 11.798 56.432 26.856  1.00 30.63 ? 232 THR B C   1 
ATOM   4365 O O   . THR B 1 226 ? 12.361 57.462 27.226  1.00 31.12 ? 232 THR B O   1 
ATOM   4366 C CB  . THR B 1 226 ? 12.096 56.703 24.395  1.00 32.49 ? 232 THR B CB  1 
ATOM   4367 O OG1 . THR B 1 226 ? 10.715 57.015 24.190  1.00 34.51 ? 232 THR B OG1 1 
ATOM   4368 C CG2 . THR B 1 226 ? 12.675 56.092 23.122  1.00 32.66 ? 232 THR B CG2 1 
ATOM   4369 N N   . ASP B 1 227 ? 10.808 55.864 27.537  1.00 31.88 ? 233 ASP B N   1 
ATOM   4370 C CA  . ASP B 1 227 ? 10.303 56.436 28.781  1.00 33.06 ? 233 ASP B CA  1 
ATOM   4371 C C   . ASP B 1 227 ? 10.636 55.540 29.973  1.00 32.61 ? 233 ASP B C   1 
ATOM   4372 O O   . ASP B 1 227 ? 9.996  55.621 31.021  1.00 33.18 ? 233 ASP B O   1 
ATOM   4373 C CB  . ASP B 1 227 ? 8.788  56.622 28.683  1.00 35.70 ? 233 ASP B CB  1 
ATOM   4374 C CG  . ASP B 1 227 ? 8.047  55.305 28.606  1.00 38.88 ? 233 ASP B CG  1 
ATOM   4375 O OD1 . ASP B 1 227 ? 8.645  54.311 28.135  1.00 40.10 ? 233 ASP B OD1 1 
ATOM   4376 O OD2 . ASP B 1 227 ? 6.863  55.266 29.006  1.00 40.56 ? 233 ASP B OD2 1 
ATOM   4377 N N   . TYR B 1 228 ? 11.645 54.690 29.812  1.00 31.56 ? 234 TYR B N   1 
ATOM   4378 C CA  . TYR B 1 228 ? 12.046 53.780 30.879  1.00 29.57 ? 234 TYR B CA  1 
ATOM   4379 C C   . TYR B 1 228 ? 12.568 54.532 32.104  1.00 29.94 ? 234 TYR B C   1 
ATOM   4380 O O   . TYR B 1 228 ? 12.867 55.726 32.038  1.00 28.29 ? 234 TYR B O   1 
ATOM   4381 C CB  . TYR B 1 228 ? 13.109 52.811 30.358  1.00 28.90 ? 234 TYR B CB  1 
ATOM   4382 C CG  . TYR B 1 228 ? 14.335 53.493 29.793  1.00 28.70 ? 234 TYR B CG  1 
ATOM   4383 C CD1 . TYR B 1 228 ? 15.351 53.948 30.632  1.00 28.22 ? 234 TYR B CD1 1 
ATOM   4384 C CD2 . TYR B 1 228 ? 14.485 53.676 28.415  1.00 26.85 ? 234 TYR B CD2 1 
ATOM   4385 C CE1 . TYR B 1 228 ? 16.486 54.560 30.117  1.00 28.15 ? 234 TYR B CE1 1 
ATOM   4386 C CE2 . TYR B 1 228 ? 15.620 54.291 27.893  1.00 26.49 ? 234 TYR B CE2 1 
ATOM   4387 C CZ  . TYR B 1 228 ? 16.615 54.725 28.748  1.00 26.70 ? 234 TYR B CZ  1 
ATOM   4388 O OH  . TYR B 1 228 ? 17.760 55.302 28.247  1.00 29.23 ? 234 TYR B OH  1 
ATOM   4389 N N   . THR B 1 229 ? 12.686 53.814 33.217  1.00 30.48 ? 235 THR B N   1 
ATOM   4390 C CA  . THR B 1 229 ? 13.154 54.400 34.465  1.00 30.68 ? 235 THR B CA  1 
ATOM   4391 C C   . THR B 1 229 ? 14.425 53.726 34.985  1.00 29.26 ? 235 THR B C   1 
ATOM   4392 O O   . THR B 1 229 ? 15.035 52.905 34.306  1.00 27.51 ? 235 THR B O   1 
ATOM   4393 C CB  . THR B 1 229 ? 12.080 54.284 35.548  1.00 31.81 ? 235 THR B CB  1 
ATOM   4394 O OG1 . THR B 1 229 ? 11.871 52.899 35.855  1.00 32.88 ? 235 THR B OG1 1 
ATOM   4395 C CG2 . THR B 1 229 ? 10.766 54.900 35.062  1.00 31.52 ? 235 THR B CG2 1 
ATOM   4396 N N   . SER B 1 230 ? 14.813 54.085 36.202  1.00 28.57 ? 236 SER B N   1 
ATOM   4397 C CA  . SER B 1 230 ? 16.006 53.527 36.821  1.00 28.43 ? 236 SER B CA  1 
ATOM   4398 C C   . SER B 1 230 ? 15.863 52.033 37.097  1.00 27.82 ? 236 SER B C   1 
ATOM   4399 O O   . SER B 1 230 ? 16.836 51.365 37.452  1.00 27.76 ? 236 SER B O   1 
ATOM   4400 C CB  . SER B 1 230 ? 16.312 54.273 38.125  1.00 30.75 ? 236 SER B CB  1 
ATOM   4401 O OG  . SER B 1 230 ? 16.874 55.551 37.854  1.00 33.03 ? 236 SER B OG  1 
ATOM   4402 N N   . SER B 1 231 ? 14.654 51.509 36.941  1.00 25.13 ? 237 SER B N   1 
ATOM   4403 C CA  . SER B 1 231 ? 14.428 50.096 37.180  1.00 25.85 ? 237 SER B CA  1 
ATOM   4404 C C   . SER B 1 231 ? 15.097 49.219 36.111  1.00 25.73 ? 237 SER B C   1 
ATOM   4405 O O   . SER B 1 231 ? 15.147 47.996 36.259  1.00 25.81 ? 237 SER B O   1 
ATOM   4406 C CB  . SER B 1 231 ? 12.928 49.791 37.259  1.00 26.07 ? 237 SER B CB  1 
ATOM   4407 O OG  . SER B 1 231 ? 12.283 50.021 36.020  1.00 28.89 ? 237 SER B OG  1 
ATOM   4408 N N   . ILE B 1 232 ? 15.606 49.824 35.037  1.00 24.90 ? 238 ILE B N   1 
ATOM   4409 C CA  . ILE B 1 232 ? 16.295 49.013 34.032  1.00 24.64 ? 238 ILE B CA  1 
ATOM   4410 C C   . ILE B 1 232 ? 17.588 48.520 34.679  1.00 25.01 ? 238 ILE B C   1 
ATOM   4411 O O   . ILE B 1 232 ? 18.085 47.453 34.333  1.00 25.40 ? 238 ILE B O   1 
ATOM   4412 C CB  . ILE B 1 232 ? 16.666 49.793 32.746  1.00 23.32 ? 238 ILE B CB  1 
ATOM   4413 C CG1 . ILE B 1 232 ? 17.595 50.962 33.075  1.00 23.91 ? 238 ILE B CG1 1 
ATOM   4414 C CG2 . ILE B 1 232 ? 15.399 50.270 32.035  1.00 23.20 ? 238 ILE B CG2 1 
ATOM   4415 C CD1 . ILE B 1 232 ? 18.125 51.676 31.836  1.00 25.29 ? 238 ILE B CD1 1 
ATOM   4416 N N   . ASP B 1 233 ? 18.122 49.307 35.621  1.00 25.96 ? 239 ASP B N   1 
ATOM   4417 C CA  . ASP B 1 233 ? 19.355 48.947 36.336  1.00 25.07 ? 239 ASP B CA  1 
ATOM   4418 C C   . ASP B 1 233 ? 19.112 47.729 37.220  1.00 25.94 ? 239 ASP B C   1 
ATOM   4419 O O   . ASP B 1 233 ? 20.002 46.896 37.414  1.00 25.98 ? 239 ASP B O   1 
ATOM   4420 C CB  . ASP B 1 233 ? 19.832 50.095 37.237  1.00 26.24 ? 239 ASP B CB  1 
ATOM   4421 C CG  . ASP B 1 233 ? 20.658 51.128 36.503  1.00 25.59 ? 239 ASP B CG  1 
ATOM   4422 O OD1 . ASP B 1 233 ? 20.954 52.169 37.120  1.00 26.73 ? 239 ASP B OD1 1 
ATOM   4423 O OD2 . ASP B 1 233 ? 21.027 50.911 35.330  1.00 25.40 ? 239 ASP B OD2 1 
ATOM   4424 N N   . VAL B 1 234 ? 17.910 47.651 37.783  1.00 24.15 ? 240 VAL B N   1 
ATOM   4425 C CA  . VAL B 1 234 ? 17.548 46.542 38.655  1.00 24.77 ? 240 VAL B CA  1 
ATOM   4426 C C   . VAL B 1 234 ? 17.431 45.251 37.859  1.00 24.17 ? 240 VAL B C   1 
ATOM   4427 O O   . VAL B 1 234 ? 17.795 44.179 38.342  1.00 23.44 ? 240 VAL B O   1 
ATOM   4428 C CB  . VAL B 1 234 ? 16.221 46.817 39.389  1.00 23.61 ? 240 VAL B CB  1 
ATOM   4429 C CG1 . VAL B 1 234 ? 15.773 45.581 40.134  1.00 22.57 ? 240 VAL B CG1 1 
ATOM   4430 C CG2 . VAL B 1 234 ? 16.413 47.978 40.362  1.00 24.17 ? 240 VAL B CG2 1 
ATOM   4431 N N   . TRP B 1 235 ? 16.905 45.356 36.646  1.00 22.44 ? 241 TRP B N   1 
ATOM   4432 C CA  . TRP B 1 235 ? 16.788 44.189 35.789  1.00 23.94 ? 241 TRP B CA  1 
ATOM   4433 C C   . TRP B 1 235 ? 18.201 43.688 35.478  1.00 22.28 ? 241 TRP B C   1 
ATOM   4434 O O   . TRP B 1 235 ? 18.479 42.498 35.586  1.00 24.50 ? 241 TRP B O   1 
ATOM   4435 C CB  . TRP B 1 235 ? 16.062 44.545 34.482  1.00 24.52 ? 241 TRP B CB  1 
ATOM   4436 C CG  . TRP B 1 235 ? 16.080 43.432 33.479  1.00 25.17 ? 241 TRP B CG  1 
ATOM   4437 C CD1 . TRP B 1 235 ? 17.107 43.101 32.632  1.00 24.90 ? 241 TRP B CD1 1 
ATOM   4438 C CD2 . TRP B 1 235 ? 15.047 42.463 33.254  1.00 25.47 ? 241 TRP B CD2 1 
ATOM   4439 N NE1 . TRP B 1 235 ? 16.775 41.990 31.899  1.00 26.22 ? 241 TRP B NE1 1 
ATOM   4440 C CE2 . TRP B 1 235 ? 15.518 41.575 32.260  1.00 25.66 ? 241 TRP B CE2 1 
ATOM   4441 C CE3 . TRP B 1 235 ? 13.768 42.258 33.799  1.00 26.36 ? 241 TRP B CE3 1 
ATOM   4442 C CZ2 . TRP B 1 235 ? 14.756 40.493 31.796  1.00 25.73 ? 241 TRP B CZ2 1 
ATOM   4443 C CZ3 . TRP B 1 235 ? 13.008 41.181 33.338  1.00 26.74 ? 241 TRP B CZ3 1 
ATOM   4444 C CH2 . TRP B 1 235 ? 13.509 40.313 32.344  1.00 26.54 ? 241 TRP B CH2 1 
ATOM   4445 N N   . SER B 1 236 ? 19.088 44.607 35.105  1.00 21.80 ? 242 SER B N   1 
ATOM   4446 C CA  . SER B 1 236 ? 20.470 44.263 34.778  1.00 22.36 ? 242 SER B CA  1 
ATOM   4447 C C   . SER B 1 236 ? 21.161 43.593 35.971  1.00 23.41 ? 242 SER B C   1 
ATOM   4448 O O   . SER B 1 236 ? 21.867 42.591 35.814  1.00 21.48 ? 242 SER B O   1 
ATOM   4449 C CB  . SER B 1 236 ? 21.247 45.519 34.367  1.00 23.39 ? 242 SER B CB  1 
ATOM   4450 O OG  . SER B 1 236 ? 20.699 46.112 33.193  1.00 26.33 ? 242 SER B OG  1 
ATOM   4451 N N   . ALA B 1 237 ? 20.957 44.154 37.161  1.00 20.19 ? 243 ALA B N   1 
ATOM   4452 C CA  . ALA B 1 237 ? 21.547 43.595 38.368  1.00 22.41 ? 243 ALA B CA  1 
ATOM   4453 C C   . ALA B 1 237 ? 21.016 42.168 38.562  1.00 23.34 ? 243 ALA B C   1 
ATOM   4454 O O   . ALA B 1 237 ? 21.749 41.269 38.977  1.00 24.12 ? 243 ALA B O   1 
ATOM   4455 C CB  . ALA B 1 237 ? 21.195 44.477 39.589  1.00 21.49 ? 243 ALA B CB  1 
ATOM   4456 N N   . GLY B 1 238 ? 19.737 41.978 38.253  1.00 23.79 ? 244 GLY B N   1 
ATOM   4457 C CA  . GLY B 1 238 ? 19.119 40.669 38.375  1.00 24.31 ? 244 GLY B CA  1 
ATOM   4458 C C   . GLY B 1 238 ? 19.781 39.694 37.416  1.00 24.61 ? 244 GLY B C   1 
ATOM   4459 O O   . GLY B 1 238 ? 19.986 38.523 37.742  1.00 24.40 ? 244 GLY B O   1 
ATOM   4460 N N   . CYS B 1 239 ? 20.117 40.175 36.223  1.00 23.83 ? 245 CYS B N   1 
ATOM   4461 C CA  . CYS B 1 239 ? 20.784 39.336 35.239  1.00 23.75 ? 245 CYS B CA  1 
ATOM   4462 C C   . CYS B 1 239 ? 22.161 38.908 35.747  1.00 24.61 ? 245 CYS B C   1 
ATOM   4463 O O   . CYS B 1 239 ? 22.592 37.779 35.507  1.00 23.55 ? 245 CYS B O   1 
ATOM   4464 C CB  . CYS B 1 239 ? 20.925 40.083 33.911  1.00 23.07 ? 245 CYS B CB  1 
ATOM   4465 S SG  . CYS B 1 239 ? 19.349 40.276 33.026  1.00 25.25 ? 245 CYS B SG  1 
ATOM   4466 N N   . VAL B 1 240 ? 22.850 39.814 36.442  1.00 23.63 ? 246 VAL B N   1 
ATOM   4467 C CA  . VAL B 1 240 ? 24.167 39.504 36.981  1.00 23.69 ? 246 VAL B CA  1 
ATOM   4468 C C   . VAL B 1 240 ? 24.023 38.465 38.097  1.00 25.09 ? 246 VAL B C   1 
ATOM   4469 O O   . VAL B 1 240 ? 24.809 37.520 38.180  1.00 25.28 ? 246 VAL B O   1 
ATOM   4470 C CB  . VAL B 1 240 ? 24.852 40.765 37.547  1.00 25.41 ? 246 VAL B CB  1 
ATOM   4471 C CG1 . VAL B 1 240 ? 26.172 40.389 38.229  1.00 25.81 ? 246 VAL B CG1 1 
ATOM   4472 C CG2 . VAL B 1 240 ? 25.101 41.765 36.422  1.00 24.80 ? 246 VAL B CG2 1 
ATOM   4473 N N   . LEU B 1 241 ? 23.018 38.639 38.952  1.00 24.50 ? 247 LEU B N   1 
ATOM   4474 C CA  . LEU B 1 241 ? 22.793 37.692 40.041  1.00 25.49 ? 247 LEU B CA  1 
ATOM   4475 C C   . LEU B 1 241 ? 22.540 36.304 39.465  1.00 25.75 ? 247 LEU B C   1 
ATOM   4476 O O   . LEU B 1 241 ? 23.181 35.330 39.855  1.00 26.54 ? 247 LEU B O   1 
ATOM   4477 C CB  . LEU B 1 241 ? 21.588 38.112 40.893  1.00 25.71 ? 247 LEU B CB  1 
ATOM   4478 C CG  . LEU B 1 241 ? 21.072 37.056 41.880  1.00 25.91 ? 247 LEU B CG  1 
ATOM   4479 C CD1 . LEU B 1 241 ? 22.173 36.643 42.849  1.00 26.90 ? 247 LEU B CD1 1 
ATOM   4480 C CD2 . LEU B 1 241 ? 19.865 37.610 42.638  1.00 27.37 ? 247 LEU B CD2 1 
ATOM   4481 N N   . ALA B 1 242 ? 21.599 36.223 38.534  1.00 25.54 ? 248 ALA B N   1 
ATOM   4482 C CA  . ALA B 1 242 ? 21.263 34.954 37.914  1.00 26.52 ? 248 ALA B CA  1 
ATOM   4483 C C   . ALA B 1 242 ? 22.494 34.339 37.251  1.00 28.09 ? 248 ALA B C   1 
ATOM   4484 O O   . ALA B 1 242 ? 22.719 33.135 37.356  1.00 28.59 ? 248 ALA B O   1 
ATOM   4485 C CB  . ALA B 1 242 ? 20.148 35.150 36.895  1.00 26.79 ? 248 ALA B CB  1 
ATOM   4486 N N   . GLU B 1 243 ? 23.300 35.171 36.593  1.00 28.68 ? 249 GLU B N   1 
ATOM   4487 C CA  . GLU B 1 243 ? 24.502 34.697 35.914  1.00 29.35 ? 249 GLU B CA  1 
ATOM   4488 C C   . GLU B 1 243 ? 25.541 34.136 36.888  1.00 30.58 ? 249 GLU B C   1 
ATOM   4489 O O   . GLU B 1 243 ? 26.189 33.127 36.598  1.00 29.87 ? 249 GLU B O   1 
ATOM   4490 C CB  . GLU B 1 243 ? 25.119 35.826 35.085  1.00 29.50 ? 249 GLU B CB  1 
ATOM   4491 C CG  . GLU B 1 243 ? 26.414 35.455 34.367  1.00 29.85 ? 249 GLU B CG  1 
ATOM   4492 C CD  . GLU B 1 243 ? 26.769 36.446 33.268  1.00 32.46 ? 249 GLU B CD  1 
ATOM   4493 O OE1 . GLU B 1 243 ? 27.889 36.364 32.724  1.00 32.69 ? 249 GLU B OE1 1 
ATOM   4494 O OE2 . GLU B 1 243 ? 25.920 37.306 32.942  1.00 33.01 ? 249 GLU B OE2 1 
ATOM   4495 N N   . LEU B 1 244 ? 25.703 34.788 38.037  1.00 29.52 ? 250 LEU B N   1 
ATOM   4496 C CA  . LEU B 1 244 ? 26.665 34.323 39.031  1.00 30.19 ? 250 LEU B CA  1 
ATOM   4497 C C   . LEU B 1 244 ? 26.213 33.000 39.631  1.00 31.84 ? 250 LEU B C   1 
ATOM   4498 O O   . LEU B 1 244 ? 27.039 32.157 39.985  1.00 31.86 ? 250 LEU B O   1 
ATOM   4499 C CB  . LEU B 1 244 ? 26.845 35.361 40.138  1.00 29.33 ? 250 LEU B CB  1 
ATOM   4500 C CG  . LEU B 1 244 ? 27.579 36.636 39.724  1.00 30.69 ? 250 LEU B CG  1 
ATOM   4501 C CD1 . LEU B 1 244 ? 27.754 37.538 40.935  1.00 30.89 ? 250 LEU B CD1 1 
ATOM   4502 C CD2 . LEU B 1 244 ? 28.935 36.274 39.126  1.00 30.65 ? 250 LEU B CD2 1 
ATOM   4503 N N   . LEU B 1 245 ? 24.900 32.819 39.730  1.00 30.45 ? 251 LEU B N   1 
ATOM   4504 C CA  . LEU B 1 245 ? 24.337 31.592 40.272  1.00 33.15 ? 251 LEU B CA  1 
ATOM   4505 C C   . LEU B 1 245 ? 24.380 30.462 39.242  1.00 35.09 ? 251 LEU B C   1 
ATOM   4506 O O   . LEU B 1 245 ? 24.626 29.306 39.590  1.00 36.09 ? 251 LEU B O   1 
ATOM   4507 C CB  . LEU B 1 245 ? 22.888 31.828 40.719  1.00 31.72 ? 251 LEU B CB  1 
ATOM   4508 C CG  . LEU B 1 245 ? 22.662 32.745 41.926  1.00 31.80 ? 251 LEU B CG  1 
ATOM   4509 C CD1 . LEU B 1 245 ? 21.169 32.990 42.114  1.00 32.47 ? 251 LEU B CD1 1 
ATOM   4510 C CD2 . LEU B 1 245 ? 23.258 32.106 43.180  1.00 31.64 ? 251 LEU B CD2 1 
ATOM   4511 N N   . LEU B 1 246 ? 24.155 30.807 37.977  1.00 35.13 ? 252 LEU B N   1 
ATOM   4512 C CA  . LEU B 1 246 ? 24.143 29.827 36.893  1.00 37.01 ? 252 LEU B CA  1 
ATOM   4513 C C   . LEU B 1 246 ? 25.492 29.437 36.306  1.00 36.41 ? 252 LEU B C   1 
ATOM   4514 O O   . LEU B 1 246 ? 25.695 28.287 35.934  1.00 37.45 ? 252 LEU B O   1 
ATOM   4515 C CB  . LEU B 1 246 ? 23.256 30.319 35.750  1.00 38.57 ? 252 LEU B CB  1 
ATOM   4516 C CG  . LEU B 1 246 ? 21.778 29.940 35.796  1.00 42.50 ? 252 LEU B CG  1 
ATOM   4517 C CD1 . LEU B 1 246 ? 21.042 30.605 34.637  1.00 42.44 ? 252 LEU B CD1 1 
ATOM   4518 C CD2 . LEU B 1 246 ? 21.650 28.423 35.714  1.00 41.76 ? 252 LEU B CD2 1 
ATOM   4519 N N   . GLY B 1 247 ? 26.407 30.391 36.201  1.00 36.10 ? 253 GLY B N   1 
ATOM   4520 C CA  . GLY B 1 247 ? 27.703 30.090 35.626  1.00 35.91 ? 253 GLY B CA  1 
ATOM   4521 C C   . GLY B 1 247 ? 27.758 30.550 34.179  1.00 35.48 ? 253 GLY B C   1 
ATOM   4522 O O   . GLY B 1 247 ? 28.745 30.323 33.481  1.00 35.67 ? 253 GLY B O   1 
ATOM   4523 N N   . GLN B 1 248 ? 26.682 31.191 33.732  1.00 35.59 ? 254 GLN B N   1 
ATOM   4524 C CA  . GLN B 1 248 ? 26.580 31.722 32.373  1.00 36.04 ? 254 GLN B CA  1 
ATOM   4525 C C   . GLN B 1 248 ? 25.417 32.711 32.305  1.00 34.84 ? 254 GLN B C   1 
ATOM   4526 O O   . GLN B 1 248 ? 24.526 32.687 33.151  1.00 34.09 ? 254 GLN B O   1 
ATOM   4527 C CB  . GLN B 1 248 ? 26.350 30.591 31.362  1.00 38.39 ? 254 GLN B CB  1 
ATOM   4528 C CG  . GLN B 1 248 ? 25.171 29.684 31.685  1.00 42.93 ? 254 GLN B CG  1 
ATOM   4529 C CD  . GLN B 1 248 ? 24.857 28.709 30.561  1.00 45.99 ? 254 GLN B CD  1 
ATOM   4530 O OE1 . GLN B 1 248 ? 24.273 29.083 29.546  1.00 49.50 ? 254 GLN B OE1 1 
ATOM   4531 N NE2 . GLN B 1 248 ? 25.253 27.453 30.735  1.00 46.50 ? 254 GLN B NE2 1 
ATOM   4532 N N   . PRO B 1 249 ? 25.414 33.598 31.297  1.00 34.79 ? 255 PRO B N   1 
ATOM   4533 C CA  . PRO B 1 249 ? 24.329 34.576 31.164  1.00 33.73 ? 255 PRO B CA  1 
ATOM   4534 C C   . PRO B 1 249 ? 22.983 33.863 31.145  1.00 32.85 ? 255 PRO B C   1 
ATOM   4535 O O   . PRO B 1 249 ? 22.857 32.785 30.578  1.00 33.12 ? 255 PRO B O   1 
ATOM   4536 C CB  . PRO B 1 249 ? 24.635 35.252 29.836  1.00 34.16 ? 255 PRO B CB  1 
ATOM   4537 C CG  . PRO B 1 249 ? 26.126 35.174 29.756  1.00 35.78 ? 255 PRO B CG  1 
ATOM   4538 C CD  . PRO B 1 249 ? 26.414 33.774 30.231  1.00 34.02 ? 255 PRO B CD  1 
ATOM   4539 N N   . ILE B 1 250 ? 21.971 34.460 31.760  1.00 32.58 ? 256 ILE B N   1 
ATOM   4540 C CA  . ILE B 1 250 ? 20.666 33.824 31.791  1.00 31.84 ? 256 ILE B CA  1 
ATOM   4541 C C   . ILE B 1 250 ? 19.810 34.127 30.558  1.00 32.28 ? 256 ILE B C   1 
ATOM   4542 O O   . ILE B 1 250 ? 18.993 33.298 30.157  1.00 33.14 ? 256 ILE B O   1 
ATOM   4543 C CB  . ILE B 1 250 ? 19.891 34.215 33.071  1.00 32.87 ? 256 ILE B CB  1 
ATOM   4544 C CG1 . ILE B 1 250 ? 18.560 33.460 33.121  1.00 33.58 ? 256 ILE B CG1 1 
ATOM   4545 C CG2 . ILE B 1 250 ? 19.684 35.724 33.123  1.00 30.22 ? 256 ILE B CG2 1 
ATOM   4546 C CD1 . ILE B 1 250 ? 17.874 33.527 34.474  1.00 34.62 ? 256 ILE B CD1 1 
ATOM   4547 N N   . PHE B 1 251 ? 19.999 35.292 29.944  1.00 30.41 ? 257 PHE B N   1 
ATOM   4548 C CA  . PHE B 1 251 ? 19.199 35.644 28.764  1.00 30.49 ? 257 PHE B CA  1 
ATOM   4549 C C   . PHE B 1 251 ? 20.061 35.981 27.542  1.00 30.12 ? 257 PHE B C   1 
ATOM   4550 O O   . PHE B 1 251 ? 19.982 37.079 26.995  1.00 30.03 ? 257 PHE B O   1 
ATOM   4551 C CB  . PHE B 1 251 ? 18.275 36.828 29.084  1.00 28.20 ? 257 PHE B CB  1 
ATOM   4552 C CG  . PHE B 1 251 ? 17.332 36.587 30.244  1.00 28.66 ? 257 PHE B CG  1 
ATOM   4553 C CD1 . PHE B 1 251 ? 16.562 35.423 30.315  1.00 28.45 ? 257 PHE B CD1 1 
ATOM   4554 C CD2 . PHE B 1 251 ? 17.180 37.547 31.244  1.00 27.29 ? 257 PHE B CD2 1 
ATOM   4555 C CE1 . PHE B 1 251 ? 15.655 35.220 31.360  1.00 28.84 ? 257 PHE B CE1 1 
ATOM   4556 C CE2 . PHE B 1 251 ? 16.272 37.354 32.299  1.00 28.44 ? 257 PHE B CE2 1 
ATOM   4557 C CZ  . PHE B 1 251 ? 15.508 36.187 32.357  1.00 28.20 ? 257 PHE B CZ  1 
ATOM   4558 N N   . PRO B 1 252 ? 20.887 35.026 27.088  1.00 31.30 ? 258 PRO B N   1 
ATOM   4559 C CA  . PRO B 1 252 ? 21.770 35.221 25.928  1.00 31.97 ? 258 PRO B CA  1 
ATOM   4560 C C   . PRO B 1 252 ? 20.963 35.378 24.646  1.00 31.25 ? 258 PRO B C   1 
ATOM   4561 O O   . PRO B 1 252 ? 19.780 35.048 24.612  1.00 30.54 ? 258 PRO B O   1 
ATOM   4562 C CB  . PRO B 1 252 ? 22.606 33.933 25.894  1.00 31.32 ? 258 PRO B CB  1 
ATOM   4563 C CG  . PRO B 1 252 ? 22.402 33.315 27.262  1.00 35.56 ? 258 PRO B CG  1 
ATOM   4564 C CD  . PRO B 1 252 ? 20.975 33.645 27.578  1.00 32.28 ? 258 PRO B CD  1 
ATOM   4565 N N   . GLY B 1 253 ? 21.613 35.855 23.589  1.00 32.24 ? 259 GLY B N   1 
ATOM   4566 C CA  . GLY B 1 253 ? 20.934 36.029 22.315  1.00 33.57 ? 259 GLY B CA  1 
ATOM   4567 C C   . GLY B 1 253 ? 21.658 37.040 21.449  1.00 34.89 ? 259 GLY B C   1 
ATOM   4568 O O   . GLY B 1 253 ? 22.046 38.105 21.931  1.00 36.24 ? 259 GLY B O   1 
ATOM   4569 N N   . ASP B 1 254 ? 21.850 36.717 20.175  1.00 34.87 ? 260 ASP B N   1 
ATOM   4570 C CA  . ASP B 1 254 ? 22.537 37.628 19.267  1.00 35.97 ? 260 ASP B CA  1 
ATOM   4571 C C   . ASP B 1 254 ? 21.615 38.724 18.752  1.00 33.95 ? 260 ASP B C   1 
ATOM   4572 O O   . ASP B 1 254 ? 22.079 39.736 18.240  1.00 33.71 ? 260 ASP B O   1 
ATOM   4573 C CB  . ASP B 1 254 ? 23.146 36.864 18.086  1.00 40.10 ? 260 ASP B CB  1 
ATOM   4574 C CG  . ASP B 1 254 ? 24.292 35.959 18.508  1.00 44.01 ? 260 ASP B CG  1 
ATOM   4575 O OD1 . ASP B 1 254 ? 25.022 36.329 19.454  1.00 45.60 ? 260 ASP B OD1 1 
ATOM   4576 O OD2 . ASP B 1 254 ? 24.470 34.887 17.888  1.00 47.22 ? 260 ASP B OD2 1 
ATOM   4577 N N   . SER B 1 255 ? 20.309 38.517 18.882  1.00 33.28 ? 261 SER B N   1 
ATOM   4578 C CA  . SER B 1 255 ? 19.337 39.513 18.443  1.00 32.23 ? 261 SER B CA  1 
ATOM   4579 C C   . SER B 1 255 ? 18.330 39.737 19.560  1.00 30.83 ? 261 SER B C   1 
ATOM   4580 O O   . SER B 1 255 ? 18.209 38.920 20.471  1.00 31.22 ? 261 SER B O   1 
ATOM   4581 C CB  . SER B 1 255 ? 18.594 39.043 17.189  1.00 32.06 ? 261 SER B CB  1 
ATOM   4582 O OG  . SER B 1 255 ? 17.669 38.020 17.512  1.00 32.39 ? 261 SER B OG  1 
ATOM   4583 N N   . GLY B 1 256 ? 17.604 40.845 19.480  1.00 31.07 ? 262 GLY B N   1 
ATOM   4584 C CA  . GLY B 1 256 ? 16.608 41.144 20.490  1.00 30.16 ? 262 GLY B CA  1 
ATOM   4585 C C   . GLY B 1 256 ? 15.563 40.050 20.532  1.00 30.56 ? 262 GLY B C   1 
ATOM   4586 O O   . GLY B 1 256 ? 15.081 39.682 21.600  1.00 27.13 ? 262 GLY B O   1 
ATOM   4587 N N   . VAL B 1 257 ? 15.225 39.515 19.360  1.00 31.24 ? 263 VAL B N   1 
ATOM   4588 C CA  . VAL B 1 257 ? 14.230 38.455 19.266  1.00 33.16 ? 263 VAL B CA  1 
ATOM   4589 C C   . VAL B 1 257 ? 14.660 37.226 20.056  1.00 33.14 ? 263 VAL B C   1 
ATOM   4590 O O   . VAL B 1 257 ? 13.871 36.651 20.803  1.00 34.84 ? 263 VAL B O   1 
ATOM   4591 C CB  . VAL B 1 257 ? 13.998 38.012 17.803  1.00 34.65 ? 263 VAL B CB  1 
ATOM   4592 C CG1 . VAL B 1 257 ? 12.811 37.079 17.747  1.00 35.87 ? 263 VAL B CG1 1 
ATOM   4593 C CG2 . VAL B 1 257 ? 13.763 39.220 16.908  1.00 35.11 ? 263 VAL B CG2 1 
ATOM   4594 N N   . ASP B 1 258 ? 15.911 36.817 19.871  1.00 32.90 ? 264 ASP B N   1 
ATOM   4595 C CA  . ASP B 1 258 ? 16.443 35.652 20.566  1.00 33.77 ? 264 ASP B CA  1 
ATOM   4596 C C   . ASP B 1 258 ? 16.455 35.901 22.074  1.00 32.63 ? 264 ASP B C   1 
ATOM   4597 O O   . ASP B 1 258 ? 16.064 35.036 22.859  1.00 32.83 ? 264 ASP B O   1 
ATOM   4598 C CB  . ASP B 1 258 ? 17.853 35.347 20.054  1.00 35.67 ? 264 ASP B CB  1 
ATOM   4599 C CG  . ASP B 1 258 ? 17.854 34.863 18.608  1.00 38.98 ? 264 ASP B CG  1 
ATOM   4600 O OD1 . ASP B 1 258 ? 16.970 35.283 17.834  1.00 42.43 ? 264 ASP B OD1 1 
ATOM   4601 O OD2 . ASP B 1 258 ? 18.742 34.073 18.237  1.00 42.00 ? 264 ASP B OD2 1 
ATOM   4602 N N   . GLN B 1 259 ? 16.893 37.091 22.473  1.00 31.38 ? 265 GLN B N   1 
ATOM   4603 C CA  . GLN B 1 259 ? 16.934 37.450 23.883  1.00 30.35 ? 265 GLN B CA  1 
ATOM   4604 C C   . GLN B 1 259 ? 15.535 37.341 24.481  1.00 30.45 ? 265 GLN B C   1 
ATOM   4605 O O   . GLN B 1 259 ? 15.347 36.739 25.546  1.00 27.79 ? 265 GLN B O   1 
ATOM   4606 C CB  . GLN B 1 259 ? 17.481 38.874 24.048  1.00 30.93 ? 265 GLN B CB  1 
ATOM   4607 C CG  . GLN B 1 259 ? 18.994 38.970 23.903  1.00 32.65 ? 265 GLN B CG  1 
ATOM   4608 C CD  . GLN B 1 259 ? 19.474 40.368 23.535  1.00 35.03 ? 265 GLN B CD  1 
ATOM   4609 O OE1 . GLN B 1 259 ? 18.982 41.366 24.056  1.00 37.17 ? 265 GLN B OE1 1 
ATOM   4610 N NE2 . GLN B 1 259 ? 20.451 40.441 22.636  1.00 37.45 ? 265 GLN B NE2 1 
ATOM   4611 N N   . LEU B 1 260 ? 14.557 37.917 23.788  1.00 30.69 ? 266 LEU B N   1 
ATOM   4612 C CA  . LEU B 1 260 ? 13.174 37.878 24.249  1.00 33.17 ? 266 LEU B CA  1 
ATOM   4613 C C   . LEU B 1 260 ? 12.678 36.442 24.410  1.00 33.45 ? 266 LEU B C   1 
ATOM   4614 O O   . LEU B 1 260 ? 11.913 36.144 25.321  1.00 33.53 ? 266 LEU B O   1 
ATOM   4615 C CB  . LEU B 1 260 ? 12.272 38.656 23.284  1.00 32.95 ? 266 LEU B CB  1 
ATOM   4616 C CG  . LEU B 1 260 ? 12.434 40.177 23.381  1.00 33.47 ? 266 LEU B CG  1 
ATOM   4617 C CD1 . LEU B 1 260 ? 11.580 40.877 22.340  1.00 34.23 ? 266 LEU B CD1 1 
ATOM   4618 C CD2 . LEU B 1 260 ? 12.041 40.632 24.780  1.00 35.27 ? 266 LEU B CD2 1 
ATOM   4619 N N   . VAL B 1 261 ? 13.116 35.553 23.527  1.00 35.05 ? 267 VAL B N   1 
ATOM   4620 C CA  . VAL B 1 261 ? 12.717 34.155 23.618  1.00 35.88 ? 267 VAL B CA  1 
ATOM   4621 C C   . VAL B 1 261 ? 13.245 33.548 24.919  1.00 35.22 ? 267 VAL B C   1 
ATOM   4622 O O   . VAL B 1 261 ? 12.508 32.883 25.643  1.00 36.27 ? 267 VAL B O   1 
ATOM   4623 C CB  . VAL B 1 261 ? 13.252 33.337 22.422  1.00 35.66 ? 267 VAL B CB  1 
ATOM   4624 C CG1 . VAL B 1 261 ? 13.041 31.852 22.674  1.00 36.21 ? 267 VAL B CG1 1 
ATOM   4625 C CG2 . VAL B 1 261 ? 12.534 33.764 21.139  1.00 37.86 ? 267 VAL B CG2 1 
ATOM   4626 N N   . GLU B 1 262 ? 14.521 33.778 25.216  1.00 35.28 ? 268 GLU B N   1 
ATOM   4627 C CA  . GLU B 1 262 ? 15.113 33.257 26.447  1.00 35.50 ? 268 GLU B CA  1 
ATOM   4628 C C   . GLU B 1 262 ? 14.354 33.785 27.663  1.00 34.83 ? 268 GLU B C   1 
ATOM   4629 O O   . GLU B 1 262 ? 14.103 33.054 28.620  1.00 35.53 ? 268 GLU B O   1 
ATOM   4630 C CB  . GLU B 1 262 ? 16.588 33.666 26.551  1.00 37.98 ? 268 GLU B CB  1 
ATOM   4631 C CG  . GLU B 1 262 ? 17.482 33.077 25.474  1.00 40.69 ? 268 GLU B CG  1 
ATOM   4632 C CD  . GLU B 1 262 ? 17.321 31.572 25.354  1.00 44.43 ? 268 GLU B CD  1 
ATOM   4633 O OE1 . GLU B 1 262 ? 17.317 30.883 26.399  1.00 45.38 ? 268 GLU B OE1 1 
ATOM   4634 O OE2 . GLU B 1 262 ? 17.203 31.077 24.212  1.00 46.96 ? 268 GLU B OE2 1 
ATOM   4635 N N   . ILE B 1 263 ? 13.987 35.059 27.619  1.00 33.39 ? 269 ILE B N   1 
ATOM   4636 C CA  . ILE B 1 263 ? 13.257 35.682 28.720  1.00 33.72 ? 269 ILE B CA  1 
ATOM   4637 C C   . ILE B 1 263 ? 11.874 35.063 28.857  1.00 35.41 ? 269 ILE B C   1 
ATOM   4638 O O   . ILE B 1 263 ? 11.412 34.767 29.965  1.00 34.81 ? 269 ILE B O   1 
ATOM   4639 C CB  . ILE B 1 263 ? 13.109 37.199 28.491  1.00 32.31 ? 269 ILE B CB  1 
ATOM   4640 C CG1 . ILE B 1 263 ? 14.488 37.861 28.558  1.00 31.36 ? 269 ILE B CG1 1 
ATOM   4641 C CG2 . ILE B 1 263 ? 12.153 37.796 29.517  1.00 31.95 ? 269 ILE B CG2 1 
ATOM   4642 C CD1 . ILE B 1 263 ? 14.486 39.319 28.161  1.00 29.20 ? 269 ILE B CD1 1 
ATOM   4643 N N   . ILE B 1 264 ? 11.218 34.863 27.720  1.00 36.94 ? 270 ILE B N   1 
ATOM   4644 C CA  . ILE B 1 264 ? 9.884  34.279 27.702  1.00 38.35 ? 270 ILE B CA  1 
ATOM   4645 C C   . ILE B 1 264 ? 9.909  32.862 28.259  1.00 38.43 ? 270 ILE B C   1 
ATOM   4646 O O   . ILE B 1 264 ? 8.993  32.458 28.965  1.00 40.16 ? 270 ILE B O   1 
ATOM   4647 C CB  . ILE B 1 264 ? 9.296  34.286 26.265  1.00 38.78 ? 270 ILE B CB  1 
ATOM   4648 C CG1 . ILE B 1 264 ? 9.045  35.734 25.833  1.00 38.51 ? 270 ILE B CG1 1 
ATOM   4649 C CG2 . ILE B 1 264 ? 7.997  33.483 26.215  1.00 38.12 ? 270 ILE B CG2 1 
ATOM   4650 C CD1 . ILE B 1 264 ? 8.527  35.890 24.416  1.00 40.93 ? 270 ILE B CD1 1 
ATOM   4651 N N   . LYS B 1 265 ? 10.964 32.112 27.962  1.00 40.10 ? 271 LYS B N   1 
ATOM   4652 C CA  . LYS B 1 265 ? 11.076 30.750 28.466  1.00 41.38 ? 271 LYS B CA  1 
ATOM   4653 C C   . LYS B 1 265 ? 11.009 30.725 29.990  1.00 42.21 ? 271 LYS B C   1 
ATOM   4654 O O   . LYS B 1 265 ? 10.387 29.842 30.576  1.00 42.34 ? 271 LYS B O   1 
ATOM   4655 C CB  . LYS B 1 265 ? 12.391 30.112 28.026  1.00 42.70 ? 271 LYS B CB  1 
ATOM   4656 C CG  . LYS B 1 265 ? 12.494 29.812 26.548  1.00 45.47 ? 271 LYS B CG  1 
ATOM   4657 C CD  . LYS B 1 265 ? 13.798 29.083 26.255  1.00 47.15 ? 271 LYS B CD  1 
ATOM   4658 C CE  . LYS B 1 265 ? 13.958 28.798 24.776  1.00 48.16 ? 271 LYS B CE  1 
ATOM   4659 N NZ  . LYS B 1 265 ? 15.225 28.069 24.506  1.00 50.70 ? 271 LYS B NZ  1 
ATOM   4660 N N   . VAL B 1 266 ? 11.651 31.699 30.629  1.00 41.63 ? 272 VAL B N   1 
ATOM   4661 C CA  . VAL B 1 266 ? 11.671 31.764 32.085  1.00 40.55 ? 272 VAL B CA  1 
ATOM   4662 C C   . VAL B 1 266 ? 10.470 32.490 32.688  1.00 40.97 ? 272 VAL B C   1 
ATOM   4663 O O   . VAL B 1 266 ? 9.806  31.961 33.578  1.00 41.19 ? 272 VAL B O   1 
ATOM   4664 C CB  . VAL B 1 266 ? 12.967 32.444 32.593  1.00 39.61 ? 272 VAL B CB  1 
ATOM   4665 C CG1 . VAL B 1 266 ? 12.996 32.442 34.112  1.00 39.34 ? 272 VAL B CG1 1 
ATOM   4666 C CG2 . VAL B 1 266 ? 14.188 31.719 32.041  1.00 39.34 ? 272 VAL B CG2 1 
ATOM   4667 N N   . LEU B 1 267 ? 10.194 33.698 32.207  1.00 41.43 ? 273 LEU B N   1 
ATOM   4668 C CA  . LEU B 1 267 ? 9.087  34.493 32.728  1.00 42.30 ? 273 LEU B CA  1 
ATOM   4669 C C   . LEU B 1 267 ? 7.735  34.158 32.115  1.00 43.66 ? 273 LEU B C   1 
ATOM   4670 O O   . LEU B 1 267 ? 6.696  34.559 32.639  1.00 44.40 ? 273 LEU B O   1 
ATOM   4671 C CB  . LEU B 1 267 ? 9.358  35.989 32.519  1.00 41.54 ? 273 LEU B CB  1 
ATOM   4672 C CG  . LEU B 1 267 ? 10.347 36.724 33.433  1.00 40.94 ? 273 LEU B CG  1 
ATOM   4673 C CD1 . LEU B 1 267 ? 11.747 36.168 33.263  1.00 39.41 ? 273 LEU B CD1 1 
ATOM   4674 C CD2 . LEU B 1 267 ? 10.318 38.203 33.095  1.00 38.36 ? 273 LEU B CD2 1 
ATOM   4675 N N   . GLY B 1 268 ? 7.744  33.430 31.006  1.00 45.17 ? 274 GLY B N   1 
ATOM   4676 C CA  . GLY B 1 268 ? 6.494  33.101 30.347  1.00 47.09 ? 274 GLY B CA  1 
ATOM   4677 C C   . GLY B 1 268 ? 6.105  34.251 29.437  1.00 48.17 ? 274 GLY B C   1 
ATOM   4678 O O   . GLY B 1 268 ? 6.697  35.330 29.502  1.00 47.04 ? 274 GLY B O   1 
ATOM   4679 N N   . THR B 1 269 ? 5.112  34.033 28.585  1.00 49.33 ? 275 THR B N   1 
ATOM   4680 C CA  . THR B 1 269 ? 4.674  35.077 27.668  1.00 50.98 ? 275 THR B CA  1 
ATOM   4681 C C   . THR B 1 269 ? 4.110  36.280 28.428  1.00 51.14 ? 275 THR B C   1 
ATOM   4682 O O   . THR B 1 269 ? 3.359  36.123 29.393  1.00 50.35 ? 275 THR B O   1 
ATOM   4683 C CB  . THR B 1 269 ? 3.608  34.540 26.694  1.00 51.71 ? 275 THR B CB  1 
ATOM   4684 O OG1 . THR B 1 269 ? 4.125  33.389 26.015  1.00 53.79 ? 275 THR B OG1 1 
ATOM   4685 C CG2 . THR B 1 269 ? 3.248  35.599 25.662  1.00 52.58 ? 275 THR B CG2 1 
ATOM   4686 N N   . PRO B 1 270 ? 4.478  37.500 28.003  1.00 51.69 ? 276 PRO B N   1 
ATOM   4687 C CA  . PRO B 1 270 ? 4.025  38.750 28.625  1.00 53.38 ? 276 PRO B CA  1 
ATOM   4688 C C   . PRO B 1 270 ? 2.576  39.067 28.276  1.00 54.81 ? 276 PRO B C   1 
ATOM   4689 O O   . PRO B 1 270 ? 2.203  39.053 27.102  1.00 55.04 ? 276 PRO B O   1 
ATOM   4690 C CB  . PRO B 1 270 ? 4.965  39.804 28.035  1.00 52.84 ? 276 PRO B CB  1 
ATOM   4691 C CG  . PRO B 1 270 ? 6.120  39.013 27.485  1.00 53.97 ? 276 PRO B CG  1 
ATOM   4692 C CD  . PRO B 1 270 ? 5.473  37.778 26.957  1.00 51.97 ? 276 PRO B CD  1 
ATOM   4693 N N   . THR B 1 271 ? 1.765  39.356 29.289  1.00 56.14 ? 277 THR B N   1 
ATOM   4694 C CA  . THR B 1 271 ? 0.370  39.706 29.053  1.00 57.21 ? 277 THR B CA  1 
ATOM   4695 C C   . THR B 1 271 ? 0.405  40.977 28.215  1.00 58.47 ? 277 THR B C   1 
ATOM   4696 O O   . THR B 1 271 ? 1.389  41.721 28.257  1.00 58.41 ? 277 THR B O   1 
ATOM   4697 C CB  . THR B 1 271 ? -0.364 40.015 30.365  1.00 57.19 ? 277 THR B CB  1 
ATOM   4698 O OG1 . THR B 1 271 ? 0.130  41.247 30.907  1.00 57.23 ? 277 THR B OG1 1 
ATOM   4699 C CG2 . THR B 1 271 ? -0.142 38.900 31.374  1.00 57.01 ? 277 THR B CG2 1 
ATOM   4700 N N   . ARG B 1 272 ? -0.654 41.237 27.454  1.00 59.58 ? 278 ARG B N   1 
ATOM   4701 C CA  . ARG B 1 272 ? -0.669 42.438 26.628  1.00 60.13 ? 278 ARG B CA  1 
ATOM   4702 C C   . ARG B 1 272 ? -0.581 43.682 27.507  1.00 59.03 ? 278 ARG B C   1 
ATOM   4703 O O   . ARG B 1 272 ? -0.133 44.739 27.061  1.00 58.99 ? 278 ARG B O   1 
ATOM   4704 C CB  . ARG B 1 272 ? -1.924 42.481 25.743  1.00 62.31 ? 278 ARG B CB  1 
ATOM   4705 C CG  . ARG B 1 272 ? -3.252 42.671 26.462  1.00 64.59 ? 278 ARG B CG  1 
ATOM   4706 C CD  . ARG B 1 272 ? -4.385 42.699 25.433  1.00 67.36 ? 278 ARG B CD  1 
ATOM   4707 N NE  . ARG B 1 272 ? -5.674 43.098 25.996  1.00 69.29 ? 278 ARG B NE  1 
ATOM   4708 C CZ  . ARG B 1 272 ? -6.784 43.256 25.278  1.00 70.25 ? 278 ARG B CZ  1 
ATOM   4709 N NH1 . ARG B 1 272 ? -6.766 43.047 23.968  1.00 70.61 ? 278 ARG B NH1 1 
ATOM   4710 N NH2 . ARG B 1 272 ? -7.914 43.629 25.868  1.00 70.71 ? 278 ARG B NH2 1 
ATOM   4711 N N   . GLU B 1 273 ? -0.993 43.547 28.764  1.00 57.89 ? 279 GLU B N   1 
ATOM   4712 C CA  . GLU B 1 273 ? -0.936 44.666 29.692  1.00 57.66 ? 279 GLU B CA  1 
ATOM   4713 C C   . GLU B 1 273 ? 0.497  44.860 30.180  1.00 56.25 ? 279 GLU B C   1 
ATOM   4714 O O   . GLU B 1 273 ? 0.936  45.988 30.407  1.00 55.44 ? 279 GLU B O   1 
ATOM   4715 C CB  . GLU B 1 273 ? -1.865 44.437 30.885  1.00 58.84 ? 279 GLU B CB  1 
ATOM   4716 C CG  . GLU B 1 273 ? -1.907 45.621 31.837  1.00 61.91 ? 279 GLU B CG  1 
ATOM   4717 C CD  . GLU B 1 273 ? -2.153 46.938 31.111  1.00 63.82 ? 279 GLU B CD  1 
ATOM   4718 O OE1 . GLU B 1 273 ? -3.228 47.087 30.488  1.00 65.06 ? 279 GLU B OE1 1 
ATOM   4719 O OE2 . GLU B 1 273 ? -1.268 47.822 31.159  1.00 64.37 ? 279 GLU B OE2 1 
ATOM   4720 N N   . GLN B 1 274 ? 1.220  43.757 30.350  1.00 54.69 ? 280 GLN B N   1 
ATOM   4721 C CA  . GLN B 1 274 ? 2.613  43.835 30.779  1.00 53.34 ? 280 GLN B CA  1 
ATOM   4722 C C   . GLN B 1 274 ? 3.386  44.514 29.655  1.00 53.05 ? 280 GLN B C   1 
ATOM   4723 O O   . GLN B 1 274 ? 4.298  45.304 29.893  1.00 51.87 ? 280 GLN B O   1 
ATOM   4724 C CB  . GLN B 1 274 ? 3.177  42.435 31.041  1.00 52.13 ? 280 GLN B CB  1 
ATOM   4725 C CG  . GLN B 1 274 ? 2.635  41.776 32.302  1.00 50.36 ? 280 GLN B CG  1 
ATOM   4726 C CD  . GLN B 1 274 ? 3.202  40.387 32.523  1.00 50.08 ? 280 GLN B CD  1 
ATOM   4727 O OE1 . GLN B 1 274 ? 3.101  39.518 31.656  1.00 50.60 ? 280 GLN B OE1 1 
ATOM   4728 N NE2 . GLN B 1 274 ? 3.799  40.168 33.689  1.00 49.25 ? 280 GLN B NE2 1 
ATOM   4729 N N   . ILE B 1 275 ? 3.003  44.203 28.423  1.00 53.44 ? 281 ILE B N   1 
ATOM   4730 C CA  . ILE B 1 275 ? 3.645  44.795 27.261  1.00 54.41 ? 281 ILE B CA  1 
ATOM   4731 C C   . ILE B 1 275 ? 3.405  46.301 27.274  1.00 54.89 ? 281 ILE B C   1 
ATOM   4732 O O   . ILE B 1 275 ? 4.280  47.081 26.897  1.00 54.96 ? 281 ILE B O   1 
ATOM   4733 C CB  . ILE B 1 275 ? 3.082  44.205 25.952  1.00 54.55 ? 281 ILE B CB  1 
ATOM   4734 C CG1 . ILE B 1 275 ? 3.387  42.706 25.888  1.00 55.54 ? 281 ILE B CG1 1 
ATOM   4735 C CG2 . ILE B 1 275 ? 3.689  44.919 24.752  1.00 54.32 ? 281 ILE B CG2 1 
ATOM   4736 C CD1 . ILE B 1 275 ? 2.793  42.005 24.678  1.00 55.74 ? 281 ILE B CD1 1 
ATOM   4737 N N   . ARG B 1 276 ? 2.218  46.703 27.721  1.00 55.93 ? 282 ARG B N   1 
ATOM   4738 C CA  . ARG B 1 276 ? 1.867  48.118 27.782  1.00 56.77 ? 282 ARG B CA  1 
ATOM   4739 C C   . ARG B 1 276 ? 2.748  48.850 28.786  1.00 55.85 ? 282 ARG B C   1 
ATOM   4740 O O   . ARG B 1 276 ? 3.219  49.952 28.515  1.00 55.21 ? 282 ARG B O   1 
ATOM   4741 C CB  . ARG B 1 276 ? 0.396  48.295 28.173  1.00 58.99 ? 282 ARG B CB  1 
ATOM   4742 C CG  . ARG B 1 276 ? -0.119 49.713 27.956  1.00 62.44 ? 282 ARG B CG  1 
ATOM   4743 C CD  . ARG B 1 276 ? -1.498 49.935 28.562  1.00 65.52 ? 282 ARG B CD  1 
ATOM   4744 N NE  . ARG B 1 276 ? -2.001 51.278 28.266  1.00 68.84 ? 282 ARG B NE  1 
ATOM   4745 C CZ  . ARG B 1 276 ? -3.071 51.828 28.839  1.00 70.45 ? 282 ARG B CZ  1 
ATOM   4746 N NH1 . ARG B 1 276 ? -3.764 51.155 29.751  1.00 70.84 ? 282 ARG B NH1 1 
ATOM   4747 N NH2 . ARG B 1 276 ? -3.454 53.053 28.496  1.00 70.57 ? 282 ARG B NH2 1 
ATOM   4748 N N   . GLU B 1 277 ? 2.961  48.237 29.948  1.00 55.64 ? 283 GLU B N   1 
ATOM   4749 C CA  . GLU B 1 277 ? 3.793  48.838 30.987  1.00 56.05 ? 283 GLU B CA  1 
ATOM   4750 C C   . GLU B 1 277 ? 5.247  48.983 30.543  1.00 55.70 ? 283 GLU B C   1 
ATOM   4751 O O   . GLU B 1 277 ? 5.934  49.922 30.946  1.00 55.18 ? 283 GLU B O   1 
ATOM   4752 C CB  . GLU B 1 277 ? 3.736  48.004 32.270  1.00 56.84 ? 283 GLU B CB  1 
ATOM   4753 C CG  . GLU B 1 277 ? 2.498  48.238 33.122  1.00 58.87 ? 283 GLU B CG  1 
ATOM   4754 C CD  . GLU B 1 277 ? 1.693  46.971 33.345  1.00 60.81 ? 283 GLU B CD  1 
ATOM   4755 O OE1 . GLU B 1 277 ? 2.286  45.947 33.751  1.00 60.85 ? 283 GLU B OE1 1 
ATOM   4756 O OE2 . GLU B 1 277 ? 0.464  47.000 33.119  1.00 62.65 ? 283 GLU B OE2 1 
ATOM   4757 N N   . MET B 1 278 ? 5.712  48.051 29.714  1.00 55.20 ? 284 MET B N   1 
ATOM   4758 C CA  . MET B 1 278 ? 7.082  48.090 29.216  1.00 55.68 ? 284 MET B CA  1 
ATOM   4759 C C   . MET B 1 278 ? 7.250  49.129 28.109  1.00 57.08 ? 284 MET B C   1 
ATOM   4760 O O   . MET B 1 278 ? 8.098  50.018 28.212  1.00 56.51 ? 284 MET B O   1 
ATOM   4761 C CB  . MET B 1 278 ? 7.505  46.708 28.710  1.00 54.19 ? 284 MET B CB  1 
ATOM   4762 C CG  . MET B 1 278 ? 7.605  45.660 29.804  1.00 52.69 ? 284 MET B CG  1 
ATOM   4763 S SD  . MET B 1 278 ? 8.324  44.114 29.226  1.00 50.18 ? 284 MET B SD  1 
ATOM   4764 C CE  . MET B 1 278 ? 6.878  43.327 28.487  1.00 50.04 ? 284 MET B CE  1 
ATOM   4765 N N   . ASN B 1 279 ? 6.453  49.019 27.050  1.00 58.76 ? 285 ASN B N   1 
ATOM   4766 C CA  . ASN B 1 279 ? 6.536  49.986 25.958  1.00 60.65 ? 285 ASN B CA  1 
ATOM   4767 C C   . ASN B 1 279 ? 5.163  50.451 25.493  1.00 61.79 ? 285 ASN B C   1 
ATOM   4768 O O   . ASN B 1 279 ? 4.461  49.733 24.770  1.00 62.27 ? 285 ASN B O   1 
ATOM   4769 C CB  . ASN B 1 279 ? 7.296  49.414 24.756  1.00 60.44 ? 285 ASN B CB  1 
ATOM   4770 C CG  . ASN B 1 279 ? 7.439  50.425 23.627  1.00 61.42 ? 285 ASN B CG  1 
ATOM   4771 O OD1 . ASN B 1 279 ? 6.916  51.539 23.707  1.00 61.27 ? 285 ASN B OD1 1 
ATOM   4772 N ND2 . ASN B 1 279 ? 8.147  50.042 22.570  1.00 60.81 ? 285 ASN B ND2 1 
ATOM   4773 N N   . PRO B 1 280 ? 4.764  51.668 25.903  1.00 62.22 ? 286 PRO B N   1 
ATOM   4774 C CA  . PRO B 1 280 ? 3.474  52.268 25.541  1.00 62.28 ? 286 PRO B CA  1 
ATOM   4775 C C   . PRO B 1 280 ? 3.359  52.461 24.023  1.00 62.35 ? 286 PRO B C   1 
ATOM   4776 O O   . PRO B 1 280 ? 2.322  52.171 23.426  1.00 62.26 ? 286 PRO B O   1 
ATOM   4777 C CB  . PRO B 1 280 ? 3.495  53.603 26.285  1.00 62.71 ? 286 PRO B CB  1 
ATOM   4778 C CG  . PRO B 1 280 ? 4.347  53.309 27.490  1.00 62.41 ? 286 PRO B CG  1 
ATOM   4779 C CD  . PRO B 1 280 ? 5.470  52.500 26.896  1.00 62.31 ? 286 PRO B CD  1 
ATOM   4780 N N   . GLU B 1 284 ? 5.682  46.286 18.297  1.00 69.68 ? 290 GLU B N   1 
ATOM   4781 C CA  . GLU B 1 284 ? 4.571  45.519 18.853  1.00 69.58 ? 290 GLU B CA  1 
ATOM   4782 C C   . GLU B 1 284 ? 4.109  44.386 17.932  1.00 69.74 ? 290 GLU B C   1 
ATOM   4783 O O   . GLU B 1 284 ? 3.366  44.624 16.977  1.00 69.62 ? 290 GLU B O   1 
ATOM   4784 C CB  . GLU B 1 284 ? 3.386  46.450 19.150  1.00 69.93 ? 290 GLU B CB  1 
ATOM   4785 C CG  . GLU B 1 284 ? 3.577  47.379 20.351  1.00 69.89 ? 290 GLU B CG  1 
ATOM   4786 C CD  . GLU B 1 284 ? 3.833  48.826 19.955  1.00 69.94 ? 290 GLU B CD  1 
ATOM   4787 O OE1 . GLU B 1 284 ? 3.056  49.364 19.135  1.00 69.13 ? 290 GLU B OE1 1 
ATOM   4788 O OE2 . GLU B 1 284 ? 4.799  49.432 20.474  1.00 70.49 ? 290 GLU B OE2 1 
ATOM   4789 N N   . PHE B 1 285 ? 4.535  43.156 18.224  1.00 69.63 ? 291 PHE B N   1 
ATOM   4790 C CA  . PHE B 1 285 ? 4.138  42.018 17.398  1.00 69.64 ? 291 PHE B CA  1 
ATOM   4791 C C   . PHE B 1 285 ? 3.774  40.718 18.140  1.00 70.13 ? 291 PHE B C   1 
ATOM   4792 O O   . PHE B 1 285 ? 2.880  40.721 18.989  1.00 69.67 ? 291 PHE B O   1 
ATOM   4793 C CB  . PHE B 1 285 ? 5.213  41.738 16.342  1.00 69.79 ? 291 PHE B CB  1 
ATOM   4794 C CG  . PHE B 1 285 ? 4.652  41.477 14.971  1.00 70.28 ? 291 PHE B CG  1 
ATOM   4795 C CD1 . PHE B 1 285 ? 3.934  42.467 14.300  1.00 70.18 ? 291 PHE B CD1 1 
ATOM   4796 C CD2 . PHE B 1 285 ? 4.805  40.231 14.363  1.00 70.12 ? 291 PHE B CD2 1 
ATOM   4797 C CE1 . PHE B 1 285 ? 3.373  42.220 13.042  1.00 69.99 ? 291 PHE B CE1 1 
ATOM   4798 C CE2 . PHE B 1 285 ? 4.250  39.975 13.110  1.00 69.66 ? 291 PHE B CE2 1 
ATOM   4799 C CZ  . PHE B 1 285 ? 3.532  40.971 12.449  1.00 69.84 ? 291 PHE B CZ  1 
ATOM   4800 N N   . LYS B 1 286 ? 4.459  39.614 17.830  1.00 70.11 ? 292 LYS B N   1 
ATOM   4801 C CA  . LYS B 1 286 ? 4.128  38.326 18.453  1.00 70.39 ? 292 LYS B CA  1 
ATOM   4802 C C   . LYS B 1 286 ? 5.306  37.425 18.844  1.00 70.53 ? 292 LYS B C   1 
ATOM   4803 O O   . LYS B 1 286 ? 6.442  37.645 18.416  1.00 71.19 ? 292 LYS B O   1 
ATOM   4804 C CB  . LYS B 1 286 ? 3.218  37.535 17.512  1.00 70.30 ? 292 LYS B CB  1 
ATOM   4805 C CG  . LYS B 1 286 ? 2.153  38.371 16.820  1.00 70.62 ? 292 LYS B CG  1 
ATOM   4806 C CD  . LYS B 1 286 ? 1.597  37.622 15.620  1.00 70.31 ? 292 LYS B CD  1 
ATOM   4807 C CE  . LYS B 1 286 ? 0.783  38.533 14.723  1.00 70.12 ? 292 LYS B CE  1 
ATOM   4808 N NZ  . LYS B 1 286 ? 0.314  37.801 13.514  1.00 69.94 ? 292 LYS B NZ  1 
ATOM   4809 N N   . PHE B 1 287 ? 5.011  36.401 19.649  1.00 70.12 ? 293 PHE B N   1 
ATOM   4810 C CA  . PHE B 1 287 ? 6.012  35.428 20.105  1.00 69.81 ? 293 PHE B CA  1 
ATOM   4811 C C   . PHE B 1 287 ? 5.410  34.029 20.280  1.00 70.42 ? 293 PHE B C   1 
ATOM   4812 O O   . PHE B 1 287 ? 4.358  33.869 20.901  1.00 70.20 ? 293 PHE B O   1 
ATOM   4813 C CB  . PHE B 1 287 ? 6.634  35.859 21.437  1.00 68.64 ? 293 PHE B CB  1 
ATOM   4814 C CG  . PHE B 1 287 ? 7.386  37.152 21.363  1.00 67.68 ? 293 PHE B CG  1 
ATOM   4815 C CD1 . PHE B 1 287 ? 6.790  38.343 21.774  1.00 67.19 ? 293 PHE B CD1 1 
ATOM   4816 C CD2 . PHE B 1 287 ? 8.680  37.187 20.850  1.00 67.28 ? 293 PHE B CD2 1 
ATOM   4817 C CE1 . PHE B 1 287 ? 7.470  39.554 21.670  1.00 66.65 ? 293 PHE B CE1 1 
ATOM   4818 C CE2 . PHE B 1 287 ? 9.371  38.392 20.739  1.00 67.15 ? 293 PHE B CE2 1 
ATOM   4819 C CZ  . PHE B 1 287 ? 8.762  39.579 21.151  1.00 66.99 ? 293 PHE B CZ  1 
ATOM   4820 N N   . PRO B 1 288 ? 6.076  32.997 19.731  1.00 70.89 ? 294 PRO B N   1 
ATOM   4821 C CA  . PRO B 1 288 ? 5.595  31.613 19.835  1.00 71.21 ? 294 PRO B CA  1 
ATOM   4822 C C   . PRO B 1 288 ? 5.658  31.069 21.263  1.00 71.28 ? 294 PRO B C   1 
ATOM   4823 O O   . PRO B 1 288 ? 6.086  29.933 21.489  1.00 71.90 ? 294 PRO B O   1 
ATOM   4824 C CB  . PRO B 1 288 ? 6.523  30.851 18.887  1.00 70.78 ? 294 PRO B CB  1 
ATOM   4825 C CG  . PRO B 1 288 ? 6.921  31.894 17.880  1.00 70.79 ? 294 PRO B CG  1 
ATOM   4826 C CD  . PRO B 1 288 ? 7.189  33.084 18.770  1.00 71.20 ? 294 PRO B CD  1 
ATOM   4827 N N   . ALA B 1 292 ? 9.785  27.174 28.317  1.00 70.37 ? 298 ALA B N   1 
ATOM   4828 C CA  . ALA B 1 292 ? 8.924  26.976 29.478  1.00 70.60 ? 298 ALA B CA  1 
ATOM   4829 C C   . ALA B 1 292 ? 9.717  26.537 30.713  1.00 70.75 ? 298 ALA B C   1 
ATOM   4830 O O   . ALA B 1 292 ? 9.712  25.360 31.079  1.00 71.50 ? 298 ALA B O   1 
ATOM   4831 C CB  . ALA B 1 292 ? 7.845  25.944 29.152  1.00 70.23 ? 298 ALA B CB  1 
ATOM   4832 N N   . HIS B 1 293 ? 10.395 27.491 31.350  1.00 70.65 ? 299 HIS B N   1 
ATOM   4833 C CA  . HIS B 1 293 ? 11.192 27.230 32.553  1.00 70.18 ? 299 HIS B CA  1 
ATOM   4834 C C   . HIS B 1 293 ? 10.658 28.057 33.719  1.00 69.31 ? 299 HIS B C   1 
ATOM   4835 O O   . HIS B 1 293 ? 10.724 29.286 33.694  1.00 70.12 ? 299 HIS B O   1 
ATOM   4836 C CB  . HIS B 1 293 ? 12.658 27.601 32.316  1.00 70.85 ? 299 HIS B CB  1 
ATOM   4837 C CG  . HIS B 1 293 ? 13.364 26.700 31.354  1.00 71.78 ? 299 HIS B CG  1 
ATOM   4838 N ND1 . HIS B 1 293 ? 12.876 26.422 30.096  1.00 72.41 ? 299 HIS B ND1 1 
ATOM   4839 C CD2 . HIS B 1 293 ? 14.531 26.018 31.465  1.00 72.18 ? 299 HIS B CD2 1 
ATOM   4840 C CE1 . HIS B 1 293 ? 13.709 25.607 29.472  1.00 72.65 ? 299 HIS B CE1 1 
ATOM   4841 N NE2 . HIS B 1 293 ? 14.720 25.347 30.282  1.00 73.13 ? 299 HIS B NE2 1 
ATOM   4842 N N   . PRO B 1 294 ? 10.130 27.393 34.762  1.00 68.15 ? 300 PRO B N   1 
ATOM   4843 C CA  . PRO B 1 294 ? 9.592  28.119 35.919  1.00 66.42 ? 300 PRO B CA  1 
ATOM   4844 C C   . PRO B 1 294 ? 10.614 29.081 36.522  1.00 65.32 ? 300 PRO B C   1 
ATOM   4845 O O   . PRO B 1 294 ? 10.705 30.239 36.112  1.00 65.43 ? 300 PRO B O   1 
ATOM   4846 C CB  . PRO B 1 294 ? 9.211  26.992 36.879  1.00 66.81 ? 300 PRO B CB  1 
ATOM   4847 C CG  . PRO B 1 294 ? 8.849  25.873 35.942  1.00 67.29 ? 300 PRO B CG  1 
ATOM   4848 C CD  . PRO B 1 294 ? 9.985  25.938 34.953  1.00 67.55 ? 300 PRO B CD  1 
ATOM   4849 N N   . TRP B 1 295 ? 11.366 28.584 37.501  1.00 63.31 ? 301 TRP B N   1 
ATOM   4850 C CA  . TRP B 1 295 ? 12.411 29.342 38.190  1.00 60.57 ? 301 TRP B CA  1 
ATOM   4851 C C   . TRP B 1 295 ? 13.175 28.351 39.053  1.00 60.96 ? 301 TRP B C   1 
ATOM   4852 O O   . TRP B 1 295 ? 14.396 28.428 39.180  1.00 60.96 ? 301 TRP B O   1 
ATOM   4853 C CB  . TRP B 1 295 ? 11.814 30.440 39.083  1.00 57.28 ? 301 TRP B CB  1 
ATOM   4854 C CG  . TRP B 1 295 ? 11.837 31.824 38.475  1.00 53.95 ? 301 TRP B CG  1 
ATOM   4855 C CD1 . TRP B 1 295 ? 10.774 32.668 38.321  1.00 52.97 ? 301 TRP B CD1 1 
ATOM   4856 C CD2 . TRP B 1 295 ? 12.979 32.521 37.950  1.00 51.39 ? 301 TRP B CD2 1 
ATOM   4857 N NE1 . TRP B 1 295 ? 11.179 33.844 37.732  1.00 51.41 ? 301 TRP B NE1 1 
ATOM   4858 C CE2 . TRP B 1 295 ? 12.527 33.781 37.493  1.00 51.02 ? 301 TRP B CE2 1 
ATOM   4859 C CE3 . TRP B 1 295 ? 14.338 32.204 37.820  1.00 49.93 ? 301 TRP B CE3 1 
ATOM   4860 C CZ2 . TRP B 1 295 ? 13.386 34.723 36.915  1.00 48.94 ? 301 TRP B CZ2 1 
ATOM   4861 C CZ3 . TRP B 1 295 ? 15.194 33.142 37.244  1.00 48.50 ? 301 TRP B CZ3 1 
ATOM   4862 C CH2 . TRP B 1 295 ? 14.712 34.386 36.799  1.00 48.78 ? 301 TRP B CH2 1 
ATOM   4863 N N   . THR B 1 296 ? 12.444 27.407 39.638  1.00 61.44 ? 302 THR B N   1 
ATOM   4864 C CA  . THR B 1 296 ? 13.054 26.395 40.490  1.00 61.39 ? 302 THR B CA  1 
ATOM   4865 C C   . THR B 1 296 ? 13.615 25.267 39.634  1.00 60.56 ? 302 THR B C   1 
ATOM   4866 O O   . THR B 1 296 ? 13.964 24.202 40.137  1.00 61.56 ? 302 THR B O   1 
ATOM   4867 C CB  . THR B 1 296 ? 12.034 25.816 41.493  1.00 62.38 ? 302 THR B CB  1 
ATOM   4868 O OG1 . THR B 1 296 ? 11.305 26.887 42.109  1.00 62.78 ? 302 THR B OG1 1 
ATOM   4869 C CG2 . THR B 1 296 ? 12.755 25.023 42.582  1.00 62.55 ? 302 THR B CG2 1 
ATOM   4870 N N   . LYS B 1 297 ? 13.694 25.509 38.331  1.00 59.68 ? 303 LYS B N   1 
ATOM   4871 C CA  . LYS B 1 297 ? 14.229 24.527 37.397  1.00 58.27 ? 303 LYS B CA  1 
ATOM   4872 C C   . LYS B 1 297 ? 15.329 25.174 36.569  1.00 56.09 ? 303 LYS B C   1 
ATOM   4873 O O   . LYS B 1 297 ? 15.852 24.574 35.632  1.00 55.62 ? 303 LYS B O   1 
ATOM   4874 C CB  . LYS B 1 297 ? 13.127 24.011 36.468  1.00 59.47 ? 303 LYS B CB  1 
ATOM   4875 C CG  . LYS B 1 297 ? 12.040 23.220 37.174  1.00 61.34 ? 303 LYS B CG  1 
ATOM   4876 C CD  . LYS B 1 297 ? 11.011 22.699 36.181  1.00 62.45 ? 303 LYS B CD  1 
ATOM   4877 C CE  . LYS B 1 297 ? 9.945  21.860 36.875  1.00 63.37 ? 303 LYS B CE  1 
ATOM   4878 N NZ  . LYS B 1 297 ? 8.894  21.380 35.926  1.00 63.33 ? 303 LYS B NZ  1 
ATOM   4879 N N   . VAL B 1 298 ? 15.673 26.405 36.927  1.00 53.63 ? 304 VAL B N   1 
ATOM   4880 C CA  . VAL B 1 298 ? 16.703 27.145 36.216  1.00 51.72 ? 304 VAL B CA  1 
ATOM   4881 C C   . VAL B 1 298 ? 18.087 26.952 36.820  1.00 50.27 ? 304 VAL B C   1 
ATOM   4882 O O   . VAL B 1 298 ? 19.067 26.797 36.096  1.00 49.38 ? 304 VAL B O   1 
ATOM   4883 C CB  . VAL B 1 298 ? 16.385 28.659 36.198  1.00 51.83 ? 304 VAL B CB  1 
ATOM   4884 C CG1 . VAL B 1 298 ? 17.531 29.429 35.563  1.00 51.38 ? 304 VAL B CG1 1 
ATOM   4885 C CG2 . VAL B 1 298 ? 15.095 28.908 35.434  1.00 51.60 ? 304 VAL B CG2 1 
ATOM   4886 N N   . PHE B 1 299 ? 18.165 26.949 38.147  1.00 49.53 ? 305 PHE B N   1 
ATOM   4887 C CA  . PHE B 1 299 ? 19.452 26.806 38.820  1.00 48.98 ? 305 PHE B CA  1 
ATOM   4888 C C   . PHE B 1 299 ? 19.770 25.403 39.326  1.00 49.88 ? 305 PHE B C   1 
ATOM   4889 O O   . PHE B 1 299 ? 18.891 24.541 39.403  1.00 49.25 ? 305 PHE B O   1 
ATOM   4890 C CB  . PHE B 1 299 ? 19.538 27.802 39.976  1.00 46.85 ? 305 PHE B CB  1 
ATOM   4891 C CG  . PHE B 1 299 ? 19.209 29.211 39.577  1.00 45.04 ? 305 PHE B CG  1 
ATOM   4892 C CD1 . PHE B 1 299 ? 17.924 29.715 39.753  1.00 44.19 ? 305 PHE B CD1 1 
ATOM   4893 C CD2 . PHE B 1 299 ? 20.176 30.027 39.000  1.00 44.09 ? 305 PHE B CD2 1 
ATOM   4894 C CE1 . PHE B 1 299 ? 17.607 31.011 39.362  1.00 43.27 ? 305 PHE B CE1 1 
ATOM   4895 C CE2 . PHE B 1 299 ? 19.869 31.327 38.602  1.00 43.33 ? 305 PHE B CE2 1 
ATOM   4896 C CZ  . PHE B 1 299 ? 18.581 31.819 38.785  1.00 42.86 ? 305 PHE B CZ  1 
ATOM   4897 N N   . ARG B 1 300 ? 21.038 25.188 39.672  1.00 50.62 ? 306 ARG B N   1 
ATOM   4898 C CA  . ARG B 1 300 ? 21.489 23.896 40.167  1.00 52.31 ? 306 ARG B CA  1 
ATOM   4899 C C   . ARG B 1 300 ? 20.716 23.484 41.417  1.00 53.42 ? 306 ARG B C   1 
ATOM   4900 O O   . ARG B 1 300 ? 20.158 24.323 42.124  1.00 53.36 ? 306 ARG B O   1 
ATOM   4901 C CB  . ARG B 1 300 ? 23.000 23.920 40.444  1.00 52.23 ? 306 ARG B CB  1 
ATOM   4902 C CG  . ARG B 1 300 ? 23.462 24.832 41.574  1.00 53.01 ? 306 ARG B CG  1 
ATOM   4903 C CD  . ARG B 1 300 ? 24.988 24.873 41.619  1.00 53.88 ? 306 ARG B CD  1 
ATOM   4904 N NE  . ARG B 1 300 ? 25.522 25.783 42.632  1.00 55.12 ? 306 ARG B NE  1 
ATOM   4905 C CZ  . ARG B 1 300 ? 25.539 25.537 43.939  1.00 56.10 ? 306 ARG B CZ  1 
ATOM   4906 N NH1 . ARG B 1 300 ? 25.049 24.398 44.415  1.00 55.97 ? 306 ARG B NH1 1 
ATOM   4907 N NH2 . ARG B 1 300 ? 26.056 26.430 44.775  1.00 55.72 ? 306 ARG B NH2 1 
ATOM   4908 N N   . PRO B 1 301 ? 20.673 22.174 41.699  1.00 54.66 ? 307 PRO B N   1 
ATOM   4909 C CA  . PRO B 1 301 ? 19.981 21.574 42.842  1.00 55.02 ? 307 PRO B CA  1 
ATOM   4910 C C   . PRO B 1 301 ? 19.973 22.342 44.165  1.00 55.10 ? 307 PRO B C   1 
ATOM   4911 O O   . PRO B 1 301 ? 18.918 22.795 44.618  1.00 55.88 ? 307 PRO B O   1 
ATOM   4912 C CB  . PRO B 1 301 ? 20.662 20.215 42.965  1.00 55.24 ? 307 PRO B CB  1 
ATOM   4913 C CG  . PRO B 1 301 ? 20.882 19.852 41.539  1.00 55.02 ? 307 PRO B CG  1 
ATOM   4914 C CD  . PRO B 1 301 ? 21.421 21.142 40.953  1.00 54.93 ? 307 PRO B CD  1 
ATOM   4915 N N   . ARG B 1 302 ? 21.142 22.487 44.779  1.00 53.92 ? 308 ARG B N   1 
ATOM   4916 C CA  . ARG B 1 302 ? 21.249 23.159 46.072  1.00 53.40 ? 308 ARG B CA  1 
ATOM   4917 C C   . ARG B 1 302 ? 21.256 24.687 46.092  1.00 51.86 ? 308 ARG B C   1 
ATOM   4918 O O   . ARG B 1 302 ? 21.757 25.298 47.038  1.00 51.64 ? 308 ARG B O   1 
ATOM   4919 C CB  . ARG B 1 302 ? 22.477 22.623 46.818  1.00 54.53 ? 308 ARG B CB  1 
ATOM   4920 C CG  . ARG B 1 302 ? 22.177 21.397 47.664  1.00 56.45 ? 308 ARG B CG  1 
ATOM   4921 C CD  . ARG B 1 302 ? 23.427 20.589 47.994  1.00 58.15 ? 308 ARG B CD  1 
ATOM   4922 N NE  . ARG B 1 302 ? 23.876 19.789 46.857  1.00 59.19 ? 308 ARG B NE  1 
ATOM   4923 C CZ  . ARG B 1 302 ? 24.870 20.126 46.041  1.00 60.55 ? 308 ARG B CZ  1 
ATOM   4924 N NH1 . ARG B 1 302 ? 25.537 21.258 46.228  1.00 60.99 ? 308 ARG B NH1 1 
ATOM   4925 N NH2 . ARG B 1 302 ? 25.195 19.328 45.033  1.00 61.02 ? 308 ARG B NH2 1 
ATOM   4926 N N   . THR B 1 303 ? 20.692 25.308 45.064  1.00 50.34 ? 309 THR B N   1 
ATOM   4927 C CA  . THR B 1 303 ? 20.640 26.763 45.020  1.00 47.87 ? 309 THR B CA  1 
ATOM   4928 C C   . THR B 1 303 ? 19.706 27.255 46.122  1.00 46.86 ? 309 THR B C   1 
ATOM   4929 O O   . THR B 1 303 ? 18.585 26.764 46.265  1.00 45.87 ? 309 THR B O   1 
ATOM   4930 C CB  . THR B 1 303 ? 20.122 27.263 43.656  1.00 48.59 ? 309 THR B CB  1 
ATOM   4931 O OG1 . THR B 1 303 ? 21.047 26.886 42.628  1.00 47.27 ? 309 THR B OG1 1 
ATOM   4932 C CG2 . THR B 1 303 ? 19.970 28.776 43.667  1.00 48.46 ? 309 THR B CG2 1 
ATOM   4933 N N   . PRO B 1 304 ? 20.162 28.229 46.926  1.00 45.71 ? 310 PRO B N   1 
ATOM   4934 C CA  . PRO B 1 304 ? 19.337 28.765 48.013  1.00 45.21 ? 310 PRO B CA  1 
ATOM   4935 C C   . PRO B 1 304 ? 17.979 29.259 47.511  1.00 44.65 ? 310 PRO B C   1 
ATOM   4936 O O   . PRO B 1 304 ? 17.898 29.991 46.525  1.00 44.90 ? 310 PRO B O   1 
ATOM   4937 C CB  . PRO B 1 304 ? 20.196 29.900 48.570  1.00 45.11 ? 310 PRO B CB  1 
ATOM   4938 C CG  . PRO B 1 304 ? 21.585 29.420 48.323  1.00 46.04 ? 310 PRO B CG  1 
ATOM   4939 C CD  . PRO B 1 304 ? 21.490 28.867 46.916  1.00 45.60 ? 310 PRO B CD  1 
ATOM   4940 N N   . PRO B 1 305 ? 16.892 28.854 48.183  1.00 44.09 ? 311 PRO B N   1 
ATOM   4941 C CA  . PRO B 1 305 ? 15.539 29.263 47.796  1.00 43.91 ? 311 PRO B CA  1 
ATOM   4942 C C   . PRO B 1 305 ? 15.390 30.780 47.733  1.00 43.06 ? 311 PRO B C   1 
ATOM   4943 O O   . PRO B 1 305 ? 14.758 31.314 46.820  1.00 42.83 ? 311 PRO B O   1 
ATOM   4944 C CB  . PRO B 1 305 ? 14.669 28.650 48.892  1.00 43.82 ? 311 PRO B CB  1 
ATOM   4945 C CG  . PRO B 1 305 ? 15.430 27.416 49.263  1.00 43.44 ? 311 PRO B CG  1 
ATOM   4946 C CD  . PRO B 1 305 ? 16.850 27.912 49.315  1.00 44.04 ? 311 PRO B CD  1 
ATOM   4947 N N   . GLU B 1 306 ? 15.975 31.467 48.711  1.00 42.56 ? 312 GLU B N   1 
ATOM   4948 C CA  . GLU B 1 306 ? 15.904 32.922 48.769  1.00 42.17 ? 312 GLU B CA  1 
ATOM   4949 C C   . GLU B 1 306 ? 16.579 33.575 47.559  1.00 40.62 ? 312 GLU B C   1 
ATOM   4950 O O   . GLU B 1 306 ? 16.170 34.648 47.120  1.00 39.89 ? 312 GLU B O   1 
ATOM   4951 C CB  . GLU B 1 306 ? 16.541 33.428 50.066  1.00 43.89 ? 312 GLU B CB  1 
ATOM   4952 C CG  . GLU B 1 306 ? 15.908 32.857 51.327  1.00 47.25 ? 312 GLU B CG  1 
ATOM   4953 C CD  . GLU B 1 306 ? 16.328 31.419 51.607  1.00 50.49 ? 312 GLU B CD  1 
ATOM   4954 O OE1 . GLU B 1 306 ? 15.702 30.784 52.486  1.00 52.89 ? 312 GLU B OE1 1 
ATOM   4955 O OE2 . GLU B 1 306 ? 17.286 30.926 50.965  1.00 49.72 ? 312 GLU B OE2 1 
ATOM   4956 N N   . ALA B 1 307 ? 17.610 32.927 47.024  1.00 39.81 ? 313 ALA B N   1 
ATOM   4957 C CA  . ALA B 1 307 ? 18.316 33.455 45.858  1.00 38.34 ? 313 ALA B CA  1 
ATOM   4958 C C   . ALA B 1 307 ? 17.377 33.427 44.656  1.00 38.04 ? 313 ALA B C   1 
ATOM   4959 O O   . ALA B 1 307 ? 17.321 34.376 43.870  1.00 36.73 ? 313 ALA B O   1 
ATOM   4960 C CB  . ALA B 1 307 ? 19.553 32.620 45.572  1.00 37.08 ? 313 ALA B CB  1 
ATOM   4961 N N   . ILE B 1 308 ? 16.643 32.327 44.521  1.00 38.71 ? 314 ILE B N   1 
ATOM   4962 C CA  . ILE B 1 308 ? 15.691 32.164 43.428  1.00 38.13 ? 314 ILE B CA  1 
ATOM   4963 C C   . ILE B 1 308 ? 14.536 33.152 43.579  1.00 37.69 ? 314 ILE B C   1 
ATOM   4964 O O   . ILE B 1 308 ? 14.056 33.713 42.594  1.00 36.81 ? 314 ILE B O   1 
ATOM   4965 C CB  . ILE B 1 308 ? 15.134 30.725 43.395  1.00 40.19 ? 314 ILE B CB  1 
ATOM   4966 C CG1 . ILE B 1 308 ? 16.250 29.754 42.992  1.00 41.03 ? 314 ILE B CG1 1 
ATOM   4967 C CG2 . ILE B 1 308 ? 13.957 30.638 42.433  1.00 40.65 ? 314 ILE B CG2 1 
ATOM   4968 C CD1 . ILE B 1 308 ? 15.829 28.295 42.975  1.00 42.15 ? 314 ILE B CD1 1 
ATOM   4969 N N   . ALA B 1 309 ? 14.096 33.361 44.817  1.00 35.84 ? 315 ALA B N   1 
ATOM   4970 C CA  . ALA B 1 309 ? 13.008 34.292 45.097  1.00 35.21 ? 315 ALA B CA  1 
ATOM   4971 C C   . ALA B 1 309 ? 13.445 35.704 44.715  1.00 33.84 ? 315 ALA B C   1 
ATOM   4972 O O   . ALA B 1 309 ? 12.696 36.450 44.081  1.00 32.96 ? 315 ALA B O   1 
ATOM   4973 C CB  . ALA B 1 309 ? 12.637 34.237 46.576  1.00 34.42 ? 315 ALA B CB  1 
ATOM   4974 N N   . LEU B 1 310 ? 14.664 36.070 45.098  1.00 32.85 ? 316 LEU B N   1 
ATOM   4975 C CA  . LEU B 1 310 ? 15.181 37.393 44.768  1.00 31.16 ? 316 LEU B CA  1 
ATOM   4976 C C   . LEU B 1 310 ? 15.224 37.577 43.248  1.00 30.60 ? 316 LEU B C   1 
ATOM   4977 O O   . LEU B 1 310 ? 14.757 38.592 42.728  1.00 29.44 ? 316 LEU B O   1 
ATOM   4978 C CB  . LEU B 1 310 ? 16.578 37.590 45.367  1.00 29.37 ? 316 LEU B CB  1 
ATOM   4979 C CG  . LEU B 1 310 ? 17.271 38.910 45.013  1.00 29.01 ? 316 LEU B CG  1 
ATOM   4980 C CD1 . LEU B 1 310 ? 16.324 40.087 45.256  1.00 27.63 ? 316 LEU B CD1 1 
ATOM   4981 C CD2 . LEU B 1 310 ? 18.525 39.061 45.855  1.00 26.86 ? 316 LEU B CD2 1 
ATOM   4982 N N   . CYS B 1 311 ? 15.775 36.599 42.534  1.00 30.88 ? 317 CYS B N   1 
ATOM   4983 C CA  . CYS B 1 311 ? 15.839 36.697 41.075  1.00 32.76 ? 317 CYS B CA  1 
ATOM   4984 C C   . CYS B 1 311 ? 14.460 36.970 40.474  1.00 32.02 ? 317 CYS B C   1 
ATOM   4985 O O   . CYS B 1 311 ? 14.311 37.850 39.631  1.00 31.58 ? 317 CYS B O   1 
ATOM   4986 C CB  . CYS B 1 311 ? 16.392 35.410 40.450  1.00 33.25 ? 317 CYS B CB  1 
ATOM   4987 S SG  . CYS B 1 311 ? 18.180 35.205 40.522  1.00 38.03 ? 317 CYS B SG  1 
ATOM   4988 N N   . SER B 1 312 ? 13.453 36.219 40.913  1.00 33.29 ? 318 SER B N   1 
ATOM   4989 C CA  . SER B 1 312 ? 12.097 36.379 40.381  1.00 34.20 ? 318 SER B CA  1 
ATOM   4990 C C   . SER B 1 312 ? 11.465 37.740 40.653  1.00 34.60 ? 318 SER B C   1 
ATOM   4991 O O   . SER B 1 312 ? 10.574 38.168 39.917  1.00 36.06 ? 318 SER B O   1 
ATOM   4992 C CB  . SER B 1 312 ? 11.172 35.284 40.930  1.00 35.04 ? 318 SER B CB  1 
ATOM   4993 O OG  . SER B 1 312 ? 10.930 35.460 42.318  1.00 37.70 ? 318 SER B OG  1 
ATOM   4994 N N   . ARG B 1 313 ? 11.914 38.417 41.705  1.00 35.17 ? 319 ARG B N   1 
ATOM   4995 C CA  . ARG B 1 313 ? 11.367 39.730 42.057  1.00 34.95 ? 319 ARG B CA  1 
ATOM   4996 C C   . ARG B 1 313 ? 12.162 40.873 41.428  1.00 33.35 ? 319 ARG B C   1 
ATOM   4997 O O   . ARG B 1 313 ? 11.753 42.030 41.482  1.00 33.27 ? 319 ARG B O   1 
ATOM   4998 C CB  . ARG B 1 313 ? 11.325 39.895 43.580  1.00 35.10 ? 319 ARG B CB  1 
ATOM   4999 C CG  . ARG B 1 313 ? 10.452 38.872 44.282  1.00 37.93 ? 319 ARG B CG  1 
ATOM   5000 C CD  . ARG B 1 313 ? 8.965  39.059 43.972  1.00 40.62 ? 319 ARG B CD  1 
ATOM   5001 N NE  . ARG B 1 313 ? 8.418  40.278 44.572  1.00 43.72 ? 319 ARG B NE  1 
ATOM   5002 C CZ  . ARG B 1 313 ? 8.339  41.455 43.954  1.00 46.52 ? 319 ARG B CZ  1 
ATOM   5003 N NH1 . ARG B 1 313 ? 8.768  41.586 42.702  1.00 47.55 ? 319 ARG B NH1 1 
ATOM   5004 N NH2 . ARG B 1 313 ? 7.835  42.505 44.590  1.00 46.50 ? 319 ARG B NH2 1 
ATOM   5005 N N   . LEU B 1 314 ? 13.305 40.545 40.839  1.00 31.65 ? 320 LEU B N   1 
ATOM   5006 C CA  . LEU B 1 314 ? 14.124 41.554 40.178  1.00 30.63 ? 320 LEU B CA  1 
ATOM   5007 C C   . LEU B 1 314 ? 13.792 41.523 38.689  1.00 30.95 ? 320 LEU B C   1 
ATOM   5008 O O   . LEU B 1 314 ? 13.603 42.563 38.051  1.00 31.36 ? 320 LEU B O   1 
ATOM   5009 C CB  . LEU B 1 314 ? 15.616 41.248 40.368  1.00 28.62 ? 320 LEU B CB  1 
ATOM   5010 C CG  . LEU B 1 314 ? 16.189 41.286 41.790  1.00 27.56 ? 320 LEU B CG  1 
ATOM   5011 C CD1 . LEU B 1 314 ? 17.630 40.777 41.779  1.00 26.22 ? 320 LEU B CD1 1 
ATOM   5012 C CD2 . LEU B 1 314 ? 16.130 42.711 42.330  1.00 26.67 ? 320 LEU B CD2 1 
ATOM   5013 N N   . LEU B 1 315 ? 13.715 40.310 38.152  1.00 30.49 ? 321 LEU B N   1 
ATOM   5014 C CA  . LEU B 1 315 ? 13.441 40.093 36.741  1.00 31.21 ? 321 LEU B CA  1 
ATOM   5015 C C   . LEU B 1 315 ? 11.951 39.955 36.462  1.00 32.41 ? 321 LEU B C   1 
ATOM   5016 O O   . LEU B 1 315 ? 11.453 38.864 36.205  1.00 33.06 ? 321 LEU B O   1 
ATOM   5017 C CB  . LEU B 1 315 ? 14.192 38.843 36.269  1.00 30.27 ? 321 LEU B CB  1 
ATOM   5018 C CG  . LEU B 1 315 ? 15.694 38.893 36.574  1.00 28.96 ? 321 LEU B CG  1 
ATOM   5019 C CD1 . LEU B 1 315 ? 16.353 37.557 36.248  1.00 28.17 ? 321 LEU B CD1 1 
ATOM   5020 C CD2 . LEU B 1 315 ? 16.328 40.028 35.764  1.00 27.62 ? 321 LEU B CD2 1 
ATOM   5021 N N   . GLU B 1 316 ? 11.248 41.080 36.524  1.00 32.99 ? 322 GLU B N   1 
ATOM   5022 C CA  . GLU B 1 316 ? 9.811  41.124 36.275  1.00 33.79 ? 322 GLU B CA  1 
ATOM   5023 C C   . GLU B 1 316 ? 9.570  41.965 35.030  1.00 32.75 ? 322 GLU B C   1 
ATOM   5024 O O   . GLU B 1 316 ? 10.263 42.959 34.814  1.00 31.62 ? 322 GLU B O   1 
ATOM   5025 C CB  . GLU B 1 316 ? 9.084  41.792 37.446  1.00 35.12 ? 322 GLU B CB  1 
ATOM   5026 C CG  . GLU B 1 316 ? 9.188  41.083 38.782  1.00 38.59 ? 322 GLU B CG  1 
ATOM   5027 C CD  . GLU B 1 316 ? 8.029  40.138 39.039  1.00 41.83 ? 322 GLU B CD  1 
ATOM   5028 O OE1 . GLU B 1 316 ? 7.821  39.759 40.212  1.00 42.30 ? 322 GLU B OE1 1 
ATOM   5029 O OE2 . GLU B 1 316 ? 7.328  39.773 38.071  1.00 44.25 ? 322 GLU B OE2 1 
ATOM   5030 N N   . TYR B 1 317 ? 8.582  41.581 34.228  1.00 32.97 ? 323 TYR B N   1 
ATOM   5031 C CA  . TYR B 1 317 ? 8.248  42.333 33.024  1.00 32.84 ? 323 TYR B CA  1 
ATOM   5032 C C   . TYR B 1 317 ? 7.846  43.758 33.374  1.00 32.59 ? 323 TYR B C   1 
ATOM   5033 O O   . TYR B 1 317 ? 8.419  44.720 32.864  1.00 33.13 ? 323 TYR B O   1 
ATOM   5034 C CB  . TYR B 1 317 ? 7.092  41.666 32.270  1.00 32.96 ? 323 TYR B CB  1 
ATOM   5035 C CG  . TYR B 1 317 ? 7.495  40.466 31.447  1.00 35.11 ? 323 TYR B CG  1 
ATOM   5036 C CD1 . TYR B 1 317 ? 6.886  39.227 31.641  1.00 36.09 ? 323 TYR B CD1 1 
ATOM   5037 C CD2 . TYR B 1 317 ? 8.467  40.575 30.454  1.00 35.37 ? 323 TYR B CD2 1 
ATOM   5038 C CE1 . TYR B 1 317 ? 7.232  38.125 30.862  1.00 36.98 ? 323 TYR B CE1 1 
ATOM   5039 C CE2 . TYR B 1 317 ? 8.823  39.481 29.671  1.00 37.05 ? 323 TYR B CE2 1 
ATOM   5040 C CZ  . TYR B 1 317 ? 8.199  38.260 29.881  1.00 37.51 ? 323 TYR B CZ  1 
ATOM   5041 O OH  . TYR B 1 317 ? 8.544  37.180 29.106  1.00 39.29 ? 323 TYR B OH  1 
ATOM   5042 N N   . THR B 1 318 ? 6.846  43.888 34.238  1.00 33.46 ? 324 THR B N   1 
ATOM   5043 C CA  . THR B 1 318 ? 6.365  45.201 34.650  1.00 33.49 ? 324 THR B CA  1 
ATOM   5044 C C   . THR B 1 318 ? 7.464  45.902 35.440  1.00 32.37 ? 324 THR B C   1 
ATOM   5045 O O   . THR B 1 318 ? 7.794  45.499 36.554  1.00 31.77 ? 324 THR B O   1 
ATOM   5046 C CB  . THR B 1 318 ? 5.105  45.071 35.523  1.00 34.51 ? 324 THR B CB  1 
ATOM   5047 O OG1 . THR B 1 318 ? 4.095  44.361 34.790  1.00 35.63 ? 324 THR B OG1 1 
ATOM   5048 C CG2 . THR B 1 318 ? 4.583  46.446 35.911  1.00 34.11 ? 324 THR B CG2 1 
ATOM   5049 N N   . PRO B 1 319 ? 8.043  46.968 34.869  1.00 32.16 ? 325 PRO B N   1 
ATOM   5050 C CA  . PRO B 1 319 ? 9.114  47.712 35.533  1.00 31.54 ? 325 PRO B CA  1 
ATOM   5051 C C   . PRO B 1 319 ? 8.807  48.125 36.964  1.00 32.76 ? 325 PRO B C   1 
ATOM   5052 O O   . PRO B 1 319 ? 9.627  47.917 37.862  1.00 31.97 ? 325 PRO B O   1 
ATOM   5053 C CB  . PRO B 1 319 ? 9.317  48.912 34.617  1.00 31.73 ? 325 PRO B CB  1 
ATOM   5054 C CG  . PRO B 1 319 ? 8.972  48.362 33.267  1.00 32.23 ? 325 PRO B CG  1 
ATOM   5055 C CD  . PRO B 1 319 ? 7.732  47.561 33.555  1.00 31.84 ? 325 PRO B CD  1 
ATOM   5056 N N   . THR B 1 320 ? 7.627  48.702 37.178  1.00 32.78 ? 326 THR B N   1 
ATOM   5057 C CA  . THR B 1 320 ? 7.237  49.159 38.508  1.00 32.88 ? 326 THR B CA  1 
ATOM   5058 C C   . THR B 1 320 ? 7.051  48.014 39.498  1.00 32.18 ? 326 THR B C   1 
ATOM   5059 O O   . THR B 1 320 ? 6.961  48.243 40.701  1.00 33.14 ? 326 THR B O   1 
ATOM   5060 C CB  . THR B 1 320 ? 5.917  49.985 38.466  1.00 33.78 ? 326 THR B CB  1 
ATOM   5061 O OG1 . THR B 1 320 ? 4.861  49.181 37.927  1.00 34.28 ? 326 THR B OG1 1 
ATOM   5062 C CG2 . THR B 1 320 ? 6.085  51.220 37.598  1.00 34.18 ? 326 THR B CG2 1 
ATOM   5063 N N   . ALA B 1 321 ? 6.997  46.784 38.997  1.00 31.54 ? 327 ALA B N   1 
ATOM   5064 C CA  . ALA B 1 321 ? 6.809  45.627 39.871  1.00 31.10 ? 327 ALA B CA  1 
ATOM   5065 C C   . ALA B 1 321 ? 8.126  45.122 40.453  1.00 31.54 ? 327 ALA B C   1 
ATOM   5066 O O   . ALA B 1 321 ? 8.135  44.384 41.437  1.00 31.83 ? 327 ALA B O   1 
ATOM   5067 C CB  . ALA B 1 321 ? 6.112  44.502 39.111  1.00 30.90 ? 327 ALA B CB  1 
ATOM   5068 N N   . ARG B 1 322 ? 9.237  45.518 39.843  1.00 29.96 ? 328 ARG B N   1 
ATOM   5069 C CA  . ARG B 1 322 ? 10.543 45.083 40.316  1.00 29.18 ? 328 ARG B CA  1 
ATOM   5070 C C   . ARG B 1 322 ? 10.881 45.706 41.662  1.00 30.05 ? 328 ARG B C   1 
ATOM   5071 O O   . ARG B 1 322 ? 10.466 46.825 41.962  1.00 31.30 ? 328 ARG B O   1 
ATOM   5072 C CB  . ARG B 1 322 ? 11.619 45.466 39.298  1.00 27.55 ? 328 ARG B CB  1 
ATOM   5073 C CG  . ARG B 1 322 ? 11.362 44.892 37.919  1.00 25.59 ? 328 ARG B CG  1 
ATOM   5074 C CD  . ARG B 1 322 ? 12.277 45.483 36.859  1.00 27.89 ? 328 ARG B CD  1 
ATOM   5075 N NE  . ARG B 1 322 ? 11.849 45.023 35.546  1.00 26.79 ? 328 ARG B NE  1 
ATOM   5076 C CZ  . ARG B 1 322 ? 12.077 45.666 34.407  1.00 29.16 ? 328 ARG B CZ  1 
ATOM   5077 N NH1 . ARG B 1 322 ? 12.746 46.810 34.409  1.00 26.65 ? 328 ARG B NH1 1 
ATOM   5078 N NH2 . ARG B 1 322 ? 11.592 45.177 33.270  1.00 28.43 ? 328 ARG B NH2 1 
ATOM   5079 N N   . LEU B 1 323 ? 11.634 44.975 42.475  1.00 29.67 ? 329 LEU B N   1 
ATOM   5080 C CA  . LEU B 1 323 ? 12.060 45.490 43.770  1.00 29.29 ? 329 LEU B CA  1 
ATOM   5081 C C   . LEU B 1 323 ? 12.939 46.700 43.488  1.00 29.24 ? 329 LEU B C   1 
ATOM   5082 O O   . LEU B 1 323 ? 13.580 46.778 42.432  1.00 29.37 ? 329 LEU B O   1 
ATOM   5083 C CB  . LEU B 1 323 ? 12.925 44.461 44.506  1.00 28.65 ? 329 LEU B CB  1 
ATOM   5084 C CG  . LEU B 1 323 ? 12.390 43.090 44.901  1.00 29.94 ? 329 LEU B CG  1 
ATOM   5085 C CD1 . LEU B 1 323 ? 13.534 42.280 45.495  1.00 31.18 ? 329 LEU B CD1 1 
ATOM   5086 C CD2 . LEU B 1 323 ? 11.269 43.235 45.918  1.00 31.64 ? 329 LEU B CD2 1 
ATOM   5087 N N   . THR B 1 324 ? 12.978 47.638 44.424  1.00 28.09 ? 330 THR B N   1 
ATOM   5088 C CA  . THR B 1 324 ? 13.854 48.790 44.277  1.00 28.26 ? 330 THR B CA  1 
ATOM   5089 C C   . THR B 1 324 ? 15.192 48.300 44.855  1.00 27.16 ? 330 THR B C   1 
ATOM   5090 O O   . THR B 1 324 ? 15.241 47.257 45.500  1.00 27.19 ? 330 THR B O   1 
ATOM   5091 C CB  . THR B 1 324 ? 13.355 49.987 45.101  1.00 28.79 ? 330 THR B CB  1 
ATOM   5092 O OG1 . THR B 1 324 ? 13.486 49.694 46.498  1.00 30.46 ? 330 THR B OG1 1 
ATOM   5093 C CG2 . THR B 1 324 ? 11.884 50.272 44.782  1.00 28.39 ? 330 THR B CG2 1 
ATOM   5094 N N   . PRO B 1 325 ? 16.292 49.025 44.610  1.00 27.41 ? 331 PRO B N   1 
ATOM   5095 C CA  . PRO B 1 325 ? 17.593 48.598 45.144  1.00 26.97 ? 331 PRO B CA  1 
ATOM   5096 C C   . PRO B 1 325 ? 17.607 48.440 46.664  1.00 29.03 ? 331 PRO B C   1 
ATOM   5097 O O   . PRO B 1 325 ? 18.131 47.455 47.192  1.00 27.54 ? 331 PRO B O   1 
ATOM   5098 C CB  . PRO B 1 325 ? 18.529 49.698 44.677  1.00 25.43 ? 331 PRO B CB  1 
ATOM   5099 C CG  . PRO B 1 325 ? 17.945 50.075 43.357  1.00 26.07 ? 331 PRO B CG  1 
ATOM   5100 C CD  . PRO B 1 325 ? 16.460 50.133 43.654  1.00 26.28 ? 331 PRO B CD  1 
ATOM   5101 N N   . LEU B 1 326 ? 17.028 49.408 47.369  1.00 28.61 ? 332 LEU B N   1 
ATOM   5102 C CA  . LEU B 1 326 ? 17.006 49.346 48.823  1.00 29.14 ? 332 LEU B CA  1 
ATOM   5103 C C   . LEU B 1 326 ? 16.185 48.140 49.277  1.00 28.77 ? 332 LEU B C   1 
ATOM   5104 O O   . LEU B 1 326 ? 16.556 47.451 50.227  1.00 30.26 ? 332 LEU B O   1 
ATOM   5105 C CB  . LEU B 1 326 ? 16.436 50.648 49.393  1.00 31.85 ? 332 LEU B CB  1 
ATOM   5106 C CG  . LEU B 1 326 ? 16.874 51.036 50.806  1.00 33.67 ? 332 LEU B CG  1 
ATOM   5107 C CD1 . LEU B 1 326 ? 18.399 51.124 50.880  1.00 32.39 ? 332 LEU B CD1 1 
ATOM   5108 C CD2 . LEU B 1 326 ? 16.237 52.371 51.168  1.00 33.89 ? 332 LEU B CD2 1 
ATOM   5109 N N   . GLU B 1 327 ? 15.080 47.864 48.594  1.00 28.94 ? 333 GLU B N   1 
ATOM   5110 C CA  . GLU B 1 327 ? 14.262 46.710 48.966  1.00 30.07 ? 333 GLU B CA  1 
ATOM   5111 C C   . GLU B 1 327 ? 15.028 45.408 48.722  1.00 29.80 ? 333 GLU B C   1 
ATOM   5112 O O   . GLU B 1 327 ? 14.861 44.441 49.458  1.00 29.55 ? 333 GLU B O   1 
ATOM   5113 C CB  . GLU B 1 327 ? 12.954 46.686 48.177  1.00 30.00 ? 333 GLU B CB  1 
ATOM   5114 C CG  . GLU B 1 327 ? 12.078 47.914 48.383  1.00 33.03 ? 333 GLU B CG  1 
ATOM   5115 C CD  . GLU B 1 327 ? 10.829 47.889 47.517  1.00 32.94 ? 333 GLU B CD  1 
ATOM   5116 O OE1 . GLU B 1 327 ? 10.863 47.275 46.431  1.00 32.53 ? 333 GLU B OE1 1 
ATOM   5117 O OE2 . GLU B 1 327 ? 9.816  48.498 47.913  1.00 34.63 ? 333 GLU B OE2 1 
ATOM   5118 N N   . ALA B 1 328 ? 15.860 45.382 47.683  1.00 28.80 ? 334 ALA B N   1 
ATOM   5119 C CA  . ALA B 1 328 ? 16.646 44.191 47.380  1.00 27.16 ? 334 ALA B CA  1 
ATOM   5120 C C   . ALA B 1 328 ? 17.653 43.963 48.513  1.00 27.15 ? 334 ALA B C   1 
ATOM   5121 O O   . ALA B 1 328 ? 17.818 42.842 48.991  1.00 26.85 ? 334 ALA B O   1 
ATOM   5122 C CB  . ALA B 1 328 ? 17.373 44.360 46.029  1.00 26.09 ? 334 ALA B CB  1 
ATOM   5123 N N   . CYS B 1 329 ? 18.320 45.025 48.951  1.00 25.82 ? 335 CYS B N   1 
ATOM   5124 C CA  . CYS B 1 329 ? 19.273 44.896 50.049  1.00 27.78 ? 335 CYS B CA  1 
ATOM   5125 C C   . CYS B 1 329 ? 18.606 44.274 51.278  1.00 28.32 ? 335 CYS B C   1 
ATOM   5126 O O   . CYS B 1 329 ? 19.239 43.529 52.034  1.00 29.72 ? 335 CYS B O   1 
ATOM   5127 C CB  . CYS B 1 329 ? 19.842 46.264 50.445  1.00 27.89 ? 335 CYS B CB  1 
ATOM   5128 S SG  . CYS B 1 329 ? 21.006 47.002 49.280  1.00 28.20 ? 335 CYS B SG  1 
ATOM   5129 N N   . ALA B 1 330 ? 17.327 44.585 51.472  1.00 29.02 ? 336 ALA B N   1 
ATOM   5130 C CA  . ALA B 1 330 ? 16.571 44.090 52.618  1.00 29.25 ? 336 ALA B CA  1 
ATOM   5131 C C   . ALA B 1 330 ? 16.011 42.683 52.427  1.00 30.23 ? 336 ALA B C   1 
ATOM   5132 O O   . ALA B 1 330 ? 15.421 42.126 53.345  1.00 28.65 ? 336 ALA B O   1 
ATOM   5133 C CB  . ALA B 1 330 ? 15.428 45.059 52.942  1.00 27.88 ? 336 ALA B CB  1 
ATOM   5134 N N   . HIS B 1 331 ? 16.202 42.111 51.241  1.00 29.78 ? 337 HIS B N   1 
ATOM   5135 C CA  . HIS B 1 331 ? 15.696 40.770 50.955  1.00 30.65 ? 337 HIS B CA  1 
ATOM   5136 C C   . HIS B 1 331 ? 16.337 39.730 51.882  1.00 31.30 ? 337 HIS B C   1 
ATOM   5137 O O   . HIS B 1 331 ? 17.464 39.907 52.351  1.00 30.52 ? 337 HIS B O   1 
ATOM   5138 C CB  . HIS B 1 331 ? 15.980 40.400 49.494  1.00 29.29 ? 337 HIS B CB  1 
ATOM   5139 C CG  . HIS B 1 331 ? 15.295 39.146 49.046  1.00 28.33 ? 337 HIS B CG  1 
ATOM   5140 N ND1 . HIS B 1 331 ? 14.030 39.146 48.496  1.00 30.63 ? 337 HIS B ND1 1 
ATOM   5141 C CD2 . HIS B 1 331 ? 15.700 37.855 49.064  1.00 27.57 ? 337 HIS B CD2 1 
ATOM   5142 C CE1 . HIS B 1 331 ? 13.688 37.906 48.189  1.00 30.01 ? 337 HIS B CE1 1 
ATOM   5143 N NE2 . HIS B 1 331 ? 14.683 37.104 48.523  1.00 30.94 ? 337 HIS B NE2 1 
ATOM   5144 N N   . SER B 1 332 ? 15.620 38.638 52.130  1.00 32.12 ? 338 SER B N   1 
ATOM   5145 C CA  . SER B 1 332 ? 16.112 37.583 53.009  1.00 33.81 ? 338 SER B CA  1 
ATOM   5146 C C   . SER B 1 332 ? 17.382 36.894 52.501  1.00 34.53 ? 338 SER B C   1 
ATOM   5147 O O   . SER B 1 332 ? 18.163 36.359 53.294  1.00 34.31 ? 338 SER B O   1 
ATOM   5148 C CB  . SER B 1 332 ? 15.009 36.544 53.241  1.00 36.46 ? 338 SER B CB  1 
ATOM   5149 O OG  . SER B 1 332 ? 14.525 36.040 52.010  1.00 40.03 ? 338 SER B OG  1 
ATOM   5150 N N   . PHE B 1 333 ? 17.591 36.908 51.184  1.00 33.96 ? 339 PHE B N   1 
ATOM   5151 C CA  . PHE B 1 333 ? 18.780 36.288 50.601  1.00 32.15 ? 339 PHE B CA  1 
ATOM   5152 C C   . PHE B 1 333 ? 20.018 36.871 51.272  1.00 31.81 ? 339 PHE B C   1 
ATOM   5153 O O   . PHE B 1 333 ? 21.048 36.206 51.392  1.00 31.97 ? 339 PHE B O   1 
ATOM   5154 C CB  . PHE B 1 333 ? 18.833 36.557 49.089  1.00 30.43 ? 339 PHE B CB  1 
ATOM   5155 C CG  . PHE B 1 333 ? 20.088 36.055 48.416  1.00 30.54 ? 339 PHE B CG  1 
ATOM   5156 C CD1 . PHE B 1 333 ? 20.469 34.719 48.520  1.00 30.24 ? 339 PHE B CD1 1 
ATOM   5157 C CD2 . PHE B 1 333 ? 20.885 36.920 47.669  1.00 30.24 ? 339 PHE B CD2 1 
ATOM   5158 C CE1 . PHE B 1 333 ? 21.631 34.248 47.886  1.00 30.13 ? 339 PHE B CE1 1 
ATOM   5159 C CE2 . PHE B 1 333 ? 22.048 36.461 47.030  1.00 30.59 ? 339 PHE B CE2 1 
ATOM   5160 C CZ  . PHE B 1 333 ? 22.420 35.125 47.141  1.00 29.98 ? 339 PHE B CZ  1 
ATOM   5161 N N   . PHE B 1 334 ? 19.907 38.115 51.724  1.00 30.45 ? 340 PHE B N   1 
ATOM   5162 C CA  . PHE B 1 334 ? 21.030 38.779 52.368  1.00 30.32 ? 340 PHE B CA  1 
ATOM   5163 C C   . PHE B 1 334 ? 21.030 38.701 53.895  1.00 30.78 ? 340 PHE B C   1 
ATOM   5164 O O   . PHE B 1 334 ? 21.861 39.328 54.551  1.00 31.94 ? 340 PHE B O   1 
ATOM   5165 C CB  . PHE B 1 334 ? 21.085 40.239 51.914  1.00 28.52 ? 340 PHE B CB  1 
ATOM   5166 C CG  . PHE B 1 334 ? 21.230 40.399 50.419  1.00 27.17 ? 340 PHE B CG  1 
ATOM   5167 C CD1 . PHE B 1 334 ? 20.256 41.058 49.678  1.00 27.75 ? 340 PHE B CD1 1 
ATOM   5168 C CD2 . PHE B 1 334 ? 22.339 39.881 49.757  1.00 25.88 ? 340 PHE B CD2 1 
ATOM   5169 C CE1 . PHE B 1 334 ? 20.384 41.202 48.296  1.00 27.97 ? 340 PHE B CE1 1 
ATOM   5170 C CE2 . PHE B 1 334 ? 22.479 40.017 48.377  1.00 27.40 ? 340 PHE B CE2 1 
ATOM   5171 C CZ  . PHE B 1 334 ? 21.502 40.679 47.643  1.00 27.59 ? 340 PHE B CZ  1 
ATOM   5172 N N   . ASP B 1 335 ? 20.116 37.926 54.466  1.00 31.52 ? 341 ASP B N   1 
ATOM   5173 C CA  . ASP B 1 335 ? 20.055 37.805 55.926  1.00 31.79 ? 341 ASP B CA  1 
ATOM   5174 C C   . ASP B 1 335 ? 21.379 37.385 56.549  1.00 32.31 ? 341 ASP B C   1 
ATOM   5175 O O   . ASP B 1 335 ? 21.787 37.932 57.570  1.00 31.13 ? 341 ASP B O   1 
ATOM   5176 C CB  . ASP B 1 335 ? 18.964 36.819 56.333  1.00 32.84 ? 341 ASP B CB  1 
ATOM   5177 C CG  . ASP B 1 335 ? 17.579 37.417 56.236  1.00 35.93 ? 341 ASP B CG  1 
ATOM   5178 O OD1 . ASP B 1 335 ? 16.600 36.666 56.417  1.00 38.18 ? 341 ASP B OD1 1 
ATOM   5179 O OD2 . ASP B 1 335 ? 17.468 38.638 55.980  1.00 37.65 ? 341 ASP B OD2 1 
ATOM   5180 N N   . GLU B 1 336 ? 22.061 36.426 55.928  1.00 33.00 ? 342 GLU B N   1 
ATOM   5181 C CA  . GLU B 1 336 ? 23.340 35.959 56.449  1.00 32.39 ? 342 GLU B CA  1 
ATOM   5182 C C   . GLU B 1 336 ? 24.336 37.111 56.632  1.00 31.92 ? 342 GLU B C   1 
ATOM   5183 O O   . GLU B 1 336 ? 25.168 37.095 57.545  1.00 30.09 ? 342 GLU B O   1 
ATOM   5184 C CB  . GLU B 1 336 ? 23.933 34.897 55.515  1.00 34.21 ? 342 GLU B CB  1 
ATOM   5185 C CG  . GLU B 1 336 ? 25.381 34.537 55.836  1.00 38.76 ? 342 GLU B CG  1 
ATOM   5186 C CD  . GLU B 1 336 ? 25.866 33.291 55.104  1.00 40.62 ? 342 GLU B CD  1 
ATOM   5187 O OE1 . GLU B 1 336 ? 25.343 32.988 54.007  1.00 41.43 ? 342 GLU B OE1 1 
ATOM   5188 O OE2 . GLU B 1 336 ? 26.784 32.624 55.623  1.00 43.39 ? 342 GLU B OE2 1 
ATOM   5189 N N   . LEU B 1 337 ? 24.243 38.121 55.773  1.00 29.14 ? 343 LEU B N   1 
ATOM   5190 C CA  . LEU B 1 337 ? 25.158 39.252 55.862  1.00 28.70 ? 343 LEU B CA  1 
ATOM   5191 C C   . LEU B 1 337 ? 24.895 40.107 57.096  1.00 27.95 ? 343 LEU B C   1 
ATOM   5192 O O   . LEU B 1 337 ? 25.761 40.871 57.528  1.00 27.86 ? 343 LEU B O   1 
ATOM   5193 C CB  . LEU B 1 337 ? 25.045 40.124 54.609  1.00 28.60 ? 343 LEU B CB  1 
ATOM   5194 C CG  . LEU B 1 337 ? 25.374 39.439 53.279  1.00 28.21 ? 343 LEU B CG  1 
ATOM   5195 C CD1 . LEU B 1 337 ? 25.297 40.463 52.142  1.00 27.22 ? 343 LEU B CD1 1 
ATOM   5196 C CD2 . LEU B 1 337 ? 26.768 38.814 53.363  1.00 25.35 ? 343 LEU B CD2 1 
ATOM   5197 N N   . ARG B 1 338 ? 23.694 39.981 57.651  1.00 29.48 ? 344 ARG B N   1 
ATOM   5198 C CA  . ARG B 1 338 ? 23.315 40.756 58.832  1.00 32.69 ? 344 ARG B CA  1 
ATOM   5199 C C   . ARG B 1 338 ? 23.592 39.994 60.128  1.00 34.50 ? 344 ARG B C   1 
ATOM   5200 O O   . ARG B 1 338 ? 23.407 40.522 61.222  1.00 34.20 ? 344 ARG B O   1 
ATOM   5201 C CB  . ARG B 1 338 ? 21.833 41.148 58.745  1.00 32.09 ? 344 ARG B CB  1 
ATOM   5202 C CG  . ARG B 1 338 ? 21.553 42.282 57.751  1.00 32.47 ? 344 ARG B CG  1 
ATOM   5203 C CD  . ARG B 1 338 ? 20.066 42.624 57.666  1.00 30.65 ? 344 ARG B CD  1 
ATOM   5204 N NE  . ARG B 1 338 ? 19.334 41.724 56.779  1.00 32.39 ? 344 ARG B NE  1 
ATOM   5205 C CZ  . ARG B 1 338 ? 19.269 41.860 55.458  1.00 30.12 ? 344 ARG B CZ  1 
ATOM   5206 N NH1 . ARG B 1 338 ? 19.889 42.865 54.854  1.00 29.58 ? 344 ARG B NH1 1 
ATOM   5207 N NH2 . ARG B 1 338 ? 18.579 40.987 54.740  1.00 32.29 ? 344 ARG B NH2 1 
ATOM   5208 N N   . ASP B 1 339 ? 24.040 38.750 59.993  1.00 36.71 ? 345 ASP B N   1 
ATOM   5209 C CA  . ASP B 1 339 ? 24.360 37.911 61.146  1.00 37.96 ? 345 ASP B CA  1 
ATOM   5210 C C   . ASP B 1 339 ? 25.618 38.459 61.819  1.00 38.08 ? 345 ASP B C   1 
ATOM   5211 O O   . ASP B 1 339 ? 26.627 38.705 61.163  1.00 39.03 ? 345 ASP B O   1 
ATOM   5212 C CB  . ASP B 1 339 ? 24.577 36.469 60.678  1.00 39.71 ? 345 ASP B CB  1 
ATOM   5213 C CG  . ASP B 1 339 ? 24.811 35.493 61.828  1.00 42.27 ? 345 ASP B CG  1 
ATOM   5214 O OD1 . ASP B 1 339 ? 24.610 34.279 61.612  1.00 42.60 ? 345 ASP B OD1 1 
ATOM   5215 O OD2 . ASP B 1 339 ? 25.201 35.926 62.931  1.00 41.14 ? 345 ASP B OD2 1 
ATOM   5216 N N   . PRO B 1 340 ? 25.569 38.661 63.146  1.00 39.52 ? 346 PRO B N   1 
ATOM   5217 C CA  . PRO B 1 340 ? 26.694 39.185 63.926  1.00 40.03 ? 346 PRO B CA  1 
ATOM   5218 C C   . PRO B 1 340 ? 28.015 38.434 63.742  1.00 40.59 ? 346 PRO B C   1 
ATOM   5219 O O   . PRO B 1 340 ? 29.087 39.038 63.744  1.00 40.77 ? 346 PRO B O   1 
ATOM   5220 C CB  . PRO B 1 340 ? 26.191 39.084 65.365  1.00 39.86 ? 346 PRO B CB  1 
ATOM   5221 C CG  . PRO B 1 340 ? 24.727 39.237 65.221  1.00 41.88 ? 346 PRO B CG  1 
ATOM   5222 C CD  . PRO B 1 340 ? 24.421 38.379 64.025  1.00 39.52 ? 346 PRO B CD  1 
ATOM   5223 N N   . ASN B 1 341 ? 27.942 37.121 63.573  1.00 41.80 ? 347 ASN B N   1 
ATOM   5224 C CA  . ASN B 1 341 ? 29.158 36.329 63.439  1.00 43.59 ? 347 ASN B CA  1 
ATOM   5225 C C   . ASN B 1 341 ? 29.644 36.057 62.023  1.00 43.74 ? 347 ASN B C   1 
ATOM   5226 O O   . ASN B 1 341 ? 30.612 35.318 61.834  1.00 42.71 ? 347 ASN B O   1 
ATOM   5227 C CB  . ASN B 1 341 ? 28.987 35.001 64.179  1.00 44.85 ? 347 ASN B CB  1 
ATOM   5228 C CG  . ASN B 1 341 ? 28.689 35.199 65.647  1.00 46.31 ? 347 ASN B CG  1 
ATOM   5229 O OD1 . ASN B 1 341 ? 29.380 35.958 66.328  1.00 46.20 ? 347 ASN B OD1 1 
ATOM   5230 N ND2 . ASN B 1 341 ? 27.659 34.520 66.146  1.00 47.02 ? 347 ASN B ND2 1 
ATOM   5231 N N   . VAL B 1 342 ? 28.996 36.651 61.026  1.00 42.83 ? 348 VAL B N   1 
ATOM   5232 C CA  . VAL B 1 342 ? 29.415 36.422 59.650  1.00 41.63 ? 348 VAL B CA  1 
ATOM   5233 C C   . VAL B 1 342 ? 30.865 36.860 59.451  1.00 42.75 ? 348 VAL B C   1 
ATOM   5234 O O   . VAL B 1 342 ? 31.300 37.881 59.975  1.00 42.22 ? 348 VAL B O   1 
ATOM   5235 C CB  . VAL B 1 342 ? 28.493 37.174 58.643  1.00 40.41 ? 348 VAL B CB  1 
ATOM   5236 C CG1 . VAL B 1 342 ? 28.706 38.676 58.750  1.00 36.61 ? 348 VAL B CG1 1 
ATOM   5237 C CG2 . VAL B 1 342 ? 28.760 36.679 57.234  1.00 39.99 ? 348 VAL B CG2 1 
ATOM   5238 N N   . LYS B 1 343 ? 31.608 36.064 58.694  1.00 43.64 ? 349 LYS B N   1 
ATOM   5239 C CA  . LYS B 1 343 ? 33.010 36.348 58.396  1.00 45.18 ? 349 LYS B CA  1 
ATOM   5240 C C   . LYS B 1 343 ? 33.281 35.939 56.950  1.00 44.83 ? 349 LYS B C   1 
ATOM   5241 O O   . LYS B 1 343 ? 32.520 35.165 56.390  1.00 44.15 ? 349 LYS B O   1 
ATOM   5242 C CB  . LYS B 1 343 ? 33.913 35.533 59.327  1.00 46.96 ? 349 LYS B CB  1 
ATOM   5243 C CG  . LYS B 1 343 ? 34.247 36.194 60.656  1.00 49.71 ? 349 LYS B CG  1 
ATOM   5244 C CD  . LYS B 1 343 ? 35.387 37.173 60.468  1.00 51.75 ? 349 LYS B CD  1 
ATOM   5245 C CE  . LYS B 1 343 ? 35.903 37.700 61.790  1.00 53.76 ? 349 LYS B CE  1 
ATOM   5246 N NZ  . LYS B 1 343 ? 37.213 38.392 61.612  1.00 54.23 ? 349 LYS B NZ  1 
ATOM   5247 N N   . LEU B 1 344 ? 34.340 36.465 56.342  1.00 46.13 ? 350 LEU B N   1 
ATOM   5248 C CA  . LEU B 1 344 ? 34.681 36.084 54.980  1.00 47.20 ? 350 LEU B CA  1 
ATOM   5249 C C   . LEU B 1 344 ? 35.370 34.726 55.067  1.00 48.65 ? 350 LEU B C   1 
ATOM   5250 O O   . LEU B 1 344 ? 35.905 34.359 56.112  1.00 49.02 ? 350 LEU B O   1 
ATOM   5251 C CB  . LEU B 1 344 ? 35.654 37.091 54.354  1.00 47.11 ? 350 LEU B CB  1 
ATOM   5252 C CG  . LEU B 1 344 ? 35.222 38.552 54.210  1.00 47.27 ? 350 LEU B CG  1 
ATOM   5253 C CD1 . LEU B 1 344 ? 36.357 39.330 53.560  1.00 47.54 ? 350 LEU B CD1 1 
ATOM   5254 C CD2 . LEU B 1 344 ? 33.991 38.677 53.339  1.00 46.48 ? 350 LEU B CD2 1 
ATOM   5255 N N   . PRO B 1 345 ? 35.377 33.966 53.963  1.00 50.08 ? 351 PRO B N   1 
ATOM   5256 C CA  . PRO B 1 345 ? 36.027 32.654 53.975  1.00 50.66 ? 351 PRO B CA  1 
ATOM   5257 C C   . PRO B 1 345 ? 37.487 32.719 54.421  1.00 51.02 ? 351 PRO B C   1 
ATOM   5258 O O   . PRO B 1 345 ? 37.985 31.787 55.047  1.00 51.32 ? 351 PRO B O   1 
ATOM   5259 C CB  . PRO B 1 345 ? 35.869 32.189 52.534  1.00 50.07 ? 351 PRO B CB  1 
ATOM   5260 C CG  . PRO B 1 345 ? 34.535 32.739 52.170  1.00 50.39 ? 351 PRO B CG  1 
ATOM   5261 C CD  . PRO B 1 345 ? 34.606 34.153 52.718  1.00 50.41 ? 351 PRO B CD  1 
ATOM   5262 N N   . ASN B 1 346 ? 38.162 33.820 54.100  1.00 51.51 ? 352 ASN B N   1 
ATOM   5263 C CA  . ASN B 1 346 ? 39.559 33.993 54.481  1.00 52.01 ? 352 ASN B CA  1 
ATOM   5264 C C   . ASN B 1 346 ? 39.735 34.413 55.946  1.00 52.65 ? 352 ASN B C   1 
ATOM   5265 O O   . ASN B 1 346 ? 40.844 34.754 56.370  1.00 53.14 ? 352 ASN B O   1 
ATOM   5266 C CB  . ASN B 1 346 ? 40.259 35.022 53.574  1.00 52.32 ? 352 ASN B CB  1 
ATOM   5267 C CG  . ASN B 1 346 ? 39.657 36.420 53.684  1.00 53.24 ? 352 ASN B CG  1 
ATOM   5268 O OD1 . ASN B 1 346 ? 38.928 36.726 54.631  1.00 53.76 ? 352 ASN B OD1 1 
ATOM   5269 N ND2 . ASN B 1 346 ? 39.976 37.280 52.721  1.00 52.67 ? 352 ASN B ND2 1 
ATOM   5270 N N   . GLY B 1 347 ? 38.646 34.397 56.711  1.00 52.19 ? 353 GLY B N   1 
ATOM   5271 C CA  . GLY B 1 347 ? 38.714 34.761 58.117  1.00 51.48 ? 353 GLY B CA  1 
ATOM   5272 C C   . GLY B 1 347 ? 38.562 36.240 58.439  1.00 51.11 ? 353 GLY B C   1 
ATOM   5273 O O   . GLY B 1 347 ? 38.360 36.604 59.598  1.00 50.85 ? 353 GLY B O   1 
ATOM   5274 N N   . ARG B 1 348 ? 38.658 37.102 57.431  1.00 50.82 ? 354 ARG B N   1 
ATOM   5275 C CA  . ARG B 1 348 ? 38.525 38.536 57.664  1.00 50.15 ? 354 ARG B CA  1 
ATOM   5276 C C   . ARG B 1 348 ? 37.073 38.942 57.891  1.00 48.49 ? 354 ARG B C   1 
ATOM   5277 O O   . ARG B 1 348 ? 36.148 38.198 57.566  1.00 47.30 ? 354 ARG B O   1 
ATOM   5278 C CB  . ARG B 1 348 ? 39.058 39.333 56.473  1.00 51.91 ? 354 ARG B CB  1 
ATOM   5279 C CG  . ARG B 1 348 ? 40.477 39.013 56.054  1.00 54.40 ? 354 ARG B CG  1 
ATOM   5280 C CD  . ARG B 1 348 ? 40.997 40.100 55.124  1.00 56.13 ? 354 ARG B CD  1 
ATOM   5281 N NE  . ARG B 1 348 ? 42.227 39.718 54.437  1.00 58.33 ? 354 ARG B NE  1 
ATOM   5282 C CZ  . ARG B 1 348 ? 43.019 40.573 53.796  1.00 59.52 ? 354 ARG B CZ  1 
ATOM   5283 N NH1 . ARG B 1 348 ? 42.710 41.863 53.758  1.00 60.02 ? 354 ARG B NH1 1 
ATOM   5284 N NH2 . ARG B 1 348 ? 44.116 40.138 53.188  1.00 60.48 ? 354 ARG B NH2 1 
ATOM   5285 N N   . ASP B 1 349 ? 36.887 40.129 58.459  1.00 47.74 ? 355 ASP B N   1 
ATOM   5286 C CA  . ASP B 1 349 ? 35.554 40.661 58.694  1.00 47.14 ? 355 ASP B CA  1 
ATOM   5287 C C   . ASP B 1 349 ? 35.021 41.064 57.330  1.00 45.49 ? 355 ASP B C   1 
ATOM   5288 O O   . ASP B 1 349 ? 35.785 41.219 56.377  1.00 45.05 ? 355 ASP B O   1 
ATOM   5289 C CB  . ASP B 1 349 ? 35.612 41.900 59.594  1.00 48.63 ? 355 ASP B CB  1 
ATOM   5290 C CG  . ASP B 1 349 ? 35.431 41.570 61.062  1.00 50.63 ? 355 ASP B CG  1 
ATOM   5291 O OD1 . ASP B 1 349 ? 36.190 40.731 61.582  1.00 51.95 ? 355 ASP B OD1 1 
ATOM   5292 O OD2 . ASP B 1 349 ? 34.528 42.154 61.699  1.00 52.40 ? 355 ASP B OD2 1 
ATOM   5293 N N   . THR B 1 350 ? 33.710 41.226 57.231  1.00 44.33 ? 356 THR B N   1 
ATOM   5294 C CA  . THR B 1 350 ? 33.112 41.632 55.969  1.00 42.40 ? 356 THR B CA  1 
ATOM   5295 C C   . THR B 1 350 ? 33.292 43.139 55.863  1.00 40.89 ? 356 THR B C   1 
ATOM   5296 O O   . THR B 1 350 ? 33.675 43.795 56.835  1.00 39.28 ? 356 THR B O   1 
ATOM   5297 C CB  . THR B 1 350 ? 31.604 41.310 55.933  1.00 42.95 ? 356 THR B CB  1 
ATOM   5298 O OG1 . THR B 1 350 ? 30.949 41.961 57.031  1.00 43.47 ? 356 THR B OG1 1 
ATOM   5299 C CG2 . THR B 1 350 ? 31.377 39.807 56.027  1.00 43.18 ? 356 THR B CG2 1 
ATOM   5300 N N   . PRO B 1 351 ? 33.055 43.705 54.670  1.00 39.35 ? 357 PRO B N   1 
ATOM   5301 C CA  . PRO B 1 351 ? 33.195 45.154 54.500  1.00 37.93 ? 357 PRO B CA  1 
ATOM   5302 C C   . PRO B 1 351 ? 32.073 45.809 55.306  1.00 36.36 ? 357 PRO B C   1 
ATOM   5303 O O   . PRO B 1 351 ? 31.204 45.116 55.826  1.00 34.61 ? 357 PRO B O   1 
ATOM   5304 C CB  . PRO B 1 351 ? 33.000 45.347 52.995  1.00 37.93 ? 357 PRO B CB  1 
ATOM   5305 C CG  . PRO B 1 351 ? 33.470 44.050 52.417  1.00 38.34 ? 357 PRO B CG  1 
ATOM   5306 C CD  . PRO B 1 351 ? 32.887 43.036 53.368  1.00 38.38 ? 357 PRO B CD  1 
ATOM   5307 N N   . ALA B 1 352 ? 32.091 47.132 55.417  1.00 37.88 ? 358 ALA B N   1 
ATOM   5308 C CA  . ALA B 1 352 ? 31.046 47.837 56.156  1.00 37.93 ? 358 ALA B CA  1 
ATOM   5309 C C   . ALA B 1 352 ? 29.779 47.791 55.307  1.00 37.99 ? 358 ALA B C   1 
ATOM   5310 O O   . ALA B 1 352 ? 29.719 48.399 54.244  1.00 39.26 ? 358 ALA B O   1 
ATOM   5311 C CB  . ALA B 1 352 ? 31.461 49.277 56.409  1.00 40.54 ? 358 ALA B CB  1 
ATOM   5312 N N   . LEU B 1 353 ? 28.769 47.069 55.778  1.00 36.47 ? 359 LEU B N   1 
ATOM   5313 C CA  . LEU B 1 353 ? 27.536 46.924 55.017  1.00 36.42 ? 359 LEU B CA  1 
ATOM   5314 C C   . LEU B 1 353 ? 26.333 47.660 55.580  1.00 35.68 ? 359 LEU B C   1 
ATOM   5315 O O   . LEU B 1 353 ? 25.280 47.679 54.945  1.00 35.46 ? 359 LEU B O   1 
ATOM   5316 C CB  . LEU B 1 353 ? 27.178 45.441 54.906  1.00 35.70 ? 359 LEU B CB  1 
ATOM   5317 C CG  . LEU B 1 353 ? 28.250 44.498 54.358  1.00 35.68 ? 359 LEU B CG  1 
ATOM   5318 C CD1 . LEU B 1 353 ? 27.787 43.062 54.518  1.00 35.72 ? 359 LEU B CD1 1 
ATOM   5319 C CD2 . LEU B 1 353 ? 28.519 44.817 52.899  1.00 34.23 ? 359 LEU B CD2 1 
ATOM   5320 N N   . PHE B 1 354 ? 26.478 48.278 56.749  1.00 36.34 ? 360 PHE B N   1 
ATOM   5321 C CA  . PHE B 1 354 ? 25.334 48.937 57.374  1.00 37.46 ? 360 PHE B CA  1 
ATOM   5322 C C   . PHE B 1 354 ? 25.430 50.422 57.670  1.00 37.12 ? 360 PHE B C   1 
ATOM   5323 O O   . PHE B 1 354 ? 24.513 50.989 58.258  1.00 38.17 ? 360 PHE B O   1 
ATOM   5324 C CB  . PHE B 1 354 ? 24.978 48.198 58.664  1.00 38.89 ? 360 PHE B CB  1 
ATOM   5325 C CG  . PHE B 1 354 ? 25.137 46.714 58.561  1.00 39.10 ? 360 PHE B CG  1 
ATOM   5326 C CD1 . PHE B 1 354 ? 26.166 46.064 59.234  1.00 39.39 ? 360 PHE B CD1 1 
ATOM   5327 C CD2 . PHE B 1 354 ? 24.275 45.966 57.769  1.00 38.64 ? 360 PHE B CD2 1 
ATOM   5328 C CE1 . PHE B 1 354 ? 26.331 44.692 59.120  1.00 38.94 ? 360 PHE B CE1 1 
ATOM   5329 C CE2 . PHE B 1 354 ? 24.433 44.593 57.650  1.00 39.23 ? 360 PHE B CE2 1 
ATOM   5330 C CZ  . PHE B 1 354 ? 25.462 43.955 58.327  1.00 37.32 ? 360 PHE B CZ  1 
ATOM   5331 N N   . ASN B 1 355 ? 26.520 51.059 57.274  1.00 38.00 ? 361 ASN B N   1 
ATOM   5332 C CA  . ASN B 1 355 ? 26.651 52.484 57.520  1.00 38.28 ? 361 ASN B CA  1 
ATOM   5333 C C   . ASN B 1 355 ? 25.875 53.301 56.481  1.00 38.20 ? 361 ASN B C   1 
ATOM   5334 O O   . ASN B 1 355 ? 26.444 54.141 55.781  1.00 38.29 ? 361 ASN B O   1 
ATOM   5335 C CB  . ASN B 1 355 ? 28.131 52.883 57.542  1.00 38.80 ? 361 ASN B CB  1 
ATOM   5336 C CG  . ASN B 1 355 ? 28.892 52.413 56.314  1.00 40.08 ? 361 ASN B CG  1 
ATOM   5337 O OD1 . ASN B 1 355 ? 28.393 51.619 55.516  1.00 40.52 ? 361 ASN B OD1 1 
ATOM   5338 N ND2 . ASN B 1 355 ? 30.120 52.896 56.165  1.00 40.65 ? 361 ASN B ND2 1 
ATOM   5339 N N   . PHE B 1 356 ? 24.571 53.041 56.392  1.00 38.70 ? 362 PHE B N   1 
ATOM   5340 C CA  . PHE B 1 356 ? 23.697 53.748 55.455  1.00 39.44 ? 362 PHE B CA  1 
ATOM   5341 C C   . PHE B 1 356 ? 23.523 55.206 55.866  1.00 41.00 ? 362 PHE B C   1 
ATOM   5342 O O   . PHE B 1 356 ? 23.443 55.521 57.059  1.00 40.74 ? 362 PHE B O   1 
ATOM   5343 C CB  . PHE B 1 356 ? 22.304 53.112 55.409  1.00 38.66 ? 362 PHE B CB  1 
ATOM   5344 C CG  . PHE B 1 356 ? 22.249 51.786 54.706  1.00 39.77 ? 362 PHE B CG  1 
ATOM   5345 C CD1 . PHE B 1 356 ? 22.460 50.601 55.403  1.00 39.14 ? 362 PHE B CD1 1 
ATOM   5346 C CD2 . PHE B 1 356 ? 21.961 51.722 53.345  1.00 38.22 ? 362 PHE B CD2 1 
ATOM   5347 C CE1 . PHE B 1 356 ? 22.382 49.370 54.758  1.00 39.31 ? 362 PHE B CE1 1 
ATOM   5348 C CE2 . PHE B 1 356 ? 21.881 50.498 52.692  1.00 39.07 ? 362 PHE B CE2 1 
ATOM   5349 C CZ  . PHE B 1 356 ? 22.091 49.318 53.399  1.00 39.19 ? 362 PHE B CZ  1 
ATOM   5350 N N   . THR B 1 357 ? 23.453 56.093 54.879  1.00 40.97 ? 363 THR B N   1 
ATOM   5351 C CA  . THR B 1 357 ? 23.254 57.510 55.151  1.00 41.07 ? 363 THR B CA  1 
ATOM   5352 C C   . THR B 1 357 ? 21.781 57.807 54.921  1.00 41.73 ? 363 THR B C   1 
ATOM   5353 O O   . THR B 1 357 ? 21.057 56.981 54.358  1.00 43.06 ? 363 THR B O   1 
ATOM   5354 C CB  . THR B 1 357 ? 24.070 58.401 54.195  1.00 41.23 ? 363 THR B CB  1 
ATOM   5355 O OG1 . THR B 1 357 ? 23.630 58.178 52.849  1.00 39.85 ? 363 THR B OG1 1 
ATOM   5356 C CG2 . THR B 1 357 ? 25.556 58.095 54.307  1.00 39.24 ? 363 THR B CG2 1 
ATOM   5357 N N   . THR B 1 358 ? 21.334 58.979 55.359  1.00 41.95 ? 364 THR B N   1 
ATOM   5358 C CA  . THR B 1 358 ? 19.943 59.372 55.171  1.00 41.06 ? 364 THR B CA  1 
ATOM   5359 C C   . THR B 1 358 ? 19.656 59.395 53.666  1.00 41.01 ? 364 THR B C   1 
ATOM   5360 O O   . THR B 1 358 ? 18.586 58.985 53.219  1.00 40.91 ? 364 THR B O   1 
ATOM   5361 C CB  . THR B 1 358 ? 19.679 60.775 55.769  1.00 42.19 ? 364 THR B CB  1 
ATOM   5362 O OG1 . THR B 1 358 ? 20.016 60.770 57.163  1.00 41.38 ? 364 THR B OG1 1 
ATOM   5363 C CG2 . THR B 1 358 ? 18.216 61.157 55.618  1.00 41.48 ? 364 THR B CG2 1 
ATOM   5364 N N   . GLN B 1 359 ? 20.635 59.861 52.897  1.00 39.95 ? 365 GLN B N   1 
ATOM   5365 C CA  . GLN B 1 359 ? 20.526 59.944 51.441  1.00 40.99 ? 365 GLN B CA  1 
ATOM   5366 C C   . GLN B 1 359 ? 20.212 58.572 50.845  1.00 40.05 ? 365 GLN B C   1 
ATOM   5367 O O   . GLN B 1 359 ? 19.282 58.430 50.049  1.00 39.48 ? 365 GLN B O   1 
ATOM   5368 C CB  . GLN B 1 359 ? 21.841 60.477 50.857  1.00 42.77 ? 365 GLN B CB  1 
ATOM   5369 C CG  . GLN B 1 359 ? 21.872 60.634 49.335  1.00 45.85 ? 365 GLN B CG  1 
ATOM   5370 C CD  . GLN B 1 359 ? 20.871 61.655 48.825  1.00 48.32 ? 365 GLN B CD  1 
ATOM   5371 O OE1 . GLN B 1 359 ? 20.756 62.756 49.369  1.00 48.96 ? 365 GLN B OE1 1 
ATOM   5372 N NE2 . GLN B 1 359 ? 20.149 61.300 47.767  1.00 47.63 ? 365 GLN B NE2 1 
ATOM   5373 N N   . GLU B 1 360 ? 20.992 57.568 51.246  1.00 39.19 ? 366 GLU B N   1 
ATOM   5374 C CA  . GLU B 1 360 ? 20.822 56.196 50.766  1.00 38.56 ? 366 GLU B CA  1 
ATOM   5375 C C   . GLU B 1 360 ? 19.473 55.584 51.109  1.00 37.35 ? 366 GLU B C   1 
ATOM   5376 O O   . GLU B 1 360 ? 18.937 54.784 50.341  1.00 35.66 ? 366 GLU B O   1 
ATOM   5377 C CB  . GLU B 1 360 ? 21.898 55.278 51.351  1.00 38.80 ? 366 GLU B CB  1 
ATOM   5378 C CG  . GLU B 1 360 ? 23.315 55.546 50.912  1.00 40.68 ? 366 GLU B CG  1 
ATOM   5379 C CD  . GLU B 1 360 ? 24.269 54.473 51.425  1.00 42.13 ? 366 GLU B CD  1 
ATOM   5380 O OE1 . GLU B 1 360 ? 24.202 53.323 50.933  1.00 40.14 ? 366 GLU B OE1 1 
ATOM   5381 O OE2 . GLU B 1 360 ? 25.073 54.777 52.329  1.00 42.50 ? 366 GLU B OE2 1 
ATOM   5382 N N   . LEU B 1 361 ? 18.944 55.942 52.277  1.00 36.56 ? 367 LEU B N   1 
ATOM   5383 C CA  . LEU B 1 361 ? 17.669 55.414 52.754  1.00 36.90 ? 367 LEU B CA  1 
ATOM   5384 C C   . LEU B 1 361 ? 16.465 56.256 52.325  1.00 37.04 ? 367 LEU B C   1 
ATOM   5385 O O   . LEU B 1 361 ? 15.325 55.816 52.445  1.00 36.55 ? 367 LEU B O   1 
ATOM   5386 C CB  . LEU B 1 361 ? 17.691 55.336 54.284  1.00 36.58 ? 367 LEU B CB  1 
ATOM   5387 C CG  . LEU B 1 361 ? 18.832 54.535 54.925  1.00 36.71 ? 367 LEU B CG  1 
ATOM   5388 C CD1 . LEU B 1 361 ? 19.037 54.989 56.375  1.00 37.07 ? 367 LEU B CD1 1 
ATOM   5389 C CD2 . LEU B 1 361 ? 18.519 53.051 54.856  1.00 36.01 ? 367 LEU B CD2 1 
ATOM   5390 N N   . SER B 1 362 ? 16.726 57.459 51.822  1.00 38.48 ? 368 SER B N   1 
ATOM   5391 C CA  . SER B 1 362 ? 15.668 58.385 51.416  1.00 39.83 ? 368 SER B CA  1 
ATOM   5392 C C   . SER B 1 362 ? 14.485 57.802 50.651  1.00 40.32 ? 368 SER B C   1 
ATOM   5393 O O   . SER B 1 362 ? 13.364 58.286 50.793  1.00 40.36 ? 368 SER B O   1 
ATOM   5394 C CB  . SER B 1 362 ? 16.262 59.544 50.610  1.00 39.80 ? 368 SER B CB  1 
ATOM   5395 O OG  . SER B 1 362 ? 16.796 59.102 49.378  1.00 42.41 ? 368 SER B OG  1 
ATOM   5396 N N   . SER B 1 363 ? 14.713 56.769 49.847  1.00 40.41 ? 369 SER B N   1 
ATOM   5397 C CA  . SER B 1 363 ? 13.613 56.191 49.080  1.00 41.09 ? 369 SER B CA  1 
ATOM   5398 C C   . SER B 1 363 ? 12.606 55.470 49.972  1.00 41.23 ? 369 SER B C   1 
ATOM   5399 O O   . SER B 1 363 ? 11.450 55.282 49.587  1.00 39.65 ? 369 SER B O   1 
ATOM   5400 C CB  . SER B 1 363 ? 14.139 55.219 48.010  1.00 41.18 ? 369 SER B CB  1 
ATOM   5401 O OG  . SER B 1 363 ? 14.300 53.908 48.529  1.00 40.17 ? 369 SER B OG  1 
ATOM   5402 N N   . ASN B 1 364 ? 13.044 55.066 51.162  1.00 41.13 ? 370 ASN B N   1 
ATOM   5403 C CA  . ASN B 1 364 ? 12.165 54.358 52.089  1.00 41.62 ? 370 ASN B CA  1 
ATOM   5404 C C   . ASN B 1 364 ? 12.845 54.211 53.453  1.00 42.45 ? 370 ASN B C   1 
ATOM   5405 O O   . ASN B 1 364 ? 13.304 53.128 53.817  1.00 40.84 ? 370 ASN B O   1 
ATOM   5406 C CB  . ASN B 1 364 ? 11.826 52.973 51.533  1.00 40.89 ? 370 ASN B CB  1 
ATOM   5407 C CG  . ASN B 1 364 ? 10.639 52.342 52.231  1.00 41.90 ? 370 ASN B CG  1 
ATOM   5408 O OD1 . ASN B 1 364 ? 10.409 52.568 53.419  1.00 43.12 ? 370 ASN B OD1 1 
ATOM   5409 N ND2 . ASN B 1 364 ? 9.884  51.536 51.499  1.00 42.91 ? 370 ASN B ND2 1 
ATOM   5410 N N   . PRO B 1 365 ? 12.907 55.306 54.229  1.00 43.69 ? 371 PRO B N   1 
ATOM   5411 C CA  . PRO B 1 365 ? 13.532 55.316 55.555  1.00 43.61 ? 371 PRO B CA  1 
ATOM   5412 C C   . PRO B 1 365 ? 13.208 54.121 56.461  1.00 43.43 ? 371 PRO B C   1 
ATOM   5413 O O   . PRO B 1 365 ? 14.104 53.544 57.076  1.00 43.19 ? 371 PRO B O   1 
ATOM   5414 C CB  . PRO B 1 365 ? 13.059 56.644 56.136  1.00 43.74 ? 371 PRO B CB  1 
ATOM   5415 C CG  . PRO B 1 365 ? 13.039 57.523 54.921  1.00 43.99 ? 371 PRO B CG  1 
ATOM   5416 C CD  . PRO B 1 365 ? 12.363 56.638 53.901  1.00 43.04 ? 371 PRO B CD  1 
ATOM   5417 N N   . PRO B 1 366 ? 11.925 53.736 56.554  1.00 43.24 ? 372 PRO B N   1 
ATOM   5418 C CA  . PRO B 1 366 ? 11.526 52.606 57.400  1.00 43.63 ? 372 PRO B CA  1 
ATOM   5419 C C   . PRO B 1 366 ? 12.292 51.303 57.171  1.00 43.34 ? 372 PRO B C   1 
ATOM   5420 O O   . PRO B 1 366 ? 12.370 50.462 58.069  1.00 43.00 ? 372 PRO B O   1 
ATOM   5421 C CB  . PRO B 1 366 ? 10.039 52.461 57.092  1.00 44.40 ? 372 PRO B CB  1 
ATOM   5422 C CG  . PRO B 1 366 ? 9.626  53.875 56.845  1.00 43.83 ? 372 PRO B CG  1 
ATOM   5423 C CD  . PRO B 1 366 ? 10.740 54.383 55.965  1.00 43.65 ? 372 PRO B CD  1 
ATOM   5424 N N   . LEU B 1 367 ? 12.849 51.125 55.974  1.00 41.41 ? 373 LEU B N   1 
ATOM   5425 C CA  . LEU B 1 367 ? 13.592 49.903 55.680  1.00 39.81 ? 373 LEU B CA  1 
ATOM   5426 C C   . LEU B 1 367 ? 14.821 49.739 56.559  1.00 38.38 ? 373 LEU B C   1 
ATOM   5427 O O   . LEU B 1 367 ? 15.329 48.632 56.721  1.00 37.59 ? 373 LEU B O   1 
ATOM   5428 C CB  . LEU B 1 367 ? 14.006 49.852 54.201  1.00 38.33 ? 373 LEU B CB  1 
ATOM   5429 C CG  . LEU B 1 367 ? 12.903 49.431 53.230  1.00 37.81 ? 373 LEU B CG  1 
ATOM   5430 C CD1 . LEU B 1 367 ? 13.460 49.354 51.805  1.00 37.88 ? 373 LEU B CD1 1 
ATOM   5431 C CD2 . LEU B 1 367 ? 12.352 48.078 53.659  1.00 37.89 ? 373 LEU B CD2 1 
ATOM   5432 N N   . ALA B 1 368 ? 15.299 50.843 57.122  1.00 38.87 ? 374 ALA B N   1 
ATOM   5433 C CA  . ALA B 1 368 ? 16.470 50.808 57.990  1.00 39.42 ? 374 ALA B CA  1 
ATOM   5434 C C   . ALA B 1 368 ? 16.262 49.881 59.186  1.00 39.67 ? 374 ALA B C   1 
ATOM   5435 O O   . ALA B 1 368 ? 17.225 49.440 59.805  1.00 39.11 ? 374 ALA B O   1 
ATOM   5436 C CB  . ALA B 1 368 ? 16.806 52.213 58.475  1.00 39.09 ? 374 ALA B CB  1 
ATOM   5437 N N   . THR B 1 369 ? 15.008 49.586 59.512  1.00 41.47 ? 375 THR B N   1 
ATOM   5438 C CA  . THR B 1 369 ? 14.718 48.709 60.643  1.00 42.64 ? 375 THR B CA  1 
ATOM   5439 C C   . THR B 1 369 ? 15.132 47.278 60.324  1.00 42.64 ? 375 THR B C   1 
ATOM   5440 O O   . THR B 1 369 ? 15.269 46.444 61.219  1.00 42.02 ? 375 THR B O   1 
ATOM   5441 C CB  . THR B 1 369 ? 13.220 48.739 61.018  1.00 43.93 ? 375 THR B CB  1 
ATOM   5442 O OG1 . THR B 1 369 ? 12.440 48.147 59.970  1.00 44.39 ? 375 THR B OG1 1 
ATOM   5443 C CG2 . THR B 1 369 ? 12.769 50.179 61.242  1.00 44.44 ? 375 THR B CG2 1 
ATOM   5444 N N   . ILE B 1 370 ? 15.325 47.002 59.039  1.00 42.21 ? 376 ILE B N   1 
ATOM   5445 C CA  . ILE B 1 370 ? 15.757 45.683 58.587  1.00 41.50 ? 376 ILE B CA  1 
ATOM   5446 C C   . ILE B 1 370 ? 17.222 45.762 58.167  1.00 40.40 ? 376 ILE B C   1 
ATOM   5447 O O   . ILE B 1 370 ? 18.036 44.917 58.539  1.00 39.96 ? 376 ILE B O   1 
ATOM   5448 C CB  . ILE B 1 370 ? 14.953 45.208 57.364  1.00 42.62 ? 376 ILE B CB  1 
ATOM   5449 C CG1 . ILE B 1 370 ? 13.486 45.026 57.735  1.00 43.27 ? 376 ILE B CG1 1 
ATOM   5450 C CG2 . ILE B 1 370 ? 15.534 43.902 56.835  1.00 42.20 ? 376 ILE B CG2 1 
ATOM   5451 C CD1 . ILE B 1 370 ? 12.621 44.652 56.560  1.00 45.14 ? 376 ILE B CD1 1 
ATOM   5452 N N   . LEU B 1 371 ? 17.541 46.797 57.393  1.00 38.76 ? 377 LEU B N   1 
ATOM   5453 C CA  . LEU B 1 371 ? 18.886 47.006 56.878  1.00 36.37 ? 377 LEU B CA  1 
ATOM   5454 C C   . LEU B 1 371 ? 19.965 47.148 57.939  1.00 37.06 ? 377 LEU B C   1 
ATOM   5455 O O   . LEU B 1 371 ? 21.074 46.641 57.767  1.00 35.38 ? 377 LEU B O   1 
ATOM   5456 C CB  . LEU B 1 371 ? 18.907 48.233 55.966  1.00 35.51 ? 377 LEU B CB  1 
ATOM   5457 C CG  . LEU B 1 371 ? 18.060 48.129 54.694  1.00 34.71 ? 377 LEU B CG  1 
ATOM   5458 C CD1 . LEU B 1 371 ? 18.169 49.441 53.930  1.00 34.18 ? 377 LEU B CD1 1 
ATOM   5459 C CD2 . LEU B 1 371 ? 18.545 46.956 53.825  1.00 33.60 ? 377 LEU B CD2 1 
ATOM   5460 N N   . ILE B 1 372 ? 19.654 47.852 59.025  1.00 36.27 ? 378 ILE B N   1 
ATOM   5461 C CA  . ILE B 1 372 ? 20.620 48.036 60.099  1.00 36.37 ? 378 ILE B CA  1 
ATOM   5462 C C   . ILE B 1 372 ? 20.299 47.031 61.205  1.00 36.31 ? 378 ILE B C   1 
ATOM   5463 O O   . ILE B 1 372 ? 19.319 47.182 61.937  1.00 36.63 ? 378 ILE B O   1 
ATOM   5464 C CB  . ILE B 1 372 ? 20.559 49.467 60.647  1.00 37.54 ? 378 ILE B CB  1 
ATOM   5465 C CG1 . ILE B 1 372 ? 20.791 50.460 59.503  1.00 37.59 ? 378 ILE B CG1 1 
ATOM   5466 C CG2 . ILE B 1 372 ? 21.610 49.652 61.725  1.00 35.71 ? 378 ILE B CG2 1 
ATOM   5467 C CD1 . ILE B 1 372 ? 20.646 51.915 59.898  1.00 38.89 ? 378 ILE B CD1 1 
ATOM   5468 N N   . PRO B 1 373 ? 21.124 45.978 61.323  1.00 36.01 ? 379 PRO B N   1 
ATOM   5469 C CA  . PRO B 1 373 ? 20.975 44.908 62.312  1.00 35.31 ? 379 PRO B CA  1 
ATOM   5470 C C   . PRO B 1 373 ? 21.135 45.402 63.744  1.00 34.24 ? 379 PRO B C   1 
ATOM   5471 O O   . PRO B 1 373 ? 21.843 46.375 63.997  1.00 33.60 ? 379 PRO B O   1 
ATOM   5472 C CB  . PRO B 1 373 ? 22.087 43.925 61.937  1.00 35.58 ? 379 PRO B CB  1 
ATOM   5473 C CG  . PRO B 1 373 ? 22.388 44.239 60.518  1.00 38.37 ? 379 PRO B CG  1 
ATOM   5474 C CD  . PRO B 1 373 ? 22.302 45.731 60.477  1.00 36.32 ? 379 PRO B CD  1 
ATOM   5475 N N   . PRO B 1 374 ? 20.482 44.725 64.699  1.00 34.76 ? 380 PRO B N   1 
ATOM   5476 C CA  . PRO B 1 374 ? 20.580 45.125 66.103  1.00 35.12 ? 380 PRO B CA  1 
ATOM   5477 C C   . PRO B 1 374 ? 22.022 45.381 66.537  1.00 35.41 ? 380 PRO B C   1 
ATOM   5478 O O   . PRO B 1 374 ? 22.319 46.434 67.091  1.00 35.83 ? 380 PRO B O   1 
ATOM   5479 C CB  . PRO B 1 374 ? 19.949 43.946 66.837  1.00 34.52 ? 380 PRO B CB  1 
ATOM   5480 C CG  . PRO B 1 374 ? 18.877 43.517 65.889  1.00 34.09 ? 380 PRO B CG  1 
ATOM   5481 C CD  . PRO B 1 374 ? 19.585 43.565 64.544  1.00 34.64 ? 380 PRO B CD  1 
ATOM   5482 N N   . HIS B 1 375 ? 22.927 44.442 66.260  1.00 36.20 ? 381 HIS B N   1 
ATOM   5483 C CA  . HIS B 1 375 ? 24.316 44.622 66.678  1.00 37.27 ? 381 HIS B CA  1 
ATOM   5484 C C   . HIS B 1 375 ? 24.987 45.855 66.093  1.00 38.61 ? 381 HIS B C   1 
ATOM   5485 O O   . HIS B 1 375 ? 25.953 46.362 66.660  1.00 38.66 ? 381 HIS B O   1 
ATOM   5486 C CB  . HIS B 1 375 ? 25.169 43.379 66.367  1.00 36.61 ? 381 HIS B CB  1 
ATOM   5487 C CG  . HIS B 1 375 ? 25.512 43.206 64.918  1.00 36.84 ? 381 HIS B CG  1 
ATOM   5488 N ND1 . HIS B 1 375 ? 24.685 42.558 64.027  1.00 35.51 ? 381 HIS B ND1 1 
ATOM   5489 C CD2 . HIS B 1 375 ? 26.611 43.570 64.213  1.00 35.95 ? 381 HIS B CD2 1 
ATOM   5490 C CE1 . HIS B 1 375 ? 25.260 42.526 62.837  1.00 36.80 ? 381 HIS B CE1 1 
ATOM   5491 N NE2 . HIS B 1 375 ? 26.430 43.133 62.923  1.00 36.41 ? 381 HIS B NE2 1 
ATOM   5492 N N   . ALA B 1 376 ? 24.479 46.342 64.965  1.00 39.49 ? 382 ALA B N   1 
ATOM   5493 C CA  . ALA B 1 376 ? 25.060 47.524 64.332  1.00 40.56 ? 382 ALA B CA  1 
ATOM   5494 C C   . ALA B 1 376 ? 24.605 48.810 65.028  1.00 41.03 ? 382 ALA B C   1 
ATOM   5495 O O   . ALA B 1 376 ? 25.143 49.888 64.773  1.00 41.07 ? 382 ALA B O   1 
ATOM   5496 C CB  . ALA B 1 376 ? 24.681 47.565 62.850  1.00 39.75 ? 382 ALA B CB  1 
ATOM   5497 N N   . ARG B 1 377 ? 23.616 48.690 65.910  1.00 42.73 ? 383 ARG B N   1 
ATOM   5498 C CA  . ARG B 1 377 ? 23.089 49.847 66.637  1.00 43.25 ? 383 ARG B CA  1 
ATOM   5499 C C   . ARG B 1 377 ? 23.626 49.925 68.061  1.00 44.29 ? 383 ARG B C   1 
ATOM   5500 O O   . ARG B 1 377 ? 23.167 50.747 68.861  1.00 43.96 ? 383 ARG B O   1 
ATOM   5501 C CB  . ARG B 1 377 ? 21.568 49.782 66.705  1.00 43.47 ? 383 ARG B CB  1 
ATOM   5502 C CG  . ARG B 1 377 ? 20.890 49.560 65.377  1.00 43.81 ? 383 ARG B CG  1 
ATOM   5503 C CD  . ARG B 1 377 ? 19.424 49.271 65.595  1.00 45.42 ? 383 ARG B CD  1 
ATOM   5504 N NE  . ARG B 1 377 ? 18.779 48.774 64.389  1.00 45.95 ? 383 ARG B NE  1 
ATOM   5505 C CZ  . ARG B 1 377 ? 17.523 48.346 64.345  1.00 49.07 ? 383 ARG B CZ  1 
ATOM   5506 N NH1 . ARG B 1 377 ? 16.782 48.358 65.446  1.00 49.85 ? 383 ARG B NH1 1 
ATOM   5507 N NH2 . ARG B 1 377 ? 17.008 47.906 63.204  1.00 49.24 ? 383 ARG B NH2 1 
ATOM   5508 N N   . ILE B 1 378 ? 24.581 49.062 68.384  1.00 44.26 ? 384 ILE B N   1 
ATOM   5509 C CA  . ILE B 1 378 ? 25.167 49.048 69.720  1.00 45.29 ? 384 ILE B CA  1 
ATOM   5510 C C   . ILE B 1 378 ? 25.995 50.310 69.956  1.00 46.93 ? 384 ILE B C   1 
ATOM   5511 O O   . ILE B 1 378 ? 26.822 50.631 69.077  1.00 48.67 ? 384 ILE B O   1 
ATOM   5512 C CB  . ILE B 1 378 ? 26.056 47.802 69.907  1.00 44.09 ? 384 ILE B CB  1 
ATOM   5513 C CG1 . ILE B 1 378 ? 25.177 46.551 69.921  1.00 42.23 ? 384 ILE B CG1 1 
ATOM   5514 C CG2 . ILE B 1 378 ? 26.881 47.921 71.183  1.00 43.84 ? 384 ILE B CG2 1 
ATOM   5515 C CD1 . ILE B 1 378 ? 25.954 45.252 69.925  1.00 45.07 ? 384 ILE B CD1 1 
HETATM 5516 C C1  . TMU C 2 .   ? 22.489 23.571 6.756   1.00 32.63 ? 901 TMU A C1  1 
HETATM 5517 S S2  . TMU C 2 .   ? 21.537 24.434 7.929   1.00 30.85 ? 901 TMU A S2  1 
HETATM 5518 N N3  . TMU C 2 .   ? 21.634 23.380 5.773   1.00 29.35 ? 901 TMU A N3  1 
HETATM 5519 N N4  . TMU C 2 .   ? 23.817 23.186 6.822   1.00 31.80 ? 901 TMU A N4  1 
HETATM 5520 C C5  . TMU C 2 .   ? 20.034 24.485 6.987   1.00 33.88 ? 901 TMU A C5  1 
HETATM 5521 C C6  . TMU C 2 .   ? 20.405 23.824 5.860   1.00 32.81 ? 901 TMU A C6  1 
HETATM 5522 C C7  . TMU C 2 .   ? 24.641 23.545 7.840   1.00 32.59 ? 901 TMU A C7  1 
HETATM 5523 N N8  . TMU C 2 .   ? 18.749 25.091 7.353   1.00 37.35 ? 901 TMU A N8  1 
HETATM 5524 N N9  . TMU C 2 .   ? 25.933 23.123 7.783   1.00 32.58 ? 901 TMU A N9  1 
HETATM 5525 O O10 . TMU C 2 .   ? 24.236 24.233 8.780   1.00 28.47 ? 901 TMU A O10 1 
HETATM 5526 O O11 . TMU C 2 .   ? 17.962 25.435 6.481   1.00 43.13 ? 901 TMU A O11 1 
HETATM 5527 O O12 . TMU C 2 .   ? 18.481 25.265 8.527   1.00 41.34 ? 901 TMU A O12 1 
HETATM 5528 C C13 . TMU C 2 .   ? 26.918 23.453 8.827   1.00 33.85 ? 901 TMU A C13 1 
HETATM 5529 C C14 . TMU C 2 .   ? 26.936 22.361 9.865   1.00 36.00 ? 901 TMU A C14 1 
HETATM 5530 C C15 . TMU C 2 .   ? 26.823 21.002 9.475   1.00 37.95 ? 901 TMU A C15 1 
HETATM 5531 C C16 . TMU C 2 .   ? 27.062 22.701 11.227  1.00 35.64 ? 901 TMU A C16 1 
HETATM 5532 C C17 . TMU C 2 .   ? 26.836 19.985 10.450  1.00 40.45 ? 901 TMU A C17 1 
HETATM 5533 C C18 . TMU C 2 .   ? 27.076 21.691 12.207  1.00 39.24 ? 901 TMU A C18 1 
HETATM 5534 C C19 . TMU C 2 .   ? 26.964 20.324 11.825  1.00 40.98 ? 901 TMU A C19 1 
HETATM 5535 O O20 . TMU C 2 .   ? 26.971 19.338 12.779  1.00 44.21 ? 901 TMU A O20 1 
HETATM 5536 C C21 . TMU C 2 .   ? 28.334 18.943 13.022  1.00 46.56 ? 901 TMU A C21 1 
HETATM 5537 C C1  . TMU D 2 .   ? 39.787 48.861 37.507  1.00 36.76 ? 902 TMU B C1  1 
HETATM 5538 S S2  . TMU D 2 .   ? 38.981 49.523 36.108  1.00 37.49 ? 902 TMU B S2  1 
HETATM 5539 N N3  . TMU D 2 .   ? 39.737 49.868 38.365  1.00 35.66 ? 902 TMU B N3  1 
HETATM 5540 N N4  . TMU D 2 .   ? 40.340 47.595 37.696  1.00 37.28 ? 902 TMU B N4  1 
HETATM 5541 C C5  . TMU D 2 .   ? 38.629 51.127 36.795  1.00 38.86 ? 902 TMU B C5  1 
HETATM 5542 C C6  . TMU D 2 .   ? 39.167 51.009 38.037  1.00 37.40 ? 902 TMU B C6  1 
HETATM 5543 C C7  . TMU D 2 .   ? 40.349 46.632 36.740  1.00 38.29 ? 902 TMU B C7  1 
HETATM 5544 N N8  . TMU D 2 .   ? 37.937 52.261 36.171  1.00 41.71 ? 902 TMU B N8  1 
HETATM 5545 N N9  . TMU D 2 .   ? 40.906 45.435 37.039  1.00 40.08 ? 902 TMU B N9  1 
HETATM 5546 O O10 . TMU D 2 .   ? 39.866 46.832 35.632  1.00 38.33 ? 902 TMU B O10 1 
HETATM 5547 O O11 . TMU D 2 .   ? 37.494 53.164 36.861  1.00 45.80 ? 902 TMU B O11 1 
HETATM 5548 O O12 . TMU D 2 .   ? 37.792 52.284 34.962  1.00 46.61 ? 902 TMU B O12 1 
HETATM 5549 C C13 . TMU D 2 .   ? 40.960 44.339 36.061  1.00 41.94 ? 902 TMU B C13 1 
HETATM 5550 C C14 . TMU D 2 .   ? 42.233 44.446 35.253  1.00 43.34 ? 902 TMU B C14 1 
HETATM 5551 C C15 . TMU D 2 .   ? 43.469 44.707 35.898  1.00 44.75 ? 902 TMU B C15 1 
HETATM 5552 C C16 . TMU D 2 .   ? 42.186 44.284 33.854  1.00 44.72 ? 902 TMU B C16 1 
HETATM 5553 C C17 . TMU D 2 .   ? 44.653 44.805 35.141  1.00 46.37 ? 902 TMU B C17 1 
HETATM 5554 C C18 . TMU D 2 .   ? 43.366 44.380 33.088  1.00 45.38 ? 902 TMU B C18 1 
HETATM 5555 C C19 . TMU D 2 .   ? 44.608 44.639 33.727  1.00 46.90 ? 902 TMU B C19 1 
HETATM 5556 O O20 . TMU D 2 .   ? 45.756 44.733 32.985  1.00 49.75 ? 902 TMU B O20 1 
HETATM 5557 C C21 . TMU D 2 .   ? 46.347 43.417 32.890  1.00 51.30 ? 902 TMU B C21 1 
HETATM 5558 O O   . HOH E 3 .   ? 7.572  43.277 12.679  1.00 21.02 ? 502 HOH A O   1 
HETATM 5559 O O   . HOH E 3 .   ? 14.572 28.239 -3.254  1.00 21.64 ? 505 HOH A O   1 
HETATM 5560 O O   . HOH E 3 .   ? 23.714 33.035 -8.515  1.00 27.83 ? 507 HOH A O   1 
HETATM 5561 O O   . HOH E 3 .   ? 16.038 38.729 13.950  1.00 30.64 ? 508 HOH A O   1 
HETATM 5562 O O   . HOH E 3 .   ? 19.998 45.380 9.325   1.00 24.02 ? 509 HOH A O   1 
HETATM 5563 O O   . HOH E 3 .   ? 17.156 44.761 -6.192  1.00 27.12 ? 511 HOH A O   1 
HETATM 5564 O O   . HOH E 3 .   ? 14.712 43.251 -6.241  1.00 25.33 ? 514 HOH A O   1 
HETATM 5565 O O   . HOH E 3 .   ? 26.043 47.105 11.969  1.00 24.24 ? 515 HOH A O   1 
HETATM 5566 O O   . HOH E 3 .   ? 27.485 28.522 11.244  1.00 28.77 ? 516 HOH A O   1 
HETATM 5567 O O   . HOH E 3 .   ? 14.678 35.747 8.450   1.00 27.46 ? 518 HOH A O   1 
HETATM 5568 O O   . HOH E 3 .   ? 15.842 50.893 5.855   1.00 28.42 ? 520 HOH A O   1 
HETATM 5569 O O   . HOH E 3 .   ? 24.922 26.148 -10.245 1.00 32.72 ? 522 HOH A O   1 
HETATM 5570 O O   . HOH E 3 .   ? 24.199 30.924 -15.418 1.00 29.05 ? 524 HOH A O   1 
HETATM 5571 O O   . HOH E 3 .   ? 19.119 49.225 -0.664  1.00 29.21 ? 526 HOH A O   1 
HETATM 5572 O O   . HOH E 3 .   ? 30.783 42.543 9.980   1.00 28.90 ? 528 HOH A O   1 
HETATM 5573 O O   . HOH E 3 .   ? 24.717 29.786 -7.922  1.00 32.75 ? 532 HOH A O   1 
HETATM 5574 O O   . HOH E 3 .   ? 14.818 43.399 -8.971  1.00 32.46 ? 533 HOH A O   1 
HETATM 5575 O O   . HOH E 3 .   ? 18.486 42.889 17.498  1.00 33.10 ? 534 HOH A O   1 
HETATM 5576 O O   . HOH E 3 .   ? 11.035 47.641 1.695   1.00 32.35 ? 538 HOH A O   1 
HETATM 5577 O O   . HOH E 3 .   ? 35.935 41.676 -10.504 1.00 28.85 ? 539 HOH A O   1 
HETATM 5578 O O   . HOH E 3 .   ? 9.112  34.902 8.946   1.00 23.92 ? 540 HOH A O   1 
HETATM 5579 O O   . HOH E 3 .   ? 13.203 28.507 -1.065  1.00 27.63 ? 541 HOH A O   1 
HETATM 5580 O O   . HOH E 3 .   ? 36.045 37.206 8.297   1.00 34.78 ? 542 HOH A O   1 
HETATM 5581 O O   . HOH E 3 .   ? 19.257 41.831 7.720   1.00 22.90 ? 543 HOH A O   1 
HETATM 5582 O O   . HOH E 3 .   ? 26.315 39.100 -13.566 1.00 25.55 ? 544 HOH A O   1 
HETATM 5583 O O   . HOH E 3 .   ? 9.096  29.889 12.429  1.00 33.95 ? 545 HOH A O   1 
HETATM 5584 O O   . HOH E 3 .   ? 26.933 47.077 14.652  1.00 34.59 ? 546 HOH A O   1 
HETATM 5585 O O   . HOH E 3 .   ? 37.920 35.322 7.834   1.00 34.79 ? 547 HOH A O   1 
HETATM 5586 O O   . HOH E 3 .   ? 29.881 44.318 11.903  1.00 27.97 ? 548 HOH A O   1 
HETATM 5587 O O   . HOH E 3 .   ? 5.056  38.471 6.173   1.00 31.75 ? 549 HOH A O   1 
HETATM 5588 O O   . HOH E 3 .   ? 2.053  25.694 10.689  1.00 35.41 ? 550 HOH A O   1 
HETATM 5589 O O   . HOH E 3 .   ? 25.932 48.968 -9.855  1.00 41.90 ? 551 HOH A O   1 
HETATM 5590 O O   . HOH E 3 .   ? 9.575  32.463 -8.234  1.00 35.42 ? 553 HOH A O   1 
HETATM 5591 O O   . HOH E 3 .   ? 15.727 46.091 -2.320  1.00 29.81 ? 554 HOH A O   1 
HETATM 5592 O O   . HOH E 3 .   ? 39.103 38.658 1.888   1.00 33.36 ? 555 HOH A O   1 
HETATM 5593 O O   . HOH E 3 .   ? 37.130 26.137 -5.127  1.00 30.62 ? 556 HOH A O   1 
HETATM 5594 O O   . HOH E 3 .   ? 17.720 26.191 -3.835  1.00 30.68 ? 557 HOH A O   1 
HETATM 5595 O O   . HOH E 3 .   ? 13.955 54.250 8.601   1.00 38.81 ? 560 HOH A O   1 
HETATM 5596 O O   . HOH E 3 .   ? 43.367 26.607 -9.398  1.00 37.81 ? 561 HOH A O   1 
HETATM 5597 O O   . HOH E 3 .   ? 11.446 44.938 -0.879  1.00 33.21 ? 565 HOH A O   1 
HETATM 5598 O O   . HOH E 3 .   ? 11.124 26.854 -1.066  1.00 29.54 ? 567 HOH A O   1 
HETATM 5599 O O   . HOH E 3 .   ? 39.726 42.047 -7.686  1.00 38.17 ? 568 HOH A O   1 
HETATM 5600 O O   . HOH E 3 .   ? 22.047 46.960 18.429  1.00 30.96 ? 569 HOH A O   1 
HETATM 5601 O O   . HOH E 3 .   ? 29.163 36.465 12.808  1.00 31.42 ? 571 HOH A O   1 
HETATM 5602 O O   . HOH E 3 .   ? 34.978 37.133 11.186  1.00 38.27 ? 572 HOH A O   1 
HETATM 5603 O O   . HOH E 3 .   ? 12.043 42.325 -15.202 1.00 32.27 ? 577 HOH A O   1 
HETATM 5604 O O   . HOH E 3 .   ? 3.034  19.762 -5.052  1.00 47.26 ? 580 HOH A O   1 
HETATM 5605 O O   . HOH E 3 .   ? 18.508 51.778 -0.844  1.00 28.73 ? 581 HOH A O   1 
HETATM 5606 O O   . HOH E 3 .   ? 9.878  45.859 -13.740 1.00 41.24 ? 583 HOH A O   1 
HETATM 5607 O O   . HOH E 3 .   ? 15.500 52.425 2.005   1.00 35.39 ? 584 HOH A O   1 
HETATM 5608 O O   . HOH E 3 .   ? 39.971 37.730 -7.785  1.00 50.45 ? 585 HOH A O   1 
HETATM 5609 O O   . HOH E 3 .   ? 43.710 27.600 4.283   1.00 49.06 ? 588 HOH A O   1 
HETATM 5610 O O   . HOH E 3 .   ? 3.290  9.024  -1.020  1.00 40.16 ? 589 HOH A O   1 
HETATM 5611 O O   . HOH E 3 .   ? 8.793  49.928 5.100   1.00 39.43 ? 591 HOH A O   1 
HETATM 5612 O O   . HOH E 3 .   ? 30.937 43.147 20.977  1.00 52.31 ? 595 HOH A O   1 
HETATM 5613 O O   . HOH E 3 .   ? 24.714 45.614 15.260  1.00 36.56 ? 596 HOH A O   1 
HETATM 5614 O O   . HOH E 3 .   ? 37.068 27.890 0.892   1.00 50.54 ? 597 HOH A O   1 
HETATM 5615 O O   . HOH E 3 .   ? 13.948 28.862 6.723   1.00 35.81 ? 598 HOH A O   1 
HETATM 5616 O O   . HOH E 3 .   ? 28.557 42.270 -19.105 1.00 48.18 ? 600 HOH A O   1 
HETATM 5617 O O   . HOH E 3 .   ? 27.695 50.949 26.355  1.00 31.03 ? 602 HOH A O   1 
HETATM 5618 O O   . HOH E 3 .   ? 30.398 49.507 -10.341 1.00 35.15 ? 603 HOH A O   1 
HETATM 5619 O O   . HOH E 3 .   ? 33.374 28.848 -15.131 1.00 34.41 ? 604 HOH A O   1 
HETATM 5620 O O   . HOH E 3 .   ? 32.968 48.113 19.740  1.00 45.06 ? 605 HOH A O   1 
HETATM 5621 O O   . HOH E 3 .   ? 7.045  48.790 6.471   1.00 37.49 ? 606 HOH A O   1 
HETATM 5622 O O   . HOH E 3 .   ? 11.539 39.977 -18.991 1.00 43.44 ? 607 HOH A O   1 
HETATM 5623 O O   . HOH E 3 .   ? 31.626 46.704 23.455  1.00 51.42 ? 609 HOH A O   1 
HETATM 5624 O O   . HOH E 3 .   ? 9.859  35.831 -13.752 1.00 33.31 ? 610 HOH A O   1 
HETATM 5625 O O   . HOH E 3 .   ? 31.602 33.858 -16.546 1.00 40.04 ? 613 HOH A O   1 
HETATM 5626 O O   . HOH E 3 .   ? 17.822 50.375 -9.310  1.00 39.38 ? 614 HOH A O   1 
HETATM 5627 O O   . HOH E 3 .   ? 21.513 39.640 11.316  1.00 38.21 ? 615 HOH A O   1 
HETATM 5628 O O   . HOH E 3 .   ? 13.679 32.074 -9.538  1.00 41.14 ? 616 HOH A O   1 
HETATM 5629 O O   . HOH E 3 .   ? 26.863 57.512 4.794   1.00 35.85 ? 618 HOH A O   1 
HETATM 5630 O O   . HOH E 3 .   ? 17.583 47.683 -8.655  1.00 32.41 ? 623 HOH A O   1 
HETATM 5631 O O   . HOH E 3 .   ? 10.521 15.625 13.802  1.00 47.35 ? 624 HOH A O   1 
HETATM 5632 O O   . HOH E 3 .   ? 6.738  53.844 12.125  1.00 50.96 ? 625 HOH A O   1 
HETATM 5633 O O   . HOH E 3 .   ? 16.367 27.557 6.975   1.00 37.71 ? 626 HOH A O   1 
HETATM 5634 O O   . HOH E 3 .   ? 24.787 28.421 11.113  1.00 36.86 ? 630 HOH A O   1 
HETATM 5635 O O   . HOH E 3 .   ? 2.081  17.311 5.923   1.00 39.63 ? 631 HOH A O   1 
HETATM 5636 O O   . HOH E 3 .   ? 10.583 25.835 19.117  1.00 41.77 ? 632 HOH A O   1 
HETATM 5637 O O   . HOH E 3 .   ? 9.064  18.253 -2.933  1.00 44.93 ? 633 HOH A O   1 
HETATM 5638 O O   . HOH E 3 .   ? 30.165 25.018 -9.588  1.00 35.37 ? 635 HOH A O   1 
HETATM 5639 O O   . HOH E 3 .   ? 28.222 31.114 -14.522 1.00 43.41 ? 637 HOH A O   1 
HETATM 5640 O O   . HOH E 3 .   ? 2.497  30.642 1.185   1.00 37.52 ? 639 HOH A O   1 
HETATM 5641 O O   . HOH E 3 .   ? 39.006 54.821 11.882  1.00 68.99 ? 641 HOH A O   1 
HETATM 5642 O O   . HOH E 3 .   ? 7.937  20.641 -3.694  1.00 37.06 ? 642 HOH A O   1 
HETATM 5643 O O   . HOH E 3 .   ? 25.345 25.267 13.600  1.00 49.30 ? 644 HOH A O   1 
HETATM 5644 O O   . HOH E 3 .   ? 16.073 34.675 11.681  1.00 38.78 ? 649 HOH A O   1 
HETATM 5645 O O   . HOH E 3 .   ? 33.235 33.522 11.502  1.00 40.75 ? 650 HOH A O   1 
HETATM 5646 O O   . HOH E 3 .   ? 35.214 51.375 13.829  1.00 46.46 ? 654 HOH A O   1 
HETATM 5647 O O   . HOH E 3 .   ? 17.123 30.830 -9.582  1.00 42.03 ? 655 HOH A O   1 
HETATM 5648 O O   . HOH E 3 .   ? 37.950 44.211 -7.974  1.00 47.07 ? 657 HOH A O   1 
HETATM 5649 O O   . HOH E 3 .   ? 17.348 22.045 -4.540  1.00 54.65 ? 658 HOH A O   1 
HETATM 5650 O O   . HOH E 3 .   ? 30.071 20.051 6.928   1.00 46.77 ? 660 HOH A O   1 
HETATM 5651 O O   . HOH E 3 .   ? 11.207 35.211 -16.345 1.00 41.53 ? 662 HOH A O   1 
HETATM 5652 O O   . HOH E 3 .   ? 24.402 58.312 3.563   1.00 44.47 ? 666 HOH A O   1 
HETATM 5653 O O   . HOH E 3 .   ? 40.641 36.134 8.478   1.00 53.51 ? 667 HOH A O   1 
HETATM 5654 O O   . HOH E 3 .   ? 31.161 42.861 -16.535 1.00 35.47 ? 671 HOH A O   1 
HETATM 5655 O O   . HOH E 3 .   ? 31.553 37.596 -22.281 1.00 54.87 ? 676 HOH A O   1 
HETATM 5656 O O   . HOH E 3 .   ? 8.639  34.154 11.336  1.00 40.47 ? 677 HOH A O   1 
HETATM 5657 O O   . HOH E 3 .   ? 31.574 35.751 11.365  1.00 54.57 ? 678 HOH A O   1 
HETATM 5658 O O   . HOH E 3 .   ? 11.375 50.648 18.493  1.00 41.42 ? 681 HOH A O   1 
HETATM 5659 O O   . HOH E 3 .   ? 17.858 51.751 -15.688 1.00 58.91 ? 683 HOH A O   1 
HETATM 5660 O O   . HOH E 3 .   ? 16.955 28.123 10.268  1.00 44.40 ? 684 HOH A O   1 
HETATM 5661 O O   . HOH E 3 .   ? 39.650 34.569 -13.380 1.00 45.86 ? 685 HOH A O   1 
HETATM 5662 O O   . HOH E 3 .   ? 14.597 31.514 13.123  1.00 51.10 ? 686 HOH A O   1 
HETATM 5663 O O   . HOH E 3 .   ? 9.315  43.792 -7.903  1.00 56.40 ? 690 HOH A O   1 
HETATM 5664 O O   . HOH E 3 .   ? 23.288 14.390 0.010   1.00 51.45 ? 692 HOH A O   1 
HETATM 5665 O O   . HOH E 3 .   ? -1.296 22.331 4.689   1.00 50.44 ? 693 HOH A O   1 
HETATM 5666 O O   . HOH E 3 .   ? 8.613  37.675 10.894  1.00 44.62 ? 695 HOH A O   1 
HETATM 5667 O O   . HOH E 3 .   ? 3.091  12.658 9.402   1.00 40.40 ? 697 HOH A O   1 
HETATM 5668 O O   . HOH E 3 .   ? 7.583  31.749 11.882  1.00 36.22 ? 698 HOH A O   1 
HETATM 5669 O O   . HOH E 3 .   ? 28.307 17.580 5.346   1.00 45.14 ? 702 HOH A O   1 
HETATM 5670 O O   . HOH E 3 .   ? 32.181 39.880 22.502  1.00 61.24 ? 709 HOH A O   1 
HETATM 5671 O O   . HOH E 3 .   ? 23.186 28.476 19.272  1.00 63.15 ? 710 HOH A O   1 
HETATM 5672 O O   . HOH E 3 .   ? 25.768 23.078 -4.849  1.00 45.15 ? 711 HOH A O   1 
HETATM 5673 O O   . HOH E 3 .   ? 20.941 48.747 21.028  1.00 28.17 ? 714 HOH A O   1 
HETATM 5674 O O   . HOH E 3 .   ? 9.743  43.711 -15.278 1.00 36.24 ? 716 HOH A O   1 
HETATM 5675 O O   . HOH E 3 .   ? 23.136 27.566 -8.390  1.00 35.06 ? 719 HOH A O   1 
HETATM 5676 O O   . HOH E 3 .   ? 13.126 41.738 -17.674 1.00 35.22 ? 722 HOH A O   1 
HETATM 5677 O O   . HOH E 3 .   ? 12.990 45.136 -5.296  1.00 35.48 ? 723 HOH A O   1 
HETATM 5678 O O   . HOH E 3 .   ? 28.149 50.596 -9.476  1.00 36.66 ? 729 HOH A O   1 
HETATM 5679 O O   . HOH E 3 .   ? 8.786  49.194 2.577   1.00 43.06 ? 731 HOH A O   1 
HETATM 5680 O O   . HOH E 3 .   ? 25.057 21.477 -1.324  1.00 41.95 ? 732 HOH A O   1 
HETATM 5681 O O   . HOH E 3 .   ? 30.951 31.470 -16.448 1.00 49.92 ? 734 HOH A O   1 
HETATM 5682 O O   . HOH E 3 .   ? 16.425 33.140 -10.709 1.00 44.24 ? 735 HOH A O   1 
HETATM 5683 O O   . HOH E 3 .   ? 38.132 24.236 -3.326  1.00 35.79 ? 736 HOH A O   1 
HETATM 5684 O O   . HOH E 3 .   ? 9.253  45.862 0.850   1.00 44.38 ? 738 HOH A O   1 
HETATM 5685 O O   . HOH E 3 .   ? 12.947 46.706 -2.028  1.00 36.14 ? 739 HOH A O   1 
HETATM 5686 O O   . HOH E 3 .   ? 5.124  32.504 12.613  1.00 40.51 ? 741 HOH A O   1 
HETATM 5687 O O   . HOH E 3 .   ? 9.933  48.327 -15.485 1.00 46.33 ? 742 HOH A O   1 
HETATM 5688 O O   . HOH E 3 .   ? 14.418 53.173 6.092   1.00 35.85 ? 743 HOH A O   1 
HETATM 5689 O O   . HOH E 3 .   ? 15.121 46.641 -5.083  1.00 40.50 ? 744 HOH A O   1 
HETATM 5690 O O   . HOH E 3 .   ? 29.944 46.342 -13.913 1.00 40.18 ? 745 HOH A O   1 
HETATM 5691 O O   . HOH E 3 .   ? 41.013 35.376 -5.329  1.00 38.44 ? 746 HOH A O   1 
HETATM 5692 O O   . HOH E 3 .   ? 36.800 44.125 -10.734 1.00 55.43 ? 750 HOH A O   1 
HETATM 5693 O O   . HOH E 3 .   ? 31.000 52.371 -6.439  1.00 48.26 ? 751 HOH A O   1 
HETATM 5694 O O   . HOH E 3 .   ? 16.805 48.148 -1.040  1.00 42.28 ? 753 HOH A O   1 
HETATM 5695 O O   . HOH E 3 .   ? 6.448  41.195 -7.492  1.00 46.77 ? 754 HOH A O   1 
HETATM 5696 O O   . HOH E 3 .   ? 31.793 39.790 -19.792 1.00 51.14 ? 755 HOH A O   1 
HETATM 5697 O O   . HOH E 3 .   ? 13.105 14.605 13.437  1.00 58.84 ? 757 HOH A O   1 
HETATM 5698 O O   . HOH E 3 .   ? 14.299 54.553 3.650   1.00 40.18 ? 761 HOH A O   1 
HETATM 5699 O O   . HOH E 3 .   ? 23.897 23.522 -2.399  1.00 42.24 ? 763 HOH A O   1 
HETATM 5700 O O   . HOH E 3 .   ? 12.711 21.840 18.321  1.00 47.63 ? 765 HOH A O   1 
HETATM 5701 O O   . HOH E 3 .   ? 38.155 36.240 5.284   1.00 48.24 ? 766 HOH A O   1 
HETATM 5702 O O   . HOH E 3 .   ? 11.680 17.515 -3.308  1.00 57.12 ? 767 HOH A O   1 
HETATM 5703 O O   . HOH E 3 .   ? 41.155 26.547 -11.518 1.00 42.79 ? 769 HOH A O   1 
HETATM 5704 O O   . HOH E 3 .   ? 14.643 49.681 0.216   1.00 43.75 ? 770 HOH A O   1 
HETATM 5705 O O   . HOH E 3 .   ? 20.086 30.748 12.020  1.00 47.31 ? 773 HOH A O   1 
HETATM 5706 O O   . HOH E 3 .   ? 29.805 54.940 3.100   1.00 42.58 ? 774 HOH A O   1 
HETATM 5707 O O   . HOH E 3 .   ? 10.003 47.899 18.078  1.00 42.52 ? 775 HOH A O   1 
HETATM 5708 O O   . HOH E 3 .   ? 5.189  45.841 7.127   1.00 44.07 ? 777 HOH A O   1 
HETATM 5709 O O   . HOH E 3 .   ? 20.045 28.168 15.159  1.00 56.33 ? 779 HOH A O   1 
HETATM 5710 O O   . HOH E 3 .   ? 40.247 48.250 10.240  1.00 52.96 ? 783 HOH A O   1 
HETATM 5711 O O   . HOH E 3 .   ? 9.259  13.122 12.948  1.00 46.48 ? 785 HOH A O   1 
HETATM 5712 O O   . HOH E 3 .   ? 3.505  41.057 7.144   1.00 44.35 ? 789 HOH A O   1 
HETATM 5713 O O   . HOH E 3 .   ? 13.982 26.129 -5.080  1.00 47.88 ? 793 HOH A O   1 
HETATM 5714 O O   . HOH E 3 .   ? 41.729 35.337 -7.773  1.00 48.99 ? 795 HOH A O   1 
HETATM 5715 O O   . HOH E 3 .   ? -1.681 24.447 2.588   1.00 50.46 ? 797 HOH A O   1 
HETATM 5716 O O   . HOH E 3 .   ? 37.070 48.189 -12.240 1.00 50.16 ? 798 HOH A O   1 
HETATM 5717 O O   . HOH E 3 .   ? 19.438 59.174 19.155  1.00 49.64 ? 801 HOH A O   1 
HETATM 5718 O O   . HOH E 3 .   ? 6.740  52.969 6.005   1.00 56.31 ? 802 HOH A O   1 
HETATM 5719 O O   . HOH E 3 .   ? 29.677 56.837 -0.423  1.00 51.98 ? 803 HOH A O   1 
HETATM 5720 O O   . HOH E 3 .   ? -0.294 23.813 7.239   1.00 49.69 ? 806 HOH A O   1 
HETATM 5721 O O   . HOH E 3 .   ? 26.553 12.809 7.881   1.00 56.51 ? 807 HOH A O   1 
HETATM 5722 O O   . HOH E 3 .   ? 6.384  51.634 8.282   1.00 51.04 ? 808 HOH A O   1 
HETATM 5723 O O   . HOH E 3 .   ? 2.495  43.643 10.419  1.00 55.19 ? 811 HOH A O   1 
HETATM 5724 O O   . HOH E 3 .   ? 39.608 23.587 -14.973 1.00 47.01 ? 814 HOH A O   1 
HETATM 5725 O O   . HOH E 3 .   ? 25.885 41.607 -21.767 1.00 48.66 ? 816 HOH A O   1 
HETATM 5726 O O   . HOH E 3 .   ? 24.431 25.826 11.005  1.00 53.64 ? 817 HOH A O   1 
HETATM 5727 O O   . HOH E 3 .   ? 34.370 26.093 -4.398  1.00 53.78 ? 820 HOH A O   1 
HETATM 5728 O O   . HOH E 3 .   ? 8.254  6.151  11.866  1.00 53.94 ? 822 HOH A O   1 
HETATM 5729 O O   . HOH E 3 .   ? 29.705 52.573 26.515  1.00 59.49 ? 827 HOH A O   1 
HETATM 5730 O O   . HOH E 3 .   ? 28.774 27.628 13.484  1.00 46.61 ? 828 HOH A O   1 
HETATM 5731 O O   . HOH E 3 .   ? 22.081 29.275 -16.715 1.00 54.17 ? 833 HOH A O   1 
HETATM 5732 O O   . HOH E 3 .   ? 41.057 40.428 11.430  1.00 57.63 ? 834 HOH A O   1 
HETATM 5733 O O   . HOH E 3 .   ? 13.352 16.125 -1.756  1.00 50.55 ? 835 HOH A O   1 
HETATM 5734 O O   . HOH E 3 .   ? 35.709 49.236 12.033  1.00 49.64 ? 837 HOH A O   1 
HETATM 5735 O O   . HOH E 3 .   ? 35.408 29.522 -17.927 1.00 58.33 ? 840 HOH A O   1 
HETATM 5736 O O   . HOH E 3 .   ? 5.058  4.702  -0.243  1.00 52.12 ? 844 HOH A O   1 
HETATM 5737 O O   . HOH E 3 .   ? 8.497  5.975  2.944   1.00 56.38 ? 846 HOH A O   1 
HETATM 5738 O O   . HOH E 3 .   ? 3.993  12.689 15.836  1.00 58.10 ? 847 HOH A O   1 
HETATM 5739 O O   . HOH E 3 .   ? 43.271 49.361 1.306   1.00 54.82 ? 852 HOH A O   1 
HETATM 5740 O O   . HOH E 3 .   ? 22.399 12.297 8.408   1.00 55.71 ? 853 HOH A O   1 
HETATM 5741 O O   . HOH E 3 .   ? 28.406 24.919 -13.275 1.00 56.52 ? 855 HOH A O   1 
HETATM 5742 O O   . HOH E 3 .   ? 4.761  8.337  -3.249  1.00 58.98 ? 858 HOH A O   1 
HETATM 5743 O O   . HOH E 3 .   ? 26.766 48.978 -12.590 1.00 53.95 ? 859 HOH A O   1 
HETATM 5744 O O   . HOH E 3 .   ? 19.107 58.862 -0.617  1.00 56.58 ? 860 HOH A O   1 
HETATM 5745 O O   . HOH E 3 .   ? 17.084 57.535 18.606  1.00 54.98 ? 861 HOH A O   1 
HETATM 5746 O O   . HOH E 3 .   ? 15.256 27.529 -8.763  1.00 54.53 ? 863 HOH A O   1 
HETATM 5747 O O   . HOH E 3 .   ? 9.411  30.128 -9.605  1.00 52.89 ? 867 HOH A O   1 
HETATM 5748 O O   . HOH E 3 .   ? 4.553  13.267 11.527  1.00 53.88 ? 868 HOH A O   1 
HETATM 5749 O O   . HOH E 3 .   ? 10.465 7.449  1.396   1.00 56.20 ? 870 HOH A O   1 
HETATM 5750 O O   . HOH E 3 .   ? 28.187 23.566 -10.959 1.00 55.12 ? 872 HOH A O   1 
HETATM 5751 O O   . HOH E 3 .   ? 10.838 54.760 16.948  1.00 57.46 ? 873 HOH A O   1 
HETATM 5752 O O   . HOH E 3 .   ? 20.053 22.964 -5.369  1.00 49.27 ? 874 HOH A O   1 
HETATM 5753 O O   . HOH E 3 .   ? 10.625 22.823 22.374  1.00 50.07 ? 878 HOH A O   1 
HETATM 5754 O O   . HOH F 3 .   ? 30.222 42.358 31.018  1.00 28.16 ? 501 HOH B O   1 
HETATM 5755 O O   . HOH F 3 .   ? 19.415 59.421 26.591  1.00 22.65 ? 503 HOH B O   1 
HETATM 5756 O O   . HOH F 3 .   ? 28.317 48.088 51.357  1.00 24.71 ? 504 HOH B O   1 
HETATM 5757 O O   . HOH F 3 .   ? 18.241 40.805 29.679  1.00 24.38 ? 506 HOH B O   1 
HETATM 5758 O O   . HOH F 3 .   ? 13.890 56.753 37.161  1.00 29.45 ? 510 HOH B O   1 
HETATM 5759 O O   . HOH F 3 .   ? 23.146 37.200 32.838  1.00 23.33 ? 512 HOH B O   1 
HETATM 5760 O O   . HOH F 3 .   ? 18.786 47.301 31.442  1.00 25.56 ? 513 HOH B O   1 
HETATM 5761 O O   . HOH F 3 .   ? 22.161 48.123 23.452  1.00 23.94 ? 517 HOH B O   1 
HETATM 5762 O O   . HOH F 3 .   ? 13.175 48.841 40.599  1.00 31.20 ? 519 HOH B O   1 
HETATM 5763 O O   . HOH F 3 .   ? 12.024 51.066 33.387  1.00 26.67 ? 521 HOH B O   1 
HETATM 5764 O O   . HOH F 3 .   ? 36.623 42.486 33.037  1.00 32.48 ? 523 HOH B O   1 
HETATM 5765 O O   . HOH F 3 .   ? 32.569 57.072 45.400  1.00 29.73 ? 525 HOH B O   1 
HETATM 5766 O O   . HOH F 3 .   ? 21.934 48.881 33.416  1.00 30.10 ? 527 HOH B O   1 
HETATM 5767 O O   . HOH F 3 .   ? 7.166  39.178 35.209  1.00 33.56 ? 529 HOH B O   1 
HETATM 5768 O O   . HOH F 3 .   ? 21.527 44.992 55.643  1.00 27.98 ? 530 HOH B O   1 
HETATM 5769 O O   . HOH F 3 .   ? 21.512 37.360 30.577  1.00 30.75 ? 531 HOH B O   1 
HETATM 5770 O O   . HOH F 3 .   ? 12.802 38.689 51.473  1.00 36.34 ? 535 HOH B O   1 
HETATM 5771 O O   . HOH F 3 .   ? 18.833 43.695 22.561  1.00 31.95 ? 536 HOH B O   1 
HETATM 5772 O O   . HOH F 3 .   ? 16.104 52.002 46.358  1.00 31.33 ? 537 HOH B O   1 
HETATM 5773 O O   . HOH F 3 .   ? 25.308 51.654 27.372  1.00 32.57 ? 552 HOH B O   1 
HETATM 5774 O O   . HOH F 3 .   ? 27.887 51.948 71.848  1.00 40.88 ? 558 HOH B O   1 
HETATM 5775 O O   . HOH F 3 .   ? 47.008 60.689 30.027  1.00 57.72 ? 559 HOH B O   1 
HETATM 5776 O O   . HOH F 3 .   ? 5.529  41.414 35.791  1.00 42.17 ? 562 HOH B O   1 
HETATM 5777 O O   . HOH F 3 .   ? 10.470 49.126 40.188  1.00 41.87 ? 563 HOH B O   1 
HETATM 5778 O O   . HOH F 3 .   ? 34.915 54.431 46.830  1.00 34.88 ? 564 HOH B O   1 
HETATM 5779 O O   . HOH F 3 .   ? 32.429 58.182 42.909  1.00 33.68 ? 570 HOH B O   1 
HETATM 5780 O O   . HOH F 3 .   ? 21.307 34.806 53.661  1.00 35.59 ? 573 HOH B O   1 
HETATM 5781 O O   . HOH F 3 .   ? 3.568  47.559 39.512  1.00 44.26 ? 574 HOH B O   1 
HETATM 5782 O O   . HOH F 3 .   ? 34.488 68.211 42.008  1.00 58.37 ? 575 HOH B O   1 
HETATM 5783 O O   . HOH F 3 .   ? 9.891  51.722 36.971  1.00 34.23 ? 576 HOH B O   1 
HETATM 5784 O O   . HOH F 3 .   ? 31.535 47.634 51.158  1.00 35.56 ? 578 HOH B O   1 
HETATM 5785 O O   . HOH F 3 .   ? 22.530 41.786 65.177  1.00 35.95 ? 579 HOH B O   1 
HETATM 5786 O O   . HOH F 3 .   ? 17.381 36.529 15.361  1.00 34.60 ? 582 HOH B O   1 
HETATM 5787 O O   . HOH F 3 .   ? 13.465 57.760 29.955  1.00 36.71 ? 587 HOH B O   1 
HETATM 5788 O O   . HOH F 3 .   ? 27.336 54.327 32.819  1.00 36.58 ? 590 HOH B O   1 
HETATM 5789 O O   . HOH F 3 .   ? 34.208 64.921 26.754  1.00 45.07 ? 592 HOH B O   1 
HETATM 5790 O O   . HOH F 3 .   ? 35.003 52.956 26.948  1.00 56.59 ? 593 HOH B O   1 
HETATM 5791 O O   . HOH F 3 .   ? 33.603 60.551 42.917  1.00 35.50 ? 594 HOH B O   1 
HETATM 5792 O O   . HOH F 3 .   ? 12.550 43.265 50.435  1.00 37.30 ? 599 HOH B O   1 
HETATM 5793 O O   . HOH F 3 .   ? 29.762 31.866 39.459  1.00 43.15 ? 601 HOH B O   1 
HETATM 5794 O O   . HOH F 3 .   ? 7.613  37.247 41.133  1.00 44.02 ? 608 HOH B O   1 
HETATM 5795 O O   . HOH F 3 .   ? 17.140 55.321 48.787  1.00 36.15 ? 611 HOH B O   1 
HETATM 5796 O O   . HOH F 3 .   ? 16.101 57.106 40.160  1.00 35.88 ? 612 HOH B O   1 
HETATM 5797 O O   . HOH F 3 .   ? 16.401 58.678 54.556  1.00 40.53 ? 617 HOH B O   1 
HETATM 5798 O O   . HOH F 3 .   ? 24.551 31.814 28.674  1.00 51.57 ? 619 HOH B O   1 
HETATM 5799 O O   . HOH F 3 .   ? 22.469 63.425 33.375  1.00 37.99 ? 620 HOH B O   1 
HETATM 5800 O O   . HOH F 3 .   ? 30.211 37.764 32.325  1.00 42.54 ? 621 HOH B O   1 
HETATM 5801 O O   . HOH F 3 .   ? 35.406 68.176 29.757  1.00 48.96 ? 622 HOH B O   1 
HETATM 5802 O O   . HOH F 3 .   ? 27.362 55.686 52.374  1.00 39.21 ? 627 HOH B O   1 
HETATM 5803 O O   . HOH F 3 .   ? 18.656 39.308 27.169  1.00 38.35 ? 628 HOH B O   1 
HETATM 5804 O O   . HOH F 3 .   ? 16.137 55.282 21.102  1.00 48.46 ? 629 HOH B O   1 
HETATM 5805 O O   . HOH F 3 .   ? 18.987 31.707 16.795  1.00 60.08 ? 634 HOH B O   1 
HETATM 5806 O O   . HOH F 3 .   ? 29.457 54.682 51.623  1.00 41.53 ? 636 HOH B O   1 
HETATM 5807 O O   . HOH F 3 .   ? 27.314 59.922 31.708  1.00 30.99 ? 638 HOH B O   1 
HETATM 5808 O O   . HOH F 3 .   ? 30.752 31.766 36.903  1.00 39.62 ? 640 HOH B O   1 
HETATM 5809 O O   . HOH F 3 .   ? 9.077  51.916 29.934  1.00 36.76 ? 643 HOH B O   1 
HETATM 5810 O O   . HOH F 3 .   ? 19.294 64.269 32.018  1.00 49.28 ? 645 HOH B O   1 
HETATM 5811 O O   . HOH F 3 .   ? 18.273 40.079 58.836  1.00 42.20 ? 646 HOH B O   1 
HETATM 5812 O O   . HOH F 3 .   ? 24.405 66.276 30.239  1.00 61.42 ? 647 HOH B O   1 
HETATM 5813 O O   . HOH F 3 .   ? 39.223 35.609 33.719  1.00 44.80 ? 648 HOH B O   1 
HETATM 5814 O O   . HOH F 3 .   ? 36.798 43.316 54.408  1.00 35.98 ? 651 HOH B O   1 
HETATM 5815 O O   . HOH F 3 .   ? 32.924 60.119 29.147  1.00 42.13 ? 652 HOH B O   1 
HETATM 5816 O O   . HOH F 3 .   ? 9.106  58.641 25.816  1.00 55.31 ? 653 HOH B O   1 
HETATM 5817 O O   . HOH F 3 .   ? 32.176 40.384 59.787  1.00 47.86 ? 659 HOH B O   1 
HETATM 5818 O O   . HOH F 3 .   ? 29.365 33.843 32.901  1.00 58.59 ? 661 HOH B O   1 
HETATM 5819 O O   . HOH F 3 .   ? 22.023 31.050 51.648  1.00 41.51 ? 663 HOH B O   1 
HETATM 5820 O O   . HOH F 3 .   ? 27.091 55.230 26.598  1.00 57.98 ? 664 HOH B O   1 
HETATM 5821 O O   . HOH F 3 .   ? 13.149 59.915 31.818  1.00 42.33 ? 665 HOH B O   1 
HETATM 5822 O O   . HOH F 3 .   ? 18.196 63.649 46.539  1.00 49.53 ? 668 HOH B O   1 
HETATM 5823 O O   . HOH F 3 .   ? 33.412 22.614 44.214  1.00 55.76 ? 669 HOH B O   1 
HETATM 5824 O O   . HOH F 3 .   ? 29.228 39.522 30.686  1.00 35.03 ? 670 HOH B O   1 
HETATM 5825 O O   . HOH F 3 .   ? 13.496 53.577 20.524  1.00 38.40 ? 672 HOH B O   1 
HETATM 5826 O O   . HOH F 3 .   ? 28.916 52.619 29.899  1.00 42.89 ? 674 HOH B O   1 
HETATM 5827 O O   . HOH F 3 .   ? -0.603 50.584 31.370  1.00 60.10 ? 675 HOH B O   1 
HETATM 5828 O O   . HOH F 3 .   ? 17.744 30.968 30.817  1.00 46.42 ? 679 HOH B O   1 
HETATM 5829 O O   . HOH F 3 .   ? 36.383 39.387 46.859  1.00 48.73 ? 680 HOH B O   1 
HETATM 5830 O O   . HOH F 3 .   ? 36.223 45.541 32.713  1.00 37.83 ? 682 HOH B O   1 
HETATM 5831 O O   . HOH F 3 .   ? 33.460 35.632 29.812  1.00 64.39 ? 687 HOH B O   1 
HETATM 5832 O O   . HOH F 3 .   ? 17.593 25.054 41.998  1.00 55.29 ? 688 HOH B O   1 
HETATM 5833 O O   . HOH F 3 .   ? 15.933 62.376 31.430  1.00 41.81 ? 689 HOH B O   1 
HETATM 5834 O O   . HOH F 3 .   ? 8.449  48.833 45.382  1.00 58.92 ? 691 HOH B O   1 
HETATM 5835 O O   . HOH F 3 .   ? 21.263 33.791 19.370  1.00 42.83 ? 694 HOH B O   1 
HETATM 5836 O O   . HOH F 3 .   ? 26.841 41.115 60.287  1.00 38.25 ? 696 HOH B O   1 
HETATM 5837 O O   . HOH F 3 .   ? 12.484 42.725 53.372  1.00 48.51 ? 700 HOH B O   1 
HETATM 5838 O O   . HOH F 3 .   ? 22.927 27.260 38.893  1.00 41.70 ? 701 HOH B O   1 
HETATM 5839 O O   . HOH F 3 .   ? 38.791 47.099 49.501  1.00 54.61 ? 703 HOH B O   1 
HETATM 5840 O O   . HOH F 3 .   ? 20.726 37.270 60.155  1.00 53.47 ? 704 HOH B O   1 
HETATM 5841 O O   . HOH F 3 .   ? 17.317 54.504 46.154  1.00 36.54 ? 705 HOH B O   1 
HETATM 5842 O O   . HOH F 3 .   ? 13.594 26.763 22.324  1.00 61.15 ? 706 HOH B O   1 
HETATM 5843 O O   . HOH F 3 .   ? 28.296 28.019 44.201  1.00 46.80 ? 707 HOH B O   1 
HETATM 5844 O O   . HOH F 3 .   ? -4.068 55.220 26.482  1.00 65.30 ? 708 HOH B O   1 
HETATM 5845 O O   . HOH F 3 .   ? 27.128 33.544 69.082  1.00 63.02 ? 712 HOH B O   1 
HETATM 5846 O O   . HOH F 3 .   ? 44.482 42.262 39.145  1.00 45.62 ? 713 HOH B O   1 
HETATM 5847 O O   . HOH F 3 .   ? 17.560 44.447 19.904  1.00 28.99 ? 715 HOH B O   1 
HETATM 5848 O O   . HOH F 3 .   ? 7.824  52.046 34.768  1.00 37.11 ? 717 HOH B O   1 
HETATM 5849 O O   . HOH F 3 .   ? 20.250 42.113 26.342  1.00 36.74 ? 718 HOH B O   1 
HETATM 5850 O O   . HOH F 3 .   ? 9.667  51.968 32.581  1.00 33.13 ? 720 HOH B O   1 
HETATM 5851 O O   . HOH F 3 .   ? 14.533 55.596 41.373  1.00 35.58 ? 721 HOH B O   1 
HETATM 5852 O O   . HOH F 3 .   ? 13.076 51.640 48.305  1.00 37.87 ? 724 HOH B O   1 
HETATM 5853 O O   . HOH F 3 .   ? 29.046 33.367 35.882  1.00 42.65 ? 725 HOH B O   1 
HETATM 5854 O O   . HOH F 3 .   ? 6.004  48.255 16.514  1.00 49.39 ? 726 HOH B O   1 
HETATM 5855 O O   . HOH F 3 .   ? 33.469 49.319 51.961  1.00 40.06 ? 727 HOH B O   1 
HETATM 5856 O O   . HOH F 3 .   ? 11.879 58.301 36.012  1.00 42.92 ? 728 HOH B O   1 
HETATM 5857 O O   . HOH F 3 .   ? 48.422 58.715 30.920  1.00 56.80 ? 730 HOH B O   1 
HETATM 5858 O O   . HOH F 3 .   ? 27.043 30.953 42.394  1.00 37.86 ? 733 HOH B O   1 
HETATM 5859 O O   . HOH F 3 .   ? 34.130 58.347 47.401  1.00 54.90 ? 737 HOH B O   1 
HETATM 5860 O O   . HOH F 3 .   ? 34.296 67.419 27.053  1.00 55.31 ? 740 HOH B O   1 
HETATM 5861 O O   . HOH F 3 .   ? 34.468 48.237 54.263  1.00 45.55 ? 747 HOH B O   1 
HETATM 5862 O O   . HOH F 3 .   ? 15.555 53.057 42.042  1.00 33.25 ? 748 HOH B O   1 
HETATM 5863 O O   . HOH F 3 .   ? 38.765 46.235 33.213  1.00 44.73 ? 749 HOH B O   1 
HETATM 5864 O O   . HOH F 3 .   ? 15.186 58.634 38.131  1.00 50.75 ? 752 HOH B O   1 
HETATM 5865 O O   . HOH F 3 .   ? 10.375 50.901 48.661  1.00 45.63 ? 756 HOH B O   1 
HETATM 5866 O O   . HOH F 3 .   ? 7.354  46.717 43.760  1.00 55.49 ? 758 HOH B O   1 
HETATM 5867 O O   . HOH F 3 .   ? 12.078 58.291 33.439  1.00 43.83 ? 759 HOH B O   1 
HETATM 5868 O O   . HOH F 3 .   ? 16.033 30.945 28.912  1.00 47.60 ? 760 HOH B O   1 
HETATM 5869 O O   . HOH F 3 .   ? 35.082 54.173 35.791  1.00 37.44 ? 762 HOH B O   1 
HETATM 5870 O O   . HOH F 3 .   ? 30.483 29.002 36.375  1.00 51.20 ? 764 HOH B O   1 
HETATM 5871 O O   . HOH F 3 .   ? 14.570 53.923 44.732  1.00 46.01 ? 768 HOH B O   1 
HETATM 5872 O O   . HOH F 3 .   ? 16.649 58.109 57.342  1.00 53.36 ? 771 HOH B O   1 
HETATM 5873 O O   . HOH F 3 .   ? 34.905 56.362 48.859  1.00 47.14 ? 772 HOH B O   1 
HETATM 5874 O O   . HOH F 3 .   ? 36.111 45.302 30.172  1.00 43.22 ? 776 HOH B O   1 
HETATM 5875 O O   . HOH F 3 .   ? 53.592 72.643 39.117  1.00 50.56 ? 778 HOH B O   1 
HETATM 5876 O O   . HOH F 3 .   ? 14.907 59.057 46.976  1.00 53.50 ? 780 HOH B O   1 
HETATM 5877 O O   . HOH F 3 .   ? 38.293 71.973 28.217  1.00 56.92 ? 781 HOH B O   1 
HETATM 5878 O O   . HOH F 3 .   ? 10.283 44.903 49.859  1.00 55.65 ? 782 HOH B O   1 
HETATM 5879 O O   . HOH F 3 .   ? 13.857 51.504 40.637  1.00 45.82 ? 784 HOH B O   1 
HETATM 5880 O O   . HOH F 3 .   ? 40.690 74.446 50.066  1.00 59.76 ? 786 HOH B O   1 
HETATM 5881 O O   . HOH F 3 .   ? 9.438  53.576 21.515  1.00 50.41 ? 787 HOH B O   1 
HETATM 5882 O O   . HOH F 3 .   ? 8.191  47.576 19.932  1.00 50.06 ? 788 HOH B O   1 
HETATM 5883 O O   . HOH F 3 .   ? 40.005 50.839 45.619  1.00 48.68 ? 790 HOH B O   1 
HETATM 5884 O O   . HOH F 3 .   ? 26.781 61.935 48.838  1.00 47.65 ? 791 HOH B O   1 
HETATM 5885 O O   . HOH F 3 .   ? 25.603 28.604 42.200  1.00 47.83 ? 792 HOH B O   1 
HETATM 5886 O O   . HOH F 3 .   ? 39.352 69.585 47.422  1.00 52.40 ? 794 HOH B O   1 
HETATM 5887 O O   . HOH F 3 .   ? 48.750 69.288 33.602  1.00 52.59 ? 796 HOH B O   1 
HETATM 5888 O O   . HOH F 3 .   ? 24.017 52.950 60.683  1.00 53.47 ? 799 HOH B O   1 
HETATM 5889 O O   . HOH F 3 .   ? 19.149 33.403 53.963  1.00 52.01 ? 800 HOH B O   1 
HETATM 5890 O O   . HOH F 3 .   ? 19.634 32.130 51.296  1.00 42.92 ? 804 HOH B O   1 
HETATM 5891 O O   . HOH F 3 .   ? 28.088 60.271 29.250  1.00 53.68 ? 805 HOH B O   1 
HETATM 5892 O O   . HOH F 3 .   ? 33.744 56.470 35.582  1.00 47.27 ? 809 HOH B O   1 
HETATM 5893 O O   . HOH F 3 .   ? 11.525 40.878 50.334  1.00 50.76 ? 810 HOH B O   1 
HETATM 5894 O O   . HOH F 3 .   ? 46.250 44.443 40.300  1.00 51.99 ? 812 HOH B O   1 
HETATM 5895 O O   . HOH F 3 .   ? 10.180 36.826 37.656  1.00 46.68 ? 813 HOH B O   1 
HETATM 5896 O O   . HOH F 3 .   ? 29.389 44.972 58.088  1.00 46.68 ? 815 HOH B O   1 
HETATM 5897 O O   . HOH F 3 .   ? 21.360 40.144 62.935  1.00 46.16 ? 818 HOH B O   1 
HETATM 5898 O O   . HOH F 3 .   ? 31.197 50.435 53.405  1.00 56.41 ? 819 HOH B O   1 
HETATM 5899 O O   . HOH F 3 .   ? 8.388  41.449 47.347  1.00 46.97 ? 821 HOH B O   1 
HETATM 5900 O O   . HOH F 3 .   ? 15.865 25.282 25.498  1.00 58.02 ? 823 HOH B O   1 
HETATM 5901 O O   . HOH F 3 .   ? 7.060  56.809 25.271  1.00 44.99 ? 824 HOH B O   1 
HETATM 5902 O O   . HOH F 3 .   ? 24.128 35.439 22.261  1.00 50.67 ? 825 HOH B O   1 
HETATM 5903 O O   . HOH F 3 .   ? 37.626 36.079 51.290  1.00 58.48 ? 826 HOH B O   1 
HETATM 5904 O O   . HOH F 3 .   ? 31.377 25.203 42.340  1.00 57.08 ? 829 HOH B O   1 
HETATM 5905 O O   . HOH F 3 .   ? 32.426 35.908 33.104  1.00 44.35 ? 830 HOH B O   1 
HETATM 5906 O O   . HOH F 3 .   ? 28.237 42.192 57.811  1.00 53.57 ? 831 HOH B O   1 
HETATM 5907 O O   . HOH F 3 .   ? 23.162 40.279 67.545  1.00 51.08 ? 832 HOH B O   1 
HETATM 5908 O O   . HOH F 3 .   ? 47.705 50.031 45.158  1.00 50.12 ? 836 HOH B O   1 
HETATM 5909 O O   . HOH F 3 .   ? 12.672 60.515 52.377  1.00 49.18 ? 838 HOH B O   1 
HETATM 5910 O O   . HOH F 3 .   ? 30.609 61.248 29.194  1.00 46.76 ? 839 HOH B O   1 
HETATM 5911 O O   . HOH F 3 .   ? 7.365  50.013 52.181  1.00 56.90 ? 841 HOH B O   1 
HETATM 5912 O O   . HOH F 3 .   ? 39.411 41.729 59.105  1.00 56.23 ? 842 HOH B O   1 
HETATM 5913 O O   . HOH F 3 .   ? 17.960 43.426 60.786  1.00 44.46 ? 843 HOH B O   1 
HETATM 5914 O O   . HOH F 3 .   ? 38.731 48.716 47.069  1.00 56.76 ? 845 HOH B O   1 
HETATM 5915 O O   . HOH F 3 .   ? 6.101  53.257 30.654  1.00 47.15 ? 848 HOH B O   1 
HETATM 5916 O O   . HOH F 3 .   ? 44.036 70.340 33.385  1.00 57.30 ? 849 HOH B O   1 
HETATM 5917 O O   . HOH F 3 .   ? 41.731 63.504 45.614  1.00 51.81 ? 850 HOH B O   1 
HETATM 5918 O O   . HOH F 3 .   ? 11.425 36.480 50.190  1.00 55.14 ? 851 HOH B O   1 
HETATM 5919 O O   . HOH F 3 .   ? 27.492 65.389 17.147  1.00 59.30 ? 854 HOH B O   1 
HETATM 5920 O O   . HOH F 3 .   ? 14.998 61.054 54.111  1.00 48.09 ? 856 HOH B O   1 
HETATM 5921 O O   . HOH F 3 .   ? 12.214 39.385 54.175  1.00 53.76 ? 857 HOH B O   1 
HETATM 5922 O O   . HOH F 3 .   ? 29.228 68.259 38.795  1.00 53.85 ? 862 HOH B O   1 
HETATM 5923 O O   . HOH F 3 .   ? 38.175 41.399 31.036  1.00 51.13 ? 864 HOH B O   1 
HETATM 5924 O O   . HOH F 3 .   ? 40.847 47.625 46.011  1.00 52.75 ? 865 HOH B O   1 
HETATM 5925 O O   . HOH F 3 .   ? 22.709 64.357 49.443  1.00 55.41 ? 866 HOH B O   1 
HETATM 5926 O O   . HOH F 3 .   ? 55.011 57.953 33.721  1.00 58.36 ? 869 HOH B O   1 
HETATM 5927 O O   . HOH F 3 .   ? 18.667 26.925 33.292  1.00 55.64 ? 871 HOH B O   1 
HETATM 5928 O O   . HOH F 3 .   ? 39.931 44.845 31.206  1.00 56.07 ? 875 HOH B O   1 
HETATM 5929 O O   . HOH F 3 .   ? 19.017 41.378 61.704  1.00 48.60 ? 876 HOH B O   1 
HETATM 5930 O O   . HOH F 3 .   ? 26.376 31.379 52.103  1.00 51.33 ? 877 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   THR 1   7   ?   ?   ?   A . n 
A 1 2   THR 2   8   ?   ?   ?   A . n 
A 1 3   SER 3   9   ?   ?   ?   A . n 
A 1 4   PHE 4   10  ?   ?   ?   A . n 
A 1 5   ALA 5   11  ?   ?   ?   A . n 
A 1 6   GLU 6   12  ?   ?   ?   A . n 
A 1 7   SER 7   13  ?   ?   ?   A . n 
A 1 8   CYS 8   14  ?   ?   ?   A . n 
A 1 9   LYS 9   15  ?   ?   ?   A . n 
A 1 10  PRO 10  16  ?   ?   ?   A . n 
A 1 11  VAL 11  17  ?   ?   ?   A . n 
A 1 12  GLN 12  18  ?   ?   ?   A . n 
A 1 13  GLN 13  19  ?   ?   ?   A . n 
A 1 14  PRO 14  20  ?   ?   ?   A . n 
A 1 15  SER 15  21  ?   ?   ?   A . n 
A 1 16  ALA 16  22  ?   ?   ?   A . n 
A 1 17  PHE 17  23  ?   ?   ?   A . n 
A 1 18  GLY 18  24  ?   ?   ?   A . n 
A 1 19  SER 19  25  ?   ?   ?   A . n 
A 1 20  MET 20  26  ?   ?   ?   A . n 
A 1 21  LYS 21  27  ?   ?   ?   A . n 
A 1 22  VAL 22  28  ?   ?   ?   A . n 
A 1 23  SER 23  29  ?   ?   ?   A . n 
A 1 24  ARG 24  30  ?   ?   ?   A . n 
A 1 25  ASP 25  31  ?   ?   ?   A . n 
A 1 26  LYS 26  32  ?   ?   ?   A . n 
A 1 27  ASP 27  33  ?   ?   ?   A . n 
A 1 28  GLY 28  34  ?   ?   ?   A . n 
A 1 29  SER 29  35  35  SER SER A . n 
A 1 30  LYS 30  36  36  LYS LYS A . n 
A 1 31  VAL 31  37  37  VAL VAL A . n 
A 1 32  THR 32  38  38  THR THR A . n 
A 1 33  THR 33  39  39  THR THR A . n 
A 1 34  VAL 34  40  40  VAL VAL A . n 
A 1 35  VAL 35  41  41  VAL VAL A . n 
A 1 36  ALA 36  42  42  ALA ALA A . n 
A 1 37  THR 37  43  43  THR THR A . n 
A 1 38  PRO 38  44  44  PRO PRO A . n 
A 1 39  GLY 39  45  45  GLY GLY A . n 
A 1 40  GLN 40  46  46  GLN GLN A . n 
A 1 41  GLY 41  47  47  GLY GLY A . n 
A 1 42  PRO 42  48  48  PRO PRO A . n 
A 1 43  ASP 43  49  49  ASP ASP A . n 
A 1 44  ARG 44  50  50  ARG ARG A . n 
A 1 45  PRO 45  51  51  PRO PRO A . n 
A 1 46  GLN 46  52  52  GLN GLN A . n 
A 1 47  GLU 47  53  53  GLU GLU A . n 
A 1 48  VAL 48  54  54  VAL VAL A . n 
A 1 49  SER 49  55  55  SER SER A . n 
A 1 50  TYR 50  56  56  TYR TYR A . n 
A 1 51  THR 51  57  57  THR THR A . n 
A 1 52  ASP 52  58  58  ASP ASP A . n 
A 1 53  THR 53  59  59  THR THR A . n 
A 1 54  LYS 54  60  60  LYS LYS A . n 
A 1 55  VAL 55  61  61  VAL VAL A . n 
A 1 56  ILE 56  62  62  ILE ILE A . n 
A 1 57  GLY 57  63  63  GLY GLY A . n 
A 1 58  ASN 58  64  64  ASN ASN A . n 
A 1 59  GLY 59  65  65  GLY GLY A . n 
A 1 60  SER 60  66  66  SER SER A . n 
A 1 61  PHE 61  67  67  PHE PHE A . n 
A 1 62  GLY 62  68  68  GLY GLY A . n 
A 1 63  VAL 63  69  69  VAL VAL A . n 
A 1 64  VAL 64  70  70  VAL VAL A . n 
A 1 65  TYR 65  71  71  TYR TYR A . n 
A 1 66  GLN 66  72  72  GLN GLN A . n 
A 1 67  ALA 67  73  73  ALA ALA A . n 
A 1 68  LYS 68  74  74  LYS LYS A . n 
A 1 69  LEU 69  75  75  LEU LEU A . n 
A 1 70  CYS 70  76  76  CYS CYS A . n 
A 1 71  ASP 71  77  77  ASP ASP A . n 
A 1 72  SER 72  78  78  SER SER A . n 
A 1 73  GLY 73  79  79  GLY GLY A . n 
A 1 74  GLU 74  80  80  GLU GLU A . n 
A 1 75  LEU 75  81  81  LEU LEU A . n 
A 1 76  VAL 76  82  82  VAL VAL A . n 
A 1 77  ALA 77  83  83  ALA ALA A . n 
A 1 78  ILE 78  84  84  ILE ILE A . n 
A 1 79  LYS 79  85  85  LYS LYS A . n 
A 1 80  LYS 80  86  86  LYS LYS A . n 
A 1 81  VAL 81  87  87  VAL VAL A . n 
A 1 82  LEU 82  88  88  LEU LEU A . n 
A 1 83  GLN 83  89  89  GLN GLN A . n 
A 1 84  ASP 84  90  90  ASP ASP A . n 
A 1 85  LYS 85  91  91  LYS LYS A . n 
A 1 86  ARG 86  92  92  ARG ARG A . n 
A 1 87  PHE 87  93  93  PHE PHE A . n 
A 1 88  LYS 88  94  94  LYS LYS A . n 
A 1 89  ASN 89  95  95  ASN ASN A . n 
A 1 90  ARG 90  96  96  ARG ARG A . n 
A 1 91  GLU 91  97  97  GLU GLU A . n 
A 1 92  LEU 92  98  98  LEU LEU A . n 
A 1 93  GLN 93  99  99  GLN GLN A . n 
A 1 94  ILE 94  100 100 ILE ILE A . n 
A 1 95  MET 95  101 101 MET MET A . n 
A 1 96  ARG 96  102 102 ARG ARG A . n 
A 1 97  LYS 97  103 103 LYS LYS A . n 
A 1 98  LEU 98  104 104 LEU LEU A . n 
A 1 99  ASP 99  105 105 ASP ASP A . n 
A 1 100 HIS 100 106 106 HIS HIS A . n 
A 1 101 CYS 101 107 107 CYS CYS A . n 
A 1 102 ASN 102 108 108 ASN ASN A . n 
A 1 103 ILE 103 109 109 ILE ILE A . n 
A 1 104 VAL 104 110 110 VAL VAL A . n 
A 1 105 ARG 105 111 111 ARG ARG A . n 
A 1 106 LEU 106 112 112 LEU LEU A . n 
A 1 107 ARG 107 113 113 ARG ARG A . n 
A 1 108 TYR 108 114 114 TYR TYR A . n 
A 1 109 PHE 109 115 115 PHE PHE A . n 
A 1 110 PHE 110 116 116 PHE PHE A . n 
A 1 111 TYR 111 117 117 TYR TYR A . n 
A 1 112 SER 112 118 118 SER SER A . n 
A 1 113 SER 113 119 119 SER SER A . n 
A 1 114 GLY 114 120 ?   ?   ?   A . n 
A 1 115 GLU 115 121 ?   ?   ?   A . n 
A 1 116 LYS 116 122 122 LYS LYS A . n 
A 1 117 LYS 117 123 123 LYS LYS A . n 
A 1 118 ASP 118 124 124 ASP ASP A . n 
A 1 119 GLU 119 125 125 GLU GLU A . n 
A 1 120 VAL 120 126 126 VAL VAL A . n 
A 1 121 TYR 121 127 127 TYR TYR A . n 
A 1 122 LEU 122 128 128 LEU LEU A . n 
A 1 123 ASN 123 129 129 ASN ASN A . n 
A 1 124 LEU 124 130 130 LEU LEU A . n 
A 1 125 VAL 125 131 131 VAL VAL A . n 
A 1 126 LEU 126 132 132 LEU LEU A . n 
A 1 127 ASP 127 133 133 ASP ASP A . n 
A 1 128 TYR 128 134 134 TYR TYR A . n 
A 1 129 VAL 129 135 135 VAL VAL A . n 
A 1 130 PRO 130 136 136 PRO PRO A . n 
A 1 131 GLU 131 137 137 GLU GLU A . n 
A 1 132 THR 132 138 138 THR THR A . n 
A 1 133 VAL 133 139 139 VAL VAL A . n 
A 1 134 TYR 134 140 140 TYR TYR A . n 
A 1 135 ARG 135 141 141 ARG ARG A . n 
A 1 136 VAL 136 142 142 VAL VAL A . n 
A 1 137 ALA 137 143 143 ALA ALA A . n 
A 1 138 ARG 138 144 144 ARG ARG A . n 
A 1 139 HIS 139 145 145 HIS HIS A . n 
A 1 140 TYR 140 146 146 TYR TYR A . n 
A 1 141 SER 141 147 147 SER SER A . n 
A 1 142 ARG 142 148 148 ARG ARG A . n 
A 1 143 ALA 143 149 149 ALA ALA A . n 
A 1 144 LYS 144 150 150 LYS LYS A . n 
A 1 145 GLN 145 151 151 GLN GLN A . n 
A 1 146 THR 146 152 152 THR THR A . n 
A 1 147 LEU 147 153 153 LEU LEU A . n 
A 1 148 PRO 148 154 154 PRO PRO A . n 
A 1 149 VAL 149 155 155 VAL VAL A . n 
A 1 150 ILE 150 156 156 ILE ILE A . n 
A 1 151 TYR 151 157 157 TYR TYR A . n 
A 1 152 VAL 152 158 158 VAL VAL A . n 
A 1 153 LYS 153 159 159 LYS LYS A . n 
A 1 154 LEU 154 160 160 LEU LEU A . n 
A 1 155 TYR 155 161 161 TYR TYR A . n 
A 1 156 MET 156 162 162 MET MET A . n 
A 1 157 TYR 157 163 163 TYR TYR A . n 
A 1 158 GLN 158 164 164 GLN GLN A . n 
A 1 159 LEU 159 165 165 LEU LEU A . n 
A 1 160 PHE 160 166 166 PHE PHE A . n 
A 1 161 ARG 161 167 167 ARG ARG A . n 
A 1 162 SER 162 168 168 SER SER A . n 
A 1 163 LEU 163 169 169 LEU LEU A . n 
A 1 164 ALA 164 170 170 ALA ALA A . n 
A 1 165 TYR 165 171 171 TYR TYR A . n 
A 1 166 ILE 166 172 172 ILE ILE A . n 
A 1 167 HIS 167 173 173 HIS HIS A . n 
A 1 168 SER 168 174 174 SER SER A . n 
A 1 169 PHE 169 175 175 PHE PHE A . n 
A 1 170 GLY 170 176 176 GLY GLY A . n 
A 1 171 ILE 171 177 177 ILE ILE A . n 
A 1 172 CYS 172 178 178 CYS CYS A . n 
A 1 173 HIS 173 179 179 HIS HIS A . n 
A 1 174 ARG 174 180 180 ARG ARG A . n 
A 1 175 ASP 175 181 181 ASP ASP A . n 
A 1 176 ILE 176 182 182 ILE ILE A . n 
A 1 177 LYS 177 183 183 LYS LYS A . n 
A 1 178 PRO 178 184 184 PRO PRO A . n 
A 1 179 GLN 179 185 185 GLN GLN A . n 
A 1 180 ASN 180 186 186 ASN ASN A . n 
A 1 181 LEU 181 187 187 LEU LEU A . n 
A 1 182 LEU 182 188 188 LEU LEU A . n 
A 1 183 LEU 183 189 189 LEU LEU A . n 
A 1 184 ASP 184 190 190 ASP ASP A . n 
A 1 185 PRO 185 191 191 PRO PRO A . n 
A 1 186 ASP 186 192 192 ASP ASP A . n 
A 1 187 THR 187 193 193 THR THR A . n 
A 1 188 ALA 188 194 194 ALA ALA A . n 
A 1 189 VAL 189 195 195 VAL VAL A . n 
A 1 190 LEU 190 196 196 LEU LEU A . n 
A 1 191 LYS 191 197 197 LYS LYS A . n 
A 1 192 LEU 192 198 198 LEU LEU A . n 
A 1 193 CYS 193 199 199 CYS CYS A . n 
A 1 194 ASP 194 200 200 ASP ASP A . n 
A 1 195 PHE 195 201 201 PHE PHE A . n 
A 1 196 GLY 196 202 202 GLY GLY A . n 
A 1 197 SER 197 203 203 SER SER A . n 
A 1 198 ALA 198 204 204 ALA ALA A . n 
A 1 199 LYS 199 205 205 LYS LYS A . n 
A 1 200 GLN 200 206 206 GLN GLN A . n 
A 1 201 LEU 201 207 207 LEU LEU A . n 
A 1 202 VAL 202 208 208 VAL VAL A . n 
A 1 203 ARG 203 209 209 ARG ARG A . n 
A 1 204 GLY 204 210 210 GLY GLY A . n 
A 1 205 GLU 205 211 211 GLU GLU A . n 
A 1 206 PRO 206 212 212 PRO PRO A . n 
A 1 207 ASN 207 213 213 ASN ASN A . n 
A 1 208 VAL 208 214 214 VAL VAL A . n 
A 1 209 SER 209 215 215 SER SER A . n 
A 1 210 TYR 210 216 216 TYR TYR A . n 
A 1 211 ILE 211 217 217 ILE ILE A . n 
A 1 212 CYS 212 218 218 CYS CYS A . n 
A 1 213 SER 213 219 219 SER SER A . n 
A 1 214 ARG 214 220 220 ARG ARG A . n 
A 1 215 TYR 215 221 221 TYR TYR A . n 
A 1 216 TYR 216 222 222 TYR TYR A . n 
A 1 217 ARG 217 223 223 ARG ARG A . n 
A 1 218 ALA 218 224 224 ALA ALA A . n 
A 1 219 PRO 219 225 225 PRO PRO A . n 
A 1 220 GLU 220 226 226 GLU GLU A . n 
A 1 221 LEU 221 227 227 LEU LEU A . n 
A 1 222 ILE 222 228 228 ILE ILE A . n 
A 1 223 PHE 223 229 229 PHE PHE A . n 
A 1 224 GLY 224 230 230 GLY GLY A . n 
A 1 225 ALA 225 231 231 ALA ALA A . n 
A 1 226 THR 226 232 232 THR THR A . n 
A 1 227 ASP 227 233 233 ASP ASP A . n 
A 1 228 TYR 228 234 234 TYR TYR A . n 
A 1 229 THR 229 235 235 THR THR A . n 
A 1 230 SER 230 236 236 SER SER A . n 
A 1 231 SER 231 237 237 SER SER A . n 
A 1 232 ILE 232 238 238 ILE ILE A . n 
A 1 233 ASP 233 239 239 ASP ASP A . n 
A 1 234 VAL 234 240 240 VAL VAL A . n 
A 1 235 TRP 235 241 241 TRP TRP A . n 
A 1 236 SER 236 242 242 SER SER A . n 
A 1 237 ALA 237 243 243 ALA ALA A . n 
A 1 238 GLY 238 244 244 GLY GLY A . n 
A 1 239 CYS 239 245 245 CYS CYS A . n 
A 1 240 VAL 240 246 246 VAL VAL A . n 
A 1 241 LEU 241 247 247 LEU LEU A . n 
A 1 242 ALA 242 248 248 ALA ALA A . n 
A 1 243 GLU 243 249 249 GLU GLU A . n 
A 1 244 LEU 244 250 250 LEU LEU A . n 
A 1 245 LEU 245 251 251 LEU LEU A . n 
A 1 246 LEU 246 252 252 LEU LEU A . n 
A 1 247 GLY 247 253 253 GLY GLY A . n 
A 1 248 GLN 248 254 254 GLN GLN A . n 
A 1 249 PRO 249 255 255 PRO PRO A . n 
A 1 250 ILE 250 256 256 ILE ILE A . n 
A 1 251 PHE 251 257 257 PHE PHE A . n 
A 1 252 PRO 252 258 258 PRO PRO A . n 
A 1 253 GLY 253 259 259 GLY GLY A . n 
A 1 254 ASP 254 260 260 ASP ASP A . n 
A 1 255 SER 255 261 261 SER SER A . n 
A 1 256 GLY 256 262 262 GLY GLY A . n 
A 1 257 VAL 257 263 263 VAL VAL A . n 
A 1 258 ASP 258 264 264 ASP ASP A . n 
A 1 259 GLN 259 265 265 GLN GLN A . n 
A 1 260 LEU 260 266 266 LEU LEU A . n 
A 1 261 VAL 261 267 267 VAL VAL A . n 
A 1 262 GLU 262 268 268 GLU GLU A . n 
A 1 263 ILE 263 269 269 ILE ILE A . n 
A 1 264 ILE 264 270 270 ILE ILE A . n 
A 1 265 LYS 265 271 271 LYS LYS A . n 
A 1 266 VAL 266 272 272 VAL VAL A . n 
A 1 267 LEU 267 273 273 LEU LEU A . n 
A 1 268 GLY 268 274 274 GLY GLY A . n 
A 1 269 THR 269 275 275 THR THR A . n 
A 1 270 PRO 270 276 276 PRO PRO A . n 
A 1 271 THR 271 277 277 THR THR A . n 
A 1 272 ARG 272 278 278 ARG ARG A . n 
A 1 273 GLU 273 279 279 GLU GLU A . n 
A 1 274 GLN 274 280 280 GLN GLN A . n 
A 1 275 ILE 275 281 281 ILE ILE A . n 
A 1 276 ARG 276 282 282 ARG ARG A . n 
A 1 277 GLU 277 283 283 GLU GLU A . n 
A 1 278 MET 278 284 284 MET MET A . n 
A 1 279 ASN 279 285 285 ASN ASN A . n 
A 1 280 PRO 280 286 286 PRO PRO A . n 
A 1 281 ASN 281 287 ?   ?   ?   A . n 
A 1 282 TYR 282 288 ?   ?   ?   A . n 
A 1 283 THR 283 289 ?   ?   ?   A . n 
A 1 284 GLU 284 290 290 GLU GLU A . n 
A 1 285 PHE 285 291 291 PHE PHE A . n 
A 1 286 LYS 286 292 292 LYS LYS A . n 
A 1 287 PHE 287 293 293 PHE PHE A . n 
A 1 288 PRO 288 294 294 PRO PRO A . n 
A 1 289 GLN 289 295 295 GLN GLN A . n 
A 1 290 ILE 290 296 296 ILE ILE A . n 
A 1 291 LYS 291 297 297 LYS LYS A . n 
A 1 292 ALA 292 298 298 ALA ALA A . n 
A 1 293 HIS 293 299 299 HIS HIS A . n 
A 1 294 PRO 294 300 300 PRO PRO A . n 
A 1 295 TRP 295 301 301 TRP TRP A . n 
A 1 296 THR 296 302 302 THR THR A . n 
A 1 297 LYS 297 303 303 LYS LYS A . n 
A 1 298 VAL 298 304 304 VAL VAL A . n 
A 1 299 PHE 299 305 305 PHE PHE A . n 
A 1 300 ARG 300 306 306 ARG ARG A . n 
A 1 301 PRO 301 307 307 PRO PRO A . n 
A 1 302 ARG 302 308 308 ARG ARG A . n 
A 1 303 THR 303 309 309 THR THR A . n 
A 1 304 PRO 304 310 310 PRO PRO A . n 
A 1 305 PRO 305 311 311 PRO PRO A . n 
A 1 306 GLU 306 312 312 GLU GLU A . n 
A 1 307 ALA 307 313 313 ALA ALA A . n 
A 1 308 ILE 308 314 314 ILE ILE A . n 
A 1 309 ALA 309 315 315 ALA ALA A . n 
A 1 310 LEU 310 316 316 LEU LEU A . n 
A 1 311 CYS 311 317 317 CYS CYS A . n 
A 1 312 SER 312 318 318 SER SER A . n 
A 1 313 ARG 313 319 319 ARG ARG A . n 
A 1 314 LEU 314 320 320 LEU LEU A . n 
A 1 315 LEU 315 321 321 LEU LEU A . n 
A 1 316 GLU 316 322 322 GLU GLU A . n 
A 1 317 TYR 317 323 323 TYR TYR A . n 
A 1 318 THR 318 324 324 THR THR A . n 
A 1 319 PRO 319 325 325 PRO PRO A . n 
A 1 320 THR 320 326 326 THR THR A . n 
A 1 321 ALA 321 327 327 ALA ALA A . n 
A 1 322 ARG 322 328 328 ARG ARG A . n 
A 1 323 LEU 323 329 329 LEU LEU A . n 
A 1 324 THR 324 330 330 THR THR A . n 
A 1 325 PRO 325 331 331 PRO PRO A . n 
A 1 326 LEU 326 332 332 LEU LEU A . n 
A 1 327 GLU 327 333 333 GLU GLU A . n 
A 1 328 ALA 328 334 334 ALA ALA A . n 
A 1 329 CYS 329 335 335 CYS CYS A . n 
A 1 330 ALA 330 336 336 ALA ALA A . n 
A 1 331 HIS 331 337 337 HIS HIS A . n 
A 1 332 SER 332 338 338 SER SER A . n 
A 1 333 PHE 333 339 339 PHE PHE A . n 
A 1 334 PHE 334 340 340 PHE PHE A . n 
A 1 335 ASP 335 341 341 ASP ASP A . n 
A 1 336 GLU 336 342 342 GLU GLU A . n 
A 1 337 LEU 337 343 343 LEU LEU A . n 
A 1 338 ARG 338 344 344 ARG ARG A . n 
A 1 339 ASP 339 345 345 ASP ASP A . n 
A 1 340 PRO 340 346 346 PRO PRO A . n 
A 1 341 ASN 341 347 347 ASN ASN A . n 
A 1 342 VAL 342 348 348 VAL VAL A . n 
A 1 343 LYS 343 349 349 LYS LYS A . n 
A 1 344 LEU 344 350 350 LEU LEU A . n 
A 1 345 PRO 345 351 351 PRO PRO A . n 
A 1 346 ASN 346 352 352 ASN ASN A . n 
A 1 347 GLY 347 353 353 GLY GLY A . n 
A 1 348 ARG 348 354 354 ARG ARG A . n 
A 1 349 ASP 349 355 355 ASP ASP A . n 
A 1 350 THR 350 356 356 THR THR A . n 
A 1 351 PRO 351 357 357 PRO PRO A . n 
A 1 352 ALA 352 358 358 ALA ALA A . n 
A 1 353 LEU 353 359 359 LEU LEU A . n 
A 1 354 PHE 354 360 360 PHE PHE A . n 
A 1 355 ASN 355 361 361 ASN ASN A . n 
A 1 356 PHE 356 362 362 PHE PHE A . n 
A 1 357 THR 357 363 363 THR THR A . n 
A 1 358 THR 358 364 364 THR THR A . n 
A 1 359 GLN 359 365 365 GLN GLN A . n 
A 1 360 GLU 360 366 366 GLU GLU A . n 
A 1 361 LEU 361 367 367 LEU LEU A . n 
A 1 362 SER 362 368 368 SER SER A . n 
A 1 363 SER 363 369 369 SER SER A . n 
A 1 364 ASN 364 370 370 ASN ASN A . n 
A 1 365 PRO 365 371 371 PRO PRO A . n 
A 1 366 PRO 366 372 372 PRO PRO A . n 
A 1 367 LEU 367 373 373 LEU LEU A . n 
A 1 368 ALA 368 374 374 ALA ALA A . n 
A 1 369 THR 369 375 375 THR THR A . n 
A 1 370 ILE 370 376 376 ILE ILE A . n 
A 1 371 LEU 371 377 377 LEU LEU A . n 
A 1 372 ILE 372 378 378 ILE ILE A . n 
A 1 373 PRO 373 379 379 PRO PRO A . n 
A 1 374 PRO 374 380 380 PRO PRO A . n 
A 1 375 HIS 375 381 381 HIS HIS A . n 
A 1 376 ALA 376 382 382 ALA ALA A . n 
A 1 377 ARG 377 383 383 ARG ARG A . n 
A 1 378 ILE 378 384 384 ILE ILE A . n 
A 1 379 GLN 379 385 ?   ?   ?   A . n 
A 1 380 ALA 380 386 ?   ?   ?   A . n 
A 1 381 ALA 381 387 ?   ?   ?   A . n 
A 1 382 ALA 382 388 ?   ?   ?   A . n 
A 1 383 SER 383 389 ?   ?   ?   A . n 
A 1 384 THR 384 390 ?   ?   ?   A . n 
A 1 385 PRO 385 391 ?   ?   ?   A . n 
A 1 386 THR 386 392 ?   ?   ?   A . n 
A 1 387 ASN 387 393 ?   ?   ?   A . n 
A 1 388 ALA 388 394 ?   ?   ?   A . n 
A 1 389 THR 389 395 ?   ?   ?   A . n 
A 1 390 ALA 390 396 ?   ?   ?   A . n 
A 1 391 ALA 391 397 ?   ?   ?   A . n 
A 1 392 SER 392 398 ?   ?   ?   A . n 
A 1 393 ASP 393 399 ?   ?   ?   A . n 
A 1 394 ALA 394 400 ?   ?   ?   A . n 
A 1 395 ASN 395 401 ?   ?   ?   A . n 
A 1 396 THR 396 402 ?   ?   ?   A . n 
A 1 397 GLY 397 403 ?   ?   ?   A . n 
A 1 398 ASP 398 404 ?   ?   ?   A . n 
A 1 399 ARG 399 405 ?   ?   ?   A . n 
A 1 400 GLY 400 406 ?   ?   ?   A . n 
A 1 401 GLN 401 407 ?   ?   ?   A . n 
A 1 402 THR 402 408 ?   ?   ?   A . n 
A 1 403 ASN 403 409 ?   ?   ?   A . n 
A 1 404 ASN 404 410 ?   ?   ?   A . n 
A 1 405 ALA 405 411 ?   ?   ?   A . n 
A 1 406 ALA 406 412 ?   ?   ?   A . n 
A 1 407 SER 407 413 ?   ?   ?   A . n 
A 1 408 ALA 408 414 ?   ?   ?   A . n 
A 1 409 SER 409 415 ?   ?   ?   A . n 
A 1 410 ALA 410 416 ?   ?   ?   A . n 
A 1 411 SER 411 417 ?   ?   ?   A . n 
A 1 412 ASN 412 418 ?   ?   ?   A . n 
A 1 413 SER 413 419 ?   ?   ?   A . n 
A 1 414 THR 414 420 ?   ?   ?   A . n 
B 1 1   THR 1   7   ?   ?   ?   B . n 
B 1 2   THR 2   8   ?   ?   ?   B . n 
B 1 3   SER 3   9   ?   ?   ?   B . n 
B 1 4   PHE 4   10  ?   ?   ?   B . n 
B 1 5   ALA 5   11  ?   ?   ?   B . n 
B 1 6   GLU 6   12  ?   ?   ?   B . n 
B 1 7   SER 7   13  ?   ?   ?   B . n 
B 1 8   CYS 8   14  ?   ?   ?   B . n 
B 1 9   LYS 9   15  ?   ?   ?   B . n 
B 1 10  PRO 10  16  ?   ?   ?   B . n 
B 1 11  VAL 11  17  ?   ?   ?   B . n 
B 1 12  GLN 12  18  ?   ?   ?   B . n 
B 1 13  GLN 13  19  ?   ?   ?   B . n 
B 1 14  PRO 14  20  ?   ?   ?   B . n 
B 1 15  SER 15  21  ?   ?   ?   B . n 
B 1 16  ALA 16  22  ?   ?   ?   B . n 
B 1 17  PHE 17  23  ?   ?   ?   B . n 
B 1 18  GLY 18  24  ?   ?   ?   B . n 
B 1 19  SER 19  25  ?   ?   ?   B . n 
B 1 20  MET 20  26  ?   ?   ?   B . n 
B 1 21  LYS 21  27  ?   ?   ?   B . n 
B 1 22  VAL 22  28  ?   ?   ?   B . n 
B 1 23  SER 23  29  ?   ?   ?   B . n 
B 1 24  ARG 24  30  ?   ?   ?   B . n 
B 1 25  ASP 25  31  ?   ?   ?   B . n 
B 1 26  LYS 26  32  ?   ?   ?   B . n 
B 1 27  ASP 27  33  ?   ?   ?   B . n 
B 1 28  GLY 28  34  ?   ?   ?   B . n 
B 1 29  SER 29  35  35  SER SER B . n 
B 1 30  LYS 30  36  36  LYS LYS B . n 
B 1 31  VAL 31  37  37  VAL VAL B . n 
B 1 32  THR 32  38  38  THR THR B . n 
B 1 33  THR 33  39  39  THR THR B . n 
B 1 34  VAL 34  40  40  VAL VAL B . n 
B 1 35  VAL 35  41  41  VAL VAL B . n 
B 1 36  ALA 36  42  42  ALA ALA B . n 
B 1 37  THR 37  43  43  THR THR B . n 
B 1 38  PRO 38  44  44  PRO PRO B . n 
B 1 39  GLY 39  45  45  GLY GLY B . n 
B 1 40  GLN 40  46  46  GLN GLN B . n 
B 1 41  GLY 41  47  47  GLY GLY B . n 
B 1 42  PRO 42  48  48  PRO PRO B . n 
B 1 43  ASP 43  49  49  ASP ASP B . n 
B 1 44  ARG 44  50  50  ARG ARG B . n 
B 1 45  PRO 45  51  51  PRO PRO B . n 
B 1 46  GLN 46  52  52  GLN GLN B . n 
B 1 47  GLU 47  53  53  GLU GLU B . n 
B 1 48  VAL 48  54  54  VAL VAL B . n 
B 1 49  SER 49  55  55  SER SER B . n 
B 1 50  TYR 50  56  56  TYR TYR B . n 
B 1 51  THR 51  57  57  THR THR B . n 
B 1 52  ASP 52  58  58  ASP ASP B . n 
B 1 53  THR 53  59  59  THR THR B . n 
B 1 54  LYS 54  60  60  LYS LYS B . n 
B 1 55  VAL 55  61  61  VAL VAL B . n 
B 1 56  ILE 56  62  62  ILE ILE B . n 
B 1 57  GLY 57  63  63  GLY GLY B . n 
B 1 58  ASN 58  64  64  ASN ASN B . n 
B 1 59  GLY 59  65  65  GLY GLY B . n 
B 1 60  SER 60  66  66  SER SER B . n 
B 1 61  PHE 61  67  67  PHE PHE B . n 
B 1 62  GLY 62  68  68  GLY GLY B . n 
B 1 63  VAL 63  69  69  VAL VAL B . n 
B 1 64  VAL 64  70  70  VAL VAL B . n 
B 1 65  TYR 65  71  71  TYR TYR B . n 
B 1 66  GLN 66  72  72  GLN GLN B . n 
B 1 67  ALA 67  73  73  ALA ALA B . n 
B 1 68  LYS 68  74  74  LYS LYS B . n 
B 1 69  LEU 69  75  75  LEU LEU B . n 
B 1 70  CYS 70  76  76  CYS CYS B . n 
B 1 71  ASP 71  77  77  ASP ASP B . n 
B 1 72  SER 72  78  78  SER SER B . n 
B 1 73  GLY 73  79  79  GLY GLY B . n 
B 1 74  GLU 74  80  80  GLU GLU B . n 
B 1 75  LEU 75  81  81  LEU LEU B . n 
B 1 76  VAL 76  82  82  VAL VAL B . n 
B 1 77  ALA 77  83  83  ALA ALA B . n 
B 1 78  ILE 78  84  84  ILE ILE B . n 
B 1 79  LYS 79  85  85  LYS LYS B . n 
B 1 80  LYS 80  86  86  LYS LYS B . n 
B 1 81  VAL 81  87  87  VAL VAL B . n 
B 1 82  LEU 82  88  88  LEU LEU B . n 
B 1 83  GLN 83  89  89  GLN GLN B . n 
B 1 84  ASP 84  90  90  ASP ASP B . n 
B 1 85  LYS 85  91  91  LYS LYS B . n 
B 1 86  ARG 86  92  92  ARG ARG B . n 
B 1 87  PHE 87  93  93  PHE PHE B . n 
B 1 88  LYS 88  94  94  LYS LYS B . n 
B 1 89  ASN 89  95  95  ASN ASN B . n 
B 1 90  ARG 90  96  96  ARG ARG B . n 
B 1 91  GLU 91  97  97  GLU GLU B . n 
B 1 92  LEU 92  98  98  LEU LEU B . n 
B 1 93  GLN 93  99  99  GLN GLN B . n 
B 1 94  ILE 94  100 100 ILE ILE B . n 
B 1 95  MET 95  101 101 MET MET B . n 
B 1 96  ARG 96  102 102 ARG ARG B . n 
B 1 97  LYS 97  103 103 LYS LYS B . n 
B 1 98  LEU 98  104 104 LEU LEU B . n 
B 1 99  ASP 99  105 105 ASP ASP B . n 
B 1 100 HIS 100 106 106 HIS HIS B . n 
B 1 101 CYS 101 107 107 CYS CYS B . n 
B 1 102 ASN 102 108 108 ASN ASN B . n 
B 1 103 ILE 103 109 109 ILE ILE B . n 
B 1 104 VAL 104 110 110 VAL VAL B . n 
B 1 105 ARG 105 111 111 ARG ARG B . n 
B 1 106 LEU 106 112 112 LEU LEU B . n 
B 1 107 ARG 107 113 113 ARG ARG B . n 
B 1 108 TYR 108 114 114 TYR TYR B . n 
B 1 109 PHE 109 115 115 PHE PHE B . n 
B 1 110 PHE 110 116 116 PHE PHE B . n 
B 1 111 TYR 111 117 117 TYR TYR B . n 
B 1 112 SER 112 118 118 SER SER B . n 
B 1 113 SER 113 119 119 SER SER B . n 
B 1 114 GLY 114 120 120 GLY GLY B . n 
B 1 115 GLU 115 121 121 GLU GLU B . n 
B 1 116 LYS 116 122 122 LYS LYS B . n 
B 1 117 LYS 117 123 123 LYS LYS B . n 
B 1 118 ASP 118 124 124 ASP ASP B . n 
B 1 119 GLU 119 125 125 GLU GLU B . n 
B 1 120 VAL 120 126 126 VAL VAL B . n 
B 1 121 TYR 121 127 127 TYR TYR B . n 
B 1 122 LEU 122 128 128 LEU LEU B . n 
B 1 123 ASN 123 129 129 ASN ASN B . n 
B 1 124 LEU 124 130 130 LEU LEU B . n 
B 1 125 VAL 125 131 131 VAL VAL B . n 
B 1 126 LEU 126 132 132 LEU LEU B . n 
B 1 127 ASP 127 133 133 ASP ASP B . n 
B 1 128 TYR 128 134 134 TYR TYR B . n 
B 1 129 VAL 129 135 135 VAL VAL B . n 
B 1 130 PRO 130 136 136 PRO PRO B . n 
B 1 131 GLU 131 137 137 GLU GLU B . n 
B 1 132 THR 132 138 138 THR THR B . n 
B 1 133 VAL 133 139 139 VAL VAL B . n 
B 1 134 TYR 134 140 140 TYR TYR B . n 
B 1 135 ARG 135 141 141 ARG ARG B . n 
B 1 136 VAL 136 142 142 VAL VAL B . n 
B 1 137 ALA 137 143 143 ALA ALA B . n 
B 1 138 ARG 138 144 144 ARG ARG B . n 
B 1 139 HIS 139 145 145 HIS HIS B . n 
B 1 140 TYR 140 146 146 TYR TYR B . n 
B 1 141 SER 141 147 147 SER SER B . n 
B 1 142 ARG 142 148 148 ARG ARG B . n 
B 1 143 ALA 143 149 149 ALA ALA B . n 
B 1 144 LYS 144 150 150 LYS LYS B . n 
B 1 145 GLN 145 151 151 GLN GLN B . n 
B 1 146 THR 146 152 152 THR THR B . n 
B 1 147 LEU 147 153 153 LEU LEU B . n 
B 1 148 PRO 148 154 154 PRO PRO B . n 
B 1 149 VAL 149 155 155 VAL VAL B . n 
B 1 150 ILE 150 156 156 ILE ILE B . n 
B 1 151 TYR 151 157 157 TYR TYR B . n 
B 1 152 VAL 152 158 158 VAL VAL B . n 
B 1 153 LYS 153 159 159 LYS LYS B . n 
B 1 154 LEU 154 160 160 LEU LEU B . n 
B 1 155 TYR 155 161 161 TYR TYR B . n 
B 1 156 MET 156 162 162 MET MET B . n 
B 1 157 TYR 157 163 163 TYR TYR B . n 
B 1 158 GLN 158 164 164 GLN GLN B . n 
B 1 159 LEU 159 165 165 LEU LEU B . n 
B 1 160 PHE 160 166 166 PHE PHE B . n 
B 1 161 ARG 161 167 167 ARG ARG B . n 
B 1 162 SER 162 168 168 SER SER B . n 
B 1 163 LEU 163 169 169 LEU LEU B . n 
B 1 164 ALA 164 170 170 ALA ALA B . n 
B 1 165 TYR 165 171 171 TYR TYR B . n 
B 1 166 ILE 166 172 172 ILE ILE B . n 
B 1 167 HIS 167 173 173 HIS HIS B . n 
B 1 168 SER 168 174 174 SER SER B . n 
B 1 169 PHE 169 175 175 PHE PHE B . n 
B 1 170 GLY 170 176 176 GLY GLY B . n 
B 1 171 ILE 171 177 177 ILE ILE B . n 
B 1 172 CYS 172 178 178 CYS CYS B . n 
B 1 173 HIS 173 179 179 HIS HIS B . n 
B 1 174 ARG 174 180 180 ARG ARG B . n 
B 1 175 ASP 175 181 181 ASP ASP B . n 
B 1 176 ILE 176 182 182 ILE ILE B . n 
B 1 177 LYS 177 183 183 LYS LYS B . n 
B 1 178 PRO 178 184 184 PRO PRO B . n 
B 1 179 GLN 179 185 185 GLN GLN B . n 
B 1 180 ASN 180 186 186 ASN ASN B . n 
B 1 181 LEU 181 187 187 LEU LEU B . n 
B 1 182 LEU 182 188 188 LEU LEU B . n 
B 1 183 LEU 183 189 189 LEU LEU B . n 
B 1 184 ASP 184 190 190 ASP ASP B . n 
B 1 185 PRO 185 191 191 PRO PRO B . n 
B 1 186 ASP 186 192 192 ASP ASP B . n 
B 1 187 THR 187 193 193 THR THR B . n 
B 1 188 ALA 188 194 194 ALA ALA B . n 
B 1 189 VAL 189 195 195 VAL VAL B . n 
B 1 190 LEU 190 196 196 LEU LEU B . n 
B 1 191 LYS 191 197 197 LYS LYS B . n 
B 1 192 LEU 192 198 198 LEU LEU B . n 
B 1 193 CYS 193 199 199 CYS CYS B . n 
B 1 194 ASP 194 200 200 ASP ASP B . n 
B 1 195 PHE 195 201 201 PHE PHE B . n 
B 1 196 GLY 196 202 202 GLY GLY B . n 
B 1 197 SER 197 203 203 SER SER B . n 
B 1 198 ALA 198 204 204 ALA ALA B . n 
B 1 199 LYS 199 205 205 LYS LYS B . n 
B 1 200 GLN 200 206 206 GLN GLN B . n 
B 1 201 LEU 201 207 207 LEU LEU B . n 
B 1 202 VAL 202 208 208 VAL VAL B . n 
B 1 203 ARG 203 209 209 ARG ARG B . n 
B 1 204 GLY 204 210 210 GLY GLY B . n 
B 1 205 GLU 205 211 211 GLU GLU B . n 
B 1 206 PRO 206 212 212 PRO PRO B . n 
B 1 207 ASN 207 213 213 ASN ASN B . n 
B 1 208 VAL 208 214 214 VAL VAL B . n 
B 1 209 SER 209 215 215 SER SER B . n 
B 1 210 TYR 210 216 216 TYR TYR B . n 
B 1 211 ILE 211 217 217 ILE ILE B . n 
B 1 212 CYS 212 218 218 CYS CYS B . n 
B 1 213 SER 213 219 219 SER SER B . n 
B 1 214 ARG 214 220 220 ARG ARG B . n 
B 1 215 TYR 215 221 221 TYR TYR B . n 
B 1 216 TYR 216 222 222 TYR TYR B . n 
B 1 217 ARG 217 223 223 ARG ARG B . n 
B 1 218 ALA 218 224 224 ALA ALA B . n 
B 1 219 PRO 219 225 225 PRO PRO B . n 
B 1 220 GLU 220 226 226 GLU GLU B . n 
B 1 221 LEU 221 227 227 LEU LEU B . n 
B 1 222 ILE 222 228 228 ILE ILE B . n 
B 1 223 PHE 223 229 229 PHE PHE B . n 
B 1 224 GLY 224 230 230 GLY GLY B . n 
B 1 225 ALA 225 231 231 ALA ALA B . n 
B 1 226 THR 226 232 232 THR THR B . n 
B 1 227 ASP 227 233 233 ASP ASP B . n 
B 1 228 TYR 228 234 234 TYR TYR B . n 
B 1 229 THR 229 235 235 THR THR B . n 
B 1 230 SER 230 236 236 SER SER B . n 
B 1 231 SER 231 237 237 SER SER B . n 
B 1 232 ILE 232 238 238 ILE ILE B . n 
B 1 233 ASP 233 239 239 ASP ASP B . n 
B 1 234 VAL 234 240 240 VAL VAL B . n 
B 1 235 TRP 235 241 241 TRP TRP B . n 
B 1 236 SER 236 242 242 SER SER B . n 
B 1 237 ALA 237 243 243 ALA ALA B . n 
B 1 238 GLY 238 244 244 GLY GLY B . n 
B 1 239 CYS 239 245 245 CYS CYS B . n 
B 1 240 VAL 240 246 246 VAL VAL B . n 
B 1 241 LEU 241 247 247 LEU LEU B . n 
B 1 242 ALA 242 248 248 ALA ALA B . n 
B 1 243 GLU 243 249 249 GLU GLU B . n 
B 1 244 LEU 244 250 250 LEU LEU B . n 
B 1 245 LEU 245 251 251 LEU LEU B . n 
B 1 246 LEU 246 252 252 LEU LEU B . n 
B 1 247 GLY 247 253 253 GLY GLY B . n 
B 1 248 GLN 248 254 254 GLN GLN B . n 
B 1 249 PRO 249 255 255 PRO PRO B . n 
B 1 250 ILE 250 256 256 ILE ILE B . n 
B 1 251 PHE 251 257 257 PHE PHE B . n 
B 1 252 PRO 252 258 258 PRO PRO B . n 
B 1 253 GLY 253 259 259 GLY GLY B . n 
B 1 254 ASP 254 260 260 ASP ASP B . n 
B 1 255 SER 255 261 261 SER SER B . n 
B 1 256 GLY 256 262 262 GLY GLY B . n 
B 1 257 VAL 257 263 263 VAL VAL B . n 
B 1 258 ASP 258 264 264 ASP ASP B . n 
B 1 259 GLN 259 265 265 GLN GLN B . n 
B 1 260 LEU 260 266 266 LEU LEU B . n 
B 1 261 VAL 261 267 267 VAL VAL B . n 
B 1 262 GLU 262 268 268 GLU GLU B . n 
B 1 263 ILE 263 269 269 ILE ILE B . n 
B 1 264 ILE 264 270 270 ILE ILE B . n 
B 1 265 LYS 265 271 271 LYS LYS B . n 
B 1 266 VAL 266 272 272 VAL VAL B . n 
B 1 267 LEU 267 273 273 LEU LEU B . n 
B 1 268 GLY 268 274 274 GLY GLY B . n 
B 1 269 THR 269 275 275 THR THR B . n 
B 1 270 PRO 270 276 276 PRO PRO B . n 
B 1 271 THR 271 277 277 THR THR B . n 
B 1 272 ARG 272 278 278 ARG ARG B . n 
B 1 273 GLU 273 279 279 GLU GLU B . n 
B 1 274 GLN 274 280 280 GLN GLN B . n 
B 1 275 ILE 275 281 281 ILE ILE B . n 
B 1 276 ARG 276 282 282 ARG ARG B . n 
B 1 277 GLU 277 283 283 GLU GLU B . n 
B 1 278 MET 278 284 284 MET MET B . n 
B 1 279 ASN 279 285 285 ASN ASN B . n 
B 1 280 PRO 280 286 286 PRO PRO B . n 
B 1 281 ASN 281 287 ?   ?   ?   B . n 
B 1 282 TYR 282 288 ?   ?   ?   B . n 
B 1 283 THR 283 289 ?   ?   ?   B . n 
B 1 284 GLU 284 290 290 GLU GLU B . n 
B 1 285 PHE 285 291 291 PHE PHE B . n 
B 1 286 LYS 286 292 292 LYS LYS B . n 
B 1 287 PHE 287 293 293 PHE PHE B . n 
B 1 288 PRO 288 294 294 PRO PRO B . n 
B 1 289 GLN 289 295 ?   ?   ?   B . n 
B 1 290 ILE 290 296 ?   ?   ?   B . n 
B 1 291 LYS 291 297 ?   ?   ?   B . n 
B 1 292 ALA 292 298 298 ALA ALA B . n 
B 1 293 HIS 293 299 299 HIS HIS B . n 
B 1 294 PRO 294 300 300 PRO PRO B . n 
B 1 295 TRP 295 301 301 TRP TRP B . n 
B 1 296 THR 296 302 302 THR THR B . n 
B 1 297 LYS 297 303 303 LYS LYS B . n 
B 1 298 VAL 298 304 304 VAL VAL B . n 
B 1 299 PHE 299 305 305 PHE PHE B . n 
B 1 300 ARG 300 306 306 ARG ARG B . n 
B 1 301 PRO 301 307 307 PRO PRO B . n 
B 1 302 ARG 302 308 308 ARG ARG B . n 
B 1 303 THR 303 309 309 THR THR B . n 
B 1 304 PRO 304 310 310 PRO PRO B . n 
B 1 305 PRO 305 311 311 PRO PRO B . n 
B 1 306 GLU 306 312 312 GLU GLU B . n 
B 1 307 ALA 307 313 313 ALA ALA B . n 
B 1 308 ILE 308 314 314 ILE ILE B . n 
B 1 309 ALA 309 315 315 ALA ALA B . n 
B 1 310 LEU 310 316 316 LEU LEU B . n 
B 1 311 CYS 311 317 317 CYS CYS B . n 
B 1 312 SER 312 318 318 SER SER B . n 
B 1 313 ARG 313 319 319 ARG ARG B . n 
B 1 314 LEU 314 320 320 LEU LEU B . n 
B 1 315 LEU 315 321 321 LEU LEU B . n 
B 1 316 GLU 316 322 322 GLU GLU B . n 
B 1 317 TYR 317 323 323 TYR TYR B . n 
B 1 318 THR 318 324 324 THR THR B . n 
B 1 319 PRO 319 325 325 PRO PRO B . n 
B 1 320 THR 320 326 326 THR THR B . n 
B 1 321 ALA 321 327 327 ALA ALA B . n 
B 1 322 ARG 322 328 328 ARG ARG B . n 
B 1 323 LEU 323 329 329 LEU LEU B . n 
B 1 324 THR 324 330 330 THR THR B . n 
B 1 325 PRO 325 331 331 PRO PRO B . n 
B 1 326 LEU 326 332 332 LEU LEU B . n 
B 1 327 GLU 327 333 333 GLU GLU B . n 
B 1 328 ALA 328 334 334 ALA ALA B . n 
B 1 329 CYS 329 335 335 CYS CYS B . n 
B 1 330 ALA 330 336 336 ALA ALA B . n 
B 1 331 HIS 331 337 337 HIS HIS B . n 
B 1 332 SER 332 338 338 SER SER B . n 
B 1 333 PHE 333 339 339 PHE PHE B . n 
B 1 334 PHE 334 340 340 PHE PHE B . n 
B 1 335 ASP 335 341 341 ASP ASP B . n 
B 1 336 GLU 336 342 342 GLU GLU B . n 
B 1 337 LEU 337 343 343 LEU LEU B . n 
B 1 338 ARG 338 344 344 ARG ARG B . n 
B 1 339 ASP 339 345 345 ASP ASP B . n 
B 1 340 PRO 340 346 346 PRO PRO B . n 
B 1 341 ASN 341 347 347 ASN ASN B . n 
B 1 342 VAL 342 348 348 VAL VAL B . n 
B 1 343 LYS 343 349 349 LYS LYS B . n 
B 1 344 LEU 344 350 350 LEU LEU B . n 
B 1 345 PRO 345 351 351 PRO PRO B . n 
B 1 346 ASN 346 352 352 ASN ASN B . n 
B 1 347 GLY 347 353 353 GLY GLY B . n 
B 1 348 ARG 348 354 354 ARG ARG B . n 
B 1 349 ASP 349 355 355 ASP ASP B . n 
B 1 350 THR 350 356 356 THR THR B . n 
B 1 351 PRO 351 357 357 PRO PRO B . n 
B 1 352 ALA 352 358 358 ALA ALA B . n 
B 1 353 LEU 353 359 359 LEU LEU B . n 
B 1 354 PHE 354 360 360 PHE PHE B . n 
B 1 355 ASN 355 361 361 ASN ASN B . n 
B 1 356 PHE 356 362 362 PHE PHE B . n 
B 1 357 THR 357 363 363 THR THR B . n 
B 1 358 THR 358 364 364 THR THR B . n 
B 1 359 GLN 359 365 365 GLN GLN B . n 
B 1 360 GLU 360 366 366 GLU GLU B . n 
B 1 361 LEU 361 367 367 LEU LEU B . n 
B 1 362 SER 362 368 368 SER SER B . n 
B 1 363 SER 363 369 369 SER SER B . n 
B 1 364 ASN 364 370 370 ASN ASN B . n 
B 1 365 PRO 365 371 371 PRO PRO B . n 
B 1 366 PRO 366 372 372 PRO PRO B . n 
B 1 367 LEU 367 373 373 LEU LEU B . n 
B 1 368 ALA 368 374 374 ALA ALA B . n 
B 1 369 THR 369 375 375 THR THR B . n 
B 1 370 ILE 370 376 376 ILE ILE B . n 
B 1 371 LEU 371 377 377 LEU LEU B . n 
B 1 372 ILE 372 378 378 ILE ILE B . n 
B 1 373 PRO 373 379 379 PRO PRO B . n 
B 1 374 PRO 374 380 380 PRO PRO B . n 
B 1 375 HIS 375 381 381 HIS HIS B . n 
B 1 376 ALA 376 382 382 ALA ALA B . n 
B 1 377 ARG 377 383 383 ARG ARG B . n 
B 1 378 ILE 378 384 384 ILE ILE B . n 
B 1 379 GLN 379 385 ?   ?   ?   B . n 
B 1 380 ALA 380 386 ?   ?   ?   B . n 
B 1 381 ALA 381 387 ?   ?   ?   B . n 
B 1 382 ALA 382 388 ?   ?   ?   B . n 
B 1 383 SER 383 389 ?   ?   ?   B . n 
B 1 384 THR 384 390 ?   ?   ?   B . n 
B 1 385 PRO 385 391 ?   ?   ?   B . n 
B 1 386 THR 386 392 ?   ?   ?   B . n 
B 1 387 ASN 387 393 ?   ?   ?   B . n 
B 1 388 ALA 388 394 ?   ?   ?   B . n 
B 1 389 THR 389 395 ?   ?   ?   B . n 
B 1 390 ALA 390 396 ?   ?   ?   B . n 
B 1 391 ALA 391 397 ?   ?   ?   B . n 
B 1 392 SER 392 398 ?   ?   ?   B . n 
B 1 393 ASP 393 399 ?   ?   ?   B . n 
B 1 394 ALA 394 400 ?   ?   ?   B . n 
B 1 395 ASN 395 401 ?   ?   ?   B . n 
B 1 396 THR 396 402 ?   ?   ?   B . n 
B 1 397 GLY 397 403 ?   ?   ?   B . n 
B 1 398 ASP 398 404 ?   ?   ?   B . n 
B 1 399 ARG 399 405 ?   ?   ?   B . n 
B 1 400 GLY 400 406 ?   ?   ?   B . n 
B 1 401 GLN 401 407 ?   ?   ?   B . n 
B 1 402 THR 402 408 ?   ?   ?   B . n 
B 1 403 ASN 403 409 ?   ?   ?   B . n 
B 1 404 ASN 404 410 ?   ?   ?   B . n 
B 1 405 ALA 405 411 ?   ?   ?   B . n 
B 1 406 ALA 406 412 ?   ?   ?   B . n 
B 1 407 SER 407 413 ?   ?   ?   B . n 
B 1 408 ALA 408 414 ?   ?   ?   B . n 
B 1 409 SER 409 415 ?   ?   ?   B . n 
B 1 410 ALA 410 416 ?   ?   ?   B . n 
B 1 411 SER 411 417 ?   ?   ?   B . n 
B 1 412 ASN 412 418 ?   ?   ?   B . n 
B 1 413 SER 413 419 ?   ?   ?   B . n 
B 1 414 THR 414 420 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 TMU 1   901 901 TMU TMU A . 
D 2 TMU 1   902 902 TMU TMU B . 
E 3 HOH 1   502 502 HOH HOH A . 
E 3 HOH 2   505 505 HOH HOH A . 
E 3 HOH 3   507 507 HOH HOH A . 
E 3 HOH 4   508 508 HOH HOH A . 
E 3 HOH 5   509 509 HOH HOH A . 
E 3 HOH 6   511 511 HOH HOH A . 
E 3 HOH 7   514 514 HOH HOH A . 
E 3 HOH 8   515 515 HOH HOH A . 
E 3 HOH 9   516 516 HOH HOH A . 
E 3 HOH 10  518 518 HOH HOH A . 
E 3 HOH 11  520 520 HOH HOH A . 
E 3 HOH 12  522 522 HOH HOH A . 
E 3 HOH 13  524 524 HOH HOH A . 
E 3 HOH 14  526 526 HOH HOH A . 
E 3 HOH 15  528 528 HOH HOH A . 
E 3 HOH 16  532 532 HOH HOH A . 
E 3 HOH 17  533 533 HOH HOH A . 
E 3 HOH 18  534 534 HOH HOH A . 
E 3 HOH 19  538 538 HOH HOH A . 
E 3 HOH 20  539 539 HOH HOH A . 
E 3 HOH 21  540 540 HOH HOH A . 
E 3 HOH 22  541 541 HOH HOH A . 
E 3 HOH 23  542 542 HOH HOH A . 
E 3 HOH 24  543 543 HOH HOH A . 
E 3 HOH 25  544 544 HOH HOH A . 
E 3 HOH 26  545 545 HOH HOH A . 
E 3 HOH 27  546 546 HOH HOH A . 
E 3 HOH 28  547 547 HOH HOH A . 
E 3 HOH 29  548 548 HOH HOH A . 
E 3 HOH 30  549 549 HOH HOH A . 
E 3 HOH 31  550 550 HOH HOH A . 
E 3 HOH 32  551 551 HOH HOH A . 
E 3 HOH 33  553 553 HOH HOH A . 
E 3 HOH 34  554 554 HOH HOH A . 
E 3 HOH 35  555 555 HOH HOH A . 
E 3 HOH 36  556 556 HOH HOH A . 
E 3 HOH 37  557 557 HOH HOH A . 
E 3 HOH 38  560 560 HOH HOH A . 
E 3 HOH 39  561 561 HOH HOH A . 
E 3 HOH 40  565 565 HOH HOH A . 
E 3 HOH 41  567 567 HOH HOH A . 
E 3 HOH 42  568 568 HOH HOH A . 
E 3 HOH 43  569 569 HOH HOH A . 
E 3 HOH 44  571 571 HOH HOH A . 
E 3 HOH 45  572 572 HOH HOH A . 
E 3 HOH 46  577 577 HOH HOH A . 
E 3 HOH 47  580 580 HOH HOH A . 
E 3 HOH 48  581 581 HOH HOH A . 
E 3 HOH 49  583 583 HOH HOH A . 
E 3 HOH 50  584 584 HOH HOH A . 
E 3 HOH 51  585 585 HOH HOH A . 
E 3 HOH 52  588 588 HOH HOH A . 
E 3 HOH 53  589 589 HOH HOH A . 
E 3 HOH 54  591 591 HOH HOH A . 
E 3 HOH 55  595 595 HOH HOH A . 
E 3 HOH 56  596 596 HOH HOH A . 
E 3 HOH 57  597 597 HOH HOH A . 
E 3 HOH 58  598 598 HOH HOH A . 
E 3 HOH 59  600 600 HOH HOH A . 
E 3 HOH 60  602 602 HOH HOH A . 
E 3 HOH 61  603 603 HOH HOH A . 
E 3 HOH 62  604 604 HOH HOH A . 
E 3 HOH 63  605 605 HOH HOH A . 
E 3 HOH 64  606 606 HOH HOH A . 
E 3 HOH 65  607 607 HOH HOH A . 
E 3 HOH 66  609 609 HOH HOH A . 
E 3 HOH 67  610 610 HOH HOH A . 
E 3 HOH 68  613 613 HOH HOH A . 
E 3 HOH 69  614 614 HOH HOH A . 
E 3 HOH 70  615 615 HOH HOH A . 
E 3 HOH 71  616 616 HOH HOH A . 
E 3 HOH 72  618 618 HOH HOH A . 
E 3 HOH 73  623 623 HOH HOH A . 
E 3 HOH 74  624 624 HOH HOH A . 
E 3 HOH 75  625 625 HOH HOH A . 
E 3 HOH 76  626 626 HOH HOH A . 
E 3 HOH 77  630 630 HOH HOH A . 
E 3 HOH 78  631 631 HOH HOH A . 
E 3 HOH 79  632 632 HOH HOH A . 
E 3 HOH 80  633 633 HOH HOH A . 
E 3 HOH 81  635 635 HOH HOH A . 
E 3 HOH 82  637 637 HOH HOH A . 
E 3 HOH 83  639 639 HOH HOH A . 
E 3 HOH 84  641 641 HOH HOH A . 
E 3 HOH 85  642 642 HOH HOH A . 
E 3 HOH 86  644 644 HOH HOH A . 
E 3 HOH 87  649 649 HOH HOH A . 
E 3 HOH 88  650 650 HOH HOH A . 
E 3 HOH 89  654 654 HOH HOH A . 
E 3 HOH 90  655 655 HOH HOH A . 
E 3 HOH 91  657 657 HOH HOH A . 
E 3 HOH 92  658 658 HOH HOH A . 
E 3 HOH 93  660 660 HOH HOH A . 
E 3 HOH 94  662 662 HOH HOH A . 
E 3 HOH 95  666 666 HOH HOH A . 
E 3 HOH 96  667 667 HOH HOH A . 
E 3 HOH 97  671 671 HOH HOH A . 
E 3 HOH 98  676 676 HOH HOH A . 
E 3 HOH 99  677 677 HOH HOH A . 
E 3 HOH 100 678 678 HOH HOH A . 
E 3 HOH 101 681 681 HOH HOH A . 
E 3 HOH 102 683 683 HOH HOH A . 
E 3 HOH 103 684 684 HOH HOH A . 
E 3 HOH 104 685 685 HOH HOH A . 
E 3 HOH 105 686 686 HOH HOH A . 
E 3 HOH 106 690 690 HOH HOH A . 
E 3 HOH 107 692 692 HOH HOH A . 
E 3 HOH 108 693 693 HOH HOH A . 
E 3 HOH 109 695 695 HOH HOH A . 
E 3 HOH 110 697 697 HOH HOH A . 
E 3 HOH 111 698 698 HOH HOH A . 
E 3 HOH 112 702 702 HOH HOH A . 
E 3 HOH 113 709 709 HOH HOH A . 
E 3 HOH 114 710 710 HOH HOH A . 
E 3 HOH 115 711 711 HOH HOH A . 
E 3 HOH 116 714 714 HOH HOH A . 
E 3 HOH 117 716 716 HOH HOH A . 
E 3 HOH 118 719 719 HOH HOH A . 
E 3 HOH 119 722 722 HOH HOH A . 
E 3 HOH 120 723 723 HOH HOH A . 
E 3 HOH 121 729 729 HOH HOH A . 
E 3 HOH 122 731 731 HOH HOH A . 
E 3 HOH 123 732 732 HOH HOH A . 
E 3 HOH 124 734 734 HOH HOH A . 
E 3 HOH 125 735 735 HOH HOH A . 
E 3 HOH 126 736 736 HOH HOH A . 
E 3 HOH 127 738 738 HOH HOH A . 
E 3 HOH 128 739 739 HOH HOH A . 
E 3 HOH 129 741 741 HOH HOH A . 
E 3 HOH 130 742 742 HOH HOH A . 
E 3 HOH 131 743 743 HOH HOH A . 
E 3 HOH 132 744 744 HOH HOH A . 
E 3 HOH 133 745 745 HOH HOH A . 
E 3 HOH 134 746 746 HOH HOH A . 
E 3 HOH 135 750 750 HOH HOH A . 
E 3 HOH 136 751 751 HOH HOH A . 
E 3 HOH 137 753 753 HOH HOH A . 
E 3 HOH 138 754 754 HOH HOH A . 
E 3 HOH 139 755 755 HOH HOH A . 
E 3 HOH 140 757 757 HOH HOH A . 
E 3 HOH 141 761 761 HOH HOH A . 
E 3 HOH 142 763 763 HOH HOH A . 
E 3 HOH 143 765 765 HOH HOH A . 
E 3 HOH 144 766 766 HOH HOH A . 
E 3 HOH 145 767 767 HOH HOH A . 
E 3 HOH 146 769 769 HOH HOH A . 
E 3 HOH 147 770 770 HOH HOH A . 
E 3 HOH 148 773 773 HOH HOH A . 
E 3 HOH 149 774 774 HOH HOH A . 
E 3 HOH 150 775 775 HOH HOH A . 
E 3 HOH 151 777 777 HOH HOH A . 
E 3 HOH 152 779 779 HOH HOH A . 
E 3 HOH 153 783 783 HOH HOH A . 
E 3 HOH 154 785 785 HOH HOH A . 
E 3 HOH 155 789 789 HOH HOH A . 
E 3 HOH 156 793 793 HOH HOH A . 
E 3 HOH 157 795 795 HOH HOH A . 
E 3 HOH 158 797 797 HOH HOH A . 
E 3 HOH 159 798 798 HOH HOH A . 
E 3 HOH 160 801 801 HOH HOH A . 
E 3 HOH 161 802 802 HOH HOH A . 
E 3 HOH 162 803 803 HOH HOH A . 
E 3 HOH 163 806 806 HOH HOH A . 
E 3 HOH 164 807 807 HOH HOH A . 
E 3 HOH 165 808 808 HOH HOH A . 
E 3 HOH 166 811 811 HOH HOH A . 
E 3 HOH 167 814 814 HOH HOH A . 
E 3 HOH 168 816 816 HOH HOH A . 
E 3 HOH 169 817 817 HOH HOH A . 
E 3 HOH 170 820 820 HOH HOH A . 
E 3 HOH 171 822 822 HOH HOH A . 
E 3 HOH 172 827 827 HOH HOH A . 
E 3 HOH 173 828 828 HOH HOH A . 
E 3 HOH 174 833 833 HOH HOH A . 
E 3 HOH 175 834 834 HOH HOH A . 
E 3 HOH 176 835 835 HOH HOH A . 
E 3 HOH 177 837 837 HOH HOH A . 
E 3 HOH 178 840 840 HOH HOH A . 
E 3 HOH 179 844 844 HOH HOH A . 
E 3 HOH 180 846 846 HOH HOH A . 
E 3 HOH 181 847 847 HOH HOH A . 
E 3 HOH 182 852 852 HOH HOH A . 
E 3 HOH 183 853 853 HOH HOH A . 
E 3 HOH 184 855 855 HOH HOH A . 
E 3 HOH 185 858 858 HOH HOH A . 
E 3 HOH 186 859 859 HOH HOH A . 
E 3 HOH 187 860 860 HOH HOH A . 
E 3 HOH 188 861 861 HOH HOH A . 
E 3 HOH 189 863 863 HOH HOH A . 
E 3 HOH 190 867 867 HOH HOH A . 
E 3 HOH 191 868 868 HOH HOH A . 
E 3 HOH 192 870 870 HOH HOH A . 
E 3 HOH 193 872 872 HOH HOH A . 
E 3 HOH 194 873 873 HOH HOH A . 
E 3 HOH 195 874 874 HOH HOH A . 
E 3 HOH 196 878 878 HOH HOH A . 
F 3 HOH 1   501 501 HOH HOH B . 
F 3 HOH 2   503 503 HOH HOH B . 
F 3 HOH 3   504 504 HOH HOH B . 
F 3 HOH 4   506 506 HOH HOH B . 
F 3 HOH 5   510 510 HOH HOH B . 
F 3 HOH 6   512 512 HOH HOH B . 
F 3 HOH 7   513 513 HOH HOH B . 
F 3 HOH 8   517 517 HOH HOH B . 
F 3 HOH 9   519 519 HOH HOH B . 
F 3 HOH 10  521 521 HOH HOH B . 
F 3 HOH 11  523 523 HOH HOH B . 
F 3 HOH 12  525 525 HOH HOH B . 
F 3 HOH 13  527 527 HOH HOH B . 
F 3 HOH 14  529 529 HOH HOH B . 
F 3 HOH 15  530 530 HOH HOH B . 
F 3 HOH 16  531 531 HOH HOH B . 
F 3 HOH 17  535 535 HOH HOH B . 
F 3 HOH 18  536 536 HOH HOH B . 
F 3 HOH 19  537 537 HOH HOH B . 
F 3 HOH 20  552 552 HOH HOH B . 
F 3 HOH 21  558 558 HOH HOH B . 
F 3 HOH 22  559 559 HOH HOH B . 
F 3 HOH 23  562 562 HOH HOH B . 
F 3 HOH 24  563 563 HOH HOH B . 
F 3 HOH 25  564 564 HOH HOH B . 
F 3 HOH 26  570 570 HOH HOH B . 
F 3 HOH 27  573 573 HOH HOH B . 
F 3 HOH 28  574 574 HOH HOH B . 
F 3 HOH 29  575 575 HOH HOH B . 
F 3 HOH 30  576 576 HOH HOH B . 
F 3 HOH 31  578 578 HOH HOH B . 
F 3 HOH 32  579 579 HOH HOH B . 
F 3 HOH 33  582 582 HOH HOH B . 
F 3 HOH 34  587 587 HOH HOH B . 
F 3 HOH 35  590 590 HOH HOH B . 
F 3 HOH 36  592 592 HOH HOH B . 
F 3 HOH 37  593 593 HOH HOH B . 
F 3 HOH 38  594 594 HOH HOH B . 
F 3 HOH 39  599 599 HOH HOH B . 
F 3 HOH 40  601 601 HOH HOH B . 
F 3 HOH 41  608 608 HOH HOH B . 
F 3 HOH 42  611 611 HOH HOH B . 
F 3 HOH 43  612 612 HOH HOH B . 
F 3 HOH 44  617 617 HOH HOH B . 
F 3 HOH 45  619 619 HOH HOH B . 
F 3 HOH 46  620 620 HOH HOH B . 
F 3 HOH 47  621 621 HOH HOH B . 
F 3 HOH 48  622 622 HOH HOH B . 
F 3 HOH 49  627 627 HOH HOH B . 
F 3 HOH 50  628 628 HOH HOH B . 
F 3 HOH 51  629 629 HOH HOH B . 
F 3 HOH 52  634 634 HOH HOH B . 
F 3 HOH 53  636 636 HOH HOH B . 
F 3 HOH 54  638 638 HOH HOH B . 
F 3 HOH 55  640 640 HOH HOH B . 
F 3 HOH 56  643 643 HOH HOH B . 
F 3 HOH 57  645 645 HOH HOH B . 
F 3 HOH 58  646 646 HOH HOH B . 
F 3 HOH 59  647 647 HOH HOH B . 
F 3 HOH 60  648 648 HOH HOH B . 
F 3 HOH 61  651 651 HOH HOH B . 
F 3 HOH 62  652 652 HOH HOH B . 
F 3 HOH 63  653 653 HOH HOH B . 
F 3 HOH 64  659 659 HOH HOH B . 
F 3 HOH 65  661 661 HOH HOH B . 
F 3 HOH 66  663 663 HOH HOH B . 
F 3 HOH 67  664 664 HOH HOH B . 
F 3 HOH 68  665 665 HOH HOH B . 
F 3 HOH 69  668 668 HOH HOH B . 
F 3 HOH 70  669 669 HOH HOH B . 
F 3 HOH 71  670 670 HOH HOH B . 
F 3 HOH 72  672 672 HOH HOH B . 
F 3 HOH 73  674 674 HOH HOH B . 
F 3 HOH 74  675 675 HOH HOH B . 
F 3 HOH 75  679 679 HOH HOH B . 
F 3 HOH 76  680 680 HOH HOH B . 
F 3 HOH 77  682 682 HOH HOH B . 
F 3 HOH 78  687 687 HOH HOH B . 
F 3 HOH 79  688 688 HOH HOH B . 
F 3 HOH 80  689 689 HOH HOH B . 
F 3 HOH 81  691 691 HOH HOH B . 
F 3 HOH 82  694 694 HOH HOH B . 
F 3 HOH 83  696 696 HOH HOH B . 
F 3 HOH 84  700 700 HOH HOH B . 
F 3 HOH 85  701 701 HOH HOH B . 
F 3 HOH 86  703 703 HOH HOH B . 
F 3 HOH 87  704 704 HOH HOH B . 
F 3 HOH 88  705 705 HOH HOH B . 
F 3 HOH 89  706 706 HOH HOH B . 
F 3 HOH 90  707 707 HOH HOH B . 
F 3 HOH 91  708 708 HOH HOH B . 
F 3 HOH 92  712 712 HOH HOH B . 
F 3 HOH 93  713 713 HOH HOH B . 
F 3 HOH 94  715 715 HOH HOH B . 
F 3 HOH 95  717 717 HOH HOH B . 
F 3 HOH 96  718 718 HOH HOH B . 
F 3 HOH 97  720 720 HOH HOH B . 
F 3 HOH 98  721 721 HOH HOH B . 
F 3 HOH 99  724 724 HOH HOH B . 
F 3 HOH 100 725 725 HOH HOH B . 
F 3 HOH 101 726 726 HOH HOH B . 
F 3 HOH 102 727 727 HOH HOH B . 
F 3 HOH 103 728 728 HOH HOH B . 
F 3 HOH 104 730 730 HOH HOH B . 
F 3 HOH 105 733 733 HOH HOH B . 
F 3 HOH 106 737 737 HOH HOH B . 
F 3 HOH 107 740 740 HOH HOH B . 
F 3 HOH 108 747 747 HOH HOH B . 
F 3 HOH 109 748 748 HOH HOH B . 
F 3 HOH 110 749 749 HOH HOH B . 
F 3 HOH 111 752 752 HOH HOH B . 
F 3 HOH 112 756 756 HOH HOH B . 
F 3 HOH 113 758 758 HOH HOH B . 
F 3 HOH 114 759 759 HOH HOH B . 
F 3 HOH 115 760 760 HOH HOH B . 
F 3 HOH 116 762 762 HOH HOH B . 
F 3 HOH 117 764 764 HOH HOH B . 
F 3 HOH 118 768 768 HOH HOH B . 
F 3 HOH 119 771 771 HOH HOH B . 
F 3 HOH 120 772 772 HOH HOH B . 
F 3 HOH 121 776 776 HOH HOH B . 
F 3 HOH 122 778 778 HOH HOH B . 
F 3 HOH 123 780 780 HOH HOH B . 
F 3 HOH 124 781 781 HOH HOH B . 
F 3 HOH 125 782 782 HOH HOH B . 
F 3 HOH 126 784 784 HOH HOH B . 
F 3 HOH 127 786 786 HOH HOH B . 
F 3 HOH 128 787 787 HOH HOH B . 
F 3 HOH 129 788 788 HOH HOH B . 
F 3 HOH 130 790 790 HOH HOH B . 
F 3 HOH 131 791 791 HOH HOH B . 
F 3 HOH 132 792 792 HOH HOH B . 
F 3 HOH 133 794 794 HOH HOH B . 
F 3 HOH 134 796 796 HOH HOH B . 
F 3 HOH 135 799 799 HOH HOH B . 
F 3 HOH 136 800 800 HOH HOH B . 
F 3 HOH 137 804 804 HOH HOH B . 
F 3 HOH 138 805 805 HOH HOH B . 
F 3 HOH 139 809 809 HOH HOH B . 
F 3 HOH 140 810 810 HOH HOH B . 
F 3 HOH 141 812 812 HOH HOH B . 
F 3 HOH 142 813 813 HOH HOH B . 
F 3 HOH 143 815 815 HOH HOH B . 
F 3 HOH 144 818 818 HOH HOH B . 
F 3 HOH 145 819 819 HOH HOH B . 
F 3 HOH 146 821 821 HOH HOH B . 
F 3 HOH 147 823 823 HOH HOH B . 
F 3 HOH 148 824 824 HOH HOH B . 
F 3 HOH 149 825 825 HOH HOH B . 
F 3 HOH 150 826 826 HOH HOH B . 
F 3 HOH 151 829 829 HOH HOH B . 
F 3 HOH 152 830 830 HOH HOH B . 
F 3 HOH 153 831 831 HOH HOH B . 
F 3 HOH 154 832 832 HOH HOH B . 
F 3 HOH 155 836 836 HOH HOH B . 
F 3 HOH 156 838 838 HOH HOH B . 
F 3 HOH 157 839 839 HOH HOH B . 
F 3 HOH 158 841 841 HOH HOH B . 
F 3 HOH 159 842 842 HOH HOH B . 
F 3 HOH 160 843 843 HOH HOH B . 
F 3 HOH 161 845 845 HOH HOH B . 
F 3 HOH 162 848 848 HOH HOH B . 
F 3 HOH 163 849 849 HOH HOH B . 
F 3 HOH 164 850 850 HOH HOH B . 
F 3 HOH 165 851 851 HOH HOH B . 
F 3 HOH 166 854 854 HOH HOH B . 
F 3 HOH 167 856 856 HOH HOH B . 
F 3 HOH 168 857 857 HOH HOH B . 
F 3 HOH 169 862 862 HOH HOH B . 
F 3 HOH 170 864 864 HOH HOH B . 
F 3 HOH 171 865 865 HOH HOH B . 
F 3 HOH 172 866 866 HOH HOH B . 
F 3 HOH 173 869 869 HOH HOH B . 
F 3 HOH 174 871 871 HOH HOH B . 
F 3 HOH 175 875 875 HOH HOH B . 
F 3 HOH 176 876 876 HOH HOH B . 
F 3 HOH 177 877 877 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-08-10 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNX    refinement       2002      ? 1 
MOSFLM 'data reduction' .         ? 2 
CCP4   'data scaling'   '(SCALA)' ? 3 
MOLREP phasing          .         ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 93  ? ? 140.54  135.75  
2  1 LYS A 123 ? ? 63.03   -72.30  
3  1 ASP A 181 ? ? -153.43 47.18   
4  1 ASP A 200 ? ? 56.25   81.90   
5  1 CYS A 218 ? ? 78.79   134.14  
6  1 TYR A 221 ? ? 99.66   -34.41  
7  1 GLN A 295 ? ? -69.06  97.04   
8  1 ASN A 370 ? ? -173.13 74.10   
9  1 ARG A 383 ? ? 37.72   51.77   
10 1 SER B 66  ? ? -27.46  -52.64  
11 1 PHE B 67  ? ? -61.99  -72.52  
12 1 SER B 118 ? ? -176.01 -152.60 
13 1 LYS B 123 ? ? -6.57   77.96   
14 1 ASP B 124 ? ? 150.87  -82.96  
15 1 GLU B 125 ? ? -32.36  126.46  
16 1 ASP B 181 ? ? -148.70 43.10   
17 1 ASP B 200 ? ? 58.86   79.46   
18 1 CYS B 218 ? ? 75.09   135.72  
19 1 TYR B 221 ? ? 93.62   -37.01  
20 1 PHE B 291 ? ? -138.90 -122.66 
21 1 PRO B 300 ? ? -54.66  -91.68  
22 1 TRP B 301 ? ? -170.50 -37.97  
23 1 ASN B 370 ? ? -170.97 75.17   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A THR 7   ? A THR 1   
2   1 Y 1 A THR 8   ? A THR 2   
3   1 Y 1 A SER 9   ? A SER 3   
4   1 Y 1 A PHE 10  ? A PHE 4   
5   1 Y 1 A ALA 11  ? A ALA 5   
6   1 Y 1 A GLU 12  ? A GLU 6   
7   1 Y 1 A SER 13  ? A SER 7   
8   1 Y 1 A CYS 14  ? A CYS 8   
9   1 Y 1 A LYS 15  ? A LYS 9   
10  1 Y 1 A PRO 16  ? A PRO 10  
11  1 Y 1 A VAL 17  ? A VAL 11  
12  1 Y 1 A GLN 18  ? A GLN 12  
13  1 Y 1 A GLN 19  ? A GLN 13  
14  1 Y 1 A PRO 20  ? A PRO 14  
15  1 Y 1 A SER 21  ? A SER 15  
16  1 Y 1 A ALA 22  ? A ALA 16  
17  1 Y 1 A PHE 23  ? A PHE 17  
18  1 Y 1 A GLY 24  ? A GLY 18  
19  1 Y 1 A SER 25  ? A SER 19  
20  1 Y 1 A MET 26  ? A MET 20  
21  1 Y 1 A LYS 27  ? A LYS 21  
22  1 Y 1 A VAL 28  ? A VAL 22  
23  1 Y 1 A SER 29  ? A SER 23  
24  1 Y 1 A ARG 30  ? A ARG 24  
25  1 Y 1 A ASP 31  ? A ASP 25  
26  1 Y 1 A LYS 32  ? A LYS 26  
27  1 Y 1 A ASP 33  ? A ASP 27  
28  1 Y 1 A GLY 34  ? A GLY 28  
29  1 Y 1 A GLY 120 ? A GLY 114 
30  1 Y 1 A GLU 121 ? A GLU 115 
31  1 Y 1 A ASN 287 ? A ASN 281 
32  1 Y 1 A TYR 288 ? A TYR 282 
33  1 Y 1 A THR 289 ? A THR 283 
34  1 Y 1 A GLN 385 ? A GLN 379 
35  1 Y 1 A ALA 386 ? A ALA 380 
36  1 Y 1 A ALA 387 ? A ALA 381 
37  1 Y 1 A ALA 388 ? A ALA 382 
38  1 Y 1 A SER 389 ? A SER 383 
39  1 Y 1 A THR 390 ? A THR 384 
40  1 Y 1 A PRO 391 ? A PRO 385 
41  1 Y 1 A THR 392 ? A THR 386 
42  1 Y 1 A ASN 393 ? A ASN 387 
43  1 Y 1 A ALA 394 ? A ALA 388 
44  1 Y 1 A THR 395 ? A THR 389 
45  1 Y 1 A ALA 396 ? A ALA 390 
46  1 Y 1 A ALA 397 ? A ALA 391 
47  1 Y 1 A SER 398 ? A SER 392 
48  1 Y 1 A ASP 399 ? A ASP 393 
49  1 Y 1 A ALA 400 ? A ALA 394 
50  1 Y 1 A ASN 401 ? A ASN 395 
51  1 Y 1 A THR 402 ? A THR 396 
52  1 Y 1 A GLY 403 ? A GLY 397 
53  1 Y 1 A ASP 404 ? A ASP 398 
54  1 Y 1 A ARG 405 ? A ARG 399 
55  1 Y 1 A GLY 406 ? A GLY 400 
56  1 Y 1 A GLN 407 ? A GLN 401 
57  1 Y 1 A THR 408 ? A THR 402 
58  1 Y 1 A ASN 409 ? A ASN 403 
59  1 Y 1 A ASN 410 ? A ASN 404 
60  1 Y 1 A ALA 411 ? A ALA 405 
61  1 Y 1 A ALA 412 ? A ALA 406 
62  1 Y 1 A SER 413 ? A SER 407 
63  1 Y 1 A ALA 414 ? A ALA 408 
64  1 Y 1 A SER 415 ? A SER 409 
65  1 Y 1 A ALA 416 ? A ALA 410 
66  1 Y 1 A SER 417 ? A SER 411 
67  1 Y 1 A ASN 418 ? A ASN 412 
68  1 Y 1 A SER 419 ? A SER 413 
69  1 Y 1 A THR 420 ? A THR 414 
70  1 Y 1 B THR 7   ? B THR 1   
71  1 Y 1 B THR 8   ? B THR 2   
72  1 Y 1 B SER 9   ? B SER 3   
73  1 Y 1 B PHE 10  ? B PHE 4   
74  1 Y 1 B ALA 11  ? B ALA 5   
75  1 Y 1 B GLU 12  ? B GLU 6   
76  1 Y 1 B SER 13  ? B SER 7   
77  1 Y 1 B CYS 14  ? B CYS 8   
78  1 Y 1 B LYS 15  ? B LYS 9   
79  1 Y 1 B PRO 16  ? B PRO 10  
80  1 Y 1 B VAL 17  ? B VAL 11  
81  1 Y 1 B GLN 18  ? B GLN 12  
82  1 Y 1 B GLN 19  ? B GLN 13  
83  1 Y 1 B PRO 20  ? B PRO 14  
84  1 Y 1 B SER 21  ? B SER 15  
85  1 Y 1 B ALA 22  ? B ALA 16  
86  1 Y 1 B PHE 23  ? B PHE 17  
87  1 Y 1 B GLY 24  ? B GLY 18  
88  1 Y 1 B SER 25  ? B SER 19  
89  1 Y 1 B MET 26  ? B MET 20  
90  1 Y 1 B LYS 27  ? B LYS 21  
91  1 Y 1 B VAL 28  ? B VAL 22  
92  1 Y 1 B SER 29  ? B SER 23  
93  1 Y 1 B ARG 30  ? B ARG 24  
94  1 Y 1 B ASP 31  ? B ASP 25  
95  1 Y 1 B LYS 32  ? B LYS 26  
96  1 Y 1 B ASP 33  ? B ASP 27  
97  1 Y 1 B GLY 34  ? B GLY 28  
98  1 Y 1 B ASN 287 ? B ASN 281 
99  1 Y 1 B TYR 288 ? B TYR 282 
100 1 Y 1 B THR 289 ? B THR 283 
101 1 Y 1 B GLN 295 ? B GLN 289 
102 1 Y 1 B ILE 296 ? B ILE 290 
103 1 Y 1 B LYS 297 ? B LYS 291 
104 1 Y 1 B GLN 385 ? B GLN 379 
105 1 Y 1 B ALA 386 ? B ALA 380 
106 1 Y 1 B ALA 387 ? B ALA 381 
107 1 Y 1 B ALA 388 ? B ALA 382 
108 1 Y 1 B SER 389 ? B SER 383 
109 1 Y 1 B THR 390 ? B THR 384 
110 1 Y 1 B PRO 391 ? B PRO 385 
111 1 Y 1 B THR 392 ? B THR 386 
112 1 Y 1 B ASN 393 ? B ASN 387 
113 1 Y 1 B ALA 394 ? B ALA 388 
114 1 Y 1 B THR 395 ? B THR 389 
115 1 Y 1 B ALA 396 ? B ALA 390 
116 1 Y 1 B ALA 397 ? B ALA 391 
117 1 Y 1 B SER 398 ? B SER 392 
118 1 Y 1 B ASP 399 ? B ASP 393 
119 1 Y 1 B ALA 400 ? B ALA 394 
120 1 Y 1 B ASN 401 ? B ASN 395 
121 1 Y 1 B THR 402 ? B THR 396 
122 1 Y 1 B GLY 403 ? B GLY 397 
123 1 Y 1 B ASP 404 ? B ASP 398 
124 1 Y 1 B ARG 405 ? B ARG 399 
125 1 Y 1 B GLY 406 ? B GLY 400 
126 1 Y 1 B GLN 407 ? B GLN 401 
127 1 Y 1 B THR 408 ? B THR 402 
128 1 Y 1 B ASN 409 ? B ASN 403 
129 1 Y 1 B ASN 410 ? B ASN 404 
130 1 Y 1 B ALA 411 ? B ALA 405 
131 1 Y 1 B ALA 412 ? B ALA 406 
132 1 Y 1 B SER 413 ? B SER 407 
133 1 Y 1 B ALA 414 ? B ALA 408 
134 1 Y 1 B SER 415 ? B SER 409 
135 1 Y 1 B ALA 416 ? B ALA 410 
136 1 Y 1 B SER 417 ? B SER 411 
137 1 Y 1 B ASN 418 ? B ASN 412 
138 1 Y 1 B SER 419 ? B SER 413 
139 1 Y 1 B THR 420 ? B THR 414 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "N-(4-METHOXYBENZYL)-N'-(5-NITRO-1,3-THIAZOL-2-YL)UREA" TMU 
3 water                                                   HOH 
#